4LSNB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj518), a non-nucleoside inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
428
structure length
416
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 101
structure length 416
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lsnB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnB03
2V0NA 5KFNA 3CDEA 3MFIA 3RB4A 2D3ZA 3MR3A 2OPRB 5CYQB 5HP1A 3I5AA 1HQUA 2WB4A 2IJFA 1EP4A 5C5JA 1LW0A 4ECSA 2IC3B 4NLRA 4R0EA 5CYMA 4QWAA 4DG1A 3CDUA 4MK9A 4RNMA 1C0TA 2IAJB 2BE2A 3RB6A 3PW5A 3MEGA 3KLHA 1TL3B 1Z4UA 2AU0A 4H4MB 2EC0A 1RT6A 3OLBA 4FBTA 1BQMB 2RF2B 4OL8A 3Q8QB 2IA6A 2JC0A 4MFBB 3G6VA 2IM0A 3LP0A 4K4WA 5EWGA 2ZE2A 2CKWA 4PWDA 3KOAA 4Q43A 3UQSA 2UUTA 1JKHA 2C2RA 5K14B 1SUQA 3CJ2A 3GIKA 1S6PA 3IG1B 4EYHB 1JLFB 4YR3A 4TLRA 5KT3A 3DOLB 3DLKA 1KHVA 3V6DB 4Q8EA 2J6SA 1GX6A 3CJ0A 1S9EA 1JXLA 4ZP7A 4RW4A 4RNHA 3M8PA 2R2RA 1TKXB 1S1VA 3QGHA 1S0OA 2AX0A 3QYYA 2DPIA 5KFWA 4PQUB 3LAMA 3BR9A 2FLLA 3BSNA 2RKIB 1C0UA 3DOKA 4LSLA 3T5HA 1C1CA 3IS9A 4J9MA 1NHUA 4DL5A 3ITHA 2CJQA 4MIAA 1TL1A 2I1RA 1XR6A 2W9BA 4WFYA 2R8KA 3DLGB 1RT5A 4J9SA 1T05A 3SI8A 2YNGB 4H4OA 5HLFB 3Q8SB 4TY8B 3DI6A 4Y2CA 2I5JB 4R5PB 3V81A 1TV6A 4NLSA 3C6TA 1IKVB 2BQUA 4ZVHA 5DGBA 2YNFA 3E01B 4NLDA 3UDLA 4ZMMA 4IR1A 3QGGA 3CJ5A 4DL6A 5F8MA 1N5YA 2VG7A 4I7FA 1JLGA 3MEDA 5KFVA 4HKQA 4GC6A 4FS1A 3T5KA 1R0AB 3IGNA 4KV8A 1RTHA 3BREA 2J6TA 4ED2A 4RW6B 4QW8A 2V9WA 4IG3A 3I5BA 4MK7A 4MK8A 2BQ3A 4K4ZA 4KHMA 2YNHA 3H40A 5DGAA 4Y3CA 1HNVB 4KKOB 2BRKA 3EZUA 1DTTA 4U6PA 3NAIA 1HPZA 3T1AA 1RTIB 4O3NA 3CJ3A 1HARA 4J9QA 4O44A 3RB3A 3OSPA 3H5SA 1HMVA 2ZD1B 3LP1A 4WE1A 3MR6A 3ISND 5DQIA 4RW7A 4URSA 3CIZA 4X2BA 4ID5B 3GIMA 3PW4A 4M95A 4J9PA 1SV5A 2JEFA 1DTQB 1S1TB 4I2PB 3MEEA 3LP2B 4XPCA 3PVXA 4QWDA 4HYKA 3SFUA 2IMWP 1LWFB 3C6UA 3G6XA 1S6QB 4ZP8A 5F8LA 4ECYA 4IR9A 2AGQA 3EPGA 4J9NA 4J9LA 2WK4A 5L1LA 1IKXA 2HNZB 5HP1B 4ICLA 5J1EA 3PJWA 4ZPAA 1LW0B 5KG2A 1HQEA 5KFJA 5CYMB 4DG1B 4IOBA 1C0TB 5KT4A 4RW9A 1RT2A 3OHBA 1JLCA 2BE2B 3HVAA 4F4YA 4NYZA 2W8KA 3MEGB 3KLHB 3DLEA 4EBEA 4NLOA 4IDKB 1S1XA 3IN5A 1RT6B 4ZHRA 3KLFB 5KFKA 1RT1A 4Q8FA 1ZTTA 1S9GA 1TKZA 3KMQA 3LP0B 1RT3B 2WTFA 3DRPA 2ZE2B 4O3SA 4TN2A 4PWDB 2JEIA 3NAHA 4EBCA 1JKHB 5KFRA 5F8NA 2W7PA 2VG5A 2HWIA 1S6PB 4TXSA 1S0MA 3DMJA 2ALZA 1JLBA 2IM3A 3NGDA 4O3RA 5L1KA 3LANA 4DL3A 1JLEA 4ZP6A 2B6AB 1XR7A 4TY9A 1C2PA 1S9EB 2OPQA 3QLHA 3BSCA 5I3UB 4RW4B 2BQRA 4NLYA 5F9NA 1UWBA 3M8PB 4IG0A 3Q8RB 4Q45A 4O4GA 2R2UA 1S1VB 1SH0A 5KT6A 2YNIA 4IFYA 3GQCA 2HNDA 2JLEA 1OS5A 4KBIA 2ATLA 1C0UB 4LSLB 3OL9A 2YKNA 4LSNA 1C1CB 5F9LA 3IS9B 5D3GB 5KFZA 4JV2A 2XI2A 1FK9A 5KT7A 1TL1B 3FQLA 2C2EA 2W9BB 3T5LA 4NRUA 1IM4A 4ZVGA 3MR5A 1RT5B 1TKTA 3KK2A 2D41A 1T05B 5KFLA 4ECZA 2ASLA 2C28A 4H4OB 3BSOA 2BANA 1LW2A 1RT4B 3DI6B 3FFIA 4PUOA 3KLGB 1K1QA 1TV6B 3H59A 5JUMA 3CJ4A 3I0RA 3IRXA 5KFIA 4ED6A 4M94A 3PJXA 2YNFB 2QV6A 1NNDA 3RB0A 2YKMA 1N5YB 2VG7B 3FSIA 1JLGB 1T03B 4Q0BA 2C22A 2AQ4A 4KO0A 3M9OB 4F4WA 2IBKA 5C25A 4KV8B 1RTHB 1HYSA 2WRMA 1VRUA 4IG3B 4ECXA 4MH8A 1QE1A 5KFDA 2YNHB 3GV7B 2UUWA 3KNAA 3GIIA 5KFOA 1FKOB 3RBDA 2IM2A 3QGIA 3BQ1A 1DTTB 5C24A 1HPZB 3I5CA 1RA7A 2XCPA 3KHHA 4RNOA 4O44B 2B5JA 4Y2AA 4K4XA 1HMVB 3LP1B 4WE1B 1HNIA 4RW7B 1C1BA 5KFFA 2UVVA 2GIQA 4K4UA 3KMSA 3RAXA 1EETB 1SV5B 1JLAA 4YMEA 1VRTA 3MEEB 4R8UA 1MU2A 3Q8PB 5F8GA 1WNEA 5FDLB 4WZQA 4FBUA 4YQWA 3GILA 5KG1A 1LWEA 2R8JA 4IRKA 2WONA 1FKPA 1JIHA 2ASDA 1KHWA 4ZVFA 1IKXB 4NZ0A 1DLOB 1S1UA 4ICLB 5CYQA 5J1EB 4Q44A 5KG3A 2XC9A 1HQEB 3LALA 3DRSA 3MFHA 4RW8B 1RT2B 1NHVA 3DLEB 5DLGA 1KLMA 3H5YA 5KFMA 5EWFA 4ED1A 5KFUA 1J5OA 1LWCB 3NBPA 1S1XB 1JX4A 4H4MA 3V4IA 2WOMA 4ZHRB 1D0EA 1S49A 2E9TA 1IKYA 5J2NA 1RT1B 4ZP9A 4J9OA 1T3NA 4B3OA 2FJWA 3KK3B 1RDRA 1BQMA 2RF2A 1S9GB 4RZRA 3DRPB 3HHKA 2IM1A 1T94A 5L9XA 4EO6A 2VG5B 3DM2A 4XPEA 3NKYA 2OPSA 3DMJB 5KFXA 2AGPA 1JLBB 4Y34A 4MIBA 3M9MB 1JLEB 3JYTA 4QW9A 5T14A 3V6DA 5I42A 4IRDA 2OPQB 3QLHB 3CDWA 3MTKA 4ZPDA 4RUAA 2DPJA 3KLEB 2JEGA 4FS2A 1UWBB 4IG0B 3JSMA 1ZTWA 5KFEA 3GV8B 5L1JA 4DL2A 2R8GA 4O4GB 4ECTA 4YR2A 2YNIB 4IFYB 4MKAA 4KFBA 1HQUB 2HNDB 1EP4B 2WCXA 5C42A 2YKNB 4LSNB 1RT7A 5EWEA 3I0SA 4NLWA 3H4DA 1FK9B 5DQHA 3CO9A 3QO9A 1S1WA 1BQNA 5HROA 4ECRA 3KK2B 1TKTB 3DLGA 4TQSA 4U7CA 5KG4A 2BANB 1LW2B 3FFIB 5HLFA 2HNYA 4PUOB 2WHOA 4NLTA 4NLPA 3N6MA 4O4RA 3QZ7A 3V6JA 2E9RX 3I0RB 2ILYA 3IRXB 2VG6A 5HBMA 3HVWA 3QIPA 3E01A 3HVTA 3FDSA 1YVFA 2IJNA 3VQSA 4ECVA 2YKMB 1SUQB 1RTJA 2QE5A 4WFZA 3BJYA 3OL6A 3OSNA 4ED0A 3TQ1A 2HMIA 1REVA 4TYBA 4Q0BB 1I6JA 5KG0A 3KLIA 4LQ3A 2F8EX 1RYRA 4KO0B 5J2MA 3DLKB 3KJVA 1S4FA 5C25B 3SFGA 4NLGA 4WZMA 1HYSB 3FQKA 4RUCA 4NCGA 5KG6A 1QAJA 1VRUB 4RW6A 5KFBA 2V4QA 2OH2A 1QE1B 3V6KA 4GC7A 4IH5A 5KFHA 3H2LA 1HNVA 3BGRA 5C24B 2GC8A 1TVRA 1RTIA 1JLQA 2B5JB 3DOKB 3DDKA 3KK1A 2R8IA 2C2DA 3ITHB 4G1QA 2FVSA 2HWHA 3G86A 4EO8A 2AWZA 2XGQA 3H4BA 2UVRA 2XGPA 4WXWA 1JLAB 3CWJA 1VRTB 4O3PA 4R8UB 1MU2B 4DL7A 3V81B 4QWBA 3C6TB 1LWFA 4ED3A 2R2TA 1LWEB 4NRTA 2WONB 1FKPB 4URGA 3QZ8A 2RDJA 4ZPCA 1S1UB 2HNZA 1MMLA 2GIRA 3H5UA 5KT2A 4I7FB 5EDWA 3MEDB 3DRSB 3UR0A 4I2QA 2FJXA 4WYLA 4K4TA 1RTDA 2W9CA 4QPXA 3PZPA 1KLMB 3MECA 3DRRA 1J5OB 3NBPB 4IDKA 2OPPA 3V4IB 4YR0A 2WOMB 3OL7A 3KLFA 2JEJA 1IKYB 5J2NB 5J2QA 4B3OB 4F4XA 2FVQA 5L1IA 1S10A 3N6LA 1U09A 4YP3A 4JV0A 4K4VA 1RT3A 2ZKUA 4NLUA 3EPIA 3PHEA 3DYAA 4IFVA 3PR5B 1RYSA 2D7SA 4K50A 4KB7A 3DM2B 3M8QA 1QAIA 2OPSB 2ILZA 3GV5B 4TQRA 4ZPBA 2O5DA 2UVUA 2J6UA 4NLVA 2BR0A 3JYTB 5J2PA 1W25A 4TYAA 5KG5A 2B6AA 4QWEA 4J9RA 4K4YA 5I42B 4XO0A 1IKWA 1N6QA 1GX5A 3RBEA 5I3UA 2AGOA 2FLPA 3C6UB 4K4SA 3TAMA 3JSMB 4KHRA 4KFBB 1K1SA 3T5JA 2OPRA 4IH7A 3KHGA 4EEYA 4DL4A 5C42B 1RT7B 2FJVA 4WYWA 2IC3A 3I0SB 5DG9A 4RW9B 5D3GA 1S0NA 1JLCB 2IAJA 1RAJA 3H98A 3T19A 2W9AA 1TL3A 3QO9B 1S1WB 4DEZA 4QWCA 1BQNB 5HROB 1TP7A 5F8HA 3H5XA 3PW0A 1RT4A 2HNYB 3PW2A 2FLNA 2V4RA 3KLGA 5DG7A 3ISNC 3ICLA 4F4ZA 1TKZB 4MFBA 2VG6B 5HBMB 3BSAA 1QUVA 3QIPB 3G6YA 3HVTB 1S48A 1N4LA 4MKBA 5KFYA 3E51A 3FRZA 5KFQA 4RU9A 1RTJB 5K14A 4JUZA 4ECUA 2HMIB 1REVB 5KFCA 3IG1A 3KHRA 1JLFA 1T03A 1S97A 1N56A 3KLIB 4IRCA 4G3IA 5J2MB 2RDIA 3KJVB 3DOLA 3OL8A 2FVRA 4NCGB 1RA6A 4LQ9A 4RNNA 5F8IA 3NL0A 1SH2A 3CVKA 3HKWA 4H54A 1FKOA 3BGRB 1TKXA 1TVRB 1ZETA 2FVPA 4PQUA 4ZVEA 4ECWA 1JLQB 2RKIA 2XWYA 3PR4A 3KK1B 4G1QB 4O3OA 2E9ZA 2JC1A 3GYNA 4KAIA 5KFPA 4WXOA 1D1UA 3RAQA 1EETA 1N48A 2UVWA 4RNFA 2VA3A 4ED7A 1S9FA 2YNGA 2XCAA 2AX1A 5KFAA 5JXSA 4TY8A 4NLQA 5F8JA 3D5MA 2I5JA 4R5PA 2FVCA 4IH6A 3KLVA 5KFSA 5FDLA 2HAIA 3BQ0A 1IKVA 3LAKA 5KT5A 2XI3A 3MR2A 4KSEB 5DLFA 1DLOA 3GIJA 3V6HA 3M9NB 4J9KA 5DG8A 4ECQA 2B43A 5DQGA 4NLXA 4I2QB 4F50A 2W8LA 4RW8A 1RTDB 1R0AA 3OLAA 2W9CB 3KHLA 3MECB 5KFTA 3NMAA 2W7OA 3DRRB 1XR5A 1LWCA 2OPPB 2D3UA 5KFGA 2ASJA 2R2SA 4KKOA 5J2QB 1SH3A 4EBDA 3KK3A 2R8HA 4IKAA 4ED8A 4IQXA 4EYIB 3DYAB 4IFVB 4URQU 2ZD1A 5EUHA 1HNIB 1C1BB 3M8QB 1CSJA 2VA2A 4ID5A 2BRLA 3QIDA 3OHAA 4WFXA 3IGVA 5J2PB 1DTQA 1S1TA 4I2PA 3BQ2A 3LP2A 3D28A 1IKWB 1N6QB 3PW7A 4KE5A 4JV1A 3KLEA 1TQLA 3TVKA 4O3QA 1S6QA 3TAMB 3UPFA 5KG7A 3MF5A 3N6NA
chains in the Genus database with same CATH superfamily
3AAWB 3HSJA 2RQ4A 3WIUA 1NK5A 1EX8A 1Q95G 2UV8G 1TL3B 4H4MB 2YWGA 4N56A 1RT6A 2NS1B 2VF3A 2JC0A 4DV0F 4DUYF 3FKBA 3FBCA 2I6WA 5KT3A 3IC1A 1KONA 2BACA 1DZ5A 5HQMA 5DRKA 1JXLA 2WSCC 1YRTA 4RNHA 1NM2A 3BR9A 2PMHA 2CG8A 3P4UB 2LLZA 2YNGB 3Q23A 1AFJA 2I5JB 5LJ5Y 1RWPB 1IBKF 1QTMA 2ZVSA 4DPXA 1YKWA 4PYDA 5EHHA 3BREA 4RR5A 4ED2A 3W8GA 1FJGJ 4USIA 1UCNA 2H4YB 5IM0A 4F7VA 1RTIB 3RGIA 4CLTA 4O44A 1AUDA 1HIYA 3MUTP 1YITS 2GHVC 3A4TA 2ZH5A 3OW2R 5DJBA 2HVDA 2WK4A 4C8LA 5J1EA 3MMBB 4OZ0A 1VQLS 3AH6A 1ZAWA 4ZHRA 3R7NB 3RBZA 4TN2A 1RBOB 4MT1A 3CCTA 2MB0B 2LQ5A 1XR7A 4PXDA 2D3O1 1C2PA 2X1BA 3QLHA 3BO4A 1I1GA 4RW4B 3TUZC 4Q45A 1SKUB 2W24A 1HNZF 5RUBA 2H54B 7FDRA 5KFZA 3UDVA 2XMAA 5K8PA 3BSOA 3DI6B 1K1QA 1TV6B 1I3OB 2N3LA 2Z57B 5LMNJ 3TZZA 5C25A 2DEIA 2RSQA 2P6TA 1KRPA 4CYUB 4ERDA 4HTIA 3DHWC 6FD1A 5IWAF 5HMXA 3N01A 4RW7B 1QAXA 1VC0A 4OHZA 5B0BA 2ZBQA 3GILA 1LWEA 5GAHU 2R4FA 3GYXB 3TR5A 1OJ4A 3Q2TC 2JLFA 1KSPA 3RBXA 1S1XB 4F2SA 2E9TA 2H5EA 3EJMA 1FFGB 3L9ZA 1KTVA 3R3TA 5AJ3F 2ZZNA 1WC3A 4XPEA 4C6AA 2HHPA 2MDAA 1EJ7L 5I42A 1RHKB 2DPJA 3GIRA 3RW6A 1N5VA 4ECTA 1PSDA 3C16A 4CO3A 4DSLA 5EWEA 4NLWA 1SJ1A 3NOCA 1P6TA 2M8DB 4F8RA 2B8QA 5KG4A 3QSYB 4ZVOB 2Y8WA 3V6JA 3I0RB 4M5MA 2BMBA 2YKMB 3TQ1A 2EPIA 4RUCA 3HULA 1U2RA 2OH2A 3V6KA 2FY8A 1S4EA 5C24B 1TVRA 2K3IA 2E1AA 2CVEA 2B5JB 4PCQA 2ALYB 2HWTA 4DR2F 1IQTA 3KNGA 1HNXF 3FK4A 4FP9A 1Q5VA 2W2OP 4NPOA 3G87A 3MM5A 2QA4S 1MMLA 1FHTA 4IO1A 5T41A 2ZBCA 4LF1A 2UP1A 1GT8A 3NBPB 3ZZUA 1D9AA 3M2VB 4WP9A 2CQCA 1AUSL 3VAFA 2FJBB 1F2HA 3GV5B 1RWKB 3ILOA 5J2PA 1F5AA 5E3CA 2FHJA 4K4SA 3DGPB 5F0UA 5B0AA 2FJEB 1WORA 3D3CJ 4RW9B 1OY8A 2W9AA 4PRFA 1TMMA 4QWCA 4KHPJ 5B0DA 2FDNA 4X4NA 1WHWA 2DJWA 4K7QA 5EX0A 2FC8A 3QIPB 5KFYA 1XMQF 1FCAA 4ECUA 1S97A 1JLFA 2VBZA 4G6VB 3PIPQ 5ITHA 1GAOA 1RK8A 4ZCMA 3SSQA 1ZETA 2MGZA 2BDPA 1IJEB 4DR4J 2BKOA 2V8PA 3EMTA 3RAQA 4B17A 3FSXA 1RHQB 4MTPA 2KTQA 2DGWA 3RYLA 5DLFA 4KSEB 4KGKA 1TFWA 3R5CA 3MM6A 4BC7A 1AA1B 5LOQA 3A8EA 2CQPA 5B0EA 1PKUA 1N52B 3GG1A 2C2NA 1HWKA 1OSCA 1RSCA 2QSWA 4W98A 3ADAC 1Y10A 4YS2A 3POTA 2FGOA 4ELUA 2DR5A 4AD6A 5E7OB 2WSFC 5B7WA 2V68A 3I5AA 2R7XA 2DNOA 5ETVA 4ECSA 4X65F 1A6LA 4PPDA 2F4VF 3H90A 2EC0A 2HYIB 3OLBA 4W90B 2OELA 2HHSA 3CCUS 3O1LA 4MFBB 4C0OC 4K4WA 3PYGA 5HQ8A 1T3OA 1YQHA 3E2EA 4UOFA 2DYAA 3VZIA 1PJ6A 3DOLB 1XJWB 4NZ7A 4CH1A 3W64A 1FJCA 2Y1JA 3DDNA 1B0TA 4PQUB 3WHIA 1NLKL 3BSNA 3MPDA 1X4CA 1UJ6A 3P45B 1UFKA 3UVJB 1KKHA 4K0KJ 3GB0A 5LMUF 3QJLA 3KUHA 3CJ5A 1C4AA 5F8MA 4MK8A 5I4MA 1JJ2R 2D69A 3VVUA 1D8ZA 2M3DA 3F44A 3IAM9 2JEFA 3MEEA 2UUCJ 2KFNA 4ZVTB 1S6QB 3CJQA 1H74A 1PYOB 2QIFA 4FF2A 1YIJS 5KT4A 3AODA 4AXJA 4Q8FA 3MMAB 2WBRA 1H7XA 5A0YA 4PZVA 1R0BG 2XWXA 2Y8YA 2XULA 4KR0B 2BQRA 4IYQA 2Q79A 4DJBA 2JLEA 2H9ZA 4YB6A 2X3GA 4LF6F 1AZSA 1GQEA 1FWKA 3H59A 1NJZA 2XTJP 4W92B 2XNQA 4QIWD 4CI0B 4FXVA 1N5SA 1WKKA 2V2ZA 1OY9A 2V4JA 1BGXT 1IVZA 2L9NA 2MEWA 4PEOA 2DIVA 4LF7F 4A8YA 2ZH2A 3LP1B 5H1SV 4DV7F 2K2PA 1VS3A 5G4DA 1WNEA 2VOPA 1KOHA 1BWVA 3LALA 3I6PA 4N77A 3F56A 1V3RA 5EWFA 1N5TA 4H4MA 3CSKA 1S49A 3PFEA 3CMES 1T3NA 4HHHA 3O3LA 3S8SA 2G2ZA 2R9LA 2CJYB 2AIRB 2F1FA 3H8YA 3BGOP 4ZPDA 3ENAA 4JI2J 4CO1A 3NNAA 5ETPA 4HACB 1KWMA 4CNYA 4DV5J 5LT5A 4ZPWR 2F5GA 1NDLA 3GCXP 3P5TL 2AYEA 4LFAF 4HHJA 5GMEA 4U96A 2EXUA 1RTIA 2ZOFA 2LEAA 3ILIA 1XNRJ 2JJ4D 1SC4B 4QWBA 4XAKA 1NZ8A 1FKPB 4I7FB 3JTPA 3DRSB 2ZVIA 3NWRA 2LU2A 1VK8A 2OPPA 3UE2A 2ZZMA 4KYZA 3QQCD 2FVQA 1SBRA 4A8FA 1Q53A 4IFVA 1D9DA 4K50A 4DFKA 2JWNA 4LVOP 2CDQA 3MM8B 2AGOA 4XDCA 5IXUA 3TAMA 3JSMB 4G1IA 2Y1IA 4LUBA 3G4SS 2GVZB 3HHNB 5CD4A 5DS7A 4I4BA 3VVTA 3H5XA 3HI9A 1ZH5A 4UQTA 1TKZB 3CO0P 4P73A 3HVTB 1N4LA 1WDDA 3HFZB 5K14A 4DV2J 4K2JA 4G3IA 1MWZA 3CCVS 1Q78A 1T7PA 1VMBA 2XYGB 5ETLA 4ES1A 4M5GA 1F2GA 1VJQA 1X5SA 2AJQA 2VA3A 2DGVA 3B4DA 1RXOB 4IH6A 3CXCR 2VQFJ 2JSXA 5DDQC 2HQFA 2FHJD 4RWXA 2W8LA 1R0AA 1X5PA 1UETA 4OZNA 3DRXA 2AJ4A 4H4KA 1HQ2A 2P9CA 1XWLA 4IKAA 4HT7A 4UQGA 2NPFA 4ANDA 1HW9A 2C3PA 1FXRA 3LP2A 1VLYA 4FKXA 2MKIA 3N6NA 2V0NA 1HBUB 2OHDA 2DH8A 3LO3A 3PW5A 2FZKB 4Y2KA 3IP0A 2MKKA 3VF0B 3ILLA 4OYOA 2RT3A 2RF2B 1FJGF 3NGTA 3AD7C 2DHHA 2CKWA 4WBFA 2BBEA 2KXNB 3IG1B 4YR3A 3QFWA 1GX6A 3ZZYA 1LFWA 4B3MF 1YJ9S 2DPIA 3LAMA 5IFMA 4ZPTR 2C3YA 2MTLA 1YRUA 4CLZA 4J9SA 3Q8SB 4D3HA 4Y2CA 5AE1A 4LRDA 2CJXB 1RCXB 4HEA9 1BE4A 4OYIA 4U7UK 1CJVA 4KV8A 1T0TV 5KTQA 3CT9A 1FD2A 3OFEA 1FT8A 4ID5B 4N5SA 1SV5A 4YB7A 2HRUA 5LXYA 4ZLJA 1XN9A 1Z2ZA 2MLZA 1Y9OA 2E5IA 2AGQA 3A8JA 2L48A 1U1KA 3G9CA 4RW9A 1RT2A 2FHOB 1U45A 1I94F 4UZBA 4EBEA 3DLEA 3SBMA 5LMNF 1YI2S 3KMQA 3U02A 1SIWB 4DSJA 4ILMA 1S0MA 1NEEA 3DMJA 2UV8A 4DR7J 1JLEA 1YBAA 2YWHA 2MSTA 1ZOTA 2DCUB 3JQJA 1OMSA 3BYPA 1NMEB 4KBIA 1IBLJ 1RT5B 4J9VA 1U6BA 4H4OB 4PUOA 1RT4B 3ZTPA 1YGYA 2VBWA 4YY3J 2Y0BB 2RDDA 1GXTA 3W61A 4Q0BA 4ZIWA 4ECXA 3GV7B 2UUWA 3AY0A 3W8PA 5KFOA 1UKUA 8ATCB 2BJ9A 4Y2AA 3GMGA 2V69A 2UVVA 1FKAF 3KMSA 3R27A 2DCLA 1JLAA 4DCJB 3OVBA 2XMWA 4IOCQ 1IXKA 4M5NA 1L3SA 2HVIA 5J1NA 3AQPA 4X4PA 2PC6A 1RT1B 4FXDA 1NPKA 2NXCA 1S9GB 4MJKA 1WWHA 2ZH7A 2VG5B 3LQVA 2LQ9A 2DD8S 4RPFA 4Y34A 3TJAA 2DGSA 4E2FB 4UOHA 4IRDA 4RBTA 1LOUA 2FZGB 3TO8A 1EHWA 2YNIB 1S99A 2ACYA 4OLPA 3AXMA 1VQ6S 1BQNA 1DY3A 1WDTA 3DOMA 2F9DA 3HVWA 2V6AA 2VHGA 3LPYA 1REVA 3DU6A 1GMWA 5J2MA 4OYXA 3FQKA 2V4QA 4NCGA 2BX6A 3ONQA 3BBFA 3B82A 2OD6A 1DARA 2W25A 2CQ4A 2FVSA 3EGWB 3GLJA 1TAQA 2EFVA 2UVRA 4BCAA 3TQEA 1S72S 2E29A 2DNLA 2Q6BA 4KHPF 3OR1A 2GCFA 3LUYA 3VTIA 3DRRA 3R9LA 1TK5A 5L1IA 4UOCA 1WOPA 3M8QA 1QAIA 3D9BA 1DQAA 2J6UA 1ITPA 3ETOA 4DR4F 1O8BA 2DIUA 3CPWR 2AHOB 4EEYA 1GNKA 1CULB 1CEZA 2YH1A 2RH3A 2RRBA 3ET6B 1KFSA 4A46A 3PW2A 1SC6A 3ICLA 2VG6B 3E51A 1N56A 2BYCA 2DO4A 2OUGA 4HDGA 1TKXA 3P5BP 4X66J 3BGFA 1N0VC 1W7WA 3KK1B 3MAAA 3O5TB 1D1UA 4F3MA 4P7TA 3WQPA 5F8JA 1YJUA 3GIJA 3V6HA 3AT1B 5DQGA 3MCOA 2W9CB 2KT2A 2NPIA 2ZNZA 4ED8A 4EYIB 3M2UA 3K59A 3NGRA 1TL5A 2BE7D 2Z30B 1J5EF 3D28A 3BKUA 2OJ3A 3DLHA 3MFIA 4GKJJ 2D3ZA 1S6OA 4K0KF 3VAHA 3SXLA 4R0EA 3UCUP 3ULHA 3MUMP 4J90A 3CF5Q 3W2WB 2ZDOA 2AJ2A 4LF8J 2O3DA 1VBZA 3Q8QB 3VWSA 4LR7A 4LRAA 4PWDA 2DRDA 1RWVB 1PBUA 4EWTA 3A3NB 3QWPA 1TELA 1ZZFA 4JI4J 3SSSA 1QSYA 2UUCF 1YRXA 1S0OA 2AX0A 4B3SF 5LXRA 1KFDA 2P6SA 1FNOA 2HVZA 3I56S 2R8KA 2DHGA 3JTNA 5IV4A 2HZVA 1IKVB 2BQUA 1Q7YT 1U0HB 3KG4A 4I7FA 1YBTA 4HKQA 4GC6A 5JJBA 1M1GA 2BOAA 4RW6B 4IG3A 1HHTP 1UJ4A 4C8YA 3B6BA 2ZD1B 4URSA 1UVNA 1WOSA 1CC7A 4J9PA 5KOXA 1S1TB 3TARA 4E0DA 4FYXB 2XSFA 4HYKA 1XTZA 4U8VA 2WW4A 3JSBA 4IDKB 1ULRA 2H1YA 2ZUAA 1TKZA 4XK8C 5G0RA 5M2PA 4X4VA 2JEIA 3UCZP 4L72B 1JKHB 3D3BJ 3O2IA 1SJ4P 4LJMA 3FBEA 5L1KA 4PWUA 5CQGA 2B6AB 2H5IB 4NEZA 2XMTA 4CIOA 3X1LB 2R2UA 1X4FA 3IS9B 4L75A 1FK9A 3HKZD 1TKTA 1KP6A 3EXCX 3IRXA 2BUNA 5KFIA 2UXCF 4EU0A 2QFIA 3NEKA 5D0EA 1HW8A 3FZ2A 1RHJB 2XCPA 3GR0A 4TVAB 5C7PA 1HMVB 3EGZA 1X31C 4X84A 5IT0A 1Z2LA 2CZVC 4N7TA 2R8JA 4F02A 3W5YA 5E3AA 2DVIA 4CO0A 2DEJA 3CCQS 3R7SB 3NG8A 2VDHA 1D0EA 3U7JA 2RF2A 3MD3A 3GJSB 1FA0A 2PD1A 3BN7A 1T94A 2WB1D 3DM2A 4NXMJ 3DFEA 3FC9A 4QW9A 1SPBP 4CM0A 1XNRF 1EP4B 4NXNF 2M88A 2YKNB 3T9ZA 2VC0A 5DQHA 1AT1B 4QBUA 3OPKA 4U7CA 2YKOA 2MJNA 4LBHA 1HBMB 3GFHA 2YX4A 4TU9A 3DLKB 4WZMA 1QE1B 2B8PA 1V9OA 4FPIA 1D9FA 5B0FA 1WG1A 3W60A 4PG8A 2VOOA 3TVZA 2F3JA 2B0GA 5IOLA 4I64A 2E7WA 2KJVA 4HL9A 4PXCA 4ER8A 1RQ0A 3A3PB 3BB5A 5KT2A 1XMBA 5D78A 4DV2F 1VIXA 4L76A 5J2QA 4B3OB 3N6LA 4YP3A 4K4VA 1OWXA 1F3VA 4TQRA 4ZPBA 1ZA2B 4QWEA 5A6PA 1Y4ZB 2PMZD 3RBEA 3C6UB 5HK4A 4FYDA 3IMQJ 2NZ4A 1GMWD 2ZEJA 2CJ9A 3OTOJ 2P9GA 1KC8T 5HROB 1SVDA 5DDPC 4J5OA 2CQDA 1RT4A 4A47A 4ELTA 3CUNA 1QUVA 3G6YA 3BZQA 2G13A 2ZWOA 2BEFA 4MKBA 4RU9A 4IRCA 3FEYB 2D3OR 3ZO7A 4H54A 2VPWB 3PIOQ 1FEEA 4FXWA 3C3LA 2B4VA 3OTDA 3JXOA 2YH0A 3KLVA 4RWWA 2KYXA 2VKZG 2MQQA 4ECQA 2KO1A 4F50A 1MN9A 1UVLA 2W7OA 1YWXA 2VV5A 2ASJA 3H25A 3BN4A 1R8AA 2DRBA 3T6JA 4DMZA 2YWEA 4HH1A 1NKBA 3G71S 1UMJA 3CDEA 3T41A 3HT0A 2MMYA 3MR3A 1WC0A 2XS7A 2IC3B 1SC1B 1M1HA 4LBIA 3KLHA 3RU0A 3D6HB 2W2NP 3V5RA 4WTOB 3LGHA 3UQSA 5JVGQ 4P2XA 2XEXA 2QMWA 1VJWA 1NJWA 1VK3A 4XDDA 4DQRA 5BYQA 4ZCLA 1U24A 4WIIA 2CJQA 4ZVRB 1TL1A 1XR6A 4M5JA 2LDYA 3R5BA 5HLFB 2CQBA 2DXEA 4DV1F 1DQ8A 1N36F 2HGNA 3Q24A 4ZMMA 5GADU 4DL6A 1N5YA 2AEMA 5D77A 4DR7F 4KKOB 3R7BB 1WUUA 2DISA 3ISND 5DQIA 3GIMA 4AQYJ 1IBLF 3WZ0A 2DXDA 1CJUA 3SCKE 1WSRA 1LWFB 2D1CA 5CYMB 1C0TB 3OHBA 4JI0J 2AYMA 2ADBA 4GRSA 3R5GA 1H2UX 2ZE2B 4DQPA 2DY9A 1UVMA 3NGDA 1GTEA 3W3SA 4NLYA 3Q8RB 4P75A 1U1PA 2QA4G 4LSNA 1JWWA 3C15A 2C2EA 3FQLA 4ED5A 1CPZA 3KK2A 3SV3A 1T05B 2MKYA 3PX6A 5JUMA 1ZM4A 4ETXA 1ZZNA 3M1VA 4ED6A 3CCES 2ZITA 2KZMA 1F6TA 1JLGB 4KC5A 3CCMS 1RTHB 1HYSA 2WRMA 3W2VA 1VRUA 2WVDA 4KGMA 4ATNA 1FKOB 1LXNA 1RHMB 1DTTB 3ZTOA 3I5CA 1F60B 3KDNA 2HHUA 1Q8LA 1X5OA 1DBDA 1IN0A 1FESA 3OTEA 1HKAA 2BVZA 4FBUA 2VIHA 2WONA 1JIHA 1HQEB 5L38A 1SCJB 2VDIA 1NHVA 3W2WA 5KFMA 1RLCL 4OHWA 3QRRA 4ZP9A 3JTOA 3EXYA 4WKYA 2F4FA 3DRPB 3L95X 2ZKTA 2DNKA 3UNYA 1JLBB 1NPPA 2DGQA 2LMIA 2GHPA 1VCTA 4OZ1A 4O4GB 3HO1A 4IFYB 3HPOA 3K8WA 1IBCB 3H4DA 3G82B 6AT1B 2NLWA 1KEKA 3TWZA 1CJKA 4ED4A 4JI6F 2E5LJ 2VKRA 5SZTA 2MQPA 4X4RA 1RTJA 1IBMJ 2B9WA 4KO0B 2XO6A 3HDSA 4OHVA 4RW6A 1MLAA 3K89A 1F0XA 5H9EK 3Q8YA 4RLEA 4AFFA 5CXTA 3NLCA 3CWJA 4LF2A 2AZ3A 4JYAJ 2IY5B 2VFSA 3P6YC 5BXIA 1WF0A 4E98A 1WEZA 4CLSA 3ZZRA 4IDKA 4YR0A 2WOMB 4DR1J 2M9KA 2W2MP 1JNZB 1G4CA 2DNQA 3IRWP 3PR5B 4DR6J 5AE2A 4X66F 2P5VA 1PJ7A 3IO1A 2B6AA 3QNWB 4FN5A 1OY6A 5GMDA 4KFBB 1K1SA 2C2KB 2ZH9A 3D68A 4U8YA 2CQGA 2HBRB 1JLCB 2IAJA 1PG5B 2J7WA 4DUTA 2CWXA 2EKYA 4Z7CA 4F67A 3IWXA 3QWUA 4M5DB 1N32J 3E8OA 3DHXA 5F8IA 1ZM2A 2HVHA 4QJVA 4DUYJ 4ZVEA 1NK7A 2O66A 4GKJF 1NSKL 4ZCIA 3HZGA 2FZCB 2F40A 4ED7A 5KFAA 4TY8A 5CHCB 4JI3J 1GXUA 2C2OB 2NYIA 5AXMA 1M5PC 4LF8F 2AEJA 1VQSA 3R8YA 1IBKJ 1SH3A 3HVRA 4JI4F 3QRPA 5EUHA 1Q8KA 1OPZA 2MKHA 2CPYA 3Q2SC 2JX2A 2OPRB 1H73A 1EP4A 2LXFA 3AOAA 1LW0A 1VQOS 4DG1A 4MK9A 4RNMA 1C4CA 5K20B 4NA2A 1E6VA 1SKWA 3G6VA 2DH7A 2NSCA 3DLKA 1HWUA 2RILA 4QOTA 1PYTA 2XZTB 4DDFA 2IVFB 1VRQC 2I1RA 2NXJA 2HURA 2XLKA 1JJHA 4ZVHA 2J9DE 2VG7A 2GQ2A 2HFZA 3MPWA 4A8XA 2KI2A 3FCWA 3H40A 2QFJA 1FX4A 1MMDA 5E33A 4U6PA 1RAOA 3DLBA 4Q5VA 1WACA 2XMUA 3D0GE 3SV4A 3FSYA 5ETOA 2GA7A 2ZBRA 4FPRA 3C6UA 5F8LA 3Q8UA 3CTRA 4CRJA 2O1PA 2YQ0A 1Q1KA 3EWGA 1DAXA 4NLOA 2FY1A 1RT6B 1VQMS 2DB1A 2MYFA 3H20A 4YHHJ 2AF6A 4DS5A 1HLWA 4LIRA 1X9MA 4QQBA 2F65A 1Y0HA 1UWBA 5AJ3J 3GQCA 3CJ8A 3SCIE 1ZA1B 3D2WA 3KG1A 2ASLA 3T9NA 2BANA 2NQPA 2VPYB 4P7VA 3CMQA 3N5BA 2QV6A 3FSIA 2QLFB 2RE1A 1UEUA 1NSAA 4F4WA 4DPOA 2CADA 4NXMF 4Z2XA 3N4WA 5IM0B 3GIIA 4RUHA 3DXSX 3KHHA 4O44B 2H65B 2NXNA 1RE1B 2XZWA 1NK6A 3AOCA 4R8UA 3UO0A 1NPRA 4WZQA 4YQWA 2BM1A 2ASDA 4DR2J 5J1EB 2EVZA 2CIMA 5IT9Y 1YJNS 1HNXJ 3CB4A 3MEKA 3ZXWA 2FIUA 1KLMA 2HGMA 4PG7A 5D4OA 3QMQA 4ZHRB 2PA8D 2KG0A 3KK3B 2R7TA 2OPSA 3AOBA 4KQZA 3GP9A 2WVCA 5BJRA 4EI2A 3QLHB 1PJ5A 2QL5B 2R8GA 4BC9A 5L1JA 3W66A 4GO5X 2RS8A 4FNIA 3D6TB 4ZN1A 5ETMA 4ANEA 1QSSA 1S1WA 2K3KA 4DXLA 4TQSA 5HLFA 4I6AA 1UA0A 1WC5A 4WFZA 2QE5A 2DNYA 4TYBA 4LQ3A 3SFGA 5C25B 4Y28C 1EZZB 3TA0A 5KFBA 4DL0C 5BYSA 3CGIA 3BH6B 5AXKA 2HZCA 2ZH1A 1HFEL 3TUPA 1BQXA 1FI4A 3GJQB 3DDIA 1EQMA 4PXEA 1RAEB 2R8IA 4A48A 1VC5A 1LWFA 1LWEB 2RDJA 4URGA 2R7RA 3MCSA 2FJXA 2A1BA 2YQ3A 4OZ3A 2W4DA 4WF9Q 3LWLA 3MPVA 4NCAA 3DYAA 3GZ7A 2N4DA 3HMJG 2O5DA 3M8ZA 1WHVA 1W25A 2QO3A 1NSQA 4B02A 5I42B 3HHDA 4UF4A 5CZVA 1EKRA 3C16B 2MZRA 3S6EA 1UJ5A 3EGVA 2W1BA 1SKRA 4QU7A 1NK9A 2ZHOA 2A6OA 3H2VE 4X65J 3BDEA 2ZBPA 2KRRA 2IBOA 2NYHA 1X9SA 3G8SA 3CCWA 1U6FA 5IC6B 1RA6A 3FRYA 1CS4B 3ENVA 3CVKA 2V2VA 1FKOA 3PX4A 1TVRB 2V8GA 3PRVA 1TTHB 4A8WA 2M4MA 3M32A 2E1PA 3DKDA 4QPTA 4F04B 4AYBD 4WXOA 1Z1ZA 3KG0A 3CD0A 3BDPA 2D9PA 5L8RC 1HBNB 3MM5B 2X51A 2LCWA 1FTCA 4DOZA 5HI7A 3OLAA 2QLWA 3ZTQA 4C0BA 4OYPA 3NMAA 1Q81T 2V50A 2R2SA 2VFVA 4B3RF 2VA2A 3TZYA 1WI8A 5J2PB 4OZLA 2YBVA 3BQ2A 1WC4A 2ABYA 4QYRA 1BHNA 1NCLA 4QWAA 2BE2A 3PO4A 2XMVA 3R2CJ 2DH9A 3PKYA 5CABA 2B4PA 5DDRC 4N41A 3LP0A 4DCPB 1JLFB 2GMJA 4QIEA 2J6SA 2PT0A 3SQOP 4AQYF 3MPYA 3FCVA 5KFWA 2MGZB 4OYWA 1VQNS 2JVOA 2W9BA 1V5VA 4NLSA 5GAEI 3QT5A 2WBMA 2HS4A 3IR6B 4YUDA 3MM6B 2ZH6A 1SXLA 2YNHA 1Q4RA 3T1YJ 3HM9A 5GAGI 1A0OB 3SEOA 4P6QA 1ZS6A 3POTB 1JXEA 2IMWP 4QR2A 2DGOA 5DETA 3EPGA 1IKXA 1LNQA 3Q8VA 2LECA 4QR1A 1XK8A 4DU7A 1JLCA 1FRIA 3PYEA 3QATA 2PGCA 3MR7A 2YTCA 3EICA 2EK1A 2HGLA 4O3SA 4LRFA 4RKUC 1JXVA 4M5DA 2W7PA 1Y11A 3T3FA 3LANA 4TY9A 1J2VA 1KBRA 2EFQA 4QU6A 1UL3A 4NOHA 2X1GA 5KT7A 3PXGa 2J0SD 2CVIA 3HFKA 5IC4B 3CJ4A 4OJHA 5MAOA 5ETNA 4M5KA 4AT1B 3J7AN 4OI4A 5KFDA 3BH7B 3KNAA 2DBBA 2QMXA 4M5HA 4K4XA 2KZZA 1RUSA 5FIIA 2UU9J 3MEEB 3C66A 2VPZB 1QM9A 2A3JA 1EKSA 2WZ1A 4CM2A 5HN0A 2XC9A 4RW8B 1R8BA 2YKPA 5LJ3Y 1IBMF 3SQGA 1JX4A 1OPIA 4EGLA 3V4IA 2H3EB 1IKYA 1NB7A 1X4AA 4DN9A 5A0YB 3GWCA 4EO6A 3UNGC 1OQ6A 2AKWB 5IV3A 2W4PA 3JYTA 4I0WA 1XERA 1O51A 4MKAA 1HQUB 4MMOA 2XM3A 1RT7A 1AZSB 3SYZA 4U95A 2HNYA 4C3MA 3VV2B 4DR1F 3OFHA 4M5LA 3FDSA 1I6JA 2F8HA 2V4JB 3VGVA 2OP5A 3H2LA 2CPDA 4OV1A 2ROGA 2CPJA 4G1QA 3G86A 2LA4A 4EO8A 3H4BA 4FYVB 1RBAA 2KJWA 4ZN3A 1R8PA 3N0VA 3BBBA 2DNNA 1UPPA 3H5UA 3I9ZA 3UR0A 2Q43A 5IT4A 4HHUA 3PZPA 4HI1A 1N32F 1GTHA 3OL7A 1U1MA 2I2YA 1T9YA 2ZKUA 3GR1A 4PAAA 3EPIA 1PAEX 2RHSB 5D6GA 3TVYA 2J76E 4J9RA 2HQIA 4ANCA 3PEJA 1IKWA 3RUBL 3M8RA 4B9SA 1U7LA 4PYAA 4JI3F 4WYWA 1RAJA 2HFSA 2PSZA 4DEZA 5F8HA 1JNRB 2B9EA 3AHPA 4XIUA 4BBYA 2XNRA 4CH0S 1S48A 3TEGA 3EGNA 4PR6A 4RNNA 4LR8A 2CFXA 3P49B 1P1LA 2RKIA 3FJ2A 1AROP 2K1RA 5DZ7A 1NJYA 4OHXA 4KJIA 2QLXA 4B3MJ 2QZ8A 1NDPA 2MLXA 4LMZA 2CYYA 1G6BA 3K5OA 1S6UA 3MM9A 3HLUA 2OPPB 3THTA 3LTOA 3KK3A 3HXMA 1HHSA 3UFCX 4IFVB 4NL5A 7FD1A 3DLJA 3AD9C 4I2PA 3QFHA 3QJPA 3TVKA 4O3QA 4WYLA 3TAMB 3IBFB 3UPFA 3G96A 3K5MA 4F25A 2WB4A 5AXNA 5ADZA 1B70B 3VZHA 4JI7F 3EZOA 4G65A 1I94J 2J8SA 5K14B 1AYEA 1S6PA 1SJRA 3BGUA 4USJC 3TZXA 3M8PA 2R2RA 4DV6J 1HA1A 4A8OA 1DRZA 2LVWA 4R25A 3BYRA 1CG2A 5H9EJ 1SJFA 3B54A 4N47A 2X7IA 3DLGB 1ICEB 3SI8A 2HIYA 3A8KA 3RRKA 4WU2A 4NLDA 4IR1A 3QGGA 2PEBA 1X7VA 4ZA1A 2R7SA 1V3ZA 1LWXA 3WC0A 4FS1A 1R0AB 4YHHF 4MK7A 4HTJA 2CPFA 1HARA 2DGXA 2OFHX 3H5SA 1NDKA 2MKSA 4X2BA 1FDDA 3R1LA 3LP2B 3W62A 4IR9A 5L1LA 1VQ5S 4OI3A 1G1XA 4ZDNA 4PQAA 3O8WA 3QRQA 4NYZA 1VDHA 4PPZA 1KQFB 3PYDA 2EC2A 1FDAA 5IT9U 4B08A 1Q7LB 4DPWA 1CS4A 2VONA 4L74A 5KT6A 1SH0A 2HNDA 1VBYA 1M5SA 4NA3A 5F9LA 4P52A 3ZC4A 2B3TB 4QIGA 3K0JA 4NRUA 2PI5A 4ZVGA 4WP3A 2D41A 3MWBA 1HBNA 5DZ6A 2ZJQQ 1VC6A 1U0SA 3OJSA 3NNHA 2KM8B 1CJVB 4KV8B 2ADCA 1U1RA 5HMYA 1J27A 2DK2A 2R42A 2HEKA 1RGVA 1YX2A 3K5PA 2MHEA 1YHQS 1SV5B 2VBYA 4CCHA 3QT7A 1M90T 4P72A 1IR0A 8AT1B 2F9JA 1S1UA 4Q44A 4NI2B 5F41A 3GPAA 4XTTA 1RT2B 4JBCA 4P10A 2L41A 3BKFA 3DLEB 4Y2IA 2V8VA 2CNOB 5L9XA 2BJDA 3DMJB 4LSZB 1K9MT 3RG6A 1JLEB 3RR8A 4IOAQ 3UDEA 2OMLA 4RUAA 4X4QA 3KLEB 4FS2A 4JI1J 3JQMA 1ACMB 1RKJA 3QPIA 5D4NA 1D8YA 1WG5A 4X4TA 2BJ8A 4OI2A 1ZBTA 1RU1A 4PUOB 3B4MA 5HBMA 1SI9A 3BKTA 3CD7A 2KFYA 2DNGA 1SUQB 4IO9Q 1SJQA 4QIFA 4Q0BB 3KJVA 2XZDB 2N7CA 2G0CA 4KIAA 2ZDPA 3BGRA 3MTJA 1NDCA 2HQ3A 1JLQA 3UN5A 2AEFA 1NO8A 1H2TZ 4YB5A 1JLAB 4LFCF 3VGSA 3FGVA 2XG8A 2ZC3A 2GVDB 1PGZA 2XS2A 4F0KA 2GIRA 3BPDA 3M8YA 2J0WA 4Y65A 4ZJQA 2N3OA 2R7OA 4NE9C 2VU5A 4MKVA 1YSJA 1FE0A 1HL6A 1R6VA 4KB7A 1MROA 3DU5A 4X64F 3I4HX 4OIXA 1N6QA 2UXDJ 4OJ3A 3NS6A 4KH1B 4PWWA 1O6XA 3NOGA 5DG9A 1J5EJ 1EIYB 3H98A 1BQNB 1FJEB 3DOMB 2G1HA 1URRA 1H0HB 3FCHA 4AUKA 4UY85 1REVB 5J2MB 3OL8A 4NCGB 4FF3A 3I32A 1TK0A 2JL9A 4A8KA 1MG7A 3GYNA 1HD1A 1Y3JA 4RNFA 3RJMB 4B3SJ 4C98A 4OI6A 2IVMA 4J91A 2HAIA 1SB6A 1UFLA 3OR1B 4RW8A 2EFPA 3DRRB 1XR5A 2GV1A 1R31A 3OVAA 3BO3A 2Z2ZA 3M8QB 1TUWA 2ZFHA 2RQMA 4YB1P 5CAAA 3OHAA 3OXLA 1DTQA 3AJ2A 2D9OA 3FEXB 1RWWB 3VGUA 2DGTA 1HQUA 1WC6A 2OIHA 3HD1A 4NLRA 1PILA 4ILLA 1T02A 3HSZA 4LBPA 5A8KA 4OL8A 2UUTA 2XBPA 3T1YF 1MSWD 2HFNA 2V63A 1KHVA 2BABA 3CJ0A 1NB2A 1VQYA 1TKXB 1T9VA 1S1VA 3CW2C 1C1CA 3U27A 4C4WA 3MAAB 4ILRA 2HIQA 4ALZA 4B9LA 3OFGA 2PO4A 3M30B 4CLKA 3UN2A 2YQ1A 2YNFA 4DSEA 2GHWA 1RACB 2V67A 1AW0A 4MYTA 1GXLA 2NREA 2UXCJ 4Y3CA 2OMOA 1S57A 2HKEA 4X62J 3EZUA 2V94A 3MM7B 4J9QA 4WE1A 2BXJA 3M2UB 3C46A 2B51A 2XY6A 1UW9A 1UVIA 1NJXA 4DV4J 1JB0C 2MKJA 4ICLA 3OV7A 3HVAA 4F4YA 4ID8A 3IN5A 3U1MA 4ELVA 5LSOA 2M0GB 1RT3B 2WTFA 4PWDB 2Z2YB 4TXSA 2POKA 2OPQA 5I3UB 2UU9F 2U1AA 6FDRA 2IRYA 4IG0A 2Z8QA 1U1NA 1OS5A 5D3GB 3NP5A 2W2QP 2RB7A 4Y6IA 1LW2A 2CPZA 3KWMA 1BMQB 4NXNJ 1FXDA 3Q86A 1X8DA 4WU3A 2DHAA 3K7RA 1Q82T 2N82B 5HATA 3GE9A 3WDOA 2UZAA 4IG3B 4USVA 3IA0A 1RAAB 1VR6A 2YX1A 3QGIA 1OYEA 5BR8J 2IPOB 3BGLA 2XHWA 4GVBB 2NCKL 1VRTA 2FUG9 4JB8B 2MZSA 1UEVA 3SMZA 3UI3A 2J8AA 4QYZJ 2ROEA 4ZVFA 4GMKA 4RX6A 2DO0A 4UUWA 2OSQA 4ED1A 1J5OA 1LWCB 5J2NA 2E7XA 2CQ3A 5G0RB 4PKDB 3HHKA 1NXIA 1WELA 2JFKA 5HJXA 3MAQA 3CDWA 3G6ES 1U8SA 1N0UA 4DFJA 1ZTWA 1TL7A 5KFEA 1HI8A 4O0IA 4ZJLA 2XHCA 2CPXA 1FK9B 5HVHA 2IRUA 2GGPB 4ECRA 1TKTB 3DLGA 3C14B 3O6QA 2FGCA 3IRXB 3MMCA 2PDAA 1JK9B 2HHXA 4ECVA 1VIOA 3TA2A 3KLIA 1S4FA 2LDIA 5KG6A 1WJ9A 1RKIA 3ITHB 3BF4A 2OD4A 2FB0A 1IM6A 3RAMA 4CTAA 3S01A 1JJ4A 3Q0AA 4DSFA 4LR9A 4ZPCA 3LH2S 1L3KA 3LGMA 2KYZA 4I2QA 1RTDA 2ZC4A 2HQCA 3W5XA 5L39A 5K8MA 3RW7A 3U1LA 2WVEA 5JMNA 1PC4A 3DM2B 2CJAA 2G1DA 1PIEA 3MCMA 5KG5A 2VFTA 1X4EA 4B3TF 1S12A 5EX3A 1WI6A 1H3DA 1PO6A 5K5MA 4J9UE 1Q79A 3CCLS 1XMOJ 3OBIA 2YVSA 4C2MA 3FZBA 2YKAA 2W7AA 3KHRA 4LF9J 3HKWA 4FNHA 3KUGA 4U9RA 2BKNA 3AA9A 3HSDA 2FVPA 5ETQA 3EVOA 2P2CB 3HHLB 4DLEA 1CJTA 3R97A 2L9WA 4F26A 3W63A 2XLIA 4K8RA 3LAKA 3KXDA 3V2UC 1HBOA 1Q8IA 4OYBA 2KL8A 4NI2A 4WTYA 3A3OB 4D3GA 1TK8A 4DV1J 1QSLA 1Y5NB 1N36J 3NNCA 1EB0A 5J2QB 1Q16B 1FFWB 3J7YI 1CC8A 2WW8A 1HNIB 4DV6F 1W2IA 1XQIA 3FVYA 3PW7A 3KLEA 1FD8A 2HQDA 2CUYA 1WC1A 3EDQB 3N5FA 3RTVA 5HP1A 4EZ9A 2XB2D 3CDUA 2IIHA 2RAQA 1P1TA 1Z4UA 9RUBA 1U2CA 4LF4J 2E1MC 3UN3A 5CYJA 1SUQA 1S9EA 2GJ2A 4B9TA 1X4DA 1BUXA 2UVUA 4FKYA 2CQHA 1C0UA 1X5TA 2KT3A 4WFYA 4CLFA 3CCZA 2OFGX 2GVDA 2PFDA 5DGBA 2ROPA 2K06A 4YN3B 3PM9A 1YDLA 4I1TA 2VQEJ 2ZH8A 2ASYA 1E6YA 4DLGA 1VQPS 5I3PA 4G1PA 4HVZA 4ZLNA 3OR2B 4ZVQB 4WFNQ 4C9DA 1WHYA 4O3NA 3R5DA 4DX8H 5DO2A 2I38A 3U1NA 2CDRB 1WG4A 3PTWA 5K8NA 2BE9B 1FEHA 3KKFA 4QWDA 3SFUA 3J7A1 2ZNYA 1A9NB 1VHFA 4ECYA 4C8NA 4I68A 1N88A 2UUAF 2VZ9A 3KLHB 3S7RA 2KKHA 2R7QA 5CD4H 3QJJA 3D6FB 2EFOA 1KS2A 2GX8A 4ZP6A 3H2UB 2VASA 4MYUA 4OLOA 2HW3A 1D09B 2HS3A 2AW0A 1FF2A 2A2DA 2V9KA 3GSIA 2ATLA 1N54B 1TL1B 3QBCA 3IAS9 2YY3A 1S5ZA 3DNCA 2NR0A 2LQ8A 4F0HA 1N5YB 4HT5A 2LU1A 2AQ4A 5H9FK 2F8MA 4F0MA 5A8RA 4ENOA 1W2BR 4MH8A 4JI6J 2FTRA 2OLWA 4EK2A 4JI1F 2XYPB 1PYSB 5HL7Q 4YMEA 2BJ3A 1CJUB 1MU2A 4ITSA 3A1YG 3Q8PB 1H38A 3PY8A 5FDLB 4CZCA 1TFYA 1LFPA 4B9MA 2HFOA 1X4BA 2P8IA 2G4BA 4S0MA 2KH9A 2DT9A 4B9UA 3L4BC 1X4GA 1RDRA 4ZVUB 2BM0A 4OHYA 2IM1A 2JFDA 2NSBA 3OTBA 4DX6A 1FNMA 2RRNA 2PI4A 3GV8B 4AL7A 1H6KX 5C42A 4LSNB 3I0SA 2KFZA 2FD2A 3C15B 3CCSS 3MOJB 3KK2B 3FEZA 2A6MA 4NLPA 4ZP8A 3M30A 3QZ7A 2C3MA 3M1VB 3GJRB 2IJNA 3MZIA 2PIIA 2XY7A 2V34A 2HLTA 1HYSB 3W2VB 1VRUB 2VPXB 1G3OA 1UZDA 2UXDF 3MM7A 2QL7B 4WPAA 5A8WB 2X1FA 4JOUA 5DDOC 2DNRA 2HQGA 3D7SB 3M2RB 2WONB 4F4KA 3MEDB 2OKQA 3ZTSA 3H0PA 4GO7X 1QD1A 1B0VA 4H4KC 1RT3A 4C7QA 3NWGA 1W26A 1IQZA 2JZ5A 4NLVA 4KY3A 2BR0A 4TYAA 4XO0A 5I3UA 1KVIA 1RWMB 3EE3A 3N28A 2SXLA 4KH0B 3T5JA 4DUZF 2E66A 4DL4A 5D3GA 3DGVA 3KJNB 3BO2A 4C11B 2KHDA 5HMWA 1CJKB 2QYGA 2RUGA 5HVFA 1RP5A 4EUVA 1RTJB 3GG0A 1FRXA 2EBEA 3IR5B 1YJWS 4LQ9A 4PABA 1R43A 3TZWA 4BWMA 3QSIA 4ZJOA 4GVBA 2Q1LA 4JI8F 3CCJS 2GMLA 1U2FA 4NLQA 3D5MA 4R5PA 3US5A 5KFSA 1B3TA 2XI3A 3BPSP 3M9NB 3NGUA 2GIFA 1HWIA 2B43A 3UCGA 3KFWX 5IQQA 3ISZA 3GONA 2KM8C 2CNLB 1LWCA 3W9HA 4NZ6A 5KFGA 2IYIA 1RWXB 4LRBA 4NWBA 4IQXA 5E3RA 4M63A 3MURP 3D4JA 3QIDA 4PG5A 1KD1T 3PNIA 1TR0A 1NUEA 2MQMA 4DHVA 2OEJA 2GW8A 1TQLA 1RAFB 1B4SA 1F9HA 2I8EA 1CQMA 3CE8A 2MXYA 4K2XA 4NYPA 5HVGA 2IAJB 2W2PP 3MEGA 2GGPA 1YJVA 4KT0C 2KHCA 4TU7A 2N7YA 3SDEA 2B9YA 4FDFA 3C14A 3MD1A 2IDLA 5FLXY 2F63A 4X62F 4I67A 2CJBA 1Q5YA 1T9WA 4Q8EA 3HCXA 1FFSB 1NK0A 3M6VA 8RUCA 2CRLA 2MSSA 2CJKA 4LSLA 4DV4F 2Y9HA 1IJFB 3ITHA 2EK6A 4MIAA 1NKEA 4AL5A 1T9UA 4TY8B 2DHSA 2AJ1A 3E01B 3F73A 4IQMA 2VD3A 2MQNA 2V9WA 2XSJA 2BKPA 1NHKL 1DHMA 1HPZA 3CJ3A 1KN6A 1K73T 3CD6S 2GJFA 4J9NA 3PJWA 2E44A 2PMWA 5KFJA 1LW0B 2KVIA 5KG2A 2HPUA 4DG1B 1WTFA 2CWKA 1E6VB 3KLFB 1MN7A 1U1OA 1SL1A 2E1CA 4P2SA 4CH7A 5KFRA 5BR8F 2IM3A 1UAWA 2ZH4A 4DF8A 3OJUA 4F2RA 1RI7A 1M5KC 3E3XA 2CQ1A 5IQ6A 3OL9A 4HDHA 2QSFA 2XI2A 3B78A 1BXNA 3HHLA 4ZIVA 3MR5A 4A8QA 5KFLA 2QLBB 1FRJA 3FFIA 3RB0A 3NMRA 1XNQJ 2VG7B 1T03B 4TKTA 4DBQA 3WC2A 1HNIA 5KFFA 2XMKA 2GIQA 1S76D 5A2QY 1MWYA 1KQSR 1HWLA 4NZ0A 3A12A 2RS2A 4O0NA 4DU8A 5T7LA 4Z7YA 5KFUA 4LT6A 1F9EB 2LQJA 3K5LA 3Q89A 2GAGC 2MQOA 2AGPA 4DV3F 2B7BB 5CH7B 5T14A 1RISA 2QEXS 3MTKA 2EW9A 1UWBB 1GEHA 3VAIA 4GKKJ 4OX8A 1SIZA 1BY9A 1UW4A 3QO9A 4WKRA 2RUSA 2BANB 2NXUA 1FTRA 3OT9A 2ILYA 7AT1B 4C3LA 3VQSA 3R5JB 2HMIA 2F8EX 1KVJA 4P74A 3OR2A 1TAUA 3EYZA 3HF5A 1S77D 2Y1LB 1B99A 3DOKB 5EGYA 5D8HB 3ELHA 4R8UB 2YXLA 1NK8A 2VB6A 3Q22A 1U1LA 4F3OA 5E2QA 4FVCA 4ED3A 1XMOF 3DXBA 5EDWA 3MDFA 1GMVA 1KLMB 3MECA 1A7GE 2JLGA 2JEJA 1ZPWX 2QJ3A 1Q86T 4LF9F 2R7VA 5BYRA 1PCAA 4NLUA 4C97A 2OPSB 2OAUA 2JNJA 4UOGA 1Y5LB 4B3RJ 1BD6A 1UA1A 4J7CA 2UXBJ 2HHVA 3G2XA 1VGYA 4FZVA 4C3KA 3HSGA 1U47A 1H98A 3IBWA 1TL3A 1S1WB 3VAJA 4A8MP 1TP7A 3TAQA 1R8CA 2MY7A 3ISNC 3LOUA 2KXFA 2GFFA 4JUZA 4MAKA 5LSLA 4JI5F 2V2QA 2CNNB 2OSRA 4USWA 2A10A 3GJTB 2QLJB 2IFXA 3HX9A 1RADB 5HQLA 2YNGA 1RCOB 5JXSA 4JV5F 2AJFE 2I5JA 5JVHQ 5FDLA 3BQ0A 4USKA 2IJRA 3BS9A 1M5VC 2RU3A 4LF4F 4NLXA 2RD5C 2CPIA 1VYAA 3W7BA 1U6ZA 3OTCA 4EBDA 4OV6A 1HNWF 2ZH3A 3DYAB 1NAQA 2HS0A 1CSJA 1R0CB 2BW7A 4CNZA 2KDOA 3MMBA 2HVEA 2IJFA 1JJCB 2E5JA 3PG9A 3ZZ0A 5LM7E 1UEKA 4DI6A 2VQEF 4FBTA 2DGUA 3R1HA 4B9VA 2L9DA 4EYHB 1BC6A 2E5GA 1DFDA 3V6DB 2O67A 2D74B 5GAEU 2Y1RI 4RW4A 2VODA 1Y3KA 5E5NA 3AFGA 2ZJRQ 2FLLA 2HHTA 3M32B 5A8WA 4OZJA 1TUGB 2XMJA 2HAFA 3AB2B 2HK3A 2FHKA 1P27B 3DI6A 5GAGU 1TV6A 4DR3J 4HH0A 4DQQA 1UFWA 2M7SA 2FYXA 3PRBA 3M2RA 1GH8A 1FX2A 5U47A 2O01C 3MEDA 5KFVA 2BJ7A 3T5KA 2E7VA 1IR1A 2J6TA 3OFFA 3I5BA 4NX9A 1B7FA 1P9YA 4CYUA 3NAIA 3T1AA 2V2KA 4USHA 4RW7A 1VOMA 3MHYA 1LQ9A 2XY5A 4W4MA 3I9V9 1R7IA 2BE2B 3L3CA 3D1QA 4C11A 1S1XA 1EARA 2KRBA 3LP0B 4NMXA 5E3PA 1XEZA 3HT3A 2ALZA 4HLBA 2YWKA 2IDEA 4DFPA 1NRKA 1YBUA 3D1HA 1CLFA 2FJAB 2BOPA 3TOQA 1H2VZ 2W9BB 3MOZA 3VALA 2EFGA 1V6HA 3KLGB 4DSKA 3TW0A 3I0RA 2JDJA 4M94A 2C42A 3PJXA 1M0SA 2H51B 2YKMA 3CMAS 3ETMA 2YNHB 3RBDA 5C24A 4NA1A 1ZM3A 4RNOA 2B5JA 4K4UA 3J80Y 2ERRA 1IWGA 3HHLC 4WWSA 3PJ9A 5KG1A 5HJYA 4IRKA 1KHWA 1IKXB 1KLNA 1HHQA 3CC2S 3V4MA 2DY1A 1U49A 3NBPA 4OX6A 2V8DA 3D0IE 3M2VA 3HHLD 1M1KT 2QGFB 5GAHI 5KFXA 2L08A 3MI7X 3FMWA 2YPZA 5SUHA 2HFVA 3OVSA 3DGPA 3I82A 4YR2A 4CT9A 2Q3PA 2J7KA 3A8IA 3FNNA 4CDIA 3QIPA 3L7UA 3E01A 4TU8A 1RZMA 1QAJA 4DSIA 3JB9k 4L6V3 1AFIA 4M5IA 3J81Y 2WVBA 3OUYB 3RRGA 4EZ6A 2HHQA 4ZLPA 4A8SA 3AD8C 3PHTA 2Q66A 4NRTA 2CG4A 4UZCA 3OXFA 3DC2A 1Y5IB 5C2GA 3SQGB 3V4IB 1WHXA 3KLFA 1IKYB 2C1EB 1S10A 3R5AA 2J7UA 3PHEA 2D7SA 2B4UA 2ATCB 3JSRA 4OI1A 1B0PA 3JYTB 4K4YA 3W65A 2GMHA 3VAGA 2C2ZB 2FLPA 3THPA 4DR5J 3EZ5A 1UVKA 4KHRA 5ETKA 1YLXA 1RT7B 4DPUA 1KR4A 5GVQA 1MW7A 1S0NA 3PACA 3H7HB 3G8TA 2HNYB 3MPUB 2V4RA 4MFBA 4N8NA 4FVMA 3FRZA 2Q6CA 1ZPVA 5KFCA 4JI7J 1T03A 3DOLA 4HR2A 3MGJA 3PX0A 1U1QA 3NL0A 2CZ4A 5H9FJ 2CNKB 4PQUA 1KDNA 4ECWA 2YPYA 3CJSA 4G1QB 3THVA 5FLXU 5KFPA 3UVJA 2FVCA 1QY7A 4ZVSB 1CQNA 2Y3YA 3A13A 4J9KA 1FRKA 4CO2A 2D3UA 4FYWB 1MNEA 1SQFA 5AXLA 4URQU 3I55S 4NEYA 2QTWA 2BRLA 1RAHB 1IKWB 4KE5A 1S6QA 4F3QA 2BV3A 3RB4A 2G2OA 2RVJA 5C5JA 4CLLA 2QMUB 5CA5A 3PRDA 1NKCA 1TUVA 5D4LA 4YOEA 3VCDA 1BQMB 3ENQA 1PAUB 3MMAA 4Q43A 3GIKA 2DR8A 3VHQA 2Z0GA 4DWIA 3TRGA 4ZP7A 1FWPA 4MIWA 4FF1A 3ZTRA 5ETRA 2RKIB 3DOKA 3CD5A 3TUIC 5I3QA 4DL5A 2K1RB 5LSRA 2ZJPQ 4TNOA 5K8OA 2ZM6J 5GMKa 1VISA 1GMUA 3J7Z5 1LKZA 3UDLA 1RAIB 1K8AT 2U2FA 3MM9B 3WX4A 2VFRA 3IGNA 3MAHA 2RNEA 4QW8A 3N9UC 5HAOA 1HNVB 2BRKA 2R7UA 4BDPA 4WJBA 3OSPA 3SSRA 4QR0A 5F3TA 3LP1A 2A18A 3MR6A 3JAMY 1T9TA 2G0IA 3PW4A 4M95A 4I2PB 1K44A 3PVXA 1XIQA 4Z37A 4J9LA 3PKMA 4LREA 2LYVA 4PG4A 3W1YC 3TX0A 4IOBA 1T95A 1XNQF 1WEYA 3DLLQ 4OJGA 5KFKA 1ZTTA 1N34J 2ZUGA 5A2QU 1SL2A 5F8NA 2CPEA 2HWIA 1S6PB 1U25A 2HRYA 3FBFA 4UUXA 2VBXA 4RO0A 3M8PB 4Y00A 4HACA 3T1HJ 1RHUB 1IR2A 2RU9A 4JV2A 4Q2MA 3QGPA 2IYGA 3LGNA 4DQSA 4RBUA 5M2UA 1GFWB 3ZZTA 2AMCB 3BEGB 4WK3A 4X4OA 3UD5A 5FJ4A 1SKSA 3LF0A 4GKKF 4WFAQ 3ENWA 3T6BA 3CC7S 3SCJE 1ZYQA 3VQTA 4DX5A 3GCWP 1PBAA 5HO4A 2OO4A 2EFNA 1FKPA 2OI2A 2WAQD 3EM1A 5KG3A 5DM6Q 3DRSA 1S7HA 3IR7B 4LFCJ 4USMA 5D0GA 3H5YA 3AJDA 2C3OA 4IUFA 2AYBA 4KTQA 1TZ0A 2GJIA 2FJWA 4RZRA 3RZAA 1X4HA 3ZNUA 1VQKS 4U7UD 2XYHB 4MIBA 3M9MB 3V6DA 4C0HA 5FD1A 3CDBA 3MM8A 5A76A 2EG2A 2CXEA 2OEKA 3JSMA 2RHQB 1VFJA 2ZHAA 1NU4A 1QAYA 4X64J 2HNDB 3K5NA 2WCXA 2AJ0A 2GVZA 2LKZA 2DNZA 2M5YA 4NYOA 1SJ3P 4OX7A 1X0PA 1OSDA 1L3VA 1B7YB 4AL6A 3HVTA 1YVFA 3BJYA 3OL6A 4O23A 3OSNA 1KQGB 4NLGA 3FMBA 4ZK7M 4GC7A 5KFHA 1LEOA 2YX7A 1Q0NA 1WD6A 4QYZK 2UXBF 2QG9B 2CQIA 4OX9J 2MY8A 2M8HA 1FO1A 3V81B 4ZPVR 4BHQA 1KNZA 4I56A 1S1UB 1VBXA 1MWQA 2B9XA 2KXHA 2GO9A 3OQ2A 3LWMA 1G2EA 4JI2F 1YJ7A 2FJDB 2M70A 4M8LA 3UD4P 3TANA 1RAGB 3I31A 2CA9A 4RBVA 4ETZA 5MLCV 1WOOA 3CULA 4DV5F 1HBUA 4C8ZA 3S1TA 2DNPA 3NCRA 2JRSA 2J0XA 5C2CA 1HR0J 3NGKA 3MUVP 3GU0A 3KLGA 2CQ2A 3B8HA 4K59A 3BSAA 5HBMB 3D54A 3RR7A 3IG1A 3KJVB 4RU2A 3ZFVA 3CJTA 4B9NA 3BGRB 3M05A 1T8EA 2G9OA 1JLQB 4OZ2A 4LFBJ 1UZHA 1FDBA 2E9ZA 5ETTA 3W9JA 3X3UA 2CQ0A 3G8QA 1JMTA 2AX1A 3AJ1A 3QAEA 3UW1A 4L3NA 2DXFA 3M4XA 3KHLA 3HK2A 4OFZA 3CNQP 2BZ2A 4ZS6A 3JS9A 3J81j 3KYLA 1UP1A 3D66A 2MHNA 1NSPA 3VGTA 1LXJA 3TNVA 1C1BB 3Q83A 1MROB 4ID5A 1TU0B 3K8VA 1T11A 1N6QB 4JV1A 3I4PA 5F0WA 3TUJC 3MF5A 3L7PA 4DR3F 2VL1A 3L09A 4PXBA 2VFUA 2W4CA 4NASA 3R6GB 1FVSA 2PE8A 4QCLA 3IM9A 3KOAA 3CJ2A 1OIAA 3J7ZT 2B56A 4CLWA 2MZ1A 1M5HA 2E5HA 2AZ1A 1VQ4S 3WIVA 1SQEA 2GO8A 3OUYA 2VQFF 4RJVA 1O0PA 1V3SA 1RT5A 1U26A 4H4OA 1AXQA 4WFBQ 1ZM9A 2NZCA 1Q8BA 1G7CB 2VH7A 1FXLA 3TEHB 4USUA 5F3ZA 2J5AA 2HG4A 4DPYA 1VHIA 1DTQB 4XPCA 2OEMA 3G6XA 1YZ6A 5B09A 1OYDA 2HNZB 3F0NA 4M1KA 4ZPAA 2I9SA 1EAYC 2LXUA 3NS7B 5A8KB 3J80U 1RT1A 1S9GA 2Y0SD 3NAHA 4EBCA 1PC5A 2VG5A 5B08A 4CO4A 4O3RA 1U8WA 4EFAC 1F9FA 1P8GA 1S1VB 4OI0A 2YNIA 1C1CB 1VQ7S 3N79A 2NXEA 5E41A 2ZBIA 3F41A 3T5LA 4L3KA 5D15A 4F4AA 2YNFB 2HBZB 1XBWA 1RWOB 2HHHJ 2IBKA 1K0VA 1RTZA 3P96A 3IXQA 1SQGA 4J37A 3ILJA 3BQ1A 2H4WB 1X60A 4WE1B 1F3FA 1SC3B 2MZJA 1QJHA 2IVYA 4ICLB 3NY0A 3I96A 3J81U 3PYFA 3MFHA 4CQ1A 3HJFA 3PFOA 2IMOA 2UUBJ 1APSA 3H42A 2HRTA 4J9OA 1BQMA 4BS2A 3PV8A 4PG6A 4ES2A 3P3DA 2OPQB 2JEGA 2AP6A 4IG0B 4DL2A 2DNHA 2L3MA 4OYAA 1CULA 4YY3F 4B3TJ 4P2MA 2RJZA 3CO9A 3M6UA 2W01A 2EBGA 2M2BA 1CBKA 4N76A 1WKLA 3ET6A 1LW2B 2WHOA 2E9RX 4O4RA 2DR6A 4WIQA 2VG6A 2FQQB 3JQKA 2KU7A 4RL1A 2PFFB 5KG0A 4JP8A 1V5IB 2VICA 4TLQA 4IH5A 3M8SA 1HNVA 1N33J 1R89A 4DR5F 3DDKA 3KK1A 2HWHA 1VQ9S 2XGPA 4WXWA 5EN1A 3C2PA 4ZITA 1VRTB 2AD9A 3C6TB 4R0JA 5D0RA 4KRWA 5K9FA 3KJFB 1H7WA 2W9CA 1J5OB 1KOOA 3P8BB 5J2NB 1O5JA 3WBZA 4V1Ak 1RABB 3NRBA 2OGUA 1REGX 3HZEA 3I87A 4BWJA 1TL7B 5DM7Q 2B4OA 4IH7A 3KHGA 2G2YA 2GS8A 3EX7B 2BJEA 1ZAVA 1TKDA 4ZKAA 3M7VA 5HMZA 5ETSA 2V8HA 2FLNA 1R3NA 3ZZZA 3MMCB 2HZAA 2AT1B 2LXIA 3KLIB 4KGZB 1FNXH 4DX7A 1QDUB 3BM7A 1BWEA 1H72C 2XWYA 3PR4A 3PEHA 1QTNB 4KAIA 2ACMA 1S9FA 5D4PA 4CTAB 2JOQA 3J7YU 1IKVA 1U0HA 3BBCA 3HFVA 3CJKB 1R27B 4ZOSA 1ELOA 4I2QB 1RTDB 5KFTA 2I0XA 2VJUA 2ZD1A 2A0FB 2Z4PA 3K58A 3LA0A 2J9DA 4WFXA 3IGVA 1S1TA 2EG1A 3GFZA 2ZM6F 5KG7A 2YKQA 2KT5A 4V19X 1FDNA 3SIPB 5CYQB 2IA0A 1WF1A 2QT7A 3JAMU 1VQ8S 1HI1A 1VBKA 1DJ0A 3UD3P 4CP5A 4P9SA 2IA6A 2IM0A 3CDAA 4AE5A 2UUAJ 1UPMB 1JKHA 3KTQA 4TLRA 1QLNA 4ES3A 4YEAA 3MXHP 4LF5J 1X0FA 1YJRA 3QYYA 1AB8A 2RRAA 3T5HA 3PCOB 3IS9A 1NHUA 1K47A 3MCNA 4I69A 1OQ3A 1CJTB 2E1RA 2V5HG 5E0OA 4GVLA 3V81A 2R7WA 4Y0FA 2MQLA 4OZ5A 4A4JA 1HBOB 2NUHA 1N34F 1MMNA 2F7VA 3CC4S 5B0CA 2BQ3A 4DV0J 1FJ7A 4LRCA 1NH7A 3TA1A 2A2CA 1FWLA 1HMVA 3CIZA 3FBBA 3T1HF 4CT8A 3UWTA 4LIWA 4LVNP 4WP8A 3AQOA 2HSEB 5HP1B 2HHWA 5CCLA 4X4UA 2GZOA 2QRRA 2JH3A 3VAKA 1SL0A 1X9WA 2GNKA 1S9EB 2C2MB 3BSCA 3PDNA 3BR8A 2JVRA 3QAUA 2BW2A 1C0UB 4DFMA 2YKNA 4P2FA 1FRMA 3D1OA 4NMLA 4OJ1A 2MLYA 2LQBA 1IM4A 4ECZA 2FHMA 2C28A 2MZQA 3R6LB 1NNDA 1KQKA 4CLPA 2Z2MA 2QYCA 1HBMA 3GFXA 2C22A 4BLGA 3M6XA 1E6YB 4I6WA 1R6YA 1QE1A 3WX8A 3DN9A 2IM2A 2K7JA 1VLOA 4YFUA 3GSDA 5B0GA 3VR1A 2QA2A 2IHR1 1C1BA 1EETB 4FYYB 4DPTA 3W9IA 1HNZJ 1IUJA 3L7OA 2PA3A 1DLOB 1WKJA 2RIJA 5DLGA 3DRYA 4B3OA 3ZZOA 2J0QD 3ZNJ1 3MMJA 5AT1B 1LK7A 2P9EA 1YK9A 1UVJA 2CPHA 5KAKA 5IWAJ 4OX9F 4AXIA 2QC3A 4FF4A 1LV5A 2DHXA 5HROA 1YTYA 1L5UA 4P71A 3GTYX 4DUZJ 4NLTA 3N6MA 1WEXA 4WK1A 2XLJA 3C8YA 1S0VA 3D6MB 4YDXA 1WTBA 1RYRA 5A8RB 4Q7AA 2XS5A 2GC8A 4KPCA 5L46A 5J1PA 3AA8A 2XGQA 2AWZA 4UTGA 4KGVB 2ZZTA 3RRHA 3R2DJ 1MU2B 4DL7A 1HR0F 4C8KA 3FUYA 2R2TA 1RU2A 2YWWA 3QZ8A 2LEPA 2HNZA 2HBYB 3TJ8A 4JI8J 4E8UA 1DURA 4EMDA 4QPXA 1Y00A 2J9EA 2LP4A 3KUEA 1HWJA 1U09A 5KOWA 4JV0A 1M5OC 3M8WA 3CCRS 2LA6A 1QVFR 2X1AA 4LFBF 1QVGR 3AXKA 1GX5A 2KN4A 4K5RA 4USTA 5C42B 2MJUA 5CZXA 3K57A 2IC3A 3I0SB 3T19A 1U02A 2BA9A 2WVFA 4UW2A 2CZ9A 1FE4A 2DKOB 5D0HA 4F4ZA 1S7IA 1IWAA 1T9XA 2VUGA 2APOA 2ZHBA 3QT8A 2B7CB 3W5ZA 2VJVA 2ZOMA 2RDIA 2FVRA 2R3VA 1YG0A 3DCAA 2BJ1A 2GAHC 3D67A 2QL9B 4KPYA 2Z2LA 2EEYA 4DS4A 2YWFA 3TP2A 3K17A 1N48A 2XCAA 4X4SA 2KVQE 1P9QC 1NZAA 3NCPA 1RB0A 3LW5C 2H5JB 2AYGA 1WF2A 3CEDA 1XMQJ 4KKOA 3NS5A 4YDDB 3M6WA 2DR7A 2FLOA 2M52A 2GQQA 2VC1A 3OTOF 4U67Q 1EQ0A 5KFNA 3HJVA 5IZHA 1FVQA 3UDCA 4DN0A 5CYMA 5M2RA 1C0TA 3SZ2A 3RB6A 1UTAA 2AU0A 3HHEA 3UR3C 3EUNA 2X3DA 5EWGA 2ZE2A 2RMLA 1F1BB 2C2RA 4RUBA 2OTLS 3IWNC 4DQIA 4DCOB 2K8GA 1RHRB 2QX0A 3HD2A 4QZVB 4DZ6A 3QGHA 2FC9A 4J9MA 3D0HE 1KTQA 4NCBA 1B64A 1I5OB 3TX8A 1T05A 1XC9A 4R5PB 2Z58B 2DNMA 3C6TA 4CO5A 2F4VJ 4ZCKA 2MZTA 2XO7A 3NGSA 1JLGA 4CLYA 2CAJA 5LL6d 1RTHA 2JHEA 1URNA 4K4ZA 1TMJA 4KHMA 1WSVA 2COLA 5DGAA 3NCQA 1DTTA 3EVWA 1NBEB 2EWHA 3RB3A 1N5QA 1FERA 5GADI 2J9CA 5HSPA 2WSEC 1L3UA 3TAPA 4ZLLA 1HQEA 3KJQB 2W8KA 3MEGB 3ZZPA 5LMUJ 3SDEB 2QA1A 4Y2MA 2N4CA 2HHHF 3DRPA 3GFYA 2XMMA 1ROFA 1JLBA 4DL3A 1S79A 2KG1A 1NK4A 3OXGA 5F9NA 1CVJA 4O4GA 1TL4A 4IFYA 1I51B 4C48A 4KGXB 4LSLB 4DV3J 4QIVA 4V19J 3G82A 2UUBF 3BV8A 3TJ9A 4F36A 1JQGA 3CJKA 1F5CA 1LK5A 2H48B 4KO0A 2MQ8A 3M9OB 3SCLE 2XSJB 4Q2LA 1HPZB 5CCMA 1RA7A 2IRXA 2DITA 1GK8A 2MKCA 3RAXA 3LPEA 2LEBA 3KDOA 4UY8T 5F8GA 4JI0F 4CWBA 4LF6J 3IBCB 1F5BA 4C8OA 5CYQA 9ATCB 1N8RT 1L3TA 2ZWPA 1ZAXA 5IS2A 2WOMA 3CJRA 1HD0A 2HK2A 1YZ7A 1FRHA 1N33F 3NKYA 2PN6A 2GQCA 1RWUA 3C19A 3EDRB 2RQCA 4LF7J 4ZVPB 3AB4B 3QT6A 4KFBA 1UWAA 2HLUA 4DV7J 2Z56B 2PEHA 4OQJA 3OD2A 3FFIB 5A6WA 4DZDA 2KB2A 2K7KA 4ED0A 1NJIT 1QUPA 4L73A 5HANA 2C3UA 4JI5J 3IFEA 2C2DA 3VAMA 3IM8A 3IWLA 4O3PA 3GYGA 1VI7A 4K4TA 4JV5J 2G0JA 5T7LB 1YJTA 2XQCA 1U4BA 3O44A 4C8MA 1OO0B 4F4XA 2NUUG 1RYSA 4LFAJ 2ILZA 1HNWJ 4N8OA 3CIMA 2OPRA 4HI2A 5E3QA 3EVMA 2FJVA 5THWA 2E5LF 1R8HA 3QO9B 4OYZA 1D3WA 3PW0A 5DG7A 1U48A 1RWNB 1RJJA 1BLUA 2RQKA 5KFQA 4UT4A 4I6YA 1HI0P 2HMIB 1DQ9A 2HFUA 1NH8A 4K5SA 4CLUA 1K0TA 2DTJA 1SH2A 2HBQB 1FRLA 2QN6B 4JYAF 3NXZA 2FPHX 3JSYA 4O3OA 2JC1A 2DRAA 1RBLA 1EETA 2UVWA 2EI5A 3HP6A 3K2YA 4MKYA 2EKNA 1S59A 2MPUA 1Y7PA 5KT5A 3MR2A 1DLOA 4OMFG 3PO5A 2OTJS 4WCEQ 5DG8A 2DR9A 2LFVA 2ZOGA 4DR6F 1RLDA 2AV5A 3TI0A 3MECB 3TYTA 1KVKA 2R8HA 5AE3A 5L9NA 4LF5F 4DF4A 4OYMA
chains in the Genus database with same CATH topology
2BV3A 3CDEA 3AAWB 3RB4A 2MMYA 2RQ4A 3MR3A 2DGTA 1HQUA 2RVJA 5C5JA 2OIHA 2XS7A 2IC3B 4NLRA 1NK5A 1PILA 4ILLA 2UV8G 1T02A 5CA5A 3KLHA 1TL3B 3PRDA 3RU0A 4H4MB 2YWGA 5A8KA 4N56A 1RT6A 1TUVA 1NKCA 5D4LA 3V5RA 4YOEA 2NS1B 3VCDA 1BQMB 4OL8A 2JC0A 4DV0F 3ENQA 3MMAA 4Q43A 3UQSA 2UUTA 2XBPA 3GIKA 5JVGQ 3T1YF 4DUYF 2DR8A 1MSWD 2HFNA 5KT3A 3IC1A 2XEXA 1KONA 1KHVA 2Z0GA 2BACA 4DWIA 1DZ5A 2BABA 3CJ0A 5DRKA 2WSCC 3TRGA 1JXLA 4ZP7A 1YRTA 2QMWA 4RNHA 1VJWA 4MIWA 1VQYA 4FF1A 1TKXB 1NJWA 1S1VA 3BR9A 1VK3A 2RKIB 4XDDA 4DQRA 3DOKA 3CD5A 2PMHA 4ZCLA 1U24A 1C1CA 5BYQA 3TUIC 3U27A 5I3QA 2K1RB 5LSRA 4DL5A 4ILRA 4C4WA 4WIIA 2HIQA 2LLZA 2CJQA 1TL1A 2ZJPQ 4TNOA 1XR6A 4ALZA 5K8OA 4B9LA 3OFGA 5GMKa 2LDYA 2YNGB 3R5BA 5HLFB 2PO4A 3M30B 2CQBA 3Q23A 1AFJA 2I5JB 4DV1F 1DQ8A 3J7Z5 5LJ5Y 1N36F 1IBKF 1QTMA 1LKZA 2ZVSA 2HGNA 2YNFA 3UDLA 3Q24A 4ZMMA 5GADU 4DL6A 4DSEA 1N5YA 1K8AT 2GHWA 2U2FA 5EHHA 3MM9B 3WX4A 1AW0A 2VFRA 3IGNA 3BREA 3MAHA 2RNEA 4ED2A 4QW8A 3N9UC 4MYTA 4USIA 1GXLA 2NREA 5D77A 5IM0A 4Y3CA 2OMOA 4DR7F 1HNVB 4KKOB 2BRKA 3EZUA 2R7UA 2V94A 4BDPA 1RTIB 2DISA 3MM7B 4WJBA 4J9QA 4O44A 3OSPA 3SSRA 4QR0A 5F3TA 3LP1A 2A18A 4WE1A 2BXJA 3ISND 3M2UB 5DQIA 3MR6A 1AUDA 3JAMY 3MUTP 1YITS 3C46A 3GIMA 2B51A 3PW4A 4M95A 1IBLF 3WZ0A 2GHVC 2ZH5A 2XY6A 3OW2R 4I2PB 3PVXA 3SCKE 5DJBA 1UVIA 4Z37A 1NJXA 1LWFB 4J9LA 3PKMA 2WK4A 1JB0C 2MKJA 4C8LA 4ICLA 5J1EA 2LYVA 2D1CA 3MMBB 4OZ0A 4PG4A 5CYMB 3OV7A 4IOBA 1C0TB 3OHBA 3HVAA 4F4YA 1VQLS 1T95A 4ID8A 1XNQF 3AH6A 1WEYA 3IN5A 4OJGA 3U1MA 3DLLQ 1ZAWA 4ZHRA 4ELVA 5LSOA 5KFKA 2AYMA 2M0GB 1ZTTA 2ADBA 2ZUGA 1H2UX 1RT3B 2WTFA 2ZE2B 4DQPA 4TN2A 4PWDB 1SL2A 5F8NA 2CPEA 2HWIA 1S6PB 4TXSA 1U25A 3CCTA 2MB0B 2LQ5A 1UVMA 3NGDA 2POKA 1GTEA 2HRYA 1XR7A 4PXDA 4UUXA 1C2PA 2X1BA 3W3SA 2OPQA 3QLHA 2VBXA 3BO4A 5I3UB 4RW4B 1I1GA 2U1AA 4NLYA 6FDRA 2UU9F 3M8PB 2IRYA 4IG0A