2H65B

Crystal strusture of caspase-3 with inhibitor ac-vdvad-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords caspase-3, p17 subunit
publication title Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h65B00
2C2ZB 2QLJB 2FQQB 2QLFB 2P2CB 1I51B 1RWOB 3P4UB 3R6GB 1RHRB 2C2KB 1RHJB 1RWWB 3R7NB 3GJQB 1I3OB 2CDRB 2Y1LB 4ZVPB 1PYOB 4LSZB 2C2MB 3EDRB 1IBCB 2H5JB 2XYGB 1RWMB 1RHUB 1RHMB 4ZVQB 2QLBB 3IBCB 3KJNB 4DCPB 2XZDB 1BMQB 2HBRB 3D6MB 1RE1B 2C1EB 1F9EB 1SC4B 2H54B 2XYHB 1RWNB 2Y0BB 1QTNB 2H51B 2CNNB 3NS7B 2HBQB 1RWXB 1RWKB 1QDUB 3GJRB 4ZVSB 4ZVTB 4ZVUB 2H4WB 2CNLB 4DCOB 1SC3B 2HBYB 3R7BB 2XZTB 4ZVOB 2DKOB 1RHKB 2XYPB 2CNKB 3SIPB 2H48B 5IC6B 3GJTB 4ZVRB 1GFWB 3R5JB 3KJFB 3R6LB 1RWVB 3P45B 2QL9B 3KJQB 1ICEB 3D6FB 3R7SB 5K20B 2QL7B 1PAUB 2H5IB 2CNOB 2QL5B 3IBFB 3GJSB 3D6HB 1RWPB 1SC1B 4JB8B 1NMEB 2CJXB 3QNWB 2CJYB 3RJMB 4DCJB 2H4YB 2C2OB 3EDQB 2H65B 2HBZB 1RHQB 5IC4B
chains in the Genus database with same CATH superfamily
3QAEA 5KFRA 1SQFA 1WOSA 4UY8T 4LUBA 1H72C 3MD1A 1DTTA 5KT7A 4LF8F 5GADU 3Q8RB 4X4SA 2MQ8A 3WDOA 2IDEA 4RUCA 3FVYA 1MROA 4DPTA 5LJ3Y 3CGIA 4CYUA 5L39A 4B3OB 1F9EB 2LQ9A 1FFWB 3M8RA 3VGUA 5LXRA 2HNZB 2IM1A 1M1KT 3FUYA 2CZVC 1EJ7L 1HD1A 3TX0A 4F4ZA 4FF1A 4UZBA 4NI2A 3M4XA 3HHLC 2ZKUA 3KKFA 4L76A 2ATLA 1PC4A 1T8EA 2R7TA 2DITA 3CNQP 1SI9A 1V5IB 2Q1LA 2NXCA 4GVBA 1HPZB 4HHUA 3DLEB 3NOGA 1JJ4A 4H4KA 3H2VE 5CZVA 4DV5F 3G96A 4ZCLA 1JLGB 4RNNA 2MKJA 3NGTA 2B4OA 4NYOA 1HFEL 2Q79A 2XSJA 3PW5A 1WWHA 4KY3A 1WC1A 1YRTA 4Y2KA 5JXSA 2A2DA 4DR3J 5B0GA 3H5XA 1U24A 2LU1A 5M2PA 2OTJS 3F0NA 4B9VA 2MY7A 1RB0A 1XIQA 3JSBA 3UVJB 2BX6A 4MK8A 1V3RA 4NCGA 1QUVA 1RWKB 2GA7A 3RTVA 2BR0A 1NK0A 1ZM4A 4NWBA 1T02A 5CHCB 2BZ2A 4ECSA 3OVBA 1Q78A 4USWA 3NG8A 2QO3A 3R6LB 6FDRA 3SQGB 2KZMA 4L3NA 4C3MA 2JX2A 3KJQB 1ICEB 4IKAA 5EGYA 2BKNA 2XS5A 3KLFA 2UUCF 4NE9C 1WDDA 2FJEB 5E7OB 2V6AA 2ZFHA 1BHNA 3BV8A 1SVDA 1U6FA 2P6TA 1EHWA 1P27B 1FJGF 3NXZA 5IWAF 3HFVA 4ERDA 1REGX 2QYCA 1M5VC 4OYWA 2LLZA 4DUZJ 3PYGA 4I7FB 3MPVA 4CM0A 4ZCKA 3HKWA 3DRSA 1SL1A 4YDDB 2H5EA 1Z2LA 1RE1B 3M8ZA 2CUYA 4CNZA 4ECZA 4FYDA 4AL7A 2UUAF 4FYWB 4DFPA 1X9MA 1PILA 4DV0F 2HZCA 3HHLD 4QYZK 3I5BA 4FP9A 3W5ZA 5E0OA 1X5PA 3MCMA 1KOHA 2DD8S 2KKHA 2M5YA 4E2FB 3E2EA 4FXVA 5A8KB 2O5DA 2J76E 4ZIWA 1YJVA 4IFYA 4PWWA 2Z56B 5A8WB 3SZ2A 3TW0A 1JKHB 2A6OA 4ANCA 1ZAWA 3PX6A 3MM7A 4I2PA 4PXDA 4RNFA 5L9NA 2K1RB 4ECRA 1HNIB 4WK3A 3O2IA 2J6SA 2FVPA 3R7NB 3MDFA 3DU6A 3IM9A 1Y5NB 2V4RA 1ZAXA 3BR9A 4IRDA 2XY7A 3CTRA 4NLDA 3D0IE 2OMLA 2A1BA 1U6BA 1XMQJ 3FCWA 2D3ZA 2VG6B 4PPDA 2UXBJ 5IV3A 3MEEA 5K5MA 4F04B 2V8DA 1H0HB 2VA3A 3MPWA 1C0UB 3DI6A 3DLHA 3EZUA 1GMWA 3DDNA 1VDHA 2ZOFA 1FKAF 1CQNA 4B3TF 5A6PA 1JIHA 5DZ6A 2V8VA 2XM3A 4PXBA 4A4JA 3K5LA 3N28A 2R7RA 3IBFB 1O5JA 1NK7A 3MEDA 3L95X 1H6KX 3UWTA 2H65B 2PA3A 2ZUAA 3EGVA 4V19X 2HHPA 1HBMB 2NYHA 1NKCA 3JXOA 4O3QA 4A8SA 4LFAF 3DU5A 1IKVA 1QLNA 1O6XA 3JYTB 3FQLA 2HHUA 2BA9A 1ZYQA 3KLEB 1C0TB 1N0VC 4Y00A 1JLCB 1YRXA 1TV6B 2B6AB 2XTJP 2F4VJ 3DFEA 2NZ4A 2P9CA 3KUGA 1TL1B 2DGVA 2MLYA 4YEAA 5DG8A 2AGPA 2U1AA 4UF4A 2HGMA 3Q23A 1FX4A 3ILLA 4RJVA 4J9MA 4U8VA 3RAXA 1F5CA 2SXLA 2E7WA 4LF6J 4ZPAA 5AT1B 5C2GA 5IT9U 4LF8J 1S6OA 2RKIB 1KS2A 1S1WA 3ZFVA 1RAJA 2GVDA 2DB1A 1F3VA 2QL7B 2VIHA 5EX0A 2CQ0A 3HVRA 2VFVA 4JB8B 1S1XB 3HZEA 3QZ8A 2BACA 5EX3A 2BW2A 2BJ9A 3DGVA 4C3KA 3GU0A 2NR0A 2HNYB 2P9EA 1EP4A 1NPRA 4F4XA 4K5SA 3OBIA 4B17A 2DH9A 1FFGB 5CXTA 3KLHB 3K17A 1DTTB 3EDRB 3ZTSA 1F0XA 1DARA 1U6ZA 3DRXA 4GMKA 3TJ9A 5EWFA 3MZIA 5G0RB 3GWCA 4TY8A 4DV5J 1NB2A 3DLLQ 2GV1A 4ENOA 4L3KA 2CPXA 4FS1A 2XZTB 2OP5A 3LGHA 4NI2B 2O67A 3RU0A 2FJBB 3M8PA 1U7LA 1S72S 4WCEQ 5F8GA 2KYXA 3KG0A 1TMMA 4EBDA 2OPRA 2CNOB 3QYYA 1T9XA 2AT1B 3ONQA 2HHWA 1UWAA 4LF2A 4NZ0A 3HHKA 2B4VA 2HQ3A 2FVCA 1XTZA 5EDWA 4K50A 1XBWA 5I42B 1NKBA 2GIQA 2AIRB 3BEGB 3SDEA 3D3BJ 3GB0A 1JNRB 2R3VA 1S59A 5HP1A 1KD1T 1HNVA 2MJUA 2P5VA 3THPA 4ZVGA 1EQMA 2UUCJ 4DLGA 1WI6A 1MNEA 1LWCB 4IG3A 3HVTA 2YKPA 1BC6A 4J9RA 4NCGB 2HAIA 2EFVA 4F3QA 1FJGJ 3ZZ0A 5IWAJ 2H48B 2WONA 1IJEB 2PFDA 2F8EX 1LWEB 4OYPA 2BANA 3JS9A 2VODA 3VGVA 3NNHA 2L9WA 3O44A 3PHTA 2XMKA 3P6YC 5L1JA 4EK2A 3SBMA 2QA4G 1VI7A 3PHEA 2AU0A 4A8XA 1YK9A 3M9MB 1H2VZ 1UTAA 5FD1A 2IM2A 4QIWD 2UUAJ 1ZPVA 4YY3F 4DV0J 3KWMA 3PACA 1UW9A 4ZITA 1BUXA 3FSXA 1S97A 4J9PA 3VWSA 2VA2A 5LXYA 3H98A 2QA4S 4O3NA 4DL3A 2QLBB 5C24B 2HK3A 4HEA9 4ZPDA 3RGIA 1QY7A 4DZDA 4Z7CA 3SFUA 4QR2A 4F2RA 4NA3A 2OO4A 4B9TA 1FKPB 3MFIA 4IH7A 4HI1A 4K4SA 3NGKA 3D0GE 3UN5A 2F5GA 5J2MA 2DCLA 2V5HG 1U1KA 3M30A 2H1YA 1CS4B 4DOZA 3NAHA 3IWXA 4OZ1A 2HVEA 1J2VA 3MWBA 4XTTA 3LQVA 1CJKA 5HK4A 1KLMA 4Z2XA 2ZH6A 1OO0B 4ZVRB 5KFIA 4PUOA 3OFEA 3QO9A 3NOCA 3W1YC 3AA8A 3AHPA 1NJIT 4IFVA 1P8GA 2HVDA 3W8PA 5CYMB 5IT0A 1JQGA 1RXOB 5HQ8A 4OX8A 4YB1P 3CEDA 2H4YB 1RABB 4KFBB 1UZHA 1RI7A 2LXFA 1FK9A 2MTLA 1I51B 2CQHA 1NLKL 5CCLA 4QWDA 2FB0A 4DL4A 1EETA 2IRYA 4B3TJ 4IQMA 4ZP8A 5E3QA 1B64A 1GMWD 3WZ0A 5D78A 4WKRA 1IBKF 2IJRA 3JQJA 3WHIA 1V6HA 4U7CA 2BVZA 2W2QP 5HVHA 2PN6A 5DGBA 4CLPA 1FXRA 1TKZA 5K14A 3HFKA 3MEEB 4LFAJ 3N4WA 4ILMA 2DVIA 2Z57B 3DI6B 4Y28C 3F73A 2Y1IA 2N4CA 4J9OA 5IZHA 2Q66A 5K8PA 3SSSA 1J5OB 3RBZA 2QRRA 1B3TA 2BJ3A 1VQ9S 4BWJA 4DLEA 3AD8C 1OQ3A 2OJ3A 1T9YA 3M6VA 3FBBA 4ECVA 5KFAA 1VBZA 1X9SA 2EFGA 1YDLA 1JXEA 4ECYA 3ISNC 3GJQB 2DGXA 2NPFA 2EFOA 3SSQA 2BOPA 1B0TA 2ALYB 3T5HA 3TVKA 4X62F 5GMDA 1GQEA 4C8OA 1TU0B 1EZZB 6FD1A 3GJRB 5IV4A 4F26A 4N56A 4C11A 4NA2A 3NMAA 1IM4A 2CNKB 1NKEA 1LK7A 2CQCA 2GJFA 2LDYA 3RW7A 4ZPVR 3FSYA 3R8YA 3TA1A 1MSWD 5L8RC 1P9QC 1KVIA 1CEZA 1N52B 3EWGA 3OFHA 3PFEA 2X7IA 2G2YA 3FGVA 2GVDB 1B70B 2GMHA 2XWXA 3KDOA 1FRMA 4IO1A 4C2MA 4ID5A 2NXNA 1S0VA 4ZLJA 2WHOA 2QLWA 1JB0C 1IKWA 3MPDA 4CTAB 2COLA 2OEKA 2YKMA 3I56S 1HHQA 3B4DA 4O44B 2CPJA 4P6QA 5DGAA 4PG4A 5H9EK 4K7QA 2FC9A 4P74A 4JI3F 1FXDA 3BZQA 4YHHF 2NXJA 3D3CJ 3PY8A 3T6BA 4DMZA 4OZ2A 4XDCA 1V3SA 2MGZA 4AT1B 3ILJA 1I5OB 3HD1A 2YX1A 3BBFA 1RT2A 4ZN1A 2EFNA 2BE2B 4DX6A 1X4DA 4ZVOB 2L08A 4PYDA 3POTB 3J7Z5 2AV5A 1SPBP 2OPPB 1KN6A 4QR1A 1RWVB 4ED3A 2FJXA 3KLGA 3LPEA 1MWYA 1FD8A 2V9KA 3A4TA 3Q83A 4ILRA 4HH0A 1VQ8S 3CDEA 3OTBA 2Y1JA 4Y2IA 3GZ7A 3KG1A 3EDQB 5D0HA 4ZIVA 4ZOSA 3QRPA 4HDGA 4GC7A 1VK3A 4J9LA 4DPXA 1UMJA 1FJ7A 3D66A 2DGUA 3ISND 1DJ0A 5U47A 3EMTA 2P9GA 3UN2A 4ZVHA 1Q5VA 7FD1A 2X51A 4CNYA 1YI2S 4H4MA 2LA4A 1N5YA 3MHYA 1HNVB 2KRRA 4HHHA 5KFGA 4F4KA 1LWXA 4EFAC 1F5BA 4EYHB 3R1LA 2ILZA 3MM6A 4Q2LA 3QRRA 2CADA 2R4FA 4OZ0A 1U1LA 2MHNA 1NK6A 3CMAS 3TAQA 3M8SA 4YY3J 2HAFA 3OXFA 4IOAQ 2K3IA 3DRRB 4OI4A 1CULB 3ZTRA 1IBLF 1UL3A 2ZH5A 1BXNA 1SKWA 2ZBCA 4O4RA 1VISA 1VRQC 4YP3A 1UAWA 4QPXA 5D3GA 3Q24A 1HWKA 2QEXS 1IWAA 3QGPA 1YIJS 1SJ1A 1G7CB 4DSFA 5HN0A 3EVWA 3MR5A 2ASDA 4GRSA 3PCOB 1Y3KA 3UD4P 2GHPA 3ETMA 2L9DA 3K5OA 3KOAA 3H2UB 5T14A 1FJCA 1IQZA 4PZVA 4LSLA 1HQEA 2F9JA 4WP8A 4CP5A 4UOGA 2V69A 5K8OA 4ZHRA 4P7VA 3CDUA 1Q79A 1XEZA 1MW7A 2JLFA 4DV7F 3LW5C 1HW8A 1VQNS 2GGPB 1PC5A 2J0WA 1DLOB 2MB0B 3UDVA 4GKJF 1XNQF 5CAAA 2BJ1A 2NXEA 3HT0A 1P1LA 2K7JA 2N3OA 2MKCA 4CCHA 4QBUA 4RW7A 2DY9A 2FYXA 2J6TA 4AQYF 3G71S 4RO0A 5KFBA 3VGTA 3K5NA 2JVOA 2F7VA 4TVAB 1FJEB 2E44A 2OEJA 3R3TA 1YSJA 4WFZA 3A8IA 3H5SA 1IBKJ 3R2DJ 4LF1A 4DV6F 4K4ZA 3L3CA 1FI4A 3CF5Q 2JZ5A 4ZPTR 3V6JA 4JI2F 3DLKB 3ZZYA 4EBEA 1T95A 1R0BG 1B99A 3PKYA 2HHXA 3C6UA 3A13A 1IKXA 3AAWB 4DJBA 4PRFA 1CJUB 3MAAB 1X4FA 5LSLA 2FIUA 3P5BP 1ROFA 2DNQA 2MLZA 2L3MA 2LXUA 5D0EA 2IVYA 2PMZD 1R43A 3GIKA 2LP4A 3H4DA 3ETOA 4C48A 3TUIC 4BCAA 2W7AA 4ZDNA 4NRUA 3CIZA 4HKQA 1VQ4S 5K14B 4I6WA 1GFWB 3UR3C 1GEHA 1QE1A 3GTYX 4RW4A 2LQBA 4OJGA 5HL7Q 2C2RA 2N7YA 2W4PA 4X62J 1XMBA 3TVZA 3DKDA 1Y00A 4NLSA 3GLJA 4TQRA 2OSRA 2VF3A 3M2UA 3PO5A 1UVLA 1TVRA 1S9EB 4ECQA 3WC0A 1R8BA 2E7XA 1K0TA 1IR1A 3TA0A 1SJQA 2XMVA 3LP0B 2B5JA 3QMQA 4A48A 2CPYA 4OX7A 2XMAA 1FWLA 1U02A 1RTDA 4DR6F 1TAUA 1I3OB 4F2SA 2CJ9A 2MXYA 1G4CA 3LGMA 2JJ4D 1T9UA 1N56A 5HATA 3QGGA 4HYKA 4CLKA 3BKUA 2VBWA 3JSYA 2RS8A 1HW9A 4LMZA 2ZBRA 2DTJA 3T3FA 4QIEA 4DL2A 2M4MA 2MY8A 4QCLA 4C11B 4G1IA 4RW8A 4USJC 3S1TA 2PEBA 1TKXA 5ETQA 1HLWA 3OXLA 2VFUA 2YKNA 3CJRA 4LQ3A 1VIOA 1KVJA 4ECUA 3E01A 3P45B 4DL7A 3FFIA 1FRJA 2M3DA 4C8KA 3AB4B 4YHHJ 1SIZA 2YNFB 1VQOS 1D1UA 1AB8A 1OSDA 3ZTPA 4CDIA 4RX6A 4MFBA 1YGYA 3ELHA 3FBEA 4UY85 1RHRB 1IKWB 2YKMB 1NK4A 4PG8A 2NZCA 4BS2A 4I56A 2V4QA 4DG1A 2Y0SD 2EVZA 3AA9A 2FHJD 2YNGB 1IXKA 2EC2A 4N5SA 1X31C 4WZMA 3KLIB 2F65A 3SCJE 4L72B 1HARA 3ICLA 4AFFA 5KT2A 3C6TA 4TLQA 3MMCB 1NJZA 3W2VA 1TL7A 5GAHI 5ITHA 1RT2B 3IWNC 4ZP9A 1ULRA 2G1DA 2IBOA 4KC5A 4R0JA 2KH9A 2DNYA 4JI7F 4K4UA 3H20A 4ZLNA 3QT8A 3GFZA 2VG7A 4IR1A 1TUVA 2YNHA 3FBCA 1Q82T 4B9SA 4DCJB 3HMJG 3KK2A 1K47A 2E1PA 4KHPF 1RT5A 3R6GB 3M9NB 1YTYA 4JV0A 1NHVA 3R9LA 4UOHA 4F4YA 3CCJS 2XLIA 5J1EB 3B54A 4IUFA 1HWUA 4MKVA 4RL1A 4N41A 4O3SA 4MMOA 1IBLJ 2BJEA 2LMIA 3CJTA 3R27A 2W4CA 4CRJA 4B9MA 2M8HA 1ZETA 1LW2A 1N5YB 2DIUA 4F7VA 2J8SA 4OV1A 4TQSA 2DEJA 1ZA1B 1NK5A 2DGOA 2DPIA 4FXDA 1G6BA 2JNJA 4NX9A 1IBMJ 4N7TA 1U1MA 4ZJOA 5KFCA 1KQFB 2RDDA 2I5JA 2J9CA 2CQ2A 2V34A 4OZJA 3DOLA 3VGSA 3IC1A 3GYGA 3MAQA 2IY5B 1K44A 3PDNA 5J1NA 3RRGA 2KG1A 2YWHA 1RAGB 5F8HA 3QLHB 4DV7J 4DV1F 6AT1B 4USKA 4AL6A 4JI8F 4DQSA 4WFYA 1K73T 4GKJJ 1XNQJ 1LXNA 4O0NA 3TNVA 4OIXA 1YRUA 3CJKB 3D28A 4CO1A 1K8AT 2MZ1A 2C2DA 1RZMA 4B9NA 2IPOB 2JEJA 4AQYJ 3V6HA 1PYOB 3LGNA 3R97A 4CT8A 2H5JB 2HEKA 4LSLB 1HQEB 3ZO7A 3IRXB 1BWEA 1KBRA 1RT1A 2J9DE 1WACA 1OY8A 1T05A 4ZHRB 1D9AA 1WEYA 3CJ3A 3FBFA 2Y8WA 4YB7A 2W01A 1TTHB 4NCAA 4X65F 4DV6J 1T9VA 5THWA 4YOEA 1X60A 2DO0A 3KUHA 4B9UA 1M1HA 4JI2J 2GJ2A 2XMMA 1FEHA 3DXSX 2HFOA 2KZZA 4DSEA 2D9PA 3JQMA 3ENVA 4ZVFA 4E98A 1XR7A 3SMZA 1N88A 3D67A 4C9DA 3ENWA 3C16A 4RW6A 1JLBA 1R8HA 3JSMA 5KTQA 2E5IA 4RWXA 1HI8A 1RTJB 3UDEA 5C7PA 2VQEF 4DN9A 3BGFA 5J2NA 4LVNP 2BQRA 3RYLA 3KTQA 1OY6A 1OWXA 2GC8A 3UE2A 3S8SA 4CLLA 4F3MA 3HSDA 3AXKA 3PJ9A 2E29A 1T03A 3MPYA 2OD4A 2E5JA 5H9EJ 4WYWA 2F8HA 4J9UE 5CQGA 2CQDA 4YR2A 3NNCA 3THVA 2DNRA 3I82A 1QD1A 4ZVSB 2LEPA 5CYQA 4CH0S 1S7IA 3OL8A 5KFTA 3DLJA 1NO8A 4U6PA 1XJWB 4H4OA 2VZ9A 3L7UA 4DPWA 1YG0A 2MZJA 2PMHA 3W65A 2ZH3A 2CVIA 3IM8A 4DR6J 1W2BR 1XR5A 1AW0A 4DX7A 4USMA 2YWKA 2D1CA 1JJCB 4KKOA 4CLYA 4WIIA 3I4HX 4DL6A 4NXMF 1QE1B 3PXGa 3FDSA 4RU2A 2LFVA 4RW4B 3TZXA 2OLWA 2IJNA 1KLNA 4DPOA 1RU2A 3GYNA 4LBHA 2JWNA 2BRKA 1X0PA 3FRZA 3G6YA 4K8RA 2XQCA 1RWOB 1TVRB 4PWUA 4ZLLA 2B5JB 4A8MP 2JSXA 4OJ3A 1SKSA 1IBCB 4DS4A 3KJNB 2V8HA 2KTQA 4B9LA 3MCOA 1YHQS 4EUVA 2QMXA 3OR2B 1YZ6A 2HHVA 1JWWA 5FIIA 2R9LA 4G65A 5DJBA 1PAEX 1S1TB 2UV8A 4ZVUB 4IO9Q 3CD7A 2VG5B 5LSOA 4Q7AA 3CPWR 5AXLA 2A10A 3LOUA 3N0VA 4C98A 3P5TL 2KVQE 4UOFA 4RW8B 2AYGA 4LFCF 2GO9A 1BQNA 3MD3A 4KH1B 2YKNB 4FS2A 2H5IB 3M1VA 1D0EA 1KDNA 3HLUA 3E01B 5C25B 4MIAA 3HJVA 2PI5A 4IRCA 3K59A 5J1PA 3NS5A 2XCAA 1C1CB 4ZA1A 5ADZA 2C42A 1WG1A 2KJVA 2C22A 5EHHA 4FDFA 3UNYA 7FDRA 1NSQA 3PZPA 4BBYA 3F44A 2HVHA 2PMWA 4U9RA 5HROA 3HVAA 3MM5A 2K3KA 3OT9A 2ZZNA 4QIVA 1QSYA 4JI7J 2AQ4A 1HIYA 2Q6CA 3FZ2A 1T7PA 5KG6A 2VD3A 3T1AA 1NJWA 4DSJA 5HVGA 4A8WA 4CIOA 4NXNF 2GS8A 3B4MA 4WFBQ 1Z4UA 3EGZA 2CNNB 3GE9A 1QAIA 2PO4A 1MU2B 3J81Y 3LO3A 1JLQA 1WC4A 2DIVA 3I55S 1GXLA 1KTQA 1V9OA 2YKQA 3C6TB 4KH0B 1REVB 4X4VA 1JLAB 1BE4A 4DV3F 1B0PA 1KQKA 1KP6A 2CQBA 2XI2A 2W9BA 4O3OA 3M2RA 2UU9F 3OQ2A 2HS3A 1QAXA 5IS2A 4IG0A 1CJVB 3BSCA 4NLQA 1TL3B 1WG5A 1RLDA 1UJ4A 2YNHB 3R2CJ 2RUGA 1WF1A 2DNMA 2DNKA 3C46A 4W90B 4LFBF 1S1VA 4CQ1A 4M5GA 2XCPA 2GCFA 1CC7A 2B4UA 1A6LA 3IG1B 2MQNA 1F3FA 3G8SA 3TWZA 3L4BC 3MM8A 3CD0A 1WF2A 4B02A 2W4DA 3ZTQA 2P8IA 2LXIA 3MR2A 3PIPQ 5DG7A 3N6MA 2AX0A 1RWXB 4OX9F 1B7YB 4DV1J 2MDAA 2ERRA 4QU7A 3CMES 1MLAA 5KFMA 4DUYF 4JI8J 1W7WA 3FEZA 5AJ3F 2BQUA 2FVRA 2HRYA 4QYRA 1R6YA 1F6TA 4Q8FA 2FJAB 3L09A 1U1PA 2N4DA 1WHXA 1U2RA 2YXLA 4URQU 3U1NA 3I31A 5GMEA 3BF4A 3DM2A 1IN0A 2UVUA 2C2OB 4KRWA 2HQCA 2QSWA 1S79A 4X65J 5KT4A 2QLJB 2B56A 2DJWA 2DR8A 4CO2A 1BQMA 3P4UB 1AXQA 4F50A 4WE1B 2UP1A 4ALZA 3LA0A 4KPYA 1MN9A 4OQJA 4NLGA 1N36F 2HK2A 2ZE2B 1VRTB 5GAHU 2WVCA 2X1FA 3HZGA 2HYIB 3OTCA 2HS0A 4ED6A 3IO1A 2B9XA 1RWMB 1PO6A 1ZBTA 2B9WA 2GJIA 1Q0NA 3DXBA 3ZNJ1 4HT5A 1YLXA 3S01A 1OYEA 3M8QA 2ZKTA 5KFFA 2HSEB 4OX6A 3BPDA 3AT1B 2NS1B 1MN7A 2DHAA 1YJTA 4I64A 2VQEJ 3V6DA 2E66A 2H3EB 2AMCB 3QBCA 1VRUB 3TAMB 2VQFJ 2EEYA 4E8UA 2MSSA 3DCAA 2V8PA 3B8HA 3PTWA 4WFNQ 1RKIA 4DL5A 2W2OP 2IC3A 4OHZA 4JI0F 1OS5A 1RTIA 2CZ4A 4QIFA 3TX8A 3D6HB 5IOLA 1NDLA 1LKZA 3L7PA 3T1YF 3RB3A 1YX2A 2AX1A 4PXEA 3VALA 1UVMA 5E33A 3C16B 5HLFA 1HI0P 3VTIA 5A6WA 3B78A 4P2SA 2ZBQA 2YKAA 5B0CA 2CWKA 4IH6A 1C1BA 2MQPA 1T94A 1WTFA 3C15A 5F0UA 1HNXF 4Q2MA 2J6UA 4QWAA 3DRPA 5J2NB 2KN4A 2APOA 2GVZA 3D6TB 3W66A 1DHMA 2LQJA 4NXMJ 5KFLA 5F9LA 4LF7F 2CJQA 4J90A 1TR0A 2J0QD 2C2EA 3MMBB 2ZVSA 1RT3B 3NBPB 1FRKA 2RQCA 1TELA 5CYQB 2AYBA 1FX2A 1NNDA 3QIPA 5D77A 3RRKA 1RT6B 1FNMA 3W7BA 3M8YA 3VZIA 2UXDF 1GXTA 1JJ2R 2GX8A 2RILA 2QL5B 1DTQA 3LP2A 1RWUA 2OI2A 2AEJA 2C2NA 1SL0A 3PR4A 2XMUA 4ECWA 3HI9A 1APSA 2HGNA 3OV7A 1JLFA 4PG5A 2B8QA 4A8KA 3M6UA 3D4JA 3OHAA 3IRWP 1R27B 3TANA 2OH2A 4KO0A 2BQ3A 1HL6A 2ZNZA 4AXIA 5LJ5Y 2OFGX 1VQMS 3ISZA 4ZP7A 3G82A 3U27A 4LFCJ 1UETA 3KJVA 2GQCA 4DR7F 3D1HA 3VCDA 3WIVA 4M1KA 2OFHX 1O51A 2OD6A 5J2QB 1SV5A 3OSPA 3PW2A 4AXJA 1UW4A 3CCSS 3NY0A 1HHTP 4NCBA 5KFXA 1WNEA 2QV6A 4ZCIA 4PXCA 1WELA 2VBYA 3W5XA 4L73A 1BLUA 4FF2A 4CLFA 2VPWB 1RGVA 1JXLA 1KHVA 4DEZA 4TY9A 2GMJA 2CDQA 3Q8UA 2MKSA 4QW8A 5IT4A 3EICA 4NXNJ 3K89A 5KOXA 1M1GA 4MKBA 3TRGA 4OYIA 3OUYA 2P2CB 1Q53A 4WP9A 3LH2S 1X4CA 1RWWB 5F8IA 3CJQA 2A2CA 1U26A 4F8RA 4DV3J 2YKOA 2OUGA 2OSQA 3OXGA 2HIYA 4CH7A 3FJ2A 3A3PB 3D6MB 2IYGA 1LFPA 5JUMA 3TAPA 3W62A 2JL9A 3FNNA 3G87A 1J5EF 2E7VA 2UU9J 2DNNA 5LMNF 2QG9B 5L46A 2KI2A 2GZOA 1CG2A 2E5HA 5L1KA 1YJNS 1JLQB 1TL5A 4LFBJ 2R7QA 2X1BA 2GAHC 2MQMA 4CLUA 2I9SA 3IS9A 3LPYA 1RTZA 4FYYB 3ILOA 4KGKA 4M94A 3K8VA 2DRAA 4RUAA 3GP9A 4ZPCA 4OZNA 1RK8A 4QWBA 2ZDOA 1TFWA 3T41A 4ZN3A 4USTA 4OFZA 4UW2A 5RUBA 1IM6A 1RAEB 3JTOA 3KHRA 4OX9J 4M5DA 3OJUA 9ATCB 3MURP 1G2EA 4DUYJ 2WRMA 4J9VA 2Z2MA 2XMTA 3I0SB 2V94A 4KGVB 1VQPS 4N8OA 2ZC4A 3FKBA 5AJ3J 1NPPA 1XWLA 3PNIA 3V81A 1SJRA 3PYFA 2QYGA 4X64F 1KRPA 2NUUG 4IDKB 1HQUA 3TUJC 3UO0A 2VHGA 2G9OA 2NCKL 4G1QA 1DRZA 4NLVA 4KHMA 4KE5A 1ZOTA 3BGRB 5AE1A 3QAUA 8ATCB 3IBWA 3IGVA 2XO6A 2AJQA 5B0EA 3EM1A 2ZOMA 3SCIE 1K1QA 4R5PA 2V0NA 1NU4A 3EXCX 4OYBA 3NCPA 5KFOA 2GIFA 1N36J 3KK1A 3KDNA 4MYTA 4USIA 3HT3A 2RF2B 1GTEA 3BH7B 4Y34A 2A3JA 2RAQA 1UVIA 3GCWP 3W8GA 2ZH8A 2GO8A 4I4BA 4MIBA 1NDKA 4BWMA 1OY9A 2V2VA 4CH1A 1VC0A 4EBCA 2EK1A 1E6VA 4ELUA 3CJ0A 2KO1A 1SL2A 2VFTA 3M05A 3MTKA 1SUQB 1U25A 3MUMP 2CPHA 1TZ0A 2PA8D 1M5KC 3HHNB 1NAQA 4RW9A 4R8UA 5I3UB 4DV4F 1GT8A 4JI0J 4BHQA 3UN3A 1VFJA 3NKYA 4HTJA 3BREA 1WORA 1CVJA 3T1YJ 1NZ8A 2JVRA 3JB9k 1SC3B 4YB6A 1YBUA 1NSAA 4ED7A 2Z4PA 1WHVA 3M8QB 1UVKA 2YX7A 4NLXA 1AZSA 4QW9A 3V6DB 4M5JA 3RB0A 3PVXA 2HVIA 1HNXJ 3OFFA 4DR2F 1WC5A 1YZ7A 4U67Q 4DV2F 1U45A 3RBEA 2VH7A 4AYBD 1WC0A 1RTIB 1WI8A 3J7YI 4LF7J 1F5AA 2BRLA 1HBOB 4OZLA 1TKTA 3DNCA 4ICLB 4USUA 1CQMA 2OPQA 1SKUB 3I96A 3L9ZA 1LNQA 1SQEA 2DY1A 2MKYA 3OW2R 2YWFA 3VZHA 1CBKA 2VOPA 1AUSL 4L6V3 1NHKL 4AE5A 1C1BB 3MCSA 2BKPA 3R5CA 3DOMB 1H7XA 3DRPB 3VAIA 3HJFA 2HFSA 2UXDJ 2GVZB 3NS7B 5GAGI 2WB4A 2BDPA 4B3SJ 2I2YA 2KL8A 5B0AA 2R2TA 3A3OB 3DYAB 4W98A 3KK3A 2W9AA 1NH8A 1PYTA 2R8GA 2IAJA 3CJ4A 5HSPA 4B3RF 3HSZA 4LR8A 2XLKA 2ZJQQ 4J9KA 2MQLA 4BC9A 4DR7J 4DBQA 4CM2A 3PM9A 3FCVA 2DR7A 1YJRA 5FLXY 3ZC4A 1C4CA 1S12A 1JJHA 5FDLA 2QLFB 3HSGA 2BOAA 2ROPA 1T3OA 4EZ6A 2MZTA 2MHEA 4IOBA 3GIRA 1HMVA 3MOJB 2Y1RI 3GQCA 5E2QA 1PJ5A 2XYGB 5IM0B 1NDCA 3G82B 3KXDA 5C2CA 2WK4A 2F4FA 5HMYA 1EB0A 1OMSA 2UZAA 4PWDA 5F8LA 3OLBA 3GIMA 3QJPA 3GYXB 1SV5B 1SIWB 3I0RA 3ET6A 3I6PA 1S6QA 3KJFB 3HHLB 4OI2A 4MTPA 2DK2A 4PQUB 4WXWA 3U1LA 1UPMB 4KTQA 3LALA 1N54B 4LRFA 3W60A 2AYMA 1J5EJ 1U1RA 5D4LA 4OJHA 2DO4A 1I1GA 4J91A 5LMNJ 2NUHA 5IC4B 3CCES 4M5IA 2V2QA 5KT6A 5B7WA 3UD5A 3MM9B 4JI1F 2HFZA 3W3SA 2B9EA 1B7FA 1FCAA 4HHJA 3GV8B 3SCKE 2OMOA 2FVSA 4R0EA 1HBNA 1GX5A 1JNZB 2XI3A 3ITHA 4ZJLA 2JRSA 1VLYA 2YX4A 4ED1A 4L75A 2XHWA 2BE7D 3ZZPA 3TARA 1CJTA 5DDPC 4ZCMA 2J0SD 4JI4F 3GR0A 1WF0A 4OLOA 1RAOA 1FRHA 1UFKA 3G86A 4QWCA 3GJTB 2DNZA 4OHYA 3MEGB 3PV8A 2DGTA 2QIFA 2KFZA 4X64J 2QN6B 3H25A 2Y3YA 5SZTA 2AGOA 3EXYA 2XY6A 4X4QA 2JDJA 2G0IA 4OYOA 4MK7A 1IKYB 3DLGB 4WU2A 3K5MA 4LIWA 2IVMA 2WW4A 4I69A 1NBEB 1S9GB 3PFOA 5HAOA 1E6YA 1LWFA 3KNAA 1DQAA 1AYEA 1BY9A 2B7CB 2HWHA 3VF0B 3UCGA 2EG2A 3W2WA 5C42A 3ZXWA 1GH8A 1RT4A 1U0HB 1Q8KA 1X4HA 4DF8A 1NDPA 1FWKA 2AJFE 2XB2D 2RSQA 4LSNA 1R0AA 1CPZA 1FTCA 5GAEI 3MECA 4OHVA 4G1QB 2DGQA 3PEJA 4OI6A 1H98A 4DL0C 4DCOB 4YQWA 3V4IA 1S0MA 5SUHA 3NGUA 3BN4A 3BKTA 1RAFB 2ZBPA 4YS2A 1DURA 4X84A 2VKZG 2WSFC 2DH7A 3BGOP 5B0BA 4DWIA 4LF5F 4I1TA 3LAKA 4M5KA 3W5YA 1NK8A 4DV4J 2POKA 4MK9A 3GJSB 2I0XA 1Q7LB 2ZD1A 4DI6A 2HVZA 3VAJA 3ILIA 4QIGA 2KM8C 3M32A 3NMRA 1WHWA 1ZZNA 2VONA 2R2UA 4XDDA 1MROB 1KFSA 1N6QA 4CYUB 4WIQA 4U96A 4X66F 1U47A 1K9MT 1PSDA 1S5ZA 1GNKA 3H59A 2DHGA 5CD4A 4Z37A 4OYZA 4DR2J 1VC5A 4RW9B 4DV2J 2XYHB 2YWGA 2QTWA 2KDOA 2FY1A 3WC2A 2DGWA 4YB5A 4ES2A 4B3OA 3R5DA 1TP7A 2HNZA 1S48A 2FHKA 4GVBB 4CLZA 2FTRA 2JH3A 5ETLA 2O1PA 2YH1A 5ETSA 1AZSB 2HKEA 3E51A 4C97A 1SH2A 2EI5A 4KGMA 2W7OA 5D6GA 1R0CB 3N6NA 2CJXB 4ZPWR 2XSJB 3PW7A 3LUYA 5KFQA 4ZK7M 1HPZA 3EGWB 2VPYB 3PRBA 4Y6IA 2J7UA 1PCAA 3QGIA 5M2RA 3PYDA 2OPQB 2YWEA 3ZZRA 2MKKA 1JLGA 3J81U 2V9WA 3WX4A 1RHUB 5DZ7A 3FRYA 1L3TA 3QT5A 2VKRA 2GNKA 2Z8QA 5KFYA 1WD6A 4B3RJ 1VQ5S 3BBCA 2F8MA 2LECA 3H90A 3PYEA 2D74B 1TAQA 5KG3A 1KEKA 1TFYA 4ZVTB 2RUSA 2W8KA 1EX8A 5T7LA 1IR2A 4K0KF 3UVJA 1N33F 5ETPA 2IA6A 3LANA 1K1SA 3KLFB 1TK5A 1W2IA 4DR1F 1QTMA 5DQGA 3W9IA 1S77D 2I8EA 1FRIA 1XC9A 3LWLA 4Q44A 3SQGA 3MR3A 4OZ5A 2QE5A 3HSJA 1D8ZA 3C8YA 3CCRS 3W63A 2PD1A 1Q95G 4RPFA 1U09A 2DHXA 3I5AA 3VQTA 2VDHA 2X1GA 3PO4A 3DRSB 2VFSA 1DQ8A 4P52A 3O8WA 5H9FK 1UFWA 2QMWA 4NEZA 4N47A 1PIEA 5L9XA 2YQ1A 4DQIA 4ZKAA 3CDWA 4P73A 4FYXB 2I38A 4LJMA 4ES1A 2KJWA 4WFXA 2JFDA 4I7FA 2EBGA 2O66A 4JV2A 2QFIA 1Q8BA 1DQ9A 2RIJA 1XQIA 3HHEA 1X8DA 3S6EA 1M90T 2ZWPA 3MUTP 2KRBA 1UA0A 3J7YU 4IFYB 4JI1J 1YJ9S 4X4UA 5IFMA 3MM7B 3OFGA 3TP2A 4I2PB 2F1FA 1ZM3A 1RWPB 2XC9A 2HURA 4LR9A 2CWXA 5A8WA 4JI4J 1JKHA 2M52A 5GAGU 4DQRA 2EBEA 3M8WA 4OYXA 2BYCA 4K4XA 1L3UA 5DRKA 3F56A 2FC8A 4FKYA 2K1RA 2HPUA 5C5JA 4ZVQB 3ENAA 1KTVA 2KG0A 2X3DA 4XO0A 4X2BA 1UFLA 2BJ8A 4ANEA 4C6AA 3A8JA 2C1EB 2RVJA 4S0MA 2QSFA 2HBQB 2HQGA 2PC6A 1EARA 1NJXA 2D3O1 1AFIA 2XULA 5KT3A 4TN2A 2ZHAA 3O6QA 4WKYA 1VJWA 1S6UA 2FDNA 2Y8YA 3MEDB 4YN3B 5ETNA 1C0UA 1S7HA 4J5OA 2RDJA 1IKVB 3O3LA 3IFEA 5F41A 5DDQC 1ZZFA 2PDAA 1KC8T 3F41A 2E1AA 1K0VA 2VU5A 2MZRA 2HS4A 1HBMA 2UVVA 1NZAA 1RHMB 2IMWP 4NMLA 1NRKA 3I9V9 3VVUA 2MZQA 1DFDA 1LWFB 2IDLA 3JYTA 1UEUA 4LF5J 4V1Ak 1RTHA 4KT0C 2GW8A 2HFNA 3W2WB 5C42B 3VAMA 1V5VA 3KLEA 1O0PA 4O3RA 1C0TA 1UZDA 1JLCA 1BWVA 1TV6A 2B6AA 2VDIA 3BO4A 3NCRA 5LM7E 3DDKA 3ULHA 2VPXB 2DNLA 1S1WB 3C14A 1T9WA 3MECB 1TL1A 4QPTA 3D1QA 4D3GA 2ABYA 3K8WA 1IVZA 2MJNA 2AGQA 3DOKA 3SSRA 3G8QA 5ETRA 3DHXA 1HYSA 1RCXB 2RKIA 1EP4B 3BSAA 1HWLA 3BS9A 3RB6A 5L1IA 2F40A 1XNRF 3D54A 3CULA 2RMLA 1Z1ZA 4DSIA 4NLRA 1S1XA 4R25A 2A6MA 2RHQB 4TNOA 1Y7PA 2WSEC 1QM9A 2CDRB 2HNYA 3WX8A 5MLCV 5KG0A 3MR7A 1QSLA 4FVMA 1N6QB 2CRLA 1L3VA 2QMUB 5KFVA 4TY8B 5HJXA 3D7SB 1VQYA 3KLHA 5DS7A 3TZWA 3GG1A 4QYZJ 2FHJA 2IFXA 4YR3A 4Q0BA 1X5TA 4ED5A 3CW2C 3M8PB 4GC6A 3WBZA 5ETMA 2CIMA 5I3PA 1PGZA 4DU8A 2R2SA 1S49A 5G0RA 2QC3A 3A8KA 5CABA 2XS2A 2QZ8A 2OPRB 4TXSA 1U49A 1S76D 2M0GB 4RBTA 2W9CA 2MQQA 1FE4A 2DRBA 1VLOA 4N76A 1FVQA 3EPIA 4PAAA 2J7WA 3FMWA 5KAKA 3B82A 1SKRA 4FKXA 3SDEB 4FF3A 1U0SA 3T1HF 3QATA 1RUSA 4P71A 4MKAA 2B0GA 5HP1B 4K0KJ 2UUBF 1FNOA 1N33J 2V67A 5GAEU 2L9NA 3EUNA 4UTGA 1X0FA 3IGNA 2IBKA 4ZVPB 2FJWA 3RZAA 4DR1J 5KFSA 1OSCA 5IQQA 3KFWX 2FJDB 4X4RA 2DNPA 4IG3B 3MF5A 5I42A 3HVTB 3UDCA 5F8JA 2C3MA 4TYBA 1UEKA 3CDBA 1OIAA 3UW1A 1PBUA 1VOMA 1RWNB 2V4JA 3AJ1A 3JAMY 2XS7A 2LEAA 2WONB 1KSPA 2HZAA 4WPAA 1RAIB 3UI3A 1LXJA 2HBYB 3GIJA 2BANB 1C4AA 5E3AA 5T7LB 1LWCA 2RJZA 3NCQA 3BO3A 1Y5LB 4OL8A 1YJWS 3T5KA 2ATCB 2CQPA 4OV6A 1HNZF 1U8WA 1BGXT 2B43A 3IA0A 2VV5A 4ZS6A 5B09A 4NRTA 4NLWA 1LWEA 5DM7Q 2AF6A 2DXEA 3ZNUA 4KPCA 1NUEA 1YJ7A 3GMGA 4FZVA 3BR8A 3IAS9 1IUJA 1UVNA 4K2XA 2NXUA 3VHQA 2RS2A 1WKLA 1Y4ZB 1OJ4A 1SH3A 2CKWA 2WTFA 2CZ9A 5D4OA 1JXVA 3R5AA 5J2MB 1U1OA 4X4NA 3M30B 3K58A 1AUDA 1WHYA 2D9OA 1ZM2A 4USHA 2MLXA 1R8PA 4CO3A 3K2YA 5C24A 1CJKB 4FN5A 1KLMB 2H9ZA 1FF2A 4M5MA 1FKPA 1G3OA 1VMBA 4PUOB 3QO9B 1HKAA 4DF4A 2M7SA 2Z0GA 4XPEA 4IFVB 1CS4A 2C28A 3N6LA 4JI6F 2R8JA 1SQGA 2VFRA 3SV3A 2GHWA 2VUGA 3HD2A 1NJYA 1FK9B 4CLSA 4QR0A 3TYTA 3CCUS 1YBAA 2C3YA 4KYZA 4ZJQA 3BBBA 1EETB 2HRTA 4JI5F 3OPKA 1QJHA 5CYMA 4KSEB 1NK9A 1FHTA 2PT0A 1ZTWA 5ETTA 4KFBA 1U4BA 4DX8H 5D4NA 4WU3A 1N34F 1PJ7A 4MIWA 4DDFA 4F4WA 1GK8A 4ILLA 2K7KA 4LF9F 1TKZB 5BR8F 3CC4S 3KLVA 4RNOA 2PIIA 1AT1B 1R8CA 1HWJA 2J0XA 3LTOA 2E1CA 4RR5A 1F9HA 5CZXA 2GQQA 3M9OB 2EC0A 2W7PA 1SJ4P 2MEWA 4YUDA 3RG6A 4ZMMA 4J9NA 4K4WA 1NSPA 2Z2ZA 3R7SB 4H4KC 2DGSA 3MI7X 3GSDA 3RRHA 3RBXA 1KKHA 7AT1B 4ED0A 4EYIB 1LW0A 3TQEA 3BN7A 4DFKA 2O01C 4AD6A 4ATNA 1J5OA 2L48A 3HF5A 4WFAQ 1RHJB 4A46A 5AXKA 4FYVB 1OPIA 4YDXA 4DXLA 4PYAA 3G6XA 2EFPA 4ELTA 1RJJA 1Z2ZA 2DT9A 3N5FA 2HBRB 4RLEA 4O3PA 3W9HA 1RTHB 1KFDA 4P75A 4EI2A 2E5LF 1XNRJ 1VS3A 4QU6A 1RQ0A 2Q3PA 1N5SA 4NZ6A 3R5GA 2EPIA 5JVGQ 4JI3J 1RAAB 3CB4A 2DKOB 2OELA 4Q8EA 1FE0A 3IR5B 2WBMA 5LT5A 2CPDA 1JLEA 1N4LA 3C14B 2JOQA 2AD9A 5FLXU 1Q5YA 1AROP 3OTOF 3EPGA 1RA7A 1FEEA 2DXFA 2QL9B 1QAYA 4ID5B 1FRXA 3DOKB 2BJ7A 1DAXA 3QGHA 3H42A 1FO1A 1NHUA 3RAMA 2OTLS 1HYSB 1YJUA 5KG7A 3TA2A 2YH0A 3D5MA 1G1XA 3BJYA 3QT6A 3QIDA 3HX9A 4V19J 2ACYA 2KVIA 4NLTA 4IQXA 1UJ6A 3HM9A 2YY3A 1O8BA 4CTAA 2MGZB 4QOTA 5H9FJ 3IBCB 4KBIA 3Q8QB 4O44A 4DCPB 1XMOF 3J80Y 3BSOA 1X4EA 4O23A 2RRBA 1ZAVA 4MKYA 1RA6A 2RDIA 2HMIA 2JHEA 4Y3CA 4A8YA 4C4WA 4Q0BB 3T1HJ 3KLGB 4IH5A 2W2MP 3TI0A 2E1MC 1PYSB 2QA1A 2UUBJ 2BE2A 2DRDA 3AQPA 2FPHX 4P10A 2DNHA 1P6TA 1D09B 1XN9A 3POTA 8AT1B 1N5VA 3SYZA 2ZUGA 2OPPA 2W9CB 1HI1A 1RISA 5F8NA 3OL7A 3N01A 1S6PA 1Y10A 4PEOA 1Q1KA 3EE3A 4NMXA 3EYZA 3DC2A 2B9YA 3KUEA 4CWBA 4H4MB 2DNOA 1YKWA 3JTPA 1Q16B 4A8OA 4TU9A 2EXUA 2O3DA 2BKOA 2KT3A 4O0IA 4LSZB 4BDPA 2WOMA 4HL9A 3MM6B 3J81j 2UUWA 4WBFA 2EG1A 1ZA2B 4FPIA 3ZZTA 1IQTA 1HNZJ 4PPZA 3CO9A 3G4SS 2XMJA 4CO5A 1FFSB 2V4JB 4P7TA 2E5GA 1KQGB 3IP0A 5I3QA 1LK5A 4M5LA 4BC7A 2ZNYA 2OKQA 4XIUA 2G2ZA 2JEGA 3TUPA 2P6SA 3D9BA 4DFMA 2YBVA 5D3GB 4F0HA 5ETKA 4HH1A 2KHDA 1R89A 2HWIA 2R42A 3DRRA 2YQ3A 1CULA 3OL6A 3ZZOA 5JJBA 3CJ5A 3U1MA 4C8YA 5DQHA 1U2CA 3AB2B 2XBPA 4XK8C 1X9WA 3CCWA 3CCLS 2LA6A 3AOBA 3BO2A 3D1OA 4WYLA 1B0VA 2ZM6F 1QVFR 4JI6J 2QLXA 3C3LA 3NL0A 5EN1A 1RCOB 2OIHA 1N5TA 4TKTA 3W61A 5E3CA 2XGPA 3A1YG 2UVWA 5HI7A 4RW7B 4CI0B 2ZJRQ 2IRUA 5KFUA 1BQXA 1VQSA 1LEOA 2N82B 4JI5J 1Q4RA 2LYVA 2VC1A 2GGPA 1DLOA 2CVEA 5IC6B 4JYAF 1DBDA 4I2QA 1TL4A 1M5HA 2U2FA 3O5TB 4KQZA 5F9NA 3T9ZA 1SJFA 4OYMA 1URRA 2NSCA 3VAHA 1N34J 4OMFG 1NMEB 4LF9J 3QSYB 5BR8J 4FPRA 2WB1D 3AY0A 2RNEA 1OPZA 2PGCA 3C6UB 2PI4A 1IKXB 3CUNA 1U2FA 1QUPA 4PG6A 3BDEA 3DLKA 2DR5A 1RSCA 1FDDA 2D7SA 2EKNA 3HKZD 4JOUA 1QTNB 3HVWA 2W2PP 2NREA 2HLTA 3RR8A 1CJUA 3P8BB 4NL5A 3MAAA 2BJDA 1KNZA 1B4SA 1KHWA 3OR1A 1Q86T 3K5PA 5KT5A 3T5LA 2ZZMA 5D8HB 5E41A 2HRUA 3B6BA 3PW4A 4K4VA 1ZTTA 3TEHB 1DY3A 3X3UA 1ACMB 2BW7A 1X4GA 3AD9C 3M2UB 1RYRA 2JFKA 3DMJA 3ENQA 5B0FA 2PSZA 2V8GA 2X1AA 4DPYA 3MGJA 4QZVB 1RTDB 2G4BA 1VK8A 3CCZA 2E5LJ 5BJRA 1UCNA 2JLEA 3FCHA 2YPYA 1LW0B 4H54A 3RBDA 1Y0HA 5D0GA 4DSLA 2C2KB 2K2PA 2ZDPA 2PEHA 2ROGA 1VR6A 1KR4A 1S9EA 2ZHOA 1FDAA 4FF4A 2CPEA 2VBXA 3PKMA 3OTOJ 2R7SA 4A8FA 3LP0A 4UT4A 2Z2LA 1VQ6S 1BMQB 4UOCA 4QWEA 4ED2A 5AE2A 3AODA 5BYRA 2KFNA 2BXJA 1TKXB 4DR4F 3SQOP 3EJMA 2VICA 2V50A 1KOOA 3HP6A 2BM1A 4C0OC 3FFIB 3Q8YA 4ED8A 4RNHA 2I6WA 4W4MA 3FQKA 5DDRC 2FVQA 2FLLA 4F02A 1JLEB 4GO5X 4RBVA 4O4GA 3QSIA 1FRLA 4MFBB 3KHGA 1XMOJ 1S0OA 3HFZB 1HR0F 1N8RT 3V4MA 2ASYA 4K4YA 4PKDB 4TU7A 4J37A 3TJAA 1VJQA 1WSVA 1HD0A 4Y2AA 2YNFA 3WIUA 1EKSA 2E9RX 3THTA 4DG1B 3Q2TC 3CJSA 1Q7YT 2DR9A 3Q22A 3N5BA 3BPSP 2B3TB 4F36A 2BE9B 1WC3A 5IXUA 4LREA 2CQ3A 2FLOA 3W2VB 4KHPJ 1RP5A 1TL7B 3VR1A 1T3NA 2KXFA 4Y2CA 3T6JA 2DH8A 2Q6BA 3CCMS 1Q8LA 2MPUA 2GAGC 4C0BA 4FBTA 2AZ3A 1HHSA 2YNGA 1RT7A 5EUHA 3KLIA 5KFEA 2HMIB 3H40A 4X4OA 3MMCA 2VBZA 2VG7B 2CG4A 1MG7A 4DU7A 2M2BA 2V2ZA 4F25A 4ZVEA 3KK2B 1F2HA 5MAOA 1RT5B 3G8TA 3FZBA 5HBMA 1GXUA 1R31A 3TJ8A 1MMDA 4DUTA 1P9YA 2HNDA 1S6PB 4RU9A 4WTYA 2LVWA 5LMUF 3FEXB 2IRXA 2DHSA 3VVTA 5CYJA 3GIIA 2BABA 3DLBA 1LW2B 3TVYA 1HNWF 5HMWA 4JV5F 4HR2A 5J1EA 3NWGA 4JP8A 3UCZP 2WOMB 2H54B 2DISA 2IA0A 1X4AA 4U7UK 1EKRA 1U48A 2R7VA 2I5JB 3RAQA 2FZCB 2LKZA 3DOLB 5A2QY 3H5UA 1ELOA 4AL5A 4OHWA 4G6VB 4EEYA 3NGRA 2CQIA 3GFXA 3BYPA 2ZM6J 1GX6A 1X4BA 2FGOA 2EK6A 2NYIA 2XLJA 2MQOA 2AJ1A 2CXEA 3AH6A 5EWEA 4M63A 2QFJA 3V2UC 1HBUA 2A18A 4CO4A 5J2PA 3KMQA 2VL1A 3UCUP 2IVFB 2XSFA 1RBLA 1SXLA 4XAKA 3SXLA 5F3TA 1U8SA 3LF0A 3PW0A 2DR6A 3DHWC 5K8NA 3CJ2A 3QLHA 3QQCD 3HCXA 3QJJA 1RT1B 2MZSA 2LCWA 1T05B 4EZ9A 3I87A 4JYAJ 4ED4A 3CJKA 5EWGA 4OYAA 1KONA 1IBMF 2HQDA 1VGYA 4ER8A 3AXMA 3BGLA 4ZP6A 4Q43A 4MAKA 4C0HA 4PCQA 1SCJB 3IRXA 2Y9HA 1R6VA 1H3DA 3QRQA 4K2JA 1S4FA 3UQSA 4RKUC 1U1QA 4AUKA 1FDBA 2FJVA 1MWQA 3FC9A 2KFYA 2HG4A 1OYDA 4RW6B 2V2KA 1JLBB 3D2WA 3CCVS 1NXIA 4I2QB 3JSMB 5F0WA 3H2LA 1M5OC 2HLUA 3PJWA 2XZWA 1SC1B 1Y3JA 3ZZZA 3PG9A 2HZVA 1MWZA 3BSNA 4Z7YA 2NSBA 2HWTA 1T03B 2B8PA 2L41A 2N3LA 4Q45A 2ZITA 1VBYA 1R8AA 1RTJA 3Q0AA 2ZBIA 1DZ5A 1NEEA 1L5UA 3AOAA 1QAJA 2Z30B 1SC4B 1AA1B 4H4OB 1RBAA 2RT3A 1NPKA 9RUBA 3M2VA 4TLRA 3EX7B 1H7WA 3VV2B 2F9DA 4QJVA 4F0MA 4C3LA 1L3SA 4KJIA 4J7CA 3G6ES 3BB5A 4KKOB 4RBUA 4DR5F 3BDPA 2CJAA 4C8MA 3GV7B 3RB4A 3EGNA 3OR1B 2CQ1A 3H0PA 2ZOGA 4UUWA 3HULA 2IJFA 3UNGC 3DMJB 4F4AA 1X7VA 2DXDA 2IM0A 3DGPA 2HFVA 2R8IA 2C2ZB 1S57A 4DR4J 1UVJA 2ZC3A 3EVMA 1JMTA 4KGZB 3JAMU 1S10A 4K4TA 3GILA 1MMNA 3VAFA 8RUCA 1WG4A 2E1RA 1H38A 2XHCA 2R8KA 4DN0A 4EWTA 2D69A 3HDSA 4NLOA 5KG5A 5FJ4A 3LP1A 5BYSA 1S0NA 1HR0J 3OR2A 4C8LA 2VASA 3P96A 4PQAA 3PRVA 5D4PA 1KQSR 5DG9A 2WSCC 1BQNB 2XYPB 4YFUA 1ZM9A 1S1TA 4DHVA 2MMYA 3M1VB 4HT7A 3MOZA 1Y5IB 3NP5A 3CMQA 2G1HA 2CPIA 4BLGA 2VG5A 3CO0P 3S7RA 1WTBA 1PAUB 1S99A 1VBXA 4LRDA 3I9ZA 3OD2A 4DSKA 4O4GB 3BM7A 1VBKA 3QNWB 4GO7X 2CJYB 1UPPA 2DNGA 2YWWA 3GG0A 4MH8A 2XGQA 1WKKA 1PKUA 3I4PA 5C25A 2CJBA 2EFQA 3PIOQ 5HROB 2HFUA 3MM5B 4OHXA 1H2TZ 1C1CA 4URGA 2BBEA 2LQ8A 4LRBA 2KT5A 4IR9A 3MTJA 3MEKA 2ZH1A 1MMLA 4PR6A 2AW0A 3SI8A 3Q8SB 3FMBA 5DM6Q 4DQPA 3AOCA 2HHTA 2HGLA 2HQFA 2FHMA 2CYYA 1YITS 1IR0A 4Y2MA 2JEFA 1X5SA 3JSRA 5KFDA 1D9FA 4J9SA 1SBRA 1RU1A 1RT7B 5KFNA 3CC2S 3D0HE 1MU2A 1VCTA 3MMAA 1JX4A 3HXMA 2MKHA 4OI0A 2W9BB 2NLWA 3M2RB 5LMUJ 5HMXA 3Q2SC 2GHVC 4NZ7A 5G4DA 1VYAA 3BQ2A 1UP1A 4IG0B 3CD5A 1HNWJ 1WOPA 1REVA 4NA1A 2AJ4A 1JLAA 4JV5J 3GFHA 5LOQA 3E3XA 1VQLS 4P72A 3CC7S 2ZVIA 5KFJA 1UA1A 1S1VB 2WAQD 2KYZA 2FGCA 5HBMB 1YVFA 2Z2YB 3HPOA 4M95A 1HQ2A 4HDHA 2WVFA 1CJVA 1HA1A 3MM8B 2HNDB 1TL3A 2RQ4A 5F8MA 2W2NP 4U7UD 4M5NA 2ILYA 2A0FB 4L74A 5CA5A 1WC6A 2EKYA 1FKOA 5CCMA 1N48A 3IG1A 2I1RA 4KV8A 5F3ZA 3W9JA 4Y0FA 2AYEA 1S4EA 2RRAA 2ZZTA 2FHOB 3VAKA 5I4MA 1NB7A 3UR0A 1JK9B 2QJ3A 4X4PA 1Q81T 1M5PC 4IRKA 2BM0A 2FY8A 2VPZB 4I0WA 1P1TA 1F9FA 4DFJA 2CA9A 3DM2B 4I6AA 4WZQA 3CJ8A 2IYIA 2G2OA 3H4BA 4F0KA 1NM2A 4P9SA 2CQ4A 3GCXP 2MKIA 1BQMB 3MUVP 3M6XA 3FEYB 1HBUB 4CO0A 1SH0A 3EZOA 5J2PB 2CPZA 2OGUA 5DLGA 1GTHA 2LEBA 3K57A 3NGDA 2RU9A 4LQ9A 4Y65A 4KAIA 1UKUA 2YQ0A 5KG2A 1KVKA 2FD2A 2CJKA 4E0DA 1FWPA 4WXOA 3U02A 3TUZC 3H8YA 1XK8A 1X5OA 3TZZA 2C2MB 3T19A 2K06A 4WE1A 4RNMA 2ZH2A 4WTOB 1IWGA 2ZE2A 2XG8A 1VRTA 3QPIA 2Y0BB 2QT7A 4OI3A 3LAMA 2ZH9A 1SC6A 2FUG9 3KHLA 2AWZA 1H2UX 1FNXH 4WWSA 3CT9A 3MCNA 2LQ5A 1D3WA 3IR6B 2R7WA 2IC3B 1N32F 1M0SA 4JBCA 1D9DA 2IIHA 2CFXA 1URNA 4HLBA 1RAHB 3NGSA 2XEXA 4XPCA 3AJ2A 4F67A 2ADBA 3NAIA 5HLFB 1VRUA 2VB6A 3TAMA 4PABA 3UD3P 1ITPA 1UEVA 3BKFA 3Q86A 3C15B 3ZZUA 3NEKA 2IHR1 3J80U 5A0YA 2ZEJA 3L7OA 2FLNA 4EO6A 1YBTA 2Q43A 4DR5J 3DDIA 2Y1LB 3MAHA 1F60B 1GMVA 4N77A 3IAM9 3K0JA 3IMQJ 4WJBA 2HW3A 1WDTA 2XZDB 2HQIA 2ZWOA 3A3NB 4LIRA 2VQFF 3PEHA 3VAGA 5JVHQ 3IN5A 3QIPB 2J7KA 4IYQA 3M2VB 3P49B 2HHQA 3RUBL 3QZ7A 4OZ3A 4ETZA 4KIAA 4WK1A 3MMBA 1ZH5A 1RT3A 5KG1A 2G0JA 1DTQB 3LP2B 3NBPA 3MMJA 3C19A 1YQHA 1WOOA 3QT7A 1H74A 2LU2A 2ASJA 2NQPA 1JLFB 1FA0A 3WQPA 1IJFB 4G1PA 1QVGR 3AD7C 1RT6A 4OLPA 4WF9Q 1UWBA 5IT9Y 4KO0B 4ECXA 4W92B 3OTDA 2J8AA 3OLAA 4NEYA 4FVCA 3UFCX 4ELVA 3DGPB 2BUNA 2JEIA 3KJVB 2C3OA 2QA2A 3JQKA 2ZH4A 4LT6A 2OPSA 1WUUA 3BQ1A 1EQ0A 1FERA 5KFPA 1VQKS 5KOWA 2KXNB 3QWPA 3GPAA 2V63A 3A12A 1TUGB 2CAJA 3OSNA 3LP1B 1Y9OA 5A8RA 5HO4A 2BMBA 2BV3A 2CPFA 5BYQA 2HHSA 3SCLE 4UQGA 5J2QA 1VIXA 3KMSA 3VQSA 2UXCF 4LF4F 3OUYB 4FNHA 2ADCA 5L38A 2GFFA 2RH3A 2UUTA 2W25A 4ZLPA 1FTRA 4JV1A 3Q8PB 1EAYC 3C66A 4RZRA 5HQMA 1KWMA 1D8YA 2B51A 3SFGA 4RUHA 1LV5A 1TK0A 1NSKL 3CDAA 2KXHA 1WEXA 4B3MF 1F2GA 2WZ1A 3QWUA 2HIQA 5AXMA 5KFKA 4M5HA 3US5A 3W64A 1WKJA 4X4TA 4CLWA 2NPIA 2D41A 4CZCA 2J5AA 2OAUA 3N79A 1TMJA 4CLTA 2YPZA 3NLCA 4UQTA 1J27A 1T11A 4HACA 2AZ1A 3OJSA 4U8YA 3PJXA 1EIYB 1LFWA 2JC0A 5DETA 3IS9B 1RACB 2HHHF 5GADI 4NLYA 1QSSA 4GKKF 2K8GA 3CXCR 5DO2A 4UZCA 1LQ9A 3MMAB 4P2XA 1SB6A 5D15A 2VOOA 2AHOB 2J9EA 4M5DB 3Q8VA 3M7VA 3QFHA 4TU8A 5M2UA 2ALZA 3G6VA 2RQMA 1VQ7S 5LL6d 2UV8G 4C8ZA 2QX0A 5B0DA 3V81B 2FQQB 2YNIA 3CWJA 2J9DA 2GIRA 2KHCA 2G0CA 4EGLA 2W24A 1HQUB 2XWYA 4J9QA 5CD4H 3I0SA 1TKDA 1FVSA 3M6WA 5HJYA 3EVOA 3OHBA 1N5QA 3CSKA 1TUWA 3QFWA 3GV5B 4R5PB 1QDUB 1FKOB 2EW9A 2ASLA 3GSIA 2DBBA 2D3OR 1YWXA 4IDKA 2FLPA 3KK1B 4KV8B 2ZH7A 2AJ2A 5L1LA 1A0OB 2DYAA 4LRCA 5E3PA 3BGRA 3SIPB 2LDIA 4NLUA 1F1BB 4G3IA 2WVDA 5B08A 2JC1A 5GVQA 4YR0A 4LBPA 2GMLA 1S1UA 3I32A 3KYLA 4DX5A 4LRAA 3OVSA 1V3ZA 2R7OA 4FBUA 4P2MA 1WEZA 3J7A1 1E6VB 1U1NA 2RF2A 3BQ0A 3G9CA 5KG4A 1I94F 2MSTA 2CG8A 4FNIA 5BXIA 4ZPBA 2VC0A 4R8UB 2Z58B 4ECTA 2XO7A 3ADAC 3NRBA 4LR7A 3V6KA 1N32J 4PG7A 4DQQA 3K7RA 4ES3A 2WCXA 3RR7A 1PBAA 3OVAA 5E5NA 1SUQA 1S9FA 2AEMA 1H73A 3IWLA 4OJ1A 5I3UA 3G2XA 2AP6A 1W25A 1LOUA 4DS5A 3PX4A 1VHIA 2XY5A 3V5RA 3I5CA 4HTIA 3JTNA 3J7ZT 2ROEA 2CQGA 4N8NA 4QQBA 2V68A 3DLEA 2B4PA 1Y11A 2FZKB 5JMNA 2R8HA 4CT9A 1TKTB 2GQ2A 4ITSA 2ACMA 2C3UA 3KHHA 4YMEA 4KB7A 1FDNA 2OEMA 4NASA 3PR5B 2M88A 2RRNA 1RHQB 3R1HA 3AFGA 3GFYA 3J7AN 1M5SA 1RDRA 4ID8A 2IMOA 2RHSB 1R3NA 2RB7A 5A0YB 1HBOA 1Q8IA 3GR1A 4LBIA 4ICLA 5K9FA 3HHDA 1A9NB 4LVOP 4MYUA 1CC8A 3KG4A 3KNGA 2X3GA 3KK3B 4NOHA 4MT1A 3DOMA 1W26A 2CNLB 2H4WB 4EMDA 2R2RA 3CD6S 3R7BB 1FESA 2IAJB 3BH6B 4U95A 5AXNA 4NYZA 1RBOB 4DR3F 3CE8A 3Q89A 4K5RA 3OTEA 4K59A 1XR6A 3DYAA 3U7JA 4HI2A 4DPUA 1N0UA 5FDLB 3H5YA 3BGUA 3DRYA 1T0TV 3PRDA 3E8OA 2QGFB 2E9ZA 2PFFB 3MFHA 4NYPA 5DQIA 1PG5B 1HMVB 3NS6A 1UWBB 1CLFA 4C7QA 3R5BA 2ZHBA 3OL9A 2YTCA 5LSRA 4NLPA 5KFZA 5GMKa 4RUBA 4IOCQ 5ETVA 4KGXB 2KM8B 1CSJA 4D3HA 3C2PA 4B3SF 1A7GE 5A76A 4PWDB 5CH7B 2UXCJ 5A2QU 4USVA 2OPSB 1NH7A 4LF4J 5D0RA 2F3JA 1GMUA 5IM0A 2WW8A 3I0RB 3AJDA 3ET6B 4GVLA 2UVRA 4C8NA 1S6QB 4A47A 3A8EA 3MXHP 1UJ5A 3DN9A 4I6YA 2D3UA 2B7BB 1RHKB 1BD6A 4HVZA 5A8RB 4DUZF 1L3KA 5KFHA 2N7CA 5A8KA 1GAOA 1R7IA 2WVBA 1TK8A 2BEFA 4MJKA 3P3DA 4B3MJ 1RYSA 4A8QA 3X1LB 2ZJPQ 3NNAA 2R7XA 5K20B 2M8DB 2R7UA 3HK2A 3T5JA 2RQKA 2AKWB 4TYAA 1RADB 3HHLA 4WP3A 4M8LA 2WVEA 4PQUA 1XERA 4RWWA 1HNIA 1PJ6A 2W1BA 5HVFA 2HHHJ 2WBRA 1VHFA 2DPJA 5K8MA 4GKKJ 3LWMA 1HBNB 3EZ5A 2YVSA 1NCLA 3ITHB 4NPOA 3ZTOA 3MM9A 4UUXA 2C3PA 1OQ6A 1CJTB 2RU3A 2XNRA 1ZPWX 1WSRA 3TO8A 3TZYA 3UPFA 4FXWA 2W8LA 2RE1A 5AE3A 2VG6A 3IXQA 3TQ1A 3MPUB 3FK4A 4EU0A 2XNQA 4HACB 3HO1A 4I68A 5IQ6A 2F63A 1FT8A 2FZGB 2PE8A 1FD2A 3MR6A 3AQOA 2OHDA 2VJUA 3D6FB 3SEOA 2M9KA 3FSIA 4DZ6A 2EWHA 2MYFA 2KT2A 3MEGA 1HWIA 2RD5C 1XMQF 1C2PA 3CIMA 1AFJA 3GONA 3RJMB 1RKJA 2UXBF 2AJ0A 2HBZB 5E3RA 3CCTA 1E6YB 2G13A 3TEGA 2DCUB 3IR7B 5HANA 3D68A 1VC6A 4F3OA 4KHRA 1RT4B 2YNIB 3SV4A 2AEFA 3CVKA 4ETXA 2JLGA 3H7HB 1FXLA 5KFWA 3NWRA 4B08A 5DDOC 1IKYA 3DLGA 3BYRA 4LSNB 2M70A 5H1SV 1R0AB 2E9TA 4URSA 5ETOA 3CCQS 1S9GA 5HMZA 3V4IB 1T9TA 2H51B 4KR0B 2KU7A 4X66J 5DLFA 2IM3A 2DHHA 1U0HA 5HQLA 1I94J 4JUZA 2VJVA 1ZS6A 2XMWA 5T41A 3TOQA 4OI1A 1SJ3P 1TQLA 3R5JB 1WJ9A 3UDLA 4ANDA 2ZD1B 4P2FA 3O1LA 2F4VF 3QJLA 3RW6A 4I67A 3T9NA 3TR5A 3M32B 1S1UB 3PX0A 4Q5VA 1I6JA 1RLCL 4EO8A 2DEIA 3N9UC 2KB2A 4LF6F
chains in the Genus database with same CATH topology
2C2ZB 2QLJB 2FQQB 2QLFB 2P2CB 1I51B 1RWOB 3P4UB 3R6GB 1RHRB 2C2KB 1RHJB 1RWWB 3R7NB 3GJQB 1I3OB 2CDRB 2Y1LB 4ZVPB 1PYOB 4LSZB 2C2MB 3EDRB 1IBCB 2H5JB 2XYGB 1RWMB 1RHUB 1RHMB 4ZVQB 2QLBB 3IBCB 3KJNB 4DCPB 2XZDB 1BMQB 2HBRB 3D6MB 1RE1B 2C1EB 1F9EB 1SC4B 2H54B 2XYHB 1RWNB 2Y0BB 1QTNB 2H51B 2CNNB 3NS7B 2HBQB 1RWXB 1RWKB 1QDUB 3GJRB 4ZVSB 4ZVTB 4ZVUB 2H4WB 2CNLB 4DCOB 1SC3B 2HBYB 3R7BB 2XZTB 4ZVOB 2DKOB 1RHKB 2XYPB 2CNKB 3SIPB 2H48B 5IC6B 3GJTB 4ZVRB 1GFWB 3R5JB 3KJFB 3R6LB 1RWVB 3P45B 2QL9B 3KJQB 1ICEB 3D6FB 3R7SB 5K20B 2QL7B 1PAUB 2H5IB 2CNOB 2QL5B 3IBFB 3GJSB 3D6HB 1RWPB 1SC1B 4JB8B 1NMEB 2CJXB 3QNWB 2CJYB 3RJMB 4DCJB 2H4YB 2C2OB 3EDQB 2H65B 2HBZB 1RHQB 5IC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2Z B;  2QLJ B;  2FQQ B;  2QLF B;  2P2C B;  1I51 B;  1RWO B;  3P4U B;  3R6G B;  1RHR B;  2C2K B;  1RHJ B;  1RWW B;  3R7N B;  3GJQ B;  1I3O B;  2CDR B;  2Y1L B;  4ZVP B;  1PYO B;  4LSZ B;  2C2M B;  3EDR B;  1IBC B;  2H5J B;  2XYG B;  1RWM B;  1RHU B;  1RHM B;  4ZVQ B;  2QLB B;  3IBC B;  3KJN B;  4DCP B;  2XZD B;  1BMQ B;  2HBR B;  3D6M B;  1RE1 B;  2C1E B;  1F9E B;  1SC4 B;  2H54 B;  2XYH B;  1RWN B;  2Y0B B;  1QTN B;  2H51 B;  2CNN B;  3NS7 B;  2HBQ B;  1RWX B;  1RWK B;  1QDU B;  3GJR B;  4ZVS B;  4ZVT B;  4ZVU B;  2H4W B;  2CNL B;  4DCO B;  1SC3 B;  2HBY B;  3R7B B;  2XZT B;  4ZVO B;  2DKO B;  1RHK B;  2XYP B;  2CNK B;  3SIP B;  2H48 B;  5IC6 B;  3GJT B;  4ZVR B;  1GFW B;  3R5J B;  3KJF B;  3R6L B;  1RWV B;  3P45 B;  2QL9 B;  3KJQ B;  1ICE B;  3D6F B;  3R7S B;  5K20 B;  2QL7 B;  1PAU B;  2H5I B;  2CNO B;  2QL5 B;  3IBF B;  3GJS B;  3D6H B;  1RWP B;  1SC1 B;  4JB8 B;  1NME B;  2CJX B;  3QNW B;  2CJY B;  3RJM B;  4DCJ B;  2H4Y B;  2C2O B;  3EDQ B;  2H65 B;  2HBZ B;  1RHQ B;  5IC4 B; 
#chains in the Genus database with same CATH topology
 3QAE A;  5KFR A;  1SQF A;  1WOS A;  4UY8 T;  4LUB A;  1H72 C;  3MD1 A;  1DTT A;  5KT7 A;  4LF8 F;  5GAD U;  3Q8R B;  4X4S A;  2MQ8 A;  3WDO A;  2IDE A;  4RUC A;  3FVY A;  1MRO A;  4DPT A;  5LJ3 Y;  3CGI A;  4CYU A;  5L39 A;  4B3O B;  1F9E B;  2LQ9 A;  1FFW B;  3M8R A;  3VGU A;  5LXR A;  2HNZ B;  2IM1 A;  1M1K T;  3FUY A;  2CZV C;  1EJ7 L;  1HD1 A;  3TX0 A;  4F4Z A;  4FF1 A;  4UZB A;  4NI2 A;  3M4X A;  3HHL C;  2ZKU A;  3KKF A;  4L76 A;  2ATL A;  1PC4 A;  1T8E A;  2R7T A;  2DIT A;  3CNQ P;  1SI9 A;  1V5I B;  2Q1L A;  2NXC A;  4GVB A;  1HPZ B;  4HHU A;  3DLE B;  3NOG A;  1JJ4 A;  4H4K A;  3H2V E;  5CZV A;  4DV5 F;  3G96 A;  4ZCL A;  1JLG B;  4RNN A;  2MKJ A;  3NGT A;  2B4O A;  4NYO A;  1HFE L;  2Q79 A;  2XSJ A;  3PW5 A;  1WWH A;  4KY3 A;  1WC1 A;  1YRT A;  4Y2K A;  5JXS A;  2A2D A;  4DR3 J;  5B0G A;  3H5X A;  1U24 A;  2LU1 A;  5M2P A;  2OTJ S;  3F0N A;  4B9V A;  2MY7 A;  1RB0 A;  1XIQ A;  3JSB A;  3UVJ B;  2BX6 A;  4MK8 A;  1V3R A;  4NCG A;  1QUV A;  1RWK B;  2GA7 A;  3RTV A;  2BR0 A;  1NK0 A;  1ZM4 A;  4NWB A;  1T02 A;  5CHC B;  2BZ2 A;  4ECS A;  3OVB A;  1Q78 A;  4USW A;  3NG8 A;  2QO3 A;  3R6L B;  6FDR A;  3SQG B;  2KZM A;  4L3N A;  4C3M A;  2JX2 A;  3KJQ B;  1ICE B;  4IKA A;  5EGY A;  2BKN A;  2XS5 A;  3KLF A;  2UUC F;  4NE9 C;  1WDD A;  2FJE B;  5E7O B;  2V6A A;  2ZFH A;  1BHN A;  3BV8 A;  1SVD A;  1U6F A;  2P6T A;  1EHW A;  1P27 B;  1FJG F;  3NXZ A;  5IWA F;  3HFV A;  4ERD A;  1REG X;  2QYC A;  1M5V C;  4OYW A;  2LLZ A;  4DUZ J;  3PYG A;  4I7F B;  3MPV A;  4CM0 A;  4ZCK A;  3HKW A;  3DRS A;  1SL1 A;  4YDD B;  2H5E A;  1Z2L A;  1RE1 B;  3M8Z A;  2CUY A;  4CNZ A;  4ECZ A;  4FYD A;  4AL7 A;  2UUA F;  4FYW B;  4DFP A;  1X9M A;  1PIL A;  4DV0 F;  2HZC A;  3HHL D;  4QYZ K;  3I5B A;  4FP9 A;  3W5Z A;  5E0O A;  1X5P A;  3MCM A;  1KOH A;  2DD8 S;  2KKH A;  2M5Y A;  4E2F B;  3E2E A;  4FXV A;  5A8K B;  2O5D A;  2J76 E;  4ZIW A;  1YJV A;  4IFY A;  4PWW A;  2Z56 B;  5A8W B;  3SZ2 A;  3TW0 A;  1JKH B;  2A6O A;  4ANC A;  1ZAW A;  3PX6 A;  3MM7 A;  4I2P A;  4PXD A;  4RNF A;  5L9N A;  2K1R B;  4ECR A;  1HNI B;  4WK3 A;  3O2I A;  2J6S A;  2FVP A;  3R7N B;  3MDF A;  3DU6 A;  3IM9 A;  1Y5N B;  2V4R A;  1ZAX A;  3BR9 A;  4IRD A;  2XY7 A;  3CTR A;  4NLD A;  3D0I E;  2OML A;  2A1B A;  1U6B A;  1XMQ J;  3FCW A;  2D3Z A;  2VG6 B;  4PPD A;  2UXB J;  5IV3 A;  3MEE A;  5K5M A;  4F04 B;  2V8D A;  1H0H B;  2VA3 A;  3MPW A;  1C0U B;  3DI6 A;  3DLH A;  3EZU A;  1GMW A;  3DDN A;  1VDH A;  2ZOF A;  1FKA F;  1CQN A;  4B3T F;  5A6P A;  1JIH A;  5DZ6 A;  2V8V A;  2XM3 A;  4PXB A;  4A4J A;  3K5L A;  3N28 A;  2R7R A;  3IBF B;  1O5J A;  1NK7 A;  3MED A;  3L95 X;  1H6K X;  3UWT A;  2H65 B;  2PA3 A;  2ZUA A;  3EGV A;  4V19 X;  2HHP A;  1HBM B;  2NYH A;  1NKC A;  3JXO A;  4O3Q A;  4A8S A;  4LFA F;  3DU5 A;  1IKV A;  1QLN A;  1O6X A;  3JYT B;  3FQL A;  2HHU A;  2BA9 A;  1ZYQ A;  3KLE B;  1C0T B;  1N0V C;  4Y00 A;  1JLC B;  1YRX A;  1TV6 B;  2B6A B;  2XTJ P;  2F4V J;  3DFE A;  2NZ4 A;  2P9C A;  3KUG A;  1TL1 B;  2DGV A;  2MLY A;  4YEA A;  5DG8 A;  2AGP A;  2U1A A;  4UF4 A;  2HGM A;  3Q23 A;  1FX4 A;  3ILL A;  4RJV A;  4J9M A;  4U8V A;  3RAX A;  1F5C A;  2SXL A;  2E7W A;  4LF6 J;  4ZPA A;  5AT1 B;  5C2G A;  5IT9 U;  4LF8 J;  1S6O A;  2RKI B;  1KS2 A;  1S1W A;  3ZFV A;  1RAJ A;  2GVD A;  2DB1 A;  1F3V A;  2QL7 B;  2VIH A;  5EX0 A;  2CQ0 A;  3HVR A;  2VFV A;  4JB8 B;  1S1X B;  3HZE A;  3QZ8 A;  2BAC A;  5EX3 A;  2BW2 A;  2BJ9 A;  3DGV A;  4C3K A;  3GU0 A;  2NR0 A;  2HNY B;  2P9E A;  1EP4 A;  1NPR A;  4F4X A;  4K5S A;  3OBI A;  4B17 A;  2DH9 A;  1FFG B;  5CXT A;  3KLH B;  3K17 A;  1DTT B;  3EDR B;  3ZTS A;  1F0X A;  1DAR A;  1U6Z A;  3DRX A;  4GMK A;  3TJ9 A;  5EWF A;  3MZI A;  5G0R B;  3GWC A;  4TY8 A;  4DV5 J;  1NB2 A;  3DLL Q;  2GV1 A;  4ENO A;  4L3K A;  2CPX A;  4FS1 A;  2XZT B;  2OP5 A;  3LGH A;  4NI2 B;  2O67 A;  3RU0 A;  2FJB B;  3M8P A;  1U7L A;  1S72 S;  4WCE Q;  5F8G A;  2KYX A;  3KG0 A;  1TMM A;  4EBD A;  2OPR A;  2CNO B;  3QYY A;  1T9X A;  2AT1 B;  3ONQ A;  2HHW A;  1UWA A;  4LF2 A;  4NZ0 A;  3HHK A;  2B4V A;  2HQ3 A;  2FVC A;  1XTZ A;  5EDW A;  4K50 A;  1XBW A;  5I42 B;  1NKB A;  2GIQ A;  2AIR B;  3BEG B;  3SDE A;  3D3B J;  3GB0 A;  1JNR B;  2R3V A;  1S59 A;  5HP1 A;  1KD1 T;  1HNV A;  2MJU A;  2P5V A;  3THP A;  4ZVG A;  1EQM A;  2UUC J;  4DLG A;  1WI6 A;  1MNE A;  1LWC B;  4IG3 A;  3HVT A;  2YKP A;  1BC6 A;  4J9R A;  4NCG B;  2HAI A;  2EFV A;  4F3Q A;  1FJG J;  3ZZ0 A;  5IWA J;  2H48 B;  2WON A;  1IJE B;  2PFD A;  2F8E X;  1LWE B;  4OYP A;  2BAN A;  3JS9 A;  2VOD A;  3VGV A;  3NNH A;  2L9W A;  3O44 A;  3PHT A;  2XMK A;  3P6Y C;  5L1J A;  4EK2 A;  3SBM A;  2QA4 G;  1VI7 A;  3PHE A;  2AU0 A;  4A8X A;  1YK9 A;  3M9M B;  1H2V Z;  1UTA A;  5FD1 A;  2IM2 A;  4QIW D;  2UUA J;  1ZPV A;  4YY3 F;  4DV0 J;  3KWM A;  3PAC A;  1UW9 A;  4ZIT A;  1BUX A;  3FSX A;  1S97 A;  4J9P A;  3VWS A;  2VA2 A;  5LXY A;  3H98 A;  2QA4 S;  4O3N A;  4DL3 A;  2QLB B;  5C24 B;  2HK3 A;  4HEA 9;  4ZPD A;  3RGI A;  1QY7 A;  4DZD A;  4Z7C A;  3SFU A;  4QR2 A;  4F2R A;  4NA3 A;  2OO4 A;  4B9T A;  1FKP B;  3MFI A;  4IH7 A;  4HI1 A;  4K4S A;  3NGK A;  3D0G E;  3UN5 A;  2F5G A;  5J2M A;  2DCL A;  2V5H G;  1U1K A;  3M30 A;  2H1Y A;  1CS4 B;  4DOZ A;  3NAH A;  3IWX A;  4OZ1 A;  2HVE A;  1J2V A;  3MWB A;  4XTT A;  3LQV A;  1CJK A;  5HK4 A;  1KLM A;  4Z2X A;  2ZH6 A;  1OO0 B;  4ZVR B;  5KFI A;  4PUO A;  3OFE A;  3QO9 A;  3NOC A;  3W1Y C;  3AA8 A;  3AHP A;  1NJI T;  4IFV A;  1P8G A;  2HVD A;  3W8P A;  5CYM B;  5IT0 A;  1JQG A;  1RXO B;  5HQ8 A;  4OX8 A;  4YB1 P;  3CED A;  2H4Y B;  1RAB B;  4KFB B;  1UZH A;  1RI7 A;  2LXF A;  1FK9 A;  2MTL A;  1I51 B;  2CQH A;  1NLK L;  5CCL A;  4QWD A;  2FB0 A;  4DL4 A;  1EET A;  2IRY A;  4B3T J;  4IQM A;  4ZP8 A;  5E3Q A;  1B64 A;  1GMW D;  3WZ0 A;  5D78 A;  4WKR A;  1IBK F;  2IJR A;  3JQJ A;  3WHI A;  1V6H A;  4U7C A;  2BVZ A;  2W2Q P;  5HVH A;  2PN6 A;  5DGB A;  4CLP A;  1FXR A;  1TKZ A;  5K14 A;  3HFK A;  3MEE B;  4LFA J;  3N4W A;  4ILM A;  2DVI A;  2Z57 B;  3DI6 B;  4Y28 C;  3F73 A;  2Y1I A;  2N4C A;  4J9O A;  5IZH A;  2Q66 A;  5K8P A;  3SSS A;  1J5O B;  3RBZ A;  2QRR A;  1B3T A;  2BJ3 A;  1VQ9 S;  4BWJ A;  4DLE A;  3AD8 C;  1OQ3 A;  2OJ3 A;  1T9Y A;  3M6V A;  3FBB A;  4ECV A;  5KFA A;  1VBZ A;  1X9S A;  2EFG A;  1YDL A;  1JXE A;  4ECY A;  3ISN C;  3GJQ B;  2DGX A;  2NPF A;  2EFO A;  3SSQ A;  2BOP A;  1B0T A;  2ALY B;  3T5H A;  3TVK A;  4X62 F;  5GMD A;  1GQE A;  4C8O A;  1TU0 B;  1EZZ B;  6FD1 A;  3GJR B;  5IV4 A;  4F26 A;  4N56 A;  4C11 A;  4NA2 A;  3NMA A;  1IM4 A;  2CNK B;  1NKE A;  1LK7 A;  2CQC A;  2GJF A;  2LDY A;  3RW7 A;  4ZPV R;  3FSY A;  3R8Y A;  3TA1 A;  1MSW D;  5L8R C;  1P9Q C;  1KVI A;  1CEZ A;  1N52 B;  3EWG A;  3OFH A;  3PFE A;  2X7I A;  2G2Y A;  3FGV A;  2GVD B;  1B70 B;  2GMH A;  2XWX A;  3KDO A;  1FRM A;  4IO1 A;  4C2M A;  4ID5 A;  2NXN A;  1S0V A;  4ZLJ A;  2WHO A;  2QLW A;  1JB0 C;  1IKW A;  3MPD A;  4CTA B;  2COL A;  2OEK A;  2YKM A;  3I56 S;  1HHQ A;  3B4D A;  4O44 B;  2CPJ A;  4P6Q A;  5DGA A;  4PG4 A;  5H9E K;  4K7Q A;  2FC9 A;  4P74 A;  4JI3 F;  1FXD A;  3BZQ A;  4YHH F;  2NXJ A;  3D3C J;  3PY8 A;  3T6B A;  4DMZ A;  4OZ2 A;  4XDC A;  1V3S A;  2MGZ A;  4AT1 B;  3ILJ A;  1I5O B;  3HD1 A;  2YX1 A;  3BBF A;  1RT2 A;  4ZN1 A;  2EFN A;  2BE2 B;  4DX6 A;  1X4D A;  4ZVO B;  2L08 A;  4PYD A;  3POT B;  3J7Z 5;  2AV5 A;  1SPB P;  2OPP B;  1KN6 A;  4QR1 A;  1RWV B;  4ED3 A;  2FJX A;  3KLG A;  3LPE A;  1MWY A;  1FD8 A;  2V9K A;  3A4T A;  3Q83 A;  4ILR A;  4HH0 A;  1VQ8 S;  3CDE A;  3OTB A;  2Y1J A;  4Y2I A;  3GZ7 A;  3KG1 A;  3EDQ B;  5D0H A;  4ZIV A;  4ZOS A;  3QRP A;  4HDG A;  4GC7 A;  1VK3 A;  4J9L A;  4DPX A;  1UMJ A;  1FJ7 A;  3D66 A;  2DGU A;  3ISN D;  1DJ0 A;  5U47 A;  3EMT A;  2P9G A;  3UN2 A;  4ZVH A;  1Q5V A;  7FD1 A;  2X51 A;  4CNY A;  1YI2 S;  4H4M A;  2LA4 A;  1N5Y A;  3MHY A;  1HNV B;  2KRR A;  4HHH A;  5KFG A;  4F4K A;  1LWX A;  4EFA C;  1F5B A;  4EYH B;  3R1L A;  2ILZ A;  3MM6 A;  4Q2L A;  3QRR A;  2CAD A;  2R4F A;  4OZ0 A;  1U1L A;  2MHN A;  1NK6 A;  3CMA S;  3TAQ A;  3M8S A;  4YY3 J;  2HAF A;  3OXF A;  4IOA Q;  2K3I A;  3DRR B;  4OI4 A;  1CUL B;  3ZTR A;  1IBL F;  1UL3 A;  2ZH5 A;  1BXN A;  1SKW A;  2ZBC A;  4O4R A;  1VIS A;  1VRQ C;  4YP3 A;  1UAW A;  4QPX A;  5D3G A;  3Q24 A;  1HWK A;  2QEX S;  1IWA A;  3QGP A;  1YIJ S;  1SJ1 A;  1G7C B;  4DSF A;  5HN0 A;  3EVW A;  3MR5 A;  2ASD A;  4GRS A;  3PCO B;  1Y3K A;  3UD4 P;  2GHP A;  3ETM A;  2L9D A;  3K5O A;  3KOA A;  3H2U B;  5T14 A;  1FJC A;  1IQZ A;  4PZV A;  4LSL A;  1HQE A;  2F9J A;  4WP8 A;  4CP5 A;  4UOG A;  2V69 A;  5K8O A;  4ZHR A;  4P7V A;  3CDU A;  1Q79 A;  1XEZ A;  1MW7 A;  2JLF A;  4DV7 F;  3LW5 C;  1HW8 A;  1VQN S;  2GGP B;  1PC5 A;  2J0W A;  1DLO B;  2MB0 B;  3UDV A;  4GKJ F;  1XNQ F;  5CAA A;  2BJ1 A;  2NXE A;  3HT0 A;  1P1L A;  2K7J A;  2N3O A;  2MKC A;  4CCH A;  4QBU A;  4RW7 A;  2DY9 A;  2FYX A;  2J6T A;  4AQY F;  3G71 S;  4RO0 A;  5KFB A;  3VGT A;  3K5N A;  2JVO A;  2F7V A;  4TVA B;  1FJE B;  2E44 A;  2OEJ A;  3R3T A;  1YSJ A;  4WFZ A;  3A8I A;  3H5S A;  1IBK J;  3R2D J;  4LF1 A;  4DV6 F;  4K4Z A;  3L3C A;  1FI4 A;  3CF5 Q;  2JZ5 A;  4ZPT R;  3V6J A;  4JI2 F;  3DLK B;  3ZZY A;  4EBE A;  1T95 A;  1R0B G;  1B99 A;  3PKY A;  2HHX A;  3C6U A;  3A13 A;  1IKX A;  3AAW B;  4DJB A;  4PRF A;  1CJU B;  3MAA B;  1X4F A;  5LSL A;  2FIU A;  3P5B P;  1ROF A;  2DNQ A;  2MLZ A;  2L3M A;  2LXU A;  5D0E A;  2IVY A;  2PMZ D;  1R43 A;  3GIK A;  2LP4 A;  3H4D A;  3ETO A;  4C48 A;  3TUI C;  4BCA A;  2W7A A;  4ZDN A;  4NRU A;  3CIZ A;  4HKQ A;  1VQ4 S;  5K14 B;  4I6W A;  1GFW B;  3UR3 C;  1GEH A;  1QE1 A;  3GTY X;  4RW4 A;  2LQB A;  4OJG A;  5HL7 Q;  2C2R A;  2N7Y A;  2W4P A;  4X62 J;  1XMB A;  3TVZ A;  3DKD A;  1Y00 A;  4NLS A;  3GLJ A;  4TQR A;  2OSR A;  2VF3 A;  3M2U A;  3PO5 A;  1UVL A;  1TVR A;  1S9E B;  4ECQ A;  3WC0 A;  1R8B A;  2E7X A;  1K0T A;  1IR1 A;  3TA0 A;  1SJQ A;  2XMV A;  3LP0 B;  2B5J A;  3QMQ A;  4A48 A;  2CPY A;  4OX7 A;  2XMA A;  1FWL A;  1U02 A;  1RTD A;  4DR6 F;  1TAU A;  1I3O B;  4F2S A;  2CJ9 A;  2MXY A;  1G4C A;  3LGM A;  2JJ4 D;  1T9U A;  1N56 A;  5HAT A;  3QGG A;  4HYK A;  4CLK A;  3BKU A;  2VBW A;  3JSY A;  2RS8 A;  1HW9 A;  4LMZ A;  2ZBR A;  2DTJ A;  3T3F A;  4QIE A;  4DL2 A;  2M4M A;  2MY8 A;  4QCL A;  4C11 B;  4G1I A;  4RW8 A;  4USJ C;  3S1T A;  2PEB A;  1TKX A;  5ETQ A;  1HLW A;  3OXL A;  2VFU A;  2YKN A;  3CJR A;  4LQ3 A;  1VIO A;  1KVJ A;  4ECU A;  3E01 A;  3P45 B;  4DL7 A;  3FFI A;  1FRJ A;  2M3D A;  4C8K A;  3AB4 B;  4YHH J;  1SIZ A;  2YNF B;  1VQO S;  1D1U A;  1AB8 A;  1OSD A;  3ZTP A;  4CDI A;  4RX6 A;  4MFB A;  1YGY A;  3ELH A;  3FBE A;  4UY8 5;  1RHR B;  1IKW B;  2YKM B;  1NK4 A;  4PG8 A;  2NZC A;  4BS2 A;  4I56 A;  2V4Q A;  4DG1 A;  2Y0S D;  2EVZ A;  3AA9 A;  2FHJ D;  2YNG B;  1IXK A;  2EC2 A;  4N5S A;  1X31 C;  4WZM A;  3KLI B;  2F65 A;  3SCJ E;  4L72 B;  1HAR A;  3ICL A;  4AFF A;  5KT2 A;  3C6T A;  4TLQ A;  3MMC B;  1NJZ A;  3W2V A;  1TL7 A;  5GAH I;  5ITH A;  1RT2 B;  3IWN C;  4ZP9 A;  1ULR A;  2G1D A;  2IBO A;  4KC5 A;  4R0J A;  2KH9 A;  2DNY A;  4JI7 F;  4K4U A;  3H20 A;  4ZLN A;  3QT8 A;  3GFZ A;  2VG7 A;  4IR1 A;  1TUV A;  2YNH A;  3FBC A;  1Q82 T;  4B9S A;  4DCJ B;  3HMJ G;  3KK2 A;  1K47 A;  2E1P A;  4KHP F;  1RT5 A;  3R6G B;  3M9N B;  1YTY A;  4JV0 A;  1NHV A;  3R9L A;  4UOH A;  4F4Y A;  3CCJ S;  2XLI A;  5J1E B;  3B54 A;  4IUF A;  1HWU A;  4MKV A;  4RL1 A;  4N41 A;  4O3S A;  4MMO A;  1IBL J;  2BJE A;  2LMI A;  3CJT A;  3R27 A;  2W4C A;  4CRJ A;  4B9M A;  2M8H A;  1ZET A;  1LW2 A;  1N5Y B;  2DIU A;  4F7V A;  2J8S A;  4OV1 A;  4TQS A;  2DEJ A;  1ZA1 B;  1NK5 A;  2DGO A;  2DPI A;  4FXD A;  1G6B A;  2JNJ A;  4NX9 A;  1IBM J;  4N7T A;  1U1M A;  4ZJO A;  5KFC A;  1KQF B;  2RDD A;  2I5J A;  2J9C A;  2CQ2 A;  2V34 A;  4OZJ A;  3DOL A;  3VGS A;  3IC1 A;  3GYG A;  3MAQ A;  2IY5 B;  1K44 A;  3PDN A;  5J1N A;  3RRG A;  2KG1 A;  2YWH A;  1RAG B;  5F8H A;  3QLH B;  4DV7 J;  4DV1 F;  6AT1 B;  4USK A;  4AL6 A;  4JI8 F;  4DQS A;  4WFY A;  1K73 T;  4GKJ J;  1XNQ J;  1LXN A;  4O0N A;  3TNV A;  4OIX A;  1YRU A;  3CJK B;  3D28 A;  4CO1 A;  1K8A T;  2MZ1 A;  2C2D A;  1RZM A;  4B9N A;  2IPO B;  2JEJ A;  4AQY J;  3V6H A;  1PYO B;  3LGN A;  3R97 A;  4CT8 A;  2H5J B;  2HEK A;  4LSL B;  1HQE B;  3ZO7 A;  3IRX B;  1BWE A;  1KBR A;  1RT1 A;  2J9D E;  1WAC A;  1OY8 A;  1T05 A;  4ZHR B;  1D9A A;  1WEY A;  3CJ3 A;  3FBF A;  2Y8W A;  4YB7 A;  2W01 A;  1TTH B;  4NCA A;  4X65 F;  4DV6 J;  1T9V A;  5THW A;  4YOE A;  1X60 A;  2DO0 A;  3KUH A;  4B9U A;  1M1H A;  4JI2 J;  2GJ2 A;  2XMM A;  1FEH A;  3DXS X;  2HFO A;  2KZZ A;  4DSE A;  2D9P A;  3JQM A;  3ENV A;  4ZVF A;  4E98 A;  1XR7 A;  3SMZ A;  1N88 A;  3D67 A;  4C9D A;  3ENW A;  3C16 A;  4RW6 A;  1JLB A;  1R8H A;  3JSM A;  5KTQ A;  2E5I A;  4RWX A;  1HI8 A;  1RTJ B;  3UDE A;  5C7P A;  2VQE F;  4DN9 A;  3BGF A;  5J2N A;  4LVN P;  2BQR A;  3RYL A;  3KTQ A;  1OY6 A;  1OWX A;  2GC8 A;  3UE2 A;  3S8S A;  4CLL A;  4F3M A;  3HSD A;  3AXK A;  3PJ9 A;  2E29 A;  1T03 A;  3MPY A;  2OD4 A;  2E5J A;  5H9E J;  4WYW A;  2F8H A;  4J9U E;  5CQG A;  2CQD A;  4YR2 A;  3NNC A;  3THV A;  2DNR A;  3I82 A;  1QD1 A;  4ZVS B;  2LEP A;  5CYQ A;  4CH0 S;  1S7I A;  3OL8 A;  5KFT A;  3DLJ A;  1NO8 A;  4U6P A;  1XJW B;  4H4O A;  2VZ9 A;  3L7U A;  4DPW A;  1YG0 A;  2MZJ A;  2PMH A;  3W65 A;  2ZH3 A;  2CVI A;  3IM8 A;  4DR6 J;  1W2B R;  1XR5 A;  1AW0 A;  4DX7 A;  4USM A;  2YWK A;  2D1C A;  1JJC B;  4KKO A;  4CLY A;  4WII A;  3I4H X;  4DL6 A;  4NXM F;  1QE1 B;  3PXG a;  3FDS A;  4RU2 A;  2LFV A;  4RW4 B;  3TZX A;  2OLW A;  2IJN A;  1KLN A;  4DPO A;  1RU2 A;  3GYN A;  4LBH A;  2JWN A;  2BRK A;  1X0P A;  3FRZ A;  3G6Y A;  4K8R A;  2XQC A;  1RWO B;  1TVR B;  4PWU A;  4ZLL A;  2B5J B;  4A8M P;  2JSX A;  4OJ3 A;  1SKS A;  1IBC B;  4DS4 A;  3KJN B;  2V8H A;  2KTQ A;  4B9L A;  3MCO A;  1YHQ S;  4EUV A;  2QMX A;  3OR2 B;  1YZ6 A;  2HHV A;  1JWW A;  5FII A;  2R9L A;  4G65 A;  5DJB A;  1PAE X;  1S1T B;  2UV8 A;  4ZVU B;  4IO9 Q;  3CD7 A;  2VG5 B;  5LSO A;  4Q7A A;  3CPW R;  5AXL A;  2A10 A;  3LOU A;  3N0V A;  4C98 A;  3P5T L;  2KVQ E;  4UOF A;  4RW8 B;  2AYG A;  4LFC F;  2GO9 A;  1BQN A;  3MD3 A;  4KH1 B;  2YKN B;  4FS2 A;  2H5I B;  3M1V A;  1D0E A;  1KDN A;  3HLU A;  3E01 B;  5C25 B;  4MIA A;  3HJV A;  2PI5 A;  4IRC A;  3K59 A;  5J1P A;  3NS5 A;  2XCA A;  1C1C B;  4ZA1 A;  5ADZ A;  2C42 A;  1WG1 A;  2KJV A;  2C22 A;  5EHH A;  4FDF A;  3UNY A;  7FDR A;  1NSQ A;  3PZP A;  4BBY A;  3F44 A;  2HVH A;  2PMW A;  4U9R A;  5HRO A;  3HVA A;  3MM5 A;  2K3K A;  3OT9 A;  2ZZN A;  4QIV A;  1QSY A;  4JI7 J;  2AQ4 A;  1HIY A;  2Q6C A;  3FZ2 A;  1T7P A;  5KG6 A;  2VD3 A;  3T1A A;  1NJW A;  4DSJ A;  5HVG A;  4A8W A;  4CIO A;  4NXN F;  2GS8 A;  3B4M A;  4WFB Q;  1Z4U A;  3EGZ A;  2CNN B;  3GE9 A;  1QAI A;  2PO4 A;  1MU2 B;  3J81 Y;  3LO3 A;  1JLQ A;  1WC4 A;  2DIV A;  3I55 S;  1GXL A;  1KTQ A;  1V9O A;  2YKQ A;  3C6T B;  4KH0 B;  1REV B;  4X4V A;  1JLA B;  1BE4 A;  4DV3 F;  1B0P A;  1KQK A;  1KP6 A;  2CQB A;  2XI2 A;  2W9B A;  4O3O A;  3M2R A;  2UU9 F;  3OQ2 A;  2HS3 A;  1QAX A;  5IS2 A;  4IG0 A;  1CJV B;  3BSC A;  4NLQ A;  1TL3 B;  1WG5 A;  1RLD A;  1UJ4 A;  2YNH B;  3R2C J;  2RUG A;  1WF1 A;  2DNM A;  2DNK A;  3C46 A;  4W90 B;  4LFB F;  1S1V A;  4CQ1 A;  4M5G A;  2XCP A;  2GCF A;  1CC7 A;  2B4U A;  1A6L A;  3IG1 B;  2MQN A;  1F3F A;  3G8S A;  3TWZ A;  3L4B C;  3MM8 A;  3CD0 A;  1WF2 A;  4B02 A;  2W4D A;  3ZTQ A;  2P8I A;  2LXI A;  3MR2 A;  3PIP Q;  5DG7 A;  3N6M A;  2AX0 A;  1RWX B;  4OX9 F;  1B7Y B;  4DV1 J;  2MDA A;  2ERR A;  4QU7 A;  3CME S;  1MLA A;  5KFM A;  4DUY F;  4JI8 J;  1W7W A;  3FEZ A;  5AJ3 F;  2BQU A;  2FVR A;  2HRY A;  4QYR A;  1R6Y A;  1F6T A;  4Q8F A;  2FJA B;  3L09 A;  1U1P A;  2N4D A;  1WHX A;  1U2R A;  2YXL A;  4URQ U;  3U1N A;  3I31 A;  5GME A;  3BF4 A;  3DM2 A;  1IN0 A;  2UVU A;  2C2O B;  4KRW A;  2HQC A;  2QSW A;  1S79 A;  4X65 J;  5KT4 A;  2QLJ B;  2B56 A;  2DJW A;  2DR8 A;  4CO2 A;  1BQM A;  3P4U B;  1AXQ A;  4F50 A;  4WE1 B;  2UP1 A;  4ALZ A;  3LA0 A;  4KPY A;  1MN9 A;  4OQJ A;  4NLG A;  1N36 F;  2HK2 A;  2ZE2 B;  1VRT B;  5GAH U;  2WVC A;  2X1F A;  3HZG A;  2HYI B;  3OTC A;  2HS0 A;  4ED6 A;  3IO1 A;  2B9X A;  1RWM B;  1PO6 A;  1ZBT A;  2B9W A;  2GJI A;  1Q0N A;  3DXB A;  3ZNJ 1;  4HT5 A;  1YLX A;  3S01 A;  1OYE A;  3M8Q A;  2ZKT A;  5KFF A;  2HSE B;  4OX6 A;  3BPD A;  3AT1 B;  2NS1 B;  1MN7 A;  2DHA A;  1YJT A;  4I64 A;  2VQE J;  3V6D A;  2E66 A;  2H3E B;  2AMC B;  3QBC A;  1VRU B;  3TAM B;  2VQF J;  2EEY A;  4E8U A;  2MSS A;  3DCA A;  2V8P A;  3B8H A;  3PTW A;  4WFN Q;  1RKI A;  4DL5 A;  2W2O P;  2IC3 A;  4OHZ A;  4JI0 F;  1OS5 A;  1RTI A;  2CZ4 A;  4QIF A;  3TX8 A;  3D6H B;  5IOL A;  1NDL A;  1LKZ A;  3L7P A;  3T1Y F;  3RB3 A;  1YX2 A;  2AX1 A;  4PXE A;  3VAL A;  1UVM A;  5E33 A;  3C16 B;  5HLF A;  1HI0 P;  3VTI A;  5A6W A;  3B78 A;  4P2S A;  2ZBQ A;  2YKA A;  5B0C A;  2CWK A;  4IH6 A;  1C1B A;  2MQP A;  1T94 A;  1WTF A;  3C15 A;  5F0U A;  1HNX F;  4Q2M A;  2J6U A;  4QWA A;  3DRP A;  5J2N B;  2KN4 A;  2APO A;  2GVZ A;  3D6T B;  3W66 A;  1DHM A;  2LQJ A;  4NXM J;  5KFL A;  5F9L A;  4LF7 F;  2CJQ A;  4J90 A;  1TR0 A;  2J0Q D;  2C2E A;  3MMB B;  2ZVS A;  1RT3 B;  3NBP B;  1FRK A;  2RQC A;  1TEL A;  5CYQ B;  2AYB A;  1FX2 A;  1NND A;  3QIP A;  5D77 A;  3RRK A;  1RT6 B;  1FNM A;  3W7B A;  3M8Y A;  3VZI A;  2UXD F;  1GXT A;  1JJ2 R;  2GX8 A;  2RIL A;  2QL5 B;  1DTQ A;  3LP2 A;  1RWU A;  2OI2 A;  2AEJ A;  2C2N A;  1SL0 A;  3PR4 A;  2XMU A;  4ECW A;  3HI9 A;  1APS A;  2HGN A;  3OV7 A;  1JLF A;  4PG5 A;  2B8Q A;  4A8K A;  3M6U A;  3D4J A;  3OHA A;  3IRW P;  1R27 B;  3TAN A;  2OH2 A;  4KO0 A;  2BQ3 A;  1HL6 A;  2ZNZ A;  4AXI A;  5LJ5 Y;  2OFG X;  1VQM S;  3ISZ A;  4ZP7 A;  3G82 A;  3U27 A;  4LFC J;  1UET A;  3KJV A;  2GQC A;  4DR7 F;  3D1H A;  3VCD A;  3WIV A;  4M1K A;  2OFH X;  1O51 A;  2OD6 A;  5J2Q B;  1SV5 A;  3OSP A;  3PW2 A;  4AXJ A;  1UW4 A;  3CCS S;  3NY0 A;  1HHT P;  4NCB A;  5KFX A;  1WNE A;  2QV6 A;  4ZCI A;  4PXC A;  1WEL A;  2VBY A;  3W5X A;  4L73 A;  1BLU A;  4FF2 A;  4CLF A;  2VPW B;  1RGV A;  1JXL A;  1KHV A;  4DEZ A;  4TY9 A;  2GMJ A;  2CDQ A;  3Q8U A;  2MKS A;  4QW8 A;  5IT4 A;  3EIC A;  4NXN J;  3K89 A;  5KOX A;  1M1G A;  4MKB A;  3TRG A;  4OYI A;  3OUY A;  2P2C B;  1Q53 A;  4WP9 A;  3LH2 S;  1X4C A;  1RWW B;  5F8I A;  3CJQ A;  2A2C A;  1U26 A;  4F8R A;  4DV3 J;  2YKO A;  2OUG A;  2OSQ A;  3OXG A;  2HIY A;  4CH7 A;  3FJ2 A;  3A3P B;  3D6M B;  2IYG A;  1LFP A;  5JUM A;  3TAP A;  3W62 A;  2JL9 A;  3FNN A;  3G87 A;  1J5E F;  2E7V A;  2UU9 J;  2DNN A;  5LMN F;  2QG9 B;  5L46 A;  2KI2 A;  2GZO A;  1CG2 A;  2E5H A;  5L1K A;  1YJN S;  1JLQ B;  1TL5 A;  4LFB J;  2R7Q A;  2X1B A;  2GAH C;  2MQM A;  4CLU A;  2I9S A;  3IS9 A;  3LPY A;  1RTZ A;  4FYY B;  3ILO A;  4KGK A;  4M94 A;  3K8V A;  2DRA A;  4RUA A;  3GP9 A;  4ZPC A;  4OZN A;  1RK8 A;  4QWB A;  2ZDO A;  1TFW A;  3T41 A;  4ZN3 A;  4UST A;  4OFZ A;  4UW2 A;  5RUB A;  1IM6 A;  1RAE B;  3JTO A;  3KHR A;  4OX9 J;  4M5D A;  3OJU A;  9ATC B;  3MUR P;  1G2E A;  4DUY J;  2WRM A;  4J9V A;  2Z2M A;  2XMT A;  3I0S B;  2V94 A;  4KGV B;  1VQP S;  4N8O A;  2ZC4 A;  3FKB A;  5AJ3 J;  1NPP A;  1XWL A;  3PNI A;  3V81 A;  1SJR A;  3PYF A;  2QYG A;  4X64 F;  1KRP A;  2NUU G;  4IDK B;  1HQU A;  3TUJ C;  3UO0 A;  2VHG A;  2G9O A;  2NCK L;  4G1Q A;  1DRZ A;  4NLV A;  4KHM A;  4KE5 A;  1ZOT A;  3BGR B;  5AE1 A;  3QAU A;  8ATC B;  3IBW A;  3IGV A;  2XO6 A;  2AJQ A;  5B0E A;  3EM1 A;  2ZOM A;  3SCI E;  1K1Q A;  4R5P A;  2V0N A;  1NU4 A;  3EXC X;  4OYB A;  3NCP A;  5KFO A;  2GIF A;  1N36 J;  3KK1 A;  3KDN A;  4MYT A;  4USI A;  3HT3 A;  2RF2 B;  1GTE A;  3BH7 B;  4Y34 A;  2A3J A;  2RAQ A;  1UVI A;  3GCW P;  3W8G A;  2ZH8 A;  2GO8 A;  4I4B A;  4MIB A;  1NDK A;  4BWM A;  1OY9 A;  2V2V A;  4CH1 A;  1VC0 A;  4EBC A;  2EK1 A;  1E6V A;  4ELU A;  3CJ0 A;  2KO1 A;  1SL2 A;  2VFT A;  3M05 A;  3MTK A;  1SUQ B;  1U25 A;  3MUM P;  2CPH A;  1TZ0 A;  2PA8 D;  1M5K C;  3HHN B;  1NAQ A;  4RW9 A;  4R8U A;  5I3U B;  4DV4 F;  1GT8 A;  4JI0 J;  4BHQ A;  3UN3 A;  1VFJ A;  3NKY A;  4HTJ A;  3BRE A;  1WOR A;  1CVJ A;  3T1Y J;  1NZ8 A;  2JVR A;  3JB9 k;  1SC3 B;  4YB6 A;  1YBU A;  1NSA A;  4ED7 A;  2Z4P A;  1WHV A;  3M8Q B;  1UVK A;  2YX7 A;  4NLX A;  1AZS A;  4QW9 A;  3V6D B;  4M5J A;  3RB0 A;  3PVX A;  2HVI A;  1HNX J;  3OFF A;  4DR2 F;  1WC5 A;  1YZ7 A;  4U67 Q;  4DV2 F;  1U45 A;  3RBE A;  2VH7 A;  4AYB D;  1WC0 A;  1RTI B;  1WI8 A;  3J7Y I;  4LF7 J;  1F5A A;  2BRL A;  1HBO B;  4OZL A;  1TKT A;  3DNC A;  4ICL B;  4USU A;  1CQM A;  2OPQ A;  1SKU B;  3I96 A;  3L9Z A;  1LNQ A;  1SQE A;  2DY1 A;  2MKY A;  3OW2 R;  2YWF A;  3VZH A;  1CBK A;  2VOP A;  1AUS L;  4L6V 3;  1NHK L;  4AE5 A;  1C1B B;  3MCS A;  2BKP A;  3R5C A;  3DOM B;  1H7X A;  3DRP B;  3VAI A;  3HJF A;  2HFS A;  2UXD J;  2GVZ B;  3NS7 B;  5GAG I;  2WB4 A;  2BDP A;  4B3S J;  2I2Y A;  2KL8 A;  5B0A A;  2R2T A;  3A3O B;  3DYA B;  4W98 A;  3KK3 A;  2W9A A;  1NH8 A;  1PYT A;  2R8G A;  2IAJ A;  3CJ4 A;  5HSP A;  4B3R F;  3HSZ A;  4LR8 A;  2XLK A;  2ZJQ Q;  4J9K A;  2MQL A;  4BC9 A;  4DR7 J;  4DBQ A;  4CM2 A;  3PM9 A;  3FCV A;  2DR7 A;  1YJR A;  5FLX Y;  3ZC4 A;  1C4C A;  1S12 A;  1JJH A;  5FDL A;  2QLF B;  3HSG A;  2BOA A;  2ROP A;  1T3O A;  4EZ6 A;  2MZT A;  2MHE A;  4IOB A;  3GIR A;  1HMV A;  3MOJ B;  2Y1R I;  3GQC A;  5E2Q A;  1PJ5 A;  2XYG B;  5IM0 B;  1NDC A;  3G82 B;  3KXD A;  5C2C A;  2WK4 A;  2F4F A;  5HMY A;  1EB0 A;  1OMS A;  2UZA A;  4PWD A;  5F8L A;  3OLB A;  3GIM A;  3QJP A;  3GYX B;  1SV5 B;  1SIW B;  3I0R A;  3ET6 A;  3I6P A;  1S6Q A;  3KJF B;  3HHL B;  4OI2 A;  4MTP A;  2DK2 A;  4PQU B;  4WXW A;  3U1L A;  1UPM B;  4KTQ A;  3LAL A;  1N54 B;  4LRF A;  3W60 A;  2AYM A;  1J5E J;  1U1R A;  5D4L A;  4OJH A;  2DO4 A;  1I1G A;  4J91 A;  5LMN J;  2NUH A;  5IC4 B;  3CCE S;  4M5I A;  2V2Q A;  5KT6 A;  5B7W A;  3UD5 A;  3MM9 B;  4JI1 F;  2HFZ A;  3W3S A;  2B9E A;  1B7F A;  1FCA A;  4HHJ A;  3GV8 B;  3SCK E;  2OMO A;  2FVS A;  4R0E A;  1HBN A;  1GX5 A;  1JNZ B;  2XI3 A;  3ITH A;  4ZJL A;  2JRS A;  1VLY A;  2YX4 A;  4ED1 A;  4L75 A;  2XHW A;  2BE7 D;  3ZZP A;  3TAR A;  1CJT A;  5DDP C;  4ZCM A;  2J0S D;  4JI4 F;  3GR0 A;  1WF0 A;  4OLO A;  1RAO A;  1FRH A;  1UFK A;  3G86 A;  4QWC A;  3GJT B;  2DNZ A;  4OHY A;  3MEG B;  3PV8 A;  2DGT A;  2QIF A;  2KFZ A;  4X64 J;  2QN6 B;  3H25 A;  2Y3Y A;  5SZT A;  2AGO A;  3EXY A;  2XY6 A;  4X4Q A;  2JDJ A;  2G0I A;  4OYO A;  4MK7 A;  1IKY B;  3DLG B;  4WU2 A;  3K5M A;  4LIW A;  2IVM A;  2WW4 A;  4I69 A;  1NBE B;  1S9G B;  3PFO A;  5HAO A;  1E6Y A;  1LWF A;  3KNA A;  1DQA A;  1AYE A;  1BY9 A;  2B7C B;  2HWH A;  3VF0 B;  3UCG A;  2EG2 A;  3W2W A;  5C42 A;  3ZXW A;  1GH8 A;  1RT4 A;  1U0H B;  1Q8K A;  1X4H A;  4DF8 A;  1NDP A;  1FWK A;  2AJF E;  2XB2 D;  2RSQ A;  4LSN A;  1R0A A;  1CPZ A;  1FTC A;  5GAE I;  3MEC A;  4OHV A;  4G1Q B;  2DGQ A;  3PEJ A;  4OI6 A;  1H98 A;  4DL0 C;  4DCO B;  4YQW A;  3V4I A;  1S0M A;  5SUH A;  3NGU A;  3BN4 A;  3BKT A;  1RAF B;  2ZBP A;  4YS2 A;  1DUR A;  4X84 A;  2VKZ G;  2WSF C;  2DH7 A;  3BGO P;  5B0B A;  4DWI A;  4LF5 F;  4I1T A;  3LAK A;  4M5K A;  3W5Y A;  1NK8 A;  4DV4 J;  2POK A;  4MK9 A;  3GJS B;  2I0X A;  1Q7L B;  2ZD1 A;  4DI6 A;  2HVZ A;  3VAJ A;  3ILI A;  4QIG A;  2KM8 C;  3M32 A;  3NMR A;  1WHW A;  1ZZN A;  2VON A;  2R2U A;  4XDD A;  1MRO B;  1KFS A;  1N6Q A;  4CYU B;  4WIQ A;  4U96 A;  4X66 F;  1U47 A;  1K9M T;  1PSD A;  1S5Z A;  1GNK A;  3H59 A;  2DHG A;  5CD4 A;  4Z37 A;  4OYZ A;  4DR2 J;  1VC5 A;  4RW9 B;  4DV2 J;  2XYH B;  2YWG A;  2QTW A;  2KDO A;  2FY1 A;  3WC2 A;  2DGW A;  4YB5 A;  4ES2 A;  4B3O A;  3R5D A;  1TP7 A;  2HNZ A;  1S48 A;  2FHK A;  4GVB B;  4CLZ A;  2FTR A;  2JH3 A;  5ETL A;  2O1P A;  2YH1 A;  5ETS A;  1AZS B;  2HKE A;  3E51 A;  4C97 A;  1SH2 A;  2EI5 A;  4KGM A;  2W7O A;  5D6G A;  1R0C B;  3N6N A;  2CJX B;  4ZPW R;  2XSJ B;  3PW7 A;  3LUY A;  5KFQ A;  4ZK7 M;  1HPZ A;  3EGW B;  2VPY B;  3PRB A;  4Y6I A;  2J7U A;  1PCA A;  3QGI A;  5M2R A;  3PYD A;  2OPQ B;  2YWE A;  3ZZR A;  2MKK A;  1JLG A;  3J81 U;  2V9W A;  3WX4 A;  1RHU B;  5DZ7 A;  3FRY A;  1L3T A;  3QT5 A;  2VKR A;  2GNK A;  2Z8Q A;  5KFY A;  1WD6 A;  4B3R J;  1VQ5 S;  3BBC A;  2F8M A;  2LEC A;  3H90 A;  3PYE A;  2D74 B;  1TAQ A;  5KG3 A;  1KEK A;  1TFY A;  4ZVT B;  2RUS A;  2W8K A;  1EX8 A;  5T7L A;  1IR2 A;  4K0K F;  3UVJ A;  1N33 F;  5ETP A;  2IA6 A;  3LAN A;  1K1S A;  3KLF B;  1TK5 A;  1W2I A;  4DR1 F;  1QTM A;  5DQG A;  3W9I A;  1S77 D;  2I8E A;  1FRI A;  1XC9 A;  3LWL A;  4Q44 A;  3SQG A;  3MR3 A;  4OZ5 A;  2QE5 A;  3HSJ A;  1D8Z A;  3C8Y A;  3CCR S;  3W63 A;  2PD1 A;  1Q95 G;  4RPF A;  1U09 A;  2DHX A;  3I5A A;  3VQT A;  2VDH A;  2X1G A;  3PO4 A;  3DRS B;  2VFS A;  1DQ8 A;  4P52 A;  3O8W A;  5H9F K;  1UFW A;  2QMW A;  4NEZ A;  4N47 A;  1PIE A;  5L9X A;  2YQ1 A;  4DQI A;  4ZKA A;  3CDW A;  4P73 A;  4FYX B;  2I38 A;  4LJM A;  4ES1 A;  2KJW A;  4WFX A;  2JFD A;  4I7F A;  2EBG A;  2O66 A;  4JV2 A;  2QFI A;  1Q8B A;  1DQ9 A;  2RIJ A;  1XQI A;  3HHE A;  1X8D A;  3S6E A;  1M90 T;  2ZWP A;  3MUT P;  2KRB A;  1UA0 A;  3J7Y U;  4IFY B;  4JI1 J;  1YJ9 S;  4X4U A;  5IFM A;  3MM7 B;  3OFG A;  3TP2 A;  4I2P B;  2F1F A;  1ZM3 A;  1RWP B;  2XC9 A;  2HUR A;  4LR9 A;  2CWX A;  5A8W A;  4JI4 J;  1JKH A;  2M52 A;  5GAG U;  4DQR A;  2EBE A;  3M8W A;  4OYX A;  2BYC A;  4K4X A;  1L3U A;  5DRK A;  3F56 A;  2FC8 A;  4FKY A;  2K1R A;  2HPU A;  5C5J A;  4ZVQ B;  3ENA A;  1KTV A;  2KG0 A;  2X3D A;  4XO0 A;  4X2B A;  1UFL A;  2BJ8 A;  4ANE A;  4C6A A;  3A8J A;  2C1E B;  2RVJ A;  4S0M A;  2QSF A;  2HBQ B;  2HQG A;  2PC6 A;  1EAR A;  1NJX A;  2D3O 1;  1AFI A;  2XUL A;  5KT3 A;  4TN2 A;  2ZHA A;  3O6Q A;  4WKY A;  1VJW A;  1S6U A;  2FDN A;  2Y8Y A;  3MED B;  4YN3 B;  5ETN A;  1C0U A;  1S7H A;  4J5O A;  2RDJ A;  1IKV B;  3O3L A;  3IFE A;  5F41 A;  5DDQ C;  1ZZF A;  2PDA A;  1KC8 T;  3F41 A;  2E1A A;  1K0V A;  2VU5 A;  2MZR A;  2HS4 A;  1HBM A;  2UVV A;  1NZA A;  1RHM B;  2IMW P;  4NML A;  1NRK A;  3I9V 9;  3VVU A;  2MZQ A;  1DFD A;  1LWF B;  2IDL A;  3JYT A;  1UEU A;  4LF5 J;  4V1A k;  1RTH A;  4KT0 C;  2GW8 A;  2HFN A;  3W2W B;  5C42 B;  3VAM A;  1V5V A;  3KLE A;  1O0P A;  4O3R A;  1C0T A;  1UZD A;  1JLC A;  1BWV A;  1TV6 A;  2B6A A;  2VDI A;  3BO4 A;  3NCR A;  5LM7 E;  3DDK A;  3ULH A;  2VPX B;  2DNL A;  1S1W B;  3C14 A;  1T9W A;  3MEC B;  1TL1 A;  4QPT A;  3D1Q A;  4D3G A;  2ABY A;  3K8W A;  1IVZ A;  2MJN A;  2AGQ A;  3DOK A;  3SSR A;  3G8Q A;  5ETR A;  3DHX A;  1HYS A;  1RCX B;  2RKI A;  1EP4 B;  3BSA A;  1HWL A;  3BS9 A;  3RB6 A;  5L1I A;  2F40 A;  1XNR F;  3D54 A;  3CUL A;  2RML A;  1Z1Z A;  4DSI A;  4NLR A;  1S1X A;  4R25 A;  2A6M A;  2RHQ B;  4TNO A;  1Y7P A;  2WSE C;  1QM9 A;  2CDR B;  2HNY A;  3WX8 A;  5MLC V;  5KG0 A;  3MR7 A;  1QSL A;  4FVM A;  1N6Q B;  2CRL A;  1L3V A;  2QMU B;  5KFV A;  4TY8 B;  5HJX A;  3D7S B;  1VQY A;  3KLH A;  5DS7 A;  3TZW A;  3GG1 A;  4QYZ J;  2FHJ A;  2IFX A;  4YR3 A;  4Q0B A;  1X5T A;  4ED5 A;  3CW2 C;  3M8P B;  4GC6 A;  3WBZ A;  5ETM A;  2CIM A;  5I3P A;  1PGZ A;  4DU8 A;  2R2S A;  1S49 A;  5G0R A;  2QC3 A;  3A8K A;  5CAB A;  2XS2 A;  2QZ8 A;  2OPR B;  4TXS A;  1U49 A;  1S76 D;  2M0G B;  4RBT A;  2W9C A;  2MQQ A;  1FE4 A;  2DRB A;  1VLO A;  4N76 A;  1FVQ A;  3EPI A;  4PAA A;  2J7W A;  3FMW A;  5KAK A;  3B82 A;  1SKR A;  4FKX A;  3SDE B;  4FF3 A;  1U0S A;  3T1H F;  3QAT A;  1RUS A;  4P71 A;  4MKA A;  2B0G A;  5HP1 B;  4K0K J;  2UUB F;  1FNO A;  1N33 J;  2V67 A;  5GAE U;  2L9N A;  3EUN A;  4UTG A;  1X0F A;  3IGN A;  2IBK A;  4ZVP B;  2FJW A;  3RZA A;  4DR1 J;  5KFS A;  1OSC A;  5IQQ A;  3KFW X;  2FJD B;  4X4R A;  2DNP A;  4IG3 B;  3MF5 A;  5I42 A;  3HVT B;  3UDC A;  5F8J A;  2C3M A;  4TYB A;  1UEK A;  3CDB A;  1OIA A;  3UW1 A;  1PBU A;  1VOM A;  1RWN B;  2V4J A;  3AJ1 A;  3JAM Y;  2XS7 A;  2LEA A;  2WON B;  1KSP A;  2HZA A;  4WPA A;  1RAI B;  3UI3 A;  1LXJ A;  2HBY B;  3GIJ A;  2BAN B;  1C4A A;  5E3A A;  5T7L B;  1LWC A;  2RJZ A;  3NCQ A;  3BO3 A;  1Y5L B;  4OL8 A;  1YJW S;  3T5K A;  2ATC B;  2CQP A;  4OV6 A;  1HNZ F;  1U8W A;  1BGX T;  2B43 A;  3IA0 A;  2VV5 A;  4ZS6 A;  5B09 A;  4NRT A;  4NLW A;  1LWE A;  5DM7 Q;  2AF6 A;  2DXE A;  3ZNU A;  4KPC A;  1NUE A;  1YJ7 A;  3GMG A;  4FZV A;  3BR8 A;  3IAS 9;  1IUJ A;  1UVN A;  4K2X A;  2NXU A;  3VHQ A;  2RS2 A;  1WKL A;  1Y4Z B;  1OJ4 A;  1SH3 A;  2CKW A;  2WTF A;  2CZ9 A;  5D4O A;  1JXV A;  3R5A A;  5J2M B;  1U1O A;  4X4N A;  3M30 B;  3K58 A;  1AUD A;  1WHY A;  2D9O A;  1ZM2 A;  4USH A;  2MLX A;  1R8P A;  4CO3 A;  3K2Y A;  5C24 A;  1CJK B;  4FN5 A;  1KLM B;  2H9Z A;  1FF2 A;  4M5M A;  1FKP A;  1G3O A;  1VMB A;  4PUO B;  3QO9 B;  1HKA A;  4DF4 A;  2M7S A;  2Z0G A;  4XPE A;  4IFV B;  1CS4 A;  2C28 A;  3N6L A;  4JI6 F;  2R8J A;  1SQG A;  2VFR A;  3SV3 A;  2GHW A;  2VUG A;  3HD2 A;  1NJY A;  1FK9 B;  4CLS A;  4QR0 A;  3TYT A;  3CCU S;  1YBA A;  2C3Y A;  4KYZ A;  4ZJQ A;  3BBB A;  1EET B;  2HRT A;  4JI5 F;  3OPK A;  1QJH A;  5CYM A;  4KSE B;  1NK9 A;  1FHT A;  2PT0 A;  1ZTW A;  5ETT A;  4KFB A;  1U4B A;  4DX8 H;  5D4N A;  4WU3 A;  1N34 F;  1PJ7 A;  4MIW A;  4DDF A;  4F4W A;  1GK8 A;  4ILL A;  2K7K A;  4LF9 F;  1TKZ B;  5BR8 F;  3CC4 S;  3KLV A;  4RNO A;  2PII A;  1AT1 B;  1R8C A;  1HWJ A;  2J0X A;  3LTO A;  2E1C A;  4RR5 A;  1F9H A;  5CZX A;  2GQQ A;  3M9O B;  2EC0 A;  2W7P A;  1SJ4 P;  2MEW A;  4YUD A;  3RG6 A;  4ZMM A;  4J9N A;  4K4W A;  1NSP A;  2Z2Z A;  3R7S B;  4H4K C;  2DGS A;  3MI7 X;  3GSD A;  3RRH A;  3RBX A;  1KKH A;  7AT1 B;  4ED0 A;  4EYI B;  1LW0 A;  3TQE A;  3BN7 A;  4DFK A;  2O01 C;  4AD6 A;  4ATN A;  1J5O A;  2L48 A;  3HF5 A;  4WFA Q;  1RHJ B;  4A46 A;  5AXK A;  4FYV B;  1OPI A;  4YDX A;  4DXL A;  4PYA A;  3G6X A;  2EFP A;  4ELT A;  1RJJ A;  1Z2Z A;  2DT9 A;  3N5F A;  2HBR B;  4RLE A;  4O3P A;  3W9H A;  1RTH B;  1KFD A;  4P75 A;  4EI2 A;  2E5L F;  1XNR J;  1VS3 A;  4QU6 A;  1RQ0 A;  2Q3P A;  1N5S A;  4NZ6 A;  3R5G A;  2EPI A;  5JVG Q;  4JI3 J;  1RAA B;  3CB4 A;  2DKO B;  2OEL A;  4Q8E A;  1FE0 A;  3IR5 B;  2WBM A;  5LT5 A;  2CPD A;  1JLE A;  1N4L A;  3C14 B;  2JOQ A;  2AD9 A;  5FLX U;  1Q5Y A;  1ARO P;  3OTO F;  3EPG A;  1RA7 A;  1FEE A;  2DXF A;  2QL9 B;  1QAY A;  4ID5 B;  1FRX A;  3DOK B;  2BJ7 A;  1DAX A;  3QGH A;  3H42 A;  1FO1 A;  1NHU A;  3RAM A;  2OTL S;  1HYS B;  1YJU A;  5KG7 A;  3TA2 A;  2YH0 A;  3D5M A;  1G1X A;  3BJY A;  3QT6 A;  3QID A;  3HX9 A;  4V19 J;  2ACY A;  2KVI A;  4NLT A;  4IQX A;  1UJ6 A;  3HM9 A;  2YY3 A;  1O8B A;  4CTA A;  2MGZ B;  4QOT A;  5H9F J;  3IBC B;  4KBI A;  3Q8Q B;  4O44 A;  4DCP B;  1XMO F;  3J80 Y;  3BSO A;  1X4E A;  4O23 A;  2RRB A;  1ZAV A;  4MKY A;  1RA6 A;  2RDI A;  2HMI A;  2JHE A;  4Y3C A;  4A8Y A;  4C4W A;  4Q0B B;  3T1H J;  3KLG B;  4IH5 A;  2W2M P;  3TI0 A;  2E1M C;  1PYS B;  2QA1 A;  2UUB J;  2BE2 A;  2DRD A;  3AQP A;  2FPH X;  4P10 A;  2DNH A;  1P6T A;  1D09 B;  1XN9 A;  3POT A;  8AT1 B;  1N5V A;  3SYZ A;  2ZUG A;  2OPP A;  2W9C B;  1HI1 A;  1RIS A;  5F8N A;  3OL7 A;  3N01 A;  1S6P A;  1Y10 A;  4PEO A;  1Q1K A;  3EE3 A;  4NMX A;  3EYZ A;  3DC2 A;  2B9Y A;  3KUE A;  4CWB A;  4H4M B;  2DNO A;  1YKW A;  3JTP A;  1Q16 B;  4A8O A;  4TU9 A;  2EXU A;  2O3D A;  2BKO A;  2KT3 A;  4O0I A;  4LSZ B;  4BDP A;  2WOM A;  4HL9 A;  3MM6 B;  3J81 j;  2UUW A;  4WBF A;  2EG1 A;  1ZA2 B;  4FPI A;  3ZZT A;  1IQT A;  1HNZ J;  4PPZ A;  3CO9 A;  3G4S S;  2XMJ A;  4CO5 A;  1FFS B;  2V4J B;  4P7T A;  2E5G A;  1KQG B;  3IP0 A;  5I3Q A;  1LK5 A;  4M5L A;  4BC7 A;  2ZNY A;  2OKQ A;  4XIU A;  2G2Z A;  2JEG A;  3TUP A;  2P6S A;  3D9B A;  4DFM A;  2YBV A;  5D3G B;  4F0H A;  5ETK A;  4HH1 A;  2KHD A;  1R89 A;  2HWI A;  2R42 A;  3DRR A;  2YQ3 A;  1CUL A;  3OL6 A;  3ZZO A;  5JJB A;  3CJ5 A;  3U1M A;  4C8Y A;  5DQH A;  1U2C A;  3AB2 B;  2XBP A;  4XK8 C;  1X9W A;  3CCW A;  3CCL S;  2LA6 A;  3AOB A;  3BO2 A;  3D1O A;  4WYL A;  1B0V A;  2ZM6 F;  1QVF R;  4JI6 J;  2QLX A;  3C3L A;  3NL0 A;  5EN1 A;  1RCO B;  2OIH A;  1N5T A;  4TKT A;  3W61 A;  5E3C A;  2XGP A;  3A1Y G;  2UVW A;  5HI7 A;  4RW7 B;  4CI0 B;  2ZJR Q;  2IRU A;  5KFU A;  1BQX A;  1VQS A;  1LEO A;  2N82 B;  4JI5 J;  1Q4R A;  2LYV A;  2VC1 A;  2GGP A;  1DLO A;  2CVE A;  5IC6 B;  4JYA F;  1DBD A;  4I2Q A;  1TL4 A;  1M5H A;  2U2F A;  3O5T B;  4KQZ A;  5F9N A;  3T9Z A;  1SJF A;  4OYM A;  1URR A;  2NSC A;  3VAH A;  1N34 J;  4OMF G;  1NME B;  4LF9 J;  3QSY B;  5BR8 J;  4FPR A;  2WB1 D;  3AY0 A;  2RNE A;  1OPZ A;  2PGC A;  3C6U B;  2PI4 A;  1IKX B;  3CUN A;  1U2F A;  1QUP A;  4PG6 A;  3BDE A;  3DLK A;  2DR5 A;  1RSC A;  1FDD A;  2D7S A;  2EKN A;  3HKZ D;  4JOU A;  1QTN B;  3HVW A;  2W2P P;  2NRE A;  2HLT A;  3RR8 A;  1CJU A;  3P8B B;  4NL5 A;  3MAA A;  2BJD A;  1KNZ A;  1B4S A;  1KHW A;  3OR1 A;  1Q86 T;  3K5P A;  5KT5 A;  3T5L A;  2ZZM A;  5D8H B;  5E41 A;  2HRU A;  3B6B A;  3PW4 A;  4K4V A;  1ZTT A;  3TEH B;  1DY3 A;  3X3U A;  1ACM B;  2BW7 A;  1X4G A;  3AD9 C;  3M2U B;  1RYR A;  2JFK A;  3DMJ A;  3ENQ A;  5B0F A;  2PSZ A;  2V8G A;  2X1A A;  4DPY A;  3MGJ A;  4QZV B;  1RTD B;  2G4B A;  1VK8 A;  3CCZ A;  2E5L J;  5BJR A;  1UCN A;  2JLE A;  3FCH A;  2YPY A;  1LW0 B;  4H54 A;  3RBD A;  1Y0H A;  5D0G A;  4DSL A;  2C2K B;  2K2P A;  2ZDP A;  2PEH A;  2ROG A;  1VR6 A;  1KR4 A;  1S9E A;  2ZHO A;  1FDA A;  4FF4 A;  2CPE A;  2VBX A;  3PKM A;  3OTO J;  2R7S A;  4A8F A;  3LP0 A;  4UT4 A;  2Z2L A;  1VQ6 S;  1BMQ B;  4UOC A;  4QWE A;  4ED2 A;  5AE2 A;  3AOD A;  5BYR A;  2KFN A;  2BXJ A;  1TKX B;  4DR4 F;  3SQO P;  3EJM A;  2VIC A;  2V50 A;  1KOO A;  3HP6 A;  2BM1 A;  4C0O C;  3FFI B;  3Q8Y A;  4ED8 A;  4RNH A;  2I6W A;  4W4M A;  3FQK A;  5DDR C;  2FVQ A;  2FLL A;  4F02 A;  1JLE B;  4GO5 X;  4RBV A;  4O4G A;  3QSI A;  1FRL A;  4MFB B;  3KHG A;  1XMO J;  1S0O A;  3HFZ B;  1HR0 F;  1N8R T;  3V4M A;  2ASY A;  4K4Y A;  4PKD B;  4TU7 A;  4J37 A;  3TJA A;  1VJQ A;  1WSV A;  1HD0 A;  4Y2A A;  2YNF A;  3WIU A;  1EKS A;  2E9R X;  3THT A;  4DG1 B;  3Q2T C;  3CJS A;  1Q7Y T;  2DR9 A;  3Q22 A;  3N5B A;  3BPS P;  2B3T B;  4F36 A;  2BE9 B;  1WC3 A;  5IXU A;  4LRE A;  2CQ3 A;  2FLO A;  3W2V B;  4KHP J;  1RP5 A;  1TL7 B;  3VR1 A;  1T3N A;  2KXF A;  4Y2C A;  3T6J A;  2DH8 A;  2Q6B A;  3CCM S;  1Q8L A;  2MPU A;  2GAG C;  4C0B A;  4FBT A;  2AZ3 A;  1HHS A;  2YNG A;  1RT7 A;  5EUH A;  3KLI A;  5KFE A;  2HMI B;  3H40 A;  4X4O A;  3MMC A;  2VBZ A;  2VG7 B;  2CG4 A;  1MG7 A;  4DU7 A;  2M2B A;  2V2Z A;  4F25 A;  4ZVE A;  3KK2 B;  1F2H A;  5MAO A;  1RT5 B;  3G8T A;  3FZB A;  5HBM A;  1GXU A;  1R31 A;  3TJ8 A;  1MMD A;  4DUT A;  1P9Y A;  2HND A;  1S6P B;  4RU9 A;  4WTY A;  2LVW A;  5LMU F;  3FEX B;  2IRX A;  2DHS A;  3VVT A;  5CYJ A;  3GII A;  2BAB A;  3DLB A;  1LW2 B;  3TVY A;  1HNW F;  5HMW A;  4JV5 F;  4HR2 A;  5J1E A;  3NWG A;  4JP8 A;  3UCZ P;  2WOM B;  2H54 B;  2DIS A;  2IA0 A;  1X4A A;  4U7U K;  1EKR A;  1U48 A;  2R7V A;  2I5J B;  3RAQ A;  2FZC B;  2LKZ A;  3DOL B;  5A2Q Y;  3H5U A;  1ELO A;  4AL5 A;  4OHW A;  4G6V B;  4EEY A;  3NGR A;  2CQI A;  3GFX A;  3BYP A;  2ZM6 J;  1GX6 A;  1X4B A;  2FGO A;  2EK6 A;  2NYI A;  2XLJ A;  2MQO A;  2AJ1 A;  2CXE A;  3AH6 A;  5EWE A;  4M63 A;  2QFJ A;  3V2U C;  1HBU A;  2A18 A;  4CO4 A;  5J2P A;  3KMQ A;  2VL1 A;  3UCU P;  2IVF B;  2XSF A;  1RBL A;  1SXL A;  4XAK A;  3SXL A;  5F3T A;  1U8S A;  3LF0 A;  3PW0 A;  2DR6 A;  3DHW C;  5K8N A;  3CJ2 A;  3QLH A;  3QQC D;  3HCX A;  3QJJ A;  1RT1 B;  2MZS A;  2LCW A;  1T05 B;  4EZ9 A;  3I87 A;  4JYA J;  4ED4 A;  3CJK A;  5EWG A;  4OYA A;  1KON A;  1IBM F;  2HQD A;  1VGY A;  4ER8 A;  3AXM A;  3BGL A;  4ZP6 A;  4Q43 A;  4MAK A;  4C0H A;  4PCQ A;  1SCJ B;  3IRX A;  2Y9H A;  1R6V A;  1H3D A;  3QRQ A;  4K2J A;  1S4F A;  3UQS A;  4RKU C;  1U1Q A;  4AUK A;  1FDB A;  2FJV A;  1MWQ A;  3FC9 A;  2KFY A;  2HG4 A;  1OYD A;  4RW6 B;  2V2K A;  1JLB B;  3D2W A;  3CCV S;  1NXI A;  4I2Q B;  3JSM B;  5F0W A;  3H2L A;  1M5O C;  2HLU A;  3PJW A;  2XZW A;  1SC1 B;  1Y3J A;  3ZZZ A;  3PG9 A;  2HZV A;  1MWZ A;  3BSN A;  4Z7Y A;  2NSB A;  2HWT A;  1T03 B;  2B8P A;  2L41 A;  2N3L A;  4Q45 A;  2ZIT A;  1VBY A;  1R8A A;  1RTJ A;  3Q0A A;  2ZBI A;  1DZ5 A;  1NEE A;  1L5U A;  3AOA A;  1QAJ A;  2Z30 B;  1SC4 B;  1AA1 B;  4H4O B;  1RBA A;  2RT3 A;  1NPK A;  9RUB A;  3M2V A;  4TLR A;  3EX7 B;  1H7W A;  3VV2 B;  2F9D A;  4QJV A;  4F0M A;  4C3L A;  1L3S A;  4KJI A;  4J7C A;  3G6E S;  3BB5 A;  4KKO B;  4RBU A;  4DR5 F;  3BDP A;  2CJA A;  4C8M A;  3GV7 B;  3RB4 A;  3EGN A;  3OR1 B;  2CQ1 A;  3H0P A;  2ZOG A;  4UUW A;  3HUL A;  2IJF A;  3UNG C;  3DMJ B;  4F4A A;  1X7V A;  2DXD A;  2IM0 A;  3DGP A;  2HFV A;  2R8I A;  2C2Z B;  1S57 A;  4DR4 J;  1UVJ A;  2ZC3 A;  3EVM A;  1JMT A;  4KGZ B;  3JAM U;  1S10 A;  4K4T A;  3GIL A;  1MMN A;  3VAF A;  8RUC A;  1WG4 A;  2E1R A;  1H38 A;  2XHC A;  2R8K A;  4DN0 A;  4EWT A;  2D69 A;  3HDS A;  4NLO A;  5KG5 A;  5FJ4 A;  3LP1 A;  5BYS A;  1S0N A;  1HR0 J;  3OR2 A;  4C8L A;  2VAS A;  3P96 A;  4PQA A;  3PRV A;  5D4P A;  1KQS R;  5DG9 A;  2WSC C;  1BQN B;  2XYP B;  4YFU A;  1ZM9 A;  1S1T A;  4DHV A;  2MMY A;  3M1V B;  4HT7 A;  3MOZ A;  1Y5I B;  3NP5 A;  3CMQ A;  2G1H A;  2CPI A;  4BLG A;  2VG5 A;  3CO0 P;  3S7R A;  1WTB A;  1PAU B;  1S99 A;  1VBX A;  4LRD A;  3I9Z A;  3OD2 A;  4DSK A;  4O4G B;  3BM7 A;  1VBK A;  3QNW B;  4GO7 X;  2CJY B;  1UPP A;  2DNG A;  2YWW A;  3GG0 A;  4MH8 A;  2XGQ A;  1WKK A;  1PKU A;  3I4P A;  5C25 A;  2CJB A;  2EFQ A;  3PIO Q;  5HRO B;  2HFU A;  3MM5 B;  4OHX A;  1H2T Z;  1C1C A;  4URG A;  2BBE A;  2LQ8 A;  4LRB A;  2KT5 A;  4IR9 A;  3MTJ A;  3MEK A;  2ZH1 A;  1MML A;  4PR6 A;  2AW0 A;  3SI8 A;  3Q8S B;  3FMB A;  5DM6 Q;  4DQP A;  3AOC A;  2HHT A;  2HGL A;  2HQF A;  2FHM A;  2CYY A;  1YIT S;  1IR0 A;  4Y2M A;  2JEF A;  1X5S A;  3JSR A;  5KFD A;  1D9F A;  4J9S A;  1SBR A;  1RU1 A;  1RT7 B;  5KFN A;  3CC2 S;  3D0H E;  1MU2 A;  1VCT A;  3MMA A;  1JX4 A;  3HXM A;  2MKH A;  4OI0 A;  2W9B B;  2NLW A;  3M2R B;  5LMU J;  5HMX A;  3Q2S C;  2GHV C;  4NZ7 A;  5G4D A;  1VYA A;  3BQ2 A;  1UP1 A;  4IG0 B;  3CD5 A;  1HNW J;  1WOP A;  1REV A;  4NA1 A;  2AJ4 A;  1JLA A;  4JV5 J;  3GFH A;  5LOQ A;  3E3X A;  1VQL S;  4P72 A;  3CC7 S;  2ZVI A;  5KFJ A;  1UA1 A;  1S1V B;  2WAQ D;  2KYZ A;  2FGC A;  5HBM B;  1YVF A;  2Z2Y B;  3HPO A;  4M95 A;  1HQ2 A;  4HDH A;  2WVF A;  1CJV A;  1HA1 A;  3MM8 B;  2HND B;  1TL3 A;  2RQ4 A;  5F8M A;  2W2N P;  4U7U D;  4M5N A;  2ILY A;  2A0F B;  4L74 A;  5CA5 A;  1WC6 A;  2EKY A;  1FKO A;  5CCM A;  1N48 A;  3IG1 A;  2I1R A;  4KV8 A;  5F3Z A;  3W9J A;  4Y0F A;  2AYE A;  1S4E A;  2RRA A;  2ZZT A;  2FHO B;  3VAK A;  5I4M A;  1NB7 A;  3UR0 A;  1JK9 B;  2QJ3 A;  4X4P A;  1Q81 T;  1M5P C;  4IRK A;  2BM0 A;  2FY8 A;  2VPZ B;  4I0W A;  1P1T A;  1F9F A;  4DFJ A;  2CA9 A;  3DM2 B;  4I6A A;  4WZQ A;  3CJ8 A;  2IYI A;  2G2O A;  3H4B A;  4F0K A;  1NM2 A;  4P9S A;  2CQ4 A;  3GCX P;  2MKI A;  1BQM B;  3MUV P;  3M6X A;  3FEY B;  1HBU B;  4CO0 A;  1SH0 A;  3EZO A;  5J2P B;  2CPZ A;  2OGU A;  5DLG A;  1GTH A;  2LEB A;  3K57 A;  3NGD A;  2RU9 A;  4LQ9 A;  4Y65 A;  4KAI A;  1UKU A;  2YQ0 A;  5KG2 A;  1KVK A;  2FD2 A;  2CJK A;  4E0D A;  1FWP A;  4WXO A;  3U02 A;  3TUZ C;  3H8Y A;  1XK8 A;  1X5O A;  3TZZ A;  2C2M B;  3T19 A;  2K06 A;  4WE1 A;  4RNM A;  2ZH2 A;  4WTO B;  1IWG A;  2ZE2 A;  2XG8 A;  1VRT A;  3QPI A;  2Y0B B;  2QT7 A;  4OI3 A;  3LAM A;  2ZH9 A;  1SC6 A;  2FUG 9;  3KHL A;  2AWZ A;  1H2U X;  1FNX H;  4WWS A;  3CT9 A;  3MCN A;  2LQ5 A;  1D3W A;  3IR6 B;  2R7W A;  2IC3 B;  1N32 F;  1M0S A;  4JBC A;  1D9D A;  2IIH A;  2CFX A;  1URN A;  4HLB A;  1RAH B;  3NGS A;  2XEX A;  4XPC A;  3AJ2 A;  4F67 A;  2ADB A;  3NAI A;  5HLF B;  1VRU A;  2VB6 A;  3TAM A;  4PAB A;  3UD3 P;  1ITP A;  1UEV A;  3BKF A;  3Q86 A;  3C15 B;  3ZZU A;  3NEK A;  2IHR 1;  3J80 U;  5A0Y A;  2ZEJ A;  3L7O A;  2FLN A;  4EO6 A;  1YBT A;  2Q43 A;  4DR5 J;  3DDI A;  2Y1L B;  3MAH A;  1F60 B;  1GMV A;  4N77 A;  3IAM 9;  3K0J A;  3IMQ J;  4WJB A;  2HW3 A;  1WDT A;  2XZD B;  2HQI A;  2ZWO A;  3A3N B;  4LIR A;  2VQF F;  3PEH A;  3VAG A;  5JVH Q;  3IN5 A;  3QIP B;  2J7K A;  4IYQ A;  3M2V B;  3P49 B;  2HHQ A;  3RUB L;  3QZ7 A;  4OZ3 A;  4ETZ A;  4KIA A;  4WK1 A;  3MMB A;  1ZH5 A;  1RT3 A;  5KG1 A;  2G0J A;  1DTQ B;  3LP2 B;  3NBP A;  3MMJ A;  3C19 A;  1YQH A;  1WOO A;  3QT7 A;  1H74 A;  2LU2 A;  2ASJ A;  2NQP A;  1JLF B;  1FA0 A;  3WQP A;  1IJF B;  4G1P A;  1QVG R;  3AD7 C;  1RT6 A;  4OLP A;  4WF9 Q;  1UWB A;  5IT9 Y;  4KO0 B;  4ECX A;  4W92 B;  3OTD A;  2J8A A;  3OLA A;  4NEY A;  4FVC A;  3UFC X;  4ELV A;  3DGP B;  2BUN A;  2JEI A;  3KJV B;  2C3O A;  2QA2 A;  3JQK A;  2ZH4 A;  4LT6 A;  2OPS A;  1WUU A;  3BQ1 A;  1EQ0 A;  1FER A;  5KFP A;  1VQK S;  5KOW A;  2KXN B;  3QWP A;  3GPA A;  2V63 A;  3A12 A;  1TUG B;  2CAJ A;  3OSN A;  3LP1 B;  1Y9O A;  5A8R A;  5HO4 A;  2BMB A;  2BV3 A;  2CPF A;  5BYQ A;  2HHS A;  3SCL E;  4UQG A;  5J2Q A;  1VIX A;  3KMS A;  3VQS A;  2UXC F;  4LF4 F;  3OUY B;  4FNH A;  2ADC A;  5L38 A;  2GFF A;  2RH3 A;  2UUT A;  2W25 A;  4ZLP A;  1FTR A;  4JV1 A;  3Q8P B;  1EAY C;  3C66 A;  4RZR A;  5HQM A;  1KWM A;  1D8Y A;  2B51 A;  3SFG A;  4RUH A;  1LV5 A;  1TK0 A;  1NSK L;  3CDA A;  2KXH A;  1WEX A;  4B3M F;  1F2G A;  2WZ1 A;  3QWU A;  2HIQ A;  5AXM A;  5KFK A;  4M5H A;  3US5 A;  3W64 A;  1WKJ A;  4X4T A;  4CLW A;  2NPI A;  2D41 A;  4CZC A;  2J5A A;  2OAU A;  3N79 A;  1TMJ A;  4CLT A;  2YPZ A;  3NLC A;  4UQT A;  1J27 A;  1T11 A;  4HAC A;  2AZ1 A;  3OJS A;  4U8Y A;  3PJX A;  1EIY B;  1LFW A;  2JC0 A;  5DET A;  3IS9 B;  1RAC B;  2HHH F;  5GAD I;  4NLY A;  1QSS A;  4GKK F;  2K8G A;  3CXC R;  5DO2 A;  4UZC A;  1LQ9 A;  3MMA B;  4P2X A;  1SB6 A;  5D15 A;  2VOO A;  2AHO B;  2J9E A;  4M5D B;  3Q8V A;  3M7V A;  3QFH A;  4TU8 A;  5M2U A;  2ALZ A;  3G6V A;  2RQM A;  1VQ7 S;  5LL6 d;  2UV8 G;  4C8Z A;  2QX0 A;  5B0D A;  3V81 B;  2FQQ B;  2YNI A;  3CWJ A;  2J9D A;  2GIR A;  2KHC A;  2G0C A;  4EGL A;  2W24 A;  1HQU B;  2XWY A;  4J9Q A;  5CD4 H;  3I0S A;  1TKD A;  1FVS A;  3M6W A;  5HJY A;  3EVO A;  3OHB A;  1N5Q A;  3CSK A;  1TUW A;  3QFW A;  3GV5 B;  4R5P B;  1QDU B;  1FKO B;  2EW9 A;  2ASL A;  3GSI A;  2DBB A;  2D3O R;  1YWX A;  4IDK A;  2FLP A;  3KK1 B;  4KV8 B;  2ZH7 A;  2AJ2 A;  5L1L A;  1A0O B;  2DYA A;  4LRC A;  5E3P A;  3BGR A;  3SIP B;  2LDI A;  4NLU A;  1F1B B;  4G3I A;  2WVD A;  5B08 A;  2JC1 A;  5GVQ A;  4YR0 A;  4LBP A;  2GML A;  1S1U A;  3I32 A;  3KYL A;  4DX5 A;  4LRA A;  3OVS A;  1V3Z A;  2R7O A;  4FBU A;  4P2M A;  1WEZ A;  3J7A 1;  1E6V B;  1U1N A;  2RF2 A;  3BQ0 A;  3G9C A;  5KG4 A;  1I94 F;  2MST A;  2CG8 A;  4FNI A;  5BXI A;  4ZPB A;  2VC0 A;  4R8U B;  2Z58 B;  4ECT A;  2XO7 A;  3ADA C;  3NRB A;  4LR7 A;  3V6K A;  1N32 J;  4PG7 A;  4DQQ A;  3K7R A;  4ES3 A;  2WCX A;  3RR7 A;  1PBA A;  3OVA A;  5E5N A;  1SUQ A;  1S9F A;  2AEM A;  1H73 A;  3IWL A;  4OJ1 A;  5I3U A;  3G2X A;  2AP6 A;  1W25 A;  1LOU A;  4DS5 A;  3PX4 A;  1VHI A;  2XY5 A;  3V5R A;  3I5C A;  4HTI A;  3JTN A;  3J7Z T;  2ROE A;  2CQG A;  4N8N A;  4QQB A;  2V68 A;  3DLE A;  2B4P A;  1Y11 A;  2FZK B;  5JMN A;  2R8H A;  4CT9 A;  1TKT B;  2GQ2 A;  4ITS A;  2ACM A;  2C3U A;  3KHH A;  4YME A;  4KB7 A;  1FDN A;  2OEM A;  4NAS A;  3PR5 B;  2M88 A;  2RRN A;  1RHQ B;  3R1H A;  3AFG A;  3GFY A;  3J7A N;  1M5S A;  1RDR A;  4ID8 A;  2IMO A;  2RHS B;  1R3N A;  2RB7 A;  5A0Y B;  1HBO A;  1Q8I A;  3GR1 A;  4LBI A;  4ICL A;  5K9F A;  3HHD A;  1A9N B;  4LVO P;  4MYU A;  1CC8 A;  3KG4 A;  3KNG A;  2X3G A;  3KK3 B;  4NOH A;  4MT1 A;  3DOM A;  1W26 A;  2CNL B;  2H4W B;  4EMD A;  2R2R A;  3CD6 S;  3R7B B;  1FES A;  2IAJ B;  3BH6 B;  4U95 A;  5AXN A;  4NYZ A;  1RBO B;  4DR3 F;  3CE8 A;  3Q89 A;  4K5R A;  3OTE A;  4K59 A;  1XR6 A;  3DYA A;  3U7J A;  4HI2 A;  4DPU A;  1N0U A;  5FDL B;  3H5Y A;  3BGU A;  3DRY A;  1T0T V;  3PRD A;  3E8O A;  2QGF B;  2E9Z A;  2PFF B;  3MFH A;  4NYP A;  5DQI A;  1PG5 B;  1HMV B;  3NS6 A;  1UWB B;  1CLF A;  4C7Q A;  3R5B A;  2ZHB A;  3OL9 A;  2YTC A;  5LSR A;  4NLP A;  5KFZ A;  5GMK a;  4RUB A;  4IOC Q;  5ETV A;  4KGX B;  2KM8 B;  1CSJ A;  4D3H A;  3C2P A;  4B3S F;  1A7G E;  5A76 A;  4PWD B;  5CH7 B;  2UXC J;  5A2Q U;  4USV A;  2OPS B;  1NH7 A;  4LF4 J;  5D0R A;  2F3J A;  1GMU A;  5IM0 A;  2WW8 A;  3I0R B;  3AJD A;  3ET6 B;  4GVL A;  2UVR A;  4C8N A;  1S6Q B;  4A47 A;  3A8E A;  3MXH P;  1UJ5 A;  3DN9 A;  4I6Y A;  2D3U A;  2B7B B;  1RHK B;  1BD6 A;  4HVZ A;  5A8R B;  4DUZ F;  1L3K A;  5KFH A;  2N7C A;  5A8K A;  1GAO A;  1R7I A;  2WVB A;  1TK8 A;  2BEF A;  4MJK A;  3P3D A;  4B3M J;  1RYS A;  4A8Q A;  3X1L B;  2ZJP Q;  3NNA A;  2R7X A;  5K20 B;  2M8D B;  2R7U A;  3HK2 A;  3T5J A;  2RQK A;  2AKW B;  4TYA A;  1RAD B;  3HHL A;  4WP3 A;  4M8L A;  2WVE A;  4PQU A;  1XER A;  4RWW A;  1HNI A;  1PJ6 A;  2W1B A;  5HVF A;  2HHH J;  2WBR A;  1VHF A;  2DPJ A;  5K8M A;  4GKK J;  3LWM A;  1HBN B;  3EZ5 A;  2YVS A;  1NCL A;  3ITH B;  4NPO A;  3ZTO A;  3MM9 A;  4UUX A;  2C3P A;  1OQ6 A;  1CJT B;  2RU3 A;  2XNR A;  1ZPW X;  1WSR A;  3TO8 A;  3TZY A;  3UPF A;  4FXW A;  2W8L A;  2RE1 A;  5AE3 A;  2VG6 A;  3IXQ A;  3TQ1 A;  3MPU B;  3FK4 A;  4EU0 A;  2XNQ A;  4HAC B;  3HO1 A;  4I68 A;  5IQ6 A;  2F63 A;  1FT8 A;  2FZG B;  2PE8 A;  1FD2 A;  3MR6 A;  3AQO A;  2OHD A;  2VJU A;  3D6F B;  3SEO A;  2M9K A;  3FSI A;  4DZ6 A;  2EWH A;  2MYF A;  2KT2 A;  3MEG A;  1HWI A;  2RD5 C;  1XMQ F;  1C2P A;  3CIM A;  1AFJ A;  3GON A;  3RJM B;  1RKJ A;  2UXB F;  2AJ0 A;  2HBZ B;  5E3R A;  3CCT A;  1E6Y B;  2G13 A;  3TEG A;  2DCU B;  3IR7 B;  5HAN A;  3D68 A;  1VC6 A;  4F3O A;  4KHR A;  1RT4 B;  2YNI B;  3SV4 A;  2AEF A;  3CVK A;  4ETX A;  2JLG A;  3H7H B;  1FXL A;  5KFW A;  3NWR A;  4B08 A;  5DDO C;  1IKY A;  3DLG A;  3BYR A;  4LSN B;  2M70 A;  5H1S V;  1R0A B;  2E9T A;  4URS A;  5ETO A;  3CCQ S;  1S9G A;  5HMZ A;  3V4I B;  1T9T A;  2H51 B;  4KR0 B;  2KU7 A;  4X66 J;  5DLF A;  2IM3 A;  2DHH A;  1U0H A;  5HQL A;  1I94 J;  4JUZ A;  2VJV A;  1ZS6 A;  2XMW A;  5T41 A;  3TOQ A;  4OI1 A;  1SJ3 P;  1TQL A;  3R5J B;  1WJ9 A;  3UDL A;  4AND A;  2ZD1 B;  4P2F A;  3O1L A;  2F4V F;  3QJL A;  3RW6 A;  4I67 A;  3T9N A;  3TR5 A;  3M32 B;  1S1U B;  3PX0 A;  4Q5V A;  1I6J A;  1RLC L;  4EO8 A;  2DEI A;  3N9U C;  2KB2 A;  4LF6 F; 
#chains in the Genus database with same CATH homology
 2C2Z B;  2QLJ B;  2FQQ B;  2QLF B;  2P2C B;  1I51 B;  1RWO B;  3P4U B;  3R6G B;  1RHR B;  2C2K B;  1RHJ B;  1RWW B;  3R7N B;  3GJQ B;  1I3O B;  2CDR B;  2Y1L B;  4ZVP B;  1PYO B;  4LSZ B;  2C2M B;  3EDR B;  1IBC B;  2H5J B;  2XYG B;  1RWM B;  1RHU B;  1RHM B;  4ZVQ B;  2QLB B;  3IBC B;  3KJN B;  4DCP B;  2XZD B;  1BMQ B;  2HBR B;  3D6M B;  1RE1 B;  2C1E B;  1F9E B;  1SC4 B;  2H54 B;  2XYH B;  1RWN B;  2Y0B B;  1QTN B;  2H51 B;  2CNN B;  3NS7 B;  2HBQ B;  1RWX B;  1RWK B;  1QDU B;  3GJR B;  4ZVS B;  4ZVT B;  4ZVU B;  2H4W B;  2CNL B;  4DCO B;  1SC3 B;  2HBY B;  3R7B B;  2XZT B;  4ZVO B;  2DKO B;  1RHK B;  2XYP B;  2CNK B;  3SIP B;  2H48 B;  5IC6 B;  3GJT B;  4ZVR B;  1GFW B;  3R5J B;  3KJF B;  3R6L B;  1RWV B;  3P45 B;  2QL9 B;  3KJQ B;  1ICE B;  3D6F B;  3R7S B;  5K20 B;  2QL7 B;  1PAU B;  2H5I B;  2CNO B;  2QL5 B;  3IBF B;  3GJS B;  3D6H B;  1RWP B;  1SC1 B;  4JB8 B;  1NME B;  2CJX B;  3QNW B;  2CJY B;  3RJM B;  4DCJ B;  2H4Y B;  2C2O B;  3EDQ B;  2H65 B;  2HBZ B;  1RHQ B;  5IC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...