4LSNB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj518), a non-nucleoside inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
428
structure length
416
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 101
structure length 416
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lsnB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB03
1OS5A 3OHAA 3TAMB 4FS2A 2XI3A 3PJXA 5J2QB 3V6DB 2F8EX 4G3IA 4M95A 3JSMA 2C22A 1DLOA 1S0NA 5KT4A 1MMLA 4LSNB 4YR2A 1TL3A 4K4YA 4DL5A 3OSPA 3KMQA 2OPSA 5KT2A 1RTDB 1TV6B 4NRTA 4DL4A 4NLWA 2R8IA 4ECRA 4JV2A 4IG3B 2UVWA 3BQ1A 3T1AA 1RT3A 3DRPB 2W7PA 4NLDA 3MECA 1S49A 1S4FA 3FFIB 4MK7A 4RNMA 2R2UA 4J9RA 4Q44A 5J2MA 4NZ0A 5L1KA 2IMWP 2BANA 2ATLA 2J6TA 4IFVA 2BQUA 2UVVA 3CDWA 3IGVA 1DLOB 2YNIB 4KKOA 3I0SA 5EWFA 4MKBA 3MR3A 2OPSB 3DMJA 2I1RA 5KG0A 5F8GA 3ISND 3CDEA 5KFMA 1C1CB 4F50A 4ECVA 5DG7A 2W9CB 4FBUA 4G1QB 1S1UA 2JLEA 4IQXA 2HNDB 3RBEA 3DYAB 1S1TA 3MECB 2VG5A 1MU2A 4KHRA 1TKXA 2FVSA 2C2RA 3SFGA 3T5JA 3DLGA 3DLKA 4ED0A 3Q8QB 1JIHA 3N6LA 3KLIA 1XR7A 1HPZA 3Q8PB 3CWJA 4KV8A 5EDWA 2VG6A 1IKYA 4KFBA 3FSIA 2AGPA 5F8HA 3GQCA 4ECTA 5KT7A 5HROA 4RUCA 4KB7A 3GV8B 5DGAA 2J6UA 2D3ZA 3EZUA 3RB3A 1S1TB 5DGBA 3BQ2A 2HNZA 5J2NA 4NLQA 4K4VA 3T19A 3H4DA 1TKTA 1RT6B 3DDKA 4XPCA 3OL6A 1S6PB 3CDUA 5KFTA 4M94A 1JLEB 3KLGA 1S9FA 2QV6A 3LP1A 4H4OA 1TP7A 2YKNA 4H54A 3BGRA 4O3RA 3QGGA 2I5JB 1LWCB 3I5CA 3CIZA 3UQSA 5KFZA 4GC7A 3DRSB 2WCXA 2WHOA 1S0OA 4RW7B 2OPPA 1HNVA 1RT5A 5F8IA 4H4MA 4ZVHA 3Q8SB 3OLBA 1N4LA 3KK3B 4R5PA 4ZMMA 3MFHA 3TQ1A 4EYHB 3ISNC 1K1SA 2R2RA 1TKZA 2AX1A 3QLHB 2AWZA 4NLSA 1HMVA 2RF2B 1JLQA 1QAIA 4ZVGA 3KLGB 5DG8A 2XGPA 4ECZA 1RYRA 2R8GA 5CYMB 3DOKA 5KFRA 1REVB 3KJVA 2AGOA 1RT2A 5HBMA 1DTQA 2B6AB 1BQMB 3QIPB 4IDKB 3PJWA 4KHMA 3D28A 4RZRA 3KHHA 1XR6A 1BQNA 2UUWA 2IM0A 1RT5B 2HMIA 4DL3A 1JLCA 2WOMB 5KFGA 5KG3A 2YNGB 3M9MB 5F9LA 2ZD1B 3M8PA 5C24A 4WYWA 4NCGB 1IKVB 4YMEA 3DLEB 1QE1A 4TQSA 1N48A 1LWFB 1TKZB 1RA7A 1U09A 1HMVB 3KK1A 4IKAA 2IBKA 2OPQA 4K4WA 4TY9A 5KFAA 2HNYB 4NLGA 2YNFA 2VG7B 4YQWA 2ASJA 4RW8A 5HLFA 4ED1A 3RAXA 4TXSA 4J9SA 5KFSA 1JLFB 4ZPBA 1RTIA 4RW9B 4ZHRB 5HP1B 1C1BA 2HMIB 4R0EA 3LP0B 5L9XA 1JLCB 5KFNA 4U6PA 4ECWA 3TAMA 1FKPB 1S0MA 5J2QA 5KFYA 3V6DA 3KOAA 5J2PA 3PR4A 3KLHB 4IFYB 1VRUB 5JUMA 3PW7A 2AGQA 3V4IB 3KMSA 4EO6A 1JKHA 2GC8A 3NBPA 4LSNA 1QAJA 1DTTB 1RTDA 1TV6A 2YNFB 1XR5A 4RW8B 4NRUA 1IM4A 4DL6A 4IG3A 5F8MA 2HWHA 3DRPA 3T5HA 1RTIB 1N5YB 3FFIA 4IH6A 1HYSB 4PWDB 3KLEB 4O4GB 4MIBA 5KFWA 2JEFA 3LP2A 5I42B 3I5BA 4WXOA 5J2PB 3FQLA 3PHEA 4MK8A 5DQIA 5KFQA 2FJWA 5KG4A 3N6MA 4URSA 2ASLA 3NAHA 5L1IA 2YNIA 1JLBB 1JKHB 3LAMA 4B3OB 3NBPB 1WNEA 2BR0A 4NLVA 4MFBB 1C1CA 5JXSA 4R8UB 4ED8A 2W9CA 5KG2A 4IOBA 4Q8FA 4G1QA 4U7CA 4F4WA 2HNDA 2VA3A 4PUOB 3DYAA 1GX5A 1KHWA 2ZKUA 4IRKA 3G6XA 1W25A 5F8JA 1SUQB 1S1VB 4HKQA 3LP2B 5KFEA 3MR6A 4QWDA 4FS1A 2OPRB 4IR9A 1HARA 3C6UB 1RA6A 4LQ9A 2XWYA 1FKOB 3FRZA 1TVRB 4DEZA 3DRRB 3LAKA 2ZE2B 1YVFA 1S97A 4NLXA 5F8NA 4WE1B 1SH3A 4IH7A 1SH2A 4Q45A 4NLPA 4JV0A 4QWCA 5F9NA 4ID5B 4RNNA 2RKIB 4ZVEA 2YNHA 4MKAA 5DLGA 3IS9A 4WXWA 3FQKA 2XI2A 4KO0B 5J1EB 4ECSA 3RB4A 1RT6A 3GYNA 2UVRA 1S6PA 1S48A 1JLEA 4ZP9A 4IRDA 3RAQA 5L1LA 4ZPAA 2OH2A 1S1XA 3TVKA 3IN5A 2I5JA 1LWCA 4I2QB 2IC3B 4QW8A 4EYIB 3DRSA 5F8LA 4LSLA 2XCAA 3ICLA 4RW7A 3H2LA 3OLAA 4WZMA 2ALZA 2FLPA 5C25B 3CO9A 5KFBA 4O44A 3JYTB 1T03B 3H5UA 2YNHB 2V0NA 1TQLA 3KK3A 4RNHA 1RTHB 1GX6A 3IS9B 2HWIA 5KFFA 4ECYA 4K4UA 4ECQA 1SV5B 2RDIA 2R2TA 1R0AB 3QLHA 4YR3A 2RF2A 5KFOA 1S1WA 4DL2A 5CYMA 1S1XB 2BE2A 3BREA 3CJ2A 1REVA 3UR0A 2C2EA 3QGHA 3G6VA 3LANA 2B6AA 3QIPA 1BQMA 4IDKA 1ZTTA 2FJVA 3IG1B 4WFZA 2VA2A 4LSLB 4J9OA 3GILA 5KG1A 1RYSA 3ITHA 4O44B 4QPXA 1FK9B 2WOMA 4ICLA 1D1UA 2YNGA 4MK9A 5EWGA 1Z4UA 1EP4A 2ZD1A 3GIJA 4MIAA 4NCGA 1IKVA 3BSAA 3DLEA 4RW4B 3H40A 3OL7A 1T05B 1LWFA 1S1WB 3QO9B 4I2PB 4ECXA 4KSEB 3CJ4A 2BE2B 2HNYA 3MEDA 3DOLB 4J9KA 2VG7A 3V81B 4JV1A 2FVQA 1UWBB 4QW9A 1JLFA 4ED3A 5KFCA 4RW9A 5HP1A 4ZHRA 3KHGA 1RTJB 3ITHB 3LP0A 2HAIA 4ICLB 1EETB 5C42B 2FVCA 3RBDA 1TL1B 1LWEB 1EP4B 1FKPA 2QE5A 4F4XA 4K4SA 3KLHA 5CYQB 4IFYA 1VRUA 3HVTB 2IA6A 3HVWA 3V4IA 3NAIA 3PW0A 4RU9A 4ECUA 5KFKA 1VRTB 1DTTA 3MEDB 3C6TB 2WONB 4RNOA 4WFXA 4RW6B 5FDLB 5T14A 2XCPA 1HNIB 2XC9A 2B5JB 4ED6A 3E51A 1N5YA 4GC6A 3QZ7A 1JXLA 2IJFA 3NL0A 1HYSA 4PWDA 3KLEA 3FDSA 4O4GA 5I42A 1JLGB 4DG1A 1LW2B 3H5SA 5KG7A 2ILZA 5K14A 2JEJA 5KFUA 1JLBA 3UDLA 4B3OA 1JLAB 1IKXB 2W9AA 3KHLA 3E01A 4MFBA 3MEGB 4R8UA 4IR1A 1ZETA 1C2PA 3GV7B 2W8KA 2W7OA 4PUOA 4URQU 2JC1A 5I3UB 3G6YA 4TYAA 1SUQA 5KT5A 1S1VA 3RB6A 4EEYA 3H59A 3H5YA 1CSJA 3KK2B 4DG1B 2J6SA 2OPRA 2FVPA 3BQ0A 4Y3CA 4URGA 3C6UA 1RT4A 5K14B 1FKOA 3BR9A 1TVRA 3DRRA 5EUHA 2ZE2A 5DG9A 3BSOA 4IG0B 3T5LA 3E01B 4WE1A 3I0RB 3DI6B 3MEEB 4NLUA 2EC0A 1S9EA 1HQUB 4I7FB 2IJNA 1C0TB 3V6KA 3OHBA 3EPGA 4ID5A 3HKWA 2RKIA 4PQUB 1N56A 2IAJB 3DM2B 4J9PA 3GIMA 3SI8A 2W9BB 4Q8EA 3IRXB 4KO0A 5J1EA 1RT7B 2IM3A 1KLMB 2C2DA 2B43A 4LQ3A 4Q0BB 1RT4B 1S9GB 3CJ5A 1LW0B 4JUZA 3NGDA 2AQ4A 1D0EA 2R8KA 4NLYA 2GIQA 4O3OA 3VQSA 2YKMB 4I2QA 2IC3A 1S9EB 2IM1A 4ZP6A 3KLVA 3M8QB 2E9ZA 1J5OA 3SFUA 5C25A 3PZPA 4WFYA 1S6QB 3JYTA 1T03A 4K4ZA 3PVXA 1RTHA 3MFIA 1SV5A 4RNFA 3GIIA 5D3GB 1RAJA 4O3QA 1RT1B 4MH8A 1R0AA 3I5AA 1NNDA 4DL7A 3OL9A 4KE5A 2O5DA 3JSMB 4OL8A 5KFJA 3QIDA 5KFVA 3KLFA 2D3UA 2BRKA 4ED2A 1S10A 3IG1A 1TL3B 3QGIA 4F4YA 1J5OB 4EBEA 1FK9A 1KHVA 1IKWA 1RT3B 4TQRA 2XGQA 5KFIA 4NYZA 4WZQA 4RW4A 4XO0A 2FJXA 3CJ3A 1T05A 3MR5A 4EBCA 1K1QA 2JEIA 4O3NA 5J2MB 3HVAA 4O4RA 4ZP7A 3PW2A 4I2PA 2BANB 3QO9A 3UPFA 2E9RX 5KFXA 4IFVB 4K4XA 4K50A 3EPIA 4YP3A 3DOLA 1JX4A 2WB4A 3V81A 3KLFB 2BQ3A 4KKOB 3I0SB 3M9OB 1UWBA 3DMJB 2ILYA 2R8JA 3G86A 3H98A 2R8HA 1RTJA 1EETA 5C42A 1HQEA 1S1UB 1LWEA 1IKWB 1TL1A 4X2BA 4NLRA 3OSNA 2VG5B 4ZPDA 4IH5A 3BJYA 4K4TA 3PW4A 1MU2B 5CYQA 1TKXB 3HVTA 5DLFA 5KFDA 3DLGB 3DLKB 2AX0A 5KG5A 4EBDA 4RUAA 3KLIB 1VRTA 4ZP8A 4XPEA 1HPZB 3C6TA 2WONA 2UVUA 3H5XA 4KV8B 4RW6A 5FDLA 3CVKA 5KFLA 4Y2AA 1HNIA 2VG6B 1IKYB 4YR0A 2WTFA 2B5JA 2JC0A 4KFBB 4KAIA 2FLLA 2D41A 2CJQA 4KBIA 5C5JA 5HROB 3H4BA 4QWEA 2W8LA 1HQEB 4TY8A 3MR2A 2V9WA 4TLRA 1JLGA 5KG6A 1LW2A 2HNZB 2ASDA 5J2NB 4QWBA 1TKTB 2BQRA 2E9TA 1JLAA 1IKXA 3QZ8A 3MEGA 3LP1B 4H4OB 2YKNB 2R2SA 3BGRB 2D7SA 3V6HA 1RDRA 3BSNA 4ZPCA 4J9NA 3RB0A 5I3UA 3NMAA 2OPPB 3BSCA 1HNVB 3V6JA 4TY8B 2V4RA 5KFPA 4H4MB 3NKYA 4IRCA 4NLTA 3KK2A 4Q43A 4QWAA 4R5PB 1T94A 2BRLA 3HHKA 3MTKA 4TN2A 4J9LA 3CJ0A 4WYLA 1QUVA 4IG0A 1JLQB 1NHUA 1NHVA 2IM2A 3I0RA 3DI6A 3MEEA 4NLOA 4TYBA 3M9NB 4J9MA 1HQUA 3DOKB 4I7FA 3D5MA 1C0TA 2WK4A 2AU0A 5KT3A 1ZTWA 3KJVB 3QYYA 1RT2B 5HBMB 4ZVFA 3Q8RB 1DTQB 4PQUA 3LALA 2FLNA 2IAJA 3OL8A 2DPJA 1N6QA 3DM2A 4FBTA 3IGNA 1BQNB 2W9BA 1C0UA 3IRXA 4HYKA 4O3PA 4O3SA 5DQHA 1RT7A 3KNAA 1KLMA 3GV5B 5EWEA 3M8PB 5C24B 2CKWA 3N6NA 4Y34A 3PW5A 4F4ZA 2FVRA 4Q0BA 1QE1B 1S9GA 1LW0A 2UUTA 3PR5B 3KHRA 3GIKA 3KK1B 2OPQB 2YKMA 2C28A 2RDJA 4J9QA 3MF5A 3M8QA 1SH0A 5DQGA 2V4QA 5KFHA 4ED7A 5HLFB 4Y2CA 1S6QA 3T5KA 2GIRA 1N6QB 4EO8A 2JEGA 1I6JA 2DPIA 1C0UB 1C1BB 5KT6A 2WRMA 5D3GA 5L1JA 1T3NA 1RT1A
chains in the Genus database with same CATH superfamily
4DQIA 4JI3F 3W62A 4DL4A 1HNWF 1O51A 1VC6A 2X7IA 2EKNA 2UVWA 3L95X 2EEYA 4Q44A 3P8BB 2QFIA 2HQ3A 1PYSB 2I8EA 3AQPA 2V2ZA 3GIRA 1VK8A 5KG0A 1WJ9A 8RUCA 1RAFB 2NREA 1FWLA 3HZGA 2HFUA 3Q8PB 4DFKA 2L3MA 3P4UB 1OYDA 2QT7A 3JTNA 2BA9A 3GV8B 2CZ9A 2LEPA 3AODA 5DGBA 3BH6B 5KFTA 5A0YA 4FKXA 4UT4A 4USIA 5AXLA 1X5TA 3MFHA 3VWSA 1WHYA 3VAFA 1X60A 3VVTA 4M5DB 3ET6B 4NXMF 1VHIA 4C0HA 1VBKA 3BPDA 5T41A 2CPZA 1TFWA 1H38A 2MSSA 3RW6A 4FYDA 1ZYQA 1DRZA 2MGZB 1T9WA 5HMWA 5CH7B 4LIWA 2BZ2A 1RTIA 3O44A 1M5SA 3ETOA 3TAMA 4Z37A 4OX7A 2WVEA 3ADAC 1S7IA 2GC8A 4CWBA 1RTDA 4IG3A 1M90T 1XMOJ 3T5HA 2HLTA 3FCWA 3N79A 2XZWA 2MQNA 1QD1A 3HVRA 3MPVA 1Y0HA 3PX0A 1BXNA 3CIMA 2XTJP 3EGNA 4W98A 3KG4A 2FDNA 5J1NA 2VL1A 5F8JA 3OFFA 4LF2A 2OPRB 4LQ9A 3FRZA 4C0OC 4DX8H 5LSRA 4RNNA 2WVCA 2NXCA 4WXWA 1MROB 1S48A 1KTVA 2ZC4A 2RNEA 4ZPAA 3MPUB 3TVZA 1LWCA 1T95A 2G9OA 1KWMA 4HVZA 3IS9B 4U7UK 4B9UA 1S1WA 1GXTA 3NCRA 4DUTA 8AT1B 2J9DE 2YNGA 4DSFA 1RWXB 1OQ3A 3VGVA 3DLEA 2CQPA 3T41A 4FF4A 1T05B 4QIEA 4Y2IA 4HI2A 2YKAA 3RRKA 2QGFB 4RW9A 4ZHRA 1OJ4A 3RBDA 2QE5A 5CYQB 3KG0A 4HT5A 1VRTB 5IM0A 3MEDB 2RD5C 3TANA 1DAXA 3BPSP 4WFXA 5FDLB 4YY3F 3CC4S 4O4GA 2GX8A 4OIXA 3PKYA 3R5CA 4CLYA 5CABA 1YGYA 2XLKA 4MFBA 2W4CA 2IIHA 2W8KA 5A8RB 2JC1A 3EVWA 3Q0AA 4DR1F 2M7SA 2Y1JA 5K14B 1RP5A 4LFAJ 4B9MA 3I32A 3WIUA 3IBWA 4CO5A 2IJNA 3VGUA 3OHBA 2M8HA 2OJ3A 3Q8UA 2W9BB 1WI8A 3CJSA 2UUBF 2M2BA 4O3OA 2IC3A 2Z30B 4ZP6A 3U1LA 1R27B 5C25A 3QT7A 4LVOP 3S6EA 2DNOA 4CH1A 1QAXA 3MFIA 3J80Y 1NNDA 3DXSX 4NASA 3W8PA 1QJHA 1WKLA 1F3VA 4EBEA 2K3IA 2PD1A 2IRYA 5B7WA 2BM1A 4JI8J 4OYBA 4ZLNA 3CCJS 4WZQA 3FSYA 1QSSA 2E9RX 4WU2A 2CDRB 3RGIA 5M2PA 5KOWA 1EETA 1HBOA 3VF0B 4K4TA 4M5GA 1NKBA 5D77A 1SIWB 3DRYA 1UTAA 1Y00A 4RR5A 3A8KA 1REGX 4DCOB 4K0KJ 4G65A 3IRWP 4TY8A 1FX2A 5MAOA 3UFCX 1YJVA 2MQPA 5HQLA 1A9NB 3UO0A 1ACMB 4H4OB 2HBZB 1NSAA 4B9NA 5KTQA 4KH1B 3HHLD 4Y6IA 2BRLA 1BQXA 4I68A 3DI6A 3QT8A 1RT2B 4UY85 2LKZA 3OTCA 3MM5B 1IWGA 1V3ZA 1U48A 1S9GA 1F2HA 2ZNZA 5E3PA 2YKMA 3LGHA 3MF5A 1EKSA 2HEKA 3N28A 4OHXA 3MGJA 1N6QB 1CJVA 2V4JA 2VBZA 2AYMA 3OSPA 2ACMA 1RT1A 3SCJE 3M4XA 8ATCB 2VPZB 1D09B 1UA0A 4N8OA 4ECRA 1S4FA 3FFIB 2I38A 3ZZYA 1U25A 2ATLA 3ILIA 2I1RA 2ZDOA 3UDEA 4FBUA 1RWPB 5E5NA 3M2UA 3JTPA 2GQ2A 4ZLPA 3M2RB 1FRJA 3Q8QB 1HPZA 4LSZB 3HSDA 1X0PA 4U8VA 2AGPA 3PHTA 3MCOA 3AA9A 1ZZFA 3Q24A 2XHWA 4RBTA 2IRXA 4M94A 1JLEB 2QV6A 4DPXA 1TP7A 3QGGA 2I5JB 7AT1B 4C6AA 4R5PA 3I4PA 3QWPA 3TJ8A 3HMJG 2E1CA 2F7VA 1UKUA 2OEJA 1CULA 5THWA 4FPRA 4DX7A 1FXDA 2YY3A 3SSRA 4NLGA 3IM9A 3OFGA 5DJBA 2B4VA 4K5SA 1PIEA 3WIVA 3DNCA 4EO6A 2XULA 1LFPA 4N56A 2JWNA 4LBHA 2EVZA 4P10A 2J76E 4DQPA 1ZPVA 1S6OA 2M52A 2FJWA 2CADA 4B3OB 2F9DA 2UUAJ 3I82A 4DV7J 2W7AA 5AJ3F 2VA3A 3MEKA 4A8KA 3C6UB 3W5XA 5CCMA 1NJYA 1NSQA 3LAKA 2JH3A 2XMAA 4RLEA 2GHVC 2FTRA 1NCLA 3UCUP 4TLQA 2XS2A 3F41A 4DUZJ 3OD2A 2WBRA 4RBVA 4J7CA 4EYIB 3ICLA 1T03B 3KTQA 1X4EA 2R4FA 1VK3A 4M5DA 2D69A 3ET6A 3CJ2A 3RR7A 3QGHA 1HWIA 2JDJA 4X4OA 1K73T 4O44B 4AFFA 1VFJA 1ICEB 2O1PA 2MGZA 3HLUA 3W64A 2KDOA 1LOUA 3P49B 2X3DA 2DGVA 4JV1A 2NPIA 3JSYA 3MD3A 5KFCA 3OW2R 1MN7A 2H65B 1NK9A 1H73A 2H3EB 3HVTB 1WHWA 4DQRA 4RW6B 4OHVA 3FNNA 5I4MA 4ED6A 4RBUA 2OAUA 5L39A 4PG7A 3FDSA 2ILZA 1ZH5A 4ZJQA 3NS6A 1N33F 2C42A 5LL6d 4DR5J 2HHXA 4AXJA 1WC1A 1TFYA 2MSTA 1CSJA 2OPRA 2JLFA 3E01B 3I0RB 5A8WA 1M1HA 4ZCLA 4B3TF 2BX6A 5CA5A 2IM3A 2KJVA 1MROA 2GO9A 3JAMY 2ROPA 3RRGA 2AQ4A 1LW0B 3NGDA 1HLWA 4KPCA 1FVSA 3GONA 1D3WA 2HFVA 4X4NA 4AQYF 1WHXA 1FO1A 5CD4A 2HS0A 2R42A 3DXBA 4C3MA 3K5NA 3SV3A 1IKWA 2FJXA 1T05A 1VQ9S 2DXDA 5J2MB 2WB1D 5ADZA 2BJ9A 3I0SB 4X64J 4P72A 3CSKA 4NLRA 1H72C 3TA2A 5CYQA 2LQ9A 3PM9A 1VRTA 5FDLA 4QOTA 5F41A 4KFBB 1YIJS 2JSXA 2GJ2A 2QMUB 1QM9A 2NR0A 3FEYB 4RWWA 1YRUA 2ASDA 1WC5A 2NXUA 5F0WA 2R9LA 3MDFA 4C8KA 5A8RA 3V6JA 1VIOA 2IVYA 4NLTA 4Q43A 3A8IA 1RU2A 3MTKA 4ID8A 1JLQB 2CNOB 3FGVA 2AU0A 4F02A 1IJEB 1MWQA 3Q8RB 1Q7YT 4FBTA 2W9BA 3DDNA 1FRXA 1C0UA 2YQ3A 2R7OA 4G1IA 3H7HB 5EWEA 3TWZA 2EFVA 4GKKF 2Z8QA 2MKIA 1U0SA 2RH3A 3FZ2A 1FRIA 3PJXA 4OYAA 3ZFVA 2KU7A 4QIWD 3BB5A 1BLUA 1IBLJ 1Q5VA 1QLNA 1ZPWX 1LEOA 4NLDA 1VI7A 1IM6A 2Z4PA 2BQUA 3T9ZA 5EWFA 3R5DA 3DLHA 3CDEA 2E5JA 2FGCA 2PMWA 3C15B 3EGVA 1QSYA 5BYRA 5EDWA 1S77D 1NXIA 2AMCB 1YBUA 4ZDNA 3MOZA 1S1TB 3CD6S 3H4DA 3CDUA 2AF6A 1XTZA 4CO0A 4H4OA 2IYGA 3POTB 2ZHBA 2A6MA 2DNYA 2Z2MA 4DUYJ 3Q83A 2FIUA 4A4JA 4KH0B 2DB1A 2P2CB 1RT2A 2MLYA 3PJWA 3MM5A 1VC5A 1TK5A 2VHGA 4WYWA 4YMEA 4Z7YA 3TA1A 2CG4A 3Q22A 2ASJA 4RW8A 5HP1B 2MYFA 2XS5A 4U7UD 4HDHA 4P75A 3HO1A 1CJUB 3DU5A 5HAOA 4LMZA 2HWHA 4ZVQB 2OD6A 3FFIA 2FZCB 4IH6A 1J27A 2K1RB 3FQLA 3MUTP 1YJ7A 5L1IA 2OGUA 3LW5C 3DLJA 5JXSA 1XMBA 1ZOTA 2FUG9 2W2PP 3G82B 1S1VB 3M2RA 4RU2A 3DHWC 4USMA 2B51A 4AL6A 2MJNA 2QSFA 5L38A 4IO1A 2Z58B 2V2KA 3PJ9A 4ZVEA 2EI5A 4M63A 4A47A 2XI2A 1JLEA 1QVFR 1UFKA 3T9NA 2I5JA 4I2QB 2LQBA 5CZVA 2C3MA 1XEZA 1ZAVA 4RNHA 1DFDA 1WUUA 3GU0A 1HI0P 1CQMA 5IT9Y 2QMXA 5K8MA 4DV1J 3MPDA 1TK0A 1FK9B 1X5PA 4MK9A 2RJZA 4Y00A 4P73A 1O5JA 4F4KA 1D9AA 4ED3A 3JTOA 1EP4B 3F56A 2B3TB 4RL1A 5CD4H 1C4CA 2ZM6J 1TUVA 2VBXA 2QN6B 4OI3A 4PZVA 2J0WA 2VJUA 4X66F 3NGKA 5IQ6A 1RWVB 4BWMA 4A8QA 5KG7A 1YJNS 1UPMB 2Q79A 4B3OA 1E6YB 1LK5A 3RB6A 1XMOF 4Y3CA 3C6UA 4JB8B 2MXYA 4IG0B 1OPZA 4FVMA 2VOPA 3MM8B 1FRLA 1RT7B 2HSEB 1D8ZA 3CJ5A 2V9KA 3B4DA 2VONA 1VIXA 1S9EB 2E9ZA 2W2OP 3C19A 1RK8A 1T03A 2Q43A 2VJVA 2DISA 2ZDPA 4CO2A 3VV2B 3QIDA 1NU4A 4UQTA 1J5OB 2XY5A 1KRPA 2XO6A 2KM8C 4UW2A 4K4XA 2YKOA 3UDCA 4TNOA 3HVTA 3K89A 2D3OR 2AZ3A 9RUBA 4R0JA 2NUHA 2FY8A 2KJWA 4RW6A 5E3AA 1XWLA 2VG6B 3NEKA 4WP3A 4QWEA 1HQEB 1NK0A 2WVBA 2V5HG 5J2NB 2CPJA 2B4OA 5B0FA 3LP1B 1TK8A 1PAUB 5DDRC 3RB0A 2LXIA 1NB2A 3RTVA 3A3PB 5DZ6A 3RRHA 4HHJA 1KOOA 3PRBA 3I0RA 5H9EK 3DOKB 3KJVB 2CQIA 5B09A 5IT4A 3QRPA 3VAIA 4GKJJ 1D9DA 3QAUA 4JI2F 2ZH3A 1LW0A 2RDJA 2F4VF 2VPWB 4Y2CA 4LFAF 2GIRA 1DY3A 1NEEA 3KUEA 1C1BB 1S0VA 4K8RA 4FS2A 4ALZA 2JJ4D 4KGMA 2LDYA 2VD3A 1K0VA 1MMLA 4LSNB 2OPSA 2IJRA 4DU7A 1U1KA 4NLWA 4NZ7A 1YBTA 5J2MA 1B0PA 2UVVA 4OZJA 1DLOB 3I0SA 4GMKA 4UOGA 5EN1A 4Q7AA 3RBEA 1NUEA 2C2RA 5IC4B 4RWXA 4JI8F 2AJFE 3BF4A 2DR8A 2ZEJA 4KFBA 1FJGJ 1SL1A 4A8SA 5GMEA 1Q86T 2HK3A 2Q6BA 2DO4A 5CQGA 2Y1LB 3K7RA 5DM7Q 3GFHA 4UY8T 2J0XA 4HTIA 1FEEA 4LFCF 4K0KF 5FLXY 2EBEA 4Z7CA 1U1LA 2KFZA 4J37A 1JLQA 1QAIA 5CYMB 2MQ8A 1SQFA 1VGYA 2AGOA 2B6AB 1IBCB 1N5VA 3D28A 3W1YC 2UZAA 3CDAA 4DL3A 1FDBA 2XNQA 5A2QU 2OD4A 2MKJA 1OPIA 2YNFA 4HHUA 5DRKA 1SKWA 4KC5A 1KONA 1H2TZ 3G6ES 2HHWA 4DL6A 1JXVA 1JNRB 4NX9A 4V19X 5CYJA 2VH7A 3LP2A 1BUXA 1WOPA 3W8GA 2ZOMA 3M6XA 2HHSA 2R7WA 2AT1B 2MKCA 2G0IA 3G71S 2DIVA 5IWAJ 1PO6A 1Q1KA 1Y7PA 2EC2A 4DSEA 5E7OB 1KLNA 4LF5J 1UJ4A 3BYPA 3K58A 5F3TA 3RB4A 3W66A 3L09A 1AFIA 4NMLA 1R8CA 5IFMA 3POTA 4KRWA 1OYEA 1N5TA 5KFBA 2HGLA 2YNHB 1TQLA 2FHJA 1GX6A 3LGNA 1EARA 2I9SA 3OTDA 2XLIA 3C3LA 2NUUG 3ITHA 4C2MA 2CRLA 1R89A 3BSAA 2EPIA 2YXLA 4B3RJ 4ZVRB 5LMNF 5E3QA 3L9ZA 5HJYA 3HXMA 4CNYA 1VYAA 3FBEA 1Y10A 4U96A 5HP1A 3THVA 1R6YA 4F4XA 3QT5A 4DR7J 5GMDA 2VQEJ 1CJUA 5T14A 2CVIA 3AD9C 2K1RA 1Q81T 1UP1A 3H5SA 4JI1J 1WC6A 4ANCA 4ZKAA 1FDAA 4UOHA 5E41A 2A3JA 3G82A 3I31A 4X62F 5I3UB 3G6YA 3UE2A 2MKYA 3GWCA 1S1VA 1U6ZA 3H5YA 3KK2B 4PXBA 2FD2A 4J91A 5K8NA 5EHHA 3MMBA 4I64A 4CO1A 1Y4ZB 3ZTRA 3HKWA 2IAJB 2CJBA 2JVRA 3GIMA 5HI7A 4Q8EA 3IRXB 2UUAF 4DV7F 4XDDA 4PXEA 4Q0BB 2D1CA 1D0EA 4NLYA 4LF8J 4DV0F 4I2QA 2W2NP 2E44A 3PVXA 2KXNB 3HD2A 4PCQA 3NLCA 4L74A 1RAJA 3PO4A 2O67A 2XYPB 3T6JA 2RHQB 4ED5A 2KHDA 1TL3B 3PRVA 1PYTA 4MTPA 1FK9A 2DEIA 2KYXA 2QMWA 3LWMA 3PYFA 2AHOB 1IR0A 1FRHA 4WTOB 1UETA 3RJMB 2J0SD 1XJWB 3PYGA 3EVOA 1ZZNA 3G86A 3W5YA 4OI2A 1UAWA 1YSJA 5K9FA 1X4GA 4DX6A 2KT3A 3CCZA 4DHVA 3AB2B 3IAS9 1N0VC 1UPPA 2HS4A 1E6YA 3BGFA 2XWXA 5IV3A 3EGZA 5L9NA 1MMDA 3NMAA 2CPYA 2FZGB 3WX8A 5LJ5Y 5ETOA 3QRQA 1ZA2B 1OSDA 4IG0A 1KVKA 1RHKB 2KM8B 5KT3A 5HBMB 3AY0A 4U8YA 2ZHOA 3MM8A 1NAQA 5DQHA 1RT7A 3BO4A 2Q1LA 2OSRA 4DR5F 1RAEB 3KHRA 3GIKA 2DVIA 2ZJRQ 3R5BA 4LFBF 3EDRB 1FEHA 2JEGA 3K59A 4Z2XA 1A6LA 2ZWPA 2JX2A 3K5MA 3HFZB 1TV6B 4I67A 1NH8A 2E5LF 2QLBB 2LQJA 1N8RT 5KFMA 1SI9A 3AA8A 4ZLLA 4RJVA 4GO5X 4D3HA 3M2VA 4ZCMA 2GMLA 2M70A 1JIHA 3N6LA 4AL7A 2OFGX 3TZYA 1VRQC 2VG6A 1J2VA 3TJ9A 3PIPQ 4A48A 1AT1B 1KQGB 2YVSA 1RQ0A 5J2NA 4X64F 4XPCA 3M8YA 2PC6A 1EIYB 7FDRA 3KLGA 3LP1A 1Z2LA 1PG5B 3PKMA 3I5CA 2N82B 5H9FK 3KKFA 3OVBA 3KUGA 4OI1A 3N4WA 1FI4A 4ECZA 3DOKA 4J90A 5K8OA 1TKDA 4LF7J 3KJVA 4RZRA 4JI4F 2A2CA 1RWMB 1RABB 5F9LA 4WBFA 2X1FA 2DO0A 1Y9OA 2VODA 2HQCA 2ZZNA 1VQSA 2GMHA 1C1BA 5DDQC 4LVNP 1S76D 4DV2J 4DFJA 4LSNA 4P6QA 1IM4A 1PAEX 5T7LB 3OTOJ 3NY0A 5J2PB 4B9TA 1JKHB 4F0KA 4CIOA 4R8UB 1IBLF 4IOBA 1HW8A 4HT7A 4JI3J 1F6TA 3D3BJ 4F0HA 3A13A 2N4CA 4FS1A 3TUPA 2WW8A 1HNWJ 2HFSA 4NLPA 4JV0A 4ID5B 5I3QA 2E5HA 4PR6A 3OQ2A 4L6V3 1NPPA 1S1XA 4A8OA 5KOXA 3J7AN 4AL5A 2XCAA 3JYTB 1WC4A 3H8YA 3DU6A 2MQMA 3D0GE 3C8YA 1FT8A 4DL2A 5CYMA 1NJWA 2B6AA 4WFZA 1N36J 3H42A 4J9OA 1YITS 4I69A 4MIAA 2UV8A 4RW4B 2RMLA 2Y0BB 1W7WA 1J5EJ 2BE2B 2YH0A 3WC2A 4QZVB 2IVMA 2HAIA 4NXMJ 2BJ8A 5E2QA 3GR0A 3HVWA 3PW0A 4GO7X 4ECUA 3MURP 1PC4A 2QYCA 4ILLA 2D74B 4OYOA 3BBFA 2CJAA 2YX1A 1DARA 2HG4A 2I0XA 1VBYA 4HI1A 2UXCJ 2APOA 2ZBIA 3G2XA 2B7CB 4NCBA 3MEGB 2EKYA 5LMUJ 1AROP 3GV7B 1X4AA 2G2OA 3JQMA 3NOCA 5CZXA 3PFEA 2QYGA 3E3XA 4DG1B 4WU3A 4AXIA 1KP6A 5M2RA 1MSWD 3CB4A 4CZCA 1XNQF 1T11A 4KPYA 2QA1A 4KGKA 1RT4B 2A10A 1VR6A 3V4MA 3BEGB 4FDFA 1IN0A 3RAMA 2QL5B 1RISA 4YDXA 4ZK7M 1M5HA 2YKQA 4MH8A 2ZH5A 3FC9A 2BXJA 3OL9A 1UL3A 2AP6A 1XIQA 4NI2B 4DV3F 3Q86A 1OMSA 2YWEA 4XO0A 3HSGA 2BANB 2YWFA 4OYXA 1LV5A 4B9SA 1URRA 3K0JA 2PE8A 4X2BA 4F0MA 4DV1F 4FXVA 1F1BB 5KFDA 3DLGB 2ERRA 3DCAA 2B4UA 1Q79A 3H5XA 3A4TA 1RWKB 3QZ8A 4CRJA 1RDRA 1ELOA 1UWAA 2ZM6F 2OMOA 5I3UA 3M6WA 3TRGA 3KK2A 2F3JA 2DNZA 3J81j 1VQ7S 4R0EA 3P96A 1AB8A 2IAJA 3HDSA 3F44A 3IRXA 4O3PA 2XY7A 1CC7A 1N5QA 4Q0BA 3JS9A 2RHSB 3KK1B 4DR1J 3BO2A 2H5JB 3FKBA 2B4PA 3ZTSA 4WTYA 2DPIA 3P5TL 1Q7LB 5L1JA 3OHAA 2XI3A 4YR2A 1TL3A 1JNZB 4NRTA 2W7PA 1HD0A 3ZTPA 4B08A 5ETKA 4WIQA 1R8HA 2ZBRA 1NDPA 2YNIB 1KQKA 3MR3A 3CEDA 5F8GA 4J9UE 2W9CB 4KGVB 2AJ2A 4G1QB 3O2IA 2YX7A 1SPBP 1H2UX 3SFGA 1A0OB 1FWPA 2BE9B 2RRAA 4C7QA 3UW1A 3VAHA 1ZAXA 3C14B 1I3OB 3BQ2A 4NLQA 2KVQE 4HL9A 3TR5A 5HN0A 5KFZA 1RT5A 4V19J 2DGXA 3MZIA 1WF1A 4WIIA 1S12A 4DV6J 5HBMA 4IDKB 1WKKA 1TKZB 2XMMA 4BCAA 4N77A 3MR7A 3MMAA 3AQOA 3J81U 2HMIB 3LP0B 1JLCB 1HWLA 4OZ5A 2DCUB 4GKJF 4L72B 4JYAJ 1DTTB 1TV6A 3PEJA 1VISA 2UXBF 1VCTA 4ZVOB 1WKJA 4PWDB 2JEFA 1H74A 1N32F 2QX0A 5KG4A 3UN3A 1FA0A 1WNEA 3NBPB 1R0CB 4NLVA 3SMZA 2HIYA 3VZHA 1KHWA 4C4WA 1NKEA 1LWXA 1EX8A 4NLXA 1YJ9S 1E6VB 4UF4A 5F9NA 3CCES 3RR8A 4W92B 3FQKA 2UVRA 2LQ8A 5H9EJ 4ZP9A 3DLLQ 4CLWA 4LSLA 1FX4A 3OLAA 3TVYA 2IDEA 1Q53A 1FJGF 3BREA 1WG5A 2DHXA 1SJ1A 1F2GA 1QDUB 4LF9F 2DY9A 2CQ0A 2RB7A 4ZN3A 3QO9B 2F8HA 1B99A 4D3GA 1X9WA 5C42B 4YUDA 5IXUA 1TL1B 2C3PA 5AXKA 2IA6A 2Q6CA 5FJ4A 3R9LA 4RNOA 1UW4A 1HNIB 5T7LA 3E51A 2DHAA 3QZ7A 3I9V9 3QT6A 2AYEA 3FCHA 2AYGA 4PG5A 4R8UA 1R43A 3CCTA 5BYSA 2YWGA 2RT3A 2OMLA 1FF2A 6FDRA 2VBWA 2CZ4A 2E1MC 3IAM9 4ES3A 5D4OA 4ANDA 2Y1IA 4ID5A 1N56A 3L3CA 3THTA 3IO1A 2C2MB 1PGZA 2YWWA 2R8KA 3LO3A 5IWAF 1L3KA 2G0JA 3JYTA 1WTFA 3SIPB 3GIIA 4H4KA 4O3QA 4LF5F 3NCQA 4KTQA 4KE5A 2QA2A 4EK2A 2MMYA 3MM9B 4DV4F 2JNJA 3DHXA 4TQRA 1NDKA 3BKFA 2DY1A 3BDEA 3RW7A 4RW4A 2JEIA 1H2VZ 3NS5A 1SJQA 3H98A 2KFYA 1L3VA 2HW3A 2LVWA 3M6UA 2KI2A 2VG5B 2KRRA 4IH5A 4FKYA 3N9UC 4EBDA 2AEMA 4FVCA 2BM0A 2FHOB 3BGOP 4GRSA 2DHSA 2D41A 3H4BA 2F1FA 1CBKA 1IBMJ 3HX9A 4LF6F 4CT9A 1R0BG 4DCJB 3MEGA 2R7RA 1HHTP 1EQMA 3BSNA 1IR2A 2LYVA 4J9NA 4DR7F 2VQEF 1JWWA 1N34J 2LEAA 1IJFB 1HNXF 1B0TA 1AW0A 1QUVA 2FJEB 3D5MA 4M5IA 3OL8A 3BN4A 1IR1A 2DTJA 4O3SA 2H1YA 2OTJS 5C24B 2MZTA 3CCLS 1R6VA 3NWGA 3IXQA 3WC0A 5FD1A 2OPQB 4KY3A 3ZTQA 4OZNA 1SIZA 1Q5YA 1I6JA 4ZVUB 3ETMA 2WRMA 4ZOSA 2XMUA 2DNLA 3MI7X 3MPWA 4B3TJ 2ALYB 4PQAA 2C22A 1N52B 2VBYA 1GMVA 4ERDA 4LF8F 5L1KA 3D6FB 2BANA 3PACA 2PT0A 1GMWD 3CDWA 4ZVPB 5DG7A 1TMMA 3HF5A 3KWMA 2HHHF 2ZJQQ 5G4DA 1FE4A 2HNDB 2BEFA 1FTRA 1NO8A 2YPYA 5E3CA 1VDHA 4KHRA 3VGTA 1UZDA 3DLGA 4QR0A 1XR7A 2B56A 1NK7A 1SKSA 3FSIA 1SC4B 4X84A 2XZDB 1NMEB 2D3ZA 4J5OA 3GG0A 3RB3A 3TNVA 4NA1A 1VQ6S 3BV8A 1VQNS 3W5ZA 1S0OA 4Y65A 2MZJA 4WF9Q 1FJEB 3SDEB 3QSIA 2AWZA 1FJCA 3GZ7A 1JJCB 2W01A 2XMWA 3RBXA 2XZTB 3HJVA 2HYIB 1RJJA 2GV1A 2OELA 5EX3A 5KFGA 1HNZJ 4AUKA 3W61A 2FJBB 5JVGQ 4DI6A 3KK1A 4A8WA 3QATA 5B0EA 4ED1A 5FIIA 1FKPB 4QPTA 3KLHB 4PXCA 1I51B 3V4IB 2F40A 3AT1B 4NZ6A 1OO0B 2ZFHA 1N5YB 4GKKJ 2EK6A 4CTAB 5KFWA 4WXOA 5L8RC 4YDDB 2MJUA 1U47A 3PX6A 2EW9A 2YNIA 2WVFA 4C8ZA 4OV1A 2W9CA 2V2VA 4G1QA 4LF1A 1GAOA 1NRKA 4KIAA 4M5MA 1YLXA 1N54B 3IWNC 2ZE2B 4LRDA 5F8NA 4K5RA 4F2RA 2V8HA 4M5HA 4FP9A 4I4BA 2G2ZA 3NNAA 1LXNA 1RU1A 5L1LA 1U4BA 1DURA 2R7SA 1S79A 2DR6A 3IM8A 4F25A 4WZMA 1RXOB 4TU9A 2C1EB 4X65J 5IOLA 1SV5B 7FD1A 5KFOA 3CCWA 4BWJA 4OHYA 4IDKA 2AZ1A 2QJ3A 3GILA 4RKUC 2ZOGA 1ZAWA 2K8GA 2KH9A 2W2QP 3DGPA 1S72S 3HSZA 4HTJA 3HHEA 2E7VA 4CH7A 3LP0A 2F5GA 4LF7F 3EJMA 1KR4A 4FF3A 1QTNB 1DTTA 1RACB 2V8PA 3US5A 2NSBA 1T7PA 4PWDA 4QQBA 4C98A 2RUGA 3UDLA 3KHLA 2CJKA 4DV2F 2L08A 1PJ6A 2B9XA 4CDIA 2L9NA 4URGA 1QY7A 1SKRA 4NLUA 1E6VA 2UUCF 5H9FJ 5AXNA 2LU1A 3EPGA 4V1Ak 3DM2B 3OV7A 1FD8A 3W65A 3GR1A 3G87A 3EX7B 1H6KX 3Q8YA 3RZAA 1KFDA 1AUDA 1TL7B 5RUBA 3GJSB 1XMQF 4ES1A 1OY9A 5J1PA 1RCXB 4OFZA 5HVHA 1NDCA 3OPKA 5KFIA 3GJTB 1K1QA 3HVAA 4ZP7A 3QO9A 3K5LA 4CLZA 5KFXA 2ZH7A 4C8YA 1JX4A 2Z57B 2WB4A 1NK6A 2ZKTA 1KEKA 5HL7Q 4MKVA 1TELA 2R8HA 4FYXB 5C42A 1TL1A 2CYYA 3SCIE 1N36F 2KXFA 1B4SA 1S4EA 4ZP8A 1PSDA 5KFLA 2WTFA 1HNIA 2JC0A 2CJQA 1J5EF 3MR2A 4DSKA 4USVA 3TJAA 1EKRA 4U67Q 1U0HB 4N7TA 3V6HA 2DH9A 4WP9A 1ITPA 3HHKA 1T9YA 4TU7A 4X66J 2UXCF 2DNKA 1VBZA 2WW4A 3L7PA 1RHUB 5LMUF 2J7KA 4CYUB 2OEMA 3M8PB 1QE1B 4ZITA 1VQLS 1VQYA 4A46A 3A1YG 4PEOA 2CQGA 1TL4A 5JVHQ 3NGUA 5HSPA 4B3MJ 3V6DB 1WOSA 4G3IA 3PNIA 3THPA 5LSLA 3PFOA 1PBAA 1OIAA 3MM9A 4ED4A 1NDLA 5B0DA 3NMRA 4NZ0A 2CPEA 3HD1A 3CO0P 4ZJOA 2KRBA 2XM3A 2CQDA 2HQIA 3C16B 4WJBA 4ECVA 1MMNA 5A8KA 3MECB 2VG5A 4RO0A 3PO5A 3CWJA 4OZ3A 3MAAB 4AE5A 5GAEI 4KB7A 2VC1A 3ILJA 2QO3A 1FDNA 2NYHA 3T19A 1FXLA 3AOCA 3DDKA 2DGSA 3QWUA 3CCMS 2ATCB 5HATA 4RW7B 3D6TB 4EMDA 4CT8A 4HH0A 3MTJA 3IP0A 1HMVA 2RSQA 4JI7J 2CJ9A 3K57A 4WFBQ 2Y8YA 4NCAA 1FE0A 1RAHB 5C24A 4NCGB 1IKVB 2X3GA 1EAYC 1N48A 1LWFB 3SQGB 3D67A 5ETVA 2IBKA 2OPQA 4TY9A 3RG6A 1ZM3A 3RAXA 2HRUA 5KFSA 2BW2A 2BUNA 5L9XA 1F0XA 2MZQA 2ZBCA 3ZZUA 2DRBA 2ZOFA 3EXCX 4IFYB 2AGQA 1KQFB 4C3LA 3CULA 2KG0A 4JI2J 2MPUA 1UJ5A 1HYSB 4JP8A 3LPYA 2F4VJ 2BJ7A 4IOAQ 2DNHA 3HFVA 3J7Z5 2ZC3A 5KG2A 5DDOC 1AFJA 2HNDA 1UVLA 2ZKUA 3K8VA 1NPKA 4AYBD 3VCDA 5H1SV 3D9BA 2RKIB 2BOPA 1OY6A 3JSBA 1XNRF 2C3OA 4KO0B 3WHIA 3IBCB 4CM0A 1U2CA 1SC3B 1D9FA 2HS3A 1NJZA 1QTMA 1GTEA 3SDEA 4MT1A 2R2TA 3LH2S 1LXJA 2DCLA 1YG0A 3R2DJ 2GHWA 5K20B 4PG6A 4XAKA 3JSRA 4ICLA 5HMXA 3BKTA 4IUFA 2V63A 4I2PB 3CJ4A 2DXFA 1URNA 1BD6A 4USHA 4LFCJ 2BACA 1UWBB 4YB5A 3KHGA 1RTJB 2FVCA 4N8NA 4DV6F 1FKPA 3KLHA 3NAIA 3V4IA 4NXNF 2FY1A 2H48B 3FBCA 2XCPA 1Y3KA 2FQQB 2B5JB 1N5YA 3GJQB 2IJFA 3NL0A 4YHHF 4CTAA 2M3DA 1HWJA 2BABA 3QQCD 3CD7A 4WKYA 4F67A 2F65A 4URQU 1PJ7A 4TVAB 5KT5A 4JYAF 2EFOA 5BYQA 2RIJA 3D68A 2KT5A 2ZE2A 4F2SA 2QLXA 2OI2A 1C0TB 1R31A 5HVGA 3L4BC 4ETZA 3SI8A 3H0PA 2DH7A 1X4CA 2MQQA 4KHPJ 4JUZA 2CQ1A 3GLJA 4Y28C 2IM1A 2KO1A 1UVNA 5CXTA 1MG7A 4LRAA 4OLPA 2ASYA 3WBZA 1SV5A 1FJ7A 2ZVIA 3EGWB 3ZNJ1 3KLFA 2BRKA 1S10A 3TUZC 1HI8A 3QGIA 2DYAA 4E8UA 2GIFA 4KKOB 3QBCA 3EE3A 2JVOA 2VU5A 1S1UB 3CCUS 4B17A 1TKXB 1FHTA 5DLFA 2AX0A 4CLPA 1XC9A 4NL5A 4CLTA 5LMNJ 4Q5VA 2HFZA 3KDOA 2VPXB 3DGVA 1AYEA 5E33A 1F9HA 2ZH2A 1SQEA 2D7SA 2PEBA 2YWKA 2DJWA 4H4MB 1L3SA 2CZVC 3CJ0A 2HZVA 3M1VB 3QYYA 4ZVFA 3DM2A 3MM6B 4HYKA 3OJUA 3GV5B 4X4TA 3OR2B 1DQ8A 3PR5B 2IRUA 5A6PA 2FZKB 4X62J 4EZ6A 1WEXA 2DXEA 1NK5A 3NRBA 2OTLS 1RAOA 4OMFG 2Y0SD 1G2EA 2LXUA 2N4DA 2R2UA 1EZZB 2ABYA 4X4UA 4DV0J 3P5BP 3VALA 3TEHB 4BBYA 2PMZD 3IGVA 4YB7A 4LR9A 4F50A 1C1CB 3QFHA 4O0NA 3B78A 3S7RA 1U6FA 2OO4A 4PYDA 2LEBA 5F8HA 2J6UA 1IVZA 1K8AT 1S6PB 4UUWA 1U0HA 3UQSA 5GAEU 2WCXA 2DKOB 3EDQB 4M5KA 1X5OA 4DR6J 1DZ5A 1RE1B 1H98A 1RLDA 4EYHB 3A8JA 1WG4A 2XSFA 3S1TA 5ETQA 1IBMF 2HAFA 2PFDA 2V8VA 4CYUA 3M8PA 1KC8T 1QE1A 4HDGA 1U1PA 2KTQA 1N34F 4IKAA 2N7CA 2GCFA 3LUYA 2GMJA 3SBMA 3SSSA 3R5AA 3V6DA 3PR4A 2MHEA 4OZ2A 5LXYA 1RWNB 2CQBA 3K2YA 2DGOA 2PGCA 1RTIB 4NA2A 3CW2C 3KLEB 2ZWOA 2CG8A 4K2JA 3PHEA 4LFBJ 3N6MA 4URSA 3C16A 2V68A 4RUHA 4U7CA 4IRKA 2QC3A 4FNIA 1JJ4A 2HK2A 5HQ8A 4QWDA 2N3LA 1T02A 4E0DA 3MAAA 3J80U 4QWCA 2RAQA 2E5LJ 1PKUA 3IS9A 4P2SA 3OBIA 1YJUA 1F5CA 5GAHI 4RW7A 4DS4A 3DN9A 1Q8BA 2FLPA 2VICA 4K4UA 1ZM4A 3MD1A 4YR3A 3VGSA 3UR0A 3R97A 2M4MA 2MHNA 1SJRA 1R3NA 2EXUA 4QPXA 1RYSA 2O3DA 1NHKL 4OJ3A 1Z4UA 3W2VB 4NCGA 1IKVA 1SC6A 4G1PA 1LWFA 3SQGA 1S1WB 3MEDA 2DHGA 2G1DA 1FTCA 2KFNA 3Q89A 2CWKA 1WD6A 2JL9A 3OJSA 4IFYA 2HQGA 5KFKA 1WORA 1HNZF 5LSOA 4JI4J 2QIFA 3T3FA 1B64A 4K2XA 5GADI 2VZ9A 4FYVB 2V8DA 2MLZA 1HYSA 2W2MP 3GSIA 1C4AA 3JQKA 5K14A 3ULHA 4YEAA 4DSLA 3DC2A 4CLSA 4X4PA 2ZHAA 2OUGA 4QCLA 2QL7B 4EEYA 1P27B 1RHRB 2HURA 5DG9A 3LA0A 3IC1A 1HQ2A 2RKIA 4ELUA 2R7XA 4J9PA 2CQCA 4KO0A 3SCKE 2VFRA 2ZZMA 3RBZA 1NK8A 4USWA 1Q78A 2GIQA 3CD5A 1Q8IA 3HHLC 4BLGA 4NYOA 4K4ZA 2CNNB 4DL7A 3JSMB 5KFJA 4USTA 2YQ1A 1G4CA 5GVQA 4ZIWA 3R6GB 3KJNB 4PG4A 4HH1A 3HK2A 5BR8F 1RT3B 4NYZA 1V3RA 2YKPA 4JV5J 4I2PA 2CVEA 2ZUAA 3UCGA 4X65F 4DPUA 2PEHA 1UWBA 4NPOA 1RTJA 2X1GA 3R7NB 1L3UA 1T9VA 4PAAA 3DLKB 2EG2A 4XPEA 2UVUA 4KV8B 2C28A 2B5JA 4KBIA 5HROB 2F8MA 2V9WA 2GJIA 2M5YA 2BQRA 4ZS6A 4OI0A 4I0WA 2YKNB 2R2SA 2DNMA 2WBMA 3SYZA 2DRDA 2XMKA 4TY8B 2V4RA 4OX6A 3NKYA 1GXLA 4ILRA 1Y11A 4WYLA 2UU9F 3M9NB 1C0TA 3FK4A 3FBBA 5HANA 1DTQB 2JFDA 1N6QA 1JJHA 1RI7A 3F0NA 2VFVA 4Y34A 4ATNA 2OFHX 1U8WA 4EI2A 4ED7A 2PI4A 3R27A 1WG1A 4ANEA 3CCVS 4ZCIA 3PTWA 4C0BA 4ZN1A 4ZPWR 2CPXA 5KT4A 3R2CJ 2L9WA 3CMES 2HBQB 4JV2A 1XNQJ 4PPDA 1M5PC 2V4JB 3A3OB 3AXMA 3BH7B 3HP6A 1HHQA 3ZZPA 2EG1A 9ATCB 4KKOA 3R6LB 1S1UA 1BE4A 2H54B 1FD2A 1HWUA 1TKXA 2BKOA 1BHNA 4DV3J 5DM6Q 4DV5J 2W24A 2W4DA 5KT7A 1R8AA 4RUCA 1TAUA 2V2QA 2KHCA 3SEOA 4DBQA 1PC5A 1M5OC 2HHUA 3GFXA 1KVIA 3FJ2A 4LRCA 1QSLA 1X9MA 1Q0NA 4TKTA 4CH0S 2JLGA 4H4MA 2FPHX 2B9WA 1N4LA 4ZVSB 1GK8A 1U1MA 3QLHB 1ZM9A 3M1VA 1SB6A 4B3SF 2XMJA 1X31C 2CQ3A 1UW9A 1XR6A 2UUWA 3C46A 3UN5A 3G96A 1TZ0A 1YBAA 2FHJD 4WK1A 3ENVA 3OR2A 2VF3A 3CJRA 3AD8C 2HZCA 2PSZA 2GHPA 4B9LA 3OXLA 4QR2A 4KGXB 5KFYA 1CLFA 1VRUB 1YJRA 2NXNA 2R7VA 1T9XA 1HBMB 2FC9A 2Z0GA 1V5VA 2CAJA 4O23A 4UZCA 4MK8A 3NAHA 4B3MF 1C1CA 4ETXA 3ZZRA 3GE9A 2YPZA 4ZVTB 4Q2LA 3T1YJ 4PUOB 3JAMU 3G6XA 2VFTA 4WCEQ 3IFEA 2E7WA 4GVLA 1HARA 1T9UA 4NEYA 2E5GA 1X4BA 3IMQJ 3TUJC 2CXEA 5ETLA 4CLFA 4RPFA 4ZPVR 2DHHA 1S6PA 2C2ZB 2YTCA 4IRDA 1L3TA 2GQQA 4KGZB 3GG1A 2X1AA 5E3RA 3ISZA 3CMQA 4O44A 4DL5A 3WDOA 2B7BB 4ECYA 2UXDJ 4BDPA 2RDIA 1R0AB 4P74A 4LR7A 3VAMA 2J7WA 3G6VA 4F3QA 5GAHU 2D3O1 5KG1A 2EFNA 3CCQS 4M5NA 1PCAA 3ENWA 4J9KA 4Q2MA 3TZWA 1BGXT 2D9OA 4JI7F 3BR8A 3UNYA 4DPYA 1XN9A 4K4SA 2EFQA 3J7ZT 5SUHA 4DFMA 2WONB 1VQKS 2ZH4A 2MEWA 3DFEA 4DSIA 3KLEA 3M05A 4LT6A 1NB7A 1GMWA 2CQHA 2L41A 1V6HA 3E01A 5GADU 2CPHA 4WFNQ 1JMTA 2UXBJ 2V8GA 2EC0A 3MEEB 3EUNA 5K5MA 1HQUB 1N32J 2VKZG 2B43A 2HHTA 5A8WB 4DF4A 4OYWA 3M8QB 1O0PA 1S6QB 3U1NA 5D3GB 3BBCA 2IY5B 3AOAA 3DRXA 3TX0A 2D3UA 2ADBA 4DPWA 4F4YA 3W2VA 1Q16B 3MM7B 3EPIA 4K50A 2NPFA 3OVAA 3W9IA 5B08A 3CCSS 2CPDA 4DLGA 1IKWB 3OSNA 2VPYB 4DR3J 4LF9J 1K47A 2QZ8A 3UD3P 1VQ5S 1IKYB 1N0UA 5C5JA 4WFAQ 1HI1A 5KAKA 2HNZB 1IQZA 3HHLB 3EXYA 4N41A 1U24A 2ZBQA 3VQTA 4HLBA 3CJQA 5LJ3Y 3W60A 3ILLA 4USKA 4QWAA 2NXEA 4FZVA 1RADB 3PV8A 4G6VB 2QG9B 3IGNA 2E1AA 3KNAA 3NGRA 3N6NA 1OWXA 3KJFB 3D3CJ 3LQVA 5IQQA 3T5KA 2Z2LA 2JFKA 1P9QC 1C0UB 1F3FA 5SZTA 1T3NA 1Y5IB 1M5KC 4M95A 3JSMA 5A76A 1LKZA 3ZZZA 1FWKA 3VR1A 3KMQA 2E7XA 4KHPF 1YZ6A 2Y3YA 3L7OA 3VAJA 1RKIA 1RT3A 3QSYB 3C15A 3D2WA 1U26A 3ISND 3HULA 5AE1A 1S1TA 5K8PA 2IFXA 4OJGA 4ELTA 2XS7A 3DLKA 4ED0A 4DV4J 2ZNYA 3W3SA 4KV8A 1X8DA 5DZ7A 2HVZA 2C2KB 5HROA 2WSFC 5LOQA 1WSVA 1NKCA 5IT9U 3EZUA 3MCMA 2E5IA 3G8QA 1RT6B 3AD7C 1M1GA 4ENOA 4W90B 2YKNA 3SXLA 2HLUA 2Q3PA 4UTGA 2WHOA 4KJIA 2XYGB 3Q8SB 3O8WA 3CD0A 1BWEA 2R2RA 2AX1A 4ZVGA 2B9EA 2B0GA 3H20A 1REVB 3GFZA 1DTQA 2PA3A 2UV8G 3MAQA 4LF6J 2BKPA 3CTRA 4TQSA 4DF8A 4Y2MA 3I4HX 5KFAA 3HJFA 2HNYB 5JMNA 2VG7B 4J9SA 1HNXJ 4DS5A 3OR1B 5D15A 3KOAA 3LPEA 5HK4A 1G7CB 2W4PA 4E98A 3IWLA 4RW8B 3FVYA 4PXDA 5F8MA 2Y9HA 1U7LA 1IBKJ 4MIBA 4DWIA 4P71A 3CPWR 1BMQB 2BR0A 1FNOA 5CHCB 1W25A 2F9JA 2QLWA 4Y0FA 4DQSA 2GZOA 1VS3A 2EFPA 3FRYA 2XWYA 1FKOB 2PO4A 3D7SB 3D0IE 2J9CA 4EWTA 1DQAA 1WOOA 3KDNA 2BJ3A 4A8XA 4CNZA 3FMWA 2J8SA 2C2NA 4I6AA 4JI6J 5GAGI 1XBWA 2HHHJ 3VAKA 2DK2A 2V67A 2MKSA 4QW8A 5F8LA 1GH8A 4OYZA 3AOBA 1D8YA 4ECQA 2HIQA 4HHHA 3QLHA 1KBRA 2YQ0A 2Y8WA 3W63A 3LANA 3TZZA 2VA2A 2MZ1A 4DR2J 1EP4A 3GIJA 3FBFA 4F3MA 1KD1T 4DR6F 4EUVA 2KVIA 1V3SA 5HO4A 2FVQA 2HVIA 3PEHA 1K9MT 4QW9A 1NBEB 2BYCA 3M8RA 1VRUA 1CVJA 4OI6A 5BXIA 1HBMA 1I1GA 1JXLA 4CCHA 2CJXB 2G0CA 3HI9A 4OYPA 4C8OA 5LT5A 4PUOA 3VZIA 4B9VA 3H59A 2M88A 3BR9A 2XYHB 2MY7A 1U8SA 3GPAA 1S9EA 4I7FB 2D9PA 4PQUB 4OLOA 2V94A 1KLMB 2R3VA 2YX4A 1CQNA 2QA4G 2G1HA 1J5OA 2QLFB 5IT0A 2CUYA 1R0AA 2OSQA 1RWOB 3TAPA 3NWRA 2NXJA 2GGPB 2RILA 3DLBA 1SKUB 2XGQA 1FDDA 3CJ3A 2V69A 4O4RA 4YP3A 3D4JA 4U95A 1UFWA 3M6VA 3PY8A 3P45B 3DMJB 2IBOA 1HQEA 2EFGA 3PW4A 1MLAA 4ER8A 4JBCA 4Y2KA 1EQ0A 1T9TA 2WONA 5FLXU 1BC6A 2Z2ZA 3KUHA 1HFEL 4F04B 3IR6B 2J8AA 2A18A 4QR1A 4LF4F 1UEVA 1TKTB 2E9TA 4C3KA 2YWHA 3NXZA 2BJDA 3W2WB 4QYZK 4J9LA 1NLKL 3J7YI 3MEEA 4NLOA 1HQUA 4EZ9A 3IR7B 3W9JA 5D4LA 1V9OA 4I6WA 5ETMA 4HR2A 1H3DA 2FVRA 3BS9A 4UZBA 4J9QA 1FRKA 3M8QA 3OFEA 1BWVA 1I94F 1S6QA 4EO8A 3VTIA 1WI6A 2DR5A 5D3GA 3R7BB 1JK9B 2UUCJ 3MUMP 2DNQA 2F8EX 1DLOA 1S0NA 2R8IA 1K0TA 2ZZTA 2FGOA 1S49A 3QPIA 2ROEA 4DX5A 1VQ4S 2IMWP 2J6TA 3MM7A 4YB1P 1SL2A 2OPSB 2R8GA 4F8RA 5D0GA 1XMQJ 3OTEA 2RS8A 1IKYA 4JV5F 3MWBA 3GQCA 4A8MP 3LF0A 1Q95G 2L9DA 1X7VA 4OHZA 2HNZA 3HHLA 3NCPA 2E66A 3OL6A 4CM2A 4FXWA 4O3RA 4GC7A 5F8IA 2W1BA 3OLBA 3KK3B 1YKWA 1YZ7A 2H4WB 3ISNC 1SBRA 2RF2B 1B70B 2JZ5A 5D6GA 5KFRA 4N47A 1WELA 1YI2S 1BQMB 3A8EA 4OJHA 2LDIA 2IHR1 3GYGA 1UZHA 5KG3A 2FB0A 1X9SA 3K5PA 2F63A 3H2VE 1KN6A 4F4AA 4YQWA 1KOHA 2HGNA 2Y1RI 4TXSA 4U6PA 3Q23A 4R25A 1PBUA 3PW7A 3KMSA 2KYZA 2MKHA 2YNFB 2B8QA 3TP2A 2OLWA 2MY8A 3UDVA 4GVBB 3M8WA 1RB0A 2HVDA 3I5BA 2HRYA 1YHQS 5KFQA 2ZH1A 4IOCQ 2HBYB 1Q8KA 1GX5A 4KT0C 1SUQB 3LP2B 2M8DB 4IR9A 2E1PA 1RA6A 1TVRB 3DRRB 4CLUA 4WE1B 1S5ZA 4IH7A 6AT1B 1SH2A 3CJ8A 2N3OA 2YNHA 5ETNA 2ZH9A 4FN5A 1RT6A 1Y5NB 2V6AA 3RAQA 1AUSL 2CJYB 1KDNA 4DV5F 5GAGU 4ZLJA 1REVA 2C2EA 1WF2A 3IG1B 1GMUA 1Q4RA 1WC3A 2CIMA 2XY6A 3EM1A 4JI5J 1TTHB 2HNYA 1M5VC 2VG7A 3V81B 2VDHA 2DGTA 3ITHB 3OR1A 2FHKA 1KSPA 2BV3A 3HCXA 3R1HA 1X4DA 4YB6A 4FF1A 1KS2A 5G0RB 3QNWB 5A2QY 3NNCA 3Q2TC 4CI0B 5IS2A 1LW2B 1EHWA 2LLZA 2P8IA 3M8ZA 4MMOA 1HR0J 5AXMA 2W7OA 1SC1B 3E8OA 4UOFA 3UI3A 2CDQA 1FKOA 1W2IA 2H5EA 3BSOA 4C8LA 2DRAA 2AJ4A 2HFNA 3GB0A 3ZTOA 4AD6A 2XNRA 3T1HJ 3T1YF 3GTYX 1ZBTA 3MMBB 2C3YA 2ROGA 1GNKA 4IYQA 2OIHA 4C11B 1YQHA 2PDAA 2HQDA 2DH8A 3I5AA 3G4SS 2O5DA 1KKHA 3ONQA 4ED2A 1XNRJ 1G1XA 3QJJA 2RQ4A 1KHVA 4EBCA 3GMGA 3PW2A 3UPFA 2Z56B 2RRBA 2RVJA 5ETRA 1X4HA 2UXDF 1YJWS 1FNXH 4OYMA 3CF5Q 4UQGA 4YOEA 4BC9A 2IVFB 1NZAA 2GNKA 5KG5A 2O66A 4RUAA 4DXLA 4XK8C 1RBAA 2ACYA 1YWXA 2VB6A 1RHMB 4DL0C 1N5SA 2BBEA 1ZS6A 2HRTA 5AT1B 1LFWA 3UD5A 3KXDA 3H90A 3V2UC 2VOOA 1MWYA 2DGWA 3BSCA 1HNVB 1RSCA 4NXNJ 4IRCA 4LIRA 4DN0A 4I7FA 3GCXP 4YHHJ 5B0CA 4PQUA 3LALA 1WDTA 4E2FB 1BQNB 2K06A 2XG8A 2DGUA 1KLMA 2H9ZA 1CS4B 3J7YU 4OHWA 2LP4A 4NA3A 1EJ7L 3HPOA 1U1OA 2GGPA 5KT2A 1U6BA 3DRPB 1WHVA 1HD1A 1GXUA 4MKBA 3DMJA 1WDDA 3H25A 3HT0A 4FPIA 1P8GA 3DYAB 5ETTA 4X4QA 4DDFA 2FVSA 3R5JB 1VJWA 2W25A 1U1NA 1U49A 3R5GA 1R7IA 2NZ4A 2AD9A 4ES2A 1HL6A 1RBOB 3M2VB 1TKTA 2AJQA 5MLCV 3OVSA 3G8TA 2VC0A 4WP8A 3RYLA 1F5BA 2A1BA 4HACB 4DR3F 3CIZA 3DRSB 2K2PA 5E0OA 3W2WA 4ZMMA 3TQ1A 3B6BA 5GMKa 2XGPA 3KLGB 1RYRA 2XSJB 3GCWP 2DR7A 1SJ4P 3EYZA 1F5AA 2MZRA 4M5JA 3M9MB 2ZD1B 4FNHA 4LRBA 3G9CA 2DT9A 3PYEA 1JLFB 2K3KA 4PRFA 4ZPBA 3OUYB 3BYRA 1T3OA 1S0MA 5J2PA 1ULRA 1JKHA 3NS7B 1RWWB 1QAJA 5IC6B 3I56S 1U02A 3MCNA 5I42B 3TEGA 1APSA 3AAWB 5DQIA 1VQOS 3D54A 2A0FB 1DBDA 2OKQA 4DR4J 2H5IB 3MR6A 2J0QD 2AJ0A 3X3UA 5M2UA 4RX6A 1L5UA 2HHVA 4P2MA 1CJKB 2G2YA 2CPIA 5DLGA 4A8FA 4MYTA 3GYNA 5B0AA 4ZCKA 2AIRB 1P1LA 3KK3A 2RF2A 3MHYA 1S1XB 2BE2A 3TQEA 4IO9Q 1BQMA 4YFUA 1X4FA 3HSJA 4M1KA 1QVGR 4DFPA 3OL7A 3HHDA 1O6XA 1HHSA 3DOLB 4OX9J 1AZSB 2YBVA 4A8YA 2ZH6A 1HIYA 3BKUA 3ZC4A 1GT8A 4FYWB 3CGIA 2FC8A 3BGLA 2BDPA 2VQFJ 2CFXA 3FUYA 1F60B 4EU0A 4GVBA 2XMVA 4JOUA 1JLGB 4DG1A 1S59A 3D0HE 4OZLA 2X51A 1R8PA 4ZIVA 1DQ9A 5F3ZA 4H4KC 2J9EA 1KVJA 3NGSA 1NM2A 1SUQA 2DNPA 3ENQA 2KZZA 1RT4A 1TVRA 3DRRA 5EUHA 3SCLE 1IBKF 2VKRA 4WE1A 2CNKB 1X5SA 2LA6A 4EFAC 3AFGA 2IMOA 3VQSA 3KLVA 4ITSA 4NI2A 3PZPA 3ENAA 3HZEA 1Z1ZA 3K8WA 5D0HA 4ZPTR 1UVMA 2GS8A 3IG1A 2VFSA 4DPTA 4JI6F 2XO7A 3MR5A 3BBBA 1F9EB 3PRDA 4IFVB 4PPZA 4C9DA 2VV5A 3V81A 2H51B 2LXFA 3M9OB 1GEHA 2HKEA 1S7HA 4ZPDA 3BJYA 1MU2B 4C8NA 5HMZA 2WVDA 3M30B 4DR2F 3AJ1A 1S99A 2GJFA 1WEZA 2HPUA 2Q66A 4MYUA 5G0RA 3Q2SC 4LREA 4P7TA 2PFFB 1NZ8A 3DOMB 1LW2A 3D1HA 4WWSA 4PYAA 4DU8A 5C2GA 3DKDA 3MOJB 1T94A 1GQEA 3OXFA 4CQ1A 1VC0A 4J9MA 1Q8LA 1SCJB 3D6HB 1ZTWA 3ILOA 3P3DA 3AJ2A 2Z2YB 2NZCA 1R8BA 2RQCA 2AYBA 1ROFA 4C11A 5DQGA 2V4QA 5KFHA 5HLFB 3EICA 4QU6A 5KT6A 5J2QB 3QRRA 3MAHA 1RUSA 2LFVA 4JI0J 4MIWA 2KT2A 2K7KA 4J9RA 5U47A 3CE8A 4DMZA 1RKJA 4DUZF 1RWUA 2FJDB 5EX0A 4WK3A 3GP9A 4IQXA 3C14A 1ZM2A 3T5JA 2HVEA 3M32B 4I6YA 1B3TA 2M0GB 3UN2A 5BR8J 3I9ZA 1QUPA 1CJTB 1UVKA 2NSCA 2GAHC 1VLYA 4KYZA 3JB9k 1CEZA 1FKAF 2A2DA 1UEKA 1OSCA 3TX8A 1HNVA 3B8HA 3CMAS 3TA0A 3I6PA 3HFKA 1G6BA 1TKZA 4NLSA 2AW0A 1HBUB 1CC8A 4LBPA 2LECA 3CCRS 3QIPB 3KHHA 1BQNA 4NMXA 4OYIA 1RT5B 2HMIA 1JLCA 1TL5A 3VHQA 2VASA 4OX8A 3OFHA 1CS4A 1RA7A 1U09A 3UCZP 4K4WA 2C3UA 3QGPA 2XLJA 1XERA 4ECWA 2UU9J 3W7BA 2PA8D 2COLA 5JUMA 2H4YB 2RU3A 3GSDA 3NBPA 1YRXA 3MMAB 4HEA9 3DRPA 3K17A 2RQKA 2I2YA 1RZMA 4DQQA 1I5OB 1MWZA 1XQIA 1RAAB 4I1TA 1JLBB 3LAMA 2RDDA 2BJ1A 1JXEA 3QJPA 3WQPA 3DYAA 3B54A 1T8EA 4FXDA 1TAQA 4USUA 4DEZA 1YVFA 1H0HB 2RQMA 4M8LA 4CO4A 1U45A 4NE9C 1P1TA 4QYZJ 4ECSA 2LA4A 2OH2A 2QSWA 3TVKA 4HACA 3IN5A 3DRSA 3H2LA 3PCOB 2ALZA 2CWXA 1YRTA 2ADCA 3O1LA 3R3TA 5JJBA 2HWIA 3KFWX 2BVZA 1H7WA 2E1RA 3RU0A 4MJKA 4DPOA 1NPRA 2XSJA 3ZXWA 2RRNA 4NOHA 2FJVA 2P6TA 4LSLB 1U1QA 4PWWA 3LTOA 3NOGA 2ZD1A 4QYRA 4ECXA 4KSEB 1LK7A 1ZA1B 3UVJB 1VHFA 2AEJA 2DIUA 1JLFA 5LM7E 3OUYA 4CLLA 2LMIA 1LWEB 1DJ0A 4B3SJ 4LR8A 3CUNA 3I55S 2CQ2A 5AE2A 4RU9A 2BKNA 1FFSB 1RHJB 3M7VA 2HBRB 3UD4P 1FCAA 5I42A 2J7UA 1V5IB 3J81Y 2W9AA 1JLAB 1IKXB 3NP5A 3UR3C 3U7JA 2G4BA 2HWTA 5B0BA 3T5LA 2BE7D 1OQ6A 2RE1A 1CJKA 2EK1A 1WSRA 4K7QA 4TU8A 2C2DA 1NJIT 2U1AA 4BC7A 1M0SA 3W9HA 1UEUA 4RNFA 4USJC 4OL8A 2CPFA 5KFVA 2XEXA 1SQGA 3BGUA 4AT1B 1WEYA 5CAAA 1TMJA 1UVJA 3FEZA 4DOZA 1M1KT 3CXCR 3DOLA 1AZSA 3B4MA 1B7YB 2ILYA 1NSPA 3J7A1 4KR0B 1PILA 4DZ6A 3AXKA 3N01A 3KLIB 3R7SB 3TARA 1B0VA 4YR0A 4DUYF 4P52A 4JI5F 2W8LA 2QL9B 1Q82T 1JLGA 5KG6A 4QWBA 4DZDA 2V34A 3EZ5A 2AEFA 3MXHP 3BGRB 1A7GE 1RTZA 3SSQA 4XDCA 4F3OA 2OPPB 5KFPA 1KQSR 1P9YA 2OEKA 1NHUA 1NHVA 1QAYA 2IM2A 4XTTA 2DPJA 4MKYA 3CC7S 4S0MA 2KKHA 1HKAA 1HR0F 3NNHA 2CKWA 3K5OA 3PW5A 5L46A 4MAKA 4C48A 2NS1B 5CCLA 1SH0A 3LGMA 1Z2ZA 2POKA 4NWBA 1FVQA 1OS5A 4J9VA 2R7UA 2BOAA 3Q8VA 3S01A 3O5TB 1TR0A 5IV4A 2GFFA 3T1HF 2XMTA 1W26A 2HHPA 5C7PA 2MZSA 4EGLA 3X1LB 3IWXA 4IFVA 3N5BA 1WWHA 1O8BA 1SL0A 1YK9A 3PDNA 1RAIB 5ITHA 2AV5A 2JLEA 1MU2A 3M30A 2MDAA 4P7VA 3LWLA 4P9SA 2HFOA 3C66A 1HA1A 1NSKL 1FNMA 5HMYA 5DDPC 4ECTA 3BO3A 2IA0A 3DOMA 3EWGA 4K4VA 3ZNUA 4L3NA 1CG2A 1S9FA 3EMTA 4H54A 4ZVHA 4WKRA 3KYLA 5DG8A 3AH6A 3N0VA 2KXHA 4KHMA 3FCVA 2IM0A 3ELHA 3TI0A 2WOMB 1JQGA 2KZMA 4YY3J 4PWUA 3CNQP 2K7JA 5HLFA 1TUGB 2MQLA 2PN6A 5KFNA 1UFLA 5J2QA 2C2OB 1K44A 3GJRB 3QAEA 5DS7A 2DITA 2J5AA 2MB0B 4DN9A 4NRUA 3KG1A 2WSEC 2V50A 3N5FA 2GW8A 1UMJA 2U2FA 3UWTA 1SJFA 3OTBA 4ED8A 1GTHA 2P9CA 2UP1A 2UUBJ 5ETSA 2CA9A 1X0FA 5KFEA 3M32A 3AHPA 1S97A 3IBFB 2GVDB 1CJTA 2DBBA 3CJKB 4OV6A 2GVZB 2FJAB 2DEJA 3U27A 2E29A 5J1EB 3B82A 4OI4A 5DO2A 2L48A 2WAQD 4OJ1A 2G13A 1S6UA 1RTHB 5KFFA 2ZJPQ 1G3OA 1UVIA 2IPOB 4B02A 1HBUA 3TYTA 5LXRA 3QIPA 1ZTTA 2B8PA 3VVUA 5EWGA 2ZVSA 2IYIA 3H40A 4OZ1A 1SVDA 2MTLA 1HWKA 3MCSA 1UJ6A 3MUVP 4QU7A 3TUIC 2DD8S 1AA1B 3WX4A 1VBXA 3DGPB 3EVMA 3C6TB 3BN7A 4L76A 3A3NB 4GC6A 3MMCB 2BJEA 2J9DA 1EB0A 1KTQA 1HBNB 5KFUA 1JLBA 3TOQA 2X1BA 1IWAA 4IR1A 1ZETA 1C2PA 3FEXB 2CQ4A 4TYAA 2N7YA 5HVFA 2J6SA 2FVPA 2HQFA 1OY8A 3H2UB 1LQ9A 1YX2A 1JB0C 3SZ2A 2VDIA 1TL7A 2MQOA 2QA4S 2DGQA 3FZBA 3EZOA 4DR4F 2QEXS 2LQ5A 2PIIA 3HKZD 3QMQA 3SFUA 4OZ0A 5D8HB 3TAQA 4F26A 2F4FA 2I6WA 2ZUGA 4YN3B 3MMJA 1W2BR 2R7QA 1WF0A 4O3NA 3UVJA 2BQ3A 1NK4A 5I3PA 4C8MA 6FD1A 1LWEA 2JRSA 2FLOA 2IDLA 2JOQA 3NG8A 1UA1A 1IXKA 2KG1A 3CVKA 2QTWA 4KAIA 2FLLA 1KNZA 4BS2A 3U02A 4OX9F 5HQMA 1JLAA 1IKXA 2DNGA 5A0YB 4K59A 3KNGA 3CT9A 2VQFF 4P2XA 1RGVA 1GFWB 4TN2A 1MN9A 2XC9A 2NCKL 5D4PA 2R7TA 1XK8A 5HJXA 1RBLA 1U2FA 5DETA 1FESA 2KN4A 1T0TV 2UUTA 2NLWA 3AJDA 3KJQB 3BZQA 3HM9A 2GO8A 1RCOB 4QJVA 4DLEA 2YH1A 3TAMB 5IZHA 4PKDB 5AJ3J 4FYYB 1FFGB 4K4YA 1FFWB 1RTDB 3ZZ0A 2ZBPA 2VIHA 4IG3B 3BQ1A 3T1AA 3V6KA 3MECA 4MK7A 4RNMA 3L7UA 3MPYA 3WZ0A 4O0IA 2EBGA 2XB2D 2GA7A 2JHEA 1PYOB 2NYIA 3BDPA 3D66A 2P9EA 3KLIA 4QIFA 1WACA 2HVHA 2EWHA 4P2FA 3CDBA 3VAGA 5A8KB 4YS2A 5DGAA 2CNLB 3T6BA 4UOCA 3I87A 3F73A 2OHDA 1P6TA 3IR5B 3R1LA 3BGRA 4B3RF 1LWCB 5C2CA 2OPPA 2PMHA 4U9RA 5B0GA 3O3LA 1Y5LB 1K1SA 1KFSA 2DR9A 2VFUA 4XIUA 4N76A 2GQCA 4LF4J 2OP5A 3U1MA 2LCWA 3D1QA 5D0RA 2YNGB 3PX4A 3DLEB 3TO8A 1HMVB 1FERA 4JI1F 4F36A 2AKWB 4RW9B 4ZHRB 4X4VA 4F7VA 2ZITA 4N5SA 1N33J 4ELVA 1HW9A 3LOUA 1VOMA 3I96A 5IM0B 1XR5A 2BMBA 4LRFA 2XHCA 4L73A 3M8SA 5EGYA 2WZ1A 4O4GB 2P6SA 3V5RA 2RUSA 3SQOP 2ASLA 1I94J 4X4SA 4MFBB 3PXGa 2DNRA 1B7FA 4Q8FA 1JJ2R 4F4WA 4HKQA 4JI0F 2BW7A 3HT3A 2KB2A 1SH3A 4AQYJ 3DDIA 4PG8A 3PG9A 4Q45A 2QRRA 1RHQB 4MKAA 4ZJLA 2HZAA 3TZXA 5D78A 1SXLA 4L75A 2VUGA 1VMBA 1CPZA 2IC3B 4LBIA 1FXRA 2NQPA 5C25B 3CO9A 3H5UA 3PYDA 2V0NA 4IQMA 5A6WA 3QFWA 3RUBL 1NH7A 1YDLA 1D1UA 2WOMA 1VJQA 3ZO7A 3ZZTA 4BHQA 2KL8A 1Y3JA 2B9YA 4ZA1A 3O6QA 3G8SA 4ICLB 1EETB 5D0EA 2M9KA 1HBOB 2FHMA 3GFYA 1DHMA 3FMBA 2GAGC 2XBPA 4NYPA 2ZH8A 3QJLA 2JEJA 3GYXB 2RS2A 3PIOQ 4UUXA 4QIVA 3OXGA 4OQJA 5ETPA 5AE3A 4X4RA 3BQ0A 2DNNA 4RUBA 4FF2A 4W4MA 4DCPB 5F0UA 3DI6B 4WPAA 2GVDA 1SJ3P 1F9FA 3D1OA 2AJ1A 3CJKA 1LNQA 1TUWA 1U1RA 1PJ5A 2GVZA 4NEZA 2HHQA 1VQ8S 1YJTA 2O01C 5J1EA 4LJMA 4LQ3A 1RAGB 1S9GB 4L3KA 2YKMB 2RU9A 1MW7A 1YTYA 4WFYA 1CJVB 1RTHA 3HHNB 2WSCC 1TU0B 4CLKA 4DJBA 1RT1B 3NGTA 1BY9A 1RLCL 4CP5A 3D6MB 4I56A 2FYXA 4LUBA 2A6OA 3JQJA 1H7XA 5D4NA 2QFJA 5BJRA 1FRMA 2HGMA 2P5VA 1VQMS 4PABA 3KLFB 4DSJA 3ZZOA 2R8JA 3BM7A 3M2UB 3UNGC 4KQZA 1VQPS 4QBUA 3C2PA 1HPZB 3C6TA 4Y2AA 3A12A 3TW0A 1U2RA 2XQCA 3MMCA 2PI5A 2MLXA 4TLRA 1HBNA 2QLJB 3P6YC 4ILMA 3CC2S 2P9GA 3R8YA 3E2EA 1UCNA 3JXOA 4ZPCA 1AXQA 3MM6A 3SV4A 4QIGA 3S8SA 4R5PB 1MNEA 3IA0A 2SXLA 4TYBA 1IQTA 1NJXA 4M5LA 2WK4A 1WTBA 3AB4B 1WC0A 2FLNA 3OT9A 2MKKA 1CULB 4CO3A 4F4ZA 1IUJA 3FSXA 3OTOF 3CJTA 4C97A 2LU2A 1N88A 1S57A 1VLOA
chains in the Genus database with same CATH topology
1A6LA 3NRBA 4DSFA 4DQIA 4JI3F 2OTLS 2JX2A 3K5MA 4OMFG 2GGPA 5KT2A 1TV6B 2Y0SD 4DL4A 1HNWF 4I67A 1O51A 1VC6A 1G2EA 1U6BA 2UVWA 1NH8A 3L95X 2LXUA 3DRPB 2N4DA 2R2UA 4Q44A 2ABYA 4X4UA 2HQ3A 2E5LF 1WHVA 3VALA 2I8EA 1HD1A 1GXUA 4BBYA 2PMZD 3IGVA 4YB7A 3AQPA 2LQJA 4MKBA 1N8RT 1VK8A 3DMJA 5KG0A 5KFMA 3H25A 4F50A 1C1CB 1P8GA 1SI9A 3AA8A 3B78A 3S7RA 3DYAB 4X4QA 4DDFA 4GO5X 2FVSA 3M2VA 4D3HA 4ZCMA 2NREA 2GMLA 2M70A 1U6FA 2OO4A 3HZGA 1JIHA 3N6LA 4AL7A 1VJWA 2W25A 2LEBA 3Q8PB 1U1NA 2OFGX 2VG6A 4DFKA 1U49A 1J2VA 5F8HA 2L3MA 1R7IA 3PIPQ 2QT7A 3JTNA 4A48A 2BA9A 3GV8B 2J6UA 2LEPA 2NZ4A 5DGBA 2YVSA 1KQGB 2AD9A 4ES2A 1HL6A 1RQ0A 5J2NA 3M2VB 1K8AT 4X64F 1TKTA 2AJQA 4XPCA 1S6PB 5MLCV 5KFTA 2PC6A 2VC0A 3OVSA 3G8TA 5A0YA 3KLGA 7FDRA 4UUWA 3LP1A 1Z2LA 3RYLA 3PKMA 1F5BA 2A1BA 3I5CA 4DR3F 3CIZA 3UQSA 3DRSB 2K2PA 5GAEU 2WCXA 5E0OA 2N82B 1X5OA 1DZ5A 4USIA 5AXLA 3W2WA 3KKFA 1H98A 1X5TA 4ZMMA 3OVBA 3MFHA 3TQ1A 4EYHB 3VWSA 1WHYA 3VAFA 1WG4A 5GMKa 4OI1A 2XSFA 3N4WA 4M5DB 2XGPA 4ECZA 3KLGB 1RYRA 4NXMF 3DOKA 2XSJB 5K8OA 3S1TA 1TKDA 2DR7A 4C0HA 1IBMF 3KJVA 1SJ4P 3EYZA 4RZRA 1F5AA 5T41A 2CPZA 4JI4F 1TFWA 2MZRA 2A2CA 1H38A 2MSSA 3RW6A 3M9MB 2V8VA 1ZYQA 4FYDA 5F9LA 1DRZA 2ZD1B 3M8PA 4FNHA 2X1FA 1KC8T 1QE1A 4HDGA 2MGZB 2DO0A 3G9CA 1Y9OA 1U1PA 2VODA 2KTQA 1N34F 4IKAA 2N7CA 2DT9A 2GCFA 3LUYA 5CH7B 5HMWA 2ZZNA 4LIWA 2GMJA 2BZ2A 3SSSA 1JLFB 2K3KA 4PRFA 1VQSA 4ZPBA 1RTIA 2GMHA 1C1BA 3O44A 5DDQC 3OUYB 1M5SA 3ETOA 3TAMA 1T3OA 4LVNP 1S0MA 1S76D 3R5AA 3V6DA 4Z37A 5J2PA 4OX7A 3PR4A 4DFJA 1ULRA 2MHEA 1JKHA 2GC8A 4LSNA 5LXYA 1QAJA 2CQBA 1RTDA 3K2YA 4P6QA 1IM4A 4IG3A 2DGOA 2PGCA 1M90T 5T7LB 3T5HA 3I56S 1RTIB 4NA2A 2HLTA 3KLEB 3N79A 2XZWA 2MQNA 5I42B 3HVRA 5J2PB 4B9TA 3MPVA 3AAWB 1Y0HA 3PX0A 3PHEA 1APSA 5DQIA 3CIMA 3N6MA 4URSA 1VQOS 1JKHB 4CIOA 3D54A 3EGNA 4R8UB 1IBLF 4RUHA 4IOBA 3KG4A 1HW8A