4LSNB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj518), a non-nucleoside inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
428
structure length
416
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 101
structure length 416
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lsnB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB03
4ZPDA 3LP2A 2ZKUA 3DLEA 2HNDA 3QGHA 1KLMA 1S49A 4IG3A 3KLGA 1T03B 5KFPA 2FVCA 3H40A 4I2QA 3MFIA 4ED2A 4IOBA 1LWCB 3I5CA 3DRRB 3N6NA 3UR0A 3BJYA 4RW4A 5KG1A 3KLEB 4TQSA 3LP1B 4QWDA 1S1VA 2OPRA 3V6JA 4O4GA 1QUVA 1TVRB 1RT5A 4ZVGA 3DYAA 3I0RB 5C24B 1BQMA 4KHRA 4YR2A 3C6UB 4IH5A 4KE5A 1S6PA 1FKPB 1FK9A 2HNZB 5T14A 4WXOA 1XR5A 1S1UB 4NLTA 4RUCA 4YMEA 1REVB 5KFHA 4NLGA 3MR6A 2R8IA 5CYQB 3D5MA 3LP0B 4J9PA 2AX1A 4EYHB 3GQCA 5DLFA 5HBMB 3KNAA 1DLOB 3CVKA 3DRPB 2HNYA 4O3NA 4MIBA 4ECQA 3T5HA 4GC7A 3CO9A 4KKOA 1S9GB 3BR9A 1K1SA 4RNOA 2XCAA 2D3ZA 3MTKA 4DEZA 5EWGA 3KLIA 3GV5B 4DL6A 3IG1B 2C2EA 1JLFB 1LW0B 4H4MA 5F8GA 2YNIA 2WOMA 5KT6A 3GV7B 1JLAB 1DTTA 5FDLB 3HHKA 4ED1A 4EO6A 3NL0A 1ZTWA 4U7CA 5F8IA 2IA6A 4RW6A 3KK1B 2JLEA 3DOKB 4KV8B 4LSLB 2RDIA 3GIIA 2R2SA 4NLVA 4IG0A 3PW7A 1S9EA 4TXSA 2R8GA 2VG5A 3FQKA 3V4IA 1J5OB 3ITHA 5CYMA 3I0SB 4Q8FA 3E01A 5F8JA 2AGOA 1TL3B 4RW7A 3PHEA 5KG3A 1S1TA 1T05B 4WXWA 3KMQA 4Q44A 1C2PA 4EEYA 5DGAA 4WE1A 2IC3B 3JSMA 4EBDA 4URQU 5KFJA 3M8QA 1JLBA 1N4LA 3MF5A 4R8UB 3IRXB 2UUTA 2BQ3A 5L1LA 2XI3A 4YQWA 2WK4A 4QW8A 4IR9A 5KG6A 4MK8A 3KHRA 5KFZA 2W9CA 1HPZB 5KG7A 2BE2A 4MIAA 3PZPA 1HARA 4O44A 5KT4A 3OSNA 5J2PA 2GIRA 2JC1A 2AQ4A 4RW8A 3ICLA 2V9WA 1RT1A 4RU9A 4JUZA 3NAIA 2YNFB 2R2RA 3QGIA 1RAJA 1HQUA 1EP4B 2GC8A 3SFUA 4QPXA 4Q43A 4J9KA 1T03A 4FS1A 5KFNA 3FQLA 1TKZA 1JIHA 4NLRA 3T5JA 4TY8A 1LWCA 4URSA 4KSEB 2W9AA 2XI2A 5KT7A 1IKYA 1RTIB 2B5JB 2IJNA 2IAJB 4ZPBA 2XC9A 4J9RA 1TVRA 2E9RX 2BANA 2IMWP 3OLAA 4ECRA 1S1XA 3IS9A 2WRMA 3T5KA 5C25A 3RB4A 1WNEA 4ECZA 2HNZA 4G1QB 2D3UA 1IKXA 3KK3B 1S0MA 3N6MA 4YR3A 4U6PA 5KG5A 3KLFB 4IRKA 1EETB 3H5UA 3KMSA 3QZ8A 3MR2A 3DLKA 3OHBA 5KFKA 4Q8EA 4MKAA 4TN2A 1NHUA 2JEGA 2I1RA 2R8JA 5K14A 4ZP9A 3NGDA 1IKWB 1RT2B 1RT6B 4NRUA 4NLWA 5J2NB 3NBPB 3PJXA 3IGNA 2VG6A 4LSNB 2W8KA 4QW9A 4O3OA 2YNGB 3IG1A 5KT3A 2V0NA 2UUWA 3TAMA 5KG4A 4PWDA 2OPPB 4RNHA 3H4BA 5J2QA 1S10A 3LAKA 1RTDA 4PUOB 3I5BA 5J1EA 3KK2B 3IGVA 4DL5A 1C1CB 4NRTA 2D41A 4KO0A 3QO9B 2HWIA 1UWBB 5I42B 5F8LA 4RZRA 3GIKA 5L1JA 1N48A 5F8HA 2EC0A 1QE1B 2QE5A 4KAIA 3MEEB 3PW0A 1J5OA 4IFYB 3TVKA 1C0UB 4TLRA 5HLFB 2RF2B 5HP1A 3FDSA 3DI6A 3DRSB 1S1WB 4ID5A 5DG8A 3MR3A 1C1BB 4M95A 3T19A 1RTHB 4IH6A 1RTJA 4WFXA 3JYTA 4ED0A 3KHGA 1MU2A 4ZVHA 3EPGA 2IM1A 5DG9A 1LW2B 1QAIA 3V81A 2OPSA 4Q0BB 1HNIB 4IFVA 1HYSA 5F9NA 1TKXB 4I7FA 4MFBB 3FSIA 4ZPCA 2BR0A 3MECB 1RT4A 1LWFB 1VRTB 1JLQA 3HVAA 5DLGA 1TP7A 2HAIA 2YKMA 1R0AB 3G86A 1SV5A 2R2UA 3PVXA 4QWCA 1ZETA 2BQUA 5I3UB 2YKNB 2UVUA 1S0OA 3PJWA 1LWEB 2IJFA 4NYZA 3IN5A 4R0EA 5EWEA 5KG0A 2VG7A 2HMIB 4NLUA 1IKVB 4IDKA 2E9ZA 3DMJB 4WFZA 2W9BB 2W7OA 4LQ3A 3RB6A 4ED7A 5D3GA 5F8MA 3BGRB 4Q45A 3EPIA 2B5JA 1RTIA 2C2RA 4O3RA 4K4VA 3N6LA 3KJVB 1DTQA 2ASLA 4YR0A 1HNVB 5J2MA 2ILZA 4RNFA 2W8LA 4K50A 4Y2AA 2R2TA 5KFEA 3H5YA 3H5SA 1JLEA 1TL1A 3M9OB 1TV6B 5HROA 3Q8SB 2UVVA 3NAHA 2JEFA 4I2PA 4H4OB 3FFIA 3C6TA 3MEDB 3CJ3A 3HVTA 1RT7B 3CJ5A 3M8PB 5C42B 1N5YB 1IKWA 1S6QB 4RW9A 3FRZA 1JKHA 3KLHB 4NLXA 1RT3A 2WONB 4FBTA 4WZMA 2OH2A 5L1KA 3DLGB 4PQUB 4QWBA 3Q8RB 3BSCA 4IQXA 3H5XA 1JLGB 3V6DA 4B3OB 2B6AB 5KFMA 5KFBA 5KFFA 2FLLA 2OPPA 2ZE2B 1D1UA 1N56A 1VRUB 4MK7A 1BQNB 1JLCA 1U09A 4RNMA 4ED3A 1I6JA 3ISNC 1TKTB 4KFBB 2OPQA 4DG1A 1HQEA 3LP2B 5KFCA 4TQRA 3DLEB 3DOLB 1FKOA 1KLMB 3QIPA 3QO9A 2RKIB 4IG3B 3KLGB 5I42A 1HMVA 4EYIB 4F4ZA 4I2QB 4O3SA 1QE1A 4EO8A 3RAQA 1C0UA 4TYBA 1C0TB 3OL6A 3BQ2A 4RW4B 2V4RA 3PR4A 3OLBA 4J9NA 1Z4UA 1S1VB 2OPRB 3E51A 3RB3A 4KFBA 4H54A 3DRRA 1RT5B 3CJ0A 1RTHA 3DYAB 3CJ4A 2V4QA 3KLEA 1BQMB 3LP1A 3Q8PB 1T94A 1S6PB 1FK9B 4J9QA 3I0RA 5C24A 5KFXA 4URGA 3C6UA 4Q0BA 1HNIA 3MR5A 3V6HA 1FKPA 3RB0A 2FLPA 1QAJA 2HWHA 3DDKA 3MECA 1S1UA 1LWFA 5EWFA 1VRTA 1REVA 3G6YA 2YNHB 3CWJA 1SUQB 2HNYB 1RA6A 5CYQA 3LP0A 4HKQA 4KKOB 1RA7A 5HBMA 2FVPA 3UPFA 5F8NA 1DLOA 4ZP8A 3DRPA 4ED6A 3QLHB 4IRDA 4EBEA 1S9GA 2FVQA 2BRKA 3DM2B 2WB4A 4ED8A 3G6XA 4FBUA 5DQHA 4F4WA 4KB7A 2YNIB 4NLDA 1DTTB 4XO0A 5KFAA 3RBEA 4QWAA 1JLFA 2J6TA 4O3QA 1LW0A 3KJVA 2XWYA 4Y3CA 3V6KA 4K4SA 4ZVEA 1JLAA 5FDLA 2C22A 4IG0B 1SH2A 2BRLA 4WYLA 1S9EB 3NMAA 3KK1A 3BSNA 3DOKA 1YVFA 4ECTA 2W7PA 4KV8A 4LSLA 2VG5B 3V4IB 2RDJA 2VA2A 3ITHB 5CYMB 5KFWA 4DL2A 3E01B 1KHVA 4O4RA 5L1IA 4RW7B 3BSAA 1S1TB 5C5JA 2E9TA 2ZD1B 3HKWA 4R5PB 3T5LA 3I0SA 3M9MB 4IKAA 4WE1B 2C28A 1RT7A 1TL3A 1T05A 5C42A 4IR1A 4EBCA 3M8QB 1N5YA 1JLBB 1S6QA 3BREA 1XR6A 4KHMA 4ZPAA 5KFIA 2AWZA 2IC3A 2IM2A 3PW4A 1TQLA 5KFRA 4ICLB 3SFGA 5KFTA 3GYNA 4R8UA 2W9CB 1T3NA 1JLGA 3IRXA 2BE2B 4FS2A 4QWEA 4YP3A 2DPIA 4O44B 5J2PB 4MK9A 2ASDA 4RW8B 3GV8B 1HPZA 4DL4A 3PW5A 4ZHRB 4DL7A 2WHOA 1JX4A 1HQUB 5KFLA 3DOLA 3MFHA 4X2BA 2RKIA 2WTFA 1TKZB 4NLYA 4J9MA 2YNFA 3KHLA 5KFUA 3QZ7A 1EP4A 4TY8B 4F4YA 1C0TA 4WFYA 3OL9A 2XCPA 2DPJA 2JC0A 5DQIA 4RNNA 3GILA 1IKYB 3EZUA 2I5JB 4NCGB 4IRCA 4K4TA 5KFYA 2BANB 2R8HA 2R8KA 3UDLA 1S1XB 3IS9B 3OHAA 5C25B 3RAXA 2AGPA 1RYRA 2IAJA 2UVRA 2ASJA 2BQRA 4JV2A 5DG7A 3KOAA 1IKXB 1N6QB 3QGGA 1S9FA 3MEGB 3CDEA 5KFQA 2JEIA 3OL8A 2AX0A 4G1QA 2IM0A 3KK3A 3OSPA 1S97A 4JV0A 2JEJA 1MMLA 2YNHA 3Q8QB 5KFOA 1SUQA 3DLKB 1GX6A 3CDUA 4NLOA 3KLFA 1S4FA 1EETA 4K4UA 5L9XA 5K14B 3LAMA 3QLHA 1KHWA 2QV6A 4LQ9A 3I5AA 2VG6B 2AU0A 3DM2A 1K1QA 1RT2A 1RT6A 2FJWA 5J2NA 3NBPA 3TAMB 4ECSA 4PWDB 1CSJA 4LSNA 5J2QB 2YNGA 2C2DA 1RTDB 5J1EB 3SI8A 4IH7A 4WYWA 4JV1A 4XPEA 1SH3A 4KO0B 3H2LA 3UQSA 4TYAA 4PUOA 3CDWA 3KK2A 4ZVFA 1C1CA 4DL3A 3ISND 2HNDB 4Y2CA 4G3IA 1UWBA 2VA3A 5KFGA 5HP1B 3DI6B 4ID5B 4WZQA 3MEEA 4NLPA 2ATLA 4IFYA 2ZD1A 5KT5A 1JXLA 4R5PA 5HLFA 1IM4A 3H59A 2IBKA 2RF2A 1RTJB 4KBIA 5KT2A 3DRSA 1S1WA 3JYTB 2AGQA 5EUHA 1MU2B 1C1BA 4O4GB 1XR7A 1GX5A 3BQ1A 4ZP6A 3V81B 2OPSB 4IFVB 1HYSB 4ICLA 2O5DA 4I7FB 2IM3A 4Y34A 4ZP7A 5JXSA 1LW2A 1RT4B 2CKWA 5EDWA 5KFDA 1JLQB 3PR5B 4M94A 1TKXA 2YKMB 4MFBA 2FVSA 1SV5B 4NLQA 4ZHRA 3TQ1A 1S0NA 3BQ0A 5KFVA 1R0AA 3CIZA 5DQGA 4TY9A 4MH8A 1NNDA 3GIJA 5I3UA 1D0EA 2ILYA 2YKNA 4HYKA 2VG7B 3LALA 1W25A 3KLIB 4IDKB 1LWEA 2WCXA 1RYSA 3HVWA 4ZMMA 2XGPA 4J9SA 2FJXA 1NHVA 5D3GB 2FJVA 2HMIA 1IKVA 2I5JA 3DMJA 4NCGA 3KHHA 2W9BA 4H4MB 4OL8A 3NKYA 2WOMB 4XPCA 2B43A 3VQSA 1DTQB 4F4XA 4GC6A 4ECUA 3BGRA 3RBDA 3T1AA 5J2MB 5F9LA 1ZTTA 4NLSA 3GIMA 3H4DA 4K4YA 4RW6B 3OL7A 2XGQA 1N6QA 1JLEB 1TL1B 1HNVA 5HROB 3MEGA 3KLVA 4F50A 2J6SA 4ECXA 2GIQA 2UVWA 4O3PA 4I2PB 4ECWA 3FFIB 1TV6A 3C6TB 3QYYA 3BSOA 3G6VA 3PW2A 3LANA 2CJQA 3H98A 3HVTB 4H4OA 5JUMA 3MEDA 2D7SA 4RW9B 2F8EX 1JKHB 5DGBA 3JSMB 1RT3B 4ECYA 3M8PA 1RDRA 4K4ZA 4RUAA 3M9NB 3V6DB 2FVRA 3D28A 4J9LA 3KLHA 2WONA 2FLNA 3DLGA 4PQUA 4MKBA 1JLCB 5KG2A 4ECVA 4NZ0A 3CJ2A 5KFSA 4B3OA 1OS5A 2B6AA 4K4XA 2OPQB 4DG1B 1HQEB 2ALZA 2J6UA 4K4WA 2ZE2A 4J9OA 1VRUA 1FKOB 1BQNA 3QIDA 3QIPB 1S48A 1HMVB 1SH0A 1TKTA 1RT1B
chains in the Genus database with same CATH superfamily
1JJ4A 2NYHA 4DV3J 5A0YB 2FY1A 3OFHA 3DRRB 4RW4A 3QGPA 4DR3F 1E6VB 3DYAA 1FK9A 1X5SA 4J9PA 2AX1A 3RG6A 3T5HA 3NLCA 1NKEA 1K1SA 2Q43A 4B9UA 1JJ2R 3GB0A 4DL6A 2EFQA 4NL5A 4A47A 2QA1A 2Y3YA 5THWA 3OVAA 1KOHA 2DTJA 4IG0A 3Q23A 1RGVA 4EMDA 4ATNA 4Q8FA 2HKEA 1F1BB 5ETVA 4JI6J 4F3MA 4JI8F 4KJIA 3NNCA 2HS0A 1ZAXA 3D1HA 3THVA 3FZBA 1SL0A 4J9RA 1IBKJ 1S77D 3IS9A 3I4HX 1UA1A 1UETA 2H65B 4K8RA 4LREA 5L39A 4TN2A 2HQGA 2AZ1A 4UY8T 2VG6A 2RVJA 2GIFA 2YNGB 1UEUA 2RHSB 4L3KA 3R2CJ 4DQIA 1EQMA 4PWDA 4HT7A 3O1LA 2HSEB 2YTCA 1XNQF 3QT7A 4NXMJ 3QO9B 1VHFA 2CUYA 1WACA 4TLRA 3TI0A 3H0PA 3L7PA 3QT6A 2CPIA 1Z2ZA 1DZ5A 1MU2A 4Z37A 4YB7A 2L9DA 4B3SJ 3KYLA 2CRLA 5DLGA 3PO5A 1SIWB 1CC7A 2UVUA 2IJFA 1EKSA 2DRAA 2ZITA 3AXKA 3OTEA 2GAHC 2ZNYA 1CS4A 1RK8A 3SV4A 3PNIA 1VCTA 1A6LA 2XLKA 1RWUA 2UVVA 1FVQA 4DN9A 3C6TA 4GRSA 1N8RT 2MKHA 5FD1A 1H38A 3HVTA 4USUA 2NZ4A 1IKWA 1PIEA 2F1FA 5A8KA 4B3OB 5E3PA 2YPZA 4QBUA 1U09A 4RWXA 1TKTB 5F3ZA 1B64A 4IG3B 3TX8A 1QE1A 1DQAA 5KAKA 2VU5A 1PG5B 1S1VB 3E51A 1SQFA 1FT8A 1RTHA 4FDFA 1IR2A 4ZCKA 4JI6F 1QAJA 1UL3A 2DGQA 3N79A 2DJWA 3OFFA 4HKQA 3DRPA 3MOJB 1UVKA 3M4XA 4AD6A 4X84A 2EK6A 4KV8A 1TL7A 4KY3A 1S1TB 1FNXH 2M52A 2AYEA 2W4DA 4IKAA 2XNQA 2LDYA 3HI9A 3MUVP 1S6QA 1KRPA 2AWZA 4PWUA 2HHXA 3ZNJ1 4OZ5A 5G0RA 1NRKA 4CIOA 2L3MA 2JDJA 4Z7YA 3OR2A 1OQ6A 1N32F 1NK0A 2GQCA 2Q6CA 3VZHA 1C0TA 1WHYA 3IM8A 3GJRB 4DBQA 1NSQA 2BW7A 5C25B 1RB0A 4FXVA 2BXJA 3GG1A 4C0OC 1IKXB 3OTOJ 3J7ZT 4WPAA 2VJVA 5KFQA 4G1QA 1WORA 2CQIA 2OP5A 1K0VA 1SKRA 1ITPA 1ZAWA 1UVNA 3CMES 2L41A 4DV7J 2XMJA 4RUHA 1SXLA 2FC8A 2C2DA 3UCUP 3ZXWA 1UKUA 3KK2A 2OMLA 1UWBA 1L5UA 4W90B 3DI6B 1FD8A 4PYAA 4IFYA 2ZD1A 2E5GA 3M8WA 1PBAA 4JI2J 3D2WA 3WZ0A 1GX5A 4ZP6A 1KONA 1VLYA 4Y34A 5KFDA 2CDQA 4LF2A 4YB6A 3TQ1A 2KJWA 3K5PA 1R0AA 2YKNA 4ILMA 3VR1A 3KDOA 3HSDA 1AA1B 1NHVA 4DCJB 1GXLA 1UPMB 3UD5A 1TELA 2KXFA 2B43A 4XPCA 4OZJA 1DTQB 4LF9J 4KR0B 1IQTA 2CVEA 2DNZA 1TL1B 3KG1A 4ECXA 2RQCA 4I2PB 4HH1A 1U8SA 2CJQA 3TJ9A 5LJ5Y 9ATCB 4DSJA 1Q0NA 2BEFA 3DRXA 3D28A 4K4XA 3CJ2A 2OPQB 4K4WA 1SH0A 4KFBA 1RABB 5IFMA 3MAAA 2HNDA 1RWXB 3VAJA 1BHNA 4RBTA 3PYEA 3KLEB 2AD9A 5EHHA 1F5CA 4HHHA 3CUNA 5DETA 4C48A 5CH7B 2BACA 3Q8YA 1S1UB 4NLGA 1YI2S 1U24A 3LP0B 3DLBA 4FF4A 4OLOA 1LOUA 3HD2A 4ELTA 2B7BB 3CDAA 2CQBA 3AQPA 4H4MA 3RGIA 4YUDA 4QOTA 5F8IA 4RW6A 3GIIA 2W4CA 1Z2LA 3OW2R 3KXDA 3E01A 5F8JA 3KMQA 3FBBA 4E98A 3MM5B 3JSMA 3P5BP 1NDLA 5KFJA 2VV5A 4RR5A 5H9FJ 5KT4A 5J2PA 1AFIA 2CG4A 1NB2A 3ICLA 2KKHA 4RU9A 3NAIA 4C97A 1N0VC 2LP4A 2RSQA 3FQLA 5GAHU 4UW2A 4KH1B 2YX7A 3B82A 2V8HA 5K8NA 3MAHA 2ZOMA 1K9MT 2YQ3A 4I56A 2BE7D 2R42A 4K0KF 3PY8A 1NHUA 2FHKA 1RHQB 1YZ7A 1VDHA 3HHLA 3J81j 1JJHA 1YKWA 2KH9A 1XNRJ 1WF2A 4PXBA 2Z2MA 2RD5C 1P8GA 5HMXA 2C2OB 1IQZA 1ZS6A 5K8OA 4OZ1A 2E5HA 5IV3A 1RWNB 1PYSB 2B0GA 2BR0A 3ZZRA 3TNVA 2N82B 2OO4A 1CJVA 3FNNA 1VC5A 2M9KA 2R2UA 4R0EA 3K57A 5E0OA 4LBPA 4YB1P 3KTQA 2VPZB 2KG0A 2ILZA 1AW0A 3NAHA 2KT5A 3MMAB 5H9EJ 3UNGC 3CJ3A 2YVSA 2DNRA 2CQ3A 2LEPA 2HBQB 2KM8B 4TNOA 5D0EA 4Z7CA 2CIMA 5KFBA 4JI5F 1D1UA 2ZE2B 3R5JB 1NJZA 4MK7A 1JLCA 4U9RA 1I6JA 1HQEA 1Q7LB 1WG1A 4QQBA 2QZ8A 5HVHA 5CABA 1EHWA 1CJKA 1PO6A 3K5OA 4RW4B 2A0FB 4H54A 3DYAB 1YJRA 1FK9B 1VQSA 2DCLA 3AXMA 2HWHA 2OTJS 3JAMY 2CJ9A 2ZVSA 2QL7B 4ZP8A 2G2YA 2DRDA 4RKUC 1N33J 4F67A 4QR0A 2J0QD 5FDLA 3FBFA 3GFXA 4IG0B 3DOKA 1EAYC 1VQYA 4YDXA 4F36A 2RIJA 2QJ3A 2DK2A 5B0CA 2RILA 4IUFA 1ROFA 1HD1A 1VMBA 2A6OA 1IXKA 3MMBA 3HULA 4FS2A 4AL6A 3KJNB 1NDPA 2GJIA 1R7IA 5KFLA 2MKJA 2RKIA 2MQ8A 1NAQA 3QSYB 3W61A 3ZTOA 1X0FA 1CEZA 5I3QA 1L3SA 3IS9B 3F73A 1B70B 4WFAQ 4DV1F 2FD2A 2H1YA 3EGNA 3IC1A 5ETRA 1Q78A 3U02A 3MM7A 1GEHA 1WKKA 2I0XA 2VG6B 4BDPA 2XM3A 4PWDB 1UVIA 2EFPA 3MURP 2Z2LA 4FYVB 2HFOA 2Z4PA 4DL3A 2OFHX 2H54B 3RUBL 1ICEB 4G3IA 2MQQA 5IZHA 3F0NA 4DV2J 1MU2B 2OJ3A 1UTAA 4ZP7A 4NA3A 1J27A 2PD1A 2MZSA 3ETOA 2ZH8A 1CS4B 2U1AA 1X9MA 2N4DA 4CO4A 1N6QA 3DN9A 1TV6A 3C6TB 4CO1A 3LANA 4K2JA 3HVTB 1VQKS 3QNWB 2J8SA 1MWZA 3AT1B 5A8KB 3M8RA 1YITS 2XS7A 2ALZA 4J9OA 1YX2A 3GPAA 2C3MA 4CO5A 3MPWA 2KYXA 3OUYA 3UR0A 3PM9A 4QWDA 3JS9A 4DFKA 4YR2A 3B4DA 3R3TA 4OHZA 4N8NA 4YMEA 2ZZMA 5DLFA 4C0BA 3DRPB 5LSRA 4GC7A 2CAJA 1WC1A 2XCAA 4DEZA 1TMMA 3W62A 4DR2J 4OX9J 2B9XA 3HP6A 1HBUB 1ZTWA 2IA6A 2YY3A 4LMZA 4KV8B 4OYWA 1TL7B 4UTGA 2HZAA 2KXHA 4DS4A 2VG5A 1WDTA 5LSLA 4Y00A 4MTPA 2B51A 4XDCA 2E1AA 5ETQA 1RAEB 4WE1A 2XS5A 1WI6A 3US5A 5G0RB 3OR2B 3TA2A 2UP1A 3NEKA 3DKDA 4CLSA 3AH6A 3JQJA 2YWFA 5RUBA 4FS1A 2YKAA 4IQMA 1TVRA 3MEKA 2IMWP 4DV2F 2HFVA 4G1QB 2XHWA 4DV6F 3R6LB 3BS9A 1NK8A 3FBCA 2J9EA 2XMMA 3HFKA 5K14A 2AW0A 3TAQA 4LF4J 1BWVA 4O3OA 5G4DA 1S10A 2GQ2A 4DR5J 3KK2B 4FPIA 2MB0B 1UWBB 3RR8A 4NYOA 2MQPA 2QE5A 3IP0A 4I4BA 4IFYB 2OELA 2KG1A 3OBIA 2DXFA 3MR3A 4DFPA 3I9ZA 2JFDA 4FF1A 2IM1A 4X64J 4ZPCA 3FSIA 1VRTB 1FHTA 3SSSA 1R0AB 3WBZA 1URNA 2YKNB 3I82A 3IBCB 2HFNA 4BC9A 2QL9B 2B5JA 3UN5A 1S79A 4Y2AA 1OWXA 3GSDA 1T7PA 3BGUA 2XMAA 4L73A 4ZPTR 3BO3A 3G96A 2KHCA 4AL7A 5HQLA 4KFBB 1HKAA 3J7YI 3MAAB 3QIPA 2CQHA 3E2EA 1KS2A 4MYUA 4DFJA 2KYZA 5B0GA 3BQ2A 3T3FA 2YH0A 1Z4UA 1QTNB 1Q1KA 1WHXA 2OTLS 1SPBP 2YWGA 4CLYA 2V2ZA 3Q86A 1L3KA 1ULRA 3V6HA 2FY8A 4P73A 3KG4A 2ZEJA 2VFSA 2MKYA 4IRDA 6AT1B 1T11A 1S9GA 1CG2A 2XHCA 3UWTA 1SKSA 3RW7A 4BS2A 1RADB 4K4SA 1T3OA 2BRLA 2BUNA 1FRXA 3MD3A 1CVJA 1CJTA 3E01B 4LFCJ 5C5JA 2C28A 7FDRA 4PABA 2IC3A 2IM2A 2M8DB 4FXWA 2MEWA 1Y11A 1YJUA 4LF7J 5J2PB 2P9CA 1QDUB 2WTFA 1EP4A 3TOQA 5LSOA 4K4TA 4ZVPB 2R8HA 4I64A 1EJ7L 1OPZA 2AX0A 3OSPA 2JEJA 3VV2B 5JJBA 4M5GA 3QAEA 3RRKA 2W2PP 3QJPA 5U47A 3HHLB 2ZOFA 2AJ2A 1FWPA 4GKJF 4LF5J 2ZHBA 4N56A 3MM9A 4BLGA 2VA3A 3PTWA 5GVQA 5K9FA 1VFJA 2LU2A 4PR6A 2ATLA 5HLFA 2IBKA 2CDRB 3AY0A 2CPHA 1C1BA 1NPRA 2LECA 2VOOA 4C8MA 2Y1JA 2O5DA 4OHWA 2ZHOA 4UT4A 1TU0B 4ZVUB 3NCQA 1NKCA 2ZM6F 2RS2A 2ZUAA 4MT1A 4EWTA 2LU1A 1S7HA 1I94F 4ECUA 3VQSA 2WOMB 4X4SA 4PPZA 5M2RA 1FJCA 2U2FA 5FIIA 3QYYA 4X66F 2J76E 5B09A 2HK2A 1OSDA 1JLCB 1HQEB 3PYGA 1ZBTA 3QIDA 4DLGA 3GFHA 1CJKB 2YBVA 1KLMA 1S49A 3KLGA 2DH9A 4ED2A 4QCLA 1RCOB 3HXMA 1VBXA 1B7YB 2WVCA 2EK1A 3V6JA 3SCJE 3L95X 4P2XA 2LFVA 2YWWA 2XO7A 3D5MA 4UOFA 3N4WA 5B0BA 2EBGA 3EXYA 3TVZA 5LXRA 3NOCA 4ECQA 2P9EA 2ALYB 1S5ZA 1VI7A 3GV5B 3CEDA 3CF5Q 3A8EA 5FDLB 2HRUA 4U7CA 2D74B 3DOKB 2GGPA 2F4VF 2WSEC 1TK0A 3W60A 2AGOA 4I6WA 4BWMA 3DGVA 2OLWA 1Q8IA 1Q5VA 2O3DA 1RTZA 3MF5A 3MMBB 3BF4A 2RHQB 4QW8A 5KG6A 3BEGB 5HATA 3EWGA 2W9CA 1RWMB 5LMNJ 2GIRA 2F7VA 1GNKA 3QGIA 1Y7PA 2DKOB 1QTMA 3T5JA 4ZOSA 4CP5A 1QAXA 3BKTA 5L9NA 2CPYA 1WNEA 1Q82T 2Q66A 3CJQA 5DDPC 4C98A 1WOPA 1RU1A 4IRKA 3Q8VA 3QWUA 2H5IB 3TO8A 1UP1A 2LMIA 1B0TA 1XMBA 2D41A 2EG2A 5I42B 4WIIA 4WU3A 4JI7J 2UXBF 3PW0A 3DRYA 2J8AA 2R7VA 3M05A 2IY5B 4ZLNA 1RTJA 4ZVHA 5BYQA 2RT3A 3NNAA 4PG6A 2OPSA 3BO4A 4IYQA 1RT4A 1TTHB 4YEAA 3UVJA 4NYZA 4N76A 4Q45A 2QLBB 4CLFA 1YK9A 1EKRA 4KHPF 5CXTA 2V34A 3M8ZA 1Q16B 4KGZB 1IR1A 1TV6B 4ID8A 2ROPA 1REGX 3HT0A 2CXEA 4DQQA 4NLXA 4QWBA 4IQXA 3V6DA 5KFFA 1B0VA 3SBMA 2EPIA 1HI1A 3O8WA 4K2XA 3RBZA 3SMZA 1HNZJ 3TWZA 3ENAA 3OUYB 3D54A 4GVBA 3PX4A 3EDQB 2DGVA 4J9QA 2QA4G 1HNIA 3MR5A 3MECA 4PXEA 1G2EA 1T9XA 2GNKA 3PCOB 3R5CA 1IN0A 3BBBA 1HWUA 5J1PA 5DQHA 2MY7A 1FA0A 3V6KA 1T9VA 3H2VE 3I55S 3QT8A 3NMAA 1I51B 2VG5B 2VBWA 2MKCA 2MKIA 1DQ8A 2HS4A 4WE1B 2FJDB 2Y0BB 1T05A 2CPXA 2M88A 4LVOP 3SCIE 4ZCMA 1T95A 2ZDPA 4NLYA 5I3PA 1V3RA 2GV1A 5DQIA 5CCLA 5KFYA 2AJ0A 3UDLA 3AJ2A 2UVRA 1TUGB 2Z58B 1S59A 4CRJA 3F41A 4JV0A 1MMLA 3KUHA 3KLFA 4YY3F 5K14B 3QLHA 1IM6A 1HHSA 2AU0A 1DRZA 3DM2A 1RT6A 4F02A 1IBLF 4LSNA 2Z56B 4DR6J 4WZQA 4NLPA 2C3PA 2CZ9A 4G1PA 3VVTA 5HMZA 4ZS6A 1EX8A 4ENOA 4DQRA 2IJRA 3KDNA 3PR5B 4MFBA 2Y1IA 4B3TJ 4F0HA 3AOAA 2ILYA 1W25A 5HJXA 3DHWC 3AOCA 2I5JA 2XGQA 4G1IA 3PW2A 1LKZA 1VGYA 5GAGI 2MY8A 2FUG9 1A0OB 4NEYA 4LF6F 4OYPA 2FVRA 4NZ0A 1OS5A 3CD5A 2Z2YB 3QIPB 3W5YA 4ZPDA 5IWAJ 3QGHA 2HHQA 1UVJA 3N6NA 4WP9A 1KWMA 3A8IA 2J9DA 2EI5A 4WXOA 2Z57B 2AIRB 5KFHA 3MM6A 2DISA 1S9GB 1HW8A 3KLIA 4ER8A 1NZ8A 2CFXA 5F8GA 5IOLA 4FF2A 1D3WA 3TW0A 2W2NP 2R2SA 2MQNA 4L6V3 3PHEA 2B7CB 1WSVA 2ZH1A 2IC3B 2JX2A 1RWPB 3M8QA 4C9DA 1B0PA 4EFAC 4JV5J 3KHRA 4LR7A 3DXBA 4MIAA 3Q89A 2DT9A 2AQ4A 2GMJA 2R2RA 1EP4B 3SFUA 1T03A 3LPEA 2ZHAA 4TY8A 4KSEB 3FK4A 3SXLA 2PO4A 1UJ5A 5A6WA 1CJUA 2Q6BA 3A13A 1XEZA 1P9QC 3G8SA 4MKVA 1X4EA 4HI1A 2CPDA 3QSIA 1PSDA 1HNWF 1M5KC 2BMBA 2UU9F 1F2GA 1QVGR 1X7VA 4X4TA 3MM9B 5L1JA 2QRRA 3ZZPA 5F8HA 1DBDA 5HLFB 4C8NA 5LMUJ 1C1BB 4DR1J 4ED0A 3CB4A 4LF8J 2QIFA 3UI3A 3HO1A 2F3JA 1FE4A 1TP7A 2HAIA 4QWCA 3BGOP 2JSXA 2PE8A 1S7IA 4ED4A 1LNQA 4X62F 1FESA 1JWWA 2YQ0A 1CLFA 4OJHA 3W9IA 4KYZA 2IVFB 2ROEA 4P75A 3Q8SB 2VC0A 4U96A 3NMRA 1CQNA 1RT3A 1T9TA 4OZ3A 2Y1RI 3V5RA 4MYTA 1N56A 5KFCA 1ZA1B 2CPZA 3NCPA 1KLMB 3KLGB 4FKXA 5JVGQ 1WG5A 2GA7A 2HBZB 3E3XA 3D6FB 3JXOA 3LGHA 2DNQA 4OZLA 2VJUA 3EXCX 3W5XA 4USTA 4X65J 3T9NA 4JV5F 3CDBA 2YNHB 4WBFA 1QD1A 1SUQB 2MJUA 5HBMA 4EBEA 3M6VA 4P71A 2UUCJ 2GGPB 3RR7A 1YVFA 4ECTA 2PI4A 3PX6A 2E9TA 3HKWA 1JQGA 4WKRA 1MMDA 5ETPA 3MWBA 1TQLA 2W9CB 3PX0A 4RBVA 3W2VA 3IWXA 4F4AA 4J9MA 1H74A 3EUNA 3GILA 2DNLA 2PMWA 2DNOA 1W7WA 3MEGB 1WEZA 4DDFA 1S97A 3QAUA 2R7RA 1GX6A 1SJ1A 4EUVA 2GFFA 5HANA 2E29A 5J2NA 4OZ2A 3AJ1A 2HLTA 3SI8A 2CNLB 3P8BB 3IFEA 4Y0FA 2AF6A 1PBUA 1RTJB 2AGQA 3DRSA 1Y0HA 3O6QA 2OPSB 1LW2A 1RT4B 3UVJB 2QL5B 5ETKA 2UV8G 3VGSA 1JNZB 2X3DA 1D0EA 3D66A 1H2TZ 1X9SA 4OI0A 2FJVA 2DR5A 3RU0A 2CYYA 1KTQA 5D77A 2HWTA 2COLA 1UW4A 4FYDA 1O8BA 3BSOA 3MEDA 1RDRA 2BJ9A 3V6DB 1SB6A 4J9LA 4DPXA 2OHDA 1V3SA 2LXFA 4N41A 3DC2A 5DGAA 2V9KA 2QSFA 2ADBA 3MOZA 2A2DA 3OVBA 2KRRA 3JTOA 3ZFVA 4CH1A 1HR0F 3HKZD 4Q2MA 2CPJA 1BQMA 1VJWA 5T14A 3NGTA 1RXOB 3RJMB 4BBYA 3CO9A 4KKOA 2ZOGA 3VGTA 4OJ3A 2RRBA 3IG1B 2C2EA 1ELOA 4NA1A 2AKWB 2RMLA 5KTQA 2MHNA 1NSKL 5LT5A 3UO0A 1T05B 1IWGA 1U1OA 3GJTB 4AUKA 4M5DA 4KTQA 1VQOS 4J9UE 1U4BA 4DSEA 2XI3A 3CJSA 3AHPA 1D9FA 4ETXA 2HIYA 1HQUA 4QPXA 1ZPVA 3C15B 5E3RA 3PG9A 2GS8A 4ZPBA 2BANA 1N34J 2PA3A 3CCMS 3CCWA 3S7RA 2KFYA 1IBMJ 2FC9A 3CO0P 3KLFB 1SC1B 4X4UA 2RQMA 3SCLE 2DGUA 1NCLA 2JEGA 1U1PA 3GCWP 1RT6B 4C8KA 2RAQA 4LSNB 5KG4A 2OPPB 1YG0A 4C8LA 2FQQB 1V5VA 3THPA 1DJ0A 3WC2A 3UNYA 3CC4S 4Q0BB 2BBEA 4MFBB 3DOMA 1L3TA 4RL1A 3G86A 2W2OP 3PJWA 2FDNA 3I9V9 1HIYA 2PSZA 2W7OA 2FB0A 1APSA 3KJVB 2ACMA 4ZK7M 2W8LA 2HYIB 3H5SA 1U45A 1PJ6A 3IRWP 2AJQA 1LFPA 1RQ0A 2DY9A 4BWJA 1R6VA 1AFJA 3OJUA 3OXGA 1Q8LA 5ADZA 4C6AA 2HQFA 1N5YB 2QGFB 1R8HA 1JLGB 2FLLA 1N36J 1U6ZA 2AT1B 3ISNC 4TQRA 2VKZG 4AXIA 3QO9A 4O3SA 3HJVA 2AV5A 1NXIA 2EG1A 1DARA 1WC4A 2MQOA 4B9TA 1YBAA 2RE1A 1FTRA 2YQ1A 1VQ4S 3QFHA 3MUMP 2VH7A 1NJWA 2ASYA 4A4JA 3PIPQ 3P96A 4ED8A 1WC6A 1R0CB 2LEAA 1TUVA 1U6BA 3PYFA 4X4NA 2ZH9A 2CNKB 3VWSA 2J6TA 2XWYA 4OYIA 4ZVEA 1RHRB 4NXNJ 4RBUA 4DL2A 3FJ2A 4CNYA 3FVYA 5ETSA 2NUUG 3ETMA 3M8QB 5IXUA 3QRRA 2K7JA 4R8UA 1T3NA 4B3RF 3TYTA 4ZITA 4DL7A 2WHOA 3T9ZA 4A8WA 2GO9A 2X1GA 1XBWA 4TY8B 4WFYA 2V5HG 3M2RA 1CJUB 3BN4A 3BPDA 4OYBA 3UE2A 2PMHA 4HTIA 4FN5A 4F04B 2GVDA 2XYHB 3BZQA 1OY6A 3J80Y 4LRCA 4ZVTB 1RBOB 3NBPA 2HQDA 3G82B 4JI4J 1CSJA 1N52B 4PKDB 2A6MA 3B4MA 4JV1A 5CZXA 4DX5A 1NK4A 3UQSA 5MLCV 4TYAA 3CDWA 1NJYA 4USHA 3D6TB 3PV8A 3L09A 4QZVB 3MI7X 3X3UA 1U49A 5IT9U 4O4GB 2OD6A 3T1HF 2CPFA 2V8GA 5K8PA 5D8HB 2I2YA 3IMQJ 2KO1A 3PACA 1RYSA 4J9SA 2HMIA 3TARA 2FYXA 1DFDA 4NMXA 1D9AA 4A8QA 4F50A 2J6SA 2HBYB 1WKLA 2ZH6A 5M2PA 1D8ZA 3W66A 3MAQA 2IYGA 1RT3B 5AXLA 4OI2A 2R7QA 2MLYA 1MSWD 1Y3JA 2FLNA 3DLGA 1F9EB 1GTHA 3C16B 3DDNA 1WOOA 4U8YA 2VQEJ 1UJ6A 2WW4A 4DCOB 4IOBA 2JNJA 1OYDA 3VZIA 2ZWPA 2I8EA 4IH5A 2HNZB 2RJZA 1WOSA 2MHEA 4KIAA 5HBMB 3KNAA 1G4CA 3GU0A 4O23A 4PYDA 2HVZA 5EWGA 4YHHJ 3LTOA 4P2FA 3FBEA 4DR7J 3J81Y 3GV7B 1RAHB 1VC6A 1U25A 4KGMA 2BYCA 2JLEA 3HPOA 3PW7A 1F3FA 1S9EA 1UA0A 1HLWA 1M5HA 3ZC4A 2MYFA 3CCES 3J80U 1RU2A 4N77A 1FRLA 3BBFA 4LR9A 5MAOA 3W2VB 3VCDA 1FFSB 1WUUA 3R5GA 4G6VB 1ZM9A 3HLUA 2BJ8A 2GC8A 2G0CA 4JI1J 2VOPA 2UXCJ 2RQ4A 5BR8F 2IJNA 4OHVA 1S1XA 4NCBA 2HPUA 3K8WA 4IOAQ 3AD7C 2B9EA 2H3EB 2B8PA 5D4OA 5J2NB 1O5JA 2HRTA 2DBBA 1WJ9A 3R7NB 1OSCA 5DDOC 2W2MP 5LJ3Y 1EB0A 3N5FA 3F56A 1FF2A 3AB4B 4DR3J 5B0FA 1FJGF 3DRSB 4CO2A 2NSBA 3P6YC 2JWNA 1VHIA 2X7IA 3MCOA 3EPGA 3PFEA 1LW2B 2XNRA 1AYEA 3TVYA 3A12A 2E44A 4IO1A 2A2CA 1MROB 4I6AA 4P7TA 2ZH2A 1XWLA 2VBXA 3G4SS 3BDPA 3W8GA 2ZJQQ 4UQTA 3UR3C 2BE9B 2W4PA 1FDNA 3TANA 4YR0A 3TA1A 2R2TA 2CQDA 3A1YG 2OUGA 4DHVA 2AYGA 4L72B 3MEDB 2Z8QA 4JI8J 3Q8RB 4J5OA 3BSCA 4QYZJ 3H5XA 3V4MA 3J81U 3VAKA 3MXHP 1GQEA 2OEKA 1KOOA 3BV8A 4F4ZA 2LCWA 2QT7A 4C8ZA 3HT3A 3RAQA 3C46A 4TYBA 4CM0A 1MW7A 3S01A 2BJEA 2V4QA 1BQMB 4JI3F 4DR4F 1M90T 4LRAA 1TAQA 3RB0A 1KP6A 1H7XA 4A46A 2V69A 1ZPWX 4B9VA 3BGFA 2LYVA 4KKOB 1XJWB 2HHSA 1U1QA 5SZTA 1DY3A 1LXJA 1XNQJ 1P1TA 3LH2S 2OMOA 4DPWA 4Y3CA 5DDQC 4JYAF 2LA4A 2UUBF 4LR8A 3T5LA 2DR9A 4M5DB 3SQOP 4IR1A 2E66A 3BREA 5KFIA 1XR6A 1SC6A 2BV3A 3CSKA 2QO3A 2RNEA 4USMA 3M8YA 4CYUA 1HQUB 2YH1A 4B9LA 1GTEA 1FRHA 4F4YA 4WP3A 2XCPA 3K8VA 5E3AA 4IRCA 4NCGB 4FVCA 2BANB 3OHAA 3NS7B 1N5QA 1JJCB 1UZDA 3QGGA 2NXUA 3Q8QB 2XZWA 3CDUA 2K1RA 1KHWA 3I5AA 3M2UA 5CZVA 4PG4A 5EX0A 4ECSA 2Z30B 2P8IA 2C3OA 2DNGA 1KFSA 3MZIA 2XMWA 4DJBA 4DPTA 3KUEA 1HA1A 4U67Q 3DLJA 3JQKA 2ZBQA 4KBIA 3I6PA 2UUAF 3BQ1A 2IM3A 3DOMB 2E7XA 2DIVA 2M8HA 1YWXA 1D8YA 4A8XA 2EFNA 3HVWA 2CJKA 2L9NA 2MDAA 1R8CA 4GC6A 3BGRA 4QJVA 1R3NA 3OL7A 4USIA 2UVWA 2GX8A 2ZBRA 4PG8A 1AUSL 2DR6A 5JUMA 1SI9A 1AROP 2R7TA 3K2YA 2F9JA 2W24A 4M63A 2VL1A 3HHNB 1N32J 1FXDA 3KG0A 5KG2A 2CQPA 4ECVA 2J6UA 5DM6Q 3ZTRA 2BZ2A 2MSSA 2VQFF 2K3KA 1RT1B 2ACYA 2RH3A 4H4KC 3DLEA 3R6GB 2FHJA 1RE1B 2KT3A 5KG1A 5IQQA 4B3MF 4ITSA 1Q81T 1QUVA 1RT5A 2D69A 2NQPA 2WSFC 1S6PA 2JLFA 2WVBA 2B56A 2G1DA 1X4HA 1FDAA 3QFWA 3WIUA 3CPWR 4UUWA 4RNOA 3BPSP 3M1VB 5JVHQ 1RHJB 1Y3KA 4PXDA 2DHGA 2A10A 3V2UC 3NNHA 3ILLA 5HK4A 5GMDA 1DTTA 5J1NA 5SUHA 4LIWA 3EM1A 5L8RC 3R1LA 3EVWA 3OR1A 4NE9C 1H6KX 4DF8A 1WC3A 1IJEB 4R8UB 3GP9A 1FKAF 2KT2A 5IS2A 2ABYA 1R43A 4PZVA 3R97A 4JUZA 1FO1A 3PHTA 3M2RB 3LWLA 1HFEL 2IYIA 1QSSA 1IKYA 2XC9A 4DUZF 3T5KA 4KPYA 2BJDA 3QPIA 4U6PA 3NGSA 5KG5A 2HEKA 2GVDB 3G8TA 4C2MA 2E1CA 5KFKA 4Q8EA 2HFUA 5IQ6A 1SJFA 4ZP9A 4NRUA 3J7A1 2WAQD 3NBPB 1LK5A 3PJXA 3ISZA 3ET6A 2QMWA 3TAMA 1FCAA 1HBUA 3H4BA 4FF3A 4B17A 1N48A 3GIKA 2H9ZA 3EVMA 3N28A 3FDSA 4AE5A 4CWBA 2V2KA 2O66A 3G9CA 3H42A 3TUJC 1LWFB 1U1MA 1AT1B 3U7JA 2HAFA 2BOPA 4DX7A 1ZM4A 2HMIB 2C2KB 4WFZA 2XS2A 3BGLA 2W1BA 2C2RA 2HBRB 2M7SA 4K59A 4OYZA 3EZOA 3OTDA 4V19X 5IM0A 4ED5A 3BH7B 5E3CA 1KLNA 3FCVA 4RW9A 3D6HB 2HHUA 4DS5A 5L1KA 3DLGB 2HIQA 3NY0A 3AD9C 1GMUA 2G2OA 5KFMA 2W7AA 4RNMA 2LEBA 4EGLA 3GMGA 2EFOA 4EYIB 3UFCX 2KRBA 3BB5A 1QY7A 2H4WB 4J9NA 3C3LA 1YLXA 2EKYA 3VAGA 4F3QA 4Y2IA 5A6PA 3DDKA 1OQ3A 4K0KJ 1VRTA 2JH3A 2GQQA 5CYQA 3TEGA 4I68A 1S12A 2BW2A 4KB7A 3RRHA 2LA6A 5KFAA 1JLFA 4O3QA 1FERA 2CWKA 1S9EB 2ROGA 4GMKA 4OX7A 3M9MB 1TFWA 3EDRB 2R7WA 4ICLB 4YFUA 4WFNQ 2W2QP 1RUSA 1DAXA 1H3DA 1HHQA 4DL4A 5FLXY 3MFHA 4YS2A 3SCKE 2MLZA 1GMVA 1S1XB 4HL9A 4ETZA 3OD2A 3EGZA 3WDOA 2JRSA 1G1XA 1FWLA 5F0UA 4OQJA 3O44A 1ZZNA 2JHEA 4JI5J 1RT2A 3JB9k 2D9PA 2H4YB 4HI2A 4XPEA 4AQYF 1MN9A 3WC0A 3BBCA 4Y2MA 4MAKA 5KT5A 3H59A 2UXDJ 2GVZA 2A1BA 4JBCA 1FVSA 4DUYF 5D15A 1OYEA 4J91A 3M6WA 3OTBA 4LFAF 1FWKA 3CNQP 3CCZA 1KQFB 4MKYA 1UEVA 5E7OB 1I3OB 4USKA 1LWXA 1CQMA 1JB0C 2IVYA 1DQ9A 1F5AA 2BABA 5A2QY 4ZIVA 3AODA 1B3TA 1J5EF 4PQAA 4OX6A 2MZ1A 4B9SA 2I9SA 3M8PA 1BUXA 3WX4A 1P6TA 4DV0F 1YJTA 5D0GA 1N88A 2DVIA 1MN7A 3UW1A 2FVCA 1SKWA 1VK3A 5B0EA 5K5MA 1FTCA 4PXCA 2FJEB 4DV1J 1XMOF 2NYIA 3NGUA 1IJFB 4ZPVR 2RRNA 1R8BA 4DV4F 2X1AA 1RWKB 5HSPA 3NWGA 1M1GA 1PC5A 2MGZB 2KI2A 5KT6A 2WOMA 4EO6A 4JOUA 3GG0A 2PMZD 3IWLA 2W01A 3NXZA 2NXEA 1GFWB 4WXWA 3CD7A 3GZ7A 1C2PA 4P9SA 1S6OA 1WC5A 2MPUA 4LSZB 1JLBA 5D0RA 3HHDA 3MD1A 2ZDOA 4CYUB 2LQJA 3LW5C 4Q7AA 3A3NB 4USJC 2JFKA 1UW9A 1NSAA 5KFNA 3CIMA 2DXEA 2VPWB 1RTIB 2UXDF 2QA2A 1NU4A 3OLAA 4ECRA 3GWCA 5ETMA 4YR3A 4QIWD 2K1RB 5HN0A 2Q1LA 3M2UB 4DI6A 3NGDA 1P27B 4C3KA 2V0NA 5E2QA 2UUWA 2RU3A 3NS5A 4P6QA 5J2QA 3C14B 2DR8A 3Q0AA 3UCZP 4OZ0A 1C0UB 3NGKA 5DZ6A 5C2GA 1NKBA 1SJ3P 3FUYA 4FPRA 2GHPA 3RAMA 1QAIA 3T1YJ 3HVAA 2FHMA 3PVXA 3SIPB 2WBRA 4CTAA 3RRGA 4WK1A 1KSPA 3CJTA 4NLUA 4ED7A 1KN6A 3BGRB 2ASLA 1UEKA 2CQCA 3M9OB 5IC6B 2R3VA 2G13A 7FD1A 3ENVA 1QM9A 4TU8A 5C42B 1S6UA 3B8HA 3FRZA 1K73T 2GO8A 5L46A 1T9YA 4FP9A 2IRUA 2XY6A 4WCEQ 4RWWA 3DLEB 3DFEA 5I42A 2IMOA 2DH7A 5LL6d 4Y6IA 3OL6A 2XMTA 4DU8A 1RT5B 3ENQA 3LP1A 1S6PB 4DV6J 3Q2SC 1PC4A 5EWFA 3CWJA 4JP8A 1NZAA 1FDDA 3S8SA 2VICA 4AT1B 5GAHI 4F4WA 1DTTB 3W2WA 3ZZOA 1AB8A 4M8LA 3JAMU 3OR1B 4O4RA 2WB1D 3I0SA 4PPDA 3HDSA 1Y00A 1T9WA 4NI2A 3PW4A 3SFGA 3P45B 4P2MA 2MQLA 3FCWA 4X4VA 1G3OA 3PW5A 3PJ9A 1FRKA 5H9FK 1S99A 2CA9A 4HDGA 1WTBA 1IKYB 2DITA 2AGPA 2IAJA 4J7CA 2AJ4A 2QC3A 8AT1B 3CDEA 1PKUA 2QEXS 2OGUA 2IM0A 1UFWA 3FMBA 3B78A 3T1YF 5L9XA 4ANEA 1W26A 1UMJA 4LQ9A 1U6FA 4F3OA 3ET6B 1K1QA 4HT5A 3TAMB 1QSYA 4L3NA 4DQPA 4L75A 2HHHJ 5KFGA 2FLOA 1TL5A 2WVDA 2BVZA 2RF2A 4X4OA 2PIIA 4NASA 1Q5YA 2P6TA 1V5IB 3TZZA 4S0MA 1V3ZA 1H2VZ 2FHJD 5CD4H 1KQKA 2RU9A 3ULHA 2XSFA 2L9WA 3HZGA 1X9WA 3GJSB 4TKTA 4WJBA 4DFMA 4P52A 3DMJA 3KHHA 3NKYA 5HQMA 4ZKAA 3T1AA 3Q83A 4LRDA 1RAOA 4O0NA 2J7WA 5IM0B 2AYMA 4USWA 4H4OA 4N47A 5E41A 1VJQA 1R31A 3S6EA 4RW9B 4PEOA 3TZXA 1AUDA 4K4ZA 5H9EK 3M9NB 3T41A 4PQUA 4I1TA 5KFSA 3RBXA 1VRUA 3L7UA 3OHBA 4F2RA 2ZKUA 3MFIA 3HVRA 2CZVC 1LWCB 3ZTSA 3LWMA 5T7LA 2X1BA 4U7UD 4QIFA 4DUTA 4XDDA 4DF4A 2IDLA 5CYQB 4O3NA 5F3TA 3HX9A 2ZZTA 4GKJJ 1JLFB 3D0GE 2N3LA 5HMWA 1F3VA 2RDIA 2ADCA 4I0WA 3LO3A 4GKKF 2X51A 4RW7A 4J37A 5F0WA 3DLLQ 2AEFA 5LXYA 4URQU 4YQWA 3EE3A 4ZVQB 3CE8A 3PZPA 2QLFB 3GFYA 2ZM6J 2RQKA 2HHHF 3LF0A 1TKZA 1I94J 4UF4A 4LIRA 1Q79A 5CCMA 3LA0A 4X66J 4M5NA 4M1KA 4ERDA 3H5UA 3KMSA 3AQOA 1UFKA 4V1Ak 3C8YA 4MKAA 2R8JA 2HHWA 3P49B 1RT2B 3M8SA 3IGNA 2QG9B 4QW9A 2WVFA 1F6TA 5E3QA 3I5BA 5J1EA 3BR8A 4OJGA 1PILA 4JI0F 1RKJA 2K2PA 4BHQA 5GMEA 2GVZB 4UQGA 2D3OR 3T19A 1FJEB 5GMKa 5DG9A 3C2PA 3V81A 3EGWB 3M6UA 2YKMA 3RYLA 3E8OA 1NBEB 3IN5A 4F26A 1NMEB 5KG0A 4OFZA 2LLZA 2G0JA 2HGLA 1KD1T 1H0HB 4O3RA 2R7XA 2O67A 2F4VJ 4NYPA 1ZAVA 3QQCD 5CYJA 4N7TA 1KVJA 1KQGB 3HF5A 4OX8A 3M8PB 3CXCR 5D4LA 1HWKA 3JSRA 7AT1B 4H4KA 3FSXA 4ZCLA 1TKDA 4DG1A 3DOLB 1NHKL 2J9DE 2V4RA 1T0TV 4UZCA 2XYGB 2NLWA 3CJ0A 2A3JA 3GONA 1B4SA 4URGA 2FLPA 1AZSA 2DY1A 3ILIA 2BJ7A 3UPFA 4ED6A 1NJIT 4QIEA 4CH0S 3C19A 2VFVA 1WI8A 2DGWA 4XO0A 1X4AA 2UXBJ 2RDJA 1SBRA 5HL7Q 2DO0A 2VZ9A 1RAGB 1YDLA 5IC4B 4UZBA 1JLBB 2V4JB 2NXCA 3IWNC 4DQSA 3GYNA 2DHHA 4IO9Q 1NLKL 4QWEA 4YP3A 2B9WA 4ZHRB 3SYZA 3CMAS 4B02A 2MXYA 4KHPJ 3UN2A 4DV3F 4WF9Q 2XYPB 4FZVA 3RAXA 2IPOB 4JV2A 1SC4B 4TVAB 4DSKA 3G71S 1HI0P 3KNGA 2YNHA 2XO6A 1SUQA 2ZWOA 1S4EA 4W4MA 2GZOA 3MGJA 1S76D 4ZA1A 2RUSA 1SJRA 1C4CA 5J2QB 4IH7A 4WYWA 3SV3A 2DHAA 4ZVFA 4PAAA 3ISND 3HHLD 1VQMS 3M32A 2C2NA 1IM4A 5BYRA 2MKKA 2K06A 3OXFA 2VF3A 3ADAC 4OYAA 2F9DA 2FVSA 1NH8A 3PXGa 4CTAB 1S0NA 4CO0A 4MH8A 1NNDA 5I3UA 5B7WA 2XG8A 1LWEA 4A8MP 2XGPA 2ZBCA 3AB2B 1IR0A 1KVKA 2X3GA 4F4XA 4CNZA 3RBDA 1RBAA 4NEZA 4NLSA 4AYBD 1IBKF 3MEGA 4CI0B 1ZOTA 4RU2A 2F40A 3A3OB 3G6VA 1U8WA 5AE3A 3IAM9 2GJ2A 5A76A 4DOZA 4RUAA 2YX4A 3P5TL 3K5LA 2APOA 2PGCA 2PDAA 1MMNA 2L08A 6FD1A 1UWAA 3D0IE 2B6AA 2PFDA 4NWBA 2DNYA 2BJ1A 4HEA9 1GK8A 3LP2A 1W2IA 3TQEA 3TZYA 5KFPA 4I2QA 1VBKA 4NXMF 4QIVA 2E5LJ 1FI4A 3LP1B 1DHMA 3CJKA 4WWSA 4ZVGA 3D68A 4DZDA 1BGXT 4YY3J 2R8IA 2DH8A 4W92B 2ZJRQ 4EYHB 2GCFA 2MTLA 4B3SF 3CVKA 1XQIA 2D3ZA 1IBLJ 1HHTP 2E7VA 2CQ0A 3FCHA 1X4CA 3W2WB 2OIHA 5HI7A 5DZ7A 1X5OA 2NXNA 1D09B 2VBYA 2XY5A 2R8GA 3V4IA 1J5OB 9RUBA 3I0SB 1FRJA 1F9FA 1NK7A 4NI2B 5AE2A 3PKYA 4KH0B 4F8RA 3RZAA 2LQ8A 2MKSA 4LBIA 4RO0A 3SDEA 1RAJA 3U27A 4J9KA 5HJYA 1NO8A 2N4CA 2W9AA 2XI2A 2E9RX 2IAJB 3UDCA 4J90A 3RB4A 4X4QA 3TRGA 1GH8A 3N9UC 2CNOB 1Q8KA 3VVUA 3SZ2A 4LF6J 3ZZZA 1JMTA 3W5ZA 3OPKA 3IG1A 1FE0A 1KKHA 4CCHA 2WZ1A 4C11A 1Y5LB 3M2VB 4KO0A 3UCGA 5F8LA 3I56S 2EC0A 3FZ2A 3TVKA 3OT9A 3G8QA 2RF2B 3LOUA 4QR2A 1BLUA 2NZCA 3GCXP 2CZ4A 1HWJA 1BD6A 5F9NA 1X60A 2N7CA 1LQ9A 4ANDA 3VAHA 1SV5A 3K5NA 5EN1A 3C15A 2EW9A 3L4BC 3DMJB 4LQ3A 4U8VA 1PAUB 5F8MA 5GAEI 2E5LF 3RTVA 2CJYB 3VGVA 1GAOA 2FHOB 2H5EA 5KOWA 3OTOF 4H4OB 1X5PA 4DCPB 4OYOA 2HFZA 1RT7B 3ILOA 2VPXB 3CCUS 2CPEA 1VS3A 4WZMA 2HS3A 4PQUB 1SL1A 2H5JB 3CW2C 1UJ4A 4DV7F 3R5BA 2OPPA 1VRUB 4ED3A 2FGCA 3BM7A 2KJVA 4EO8A 1WKJA 3NRBA 2MSTA 3A4TA 3T6BA 3MUTP 1S72S 5T7LB 3RB3A 3TUZC 2VBZA 3D1OA 5D4NA 4DX6A 1KEKA 4JI2F 4Q0BA 3BO2A 3QBCA 1K8AT 3IM9A 3K59A 1HNWJ 2C3UA 1DLOA 3MM8A 1VC0A 4OI6A 3M7VA 2BRKA 2UU9J 4BCAA 4L76A 3G6XA 4EZ9A 3D3CJ 3SSRA 4UY85 1BY9A 2Z0GA 2EVZA 2IRXA 3CCVS 3KJVA 1JLAA 4LF9F 2Y1LB 4AFFA 1Y5IB 1NK5A 1VQ6S 4RW7B 3D4JA 4R5PB 3G2XA 3HD1A 1M0SA 1N5YA 2YKOA 1GMWA 1E6YA 3WIVA 1JLGA 2NXJA 4HACB 3MPYA 2D9OA 2CWXA 1K0TA 2HQ3A 4ALZA 1TKZB 2HZVA 3KHLA 2V2QA 1RZMA 4FXDA 4X62J 2JC0A 4Q2LA 2DGOA 1NH7A 1OY9A 3TUIC 1UVLA 4CQ1A 4DMZA 3I4PA 1N5SA 1FXRA 1TR0A 1FX4A 3OL8A 4K5RA 1U0SA 2EKNA 4D3HA 1M5OC 2G9OA 5H1SV 2QX0A 4WP8A 1YBUA 4HTJA 2GAGC 2QLXA 3TR5A 2E5IA 3A3PB 1N54B 2X1FA 5J1EB 2GMLA 1YTYA 3HHEA 2VFTA 4OHXA 4PRFA 1JXLA 2HHVA 1ZA2B 2OD4A 3V81B 5FJ4A 2DNNA 3G87A 3AJDA 1WWHA 2YKMB 2ZBIA 3BQ0A 4J9VA 3CIZA 2DRBA 4ZMMA 2MQMA 1U47A 3D9BA 2W9BA 1SIZA 1ZTTA 3P3DA 3THTA 4C4WA 1SC3B 4WIQA 3UD3P 3U1MA 3I32A 2Z2ZA 4CO3A 4LFBJ 3KLHA 4QU6A 3G82A 2CJBA 4DG1B 3OVSA 1XNRF 2CVIA 4CT9A 2CQ2A 4OIXA 2D3O1 1RKIA 3D1QA 3K89A 4FYWB 4MJKA 2OPRA 4O4GA 3U1LA 1RAFB 2M4MA 2AMCB 3J7Z5 3ZTQA 1AZSB 4FNIA 2JJ4D 3MTKA 1U1LA 2QLJB 2MMYA 2LQ5A 3H90A 3HJFA 2YKPA 1U26A 2N7YA 3J7YU 4RJVA 3GIRA 3CC7S 3FQKA 1R89A 3H25A 1CPZA 8ATCB 3ZNUA 2P2CB 1XC9A 1RWOB 3ZZYA 1RI7A 4EBDA 1WD6A 1WEXA 4ZLLA 2KN4A 4G65A 2UUTA 3BKUA 3OSNA 1XERA 2JC1A 3IBFB 2V9WA 3C16A 2ZNZA 5M2UA 4NLRA 3W63A 2NR0A 4Z2XA 5LM7E 1A9NB 3IR5B 1F9HA 1QUPA 2HNZA 2F8HA 1S0MA 1HWLA 4M5LA 3PO4A 3N6MA 4CH7A 4NMLA 1KFDA 3CULA 1JK9B 1MNEA 2GHWA 1IKWB 4FYXB 2LKZA 3PEJA 2FZGB 4RNHA 1N33F 3ILJA 2AYBA 3IGVA 4DL5A 4NRTA 2V8DA 3TJ8A 1JXVA 2POKA 1QE1B 3MPVA 3M32B 1HR0J 5HP1A 1NEEA 4OI1A 1RTHB 1CULA 3KHGA 5EGYA 2V68A 3H7HB 2E7WA 3OTCA 1HYSA 4LFBF 2DGXA 2ZZNA 1H7WA 3KUGA 5I3UB 2GMHA 1LWEB 5EWEA 4CLTA 2VG7A 1R8AA 1RLDA 3RB6A 5D3GA 2RUGA 2NSCA 3N6LA 1UCNA 5J2MA 1ACMB 3R2DJ 3H5YA 2KVQE 2OKQA 2J0WA 1I1GA 1WTFA 3CJ5A 1S6QB 4BC7A 4DPOA 4OYMA 4F0MA 3BKFA 2B6AB 1FRIA 3FMWA 5BJRA 1YHQS 3LP2B 2J9CA 2EXUA 2ZVIA 4D3GA 5EX3A 4I2QB 2HK3A 1BE4A 2V63A 2J7UA 1C0TB 1BQXA 1IVZA 3CJKB 3EX7B 5AE1A 3I31A 3NCRA 1PGZA 3C6UA 1RHMB 2MLXA 1NDCA 1MROA 1REVA 1T8EA 2Y9HA 1UZHA 3R5DA 5DS7A 2HG4A 2OEJA 3AAWB 1O0PA 2F4FA 4NLDA 4ZVOB 3B6BA 2C22A 3TUPA 1SL2A 4LSLA 3V4IB 1BWEA 2EBEA 5L1IA 1B99A 2ZD1B 2MZTA 4C8YA 2KB2A 4WK3A 1RHUB 3GLJA 1FXLA 5GADI 2DPIA 1HPZA 3SDEB 4HVZA 1RBLA 3H8YA 3CC2S 3DCAA 1HBMA 1JXEA 1B7FA 3AA9A 3K7RA 2GW8A 1KTVA 1KVIA 1Q7YT 4PG7A 4I67A 3PEHA 2VONA 1S9FA 1HL6A 4CDIA 2BM1A 3NG8A 4F2SA 2J7KA 1VK8A 4KGVB 4M5IA 4C11B 2I38A 2V2VA 3TX0A 4DR2F 4OX9F 3POTA 4KO0B 1IBCB 2KZMA 2HNDB 3AFGA 1RSCA 1P9YA 1OJ4A 1FDBA 4PCQA 3PRVA 1XR7A 1T9UA 3CT9A 5D6GA 2IVMA 1U2CA 4TU7A 1SQGA 1SV5B 5AXKA 3GIJA 3LALA 2C42A 4DLEA 2M5YA 4ES1A 3ZZTA 2FJXA 1BXNA 4NCGA 4H4MB 2Y8WA 5F9LA 3EZ5A 3H4DA 4RW6B 2DGSA 4E0DA 2KL8A 1KDNA 2JVOA 3IXQA 3PRBA 1TK8A 3MCSA 3KKFA 4QR1A 5DGBA 3JSMB 2CG8A 4B3RJ 2PEHA 4LF4F 4Y65A 4KT0C 1GXUA 4N8OA 4YOEA 2CADA 4DR5F 3A8KA 3PDNA 3VF0B 3K58A 3BJYA 2YXLA 3L3CA 2FZCB 2QN6B 3BN7A 4NLTA 4LF1A 1TL4A 4X64F 1DLOB 3MM8B 4ZCIA 2OSRA 1TMJA 3QRPA 3TEHB 3GJQB 1VR6A 4OI4A 1OMSA 1U1NA 1JLAB 3HHKA 3NL0A 3NWRA 1YJ9S 1WELA 1XTZA 4C7QA 4TXSA 1RCXB 3ZTPA 3ITHA 5CYMA 3EICA 1U48A 4A48A 4FYYB 3T1HJ 4WKYA 1ZM3A 4CLUA 1E6YB 2BX6A 4O0IA 3JTPA 2IIHA 4MK8A 4P74A 1HARA 1WHWA 1R6YA 1CJVB 4HHJA 1YQHA 1RT1A 5DM7Q 1S0VA 4WU2A 4C0HA 2O01C 4MMOA 1JIHA 2LXIA 2YWEA 2YWKA 3DU6A 4TU9A 2HGMA 4ECZA 2VFUA 4A8OA 2DB1A 1XK8A 3MHYA 4Y2KA 2I1RA 1U2FA 3M1VA 5HO4A 1HW9A 2F65A 4GVLA 5KT3A 4ZPWR 4KGXB 4ZIWA 3LAKA 2HWIA 4RZRA 3MR7A 4KAIA 4ID5A 4GO5X 4LFCF 1YRXA 4XTTA 3JYTA 4ES2A 5GAEU 1HBOA 4ILLA 2FZKB 5DDRC 4I7FA 1JLQA 4LF7F 2A18A 3W65A 5AJ3J 2V50A 3KJQB 2E1PA 4IDKA 3SQGA 1V9OA 2W9BB 2VDIA 4LVNP 5KFEA 3Q2TC 1Q4RA 1FD2A 2HVEA 2BM0A 1HNXJ 1SJQA 1VIXA 3FRYA 1WC0A 3KFWX 3KLHB 2ZC3A 4NPOA 1XN9A 1FKOA 2WBMA 2RKIB 4LF5F 2CJXB 2QYGA 1GMWD 2QSWA 5BR8J 3D6MB 1X4DA 3OLBA 2OPRB 3BDEA 4ZVSB 3NGRA 1T94A 4XIUA 3I0RA 1HBNA 1FKPA 2HHPA 1LWFA 1FRMA 3MM7B 2CQ1A 5GAGU 3UDVA 2XMUA 3I87A 1K44A 4EU0A 1C4AA 4P10A 3D3BJ 1HD0A 1NK9A 1AXQA 3T6JA 1LW0A 1FJGJ 1YBTA 1RWVB 2HW3A 5CQGA 1X5TA 5I4MA 4TLQA 1VQ7S 1R8PA 2BKNA 1X4GA 1TL3A 2M0GB 2R7OA 3K17A 2XTJP 3U1NA 1KNZA 3IRXA 3TA0A 3VAIA 1M1KT 4DWIA 3LGNA 1NJXA 3CMQA 1JX4A 3CCTA 3O3LA 3KWMA 2YNFA 3MMCA 2DPJA 4XK8C 2NPIA 3R27A 2GJFA 1FFWB 4NA2A 5HVGA 3Q22A 3O5TB 4I6YA 1N6QB 2HQCA 2JEIA 3ONQA 2PI5A 5AJ3F 2XZDB 2ZH7A 1RJJA 3H2LA 3IBWA 4Y2CA 1Q8BA 1SVDA 5HP1B 4IOCQ 4F0KA 4NCAA 1FNOA 2V8PA 1HNXF 4JI3J 3Q8UA 2UZAA 4DR4J 5KT2A 2DXDA 1CULB 5EUHA 4ANCA 1HYSB 4ICLA 3MTJA 5DRKA 3QJLA 4LJMA 1TKXA 1CC8A 4CLZA 1X31C 5ETNA 5LMNF 5L38A 5DQGA 4U7UK 4DPUA 2VG7B 1N5VA 5D3GB 2RS8A 3NOGA 2ZH5A 1IKVA 2MJNA 5AXMA 3HFZB 5J2MB 4R25A 4K4YA 2JZ5A 4JYAJ 3B54A 1HNVA 3KLVA 3HZEA 1LV5A 2AZ3A 2UUBJ 4O3PA 1VQPS 4E2FB 1W2BR 4OV1A 2ZBPA 4B9NA 1HQ2A 1MWYA 3CJRA 2XQCA 5IV4A 4LBHA 2LQBA 4ECYA 1PJ7A 2XSJA 1VBZA 3JTNA 2ZJPQ 2FIUA 1P1LA 4CT8A 1EARA 2SXLA 3GYXB 2KFZA 3N0VA 3AA8A 1X4BA 4JI7F 3DGPA 1WF1A 4TQSA 3DNCA 1TVRB 1KQSR 4UOHA 4KHRA 4V19J 3C6UB 1N0UA 6FDRA 2HZCA 1RWWB 2H48B 1REVB 3GQCA 3DDIA 3M6XA 4MIBA 1LFWA 3BR9A 4KC5A 1WF0A 3R7BB 3PIOQ 2YNIA 1MWQA 3Q24A 4LSLB 3GYGA 2VD3A 4NLVA 3QRQA 1DURA 1PYTA 1NUEA 2UUAJ 3HM9A 3HSZA 4XAKA 4Q44A 1HI8A 1ZYQA 3R8YA 4A8SA 3W64A 5L1LA 2B8QA 2WK4A 4IR9A 2DNHA 4PWWA 1HPZB 2OI2A 1S57A 1HBMB 4OJ1A 4DSIA 1HNZF 2P9GA 2I6WA 4DPYA 2B5JB 2DO4A 1RISA 2PFFB 3GSIA 3K5MA 1EIYB 4B08A 2D3UA 4C8OA 3MR2A 1VBYA 3QZ8A 1IWAA 4RX6A 2C2ZB 3J7AN 2MGZA 2AEJA 2W8KA 3IR6B 2VQFJ 3POTB 3GE9A 5A8RA 4WTYA 1RTDA 2VPYB 3D67A 2VDHA 4DSFA 4B3MJ 5A8WA 2PT0A 4YN3B 3HSGA 3SSQA 2C2MB 2JVRA 1HWIA 2B4OA 4KQZA 3N01A 1X8DA 2Y0SD 3R9LA 5D0HA 1S0OA 3O2IA 2E9ZA 2ZH4A 3M30A 3GTYX 3EPIA 1RTIA 4LRFA 2HHTA 1UAWA 4HLBA 3W1YC 1VRQC 1CJTB 1BMQB 1WEYA 4KPCA 1GXTA 2BKOA 2QA4S 2P5VA 2VUGA 3EVOA 1SKUB 1JKHA 2LQ9A 1PJ5A 3C14A 2DHXA 1XIQA 2KM8C 4DR6F 2J0SD 2DNKA 1C0UA 3QT5A 4DUZJ 5E33A 3CJ4A 1RAAB 3Q8PB 5C24A 5KFXA 1EZZB 1NPPA 1Q53A 2VB6A 3IO1A 3MDFA 1G7CB 3ZZUA 1F60B 1OIAA 2FVQA 3TJAA 1FX2A 2JLGA 4FVMA 3TAPA 4B3TF 4M5MA 3RBEA 5GADU 2KDOA 1D9DA 1SH2A 3WQPA 3KK1A 3BSNA 2VA2A 3ITHB 5CYMB 2R7SA 5KFWA 4A8YA 3BSAA 2KXNB 2ERRA 2B3TB 5C42A 3FEZA 1KR4A 4EBCA 4ZPAA 1KBRA 5KFTA 2W25A 4A8KA 3WX8A 2WVEA 1FJ7A 4FKYA 4AXJA 1YIJS 2K8GA 1PYOB 4X2BA 3PYDA 1VQLS 4QU7A 2XWXA 2XB2D 5IWAF 1NK6A 4CLLA 2XMKA 4JB8B 2ZKTA 4FNHA 3KK3A 2M70A 4NLOA 5ITHA 1EETA 4K4UA 1A7GE 4EI2A 1MG7A 5HAOA 5ETOA 2J0XA 3W3SA 1M5VC 4NOHA 4PUOA 1C1CA 1Y10A 5B0DA 4ID5B 1F2HA 3MEEA 1SJ4P 1M1HA 3HMJG 1S1WA 3JYTB 2DCUB 4F4KA 2C3YA 3OQ2A 1HBOB 3PRDA 3G6ES 2XULA 4QYRA 4I7FB 4HH0A 1JLQB 2PC6A 4DU7A 4UOGA 3VQTA 2Y8YA 2HURA 2WCXA 4IDKB 3SQGB 3ZO7A 4E8UA 3QJJA 1BC6A 2E1MC 3GIMA 4N5SA 2NREA 2PA8D 1X0PA 1MLAA 4OYXA 3VTIA 3H98A 2M3DA 2XLIA 1H72C 2WONA 3CJ8A 2ATCB 3CCRS 4MKBA 2NPFA 2V6AA 2PEBA 2AEMA 1FKOB 1BQNA 2IRYA 5F41A 2R9LA 3D7SB 2PN6A 2R4FA 4QYZK 1RLCL 2P6SA 3R5AA 3QATA 1WSRA 3AOBA 5D78A 3I0RB 5LMUF 1LK7A 5CA5A 1H98A 4KE5A 4DR1F 1HBNB 1FKPB 3CTRA 1XR5A 5C7PA 1TFYA 4ELUA 4LF8F 3MR6A 4HR2A 2HRYA 2HNYA 1TZ0A 5DO2A 2DNPA 4PG5A 5HQ8A 2D1CA 2HVIA 4DSLA 2IDEA 2HVDA 3CCLS 1YSJA 4AQYJ 1LW0B 4ED1A 4P7VA 2XEXA 3HSJA 3PFOA 3UN3A 1TL3B 2G2ZA 2N3OA 4F7VA 3GFZA 2F63A 1QVFR 1N4LA 2OSQA 3IRXB 5E5NA 4ZJLA 4DUYJ 2DR7A 5KFZA 3W9HA 2BE2A 1I5OB 4O44A 3L7OA 3FC9A 4LFAJ 4RW8A 5CD4A 1FNMA 2YNFB 1U0HA 4Q43A 3MMCB 1LWCA 1TUWA 5KT7A 1O51A 3MCMA 4YDDB 2KHDA 2FPHX 1VYAA 3FEYB 1OY8A 1J5EJ 3TZWA 4X65F 3DLKA 5IT0A 5B08A 1SCJB 4DV0J 2B4UA 1FFGB 1XMQJ 3WHIA 5IT4A 2CJAA 2QYCA 2JOQA 4KGKA 3CD6S 2UUCF 3EYZA 1YJWS 2MZJA 2HFSA 1YGYA 1XMOJ 4GVBB 1VIOA 1M5SA 1YRUA 1WHVA 4ZJOA 3KJFB 1JNRB 2RB7A 4DV4J 4B9MA 1HNIB 4IFVA 1U1KA 1TKXB 3MECB 2G0IA 3OJSA 1NSPA 2BQUA 2OEMA 1ZETA 4NX9A 3LUYA 4C3MA 1IKVB 3F44A 1RAIB 1GT8A 1HNVB 2NS1B 1JLEA 5HROA 2JEFA 4EK2A 4DX8H 1QJHA 2GHVC 3FFIA 4I69A 8RUCA 2AHOB 2XSJB 2K3IA 3LQVA 2OH2A 3MMJA 3VAFA 2M2BA 2HQIA 5K8MA 2O1PA 4AL5A 5K20B 1HMVA 1LEOA 1TAUA 4CLKA 3DGPB 2IA0A 5A0YA 2V94A 3DRRA 3W9JA 1VISA 2MZQA 1E6VA 5ETTA 2E5JA 3LPYA 3W7BA 1RA6A 2HGNA 5CAAA 2YWHA 1RA7A 5F8NA 3QLHB 1RACB 3HFVA 3DM2B 2WB4A 1KC8T 2YNIB 2QTWA 5C2CA 1F0XA 2LXUA 3TP2A 2UV8A 1Z1ZA 2WW8A 3CD0A 2W7PA 1U1RA 3DXSX 2NCKL 3S1TA 2IFXA 2HVHA 5DJBA 3H2UB 4OLPA 4OV6A 5KFRA 1Y4ZB 1QAYA 3LGMA 1XMQF 2B4PA 4MK9A 2ASDA 1Q86T 4M5KA 4LT6A 3DOLA 2ZFHA 1FEHA 1WG4A 2BKPA 3QZ7A 1OO0B 2E1RA 4U95A 2LDIA 2ZH3A 4RNNA 2I5JB 1UPPA 2XBPA 4LUBA 1NDKA 2R8KA 1H2UX 1RYRA 2BQRA 5DG7A 4Q5VA 2FJBB 3GR1A 3EMTA 2VODA 5FLXU 3L9ZA 5KFOA 5HMYA 4M5JA 3GR0A 4CLPA 2QV6A 2VHGA 2H51B 1YJVA 3BYPA 2FJWA 5IT9Y 4WFBQ 5A8RB 5CHCB 2YNGA 1RTDB 3N5BA 2XLJA 3HHLC 2QFJA 3FKBA 5A8WB 4WTOB 1U2RA 2CNNB 2V4JA 3HCXA 4USVA 3OFGA 5JXSA 2CKWA 3MM6B 3C66A 4ES3A 4M94A 3FSYA 4ZHRA 2BDPA 2RRAA 4TY9A 4HYKA 3EJMA 2DNMA 3KLIB 3M30B 1VQ5S 2QMUB 2YPYA 2ZC4A 4P2SA 4UOCA 4HDHA 1N34F 2GIQA 4P72A 1VQ8S 2BJ3A 3FGVA 4MIWA 4RUBA 1IBMF 2BOAA 2D7SA 1JKHB 1YZ6A 5B0AA 3K0JA 4B3OA 4OI3A 2OAUA 1TKTA 3PKMA 4DV5J 5A2QU 4HHUA 4IG3A 1T03B 3H40A 2EEYA 3NP5A 2FJAB 3I5CA 3BH6B 2B9YA 1S1VA 1T02A 3VGUA 5C24B 3VALA 2BA9A 2F8MA 4ZN1A 5ETLA 4RUCA 3ZZ0A 2OFGX 4Y28C 2KTQA 2G4BA 3QMQA 3HK2A 1EQ0A 3D0HE 2AJ1A 3I96A 1U02A 1UVMA 1VQ9S 4A8FA 3KK1B 2Q79A 2IBOA 4RLEA 1L3UA 3DU5A 5KG3A 1S1TA 3UDEA 5LOQA 4EEYA 2KZZA 2BQ3A 1SQEA 4GO7X 2DEIA 5BXIA 5KG7A 3X1LB 3OV7A 1QLNA 2RDDA 4QPTA 1N36F 5KOXA 2HLUA 2J5AA 1URRA 2XY7A 4URSA 2V8VA 2WRMA 5C25A 3CCSS 2F5GA 1IKXA 3KK3B 2DHSA 3IAS9 4OZNA 2MZRA 1EETB 3A8JA 3MPDA 4NLWA 4ZJQA 2VC1A 4DL0C 2EC2A 2VIHA 1QSLA 4ELVA 4ZN3A 3AD8C 4PUOB 3R7SB 1C1CB 2K7KA 3CCJS 4ZDNA 3W8PA 3MEEB 1J5OA 4NXNF 2KU7A 3DI6A 1S1WB 5DG8A 4OHYA 4M95A 4IH6A 4WFXA 1ZH5A 1Q95G 4R0JA 1IUJA 4CLWA 2ZUGA 3OXLA 3VAMA 2VASA 2IHR1 2R7UA 3CCQS 4DV5F 2QLWA 2LVWA 1Y9OA 1L3VA 4K4VA 1DTQA 3DLHA 4RNFA 4GKKJ 1TL1A 3MPUB 1X4FA 2V67A 4I2PA 1FEEA 5T41A 4FBTA 2WONB 1R27B 1BQNB 3JSYA 4JI4F 3M2VA 2OPQA 2QMXA 3JQMA 3NS6A 4X4PA 2KVIA 1NB7A 3PR4A 4YB5A 2YX1A 1J2VA 3IA0A 2AJFE 3KLEA 2CQ4A 1NPKA 1VQNS 1PAEX 1S1UA 3P4UB 3G6YA 2HNYB 5BYSA 3CGIA 5HVFA 3LP0A 1F5BA 2FVPA 1YJ7A 4FBUA 2FGOA 3H20A 3UD4P 4QWAA 2JL9A 1Y5NB 4JI0J 4WYLA 4X4RA 1VLOA 1KHVA 4LRBA 1TK5A 2L48A 1N5TA 3FEXB 1RT7A 4DXLA 2XMVA 3R1HA 4KHMA 3MM5A 2KFNA 2XZTB 2BE2B 4O44B 4OMFG 4RW8B 3GV8B 2Q3PA 1U0HB 3JSBA 5KFUA 3DHXA 3QWPA 1YJNS 4K5SA 3OL9A 2WSCC 3EZUA 2VQEF 2G1HA 1ZM2A 2QFIA 2ASJA 4NZ7A 4ZLPA 3KOAA 4DZ6A 2YKQA 1M5PC 3DLKB 1LXNA 1VOMA 3SEOA 1S4FA 3MCNA 1RHKB 3LAMA 4C3LA 4EZ6A 4K7QA 2C1EB 1OPIA 2CQGA 3ENWA 4YHHF 2DGTA 3BYRA 3VHQA 1G6BA 2DD8S 1V6HA 1SH3A 1YRTA 4DR7F 4W98A 4ILRA 4M5HA 5AXNA 4R5PA 2EFVA 4CM2A 2DYAA 1K47A 4IFVB 3IR7B 1RP5A 3RW6A 5JMNA 5EDWA 4ZVRB 4HACA 4CZCA 4NLQA 1UFLA 2FTRA 5KFVA 4DN0A 4KRWA 2DIUA 2B4VA 4UUXA 4JI1F 1H73A 4OL8A 4ZLJA 2UXCF 5AT1B 1JLEB 4F25A 1WDDA 3OFEA 5HROB 1PCAA 1U7LA 4L74A 1ZZFA 3ELHA 2DEJA 4ECWA 3FFIB 4QIGA 3EGVA 3MMAA 2EFGA 2NUHA 1R0BG 2F8EX 2EWHA 1NM2A 1O6XA 2VKRA 4RPFA 5D4PA 4NZ6A 2VFRA 4K50A 1CBKA 2ZE2A 2AP6A 1S48A 1HMVB
chains in the Genus database with same CATH topology
4ZPDA 4N8OA 1JJ4A 4YOEA 3UW1A 4DR5F 3QGHA 2HHQA 2FVCA 1SKWA 5A0YB 1VK3A 2FY1A 3OFHA 3PDNA 5B0EA 3VF0B 1UVJA 3K58A 3DRRB 3N6NA 3BJYA 5K5MA 1FTCA 4RW4A 4PXCA 3L3CA 3QGPA 2FJEB 4DR3F 1E6VB 3DYAA 1XMOF 2NYIA 1FK9A 1IJFB 3BN7A 4ZPVR 2J9DA 2EI5A 4WXOA 4NLTA 5KFHA 3MM6A 2RRNA 1R8BA 1TL4A 4X64F 4DV4F 1X5SA 4J9PA 2AX1A 2X1AA 1DLOB 3MM8B 2DISA 4ZCIA 2OSRA 3NWGA 3T5HA 3NLCA 1NKEA 1S9GB 1K1SA 1HW8A 3KLIA 2Q43A 1PC5A 4OI4A 2MGZB 4B9UA 1JJ2R 3GB0A 2CFXA 2KI2A 4DL6A 1U1NA 2EFQA 5KT6A 5F8GA 4NL5A 2WOMA 4FF2A 1JLAB 3HHKA 4A47A 4EO6A 3NL0A 1D3WA 2QA1A 4JOUA 1YJ9S 5THWA 3OVAA 3GG0A 1KOHA 3TW0A 2DTJA 1WELA 2R2SA 1XTZA 4IG0A 4C7QA 2MQNA 4L6V3 4TXSA 2PMZD 3Q23A 1RGVA 3IWLA 3ITHA 5CYMA 1U48A 4ATNA 4Q8FA 4A48A 3PHEA 2B7CB 4WXWA 4WKYA 3CD7A 3GZ7A 1C2PA 2ZH1A 2IC3B 1S6OA 1ZM3A 2JX2A 1E6YB 2MPUA 3M8QA 1JLBA 4C9DA 4O0IA 1B0PA 4F3MA 3HHDA 3MD1A 4EFAC 3JTPA 2ZDOA 4MK8A 4JI8F 3KHRA 3DXBA 4MIAA 1HARA 1WHWA 1R6YA 4KJIA 2DT9A 2LQJA 3LW5C 2AQ4A 2HS0A 3NNCA 4HHJA 2GMJA 1YQHA 4Q7AA 1RT1A 4USJC 1ZAXA 5DM7Q 3D1HA 2R2RA 1EP4B 3SFUA 4WU2A 4C0HA 2O01C 1S0VA 1T03A 4MMOA 2JFKA 3THVA 5KFNA 1JIHA 3CIMA 2LXIA 2YWEA 2ZHAA 2YWKA 4TY8A 3DU6A 3FZBA 4KSEB 1SL0A 2VPWB 4TU9A 1RTIB 4J9RA 1S77D 2UXDF 2QA2A 1NU4A 3OLAA 4ECRA 3SXLA 3IS9A 1UJ5A 2PO4A 5A6WA 2HGMA 2Q6BA 4ECZA 3I4HX 1XEZA 1UA1A 1P9QC 1UETA 3G8SA 2VFUA 3GWCA 4A8OA 2DB1A 1XK8A 4YR3A 4QIWD 2K1RB 1X4EA 3MHYA 4Y2KA 4HI1A 5HN0A 2CPDA 5L39A 1PSDA 2Q1LA 4TN2A 1HNWF 3M2UB 2I1RA 1U2FA 3M1VA 3NGDA 5HO4A 1P27B 4UY8T 4C3KA 1HW9A 2VG6A 2RVJA 2YNGB 5KT3A 1UEUA 2V0NA 5E2QA 2UUWA 2RU3A 1M5KC 3NS5A 4DQIA 2UU9F 4PWDA 4HT7A 4ZPWR 1F2GA 3O1LA 4P6QA 5J2QA 2YTCA 1QVGR 3LAKA 1XNQF 1X7VA 4X4TA 3MM9B 3QO9B 2HWIA 2DR8A 4RZRA 1VHFA 3Q0AA 5L1JA 1WACA 2QRRA 3ZZPA 5F8HA 4KAIA 3UCZP 4OZ0A 1DBDA 1C0UB 4TLRA 5HLFB 3NGKA 3TI0A 3L7PA 4ID5A 4GO5X 4C8NA 1NKBA 1C1BB 1SJ3P