4LSNB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj518), a non-nucleoside inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
428
structure length
416
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 101
structure length 416
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lsnB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB03
1S4FA 5KFXA 3KLEB 3KLIA 3UR0A 1NHUA 2OH2A 4WFYA 1N5YB 2WK4A 1S0MA 3RB0A 1N6QB 4O3NA 1S1VB 5KT6A 1TKXA 1HYSB 2FVSA 3CDWA 4RW8B 3FFIB 1FK9B 4H4OB 4RNMA 3DLEA 2WHOA 5DQIA 2CKWA 4DL4A 1HQUB 1RTIB 2XWYA 3C6TA 1JKHB 4ED8A 4KKOA 4NYZA 2FJVA 1DLOA 3LP2A 2IC3A 3PW5A 1T3NA 5C25A 4WZMA 4ED2A 1RT3A 5HBMA 3NBPA 4PQUA 2W9BB 3BQ1A 4G3IA 4ECZA 4WXOA 1C0TB 3KJVA 4Y2CA 3MF5A 1S6PB 3CJ3A 3QIPA 5C24B 2JC0A 4ZVFA 1LW0A 1TKZB 3SFUA 4IKAA 5KFLA 1EETA 4I7FB 2YNGA 1ZETA 1JLCA 3CJ2A 4ZP7A 2JC1A 2W9AA 4K4YA 1LWEB 4B3OA 4IDKB 1TVRB 3IS9A 4ZVHA 1RT1B 1VRTB 3DLKB 2VG6A 4ZP8A 2XCAA 5J1EB 3KLHB 5CYQA 3QIDA 4O4GB 1BQNB 4NLYA 4KB7A 1RT5A 1IKWB 1XR5A 4RW4B 5HLFB 2V4RA 2UVVA 5KG1A 5KFQA 4K4TA 1N48A 4MKBA 4LQ9A 3IGVA 3FQLA 4QWDA 4I2QB 1HNIA 4F50A 2HNDA 3T5JA 3IG1A 4KE5A 1RA7A 2RDJA 3DLGA 3KK2B 5KFAA 2UVUA 5J2QA 4Q43A 1SV5A 2IAJB 3GV5B 2EC0A 1RT2B 3FSIA 4O44A 1JLBB 4TYBA 2J6TA 1S9GA 4K4UA 2E9ZA 3UQSA 3KLGB 3C6TB 1C2PA 4PWDA 5DGBA 2OPPB 4XPCA 4MH8A 5KFHA 5D3GB 4TQRA 5L9XA 1IKVA 4FBTA 4ZHRB 4NLTA 1S1XB 4IH5A 2C2DA 2IA6A 4QW9A 4O4GA 4ZMMA 1HNVB 2UVWA 1DTQA 2ILZA 3MR5A 3G86A 4MK9A 5KFNA 5KG2A 5KFJA 4ZPAA 5EUHA 2VG5B 5J2NB 1C1BB 4NLGA 1KLMA 4Y34A 4R8UB 4NLSA 5F9LA 1S0NA 4KV8A 3GQCA 4NLOA 1S1UB 4JV0A 5EWEA 4K4XA 2BANB 3OSPA 1BQMB 1J5OA 4NRUA 1S9EB 4TYAA 5F8HA 5KFMA 4K50A 1JXLA 1RTIA 4HYKA 1RT1A 3DLKA 3MR2A 1RT7B 3MECA 5KFVA 3E01A 3OLBA 4ECQA 1TV6B 3MEEA 2D3ZA 2B6AA 3V6DA 1RT3B 2WTFA 1RT4B 5KT3A 3ISNC 4RW9B 5DG8A 3H5SA 4DL7A 4NLWA 4WYWA 4RW7A 4RW8A 3I0RB 4O3PA 1RTJB 3I0SA 2YNIB 1IKXA 3RAXA 3DRRA 5C24A 4YQWA 3OL6A 4J9QA 1HARA 3LAKA 5J2QB 1FKPA 1LW2B 2C28A 5C42B 4PUOB 3BREA 4URGA 1RT2A 1GX6A 4J9KA 1EETB 3NKYA 4O44B 3NAHA 2YKMA 4IH6A 4IG3A 3NAIA 1RAJA 5DQHA 2W9CA 1KHVA 5KT5A 3MR3A 1ZTWA 2UUTA 5DG9A 2FVPA 3RB3A 4KFBB 2WONB 2IM1A 4MIBA 1RTHA 4DL2A 3RAQA 3MEDB 2BQUA 1S1UA 4DL3A 2DPJA 4Q45A 2AQ4A 4EEYA 5HROA 4H54A 3GV8B 5K14A 3CIZA 1BQNA 2XI2A 4MKAA 5KFPA 1RT6B 3LP1B 3Q8RB 4IQXA 5HLFA 4KKOB 2FJWA 1NNDA 1N56A 3RBDA 2YKNB 1TP7A 5FDLB 3HHKA 4ECXA 3V6DB 2QE5A 4I2QA 1JLGA 5F9NA 3JYTA 4ZP9A 4TY8A 4ED3A 2JEFA 4ZPBA 5T14A 2IBKA 3H4DA 1LWFB 4NLXA 3TVKA 5F8JA 3LP0A 4YR0A 5KFOA 3KK3B 4K4WA 3OL8A 2OPSA 1IKYA 3H4BA 5KG0A 3BSNA 3DDKA 2YNFB 1RA6A 2FLLA 2D41A 4NLDA 3BQ0A 3DRPB 5J2MB 3KHHA 4K4ZA 2WOMA 1HPZB 4LSLA 3IN5A 3H5YA 5HBMB 4M94A 1VRUA 1S10A 2W9BA 1S97A 5L1LA 1QE1A 3IG1B 5CYQB 2AX1A 2R2SA 1T03A 2OPRA 3I5AA 2AGOA 5KFCA 2R8JA 1QAJA 1FKOA 4YR2A 4IG0B 1TL1B 3MR6A 2ASJA 2JEGA 4Q8EA 3QO9B 5KFWA 1K1QA 4I7FA 3QZ8A 5CYMA 4IG3B 1LWFA 4QW8A 3H40A 2OPPA 4URQU 2FVCA 4RUCA 1NHVA 1WNEA 3SI8A 3N6LA 2WB4A 5KFKA 2OPSB 2VG6B 1S0OA 3QGGA 3GIJA 4XPEA 5KFGA 2CJQA 4LSNB 3PW2A 2RDIA 3KLEA 3KOAA 3MEEB 4OL8A 4KAIA 3T5KA 1JX4A 1U09A 5C25B 2AU0A 2JEIA 4RNNA 1XR6A 4NRTA 2E9TA 3PJWA 2ZE2B 1OS5A 5J2NA 4ID5B 1S1VA 5KFUA 3RB4A 4WE1A 4WYLA 3IGNA 3KLVA 2HNYB 5DLGA 3KJVB 4IOBA 4WFZA 4JV1A 3JSMA 4KV8B 4ECRA 2XC9A 1HNVA 4O4RA 3LALA 1T03B 2WRMA 2ASLA 2WCXA 3DLEB 1BQMA 1SV5B 2IAJA 1J5OB 2IJNA 1LW2A 4WXWA 3KHGA 1C1BA 1IKYB 2AWZA 1JKHA 3MFIA 1EP4B 1R0AB 4ECYA 4GC6A 4NLQA 2ZD1B 2C22A 3EZUA 3CDUA 3KMSA 1W25A 4F4XA 3IS9B 1TVRA 3HVTA 1K1SA 4O3QA 3DMJB 4H4MA 4ED6A 4RW9A 1SH3A 4QWCA 5K14B 1C0TA 2BRKA 3IRXB 2RKIA 2OPQA 4Y3CA 1S1XA 3TAMB 1D0EA 1CSJA 1RT6A 3E01B 3LP1A 5KG6A 3OLAA 4HKQA 1TV6A 2W8LA 4I2PA 4Q0BB 2VG5A 1D1UA 2YKMB 4YR3A 2W8KA 2HWIA 4WE1B 4EYHB 5KFBA 1IM4A 3RB6A 3H5UA 5F8NA 3Q8QB 2IM0A 4ED0A 2VA3A 2VA2A 4YMEA 3CJ4A 1VRTA 3KMQA 4MFBB 5J1EA 3ISND 1FKPB 4X2BA 5C42A 4R5PB 4PUOA 3OL9A 3KLFB 2JLEA 1TQLA 4IR9A 4QWEA 1GX5A 3PZPA 3KK1B 4QPXA 3I5CA 2YKNA 3CWJA 3N6NA 1JLQA 3CDEA 4IRDA 3ICLA 1IKVB 2B5JA 5KT4A 3VQSA 3JYTB 2XCPA 2GC8A 4ZP6A 3V6KA 3DOKA 3KK2A 2BE2A 4NCGB 3LP0B 2YNIA 4ZPCA 3Q8SB 3G6XA 2FLNA 4EO6A 1S6QA 2D3UA 2UUWA 1UWBA 4KO0A 4ZVGA 3ITHA 4F4YA 2V9WA 1JLBA 2B43A 3NMAA 1S9GB 3KLIB 3QLHB 5J2PB 4K4SA 4R8UA 5I3UA 3QO9A 5KFSA 2BQRA 1S1WB 2W9CB 2F8EX 1RTDB 4ED1A 2E9RX 5KG3A 4PWDB 2RF2B 1REVB 2WOMB 4MIAA 2WONA 2DPIA 2HWHA 1RTHB 3QGHA 2YNHA 3GIMA 3PW7A 1JLFB 3M9NB 3M8PB 4H4OA 1FK9A 5L1KA 1QE1B 2YNFA 5KFIA 2XGPA 5HP1A 3M9OB 4IRCA 2OPQB 2RKIB 3IRXA 3V81A 4J9MA 3TAMA 1RYSA 2IJFA 3GV7B 1S1TA 1HPZA 4IG0A 5F8IA 3LP2B 1SH0A 1JLEA 1N5YA 4NLUA 2R2TA 1JLGB 1JLAB 2I5JA 1RTJA 2XI3A 3H2LA 4MK8A 4TY8B 3BSOA 4K4VA 5KFFA 3DRRB 2O5DA 3DM2B 4ECWA 3FFIA 3SFGA 1MU2B 1T05B 1C0UB 3KK3A 3FRZA 3KHRA 2R8IA 2HAIA 1RYRA 5JXSA 2ALZA 5KT7A 1LW0B 1TKZA 4WFXA 3UPFA 3D5MA 3GIKA 3I5BA 4KBIA 2ZD1A 2XGQA 4DL6A 1HQEB 1XR7A 1ZTTA 2FJXA 1TL3A 3MEDA 2RF2A 1C1CB 2R8HA 2HNZB 3BGRB 4U6PA 4TQSA 2W7OA 5KFTA 2JEJA 3KNAA 3MEGB 3PJXA 1I6JA 3TQ1A 4LSNA 3N6MA 1RT5B 4GC7A 1TKTB 4ICLB 3V4IB 5KFYA 3QYYA 4DG1A 2FVQA 4KHMA 5EDWA 2R8KA 2GIQA 3H5XA 4KHRA 4J9NA 2AGQA 2BQ3A 1JLEB 3PR5B 2W7PA 4O3OA 4EYIB 2J6SA 4IRKA 5CYMB 1RTDA 4URSA 1JLCB 4XO0A 3DM2A 5L1IA 4FS1A 3DMJA 4H4MB 5HROB 3FDSA 4ECSA 4IH7A 2ZKUA 4EBCA 3QZ7A 2BRLA 4RUAA 4J9RA 3KLFA 4RNOA 3M8PA 4ZVEA 3OL7A 3M8QA 2VG7A 3EPIA 1DTTB 5F8LA 2UVRA 1DLOB 4F4WA 3BQ2A 4G1QB 1VRUB 2ZE2A 3GIIA 4EO8A 4J9PA 3PHEA 5EWFA 1SH2A 1SUQB 3HVAA 3V6JA 2HNDB 3QIPB 2V0NA 2V4QA 1S6QB 3LAMA 1S48A 5KFEA 5KT2A 1DTQB 4Q0BA 4JUZA 3FQKA 3DRSA 4RW6A 2C2EA 4KSEB 3CO9A 3PR4A 1N6QA 1KLMB 3DRPA 3PVXA 2D7SA 5JUMA 4U7CA 3GILA 2IMWP 1LWCB 1HMVB 3Q8PB 4Q8FA 4IDKA 1N4LA 1QUVA 4F4ZA 4M95A 3DYAA 3OHBA 3D28A 3UDLA 2BANA 3C6UA 4R5PA 3DI6A 5I42A 1MMLA 2AX0A 5KFDA 3V81B 1RT7A 3MECB 5KFRA 3KK1A 1YVFA 3PW4A 1FKOB 4NLRA 2B6AB 3CJ5A 1TKTA 5DQGA 4IFYA 2C2RA 2HNYA 4NZ0A 2ASDA 5DG7A 1HNIB 4NLPA 4NLVA 3JSMB 4IFVB 3KHLA 3BSAA 3MFHA 2R2UA 1SUQA 4EBDA 3QGIA 3T1AA 1T05A 2I1RA 3ITHB 1KHWA 5KG5A 3QLHA 5J2PA 3PW0A 3KLHA 4ECVA 5I3UB 1HQUA 4Y2AA 3BR9A 2VG7B 2IM2A 3T19A 5C5JA 3HVTB 5KG4A 5F8MA 1TL3B 1REVA 5DLFA 3BSCA 1LWEA 2FVRA 4ID5A 4B3OB 4TN2A 4ECUA 1HMVA 4FS2A 2IM3A 5D3GA 2ILYA 3EPGA 3RBEA 4O3RA 2AGPA 1RT4A 4ZHRA 3NGDA 1S9FA 4O3SA 3MEGA 3C6UB 4MK7A 5HP1B 5F8GA 3DI6B 5I42B 4RW7B 4ZPDA 4TLRA 4ICLA 3V4IA 4DG1B 5L1JA 1S1TB 3E51A 4LQ3A 2J6UA 4EBEA 5FDLA 1EP4A 1R0AA 4J9SA 4IFYB 3DRSB 4RW6B 4R0EA 4J9LA 1S1WA 2YNGB 3NL0A 3G6VA 3T5HA 3HKWA 5KFZA 4IFVA 2HMIB 4TY9A 4QWBA 3DOLB 3T5LA 3DLGB 4DL5A 2R8GA 4ECTA 1MU2A 2BR0A 2R2RA 3GYNA 3DYAB 3V6HA 4RZRA 3M8QB 1S49A 2ATLA 5KG7A 1DTTA 4I2PB 4RNHA 2IC3B 4RNFA 4RW4A 1JLQB 4Q44A 2B5JB 4G1QA 2HNZA 3BGRA 4TXSA 5DGAA 4LSLB 4QWAA 1TKXB 1HYSA 4J9OA 4ED7A 3OSNA 1JLAA 2BE2B 2I5JB 4NCGA 3I0RA 1S6PA 3I0SB 4YP3A 1IKXB 3H59A 1UWBB 4KO0B 2QV6A 1JIHA 3M9MB 2OPRB 4MFBA 4JV2A 1C0UA 1S9EA 4WZQA 3H98A 4FBUA 1Z4UA 1T94A 1TL1A 4RU9A 2GIRA 4IR1A 3LANA 3OHAA 3KLGA 1LWCA 1QAIA 4KFBA 1HQEA 3HVWA 2YNHB 3CVKA 3MTKA 5J2MA 2FLPA 2HMIA 1C1CA 1JLFA 3DOLA 3NBPB 4PQUB 1RDRA 4DEZA 3BJYA 3CJ0A 3G6YA 3DOKB 1IKWA 5EWGA
chains in the Genus database with same CATH superfamily
1MWZA 3TEGA 1FDNA 1DQ9A 2CQCA 4DV2J 1A9NB 1S4FA 1CEZA 2KO1A 3KLIA 3UR0A 2CZ9A 4RLEA 1HNWJ 1FEEA 4QU7A 4JI0J 4JI5F 3RB0A 4DV7J 4HACA 1GTHA 2YBVA 4O3NA 2Q66A 3C14B 3MMJA 2V2ZA 2EC2A 4ZN3A 4KH1B 1ZOTA 2VL1A 2K3IA 5GAHI 1JMTA 2CFXA 2MKCA 3ULHA 4OZ2A 2WHOA 3GFYA 5DQIA 4N7TA 4DL4A 1HQUB 1B4SA 3X3UA 5MAOA 3BGOP 3HHLA 3SMZA 2XWYA 3PEJA 2FC9A 2XM3A 3K89A 1HBMA 3QJJA 2HBYB 4KKOA 4F26A 1Y0HA 1URNA 3R6GB 3KG0A 3LUYA 1DLOA 1NK6A 4DUZF 2IC3A 1T3OA 1T3NA 4WZMA 1RT3A 3NS7B 4FXWA 4W98A 5HBMA 3MM8A 3HJVA 4PQUA 2MXYA 2W1BA 4G3IA 4WXOA 4QIVA 3KJVA 4JBCA 1LEOA 2DRDA 2M7SA 5IT0A 2UUBF 5F3ZA 5C24B 4DR7J 1R8CA 4ZVFA 4EMDA 1X4DA 3A8IA 3HJFA 2CYYA 4ILRA 2BBEA 2ZJPQ 4I7FB 2RJZA 2MLZA 2LP4A 1RHQB 3W8GA 3K8VA 3GSIA 4ZP7A 4K4YA 2WBRA 2EBGA 5D0HA 1YTYA 1J27A 1H74A 4KQZA 2NLWA 3GJSB 3LPYA 1YJNS 1O0PA 1M90T 4NEZA 3DLKB 4JI2J 3RU0A 5CABA 5D6GA 2DISA 3KLHB 1I1GA 2MQOA 4O4GB 4NLYA 1IKWB 4H4KC 5F41A 1W2BR 2DNPA 3LGNA 3MMCA 4ILLA 4QWDA 3OFGA 2BABA 2HBQB 4P6QA 4NMLA 3ZZZA 2R7VA 3J7YI 1N33J 3TX8A 2XTJP 1T9VA 1ZPWX 5FLXY 4X66F 4Q43A 1SKSA 4DSKA 3FSIA 1JLBB 4QJVA 3ZTOA 3O1LA 4K4UA 3CGIA 1QSSA 1KONA 3TVZA 3GMGA 1EQ0A 4OYAA 3G4SS 1S99A 3TO8A 1SIZA 3HP6A 3K58A 4OYMA 3QRPA 1CJVB 4XPCA 3SCKE 1FXDA 5KFHA 5E7OB 2RAQA 2ZUAA 1NB2A 1EHWA 3RYLA 3DGVA 5D4PA 3MUTP 4IH5A 2KL8A 4O4GA 2B4VA 1WC1A 1DTQA 3CCLS 2P9EA 5E3CA 3MXHP 1XMBA 3GG1A 1S7IA 1P1TA 4DV3J 1YJVA 3PIPQ 2FLOA 2APOA 5J2NB 4JI4J 2J5AA 3EVMA 2FZCB 1WI6A 2NR0A 4Y34A 4A8XA 2O66A 3DU6A 4NLSA 1RE1B 5SUHA 1YHQS 1HQ2A 2WBMA 1AYEA 4WF9Q 4KV8A 2RB7A 5EWEA 1VC6A 1N32F 2BANB 3DHWC 4TYAA 1KBRA 4GVBB 5KFMA 3M2VB 4DCOB 4C98A 1KC8T 1JXLA 4FF4A 3OUYB 3DLKA 3H2UB 3MR2A 1RT7B 3E01A 1UZDA 1TV6B 3MEEA 2KN4A 2KG0A 2FPHX 4OI4A 4BDPA 1HL6A 1RT3B 3VV2B 1BUXA 4AXIA 2J0WA 4CLZA 4USMA 1TR0A 2WTFA 3MPDA 3H5SA 1FCAA 4NLWA 1Q86T 2CQ3A 3I0RB 3GTYX 4O3PA 1UJ6A 5HJYA 3QSYB 1CULA 2X1AA 3RAXA 1QTMA 4KGKA 2CJKA 5C24A 2UU9F 1UVIA 1U0HB 2Z4PA 3NS5A 4WPAA 3OL6A 4LF4F 1HBOA 2ZHBA 3AY0A 1FKPA 1LW2B 4ZPVR 4J9KA 1JXVA 2ATCB 4DV5J 3PX6A 3NKYA 1GK8A 5DQHA 3BO2A 2YQ3A 1I3OB 1UWAA 2L9DA 1KHVA 1VK3A 5DG9A 1Q8BA 4ER8A 1UW4A 1VK8A 2RQ4A 4LF7J 3AOBA 4MIBA 2HLTA 3MEDB 4LF2A 4CCHA 3U7JA 4J37A 4LRDA 3W61A 2CJBA 2CPIA 2VOOA 1AUSL 5GAHU 4C8ZA 1UA1A 1BQNA 2G0JA 2GCFA 3C8YA 3WQPA 2FY1A 2ZWOA 4G1IA 2O1PA 1RT6B 2F7VA 2ZBRA 3R5CA 4IQXA 2FJWA 2YWFA 2POKA 3RBDA 1AFIA 5FDLB 3HHKA 4RKUC 1KN6A 4FYDA 4DPUA 1B70B 2EG2A 1JLGA 1ICEB 5F9NA 2JEFA 3LGMA 1QM9A 1EZZB 2IDLA 1BHNA 3MCMA 4ES2A 2IBKA 1Y00A 3TVKA 4RBTA 3LP0A 2X1BA 3KK3B 2YPYA 2M8DB 1YDLA 3VAKA 3CJKB 5GMKa 2H5JB 5KG0A 3BSNA 2DNMA 2D41A 2DIUA 4GVLA 5DRKA 3BQ0A 2HFNA 2IYIA 2UP1A 1M5KC 4QYRA 4Y0FA 1T9TA 4DU8A 3IC1A 2BKPA 1O8BA 4FP9A 1HPZB 4LSLA 3RAMA 1VQ9S 4JYAF 4DR5F 2VFVA 2BKNA 3MPYA 2XB2D 3PEHA 5GAEU 5CD4H 1S97A 3BEGB 4B3SF 2UUAF 3IG1B 1UW9A 2HZAA 2VFUA 1H2TZ 1YWXA 2AX1A 2DO0A 2E1AA 2JRSA 3FVYA 2OPRA 7FDRA 1J5EJ 3ZTSA 1CULB 2HHPA 2DR7A 2WB1D 3SBMA 4P2MA 4IG0B 3LH2S 1TL1B 3PXGa 5K9FA 5HMZA 2DK2A 3RBXA 3W5ZA 2QSFA 3M6XA 1XNQF 3HSGA 4K2JA 1HW9A 2V2VA 2WVFA 4KJIA 4QW8A 2KZZA 1NSAA 1HIYA 2FVCA 4RBUA 3S8SA 3PACA 2K8GA 5HVGA 3RG6A 3M2VA 4DSFA 2JJ4D 2CG8A 1TK0A 1HBUB 1HFEL 2VG6B 3OXGA 4DF8A 3QGGA 2V68A 1Q16B 4N76A 5B0BA 2XHWA 3PW2A 3KLEA 3MEEB 2CAJA 4OHYA 5IWAF 3TAPA 3CO0P 4NRTA 4TVAB 4JI0F 4JI5J 5HSPA 4DV7F 2E9TA 2G4BA 3KUGA 1S1VA 5KFUA 1JNRB 1KQGB 1UFLA 1YJUA 2ZZTA 1PBUA 4WYLA 4ZOSA 2C3MA 2RH3A 5BJRA 4OMFG 3FCHA 3JSMA 4M1KA 1RGVA 4ECRA 2OI2A 1VQ7S 2CNLB 1T03B 3UD5A 2AEJA 2VPXB 1X4CA 1J5OB 3SIPB 3S7RA 1NEEA 2EG1A 3PNIA 3LO3A 5JJBA 3GJTB 1C1BA 2A2DA 3RW6A 1MG7A 3MFIA 1EP4B 2B51A 1YZ6A 3R2CJ 4ECYA 1QVGR 2ZD1B 2RQMA 4C8YA 1W25A 3PDNA 1TVRA 1K1SA 1KLNA 2OAUA 1R8PA 2AW0A 3DMJB 4H4MA 2G2ZA 2H5IB 4RW9A 1SH3A 2DEIA 2QX0A 5DDPC 2FUG9 2GHWA 2F4FA 5K8MA 2E7WA 1Q0NA 2BRKA 3IRXB 1S0MA 5KG6A 2UV8A 2BZ2A 3PYDA 2EK1A 1UEUA 4LFCF 4ZLPA 1XERA 2W8LA 2RMLA 4I2PA 3KNGA 3IRWP 4MKYA 1KNZA 2VODA 1HR0F 3W3SA 2FHJD 4F2SA 4YEAA 3IBCB 4X4TA 1D1UA 2HAFA 2YKMB 3BV8A 1HNXJ 1DY3A 2RRBA 4M5JA 2RHQB 5KFBA 3ZZYA 5ETVA 4C48A 2BMBA 2A1BA 2NPFA 3UNGC 4JI2F 1VOMA 3FRYA 3GPAA 3KMQA 1YK9A 3R7SB 1SL2A 4PUOA 4R5PB 4KPCA 4ES3A 3ENAA 3S6EA 2ADCA 3OL9A 2JLEA 1HBUA 3KUEA 2HW3A 2R7QA 1G1XA 3KK1B 5FIIA 1TELA 1P1LA 4QPXA 3N6NA 3QPIA 3JB9k 1PKUA 2Q43A 1UVMA 4DHVA 2GC8A 3HO1A 2GQ2A 3EGVA 5ETPA 1FI4A 2E66A 5J1NA 4ZPCA 3MR7A 1CJKB 2QN6B 2NXNA 2UUWA 4YY3J 2CZVC 1UWBA 4KO0A 2Q79A 3ITHA 3KYLA 4LT6A 3ZO7A 5J2PB 1UZHA 1RADB 3O8WA 3OBIA 4CO3A 5IXUA 3JTNA 1N5TA 3CIMA 2HIQA 2H3EB 2OSQA 3C66A 3I9ZA 1GTEA 2RF2B 3DLLQ 4KPYA 3V2UC 4MIAA 3QGHA 2YNHA 4DV6F 3DNCA 1SKUB 4K8RA 1LNQA 3M8PB 4H4OA 4RO0A 1QE1B 1LXNA 2N3OA 2YNFA 4I6YA 5ETKA 1NPRA 1MN9A 2AZ1A 2CPZA 3IRXA 3LGHA 5DO2A 3VR1A 5HMWA 3RRHA 2WVEA 3ETMA 3AD9C 2KH9A 2C2NA 2WW8A 1PBAA 3LP2B 4C8NA 3ENVA 2MKIA 3NMRA 2GMLA 1LKZA 3TW0A 1JLAB 1E6VB 1RTJA 5B0AA 4ZVUB 4ZCKA 3EYZA 4OX8A 1GXLA 3DRRB 1OY8A 1XIQA 2O5DA 3D54A 1FJEB 4OI6A 2GVZB 2OD6A 4DN0A 2KZMA 4P71A 4ZVOB 1ZA2B 1VI7A 1WSVA 3CJ8A 3MZIA 4P2FA 2EFGA 2ALZA 3ZXWA 5CAAA 2HHQA 3GIKA 4KBIA 2QEXS 1TK5A 2GHPA 4YOEA 4F0HA 4ED4A 1TL3A 3EDRB 4O23A 4B3MF 1C1CB 2U2FA 2HNZB 2DHXA 1VJWA 2I38A 3FEXB 2DNQA 3HSDA 5AXKA 4TQSA 4OI0A 1XNRJ 5HN0A 3VALA 1WEZA 3KJFB 5LSLA 2MZQA 5ETSA 2UU9J 3R97A 3QSIA 1UVNA 1YLXA 1RT5B 1N54B 3QYYA 4DG1A 1OSCA 1VFJA 1KFDA 3D6TB 5EDWA 2ZH8A 1XMOF 1SI9A 1F9FA 3ZZ0A 3U1LA 1U1MA 1Y5LB 2NS1B 3AOCA 2BQ3A 2ZDPA 3N4WA 2W7PA 5CHCB 1IJFB 4FKYA 3UD4P 2C3PA 1JLCB 2WSEC 5L1IA 1U1KA 1GXUA 3T1YF 4RUAA 2V5HG 2HVIA 3M8QA 2VG7A 1LWXA 2QT7A 2VQFF 3M05A 1HWIA 5LXYA 3OVSA 1S59A 3W66A 1DTTB 5F8LA 4FF1A 4JV5J 4NCBA 4G1QB 4AL6A 2J9DE 1VQ4S 3DU5A 3ENQA 1X7VA 5A2QU 3PHEA 1WOPA 5EWFA 1MWYA 4C8MA 1LK7A 4LF9J 1U1RA 3V6JA 2HNDB 1OO0B 2W24A 2W4CA 3MM6B 2V4QA 1S6QB 3LAMA 1S48A 3KJQB 4B9MA 2GQQA 3M8ZA 4Q0BA 2RUGA 2VFRA 3DRSA 2YXLA 2L41A 1BMQB 2C2EA 3CO9A 2VICA 5LMUF 2C1EB 1IR1A 1KLMB 3DRPA 1SBRA 2D7SA 5JUMA 3DKDA 3SCLE 5K5MA 3GILA 1FJGF 2F3JA 4E98A 2RE1A 2A2CA 2MSTA 3T6JA 3I31A 4M5MA 4IDKA 1PYOB 3TANA 4F04B 4Q8FA 1ZH5A 3HFVA 2UUAJ 2KI2A 4X4UA 4CNYA 1LFPA 2MTLA 1N88A 1U1LA 2JFDA 5B0GA 3C16B 2V50A 3MPUB 3Q8UA 5KFDA 3N5FA 1YKWA 1ITPA 3MECB 1I94F 1SJ1A 1FFWB 2RRAA 2BJ3A 4NLRA 1IBCB 2B6AB 1TKTA 4IFYA 2C2RA 3DXSX 2J0QD 2CPFA 4NLPA 3MM9A 4NLVA 2GW8A 2QL9B 4IFVB 3FCWA 3QWUA 3KHLA 4DR4J 3HDSA 3CD0A 3MWBA 4ZLJA 3BYPA 4EBDA 4C4WA 3OTCA 1FWLA 1GFWB 3T1AA 2EXUA 2J9DA 2XULA 1WJ9A 4LVNP 2FHKA 2J7KA 1KHWA 3CW2C 3GFXA 5IT4A 1XTZA 2Y8WA 1CJUB 3K0JA 2JL9A 1R6VA 2VPZB 3IM9A 3TAQA 2OD4A 4DX7A 4Y2AA 1RXOB 2JSXA 1KOOA 2VG7B 3BR9A 3T19A 4J5OA 3HVTB 5KG4A 5C5JA 1TL3B 1F2GA 1LWEA 2FVRA 4ID5A 4KIAA 4ECUA 3RBEA 2IM3A 3EPGA 1NJYA 2NZ4A 1RT4A 3C46A 1VDHA 2CNNB 4MK7A 1KTVA 5F8GA 1U8SA 3H42A 2WVCA 3LOUA 3CULA 1R3NA 3QRQA 3FJ2A 1HHTP 1Y9OA 2AEFA 3E51A 1IJEB 4IO1A 1K9MT 2J6UA 4B9LA 3VTIA 4J9SA 1ZZNA 3KXDA 4RW6B 1VLOA 2E1MC 3L7PA 4R0EA 4B9TA 3CCZA 3G6VA 5HQLA 1FXLA 3UN5A 4IFVA 3GB0A 4TY9A 3BH7B 1EIYB 3AOAA 2UUCF 3HHEA 1T0TV 2R7UA 1ZAXA 4USVA 4Z7CA 2C3UA 2VBXA 1DAXA 3W1YC 1FA0A 1Y7PA 1V5IB 2CA9A 2ZHOA 3NCPA 1X4BA 4XTTA 4RUBA 4DOZA 3J81j 3OXFA 2ATLA 5KG7A 1VYAA 4MJKA 3OPKA 4BWJA 4JI4F 1JLQB 1NPPA 4LFAF 1TL5A 2D69A 2XZDB 3C3LA 1HNXF 3MM7A 1NJZA 1X4EA 1TKXB 1HYSA 4ZKAA 4LVOP 2HBZB 3OSNA 2I5JB 3FUYA 3A3NB 3JTPA 3HLUA 1VQPS 5GADU 2SXLA 2QV6A 4C6AA 4DR3J 3R27A 1NSQA 3H98A 3PKMA 3D3CJ 2GGPB 3IWLA 4PXEA 2GIRA 4IR1A 1WHWA 2FHOB 2Y1RI 1T9UA 2CQ0A 1V5VA 2B9YA 2NXCA 2XZTB 4EGLA 2KXNB 3D6FB 3MTKA 1H2UX 5A8WB 3GZ7A 2FC8A 1U6BA 5DZ7A 2XG8A 5L39A 3CJ0A 1KVKA 5ETRA 4DMZA 4FDFA 5EWGA 2AIRB 2VDIA 3KDNA 1Y4ZB 4YY3F 5CH7B 2HHVA 2CQGA 3DHXA 4PWUA 2IJRA 4WBFA 4OHZA 3GIRA 2FGOA 1L3SA 4WFYA 4NPOA 3WC0A 2WK4A 2FJEB 1WG4A 3Q8VA 4OYPA 1N6QB 2FQQB 3L4BC 4DQSA 2BW7A 2BJ1A 4QOTA 3CDWA 4RW8B 2XZWA 4DQQA 1IR0A 1W7WA 1FNXH 1FK9B 1HW8A 1U1NA 2VJVA 1NKCA 4BCAA 1NXIA 5KOWA 4ED8A 1QD1A 1RBAA 5DJBA 3QFHA 1GT8A 3GJQB 3NWRA 1FX2A 3PV8A 4ED2A 3CT9A 4LF9F 2CNOB 3D1QA 3MEKA 4KTQA 1OYEA 3CMAS 4B9VA 4ECZA 1C0TB 3K7RA 4Y2CA 2PDAA 3OV7A 2HLUA 3G82B 3Q8YA 3WX4A 2FHMA 1YRXA 2G2YA 3ZTPA 2PMWA 3EZ5A 1L3VA 2RDDA 4ERDA 1UETA 2O67A 1NK4A 1TKZB 3W8PA 2GS8A 2MDAA 4F3MA 2HZCA 5IM0A 4JYAJ 1ZETA 2VASA 4JI3F 2JC1A 3GSDA 1CVJA 2PC6A 5HAOA 4B3OA 2V8VA 2B9XA 2Z0GA 2I6WA 4DR6J 2VKRA 4NA1A 4ZVHA 1RT1B 1VRTB 4ZP8A 2VG6A 5J1EB 3QIDA 2W7AA 1BQNB 1TL4A 1X0PA 3HHDA 4KY3A 3CCUS 4U8VA 1XR5A 4JI7F 2UVVA 5KG1A 1MMDA 1VMBA 3GFHA 4MKBA 1NZ8A 4LQ9A 2PA8D 4ANEA 3FQLA 4AUKA 2JLGA 3BDPA 1IWAA 1HNIA 1H3DA 1H98A 3CD6S 1SJ3P 3W65A 3CF5Q 3M6WA 4M5IA 1P27B 1RAAB 3PX0A 2ZH5A 3KK2B 2QYCA 3A1YG 3V4MA 5KFAA 4YS2A 3T1YJ 1SV5A 2IAJB 3SV4A 1DQAA 3D6MB 1H7XA 3D68A 4O44A 2J6TA 2DNYA 1S5ZA 1S9GA 2JHEA 3AXKA 1TFWA 1S57A 3S01A 2VQFJ 2E9ZA 2KT5A 1WKLA 3ELHA 4IQMA 4DQPA 1IBLJ 2XSJA 1AT1B 1C2PA 4UY85 5T7LA 5DGBA 2OPPB 1DRZA 4MH8A 1MROA 2F8HA 1WG5A 4LBHA 5D3GB 4CH7A 4TQRA 3HXMA 1ZZFA 2Y1LB 3PTWA 4NLTA 1RU2A 4CZCA 1GEHA 1S1XB 2GFFA 4F3QA 2C2DA 2HG4A 3UW1A 2RQCA 4ZMMA 2DY9A 3CCTA 3MR5A 1F3FA 2ILZA 2UVWA 3G82A 1RZMA 2CQHA 5KFNA 3FBEA 4C7QA 4ZPAA 5KG2A 5KFJA 2VG5B 2XMJA 2RVJA 1UJ4A 2C2KB 2DGQA 3BGFA 2XLIA 1KSPA 1K0TA 3GE9A 1X5TA 3OVAA 1ZPVA 2E5IA 2D74B 4P10A 1PILA 2ROEA 1S0NA 1S1UB 1ULRA 3VAFA 3QGPA 2LECA 3M8RA 1BQMB 2FDNA 2QLFB 1S9EB 3M2UB 3NCQA 4NRUA 2RIJA 2QMUB 4HT7A 4CM2A 4GKJF 1FHTA 1RT1A 4TLQA 1PAEX 2HVDA 1U2FA 3PRBA 2AJ2A 4BLGA 2FZKB 1XMQF 2D3ZA 1QTNB 4HVZA 1HLWA 2DD8S 1GXTA 5KT3A 2CWKA 1PJ7A 3R6LB 2CQIA 4LFBJ 4YHHJ 4CLSA 3TJ8A 3PCOB 3SFUA 1WKJA 2IYGA 2P2CB 1IKXA 3SQGA 2KYZA 3B4MA 5D4NA 1HWLA 2UXBF 5IV4A 2YPZA 2ERRA 5C42B 2M9KA 4URGA 2QL7B 1FE0A 1GX6A 4F7VA 1KEKA 1U4BA 2YKMA 2AYEA 3K5PA 1RAJA 5E0OA 5AXLA 1HWKA 4FNIA 5KT5A 3MR3A 1ZTWA 2UUTA 2LEBA 2FVPA 3RB3A 1AZSA 2WONB 3RAQA 4MTPA 3SEOA 1NO8A 1S1UA 2OFGX 4DL3A 2OTLS 4Q45A 2AQ4A 5HROA 4UOFA 1U6FA 2DXEA 2IFXA 2PIIA 2WVBA 5HQ8A 3GV8B 2GNKA 3AB2B 2W01A 2XI2A 2ZITA 3P5BP 4MKAA 5KFPA 3HSZA 2CQPA 4YB5A 3SSSA 3Q8RB 5HLFA 2VB6A 1N56A 1NNDA 4ECXA 4DZDA 5GAEI 2I0XA 1GMVA 5BR8J 1NSKL 4I2QA 4OYBA 4K2XA 4ED3A 3JYTA 1WSRA 1GMUA 3N01A 5T14A 5IV3A 2HYIB 2K2PA 3JQKA 1HI1A 4DV6J 2X1FA 1ZS6A 5EN1A 1S77D 1D8YA 2H1YA 1OY9A 3I6PA 4K4WA 3OL8A 2QSWA 2OPSA 4ZVRB 1WHVA 1P9QC 2DNKA 2VKZG 4XDDA 3DDKA 3GCWP 1Q5YA 1WELA 4AT1B 3FC9A 1UMJA 1V9OA 2A18A 3CJQA 3DXBA 4RWXA 4UT4A 2VIHA 4LFAJ 3T1HF 2HZVA 3BBFA 2YVSA 4A8FA 1OPIA 1TU0B 2X1GA 4DFKA 1AROP 5KTQA 5AXMA 1VRUA 1S10A 1U02A 2W9BA 3T41A 4X4OA 2HPUA 4DV0J 1YGYA 3OTDA 1KKHA 3PY8A 4DR3F 2AGOA 3SQGB 2BDPA 5FD1A 3MOJB 1QAJA 4WWSA 1GMWD 1Q7YT 1FKOA 4X65F 1Z1ZA 1XQIA 4OHXA 1RHJB 3MR6A 3ILJA 4OLOA 1X5OA 2ASJA 1H38A 3OFFA 5IC4B 2KG1A 1XEZA 2VU5A 3DC2A 5A8RA 3AQOA 2WSFC 2BM1A 3LWLA 1PC5A 3AH6A 3VHQA 3H40A 1XNRF 4URQU 3IBFB 2GVDB 2Z56B 4OZ1A 4USJC 4ZDNA 3VQTA 3B78A 4EI2A 4RUCA 4QBUA 3SI8A 3OSPA 2LQJA 1S6OA 3CJKA 4QYZJ 3OQ2A 2Z8QA 4PABA 3MMAA 2CJQA 1WDTA 2BW2A 4L3KA 1KD1T 3MM5B 1XMOJ 1U09A 4QIWD 5LSRA 2BKOA 2IRXA 4RNNA 3PRVA 1RQ0A 3PJWA 4DUYJ 1HNZJ 3RB4A 1VBKA 3AJ2A 4KH0B 1U1OA 2AHOB 4EZ6A 1UTAA 2HNYB 4GRSA 3ZFVA 5DLGA 3KJVB 3MCSA 1R0BG 4IOBA 2C42A 1URRA 2ZVSA 2HIYA 3BZQA 3FMBA 5D4LA 3W2VB 4ZIVA 5AE2A 2QA4S 1U2CA 1HNVA 1DQ8A 4OHWA 4YN3B 2C2ZB 1OIAA 2HQIA 3NRBA 4DUTA 3BKFA 2DNRA 1UVLA 4PYAA 2ROPA 3C15B 3KHGA 1IUJA 2BVZA 3MURP 2AWZA 5F0UA 2VJUA 1HBMB 1R0AB 2CPJA 3VAGA 1VHFA 1HD1A 3RZAA 4GC6A 4NLQA 2C22A 3JSBA 2MGZB 3EZUA 1G2EA 3UFCX 3DRYA 3KMSA 4HDHA 2D9OA 3ZZPA 3PHTA 4O3QA 3U02A 1O5JA 3ADAC 3TA0A 3G8QA 2YWGA 1D3WA 2XBPA 3Q23A 2DR9A 3CCMS 1N32J 1NSPA 5CCMA 2OPQA 3R5DA 4DX6A 5BYRA 5GADI 3OLAA 4F2RA 1RCOB 2H65B 2YX4A 4OLPA 3A8JA 5M2PA 3JAMY 4DR4F 2KKHA 1WHXA 1MLAA 3N79A 4WU2A 4Q0BB 1LOUA 2QLBB 5LMUJ 3FBCA 1FRLA 1OY6A 3IMQJ 1Y11A 4CO4A 1FJGJ 4PQAA 2C3YA 4YR3A 2RT3A 2HWIA 4Q5VA 4EYHB 1X9SA 3UN2A 2DGUA 3FNNA 3I82A 2VDHA 1NK5A 3RB6A 2AD9A 5F8NA 1Q8LA 5EX3A 4OV6A 3DGPA 3QAEA 1VRTA 2HK3A 4LF5J 5I4MA 4MFBB 5J1EA 3ISND 2PD1A 3J7AN 2VH7A 4LF4J 1BWVA 4ED5A 1PYSB 1YITS 1Q4RA 2BA9A 2ZDOA 2HURA 2B4UA 1F9HA 1U26A 2R4FA 1S7HA 3MM5A 1ROFA 4ANDA 4IRDA 1IKVB 2B5JA 2BJ9A 4LF7F 4WP9A 1WTBA 4K0KJ 1HWUA 2EEYA 4USHA 3HVRA 3GWCA 3VAJA 1SC6A 2QL5B 2PO4A 3O6QA 3DOKA 3KK2A 2BE2A 4NCGB 2V63A 1FEHA 5HATA 2ZH1A 4EO6A 1S6QA 5ETNA 5KAKA 8AT1B 4D3GA 1JLBA 4DV2F 1S9GB 1PAUB 2GA7A 3F0NA 2GAGC 2HVHA 1MN7A 5KFSA 5C7PA 2BQRA 3P45B 2W9CB 3GJRB 1RTDB 3CD5A 1IXKA 4WIIA 5G0RB 5HMXA 2E9RX 2H48B 2J7WA 4AYBD 3OTOF 2WOMB 2FTRA 2HWHA 3BH6B 2H4WB 3TA1A 2W25A 3MAQA 2ZJQQ 3PW7A 1ZM9A 2K06A 1JLFB 2MMYA 1TKDA 4LJMA 2EFPA 3M9NB 2P9GA 5L1KA 4HHUA 2OKQA 4Y28C 2KDOA 2XGPA 5HP1A 1F5BA 2E7XA 3CNQP 4I56A 5DZ6A 2I2YA 2OPQB 1LFWA 1RWUA 1WEYA 4ZIWA 3MAHA 2DEJA 3H20A 4DR1J 1U1QA 4DUZJ 1SH0A 3HT3A 1N5YA 2C2MB 4HI1A 2R2TA 2I5JA 4TY8B 3G8TA 2ZOFA 4JI1J 1WC0A 3HFKA 2AYGA 1YI2S 4ECWA 3FFIA 4WKYA 2XHCA 1F2HA 3FRZA 4KGVB 2XLKA 2HAIA 1ZM2A 1TAUA 5KT7A 1LW0B 4B9UA 4CNZA 4CT9A 1H72C 2HQ3A 2P5VA 1CC8A 2B4PA 1XR7A 3CCVS 1ZTTA 4A8QA 3MEDA 2RF2A 1YBTA 3MDFA 3MGJA 4K5RA 1RCXB 2COLA 5M2RA 3VVUA 4CLUA 5AJ3F 4YHHF 2R8HA 4LFBF 2G1HA 2DH9A 1N5QA 2FZGB 3MCOA 4TU9A 5A0YB 5D0GA 2XO6A 2W7OA 2QGFB 1KVJA 3OTEA 1DJ0A 5BYQA 1OSDA 4JB8B 4LSNA 3N6MA 3QT6A 2UXBJ 3CMQA 3J7YU 1HBOB 2ABYA 4GC7A 5BYSA 4KHMA 2R8KA 4LR7A 2LFVA 2XMKA 2GGPA 3MM7B 2FY8A 3H5XA 4KHRA 3ZZUA 1RI7A 4ZVPB 4OX9J 5CYMB 3NOCA 2EVZA 4Z37A 2HWTA 4MAKA 4KC5A 3G9CA 1DFDA 4XO0A 2A6MA 5AT1B 3D1HA 5C2CA 1EB0A 2CIMA 2ZZMA 4HL9A 5HROB 1EAYC 2DGOA 4DWIA 4EBCA 2BRLA 4J9RA 2B8PA 2BJEA 1R7IA 2GV1A 3M8PA 4ZVEA 4OZ0A 5E33A 4RNOA 5B0EA 2PI4A 3QQCD 2HHTA 2OO4A 4YDXA 4W90B 2UVRA 1DLOB 2JVRA 1DURA 4CQ1A 2Y0SD 3BQ2A 4DLEA 4A8YA 2ZE2A 3MM8B 4QCLA 3GIIA 4Q2MA 5JMNA 2N4CA 2KM8C 1FVQA 5KFEA 1RJJA 2YKOA 1NCLA 1VJQA 3I55S 1NJWA 2OUGA 4C97A 1FFSB 1KOHA 1FRIA 1W2IA 2W4DA 3US5A 2FJDB 4CLYA 1GNKA 4F0KA 2NREA 3DOMA 4OYZA 1HHSA 3PVXA 2MYFA 3IWNC 2MQPA 1LWCB 2HFOA 3DN9A 3KKFA 4LF1A 1HMVB 3G71S 3Q8PB 1Q8IA 3CC4S 1N4LA 3TOQA 1R89A 2GJFA 2R9LA 3OHBA 5D4OA 3PO5A 2RQKA 3UDLA 4ELUA 4U7UK 4M8LA 3C6UA 2DNLA 1Y5IB 5I42A 3R5JB 3HZGA 1YJ7A 2IVFB 4C2MA 3ET6B 1R8AA 4XIUA 1PCAA 5DQGA 1QSYA 4JI3J 4ANCA 5DS7A 5GMDA 5B08A 3JSMB 5DDRC 5ITHA 1WC5A 2AV5A 1VCTA 3U27A 4RBVA 3MUMP 1PYTA 2I1RA 2MQ8A 3H7HB 5KG5A 3QLHA 3PW0A 3KLHA 2XNQA 4DV5F 5I3UB 4ECVA 3G87A 2CJXB 2Z57B 2CVIA 2JOQA 5F8MA 2GHVC 3B6BA 1REVA 2MSSA 1VISA 3BSCA 4AXJA 4DUYF 1VC5A 1HNZF 4DDFA 5D3GA 2ILYA 2HFSA 2OEJA 2CQDA 1VQ5S 4DXLA 3NGSA 3P96A 4O3SA 1VQSA 2DNNA 4JI8J 3P4UB 1J2VA 3N9UC 2DXDA 3BBCA 4L6V3 3J81Y 3WX8A 2MEWA 1TL7A 4F3OA 3V4IA 4J90A 1E6YA 1L3UA 4M5DB 4FF2A 1S1TB 4NCAA 4ZCIA 4DL0C 2EWHA 1EP4A 4MT1A 1R0AA 2MLXA 4IFYB 5HL7Q 3DRSB 2XWXA 4UUWA 3M8SA 3EXYA 3VAMA 1S1WA 4J9LA 5IM0B 3RR8A 5HMYA 3T5HA 1FRXA 2LQBA 2HMIB 2MKKA 3DOLB 1WC4A 3UWTA 4KYZA 1WG1A 4A8KA 1MU2A 1F5AA 4CTAB 4GVBA 4U95A 4UUXA 2BR0A 1UCNA 2D1CA 1MNEA 2P6TA 3GYNA 5CZVA 2XS7A 3T3FA 3V6HA 4USIA 3OVBA 3QJPA 1FO1A 4I2PB 4RNHA 3ILLA 2HGLA 1B3TA 3BGRA 1X4GA 4UF4A 2DGWA 4TXSA 2D3OR 3M6UA 1Q8KA 3R1LA 2Z2ZA 4OFZA 4P74A 4RU2A 4HHHA 2AJ4A 3I0RA 1NBEB 1S6PA 4OI3A 4B3SJ 2CUYA 1HA1A 3HK2A 3OD2A 3FEYB 1RBOB 4MFBA 4OZNA 2VF3A 1T9XA 3GCXP 5KOXA 1S9EA 3AODA 2HBRB 1VQKS 3U1MA 1MSWD 4PRFA 3TYTA 2LXFA 3VZHA 4CIOA 2VUGA 1T94A 4FBUA 4OZJA 2VC0A 1PO6A 3LANA 3LPEA 3KLGA 3OHAA 2C3OA 1LWCA 1QAIA 3HVWA 2RS2A 2YNHB 1C4AA 2GMJA 3Q89A 1ZYQA 2FLPA 1RDRA 3BJYA 3DOLA 3NBPB 2XS5A 4L75A 2OIHA 2CADA 3NGRA 2A3JA 4PXBA 3DOKB 1VC0A 5K8OA 2O3DA 1EARA 2LKZA 1XWLA 1OPZA 2BACA 4UTGA 1NHUA 1TL7B 1UL3A 5IWAJ 1E6YB 1BGXT 4JV5F 3ENWA 2B8QA 1WACA 2KVIA 2QC3A 5KT6A 1TKXA 1HYSB 1TUWA 3CJTA 4OYWA 1ZM3A 4DPWA 5DDOC 2ZJRQ 2AJQA 2DGVA 3RTVA 4UQTA 2M0GB 1JJ4A 4XK8C 1B0VA 1NKEA 3PYEA 3MMBA 4H4OB 2XY5A 1RWVB 4GMKA 3DLEA 2M2BA 4NASA 4OJHA 3SCIE 1QJHA 2HFZA 3GR1A 4AFFA 2CKWA 3W9HA 4NI2A 1H2VZ 2AKWB 2DGTA 2EFOA 5K20B 2MY7A 3C6TA 2ZOMA 2KXHA 1RLCL 4ZVTB 3ETOA 4NYZA 5F3TA 1NK8A 2FJVA 2FJAB 4DR1F 3Q86A 3LP2A 1TUGB 5FLXU 2RU3A 5C25A 2B56A 5D15A 3PW5A 3IXQA 4AD6A 4LBIA 2DR6A 1FDDA 1GAOA 1OQ3A 2W9BB 4UY8T 1GMWA 2BJ8A 2LVWA 3A8KA 3J7Z5 4DCJB 4FF3A 5E3RA 1D9DA 3MF5A 2ZBIA 3R7BB 4M5GA 3QIPA 3PKYA 1XJWB 3TR5A 4O0NA 4BC7A 2YWWA 3GONA 2JC0A 1I94J 1A6LA 1LW0A 2PEHA 2Q6BA 3K8WA 5LM7E 4B9NA 4IKAA 4N77A 2KRBA 2LEAA 3N5BA 3R2DJ 1JLCA 3CJ2A 2MHNA 3N28A 4CLLA 3HD2A 2OTJS 2GX8A 4FYXB 3IS9A 1K0VA 2RRNA 2RS8A 2AGPA 2XCAA 2FYXA 3OFHA 4CYUB 4B3TJ 2EPIA 2I8EA 1RAIB 1RT5A 1NDCA 4WTYA 1Q95G 5F0WA 1FRKA 3AAWB 2YQ0A 5HLFB 4CWBA 4I67A 4USKA 2V4RA 2GO8A 4FVMA 1SVDA 5EX0A 5KFQA 2IRUA 4ZCMA 4I2QB 3NCRA 4F50A 4K5SA 4PG5A 2G9OA 2Y1IA 1H73A 3IG1A 2EI5A 4KE5A 3OW2R 1IBKJ 4LF8F 2RDJA 1SJRA 3MI7X 4FYWB 4OHVA 4K59A 5J2QA 2AJ0A 1NK9A 4PG6A 3GV5B 1RT2B 2Y9HA 1YJRA 4TYBA 3SDEA 4P75A 3W7BA 4DV1F 2CWXA 4DX5A 4C9DA 4I64A 3UQSA 3KLGB 1NM2A 1V3RA 3BB5A 1Y3KA 3C6TB 6AT1B 4PWDA 3L3CA 1U0SA 1MMNA 3TZYA 1WI8A 4ZJOA 1ZA1B 2UUCJ 2XNRA 2CJ9A 2QMWA 2QIFA 2W2PP 3DFEA 3EM1A 4OI1A 4ZITA 4GKJJ 3C16A 2FHJA 2YWEA 5LMNJ 2IA6A 4IOAQ 1F5CA 1N5SA 2V6AA 3A12A 2HRYA 3G86A 4OV1A 1FDAA 1R31A 1QDUB 1WWHA 2ZVIA 3LW5C 3TJAA 2LA4A 4C8KA 4C8OA 4NLGA 1C1BB 1KLMA 1YJWS 3R5BA 1WTFA 4R8UB 3Q22A 4WKRA 2BE9B 2G0IA 4QQBA 2OMLA 4HR2A 5F9LA 1KR4A 1QSLA 1S12A 3GQCA 3GU0A 4NLOA 4JV0A 1N0VC 2J76E 5A8KB 4K4XA 4DPTA 1J5OA 5E5NA 1AW0A 3WC2A 2ZKTA 1A0OB 3PFOA 4P72A 2KHDA 2HK2A 1S76D 3OJSA 3MECA 1U25A 3DDNA 3CCES 2WSCC 2DR8A 4YB6A 1PC4A 1KQKA 1FNMA 2CQBA 4HH0A 2B6AA 2LU2A 3G6ES 3V6DA 5AXNA 4X4NA 2OLWA 1RT4B 5T7LB 3RGIA 1ELOA 5LT5A 5JVGQ 4B3MJ 4RW9B 4HACB 3OUYA 3VGVA 3SSQA 5DG8A 3SZ2A 2Y8YA 5B0DA 4RW7A 2HHWA 4DPOA 1DZ5A 3I0SA 4Y65A 5E3QA 1RUSA 4LF5F 4KGZB 1L5UA 1P9YA 3AJ1A 1HARA 2OP5A 2QMXA 3G96A 4F8RA 4CM0A 2B3TB 3C15A 4PUOB 2XYPB 3D0HE 1EETB 2WVDA 4O44B 3B82A 3NAHA 1C4CA 3S1TA 1D9AA 4CH0S 4DPYA 4F25A 4HT5A 2MQLA 4C3KA 2OFHX 3SYZA 2ASLA 1N36F 4KFBB 2IM1A 4K0KF 2K3KA 2BQUA 2NXEA 3CCRS 2DPJA 4A8MP 4EEYA 1UEKA 2YWHA 2C2OB 3JS9A 4ATNA 1FESA 2A0FB 3BM7A 1VBXA 4RR5A 1ZBTA 3RBZA 1CC7A 5K8PA 2V2KA 1RAGB 2DIVA 2DITA 1TP7A 3ZTQA 2B7CB 2ZNZA 3DDIA 1WOOA 2QZ8A 5D8HB 2QE5A 2LXUA 1E6VA 1YZ7A 1X5SA 2YTCA 4TY8A 3CPWR 1U8WA 1WF2A 4ZPBA 2DJWA 3TEHB 3VZIA 1EKRA 4NLXA 4U8YA 2V67A 4U9RA 5K8NA 3H4DA 1APSA 4YR0A 3AD8C 3FZBA 1X4HA 4OQJA 3H4BA 3POTB 1WC3A 3UVJB 4NXNF 3BPDA 2YNFB 2ZEJA 4LRAA 1N8RT 1RA6A 3AB4B 4NLDA 2J8AA 2N3LA 3H8YA 4DSIA 4X4QA 5J2MB 2HRTA 2M4MA 3B54A 4NOHA 4WIQA 5GMEA 2WOMA 3F41A 4HLBA 3KHHA 3F73A 2DHHA 3NG8A 4RPFA 3IN5A 4EZ9A 4EFAC 1A7GE 2KFYA 4JI1F 3VGTA 4NL5A 1UA0A 3C2PA 3QNWB 5L1LA 1QE1A 3P3DA 5CYQB 2M70A 2CPXA 2X3DA 3VCDA 3I5AA 1HBNB 4TU7A 2OEMA 2IIHA 2L08A 3A3PB 4TNOA 3TARA 3Q2SC 3QT7A 4YR2A 4JI7J 2R7OA 3NGUA 4X62J 2QA2A 3W5XA 1ZM4A 5KFWA 1WDDA 3QZ8A 5B7WA 3R3TA 2KYXA 2RD5C 1YX2A 1PJ6A 2JFKA 2GVZA 1CJVA 2WW4A 2ZH4A 1WNEA 1NHVA 1SQFA 2E5LF 2CPEA 2CVEA 3GR0A 3R7NB 1K47A 5KFKA 2AZ3A 5G4DA 2OPSB 1JK9B 4NZ7A 3JQJA 3GIJA 1AA1B 5KFGA 1YIJS 3TJ9A 2F1FA 1VQYA 5C2GA 2RDIA 4L73A 3KOAA 4USUA 3T5KA 4WK1A 1HNWF 2JEIA 3K17A 5RUBA 4PG8A 1YG0A 2CQ4A 1OS5A 5J2NA 1FERA 4OX9F 2DR5A 3J81U 3EXCX 2F9DA 8RUCA 4IO9Q 1YBAA 4JV1A 2VOPA 1FDBA 2UUBJ 1VGYA 4KV8B 2EKNA 4JI6F 2XC9A 3W64A 2LXIA 3D1OA 2WRMA 2HRUA 2WCXA 3A13A 2CQ2A 3H0PA 1F60B 3IR7B 4OIXA 4PAAA 4WXWA 1CG2A 2F63A 3SXLA 1XC9A 2K1RB 4LIRA 3POTA 4PPDA 2NCKL 1CJTB 3O2IA 1BD6A 1RLDA 2X51A 5ETOA 1UPPA 3TUZC 3HHNB 5THWA 4QWCA 5K14B 1C0TA 4AL7A 4Y3CA 2RKIA 4A8WA 3ILIA 1D0EA 2BOAA 3TAMB 1CSJA 3LP1A 1R8BA 2LQ9A 2YWKA 3GP9A 4ZP9A 3SV3A 4HKQA 1TV6A 2PMHA 3Q24A 2UXCJ 3AD7C 3E2EA 3IA0A 4LF6J 1IWGA 4J9VA 2F8MA 1Q1KA 2PT0A 2QFIA 3PFEA 1YJTA 3VVTA 4WK3A 3FZ2A 1KRPA 4ZVSB 1IM4A 1M5SA 1GH8A 4HTIA 2E1PA 2J0XA 3SSRA 2ZH9A 4OJGA 1VQMS 3QWPA 2DVIA 3Q8QB 2IM0A 4PG4A 4ED0A 2VA2A 3AQPA 4YMEA 3CJ4A 1H6KX 1Q53A 3W9IA 2VQEF 4CYUA 4B3TF 4DR2J 3KG1A 2R7SA 2XMTA 1NH8A 1PJ5A 2J9CA 3BKUA 4P7TA 2IA0A 1GX5A 2ZHAA 4OX7A 5E2QA 4X64F 4LR9A 3I5CA 2YKNA 1NAQA 2IPOB 4V19J 2OJ3A 1JLQA 3CDEA 3PYFA 1S72S 1FD2A 2ADBA 3VQSA 5DETA 2XCPA 1VRQC 1B7YB 2VBYA 4ZP6A 3V6KA 4X84A 1X0FA 1FJCA 5D78A 4QR1A 4PYDA 2FLNA 2YNIA 5IQ6A 3HKZD 2D3UA 2N4DA 2V9WA 4ZVGA 1UFKA 3JSYA 2UV8G 4F4YA 3KLIB 3DCAA 3NGTA 3T9ZA 3PRDA 5I3UA 1SQEA 2LMIA 3EUNA 1RISA 3QMQA 4ED1A 3JQMA 5KG3A 1D09B 4CT8A 2AEMA 3ZNJ1 4MYTA 4OZ3A 2DPIA 2KFZA 1RTHB 4ZLLA 4CH1A 4CO5A 1RKIA 3DGPB 2MHEA 5LMNF 1CJUA 2E5GA 3CUNA 1AFJA 1SC3B 3M9OB 4IUFA 2YX1A 2RKIB 3CDAA 4MKVA 4J9MA 4DV3F 3TAMA 1G7CB 2IJFA 1RAHB 2U1AA 3L7OA 2JDJA 4LREA 3FBFA 4M5DA 1HPZA 4PKDB 4IG0A 2ZBPA 3FMWA 2DNGA 2V8GA 5F8IA 1JLEA 3MPVA 3HPOA 1NK0A 4NLUA 2MZJA 2KTQA 1B64A 4NEYA 2B9WA 1NDLA 4MK8A 5LJ3Y 1T9YA 3TNVA 4QYZK 5KFFA 3DM2B 3M4XA 4KRWA 1PSDA 4ELVA 4ZA1A 5HJXA 3KK3A 3I4PA 2R8IA 3BN7A 1VBZA 2K1RA 3K2YA 4WP3A 2DHAA 3W62A 2VONA 3IBWA 2XYGB 1FTRA 1F9EB 3ILOA 3NGKA 2XGQA 1KFSA 4I69A 2KFNA 4LRCA 3UNYA 4DN9A 1RHRB 3TX0A 3BGRB 4U6PA 1N34F 2MKYA 3M32B 1WD6A 5CXTA 4LRFA 5GAGI 1HWJA 4AQYJ 2JEJA 3EDQB 2E1CA 4CLWA 4USTA 3J7A1 2E7VA 3PJXA 1I6JA 4OX6A 1T95A 3UCGA 3NS6A 3C19A 2IVYA 3V4IB 1Y10A 5I3PA 3ZC4A 3VAIA 2BJ7A 2FVQA 1MW7A 2OEKA 5HVHA 4TU8A 3M6VA 2AMCB 4J9NA 2IMOA 2AGQA 1N36J 5CQGA 2IDEA 2XY7A 1NDKA 2BUNA 3NEKA 3WHIA 2CQ1A 2HGNA 2PEBA 4A46A 4PZVA 3PR5B 1RTDA 4EYIB 2ZH2A 3R1HA 3PO4A 3HHLD 3EX7B 3DM2A 3EJMA 3GLJA 1RWWB 4HI2A 4I0WA 4ES1A 3IR5B 3AJDA 1LV5A 1RABB 2K7KA 4R0JA 4ECSA 4IH7A 3ZZTA 2ZKUA 3E3XA 4ZN1A 3KLFA 1KS2A 2CPHA 2MY8A 3HM9A 3KWMA 1U24A 2FD2A 3EPIA 1S0VA 3MOZA 4ZS6A 1RACB 2ASYA 3THPA 2X7IA 5EHHA 5JVHQ 3GYGA 1RWXB 1L3TA 3V5RA 4ZJLA 1JNZB 3ISZA 4J9PA 2XMUA 1PG5B 3J80Y 4PR6A 1IBMF 1SH2A 1RKJA 3HVAA 1TFYA 1RAFB 1CLFA 2R7XA 3CDBA 2B7BB 2H51B 1U47A 5KT2A 5HI7A 2BXJA 5DDQC 1DTQB 3QBCA 3HT0A 4JUZA 4NYPA 3P49B 4KSEB 1H0HB 4DQIA 4Q7AA 4IRKA 1JJHA 2EFVA 3PR4A 1N6QA 2V4JB 2HQFA 4FVCA 2HHUA 1UPMB 4U7CA 1AXQA 2IMWP 1TAQA 4QPTA 2QRRA 2XSJB 4F4ZA 7FD1A 2HVZA 3DYAA 1QAYA 4L74A 2W2QP 2RUSA 3D28A 2BANA 1S79A 3K5NA 3THTA 3W2WA 3DI6A 5EGYA 1MMLA 1X4FA 3M1VA 1M1KT 2AX0A 2NSBA 4P52A 1RT7A 5H9FJ 4Z7YA 3KK1A 2WZ1A 1F3VA 1YVFA 2XMWA 1FKOB 2DNHA 2YKPA 3CJSA 2EW9A 3CJ5A 4FKXA 1CQMA 4DSEA 2HNYA 2JVOA 4NZ0A 3LQVA 2DBBA 4CO0A 1HNIB 2CJAA 2DTJA 3JAMU 2ASDA 1G6BA 4V19X 1NHKL 1SJQA 3W2VA 3BSAA 3MFHA 1FNOA 1W26A 4B3RJ 3BPSP 2IRYA 1DHMA 2NYHA 1IQZA 3P5TL 4PPZA 4WU3A 3ITHB 2CG4A 1G4CA 3TZXA 4WP8A 5J2PA 4CO2A 3KDOA 2XS2A 3EE3A 4B08A 3I56S 3M30A 3NNCA 4CLKA 2N7CA 2VBWA 5A6WA 2IM2A 2BV3A 4B3OB 4Y6IA 2E1RA 1HMVA 4WCEQ 2QO3A 3AFGA 3OTOJ 1IBKF 4LF8J 4O3RA 5IT9Y 1RAOA 1Y3JA 2ACYA 3M7VA 4YB1P 2BEFA 1FVSA 3C6UB 1NB7A 3Q83A 5I42B 3IFEA 3MCNA 1PGZA 4TLRA 4OYOA 3VAHA 3UD3P 2HFUA 4ICLA 4HDGA 5L1JA 1JQGA 1IVZA 1YBUA 5FDLA 1HI0P 3SDEB 2Q6CA 2DCLA 5BR8F 2PFFB 2J6SA 1GQEA 3D0IE 4OJ1A 2MQMA 3OTBA 2AF6A 2ZH3A 1X60A 2IBOA 3I87A 3GFZA 3Q0AA 4DL5A 2ZNYA 4C11B 3R8YA 1NPKA 1SJ4P 4LMZA 2EK6A 3JXOA 1VQ6S 2R2RA 1NJXA 5CZXA 3JTOA 3UDVA 4RZRA 3TUJC 2F65A 4RJVA 3DRXA 5ETLA 4CLTA 1K73T 4NXMF 3VGSA 3P6YC 3M1VB 2YY3A 4NWBA 3T1HJ 2IC3B 3CE8A 3B4DA 3ET6A 1HR0J 3MAAB 1YQHA 2MZTA 1T7PA 5DGAA 2YH0A 1MROB 3EMTA 3EWGA 4J9OA 1VHIA 3HX9A 5A76A 5AJ3J 4C0OC 4ETZA 3I0SB 4YP3A 1IKXB 3H59A 2JZ5A 2RHSB 2DO4A 2DGSA 1UWBB 4KO0B 4ZVQB 2DRAA 1JIHA 2MKSA 1WC6A 1DARA 3OR1B 3M9MB 4OZLA 1Y5NB 2DGXA 1C0UA 2NZCA 2HQCA 6FD1A 4JV2A 1EQMA 4F36A 1UVKA 2GMHA 1WOSA 4ZJQA 4RU9A 1NRKA 3CCSS 3EGZA 1G3OA 3I9V9 1AZSB 1HQEA 3NNHA 2DB1A 5B09A 1NZAA 2HMIA 2VFSA 2QLWA 3A3OB 4PQUB 3L09A 2OELA 4C11A 3M2UA 3W2WB 5I3QA 3G6YA 1RHMB 1IKWA 1UFWA 2ZC4A 1WF0A 1Q79A 1XK8A 2HS3A 2Y3YA 4NX9A 4F0MA 2N82B 1NLKL 3K5LA 4GKKF 2MKHA 5KFXA 3KLEB 1JJCB 2F5GA 4ZPWR 2OH2A 3BS9A 1N5YB 4EWTA 2DCUB 2P6SA 3CCJS 2KJWA 4PCQA 1S1VB 4CDIA 1U49A 2N7YA 2FVSA 3HULA 2L9NA 5D77A 1U7LA 3FFIB 1ACMB 2DHSA 4NA2A 4DPXA 2HHHF 3QJLA 4OJ3A 4ETXA 2QJ3A 1B0TA 4PXDA 2VBZA 3D7SB 4RNMA 2NPIA 4S0MA 4L3NA 3IP0A 1RTIB 3TQEA 3K5OA 4QU6A 1JKHB 3TUIC 4BBYA 4QZVB 1FF2A 5AE3A 1X5PA 1X9MA 1V3ZA 2HHXA 1FTCA 4MIWA 2ACMA 4KT0C 3NBPA 3BQ1A 2VHGA 2Y0BB 3MM9B 2M3DA 4GO5X 4IYQA 5H9EJ 2P8IA 1M5VC 3TRGA 3W9JA 4IOCQ 3Q2TC 1S6PB 3CJ3A 4Y2MA 4A48A 2R7TA 4Z2XA 4NXNJ 1SIWB 5HK4A 5SZTA 4KGMA 5KFLA 5H9EK 1EETA 3P8BB 2YNGA 1S4EA 2UXDJ 3L7UA 1FRHA 2W9AA 1M1HA 4B9SA 4BC9A 1LWEB 2RNEA 2GO9A 2Q3PA 4ZLNA 2AP6A 2HHSA 1HI8A 4IDKB 1TVRB 1U2RA 2XMVA 1JB0C 3BGUA 1NKBA 5CYQA 4N8NA 4U96A 2DYAA 2CZ4A 4KB7A 4LBPA 4H4KA 9RUBA 2NQPA 1M1GA 3O5TB 4RW4B 3NWGA 2RU9A 3U1NA 2YX7A 4X62F 1WUUA 1HKAA 4K4TA 5IQQA 3QFWA 1RSCA 1RWPB 1N48A 3IGVA 1RP5A 1XNQJ 1SL0A 1AB8A 2ALYB 4CO1A 4E8UA 2L3MA 5H1SV 2D3O1 2DH7A 2HNDA 3M2RA 3T5JA 2PGCA 4P7VA 1RA7A 4LR8A 4ZPTR 2E5LJ 3DLGA 3OFEA 1DBDA 2YKQA 1HBNA 4Q2LA 2J7UA 4JI8F 2UVUA 1UVJA 1NUEA 3KUHA 2EC0A 4B17A 2ZOGA 3HI9A 3ZZOA 1U48A 1UP1A 1KP6A 4X4RA 2YQ1A 1YRUA 3HSJA 5LJ5Y 2DY1A 4FXDA 4U67Q 5CCLA 4Y00A 2MQNA 1X8DA 4G65A 1IBMJ 5L9XA 1IKVA 4JOUA 1NU4A 4ZHRB 2V69A 3G2XA 4C3MA 1Q7LB 1BXNA 5D0RA 1X9WA 3MMAB 2MB0B 4QW9A 1U0HA 1CS4B 1HNVB 2M88A 2W4PA 2R7WA 4DFPA 4Y2KA 4MK9A 3RJMB 5ETMA 4I4BA 2LA6A 2M5YA 3M8YA 3PJ9A 5EUHA 1V3SA 4KHPJ 4G6VB 3THVA 4ELTA 3AA8A 5HVFA 2KJVA 1NJIT 1VQ8S 4UW2A 2E29A 4O0IA 2L9WA 2X3GA 4FYYB 5HANA 1EJ7L 3D0GE 2DH8A 4I6WA 2PA3A 3NNAA 5F8HA 2V8DA 3HF5A 4K50A 4A4JA 3DLHA 1RTIA 4HYKA 2OGUA 4DS5A 3W63A 4LFCJ 3K5MA 1KTQA 2CPYA 2NYIA 5KFVA 3OLBA 3G8SA 2JWNA 4ECQA 4ALZA 2RSQA 3H90A 5E3PA 1YSJA 1IR2A 1CBKA 2G13A 1NMEB 1X4AA 3WIUA 1L3KA 3D66A 3ISNC 2CDRB 3X1LB 1O6XA 2NSCA 3IAM9 4LRBA 3BYRA 4A8SA 4DL7A 1FWPA 5ETQA 3WIVA 4WTOB 2C28A 4WYWA 5B0FA 4RW8A 4BHQA 1M5PC 1RTJB 1TMJA 2YNIB 1BQXA 2HGMA 5GAGU 2ZM6F 1U45A 2F4VJ 3DRRA 3PM9A 4YQWA 4KR0B 1RTZA 2R42A 4NZ6A 4J9QA 1KQSR 3ZZRA 3LAKA 5J2QB 1ZAVA 3H25A 1F6TA 4U7UD 3TI0A 3BREA 1RT2A 3N0VA 4IH6A 4I1TA 4IG3A 1R6YA 3NAIA 4X64J 3MD1A 3NP5A 3EVWA 1T8EA 4L76A 2BJDA 3BBBA 2LDYA 2MJUA 2UXCF 3NOGA 4DL2A 1RTHA 4CI0B 2OHDA 2GZOA 5ADZA 3RUBL 3IO1A 2A6OA 5A8KA 2DXFA 4C3LA 4H54A 5K14A 2GQCA 3CIZA 2VZ9A 2ZFHA 1SKRA 4F02A 1VLYA 3MHYA 4LUBA 3LP1B 2QFJA 2GJIA 3VWSA 4KKOB 4WFBQ 2PMZD 2LDIA 2YKNB 2FGCA 2YH1A 3V6DB 7AT1B 5IOLA 4YUDA 1Q5VA 4CLFA 1SPBP 3R5GA 3OJUA 1T11A 3GG0A 4G1PA 2PSZA 1LXJA 1FXRA 2VV5A 2EBEA 3CEDA 1LWFB 4QIEA 3W60A 1F1BB 1VR6A 4YFUA 4N5SA 2R7RA 3BO4A 5F8JA 3D67A 2LQ8A 2CRLA 3ZTRA 5KFOA 5LL6d 3UN3A 3CC7S 5BXIA 4DR7F 1IKYA 2ROGA 1RU1A 1VIXA 3GYXB 2JLFA 5LOQA 4NXMJ 1UJ5A 4AE5A 3DRPB 2DNOA 1OMSA 2BOPA 4K4ZA 3FBBA 1FD8A 2HEKA 1EKSA 3MMCB 4ILMA 9ATCB 2Y1JA 3H5YA 1FWKA 5HBMB 4M94A 4M5KA 5GVQA 4OYIA 5A0YA 2H5EA 4N56A 1BWEA 1T02A 2NUUG 2R2SA 2MZRA 2XMMA 1T03A 5HO4A 2NXUA 4FYVB 5L9NA 2R8JA 1VIOA 5ETTA 5KFCA 4DV4F 1KDNA 4FBTA 3CTRA 2HKEA 1QLNA 5L8RC 2XY6A 2F40A 1T9WA 4FZVA 2Z58B 2JEGA 4Q8EA 3QO9B 3K57A 1K1QA 4I7FA 2NXJA 4R25A 4YB7A 5CYMA 1P6TA 3T6BA 1N34J 4IG3B 4HHJA 4C8LA 3DOMB 3OT9A 1LWFA 2ZH7A 2OPPA 3OXLA 4AQYF 3N6LA 2WB4A 4GKKJ 4NI2B 3IR6B 2QG9B 1S0OA 4XPEA 4CP5A 1NDPA 4LSNB 2P9CA 3T9NA 1JX4A 4OL8A 1ZAWA 2BX6A 4KAIA 3O44A 5C25B 1D8ZA 2AU0A 1XR6A 3KG4A 4HEA9 2ZE2B 1WKKA 3AT1B 1OWXA 4ID5B 3M32A 1UKUA 4MMOA 3HD1A 4WE1A 1B99A 3A4TA 3I32A 3IGNA 3KLVA 4HTJA 1QVFR 1CPZA 4JP8A 4WFZA 1SB6A 2Z30B 8ATCB 2ZZNA 2PE8A 2DHGA 3LALA 3MMBB 4O4RA 5J1PA 4KGXB 3DLEB 3A8EA 4N47A 1BQMA 1SV5B 2IAJA 2FIUA 1FRMA 1LW2A 1S6UA 2B9EA 1Z2LA 2IJNA 4FN5A 4PWWA 1XBWA 4W92B 2GAHC 1IKYB 3AHPA 1Q81T 1JKHA 3BKTA 4P2SA 3EZOA 4X4PA 3E8OA 4F67A 3CDUA 1CQNA 4YDDB 4F4XA 3IS9B 3HVTA 1RAEB 1RWOB 1QUPA 3LF0A 4RL1A 2KXFA 4ED6A 2MJNA 4A47A 3FK4A 1SJFA 1S1XA 4WFAQ 1RT6A 3E01B 1U6ZA 3LA0A 4UZCA 4DSJA 4P9SA 1M5HA 1WF1A 3MD3A 1TUVA 3FSXA 5AE1A 1RHKB 4LIWA 2VG5A 1NH7A 3QRRA 2UXDF 3SCJE 3IAS9 2W8KA 3RR7A 4F4KA 4WE1B 1SCJB 1SQGA 4FPRA 5U47A 5HQMA 4X4VA 5IC6B 4DR6F 3H5UA 2AT1B 2XYHB 4P73A 2VA3A 2Z2LA 1OQ6A 3KFWX 4DF4A 1RHUB 1SC4B 2A10A 2PFDA 3FCVA 1FKPB 1RWNB 3I4HX 5C42A 3TP2A 4E2FB 4X2BA 3KLFB 4DBQA 1EX8A 3HMJG 4UZBA 1TQLA 2LLZA 4CLPA 2BYCA 4OYXA 4QWEA 3PZPA 4IR9A 3DLJA 3M8WA 3CWJA 4Y2IA 1VS3A 2XEXA 3ICLA 2BE7D 5KT4A 2B0GA 2E5JA 3CC2S 2MQQA 3CXCR 1PIEA 2EFQA 3JYTB 2FLLA 4B3RF 4ENOA 3WBZA 2YKAA 5LXRA 3Q8SB 2ZBCA 3G6XA 3LP0B 3CD7A 4DU7A 2QTWA 4B02A 1BY9A 4UOCA 3NMAA 2VPYB 2B43A 3QLHB 2E5HA 2JNJA 3JSRA 6FDRA 2XMAA 2KT2A 4R8UA 3M30B 5L46A 3QO9A 4K4SA 4GO7X 1S1WB 5MLCV 2F8EX 2QLJB 3BO3A 1IBLF 2AYBA 2EFNA 2LQ5A 1FE4A 4PWDB 4NYOA 4M63A 4UQGA 3MUVP 4X4SA 1REVB 3BF4A 4XDCA 1N52B 2WONA 3J7ZT 5LSOA 4EK2A 4CTAA 1NK7A 3GIMA 3UDEA 1FK9A 1TK8A 1VQLS 1JXEA 4P2XA 5KFIA 1FX4A 2EKYA 4QR0A 4IRCA 3V81A 1IQTA 3J80U 1RYSA 1REGX 1WORA 4W4MA 1I5OB 3B8HA 3GV7B 1S1TA 1FJ7A 4UOHA 2G0CA 5CD4A 1SKWA 3SQOP 1R43A 2QLXA 4J9UE 1HD0A 1JLGB 3CB4A 3H2LA 2XI3A 3UI3A 4C0HA 5A2QY 3BSOA 4K4VA 4TKTA 1KQFB 2E44A 2JX2A 2QA4G 3SFGA 2GVDA 1HHQA 1MU2B 1T05B 1C0UB 1UEVA 2Q1LA 4M5HA 4ZK7M 3NLCA 3KHRA 2OMOA 2V8PA 3F44A 1RYRA 1J5EF 5JXSA 4EBEA 2KRRA 3EGNA 4XAKA 1TKZA 4WFXA 4DJBA 3ONQA 2OSRA 2QA1A 3D5MA 3I5BA 1V6HA 2ZD1A 3UPFA 3R9LA 3CJRA 3H2VE 4DS4A 2M52A 4USWA 1HQEB 5DM6Q 3TA2A 2FJXA 4DL6A 3HHLC 4PG7A 2DKOB 3PYGA 3PX4A 4V1Ak 3TUPA 3L95X 2IVMA 5KFTA 3CSKA 4N8OA 4DQRA 3KNAA 2CDQA 3OR2A 3MEGB 3UO0A 2CPDA 4DFJA 4DSLA 2KT3A 1YRTA 2JH3A 3TQ1A 2J9EA 1FRJA 2CJYB 4I68A 4RUHA 3WZ0A 1TKTB 4ICLB 5KFYA 1XN9A 1F0XA 4N41A 1LQ9A 2G2OA 3TWZA 2GIQA 3VGUA 5T41A 5B0CA 2HVEA 4L72B 5FJ4A 1JLEB 3CCWA 4O3OA 2MGZA 5A8RB 2Z2MA 1RWKB 4URSA 3L9ZA 3KTQA 4PEOA 1TTHB 3W5YA 1IN0A 1N5VA 3QATA 1N33F 4FXVA 3OR1A 3DMJA 4H4MB 3FDSA 4MYUA 4FS1A 4X66J 4JI6J 2W2MP 3CCQS 3NY0A 3QZ7A 1WHYA 3LTOA 3UCZP 4C0BA 3QAUA 2HFVA 3EGWB 1R8HA 3FGVA 4J91A 2I9SA 3OL7A 3TZWA 4DV1J 5M2UA 3RW7A 3ZNUA 1O51A 4DI6A 1VQNS 4NA3A 3MAAA 2DT9A 4F4WA 2MKJA 1VRUB 1K44A 1JJ2R 4EO8A 1FT8A 1R0CB 2LEPA 2HHHJ 2HS0A 1SUQB 3EICA 4PXCA 2KVQE 2D9PA 1Q82T 1CJKA 5DM7Q 3QIPB 1RWMB 1RBLA 2V0NA 2W2NP 3D2WA 4QR2A 3UVJA 2BM0A 4OZ5A 3BN4A 3D4JA 4RW6A 3FQKA 2VFTA 2M8HA 2UZAA 3AXMA 4FNHA 1RB0A 5E41A 5L38A 2IHR1 2AJ1A 3TVYA 2LCWA 2B4OA 2GIFA 4K7QA 3UR3C 4DCPB 3DLBA 4BS2A 4AL5A 5IZHA 3BR8A 4F4AA 2IY5B 2KU7A 1YJ9S 1QUVA 4ITSA 4OI2A 4M95A 4CRJA 4DV0F 2O01C 4ZCLA 3FSYA 1KVIA 4R5PA 3RRGA 3D6HB 4EU0A 4DR2F 4DV4J 2VD3A 3OR2B 3V81B 1IM6A 4WJBA 4FPIA 5KFRA 2J0SD 2AYMA 3VF0B 3PW4A 1JWWA 4X65J 4DLGA 2KHCA 4E0DA 4RX6A 2W2OP 2XLJA 5DG7A 2AJFE 5A6PA 3M2RB 5IFMA 2L48A 2XSFA 3IM8A 2XQCA 1R27B 2DRBA 1VQOS 2WAQD 2R2UA 1P8GA 1SUQA 2V8HA 3KJNB 4M5NA 1N0UA 3QGIA 3UDCA 3I96A 1T05A 1TZ0A 2VC1A 4DFMA 4QIFA 1TMMA 2DNZA 3RRKA 3MTJA 2MZ1A 1K8AT 3PG9A 2FB0A 3LWMA 1HQUA 1D9FA 3HHLB 5CA5A 1BLUA 1CJTA 2V34A 5DLFA 1QAXA 1SC1B 1U1PA 4TN2A 2V94A 3HFZB 4FS2A 2Z2YB 4DZ6A 4ZHRA 1B0PA 3FEZA 4LF6F 3NGDA 1S9FA 2J8SA 3MEGA 4M5LA 5HP1B 2H9ZA 3DI6B 3D3BJ 4RW7B 2KM8B 1Q78A 2V9KA 4ZPDA 5IT9U 2H54B 2K7JA 2VQEJ 2ZBQA 1SXLA 4DG1B 4ID8A 1FKAF 4LQ3A 2HS4A 3TZZA 1WEXA 4EUVA 4RWWA 1AUDA 3FKBA 2MZSA 1VBYA 2MPUA 3QT5A 2YNGB 3NL0A 5G0RA 1SL1A 2V4JA 3HKWA 5KFZA 1I51B 2CXEA 5A8WA 1KWMA 4QWBA 2HSEB 3T5LA 3DLGB 2HQDA 2V2QA 3AA9A 3WDOA 4ECTA 1H7WA 2R8GA 2GJ2A 5D0EA 5E3AA 3DYAB 3CMES 2LYVA 4I6AA 4HH1A 3M8QB 2VPWB 2LU1A 1S49A 2KB2A 1CS4A 1M5OC 1DTTA 3HCXA 3HZEA 4Q44A 4RNFA 4RW4A 2F9JA 4NMXA 4KHPF 4WFNQ 2B5JB 4G1QA 2HNZA 2ZC3A 2H4YB 4NE9C 4LSLB 1X31C 4QWAA 3C14A 4DR5J 4ED7A 1BC6A 2NUHA 2RILA 1JLAA 2BE2B 4NCGA 3QT8A 1QY7A 3K59A 2ZH6A 1MWQA 4J7CA 2QYGA 3MM6A 1OYDA 2G1DA 2HQGA 5H9FK 2OPRB 1Z2ZA 2CNKB 3D9BA 5CYJA 2ZUGA 4D3HA 2R3VA 3UE2A 4WZQA 4QIGA 1Z4UA 1XMQJ 1FFGB 1TL1A 4UOGA 2XO7A 1RK8A 2PN6A 5IS2A 3UCUP 3BDEA 3IWXA 2W9CA 4KFBA 3PIOQ 3R5AA 1BE4A 3CVKA 1B7FA 5J2MA 3NXZA 1C1CA 1JLFA 1LK5A 3BGLA 3MPWA 4BWMA 4DEZA 4DX8H 2PI5A 2MLYA 4A8OA 3O3LA 4LSZB 2ZM6J 2F4VF 3EVOA 1OJ4A 1UAWA 3F56A 1M0SA 2ZWPA 2FJBB
chains in the Genus database with same CATH topology
1MWZA 1FDNA 1DQ9A 2CQCA 1A9NB 1CEZA 1S4FA 2KO1A 3KLIA 3UR0A 4RLEA 1FEEA 4QU7A 4JI5F 3RB0A 1GTHA 4O3NA 2Q66A 3MMJA 1ZOTA 2VL1A 2K3IA 5GAHI 1JMTA 2CFXA 2MKCA 3ULHA 2WHOA 3GFYA 5DQIA 4DL4A 1HQUB 3X3UA 5MAOA 3EGZA 3HHLA 3SMZA 2XWYA 3PEJA 2FC9A 3QJJA 1HBMA 4KKOA 4F26A 1Y0HA 1URNA 3KG0A 3LUYA 1DLOA 1NK6A 4DUZF 2IC3A 1T3OA 1T3NA 4WZMA 1RT3A 4FXWA 5HBMA 3MM8A 2MXYA 4PQUA 4G3IA 4WXOA 4QIVA 3KJVA 4JBCA 2M7SA 5IT0A 2UUBF 5F3ZA 5C24B 1R8CA 4ZVFA 1X4DA 3HJFA 2CYYA 4ILRA 2BBEA 2ZJPQ 4I7FB 2RJZA 3K8VA 4ZP7A 4K4YA 2WBRA 2EBGA 1YTYA 4KQZA 2NLWA 3LPYA 1YJNS 1O0PA 1M90T 3DLKB 3RU0A 5D6GA 2DISA 3KLHB 1I1GA 2MQOA 4O4GB 4NLYA 1IKWB 4H4KC 5F41A 1W2BR 2DNPA 3LGNA 3MMCA 4ILLA 4QWDA 3OFGA 2BABA 4P6QA 4NMLA 3ZZZA 2R7VA 3J7YI 3TX8A 1ZPWX 5FLXY 4X66F 4Q43A 1SKSA 4DSKA 3FSIA 1JLBB 4QJVA 3O1LA 4K4UA 3CGIA 1QSSA 1KONA 3TVZA 3GMGA 3G4SS 1S99A 3TO8A 1SIZA 3HP6A 3K58A 4XPCA 3SCKE 1FXDA 5KFHA 5E7OB 3RYLA 5D4PA 3MUTP 4IH5A 4O4GA 2B4VA 3CCLS 1DTQA 2P9EA 5E3CA 3MXHP 1XMBA 3GG1A 1P1TA 1YJVA 3PIPQ 2FLOA 2APOA 5J2NB 2J5AA 1WI6A 2NR0A 4Y34A 4A8XA 2O66A 3DU6A 4NLSA 5SUHA 1YHQS 2WBMA 4WF9Q 4KV8A 2RB7A 5EWEA 1VC6A 1N32F 2BANB 3DHWC 4TYAA 5KFMA 3M2VB 4C98A 1KC8T 1JXLA 4FF4A 3DLKA 3H2UB 3MR2A 1RT7B 3E01A 1TV6B 3MEEA 2KN4A 2KG0A 2FPHX 4OI4A 4BDPA 1HL6A 1RT3B 2WTFA 4AXIA 2J0WA 1TR0A 3H5SA 1FCAA 4NLWA 1Q86T 2CQ3A 3I0RB 4O3PA 1UJ6A 3RAXA 1QTMA 2X1AA 1UVIA 2UU9F 4KGKA 2CJKA 5C24A 2Z4PA 3NS5A 3OL6A 4LF4F 1HBOA 2ZHBA 3AY0A 1FKPA 1LW2B 4ZPVR 4J9KA 3PX6A 3NKYA 5DQHA 3BO2A 2YQ3A 2L9DA 1KHVA 1VK3A 5DG9A 1Q8BA 1UW4A 1VK8A 2RQ4A 4MIBA 2HLTA 3MEDB 4CCHA 3U7JA 4J37A 2CJBA 2CPIA 2VOOA 5GAHU 4C8ZA 1UA1A 1BQNA 2GCFA 3C8YA 2FY1A 4G1IA 2O1PA 1RT6B 2F7VA 3R5CA 4IQXA 2FJWA 2YWFA 2POKA 3RBDA 5FDLB 3HHKA 4RKUC 1KN6A 4FYDA 2EG2A 1JLGA 5F9NA 2JEFA 3LGMA 1QM9A 2IBKA 4ES2A 1Y00A 3TVKA 4RBTA 3LP0A 2X1BA 3KK3B 2M8DB