2H65B

Crystal strusture of caspase-3 with inhibitor ac-vdvad-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords caspase-3, p17 subunit
publication title Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h65B00
1QTNB 4DCOB 1RWKB 3EDRB 2QL9B 4ZVUB 2FQQB 2DKOB 3KJFB 2CNLB 4LSZB 4ZVQB 3KJNB 2C2KB 2CJXB 1I3OB 2P2CB 3R7BB 2XYHB 2QLJB 4DCPB 1RE1B 1PYOB 1SC4B 4ZVPB 3GJTB 1RHMB 2CJYB 3R5JB 1RWXB 2QL5B 4ZVOB 3R6GB 4DCJB 3KJQB 2C1EB 1RWNB 5K20B 1SC1B 1RWPB 1QDUB 2HBQB 2CDRB 2HBZB 3GJQB 2C2ZB 2H5JB 3R7NB 1GFWB 1RHQB 2CNKB 1RWVB 2H48B 3P45B 1I51B 2H65B 1NMEB 2Y0BB 3NS7B 1RWOB 2C2MB 2C2OB 3GJRB 2QLFB 2XZTB 3QNWB 1F9EB 4ZVRB 3D6HB 1RWWB 3R7SB 2XZDB 3RJMB 3SIPB 2HBRB 3IBCB 1RHKB 1RWMB 2CNOB 2CNNB 2XYGB 3D6FB 2Y1LB 4ZVTB 1PAUB 3D6MB 3P4UB 2QLBB 1RHUB 4JB8B 5IC6B 3EDQB 2H51B 1RHRB 5IC4B 2H4WB 1ICEB 2H54B 3GJSB 4ZVSB 3R6LB 2HBYB 1BMQB 1SC3B 3IBFB 2H4YB 1RHJB 2XYPB 2QL7B 2H5IB 1IBCB
chains in the Genus database with same CATH superfamily
3JQJA 4KT0C 1MG7A 3FC9A 1C4CA 5HMZA 3H2UB 2YBVA 4X4NA 2Y1IA 2KJWA 1TV6A 1CLFA 4M5KA 4JI6J 3M7VA 3Q8YA 5KFQA 3PYDA 5IT9Y 2DR5A 5HK4A 1BQMA 3T5JA 3HM9A 5FLXU 5CYMA 4ANCA 2QT7A 2CWXA 2UUAF 1IBKF 3JQKA 2HHXA 1VGYA 4ECZA 5D0EA 2IA0A 3HHNB 3JSMA 2HMIA 1CJTA 3HVTB 3ZZYA 1CJUA 1DJ0A 1H2TZ 4O3PA 4AE5A 2XZDB 2EBGA 1XMQJ 1WI8A 1UAWA 1R8HA 2I0XA 2DXDA 2BACA 2ALZA 5E0OA 5KFXA 2BJ9A 5B0AA 4OHZA 2DR6A 1YITS 3QATA 4AXJA 4OI2A 4LRBA 2RKIA 2F3JA 2ZVSA 3P5TL 5B0FA 3VAJA 1HQUB 5EWGA 3MR6A 2LEPA 3MPVA 4ZN1A 3HLUA 3ZFVA 4O3RA 1VHIA 5D77A 1UVJA 4USMA 1RT5A 4GKKJ 2HYIB 1WHVA 4DFPA 4B3TJ 4UQTA 1RWXB 5IS2A 1S6PB 4YP3A 1VK8A 1EAYC 2BANB 2N4DA 2PSZA 2RMLA 5KG1A 4DN0A 1QE1A 1KKHA 3LP2A 2ZWPA 2MHEA 2PO4A 2G2YA 1NK4A 3RG6A 2PA3A 4PG7A 1R27B 4IYQA 2XZTB 4ZIWA 2JX2A 4S0MA 3GIRA 3R5AA 1UPMB 3MEKA 4DUZJ 5A76A 1S4EA 2HWTA 3MEEA 4WBFA 3T9ZA 3J81U 1GTEA 4NLGA 3ADAC 1KQKA 1FK9B 3DYAA 5FLXY 1X5TA 4RW9B 4JYAF 2Z57B 4OZ3A 2H4YB 4K7QA 5HBMA 5FDLA 2E5IA 4JI0F 4K4XA 4ZJOA 5ETRA 1OMSA 3R27A 4DUYJ 2VPZB 3KK1B 2LYVA 2LU1A 2HNZA 2RAQA 2B9XA 4I2PB 4C0BA 1NSKL 4LR9A 2YKQA 1AUSL 3TX0A 1RLCL 2NLWA 1N5VA 1MROA 2E9RX 4ZIVA 2DGOA 1NH8A 3UI3A 4F3QA 1VRTA 1R31A 2CZVC 4C9DA 2XHWA 3E01A 1TFWA 3NAHA 1RI7A 1TAQA 5HN0A 2H5JB 3NXZA 2WVBA 2XNRA 4R5PB 1FD8A 2MZQA 1TUGB 2ZH4A 1GNKA 4R0EA 3PRDA 3V81A 3OBIA 5I42B 3ZTPA 2I8EA 4NZ0A 4IOAQ 1R6VA 2UXCJ 2HKEA 3RB0A 4P75A 2YQ3A 2HVHA 1Y5NB 4WFXA 1X9MA 4F3OA 3HKWA 1VBXA 2FC8A 4K4VA 1VQNS 1UA0A 1QM9A 3IBFB 4K5RA 4LIWA 2M88A 2BUNA 1RAJA 4CTAA 2JEIA 3HKZD 1Q8KA 4L74A 3GFYA 2YNHA 4ED1A 1CQMA 2RF2A 2EFQA 4Q8EA 3MMCA 4MAKA 5HJYA 1Y9OA 3MMBB 2AEJA 2W4CA 4EZ6A 2FGOA 4RBTA 4TY8B 1Q79A 4HYKA 3NG8A 2B3TB 1HIYA 2O1PA 3D1QA 2HHVA 3E3XA 3A3PB 4G1QA 2ZNYA 1M1GA 4QOTA 4ITSA 3K58A 3M2UB 1BQXA 3A3NB 3I9V9 2CADA 2G0CA 3VR1A 5ETKA 1DHMA 1X4DA 1NBEB 4ZCIA 4H4MA 1QUPA 3HO1A 2YWGA 2RHQB 5IFMA 3GPAA 4F3MA 2HFZA 4WU3A 2GS8A 4C8OA 3ET6A 2OTLS 5D3GA 1ZM9A 4Y3CA 1KR4A 3PVXA 2EC2A 1U0HA 2RRBA 2UVRA 4KHPF 3ZNUA 3LH2S 1HI8A 1W2IA 3CMAS 1JLGB 3TAMB 3GG1A 3M8RA 2IVYA 5I3PA 2P5VA 1FFWB 4C11B 1VMBA 4UOHA 2HQFA 3FFIA 3D54A 1ZA1B 4JBCA 1S1TA 4DR4J 4KGMA 3RAXA 4LRFA 2J0QD 2BM0A 3IA0A 1FVSA 3MD1A 4Y00A 2VPWB 5KTQA 1TFYA 4KO0A 2GHPA 4NPOA 3BN4A 4TLRA 3UDCA 1RWVB 5DLGA 4MK8A 2HVZA 3GCWP 2DCLA 2XQCA 3NGTA 3AD7C 3ENVA 2KT2A 1H3DA 2MLXA 3M32B 1FJGF 4ECTA 4EU0A 1NK9A 4UOFA 2VBXA 2V8DA 1R8AA 1XK8A 2AGOA 3CCZA 1WC5A 5C2GA 3OL8A 4FF2A 1RT7A 4FNHA 2MQPA 2LFVA 3JB9k 4EMDA 4ICLA 3T9NA 2QMWA 3N5BA 4AL7A 3DHWC 1E6YA 4ILRA 2RSQA 2C2RA 2WVCA 2KB2A 3E51A 2VQEF 2ATLA 1S9EA 4A8MP 2OFGX 3S6EA 2ZJPQ 3A3OB 2NXEA 2O3DA 4Z37A 1TU0B 4NXMJ 2F5GA 4ED6A 2QL5B 3MR7A 4ZP7A 4CO4A 1EJ7L 2CUYA 2CQHA 2GHVC 2VFSA 5A6PA 1WEXA 5HQ8A 1RAIB 2YXLA 1SV5A 3DI6B 3Q8RB 2ZH7A 3BKUA 1UWBA 2HK3A 2OMOA 1FO1A 2W24A 2OFHX 3ZZOA 4N5SA 1S48A 1TP7A 4HHUA 4ZVTB 2E1AA 2GMHA 1JKHB 4LR7A 3DRPB 2M9KA 2YKOA 1KSPA 3KJVA 1KS2A 1V5IB 1SC3B 5GMEA 1RT1B 1Q7LB 1QAYA 2FLNA 5KT6A 4YB6A 1BUXA 2D74B 5FJ4A 1FX2A 3PYEA 3I5BA 3ZTOA 4R8UA 4JI8F 3PFEA 2XS5A 3IWXA 2GMJA 2B7BB 2CQIA 3PDNA 1U1KA 4K8RA 2C3MA 3HSZA 1R0AA 1BHNA 1LWEB 1KEKA 2KG1A 1CVJA 3M6VA 2A2DA 5GVQA 2E5LJ 4ZHRA 3KLEB 1IXKA 1VC0A 4LF6J 2J9DA 1WTBA 3HXMA 1YRXA 3M1VB 5C24A 2WOMB 4EBDA 3PTWA 1KOHA 2EFNA 2W25A 1NH7A 4FBTA 4CO5A 2C2OB 4DSJA 2CKWA 5KG2A 3UVJA 1LW2B 2KM8B 4GKJF 2NYHA 2XC9A 4B3SJ 4LBIA 3IS9B 4KHMA 3DLEA 4X66F 3C6TA 1RA6A 1Y11A 2KHDA 2AYBA 4J9VA 3U7JA 2FJVA 5I4MA 4KKOA 4QIEA 1SH2A 3TA0A 1JLEB 4KGVB 1YJ7A 5AJ3J 1U1MA 4IG3A 3V6KA 2OEKA 3GZ7A 3R1HA 4X64J 2J0SD 2JJ4D 4HT7A 2BE7D 3MUTP 3CCVS 1FNOA 2X3DA 1WELA 2MY7A 3J7Z5 4F25A 2BW2A 4AL6A 4CM2A 3W60A 3A12A 5A2QU 5J2PB 3SZ2A 7FDRA 2VF3A 4LBPA 5KFOA 3N28A 2MSSA 1VK3A 1VIOA 1F3FA 3T5HA 4DL3A 2XNQA 3U1NA 5L1IA 3TQEA 5IM0A 4QR2A 1AZSA 4Y2MA 3LO3A 3PW0A 2J5AA 1FJ7A 1L3UA 2DHXA 5KFEA 3IAS9 2ZUAA 3CIZA 5GAEI 4BHQA 5DO2A 2VZ9A 1H38A 5HP1B 1BMQB 3K59A 2IBKA 2IDLA 3QGHA 3KWMA 3MM5A 3RGIA 3N6LA 3BO2A 2I2YA 1DTQB 3QSIA 3QIPA 2EEYA 4MFBB 3IGVA 1SUQA 2FVSA 3TA1A 1UA1A 3VAMA 2VUGA 2HHSA 4DV1J 1WG4A 1JWWA 3CJKB 2DNHA 4KGXB 1RAFB 4DL6A 1WOPA 3DOLB 5CAAA 2WONA 1ZPWX 4LFCJ 3KUHA 1TR0A 5LJ5Y 4Q0BB 1C1BB 3CEDA 2W2QP 4J91A 3KHLA 4X84A 5HVFA 2DT9A 3C66A 4CLSA 1FJCA 2XMJA 1L3KA 3H0PA 4DS5A 3EVMA 3TZYA 2DK2A 1IJFB 2NR0A 3MECA 1RHUB 2B8PA 3WX4A 3N5FA 2E5JA 3M2RA 2VG7A 2LXIA 4ED4A 2EI5A 3GIIA 3TAPA 1IM6A 5CH7B 2HBYB 5F8IA 3V5RA 4FS2A 2BQRA 1N56A 3MM6B 4ES1A 3M9OB 4OV6A 5L1JA 2BRKA 1RWKB 5M2UA 3GYNA 2A6MA 1I1GA 2H9ZA 4HDGA 3KK2A 2ZBIA 2ZC4A 3OXGA 4MIAA 4IH5A 3CNQP 3QLHA 1FT8A 1P27B 2B4UA 3K5NA 3PZPA 1VC6A 3MM7B 5EWFA 4DMZA 2DHAA 3W9IA 4JI3J 1U1LA 4ELVA 2FZKB 5L1KA 1GFWB 2CQ2A 3TVYA 2VV5A 3SYZA 4M94A 1JLFB 4TU9A 2KKHA 4TXSA 2HS3A 2OPSA 4IR1A 3CB4A 2GA7A 4LF5F 2DH7A 5KAKA 3SQGB 2XLIA 5F8GA 2UVUA 2M70A 1SJQA 2LP4A 2ZDPA 3OR2B 2B5JA 4W4MA 4C98A 4E8UA 3OTDA 5J1EA 4M5DB 4P6QA 1RT2B 3AD9C 4F4AA 3ETMA 4DX7A 1RTDA 4RW7A 4WU2A 2NUUG 4ZVUB 3IWLA 5HROA 2BKOA 4L72B 1AA1B 1IBLF 4KQZA 1YVFA 3M8ZA 3NGDA 2ZC3A 3BGRA 2DXEA 2Z30B 2V69A 2Z58B 4EEYA 4AYBD 2EFVA 4A48A 3O44A 2V4RA 3TVKA 2HHHF 1YK9A 3C6UA 4CQ1A 2JDJA 1HMVB 4O4GA 4WYWA 1OPIA 5KG3A 3SBMA 5CABA 2OPRB 4M5IA 1UWAA 2DO4A 1S6UA 2MQOA 5CQGA 3JAMU 3EYZA 2YWKA 2GJFA 5LMNJ 2MHNA 2HEKA 2W7PA 4C8YA 2IC3A 2L48A 3T1AA 2X1GA 2OP5A 4TYBA 1D1UA 4NLDA 3HP6A 2KFYA 3DU5A 4NLRA 1T3NA 2N3OA 1J5OB 1KWMA 2KH9A 1P6TA 3EWGA 1VQKS 1NM2A 5BYRA 4YDDB 5F8MA 2HGMA 3DKDA 4N77A 3QFWA 4ZVHA 2N7YA 4RWXA 5AXLA 3CDEA 4DX5A 5GADU 3ZC4A 2XSJA 1RU1A 2LDIA 4CNYA 2L9DA 1LWXA 2XO6A 3IC1A 3GR0A 2NREA 1Z2ZA 2DNPA 3BPDA 1OQ3A 1KHVA 3GILA 3BBCA 2W9BA 2Y1JA 2DH9A 3ICLA 5AE2A 3OVAA 1TKZA 2RVJA 2IRYA 2OEMA 3OL6A 5IV3A 4F4KA 4USJC 4MT1A 1KONA 4LF2A 3HHKA 2HURA 1RWWB 2LKZA 3W8PA 1UW4A 2PD1A 1R8CA 5KFDA 2OSRA 3AH6A 4YR3A 4K4UA 3OTOJ 4USVA 1FJEB 2ZM6J 2R7TA 2Y8WA 2BXJA 1T9UA 4LSLA 5L39A 3D0HE 2N4CA 2G0JA 4K0KF 4H4KC 2R7OA 3IXQA 3QZ8A 3M8SA 3F41A 2K06A 3NWGA 3CULA 3UR0A 2UUCF 3DRYA 2WCXA 1S79A 1DLOA 2GIQA 1N32J 3GQCA 4FP9A 3SV3A 2VBWA 1MMDA 3LPYA 1S77D 1HW9A 1I5OB 2OAUA 3J80Y 4NYOA 2R2SA 4ZPWR 2GJIA 3PXGa 2CVIA 3UE2A 4EK2A 1RK8A 3CO0P 4TYAA 1JLCB 4QWEA 5AJ3F 3Q8SB 4G3IA 4ZK7M 1OY6A 5DJBA 3MPDA 4GC6A 2FUG9 4KY3A 3TO8A 3V4IA 1URNA 2VG6A 2AJ2A 4OI4A 3KHGA 2HQGA 1VRUA 2QFJA 2PFDA 2D69A 2O01C 4ECUA 3CJ0A 5CZVA 5BJRA 5MLCV 4RL1A 1LOUA 1WG1A 2CNNB 1FDAA 1CS4B 3MEDB 2YKNB 2RRAA 4IFYA 5IC6B 3B6BA 4OHYA 2R2UA 2FLPA 1X5SA 1YJUA 3TUPA 4DU7A 3LAKA 4JI4J 2AP6A 1C0UA 1RAAB 5KG4A 2GJ2A 5G0RA 2LLZA 3R2DJ 2RRNA 3C15A 1D09B 1WI6A 1TL5A 1RP5A 1IVZA 3P6YC 2VC0A 3MMJA 4IKAA 1KNZA 1NHKL 2RH3A 2VBYA 1VR6A 1X5OA 3KLFA 4DU8A 3J7ZT 1NO8A 4CO0A 4JI5J 1TV6B 1JLBB 3OFHA 7FD1A 4DR7F 2BA9A 4YB1P 4IFVA 4DCJB 2OGUA 5E5NA 4LFAJ 2KRBA 2AU0A 5KT4A 2W7OA 3KMQA 2OTJS 1HHQA 1CQNA 2GO8A 3VZHA 2Q1LA 2FB0A 1LQ9A 2DEJA 2R7QA 4DG1A 1HR0J 3B78A 3VQTA 3JSMB 2CRLA 2DR8A 2HMIB 1K9MT 2HAIA 2CPXA 3ONQA 1FD2A 4DQSA 1VQ8S 1O5JA 2O67A 1UPPA 4Y34A 3OVBA 2J9CA 4DV2F 4FXVA 2W7AA 5CYJA 3EM1A 2EKNA 2BQ3A 5K9FA 4ZVFA 1KRPA 3OV7A 3HHDA 3WX8A 4DV3J 1KBRA 2DNKA 4ZDNA 5C25A 2ZBRA 1RXOB 1YKWA 2PN6A 4HHHA 2RKIB 2Q6BA 2R8GA 4C8MA 3UNYA 3PJ9A 2VA2A 4J9KA 2SXLA 2OPQA 4LF7J 3U1LA 1YZ7A 3ENQA 3AQPA 4RUAA 3CJRA 2FLOA 2J76E 2BE2B 1U02A 2C22A 3TWZA 5DGAA 2HVEA 1RT5B 4RWWA 1N36J 4WK1A 1TELA 1N6QA 1CULA 2ZUGA 4ZCMA 2ZKTA 1OWXA 3HFVA 2UUBJ 3MI7X 3KLGA 3D0IE 1FRJA 1OYDA 3J7YI 1QE1B 1UP1A 3LP2B 3M4XA 1BC6A 1GAOA 1HARA 5CD4A 3UO0A 4DF8A 4R0JA 1DFDA 3IM8A 4E98A 4AD6A 4RNOA 3ETOA 2I9SA 1HBMB 3NY0A 2PI5A 2CPIA 1S6PA 3MEEB 3BN7A 4ILMA 4DSKA 3NGSA 5D0HA 1HD0A 5LJ3Y 3DYAB 1VQ7S 5DDQC 3NS6A 5FDLB 1GX5A 5GAHU 2QSFA 5GAGU 4U96A 2NXCA 4ZPTR 3C14A 2UVVA 3MGJA 1N88A 4O3QA 2HNZB 4A47A 1KFDA 2FVPA 4L76A 5K20B 3W5XA 2YKPA 5HAOA 4L75A 4DFJA 3GFZA 2HBQB 1VRTB 4EFAC 2OPPA 3E01B 1FK9A 3DMJA 1WHWA 1VQSA 4J9PA 3DLGA 5D4PA 1TAUA 3D66A 1XNRJ 3M6UA 2C42A 3OHBA 3IR7B 3FEYB 4NZ7A 3C19A 2DNYA 3TUZC 3T41A 2HSEB 2HQ3A 3V81B 4O3SA 5LMNF 2P8IA 3MAAB 2W4PA 1DBDA 4KAIA 2F4VF 2IY5B 2X1AA 2DXFA 4I6WA 3PJXA 2DHHA 4P2XA 3S7RA 2EW9A 2X1FA 3VAHA 2HVDA 1PBUA 4CTAB 4R5PA 5BR8J 2VFVA 1I3OB 4J9RA 2ALYB 2YNHB 4DR5J 3TJ9A 2RF2B 5I42A 3MMCB 1H0HB 4LFBJ 4JV2A 3D3CJ 1XN9A 4ZP8A 2E44A 4P2MA 1FXRA 4ECXA 1GQEA 4OYWA 1VBZA 1VRQC 4EZ9A 2MZTA 4G1QB 1SL1A 3DDIA 1YWXA 1ZAVA 4CO1A 3LP1B 2PDAA 2Z0GA 3ILLA 3H8YA 2CQ3A 4USWA 1WHYA 4NL5A 5KG7A 4ZOSA 3MMBA 2QZ8A 3NKYA 4DFMA 4FVCA 4RO0A 1H6KX 1J2VA 1A0OB 4OZNA 4FZVA 4J9OA 3ET6B 3AODA 3MR5A 4F4ZA 2F8MA 2E5HA 1U0HB 2WAQD 4X4QA 2AEMA 3EICA 1YJ9S 4WPAA 3CJSA 1Q7YT 4HTJA 4CLKA 2GV1A 1T11A 1Q53A 2VU5A 3R5JB 3W64A 1QSYA 3FFIB 3JTPA 1U8SA 2VJVA 5F3ZA 1RBAA 2H1YA 3DXBA 1UFWA 3WBZA 4FN5A 3QWUA 4B9LA 1R8PA 3GIKA 4DR1J 4DQIA 2ASLA 4C8NA 1YX2A 4F0HA 1QAJA 4KO0B 2DYAA 3UNGC 1FKOA 1GXTA 1QJHA 1JLGA 3HVRA 4J9QA 1M5OC 2HZVA 4BDPA 2XYGB 4C11A 2E5GA 2BJ1A 4DQPA 3G71S 1OY9A 4B9SA 1FCAA 5BYSA 3O5TB 1RT7B 3V6HA 3UN2A 4IQMA 3CMES 3NCRA 4DSEA 4ICLB 2ZHBA 4I69A 4ZVQB 2OKQA 1E6YB 2Y9HA 2IMOA 1Z2LA 4DV4J 5HANA 1JX4A 4FKYA 5HMWA 1S9EB 1JK9B 4DDFA 1SVDA 4RNMA 1SJFA 2JL9A 4KIAA 3Q22A 3RB3A 1OJ4A 4CWBA 5LSLA 1RABB 1FFGB 1Q81T 4CCHA 2EK6A 1IR2A 2EBEA 4C8KA 3M6WA 2UVWA 3HF5A 3VGVA 1U2FA 4DQQA 4LFAF 1SV5B 1I94J 3V2UC 3V4MA 5M2PA 2XCPA 1UWBB 3V6JA 3PX0A 3H7HB 1FVQA 4NCGB 4K5SA 4LRCA 1FI4A 4PXBA 3PO4A 1HR0F 1NEEA 4ELUA 2XLJA 2MLYA 4OI6A 4U7UK 2Q66A 3CDBA 3IMQJ 2MY8A 4CLWA 1MLAA 1JXLA 3QGIA 1TVRA 2WTFA 1MW7A 2UU9J 1OY8A 1X0FA 1YBAA 3PHTA 1HNXJ 2QRRA 4PYDA 1HNZJ 4M5NA 3KJVB 2ZOMA 3TW0A 4L73A 1R0BG 2IJNA 2CNLB 4IOBA 2BKNA 4YR2A 4I64A 4FYWB 4A8FA 2XMAA 2GX8A 2V9WA 2XYHB 2C2DA 3PY8A 2HPUA 4PXEA 4R8UB 4ERDA 1QLNA 3GYXB 4CO3A 3VHQA 2IHR1 5HVHA 3K5OA 1TL3B 3MOJB 4DPWA 1SXLA 4JV5F 2CG4A 2QO3A 5IZHA 2K3IA 2VHGA 3MURP 1WKKA 4ZHRB 1RTZA 1X7VA 3K2YA 1N36F 2EXUA 1N33J 5C24B 1AXQA 2F1FA 3MDFA 1LWFB 3EPGA 3IN5A 2QA4S 2ZH1A 2QSWA 2UUBF 3LAMA 3EUNA 4DLGA 2CJBA 2DNRA 2XTJP 1UJ4A 3BS9A 2DNLA 2JFDA 3NNAA 2JNJA 4Y2IA 3QJJA 2AGQA 5SUHA 4DR3J 1ZAXA 2G2ZA 1F2GA 2VQFJ 1X60A 3W62A 2ZWOA 3DLEB 1U45A 1K44A 2MQLA 1SIWB 2IJRA 4YMEA 1KQGB 2E7XA 3QRPA 2HAFA 1S7IA 1JNRB 5K14A 2LQ8A 4K4ZA 3M1VA 2VC1A 3C6TB 3M2VA 3H42A 4LSZB 3DLKA 5KFRA 3MCOA 5KFSA 3VALA 2Z4PA 2CFXA 3MOZA 2HIQA 1YRUA 4ZVPB 2V2KA 4WFZA 4ZLJA 1GMVA 4TLQA 4KYZA 4IG3B 1Q5VA 2VDIA 3O3LA 2V4JA 3MCSA 4URGA 3I56S 1S9GB 1TQLA 1TUVA 1B0PA 5F8JA 3G87A 5HVGA 2DRAA 2M8DB 1PC5A 4P9SA 4WIQA 3SSRA 3CD5A 4LF4F 1MSWD 1M1HA 3KLHA 2KHCA 1DY3A 4F7VA 1X9WA 3DDKA 1ULRA 4DZDA 1JLEA 5IM0B 1PAUB 4DSIA 3O2IA 4RBVA 4JB8B 5D4LA 3TAQA 1HWLA 1AZSB 1T94A 4RNNA 3ZZPA 1UETA 2VBZA 1OYEA 4DV0J 4ZVSB 2FTRA 4GO7X 1ZBTA 3Q83A 1K1SA 1H73A 1P1TA 1FHTA 2OIHA 4PKDB 1VFJA 1U1OA 3R5BA 1NSQA 4RZRA 1XR7A 2MKHA 4BC7A 5IT0A 3MM5B 4DPTA 5JJBA 2RQCA 2A10A 2YWWA 1UFKA 1H98A 3EE3A 4OI1A 2AJ4A 2Y3YA 3IO1A 1ZOTA 4X4TA 3QIPB 3CJ8A 1VQ6S 3G2XA 4N8OA 4MK9A 1CC8A 3GMGA 4JI7J 2UXBF 2BM1A 3ZNJ1 4P10A 5CZXA 5EX3A 3B4MA 2WONB 1B64A 4DBQA 2NXJA 2C2MB 3DGVA 2FIUA 1EQMA 3R7SB 3Q86A 1WF1A 1DTQA 3OLAA 4WKRA 1X4GA 2BJEA 4KH0B 2DJWA 3U1MA 3CUNA 3CWJA 4A8OA 5DS7A 3KG1A 3MECB 4F2RA 1MWQA 3P49B 4CO2A 3T3FA 1IBKJ 3M2RB 3HX9A 2VG7B 3IR6B 2IVFB 3VCDA 3GR1A 4DWIA 4YB5A 1S57A 3DOLA 4USIA 1KLNA 1RCOB 1HBOA 1QSLA 2DKOB 1NKCA 3OUYA 2N82B 4IRDA 3HHLA 1M5HA 2YH1A 3JTOA 4WKYA 4J9NA 4C8ZA 3RR7A 1IKWA 4ANDA 4U95A 3KK2B 4DV7F 3M9NB 3G96A 1HBUA 3QLHB 1Z4UA 4A8SA 2R42A 3DOMB 5JVHQ 3H20A 1JNZB 1ACMB 1VQ4S 4OYAA 3AFGA 4HDHA 2Q6CA 4P2FA 2RIJA 3NNHA 1N5SA 3KLVA 1DTTA 4OZ2A 1IQTA 2MKCA 2XI2A 2BYCA 3HCXA 2ILZA 2H51B 3FMWA 5BYQA 1KD1T 1S1UB 1S6QA 1ZETA 2OPSB 4YHHJ 1H2VZ 4EYHB 2RUSA 1A9NB 1CJVA 4ILLA 2R7UA 5AT1B 2JH3A 5DZ7A 2QEXS 2B5JB 3NGRA 3JSRA 2I5JA 5J1EB 4M5HA 1DZ5A 4UUWA 3OJUA 1RTDB 4RW7B 5HROB 4NXNF 4FYYB 4PG5A 1FRIA 1WC1A 1KQFB 4ZVOB 1WF2A 3BGRB 1HLWA 3DC2A 4N41A 4C48A 4HACB 2B8QA 4JYAJ 2RQ4A 3C6UB 4IR9A 4KJIA 3SI8A 4QIFA 4O4GB 1Y00A 2OD4A 1U24A 4ANEA 4DV6F 3PKMA 5CA5A 1NHVA 3CT9A 4FYDA 4PEOA 2HWHA 3TEGA 1WG5A 3G4SS 3QFHA 2E66A 4KE5A 2ZITA 1YG0A 3BSNA 1UJ5A 5AE1A 2MXYA 4DR6F 4B9UA 4EBCA 1PBAA 5MAOA 1Y5LB 1N8RT 1QTNB 2WZ1A 4B08A 4LQ9A 3RBXA 1WUUA 5JVGQ 4ALZA 2UU9F 1T9YA 1P1LA 4EI2A 4MYUA 2XSJB 4CIOA 1WKLA 2AYMA 2DD8S 4ZJQA 5LSOA 5KG5A 3ELHA 5U47A 2EPIA 2GVDA 3TUIC 3RB4A 3AQOA 3NS5A 4UQGA 3T5LA 2WVFA 2W9BB 4WP9A 1P9QC 4DLEA 4OJGA 1TKZB 1DQAA 1GEHA 5JXSA 2P9EA 5ETVA 5KT5A 1S97A 4K4WA 1BY9A 2MGZA 2YWHA 3JQMA 1YIJS 5ETOA 1JQGA 4OV1A 1LXJA 4NLPA 2B6AA 2VD3A 3MTKA 2ZH3A 1TUWA 4OYZA 1GTHA 1UEKA 4IH7A 3CC4S 1JXVA 4LSLB 5C2CA 2UUTA 1U1RA 2DRBA 2P9CA 4LQ3A 2RD5C 4KPYA 2RILA 1NDCA 3VAIA 2WBMA 1WACA 3FK4A 3DLJA 1B70B 1DLOB 4L6V3 2E7WA 2Z2MA 4W92B 2RHSB 3MCNA 1T05A 3D4JA 3TP2A 4CM0A 3H90A 1XR5A 1S1WA 4O4RA 5F8NA 1Y3KA 4KHPJ 1F6TA 4B3RF 4P73A 5CCLA 3UFCX 1V6HA 4WE1A 1SJ1A 2ACMA 5D0GA 4MIBA 3V4IB 2VG6B 3FSXA 3CCMS 4F0KA 3IBCB 3NWRA 4ZCLA 3JSBA 3PX6A 1AUDA 2F63A 1R3NA 4DR2F 2DB1A 4JI1F 2HHWA 2V6AA 3HZEA 4IFYB 3QIDA 5EHHA 1YSJA 1FRXA 3W63A 3GIJA 2I38A 2EFGA 2AJ0A 4A8YA 1Q4RA 4U7CA 4U8VA 4QIVA 5G0RB 3C15B 3G6ES 5ETSA 1RUSA 2VDHA 2NSCA 1FJGJ 4FPIA 2C3PA 1A6LA 4EUVA 1V3ZA 2AKWB 3H2LA 3KLFB 5DQIA 4ZPCA 3MEDA 1BE4A 2YKNA 3UDVA 4KFBA 1F0XA 1U2RA 3MWBA 1X0PA 4IFVB 4HL9A 3R7NB 2C28A 2D1CA 3OSNA 3POTA 2KM8C 2H65B 2VQEJ 1VJQA 4OL8A 2V68A 2LEAA 4C2MA 1YTYA 1CG2A 3SV4A 2YWEA 2WSFC 3W9HA 2ZHOA 3H5XA 3QSYB 3VAGA 4ZVEA 3BBBA 1NZ8A 1HPZB 2V2VA 4FYXB 1JLBA 1FA0A 3FEXB 2YY3A 3FZ2A 4ZPBA 3TR5A 3SQOP 3BH6B 2R4FA 3HT3A 2R9LA 2CPFA 3CCJS 1T9XA 5C25B 2VICA 4UOGA 2QA4G 2MKIA 1KVJA 1RHMB 2MLZA 3R1LA 2M0GB 3H5YA 1N5QA 3ILOA 2DITA 5KFTA 1DURA 2OPQB 3HPOA 1RWUA 5L46A 4NLXA 2LQJA 3DGPA 3WHIA 2YPZA 3P96A 2ZOGA 2QA1A 3H25A 1ROFA 2E1RA 1N6QB 1S12A 1CULB 1Q8BA 1LFPA 1J5EF 4U7UD 1N5TA 4J7CA 4NA1A 2HGLA 2FVQA 4XK8C 2FGCA 3KLGB 4JI8J 2J7WA 4LVOP 3A8JA 4X62F 2K8GA 1DQ9A 4C3LA 2RU3A 2CNOB 1RISA 4Y2KA 1N34F 4YN3B 1IBMF 1U26A 4DL0C 1AROP 3BH7B 2BE2A 3GFXA 3CD7A 4NLUA 3PJWA 3I55S 1TKTA 4ZS6A 4B3MF 2W9CA 5F8HA 2ASDA 5B0EA 1ELOA 2MEWA 3O8WA 4I7FA 5HMYA 2OSQA 4HHJA 4RJVA 4RW4A 4I6YA 4HLBA 4YHHF 3NLCA 3KK3A 5HSPA 2V34A 2L9NA 1AW0A 3FQLA 3K5MA 4WP8A 1PYTA 4BC9A 4GKJJ 3HFZB 2GVZA 5E3PA 1VI7A 5DG9A 1H7XA 4P72A 2QTWA 1NRKA 5G4DA 3C14B 1NJWA 3TANA 4B02A 2ZBPA 1K0TA 2M8HA 4X66J 1HBMA 2FVCA 5A8WA 3NMRA 2HNDA 3QJPA 2V8HA 4GO5X 2FHOB 1Q8IA 4MYTA 2DPIA 3KYLA 5RUBA 3MXHP 2PEBA 4JP8A 2JHEA 4AQYF 2WRMA 3OT9A 2OPPB 3DMJB 3RZAA 4LF1A 3DLGB 3PRVA 1WJ9A 4OX7A 3D67A 1EX8A 2LDYA 3QRRA 1D9AA 3RRKA 2FYXA 6FD1A 3FQKA 2GFFA 3BBFA 3FCVA 4OYMA 3BDPA 3BB5A 3NAIA 3ISND 2QL9B 9ATCB 1SJ3P 3SSQA 3L7OA 3MPWA 4RBUA 3OTCA 1VIXA 5D78A 1AB8A 3PCOB 4OHWA 3PX4A 2ERRA 4OZLA 3VVUA 2MB0B 2JZ5A 2CVEA 3LUYA 2O5DA 3W5YA 4I4BA 4F4YA 4PR6A 1FWLA 2Q79A 1EARA 3HJVA 3LTOA 4Y65A 3R5CA 4BLGA 3I87A 1IUJA 5LXRA 3MAAA 2A18A 2EKYA 2HNYA 1TMMA 2MJNA 2OJ3A 4PPDA 1L3TA 2Y0SD 1SH3A 1NSAA 5LSRA 3AOAA 1WSVA 1NPPA 3LGMA 1G2EA 4G6VB 2DGTA 2LA6A 3DRSA 1Q95G 2GAGC 1VDHA 5AXNA 3BGUA 4OZ0A 4A8XA 1QVFR 2RQMA 3PW5A 1IR0A 3CCWA 3PIOQ 1K0VA 1G7CB 4F4XA 4DL2A 4LR8A 5LMUF 2COLA 1S0VA 4XIUA 5KOXA 3J81Y 2CJ9A 2NXUA 1RLDA 2Z2LA 1NPRA 3NMAA 4PPZA 3RYLA 4ZPDA 3KLIA 3LP1A 1C0TA 5DDRC 1PILA 2AJ1A 2M4MA 2XO7A 3W9JA 2IVMA 2BBEA 4UUXA 3U02A 1TMJA 2XY7A 4GVBA 3C8YA 3GJQB 4MJKA 5GMDA 3T1YF 4K50A 4CLPA 4QQBA 3K5LA 2OELA 1GMUA 1NKBA 2DGSA 2HHPA 6AT1B 2HBRB 4CLYA 1EB0A 1RBLA 4LSNA 1FKOB 4GVLA 3OTEA 4EYIB 3CMQA 3VQSA 4J9UE 2DVIA 4Y0FA 4WZMA 2R7XA 4HR2A 3VAFA 1HNIB 3W2VB 2HLTA 2FPHX 3SSSA 3UR3C 1TK5A 3TA2A 3ISZA 1RTJA 1BWVA 1B4SA 1C2PA 1FWPA 2BR0A 2DGUA 3PW2A 3AB4B 1F5BA 4F36A 5CD4H 2CJQA 2HK2A 2IAJA 4OZ1A 1RB0A 2V9KA 4JI2F 1JB0C 3W2WA 4LF8F 5KFKA 1G6BA 2BMBA 4LF5J 2KT3A 4QW9A 2E1PA 5K8PA 4M1KA 5T14A 1SI9A 2KVQE 3KG4A 2MQNA 3RUBL 4NRTA 3SXLA 4CH0S 3NP5A 2C3UA 2D3UA 2JEJA 2KRRA 1HFEL 1Y5IB 2DGVA 2HLUA 1HHTP 1IKVA 3FBCA 2ZH6A 1JJCB 4TU7A 1IKYB 3QNWB 3SFGA 1IBLJ 4V19J 1HD1A 2KXHA 2BW7A 3OL9A 5CCMA 3GTYX 3GSDA 5HL7Q 4KSEB 3H4DA 2HHHJ 4FVMA 4EO8A 3CCQS 4X4PA 1E6VB 2B4VA 1S1XA 4OLOA 1TVRB 2ACYA 3PM9A 2FJEB 3L9ZA 2UXDF 2DBBA 3D5MA 3MZIA 1X4EA 2HIYA 2F9DA 3EGNA 2C2NA 2PEHA 2VKRA 1NKEA 1RTHA 3Q8PB 3OTBA 3UW1A 3CDUA 3R9LA 3KNGA 2K7JA 4NCGA 3CCTA 1YHQS 1EQ0A 1J27A 1BGXT 1P9YA 3QGPA 2ZBQA 4HI1A 3M6XA 2W8LA 1SH0A 3TX8A 1NK0A 2DRDA 1IWGA 1ZA2B 2HVIA 3GV5B 2E9ZA 3Q89A 3MM8A 3KMSA 4YQWA 3BR8A 1QTMA 4OYOA 2NS1B 3RJMB 2RDDA 4MIWA 2AIRB 3L95X 1LXNA 1DARA 2X1BA 2VL1A 1WC4A 2IDEA 3JYTA 1NCLA 3CW2C 2DY1A 4MKVA 2FZGB 1TL3A 6FDRA 1IBCB 3RBDA 3DLLQ 1CPZA 4OX8A 4ZN3A 1RTIA 3QQCD 2BJ7A 5K14B 1WNEA 2AV5A 4DCPB 4ZVGA 1KTQA 3N6MA 3M2VB 2K7KA 1C1CB 3DLKB 1LWFA 2CXEA 1XNQF 2FVRA 1DAXA 4N47A 5J2NB 2HFSA 1RWPB 4K0KJ 1B0VA 3BZQA 4PWUA 2VODA 2VFRA 2ZBCA 5K8NA 3X3UA 3CC7S 1SQEA 3NCPA 2V4JB 1HNVA 2UUCJ 1BXNA 2MKKA 4WYLA 1G4CA 3BKTA 2GQCA 1EETA 1T03A 3CD0A 2CPZA 5A6WA 4C8LA 2KG0A 3KLHB 1VBYA 3LPEA 1KN6A 1NAQA 2LCWA 2HG4A 4IG0A 2P6SA 3HULA 4WTOB 3RBZA 3CCLS 4E0DA 2CPHA 2MZSA 4DPUA 2CDQA 1EP4A 2LXUA 1DQ8A 3JTNA 1EHWA 2U1AA 1R0CB 3SDEA 5A8KA 2CWKA 1S9GA 4P52A 4DF4A 1UL3A 2AX0A 2BV3A 4QR0A 2GHWA 1ZTWA 1JLAA 2HQCA 2MSTA 1TL1A 3BF4A 3DXSX 2MQ8A 2XBPA 2GO9A 2NZCA 4I2QB 2CJYB 4UTGA 1GX6A 1AT1B 2Z56B 2UP1A 2YH0A 1LWCA 2RUGA 3S1TA 3QMQA 1JJ4A 4Z2XA 3W66A 3FMBA 5C42A 2CNKB 2WVDA 5AXMA 3PFOA 5E3RA 4H54A 3RU0A 2R7WA 1YGYA 4GMKA 2O66A 1HWJA 3G8TA 3L7PA 4G1PA 1W2BR 2GIRA 4IUFA 1PGZA 3TUJC 2BJDA 2GIFA 2NXNA 3K7RA 3UWTA 5D6GA 4BCAA 1W25A 3AJDA 1IWAA 1YLXA 4DR7J 5DM6Q 1TK8A 3LWLA 5HJXA 4QYZK 5E7OB 5IXUA 2NPIA 1REVA 1NXIA 3QWPA 3DCAA 1D9FA 5DGBA 2M2BA 2VPXB 2R2TA 2NCKL 1T9TA 3R7BB 2ROEA 4RW8A 1HBOB 3IG1B 1SC4B 3OUYB 3HHLB 2ZD1A 4DV2J 4J5OA 3QO9A 4QR1A 1IKWB 2YNFA 1SC1B 4E2FB 1KFSA 4CT9A 1VLOA 5E2QA 4K2XA 2WBRA 1HBUB 2YQ1A 4I0WA 4N56A 3T1HF 1JLQA 4KBIA 3P45B 5D0RA 1WEZA 2J8SA 4FBUA 3TVZA 1NK6A 4ES2A 1TKXA 3HMJG 1Q86T 3TZZA 3VGUA 5A2QY 1DTTB 1B99A 3PO5A 3CCSS 2RNEA 3BR9A 5F0UA 4NX9A 4XPCA 1S6QB 1XBWA 5IT9U 3DOMA 2IIHA 1PKUA 3NBPA 1HHSA 2R8KA 1SJRA 2D7SA 3IAM9 1CJVB 4ECWA 2L41A 5J1NA 3M8QA 2I5JB 4F26A 4ZKAA 1FRMA 4F0MA 4CDIA 4FXDA 2PGCA 2ILYA 1FESA 4ED8A 3PYFA 2OHDA 5DZ6A 4DS4A 4WZQA 2FZCB 3NRBA 4DUTA 2V5HG 1S1UA 2HQDA 4TQSA 2CAJA 2HFNA 3VZIA 4LF9F 4ZCKA 1WKJA 3EJMA 4Q43A 3IFEA 3BSAA 3BM7A 4EGLA 2POKA 3HJFA 4DV5F 4FF3A 3BQ2A 1LV5A 2Y1LB 4W90B 3QT5A 1EKSA 5DETA 3F56A 4YY3F 2ZHAA 3OXFA 2K1RA 2OO4A 3WC0A 4QW8A 3MM9A 2DPJA 2CQ0A 4X4SA 2ASYA 4RU2A 2MKYA 3GWCA 4YUDA 5ETQA 2AJQA 2AGPA 4HACA 3TOQA 3EDRB 3I82A 3W1YC 3MEGA 4ATNA 2RS8A 3GG0A 4QZVB 4X65F 1T7PA 3R2CJ 1M5SA 2V50A 1H7WA 3G8SA 2WHOA 3KDNA 1QY7A 2KN4A 1HA1A 3EPIA 4ZP9A 4ED2A 2IBOA 5IWAF 2M5YA 2F4VJ 4C3MA 3R5GA 2AW0A 4DZ6A 4FF4A 3CPWR 2ZE2A 3V6DB 3MPYA 1F2HA 2XMVA 4NRUA 2IRUA 2GVDB 2NSBA 1XMOF 4PXCA 1U2CA 3I5AA 1F9EB 4TU8A 2E7VA 3ZZTA 2Y1RI 5LOQA 2DTJA 1LFWA 5K8OA 2DHSA 3EGWB 1XJWB 2XEXA 4KGKA 3D6TB 2H4WB 5B0DA 5A0YA 2MGZB 4DI6A 1V9OA 1X4CA 1KVKA 3R5DA 4CNZA 2PFFB 2B6AB 1MWYA 3N6NA 1SJ4P 5KFYA 1T0TV 2MZRA 3OJSA 3HSJA 4QPTA 4WCEQ 3WQPA 2FLLA 3UDLA 2XSFA 1S6OA 2XGQA 4K2JA 5KFWA 3A8IA 4NYPA 4NMLA 4CLLA 4LVNP 4KGZB 5IQQA 3KXDA 1RWNB 2FDNA 3ZTQA 5EGYA 5I3UB 1T05B 4IQXA 1HQ2A 1S1WB 1S1VA 3CVKA 4C0HA 1KVIA 2R8IA 3PRBA 2C2EA 1L3VA 2JSXA 4FYVB 1RT6A 4WE1B 4FNIA 2JVOA 3SIPB 3B54A 2QJ3A 4RNHA 2D3OR 3W65A 3LGHA 4USHA 4OYBA 3JAMY 2KZMA 1NJYA 3LALA 1HBNA 5F3TA 1FNXH 2G1DA 3L3CA 3M30A 3EX7B 3W3SA 2H5IB 3OFEA 1P8GA 3CDWA 2LQ9A 4CT8A 4Q2LA 2XY6A 4DX8H 1WC3A 3THVA 1N5YB 3DLBA 3T5KA 3W5ZA 1NLKL 1N52B 4QIGA 5L9XA 1NJZA 3LP0A 4UOCA 3KFWX 2JLFA 2C1EB 5IQ6A 4NEZA 2MQQA 1G1XA 4XTTA 2C2ZB 2DNMA 5F41A 5KG0A 2NYIA 4KFBB 4B17A 3M8WA 1FKPA 4RX6A 5L9NA 3POTB 4URQU 5B0GA 1U49A 4ECYA 2FHKA 1AFIA 1FERA 4GC7A 2MZJA 2ZH5A 3BO4A 2EG1A 1EZZB 4NI2A 3RAMA 3AJ2A 2W8KA 2C3OA 4B3OB 2F9JA 1VYAA 4UW2A 4QIWD 5C7PA 4QPXA 2AT1B 1PJ5A 4ECVA 3AOCA 5HLFA 2F40A 2ZH8A 2GMLA 2B0GA 4ZLNA 2GC8A 2ZKUA 2CPEA 3C16A 4QWAA 4PUOA 5KFGA 1S0OA 4RUBA 2EWHA 3LF0A 1WDDA 1S10A 3A13A 3D3BJ 1HPZA 4H4OA 2V4QA 3GCXP 1KHWA 3DM2A 2RDJA 4ES3A 2KI2A 3DGPB 2R8JA 3OXLA 1RKJA 3QAEA 1HYSA 3QT8A 2BZ2A 4KV8A 1EIYB 5K8MA 2B51A 3QT7A 4WIIA 3QGGA 2B9YA 1T9WA 2FHMA 4WFBQ 3R97A 3CXCR 5T7LA 4TN2A 3IR5B 4JV5J 5CXTA 1TL7A 3BGLA 2AJFE 5DQHA 3I96A 1GK8A 1SQGA 5KG6A 4ZMMA 3IRXA 2JEFA 1MN7A 3HHEA 3HHLD 1TKTB 1OSDA 1U4BA 2W9CB 4QWCA 2Y8YA 1TZ0A 2BOAA 2HZCA 3FRZA 1O51A 1X4AA 4ECSA 1MU2B 4I7FB 1IR1A 4NZ6A 4RW4B 3JXOA 3KK3B 4RUHA 2QG9B 1YRTA 3M05A 3C2PA 4FKXA 2WW8A 3MHYA 2GGPA 2IA6A 4ED5A 2DCUB 1YZ6A 2GVZB 3PEJA 2OUGA 3WIUA 2MKSA 2J7UA 2Q3PA 2YX4A 3IP0A 4QU7A 2AYEA 2IFXA 2JC0A 3OW2R 2VFTA 5A8WB 3MR3A 1XR6A 1ZTTA 2AX1A 3UQSA 2HNDB 1VQ5S 3Q8UA 4Z7YA 3DFEA 1D9DA 1T8EA 2J6SA 2W2PP 3I32A 5CYQA 3ITHA 3X1LB 1RHRB 2HHQA 2QFIA 3K5PA 3NCQA 2VOPA 1D3WA 3EVWA 1UW9A 3J7YU 4OX6A 2D3O1 4NA3A 3AJ1A 3E8OA 1HQEB 4P74A 3LGNA 3ZZZA 2DISA 5DDOC 3ZZRA 1REGX 4LF4J 1SKRA 2CJXB 1RCXB 2V94A 3K8VA 3O6QA 2QLJB 4DX6A 2V8GA 2AZ1A 1PYOB 3AD8C 4Y6IA 4O3OA 5LM7E 4TQRA 4Y28C 4USUA 2NZ4A 3K17A 1L5UA 3AAWB 4NLYA 4P7TA 2BVZA 1IKXA 2R7SA 5EX0A 2B9WA 4NLTA 1ITPA 2Y0BB 1X5PA 3M8PA 3CF5Q 3C46A 1ZAWA 4DSFA 1RGVA 2HNYB 2V67A 4JI6F 4M95A 5JMNA 3W8GA 2QLBB 3J7AN 5C5JA 1QSSA 1Q0NA 3GU0A 4H4KA 3GE9A 4ID5A 3DRSB 1RHJB 2CJAA 2UXBJ 1YJTA 4NLOA 2HHTA 2HRUA 1GXUA 3GB0A 5DG8A 3OLBA 1CJKA 5KFPA 4OZ5A 2ZNZA 3ISNC 3FBFA 1XMQF 1U6BA 5H9FK 1Q8LA 5ITHA 2DGQA 5KFMA 3OR1A 2DGXA 2NQPA 2CJKA 3M9MB 1RSCA 4D3HA 2Z2YB 2VG5A 5DDPC 1BD6A 2KDOA 3KLIB 1C0TB 3PR5B 4EBEA 2M7SA 1X4HA 3RB6A 1TTHB 1U0SA 2ABYA 5AXKA 3L09A 2DR9A 4GVBB 2PMZD 3Q24A 4PQUB 3RRHA 2G9OA 3GLJA 3VV2B 4GKKF 2VJUA 2W9AA 4CLUA 4B3TF 4DV7J 4BS2A 1RT4A 3DRRA 1AFJA 4I6AA 4MTPA 2FY1A 2JEGA 4LSNB 3LA0A 2QLWA 2VA3A 3U27A 3GV8B 1XMBA 5LT5A 3Q2TC 4QYZJ 2YVSA 3FNNA 3G9CA 1TK0A 1N54B 4I1TA 4DQRA 2B7CB 5ETLA 2QV6A 3UCGA 2B43A 2FQQB 2RS2A 1RTJB 4ETZA 2GNKA 5J1PA 4MKYA 1YJWS 4DUZF 2YTCA 2Z8QA 2JLGA 2APOA 2IAJB 1RAGB 1N4LA 4KRWA 4M5GA 2XMWA 4CI0B 5M2RA 1YQHA 3W2WB 2XULA 4YOEA 2OMLA 2L3MA 3WIVA 1RAOA 1KLMA 1QDUB 1KQSR 5KFUA 4OYPA 2DNOA 1NK5A 3OSPA 4MH8A 3P3DA 1SKSA 1RADB 4Q44A 1HNIA 3W2VA 1EKRA 4IRKA 4DUYF 2DR7A 3EXCX 2IYIA 2FJWA 3I6PA 2G2OA 2ZFHA 4OJ3A 1IKVB 4DEZA 4NXNJ 1QAIA 3EMTA 1PJ7A 1AYEA 3EZUA 5J2QA 1M5KC 5DQGA 3IGNA 2X51A 4RLEA 4LRDA 3US5A 1U25A 4A8QA 3ZTSA 4BBYA 3F44A 4WFNQ 2QC3A 1S1XB 2C2KB 3S8SA 3QZ7A 1S99A 4DV6J 2YNIB 2W01A 2UXCF 3KUEA 4NCBA 3PW7A 1IKYA 4NYZA 1RTHB 3QYYA 4DR6J 3VGSA 5E3QA 2XZWA 2AWZA 4YEAA 1H2UX 1CBKA 1VBKA 1I51B 2HGNA 1E6VA 3LOUA 2WB4A 2PC6A 3A4TA 2OEJA 4PQAA 4TKTA 4PZVA 2JLEA 3MMAB 4QU6A 1X8DA 3EGZA 3SCIE 1FXDA 3MM8B 1SBRA 2XS7A 4PG4A 2E1MC 1R89A 2HRYA 3GJSB 4C3KA 2MMYA 2HFVA 4O0NA 4K4SA 2XMMA 3JYTB 4PWDA 4OYXA 4DCOB 3LWMA 4ZITA 3CGIA 4RPFA 1S5ZA 2CPYA 3ZXWA 2K2PA 1D0EA 3D1HA 5HATA 2EFPA 1B3TA 1Y0HA 2ATCB 3HI9A 1RTIB 1Q16B 4USKA 4OX9J 2JFKA 2VB6A 1RACB 3MAQA 5L1LA 1YJVA 4DOZA 4M5MA 3PG9A 1F5AA 3KOAA 2X7IA 3QAUA 4ZPVR 2C3YA 3FGVA 1RT3A 3G8QA 1HNVB 1QAXA 2J6TA 4DR4F 2MJUA 2XY5A 3KG0A 3P4UB 2JOQA 1EETB 2XLKA 4EO6A 3B4DA 4WJBA 5H9EK 1C1CA 1T03B 4HVZA 2HHUA 4HEA9 2AYGA 4ZA1A 3AOBA 1UKUA 5J2NA 3Q8QB 1UMJA 3DOKB 3SMZA 2YNGA 3CE8A 4IG0B 4B3RJ 3I4HX 1RDRA 2V63A 2CQPA 1WF0A 1X4FA 1EP4B 4ED7A 2W4DA 3SDEB 4CYUA 2H3EB 4LJMA 5A8KB 1TL4A 2A6OA 5DG7A 3GFHA 3CJ3A 2D41A 5IV4A 1JLAB 1U1PA 3D9BA 1TL1B 1XERA 4DR2J 4MK7A 4JI1J 4NASA 1DRZA 1FF2A 2DGWA 2CDRB 2UV8A 5DRKA 3CJ2A 1RHQB 4BWMA 3BDEA 1FDNA 4X4UA 1LWCB 4NLQA 3KUGA 2I1RA 2CIMA 3D7SB 5HI7A 3HVWA 2I6WA 4RW6B 2WSEC 1Q5YA 5C42B 3BGFA 1N48A 3UPFA 3OL7A 2R8HA 5GADI 4WP3A 4KH1B 3UD5A 4NXMF 3K57A 4I2QA 4WXOA 2LQ5A 3PYGA 2CQCA 4B9NA 3D1OA 2H54B 4USTA 2IRXA 2LQBA 3J80U 2XMKA 4OHVA 4DL7A 4CLFA 4ZLPA 4FS1A 2X3GA 3AY0A 1JIHA 8RUCA 1WOSA 2FD2A 1NZAA 2YQ0A 1SKWA 1FDDA 1JXEA 3NGUA 1REVB 4CRJA 2OLWA 4F4WA 2G13A 2QYGA 2XI3A 4O44B 2OD6A 4N7TA 2KYXA 1UJ6A 4UZCA 2LMIA 4RW8B 4IDKB 1QVGR 3FBEA 3VVTA 2V8PA 2HWIA 3HD1A 4LIRA 4IOCQ 2ZD1B 1NK7A 4MKBA 3IWNC 3QO9B 2YNFB 3G82A 4DL5A 3J81j 3I0RA 3RW6A 4ELTA 4M8LA 3CJ4A 3Q0AA 4AUKA 4KR0B 3OFGA 4ZVRB 3MCMA 1JLQB 3UCZP 1FTRA 1XC9A 4J9LA 3G6VA 2ZEJA 4QCLA 1XIQA 1TKXB 3IG1A 4NE9C 2E5LF 3TZXA 2QIFA 4LF6F 3L4BC 1D8YA 4XPEA 2ZJQQ 2CQ4A 4G1IA 2YKAA 2JRSA 1S72S 4I68A 2VOOA 1J5EJ 2BE9B 3NBPB 4CP5A 3PHEA 3M8YA 2J8AA 4X62J 4B3SF 3PW4A 4C4WA 1H72C 2W2NP 3M8QB 2WB1D 3ZO7A 1U1NA 2KFZA 5KFHA 1B7FA 1ZM2A 2XCAA 1N34J 2FJXA 1IBMJ 4L3NA 3CSKA 4YDXA 2IM1A 4B3MJ 4CLZA 4MKAA 4X4OA 1SB6A 1URRA 4F02A 3R8YA 2FJAB 2XMTA 4JV0A 4UT4A 3I0SA 5J2MA 1MMLA 2E29A 5H1SV 4X64F 2FC9A 3D6MB 3THPA 4WF9Q 3GSIA 1LW0A 3D28A 3BQ1A 3ENWA 3AA8A 2D3ZA 4GRSA 2XWXA 3MF5A 1GMWD 2GZOA 2K1RB 5I3QA 3H59A 3MM9B 2AF6A 1Y10A 4AQYJ 2BABA 4JUZA 5F8LA 5A8RA 4YS2A 1HI0P 1RZMA 2F8HA 1HL6A 2WVEA 1CSJA 3MEGB 1FEHA 4OI0A 2HZAA 3CD6S 2YPYA 2V8VA 4X4RA 4A46A 1FWKA 2F65A 5DM7Q 3KHRA 4ZPAA 3GYGA 2HFUA 2QGFB 1BQNA 2ZE2B 1Y3JA 2E1CA 2DHGA 2LECA 4FF1A 1BQMB 2YWFA 3H4BA 1RAEB 2YKMA 2VASA 2HQIA 5CYMB 4W98A 1WOOA 3DNCA 4IO9Q 2LA4A 3Q2SC 3HSGA 4DV1F 3IM9A 2DIUA 4M5JA 4U9RA 2VONA 4LFCF 5A0YB 4OJ1A 5EUHA 1CJTB 3R3TA 3NL0A 1CJUB 1SQFA 3MUMP 3V6DA 5HQLA 4NLWA 2AMCB 3P8BB 3HVAA 3KNAA 1W26A 2MZ1A 3TJAA 2Q43A 2CYYA 4LMZA 5THWA 2IMWP 4ECRA 2DNZA 2QA2A 2FHJD 3RR8A 2GCFA 3D0GE 1K1QA 4HTIA 4G65A 3HVTA 3LQVA 3SCKE 5D4OA 2HFOA 3FRYA 4OX9F 5EWEA 1RWOB 5LMUJ 5ADZA 1NK8A 4JOUA 2DNGA 1S1VB 4NMXA 4HH0A 4B9VA 3KHHA 2ROGA 4XAKA 1RHKB 2KU7A 5GAHI 5GAGI 2XG8A 1RT6B 1NDLA 1JMTA 1VQLS 4C0OC 1KOOA 3K8WA 4K4YA 2EK1A 3OQ2A 3W7BA 1HQUA 2MPUA 4J9SA 4JI3F 2ZZTA 4UZBA 2BOPA 3ZZ0A 1L3SA 4K59A 5I3UA 4PYAA 1FRKA 3T1YJ 1HBNB 1WD6A 4CH1A 3ILJA 3KJNB 3M30B 9RUBA 4IH6A 5H9FJ 2BANA 3VGTA 3D2WA 1NDKA 1ZM3A 1F5CA 3HK2A 2FJDB 3PKYA 4QWBA 5HBMB 4DSLA 2KXFA 1PAEX 3LP0B 3TZWA 2W2MP 3IRWP 5HMXA 3FVYA 1U48A 1O8BA 1F9FA 1VQ9S 2RT3A 3ILIA 1S7HA 1U47A 2DH8A 3TQ1A 2PMWA 4N76A 2CQBA 5KFLA 2ZJRQ 1MROB 1R7IA 2J9EA 1S49A 3PV8A 4KB7A 4JI2J 3NEKA 1FKPB 1NHUA 4LF8J 1WWHA 1XWLA 1N5YA 2J6UA 1MWZA 4RW9A 2F8EX 1HNWJ 1ZZFA 2EG2A 2RE1A 4ED0A 4FDFA 4Q7AA 3FUYA 3CTRA 1T9VA 3KK1A 3GIMA 3CJQA 4TY9A 4J37A 1MMNA 4PRFA 4I2PA 4NI2B 3WZ0A 4OMFG 3ENAA 1RQ0A 3UN5A 3GJTB 2AD9A 5HLFB 1LK7A 2CQGA 4CH7A 1FFSB 3R6GB 2B4PA 2CPDA 4WWSA 1PJ6A 4IO1A 5D8HB 1M5VC 1VHFA 3C16B 3HD2A 4O0IA 4PUOB 2D9PA 4Q5VA 1U6FA 3WDOA 2H48B 1N0VC 4ID8A 2XHCA 1WEYA 4H4OB 4DXLA 2J7KA 3GJRB 3CC2S 1GH8A 1UZHA 3FKBA 2UXDJ 4B3OA 3DM2B 5L8RC 1YBUA 1RYRA 1NB7A 3ZZUA 1PO6A 5F9LA 4U6PA 1HYSB 3VAKA 4KC5A 3CCRS 2ZH2A 3ZTRA 1T3OA 1T95A 4KV8B 1O0PA 3WC2A 1Y4ZB 1UVMA 2R3VA 4F2SA 4OJHA 4ETXA 2EVZA 3H5SA 5DLFA 5T7LB 5IT4A 4DN9A 3SCJE 4H4MB 1TL7B 1X9SA 2MYFA 2N7CA 3IRXB 5KFVA 4TY8A 4OYIA 4IRCA 4HI2A 4OZJA 3OTOF 4F50A 1VQPS 3C3LA 4DPOA 1FX4A 4ZP6A 3G6YA 1KTVA 1ZM4A 3FSIA 5D3GB 5B08A 4PABA 2ZM6F 1VS3A 3VF0B 2BRLA 4QYRA 5LL6d 3H98A 1FEEA 3NOCA 3M2UA 4QWDA 3S01A 3GONA 2GGPB 2BQUA 3DU6A 2AEFA 4Y2AA 1FNMA 1N32F 5KFFA 3BYPA 2GW8A 1S1TB 2QMXA 4LUBA 1K73T 3D6HB 1ZZNA 2BEFA 1A7GE 3HSDA 4DPYA 2ADCA 4HKQA 3HDSA 1MU2A 2VH7A 4PAAA 3AA9A 5KT7A 3LANA 2QYCA 2L9WA 1XNQJ 3IBWA 4PG6A 4ED3A 1NSPA 5CYQB 1FE0A 3PNIA 3TAMA 3MR2A 3OFFA 3ITHB 2CQ1A 2P6TA 1Q78A 3PACA 3SEOA 1UFLA 2PA8D 2QMUB 1HW8A 4RKUC 3J7A1 2CQDA 1SL2A 1U8WA 2IM2A 4V1Ak 1XQIA 3HHLC 2HS0A 2GQQA 3PIPQ 3FDSA 3AXKA 3BJYA 5E3CA 4JI4F 3FEZA 1ZPVA 1YJNS 4WXWA 1PIEA 3EVOA 1IM4A 4ER8A 3RRGA 4OFZA 3M32A 3I5CA 5FD1A 1RKIA 2IPOB 2MKJA 3MAHA 3DN9A 1PCAA 2VPYB 2BJ8A 2UUWA 3UCUP 4CZCA 1IKXB 1HQEA 4ZLLA 4AT1B 3G86A 4QBUA 1RU2A 3D6FB 2HRTA 3M8PB 4JI5F 1M1KT 3I4PA 2WK4A 1FE4A 3QJLA 1SCJB 5H9EJ 1ICEB 2A0FB 2OI2A 2YX7A 1WSRA 3CJ5A 4P2SA 4Y2CA 1T02A 1IQZA 2HW3A 2QL7B 2ZZMA 3W61A 2DO0A 1FRLA 1NNDA 1G3OA 1U6ZA 4ID5B 3H5UA 3KJFB 3FBBA 4DPXA 1HWUA 5HQMA 1FTCA 4AFFA 2XMUA 4HH1A 1WHXA 4QJVA 1CJKB 2GQ2A 4X2BA 1HWKA 2VKZG 3VWSA 3TJ8A 1SIZA 4DL4A 3DI6A 3UD3P 4BWJA 2KTQA 3THTA 1CEZA 3OR1B 3B82A 3TYTA 3BQ0A 4DV3F 1B0TA 2VG5B 5F9NA 4CLTA 5B0CA 3LW5C 3UDEA 1R6YA 2KFNA 2KL8A 2CG8A 3DLHA 3PR4A 1F1BB 4OHXA 1UEUA 2KVIA 1R0AB 1M90T 1JKHA 4LF7F 1RWMB 3DRPA 4OQJA 2FY8A 2R2RA 4UY85 3FJ2A 3E2EA 1RT1A 1LK5A 3OVSA 4NOHA 2ZDOA 5EDWA 4Z7CA 1RT4B 3DRRB 3R6LB 1V5VA 1UVNA 1FRHA 4NA2A 3T1HJ 4U8YA 1O6XA 4M63A 4AXIA 3JSYA 5L38A 3UVJB 1BLUA 4MMOA 1FKAF 4V19X 2ZZNA 1LWEA 1UZDA 5ETTA 4AL5A 2AQ4A 2ZOFA 4DHVA 4O3NA 1Y7PA 3MD3A 1W7WA 2G1HA 1IN0A 1KDNA 2XWYA 4PQUA 1UCNA 3KLEA 2RJZA 4N8NA 4I67A 1F9HA 2DNQA 2WOMA 2FJBB 1WORA 1LEOA 2BJ3A 2VIHA 1VQYA 4D3GA 3I9ZA 2LEBA 1Q1KA 2B9EA 4KKOB 3HT0A 1LW2A 5GMKa 3NGKA 1KLMB 3QRQA 3NS7B 2PMHA 3BV8A 3K0JA 3IS9A 1VJWA 4PXDA 1RJJA 1PG5B 2PIIA 2WSCC 1ZYQA 1VLYA 1YDLA 4DJBA 4ENOA 3GP9A 1GMWA 1X4BA 1XEZA 2PE8A 3GV7B 1R43A 2Z2ZA 2LVWA 3BYRA 2UZAA 5KFNA 3TNVA 3H2VE 2CA9A 1HNWF 5J2QB 3FCHA 4LF9J 1VISA 1XNRF 3BO3A 1NUEA 3EZ5A 4B9TA 4NLVA 4FPRA 2ADBA 4DV5J 5KFJA 1GT8A 4OIXA 3BSOA 2G4BA 2QX0A 1YI2S 2XB2D 3D68A 2QE5A 2BKPA 8ATCB 3RTVA 1VC5A 1S76D 3L7UA 5J2PA 2KXNB 4YY3J 3QPIA 4C7QA 5F0WA 5B0BA 3TRGA 3BEGB 2F4FA 2RDIA 1MNEA 3H40A 1NMEB 5EN1A 1R8BA 5BR8F 1SUQB 2ZH9A 3TI0A 2A1BA 2AHOB 2QLXA 1TKDA 4X65J 2EFOA 4KPCA 1FDBA 4DR5F 4ZJLA 3CDAA 2YNIA 3G6XA 5HP1A 4LFBF 2DY9A 3BSCA 5SZTA 3JS9A 3A8EA 3N79A 5IWAJ 2H5EA 1NDPA 2XYPB 1N0UA 2R7VA 5KFIA 4I56A 1F3VA 4TNOA 4MFBA 1JJ2R 1XMOJ 3RAQA 1OIAA 3QT6A 2CZ4A 2FHJA 4PWDB 5E3AA 1NPKA 3F73A 2UUAJ 5KFBA 3MMAA 4XDCA 4U67Q 3CJKA 2A3JA 3OHAA 1IJEB 2J9DE 5CHCB 4Q2MA 4Q0BA 4B9MA 2JVRA 2G0IA 1C1BA 1VQMS 2BX6A 2NUHA 2XM3A 3MUVP 3K89A 1I6JA 4PG8A 4HT5A 3N0VA 1S4FA 3SFUA 3DDNA 4NEYA 4C97A 4UF4A 1RYSA 2W1BA 4X4VA 1YBTA 2ZVIA 2LU2A 1NU4A 3KTQA 3EDQB 1RT3B 3AXMA 3MM6A 1M0SA 1OS5A 3NOGA 4LREA 1PC4A 2PT0A 4DR1F 3MTJA 1QD1A 3VTIA 5B7WA 3HFKA 1NB2A 3CCES 2ASJA 2YNGB 3OD2A 2BDPA 3CJTA 1LNQA 3Q23A 2B4OA 3MM7A 4Q8FA 2DIVA 2AZ3A 4YB7A 1SL0A 3BREA 3TARA 4O23A 1VOMA 4KTQA 4OI3A 4CYUB 2E9TA 3EXYA 1ZS6A 3NNCA 4LT6A 3AHPA 4WK3A 4KHRA 3T6BA 2HBZB 1RAHB 1B7YB 2U2FA 1CC7A 2RQKA 2W2OP 1JLFA 3DOKA 1PSDA 2QLFB 4DV4F 4F04B 1KP6A 5ETNA 3SQGA 5ETMA 5LXYA 5KOWA 2N3LA 3Q8VA 1Z1ZA 3OR2A 1BWEA 1VCTA 4RNFA 5IC4B 4JI0J 1GXLA 1V3SA 1WC6A 2JWNA 4M5DA 2UV8G 1RT2A 4F8RA 1S0NA 1RBOB 3FZBA 2KT5A 3B8HA 3CO9A 2MQMA 1S0MA 3PEHA 3DHXA 2V2QA 2IC3B 1I94F 5JUMA 2DNNA 2IM3A 2F7VA 2P2CB 5ETPA 1FXLA 1F60B 4RW6A 4WFAQ 1SKUB 1XTZA 4A8WA 4LBHA 2MTLA 1LKZA 1S59A 4OLPA 1HMVA 2NPFA 2RB7A 3A8KA 1U09A 2V2ZA 4P71A 4K4TA 3DRXA 2OPRA 4A8KA 1NJIT 1HNXF 3CIMA 5IOLA 5AE3A 4L3KA 1HNZF 4NWBA 5KFAA 2M3DA 3FCWA 5E41A 4F67A 4P7VA 1H74A 2M52A 3G82B 1NJXA 3I0RB 1HI1A 4ECQA 2XS2A 3QBCA 2WW4A 3SCLE 2MDAA 4TVAB 3BGOP 1J5OA 1WDTA 3N9UC 4XDDA 3HZGA 4O44A 1V3RA 3BKFA 1SPBP 5K5MA 1JJHA 4WTYA 3I31A 4IDKA 1UVLA 5GAEU 2R7RA 1MN9A 2LXFA 4EWTA 7AT1B 3UN3A 1HWIA 1N33F 4NCAA 4J9MA 1WTFA 3EGVA 1QUVA 3MFHA 3AB2B 4YR0A 1ZH5A 3KDOA 1K8AT 2L08A 1RA7A 2YX1A 2D9OA 5KT3A 4PCQA 4YFUA 4URSA 1OQ6A 1OSCA 2KZZA 4DR3F 2VQFF 4DFKA 1YJRA 2B56A 5KFZA 1U7LA 2DEIA 2V0NA 4C6AA 4FXWA 2J0WA 3A1YG 5BXIA 3FSYA 1K47A 5T41A 4LRAA 4UY8T 4RUCA 2KYZA 5HO4A 1Q82T 3TEHB 2P9GA 3AT1B 2KO1A 1WC0A 3I0SB 2QN6B 5D4NA 4XO0A 1VQOS 5J2MB 1OPZA 2XGPA 2IJFA 2CZ9A 5KT2A 1APSA 2IYGA 3OPKA 4WFYA 1D8ZA 1LW0B 1VRUB 4JV1A 2EC0A 3MFIA 8AT1B 3T6JA 2VFUA 1OO0B 1C4AA 4RU9A 3T19A 3MPUB 2ROPA 5E33A 3UD4P 1JLCA 1M5PC 1RE1B 1PYSB 4NLSA 2HS4A 5A8RB 1UVKA 4RR5A 2KJVA 3KJQB 5D15A 4R25A 4DV0F 1C0UB 3F0NA 3RBEA 1UTAA 4PWWA 3N01A 3N4WA 3CCUS 2OH2A 2J0XA 3O1LA 4J90A 3EZOA 2A2CA 3BPSP 4M5LA 2CPJA 4Q45A 3KKFA 1CS4A 2GAHC 2JC1A 2K3KA 2RU9A 1X31C 1BQNB 4A4JA 1UVIA 1UEVA 2IM0A 2YKMB 1U1QA 3P5BP 3RW7A 5KFCA 4JI7F 1KC8T 2PI4A 3ULHA 1SC6A 1HKAA 4DG1B 5B09A 1S9FA 5FIIA
chains in the Genus database with same CATH topology
1QTNB 4DCOB 1RWKB 3EDRB 2QL9B 4ZVUB 2FQQB 2DKOB 3KJFB 2CNLB 4LSZB 4ZVQB 3KJNB 2C2KB 2CJXB 1I3OB 2P2CB 3R7BB 2XYHB 2QLJB 4DCPB 1RE1B 1PYOB 1SC4B 4ZVPB 3GJTB 1RHMB 2CJYB 3R5JB 1RWXB 2QL5B 4ZVOB 3R6GB 4DCJB 3KJQB 2C1EB 1RWNB 5K20B 1SC1B 1RWPB 1QDUB 2HBQB 2CDRB 2HBZB 3GJQB 2C2ZB 2H5JB 3R7NB 1GFWB 1RHQB 2CNKB 1RWVB 2H48B 3P45B 1I51B 2H65B 1NMEB 2Y0BB 3NS7B 1RWOB 2C2MB 2C2OB 3GJRB 2QLFB 2XZTB 3QNWB 1F9EB 4ZVRB 3D6HB 1RWWB 3R7SB 2XZDB 3RJMB 3SIPB 2HBRB 3IBCB 1RHKB 1RWMB 2CNOB 2CNNB 2XYGB 3D6FB 2Y1LB 4ZVTB 1PAUB 3D6MB 3P4UB 2QLBB 1RHUB 4JB8B 5IC6B 3EDQB 2H51B 1RHRB 5IC4B 2H4WB 1ICEB 2H54B 3GJSB 4ZVSB 3R6LB 2HBYB 1BMQB 1SC3B 3IBFB 2H4YB 1RHJB 2XYPB 2QL7B 2H5IB 1IBCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QTN B;  4DCO B;  1RWK B;  3EDR B;  2QL9 B;  4ZVU B;  2FQQ B;  2DKO B;  3KJF B;  2CNL B;  4LSZ B;  4ZVQ B;  3KJN B;  2C2K B;  2CJX B;  1I3O B;  2P2C B;  3R7B B;  2XYH B;  2QLJ B;  4DCP B;  1RE1 B;  1PYO B;  1SC4 B;  4ZVP B;  3GJT B;  1RHM B;  2CJY B;  3R5J B;  1RWX B;  2QL5 B;  4ZVO B;  3R6G B;  4DCJ B;  3KJQ B;  2C1E B;  1RWN B;  5K20 B;  1SC1 B;  1RWP B;  1QDU B;  2HBQ B;  2CDR B;  2HBZ B;  3GJQ B;  2C2Z B;  2H5J B;  3R7N B;  1GFW B;  1RHQ B;  2CNK B;  1RWV B;  2H48 B;  3P45 B;  1I51 B;  2H65 B;  1NME B;  2Y0B B;  3NS7 B;  1RWO B;  2C2M B;  2C2O B;  3GJR B;  2QLF B;  2XZT B;  3QNW B;  1F9E B;  4ZVR B;  3D6H B;  1RWW B;  3R7S B;  2XZD B;  3RJM B;  3SIP B;  2HBR B;  3IBC B;  1RHK B;  1RWM B;  2CNO B;  2CNN B;  2XYG B;  3D6F B;  2Y1L B;  4ZVT B;  1PAU B;  3D6M B;  3P4U B;  2QLB B;  1RHU B;  4JB8 B;  5IC6 B;  3EDQ B;  2H51 B;  1RHR B;  5IC4 B;  2H4W B;  1ICE B;  2H54 B;  3GJS B;  4ZVS B;  3R6L B;  2HBY B;  1BMQ B;  1SC3 B;  3IBF B;  2H4Y B;  1RHJ B;  2XYP B;  2QL7 B;  2H5I B;  1IBC B; 
#chains in the Genus database with same CATH topology
 3JQJ A;  4KT0 C;  1MG7 A;  3FC9 A;  1C4C A;  5HMZ A;  3H2U B;  2YBV A;  4X4N A;  2Y1I A;  2KJW A;  1TV6 A;  1CLF A;  4M5K A;  4JI6 J;  3M7V A;  3Q8Y A;  5KFQ A;  3PYD A;  5IT9 Y;  2DR5 A;  5HK4 A;  1BQM A;  3T5J A;  3HM9 A;  5FLX U;  5CYM A;  4ANC A;  2QT7 A;  2CWX A;  2UUA F;  1IBK F;  3JQK A;  2HHX A;  1VGY A;  4ECZ A;  5D0E A;  2IA0 A;  3HHN B;  3JSM A;  2HMI A;  1CJT A;  3HVT B;  3ZZY A;  1CJU A;  1DJ0 A;  1H2T Z;  4O3P A;  4AE5 A;  2XZD B;  2EBG A;  1XMQ J;  1WI8 A;  1UAW A;  1R8H A;  2I0X A;  2DXD A;  2BAC A;  2ALZ A;  5E0O A;  5KFX A;  2BJ9 A;  5B0A A;  4OHZ A;  2DR6 A;  1YIT S;  3QAT A;  4AXJ A;  4OI2 A;  4LRB A;  2RKI A;  2F3J A;  2ZVS A;  3P5T L;  5B0F A;  3VAJ A;  1HQU B;  5EWG A;  3MR6 A;  2LEP A;  3MPV A;  4ZN1 A;  3HLU A;  3ZFV A;  4O3R A;  1VHI A;  5D77 A;  1UVJ A;  4USM A;  1RT5 A;  4GKK J;  2HYI B;  1WHV A;  4DFP A;  4B3T J;  4UQT A;  1RWX B;  5IS2 A;  1S6P B;  4YP3 A;  1VK8 A;  1EAY C;  2BAN B;  2N4D A;  2PSZ A;  2RML A;  5KG1 A;  4DN0 A;  1QE1 A;  1KKH A;  3LP2 A;  2ZWP A;  2MHE A;  2PO4 A;  2G2Y A;  1NK4 A;  3RG6 A;  2PA3 A;  4PG7 A;  1R27 B;  4IYQ A;  2XZT B;  4ZIW A;  2JX2 A;  4S0M A;  3GIR A;  3R5A A;  1UPM B;  3MEK A;  4DUZ J;  5A76 A;  1S4E A;  2HWT A;  3MEE A;  4WBF A;  3T9Z A;  3J81 U;  1GTE A;  4NLG A;  3ADA C;  1KQK A;  1FK9 B;  3DYA A;  5FLX Y;  1X5T A;  4RW9 B;  4JYA F;  2Z57 B;  4OZ3 A;  2H4Y B;  4K7Q A;  5HBM A;  5FDL A;  2E5I A;  4JI0 F;  4K4X A;  4ZJO A;  5ETR A;  1OMS A;  3R27 A;  4DUY J;  2VPZ B;  3KK1 B;  2LYV A;  2LU1 A;  2HNZ A;  2RAQ A;  2B9X A;  4I2P B;  4C0B A;  1NSK L;  4LR9 A;  2YKQ A;  1AUS L;  3TX0 A;  1RLC L;  2NLW A;  1N5V A;  1MRO A;  2E9R X;  4ZIV A;  2DGO A;  1NH8 A;  3UI3 A;  4F3Q A;  1VRT A;  1R31 A;  2CZV C;  4C9D A;  2XHW A;  3E01 A;  1TFW A;  3NAH A;  1RI7 A;  1TAQ A;  5HN0 A;  2H5J B;  3NXZ A;  2WVB A;  2XNR A;  4R5P B;  1FD8 A;  2MZQ A;  1TUG B;  2ZH4 A;  1GNK A;  4R0E A;  3PRD A;  3V81 A;  3OBI A;  5I42 B;  3ZTP A;  2I8E A;  4NZ0 A;  4IOA Q;  1R6V A;  2UXC J;  2HKE A;  3RB0 A;  4P75 A;  2YQ3 A;  2HVH A;  1Y5N B;  4WFX A;  1X9M A;  4F3O A;  3HKW A;  1VBX A;  2FC8 A;  4K4V A;  1VQN S;  1UA0 A;  1QM9 A;  3IBF B;  4K5R A;  4LIW A;  2M88 A;  2BUN A;  1RAJ A;  4CTA A;  2JEI A;  3HKZ D;  1Q8K A;  4L74 A;  3GFY A;  2YNH A;  4ED1 A;  1CQM A;  2RF2 A;  2EFQ A;  4Q8E A;  3MMC A;  4MAK A;  5HJY A;  1Y9O A;  3MMB B;  2AEJ A;  2W4C A;  4EZ6 A;  2FGO A;  4RBT A;  4TY8 B;  1Q79 A;  4HYK A;  3NG8 A;  2B3T B;  1HIY A;  2O1P A;  3D1Q A;  2HHV A;  3E3X A;  3A3P B;  4G1Q A;  2ZNY A;  1M1G A;  4QOT A;  4ITS A;  3K58 A;  3M2U B;  1BQX A;  3A3N B;  3I9V 9;  2CAD A;  2G0C A;  3VR1 A;  5ETK A;  1DHM A;  1X4D A;  1NBE B;  4ZCI A;  4H4M A;  1QUP A;  3HO1 A;  2YWG A;  2RHQ B;  5IFM A;  3GPA A;  4F3M A;  2HFZ A;  4WU3 A;  2GS8 A;  4C8O A;  3ET6 A;  2OTL S;  5D3G A;  1ZM9 A;  4Y3C A;  1KR4 A;  3PVX A;  2EC2 A;  1U0H A;  2RRB A;  2UVR A;  4KHP F;  3ZNU A;  3LH2 S;  1HI8 A;  1W2I A;  3CMA S;  1JLG B;  3TAM B;  3GG1 A;  3M8R A;  2IVY A;  5I3P A;  2P5V A;  1FFW B;  4C11 B;  1VMB A;  4UOH A;  2HQF A;  3FFI A;  3D54 A;  1ZA1 B;  4JBC A;  1S1T A;  4DR4 J;  4KGM A;  3RAX A;  4LRF A;  2J0Q D;  2BM0 A;  3IA0 A;  1FVS A;  3MD1 A;  4Y00 A;  2VPW B;  5KTQ A;  1TFY A;  4KO0 A;  2GHP A;  4NPO A;  3BN4 A;  4TLR A;  3UDC A;  1RWV B;  5DLG A;  4MK8 A;  2HVZ A;  3GCW P;  2DCL A;  2XQC A;  3NGT A;  3AD7 C;  3ENV A;  2KT2 A;  1H3D A;  2MLX A;  3M32 B;  1FJG F;  4ECT A;  4EU0 A;  1NK9 A;  4UOF A;  2VBX A;  2V8D A;  1R8A A;  1XK8 A;  2AGO A;  3CCZ A;  1WC5 A;  5C2G A;  3OL8 A;  4FF2 A;  1RT7 A;  4FNH A;  2MQP A;  2LFV A;  3JB9 k;  4EMD A;  4ICL A;  3T9N A;  2QMW A;  3N5B A;  4AL7 A;  3DHW C;  1E6Y A;  4ILR A;  2RSQ A;  2C2R A;  2WVC A;  2KB2 A;  3E51 A;  2VQE F;  2ATL A;  1S9E A;  4A8M P;  2OFG X;  3S6E A;  2ZJP Q;  3A3O B;  2NXE A;  2O3D A;  4Z37 A;  1TU0 B;  4NXM J;  2F5G A;  4ED6 A;  2QL5 B;  3MR7 A;  4ZP7 A;  4CO4 A;  1EJ7 L;  2CUY A;  2CQH A;  2GHV C;  2VFS A;  5A6P A;  1WEX A;  5HQ8 A;  1RAI B;  2YXL A;  1SV5 A;  3DI6 B;  3Q8R B;  2ZH7 A;  3BKU A;  1UWB A;  2HK3 A;  2OMO A;  1FO1 A;  2W24 A;  2OFH X;  3ZZO A;  4N5S A;  1S48 A;  1TP7 A;  4HHU A;  4ZVT B;  2E1A A;  2GMH A;  1JKH B;  4LR7 A;  3DRP B;  2M9K A;  2YKO A;  1KSP A;  3KJV A;  1KS2 A;  1V5I B;  1SC3 B;  5GME A;  1RT1 B;  1Q7L B;  1QAY A;  2FLN A;  5KT6 A;  4YB6 A;  1BUX A;  2D74 B;  5FJ4 A;  1FX2 A;  3PYE A;  3I5B A;  3ZTO A;  4R8U A;  4JI8 F;  3PFE A;  2XS5 A;  3IWX A;  2GMJ A;  2B7B B;  2CQI A;  3PDN A;  1U1K A;  4K8R A;  2C3M A;  3HSZ A;  1R0A A;  1BHN A;  1LWE B;  1KEK A;  2KG1 A;  1CVJ A;  3M6V A;  2A2D A;  5GVQ A;  2E5L J;  4ZHR A;  3KLE B;  1IXK A;  1VC0 A;  4LF6 J;  2J9D A;  1WTB A;  3HXM A;  1YRX A;  3M1V B;  5C24 A;  2WOM B;  4EBD A;  3PTW A;  1KOH A;  2EFN A;  2W25 A;  1NH7 A;  4FBT A;  4CO5 A;  2C2O B;  4DSJ A;  2CKW A;  5KG2 A;  3UVJ A;  1LW2 B;  2KM8 B;  4GKJ F;  2NYH A;  2XC9 A;  4B3S J;  4LBI A;  3IS9 B;  4KHM A;  3DLE A;  4X66 F;  3C6T A;  1RA6 A;  1Y11 A;  2KHD A;  2AYB A;  4J9V A;  3U7J A;  2FJV A;  5I4M A;  4KKO A;  4QIE A;  1SH2 A;  3TA0 A;  1JLE B;  4KGV B;  1YJ7 A;  5AJ3 J;  1U1M A;  4IG3 A;  3V6K A;  2OEK A;  3GZ7 A;  3R1H A;  4X64 J;  2J0S D;  2JJ4 D;  4HT7 A;  2BE7 D;  3MUT P;  3CCV S;  1FNO A;  2X3D A;  1WEL A;  2MY7 A;  3J7Z 5;  4F25 A;  2BW2 A;  4AL6 A;  4CM2 A;  3W60 A;  3A12 A;  5A2Q U;  5J2P B;  3SZ2 A;  7FDR A;  2VF3 A;  4LBP A;  5KFO A;  3N28 A;  2MSS A;  1VK3 A;  1VIO A;  1F3F A;  3T5H A;  4DL3 A;  2XNQ A;  3U1N A;  5L1I A;  3TQE A;  5IM0 A;  4QR2 A;  1AZS A;  4Y2M A;  3LO3 A;  3PW0 A;  2J5A A;  1FJ7 A;  1L3U A;  2DHX A;  5KFE A;  3IAS 9;  2ZUA A;  3CIZ A;  5GAE I;  4BHQ A;  5DO2 A;  2VZ9 A;  1H38 A;  5HP1 B;  1BMQ B;  3K59 A;  2IBK A;  2IDL A;  3QGH A;  3KWM A;  3MM5 A;  3RGI A;  3N6L A;  3BO2 A;  2I2Y A;  1DTQ B;  3QSI A;  3QIP A;  2EEY A;  4MFB B;  3IGV A;  1SUQ A;  2FVS A;  3TA1 A;  1UA1 A;  3VAM A;  2VUG A;  2HHS A;  4DV1 J;  1WG4 A;  1JWW A;  3CJK B;  2DNH A;  4KGX B;  1RAF B;  4DL6 A;  1WOP A;  3DOL B;  5CAA A;  2WON A;  1ZPW X;  4LFC J;  3KUH A;  1TR0 A;  5LJ5 Y;  4Q0B B;  1C1B B;  3CED A;  2W2Q P;  4J91 A;  3KHL A;  4X84 A;  5HVF A;  2DT9 A;  3C66 A;  4CLS A;  1FJC A;  2XMJ A;  1L3K A;  3H0P A;  4DS5 A;  3EVM A;  3TZY A;  2DK2 A;  1IJF B;  2NR0 A;  3MEC A;  1RHU B;  2B8P A;  3WX4 A;  3N5F A;  2E5J A;  3M2R A;  2VG7 A;  2LXI A;  4ED4 A;  2EI5 A;  3GII A;  3TAP A;  1IM6 A;  5CH7 B;  2HBY B;  5F8I A;  3V5R A;  4FS2 A;  2BQR A;  1N56 A;  3MM6 B;  4ES1 A;  3M9O B;  4OV6 A;  5L1J A;  2BRK A;  1RWK B;  5M2U A;  3GYN A;  2A6M A;  1I1G A;  2H9Z A;  4HDG A;  3KK2 A;  2ZBI A;  2ZC4 A;  3OXG A;  4MIA A;  4IH5 A;  3CNQ P;  3QLH A;  1FT8 A;  1P27 B;  2B4U A;  3K5N A;  3PZP A;  1VC6 A;  3MM7 B;  5EWF A;  4DMZ A;  2DHA A;  3W9I A;  4JI3 J;  1U1L A;  4ELV A;  2FZK B;  5L1K A;  1GFW B;  2CQ2 A;  3TVY A;  2VV5 A;  3SYZ A;  4M94 A;  1JLF B;  4TU9 A;  2KKH A;  4TXS A;  2HS3 A;  2OPS A;  4IR1 A;  3CB4 A;  2GA7 A;  4LF5 F;  2DH7 A;  5KAK A;  3SQG B;  2XLI A;  5F8G A;  2UVU A;  2M70 A;  1SJQ A;  2LP4 A;  2ZDP A;  3OR2 B;  2B5J A;  4W4M A;  4C98 A;  4E8U A;  3OTD A;  5J1E A;  4M5D B;  4P6Q A;  1RT2 B;  3AD9 C;  4F4A A;  3ETM A;  4DX7 A;  1RTD A;  4RW7 A;  4WU2 A;  2NUU G;  4ZVU B;  3IWL A;  5HRO A;  2BKO A;  4L72 B;  1AA1 B;  1IBL F;  4KQZ A;  1YVF A;  3M8Z A;  3NGD A;  2ZC3 A;  3BGR A;  2DXE A;  2Z30 B;  2V69 A;  2Z58 B;  4EEY A;  4AYB D;  2EFV A;  4A48 A;  3O44 A;  2V4R A;  3TVK A;  2HHH F;  1YK9 A;  3C6U A;  4CQ1 A;  2JDJ A;  1HMV B;  4O4G A;  4WYW A;  1OPI A;  5KG3 A;  3SBM A;  5CAB A;  2OPR B;  4M5I A;  1UWA A;  2DO4 A;  1S6U A;  2MQO A;  5CQG A;  3JAM U;  3EYZ A;  2YWK A;  2GJF A;  5LMN J;  2MHN A;  2HEK A;  2W7P A;  4C8Y A;  2IC3 A;  2L48 A;  3T1A A;  2X1G A;  2OP5 A;  4TYB A;  1D1U A;  4NLD A;  3HP6 A;  2KFY A;  3DU5 A;  4NLR A;  1T3N A;  2N3O A;  1J5O B;  1KWM A;  2KH9 A;  1P6T A;  3EWG A;  1VQK S;  1NM2 A;  5BYR A;  4YDD B;  5F8M A;  2HGM A;  3DKD A;  4N77 A;  3QFW A;  4ZVH A;  2N7Y A;  4RWX A;  5AXL A;  3CDE A;  4DX5 A;  5GAD U;  3ZC4 A;  2XSJ A;  1RU1 A;  2LDI A;  4CNY A;  2L9D A;  1LWX A;  2XO6 A;  3IC1 A;  3GR0 A;  2NRE A;  1Z2Z A;  2DNP A;  3BPD A;  1OQ3 A;  1KHV A;  3GIL A;  3BBC A;  2W9B A;  2Y1J A;  2DH9 A;  3ICL A;  5AE2 A;  3OVA A;  1TKZ A;  2RVJ A;  2IRY A;  2OEM A;  3OL6 A;  5IV3 A;  4F4K A;  4USJ C;  4MT1 A;  1KON A;  4LF2 A;  3HHK A;  2HUR A;  1RWW B;  2LKZ A;  3W8P A;  1UW4 A;  2PD1 A;  1R8C A;  5KFD A;  2OSR A;  3AH6 A;  4YR3 A;  4K4U A;  3OTO J;  4USV A;  1FJE B;  2ZM6 J;  2R7T A;  2Y8W A;  2BXJ A;  1T9U A;  4LSL A;  5L39 A;  3D0H E;  2N4C A;  2G0J A;  4K0K F;  4H4K C;  2R7O A;  3IXQ A;  3QZ8 A;  3M8S A;  3F41 A;  2K06 A;  3NWG A;  3CUL A;  3UR0 A;  2UUC F;  3DRY A;  2WCX A;  1S79 A;  1DLO A;  2GIQ A;  1N32 J;  3GQC A;  4FP9 A;  3SV3 A;  2VBW A;  1MMD A;  3LPY A;  1S77 D;  1HW9 A;  1I5O B;  2OAU A;  3J80 Y;  4NYO A;  2R2S A;  4ZPW R;  2GJI A;  3PXG a;  2CVI A;  3UE2 A;  4EK2 A;  1RK8 A;  3CO0 P;  4TYA A;  1JLC B;  4QWE A;  5AJ3 F;  3Q8S B;  4G3I A;  4ZK7 M;  1OY6 A;  5DJB A;  3MPD A;  4GC6 A;  2FUG 9;  4KY3 A;  3TO8 A;  3V4I A;  1URN A;  2VG6 A;  2AJ2 A;  4OI4 A;  3KHG A;  2HQG A;  1VRU A;  2QFJ A;  2PFD A;  2D69 A;  2O01 C;  4ECU A;  3CJ0 A;  5CZV A;  5BJR A;  5MLC V;  4RL1 A;  1LOU A;  1WG1 A;  2CNN B;  1FDA A;  1CS4 B;  3MED B;  2YKN B;  2RRA A;  4IFY A;  5IC6 B;  3B6B A;  4OHY A;  2R2U A;  2FLP A;  1X5S A;  1YJU A;  3TUP A;  4DU7 A;  3LAK A;  4JI4 J;  2AP6 A;  1C0U A;  1RAA B;  5KG4 A;  2GJ2 A;  5G0R A;  2LLZ A;  3R2D J;  2RRN A;  3C15 A;  1D09 B;  1WI6 A;  1TL5 A;  1RP5 A;  1IVZ A;  3P6Y C;  2VC0 A;  3MMJ A;  4IKA A;  1KNZ A;  1NHK L;  2RH3 A;  2VBY A;  1VR6 A;  1X5O A;  3KLF A;  4DU8 A;  3J7Z T;  1NO8 A;  4CO0 A;  4JI5 J;  1TV6 B;  1JLB B;  3OFH A;  7FD1 A;  4DR7 F;  2BA9 A;  4YB1 P;  4IFV A;  4DCJ B;  2OGU A;  5E5N A;  4LFA J;  2KRB A;  2AU0 A;  5KT4 A;  2W7O A;  3KMQ A;  2OTJ S;  1HHQ A;  1CQN A;  2GO8 A;  3VZH A;  2Q1L A;  2FB0 A;  1LQ9 A;  2DEJ A;  2R7Q A;  4DG1 A;  1HR0 J;  3B78 A;  3VQT A;  3JSM B;  2CRL A;  2DR8 A;  2HMI B;  1K9M T;  2HAI A;  2CPX A;  3ONQ A;  1FD2 A;  4DQS A;  1VQ8 S;  1O5J A;  2O67 A;  1UPP A;  4Y34 A;  3OVB A;  2J9C A;  4DV2 F;  4FXV A;  2W7A A;  5CYJ A;  3EM1 A;  2EKN A;  2BQ3 A;  5K9F A;  4ZVF A;  1KRP A;  3OV7 A;  3HHD A;  3WX8 A;  4DV3 J;  1KBR A;  2DNK A;  4ZDN A;  5C25 A;  2ZBR A;  1RXO B;  1YKW A;  2PN6 A;  4HHH A;  2RKI B;  2Q6B A;  2R8G A;  4C8M A;  3UNY A;  3PJ9 A;  2VA2 A;  4J9K A;  2SXL A;  2OPQ A;  4LF7 J;  3U1L A;  1YZ7 A;  3ENQ A;  3AQP A;  4RUA A;  3CJR A;  2FLO A;  2J76 E;  2BE2 B;  1U02 A;  2C22 A;  3TWZ A;  5DGA A;  2HVE A;  1RT5 B;  4RWW A;  1N36 J;  4WK1 A;  1TEL A;  1N6Q A;  1CUL A;  2ZUG A;  4ZCM A;  2ZKT A;  1OWX A;  3HFV A;  2UUB J;  3MI7 X;  3KLG A;  3D0I E;  1FRJ A;  1OYD A;  3J7Y I;  1QE1 B;  1UP1 A;  3LP2 B;  3M4X A;  1BC6 A;  1GAO A;  1HAR A;  5CD4 A;  3UO0 A;  4DF8 A;  4R0J A;  1DFD A;  3IM8 A;  4E98 A;  4AD6 A;  4RNO A;  3ETO A;  2I9S A;  1HBM B;  3NY0 A;  2PI5 A;  2CPI A;  1S6P A;  3MEE B;  3BN7 A;  4ILM A;  4DSK A;  3NGS A;  5D0H A;  1HD0 A;  5LJ3 Y;  3DYA B;  1VQ7 S;  5DDQ C;  3NS6 A;  5FDL B;  1GX5 A;  5GAH U;  2QSF A;  5GAG U;  4U96 A;  2NXC A;  4ZPT R;  3C14 A;  2UVV A;  3MGJ A;  1N88 A;  4O3Q A;  2HNZ B;  4A47 A;  1KFD A;  2FVP A;  4L76 A;  5K20 B;  3W5X A;  2YKP A;  5HAO A;  4L75 A;  4DFJ A;  3GFZ A;  2HBQ B;  1VRT B;  4EFA C;  2OPP A;  3E01 B;  1FK9 A;  3DMJ A;  1WHW A;  1VQS A;  4J9P A;  3DLG A;  5D4P A;  1TAU A;  3D66 A;  1XNR J;  3M6U A;  2C42 A;  3OHB A;  3IR7 B;  3FEY B;  4NZ7 A;  3C19 A;  2DNY A;  3TUZ C;  3T41 A;  2HSE B;  2HQ3 A;  3V81 B;  4O3S A;  5LMN F;  2P8I A;  3MAA B;  2W4P A;  1DBD A;  4KAI A;  2F4V F;  2IY5 B;  2X1A A;  2DXF A;  4I6W A;  3PJX A;  2DHH A;  4P2X A;  3S7R A;  2EW9 A;  2X1F A;  3VAH A;  2HVD A;  1PBU A;  4CTA B;  4R5P A;  5BR8 J;  2VFV A;  1I3O B;  4J9R A;  2ALY B;  2YNH B;  4DR5 J;  3TJ9 A;  2RF2 B;  5I42 A;  3MMC B;  1H0H B;  4LFB J;  4JV2 A;  3D3C J;  1XN9 A;  4ZP8 A;  2E44 A;  4P2M A;  1FXR A;  4ECX A;  1GQE A;  4OYW A;  1VBZ A;  1VRQ C;  4EZ9 A;  2MZT A;  4G1Q B;  1SL1 A;  3DDI A;  1YWX A;  1ZAV A;  4CO1 A;  3LP1 B;  2PDA A;  2Z0G A;  3ILL A;  3H8Y A;  2CQ3 A;  4USW A;  1WHY A;  4NL5 A;  5KG7 A;  4ZOS A;  3MMB A;  2QZ8 A;  3NKY A;  4DFM A;  4FVC A;  4RO0 A;  1H6K X;  1J2V A;  1A0O B;  4OZN A;  4FZV A;  4J9O A;  3ET6 B;  3AOD A;  3MR5 A;  4F4Z A;  2F8M A;  2E5H A;  1U0H B;  2WAQ D;  4X4Q A;  2AEM A;  3EIC A;  1YJ9 S;  4WPA A;  3CJS A;  1Q7Y T;  4HTJ A;  4CLK A;  2GV1 A;  1T11 A;  1Q53 A;  2VU5 A;  3R5J B;  3W64 A;  1QSY A;  3FFI B;  3JTP A;  1U8S A;  2VJV A;  5F3Z A;  1RBA A;  2H1Y A;  3DXB A;  1UFW A;  3WBZ A;  4FN5 A;  3QWU A;  4B9L A;  1R8P A;  3GIK A;  4DR1 J;  4DQI A;  2ASL A;  4C8N A;  1YX2 A;  4F0H A;  1QAJ A;  4KO0 B;  2DYA A;  3UNG C;  1FKO A;  1GXT A;  1QJH A;  1JLG A;  3HVR A;  4J9Q A;  1M5O C;  2HZV A;  4BDP A;  2XYG B;  4C11 A;  2E5G A;  2BJ1 A;  4DQP A;  3G71 S;  1OY9 A;  4B9S A;  1FCA A;  5BYS A;  3O5T B;  1RT7 B;  3V6H A;  3UN2 A;  4IQM A;  3CME S;  3NCR A;  4DSE A;  4ICL B;  2ZHB A;  4I69 A;  4ZVQ B;  2OKQ A;  1E6Y B;  2Y9H A;  2IMO A;  1Z2L A;  4DV4 J;  5HAN A;  1JX4 A;  4FKY A;  5HMW A;  1S9E B;  1JK9 B;  4DDF A;  1SVD A;  4RNM A;  1SJF A;  2JL9 A;  4KIA A;  3Q22 A;  3RB3 A;  1OJ4 A;  4CWB A;  5LSL A;  1RAB B;  1FFG B;  1Q81 T;  4CCH A;  2EK6 A;  1IR2 A;  2EBE A;  4C8K A;  3M6W A;  2UVW A;  3HF5 A;  3VGV A;  1U2F A;  4DQQ A;  4LFA F;  1SV5 B;  1I94 J;  3V2U C;  3V4M A;  5M2P A;  2XCP A;  1UWB B;  3V6J A;  3PX0 A;  3H7H B;  1FVQ A;  4NCG B;  4K5S A;  4LRC A;  1FI4 A;  4PXB A;  3PO4 A;  1HR0 F;  1NEE A;  4ELU A;  2XLJ A;  2MLY A;  4OI6 A;  4U7U K;  2Q66 A;  3CDB A;  3IMQ J;  2MY8 A;  4CLW A;  1MLA A;  1JXL A;  3QGI A;  1TVR A;  2WTF A;  1MW7 A;  2UU9 J;  1OY8 A;  1X0F A;  1YBA A;  3PHT A;  1HNX J;  2QRR A;  4PYD A;  1HNZ J;  4M5N A;  3KJV B;  2ZOM A;  3TW0 A;  4L73 A;  1R0B G;  2IJN A;  2CNL B;  4IOB A;  2BKN A;  4YR2 A;  4I64 A;  4FYW B;  4A8F A;  2XMA A;  2GX8 A;  2V9W A;  2XYH B;  2C2D A;  3PY8 A;  2HPU A;  4PXE A;  4R8U B;  4ERD A;  1QLN A;  3GYX B;  4CO3 A;  3VHQ A;  2IHR 1;  5HVH A;  3K5O A;  1TL3 B;  3MOJ B;  4DPW A;  1SXL A;  4JV5 F;  2CG4 A;  2QO3 A;  5IZH A;  2K3I A;  2VHG A;  3MUR P;  1WKK A;  4ZHR B;  1RTZ A;  1X7V A;  3K2Y A;  1N36 F;  2EXU A;  1N33 J;  5C24 B;  1AXQ A;  2F1F A;  3MDF A;  1LWF B;  3EPG A;  3IN5 A;  2QA4 S;  2ZH1 A;  2QSW A;  2UUB F;  3LAM A;  3EUN A;  4DLG A;  2CJB A;  2DNR A;  2XTJ P;  1UJ4 A;  3BS9 A;  2DNL A;  2JFD A;  3NNA A;  2JNJ A;  4Y2I A;  3QJJ A;  2AGQ A;  5SUH A;  4DR3 J;  1ZAX A;  2G2Z A;  1F2G A;  2VQF J;  1X60 A;  3W62 A;  2ZWO A;  3DLE B;  1U45 A;  1K44 A;  2MQL A;  1SIW B;  2IJR A;  4YME A;  1KQG B;  2E7X A;  3QRP A;  2HAF A;  1S7I A;  1JNR B;  5K14 A;  2LQ8 A;  4K4Z A;  3M1V A;  2VC1 A;  3C6T B;  3M2V A;  3H42 A;  4LSZ B;  3DLK A;  5KFR A;  3MCO A;  5KFS A;  3VAL A;  2Z4P A;  2CFX A;  3MOZ A;  2HIQ A;  1YRU A;  4ZVP B;  2V2K A;  4WFZ A;  4ZLJ A;  1GMV A;  4TLQ A;  4KYZ A;  4IG3 B;  1Q5V A;  2VDI A;  3O3L A;  2V4J A;  3MCS A;  4URG A;  3I56 S;  1S9G B;  1TQL A;  1TUV A;  1B0P A;  5F8J A;  3G87 A;  5HVG A;  2DRA A;  2M8D B;  1PC5 A;  4P9S A;  4WIQ A;  3SSR A;  3CD5 A;  4LF4 F;  1MSW D;  1M1H A;  3KLH A;  2KHC A;  1DY3 A;  4F7V A;  1X9W A;  3DDK A;  1ULR A;  4DZD A;  1JLE A;  5IM0 B;  1PAU B;  4DSI A;  3O2I A;  4RBV A;  4JB8 B;  5D4L A;  3TAQ A;  1HWL A;  1AZS B;  1T94 A;  4RNN A;  3ZZP A;  1UET A;  2VBZ A;  1OYE A;  4DV0 J;  4ZVS B;  2FTR A;  4GO7 X;  1ZBT A;  3Q83 A;  1K1S A;  1H73 A;  1P1T A;  1FHT A;  2OIH A;  4PKD B;  1VFJ A;  1U1O A;  3R5B A;  1NSQ A;  4RZR A;  1XR7 A;  2MKH A;  4BC7 A;  5IT0 A;  3MM5 B;  4DPT A;  5JJB A;  2RQC A;  2A10 A;  2YWW A;  1UFK A;  1H98 A;  3EE3 A;  4OI1 A;  2AJ4 A;  2Y3Y A;  3IO1 A;  1ZOT A;  4X4T A;  3QIP B;  3CJ8 A;  1VQ6 S;  3G2X A;  4N8O A;  4MK9 A;  1CC8 A;  3GMG A;  4JI7 J;  2UXB F;  2BM1 A;  3ZNJ 1;  4P10 A;  5CZX A;  5EX3 A;  3B4M A;  2WON B;  1B64 A;  4DBQ A;  2NXJ A;  2C2M B;  3DGV A;  2FIU A;  1EQM A;  3R7S B;  3Q86 A;  1WF1 A;  1DTQ A;  3OLA A;  4WKR A;  1X4G A;  2BJE A;  4KH0 B;  2DJW A;  3U1M A;  3CUN A;  3CWJ A;  4A8O A;  5DS7 A;  3KG1 A;  3MEC B;  4F2R A;  1MWQ A;  3P49 B;  4CO2 A;  3T3F A;  1IBK J;  3M2R B;  3HX9 A;  2VG7 B;  3IR6 B;  2IVF B;  3VCD A;  3GR1 A;  4DWI A;  4YB5 A;  1S57 A;  3DOL A;  4USI A;  1KLN A;  1RCO B;  1HBO A;  1QSL A;  2DKO B;  1NKC A;  3OUY A;  2N82 B;  4IRD A;  3HHL A;  1M5H A;  2YH1 A;  3JTO A;  4WKY A;  4J9N A;  4C8Z A;  3RR7 A;  1IKW A;  4AND A;  4U95 A;  3KK2 B;  4DV7 F;  3M9N B;  3G96 A;  1HBU A;  3QLH B;  1Z4U A;  4A8S A;  2R42 A;  3DOM B;  5JVH Q;  3H20 A;  1JNZ B;  1ACM B;  1VQ4 S;  4OYA A;  3AFG A;  4HDH A;  2Q6C A;  4P2F A;  2RIJ A;  3NNH A;  1N5S A;  3KLV A;  1DTT A;  4OZ2 A;  1IQT A;  2MKC A;  2XI2 A;  2BYC A;  3HCX A;  2ILZ A;  2H51 B;  3FMW A;  5BYQ A;  1KD1 T;  1S1U B;  1S6Q A;  1ZET A;  2OPS B;  4YHH J;  1H2V Z;  4EYH B;  2RUS A;  1A9N B;  1CJV A;  4ILL A;  2R7U A;  5AT1 B;  2JH3 A;  5DZ7 A;  2QEX S;  2B5J B;  3NGR A;  3JSR A;  2I5J A;  5J1E B;  4M5H A;  1DZ5 A;  4UUW A;  3OJU A;  1RTD B;  4RW7 B;  5HRO B;  4NXN F;  4FYY B;  4PG5 A;  1FRI A;  1WC1 A;  1KQF B;  4ZVO B;  1WF2 A;  3BGR B;  1HLW A;  3DC2 A;  4N41 A;  4C48 A;  4HAC B;  2B8Q A;  4JYA J;  2RQ4 A;  3C6U B;  4IR9 A;  4KJI A;  3SI8 A;  4QIF A;  4O4G B;  1Y00 A;  2OD4 A;  1U24 A;  4ANE A;  4DV6 F;  3PKM A;  5CA5 A;  1NHV A;  3CT9 A;  4FYD A;  4PEO A;  2HWH A;  3TEG A;  1WG5 A;  3G4S S;  3QFH A;  2E66 A;  4KE5 A;  2ZIT A;  1YG0 A;  3BSN A;  1UJ5 A;  5AE1 A;  2MXY A;  4DR6 F;  4B9U A;  4EBC A;  1PBA A;  5MAO A;  1Y5L B;  1N8R T;  1QTN B;  2WZ1 A;  4B08 A;  4LQ9 A;  3RBX A;  1WUU A;  5JVG Q;  4ALZ A;  2UU9 F;  1T9Y A;  1P1L A;  4EI2 A;  4MYU A;  2XSJ B;  4CIO A;  1WKL A;  2AYM A;  2DD8 S;  4ZJQ A;  5LSO A;  5KG5 A;  3ELH A;  5U47 A;  2EPI A;  2GVD A;  3TUI C;  3RB4 A;  3AQO A;  3NS5 A;  4UQG A;  3T5L A;  2WVF A;  2W9B B;  4WP9 A;  1P9Q C;  4DLE A;  4OJG A;  1TKZ B;  1DQA A;  1GEH A;  5JXS A;  2P9E A;  5ETV A;  5KT5 A;  1S97 A;  4K4W A;  1BY9 A;  2MGZ A;  2YWH A;  3JQM A;  1YIJ S;  5ETO A;  1JQG A;  4OV1 A;  1LXJ A;  4NLP A;  2B6A A;  2VD3 A;  3MTK A;  2ZH3 A;  1TUW A;  4OYZ A;  1GTH A;  1UEK A;  4IH7 A;  3CC4 S;  1JXV A;  4LSL B;  5C2C A;  2UUT A;  1U1R A;  2DRB A;  2P9C A;  4LQ3 A;  2RD5 C;  4KPY A;  2RIL A;  1NDC A;  3VAI A;  2WBM A;  1WAC A;  3FK4 A;  3DLJ A;  1B70 B;  1DLO B;  4L6V 3;  2E7W A;  2Z2M A;  4W92 B;  2RHS B;  3MCN A;  1T05 A;  3D4J A;  3TP2 A;  4CM0 A;  3H90 A;  1XR5 A;  1S1W A;  4O4R A;  5F8N A;  1Y3K A;  4KHP J;  1F6T A;  4B3R F;  4P73 A;  5CCL A;  3UFC X;  1V6H A;  4WE1 A;  1SJ1 A;  2ACM A;  5D0G A;  4MIB A;  3V4I B;  2VG6 B;  3FSX A;  3CCM S;  4F0K A;  3IBC B;  3NWR A;  4ZCL A;  3JSB A;  3PX6 A;  1AUD A;  2F63 A;  1R3N A;  4DR2 F;  2DB1 A;  4JI1 F;  2HHW A;  2V6A A;  3HZE A;  4IFY B;  3QID A;  5EHH A;  1YSJ A;  1FRX A;  3W63 A;  3GIJ A;  2I38 A;  2EFG A;  2AJ0 A;  4A8Y A;  1Q4R A;  4U7C A;  4U8V A;  4QIV A;  5G0R B;  3C15 B;  3G6E S;  5ETS A;  1RUS A;  2VDH A;  2NSC A;  1FJG J;  4FPI A;  2C3P A;  1A6L A;  4EUV A;  1V3Z A;  2AKW B;  3H2L A;  3KLF B;  5DQI A;  4ZPC A;  3MED A;  1BE4 A;  2YKN A;  3UDV A;  4KFB A;  1F0X A;  1U2R A;  3MWB A;  1X0P A;  4IFV B;  4HL9 A;  3R7N B;  2C28 A;  2D1C A;  3OSN A;  3POT A;  2KM8 C;  2H65 B;  2VQE J;  1VJQ A;  4OL8 A;  2V68 A;  2LEA A;  4C2M A;  1YTY A;  1CG2 A;  3SV4 A;  2YWE A;  2WSF C;  3W9H A;  2ZHO A;  3H5X A;  3QSY B;  3VAG A;  4ZVE A;  3BBB A;  1NZ8 A;  1HPZ B;  2V2V A;  4FYX B;  1JLB A;  1FA0 A;  3FEX B;  2YY3 A;  3FZ2 A;  4ZPB A;  3TR5 A;  3SQO P;  3BH6 B;  2R4F A;  3HT3 A;  2R9L A;  2CPF A;  3CCJ S;  1T9X A;  5C25 B;  2VIC A;  4UOG A;  2QA4 G;  2MKI A;  1KVJ A;  1RHM B;  2MLZ A;  3R1L A;  2M0G B;  3H5Y A;  1N5Q A;  3ILO A;  2DIT A;  5KFT A;  1DUR A;  2OPQ B;  3HPO A;  1RWU A;  5L46 A;  4NLX A;  2LQJ A;  3DGP A;  3WHI A;  2YPZ A;  3P96 A;  2ZOG A;  2QA1 A;  3H25 A;  1ROF A;  2E1R A;  1N6Q B;  1S12 A;  1CUL B;  1Q8B A;  1LFP A;  1J5E F;  4U7U D;  1N5T A;  4J7C A;  4NA1 A;  2HGL A;  2FVQ A;  4XK8 C;  2FGC A;  3KLG B;  4JI8 J;  2J7W A;  4LVO P;  3A8J A;  4X62 F;  2K8G A;  1DQ9 A;  4C3L A;  2RU3 A;  2CNO B;  1RIS A;  4Y2K A;  1N34 F;  4YN3 B;  1IBM F;  1U26 A;  4DL0 C;  1ARO P;  3BH7 B;  2BE2 A;  3GFX A;  3CD7 A;  4NLU A;  3PJW A;  3I55 S;  1TKT A;  4ZS6 A;  4B3M F;  2W9C A;  5F8H A;  2ASD A;  5B0E A;  1ELO A;  2MEW A;  3O8W A;  4I7F A;  5HMY A;  2OSQ A;  4HHJ A;  4RJV A;  4RW4 A;  4I6Y A;  4HLB A;  4YHH F;  3NLC A;  3KK3 A;  5HSP A;  2V34 A;  2L9N A;  1AW0 A;  3FQL A;  3K5M A;  4WP8 A;  1PYT A;  4BC9 A;  4GKJ J;  3HFZ B;  2GVZ A;  5E3P A;  1VI7 A;  5DG9 A;  1H7X A;  4P72 A;  2QTW A;  1NRK A;  5G4D A;  3C14 B;  1NJW A;  3TAN A;  4B02 A;  2ZBP A;  1K0T A;  2M8H A;  4X66 J;  1HBM A;  2FVC A;  5A8W A;  3NMR A;  2HND A;  3QJP A;  2V8H A;  4GO5 X;  2FHO B;  1Q8I A;  4MYT A;  2DPI A;  3KYL A;  5RUB A;  3MXH P;  2PEB A;  4JP8 A;  2JHE A;  4AQY F;  2WRM A;  3OT9 A;  2OPP B;  3DMJ B;  3RZA A;  4LF1 A;  3DLG B;  3PRV A;  1WJ9 A;  4OX7 A;  3D67 A;  1EX8 A;  2LDY A;  3QRR A;  1D9A A;  3RRK A;  2FYX A;  6FD1 A;  3FQK A;  2GFF A;  3BBF A;  3FCV A;  4OYM A;  3BDP A;  3BB5 A;  3NAI A;  3ISN D;  2QL9 B;  9ATC B;  1SJ3 P;  3SSQ A;  3L7O A;  3MPW A;  4RBU A;  3OTC A;  1VIX A;  5D78 A;  1AB8 A;  3PCO B;  4OHW A;  3PX4 A;  2ERR A;  4OZL A;  3VVU A;  2MB0 B;  2JZ5 A;  2CVE A;  3LUY A;  2O5D A;  3W5Y A;  4I4B A;  4F4Y A;  4PR6 A;  1FWL A;  2Q79 A;  1EAR A;  3HJV A;  3LTO A;  4Y65 A;  3R5C A;  4BLG A;  3I87 A;  1IUJ A;  5LXR A;  3MAA A;  2A18 A;  2EKY A;  2HNY A;  1TMM A;  2MJN A;  2OJ3 A;  4PPD A;  1L3T A;  2Y0S D;  1SH3 A;  1NSA A;  5LSR A;  3AOA A;  1WSV A;  1NPP A;  3LGM A;  1G2E A;  4G6V B;  2DGT A;  2LA6 A;  3DRS A;  1Q95 G;  2GAG C;  1VDH A;  5AXN A;  3BGU A;  4OZ0 A;  4A8X A;  1QVF R;  2RQM A;  3PW5 A;  1IR0 A;  3CCW A;  3PIO Q;  1K0V A;  1G7C B;  4F4X A;  4DL2 A;  4LR8 A;  5LMU F;  2COL A;  1S0V A;  4XIU A;  5KOX A;  3J81 Y;  2CJ9 A;  2NXU A;  1RLD A;  2Z2L A;  1NPR A;  3NMA A;  4PPZ A;  3RYL A;  4ZPD A;  3KLI A;  3LP1 A;  1C0T A;  5DDR C;  1PIL A;  2AJ1 A;  2M4M A;  2XO7 A;  3W9J A;  2IVM A;  2BBE A;  4UUX A;  3U02 A;  1TMJ A;  2XY7 A;  4GVB A;  3C8Y A;  3GJQ B;  4MJK A;  5GMD A;  3T1Y F;  4K50 A;  4CLP A;  4QQB A;  3K5L A;  2OEL A;  1GMU A;  1NKB A;  2DGS A;  2HHP A;  6AT1 B;  2HBR B;  4CLY A;  1EB0 A;  1RBL A;  4LSN A;  1FKO B;  4GVL A;  3OTE A;  4EYI B;  3CMQ A;  3VQS A;  4J9U E;  2DVI A;  4Y0F A;  4WZM A;  2R7X A;  4HR2 A;  3VAF A;  1HNI B;  3W2V B;  2HLT A;  2FPH X;  3SSS A;  3UR3 C;  1TK5 A;  3TA2 A;  3ISZ A;  1RTJ A;  1BWV A;  1B4S A;  1C2P A;  1FWP A;  2BR0 A;  2DGU A;  3PW2 A;  3AB4 B;  1F5B A;  4F36 A;  5CD4 H;  2CJQ A;  2HK2 A;  2IAJ A;  4OZ1 A;  1RB0 A;  2V9K A;  4JI2 F;  1JB0 C;  3W2W A;  4LF8 F;  5KFK A;  1G6B A;  2BMB A;  4LF5 J;  2KT3 A;  4QW9 A;  2E1P A;  5K8P A;  4M1K A;  5T14 A;  1SI9 A;  2KVQ E;  3KG4 A;  2MQN A;  3RUB L;  4NRT A;  3SXL A;  4CH0 S;  3NP5 A;  2C3U A;  2D3U A;  2JEJ A;  2KRR A;  1HFE L;  1Y5I B;  2DGV A;  2HLU A;  1HHT P;  1IKV A;  3FBC A;  2ZH6 A;  1JJC B;  4TU7 A;  1IKY B;  3QNW B;  3SFG A;  1IBL J;  4V19 J;  1HD1 A;  2KXH A;  2BW7 A;  3OL9 A;  5CCM A;  3GTY X;  3GSD A;  5HL7 Q;  4KSE B;  3H4D A;  2HHH J;  4FVM A;  4EO8 A;  3CCQ S;  4X4P A;  1E6V B;  2B4V A;  1S1X A;  4OLO A;  1TVR B;  2ACY A;  3PM9 A;  2FJE B;  3L9Z A;  2UXD F;  2DBB A;  3D5M A;  3MZI A;  1X4E A;  2HIY A;  2F9D A;  3EGN A;  2C2N A;  2PEH A;  2VKR A;  1NKE A;  1RTH A;  3Q8P B;  3OTB A;  3UW1 A;  3CDU A;  3R9L A;  3KNG A;  2K7J A;  4NCG A;  3CCT A;  1YHQ S;  1EQ0 A;  1J27 A;  1BGX T;  1P9Y A;  3QGP A;  2ZBQ A;  4HI1 A;  3M6X A;  2W8L A;  1SH0 A;  3TX8 A;  1NK0 A;  2DRD A;  1IWG A;  1ZA2 B;  2HVI A;  3GV5 B;  2E9Z A;  3Q89 A;  3MM8 A;  3KMS A;  4YQW A;  3BR8 A;  1QTM A;  4OYO A;  2NS1 B;  3RJM B;  2RDD A;  4MIW A;  2AIR B;  3L95 X;  1LXN A;  1DAR A;  2X1B A;  2VL1 A;  1WC4 A;  2IDE A;  3JYT A;  1NCL A;  3CW2 C;  2DY1 A;  4MKV A;  2FZG B;  1TL3 A;  6FDR A;  1IBC B;  3RBD A;  3DLL Q;  1CPZ A;  4OX8 A;  4ZN3 A;  1RTI A;  3QQC D;  2BJ7 A;  5K14 B;  1WNE A;  2AV5 A;  4DCP B;  4ZVG A;  1KTQ A;  3N6M A;  3M2V B;  2K7K A;  1C1C B;  3DLK B;  1LWF A;  2CXE A;  1XNQ F;  2FVR A;  1DAX A;  4N47 A;  5J2N B;  2HFS A;  1RWP B;  4K0K J;  1B0V A;  3BZQ A;  4PWU A;  2VOD A;  2VFR A;  2ZBC A;  5K8N A;  3X3U A;  3CC7 S;  1SQE A;  3NCP A;  2V4J B;  1HNV A;  2UUC J;  1BXN A;  2MKK A;  4WYL A;  1G4C A;  3BKT A;  2GQC A;  1EET A;  1T03 A;  3CD0 A;  2CPZ A;  5A6W A;  4C8L A;  2KG0 A;  3KLH B;  1VBY A;  3LPE A;  1KN6 A;  1NAQ A;  2LCW A;  2HG4 A;  4IG0 A;  2P6S A;  3HUL A;  4WTO B;  3RBZ A;  3CCL S;  4E0D A;  2CPH A;  2MZS A;  4DPU A;  2CDQ A;  1EP4 A;  2LXU A;  1DQ8 A;  3JTN A;  1EHW A;  2U1A A;  1R0C B;  3SDE A;  5A8K A;  2CWK A;  1S9G A;  4P52 A;  4DF4 A;  1UL3 A;  2AX0 A;  2BV3 A;  4QR0 A;  2GHW A;  1ZTW A;  1JLA A;  2HQC A;  2MST A;  1TL1 A;  3BF4 A;  3DXS X;  2MQ8 A;  2XBP A;  2GO9 A;  2NZC A;  4I2Q B;  2CJY B;  4UTG A;  1GX6 A;  1AT1 B;  2Z56 B;  2UP1 A;  2YH0 A;  1LWC A;  2RUG A;  3S1T A;  3QMQ A;  1JJ4 A;  4Z2X A;  3W66 A;  3FMB A;  5C42 A;  2CNK B;  2WVD A;  5AXM A;  3PFO A;  5E3R A;  4H54 A;  3RU0 A;  2R7W A;  1YGY A;  4GMK A;  2O66 A;  1HWJ A;  3G8T A;  3L7P A;  4G1P A;  1W2B R;  2GIR A;  4IUF A;  1PGZ A;  3TUJ C;  2BJD A;  2GIF A;  2NXN A;  3K7R A;  3UWT A;  5D6G A;  4BCA A;  1W25 A;  3AJD A;  1IWA A;  1YLX A;  4DR7 J;  5DM6 Q;  1TK8 A;  3LWL A;  5HJX A;  4QYZ K;  5E7O B;  5IXU A;  2NPI A;  1REV A;  1NXI A;  3QWP A;  3DCA A;  1D9F A;  5DGB A;  2M2B A;  2VPX B;  2R2T A;  2NCK L;  1T9T A;  3R7B B;  2ROE A;  4RW8 A;  1HBO B;  3IG1 B;  1SC4 B;  3OUY B;  3HHL B;  2ZD1 A;  4DV2 J;  4J5O A;  3QO9 A;  4QR1 A;  1IKW B;  2YNF A;  1SC1 B;  4E2F B;  1KFS A;  4CT9 A;  1VLO A;  5E2Q A;  4K2X A;  2WBR A;  1HBU B;  2YQ1 A;  4I0W A;  4N56 A;  3T1H F;  1JLQ A;  4KBI A;  3P45 B;  5D0R A;  1WEZ A;  2J8S A;  4FBU A;  3TVZ A;  1NK6 A;  4ES2 A;  1TKX A;  3HMJ G;  1Q86 T;  3TZZ A;  3VGU A;  5A2Q Y;  1DTT B;  1B99 A;  3PO5 A;  3CCS S;  2RNE A;  3BR9 A;  5F0U A;  4NX9 A;  4XPC A;  1S6Q B;  1XBW A;  5IT9 U;  3DOM A;  2IIH A;  1PKU A;  3NBP A;  1HHS A;  2R8K A;  1SJR A;  2D7S A;  3IAM 9;  1CJV B;  4ECW A;  2L41 A;  5J1N A;  3M8Q A;  2I5J B;  4F26 A;  4ZKA A;  1FRM A;  4F0M A;  4CDI A;  4FXD A;  2PGC A;  2ILY A;  1FES A;  4ED8 A;  3PYF A;  2OHD A;  5DZ6 A;  4DS4 A;  4WZQ A;  2FZC B;  3NRB A;  4DUT A;  2V5H G;  1S1U A;  2HQD A;  4TQS A;  2CAJ A;  2HFN A;  3VZI A;  4LF9 F;  4ZCK A;  1WKJ A;  3EJM A;  4Q43 A;  3IFE A;  3BSA A;  3BM7 A;  4EGL A;  2POK A;  3HJF A;  4DV5 F;  4FF3 A;  3BQ2 A;  1LV5 A;  2Y1L B;  4W90 B;  3QT5 A;  1EKS A;  5DET A;  3F56 A;  4YY3 F;  2ZHA A;  3OXF A;  2K1R A;  2OO4 A;  3WC0 A;  4QW8 A;  3MM9 A;  2DPJ A;  2CQ0 A;  4X4S A;  2ASY A;  4RU2 A;  2MKY A;  3GWC A;  4YUD A;  5ETQ A;  2AJQ A;  2AGP A;  4HAC A;  3TOQ A;  3EDR B;  3I82 A;  3W1Y C;  3MEG A;  4ATN A;  2RS8 A;  3GG0 A;  4QZV B;  4X65 F;  1T7P A;  3R2C J;  1M5S A;  2V50 A;  1H7W A;  3G8S A;  2WHO A;  3KDN A;  1QY7 A;  2KN4 A;  1HA1 A;  3EPI A;  4ZP9 A;  4ED2 A;  2IBO A;  5IWA F;  2M5Y A;  2F4V J;  4C3M A;  3R5G A;  2AW0 A;  4DZ6 A;  4FF4 A;  3CPW R;  2ZE2 A;  3V6D B;  3MPY A;  1F2H A;  2XMV A;  4NRU A;  2IRU A;  2GVD B;  2NSB A;  1XMO F;  4PXC A;  1U2C A;  3I5A A;  1F9E B;  4TU8 A;  2E7V A;  3ZZT A;  2Y1R I;  5LOQ A;  2DTJ A;  1LFW A;  5K8O A;  2DHS A;  3EGW B;  1XJW B;  2XEX A;  4KGK A;  3D6T B;  2H4W B;  5B0D A;  5A0Y A;  2MGZ B;  4DI6 A;  1V9O A;  1X4C A;  1KVK A;  3R5D A;  4CNZ A;  2PFF B;  2B6A B;  1MWY A;  3N6N A;  1SJ4 P;  5KFY A;  1T0T V;  2MZR A;  3OJS A;  3HSJ A;  4QPT A;  4WCE Q;  3WQP A;  2FLL A;  3UDL A;  2XSF A;  1S6O A;  2XGQ A;  4K2J A;  5KFW A;  3A8I A;  4NYP A;  4NML A;  4CLL A;  4LVN P;  4KGZ B;  5IQQ A;  3KXD A;  1RWN B;  2FDN A;  3ZTQ A;  5EGY A;  5I3U B;  1T05 B;  4IQX A;  1HQ2 A;  1S1W B;  1S1V A;  3CVK A;  4C0H A;  1KVI A;  2R8I A;  3PRB A;  2C2E A;  1L3V A;  2JSX A;  4FYV B;  1RT6 A;  4WE1 B;  4FNI A;  2JVO A;  3SIP B;  3B54 A;  2QJ3 A;  4RNH A;  2D3O R;  3W65 A;  3LGH A;  4USH A;  4OYB A;  3JAM Y;  2KZM A;  1NJY A;  3LAL A;  1HBN A;  5F3T A;  1FNX H;  2G1D A;  3L3C A;  3M30 A;  3EX7 B;  3W3S A;  2H5I B;  3OFE A;  1P8G A;  3CDW A;  2LQ9 A;  4CT8 A;  4Q2L A;  2XY6 A;  4DX8 H;  1WC3 A;  3THV A;  1N5Y B;  3DLB A;  3T5K A;  3W5Z A;  1NLK L;  1N52 B;  4QIG A;  5L9X A;  1NJZ A;  3LP0 A;  4UOC A;  3KFW X;  2JLF A;  2C1E B;  5IQ6 A;  4NEZ A;  2MQQ A;  1G1X A;  4XTT A;  2C2Z B;  2DNM A;  5F41 A;  5KG0 A;  2NYI A;  4KFB B;  4B17 A;  3M8W A;  1FKP A;  4RX6 A;  5L9N A;  3POT B;  4URQ U;  5B0G A;  1U49 A;  4ECY A;  2FHK A;  1AFI A;  1FER A;  4GC7 A;  2MZJ A;  2ZH5 A;  3BO4 A;  2EG1 A;  1EZZ B;  4NI2 A;  3RAM A;  3AJ2 A;  2W8K A;  2C3O A;  4B3O B;  2F9J A;  1VYA A;  4UW2 A;  4QIW D;  5C7P A;  4QPX A;  2AT1 B;  1PJ5 A;  4ECV A;  3AOC A;  5HLF A;  2F40 A;  2ZH8 A;  2GML A;  2B0G A;  4ZLN A;  2GC8 A;  2ZKU A;  2CPE A;  3C16 A;  4QWA A;  4PUO A;  5KFG A;  1S0O A;  4RUB A;  2EWH A;  3LF0 A;  1WDD A;  1S10 A;  3A13 A;  3D3B J;  1HPZ A;  4H4O A;  2V4Q A;  3GCX P;  1KHW A;  3DM2 A;  2RDJ A;  4ES3 A;  2KI2 A;  3DGP B;  2R8J A;  3OXL A;  1RKJ A;  3QAE A;  1HYS A;  3QT8 A;  2BZ2 A;  4KV8 A;  1EIY B;  5K8M A;  2B51 A;  3QT7 A;  4WII A;  3QGG A;  2B9Y A;  1T9W A;  2FHM A;  4WFB Q;  3R97 A;  3CXC R;  5T7L A;  4TN2 A;  3IR5 B;  4JV5 J;  5CXT A;  1TL7 A;  3BGL A;  2AJF E;  5DQH A;  3I96 A;  1GK8 A;  1SQG A;  5KG6 A;  4ZMM A;  3IRX A;  2JEF A;  1MN7 A;  3HHE A;  3HHL D;  1TKT B;  1OSD A;  1U4B A;  2W9C B;  4QWC A;  2Y8Y A;  1TZ0 A;  2BOA A;  2HZC A;  3FRZ A;  1O51 A;  1X4A A;  4ECS A;  1MU2 B;  4I7F B;  1IR1 A;  4NZ6 A;  4RW4 B;  3JXO A;  3KK3 B;  4RUH A;  2QG9 B;  1YRT A;  3M05 A;  3C2P A;  4FKX A;  2WW8 A;  3MHY A;  2GGP A;  2IA6 A;  4ED5 A;  2DCU B;  1YZ6 A;  2GVZ B;  3PEJ A;  2OUG A;  3WIU A;  2MKS A;  2J7U A;  2Q3P A;  2YX4 A;  3IP0 A;  4QU7 A;  2AYE A;  2IFX A;  2JC0 A;  3OW2 R;  2VFT A;  5A8W B;  3MR3 A;  1XR6 A;  1ZTT A;  2AX1 A;  3UQS A;  2HND B;  1VQ5 S;  3Q8U A;  4Z7Y A;  3DFE A;  1D9D A;  1T8E A;  2J6S A;  2W2P P;  3I32 A;  5CYQ A;  3ITH A;  3X1L B;  1RHR B;  2HHQ A;  2QFI A;  3K5P A;  3NCQ A;  2VOP A;  1D3W A;  3EVW A;  1UW9 A;  3J7Y U;  4OX6 A;  2D3O 1;  4NA3 A;  3AJ1 A;  3E8O A;  1HQE B;  4P74 A;  3LGN A;  3ZZZ A;  2DIS A;  5DDO C;  3ZZR A;  1REG X;  4LF4 J;  1SKR A;  2CJX B;  1RCX B;  2V94 A;  3K8V A;  3O6Q A;  2QLJ B;  4DX6 A;  2V8G A;  2AZ1 A;  1PYO B;  3AD8 C;  4Y6I A;  4O3O A;  5LM7 E;  4TQR A;  4Y28 C;  4USU A;  2NZ4 A;  3K17 A;  1L5U A;  3AAW B;  4NLY A;  4P7T A;  2BVZ A;  1IKX A;  2R7S A;  5EX0 A;  2B9W A;  4NLT A;  1ITP A;  2Y0B B;  1X5P A;  3M8P A;  3CF5 Q;  3C46 A;  1ZAW A;  4DSF A;  1RGV A;  2HNY B;  2V67 A;  4JI6 F;  4M95 A;  5JMN A;  3W8G A;  2QLB B;  3J7A N;  5C5J A;  1QSS A;  1Q0N A;  3GU0 A;  4H4K A;  3GE9 A;  4ID5 A;  3DRS B;  1RHJ B;  2CJA A;  2UXB J;  1YJT A;  4NLO A;  2HHT A;  2HRU A;  1GXU A;  3GB0 A;  5DG8 A;  3OLB A;  1CJK A;  5KFP A;  4OZ5 A;  2ZNZ A;  3ISN C;  3FBF A;  1XMQ F;  1U6B A;  5H9F K;  1Q8L A;  5ITH A;  2DGQ A;  5KFM A;  3OR1 A;  2DGX A;  2NQP A;  2CJK A;  3M9M B;  1RSC A;  4D3H A;  2Z2Y B;  2VG5 A;  5DDP C;  1BD6 A;  2KDO A;  3KLI B;  1C0T B;  3PR5 B;  4EBE A;  2M7S A;  1X4H A;  3RB6 A;  1TTH B;  1U0S A;  2ABY A;  5AXK A;  3L09 A;  2DR9 A;  4GVB B;  2PMZ D;  3Q24 A;  4PQU B;  3RRH A;  2G9O A;  3GLJ A;  3VV2 B;  4GKK F;  2VJU A;  2W9A A;  4CLU A;  4B3T F;  4DV7 J;  4BS2 A;  1RT4 A;  3DRR A;  1AFJ A;  4I6A A;  4MTP A;  2FY1 A;  2JEG A;  4LSN B;  3LA0 A;  2QLW A;  2VA3 A;  3U27 A;  3GV8 B;  1XMB A;  5LT5 A;  3Q2T C;  4QYZ J;  2YVS A;  3FNN A;  3G9C A;  1TK0 A;  1N54 B;  4I1T A;  4DQR A;  2B7C B;  5ETL A;  2QV6 A;  3UCG A;  2B43 A;  2FQQ B;  2RS2 A;  1RTJ B;  4ETZ A;  2GNK A;  5J1P A;  4MKY A;  1YJW S;  4DUZ F;  2YTC A;  2Z8Q A;  2JLG A;  2APO A;  2IAJ B;  1RAG B;  1N4L A;  4KRW A;  4M5G A;  2XMW A;  4CI0 B;  5M2R A;  1YQH A;  3W2W B;  2XUL A;  4YOE A;  2OML A;  2L3M A;  3WIV A;  1RAO A;  1KLM A;  1QDU B;  1KQS R;  5KFU A;  4OYP A;  2DNO A;  1NK5 A;  3OSP A;  4MH8 A;  3P3D A;  1SKS A;  1RAD B;  4Q44 A;  1HNI A;  3W2V A;  1EKR A;  4IRK A;  4DUY F;  2DR7 A;  3EXC X;  2IYI A;  2FJW A;  3I6P A;  2G2O A;  2ZFH A;  4OJ3 A;  1IKV B;  4DEZ A;  4NXN J;  1QAI A;  3EMT A;  1PJ7 A;  1AYE A;  3EZU A;  5J2Q A;  1M5K C;  5DQG A;  3IGN A;  2X51 A;  4RLE A;  4LRD A;  3US5 A;  1U25 A;  4A8Q A;  3ZTS A;  4BBY A;  3F44 A;  4WFN Q;  2QC3 A;  1S1X B;  2C2K B;  3S8S A;  3QZ7 A;  1S99 A;  4DV6 J;  2YNI B;  2W01 A;  2UXC F;  3KUE A;  4NCB A;  3PW7 A;  1IKY A;  4NYZ A;  1RTH B;  3QYY A;  4DR6 J;  3VGS A;  5E3Q A;  2XZW A;  2AWZ A;  4YEA A;  1H2U X;  1CBK A;  1VBK A;  1I51 B;  2HGN A;  1E6V A;  3LOU A;  2WB4 A;  2PC6 A;  3A4T A;  2OEJ A;  4PQA A;  4TKT A;  4PZV A;  2JLE A;  3MMA B;  4QU6 A;  1X8D A;  3EGZ A;  3SCI E;  1FXD A;  3MM8 B;  1SBR A;  2XS7 A;  4PG4 A;  2E1M C;  1R89 A;  2HRY A;  3GJS B;  4C3K A;  2MMY A;  2HFV A;  4O0N A;  4K4S A;  2XMM A;  3JYT B;  4PWD A;  4OYX A;  4DCO B;  3LWM A;  4ZIT A;  3CGI A;  4RPF A;  1S5Z A;  2CPY A;  3ZXW A;  2K2P A;  1D0E A;  3D1H A;  5HAT A;  2EFP A;  1B3T A;  1Y0H A;  2ATC B;  3HI9 A;  1RTI B;  1Q16 B;  4USK A;  4OX9 J;  2JFK A;  2VB6 A;  1RAC B;  3MAQ A;  5L1L A;  1YJV A;  4DOZ A;  4M5M A;  3PG9 A;  1F5A A;  3KOA A;  2X7I A;  3QAU A;  4ZPV R;  2C3Y A;  3FGV A;  1RT3 A;  3G8Q A;  1HNV B;  1QAX A;  2J6T A;  4DR4 F;  2MJU A;  2XY5 A;  3KG0 A;  3P4U B;  2JOQ A;  1EET B;  2XLK A;  4EO6 A;  3B4D A;  4WJB A;  5H9E K;  1C1C A;  1T03 B;  4HVZ A;  2HHU A;  4HEA 9;  2AYG A;  4ZA1 A;  3AOB A;  1UKU A;  5J2N A;  3Q8Q B;  1UMJ A;  3DOK B;  3SMZ A;  2YNG A;  3CE8 A;  4IG0 B;  4B3R J;  3I4H X;  1RDR A;  2V63 A;  2CQP A;  1WF0 A;  1X4F A;  1EP4 B;  4ED7 A;  2W4D A;  3SDE B;  4CYU A;  2H3E B;  4LJM A;  5A8K B;  1TL4 A;  2A6O A;  5DG7 A;  3GFH A;  3CJ3 A;  2D41 A;  5IV4 A;  1JLA B;  1U1P A;  3D9B A;  1TL1 B;  1XER A;  4DR2 J;  4MK7 A;  4JI1 J;  4NAS A;  1DRZ A;  1FF2 A;  2DGW A;  2CDR B;  2UV8 A;  5DRK A;  3CJ2 A;  1RHQ B;  4BWM A;  3BDE A;  1FDN A;  4X4U A;  1LWC B;  4NLQ A;  3KUG A;  2I1R A;  2CIM A;  3D7S B;  5HI7 A;  3HVW A;  2I6W A;  4RW6 B;  2WSE C;  1Q5Y A;  5C42 B;  3BGF A;  1N48 A;  3UPF A;  3OL7 A;  2R8H A;  5GAD I;  4WP3 A;  4KH1 B;  3UD5 A;  4NXM F;  3K57 A;  4I2Q A;  4WXO A;  2LQ5 A;  3PYG A;  2CQC A;  4B9N A;  3D1O A;  2H54 B;  4UST A;  2IRX A;  2LQB A;  3J80 U;  2XMK A;  4OHV A;  4DL7 A;  4CLF A;  4ZLP A;  4FS1 A;  2X3G A;  3AY0 A;  1JIH A;  8RUC A;  1WOS A;  2FD2 A;  1NZA A;  2YQ0 A;  1SKW A;  1FDD A;  1JXE A;  3NGU A;  1REV B;  4CRJ A;  2OLW A;  4F4W A;  2G13 A;  2QYG A;  2XI3 A;  4O44 B;  2OD6 A;  4N7T A;  2KYX A;  1UJ6 A;  4UZC A;  2LMI A;  4RW8 B;  4IDK B;  1QVG R;  3FBE A;  3VVT A;  2V8P A;  2HWI A;  3HD1 A;  4LIR A;  4IOC Q;  2ZD1 B;  1NK7 A;  4MKB A;  3IWN C;  3QO9 B;  2YNF B;  3G82 A;  4DL5 A;  3J81 j;  3I0R A;  3RW6 A;  4ELT A;  4M8L A;  3CJ4 A;  3Q0A A;  4AUK A;  4KR0 B;  3OFG A;  4ZVR B;  3MCM A;  1JLQ B;  3UCZ P;  1FTR A;  1XC9 A;  4J9L A;  3G6V A;  2ZEJ A;  4QCL A;  1XIQ A;  1TKX B;  3IG1 A;  4NE9 C;  2E5L F;  3TZX A;  2QIF A;  4LF6 F;  3L4B C;  1D8Y A;  4XPE A;  2ZJQ Q;  2CQ4 A;  4G1I A;  2YKA A;  2JRS A;  1S72 S;  4I68 A;  2VOO A;  1J5E J;  2BE9 B;  3NBP B;  4CP5 A;  3PHE A;  3M8Y A;  2J8A A;  4X62 J;  4B3S F;  3PW4 A;  4C4W A;  1H72 C;  2W2N P;  3M8Q B;  2WB1 D;  3ZO7 A;  1U1N A;  2KFZ A;  5KFH A;  1B7F A;  1ZM2 A;  2XCA A;  1N34 J;  2FJX A;  1IBM J;  4L3N A;  3CSK A;  4YDX A;  2IM1 A;  4B3M J;  4CLZ A;  4MKA A;  4X4O A;  1SB6 A;  1URR A;  4F02 A;  3R8Y A;  2FJA B;  2XMT A;  4JV0 A;  4UT4 A;  3I0S A;  5J2M A;  1MML A;  2E29 A;  5H1S V;  4X64 F;  2FC9 A;  3D6M B;  3THP A;  4WF9 Q;  3GSI A;  1LW0 A;  3D28 A;  3BQ1 A;  3ENW A;  3AA8 A;  2D3Z A;  4GRS A;  2XWX A;  3MF5 A;  1GMW D;  2GZO A;  2K1R B;  5I3Q A;  3H59 A;  3MM9 B;  2AF6 A;  1Y10 A;  4AQY J;  2BAB A;  4JUZ A;  5F8L A;  5A8R A;  4YS2 A;  1HI0 P;  1RZM A;  2F8H A;  1HL6 A;  2WVE A;  1CSJ A;  3MEG B;  1FEH A;  4OI0 A;  2HZA A;  3CD6 S;  2YPY A;  2V8V A;  4X4R A;  4A46 A;  1FWK A;  2F65 A;  5DM7 Q;  3KHR A;  4ZPA A;  3GYG A;  2HFU A;  2QGF B;  1BQN A;  2ZE2 B;  1Y3J A;  2E1C A;  2DHG A;  2LEC A;  4FF1 A;  1BQM B;  2YWF A;  3H4B A;  1RAE B;  2YKM A;  2VAS A;  2HQI A;  5CYM B;  4W98 A;  1WOO A;  3DNC A;  4IO9 Q;  2LA4 A;  3Q2S C;  3HSG A;  4DV1 F;  3IM9 A;  2DIU A;  4M5J A;  4U9R A;  2VON A;  4LFC F;  5A0Y B;  4OJ1 A;  5EUH A;  1CJT B;  3R3T A;  3NL0 A;  1CJU B;  1SQF A;  3MUM P;  3V6D A;  5HQL A;  4NLW A;  2AMC B;  3P8B B;  3HVA A;  3KNA A;  1W26 A;  2MZ1 A;  3TJA A;  2Q43 A;  2CYY A;  4LMZ A;  5THW A;  2IMW P;  4ECR A;  2DNZ A;  2QA2 A;  2FHJ D;  3RR8 A;  2GCF A;  3D0G E;  1K1Q A;  4HTI A;  4G65 A;  3HVT A;  3LQV A;  3SCK E;  5D4O A;  2HFO A;  3FRY A;  4OX9 F;  5EWE A;  1RWO B;  5LMU J;  5ADZ A;  1NK8 A;  4JOU A;  2DNG A;  1S1V B;  4NMX A;  4HH0 A;  4B9V A;  3KHH A;  2ROG A;  4XAK A;  1RHK B;  2KU7 A;  5GAH I;  5GAG I;  2XG8 A;  1RT6 B;  1NDL A;  1JMT A;  1VQL S;  4C0O C;  1KOO A;  3K8W A;  4K4Y A;  2EK1 A;  3OQ2 A;  3W7B A;  1HQU A;  2MPU A;  4J9S A;  4JI3 F;  2ZZT A;  4UZB A;  2BOP A;  3ZZ0 A;  1L3S A;  4K59 A;  5I3U A;  4PYA A;  1FRK A;  3T1Y J;  1HBN B;  1WD6 A;  4CH1 A;  3ILJ A;  3KJN B;  3M30 B;  9RUB A;  4IH6 A;  5H9F J;  2BAN A;  3VGT A;  3D2W A;  1NDK A;  1ZM3 A;  1F5C A;  3HK2 A;  2FJD B;  3PKY A;  4QWB A;  5HBM B;  4DSL A;  2KXF A;  1PAE X;  3LP0 B;  3TZW A;  2W2M P;  3IRW P;  5HMX A;  3FVY A;  1U48 A;  1O8B A;  1F9F A;  1VQ9 S;  2RT3 A;  3ILI A;  1S7H A;  1U47 A;  2DH8 A;  3TQ1 A;  2PMW A;  4N76 A;  2CQB A;  5KFL A;  2ZJR Q;  1MRO B;  1R7I A;  2J9E A;  1S49 A;  3PV8 A;  4KB7 A;  4JI2 J;  3NEK A;  1FKP B;  1NHU A;  4LF8 J;  1WWH A;  1XWL A;  1N5Y A;  2J6U A;  1MWZ A;  4RW9 A;  2F8E X;  1HNW J;  1ZZF A;  2EG2 A;  2RE1 A;  4ED0 A;  4FDF A;  4Q7A A;  3FUY A;  3CTR A;  1T9V A;  3KK1 A;  3GIM A;  3CJQ A;  4TY9 A;  4J37 A;  1MMN A;  4PRF A;  4I2P A;  4NI2 B;  3WZ0 A;  4OMF G;  3ENA A;  1RQ0 A;  3UN5 A;  3GJT B;  2AD9 A;  5HLF B;  1LK7 A;  2CQG A;  4CH7 A;  1FFS B;  3R6G B;  2B4P A;  2CPD A;  4WWS A;  1PJ6 A;  4IO1 A;  5D8H B;  1M5V C;  1VHF A;  3C16 B;  3HD2 A;  4O0I A;  4PUO B;  2D9P A;  4Q5V A;  1U6F A;  3WDO A;  2H48 B;  1N0V C;  4ID8 A;  2XHC A;  1WEY A;  4H4O B;  4DXL A;  2J7K A;  3GJR B;  3CC2 S;  1GH8 A;  1UZH A;  3FKB A;  2UXD J;  4B3O A;  3DM2 B;  5L8R C;  1YBU A;  1RYR A;  1NB7 A;  3ZZU A;  1PO6 A;  5F9L A;  4U6P A;  1HYS B;  3VAK A;  4KC5 A;  3CCR S;  2ZH2 A;  3ZTR A;  1T3O A;  1T95 A;  4KV8 B;  1O0P A;  3WC2 A;  1Y4Z B;  1UVM A;  2R3V A;  4F2S A;  4OJH A;  4ETX A;  2EVZ A;  3H5S A;  5DLF A;  5T7L B;  5IT4 A;  4DN9 A;  3SCJ E;  4H4M B;  1TL7 B;  1X9S A;  2MYF A;  2N7C A;  3IRX B;  5KFV A;  4TY8 A;  4OYI A;  4IRC A;  4HI2 A;  4OZJ A;  3OTO F;  4F50 A;  1VQP S;  3C3L A;  4DPO A;  1FX4 A;  4ZP6 A;  3G6Y A;  1KTV A;  1ZM4 A;  3FSI A;  5D3G B;  5B08 A;  4PAB A;  2ZM6 F;  1VS3 A;  3VF0 B;  2BRL A;  4QYR A;  5LL6 d;  3H98 A;  1FEE A;  3NOC A;  3M2U A;  4QWD A;  3S01 A;  3GON A;  2GGP B;  2BQU A;  3DU6 A;  2AEF A;  4Y2A A;  1FNM A;  1N32 F;  5KFF A;  3BYP A;  2GW8 A;  1S1T B;  2QMX A;  4LUB A;  1K73 T;  3D6H B;  1ZZN A;  2BEF A;  1A7G E;  3HSD A;  4DPY A;  2ADC A;  4HKQ A;  3HDS A;  1MU2 A;  2VH7 A;  4PAA A;  3AA9 A;  5KT7 A;  3LAN A;  2QYC A;  2L9W A;  1XNQ J;  3IBW A;  4PG6 A;  4ED3 A;  1NSP A;  5CYQ B;  1FE0 A;  3PNI A;  3TAM A;  3MR2 A;  3OFF A;  3ITH B;  2CQ1 A;  2P6T A;  1Q78 A;  3PAC A;  3SEO A;  1UFL A;  2PA8 D;  2QMU B;  1HW8 A;  4RKU C;  3J7A 1;  2CQD A;  1SL2 A;  1U8W A;  2IM2 A;  4V1A k;  1XQI A;  3HHL C;  2HS0 A;  2GQQ A;  3PIP Q;  3FDS A;  3AXK A;  3BJY A;  5E3C A;  4JI4 F;  3FEZ A;  1ZPV A;  1YJN S;  4WXW A;  1PIE A;  3EVO A;  1IM4 A;  4ER8 A;  3RRG A;  4OFZ A;  3M32 A;  3I5C A;  5FD1 A;  1RKI A;  2IPO B;  2MKJ A;  3MAH A;  3DN9 A;  1PCA A;  2VPY B;  2BJ8 A;  2UUW A;  3UCU P;  4CZC A;  1IKX B;  1HQE A;  4ZLL A;  4AT1 B;  3G86 A;  4QBU A;  1RU2 A;  3D6F B;  2HRT A;  3M8P B;  4JI5 F;  1M1K T;  3I4P A;  2WK4 A;  1FE4 A;  3QJL A;  1SCJ B;  5H9E J;  1ICE B;  2A0F B;  2OI2 A;  2YX7 A;  1WSR A;  3CJ5 A;  4P2S A;  4Y2C A;  1T02 A;  1IQZ A;  2HW3 A;  2QL7 B;  2ZZM A;  3W61 A;  2DO0 A;  1FRL A;  1NND A;  1G3O A;  1U6Z A;  4ID5 B;  3H5U A;  3KJF B;  3FBB A;  4DPX A;  1HWU A;  5HQM A;  1FTC A;  4AFF A;  2XMU A;  4HH1 A;  1WHX A;  4QJV A;  1CJK B;  2GQ2 A;  4X2B A;  1HWK A;  2VKZ G;  3VWS A;  3TJ8 A;  1SIZ A;  4DL4 A;  3DI6 A;  3UD3 P;  4BWJ A;  2KTQ A;  3THT A;  1CEZ A;  3OR1 B;  3B82 A;  3TYT A;  3BQ0 A;  4DV3 F;  1B0T A;  2VG5 B;  5F9N A;  4CLT A;  5B0C A;  3LW5 C;  3UDE A;  1R6Y A;  2KFN A;  2KL8 A;  2CG8 A;  3DLH A;  3PR4 A;  1F1B B;  4OHX A;  1UEU A;  2KVI A;  1R0A B;  1M90 T;  1JKH A;  4LF7 F;  1RWM B;  3DRP A;  4OQJ A;  2FY8 A;  2R2R A;  4UY8 5;  3FJ2 A;  3E2E A;  1RT1 A;  1LK5 A;  3OVS A;  4NOH A;  2ZDO A;  5EDW A;  4Z7C A;  1RT4 B;  3DRR B;  3R6L B;  1V5V A;  1UVN A;  1FRH A;  4NA2 A;  3T1H J;  4U8Y A;  1O6X A;  4M63 A;  4AXI A;  3JSY A;  5L38 A;  3UVJ B;  1BLU A;  4MMO A;  1FKA F;  4V19 X;  2ZZN A;  1LWE A;  1UZD A;  5ETT A;  4AL5 A;  2AQ4 A;  2ZOF A;  4DHV A;  4O3N A;  1Y7P A;  3MD3 A;  1W7W A;  2G1H A;  1IN0 A;  1KDN A;  2XWY A;  4PQU A;  1UCN A;  3KLE A;  2RJZ A;  4N8N A;  4I67 A;  1F9H A;  2DNQ A;  2WOM A;  2FJB B;  1WOR A;  1LEO A;  2BJ3 A;  2VIH A;  1VQY A;  4D3G A;  3I9Z A;  2LEB A;  1Q1K A;  2B9E A;  4KKO B;  3HT0 A;  1LW2 A;  5GMK a;  3NGK A;  1KLM B;  3QRQ A;  3NS7 B;  2PMH A;  3BV8 A;  3K0J A;  3IS9 A;  1VJW A;  4PXD A;  1RJJ A;  1PG5 B;  2PII A;  2WSC C;  1ZYQ A;  1VLY A;  1YDL A;  4DJB A;  4ENO A;  3GP9 A;  1GMW A;  1X4B A;  1XEZ A;  2PE8 A;  3GV7 B;  1R43 A;  2Z2Z A;  2LVW A;  3BYR A;  2UZA A;  5KFN A;  3TNV A;  3H2V E;  2CA9 A;  1HNW F;  5J2Q B;  3FCH A;  4LF9 J;  1VIS A;  1XNR F;  3BO3 A;  1NUE A;  3EZ5 A;  4B9T A;  4NLV A;  4FPR A;  2ADB A;  4DV5 J;  5KFJ A;  1GT8 A;  4OIX A;  3BSO A;  2G4B A;  2QX0 A;  1YI2 S;  2XB2 D;  3D68 A;  2QE5 A;  2BKP A;  8ATC B;  3RTV A;  1VC5 A;  1S76 D;  3L7U A;  5J2P A;  2KXN B;  4YY3 J;  3QPI A;  4C7Q A;  5F0W A;  5B0B A;  3TRG A;  3BEG B;  2F4F A;  2RDI A;  1MNE A;  3H40 A;  1NME B;  5EN1 A;  1R8B A;  5BR8 F;  1SUQ B;  2ZH9 A;  3TI0 A;  2A1B A;  2AHO B;  2QLX A;  1TKD A;  4X65 J;  2EFO A;  4KPC A;  1FDB A;  4DR5 F;  4ZJL A;  3CDA A;  2YNI A;  3G6X A;  5HP1 A;  4LFB F;  2DY9 A;  3BSC A;  5SZT A;  3JS9 A;  3A8E A;  3N79 A;  5IWA J;  2H5E A;  1NDP A;  2XYP B;  1N0U A;  2R7V A;  5KFI A;  4I56 A;  1F3V A;  4TNO A;  4MFB A;  1JJ2 R;  1XMO J;  3RAQ A;  1OIA A;  3QT6 A;  2CZ4 A;  2FHJ A;  4PWD B;  5E3A A;  1NPK A;  3F73 A;  2UUA J;  5KFB A;  3MMA A;  4XDC A;  4U67 Q;  3CJK A;  2A3J A;  3OHA A;  1IJE B;  2J9D E;  5CHC B;  4Q2M A;  4Q0B A;  4B9M A;  2JVR A;  2G0I A;  1C1B A;  1VQM S;  2BX6 A;  2NUH A;  2XM3 A;  3MUV P;  3K89 A;  1I6J A;  4PG8 A;  4HT5 A;  3N0V A;  1S4F A;  3SFU A;  3DDN A;  4NEY A;  4C97 A;  4UF4 A;  1RYS A;  2W1B A;  4X4V A;  1YBT A;  2ZVI A;  2LU2 A;  1NU4 A;  3KTQ A;  3EDQ B;  1RT3 B;  3AXM A;  3MM6 A;  1M0S A;  1OS5 A;  3NOG A;  4LRE A;  1PC4 A;  2PT0 A;  4DR1 F;  3MTJ A;  1QD1 A;  3VTI A;  5B7W A;  3HFK A;  1NB2 A;  3CCE S;  2ASJ A;  2YNG B;  3OD2 A;  2BDP A;  3CJT A;  1LNQ A;  3Q23 A;  2B4O A;  3MM7 A;  4Q8F A;  2DIV A;  2AZ3 A;  4YB7 A;  1SL0 A;  3BRE A;  3TAR A;  4O23 A;  1VOM A;  4KTQ A;  4OI3 A;  4CYU B;  2E9T A;  3EXY A;  1ZS6 A;  3NNC A;  4LT6 A;  3AHP A;  4WK3 A;  4KHR A;  3T6B A;  2HBZ B;  1RAH B;  1B7Y B;  2U2F A;  1CC7 A;  2RQK A;  2W2O P;  1JLF A;  3DOK A;  1PSD A;  2QLF B;  4DV4 F;  4F04 B;  1KP6 A;  5ETN A;  3SQG A;  5ETM A;  5LXY A;  5KOW A;  2N3L A;  3Q8V A;  1Z1Z A;  3OR2 A;  1BWE A;  1VCT A;  4RNF A;  5IC4 B;  4JI0 J;  1GXL A;  1V3S A;  1WC6 A;  2JWN A;  4M5D A;  2UV8 G;  1RT2 A;  4F8R A;  1S0N A;  1RBO B;  3FZB A;  2KT5 A;  3B8H A;  3CO9 A;  2MQM A;  1S0M A;  3PEH A;  3DHX A;  2V2Q A;  2IC3 B;  1I94 F;  5JUM A;  2DNN A;  2IM3 A;  2F7V A;  2P2C B;  5ETP A;  1FXL A;  1F60 B;  4RW6 A;  4WFA Q;  1SKU B;  1XTZ A;  4A8W A;  4LBH A;  2MTL A;  1LKZ A;  1S59 A;  4OLP A;  1HMV A;  2NPF A;  2RB7 A;  3A8K A;  1U09 A;  2V2Z A;  4P71 A;  4K4T A;  3DRX A;  2OPR A;  4A8K A;  1NJI T;  1HNX F;  3CIM A;  5IOL A;  5AE3 A;  4L3K A;  1HNZ F;  4NWB A;  5KFA A;  2M3D A;  3FCW A;  5E41 A;  4F67 A;  4P7V A;  1H74 A;  2M52 A;  3G82 B;  1NJX A;  3I0R B;  1HI1 A;  4ECQ A;  2XS2 A;  3QBC A;  2WW4 A;  3SCL E;  2MDA A;  4TVA B;  3BGO P;  1J5O A;  1WDT A;  3N9U C;  4XDD A;  3HZG A;  4O44 A;  1V3R A;  3BKF A;  1SPB P;  5K5M A;  1JJH A;  4WTY A;  3I31 A;  4IDK A;  1UVL A;  5GAE U;  2R7R A;  1MN9 A;  2LXF A;  4EWT A;  7AT1 B;  3UN3 A;  1HWI A;  1N33 F;  4NCA A;  4J9M A;  1WTF A;  3EGV A;  1QUV A;  3MFH A;  3AB2 B;  4YR0 A;  1ZH5 A;  3KDO A;  1K8A T;  2L08 A;  1RA7 A;  2YX1 A;  2D9O A;  5KT3 A;  4PCQ A;  4YFU A;  4URS A;  1OQ6 A;  1OSC A;  2KZZ A;  4DR3 F;  2VQF F;  4DFK A;  1YJR A;  2B56 A;  5KFZ A;  1U7L A;  2DEI A;  2V0N A;  4C6A A;  4FXW A;  2J0W A;  3A1Y G;  5BXI A;  3FSY A;  1K47 A;  5T41 A;  4LRA A;  4UY8 T;  4RUC A;  2KYZ A;  5HO4 A;  1Q82 T;  3TEH B;  2P9G A;  3AT1 B;  2KO1 A;  1WC0 A;  3I0S B;  2QN6 B;  5D4N A;  4XO0 A;  1VQO S;  5J2M B;  1OPZ A;  2XGP A;  2IJF A;  2CZ9 A;  5KT2 A;  1APS A;  2IYG A;  3OPK A;  4WFY A;  1D8Z A;  1LW0 B;  1VRU B;  4JV1 A;  2EC0 A;  3MFI A;  8AT1 B;  3T6J A;  2VFU A;  1OO0 B;  1C4A A;  4RU9 A;  3T19 A;  3MPU B;  2ROP A;  5E33 A;  3UD4 P;  1JLC A;  1M5P C;  1RE1 B;  1PYS B;  4NLS A;  2HS4 A;  5A8R B;  1UVK A;  4RR5 A;  2KJV A;  3KJQ B;  5D15 A;  4R25 A;  4DV0 F;  1C0U B;  3F0N A;  3RBE A;  1UTA A;  4PWW A;  3N01 A;  3N4W A;  3CCU S;  2OH2 A;  2J0X A;  3O1L A;  4J90 A;  3EZO A;  2A2C A;  3BPS P;  4M5L A;  2CPJ A;  4Q45 A;  3KKF A;  1CS4 A;  2GAH C;  2JC1 A;  2K3K A;  2RU9 A;  1X31 C;  1BQN B;  4A4J A;  1UVI A;  1UEV A;  2IM0 A;  2YKM B;  1U1Q A;  3P5B P;  3RW7 A;  5KFC A;  4JI7 F;  1KC8 T;  2PI4 A;  3ULH A;  1SC6 A;  1HKA A;  4DG1 B;  5B09 A;  1S9F A;  5FII A; 
#chains in the Genus database with same CATH homology
 1QTN B;  4DCO B;  1RWK B;  3EDR B;  2QL9 B;  4ZVU B;  2FQQ B;  2DKO B;  3KJF B;  2CNL B;  4LSZ B;  4ZVQ B;  3KJN B;  2C2K B;  2CJX B;  1I3O B;  2P2C B;  3R7B B;  2XYH B;  2QLJ B;  4DCP B;  1RE1 B;  1PYO B;  1SC4 B;  4ZVP B;  3GJT B;  1RHM B;  2CJY B;  3R5J B;  1RWX B;  2QL5 B;  4ZVO B;  3R6G B;  4DCJ B;  3KJQ B;  2C1E B;  1RWN B;  5K20 B;  1SC1 B;  1RWP B;  1QDU B;  2HBQ B;  2CDR B;  2HBZ B;  3GJQ B;  2C2Z B;  2H5J B;  3R7N B;  1GFW B;  1RHQ B;  2CNK B;  1RWV B;  2H48 B;  3P45 B;  1I51 B;  2H65 B;  1NME B;  2Y0B B;  3NS7 B;  1RWO B;  2C2M B;  2C2O B;  3GJR B;  2QLF B;  2XZT B;  3QNW B;  1F9E B;  4ZVR B;  3D6H B;  1RWW B;  3R7S B;  2XZD B;  3RJM B;  3SIP B;  2HBR B;  3IBC B;  1RHK B;  1RWM B;  2CNO B;  2CNN B;  2XYG B;  3D6F B;  2Y1L B;  4ZVT B;  1PAU B;  3D6M B;  3P4U B;  2QLB B;  1RHU B;  4JB8 B;  5IC6 B;  3EDQ B;  2H51 B;  1RHR B;  5IC4 B;  2H4W B;  1ICE B;  2H54 B;  3GJS B;  4ZVS B;  3R6L B;  2HBY B;  1BMQ B;  1SC3 B;  3IBF B;  2H4Y B;  1RHJ B;  2XYP B;  2QL7 B;  2H5I B;  1IBC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...