2H65B

Crystal strusture of caspase-3 with inhibitor ac-vdvad-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
b'KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords caspase-3, p17 subunit
publication title Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h65B00
3EDQB 2XYHB 1RWMB 2H65B 4ZVQB 4ZVOB 1RWOB 2HBRB 5IC4B 4ZVSB 3SIPB 3R6LB 1RHJB 1RHQB 3KJQB 1RWXB 3GJTB 3D6MB 3RJMB 4JB8B 2HBYB 1RHRB 3R7SB 1SC3B 2QLFB 3R6GB 1NMEB 3R5JB 2CNKB 2H5IB 2QL9B 2QL5B 2XYPB 2C2ZB 3IBCB 4DCJB 1RHUB 2CJYB 2Y0BB 2C2MB 4ZVRB 3EDRB 2CNLB 1RHKB 1SC4B 1RWVB 2QLBB 3KJFB 5K20B 3KJNB 3GJRB 5IC6B 1RWNB 1PAUB 3D6HB 4LSZB 1I3OB 2P2CB 1RWPB 2C1EB 1BMQB 3R7NB 2CJXB 1QDUB 4ZVTB 1IBCB 2H48B 3IBFB 2H4YB 1RE1B 1I51B 1GFWB 1PYOB 2XYGB 3QNWB 1QTNB 2H51B 1RWWB 1RWKB 3NS7B 2Y1LB 2H4WB 1F9EB 2C2KB 2C2OB 1SC1B 2QLJB 2H5JB 2XZDB 4DCOB 2H54B 2CDRB 3R7BB 2CNNB 2QL7B 3GJSB 3GJQB 3P4UB 3P45B 2HBQB 3D6FB 2CNOB 2HBZB 4ZVUB 1RHMB 4DCPB 2DKOB 4ZVPB 1ICEB 2XZTB 2FQQB
chains in the Genus database with same CATH superfamily
4YHHF 1RISA 2FTRA 1JLFA 5KG6A 3BJYA 4BWJA 2M88A 1WI6A 1NK7A 3OL9A 3ETMA 3B6BA 1C0TA 3R6LB 3OLBA 3ZTRA 4J37A 5DDRC 2HVIA 2XWXA 1TQLA 2NPFA 3R7SB 3U1MA 2VPZB 1VBYA 1TV6B 2C3OA 4UOCA 3JQJA 3IBCB 2ZH1A 4USUA 4ZP8A 2CJYB 2QC3A 3HF5A 2GC8A 3VAHA 4RW7A 2KU7A 4RWWA 4ZP7A 1JLGB 2AIRB 3Q24A 2ZWPA 1L3VA 4N8NA 3BPDA 2QMWA 3J81j 1FXRA 1CBKA 2ABYA 8RUCA 1IBCB 4XO0A 4LF1A 5HN0A 2WRMA 1NSKL 2W4DA 3EGVA 4LFAF 2UV8G 1SKWA 2ZH7A 1SC1B 4HDHA 3GIKA 2CPIA 1XEZA 4IH5A 3U27A 3N79A 3DLBA 1OS5A 2BM0A 2B8PA 3DU6A 1NKEA 3IG1A 1TMMA 4LIWA 3WIVA 4NCGA 2D41A 5D4PA 4DX8H 5KT5A 4Y2CA 3L7PA 3TZZA 1J5OA 1H0HB 2QMUB 3H5SA 4OJ3A 1D0EA 4YEAA 4IH6A 4OYBA 4TY8B 1H2TZ 2XCPA 2G1HA 4DUZJ 1HWJA 1N5YB 3GMGA 3G96A 4MYUA 4F4YA 3FSIA 3J7AN 2MKSA 1MLAA 4PKDB 3GYXB 3DNCA 2C22A 3ITHB 5IC6B 1HQUA 5T7LB 2DJWA 3OHBA 2WVBA 4DS5A 4DV3J 2HZVA 4DF4A 3G2XA 4DV5J 3QNWB 4PEOA 3ADAC 1C1BB 6FDRA 1WG4A 3FNNA 3TJAA 3SEOA 4DCOB 1EX8A 4BC7A 3E01A 4G1IA 4LMZA 4Q2LA 5B7WA 5B09A 3U1NA 3M32B 2DY9A 2HVDA 2QGFB 2IVFB 2XEXA 2IJRA 1RYSA 2XBPA 2EFNA 5B0AA 2V4QA 3P49B 4QWDA 4ZHRA 2HWHA 3ISNC 2AU0A 1SIZA 2Q6BA 1RHRB 1FDDA 1MU2A 3SBMA 1JLQB 3HHEA 4KKOB 3PZPA 3CDEA 2HGMA 3Q8YA 1KRPA 1Q0NA 3QSIA 4PR6A 2A6MA 1YBTA 2ZZTA 4MFBB 3IXQA 2GO8A 4NCBA 1OY8A 2CQBA 4JI3F 3PKYA 3FBEA 4A8MP 2PMHA 1JLAA 5EX0A 2RVJA 2QA1A 4KQZA 2OAUA 2HNDA 2FY8A 2EC2A 1RTJA 3MR3A 2IMWP 3M30A 1LWXA 2AF6A 4DL0C 4CQ1A 3ONQA 2UVWA 1B4SA 3AB2B 5HI7A 3US5A 4OLPA 4FPIA 1N88A 1S57A 1LFWA 3BGRA 4F2RA 3BSAA 4K50A 3VGTA 2HVEA 4DV0J 4I2PA 3AFGA 2RHQB 1N5QA 2KT2A 2JEGA 1FI4A 2YTCA 2CPZA 2ZH2A 5L46A 2W2NP 1U47A 4Z37A 3CJ0A 4ZVSB 1LV5A 1ZH5A 1U8WA 2ROEA 4M94A 2P9GA 4FXWA 4WJBA 2HS4A 4DR1J 2VOPA 1HHTP 4JB8B 3FBFA 3IM9A 3GIJA 4QWAA 4NXNJ 2G13A 1IWAA 2G0IA 3O2IA 2CG4A 2QL5B 2BMBA 1LKZA 1TVRA 1A7GE 4HKQA 4AL6A 2C2MB 4QYRA 1ZPVA 5KFKA 1X60A 2HFUA 2OUGA 5KG3A 4U7CA 5J1EA 3CW2C 5A6PA 3HZGA 4I64A 4YMEA 1N8RT 2MZ1A 5DG8A 2J0SD 1P27B 3KK2B 5F8IA 1M90T 4ZCKA 1O6XA 4ATNA 1T05A 1BXNA 3I5AA 3OTOF 1WHYA 2J7WA 2R7WA 1PBUA 3NBPB 4I4BA 3GV7B 3Q8UA 4K8RA 5DLGA 2O66A 3J80U 2V8VA 1ELOA 4ZVOB 5U47A 4AQYJ 3T19A 1RAFB 1E6VB 4WU2A 2GZOA 4PXBA 2XNRA 1V5IB 2AMCB 3HMJG 2MSSA 1MMNA 4PUOB 4O4GA 4B3MF 1VOMA 3Q8PB 1X4DA 4KGKA 3UFCX 1VLYA 1H74A 3WIUA 1KFDA 1VBXA 4L73A 4RU9A 5CAAA 4DV6F 1V3SA 2DRAA 5C25A 5D15A 2UXBJ 4EYHB 1N32J 1OSCA 3M1VA 1CSJA 2FLPA 1IBMJ 3NOGA 5FD1A 2YX1A 1DHMA 4NLTA 2J8SA 4ETXA 2WZ1A 5CD4H 1TK0A 1OYEA 3UVJB 1B70B 4JV2A 1T02A 4C7QA 2ADBA 5J2QA 4NLRA 3Q89A 3DI6B 1NU4A 2KRRA 5H1SV 2Z4PA 4GKJF 1YI2S 3BN4A 4B9VA 4J9QA 4ECUA 2U2FA 1RB0A 3PFOA 3B4MA 5B0CA 1YZ6A 1XBWA 1K0TA 3JXOA 2V67A 3FK4A 3ZXWA 3CJ8A 3MOZA 2CRLA 1AFIA 2YWHA 1JLBA 2B7CB 3DXBA 3D54A 3O5TB 2BX6A 2ZNYA 1HARA 4RLEA 4IG3A 4USHA 2E5LF 5J2NB 1GXLA 4U8YA 1RGVA 5DG7A 3FFIA 3R5DA 2EC0A 5EHHA 2V2QA 4EEYA 4USKA 4C2MA 2QE5A 2HHXA 5KFZA 3PW7A 1GMWA 4F04B 4WFBQ 1FK9A 1MMLA 3G6VA 3LP0A 2ZHAA 3C46A 1X9MA 1RTIA 3W61A 2GHPA 1SH3A 1Y3KA 1F9EB 2NZCA 3QZ8A 1FEHA 1YK9A 1P8GA 1T9WA 3MECA 2XLKA 1U1NA 2XZWA 1SJ4P 2OTLS 2QX0A 3JTOA 2VKZG 4OZ1A 2FQQB 2MKYA 2MQPA 4K0KJ 2HHHJ 2PFDA 5K14A 1M5HA 2RAQA 2BJDA 1S1VB 4K4XA 3FSXA 3Q0AA 3L95X 1LWCB 4AXJA 1N5SA 4NL5A 4Y34A 1T9UA 4RW9B 4MTPA 4EBEA 3DRXA 3WC0A 1H6KX 1WSRA 1JXVA 4CTAB 2AEJA 5ETKA 1S1WB 2XLIA 1UFKA 2YNHA 1KDNA 3PJWA 4X2BA 2U1AA 4CIOA 4DSEA 4KH0B 2ZH9A 1RT2B 3PRBA 4ZCIA 4DPYA 1CULA 2DR6A 4G1PA 1WC4A 1UEKA 2JSXA 4JI2F 3G9CA 3FRZA 1BGXT 4OX9J 1FDAA 1CG2A 2JNJA 3P6YC 5F0UA 3KHGA 5C24B 2COLA 5A6WA 2IVMA 2QO3A 3HD1A 2J9DA 3TX0A 3CC4S 3C14B 3CJ5A 4DX6A 4TXSA 2MLZA 4BLGA 1YGYA 2CQ1A 3C2PA 2L08A 5BYSA 4H4OA 1XN9A 1RT1A 3N6LA 4C4WA 1T9XA 1IR0A 2VFTA 2Y0BB 4WK1A 1HYSB 1H2VZ 4BWMA 2AYEA 3UD3P 2LEAA 2F4VJ 1Q7LB 2VH7A 3A3OB 1X4BA 4ID5A 3MM5B 1TU0B 4DEZA 3FVYA 3KG4A 1JIHA 4YY3J 1XJWB 2ZDOA 3NGTA 4NE9C 4QIWD 1KKHA 3KUHA 4EK2A 4DR4F 4MIBA 4FXDA 1IVZA 1JKHB 3PIPQ 3D3CJ 1GAOA 3D1QA 2XZTB 1QTMA 1VQ6S 2RS2A 1L3TA 3H59A 1XWLA 1D09B 4M5KA 3J7YU 1U1LA 3QRQA 2FVRA 1K0VA 5DETA 3HDSA 2VA2A 1K1SA 2VG7B 5KT2A 3TW0A 2V2KA 4WFYA 3LTOA 2ZNZA 3SDEA 3KMQA 1Q79A 3RB6A 4CH1A 2A10A 4Q8FA 3QRPA 4V19J 1ZBTA 3K0JA 3BBCA 4IG0B 1UVKA 4FN5A 4B3SF 1O8BA 1N36J 4NYOA 5KFSA 3MEGA 4X4RA 4IDKA 4X4UA 4HL9A 3IGNA 2C2NA 3OFFA 2QA2A 3W2VB 2K3IA 1FRJA 4A48A 2CPDA 1EB0A 3FMWA 2R42A 5GAEU 2FGCA 1Q81T 4USTA 1NAQA 1N0UA 4EZ6A 2HFNA 1XR5A 4XTTA 2F9JA 3IRXB 1Y00A 2FC8A 3BH7B 3V81B 4QU7A 4RZRA 2ZM6J 2K06A 2HYIB 4DSLA 3Q23A 4FS1A 4RW8B 4ZPCA 1RT7A 2E1RA 1FJCA 4CNZA 2K1RA 1S48A 2DO0A 3J7A1 2HS0A 2FZGB 1WC6A 3M8YA 1RBOB 4LBIA 4C97A 3H25A 2M7SA 3UD4P 3OSPA 3DOLA 3W9HA 4OV6A 4PQUB 3I9ZA 1K73T 3GIIA 3LP2B 5LMUJ 1UCNA 4M5JA 2ZBIA 4DFKA 2O01C 3OTDA 3PYGA 1RTDB 3CD7A 5FLXU 1HLWA 4FYXB 4F4ZA 4IOAQ 1FJ7A 4ENOA 5E3QA 4J9NA 2KKHA 4JYAJ 4KR0B 4CLSA 3N5BA 5E3AA 1JLEA 4EBDA 2I6WA 5HMYA 4R0EA 3KLEB 4WE1A 2FHOB 3TX8A 2JL9A 3K5PA 4TYAA 4Q8EA 3G86A 3KJQB 1JJ2R 3QO9B 4DR6F 3DKDA 1QUVA 2HQCA 1S10A 5ETPA 3DHXA 1FWLA 2MQLA 2MSTA 5K8MA 1QE1A 1NK5A 2AEMA 3DRSB 1VQ8S 3JYTA 3HULA 4DV7F 1O5JA 4DHVA 4PWDB 3HX9A 3EPGA 2KDOA 3D2WA 1TMJA 3BYPA 3BR8A 2QFJA 3G71S 4IFYA 4J91A 1RWPB 1N6QB 3DXSX 3MCNA 1UL3A 4DPTA 2KG1A 4ZVHA 3MUVP 1NXIA 3BO4A 2WB1D 4QQBA 5FDLA 5IT0A 4NZ7A 3UR0A 2GIFA 2LQ9A 4JI8J 4LUBA 1U2CA 4W90B 3CCSS 5KFHA 1X4FA 2HKEA 2JEJA 5A2QY 4L6V3 3AHPA 5ETLA 3I32A 1JB0C 3MTKA 1PYTA 4IO1A 2DXFA 2CVIA 4OI6A 2ACMA 5HO4A 1YSJA 4U7UK 1M5PC 4B9UA 2OJ3A 5AXKA 2ZUGA 1V5VA 4BDPA 4FYWB 2NXNA 3TUIC 3DM2B 1UVLA 2PA8D 4CM0A 2ZH8A 2CQ0A 5GAGI 2Z30B 3FEZA 1VCTA 3BQ2A 3E01B 3NOCA 1URNA 2BE9B 1W7WA 4P72A 2R2UA 3KFWX 4MKYA 2LECA 4O3PA 4DR7J 5DDQC 1I3OB 2KO1A 3FCVA 2OEJA 3BSNA 1RXOB 2KVIA 3BPSP 1SB6A 1R8PA 4H54A 2YWFA 2ZWOA 1I51B 1NLKL 3VALA 3D4JA 2G1DA 4DUZF 2J5AA 3W66A 3DMJB 4UZCA 3LQVA 5JXSA 3SCIE 2QLJB 2DK2A 3Q2TC 2I5JB 2K8GA 2NYIA 4KGVB 1PGZA 1JJCB 4Q0BB 4OHXA 1YG0A 4ES1A 3Q8RB 3K7RA 1VC5A 3VGSA 4F0MA 3CE8A 2MTLA 3F73A 2OPPA 3O3LA 5KFEA 5I3UA 4DV5F 1H7XA 1Y4ZB 1HWKA 4JI7F 2MQMA 3HHLC 3I31A 2ADCA 4ZVGA 5THWA 2ZC4A 2K3KA 3DRPB 4P7TA 1FESA 4F50A 2E1MC 4KHRA 5BYQA 4LSLB 4K7QA 3CT9A 4HVZA 2F8MA 4JI0J 1VC6A 3MM8B 3KJFB 3OFEA 1W2BR 1RU1A 4GVBA 4K2XA 4Z7CA 5CHCB 3R97A 4CH0S 4NI2A 4DWIA 3QAUA 1ZAWA 5L8RC 3MMAB 4DL6A 1NHKL 1I94J 3I0RA 4ECYA 2M4MA 2G9OA 3WQPA 1HA1A 4URSA 3OXFA 1OO0B 3CJKA 3KLGB 1PJ5A 1SH0A 3O6QA 2YNIB 4LF8J 3CVKA 3KNAA 3H5YA 5L1LA 2QSWA 2DIVA 4ZPBA 4OHYA 3VR1A 2Y3YA 2VBWA 2ASYA 3M05A 2MQQA 2Y1IA 2FGOA 1RKIA 5G0RB 2D7SA 3N5FA 4TYBA 2KZMA 2FVQA 5J2MB 3H4DA 2XGQA 4ILLA 4LT6A 1HQEA 5I3QA 2XMUA 3R6GB 5L1KA 1M1GA 1H7WA 1SXLA 2XYPB 1V3RA 4P2FA 4KO0B 3R1LA 4C0BA 1IKVA 4ID8A 1VQLS 1RQ0A 1FRKA 5IFMA 3SCJE 1EQMA 3ZZUA 2WSFC 4I6AA 1VRTB 1PYSB 3BZQA 1NSPA 1YJVA 2MEWA 2DXEA 2ZE2B 4ZP6A 1F1BB 2I0XA 2DYAA 4HTIA 5LMNF 4WFAQ 2XSJA 2QTWA 2H4WB 2PI5A 2B6AB 1AYEA 2D69A 4WWSA 3S01A 4KGMA 3G8TA 4LF6J 3M6XA 2YY3A 5IWAF 3OVBA 3DOMB 2F8EX 2HWTA 5C25B 2AYMA 3BREA 4ILMA 2E44A 2GW8A 3V6DB 2RUGA 1ZM3A 2YH0A 3V4MA 2W24A 3AA9A 2LVWA 2Q3PA 2PMZD 3T9ZA 4B08A 1RTZA 1XNQF 2VBZA 3IS9B 2VFVA 4OYOA 3BH6B 1FA0A 3PX0A 3QWPA 4LRCA 5T41A 2CJQA 1SBRA 2W01A 2XMMA 2DY1A 2UZAA 4O0IA 2YX7A 5C42A 5ITHA 2Y0SD 1RCOB 2B4OA 2EK6A 4DG1A 3RTVA 1XNRF 2AEFA 2GIRA 3CDBA 4DV2F 3RGIA 1S6QA 5J1PA 2DHSA 3D0HE 5JUMA 2ZH6A 1YVFA 3ZTSA 1Q8KA 1XIQA 1HBOA 3N28A 1WC3A 2BW2A 1HNIB 4XAKA 4N8OA 5SUHA 1OPIA 4L3KA 2BANA 3V6JA 2HRUA 1VRUA 2PEBA 2XCAA 4A8KA 2P5VA 2LXIA 2HEKA 1NK9A 2Q6CA 1R0AB 4DFMA 2CNKB 1KOHA 2R7XA 1S1XB 1N0VC 2HMIA 2XMJA 4M5DA 4O44A 1CJTA 1S72S 1RWVB 4PRFA 2HURA 2GX8A 2D3OR 4A8WA 5HP1B 3JQKA 1OSDA 1NEEA 5E3PA 2IHR1 3CB4A 4C3LA 4JI5J 3PEJA 1TL1B 3U02A 1DARA 4B3RJ 5CYMB 1JK9B 1FDNA 1FNXH 1YRTA 1WELA 2AT1B 1MROA 4WFNQ 4M8LA 1GH8A 2ZVSA 2AJ0A 3M8ZA 5I42A 4CYUA 2W9BA 3KK3B 2OIHA 2L9WA 4ES2A 4KRWA 2LXFA 4MKAA 1HI0P 1RA7A 4R0JA 4DLEA 1U8SA 1JXEA 4EBCA 4C8KA 2IDLA 1TAQA 2DO4A 2W9AA 2VHGA 1TELA 2YNHB 2Z2ZA 4WXWA 2V4JB 5M2UA 5G4DA 1S99A 4J5OA 3DYAB 4YHHJ 3LP1A 3IP0A 3NG8A 1QUPA 4N56A 1RHUB 1HNVB 2ZHOA 1M5OC 2VJUA 2C28A 4HACA 3IBWA 2KH9A 5K20B 4JI4F 1EP4A 2YNFA 2ACYA 2DNKA 3PACA 3AODA 3T3FA 2VICA 2B0GA 2BRKA 5DGBA 3M2UA 4CT8A 3M2VA 5DZ7A 3DCAA 2HLUA 1VBKA 2M8HA 3I87A 4XK8C 3GFXA 4OI0A 2Z56B 3KUGA 4WZQA 1WF0A 1QSSA 4RNFA 2CA9A 3HVAA 1F5CA 4OZJA 1K1QA 5B0FA 2HBQB 2MHEA 3QGGA 2QG9B 4LFAJ 2AW0A 4DL2A 4G6VB 2MZQA 3B78A 4RBTA 3RYLA 2XMTA 2AJ4A 4URGA 4NASA 2NPIA 1UAWA 1UWBA 2UXCF 1SJ3P 2IAJA 2IDEA 3I6PA 4ECRA 4M5MA 2LXUA 2O3DA 1B3TA 3HT3A 1UPPA 2FC9A 3CCZA 3CD5A 3KLFB 2ZZNA 2MLYA 3FC9A 2VA3A 1U0SA 3X1LB 3EE3A 1VMBA 1GMUA 1Q5VA 4OFZA 4QW8A 2HRTA 1T3NA 2OO4A 2CZVC 1T8EA 1H72C 1X4EA 4ZCMA 4QPTA 3SDEB 4J9SA 2J7KA 5KG4A 3DGPA 1IKYA 3MMBA 4PXCA 3RRKA 1P1TA 3RB0A 1J5EF 4OYXA 1Y7PA 2IFXA 2Q79A 2LQ8A 3V4IA 2AQ4A 2MGZB 3CIZA 2HHSA 2OFHX 3TUZC 2LQ5A 3FCWA 2ZKUA 5DZ6A 3VVUA 3A3PB 3T6BA 2RH3A 2NSCA 3BGLA 1A9NB 2XNQA 2K2PA 1YX2A 4AE5A 2B4VA 1ZOTA 3TP2A 2GGPB 5L9NA 5IQ6A 1YJNS 1HBMA 3MPYA 3MZIA 2DISA 1Y5NB 2GJ2A 2R8GA 3M2RA 3RBZA 3OR1A 4DQIA 2ZH5A 2CYYA 3DLGA 1GXUA 1TFYA 2Z2LA 2EFVA 3KK1A 1S4EA 3W1YC 1UZDA 1NK4A 4UQGA 1X4GA 1X5SA 4Y6IA 4DV4J 4OYIA 3H98A 1SJQA 1ZZFA 3A13A 1RT7B 4JI3J 1N56A 3NEKA 3NS6A 5RUBA 5KFMA 3UDCA 1TL3A 3SMZA 1UWAA 2HQIA 3JSMB 3CCRS 1SQFA 3IAM9 5LL6d 2P9CA 2IYIA 2V50A 3TNVA 4N5SA 5LSLA 1B64A 1VR6A 3D5MA 1VHFA 4JP8A 3AQPA 2ROPA 2YNGB 2JFDA 4F67A 4CLPA 1D3WA 3ICLA 3QMQA 1U1MA 2VFSA 1SKRA 2AJQA 1DQ9A 4ZVFA 1G3OA 3TAQA 1MWZA 3QBCA 2E1CA 4NLXA 2PMWA 1HBUB 2DNHA 1XMBA 3QRRA 2OPSB 3KDNA 3W5XA 4X4PA 2NUUG 3VZHA 2J0XA 3OR2B 4DL4A 5HQLA 3S7RA 4ELTA 4F4AA 2WCXA 2GVDA 2FLOA 1S0VA 2VDHA 1IKWB 1DTQA 3A8KA 1S1UB 1R6VA 5ETTA 3D6FB 1OY6A 1TR0A 1RHMB 3GTYX 1JJHA 1SQEA 3P8BB 2WVFA 3HKWA 2YQ1A 3UR3C 1S6OA 5LMUF 4W92B 2MKKA 3TARA 3OTOJ 1JMTA 2FJEB 3ETOA 4UY85 3W3SA 2IRXA 2K7JA 1T11A 3FDSA 1S79A 2HFZA 4WTOB 5FDLB 3HVTB 4QJVA 4P73A 1DZ5A 4AFFA 3CWJA 3GYGA 3UPFA 4JYAF 4O3NA 5KFFA 4A4JA 1LWEA 2N82B 4B3MJ 4EWTA 4LSZB 1EAYC 5A8RA 2B9YA 4ECSA 3J80Y 5HVGA 3WDOA 4PWUA 3HFZB 4DV6J 2RKIA 4CO1A 1NZAA 2Y1LB 3KHHA 2MB0B 2VBXA 1BC6A 3GCWP 2NQPA 4RW4A 4YS2A 3PRVA 2GVZB 4C8MA 4C48A 3C6UB 2CPHA 4B3OB 3CCTA 1IXKA 3MR5A 4OI3A 1VDHA 3HHLB 4MK7A 5AE3A 3GSIA 2LA4A 2CWXA 3BYRA 2ALZA 2CQ4A 4DS4A 3KMSA 8AT1B 3HI9A 3LF0A 2G2YA 5A8KB 2MXYA 3N6NA 1GX5A 4B3TF 1FE0A 1BQNA 1S6PB 2BJ8A 4CO0A 4GKJJ 4F36A 1XC9A 4DSKA 3NY0A 2DGVA 1QJHA 4DQRA 3MM7B 4MIAA 2R2SA 1RA6A 2ZOGA 3OXGA 3ELHA 4CO3A 3AA8A 1FKPA 4OYAA 3TVZA 2LEPA 1TKZA 2E1PA 5IM0A 2LEBA 2GMLA 5AT1B 1NUEA 5KFNA 2N4CA 1H73A 2JLFA 1OIAA 5HBMB 1DLOA 2BJEA 5D3GA 3GILA 3MPDA 1RUSA 5EUHA 5D78A 4ANEA 2JLEA 2UXDF 1D9DA 2HVHA 3H7HB 2XZDB 3GCXP 1NDLA 4X84A 5JVGQ 5E0OA 3HCXA 2GIQA 5ETRA 1UMJA 2J9DE 3U7JA 4K4UA 4RR5A 4G1QB 5IXUA 2CJKA 4BS2A 3MAQA 2OPQA 1R31A 1RT5A 1UJ6A 3UNYA 5F9NA 3NCPA 2D1CA 4HDGA 1JQGA 3QSYB 3KLIA 3DLKB 2E7WA 3MM9B 4H4MA 1IBKF 3BSCA 4NI2B 3T1YF 2HBRB 1RHQB 3SXLA 2IJFA 1DFDA 3B82A 3TZYA 4RNOA 2O67A 5JMNA 4N47A 2H5IB 2ZBPA 3PJ9A 1WKLA 4KFBA 5KTQA 3S6EA 4KV8B 4ZVRB 2HNZB 2KI2A 1VQSA 1G2EA 5KFXA 2B56A 4X62F 1YJRA 4X66F 4H4KC 3OD2A 1VI7A 4YUDA 3A4TA 3ILIA 3JSRA 1HWLA 1DBDA 2KJWA 1IM4A 2F40A 2XYGB 3DRYA 2I8EA 2X3DA 1L3SA 3QGHA 2B5JA 2VJVA 1FTRA 1TKTB 3L7OA 3QT5A 2GJFA 2N4DA 2RDDA 2W8LA 1HI8A 5DDOC 4JI0F 3T6JA 2N3LA 2AYBA 3C15B 2QYGA 2ZD1A 1HPZB 3IWNC 3MCSA 2V94A 4DX7A 5CYJA 2H9ZA 3WHIA 4JI2J 1UA1A 4Y2MA 4LF8F 3FMBA 4I7FA 4ED7A 3T5KA 2XSJB 4QWBA 2GQCA 1F5AA 4IYQA 3NMAA 3OUYB 1SV5A 3FSYA 4ALZA 1WG1A 1VGYA 4KHMA 2GAHC 2R7SA 4AL7A 2HAIA 4YR2A 3HD2A 4DV1F 2OKQA 3N01A 3SQGB 3DFEA 4PXDA 1TL7B 3R7NB 3G87A 1YQHA 5K8PA 1PYOB 4QR0A 4UW2A 1ZZNA 2AJ2A 1RTHB 3HO1A 3EXCX 4J9PA 2UUAF 4AT1B 2UVUA 2H54B 2F7VA 3TAPA 4QYZJ 3MM6B 3BS9A 2FHJD 4XIUA 3PX6A 1VQPS 4B02A 3Q8QB 3E3XA 7AT1B 2VG5B 2R8HA 3KNGA 3FUYA 3NL0A 7FD1A 4NLOA 3PO4A 3FEXB 4DR4J 2JX2A 4DG1B 4C0HA 3MEKA 3I82A 5AE1A 2RNEA 2XMAA 1MSWD 2GQ2A 3CPWR 1GTHA 4DFPA 2D9PA 3DRRB 1WOPA 1CS4A 5A8WB 2CJ9A 2RQMA 1KVJA 2F5GA 3IMQJ 1REVA 4ICLA 3QZ7A 2HLTA 2X3GA 5EWFA 2ZZMA 2DR8A 3LPYA 1RT6A 5HMZA 2L3MA 1PIEA 1RBAA 1WF2A 4R5PA 3HHNB 3NWRA 3POTB 5B0GA 3H90A 2ASLA 4KTQA 2HWIA 3TQ1A 2XY5A 4BBYA 2Y8YA 1S9FA 4XPCA 3W60A 1S77D 3N0VA 1EIYB 2CDRB 4EFAC 4P6QA 1C1CB 4J90A 1QVFR 2DRDA 2QL7B 3PKMA 4B3SJ 2IC3A 1SKUB 4ZK7M 4CM2A 1J2VA 2OEKA 2HNYB 1Y11A 5HROA 3L7UA 1W2IA 3DU5A 2JWNA 4FYYB 1SIWB 1F6TA 3P5BP 1NNDA 1OMSA 5AJ3F 1RWXB 3GJTB 3MUTP 1C0UA 3SYZA 3HZEA 4PG4A 4CLFA 1NJIT 1MROB 2IM2A 1RCXB 2NXUA 5I42B 4CYUB 4Y3CA 4WBFA 4YFUA 3OJSA 2FIUA 3GU0A 2XWYA 2E5HA 1PAUB 3HFKA 3D6HB 1B0VA 2VIHA 1X9WA 3K8VA 1LW0A 4Q7AA 5HANA 4WFXA 1JLCA 1IKXB 4YP3A 4PG6A 1CJKA 2HSEB 1KWMA 3ISND 2KFZA 2M9KA 4ED5A 2LYVA 4WXOA 3DLEB 3I4HX 4B9TA 3RUBL 2LFVA 2Y8WA 1RSCA 1GNKA 2VPYB 2KJVA 1UVMA 2YWEA 4ZVPB 3CIMA 2WHOA 4UUXA 4KHPF 2CQGA 1KVKA 2F8HA 1X5PA 1WJ9A 4A46A 4C0OC 5BYRA 1WWHA 2OPRA 5IV4A 1HMVB 4USJC 4NX9A 3SSQA 5DJBA 1Y0HA 1KBRA 2R7QA 4GC7A 3MAAB 2WVEA 4DPOA 3M8PA 2QRRA 5F8GA 5J1NA 3MOJB 2IY5B 2HGNA 4F7VA 2C2ZB 5FLXY 1ULRA 3UDEA 5KG5A 3GR0A 3BF4A 2CKWA 1U0HB 2SXLA 2Z0GA 3UI3A 4W98A 5L39A 4O3QA 3AXKA 2Z58B 1W26A 5KG1A 1S9GB 2VG6A 4M95A 2H1YA 3CCLS 3D0IE 2PDAA 1LW2A 3PYDA 4DQQA 3ET6B 4DV7J 2XMWA 2AJFE 3AD8C 2WSEC 2ZFHA 3TAMB 4EO8A 2IAJB 2YKNA 2CUYA 3TUJC 3J81Y 4DR5F 1MW7A 2W9CA 4UUWA 3Q8SB 1WTFA 4ZS6A 2C2DA 2CNOB 4NA1A 4L76A 1NBEB 1HBNA 1Z1ZA 2HIQA 3NWGA 3MEDB 3QJJA 4WU3A 4KSEB 5HMXA 2EPIA 3AQOA 5E7OB 5IC4B 2Z2MA 3SIPB 1RHJB 2ASDA 2YXLA 3QPIA 1SL0A 4DOZA 2NR0A 4HLBA 4EI2A 1QVGR 1RADB 3G82A 4UT4A 1E6YA 3QJPA 4IFVA 4K59A 4XPEA 1U09A 1VC0A 4LF2A 4M5IA 1N4LA 4CRJA 3MMBB 4PPDA 2ZUAA 1RKJA 2RE1A 2DNMA 1Z2ZA 1ACMB 1U2FA 3GFZA 3GONA 4ZVTB 2HAFA 1KC8T 1VISA 3V4IB 1GFWB 2L9NA 2ILYA 3KLHB 2D3ZA 4OZLA 4J9UE 2OH2A 2HFSA 5GAHI 1BUXA 1CJVB 1K44A 2VF3A 2VC0A 2LDIA 1AFJA 4DLGA 1BQMB 3CCJS 1TV6A 2W4PA 3WC2A 1CVJA 3OR1B 1S1TB 5H9EJ 2BABA 4IUFA 3C6TB 2V4RA 4FDFA 5F0WA 2E29A 2WB4A 2F63A 4F3MA 2PC6A 3VAFA 1UTAA 3X3UA 1KQFB 4JI7J 1TL3B 4YB7A 3JQMA 4A8XA 2BKNA 4NLDA 2HW3A 4RL1A 4ECXA 2JJ4D 3AOCA 1MN7A 3M8SA 1ZYQA 3QJLA 1WKKA 3QT7A 4O3SA 4YR3A 1SJRA 2N7YA 5KG0A 4NXMF 2H51B 4O3RA 3H4BA 3IWLA 4RUAA 1Q5YA 2WOMB 1M0SA 3FZBA 2APOA 4CLTA 2VBYA 2BEFA 4WPAA 1BE4A 2V2ZA 1QAYA 1TUVA 5A0YB 4TY8A 1UFLA 4L74A 5D0RA 1UKUA 5BR8F 2M70A 4CDIA 3R9LA 1R3NA 3DOKB 1S49A 3DDNA 1Q95G 3MHYA 2E9RX 1CEZA 1EHWA 3WBZA 2EFQA 3R5AA 3AXMA 4DV4F 5D4LA 2R4FA 3ITHA 2FJXA 3PX4A 2CADA 5T7LA 1ITPA 5CCLA 3LUYA 2BOPA 2QJ3A 2XQCA 3BDPA 2IA0A 2V8HA 3LW5C 1GEHA 2I9SA 3PIOQ 2OMOA 3VTIA 1HHSA 1C1BA 4PPZA 3QIDA 2QLXA 2BW7A 2IBKA 2JEFA 4USVA 4EZ9A 1NJZA 3M32A 2EFPA 2XS7A 1SI9A 3NXZA 1NDCA 1XMQJ 5HQMA 4I69A 2DHXA 2DTJA 4ZJOA 2YVSA 5I3PA 4M63A 3ZZTA 4LF7F 5CYQB 3LH2S 1IR1A 1IUJA 2CQ3A 4CI0B 1Q16B 2MMYA 2DNYA 5LMNJ 2WVCA 3AJ2A 1X5TA 4HEA9 1U25A 3T5LA 4NLSA 1JLQA 2YX4A 4KKOA 5IT4A 2X7IA 2XYHB 5HLFB 5K9FA 5J2PA 2DGUA 3RBXA 1M5SA 4MFBA 4MK8A 5IWAJ 2RKIB 3UN5A 3IRWP 3PXGa 1GK8A 3ZNJ1 3MEEB 1NCLA 2DR5A 3EVMA 3FBCA 3UDVA 3FBBA 1FERA 4JUZA 1YJ7A 3EWGA 2WBMA 2RF2B 4GO7X 2N3OA 2AZ1A 2PFFB 1XNQJ 3AT1B 3TVKA 2H48B 1CC8A 4C8LA 1X4CA 1VQ4S 1T03A 2QFIA 4TN2A 4P2SA 3I55S 3GG1A 1KQKA 1C4AA 3D1HA 4NOHA 2MZJA 5HAOA 1FKPB 9RUBA 2RHSB 3LOUA 2V9WA 3HSGA 1XNRJ 2DD8S 4DN9A 4DV2J 5CZXA 4U95A 4EU0A 1OQ6A 4K4TA 4NRTA 1RLDA 3FJ2A 3I0SB 3IA0A 1VRQC 4MKBA 3W62A 3THPA 4DDFA 3MMJA 4USMA 5HVFA 2ATCB 4Y2KA 3BN7A 4BCAA 4DBQA 2YWGA 1FNMA 3AJDA 2EWHA 2IM1A 1VHIA 3PDNA 1D1UA 3KHLA 1JNZB 2RMLA 1NB2A 5KFWA 1R8CA 4AYBD 3OQ2A 4M5NA 2Z2YB 1KQGB 3KK2A 1F9HA 1IJEB 2JC0A 3RRGA 2GAGC 1PAEX 5F9LA 4TNOA 3MFHA 3RZAA 3D68A 3PNIA 5A2QU 2OD4A 3NBPA 2BBEA 4P75A 2BRLA 5GMEA 1FXDA 5GAGU 1HWUA 2K7KA 1V3ZA 1OJ4A 4LRAA 2E66A 1U2RA 2R2TA 1EETB 1FFGB 1Q82T 4NMLA 2DPJA 1AROP 2BE7D 2W2QP 2LA6A 2ZKTA 3M4XA 3MR2A 1E6VA 1UFWA 3BO3A 3GV5B 2DNLA 4ZN3A 4PUOA 3NMRA 3TVYA 4EGLA 5KAKA 1OY9A 3RW6A 3DDIA 3BBFA 2PI4A 3M6WA 2DHAA 1SL2A 4TY9A 3NGKA 3FZ2A 3PV8A 3GWCA 4DUYF 3THVA 2KFNA 4N77A 2EKYA 1QAJA 4QOTA 2OELA 4WF9Q 2W2PP 1VQNS 4Y28C 1T3OA 2KFYA 1DAXA 1L3UA 3M8RA 1TKXB 3CCMS 3ILJA 4TU9A 3GV8B 3AJ1A 3UVJA 4YB5A 1FVSA 4OI4A 3VVTA 3DI6A 2KT5A 1FRLA 1Q8BA 4OLOA 5CA5A 2DGTA 3CJQA 1FRMA 3AOAA 4MMOA 1YJ9S 4OJGA 3I5BA 5EWGA 4JI4J 3PHTA 2VFUA 5E5NA 4A8FA 4MAKA 1F9FA 3RR7A 1D8ZA 4NYPA 4E98A 4CWBA 2H3EB 2JEIA 2YKMB 3H20A 2W7PA 3OVSA 1HR0F 1X8DA 2OTJS 1M1HA 2LP4A 3JAMU 5J2NA 1U6ZA 1CJUB 3C16B 4PYDA 2R8KA 1LK5A 4CO4A 3AD9C 1IJFB 1T9VA 4HTJA 1TUWA 1FKAF 3QGIA 3TEHB 3SCLE 2QL9B 1KN6A 1C4CA 2FZKB 2V34A 1X0PA 3TZXA 3EGWB 4RO0A 4U96A 1WD6A 2Q66A 5HQ8A 3MAHA 3MUMP 4YN3B 2UXCJ 2L9DA 4ZN1A 2B9EA 2VONA 3T5HA 5C2CA 1SVDA 3HVRA 1O0PA 4ZP9A 1G6BA 1DTTB 4LF9F 4RNHA 4D3GA 2NXEA 4DPXA 2ZOFA 1YHQS 3QLHB 1VJQA 1VQ7S 2BE2B 1YJWS 1S1VA 4ZPWR 5B08A 2J6SA 3DDKA 2D3O1 3CULA 4ICLB 1LWCA 3R2DJ 2BJ1A 5LSRA 2AD9A 3A1YG 1RZMA 4RW9A 2P6SA 3CCVS 3A12A 2KL8A 3PR5B 5DO2A 4CTAA 1FX2A 3WZ0A 2VUGA 1U6BA 2BJ9A 5KOXA 2W2OP 1D9AA 1XK8A 1J5EJ 2B7BB 3MMCB 1GXTA 1S6UA 1WOOA 1X4AA 3CDUA 5D0HA 1AXQA 1RT2A 4YDXA 1FWKA 3VAIA 1RJJA 2MQOA 2HS3A 4J9VA 1WEYA 1S4FA 5ETSA 4OYPA 4ZITA 4NRUA 1YJTA 1JNRB 5HROB 3QIPB 4KB7A 2CJXB 4C8NA 1KS2A 6FD1A 1KLMB 3BGOP 5DRKA 4U9RA 5C24A 1GTEA 3CJRA 4DN0A 1C0UB 1MWYA 4IOBA 1NJXA 1IQZA 4N76A 4E8UA 3LO3A 3C14A 3D1OA 2ZC3A 2J0QD 3HSZA 1XMOF 2FPHX 1T9TA 1WTBA 3GYNA 2E5IA 2BM1A 1HD1A 1ZETA 3I9V9 3MXHP 2D74B 2DRBA 4LSNB 5LSOA 1HYSA 1WUUA 2MY7A 4LREA 1YBAA 2OSQA 1UZHA 4DU7A 4YDDB 3QGPA 3W64A 1FKOB 3NGSA 2UUBF 3MM5A 1NJWA 1KTVA 1XR7A 5DQIA 2QIFA 4OZNA 2DGQA 1Q86T 1RT3B 2V8DA 2YKAA 4NWBA 1RT4B 3M9OB 1YRXA 4OHVA 2V2VA 1N33F 1SUQB 4CO2A 4RW6A 1Q53A 2BOAA 2YWKA 2AGOA 2FDNA 2MPUA 1I5OB 1QDUB 2OPRB 3IBFB 1JKHA 2KXNB 1S7HA 2CQPA 3CO0P 1WEZA 3V6KA 1FF2A 2CJBA 4MK9A 3HHLD 1NPKA 2OSRA 2ATLA 3OPKA 1T7PA 1S7IA 1FD8A 5KG7A 1X7VA 1FX4A 2F9DA 4ZVUB 4DR3F 2D3UA 5DM6Q 1KFSA 2HK3A 1ZM9A 2BR0A 1ZA2B 4OX7A 4B9SA 1TK8A 1KVIA 2ZOMA 3HFVA 4PQAA 2HBYB 2WSCC 1HNZF 2RB7A 1UVIA 3D6TB 1JLFB 3R5JB 2CVEA 4IG0A 4QZVB 1QLNA 3A8EA 4L72B 5KFPA 3TI0A 1C0TB 5KFJA 3RAQA 2EKNA 5HJYA 3VCDA 3SSRA 1F0XA 4GC6A 4LRBA 2EEYA 1B7YB 5LT5A 1A6LA 3CMES 4ZOSA 4DQPA 2VKRA 4RW7B 2G0JA 4ES3A 3D3BJ 2JFKA 3N9UC 2A3JA 2NXJA 3CTRA 2E9ZA 2YWWA 1Y9OA 1E6YB 4GKKF 2LU2A 2YKQA 4YR0A 2NREA 2FHJA 3HHKA 4Q43A 1LXNA 3IRXA 4RNMA 1S0MA 3RR8A 3V81A 3C19A 3H8YA 5CZVA 5KFGA 1WG5A 4RW8A 4E2FB 3M8QA 1SH2A 1HNWF 5KFRA 3OTEA 2ZITA 2DPIA 1IR2A 2MDAA 4MJKA 2GHVC 2GS8A 3R27A 4ZPDA 3LAKA 3H40A 1TL4A 3MPWA 1EKSA 4P71A 3IG1B 1Z2LA 5KFOA 2EI5A 4PQUA 4I6YA 4NCGB 4TKTA 1Q8LA 1OYDA 3LP2A 1J5OB 3TRGA 1APSA 2EFOA 2JRSA 2AGQA 3HSJA 3CMAS 4LR8A 2WONA 4X64F 4LF5F 4OX6A 4B3TJ 3W5YA 1SC4B 2ZJRQ 1HHQA 3F0NA 1RTDA 3AD7C 4IRCA 4RNNA 2ZDPA 1WOSA 2E5JA 4F4WA 3EVWA 5ETVA 3L9ZA 3CXCR 2DR9A 2A2DA 4FNIA 2KT3A 3NNAA 3IGVA 2ZVIA 2VQEJ 1HQUB 2CWKA 3HXMA 4LQ9A 4C3MA 3KLEA 1XQIA 5L9XA 3BR9A 3VQTA 2CIMA 2AX0A 4OZ3A 3QO9A 2WBRA 1HD0A 2XSFA 3UD5A 4ECWA 2UXDJ 2X1AA 2EK1A 4ELVA 1S76D 3PM9A 2YH1A 2X51A 3DRSA 3DN9A 4FBUA 5DGAA 2CPJA 4PWDA 4F4KA 3UNGC 2DH7A 3E51A 5KFYA 2I2YA 2XY7A 4IQMA 2E7XA 2Y9HA 1DQ8A 1N6QA 1IBKJ 4NLYA 1Z4UA 3T1YJ 1BY9A 4ZHRB 2FJBB 2HHWA 5L1IA 2CNLB 4MKVA 4F26A 2O1PA 1URRA 1B99A 1ZAVA 1MU2B 1YKWA 2RDJA 2W2MP 1NKCA 4Y0FA 1UVNA 4NEZA 3W63A 4RPFA 4I67A 3HPOA 4CLLA 3D7SB 3IC1A 4WZMA 1CPZA 4LJMA 2OHDA 1Y3JA 9ATCB 4X62J 1WC5A 4X66J 3G8SA 5KFDA 1JLAB 2M5YA 2HNDB 1NK8A 3CSKA 3S1TA 1RTJB 3M30B 4I68A 3BKTA 3DM2A 4G65A 3UCUP 2C3PA 1ICEB 1I1GA 4DZDA 1S5ZA 1X31C 1N48A 3BGRB 2R2RA 1LEOA 4QU6A 2WAQD 1KD1T 1RK8A 4I2PB 3RW7A 2M8DB 2EBEA 3I56S 3T9NA 2BJ3A 2CG8A 2AWZA 1X9SA 3F56A 4MH8A 2EBGA 2A2CA 3A8IA 2X1FA 2MQNA 3TQEA 1UJ4A 5D6GA 5GMDA 3O8WA 3DMJA 3MR7A 4RJVA 2PN6A 2MKJA 3K89A 1Q4RA 3KXDA 1CC7A 2I5JA 5J2PB 3K8WA 1TVRB 4Q0BA 3ENQA 4P52A 4V19X 3B8HA 1KLNA 5DG9A 4QIVA 4UOFA 2DEIA 4B9MA 3KTQA 3E2EA 2H5JB 2CQCA 1UJ5A 2CQIA 4DV1J 4LQ3A 5J1EB 4FS2A 3Q22A 2GNKA 3EXYA 2P6TA 2UUAJ 1T9YA 3T1HJ 1T05B 3DRPA 3TOQA 4DUTA 4N41A 2B51A 4LSLA 5ETMA 1VK3A 1XMQF 2XHWA 3MM8A 1RLCL 1EJ7L 1MWQA 1T03B 1FJGF 2UUCF 1SC3B 5HATA 3MMAA 2A1BA 2G2OA 2V6AA 1R43A 3KLGA 2RS8A 3DLJA 2YNIA 2CPFA 4ZKAA 1RDRA 3ZO7A 3JSYA 4O4GB 1WHVA 2POKA 4Y00A 1RAOA 5DLFA 4LFCF 2FJAB 5KFLA 3GIMA 4IH7A 2QV6A 1VQOS 3DLHA 2MZRA 3IR6B 3V5RA 5KT3A 5KFVA 1GT8A 3M1VB 3OTBA 5G0RA 3SV3A 5J2MA 2HIYA 1TTHB 1PO6A 2CZ9A 2XY6A 5GVQA 4ED0A 3DHWC 4ZVEA 3SQOP 5BJRA 4P9SA 4NLPA 1SC6A 2VC1A 4B9NA 3Q83A 1BWEA 2Z8QA 5J2QB 4KO0A 5FJ4A 2DB1A 3EZOA 1GQEA 1LXJA 2IVYA 3BB5A 2M52A 3EZ5A 2PD1A 5AXMA 4DXLA 4HYKA 1VRTA 4F02A 2Z57B 4L3NA 5ETOA 1KOOA 2ZE2A 1NK0A 3TJ8A 5AJ3J 2HVZA 3A8JA 2BQUA 2DNPA 2LQJA 1U1PA 1RBLA 3U1LA 2B6AA 1JLBB 2A0FB 4DJBA 3MDFA 4DPWA 3PG9A 4PWWA 4YB1P 4IG3B 3ZTQA 1S9EA 3VV2B 1HNXF 5E2QA 3Q2SC 5CABA 3DOMA 2RILA 2IIHA 3FFIB 2JZ5A 1M1KT 3LWMA 3V6DA 4DU8A 1FK9B 3PRDA 1DURA 2JC1A 1ZAXA 1NPPA 3KYLA 1G1XA 1N34F 2VQFF 3KLVA 3LP0B 2MQ8A 3ILOA 3OHAA 4A8OA 2QA4G 1RTIB 3CC2S 2PE8A 4CCHA 2B9XA 3MPVA 4Y2AA 2RJZA 3IS9A 4ANDA 2RD5C 3MECB 2XMKA 4QYZK 4BHQA 2IM0A 2CQ2A 3LWLA 1R6YA 4ETZA 3DC2A 1G4CA 4KHPJ 2ROGA 1OWXA 3AAWB 4ILRA 4N7TA 3LALA 1XTZA 4DF8A 5K14B 5HSPA 1KP6A 1SJ1A 2B4UA 2GO9A 1U1QA 3NGDA 3PEHA 4X65J 4DZ6A 2QMXA 5KT6A 1VIOA 4TLQA 2HHVA 2IRYA 2Y1RI 1HNIA 1WDTA 1QSLA 3OTCA 3NRBA 3R2CJ 2W4CA 1FRHA 1BWVA 4RUCA 1CLFA 5GADI 4PYAA 3W8PA 5H9FJ 1VLOA 5ADZA 1CULB 3K5MA 3N4WA 1R0AA 1S1XA 2NCKL 1BHNA 4FBTA 2A18A 2EW9A 3NNCA 4DR5J 2AX1A 3HHDA 3PHEA 1TZ0A 5LXYA 2KTQA 1SQGA 3TR5A 2NZ4A 2RSQA 4OHZA 2BZ2A 3V6HA 5HL7Q 5HP1A 4ECTA 5IQQA 2EXUA 3T5JA 3K59A 4FF3A 1R8AA 2YQ0A 4MIWA 1TL1A 5F8MA 3LPEA 5CYMA 5ETNA 2NXCA 4LVNP 2CQHA 5E41A 4HHJA 2GCFA 3TANA 4ERDA 3RAXA 4KY3A 2R8JA 4H4OB 1F5BA 1RT1B 1U4BA 4YQWA 4Y65A 3KK3A 4LBPA 4W4MA 4C98A 3R5CA 4C11A 4FF1A 5DQHA 4ID5B 1HI1A 4NEYA 2VODA 2V4JA 3KHRA 4PG5A 2BVZA 5F8NA 1PILA 1WACA 3DYAA 3SV4A 4TU7A 4JI1F 4C3KA 4CP5A 4FZVA 3BGUA 2F1FA 3OW2R 4ZMMA 1HNVA 1FNOA 4P2XA 2HHUA 3VHQA 4RX6A 4GVLA 2C3MA 4DSIA 2O5DA 3QT6A 2BKPA 4WFZA 4RU2A 4O0NA 2HPUA 2MKIA 4OMFG 4BC9A 2GA7A 1U45A 1H98A 4CNYA 1ZM2A 4FPRA 4TVAB 3ENAA 4A8YA 3G6XA 2FJVA 2V8PA 4WYWA 2XO6A 4FYDA 1R7IA 4LF4F 3TWZA 1RAIB 1SL1A 2R3VA 1WORA 2VPWB 4OYZA 1FJEB 4ZPAA 3ULHA 3FQLA 2GV1A 3P5TL 4UTGA 4ECVA 1U02A 4ZIWA 4DI6A 2JVOA 2ZBRA 3FEYB 2YKPA 2LLZA 3MEGB 4IDKB 3VAJA 4R8UA 4ZIVA 4NXMJ 2PSZA 2AV5A 3D67A 2RT3A 4C9DA 3MFIA 1TUGB 4RW6B 4YOEA 2I38A 3H2UB 4QR1A 2QZ8A 1AUDA 1IN0A 3KLFA 1U7LA 3K17A 1R8HA 5E33A 3PCOB 4X4NA 3K5OA 5BR8J 5D8HB 4WKRA 3FKBA 3ZTPA 2CAJA 2MY8A 2J6UA 4LRDA 2VPXB 4C8OA 4LIRA 5SZTA 1U48A 1X0FA 1H38A 4NZ0A 4LFBF 2K1RB 1IQTA 3G6YA 3HK2A 2OLWA 4F8RA 3KUEA 1S97A 1NM2A 3KJVA 4PABA 4ZJQA 2JDJA 3LGHA 4AUKA 5AXLA 3DOLB 4NA2A 4OJHA 3R7BB 2E5GA 3B4DA 5I4MA 4DL7A 2CPXA 2MGZA 2JOQA 3HP6A 2RIJA 2DKOB 2W1BA 3K58A 3EVOA 2YPYA 1QAXA 1QAIA 4LF7J 1FFSB 3EZUA 1F2HA 3CDWA 2M2BA 3DGVA 2GGPA 3TA1A 4K4WA 3NAHA 1NMEB 1JLEB 2UP1A 4DFJA 4WE1B 3KKFA 5HK4A 3VAMA 1QM9A 5H9EK 4WP8A 2KG0A 3KJNB 2DCUB 1D8YA 4QIGA 2Q43A 3M8QB 5IT9U 2QYCA 1NZ8A 1T94A 5KG2A 4K5RA 2IMOA 1QE1B 1VQYA 2ZH4A 2WVDA 1NH8A 1EQ0A 3JYTB 4MT1A 2BACA 5LXRA 2IYGA 3GLJA 2AHOB 5KFCA 4JI6F 4IO9Q 3JSMA 2UU9F 2MJNA 5KOWA 4JOUA 4IFYB 4RUBA 1IBLF 2CZ4A 1NKBA 3SFGA 1UETA 2CPEA 2WONB 4FP9A 1UP1A 2DIUA 2YNGA 3RBDA 3H0PA 2E7VA 4DR2F 3VAKA 5LOQA 1VFJA 2BJ7A 3T1AA 3FRYA 5IV3A 2MYFA 1SKSA 3JSBA 4FNHA 1HBUA 3PTWA 1NB7A 5CXTA 2OPSA 2R7VA 2DGXA 3J7Z5 2FLNA 4NYZA 3OR2A 4FF2A 4U8VA 4O4RA 1AUSL 2IRUA 1M5VC 2V8GA 2L48A 1IKWA 2XO7A 4KIAA 3J81U 2DNRA 2ZJPQ 1S1UA 3IR5B 4K4VA 3MGJA 3EICA 3CD0A 1OQ3A 4X4QA 3EX7B 3MD1A 1RWWB 1BLUA 2JLGA 4X4SA 1YLXA 2LQBA 3ZNUA 4WK3A 2BQRA 4FYVB 3IN5A 4AD6A 3I4PA 3PR4A 1ZM4A 5IOLA 3GJQB 4ANCA 1HFEL 2VL1A 1HW9A 3HVTA 1NH7A 1FFWB 2XG8A 2CFXA 2NS1B 3BBBA 4ZVQB 3H2VE 2R7TA 1PKUA 1LQ9A 2ALYB 5GAHU 1NPRA 2VQEF 3GR1A 4NLUA 3VWSA 2DBBA 1K8AT 1KR4A 4G3IA 2J76E 4ER8A 2G0CA 2P9EA 1FD2A 1A0OB 2OPPB 3CD6S 2QEXS 2A6OA 4J9OA 5I3UB 2RQCA 1Q1KA 1AT1B 4DUYJ 4Q5VA 4A8SA 4ED6A 4I2QA 1KTQA 1FRXA 1SPBP 2GVZA 3C6UA 1TL5A 2DCLA 4B3OA 1UPMB 4TQRA 5F3ZA 5CD4A 1YIJS 1U24A 5HMWA 2XM3A 3HHLA 3W65A 2CJAA 4S0MA 3HVWA 3TYTA 5L1JA 3UO0A 4GVBB 5EWEA 1N5VA 2J6TA 5A8KA 3I0RB 3PJXA 2DGSA 3CJKB 1S6PA 3RB4A 4ZPTR 2HBZB 2ZHBA 5F8JA 3MM7A 2RU9A 3BQ0A 4UZBA 3GFHA 2NLWA 4K5SA 4ZLPA 1KNZA 3RU0A 2R7UA 4M5HA 1H3DA 4WKYA 5HVHA 4HT7A 4KGZB 2BXJA 5HBMA 1HL6A 1HR0J 4NPOA 4DV3F 2HHTA 2IPOB 2EFGA 2HQDA 3D66A 1AB8A 3BGFA 2AP6A 3EDRB 3K2YA 5DQGA 1BQXA 2HFVA 2PT0A 1HQEB 3KOAA 1FRIA 3TA2A 3JAMY 5F3TA 4G1QA 4KJIA 1JJ4A 1IKVB 4CLYA 4CZCA 1ZA1B 2KN4A 4LRFA 1MG7A 3DLKA 3UN3A 3MM9A 1WNEA 3KWMA 2W8KA 3HM9A 1TP7A 3EUNA 3LGNA 4LR7A 3PW0A 1EZZB 1GMVA 3TJ9A 3T41A 1YWXA 3GZ7A 3O1LA 4LF9J 1RI7A 1RWOB 2FVSA 4J9KA 1NRKA 5EGYA 4OZ2A 4KV8A 4F0KA 2HNZA 2R7RA 3GP9A 1U6FA 3HJVA 2RQ4A 2PGCA 1U1OA 1FCAA 4PG7A 1EARA 1RAHB 1JWWA 2AYGA 3QAEA 3NS5A 1LWFA 3T1HF 5D77A 1TKTA 2G2ZA 5E3CA 4DV0F 2ZJQQ 3W2WA 5KT4A 3C15A 4X4VA 1PC4A 4LR9A 1QD1A 1HPZA 3AB4B 3MCMA 8ATCB 1S12A 2W7AA 2C2RA 5C42B 1ZTTA 2L41A 4DR1F 2QSFA 2BV3A 4Q45A 4C8ZA 2BDPA 1O51A 4ED3A 4NXNF 3ZZYA 1Y10A 1S6QB 4JV5J 3FCHA 3EDQB 3OUYA 3GPAA 1ROFA 3G6ES 1I6JA 3OV7A 3K57A 1S9EB 2DNQA 5KT7A 4P74A 2DNGA 3R1HA 4KPYA 1HBOB 1XMOJ 5LM7E 2XLJA 5C5JA 4IRKA 4C6AA 3K5LA 3CCQS 3SQGA 1FEEA 2VFRA 1TL7A 2PA3A 3B54A 2BANB 3D9BA 1AA1B 5JJBA 4ZLLA 1VRUB 3IWXA 4ELUA 1L5UA 1RTHA 1VS3A 3CJSA 4IQXA 3L4BC 3NCRA 3LGMA 1Q7YT 2NUHA 3M7VA 2KM8C 2LMIA 1W25A 4FKYA 2V69A 2HMIB 3MM6A 2UUBJ 4RBVA 4L75A 2KZZA 2FZCB 4OI1A 3J7YI 1FVQA 4M5DB 4A47A 4O44B 1DY3A 1CJTB 1J27A 3Q86A 3TZWA 2HG4A 2VG5A 2DH9A 3NLCA 3A3NB 3H5XA 1N33J 2VV5A 4ECQA 4AQYF 2DH8A 2HZCA 3PFEA 4URQU 1PJ6A 4TQSA 4B9LA 2XC9A 3P4UB 3P45B 3NKYA 1Q78A 3ZTOA 4LBHA 2B4PA 4JV1A 3DRRA 3CO9A 1ZS6A 3OLAA 2V9KA 1U1KA 5A8WA 3ILLA 4TU8A 3UE2A 3D6MB 2UXBF 2GJIA 2W9BB 1SJFA 1N32F 4DR3J 3NGUA 4ZJLA 1TAUA 2J8AA 1IBMF 2KXHA 4DL3A 1RABB 4RUHA 5F8LA 3EPIA 1R8BA 2IM3A 3OSNA 2KYZA 3POTA 3KG0A 5HJXA 6AT1B 1VQMS 4ECZA 4U6PA 4D3HA 2VB6A 2J9CA 4KE5A 1RWNB 4XDDA 4HI1A 4QCLA 1HNZJ 4DX5A 5GAEI 3LP1B 3BM7A 1C1CA 4IRDA 1CQMA 5B0EA 4FXVA 4UOHA 1S0OA 4HACB 2HNYA 2CXEA 2IJNA 4ZCLA 1EP4B 5D0EA 4RKUC 2YNFB 3KDOA 1JXLA 1PJ7A 4PCQA 1FXLA 1FHTA 2C42A 3M2UB 3CJ2A 3M2VB 4DCPB 1YITS 4KT0C 1RAAB 2OEMA 4X65F 4JV0A 3BKUA 4GKKJ 1MMDA 2EG2A 2LU1A 2J0WA 2UUTA 3SSSA 1KONA 1HNWJ 4C11B 1WDDA 4DMZA 1T95A 2FHMA 3OBIA 2AKWB 1OPZA 3VZIA 4F25A 1V9OA 1V6HA 4QW9A 3M6VA 4IOCQ 2C3YA 2R8IA 1IKXA 2ZBCA 2NSBA 3CCWA 2EG1A 1UWBB 2C3UA 2W7OA 4USIA 2PO4A 3DLEA 4O23A 3HT0A 1YJUA 2DITA 1PBAA 3QFHA 3S8SA 5KFIA 1NK6A 3GB0A 3LA0A 2V0NA 1L3KA 4X64J 4LF5J 1RWKB 2ASJA 3N6MA 1Y5IB 2OGUA 3I96A 2CQDA 4K0KF 1RU2A 1T0TV 2X1BA 4ED4A 2HHHF 3CC7S 2XULA 3D28A 1HMVA 3OT9A 1DJ0A 2DEJA 3W7BA 1QY7A 3MAAA 3CJ3A 3IM8A 2DT9A 3PYEA 2QT7A 1AZSA 4P2MA 3AOBA 2H65B 1P1LA 2NYHA 2FVCA 2WW4A 1UA0A 1U0HA 3FQKA 4M5GA 3DGPB 1IKYB 4QR2A 5AXNA 3ENWA 3MPUB 1S9GA 2E1AA 4DSJA 1RYRA 4WP3A 3TO8A 4OJ1A 1NDKA 4DPUA 4FF4A 5B0BA 3ET6A 1NHVA 4OV1A 3BSOA 4E0DA 4R8UB 4TLRA 3SFUA 3CMQA 3TAMA 4X4TA 3SCKE 2MZSA 4KAIA 1KHVA 4OX9F 4K4SA 2H4YB 4WCEQ 4RBUA 5EX3A 5C2GA 1IWGA 2Q1LA 3MEDA 1HBMB 3V2UC 1LNQA 2CNNB 3VGVA 3M2RB 3NP5A 2HFOA 3VQSA 2Y1JA 3DLGB 3W5ZA 1F2GA 2IA6A 1RWUA 3VGUA 3KK1B 1JLGA 5JVHQ 3JTNA 3IO1A 3D0GE 4F0HA 3ZZZA 3NAIA 1HQ2A 2KVQE 5KFBA 3CDAA 3MURP 2F4FA 3ISZA 4ZDNA 1GX6A 1TFWA 1WHWA 3UWTA 4OI2A 3RAMA 1ZTWA 3KJVB 4X4OA 2F4VF 3GFYA 2QLFB 7FDRA 1R0BG 1YZ7A 2X1GA 2M0GB 2GHWA 4FKXA 2V5HG 2BQ3A 3CF5Q 3KLHA 4YY3F 4IR9A 4OYMA 3M8WA 1RHKB 5KFTA 4V1Ak 2N7CA 4MYTA 1NSAA 3W8GA 5GMKa 3F44A 3ZZRA 2RDIA 4HT5A 4C8YA 1CJVA 1AW0A 1R0CB 4NZ6A 4IR1A 1BQMA 1S0NA 1N5YA 3VAGA 2RU3A 1U1RA 5KFAA 3EMTA 3UCZP 2VDIA 2KRBA 3GJSB 1S1TA 4WTYA 4EO6A 2W25A 3PYFA 3GQCA 4F3QA 4PG8A 2ERRA 1PCAA 5IS2A 4F4XA 3C6TA 2GVDB 2FYXA 2QA4S 3HLUA 3ZFVA 1RACB 3GG0A 2DNOA 1DTQB 4K2JA 1B0TA 1MNEA 2OP5A 3JB9k 4ED8A 3RG6A 4FVCA 2MKCA 1FDBA 5F41A 3CUNA 4EYIB 1N36F 2BYCA 4U67Q 1PC5A 1XERA 1UEVA 4EMDA 3E8OA 2YKOA 2ZBQA 2DGOA 3VF0B 2MZTA 5E3RA 5D0GA 1FJGJ 1YRUA 2R9LA 2UUCJ 2FJDB 2WOMA 3EJMA 2AGPA 1GMWD 3LANA 2MHNA 3G4SS 5A0YA 3HSDA 4LVOP 1LWEB 4J9RA 1DQAA 2BA9A 1YTYA 3DOKA 5A8RB 5D4NA 4LFCJ 3F41A 3H42A 4KGXB 2ZM6F 1K9MT 3UW1A 3OVAA 4CT9A 1B7FA 4NLWA 4DL5A 3MI7X 1KEKA 4RW4B 2OMLA 5EN1A 1BD6A 2DHHA 3Q8VA 3ZZOA 2EVZA 2LCWA 4RWXA 5FIIA 2MLXA 4WIQA 2FB0A 4ZPVR 2FLLA 1RAGB 3RBEA 2JVRA 2V68A 1P6TA 1WSVA 3SZ2A 1BQNB 1X5OA 2RRAA 4QBUA 4PZVA 4GRSA 5LJ5Y 5K5MA 4NA3A 2GMJA 2YQ3A 5CYQA 4K4YA 4IKAA 1BMQB 4J7CA 1QSYA 3WX8A 1TKZB 1KQSR 5IM0B 2XI2A 5DS7A 3O44A 2RRBA 3TEGA 5HLFA 2UV8A 4HH0A 3RB3A 1DLOB 4DSFA 2WK4A 5D3GB 4NLGA 3MWBA 1HNXJ 4CO5A 3CJTA 2HQ3A 2KHCA 3MEEA 5CCMA 4I2QB 4HHUA 1FTCA 2HHQA 3HJFA 3CCES 1UVJA 4J9LA 1P9QC 3MR6A 2HGLA 1N34J 2XGPA 4KPCA 2VQFJ 2RF2A 2OPQB 4GO5X 1RT5B 2GQQA 4OZ0A 2B8QA 4A8QA 3KLIB 2QLWA 2UVVA 4H4MB 3OL7A 1P9YA 3H5UA 3ZZPA 1D9FA 2GMHA 1ZPWX 2HZAA 2VZ9A 3IR7B 2DVIA 2F65A 4GMKA 2QLBB 3GIRA 2J7UA 4JI8F 1M5KC 4NCAA 2ZEJA 1NDPA 5K8OA 5BXIA 2JHEA 4KFBB 4Z7YA 3CEDA 4Q2MA 1B0PA 3UCGA 1QTNB 4I1TA 3NS7B 3CNQP 1WKJA 1H2UX 1C2PA 3KG1A 3C3LA 3EGZA 4UOGA 1X4HA 3R5GA 3PO5A 2E5LJ 3I0SA 1VJWA 3R8YA 3P96A 5CH7B 3C66A 3R3TA 1VIXA 3R5BA 4OHWA 3MTJA 1PG5B 5B0DA 2DR7A 3IAS9 4H4KA 2B5JB 2KXFA 3TA0A 3QYYA 2MJUA 3OL8A 4UF4A 1RAJA 2ZD1B 4R25A 4OL8A 2VU5A 5CQGA 4DR7F 4PAAA 1VQ9S 5LJ3Y 1YBUA 2J9EA 2AZ3A 4KC5A 1EETA 4I7FB 3CJ4A 4K4ZA 2HRYA 3BV8A 5L38A 1SV5B 3GE9A 2XS2A 2QN6B 3L3CA 1UW9A 1IM6A 1LFPA 3HKZD 4ZLJA 3RRHA 1TKDA 4Z2XA 2FD2A 2OFGX 1NSQA 2XB2D 4KYZA 2HHPA 4NLQA 2FY1A 5K8NA 3P3DA 1LWFB 4KH1B 3UDLA 2DNZA 2D9OA 2WTFA 3AH6A 1RWMB 4YB6A 2FHKA 3G8QA 3LAMA 1Y5LB 2H5EA 2XMVA 3W2WB 4CLKA 3M9NB 2MKHA 4ZA1A 3K5NA 4QPXA 2ZH3A 1TKXA 5C7PA 5D4OA 2OD6A 3EM1A 4M5LA 1VK8A 1G7CB 4P7VA 2DHGA 3CGIA 1KSPA 2KM8B 2KHDA 2KYXA 1XR6A 1HKAA 1I94F 4JI1J 2R7OA 4NMXA 3SI8A 4ZLNA 3UN2A 2CPYA 2XTJP 2BUNA 2M3DA 1EKRA 4OQJA 2KB2A 4PXEA 5MLCV 5M2PA 1RP5A 1CS4B 4HI2A 1Q8IA 3THTA 4CLUA 3BEGB 1N5TA 4HHHA 1JX4A 3PW4A 2G4BA 5M2RA 3BDEA 1S59A 2YKMA 1UW4A 1REVB 4QWCA 2XI3A 1MN9A 5MAOA 2VASA 1RT6B 3NGRA 1CJUA 3C16A 3ZC4A 2E9TA 4LF4J 2RRNA 2FJWA 1U49A 4R5PB 2P8IA 3QATA 2UVRA 4EUVA 2RUSA 4O3OA 3W9IA 5KFQA 2RQKA 3BKFA 1S1WA 2V63A 1PSDA 4KBIA 2YPZA 5F8HA 3TUPA 3OL6A 4CLWA 2IC3B 3RJMB 2I1RA 1CQNA 4OIXA 3QQCD 4CH7A 5H9FK 1WC0A 4QIEA 1RAEB 3MCOA 3GSDA 4DCJB 2B9WA 3OFGA 2VOOA 4J9MA 2ILZA 3OFHA 1DRZA 1U26A 4F3OA 2F3JA 3W9JA 3PW2A 4JV5F 2XS5A 4WYLA 5A76A 3FGVA 1FWPA 1R27B 1DTTA 1VBZA 1WI8A 4I56A 4LF6F 2C1EB 4Q44A 3M6UA 3QLHA 3BQ1A 1RE1B 2BE2A 1YDLA 2PEHA 3MD3A 2C2OB 3H2LA 2HQFA 4DQSA 3MF5A 4LFBJ 1LW0B 2FUG9 2OI2A 1JLCB 1WHXA 2IBOA 3UQSA 5AE2A 1CJKB 3L09A 5DDPC 2CDQA 4OZ5A 3MMCA 4OYWA 3EYZA 4OX8A 1VQ5S 4B17A 1WEXA 1HIYA 3QIPA 2UUWA 1KLMA 1R89A 3BO2A 1REGX 4USWA 3M8PB 1N54B 1NJYA 2B43A 2WW8A 2DGWA 1HWIA 3IFEA 1F3FA 1WC1A 4I6WA 1F3VA 2VG7A 3QT8A 1LOUA 1VYAA 2C2KB 2HQGA 5EDWA 2VG6B 3I5CA 4HR2A 1NO8A 3PY8A 3M9MB 4LSNA 1LW2B 3ZZ0A 3JS9A 2PIIA 3PW5A 4WIIA 1SCJB 4P10A 4JI6J 4WP9A 2UU9J 1FKOA 2YKNB 5IT9Y 1IBLJ 3JTPA 4UY8T 3AY0A 2FVPA 1KHWA 2W9CB 3C8YA 4AL5A 1RT3A 2BKOA 4I0WA 1RT4A 4CLZA 2GFFA 5IZHA 2LKZA 3OJUA 1HBNB 1SUQA 1FE4A 4QWEA 4F2SA 2DXDA 4JI5F 3W2VA 1TK5A 3ENVA 3EGNA 4NLVA 4ED1A 5GADU 4ITSA 1F60B 5ETQA 4AXIA 4DR2J 3NCQA 4B3RF 2VD3A 3OXLA 4QIFA 2DNNA 5T14A 2JH3A 1NHUA 4XDCA 3GJRB 3WX4A 1HW8A 1AZSB 3G82B 1K47A 1FO1A 4IFVB 3QWUA 2AJ1A 2P2CB 1VQKS 2B3TB 3CCUS 4HH1A 1UEUA 3J7ZT 2LDYA 4UQTA 1LK7A 4M1KA 2XHCA 4FVMA 3DLLQ 3PVXA 4ED2A 4DR6J 2HK2A 3QFWA 4U7UD 1FT8A 5KFUA 1N52B 1WF1A 4JBCA 5DM7Q 3NNHA 2C2EA 2YBVA 4Y2IA
chains in the Genus database with same CATH topology
3EDQB 2XYHB 1RWMB 2H65B 4ZVQB 4ZVOB 1RWOB 2HBRB 5IC4B 4ZVSB 3SIPB 3R6LB 1RHJB 1RHQB 3KJQB 1RWXB 3GJTB 3D6MB 3RJMB 4JB8B 2HBYB 1RHRB 3R7SB 1SC3B 2QLFB 3R6GB 1NMEB 3R5JB 2CNKB 2H5IB 2QL9B 2QL5B 2XYPB 2C2ZB 3IBCB 4DCJB 1RHUB 2CJYB 2Y0BB 2C2MB 4ZVRB 3EDRB 2CNLB 1RHKB 1SC4B 1RWVB 2QLBB 3KJFB 5K20B 3KJNB 3GJRB 5IC6B 1RWNB 1PAUB 3D6HB 4LSZB 1I3OB 2P2CB 1RWPB 2C1EB 1BMQB 3R7NB 2CJXB 1QDUB 4ZVTB 1IBCB 2H48B 3IBFB 2H4YB 1RE1B 1I51B 1GFWB 1PYOB 2XYGB 3QNWB 1QTNB 2H51B 1RWWB 1RWKB 3NS7B 2Y1LB 2H4WB 1F9EB 2C2KB 2C2OB 1SC1B 2QLJB 2H5JB 2XZDB 4DCOB 2H54B 2CDRB 3R7BB 2CNNB 2QL7B 3GJSB 3GJQB 3P4UB 3P45B 2HBQB 3D6FB 2CNOB 2HBZB 4ZVUB 1RHMB 4DCPB 2DKOB 4ZVPB 1ICEB 2XZTB 2FQQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDQ B;  2XYH B;  1RWM B;  2H65 B;  4ZVQ B;  4ZVO B;  1RWO B;  2HBR B;  5IC4 B;  4ZVS B;  3SIP B;  3R6L B;  1RHJ B;  1RHQ B;  3KJQ B;  1RWX B;  3GJT B;  3D6M B;  3RJM B;  4JB8 B;  2HBY B;  1RHR B;  3R7S B;  1SC3 B;  2QLF B;  3R6G B;  1NME B;  3R5J B;  2CNK B;  2H5I B;  2QL9 B;  2QL5 B;  2XYP B;  2C2Z B;  3IBC B;  4DCJ B;  1RHU B;  2CJY B;  2Y0B B;  2C2M B;  4ZVR B;  3EDR B;  2CNL B;  1RHK B;  1SC4 B;  1RWV B;  2QLB B;  3KJF B;  5K20 B;  3KJN B;  3GJR B;  5IC6 B;  1RWN B;  1PAU B;  3D6H B;  4LSZ B;  1I3O B;  2P2C B;  1RWP B;  2C1E B;  1BMQ B;  3R7N B;  2CJX B;  1QDU B;  4ZVT B;  1IBC B;  2H48 B;  3IBF B;  2H4Y B;  1RE1 B;  1I51 B;  1GFW B;  1PYO B;  2XYG B;  3QNW B;  1QTN B;  2H51 B;  1RWW B;  1RWK B;  3NS7 B;  2Y1L B;  2H4W B;  1F9E B;  2C2K B;  2C2O B;  1SC1 B;  2QLJ B;  2H5J B;  2XZD B;  4DCO B;  2H54 B;  2CDR B;  3R7B B;  2CNN B;  2QL7 B;  3GJS B;  3GJQ B;  3P4U B;  3P45 B;  2HBQ B;  3D6F B;  2CNO B;  2HBZ B;  4ZVU B;  1RHM B;  4DCP B;  2DKO B;  4ZVP B;  1ICE B;  2XZT B;  2FQQ B; 
#chains in the Genus database with same CATH topology
 4YHH F;  1RIS A;  2FTR A;  1JLF A;  5KG6 A;  3BJY A;  4BWJ A;  2M88 A;  1WI6 A;  1NK7 A;  3OL9 A;  3ETM A;  3B6B A;  1C0T A;  3R6L B;  3OLB A;  3ZTR A;  4J37 A;  5DDR C;  2HVI A;  2XWX A;  1TQL A;  2NPF A;  3R7S B;  3U1M A;  2VPZ B;  1VBY A;  1TV6 B;  2C3O A;  4UOC A;  3JQJ A;  3IBC B;  2ZH1 A;  4USU A;  4ZP8 A;  2CJY B;  2QC3 A;  3HF5 A;  2GC8 A;  3VAH A;  4RW7 A;  2KU7 A;  4RWW A;  4ZP7 A;  1JLG B;  2AIR B;  3Q24 A;  2ZWP A;  1L3V A;  4N8N A;  3BPD A;  2QMW A;  3J81 j;  1FXR A;  1CBK A;  2ABY A;  8RUC A;  1IBC B;  4XO0 A;  4LF1 A;  5HN0 A;  2WRM A;  1NSK L;  2W4D A;  3EGV A;  4LFA F;  2UV8 G;  1SKW A;  2ZH7 A;  1SC1 B;  4HDH A;  3GIK A;  2CPI A;  1XEZ A;  4IH5 A;  3U27 A;  3N79 A;  3DLB A;  1OS5 A;  2BM0 A;  2B8P A;  3DU6 A;  1NKE A;  3IG1 A;  1TMM A;  4LIW A;  3WIV A;  4NCG A;  2D41 A;  5D4P A;  4DX8 H;  5KT5 A;  4Y2C A;  3L7P A;  3TZZ A;  1J5O A;  1H0H B;  2QMU B;  3H5S A;  4OJ3 A;  1D0E A;  4YEA A;  4IH6 A;  4OYB A;  4TY8 B;  1H2T Z;  2XCP A;  2G1H A;  4DUZ J;  1HWJ A;  1N5Y B;  3GMG A;  3G96 A;  4MYU A;  4F4Y A;  3FSI A;  3J7A N;  2MKS A;  1MLA A;  4PKD B;  3GYX B;  3DNC A;  2C22 A;  3ITH B;  5IC6 B;  1HQU A;  5T7L B;  2DJW A;  3OHB A;  2WVB A;  4DS5 A;  4DV3 J;  2HZV A;  4DF4 A;  3G2X A;  4DV5 J;  3QNW B;  4PEO A;  3ADA C;  1C1B B;  6FDR A;  1WG4 A;  3FNN A;  3TJA A;  3SEO A;  4DCO B;  1EX8 A;  4BC7 A;  3E01 A;  4G1I A;  4LMZ A;  4Q2L A;  5B7W A;  5B09 A;  3U1N A;  3M32 B;  2DY9 A;  2HVD A;  2QGF B;  2IVF B;  2XEX A;  2IJR A;  1RYS A;  2XBP A;  2EFN A;  5B0A A;  2V4Q A;  3P49 B;  4QWD A;  4ZHR A;  2HWH A;  3ISN C;  2AU0 A;  1SIZ A;  2Q6B A;  1RHR B;  1FDD A;  1MU2 A;  3SBM A;  1JLQ B;  3HHE A;  4KKO B;  3PZP A;  3CDE A;  2HGM A;  3Q8Y A;  1KRP A;  1Q0N A;  3QSI A;  4PR6 A;  2A6M A;  1YBT A;  2ZZT A;  4MFB B;  3IXQ A;  2GO8 A;  4NCB A;  1OY8 A;  2CQB A;  4JI3 F;  3PKY A;  3FBE A;  4A8M P;  2PMH A;  1JLA A;  5EX0 A;  2RVJ A;  2QA1 A;  4KQZ A;  2OAU A;  2HND A;  2FY8 A;  2EC2 A;  1RTJ A;  3MR3 A;  2IMW P;  3M30 A;  1LWX A;  2AF6 A;  4DL0 C;  4CQ1 A;  3ONQ A;  2UVW A;  1B4S A;  3AB2 B;  5HI7 A;  3US5 A;  4OLP A;  4FPI A;  1N88 A;  1S57 A;  1LFW A;  3BGR A;  4F2R A;  3BSA A;  4K50 A;  3VGT A;  2HVE A;  4DV0 J;  4I2P A;  3AFG A;  2RHQ B;  1N5Q A;  2KT2 A;  2JEG A;  1FI4 A;  2YTC A;  2CPZ A;  2ZH2 A;  5L46 A;  2W2N P;  1U47 A;  4Z37 A;  3CJ0 A;  4ZVS B;  1LV5 A;  1ZH5 A;  1U8W A;  2ROE A;  4M94 A;  2P9G A;  4FXW A;  4WJB A;  2HS4 A;  4DR1 J;  2VOP A;  1HHT P;  4JB8 B;  3FBF A;  3IM9 A;  3GIJ A;  4QWA A;  4NXN J;  2G13 A;  1IWA A;  2G0I A;  3O2I A;  2CG4 A;  2QL5 B;  2BMB A;  1LKZ A;  1TVR A;  1A7G E;  4HKQ A;  4AL6 A;  2C2M B;  4QYR A;  1ZPV A;  5KFK A;  1X60 A;  2HFU A;  2OUG A;  5KG3 A;  4U7C A;  5J1E A;  3CW2 C;  5A6P A;  3HZG A;  4I64 A;  4YME A;  1N8R T;  2MZ1 A;  5DG8 A;  2J0S D;  1P27 B;  3KK2 B;  5F8I A;  1M90 T;  4ZCK A;  1O6X A;  4ATN A;  1T05 A;  1BXN A;  3I5A A;  3OTO F;  1WHY A;  2J7W A;  2R7W A;  1PBU A;  3NBP B;  4I4B A;  3GV7 B;  3Q8U A;  4K8R A;  5DLG A;  2O66 A;  3J80 U;  2V8V A;  1ELO A;  4ZVO B;  5U47 A;  4AQY J;  3T19 A;  1RAF B;  1E6V B;  4WU2 A;  2GZO A;  4PXB A;  2XNR A;  1V5I B;  2AMC B;  3HMJ G;  2MSS A;  1MMN A;  4PUO B;  4O4G A;  4B3M F;  1VOM A;  3Q8P B;  1X4D A;  4KGK A;  3UFC X;  1VLY A;  1H74 A;  3WIU A;  1KFD A;  1VBX A;  4L73 A;  4RU9 A;  5CAA A;  4DV6 F;  1V3S A;  2DRA A;  5C25 A;  5D15 A;  2UXB J;  4EYH B;  1N32 J;  1OSC A;  3M1V A;  1CSJ A;  2FLP A;  1IBM J;  3NOG A;  5FD1 A;  2YX1 A;  1DHM A;  4NLT A;  2J8S A;  4ETX A;  2WZ1 A;  5CD4 H;  1TK0 A;  1OYE A;  3UVJ B;  1B70 B;  4JV2 A;  1T02 A;  4C7Q A;  2ADB A;  5J2Q A;  4NLR A;  3Q89 A;  3DI6 B;  1NU4 A;  2KRR A;  5H1S V;  2Z4P A;  4GKJ F;  1YI2 S;  3BN4 A;  4B9V A;  4J9Q A;  4ECU A;  2U2F A;  1RB0 A;  3PFO A;  3B4M A;  5B0C A;  1YZ6 A;  1XBW A;  1K0T A;  3JXO A;  2V67 A;  3FK4 A;  3ZXW A;  3CJ8 A;  3MOZ A;  2CRL A;  1AFI A;  2YWH A;  1JLB A;  2B7C B;  3DXB A;  3D54 A;  3O5T B;  2BX6 A;  2ZNY A;  1HAR A;  4RLE A;  4IG3 A;  4USH A;  2E5L F;  5J2N B;  1GXL A;  4U8Y A;  1RGV A;  5DG7 A;  3FFI A;  3R5D A;  2EC0 A;  5EHH A;  2V2Q A;  4EEY A;  4USK A;  4C2M A;  2QE5 A;  2HHX A;  5KFZ A;  3PW7 A;  1GMW A;  4F04 B;  4WFB Q;  1FK9 A;  1MML A;  3G6V A;  3LP0 A;  2ZHA A;  3C46 A;  1X9M A;  1RTI A;  3W61 A;  2GHP A;  1SH3 A;  1Y3K A;  1F9E B;  2NZC A;  3QZ8 A;  1FEH A;  1YK9 A;  1P8G A;  1T9W A;  3MEC A;  2XLK A;  1U1N A;  2XZW A;  1SJ4 P;  2OTL S;  2QX0 A;  3JTO A;  2VKZ G;  4OZ1 A;  2FQQ B;  2MKY A;  2MQP A;  4K0K J;  2HHH J;  2PFD A;  5K14 A;  1M5H A;  2RAQ A;  2BJD A;  1S1V B;  4K4X A;  3FSX A;  3Q0A A;  3L95 X;  1LWC B;  4AXJ A;  1N5S A;  4NL5 A;  4Y34 A;  1T9U A;  4RW9 B;  4MTP A;  4EBE A;  3DRX A;  3WC0 A;  1H6K X;  1WSR A;  1JXV A;  4CTA B;  2AEJ A;  5ETK A;  1S1W B;  2XLI A;  1UFK A;  2YNH A;  1KDN A;  3PJW A;  4X2B A;  2U1A A;  4CIO A;  4DSE A;  4KH0 B;  2ZH9 A;  1RT2 B;  3PRB A;  4ZCI A;  4DPY A;  1CUL A;  2DR6 A;  4G1P A;  1WC4 A;  1UEK A;  2JSX A;  4JI2 F;  3G9C A;  3FRZ A;  1BGX T;  4OX9 J;  1FDA A;  1CG2 A;  2JNJ A;  3P6Y C;  5F0U A;  3KHG A;  5C24 B;  2COL A;  5A6W A;  2IVM A;  2QO3 A;  3HD1 A;  2J9D A;  3TX0 A;  3CC4 S;  3C14 B;  3CJ5 A;  4DX6 A;  4TXS A;  2MLZ A;  4BLG A;  1YGY A;  2CQ1 A;  3C2P A;  2L08 A;  5BYS A;  4H4O A;  1XN9 A;  1RT1 A;  3N6L A;  4C4W A;  1T9X A;  1IR0 A;  2VFT A;  2Y0B B;  4WK1 A;  1HYS B;  1H2V Z;  4BWM A;  2AYE A;  3UD3 P;  2LEA A;  2F4V J;  1Q7L B;  2VH7 A;  3A3O B;  1X4B A;  4ID5 A;  3MM5 B;  1TU0 B;  4DEZ A;  3FVY A;  3KG4 A;  1JIH A;  4YY3 J;  1XJW B;  2ZDO A;  3NGT A;  4NE9 C;  4QIW D;  1KKH A;  3KUH A;  4EK2 A;  4DR4 F;  4MIB A;  4FXD A;  1IVZ A;  1JKH B;  3PIP Q;  3D3C J;  1GAO A;  3D1Q A;  2XZT B;  1QTM A;  1VQ6 S;  2RS2 A;  1L3T A;  3H59 A;  1XWL A;  1D09 B;  4M5K A;  3J7Y U;  1U1L A;  3QRQ A;  2FVR A;  1K0V A;  5DET A;  3HDS A;  2VA2 A;  1K1S A;  2VG7 B;  5KT2 A;  3TW0 A;  2V2K A;  4WFY A;  3LTO A;  2ZNZ A;  3SDE A;  3KMQ A;  1Q79 A;  3RB6 A;  4CH1 A;  2A10 A;  4Q8F A;  3QRP A;  4V19 J;  1ZBT A;  3K0J A;  3BBC A;  4IG0 B;  1UVK A;  4FN5 A;  4B3S F;  1O8B A;  1N36 J;  4NYO A;  5KFS A;  3MEG A;  4X4R A;  4IDK A;  4X4U A;  4HL9 A;  3IGN A;  2C2N A;  3OFF A;  2QA2 A;  3W2V B;  2K3I A;  1FRJ A;  4A48 A;  2CPD A;  1EB0 A;  3FMW A;  2R42 A;  5GAE U;  2FGC A;  1Q81 T;  4UST A;  1NAQ A;  1N0U A;  4EZ6 A;  2HFN A;  1XR5 A;  4XTT A;  2F9J A;  3IRX B;  1Y00 A;  2FC8 A;  3BH7 B;  3V81 B;  4QU7 A;  4RZR A;  2ZM6 J;  2K06 A;  2HYI B;  4DSL A;  3Q23 A;  4FS1 A;  4RW8 B;  4ZPC A;  1RT7 A;  2E1R A;  1FJC A;  4CNZ A;  2K1R A;  1S48 A;  2DO0 A;  3J7A 1;  2HS0 A;  2FZG B;  1WC6 A;  3M8Y A;  1RBO B;  4LBI A;  4C97 A;  3H25 A;  2M7S A;  3UD4 P;  3OSP A;  3DOL A;  3W9H A;  4OV6 A;  4PQU B;  3I9Z A;  1K73 T;  3GII A;  3LP2 B;  5LMU J;  1UCN A;  4M5J A;  2ZBI A;  4DFK A;  2O01 C;  3OTD A;  3PYG A;  1RTD B;  3CD7 A;  5FLX U;  1HLW A;  4FYX B;  4F4Z A;  4IOA Q;  1FJ7 A;  4ENO A;  5E3Q A;  4J9N A;  2KKH A;  4JYA J;  4KR0 B;  4CLS A;  3N5B A;  5E3A A;  1JLE A;  4EBD A;  2I6W A;  5HMY A;  4R0E A;  3KLE B;  4WE1 A;  2FHO B;  3TX8 A;  2JL9 A;  3K5P A;  4TYA A;  4Q8E A;  3G86 A;  3KJQ B;  1JJ2 R;  3QO9 B;  4DR6 F;  3DKD A;  1QUV A;  2HQC A;  1S10 A;  5ETP A;  3DHX A;  1FWL A;  2MQL A;  2MST A;  5K8M A;  1QE1 A;  1NK5 A;  2AEM A;  3DRS B;  1VQ8 S;  3JYT A;  3HUL A;  4DV7 F;  1O5J A;  4DHV A;  4PWD B;  3HX9 A;  3EPG A;  2KDO A;  3D2W A;  1TMJ A;  3BYP A;  3BR8 A;  2QFJ A;  3G71 S;  4IFY A;  4J91 A;  1RWP B;  1N6Q B;  3DXS X;  3MCN A;  1UL3 A;  4DPT A;  2KG1 A;  4ZVH A;  3MUV P;  1NXI A;  3BO4 A;  2WB1 D;  4QQB A;  5FDL A;  5IT0 A;  4NZ7 A;  3UR0 A;  2GIF A;  2LQ9 A;  4JI8 J;  4LUB A;  1U2C A;  4W90 B;  3CCS S;  5KFH A;  1X4F A;  2HKE A;  2JEJ A;  5A2Q Y;  4L6V 3;  3AHP A;  5ETL A;  3I32 A;  1JB0 C;  3MTK A;  1PYT A;  4IO1 A;  2DXF A;  2CVI A;  4OI6 A;  2ACM A;  5HO4 A;  1YSJ A;  4U7U K;  1M5P C;  4B9U A;  2OJ3 A;  5AXK A;  2ZUG A;  1V5V A;  4BDP A;  4FYW B;  2NXN A;  3TUI C;  3DM2 B;  1UVL A;  2PA8 D;  4CM0 A;  2ZH8 A;  2CQ0 A;  5GAG I;  2Z30 B;  3FEZ A;  1VCT A;  3BQ2 A;  3E01 B;  3NOC A;  1URN A;  2BE9 B;  1W7W A;  4P72 A;  2R2U A;  3KFW X;  4MKY A;  2LEC A;  4O3P A;  4DR7 J;  5DDQ C;  1I3O B;  2KO1 A;  3FCV A;  2OEJ A;  3BSN A;  1RXO B;  2KVI A;  3BPS P;  1SB6 A;  1R8P A;  4H54 A;  2YWF A;  2ZWO A;  1I51 B;  1NLK L;  3VAL A;  3D4J A;  2G1D A;  4DUZ F;  2J5A A;  3W66 A;  3DMJ B;  4UZC A;  3LQV A;  5JXS A;  3SCI E;  2QLJ B;  2DK2 A;  3Q2T C;  2I5J B;  2K8G A;  2NYI A;  4KGV B;  1PGZ A;  1JJC B;  4Q0B B;  4OHX A;  1YG0 A;  4ES1 A;  3Q8R B;  3K7R A;  1VC5 A;  3VGS A;  4F0M A;  3CE8 A;  2MTL A;  3F73 A;  2OPP A;  3O3L A;  5KFE A;  5I3U A;  4DV5 F;  1H7X A;  1Y4Z B;  1HWK A;  4JI7 F;  2MQM A;  3HHL C;  3I31 A;  2ADC A;  4ZVG A;  5THW A;  2ZC4 A;  2K3K A;  3DRP B;  4P7T A;  1FES A;  4F50 A;  2E1M C;  4KHR A;  5BYQ A;  4LSL B;  4K7Q A;  3CT9 A;  4HVZ A;  2F8M A;  4JI0 J;  1VC6 A;  3MM8 B;  3KJF B;  3OFE A;  1W2B R;  1RU1 A;  4GVB A;  4K2X A;  4Z7C A;  5CHC B;  3R97 A;  4CH0 S;  4NI2 A;  4DWI A;  3QAU A;  1ZAW A;  5L8R C;  3MMA B;  4DL6 A;  1NHK L;  1I94 J;  3I0R A;  4ECY A;  2M4M A;  2G9O A;  3WQP A;  1HA1 A;  4URS A;  3OXF A;  1OO0 B;  3CJK A;  3KLG B;  1PJ5 A;  1SH0 A;  3O6Q A;  2YNI B;  4LF8 J;  3CVK A;  3KNA A;  3H5Y A;  5L1L A;  2QSW A;  2DIV A;  4ZPB A;  4OHY A;  3VR1 A;  2Y3Y A;  2VBW A;  2ASY A;  3M05 A;  2MQQ A;  2Y1I A;  2FGO A;  1RKI A;  5G0R B;  2D7S A;  3N5F A;  4TYB A;  2KZM A;  2FVQ A;  5J2M B;  3H4D A;  2XGQ A;  4ILL A;  4LT6 A;  1HQE A;  5I3Q A;  2XMU A;  3R6G B;  5L1K A;  1M1G A;  1H7W A;  1SXL A;  2XYP B;  1V3R A;  4P2F A;  4KO0 B;  3R1L A;  4C0B A;  1IKV A;  4ID8 A;  1VQL S;  1RQ0 A;  1FRK A;  5IFM A;  3SCJ E;  1EQM A;  3ZZU A;  2WSF C;  4I6A A;  1VRT B;  1PYS B;  3BZQ A;  1NSP A;  1YJV A;  2MEW A;  2DXE A;  2ZE2 B;  4ZP6 A;  1F1B B;  2I0X A;  2DYA A;  4HTI A;  5LMN F;  4WFA Q;  2XSJ A;  2QTW A;  2H4W B;  2PI5 A;  2B6A B;  1AYE A;  2D69 A;  4WWS A;  3S01 A;  4KGM A;  3G8T A;  4LF6 J;  3M6X A;  2YY3 A;  5IWA F;  3OVB A;  3DOM B;  2F8E X;  2HWT A;  5C25 B;  2AYM A;  3BRE A;  4ILM A;  2E44 A;  2GW8 A;  3V6D B;  2RUG A;  1ZM3 A;  2YH0 A;  3V4M A;  2W24 A;  3AA9 A;  2LVW A;  2Q3P A;  2PMZ D;  3T9Z A;  4B08 A;  1RTZ A;  1XNQ F;  2VBZ A;  3IS9 B;  2VFV A;  4OYO A;  3BH6 B;  1FA0 A;  3PX0 A;  3QWP A;  4LRC A;  5T41 A;  2CJQ A;  1SBR A;  2W01 A;  2XMM A;  2DY1 A;  2UZA A;  4O0I A;  2YX7 A;  5C42 A;  5ITH A;  2Y0S D;  1RCO B;  2B4O A;  2EK6 A;  4DG1 A;  3RTV A;  1XNR F;  2AEF A;  2GIR A;  3CDB A;  4DV2 F;  3RGI A;  1S6Q A;  5J1P A;  2DHS A;  3D0H E;  5JUM A;  2ZH6 A;  1YVF A;  3ZTS A;  1Q8K A;  1XIQ A;  1HBO A;  3N28 A;  1WC3 A;  2BW2 A;  1HNI B;  4XAK A;  4N8O A;  5SUH A;  1OPI A;  4L3K A;  2BAN A;  3V6J A;  2HRU A;  1VRU A;  2PEB A;  2XCA A;  4A8K A;  2P5V A;  2LXI A;  2HEK A;  1NK9 A;  2Q6C A;  1R0A B;  4DFM A;  2CNK B;  1KOH A;  2R7X A;  1S1X B;  1N0V C;  2HMI A;  2XMJ A;  4M5D A;  4O44 A;  1CJT A;  1S72 S;  1RWV B;  4PRF A;  2HUR A;  2GX8 A;  2D3O R;  4A8W A;  5HP1 B;  3JQK A;  1OSD A;  1NEE A;  5E3P A;  2IHR 1;  3CB4 A;  4C3L A;  4JI5 J;  3PEJ A;  1TL1 B;  3U02 A;  1DAR A;  4B3R J;  5CYM B;  1JK9 B;  1FDN A;  1FNX H;  1YRT A;  1WEL A;  2AT1 B;  1MRO A;  4WFN Q;  4M8L A;  1GH8 A;  2ZVS A;  2AJ0 A;  3M8Z A;  5I42 A;  4CYU A;  2W9B A;  3KK3 B;  2OIH A;  2L9W A;  4ES2 A;  4KRW A;  2LXF A;  4MKA A;  1HI0 P;  1RA7 A;  4R0J A;  4DLE A;  1U8S A;  1JXE A;  4EBC A;  4C8K A;  2IDL A;  1TAQ A;  2DO4 A;  2W9A A;  2VHG A;  1TEL A;  2YNH B;  2Z2Z A;  4WXW A;  2V4J B;  5M2U A;  5G4D A;  1S99 A;  4J5O A;  3DYA B;  4YHH J;  3LP1 A;  3IP0 A;  3NG8 A;  1QUP A;  4N56 A;  1RHU B;  1HNV B;  2ZHO A;  1M5O C;  2VJU A;  2C28 A;  4HAC A;  3IBW A;  2KH9 A;  5K20 B;  4JI4 F;  1EP4 A;  2YNF A;  2ACY A;  2DNK A;  3PAC A;  3AOD A;  3T3F A;  2VIC A;  2B0G A;  2BRK A;  5DGB A;  3M2U A;  4CT8 A;  3M2V A;  5DZ7 A;  3DCA A;  2HLU A;  1VBK A;  2M8H A;  3I87 A;  4XK8 C;  3GFX A;  4OI0 A;  2Z56 B;  3KUG A;  4WZQ A;  1WF0 A;  1QSS A;  4RNF A;  2CA9 A;  3HVA A;  1F5C A;  4OZJ A;  1K1Q A;  5B0F A;  2HBQ B;  2MHE A;  3QGG A;  2QG9 B;  4LFA J;  2AW0 A;  4DL2 A;  4G6V B;  2MZQ A;  3B78 A;  4RBT A;  3RYL A;  2XMT A;  2AJ4 A;  4URG A;  4NAS A;  2NPI A;  1UAW A;  1UWB A;  2UXC F;  1SJ3 P;  2IAJ A;  2IDE A;  3I6P A;  4ECR A;  4M5M A;  2LXU A;  2O3D A;  1B3T A;  3HT3 A;  1UPP A;  2FC9 A;  3CCZ A;  3CD5 A;  3KLF B;  2ZZN A;  2MLY A;  3FC9 A;  2VA3 A;  1U0S A;  3X1L B;  3EE3 A;  1VMB A;  1GMU A;  1Q5V A;  4OFZ A;  4QW8 A;  2HRT A;  1T3N A;  2OO4 A;  2CZV C;  1T8E A;  1H72 C;  1X4E A;  4ZCM A;  4QPT A;  3SDE B;  4J9S A;  2J7K A;  5KG4 A;  3DGP A;  1IKY A;  3MMB A;  4PXC A;  3RRK A;  1P1T A;  3RB0 A;  1J5E F;  4OYX A;  1Y7P A;  2IFX A;  2Q79 A;  2LQ8 A;  3V4I A;  2AQ4 A;  2MGZ B;  3CIZ A;  2HHS A;  2OFH X;  3TUZ C;  2LQ5 A;  3FCW A;  2ZKU A;  5DZ6 A;  3VVU A;  3A3P B;  3T6B A;  2RH3 A;  2NSC A;  3BGL A;  1A9N B;  2XNQ A;  2K2P A;  1YX2 A;  4AE5 A;  2B4V A;  1ZOT A;  3TP2 A;  2GGP B;  5L9N A;  5IQ6 A;  1YJN S;  1HBM A;  3MPY A;  3MZI A;  2DIS A;  1Y5N B;  2GJ2 A;  2R8G A;  3M2R A;  3RBZ A;  3OR1 A;  4DQI A;  2ZH5 A;  2CYY A;  3DLG A;  1GXU A;  1TFY A;  2Z2L A;  2EFV A;  3KK1 A;  1S4E A;  3W1Y C;  1UZD A;  1NK4 A;  4UQG A;  1X4G A;  1X5S A;  4Y6I A;  4DV4 J;  4OYI A;  3H98 A;  1SJQ A;  1ZZF A;  3A13 A;  1RT7 B;  4JI3 J;  1N56 A;  3NEK A;  3NS6 A;  5RUB A;  5KFM A;  3UDC A;  1TL3 A;  3SMZ A;  1UWA A;  2HQI A;  3JSM B;  3CCR S;  1SQF A;  3IAM 9;  5LL6 d;  2P9C A;  2IYI A;  2V50 A;  3TNV A;  4N5S A;  5LSL A;  1B64 A;  1VR6 A;  3D5M A;  1VHF A;  4JP8 A;  3AQP A;  2ROP A;  2YNG B;  2JFD A;  4F67 A;  4CLP A;  1D3W A;  3ICL A;  3QMQ A;  1U1M A;  2VFS A;  1SKR A;  2AJQ A;  1DQ9 A;  4ZVF A;  1G3O A;  3TAQ A;  1MWZ A;  3QBC A;  2E1C A;  4NLX A;  2PMW A;  1HBU B;  2DNH A;  1XMB A;  3QRR A;  2OPS B;  3KDN A;  3W5X A;  4X4P A;  2NUU G;  3VZH A;  2J0X A;  3OR2 B;  4DL4 A;  5HQL A;  3S7R A;  4ELT A;  4F4A A;  2WCX A;  2GVD A;  2FLO A;  1S0V A;  2VDH A;  1IKW B;  1DTQ A;  3A8K A;  1S1U B;  1R6V A;  5ETT A;  3D6F B;  1OY6 A;  1TR0 A;  1RHM B;  3GTY X;  1JJH A;  1SQE A;  3P8B B;  2WVF A;  3HKW A;  2YQ1 A;  3UR3 C;  1S6O A;  5LMU F;  4W92 B;  2MKK A;  3TAR A;  3OTO J;  1JMT A;  2FJE B;  3ETO A;  4UY8 5;  3W3S A;  2IRX A;  2K7J A;  1T11 A;  3FDS A;  1S79 A;  2HFZ A;  4WTO B;  5FDL B;  3HVT B;  4QJV A;  4P73 A;  1DZ5 A;  4AFF A;  3CWJ A;  3GYG A;  3UPF A;  4JYA F;  4O3N A;  5KFF A;  4A4J A;  1LWE A;  2N82 B;  4B3M J;  4EWT A;  4LSZ B;  1EAY C;  5A8R A;  2B9Y A;  4ECS A;  3J80 Y;  5HVG A;  3WDO A;  4PWU A;  3HFZ B;  4DV6 J;  2RKI A;  4CO1 A;  1NZA A;  2Y1L B;  3KHH A;  2MB0 B;  2VBX A;  1BC6 A;  3GCW P;  2NQP A;  4RW4 A;  4YS2 A;  3PRV A;  2GVZ B;  4C8M A;  4C48 A;  3C6U B;  2CPH A;  4B3O B;  3CCT A;  1IXK A;  3MR5 A;  4OI3 A;  1VDH A;  3HHL B;  4MK7 A;  5AE3 A;  3GSI A;  2LA4 A;  2CWX A;  3BYR A;  2ALZ A;  2CQ4 A;  4DS4 A;  3KMS A;  8AT1 B;  3HI9 A;  3LF0 A;  2G2Y A;  5A8K B;  2MXY A;  3N6N A;  1GX5 A;  4B3T F;  1FE0 A;  1BQN A;  1S6P B;  2BJ8 A;  4CO0 A;  4GKJ J;  4F36 A;  1XC9 A;  4DSK A;  3NY0 A;  2DGV A;  1QJH A;  4DQR A;  3MM7 B;  4MIA A;  2R2S A;  1RA6 A;  2ZOG A;  3OXG A;  3ELH A;  4CO3 A;  3AA8 A;  1FKP A;  4OYA A;  3TVZ A;  2LEP A;  1TKZ A;  2E1P A;  5IM0 A;  2LEB A;  2GML A;  5AT1 B;  1NUE A;  5KFN A;  2N4C A;  1H73 A;  2JLF A;  1OIA A;  5HBM B;  1DLO A;  2BJE A;  5D3G A;  3GIL A;  3MPD A;  1RUS A;  5EUH A;  5D78 A;  4ANE A;  2JLE A;  2UXD F;  1D9D A;  2HVH A;  3H7H B;  2XZD B;  3GCX P;  1NDL A;  4X84 A;  5JVG Q;  5E0O A;  3HCX A;  2GIQ A;  5ETR A;  1UMJ A;  2J9D E;  3U7J A;  4K4U A;  4RR5 A;  4G1Q B;  5IXU A;  2CJK A;  4BS2 A;  3MAQ A;  2OPQ A;  1R31 A;  1RT5 A;  1UJ6 A;  3UNY A;  5F9N A;  3NCP A;  2D1C A;  4HDG A;  1JQG A;  3QSY B;  3KLI A;  3DLK B;  2E7W A;  3MM9 B;  4H4M A;  1IBK F;  3BSC A;  4NI2 B;  3T1Y F;  2HBR B;  1RHQ B;  3SXL A;  2IJF A;  1DFD A;  3B82 A;  3TZY A;  4RNO A;  2O67 A;  5JMN A;  4N47 A;  2H5I B;  2ZBP A;  3PJ9 A;  1WKL A;  4KFB A;  5KTQ A;  3S6E A;  4KV8 B;  4ZVR B;  2HNZ B;  2KI2 A;  1VQS A;  1G2E A;  5KFX A;  2B56 A;  4X62 F;  1YJR A;  4X66 F;  4H4K C;  3OD2 A;  1VI7 A;  4YUD A;  3A4T A;  3ILI A;  3JSR A;  1HWL A;  1DBD A;  2KJW A;  1IM4 A;  2F40 A;  2XYG B;  3DRY A;  2I8E A;  2X3D A;  1L3S A;  3QGH A;  2B5J A;  2VJV A;  1FTR A;  1TKT B;  3L7O A;  3QT5 A;  2GJF A;  2N4D A;  2RDD A;  2W8L A;  1HI8 A;  5DDO C;  4JI0 F;  3T6J A;  2N3L A;  2AYB A;  3C15 B;  2QYG A;  2ZD1 A;  1HPZ B;  3IWN C;  3MCS A;  2V94 A;  4DX7 A;  5CYJ A;  2H9Z A;  3WHI A;  4JI2 J;  1UA1 A;  4Y2M A;  4LF8 F;  3FMB A;  4I7F A;  4ED7 A;  3T5K A;  2XSJ B;  4QWB A;  2GQC A;  1F5A A;  4IYQ A;  3NMA A;  3OUY B;  1SV5 A;  3FSY A;  4ALZ A;  1WG1 A;  1VGY A;  4KHM A;  2GAH C;  2R7S A;  4AL7 A;  2HAI A;  4YR2 A;  3HD2 A;  4DV1 F;  2OKQ A;  3N01 A;  3SQG B;  3DFE A;  4PXD A;  1TL7 B;  3R7N B;  3G87 A;  1YQH A;  5K8P A;  1PYO B;  4QR0 A;  4UW2 A;  1ZZN A;  2AJ2 A;  1RTH B;  3HO1 A;  3EXC X;  4J9P A;  2UUA F;  4AT1 B;  2UVU A;  2H54 B;  2F7V A;  3TAP A;  4QYZ J;  3MM6 B;  3BS9 A;  2FHJ D;  4XIU A;  3PX6 A;  1VQP S;  4B02 A;  3Q8Q B;  3E3X A;  7AT1 B;  2VG5 B;  2R8H A;  3KNG A;  3FUY A;  3NL0 A;  7FD1 A;  4NLO A;  3PO4 A;  3FEX B;  4DR4 J;  2JX2 A;  4DG1 B;  4C0H A;  3MEK A;  3I82 A;  5AE1 A;  2RNE A;  2XMA A;  1MSW D;  2GQ2 A;  3CPW R;  1GTH A;  4DFP A;  2D9P A;  3DRR B;  1WOP A;  1CS4 A;  5A8W B;  2CJ9 A;  2RQM A;  1KVJ A;  2F5G A;  3IMQ J;  1REV A;  4ICL A;  3QZ7 A;  2HLT A;  2X3G A;  5EWF A;  2ZZM A;  2DR8 A;  3LPY A;  1RT6 A;  5HMZ A;  2L3M A;  1PIE A;  1RBA A;  1WF2 A;  4R5P A;  3HHN B;  3NWR A;  3POT B;  5B0G A;  3H90 A;  2ASL A;  4KTQ A;  2HWI A;  3TQ1 A;  2XY5 A;  4BBY A;  2Y8Y A;  1S9F A;  4XPC A;  3W60 A;  1S77 D;  3N0V A;  1EIY B;  2CDR B;  4EFA C;  4P6Q A;  1C1C B;  4J90 A;  1QVF R;  2DRD A;  2QL7 B;  3PKM A;  4B3S J;  2IC3 A;  1SKU B;  4ZK7 M;  4CM2 A;  1J2V A;  2OEK A;  2HNY B;  1Y11 A;  5HRO A;  3L7U A;  1W2I A;  3DU5 A;  2JWN A;  4FYY B;  1SIW B;  1F6T A;  3P5B P;  1NND A;  1OMS A;  5AJ3 F;  1RWX B;  3GJT B;  3MUT P;  1C0U A;  3SYZ A;  3HZE A;  4PG4 A;  4CLF A;  1NJI T;  1MRO B;  2IM2 A;  1RCX B;  2NXU A;  5I42 B;  4CYU B;  4Y3C A;  4WBF A;  4YFU A;  3OJS A;  2FIU A;  3GU0 A;  2XWY A;  2E5H A;  1PAU B;  3HFK A;  3D6H B;  1B0V A;  2VIH A;  1X9W A;  3K8V A;  1LW0 A;  4Q7A A;  5HAN A;  4WFX A;  1JLC A;  1IKX B;  4YP3 A;  4PG6 A;  1CJK A;  2HSE B;  1KWM A;  3ISN D;  2KFZ A;  2M9K A;  4ED5 A;  2LYV A;  4WXO A;  3DLE B;  3I4H X;  4B9T A;  3RUB L;  2LFV A;  2Y8W A;  1RSC A;  1GNK A;  2VPY B;  2KJV A;  1UVM A;  2YWE A;  4ZVP B;  3CIM A;  2WHO A;  4UUX A;  4KHP F;  2CQG A;  1KVK A;  2F8H A;  1X5P A;  1WJ9 A;  4A46 A;  4C0O C;  5BYR A;  1WWH A;  2OPR A;  5IV4 A;  1HMV B;  4USJ C;  4NX9 A;  3SSQ A;  5DJB A;  1Y0H A;  1KBR A;  2R7Q A;  4GC7 A;  3MAA B;  2WVE A;  4DPO A;  3M8P A;  2QRR A;  5F8G A;  5J1N A;  3MOJ B;  2IY5 B;  2HGN A;  4F7V A;  2C2Z B;  5FLX Y;  1ULR A;  3UDE A;  5KG5 A;  3GR0 A;  3BF4 A;  2CKW A;  1U0H B;  2SXL A;  2Z0G A;  3UI3 A;  4W98 A;  5L39 A;  4O3Q A;  3AXK A;  2Z58 B;  1W26 A;  5KG1 A;  1S9G B;  2VG6 A;  4M95 A;  2H1Y A;  3CCL S;  3D0I E;  2PDA A;  1LW2 A;  3PYD A;  4DQQ A;  3ET6 B;  4DV7 J;  2XMW A;  2AJF E;  3AD8 C;  2WSE C;  2ZFH A;  3TAM B;  4EO8 A;  2IAJ B;  2YKN A;  2CUY A;  3TUJ C;  3J81 Y;  4DR5 F;  1MW7 A;  2W9C A;  4UUW A;  3Q8S B;  1WTF A;  4ZS6 A;  2C2D A;  2CNO B;  4NA1 A;  4L76 A;  1NBE B;  1HBN A;  1Z1Z A;  2HIQ A;  3NWG A;  3MED B;  3QJJ A;  4WU3 A;  4KSE B;  5HMX A;  2EPI A;  3AQO A;  5E7O B;  5IC4 B;  2Z2M A;  3SIP B;  1RHJ B;  2ASD A;  2YXL A;  3QPI A;  1SL0 A;  4DOZ A;  2NR0 A;  4HLB A;  4EI2 A;  1QVG R;  1RAD B;  3G82 A;  4UT4 A;  1E6Y A;  3QJP A;  4IFV A;  4K59 A;  4XPE A;  1U09 A;  1VC0 A;  4LF2 A;  4M5I A;  1N4L A;  4CRJ A;  3MMB B;  4PPD A;  2ZUA A;  1RKJ A;  2RE1 A;  2DNM A;  1Z2Z A;  1ACM B;  1U2F A;  3GFZ A;  3GON A;  4ZVT B;  2HAF A;  1KC8 T;  1VIS A;  3V4I B;  1GFW B;  2L9N A;  2ILY A;  3KLH B;  2D3Z A;  4OZL A;  4J9U E;  2OH2 A;  2HFS A;  5GAH I;  1BUX A;  1CJV B;  1K44 A;  2VF3 A;  2VC0 A;  2LDI A;  1AFJ A;  4DLG A;  1BQM B;  3CCJ S;  1TV6 A;  2W4P A;  3WC2 A;  1CVJ A;  3OR1 B;  1S1T B;  5H9E J;  2BAB A;  4IUF A;  3C6T B;  2V4R A;  4FDF A;  5F0W A;  2E29 A;  2WB4 A;  2F63 A;  4F3M A;  2PC6 A;  3VAF A;  1UTA A;  3X3U A;  1KQF B;  4JI7 J;  1TL3 B;  4YB7 A;  3JQM A;  4A8X A;  2BKN A;  4NLD A;  2HW3 A;  4RL1 A;  4ECX A;  2JJ4 D;  3AOC A;  1MN7 A;  3M8S A;  1ZYQ A;  3QJL A;  1WKK A;  3QT7 A;  4O3S A;  4YR3 A;  1SJR A;  2N7Y A;  5KG0 A;  4NXM F;  2H51 B;  4O3R A;  3H4B A;  3IWL A;  4RUA A;  1Q5Y A;  2WOM B;  1M0S A;  3FZB A;  2APO A;  4CLT A;  2VBY A;  2BEF A;  4WPA A;  1BE4 A;  2V2Z A;  1QAY A;  1TUV A;  5A0Y B;  4TY8 A;  1UFL A;  4L74 A;  5D0R A;  1UKU A;  5BR8 F;  2M70 A;  4CDI A;  3R9L A;  1R3N A;  3DOK B;  1S49 A;  3DDN A;  1Q95 G;  3MHY A;  2E9R X;  1CEZ A;  1EHW A;  3WBZ A;  2EFQ A;  3R5A A;  3AXM A;  4DV4 F;  5D4L A;  2R4F A;  3ITH A;  2FJX A;  3PX4 A;  2CAD A;  5T7L A;  1ITP A;  5CCL A;  3LUY A;  2BOP A;  2QJ3 A;  2XQC A;  3BDP A;  2IA0 A;  2V8H A;  3LW5 C;  1GEH A;  2I9S A;  3PIO Q;  2OMO A;  3VTI A;  1HHS A;  1C1B A;  4PPZ A;  3QID A;  2QLX A;  2BW7 A;  2IBK A;  2JEF A;  4USV A;  4EZ9 A;  1NJZ A;  3M32 A;  2EFP A;  2XS7 A;  1SI9 A;  3NXZ A;  1NDC A;  1XMQ J;  5HQM A;  4I69 A;  2DHX A;  2DTJ A;  4ZJO A;  2YVS A;  5I3P A;  4M63 A;  3ZZT A;  4LF7 F;  5CYQ B;  3LH2 S;  1IR1 A;  1IUJ A;  2CQ3 A;  4CI0 B;  1Q16 B;  2MMY A;  2DNY A;  5LMN J;  2WVC A;  3AJ2 A;  1X5T A;  4HEA 9;  1U25 A;  3T5L A;  4NLS A;  1JLQ A;  2YX4 A;  4KKO A;  5IT4 A;  2X7I A;  2XYH B;  5HLF B;  5K9F A;  5J2P A;  2DGU A;  3RBX A;  1M5S A;  4MFB A;  4MK8 A;  5IWA J;  2RKI B;  3UN5 A;  3IRW P;  3PXG a;  1GK8 A;  3ZNJ 1;  3MEE B;  1NCL A;  2DR5 A;  3EVM A;  3FBC A;  3UDV A;  3FBB A;  1FER A;  4JUZ A;  1YJ7 A;  3EWG A;  2WBM A;  2RF2 B;  4GO7 X;  2N3O A;  2AZ1 A;  2PFF B;  1XNQ J;  3AT1 B;  3TVK A;  2H48 B;  1CC8 A;  4C8L A;  1X4C A;  1VQ4 S;  1T03 A;  2QFI A;  4TN2 A;  4P2S A;  3I55 S;  3GG1 A;  1KQK A;  1C4A A;  3D1H A;  4NOH A;  2MZJ A;  5HAO A;  1FKP B;  9RUB A;  2RHS B;  3LOU A;  2V9W A;  3HSG A;  1XNR J;  2DD8 S;  4DN9 A;  4DV2 J;  5CZX A;  4U95 A;  4EU0 A;  1OQ6 A;  4K4T A;  4NRT A;  1RLD A;  3FJ2 A;  3I0S B;  3IA0 A;  1VRQ C;  4MKB A;  3W62 A;  3THP A;  4DDF A;  3MMJ A;  4USM A;  5HVF A;  2ATC B;  4Y2K A;  3BN7 A;  4BCA A;  4DBQ A;  2YWG A;  1FNM A;  3AJD A;  2EWH A;  2IM1 A;  1VHI A;  3PDN A;  1D1U A;  3KHL A;  1JNZ B;  2RML A;  1NB2 A;  5KFW A;  1R8C A;  4AYB D;  3OQ2 A;  4M5N A;  2Z2Y B;  1KQG B;  3KK2 A;  1F9H A;  1IJE B;  2JC0 A;  3RRG A;  2GAG C;  1PAE X;  5F9L A;  4TNO A;  3MFH A;  3RZA A;  3D68 A;  3PNI A;  5A2Q U;  2OD4 A;  3NBP A;  2BBE A;  4P75 A;  2BRL A;  5GME A;  1FXD A;  5GAG U;  1HWU A;  2K7K A;  1V3Z A;  1OJ4 A;  4LRA A;  2E66 A;  1U2R A;  2R2T A;  1EET B;  1FFG B;  1Q82 T;  4NML A;  2DPJ A;  1ARO P;  2BE7 D;  2W2Q P;  2LA6 A;  2ZKT A;  3M4X A;  3MR2 A;  1E6V A;  1UFW A;  3BO3 A;  3GV5 B;  2DNL A;  4ZN3 A;  4PUO A;  3NMR A;  3TVY A;  4EGL A;  5KAK A;  1OY9 A;  3RW6 A;  3DDI A;  3BBF A;  2PI4 A;  3M6W A;  2DHA A;  1SL2 A;  4TY9 A;  3NGK A;  3FZ2 A;  3PV8 A;  3GWC A;  4DUY F;  3THV A;  2KFN A;  4N77 A;  2EKY A;  1QAJ A;  4QOT A;  2OEL A;  4WF9 Q;  2W2P P;  1VQN S;  4Y28 C;  1T3O A;  2KFY A;  1DAX A;  1L3U A;  3M8R A;  1TKX B;  3CCM S;  3ILJ A;  4TU9 A;  3GV8 B;  3AJ1 A;  3UVJ A;  4YB5 A;  1FVS A;  4OI4 A;  3VVT A;  3DI6 A;  2KT5 A;  1FRL A;  1Q8B A;  4OLO A;  5CA5 A;  2DGT A;  3CJQ A;  1FRM A;  3AOA A;  4MMO A;  1YJ9 S;  4OJG A;  3I5B A;  5EWG A;  4JI4 J;  3PHT A;  2VFU A;  5E5N A;  4A8F A;  4MAK A;  1F9F A;  3RR7 A;  1D8Z A;  4NYP A;  4E98 A;  4CWB A;  2H3E B;  2JEI A;  2YKM B;  3H20 A;  2W7P A;  3OVS A;  1HR0 F;  1X8D A;  2OTJ S;  1M1H A;  2LP4 A;  3JAM U;  5J2N A;  1U6Z A;  1CJU B;  3C16 B;  4PYD A;  2R8K A;  1LK5 A;  4CO4 A;  3AD9 C;  1IJF B;  1T9V A;  4HTJ A;  1TUW A;  1FKA F;  3QGI A;  3TEH B;  3SCL E;  2QL9 B;  1KN6 A;  1C4C A;  2FZK B;  2V34 A;  1X0P A;  3TZX A;  3EGW B;  4RO0 A;  4U96 A;  1WD6 A;  2Q66 A;  5HQ8 A;  3MAH A;  3MUM P;  4YN3 B;  2UXC J;  2L9D A;  4ZN1 A;  2B9E A;  2VON A;  3T5H A;  5C2C A;  1SVD A;  3HVR A;  1O0P A;  4ZP9 A;  1G6B A;  1DTT B;  4LF9 F;  4RNH A;  4D3G A;  2NXE A;  4DPX A;  2ZOF A;  1YHQ S;  3QLH B;  1VJQ A;  1VQ7 S;  2BE2 B;  1YJW S;  1S1V A;  4ZPW R;  5B08 A;  2J6S A;  3DDK A;  2D3O 1;  3CUL A;  4ICL B;  1LWC A;  3R2D J;  2BJ1 A;  5LSR A;  2AD9 A;  3A1Y G;  1RZM A;  4RW9 A;  2P6S A;  3CCV S;  3A12 A;  2KL8 A;  3PR5 B;  5DO2 A;  4CTA A;  1FX2 A;  3WZ0 A;  2VUG A;  1U6B A;  2BJ9 A;  5KOX A;  2W2O P;  1D9A A;  1XK8 A;  1J5E J;  2B7B B;  3MMC B;  1GXT A;  1S6U A;  1WOO A;  1X4A A;  3CDU A;  5D0H A;  1AXQ A;  1RT2 A;  4YDX A;  1FWK A;  3VAI A;  1RJJ A;  2MQO A;  2HS3 A;  4J9V A;  1WEY A;  1S4F A;  5ETS A;  4OYP A;  4ZIT A;  4NRU A;  1YJT A;  1JNR B;  5HRO B;  3QIP B;  4KB7 A;  2CJX B;  4C8N A;  1KS2 A;  6FD1 A;  1KLM B;  3BGO P;  5DRK A;  4U9R A;  5C24 A;  1GTE A;  3CJR A;  4DN0 A;  1C0U B;  1MWY A;  4IOB A;  1NJX A;  1IQZ A;  4N76 A;  4E8U A;  3LO3 A;  3C14 A;  3D1O A;  2ZC3 A;  2J0Q D;  3HSZ A;  1XMO F;  2FPH X;  1T9T A;  1WTB A;  3GYN A;  2E5I A;  2BM1 A;  1HD1 A;  1ZET A;  3I9V 9;  3MXH P;  2D74 B;  2DRB A;  4LSN B;  5LSO A;  1HYS A;  1WUU A;  2MY7 A;  4LRE A;  1YBA A;  2OSQ A;  1UZH A;  4DU7 A;  4YDD B;  3QGP A;  3W64 A;  1FKO B;  3NGS A;  2UUB F;  3MM5 A;  1NJW A;  1KTV A;  1XR7 A;  5DQI A;  2QIF A;  4OZN A;  2DGQ A;  1Q86 T;  1RT3 B;  2V8D A;  2YKA A;  4NWB A;  1RT4 B;  3M9O B;  1YRX A;  4OHV A;  2V2V A;  1N33 F;  1SUQ B;  4CO2 A;  4RW6 A;  1Q53 A;  2BOA A;  2YWK A;  2AGO A;  2FDN A;  2MPU A;  1I5O B;  1QDU B;  2OPR B;  3IBF B;  1JKH A;  2KXN B;  1S7H A;  2CQP A;  3CO0 P;  1WEZ A;  3V6K A;  1FF2 A;  2CJB A;  4MK9 A;  3HHL D;  1NPK A;  2OSR A;  2ATL A;  3OPK A;  1T7P A;  1S7I A;  1FD8 A;  5KG7 A;  1X7V A;  1FX4 A;  2F9D A;  4ZVU B;  4DR3 F;  2D3U A;  5DM6 Q;  1KFS A;  2HK3 A;  1ZM9 A;  2BR0 A;  1ZA2 B;  4OX7 A;  4B9S A;  1TK8 A;  1KVI A;  2ZOM A;  3HFV A;  4PQA A;  2HBY B;  2WSC C;  1HNZ F;  2RB7 A;  1UVI A;  3D6T B;  1JLF B;  3R5J B;  2CVE A;  4IG0 A;  4QZV B;  1QLN A;  3A8E A;  4L72 B;  5KFP A;  3TI0 A;  1C0T B;  5KFJ A;  3RAQ A;  2EKN A;  5HJY A;  3VCD A;  3SSR A;  1F0X A;  4GC6 A;  4LRB A;  2EEY A;  1B7Y B;  5LT5 A;  1A6L A;  3CME S;  4ZOS A;  4DQP A;  2VKR A;  4RW7 B;  2G0J A;  4ES3 A;  3D3B J;  2JFK A;  3N9U C;  2A3J A;  2NXJ A;  3CTR A;  2E9Z A;  2YWW A;  1Y9O A;  1E6Y B;  4GKK F;  2LU2 A;  2YKQ A;  4YR0 A;  2NRE A;  2FHJ A;  3HHK A;  4Q43 A;  1LXN A;  3IRX A;  4RNM A;  1S0M A;  3RR8 A;  3V81 A;  3C19 A;  3H8Y A;  5CZV A;  5KFG A;  1WG5 A;  4RW8 A;  4E2F B;  3M8Q A;  1SH2 A;  1HNW F;  5KFR A;  3OTE A;  2ZIT A;  2DPI A;  1IR2 A;  2MDA A;  4MJK A;  2GHV C;  2GS8 A;  3R27 A;  4ZPD A;  3LAK A;  3H40 A;  1TL4 A;  3MPW A;  1EKS A;  4P71 A;  3IG1 B;  1Z2L A;  5KFO A;  2EI5 A;  4PQU A;  4I6Y A;  4NCG B;  4TKT A;  1Q8L A;  1OYD A;  3LP2 A;  1J5O B;  3TRG A;  1APS A;  2EFO A;  2JRS A;  2AGQ A;  3HSJ A;  3CMA S;  4LR8 A;  2WON A;  4X64 F;  4LF5 F;  4OX6 A;  4B3T J;  3W5Y A;  1SC4 B;  2ZJR Q;  1HHQ A;  3F0N A;  1RTD A;  3AD7 C;  4IRC A;  4RNN A;  2ZDP A;  1WOS A;  2E5J A;  4F4W A;  3EVW A;  5ETV A;  3L9Z A;  3CXC R;  2DR9 A;  2A2D A;  4FNI A;  2KT3 A;  3NNA A;  3IGV A;  2ZVI A;  2VQE J;  1HQU B;  2CWK A;  3HXM A;  4LQ9 A;  4C3M A;  3KLE A;  1XQI A;  5L9X A;  3BR9 A;  3VQT A;  2CIM A;  2AX0 A;  4OZ3 A;  3QO9 A;  2WBR A;  1HD0 A;  2XSF A;  3UD5 A;  4ECW A;  2UXD J;  2X1A A;  2EK1 A;  4ELV A;  1S76 D;  3PM9 A;  2YH1 A;  2X51 A;  3DRS A;  3DN9 A;  4FBU A;  5DGA A;  2CPJ A;  4PWD A;  4F4K A;  3UNG C;  2DH7 A;  3E51 A;  5KFY A;  2I2Y A;  2XY7 A;  4IQM A;  2E7X A;  2Y9H A;  1DQ8 A;  1N6Q A;  1IBK J;  4NLY A;  1Z4U A;  3T1Y J;  1BY9 A;  4ZHR B;  2FJB B;  2HHW A;  5L1I A;  2CNL B;  4MKV A;  4F26 A;  2O1P A;  1URR A;  1B99 A;  1ZAV A;  1MU2 B;  1YKW A;  2RDJ A;  2W2M P;  1NKC A;  4Y0F A;  1UVN A;  4NEZ A;  3W63 A;  4RPF A;  4I67 A;  3HPO A;  4CLL A;  3D7S B;  3IC1 A;  4WZM A;  1CPZ A;  4LJM A;  2OHD A;  1Y3J A;  9ATC B;  4X62 J;  1WC5 A;  4X66 J;  3G8S A;  5KFD A;  1JLA B;  2M5Y A;  2HND B;  1NK8 A;  3CSK A;  3S1T A;  1RTJ B;  3M30 B;  4I68 A;  3BKT A;  3DM2 A;  4G65 A;  3UCU P;  2C3P A;  1ICE B;  1I1G A;  4DZD A;  1S5Z A;  1X31 C;  1N48 A;  3BGR B;  2R2R A;  1LEO A;  4QU6 A;  2WAQ D;  1KD1 T;  1RK8 A;  4I2P B;  3RW7 A;  2M8D B;  2EBE A;  3I56 S;  3T9N A;  2BJ3 A;  2CG8 A;  2AWZ A;  1X9S A;  3F56 A;  4MH8 A;  2EBG A;  2A2C A;  3A8I A;  2X1F A;  2MQN A;  3TQE A;  1UJ4 A;  5D6G A;  5GMD A;  3O8W A;  3DMJ A;  3MR7 A;  4RJV A;  2PN6 A;  2MKJ A;  3K89 A;  1Q4R A;  3KXD A;  1CC7 A;  2I5J A;  5J2P B;  3K8W A;  1TVR B;  4Q0B A;  3ENQ A;  4P52 A;  4V19 X;  3B8H A;  1KLN A;  5DG9 A;  4QIV A;  4UOF A;  2DEI A;  4B9M A;  3KTQ A;  3E2E A;  2H5J B;  2CQC A;  1UJ5 A;  2CQI A;  4DV1 J;  4LQ3 A;  5J1E B;  4FS2 A;  3Q22 A;  2GNK A;  3EXY A;  2P6T A;  2UUA J;  1T9Y A;  3T1H J;  1T05 B;  3DRP A;  3TOQ A;  4DUT A;  4N41 A;  2B51 A;  4LSL A;  5ETM A;  1VK3 A;  1XMQ F;  2XHW A;  3MM8 A;  1RLC L;  1EJ7 L;  1MWQ A;  1T03 B;  1FJG F;  2UUC F;  1SC3 B;  5HAT A;  3MMA A;  2A1B A;  2G2O A;  2V6A A;  1R43 A;  3KLG A;  2RS8 A;  3DLJ A;  2YNI A;  2CPF A;  4ZKA A;  1RDR A;  3ZO7 A;  3JSY A;  4O4G B;  1WHV A;  2POK A;  4Y00 A;  1RAO A;  5DLF A;  4LFC F;  2FJA B;  5KFL A;  3GIM A;  4IH7 A;  2QV6 A;  1VQO S;  3DLH A;  2MZR A;  3IR6 B;  3V5R A;  5KT3 A;  5KFV A;  1GT8 A;  3M1V B;  3OTB A;  5G0R A;  3SV3 A;  5J2M A;  2HIY A;  1TTH B;  1PO6 A;  2CZ9 A;  2XY6 A;  5GVQ A;  4ED0 A;  3DHW C;  4ZVE A;  3SQO P;  5BJR A;  4P9S A;  4NLP A;  1SC6 A;  2VC1 A;  4B9N A;  3Q83 A;  1BWE A;  2Z8Q A;  5J2Q B;  4KO0 A;  5FJ4 A;  2DB1 A;  3EZO A;  1GQE A;  1LXJ A;  2IVY A;  3BB5 A;  2M52 A;  3EZ5 A;  2PD1 A;  5AXM A;  4DXL A;  4HYK A;  1VRT A;  4F02 A;  2Z57 B;  4L3N A;  5ETO A;  1KOO A;  2ZE2 A;  1NK0 A;  3TJ8 A;  5AJ3 J;  2HVZ A;  3A8J A;  2BQU A;  2DNP A;  2LQJ A;  1U1P A;  1RBL A;  3U1L A;  2B6A A;  1JLB B;  2A0F B;  4DJB A;  3MDF A;  4DPW A;  3PG9 A;  4PWW A;  4YB1 P;  4IG3 B;  3ZTQ A;  1S9E A;  3VV2 B;  1HNX F;  5E2Q A;  3Q2S C;  5CAB A;  3DOM A;  2RIL A;  2IIH A;  3FFI B;  2JZ5 A;  1M1K T;  3LWM A;  3V6D A;  4DU8 A;  1FK9 B;  3PRD A;  1DUR A;  2JC1 A;  1ZAX A;  1NPP A;  3KYL A;  1G1X A;  1N34 F;  2VQF F;  3KLV A;  3LP0 B;  2MQ8 A;  3ILO A;  3OHA A;  4A8O A;  2QA4 G;  1RTI B;  3CC2 S;  2PE8 A;  4CCH A;  2B9X A;  3MPV A;  4Y2A A;  2RJZ A;  3IS9 A;  4AND A;  2RD5 C;  3MEC B;  2XMK A;  4QYZ K;  4BHQ A;  2IM0 A;  2CQ2 A;  3LWL A;  1R6Y A;  4ETZ A;  3DC2 A;  1G4C A;  4KHP J;  2ROG A;  1OWX A;  3AAW B;  4ILR A;  4N7T A;  3LAL A;  1XTZ A;  4DF8 A;  5K14 B;  5HSP A;  1KP6 A;  1SJ1 A;  2B4U A;  2GO9 A;  1U1Q A;  3NGD A;  3PEH A;  4X65 J;  4DZ6 A;  2QMX A;  5KT6 A;  1VIO A;  4TLQ A;  2HHV A;  2IRY A;  2Y1R I;  1HNI A;  1WDT A;  1QSL A;  3OTC A;  3NRB A;  3R2C J;  2W4C A;  1FRH A;  1BWV A;  4RUC A;  1CLF A;  5GAD I;  4PYA A;  3W8P A;  5H9F J;  1VLO A;  5ADZ A;  1CUL B;  3K5M A;  3N4W A;  1R0A A;  1S1X A;  2NCK L;  1BHN A;  4FBT A;  2A18 A;  2EW9 A;  3NNC A;  4DR5 J;  2AX1 A;  3HHD A;  3PHE A;  1TZ0 A;  5LXY A;  2KTQ A;  1SQG A;  3TR5 A;  2NZ4 A;  2RSQ A;  4OHZ A;  2BZ2 A;  3V6H A;  5HL7 Q;  5HP1 A;  4ECT A;  5IQQ A;  2EXU A;  3T5J A;  3K59 A;  4FF3 A;  1R8A A;  2YQ0 A;  4MIW A;  1TL1 A;  5F8M A;  3LPE A;  5CYM A;  5ETN A;  2NXC A;  4LVN P;  2CQH A;  5E41 A;  4HHJ A;  2GCF A;  3TAN A;  4ERD A;  3RAX A;  4KY3 A;  2R8J A;  4H4O B;  1F5B A;  1RT1 B;  1U4B A;  4YQW A;  4Y65 A;  3KK3 A;  4LBP A;  4W4M A;  4C98 A;  3R5C A;  4C11 A;  4FF1 A;  5DQH A;  4ID5 B;  1HI1 A;  4NEY A;  2VOD A;  2V4J A;  3KHR A;  4PG5 A;  2BVZ A;  5F8N A;  1PIL A;  1WAC A;  3DYA A;  3SV4 A;  4TU7 A;  4JI1 F;  4C3K A;  4CP5 A;  4FZV A;  3BGU A;  2F1F A;  3OW2 R;  4ZMM A;  1HNV A;  1FNO A;  4P2X A;  2HHU A;  3VHQ A;  4RX6 A;  4GVL A;  2C3M A;  4DSI A;  2O5D A;  3QT6 A;  2BKP A;  4WFZ A;  4RU2 A;  4O0N A;  2HPU A;  2MKI A;  4OMF G;  4BC9 A;  2GA7 A;  1U45 A;  1H98 A;  4CNY A;  1ZM2 A;  4FPR A;  4TVA B;  3ENA A;  4A8Y A;  3G6X A;  2FJV A;  2V8P A;  4WYW A;  2XO6 A;  4FYD A;  1R7I A;  4LF4 F;  3TWZ A;  1RAI B;  1SL1 A;  2R3V A;  1WOR A;  2VPW B;  4OYZ A;  1FJE B;  4ZPA A;  3ULH A;  3FQL A;  2GV1 A;  3P5T L;  4UTG A;  4ECV A;  1U02 A;  4ZIW A;  4DI6 A;  2JVO A;  2ZBR A;  3FEY B;  2YKP A;  2LLZ A;  3MEG B;  4IDK B;  3VAJ A;  4R8U A;  4ZIV A;  4NXM J;  2PSZ A;  2AV5 A;  3D67 A;  2RT3 A;  4C9D A;  3MFI A;  1TUG B;  4RW6 B;  4YOE A;  2I38 A;  3H2U B;  4QR1 A;  2QZ8 A;  1AUD A;  1IN0 A;  3KLF A;  1U7L A;  3K17 A;  1R8H A;  5E33 A;  3PCO B;  4X4N A;  3K5O A;  5BR8 J;  5D8H B;  4WKR A;  3FKB A;  3ZTP A;  2CAJ A;  2MY8 A;  2J6U A;  4LRD A;  2VPX B;  4C8O A;  4LIR A;  5SZT A;  1U48 A;  1X0F A;  1H38 A;  4NZ0 A;  4LFB F;  2K1R B;  1IQT A;  3G6Y A;  3HK2 A;  2OLW A;  4F8R A;  3KUE A;  1S97 A;  1NM2 A;  3KJV A;  4PAB A;  4ZJQ A;  2JDJ A;  3LGH A;  4AUK A;  5AXL A;  3DOL B;  4NA2 A;  4OJH A;  3R7B B;  2E5G A;  3B4D A;  5I4M A;  4DL7 A;  2CPX A;  2MGZ A;  2JOQ A;  3HP6 A;  2RIJ A;  2DKO B;  2W1B A;  3K58 A;  3EVO A;  2YPY A;  1QAX A;  1QAI A;  4LF7 J;  1FFS B;  3EZU A;  1F2H A;  3CDW A;  2M2B A;  3DGV A;  2GGP A;  3TA1 A;  4K4W A;  3NAH A;  1NME B;  1JLE B;  2UP1 A;  4DFJ A;  4WE1 B;  3KKF A;  5HK4 A;  3VAM A;  1QM9 A;  5H9E K;  4WP8 A;  2KG0 A;  3KJN B;  2DCU B;  1D8Y A;  4QIG A;  2Q43 A;  3M8Q B;  5IT9 U;  2QYC A;  1NZ8 A;  1T94 A;  5KG2 A;  4K5R A;  2IMO A;  1QE1 B;  1VQY A;  2ZH4 A;  2WVD A;  1NH8 A;  1EQ0 A;  3JYT B;  4MT1 A;  2BAC A;  5LXR A;  2IYG A;  3GLJ A;  2AHO B;  5KFC A;  4JI6 F;  4IO9 Q;  3JSM A;  2UU9 F;  2MJN A;  5KOW A;  4JOU A;  4IFY B;  4RUB A;  1IBL F;  2CZ4 A;  1NKB A;  3SFG A;  1UET A;  2CPE A;  2WON B;  4FP9 A;  1UP1 A;  2DIU A;  2YNG A;  3RBD A;  3H0P A;  2E7V A;  4DR2 F;  3VAK A;  5LOQ A;  1VFJ A;  2BJ7 A;  3T1A A;  3FRY A;  5IV3 A;  2MYF A;  1SKS A;  3JSB A;  4FNH A;  1HBU A;  3PTW A;  1NB7 A;  5CXT A;  2OPS A;  2R7V A;  2DGX A;  3J7Z 5;  2FLN A;  4NYZ A;  3OR2 A;  4FF2 A;  4U8V A;  4O4R A;  1AUS L;  2IRU A;  1M5V C;  2V8G A;  2L48 A;  1IKW A;  2XO7 A;  4KIA A;  3J81 U;  2DNR A;  2ZJP Q;  1S1U A;  3IR5 B;  4K4V A;  3MGJ A;  3EIC A;  3CD0 A;  1OQ3 A;  4X4Q A;  3EX7 B;  3MD1 A;  1RWW B;  1BLU A;  2JLG A;  4X4S A;  1YLX A;  2LQB A;  3ZNU A;  4WK3 A;  2BQR A;  4FYV B;  3IN5 A;  4AD6 A;  3I4P A;  3PR4 A;  1ZM4 A;  5IOL A;  3GJQ B;  4ANC A;  1HFE L;  2VL1 A;  1HW9 A;  3HVT A;  1NH7 A;  1FFW B;  2XG8 A;  2CFX A;  2NS1 B;  3BBB A;  4ZVQ B;  3H2V E;  2R7T A;  1PKU A;  1LQ9 A;  2ALY B;  5GAH U;  1NPR A;  2VQE F;  3GR1 A;  4NLU A;  3VWS A;  2DBB A;  1K8A T;  1KR4 A;  4G3I A;  2J76 E;  4ER8 A;  2G0C A;  2P9E A;  1FD2 A;  1A0O B;  2OPP B;  3CD6 S;  2QEX S;  2A6O A;  4J9O A;  5I3U B;  2RQC A;  1Q1K A;  1AT1 B;  4DUY J;  4Q5V A;  4A8S A;  4ED6 A;  4I2Q A;  1KTQ A;  1FRX A;  1SPB P;  2GVZ A;  3C6U A;  1TL5 A;  2DCL A;  4B3O A;  1UPM B;  4TQR A;  5F3Z A;  5CD4 A;  1YIJ S;  1U24 A;  5HMW A;  2XM3 A;  3HHL A;  3W65 A;  2CJA A;  4S0M A;  3HVW A;  3TYT A;  5L1J A;  3UO0 A;  4GVB B;  5EWE A;  1N5V A;  2J6T A;  5A8K A;  3I0R B;  3PJX A;  2DGS A;  3CJK B;  1S6P A;  3RB4 A;  4ZPT R;  2HBZ B;  2ZHB A;  5F8J A;  3MM7 A;  2RU9 A;  3BQ0 A;  4UZB A;  3GFH A;  2NLW A;  4K5S A;  4ZLP A;  1KNZ A;  3RU0 A;  2R7U A;  4M5H A;  1H3D A;  4WKY A;  5HVH A;  4HT7 A;  4KGZ B;  2BXJ A;  5HBM A;  1HL6 A;  1HR0 J;  4NPO A;  4DV3 F;  2HHT A;  2IPO B;  2EFG A;  2HQD A;  3D66 A;  1AB8 A;  3BGF A;  2AP6 A;  3EDR B;  3K2Y A;  5DQG A;  1BQX A;  2HFV A;  2PT0 A;  1HQE B;  3KOA A;  1FRI A;  3TA2 A;  3JAM Y;  5F3T A;  4G1Q A;  4KJI A;  1JJ4 A;  1IKV B;  4CLY A;  4CZC A;  1ZA1 B;  2KN4 A;  4LRF A;  1MG7 A;  3DLK A;  3UN3 A;  3MM9 A;  1WNE A;  3KWM A;  2W8K A;  3HM9 A;  1TP7 A;  3EUN A;  3LGN A;  4LR7 A;  3PW0 A;  1EZZ B;  1GMV A;  3TJ9 A;  3T41 A;  1YWX A;  3GZ7 A;  3O1L A;  4LF9 J;  1RI7 A;  1RWO B;  2FVS A;  4J9K A;  1NRK A;  5EGY A;  4OZ2 A;  4KV8 A;  4F0K A;  2HNZ A;  2R7R A;  3GP9 A;  1U6F A;  3HJV A;  2RQ4 A;  2PGC A;  1U1O A;  1FCA A;  4PG7 A;  1EAR A;  1RAH B;  1JWW A;  2AYG A;  3QAE A;  3NS5 A;  1LWF A;  3T1H F;  5D77 A;  1TKT A;  2G2Z A;  5E3C A;  4DV0 F;  2ZJQ Q;  3W2W A;  5KT4 A;  3C15 A;  4X4V A;  1PC4 A;  4LR9 A;  1QD1 A;  1HPZ A;  3AB4 B;  3MCM A;  8ATC B;  1S12 A;  2W7A A;  2C2R A;  5C42 B;  1ZTT A;  2L41 A;  4DR1 F;  2QSF A;  2BV3 A;  4Q45 A;  4C8Z A;  2BDP A;  1O51 A;  4ED3 A;  4NXN F;  3ZZY A;  1Y10 A;  1S6Q B;  4JV5 J;  3FCH A;  3EDQ B;  3OUY A;  3GPA A;  1ROF A;  3G6E S;  1I6J A;  3OV7 A;  3K57 A;  1S9E B;  2DNQ A;  5KT7 A;  4P74 A;  2DNG A;  3R1H A;  4KPY A;  1HBO B;  1XMO J;  5LM7 E;  2XLJ A;  5C5J A;  4IRK A;  4C6A A;  3K5L A;  3CCQ S;  3SQG A;  1FEE A;  2VFR A;  1TL7 A;  2PA3 A;  3B54 A;  2BAN B;  3D9B A;  1AA1 B;  5JJB A;  4ZLL A;  1VRU B;  3IWX A;  4ELU A;  1L5U A;  1RTH A;  1VS3 A;  3CJS A;  4IQX A;  3L4B C;  3NCR A;  3LGM A;  1Q7Y T;  2NUH A;  3M7V A;  2KM8 C;  2LMI A;  1W25 A;  4FKY A;  2V69 A;  2HMI B;  3MM6 A;  2UUB J;  4RBV A;  4L75 A;  2KZZ A;  2FZC B;  4OI1 A;  3J7Y I;  1FVQ A;  4M5D B;  4A47 A;  4O44 B;  1DY3 A;  1CJT B;  1J27 A;  3Q86 A;  3TZW A;  2HG4 A;  2VG5 A;  2DH9 A;  3NLC A;  3A3N B;  3H5X A;  1N33 J;  2VV5 A;  4ECQ A;  4AQY F;  2DH8 A;  2HZC A;  3PFE A;  4URQ U;  1PJ6 A;  4TQS A;  4B9L A;  2XC9 A;  3P4U B;  3P45 B;  3NKY A;  1Q78 A;  3ZTO A;  4LBH A;  2B4P A;  4JV1 A;  3DRR A;  3CO9 A;  1ZS6 A;  3OLA A;  2V9K A;  1U1K A;  5A8W A;  3ILL A;  4TU8 A;  3UE2 A;  3D6M B;  2UXB F;  2GJI A;  2W9B B;  1SJF A;  1N32 F;  4DR3 J;  3NGU A;  4ZJL A;  1TAU A;  2J8A A;  1IBM F;  2KXH A;  4DL3 A;  1RAB B;  4RUH A;  5F8L A;  3EPI A;  1R8B A;  2IM3 A;  3OSN A;  2KYZ A;  3POT A;  3KG0 A;  5HJX A;  6AT1 B;  1VQM S;  4ECZ A;  4U6P A;  4D3H A;  2VB6 A;  2J9C A;  4KE5 A;  1RWN B;  4XDD A;  4HI1 A;  4QCL A;  1HNZ J;  4DX5 A;  5GAE I;  3LP1 B;  3BM7 A;  1C1C A;  4IRD A;  1CQM A;  5B0E A;  4FXV A;  4UOH A;  1S0O A;  4HAC B;  2HNY A;  2CXE A;  2IJN A;  4ZCL A;  1EP4 B;  5D0E A;  4RKU C;  2YNF B;  3KDO A;  1JXL A;  1PJ7 A;  4PCQ A;  1FXL A;  1FHT A;  2C42 A;  3M2U B;  3CJ2 A;  3M2V B;  4DCP B;  1YIT S;  4KT0 C;  1RAA B;  2OEM A;  4X65 F;  4JV0 A;  3BKU A;  4GKK J;  1MMD A;  2EG2 A;  2LU1 A;  2J0W A;  2UUT A;  3SSS A;  1KON A;  1HNW J;  4C11 B;  1WDD A;  4DMZ A;  1T95 A;  2FHM A;  3OBI A;  2AKW B;  1OPZ A;  3VZI A;  4F25 A;  1V9O A;  1V6H A;  4QW9 A;  3M6V A;  4IOC Q;  2C3Y A;  2R8I A;  1IKX A;  2ZBC A;  2NSB A;  3CCW A;  2EG1 A;  1UWB B;  2C3U A;  2W7O A;  4USI A;  2PO4 A;  3DLE A;  4O23 A;  3HT0 A;  1YJU A;  2DIT A;  1PBA A;  3QFH A;  3S8S A;  5KFI A;  1NK6 A;  3GB0 A;  3LA0 A;  2V0N A;  1L3K A;  4X64 J;  4LF5 J;  1RWK B;  2ASJ A;  3N6M A;  1Y5I B;  2OGU A;  3I96 A;  2CQD A;  4K0K F;  1RU2 A;  1T0T V;  2X1B A;  4ED4 A;  2HHH F;  3CC7 S;  2XUL A;  3D28 A;  1HMV A;  3OT9 A;  1DJ0 A;  2DEJ A;  3W7B A;  1QY7 A;  3MAA A;  3CJ3 A;  3IM8 A;  2DT9 A;  3PYE A;  2QT7 A;  1AZS A;  4P2M A;  3AOB A;  2H65 B;  1P1L A;  2NYH A;  2FVC A;  2WW4 A;  1UA0 A;  1U0H A;  3FQK A;  4M5G A;  3DGP B;  1IKY B;  4QR2 A;  5AXN A;  3ENW A;  3MPU B;  1S9G A;  2E1A A;  4DSJ A;  1RYR A;  4WP3 A;  3TO8 A;  4OJ1 A;  1NDK A;  4DPU A;  4FF4 A;  5B0B A;  3ET6 A;  1NHV A;  4OV1 A;  3BSO A;  4E0D A;  4R8U B;  4TLR A;  3SFU A;  3CMQ A;  3TAM A;  4X4T A;  3SCK E;  2MZS A;  4KAI A;  1KHV A;  4OX9 F;  4K4S A;  2H4Y B;  4WCE Q;  4RBU A;  5EX3 A;  5C2G A;  1IWG A;  2Q1L A;  3MED A;  1HBM B;  3V2U C;  1LNQ A;  2CNN B;  3VGV A;  3M2R B;  3NP5 A;  2HFO A;  3VQS A;  2Y1J A;  3DLG B;  3W5Z A;  1F2G A;  2IA6 A;  1RWU A;  3VGU A;  3KK1 B;  1JLG A;  5JVH Q;  3JTN A;  3IO1 A;  3D0G E;  4F0H A;  3ZZZ A;  3NAI A;  1HQ2 A;  2KVQ E;  5KFB A;  3CDA A;  3MUR P;  2F4F A;  3ISZ A;  4ZDN A;  1GX6 A;  1TFW A;  1WHW A;  3UWT A;  4OI2 A;  3RAM A;  1ZTW A;  3KJV B;  4X4O A;  2F4V F;  3GFY A;  2QLF B;  7FDR A;  1R0B G;  1YZ7 A;  2X1G A;  2M0G B;  2GHW A;  4FKX A;  2V5H G;  2BQ3 A;  3CF5 Q;  3KLH A;  4YY3 F;  4IR9 A;  4OYM A;  3M8W A;  1RHK B;  5KFT A;  4V1A k;  2N7C A;  4MYT A;  1NSA A;  3W8G A;  5GMK a;  3F44 A;  3ZZR A;  2RDI A;  4HT5 A;  4C8Y A;  1CJV A;  1AW0 A;  1R0C B;  4NZ6 A;  4IR1 A;  1BQM A;  1S0N A;  1N5Y A;  3VAG A;  2RU3 A;  1U1R A;  5KFA A;  3EMT A;  3UCZ P;  2VDI A;  2KRB A;  3GJS B;  1S1T A;  4WTY A;  4EO6 A;  2W25 A;  3PYF A;  3GQC A;  4F3Q A;  4PG8 A;  2ERR A;  1PCA A;  5IS2 A;  4F4X A;  3C6T A;  2GVD B;  2FYX A;  2QA4 S;  3HLU A;  3ZFV A;  1RAC B;  3GG0 A;  2DNO A;  1DTQ B;  4K2J A;  1B0T A;  1MNE A;  2OP5 A;  3JB9 k;  4ED8 A;  3RG6 A;  4FVC A;  2MKC A;  1FDB A;  5F41 A;  3CUN A;  4EYI B;  1N36 F;  2BYC A;  4U67 Q;  1PC5 A;  1XER A;  1UEV A;  4EMD A;  3E8O A;  2YKO A;  2ZBQ A;  2DGO A;  3VF0 B;  2MZT A;  5E3R A;  5D0G A;  1FJG J;  1YRU A;  2R9L A;  2UUC J;  2FJD B;  2WOM A;  3EJM A;  2AGP A;  1GMW D;  3LAN A;  2MHN A;  3G4S S;  5A0Y A;  3HSD A;  4LVO P;  1LWE B;  4J9R A;  1DQA A;  2BA9 A;  1YTY A;  3DOK A;  5A8R B;  5D4N A;  4LFC J;  3F41 A;  3H42 A;  4KGX B;  2ZM6 F;  1K9M T;  3UW1 A;  3OVA A;  4CT9 A;  1B7F A;  4NLW A;  4DL5 A;  3MI7 X;  1KEK A;  4RW4 B;  2OML A;  5EN1 A;  1BD6 A;  2DHH A;  3Q8V A;  3ZZO A;  2EVZ A;  2LCW A;  4RWX A;  5FII A;  2MLX A;  4WIQ A;  2FB0 A;  4ZPV R;  2FLL A;  1RAG B;  3RBE A;  2JVR A;  2V68 A;  1P6T A;  1WSV A;  3SZ2 A;  1BQN B;  1X5O A;  2RRA A;  4QBU A;  4PZV A;  4GRS A;  5LJ5 Y;  5K5M A;  4NA3 A;  2GMJ A;  2YQ3 A;  5CYQ A;  4K4Y A;  4IKA A;  1BMQ B;  4J7C A;  1QSY A;  3WX8 A;  1TKZ B;  1KQS R;  5IM0 B;  2XI2 A;  5DS7 A;  3O44 A;  2RRB A;  3TEG A;  5HLF A;  2UV8 A;  4HH0 A;  3RB3 A;  1DLO B;  4DSF A;  2WK4 A;  5D3G B;  4NLG A;  3MWB A;  1HNX J;  4CO5 A;  3CJT A;  2HQ3 A;  2KHC A;  3MEE A;  5CCM A;  4I2Q B;  4HHU A;  1FTC A;  2HHQ A;  3HJF A;  3CCE S;  1UVJ A;  4J9L A;  1P9Q C;  3MR6 A;  2HGL A;  1N34 J;  2XGP A;  4KPC A;  2VQF J;  2RF2 A;  2OPQ B;  4GO5 X;  1RT5 B;  2GQQ A;  4OZ0 A;  2B8Q A;  4A8Q A;  3KLI B;  2QLW A;  2UVV A;  4H4M B;  3OL7 A;  1P9Y A;  3H5U A;  3ZZP A;  1D9F A;  2GMH A;  1ZPW X;  2HZA A;  2VZ9 A;  3IR7 B;  2DVI A;  2F65 A;  4GMK A;  2QLB B;  3GIR A;  2J7U A;  4JI8 F;  1M5K C;  4NCA A;  2ZEJ A;  1NDP A;  5K8O A;  5BXI A;  2JHE A;  4KFB B;  4Z7Y A;  3CED A;  4Q2M A;  1B0P A;  3UCG A;  1QTN B;  4I1T A;  3NS7 B;  3CNQ P;  1WKJ A;  1H2U X;  1C2P A;  3KG1 A;  3C3L A;  3EGZ A;  4UOG A;  1X4H A;  3R5G A;  3PO5 A;  2E5L J;  3I0S A;  1VJW A;  3R8Y A;  3P96 A;  5CH7 B;  3C66 A;  3R3T A;  1VIX A;  3R5B A;  4OHW A;  3MTJ A;  1PG5 B;  5B0D A;  2DR7 A;  3IAS 9;  4H4K A;  2B5J B;  2KXF A;  3TA0 A;  3QYY A;  2MJU A;  3OL8 A;  4UF4 A;  1RAJ A;  2ZD1 B;  4R25 A;  4OL8 A;  2VU5 A;  5CQG A;  4DR7 F;  4PAA A;  1VQ9 S;  5LJ3 Y;  1YBU A;  2J9E A;  2AZ3 A;  4KC5 A;  1EET A;  4I7F B;  3CJ4 A;  4K4Z A;  2HRY A;  3BV8 A;  5L38 A;  1SV5 B;  3GE9 A;  2XS2 A;  2QN6 B;  3L3C A;  1UW9 A;  1IM6 A;  1LFP A;  3HKZ D;  4ZLJ A;  3RRH A;  1TKD A;  4Z2X A;  2FD2 A;  2OFG X;  1NSQ A;  2XB2 D;  4KYZ A;  2HHP A;  4NLQ A;  2FY1 A;  5K8N A;  3P3D A;  1LWF B;  4KH1 B;  3UDL A;  2DNZ A;  2D9O A;  2WTF A;  3AH6 A;  1RWM B;  4YB6 A;  2FHK A;  3G8Q A;  3LAM A;  1Y5L B;  2H5E A;  2XMV A;  3W2W B;  4CLK A;  3M9N B;  2MKH A;  4ZA1 A;  3K5N A;  4QPX A;  2ZH3 A;  1TKX A;  5C7P A;  5D4O A;  2OD6 A;  3EM1 A;  4M5L A;  1VK8 A;  1G7C B;  4P7V A;  2DHG A;  3CGI A;  1KSP A;  2KM8 B;  2KHD A;  2KYX A;  1XR6 A;  1HKA A;  1I94 F;  4JI1 J;  2R7O A;  4NMX A;  3SI8 A;  4ZLN A;  3UN2 A;  2CPY A;  2XTJ P;  2BUN A;  2M3D A;  1EKR A;  4OQJ A;  2KB2 A;  4PXE A;  5MLC V;  5M2P A;  1RP5 A;  1CS4 B;  4HI2 A;  1Q8I A;  3THT A;  4CLU A;  3BEG B;  1N5T A;  4HHH A;  1JX4 A;  3PW4 A;  2G4B A;  5M2R A;  3BDE A;  1S59 A;  2YKM A;  1UW4 A;  1REV B;  4QWC A;  2XI3 A;  1MN9 A;  5MAO A;  2VAS A;  1RT6 B;  3NGR A;  1CJU A;  3C16 A;  3ZC4 A;  2E9T A;  4LF4 J;  2RRN A;  2FJW A;  1U49 A;  4R5P B;  2P8I A;  3QAT A;  2UVR A;  4EUV A;  2RUS A;  4O3O A;  3W9I A;  5KFQ A;  2RQK A;  3BKF A;  1S1W A;  2V63 A;  1PSD A;  4KBI A;  2YPZ A;  5F8H A;  3TUP A;  3OL6 A;  4CLW A;  2IC3 B;  3RJM B;  2I1R A;  1CQN A;  4OIX A;  3QQC D;  4CH7 A;  5H9F K;  1WC0 A;  4QIE A;  1RAE B;  3MCO A;  3GSD A;  4DCJ B;  2B9W A;  3OFG A;  2VOO A;  4J9M A;  2ILZ A;  3OFH A;  1DRZ A;  1U26 A;  4F3O A;  2F3J A;  3W9J A;  3PW2 A;  4JV5 F;  2XS5 A;  4WYL A;  5A76 A;  3FGV A;  1FWP A;  1R27 B;  1DTT A;  1VBZ A;  1WI8 A;  4I56 A;  4LF6 F;  2C1E B;  4Q44 A;  3M6U A;  3QLH A;  3BQ1 A;  1RE1 B;  2BE2 A;  1YDL A;  2PEH A;  3MD3 A;  2C2O B;  3H2L A;  2HQF A;  4DQS A;  3MF5 A;  4LFB J;  1LW0 B;  2FUG 9;  2OI2 A;  1JLC B;  1WHX A;  2IBO A;  3UQS A;  5AE2 A;  1CJK B;  3L09 A;  5DDP C;  2CDQ A;  4OZ5 A;  3MMC A;  4OYW A;  3EYZ A;  4OX8 A;  1VQ5 S;  4B17 A;  1WEX A;  1HIY A;  3QIP A;  2UUW A;  1KLM A;  1R89 A;  3BO2 A;  1REG X;  4USW A;  3M8P B;  1N54 B;  1NJY A;  2B43 A;  2WW8 A;  2DGW A;  1HWI A;  3IFE A;  1F3F A;  1WC1 A;  4I6W A;  1F3V A;  2VG7 A;  3QT8 A;  1LOU A;  1VYA A;  2C2K B;  2HQG A;  5EDW A;  2VG6 B;  3I5C A;  4HR2 A;  1NO8 A;  3PY8 A;  3M9M B;  4LSN A;  1LW2 B;  3ZZ0 A;  3JS9 A;  2PII A;  3PW5 A;  4WII A;  1SCJ B;  4P10 A;  4JI6 J;  4WP9 A;  2UU9 J;  1FKO A;  2YKN B;  5IT9 Y;  1IBL J;  3JTP A;  4UY8 T;  3AY0 A;  2FVP A;  1KHW A;  2W9C B;  3C8Y A;  4AL5 A;  1RT3 A;  2BKO A;  4I0W A;  1RT4 A;  4CLZ A;  2GFF A;  5IZH A;  2LKZ A;  3OJU A;  1HBN B;  1SUQ A;  1FE4 A;  4QWE A;  4F2S A;  2DXD A;  4JI5 F;  3W2V A;  1TK5 A;  3ENV A;  3EGN A;  4NLV A;  4ED1 A;  5GAD U;  4ITS A;  1F60 B;  5ETQ A;  4AXI A;  4DR2 J;  3NCQ A;  4B3R F;  2VD3 A;  3OXL A;  4QIF A;  2DNN A;  5T14 A;  2JH3 A;  1NHU A;  4XDC A;  3GJR B;  3WX4 A;  1HW8 A;  1AZS B;  3G82 B;  1K47 A;  1FO1 A;  4IFV B;  3QWU A;  2AJ1 A;  2P2C B;  1VQK S;  2B3T B;  3CCU S;  4HH1 A;  1UEU A;  3J7Z T;  2LDY A;  4UQT A;  1LK7 A;  4M1K A;  2XHC A;  4FVM A;  3DLL Q;  3PVX A;  4ED2 A;  4DR6 J;  2HK2 A;  3QFW A;  4U7U D;  1FT8 A;  5KFU A;  1N52 B;  1WF1 A;  4JBC A;  5DM7 Q;  3NNH A;  2C2E A;  2YBV A;  4Y2I A; 
#chains in the Genus database with same CATH homology
 3EDQ B;  2XYH B;  1RWM B;  2H65 B;  4ZVQ B;  4ZVO B;  1RWO B;  2HBR B;  5IC4 B;  4ZVS B;  3SIP B;  3R6L B;  1RHJ B;  1RHQ B;  3KJQ B;  1RWX B;  3GJT B;  3D6M B;  3RJM B;  4JB8 B;  2HBY B;  1RHR B;  3R7S B;  1SC3 B;  2QLF B;  3R6G B;  1NME B;  3R5J B;  2CNK B;  2H5I B;  2QL9 B;  2QL5 B;  2XYP B;  2C2Z B;  3IBC B;  4DCJ B;  1RHU B;  2CJY B;  2Y0B B;  2C2M B;  4ZVR B;  3EDR B;  2CNL B;  1RHK B;  1SC4 B;  1RWV B;  2QLB B;  3KJF B;  5K20 B;  3KJN B;  3GJR B;  5IC6 B;  1RWN B;  1PAU B;  3D6H B;  4LSZ B;  1I3O B;  2P2C B;  1RWP B;  2C1E B;  1BMQ B;  3R7N B;  2CJX B;  1QDU B;  4ZVT B;  1IBC B;  2H48 B;  3IBF B;  2H4Y B;  1RE1 B;  1I51 B;  1GFW B;  1PYO B;  2XYG B;  3QNW B;  1QTN B;  2H51 B;  1RWW B;  1RWK B;  3NS7 B;  2Y1L B;  2H4W B;  1F9E B;  2C2K B;  2C2O B;  1SC1 B;  2QLJ B;  2H5J B;  2XZD B;  4DCO B;  2H54 B;  2CDR B;  3R7B B;  2CNN B;  2QL7 B;  3GJS B;  3GJQ B;  3P4U B;  3P45 B;  2HBQ B;  3D6F B;  2CNO B;  2HBZ B;  4ZVU B;  1RHM B;  4DCP B;  2DKO B;  4ZVP B;  1ICE B;  2XZT B;  2FQQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...