5HL7Q

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title A novel pleuromutilin antibacterial compound, its binding mode and selectivity mechanism.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hl7Q00
1HL6A 1VQLS 1G2EA 2KXHA 2M8HA 2LEAA 5BJRA 2L9WA 3I56S 2AYBA 2E44A 2AYMA 3VAGA 4YB1P 1U1QA 3U1LA 5JVHQ 2LYVA 2OSRA 3EGZA 5LXRA 2XSFA 2DNRA 2DGUA 2MZRA 1YHQS 3CTRA 2LEBA 1Q86T 2M2BA 3MURP 4IOAQ 4QU6A 1JJHA 1U6BA 2M52A 3PIOQ 2MSSA 5D78A 5GADU 2KHCA 3UCZP 1N54B 1M5OC 2KVIA 3LQVA 2N3LA 2DISA 2KM8B 2RU3A 5CA5A 1M5KC 3CCUS 1NU4A 3H2VE 2HGNA 2DK2A 2DHXA 1KQSR 3EGNA 4IUFA 3CCRS 2RS2A 1U1PA 4W90B 2MZJA 1ZZFA 2KG1A 1K8AT 4WCEQ 4TU8A 1SJFA 2XNQA 1VQ9S 1X4HA 1X4EA 2CQPA 4QU7A 2CQGA 2DHSA 3CCQS 1YTYA 5LSOA 1YJNS 5GAEU 1SJ4P 2ZJQQ 2XS2A 1Q7YT 1FJEB 3TYTA 1N52B 3CCMS 2NZ4A 5EN1A 2LXIA 4U67Q 1YWXA 5DDOC 1FJCA 4EGLA 3P5TL 2YH1A 5GAGU 3D2WA 2F9DA 3PIPQ 1S72S 3VAHA 2DNPA 1X5OA 3BO3A 3J7YU 1JMTA 4WF9Q 2DO0A 2G0CA 4WKRA 4TU7A 1U1RA 4UY8T 1VQ8S 2N3OA 2MZTA 3CD6S 5JVGQ 2ZJPQ 5LJ5Y 1X4DA 2BZ2A 1DHMA 1ZH5A 3IWNC 5FJ4A 2F9JA 4PRFA 2DH8A 2X1FA 5H1SV 1WEYA 2RUGA 2FY1A 2KYXA 1X5TA 3BO2A 2BOPA 1H6KX 1DBDA 3BO4A 3G9CA 1N8RT 3R27A 2K3KA 3G4SS 3G8TA 1H2TZ 1WHVA 1VQKS 2CPFA 2CPEA 1U1MA 2MGZB 1NO8A 1RK8A 2DGQA 5IQQA 3MOJB 2DGSA 1SJRA 2AD9A 3DXBA 5LXYA 2LCWA 3NS6A 5GAHU 4QQBA 2VOOA 2LMIA 2MKSA 2QEXS 3CF5Q 2VOPA 2V94A 4PR6A 2L08A 1S79A 4UQTA 2DGTA 1P27B 1XN9A 2LKZA 1WF0A 4BS2A 2MPUA 3ZZZA 2DNOA 2L41A 1KD1T 3NNCA 2JVRA 3UCGA 2YTCA 3UD4P 1X4GA 3CCES 2KN4A 1X5PA 1QVFR 2XS7A 2RRAA 1VQMS 2MY7A 2DGOA 3N9UC 3P3DA 4CIOA 3VAKA 1U1LA 5IM0A 2LQ5A 2UP1A 2CQ4A 5HO4A 2DGVA 1OO0B 1YIJS 1JJ2R 1VQNS 5MLCV 3ZZYA 1WI6A 1UFWA 1VQ5S 1FJ7A 1SXLA 2DITA 4FXVA 4W92B 2XNRA 2X1GA 4A8XA 5LJ3Y 3CCJS 1UAWA 1WG1A 3G71S 2PE8A 2WBRA 2J0QD 1UW4A 3R1HA 1HD0A 5GVQA 2JWNA 2KRRA 3US5A 2HGLA 5CYJA 3CCSS 2DO4A 1VC6A 2RS8A 1R8PA 1VQPS 1VQOS 1N88A 2M4MA 1WF2A 4FXWA 4F25A 2DHAA 3S8SA 1H2VZ 2ADCA 1CVJA 2CQ0A 1U2FA 4C7QA 3VF0B 2LA6A 2DGWA 4PKDB 2CPJA 1X0FA 4OZ1A 2ERRA 3MDFA 3VAFA 1VBXA 1FXLA 2MYFA 5DM7Q 1VBZA 1NJIT 3B4DA 4IO9Q 1X4CA 2HVZA 3BEGB 2RNEA 3SDEB 4WFBQ 1W2BR 5D77A 2FHOB 3G96A 2KG0A 3S01A 3CPWR 1DRZA 1OWXA 3FEYB 1PO6A 1SJ3P 2CQCA 3IRWP 2KU7A 4LIRA 5CXTA 3THTA 2CQBA 1B7FA 1KOHA 2G1DA 1FNXH 1O0PA 3U1MA 1X4AA 2AYEA 2CQ3A 2RRBA 3MI7X 3J7ZT 4CQ1A 3LPYA 3G6ES 3HI9A 2I38A 1RKJA 2DNHA 2OIHA 2DHGA 3MUMP 2KXFA 4J5OA 3SXLA 3MXHP 2DH9A 2MKCA 1FT8A 1WHWA 3V4MA 3S6EA 4OZ0A 4F02A 3K0JA 1WEZA 2MB0B 4YOEA 2K8GA 2FC9A 1M5PC 4Y0FA 2KXNB 1M90T 3R1LA 2HZCA 5DDPC 2FC8A 3HHNB 2VODA 5DM6Q 2XS5A 1K9MT 2YH0A 2YWKA 1WF1A 3ULHA 2X1AA 3CMAS 1HD1A 1VQ6S 2Q79A 1R8HA 2HYIB 1YJ9S 3EX7B 2DB1A 4RU2A 3NMRA 3L3CA 3VAJA 4P6QA 2DNLA 3CULA 2J0SD 1WI8A 1M1KT 2CPZA 2LECA 2MJNA 2CQHA 1U6FA 5LSLA 2CPIA 3VAMA 2MGZA 3MUTP 2OSQA 2LXUA 3NNAA 3CC2S 2MJUA 2MKJA 1HA1A 1DZ5A 3CUNA 1YITS 3OW2R 2U1AA 4LMZA 2E5GA 2LA4A 2EK1A 2GO9A 4IOCQ 1QVGR 3SMZA 3CC4S 5IFMA 1KC8T 1WWHA 2DNGA 3NNHA 2DNKA 2OJ3A 2MQPA 1Q81T 4WFNQ 2MQQA 2DNNA 2CPYA 2ZJRQ 1OPIA 3TP2A 3MD1A 1M5VC 3RW7A 3CXCR 2U2FA 1UP1A 1VC5A 2I2YA 5DETA 1H2UX 2FPHX 3UD3P 2KT5A 2MSTA 1WG4A 3THPA 2KM8C 1WHXA 2RVJA 3G8SA 3P6YC 3RW6A 2MQOA 2CPXA 2J76E 2MKKA 4ED5A 3UWTA 5DDRC 1WG5A 3JB9k 2RT3A 2M7SA 1JJ4A 3MD3A 2OTJS 4ZKAA 2M8DB 2KFYA 2N82B 1SJQA 1VQ7S 4WIIA 3UCUP 1Q82T 1FO1A 2KI2A 2RQCA 1F9FA 3Q2SC 2YKAA 2N7CA 1L3KA 2HGMA 2MHNA 2NLWA 4TLQA 2PEHA 2VONA 1X4BA 2MMYA 1AUDA 1ZZNA 2CJKA 2E5IA 5GMKa 2AYGA 2RQ4A 5HL7Q 2MQLA 1WELA 3BS9A 4QPTA 3UE2A 2MZQA 4CH1A 2KRBA 2DNMA 2CQIA 2D9PA 2XB2D 3DLLQ 1U1OA 2D3OR 2B0GA 2DNZA 2EVZA 2J8AA 2MKIA 3CMES 1P1TA 1U1KA 2KH9A 3H2UB 1X5SA 2DNYA 3SDEA 1U1NA 1D9AA 2E5JA 1OIAA 4ERDA 3CC7S 1WEXA 2M0GB 1BY9A 1A7GE 3FEXB 4V19X 2MZSA 4Y00A 1YJWS 2CQDA 1X4FA 2E5HA 4C0OC 2G4BA 2MQMA 5ITHA 2DIUA 2EK6A 4LJMA 3CCVS 1QM9A 3I55S 2DGXA 4YUDA 1FHTA 3S7RA 1D8ZA 1K73T 2MQNA 2QFJA 2MY8A 1IQTA 2O3DA 1PGZA 2MZ1A 2MKHA 1WTBA 1VQ4S 5IM0B 1KOOA 4WFAQ 2JVOA 2CPDA 2X1BA 2M70A 2QA4S 3NS5A 1WHYA 2GHPA 2MXYA 1YI2S 2A3JA 2DIVA 2M9KA 2SXLA 2JRSA 3VALA 2JX2A 2DNQA 3VAIA 2D9OA 2OTLS 1URNA 3CCLS 2CPHA 3MUVP 2DH7A 4TU9A 3TO8A 4CH0S 4Z2XA 2M88A 2CQ2A 1VC0A 1VBYA 2ADBA 4M5DB 3B4MA 1A9NB 3P49B 3Q2TC 5DDQC 4C4WA 4F26A 2CQ1A 2F3JA
chains in the Genus database with same CATH superfamily
2LEAA 3K8VA 1LXJA 2C3YA 4ZN1A 1HBNB 1U1QA 3GP9A 3GV8B 2FVRA 4C11B 1PC5A 3LQVA 3KKFA 1TKZA 2PO4A 3GFHA 4XO0A 1HBOA 2IJRA 5D0EA 5B7WA 1FXDA 1ZZFA 4IKAA 4DCOB 3M30B 1K8AT 5KFYA 2ROEA 3AB4B 1SJFA 1LW2B 5J1NA 1IBLJ 4B3MF 3M9OB 4YR3A 5B0BA 4ZN3A 1N52B 4OLPA 3RBXA 2R2TA 4OYWA 4U8YA 5HVHA 4Q5VA 2HNDA 3MHYA 3I32A 1JMTA 2O01C 2W2PP 3M4XA 2JHEA 1DHMA 2HHWA 1RQ0A 2W2NP 2RUGA 4Q45A 2KYXA 2RDJA 3HF5A 3FC9A 5D0GA 4Q7AA 4KV8A 4DR4F 3NS7B 1S10A 4DV0F 4LBIA 2C2RA 3QSYB 3PKYA 1XMOF 2D41A 2E1MC 4USJC 3QGGA 3NS6A 4S0MA 3EYZA 3OFGA 4PWDA 2RHSB 4I64A 2L41A 2F63A 1DFDA 3CDBA 4DFMA 3G6XA 3EZ5A 1FE0A 2C3UA 1FJGF 3W9JA 4L6V3 4USIA 2IM2A 4NCBA 3DI6B 4OI0A 2E9RX 1JJ2R 4AXIA 3AHPA 4FYXB 4YB5A 3TQEA 2UVUA 2GO8A 1F9HA 1HI0P 4EO8A 5H9EJ 1AROP 3H20A 1EHWA 1SV5B 5GVQA 2R4FA 1RCXB 4LFAF 3MM7A 4M5GA 1EP4B 3Q8SB 3EPGA 3MR2A 2HNZB 4DUTA 2LA6A 2CPJA 4DSLA 1YBAA 2B4PA 4U7CA 2V68A 3RR8A 2V8DA 4L76A 4YDDB 1S1VA 2BX6A 3Q23A 4RW8A 5ETTA 4NA3A 4X4TA 1X31C 3D6MB 3WX8A 4JBCA 1CJTB 1U8WA 4DMZA 1YJRA 2CZ4A 2E9ZA 3G6ES 3QO9B 3HO1A 1IJEB 1QD1A 1Y4ZB 2DH9A 3D6TB 4R0EA 2ZUGA 4NLGA 2HLTA 1FF2A 1JLCA 3C19A 2KXNB 3R1LA 3HJFA 3BV8A 1J27A 2X1AA 2XMJA 1HWUA 2IDEA 1YJ9S 1TVRA 4P6QA 3MEDA 4OLOA 1ZETA 3OT9A 2HHHJ 1M1KT 1HLWA 2DY1A 3L7OA 4EUVA 1U6FA 4IG0A 1FWKA 2XI2A 4NPOA 4LMZA 1TKZB 2E5GA 1HBOB 4LF5F 4P74A 2DNGA 4O0NA 1PBUA 4CLLA 4LF6J 2LDIA 1B3TA 4ICLA 4QYZJ 2EG1A 2HQGA 3CD5A 1GMVA 5AXNA 2E1AA 3M8WA 4CO3A 4JI1F 1TL3A 1GTHA 3AJ2A 1CJUA 2WVBA 5DDRC 4KHPJ 3NWRA 2HNDB 2ZE2A 4ZKAA 1N34F 1IKWA 3IXQA 1Q82T 2KTQA 3EVOA 2GFFA 3D1QA 2EPIA 3POTA 5HL7Q 2MQLA 3ITHA 3M2RA 4KV8B 3H5SA 4PPDA 3NGTA 3J7YI 2KH9A 2H9ZA 2E5JA 4PPZA 4OZJA 3NCRA 1YX2A 3H4BA 2ZH3A 2I6WA 3W2VA 5F8LA 4PWDB 4YUDA 1FHTA 3UD5A 4ELUA 4Y2CA 3C3LA 2ZDPA 4LFBJ 2VKRA 1IWAA 4F04B 2M9KA 3OXGA 1VFJA 1IXKA 3VQTA 2CPHA 4Z2XA 1S4EA 2CJBA 1VBYA 3PX6A 2NSBA 3ILJA 3ADAC 2BDPA 2Y0SD 2DKOB 3GG1A 3P5BP 3EGZA 3QRPA 2MZRA 4OI1A 1S1VB 2OUGA 2KVIA 4RW8B 2R7WA 3BGLA 2HHUA 2FJVA 1FRLA 4WXOA 1LOUA 2DK2A 4HI2A 2HSEB 1XTZA 1U1PA 4W98A 4M5MA 2E66A 4RUAA 2XMWA 1X4HA 3V5RA 5JMNA 3H42A 4JI2F 2QL5B 1FJCA 1JLCB 3VAHA 3T1HJ 3SI8A 3CEDA 1R8BA 4ER8A 1IR1A 4KYZA 2OKQA 2ZC4A 3M8RA 1TVRB 5L1JA 4ILMA 1XEZA 4ZLNA 3MEDB 2XYHB 2HS3A 3MMJA 1XWLA 1NKEA 1X8DA 1S57A 4IG0B 1P1LA 2UUCJ 3BSOA 4DV6F 1RAAB 3C16A 4OHVA 2QEXS 3UDEA 3CF5Q 2QT7A 3N6NA 2VOPA 4PR6A 4ITSA 1VYAA 4ZVFA 1NUEA 3PJXA 3DOMA 2FDNA 3HDSA 4PAAA 4ICLB 4U95A 4GMKA 1VRTA 2B51A 1TL3B 1CJUB 3CWJA 2B9XA 5KFHA 4TQSA 1WI6A 4OZ3A 4YN3B 1VQ5S 2ZE2B 4ED8A 1KS2A 1IKWB 2F5GA 4N76A 2BANA 3NRBA 4DR1J 2HS4A 1UW4A 4YY3F 4NCGA 2H4WB 3OQ2A 1VQPS 2AEMA 1N88A 3POTB 3ITHB 3M2RB 1OYEA 1YSJA 1N5YA 4DR2J 3JSMA 3G8QA 3TJ8A 2BM1A 2XHWA 2XZTB 1DTQA 4NLXA 3KG1A 3S1TA 3S01A 2N4CA 1N32J 3W2VB 2OEMA 1O0PA 1YJUA 3R8YA 2ZH6A 3N5BA 2RRBA 1JLBA 3T3FA 2QLWA 2I8EA 2ACYA 1FCAA 4KIAA 1RTDA 2JOQA 3IAS9 4YOEA 1JIHA 3IC1A 5DM6Q 2NQPA 3LOUA 1WF1A 3ULHA 1BLUA 2QLXA 2W01A 4DL6A 4ZIVA 3SCIE 1SL1A 3VAJA 1RA7A 3VGSA 4WP9A 1QY7A 1YKWA 1BQXA 2OHDA 2HS0A 2GIRA 3R5BA 2VQFJ 4A8QA 2PD1A 3FMWA 1FESA 4RPFA 1QE1A 2EK1A 4KAIA 3CC4S 4ZPBA 2FY8A 2OJ3A 2PGCA 2DNNA 3VCDA 1QSSA 2NCKL 1ZM3A 1RAEB 5CCMA 1FWLA 1UP1A 2DRBA 2I2YA 2Y0BB 2EFPA 1TQLA 1JXEA 3OFFA 3G8SA 2BACA 4ZA1A 2RHQB 3GCWP 3VR1A 2KFYA 2W9BA 2ZKUA 1SJQA 1B4SA 3QT6A 1KFSA 4CH7A 1RZMA 3WIVA 4DUYJ 1YBTA 5MAOA 3RB6A 3NG8A 1YRUA 2R42A 3MMCA 3OL7A 1GQEA 1PYTA 3T19A 2YVSA 5HVFA 3C16B 1S1WA 2C2KB 1N56A 4X2BA 4NYZA 1CS4A 1H98A 3JSRA 5IWAJ 1VJWA 2FB0A 2JEGA 2QMUB 2DIUA 2EK6A 3DOMB 2MY8A 3TX0A 1VRTB 1GTEA 2UV8A 1D0EA 4BWMA 4HTIA 3HZGA 5GAHI 3BN4A 3VAIA 3J7AN 1GK8A 4JYAJ 4QBUA 3B54A 3MM5A 4TU9A 2XLIA 1EAYC 2BANB 4LVNP 5EWEA 2ADBA 1TKDA 4QJVA 1B0TA 3D28A 4NCGB 4ECZA 1VQLS 4F4XA 5BJRA 4K7QA 2R9LA 1OS5A 2AYMA 1N5YB 2LYVA 4DF4A 3JSMB 2Z2YB 3SZ2A 1UZHA 2XMMA 2GMLA 5H9FK 3PYGA 1DTQB 3HJVA 1M5OC 1FEHA 3I5AA 1T3OA 2GVDA 4GO7X 1SQFA 1JLBB 3CCQS 3EGVA 4CZCA 4LQ9A 2OEKA 1RTDB 5HI7A 1HHTP 2F9DA 2WVFA 5A2QU 2O67A 2OPSA 3IG1B 3UN3A 4WF9Q 2G0CA 4UUWA 5DZ7A 1QSLA 2X1FA 2IBKA 2FVPA 1X5TA 3BO2A 4G6VB 2E5LF 1N8RT 4WU2A 1U48A 2C22A 2L9DA 1D9DA 2JH3A 5CZXA 1UA0A 2ASJA 2LCWA 1QE1B 2PT0A 3ILOA 4JI8F 1UEUA 1T8EA 4HLBA 1N5QA 2R8JA 1NXIA 2K3IA 2JNJA 2ZVIA 1X4GA 3M1VA 1LEOA 3TARA 1ZAXA 3Q8RB 4XPEA 4IFYA 3QIPA 4DV5F 5GMEA 2DHHA 2WB1D 1DQAA 2WZ1A 1FJ7A 2DITA 4WP8A 3HT0A 2XNRA 2W9BB 3IO1A 2PE8A 2J0QD 2DXFA 1HWIA 1WACA 3DLKA 3CJ2A 2HGLA 1NCLA 8ATCB 2DO4A 1DQ9A 3H7HB 3CB4A 3MMCB 4R0JA 4X4PA 4G65A 2XZDB 1BWEA 1Q4RA 1NJIT 1WKKA 2CKWA 2QA1A 5KFIA 1S1WB 4LF2A 1CS4B 1FRKA 1PILA 1AYEA 1SJ3P 5HN0A 2ROGA 2C3MA 4YFUA 3OL6A 3GFZA 4CT8A 5EHHA 2WBMA 2BOAA 2CQ3A 5AJ3J 5CAAA 2DHGA 4DL4A 2F7VA 1M1HA 2V2KA 5KOWA 2EC0A 4CRJA 1S97A 5I42A 3MM5B 1RDRA 3QWPA 4WZQA 5DDPC 3FRYA 3BYRA 3OPKA 3PHTA 3HSGA 1KQFB 1R27B 3TVZA 2Q79A 4DV1J 3PO5A 3OVSA 4FNIA 1TP7A 1SVDA 1UPMB 2UXDF 2A1BA 2LFVA 1GH8A 4DDFA 1B0PA 3K59A 3CC2S 2ZH4A 1S0NA 1DZ5A 5F3TA 3NCPA 1EQMA 2GVDB 4JI6J 4ECQA 3BGUA 1U0HB 2FJDB 3A4TA 1Q81T 1VQYA 4H4MA 2G1HA 3TA0A 2HWTA 2NUHA 2QZ8A 5D4OA 3SCLE 5B0DA 1P9YA 1WG5A 2OPSB 3RYLA 4PUOA 4LF8F 4EEYA 3W2WA 2BV3A 2BE2A 3JTPA 2WK4A 4DFKA 3ENVA 2IFXA 2DEJA 4I6AA 5J2QA 2RQ4A 2CG8A 4QPTA 5I3UA 2VFTA 5DG7A 2KRBA 2D1CA 1AT1B 2CQIA 4MKAA 3EZOA 4O3NA 2B0GA 4YB6A 4FPIA 4ECYA 4K8RA 4OV6A 5DG8A 2OI2A 2MZSA 5DQGA 1NB2A 1X4FA 4Y2IA 1KWMA 3MMAA 3ZC4A 2VFSA 2GHVC 1FDBA 4R25A 4Y6IA 1GXLA 3M1VB 1T9UA 1SH2A 4YHHF 1RT7A 1MN7A 4RW7A 4IFYB 3QIPB 4JI4F 4X65J 4MK8A 4EFAC 2Q3PA 3VALA 1TUGB 2FIUA 3F44A 2OH2A 5K14A 3GYNA 3DLKB 5DDQC 3BSNA 1ELOA 2LU2A 1S12A 3E2EA 5JUMA 3NAIA 5ADZA 3I56S 4OI4A 3BJYA 3OUYA 2NSCA 3T6BA 1WC1A 2O5DA 2IY5B 2M52A 1ZS6A 3ZFVA 4YQWA 2WSEC 2LQ9A 5E41A 1KFDA 3IS9A 4O3OA 2VQEJ 2DYAA 3GG0A 1YBUA 3CCRS 4Y2KA 3W9IA 2CZ9A 1LFPA 1MWQA 2IPOB 2DRAA 1CJKB 1YGYA 4OJHA 1Q7YT 3QATA 3UNGC 1S7HA 3JAMY 2B9EA 4OI2A 5EX3A 2AU0A 4GKKJ 5I42B 2VFRA 2UUAJ 4CLWA 3Q24A 3PRBA 1HARA 5F41A 1TL1A 5IOLA 4TU7A 1U1RA 1U45A 1V3SA 2W25A 5JVGQ 4IOBA 2F9JA 4UTGA 2XHCA 1FVQA 1S48A 3DM2A 3CT9A 3GV7B 1DBDA 3G9CA 3NGRA 4PABA 1VQKS 4LR8A 3A13A 1NDCA 3D67A 4FNHA 1RE1B 1N5SA 2HAIA 1S6QA 4KJIA 5JJBA 4ZK7M 5ETRA 3MPYA 3KUEA 4BS2A 3QMQA 4H4MB 3NNCA 1MROA 1JWWA 1NJYA 4KT0C 1QVFR 2E7VA 3VAKA 4ZVPB 4MTPA 3F73A 4R8UA 2ZBPA 3M6XA 2ASLA 5ETMA 4F4KA 5BR8J 2IVYA 4PUOB 3GR1A 1XK8A 2RE1A 3W2WB 2BE2B 3IR7B 4FVCA 1VC6A 5B0EA 3MM6A 1MWZA 1TV6A 2V2VA 5J2QB 1CVJA 4C7QA 2DR8A 5I3UB 2EFVA 1Z2ZA 2JEIA 4WZMA 3PKMA 3T1YJ 3NAHA 1RU2A 4WFBQ 2VJUA 1HW8A 4NXNF 2L3MA 3B6BA 2KG0A 3EMTA 1DRZA 1X7VA 3MMAB 1KNZA 2EXUA 2P9GA 4HL9A 2GIQA 4LIRA 5CYMB 4LBHA 1FNXH 1Z4UA 3J7ZT 4CQ1A 4I6YA 4P2FA 5IT4A 1RT7B 4RW7B 3HPOA 2L9NA 4J9PA 4FBUA 1O51A 1N36F 1PBAA 4NMXA 3FCHA 2HRUA 2W7PA 2B8PA 1F1BB 5IT9U 3HHNB 1DLOA 1VS3A 5K14B 2QC3A 2HYIB 4DSIA 5AE3A 1VRUA 4Z7YA 2VFVA 2HQ3A 1JQGA 5C5JA 3OUYB 1HMVA 2W2MP 2MLXA 3MUTP 4ELVA 3NL0A 1U47A 5HJYA 1RTJA 4OX9J 3M8PA 2EKNA 2HHHF 2DR6A 3IS9B 4ZS6A 1CPZA 5DLFA 1R0AA 4DL5A 3OXFA 5KFRA 1NSPA 2ZJRQ 4KC5A 3RW7A 4ES2A 3CXCR 5AE1A 4ED4A 2QSWA 4DLEA 3VGVA 2KM8C 1RT2A 3LO3A 4LF6F 2B7BB 3UFCX 3M9MB 1TL1B 4JP8A 2WSCC 2KJVA 3Q2SC 3SV4A 5T41A 3HD2A 2CNNB 3G82A 4KE5A 1RT4B 4KHPF 3DM2B 1YDLA 1NHUA 2ZH5A 4USKA 1SC1B 4CO5A 2DNMA 1NEEA 2XB2D 2CUYA 2E7XA 1FVSA 3QJLA 2J8AA 2RSQA 3MFHA 4ECSA 2ZHAA 4CO2A 1ZA1B 4DV0J 2D7SA 1S6QB 1U49A 4Y00A 1XMOJ 1S6PA 1KLNA 4NLOA 2J9CA 4WKYA 5FLXU 4RW4A 3DU5A 4CLYA 1NH8A 4ZVSB 2OELA 2A3JA 4R8UB 3HD1A 3I9V9 4ZJLA 4CLPA 5CYQA 4FXDA 3PW7A 4HYKA 3R7SB 1LWFB 2QRRA 4N7TA 2IVFB 3MM6B 3W5ZA 1TV6B 1LV5A 4LFAJ 2CJ9A 5ETPA 2DR9A 3WC2A 2YWEA 5A6WA 3QT7A 4F2SA 4Y28C 2ILYA 1JJHA 4Z37A 3PIOQ 5KG5A 3PW0A 4QYRA 4A47A 1Q8LA 5CA5A 2C2OB 5B0CA 2B4UA 5HMXA 3ISND 4HACA 3DRXA 4NLPA 3R7NB 4NLVA 2W4PA 3IM9A 4BC9A 4NRUA 1DY3A 2YKPA 1SIWB 1DLOB 5A8RB 2H65B 2DO0A 5F8JA 3LGNA 1UKUA 3A8EA 3I82A 3A3OB 2BZ2A 2WB4A 1MW7A 4NLSA 4ZHRA 1VRUB 3BZQA 4NE9C 1RHQB 4RNFA 4OHYA 4NZ0A 1H6KX 4ID5A 3BO4A 2GQCA 5A8WA 3K8WA 1HMVB 1WHVA 2BRLA 3P45B 3W61A 3RB3A 3H8YA 3HKZD 1RTJB 3M8PB 1V9OA 2FZKB 1UJ4A 1WTFA 2WW8A 1L3SA 1LWCA 5T7LA 3VTIA 2HMIA 1P27B 3G86A 5HQ8A 1R0AB 3TEGA 2HIQA 3DNCA 3KWMA 3K7RA 2XY7A 4LF5J 4KGVB 4DEZA 3D3CJ 1FTCA 5HO4A 4CM0A 3SSSA 1RT2B 2ZH9A 1S5ZA 2G2OA 5KOXA 4JI1J 4FXVA 1AFJA 2RQMA 3MM8A 3MPVA 4A8XA 5F0UA 1WG1A 2ZD1A 2HVDA 4DBQA 4EZ9A 3G82B 5CYJA 1RU1A 4JI7F 4Q2MA 3EM1A 1HNXJ 2RF2A 1OYDA 3HVWA 2BW7A 2J9EA 3K2YA 1X0FA 2PA8D 1VK3A 1BE4A 3FBBA 3QNWB 3MOZA 3AOCA 1S6PB 1HHSA 1C4CA 3DRYA 2ASYA 2PEBA 2GAGC 2XSJA 3ETOA 4RW4B 3N6MA 1SQEA 5L8RC 1ZBTA 3HVRA 4GRSA 3MXHP 2CDRB 3V81A 2DPIA 4Y0FA 5KFNA 4ZVOB 3OVAA 2VODA 5A76A 1HD1A 2V2QA 2W4DA 2LEPA 5KG0A 2ZVSA 2Z30B 1Y11A 4DX6A 3I4HX 3FK4A 1TFWA 2XO6A 5G4DA 2XC9A 3NNAA 4J9RA 1RAGB 4U96A 2AJ0A 1FNMA 1JXVA 1HA1A 2GHWA 3OFEA 1YITS 2EI5A 2U1AA 1N0VC 1KC8T 4HACB 3MCSA 3C15A 4P72A 1VRQC 2UVWA 1Y9OA 3EDQB 4C8YA 3TP2A 3CD0A 2DCUB 1R8AA 2U2FA 1VC5A 1FKAF 4OJ3A 3QFWA 3IA0A 2QN6B 5KT3A 1F0XA 4EO6A 2KFZA 1R89A 2MQOA 2BJ3A 3KYLA 4JI2J 3T5HA 2BUNA 2M8DB 1UVJA 4OMFG 3NEKA 3G2XA 2JLGA 2HGMA 4TLQA 2PEHA 3MEKA 5HSPA 4ZHRB 1X4BA 3IR6B 3ISNC 1BGXT 4AXJA 4J9KA 2VHGA 2E5IA 4ID5B 1UA1A 4ZP7A 5A8WB 3UE2A 1JKHA 4YEAA 5IT0A 5GAGI 4OX6A 3G6YA 2D3OR 4AUKA 4DX8H 4DV3F 3H2UB 3UN5A 1BY9A 3BPDA 1LWCB 5T7LB 4DSEA 3PXGa 4TY8A 2HMIB 2NXEA 2AQ4A 4DV6J 3FGVA 2VDIA 3RB0A 3S7RA 4USMA 1UTAA 4JB8B 1S1UA 3MR7A 4DU8A 3NS5A 5IWAF 2NZCA 4UT4A 1U6ZA 2IJNA 1RB0A 4QWDA 3MM8B 4RU9A 1LKZA 2ZD1B 3NP5A 1JK9B 1TUWA 4K5SA 3CJ0A 4JYAF 3FCWA 2XMKA 2RF2B 2XMVA 5HANA 2VG6A 4KY3A 4ANEA 3HHKA 2XWYA 1Q86T 3KLFA 3MURP 1U6BA 3LW5C 2CNOB 2KZZA 5IS2A 1FKPA 1OY8A 5HBMA 2MHEA 3GTYX 2W1BA 1A0OB 5D0RA 2HGNA 2H48B 2XSJB 3HHLA 1ZA2B 4TU8A 3RRGA 2GV1A 4AD6A 2JFDA 2AT1B 4KHRA 3M6UA 5LSOA 2FTRA 1SJ4P 5HMYA 4UQGA 4Q2LA 3K89A 3CCMS 2LXIA 2YH1A 2L48A 3QQCD 4KPYA 2ZH7A 4WKRA 3TZZA 1VQ8S 4MH8A 4XIUA 2IMOA 2CRLA 1UVMA 2NUUG 1N5TA 2F8MA 5LOQA 2AX1A 3IAM9 4X66F 3OJSA 3RR7A 2K3KA 1NK8A 4RO0A 4OYPA 2WOMA 2Q6CA 1FK9A 3D9BA 1NSKL 4UQTA 5E3AA 1DURA 2MPUA 4IR9A 1KD1T 5L9NA 1HBMA 3D7SB 2GS8A 1Y0HA 2RRAA 3AB2B 3P3DA 5I3PA 4U7UK 1YIJS 2IM3A 4LRAA 3PDNA 1NH7A 5KFLA 3CCZA 1W2IA 4W92B 2WHOA 3GE9A 4FP9A 2FD2A 4IRCA 1HI8A 4EBEA 1YZ6A 2XMTA 5F3ZA 1RHJB 2FJWA 1O6XA 2ZHOA 1G3OA 3MMBA 4RNNA 1XBWA 2V69A 3HP6A 1JKHB 3MR5A 1HNVB 4OZ5A 3R5AA 1UFLA 1F5BA 4X4NA 3W8PA 1C1BA 1X4CA 1UVNA 2ZOFA 2R8IA 3M6WA 5IXUA 4KB7A 4TY8B 1JLAA 2FLOA 1NAQA 1XC9A 3FEZA 2AYEA 1DTTA 3HI9A 1S1UB 1G4CA 4CLUA 2MKCA 1LWEA 1T9TA 5IC6B 4K4VA 1GXTA 1VIOA 2YWFA 1ZPVA 4QWAA 3CMAS 3JQMA 1FE4A 1QDUB 5K8PA 3TUJC 3Q89A 1NK6A 1Q95G 4URQU 4HHHA 2X7IA 1C2PA 3OV7A 2MJNA 4DV1F 2OSQA 5A6PA 3KLFB 2MKJA 2VIHA 3CUNA 4NMLA 3THVA 4RUBA 4TN2A 1FKPB 3R3TA 5HBMB 2WVEA 3SMZA 3NNHA 3HHEA 4K4TA 4ZPAA 2PC6A 4DU7A 3HHLB 4UF4A 4MKYA 3HX9A 2RKIA 3GMGA 1Q5YA 2RDDA 2RVJA 3I4PA 3MF5A 3P6YC 2GQ2A 3EWGA 3BDPA 3JB9k 1IBKF 1S6OA 3AY0A 4F2RA 1FFGB 1CQMA 3CIMA 4FKYA 5D15A 3H5XA 5GMKa 2X3DA 5LM7E 2MKYA 4OYMA 3D1HA 2NXNA 2NS1B 2HEKA 2WOMB 2G13A 2E5LJ 2F1FA 1FK9B 2P8IA 1D9AA 3ZXWA 2PA3A 2AX0A 4X4QA 4IRKA 2IM0A 2CG4A 2Q66A 1JLEA 1ZTTA 1AW0A 1N5VA 3R6LB 1WUUA 2ZBQA 5CD4A 2J9DA 1KOOA 2BXJA 1RACB 3RU0A 1OSCA 2MXYA 1SPBP 3DHXA 4C2MA 4AYBD 5LMNF 4KKOA 2KVQE 3GYGA 2BMBA 4DV5J 1UCNA 3TO8A 4DQSA 3QZ7A 2CJYB 1VISA 1N33F 3DYAA 2J6UA 4X64J 2PMHA 4UUXA 2V4JA 4A8SA 3GIMA 2OAUA 4M5HA 2JJ4D 1G2EA 3MMBB 2BEFA 2E44A 1WD6A 1EARA 2K7JA 5KFWA 1NK7A 2NYHA 4P52A 1XMQF 2CWXA 1Y3KA 2DGUA 4DLGA 2GGPA 4QU6A 2OMOA 2YWWA 5D4PA 4WYWA 3JXOA 2QSFA 1JLAB 2UVRA 3AAWB 1WDDA 2ZOMA 4N47A 2HRYA 3EGNA 4PG7A 3AT1B 1NHKL 4R5PA 1Q16B 1DTTB 3OL9A 5KFDA 5L46A 4WE1A 2HLUA 2EC2A 5B08A 3FQLA 3MECA 4JV5J 5J2MA 1FDAA 1RWXB 2NPFA 4ALZA 1LWEB 5EX0A 3J81j 3BN7A 3W9HA 4I1TA 2FZCB 5AXKA 1KDNA 4M5NA 2B4VA 4UW2A 3TR5A 3C6TA 4M5KA 1RBOB 2RIJA 2QYGA 1HW9A 3TJ9A 4DPWA 5LT5A 4JI0F 3TNVA 3KG4A 4WTYA 1NO8A 2UXDJ 3QGIA 2FGOA 2DJWA 2C3PA 1X0PA 4DI6A 4ENOA 2VOOA 1SKUB 3KLHA 2APOA 2AWZA 3M8SA 4TNOA 5L1LA 2XQCA 4P2SA 4XK8C 2RKIB 3LPEA 3UD4P 1H38A 4FKXA 4CIOA 2JZ5A 1P6TA 2VG7A 3QIDA 1UEKA 1TL5A 3K5LA 2BR0A 4DL2A 2DGVA 3ZTSA 5EWGA 4FBTA 5K8MA 4YMEA 1RADB 4O3SA 5KTQA 3DDNA 3C8YA 2R3VA 4AL6A 1K0VA 1UJ6A 4LR9A 4OZLA 2A18A 3CCSS 2C3OA 3BREA 2C42A 4LF8J 4DHVA 1IN0A 5EWFA 1U2FA 4I0WA 4QYZK 4LBPA 3KJFB 5GADI 3MAHA 1ZM4A 3HZEA 5DM7Q 1Y10A 1WJ9A 3GONA 5D77A 4F67A 6AT1B 3W63A 1KQKA 1RTIB 2KU7A 3PY8A 4Y3CA 3PNIA 1KOHA 1ICEB 4K4WA 3FSIA 4O3RA 4RNMA 4DXLA 3R5GA 1UVLA 2WCXA 5ETOA 2KT2A 3FJ2A 4KKOB 3BGFA 5KFSA 4YHHJ 2XMAA 3JTOA 2BVZA 1TK5A 4JI4J 3GWCA 3HMJG 3FFIA 5L38A 1RT5B 4LR7A 3T6JA 4HDHA 4NLTA 2V2ZA 2RUSA 3TAQA 1WNEA 3DYAB 1R8HA 1TMMA 2NXJA 3EX7B 3PYDA 2V4JB 2HHQA 3D5MA 4CLKA 2J0SD 2W7OA 1WI8A 4F4AA 2CQHA 2MGZA 3W5YA 4ZPCA 4HH0A 2MJUA 3NWGA 4K4XA 2GGPB 3QYYA 4QPXA 1AA1B 3H25A 4ELTA 1U24A 4WBFA 3MR3A 4X4SA 3H90A 4R5PB 4OX9F 4OL8A 4WE1B 2P5VA 3M8ZA 4LSLA 4ES1A 2BKPA 4QW9A 3MECB 3R5JB 1H2UX 2Y1RI 2A2DA 5J2MB 2DTJA 1KQGB 3UD3P 2FLPA 4NZ6A 1VCTA 1P9QC 2CPXA 3C14A 7FD1A 2RT3A 1GXUA 3CCTA 1HNWJ 4M5LA 4CWBA 3SCJE 2MMYA 3C6TB 5KFGA 1V6HA 4ZJQA 2BRKA 3PX0A 4ZPTR 1K47A 1IBCB 3P96A 1IVZA 4QIFA 4F4ZA 5AT1B 5AE2A 1MG7A 4OHWA 2E1CA 4X4VA 5E0OA 4NLYA 2KDOA 4X4OA 5CH7B 2YXLA 1WTBA 4C3LA 1VQ4S 2VG7B 4MKBA 4ZCIA 1KVJA 2ZUAA 3DDKA 1ZTWA 4K59A 2DNQA 2D9OA 1JX4A 2AW0A 1WKJA 1BQNA 2ATCB 4CH0S 2RRNA 3EXYA 3CJSA 1G1XA 3B4MA 3KDOA 1G6BA 4F26A 4EYIB 3M8QA 1SQGA 2UU9J 2CQ1A 1S49A 3DKDA 4I2QA 2RILA 4YB1P 3BH7B 2YNFA 5HATA 2I1RA 2RB7A 3ILIA 4ZP8A 2DPJA 4C8OA 1EKSA 4DSFA 5E3QA 1F2HA 4GVLA 3AJ1A 4M1KA 5KT7A 3IWXA 2ZITA 1PC4A 1M5KC 4HTJA 1I6JA 3WX4A 4ZP6A 1NU4A 4BWJA 4TYAA 4NXNJ 2R8HA 2F65A 3UNYA 4PWWA 5K9FA 3QRRA 1FD8A 3PVXA 1KVIA 1RAJA 4WPAA 2V4RA 3FFIB 3BO3A 4I7FA 5RUBA 2VBYA 1MNEA 1N36J 1G7CB 4UY8T 2EFQA 2B56A 4KH0B 1X4DA 1EKRA 2Y9HA 1IR0A 4P2MA 2IM1A 4PYDA 2BOPA 1NKBA 2YQ3A 2R7OA 3LGHA 4OX8A 4RUHA 2E1RA 4J9QA 1L3VA 4I4BA 2MGZB 1KP6A 1PYSB 2DGQA 2W8LA 2XCPA 8RUCA 3DXBA 4C8LA 1EB0A 1C0UA 2DGTA 3QFHA 3CSKA 4WYLA 3W60A 3AA8A 2JVRA 4LT6A 1OQ6A 1SI9A 3CCES 3DRSA 1FA0A 4LSLB 3AA9A 3PR4A 3P8BB 1IWGA 4HT7A 4URSA 4HH1A 2RAQA 4DN0A 4E98A 1VQNS 3C14B 1BHNA 1UFWA 1XR5A 1S0MA 5C25A 3TUPA 4MYTA 2X1GA 3QT5A 2KRRA 1UWBA 1I3OB 3AQPA 3ENWA 5I4MA 4K4SA 2RS8A 5DLGA 2KT3A 2DHAA 2ADCA 1SKSA 4OZ1A 1VBZA 3B4DA 2R2RA 5CD4H 3U7JA 4OI6A 1W2BR 3BKUA 4J9SA 1CBKA 2LXFA 2QLFB 2FHOB 1HNXF 3ZZPA 1RT1A 1RP5A 4FYWB 3FEYB 3V4IA 1PO6A 2HHSA 4A46A 1FFWB 4DSKA 2BBEA 3THTA 2CQBA 3NY0A 1X4AA 4AL5A 3GILA 2UUWA 2M3DA 2KHDA 5L1IA 4FF4A 4B9SA 1V5VA 3N4WA 1M5PC 3MFIA 4O3QA 4DPXA 4OZNA 4K4YA 2XO7A 3BDEA 4Y34A 4IYQA 4DUZJ 3M8QB 1FXRA 2VPYB 2AIRB 4I2QB 1I94F 1PAUB 2FHJA 2YNFB 2KKHA 2VF3A 2BW2A 4H54A 2NYIA 1F5AA 2HHPA 3RJMB 1HBUA 4C8MA 3OW2R 4N8OA 4P73A 4A8YA 4W4MA 3KOAA 3MM7B 1REVA 4RWWA 5CHCB 2QL7B 4IO1A 1U4BA 2FZGB 2VL1A 1SJ1A 3IBCB 3PX4A 4ZJOA 1WG4A 1FDDA 4QIGA 1PIEA 2VKZG 1A6LA 1RWMB 2LQBA 1YZ7A 3U27A 2MTLA 1TAUA 3D6FB 4ECTA 3A3NB 4DCPB 3PRDA 2W9CA 3ZNJ1 4B3TF 2ZZNA 4OYIA 3CE8A 1LNQA 4FS1A 4B9UA 3J80U 2VBZA 2BA9A 4DR7J 2AJ2A 1UL3A 1Q78A 3NOGA 1H7XA 3KHHA 1D8YA 5D3GA 5J1PA 1BQMA 1C0UB 2J9DE 2YX4A 4KHMA 5ITHA 3AFGA 3DLJA 1QSYA 1K73T 2MQNA 2ZBCA 4CI0B 5ETKA 3DRSB 1IJFB 4FPRA 1K0TA 3V6KA 2FJBB 4U7UD 4MAKA 2ZFHA 3GFXA 5C25B 4K2JA 3QAEA 1VK8A 1SL0A 1K1QA 1Q5VA 4NLUA 1VC0A 2C2DA 2XM3A 1UWBB 2HK3A 2Z2LA 4JI7J 4DX5A 3I5CA 2OSRA 2XSFA 2LEBA 1AXQA 3BF4A 3UCZP 5A2QY 1REGX 5KFJA 1RT1B 3V4IB 3KNGA 1YJTA 3MWBA 3V6JA 4IUFA 3I6PA 2LQ8A 3DOLA 4UOGA 1RHUB 3PW2A 4JV1A 3TYTA 1J5OA 2NZ4A 3QGPA 3D68A 1VMBA 5DQIA 4RBVA 3BBFA 4N5SA 2XLJA 4MMOA 3SCKE 4FVMA 2F40A 3QLHA 5KFKA 5HAOA 2H5JB 4L3NA 2R2SA 4YR0A 2JFKA 2UVVA 4LFCF 5H1SV 2YPYA 3G4SS 2CPFA 2J6TA 1S0VA 1SJRA 1HBUB 2P9CA 2PDAA 2MKSA 1RT3A 4WWSA 4PG4A 2N4DA 3CVKA 3VZIA 1XN9A 2LKZA 1REVB 4ANDA 1U1LA 2VBXA 2UP1A 2R7TA 1BWVA 4DS4A 2COLA 7FDRA 3CCJS 1FFSB 1UAWA 1ZAVA 5EUHA 2P9EA 2WVDA 3UPFA 3KK2A 4M5DA 1HWJA 2ACMA 2W9CB 4UZCA 4M5IA 1R8PA 3HLUA 2X51A 1S59A 4AE5A 4PQAA 5KFVA 3H5YA 4PKDB 3AJDA 3VAFA 3OJUA 5KFZA 3LANA 1RT6A 3DGPA 1OY9A 5C7PA 4J9OA 3L09A 4ZVGA 2Z2MA 3CPWR 1BQMB 2QLJB 4DV3J 3PTWA 2ZNYA 2RU9A 1VOMA 4CLZA 3RG6A 3PCOB 1TUVA 1FX2A 1F3FA 5B0GA 4LRCA 5KG3A 1TELA 1WOSA 3GCXP 1FT8A 4Q43A 1SL2A 1Q8IA 2B7CB 1M90T 2HZCA 1TKTA 2QTWA 4DQRA 4J7CA 2YH0A 4USUA 4E8UA 2W9AA 2F4VJ 4B9MA 3EICA 3ZZOA 3NMRA 2H54B 2DBBA 2DXEA 5DQHA 2ZNZA 3BH6B 4DV2F 3NGUA 1GT8A 3KJQB 1RYSA 1YK9A 3VAMA 4EMDA 2LXUA 4EYHB 1RAFB 2IA6A 5CZVA 4ZVTB 2DVIA 1PCAA 2Y3YA 4N56A 5HQMA 4KFBA 1RWNB 2AHOB 2HFNA 3E01A 2Q43A 1QAJA 3DOLB 1M5VC 1PAEX 3OR2A 5DETA 4OV1A 3CJKA 1KEKA 1J5OB 2HK2A 2ZH1A 3R9LA 3F56A 5F0WA 3ZZUA 3F41A 3M9NB 3QLHB 1Q7LB 2W2OP 2IYIA 1AUDA 3OL8A 1RXOB 3T41A 2BJ8A 3ILLA 2FVCA 3TZWA 1WELA 1TZ0A 2HURA 1LW2A 3DLLQ 4X66J 1X5SA 3SDEA 1OIAA 2VPXB 5LSRA 1RT3B 3A8JA 4PCQA 1U26A 2UXCF 1JNZB 4FF3A 2VPZB 4EBCA 3PYEA 1R43A 2DGXA 2DD8S 4LF4J 5F8NA 4F3OA 4I56A 1GX6A 2CPDA 3VVUA 3VGUA 2QIFA 1E6VA 3Q22A 3O5TB 2BJDA 2CQ2A 5KFTA 3UR0A 1RHMB 3KK2B 4M5DB 5KFQA 4C48A 1R7IA 4LSZB 3I0SA 1HL6A 2AJQA 2M8HA 2L9WA 1ZPWX 1VQSA 1QTNB 3FBCA 1GMWA 1KTQA 4O4GA 1R8CA 4X64F 1J2VA 1RT6B 2QL9B 2B6AA 2V8PA 2M2BA 3TWZA 2E1PA 1S76D 2KHCA 4GC6A 3HSZA 4J37A 2ZM6F 4NX9A 3H98A 2RU3A 3A1YG 5K8OA 3CCUS 2FJEB 3J81Y 1S6UA 3HFVA 3H2VE 4C8NA 2RS2A 5DS7A 2MZJA 4NYOA 4WCEQ 3R97A 4LREA 4OHXA 1U25A 4YDXA 4JV2A 2GX8A 1ULRA 4QU7A 2DHSA 1EP4A 1GX5A 4DFPA 2ZJQQ 4ECXA 3WC0A 4EGLA 2YKNA 3W8GA 3EZUA 3PZPA 4FN5A 3W62A 3D2WA 4MKVA 3PIPQ 4V19J 2AP6A 2DNPA 2MQ8A 4OYAA 1TKTB 4HI1A 2HWHA 2V9KA 1SUQA 4JV5F 5T14A 3NGDA 5LJ5Y 2BE9B 4X84A 1ZM9A 4MK9A 1RBLA 2CJAA 1TFYA 3MEEA 5HMZA 3JS9A 2RDIA 3GJSB 1HYSA 2WSFC 3PFEA 2V0NA 4OIXA 1RK8A 1ACMB 4MJKA 2FQQB 4M63A 1WC6A 3QRQA 3VV2B 3KUHA 4A4JA 2QLBB 4QQBA 4NEYA 2DR7A 4F7VA 2WVCA 2POKA 1O5JA 1HI1A 3CDUA 4FDFA 4KFBB 4ZLJA 3DXSX 1LWXA 2Z4PA 3CJRA 3GR0A 1UPPA 1OPZA 3E01B 5KFEA 1S7IA 1B7YB 5CQGA 2V4QA 1EETA 3OTDA 3VWSA 2Y8YA 2XYPB 1X5PA 2XS7A 1NSQA 3OR2B 1SC3B 5IM0A 1TAQA 2IRYA 2Y8WA 3CJKB 4ZVHA 2QE5A 3KUGA 1TK0A 5MLCV 3ZZYA 1YLXA 3H59A 1RAHB 1ZYQA 2HVHA 3MTJA 3U02A 1T03A 5C42A 1RTHA 3UO0A 1V3ZA 2J0XA 1IBKJ 1HD0A 2J7WA 4LSNA 1ZAWA 4NZ7A 4FXWA 4F25A 3O8WA 3S8SA 3HULA 1H2VZ 1NJWA 1K44A 4Y2AA 4K5RA 2ERRA 3DU6A 3L7PA 2MYFA 3BBCA 2MLZA 3EE3A 3SDEB 5E33A 2XGQA 2ZEJA 3KJVA 3ET6A 5G0RA 2YNHA 1XR6A 2GJFA 2F4FA 5IT9Y 1OWXA 4F50A 2CVEA 4CO1A 3FCVA 2CQCA 4QR1A 3IRWP 4FYVB 5CXTA 2HFUA 4PXCA 4ED0A 1CSJA 1GNKA 2I38A 2OIHA 4B9VA 1LK5A 4B17A 3K17A 1QJHA 5KFUA 4KTQA 2MB0B 2FC9A 1E6VB 2UXBF 5LMNJ 1K9MT 2JEJA 2G0JA 2VJVA 1T02A 3GYXB 3I0SB 3L3CA 3HSDA 2DNLA 1HQ2A 4M5JA 1N33J 1X9WA 1TU0B 2CPZA 3NBPA 1E6YA 4B02A 1QTMA 2XMUA 3AXKA 1SH0A 4O4GB 1KVKA 3ZTQA 3UDVA 2B6AB 1HNIA 1NNDA 2FUG9 4IQMA 1XMQJ 3PM9A 3FZBA 4IOCQ 2A2CA 3KHGA 1JLQA 1PKUA 1FD2A 9ATCB 3ZNUA 1Q0NA 4QWEA 2GVZA 3AH6A 4KGXB 2ZWPA 4EZ6A 3IGVA 3PG9A 3THPA 4LF7F 4P2XA 2YKNB 2M7SA 3DOKA 2HFZA 2B4OA 1D1UA 2FJAB 1XQIA 2CAJA 2KI2A 4PWUA 3O44A 4XAKA 1BMQB 1SUQB 3DGVA 2VB6A 3H0PA 2HVEA 3T5KA 2EBEA 3MEEB 5FLXY 3MEGA 2Z0GA 4PQUA 1HYSB 1TL4A 5DJBA 1I1GA 1MMDA 2OP5A 2R7RA 4CH1A 1Q8KA 1L5UA 1HNWF 2XTJP 2OEJA 3FZ2A 4P7TA 4WK1A 4Y2MA 4I2PA 3DHWC 4JI0J 4ZLLA 3J81U 1WSRA 3LAKA 1NBEB 4OZ2A 2V67A 5U47A 1R0CB 2Y1IA 3EPIA 4B3RF 3RZAA 4HR2A 1TL7A 4IG3A 1EETB 2V9WA 1IQTA 3ZTRA 3I96A 2R7QA 1U02A 3CW2C 2OPPA 4BLGA 5IM0B 2X1BA 4C3MA 2IA0A 1HR0F 3ZTPA 4MFBA 4ED6A 5IC4B 5BYQA 1T03B 5C42B 1RTHB 2ABYA 3KJNB 2ZZTA 3N01A 4LSNB 2XY5A 2F3JA 3LP1A 1RCOB 2KXHA 3WIUA 2XLKA 1VBKA 4CYUA 4Y65A 1C4AA 2HFSA 1SB6A 3U1LA 2CYYA 3O6QA 4LF9F 2YWHA 5BYSA 2GA7A 5LXRA 2W24A 4USTA 2UU9F 3IP0A 5GADU 3KJVB 3ET6B 5G0RB 2YNHB 1DARA 4Z7CA 3BQ0A 1VJQA 2I5JA 3UQSA 3O2IA 4K4ZA 3SYZA 1MMNA 2AKWB 1KQSR 4GKJJ 3SFGA 4W90B 4EWTA 4CO4A 3R6GB 5E3RA 4DR6F 3FUYA 1NK9A 2YWGA 1NRKA 4EU0A 4U6PA 4ZVQB 3UR3C 1NLKL 4ZPDA 4U67Q 2CVIA 3TZYA 2IRUA 3E8OA 4DFJA 2ALZA 7AT1B 3SSRA 3D66A 2VH7A 3KG0A 3HXMA 1C0TA 1ZH5A 1B64A 3CNQP 4PG5A 4A8OA 4PG6A 4KO0A 3NBPB 1E6YB 3G87A 3G8TA 1H2TZ 2IBOA 4IH5A 1N4LA 3UI3A 4NRTA 1HNIB 4Q8EA 1S9GA 3IM8A 2LMIA 2L08A 1T05A 1JLQB 5DRKA 5D0HA 3ZZZA 2LDYA 5J2NA 2DT9A 4O23A 3UCGA 4U9RA 2C2NA 1W25A 1CULA 2GVZB 5LL6d 3R5CA 5D8HB 3DOKB 2JLEA 1SXLA 1RWVB 2YNIA 1S1XA 4NI2A 2HRTA 1NB7A 1AZSA 3G71S 2HHTA 4WJBA 4CDIA 3T5LA 2JWNA 1UZDA 3MEGB 1VQOS 4PQUB 4FS2A 4CLFA 1MSWD 3WDOA 1RI7A 1VIXA 4UZBA 3MDFA 3EGWB 1VBXA 4B3OA 1FDNA 4OJGA 4I2PB 2NREA 5A0YA 3WHIA 2GNKA 9RUBA 1NPPA 3K5NA 4X4RA 2ZH8A 2PFDA 5GAEI 1TL7B 2B5JA 4IG3B 2H4YB 3Q8UA 4G1PA 4DQPA 2OPPB 4RBTA 2NXCA 4DV7F 1XR7A 1NZAA 1U2CA 2KXFA 2MEWA 2K8GA 4ID8A 1CLFA 1SCJB 4MFBB 2YNGA 1M1GA 5C2CA 2FC8A 3JYTA 2Y1JA 2QX0A 3SQGA 1X9SA 1MROB 3TOQA 4F8RA 1HIYA 4RU2A 1KBRA 3M7VA 3LP1B 3CULA 4CYUB 3BSAA 3W5XA 2BQUA 3A12A 5LSLA 1WC3A 1MU2A 3SV3A 2RJZA 4DUZF 1K1SA 4OYXA 4TKTA 2LA4A 1RAIB 2FVSA 1QVGR 3OFHA 3HCXA 4CNYA 2CDQA 2I5JB 1B70B 1J5EJ 1YRTA 1IBMF 4ED7A 3MD1A 4RW9A 1FRMA 4J9UE 4TXSA 1WHXA 2JLFA 4E2FB 4ED5A 3BBBA 2J76E 3M2VA 1NMEB 3W7BA 2VASA 3H5UA 2OTJS 1B99A 3UCUP 5D4LA 3NGKA 2YKAA 2N7CA 1C0TB 2MHNA 2NLWA 1Y5LB 1YJ7A 4P9SA 2WONA 3HSJA 4G1QA 2CJKA 4KO0B 1B0VA 2AYGA 1WC0A 4NCAA 2D9PA 2DNZA 3GB0A 2MKIA 3CMES 2DY9A 3O1LA 4WP3A 2UV8G 3HVTA 5J1EA 1U1NA 1S9GB 3B8HA 4ERDA 4PG8A 1QAXA 2DXDA 1T05B 2CQDA 3JQJA 1VLYA 4B9TA 4DR5F 1JNRB 3IG1A 1XIQA 3M6VA 4DR7F 1KSPA 4RLEA 1QM9A 3I55S 5J2NB 3ENQA 1RTZA 2VG5A 1LXNA 4K0KF 1CULB 2G2ZA 3MGJA 3OTEA 5FD1A 1TMJA 3PRVA 3TA1A 4ZPVR 1FRIA 3A3PB 2OTLS 2F8EX 3CJ5A 4NXMF 3QZ8A 2DH7A 1S1XB 2YNIB 3OSPA 4NI2B 1AZSB 2IC3A 3SFUA 5ETSA 1RYRA 1UW9A 4XPCA 1RWUA 3VGTA 4C8KA 1U8SA 4A48A 3VAGA 5SUHA 3KHRA 4B3OB 2GMJA 1PJ7A 2BJEA 3CTRA 3AOBA 3GQCA 3ONQA 4L75A 5A0YB 1YJVA 3J7Z5 1FRXA 3OLAA 1N54B 2VD3A 4GO5X 4KRWA 3PFOA 2G9OA 2PI4A 4OQJA 4TYBA 3B82A 4A8FA 1S9FA 2EKYA 2B5JB 2OGUA 2B43A 3GLJA 1X4EA 3OBIA 4LIWA 1FJEB 2FLLA 2P6TA 1YWXA 3AD7C 5KG6A 4RNOA 1X5OA 2YNGB 3J7YU 2A0FB 1R31A 3CO9A 3JYTB 2LQJA 3QBCA 2N3OA 4TY9A 2K06A 3SQGB 1JXLA 3CJ8A 4PRFA 3Q0AA 4L74A 1IM4A 2YPZA 5DGAA 5C2GA 3A8KA 2BABA 2XEXA 4D3GA 2C2EA 3QT8A 1MU2B 4QR0A 4NLWA 1I94J 3KLVA 5CYQB 4L73A 4XDDA 4B9LA 3NXZA 5M2UA 5F8MA 3AD8C 4UOCA 4CO0A 4J9VA 3JQKA 1RA6A 2YTCA 2KN4A 5KT6A 4USWA 1CJVA 1NDLA 2DGOA 4RW9B 3AQOA 2CQ4A 2Z8QA 3MCOA 2BJ7A 4F0KA 4Q8FA 3D0GE 4FYDA 3M2VB 2JSXA 3TQ1A 3BR8A 3PYFA 3R1HA 4EBDA 1HPZA 3US5A 4KBIA 2WONB 5DZ6A 1U0HA 4G1QB 1WF2A 4KGMA 2CQ0A 4WTOB 2DGWA 4B3TJ 1R6VA 3I0RA 1FXLA 3U1NA 3LP0A 4RX6A 3HVTB 5J1EB 1NSAA 3I9ZA 3PJWA 2VG5B 4CNZA 4NLRA 4ZDNA 4G3IA 3LPYA 2DNHA 1CC8A 2VDHA 2XI3A 5AXLA 3MUMP 4J5OA 3SXLA 1AFIA 4DCJB 4LVOP 1D09B 3S6EA 3MPUB 2Q6BA 1SC6A 2ASDA 5B0FA 4LRDA 1XNQF 2NXUA 2IC3B 4GVBA 4DPTA 2F8HA 3W3SA 3AODA 3EXCX 4OJ1A 4XDCA 3LH2S 1YQHA 2FHKA 4DN9A 2LECA 1TTHB 2W4CA 2CPIA 2UUBF 2KFNA 1EZZB 2F4VF 2QYCA 1UFKA 3HHLD 2GW8A 1BC6A 4ETXA 4I6WA 5DGBA 4DPOA 3LTOA 3FKBA 2BJ9A 1NK4A 2P2CB 1WWHA 2D3ZA 2DNKA 2HWIA 3IBWA 3D6HB 4PEOA 4B9NA 3HKWA 4IRDA 2FPHX 4ZVUB 2VFUA 4NOHA 5KFAA 2MSTA 2O1PA 2VA3A 4DX7A 1JJ4A 4QR2A 1QUPA 4J9LA 3MTKA 1XJWB 4HT5A 4TLRA 1FO1A 1VGYA 1HNZJ 3OXLA 4QWCA 3DLHA 5KFMA 1L3KA 1KLMA 1Z1ZA 1S77D 4DOZA 5CABA 3QJJA 3LWLA 2K7KA 2YKOA 3V81B 4DR3F 5K20B 4I67A 4LFCJ 2GIFA 4L72B 1CJKA 4ES3A 2AJ4A 2EVZA 3BM7A 1OJ4A 3CC7S 4AQYJ 4V19X 1RUSA 4ZVRB 4C0OC 2MQMA 3OTOJ 2H51B 1EJ7L 1RWKB 1PGZA 4UOFA 2KZMA 1CJVB 2QA4S 2IMWP 4OYOA 3CJQA 3ISZA 3K58A 2PIIA 3IRXA 5LMUF 3M2UA 4LF4F 2JL9A 3BKFA 3D0IE 3OTCA 3BB5A 3DRRA 3C15B 4KGKA 4N41A 2BYCA 1VHIA 1T9WA 1HPZB 1NZ8A 4C4WA 3RAMA 1UVKA 4EI2A 1H72C 1FERA 1Y5NB 4C8ZA 2BKNA 4QZVB 1D3WA 4RNHA 2ZZMA 3L9ZA 3I0RB 5HROA 3ENAA 4ZCLA 2DNRA 3PEJA 3HM9A 1OQ3A 3LP0B 2HKEA 5D78A 1M5HA 5KT5A 4PZVA 2N3LA 1W26A 3UW1A 4H4OA 4JI5F 4L3KA 2DHXA 4DWIA 2KG1A 3GJTB 3HHDA 1T0TV 2D74B 2XNQA 1VQ9S 2OLWA 3HT3A 3W64A 2CJXB 5HK4A 4M94A 2XS2A 2XYGB 4UOHA 1HQUA 3DC2A 4N8NA 1VI7A 4JOUA 1RHRB 3GIKA 4IQXA 3P5TL 3TVYA 3MPWA 4GVBB 3V2UC 5KT4A 2ZH2A 2MZTA 3C66A 4MYUA 3CD6S 1BUXA 3IWNC 3LALA 3OHBA 2VC0A 3D0HE 5M2PA 3FVYA 5CYMA 1UETA 1RJJA 1KRPA 1EQ0A 3GSIA 1UEVA 3RGIA 2CPEA 2HFVA 2OPRA 2WAQD 3KNAA 1CC7A 3PHEA 4OX7A 5ETLA 8AT1B 2DGSA 3CD7A 3Q8PB 4DV2J 3UN2A 3AD9C 3CJ3A 3GFYA 3ZZ0A 5GAHU 3C46A 2ZWOA 3IGNA 4B08A 1S79A 1S1TA 4B3SJ 3QWUA 1RKIA 2C2MB 5E3CA 3K5PA 2VG6B 1VR6A 2KO1A 4I69A 4FF1A 4AL7A 1MWYA 2LQ5A 1XNRF 3QAUA 5H9FJ 2H3EB 4JI3F 2OFHX 2RQKA 4DQIA 3EVMA 2YQ0A 2JC1A 3GJRB 1KHWA 4OI3A 3TAPA 4ECRA 4PYAA 1Y00A 3HHLC 2EBGA 3T1AA 3FNNA 2AV5A 3D4JA 1KLMB 4ILRA 2H5EA 5IQ6A 2AGQA 3W65A 4YS2A 1PJ5A 4ZLPA 2LVWA 4AFFA 1BD6A 1HQEA 2C2ZB 5I3QA 4PXBA 2H1YA 1TK8A 2R7VA 2KJWA 2CIMA 1WOOA 4KPCA 1HFEL 5KFFA 1IBLF 3FRZA 1B7FA 4URGA 4ZIWA 2UXCJ 4DQQA 4DV4J 1RT4A 1IM6A 3IRXB 3M2UB 2LP4A 4ATNA 4RW6A 1N0UA 4NA2A 3DRRB 3F0NA 2XS5A 2YWKA 4MIBA 3QGHA 2A6MA 1HBMB 1UMJA 3OLBA 2R8GA 3PO4A 1SBRA 2XBPA 3RBDA 3TW0A 3DLEA 5HROB 2CWKA 2AJFE 2YKMA 4MIWA 2EFOA 4X62J 3NCQA 4H4OB 1T94A 2QGFB 2XCAA 5IFMA 4QOTA 3C2PA 4FYYB 4NYPA 2MQQA 2ZM6J 5A8KA 2G0IA 1LWFA 2KL8A 4NEZA 3GZ7A 4JUZA 4F0MA 5BXIA 1C1BB 1HQUB 1JB0C 5B0AA 4HHUA 1IR2A 1U7LA 3VHQA 5KAKA 1DJ0A 3CJ4A 3MD3A 5ETVA 2J6SA 1ZOTA 5H9EK 1RGVA 1RLCL 1WSVA 3GPAA 1RABB 1XERA 3ZTOA 3JTNA 3M8YA 3TVKA 3BSCA 2MZQA 3GU0A 2GMHA 2OPRB 3EUNA 2RMLA 3KMQA 2D3UA 3C6UA 3W66A 2HPUA 4C6AA 1WEXA 1A7GE 3FEXB 4NA1A 1S1TB 1U0SA 1YJWS 3LWMA 2DEIA 5A8RA 3GIRA 1T95A 2E7WA 1I5OB 3CCWA 3TRGA 2XWXA 2M70A 2XY6A 5F9NA 2DIVA 1W7WA 3MPDA 3LF0A 4K4UA 3R5DA 4ILLA 3KLEA 2R2UA 4J91A 1GAOA 4DZDA 5HP1A 3FDSA 3TZXA 1A9NB 1OY6A 2O66A 4NLDA 1KKHA 2FHMA 2D3O1 3N79A 1HQEB 4ED2A 5E5NA 4C97A 1ROFA 4NASA 2MSSA 4E0DA 4B3MJ 2DISA 2KM8B 2R7SA 2A10A 4ZVEA 4CP5A 4J9NA 1SH3A 3IMQJ 2GAHC 3X1LB 1VLOA 5D6GA 2QFIA 2KB2A 3KK3A 2B9YA 3L95X 3N5FA 4BBYA 2D69A 2VA2A 5FIIA 4ZCKA 3CDAA 3R2CJ 1YTYA 1YJNS 5KFBA 4MT1A 1SIZA 1WORA 3SBMA 4ZOSA 4GKJF 4KSEB 4RW6B 1VHFA 3MCMA 1SKRA 4PXEA 4C3KA 5EDWA 4DL3A 3TI0A 4RUCA 4BCAA 1JLEB 5EGYA 4DR4J 2QO3A 3CJTA 2ZJPQ 4J90A 1S0OA 2K1RA 2UXBJ 2OO4A 3IN5A 2FY1A 4IDKA 3R27A 1EIYB 1U1MA 3DLEB 3JAMU 3Q83A 4F0HA 5IQQA 3MOJB 3T9NA 1NDKA 2AD9A 2YKMB 4XTTA 2GJIA 1FJGJ 3IBFB 3P4UB 2G2YA 5GMDA 2N7YA 3UDCA 1WF0A 4LFBF 5A8KB 2GC8A 2QMWA 3GSDA 2W7AA 3N9UC 1NJZA 3H4DA 1JJCB 2Z57B 3KLIA 3GIIA 3K57A 3WZ0A 5IV4A 2B8QA 5LJ3Y 4LF7J 1U2RA 2HBZB 2KYZA 3SIPB 3HFZB 4DL7A 3FBEA 2M4MA 1WC4A 2DR5A 3MAAA 2V8HA 1RWPB 1S9EA 4HEA9 2HVZA 3C6UB 2RNEA 1GEHA 3CDEA 3UDLA 3QPIA 1M5SA 1F3VA 4PXDA 2VC1A 2PI5A 5KG2A 1H7WA 1QAIA 1RAOA 2G1DA 4H4KC 3UVJA 1NHVA 1NPKA 3KK1A 2ZKTA 4B3RJ 3PW5A 3T1HF 1HWKA 3VZHA 3RUBL 4WIQA 1Y3JA 1RHKB 3V4MA 4A8KA 1IKYA 4OZ0A 3ZZTA 2GQQA 3EJMA 3KLEB 4IFVA 2B9WA 1HR0J 3KLHB 4JV0A 5HP1B 1VDHA 3FBFA 4BDPA 4FZVA 2ROPA 3PEHA 3KXDA 4KH1B 2QA4G 1H0HB 4USHA 1PG5B 3BPSP 5ETQA 2UUCF 2YBVA 4Q44A 2CNLB 3K5OA 4ZMMA 2BM0A 1BXNA 1WDTA 4LF9J 1HHQA 1LQ9A 2GO9A 4YP3A 2C1EB 3DMJA 3QJPA 5HMWA 6FD1A 3DRPA 5JXSA 3MR6A 3KK3B 2VPWB 3LA0A 5K5MA 2CPYA 1N34J 3PACA 1RISA 3J7A1 2PSZA 3J80Y 4DR6J 2HNYA 2PFFB 1FX4A 1IKVA 4ZPWR 4DR1F 1J5EF 4O4RA 4V1Ak 4Q0BA 2A6OA 1UVIA 4WIIA 1NPRA 2RQCA 2IAJA 5J2PA 2JEFA 3SEOA 1LK7A 4DR2F 2K1RB 4C98A 1IKXA 1JLFA 2BJ1A 4D3HA 1ZZNA 4O44A 1FNOA 4OFZA 1T11A 2M5YA 1SKWA 4IDKB 1R3NA 1Q1KA 3RB4A 4P71A 3E51A 2FGCA 1U1OA 4F4WA 1KONA 1OMSA 1FKOA 1U1KA 1N32F 4MIAA 1FI4A 3NLCA 2DNYA 3RAQA 4IH6A 4J9MA 2M0GB 4X4UA 3OR1A 2E5HA 3TUIC 2G4BA 1PJ6A 1NDPA 2AEJA 3CCVS 1F5CA 1D8ZA 2QFJA 2HZAA 5HLFA 2MKHA 1MMLA 2AZ1A 1QAYA 1O8BA 4QW8A 1WHYA 1YI2S 1N48A 3KLIB 1KHVA 2JX2A 1YVFA 2HQCA 3CCLS 3FSYA 5SZTA 1NKCA 2YX1A 3MUVP 3BYPA 4DPUA 2HBQB 1H3DA 4ECWA 3Q8VA 3NKYA 3VF0B 1RWOB 4CM2A 2EW9A 4M8LA 3MAAB 1F2GA 3ZZRA 3KDNA 4FF2A 2VQFF 1WC5A 1AUSL 4ED1A 4HHJA 2ZDOA 1LFWA 1S9EB 2Z58B 2OMLA 3AOAA 3RBEA 1RWWB 4O0IA 3UVJB 2BQ3A 3NOCA 3KK1B 3BR9A 2QG9B 5GAEU 2Q1LA 1CG2A 2ZOGA 1RSCA 4USVA 1IKYB 1HNVA 4DV7J 5KG4A 2NR0A 3CDWA 4DSJA 4DUYF 5IV3A 1V5IB 4DJBA 4IFVB 1IUJA 3SSQA 2FLNA 4ZITA 2FHJD 2J7UA 2HAFA 2OFGX 1C1CA 1UWAA 1F60B 5FJ4A 2IHR1 2HQIA 2XGPA 1HWLA 1T9XA 2Y1LB 2J7KA 1BQNB 1F6TA 1NK5A 1JLGA 1NJXA 2VU5A 5M2RA 2XULA 2GJ2A 3N6LA 4ECUA 2V94A 4QWBA 1T3NA 4F4YA 3DMJB 1GMUA 1XMBA 3GIJA 3DRPB 3IR5B 3V6HA 5B09A 3HFKA 3MCNA 2DNOA 2GCFA 2CADA 3ZO7A 2ILZA 1T9YA 4RJVA 3KMSA 1VQMS 2MY7A 3ELHA 2IIHA 1HKAA 1IBMJ 1ZM2A 3BKTA 4YY3J 2BKOA 2HNYB 4ECVA 2I0XA 1IKVB 5ETNA 3JSBA 2FVQA 4Q0BB 4LF1A 3W1YC 5KG7A 3DN9A 3ICLA 4OHZA 4F3QA 5DG9A 3VVTA 1TKXA 2E29A 3FQKA 2MLYA 2IAJB 5J2PB 3BGOP 3M32A 3AXMA 5F9LA 1IKXB 1JLFB 4O44B 1YRXA 4A8MP 2AGOA 1PSDA 4N77A 2RH3A 3PR5B 1S4FA 5F8IA 1FKOB 4I7FB 3PW4A 2Z56B 3BEGB 3RAXA 1RLDA 3TX8A 2IJFA 5BYRA 4O3PA 2VV5A 3OR1B 4HKQA 2C28A 4RZRA 4HVZA 2PMZD 5FDLA 1KN6A 3U1MA 5HLFB 4DG1A 3MI7X 4DR5J 3HK2A 4DS5A 1RKJA 4ANCA 4NWBA 1X60A 2YY3A 1WHWA 3VQSA 4K0KJ 3BGRA 1Y7PA 4F02A 1WEZA 3Q86A 4HDGA 1D9FA 1H73A 1L3TA 3H2LA 3H40A 1I51B 3GJQB 3OSNA 4NXMJ 2QJ3A 1GFWB 3DDIA 3X3UA 2DB1A 3LAMA 2QV6A 1OSDA 2PMWA 3TEHB 2V8VA 3KHLA 3PV8A 4P75A 1X9MA 2FYXA 2X3GA 4RWXA 4P7VA 3EDRB 2EFNA 3M05A 2EFGA 1WKLA 2YX7A 1R0BG 2AMCB 2VZ9A 3N28A 2QA2A 2HW3A 2MQPA 3DCAA 4WFNQ 3T5JA 4NLQA 1OPIA 4I68A 3OD2A 2YQ1A 4UY85 3TAMA 4U8VA 1FEEA 2KT5A 1Q8BA 3L4BC 4WFYA 3RW6A 2MKKA 3UWTA 3K5MA 3MM9A 3CGIA 2B3TB 3TA2A 2N82B 1VQ7S 2CJQA 2OD4A 2UUTA 2BQRA 1C1CB 1YG0A 1FRJA 3D54A 2VONA 2CNKB 3NGSA 3HVAA 3L7UA 3JSYA 3BS9A 3KLGA 1HNZF 4BC7A 2R7XA 1JLGB 4C0HA 5AJ3F 3D1OA 2VICA 2XZWA 4G1IA 2WTFA 2O3DA 2MZ1A 4AQYF 5K8NA 2JVOA 3KFWX 1KR4A 2GHPA 5KG1A 2IYGA 3RBZA 2AEFA 1L3UA 2HFOA 3OTOF 1CQNA 1URNA 2CFXA 4YR2A 2DCLA 2J0WA 5HVGA 3RRHA 4TVAB 4CLTA 1TKXB 3LUYA 3Q8QB 3M32B 5KFOA 2AYBA 5JVHQ 2QMXA 1V3RA 4QCLA 1QUVA 5KFCA 3CIZA 3R2DJ 1UJ5A 1YHQS 4IOAQ 4JI6F 1APSA 4TQRA 1N6QA 2R8KA 4DL0C 5D4NA 4RKUC 1TR0A 5FDLB 2V34A 4DG1B 2ZBIA 2OPQA 1URRA 4C0BA 2R7UA 2CQPA 2CQGA 5EN1A 1NM2A 5DDOC 2V63A 3BGRB 2ZC3A 2AJ1A 2LU1A 5GAGU 5D3GB 4CCHA 3CMQA 1S72S 5IZHA 5C24A 4ZP9A 2YKQA 3RTVA 3N0VA 1T7PA 2W2QP 3FMBA 3PJ9A 2EEYA 2DH8A 5L39A 1XNQJ 4OYZA 1RTIA 1F9EB 2W8KA 1WEYA 5AXMA 5CCLA 4JI8J 2FJXA 5F8HA 2IVMA 3BQ1A 5DO2A 3LP2A 2EG2A 4RR5A 2CA9A 5LXYA 2UUBJ 4YB7A 3WBZA 3V6DA 1RT5A 2VBWA 2K2PA 3DLGA 4K50A 4KQZA 2PN6A 4DZ6A 4CTAA 5E7OB 4X65F 4RBUA 1DQ8A 3TUZC 3TAMB 4M95A 2WRMA 4B3SF 3O3LA 1OO0B 2IRXA 5HJXA 1Q79A 2RD5C 4WFZA 1Z2LA 1LW0A 3MM9B 2AGPA 3RRKA 3E3XA 2WBRA 2Z2ZA 3IWLA 2HVIA 3TANA 4A8WA 3A8IA 2V50A 2OD6A 1AB8A 4LQ3A 2P6SA 2H5IB 3TJAA 1HBNA 3KLGB 3FSXA 3ETMA 1Q53A 2AZ3A 5E2QA 4C11A 4IO9Q 1R6YA 3I87A 1RBAA 3OTBA 2CXEA 2VQEF 4DR3J 1PYOB 4F36A 2HZVA 2HQFA 3G96A 1MN9A 2MDAA 2ALYB 2HG4A 2HHXA 3GV5B 4RL1A 4LRBA 4K2XA 4P10A 3M30A 4C9DA 3SQOP 2BE7D 5E3PA 3T9ZA 2I9SA 4GKKF 2ZBRA 2UUAF 4LUBA 4GC7A 2V5HG 4H4KA 3K0JA 5HQLA 3OVBA 3D3BJ 6FDRA 3CO0P 1Y5IB 2LLZA 1QLNA 1SC4B 2ATLA 4DV4F 1U09A 4DPYA 2IDLA 5LMUJ 1VQ6S 5L1KA 3Q8YA 1GMWD 4EK2A 3DFEA 2JDJA 1ITPA 1S99A 2EWHA 3R7BB 2AF6A 2DRDA 1FRHA 4CLSA 2HIYA 4WU3A 2HBRB 2V6AA 3I5BA 2XG8A 3DLBA 1FTRA 2ZHBA 5F8GA 1DAXA 2HBYB 1CEZA 1N6QB 3G6VA 1NK0A 4KGZB 2J8SA 4CT9A 4F3MA 1MLAA 2OPQB 4JI5J 3B78A 5THWA 3KTQA 4X62F 1KTVA 2GZOA 3DGPB 3DI6A 2J5AA 5BR8F 4WK3A 3QSIA 1M0SA 4QIVA 5C24B 2VUGA 3IFEA 2V8GA 3MAQA 1F9FA 1SV5A 3OHAA 2CZVC 3EVWA 3T1YF 3NMAA 2HNZA 1WOPA 2E9TA 4DF8A 4QIWD 3LP2B 3WQPA 1P1TA 3BQ2A 3I31A 5L9XA 1FWPA 5KFXA 3V6DB 3DLGB 4ZCMA 1CJTA 4LJMA 3MZIA 1T9VA 4NL5A 4QIEA 4CTAB 2HHVA 4MK7A 4BHQA 3LGMA 1IQZA 4ED3A 4AT1B 2NPIA 3QO9A 1H74A 4WFAQ 4KR0B 2JC0A 4LRFA 2HQDA 4ETZA 5KT2A 2UZAA 2SXLA 4WFXA 2JRSA 1XNRJ 1LW0B 1EX8A 4WXWA 1P8GA 4IH7A 4OYBA 4JI3J 2M88A 2WW4A 4IR1A 3P49B 3Q2TC 5KFPA
chains in the Genus database with same CATH topology
1TV6B 1LV5A 2LEAA 3K8VA 1LXJA 2C3YA 1HBNB 4QZVB 1D3WA 2Z2LA 2CJ9A 1U1QA 4RNHA 2ZZMA 3I5CA 2DR9A 2OSRA 3I0RB 5HROA 4ZCLA 3GV8B 2XSFA 2DNRA 3PEJA 2FVRA 4C11B 3WC2A 3HM9A 2YWEA 2LEBA 1OQ3A 3LP0B 5A6WA 4F2SA 4Y28C 1PC5A 1JJHA 1AXQA 2ILYA 4Z37A 3PIOQ 3BF4A 1M5HA 5D78A 5KG5A 5A2QY 5KT5A 3UCZP 3PW0A 4QYRA 3LQVA 2N3LA 4A47A 5KFJA 3KKFA 1RT1B 1TKZA 3UW1A 1Q8LA 2PO4A 5CA5A 3GFHA 4H4OA 4XO0A 1HBOA 3V4IB 5B0CA 2B4UA 3KNGA 4JI5F 5HMXA 3ISND 1YJTA 5B7WA 3MWBA 3DRXA 1FXDA 4NLPA 2DHXA 3V6JA 4IUFA 4DWIA 3I6PA 2KG1A 1ZZFA 4IKAA 4NLVA 3M30B 2W4PA 1K8AT 3HHDA 5KFYA 2ROEA 3AB4B 1SJFA 2D74B 3DOLA 1LW2B 2XNQA 1VQ9S 5J1NA 2OLWA 4B3MF 3HT3A 3M9OB 4YR3A 4BC9A 3PW2A 5B0BA 4NRUA 4JV1A 4M94A 2XS2A 1HQUA 3DC2A 3TYTA 4N8NA 1J5OA 1N52B 2NZ4A 1VI7A 4OLPA 3QGPA 2YKPA 4JOUA 3GIKA 4IQXA 2R2TA 3P5TL 3TVYA 3MPWA 1SIWB 1VMBA 4Q5VA 5DQIA 4RBVA 2HNDA 3MHYA 4N5SA 2XLJA 4MMOA 3I32A 1JMTA 1DLOB 2O01C 3SCKE 5A8RB 3V2UC 2DO0A 4FVMA 5KT4A 3M4XA 2F40A 3QLHA 5KFKA 2ZH2A 5F8JA 3LGNA 2MZTA 3C66A 1UKUA 4MYUA 3A8EA 1XNQF 3CD6S 3I82A 2BZ2A 2JHEA 1DHMA 2WB4A 4L3NA 4YR0A 2R2SA 3IWNC 3LALA 1MW7A 2JFKA 2UVVA 2HHWA 4NLSA 3OHBA 4ZHRA 2VC0A 1RQ0A 4LFCF 1VRUB 3BZQA 2RUGA 3D0HE 5H1SV 4Q45A 2KYXA 5M2PA 4RNFA 4OHYA 4NZ0A 3FVYA 1H6KX 5CYMA 2RDJA 4ID5A 3BO4A 3HF5A 1UETA 2GQCA 5A8WA 3G4SS 3K8WA 1HMVB 1RJJA 1KRPA 1WHVA 4Q7AA 4KV8A 1UEVA 4DR4F 2BRLA 2CPFA 2CPEA 4DV0F 1S10A 2OPRA 2WAQD 3KNAA 1CC7A 2PI4A 3PHEA 4OX7A 2C2RA 3RB3A 2J6TA 3H8YA 3HKZD 1S0VA 1RTJB 3Q8PB 2DGSA 3CD7A 3PKYA 1XMOF 3M8PB 1SJRA 1V9OA 3CJ3A 2D41A 3GFYA 1HBUB 2P9CA 3ZZ0A 2E1MC 4USJC 3QGGA 2PDAA 3NS6A 5GAHU 3C46A 3IGNA 2MKSA 1UJ4A 1RT3A 1WTFA 2WW8A 1L3SA 1LWCA 5T7LA 3VTIA 4PG4A 4B08A 1S79A 2HMIA 2N4DA 1S1TA 1P27B 3CVKA 3G86A 3QWUA 3VZIA 1RKIA 5E3CA 1XN9A 2LKZA 3K5PA 3OFGA 3EYZA 4PWDA 5HQ8A 1R0AB 1REVB 4I64A 2L41A 2VG6B 2HIQA 1DFDA 3CDBA 4DFMA 3DNCA 2KO1A 4I69A 4FF1A 3G6XA 3KWMA 3K7RA 3EZ5A 1FE0A 2C3UA 4AL7A 2XY7A 1FJGF 4DEZA 4L6V3 4USIA 1MWYA 1U1LA 2VBXA 1FTCA 2UP1A 2IM2A 2LQ5A 1XNRF 2R7TA 4NCBA 3DI6B 3QAUA 5HO4A 4OI0A 5H9FJ 2E9RX 3SSSA 4JI3F 1RT2B 2OFHX 2RQKA 2ZH9A 4AXIA 4DS4A 1JJ2R 4DQIA 3AHPA 2JC1A 1KHWA 4OI3A 4YB5A 5KOXA 2COLA 4FXVA 7FDRA 3TAPA 1AFJA 2RQMA 2GO8A 4ECRA 2UVUA 3MM8A 3MPVA 4A8XA 1Y00A 5F0UA 1UAWA 1WG1A 2EBGA 3HHLC 1ZAVA 5EUHA 2ZD1A 4EO8A 1AROP 5H9EJ 3H20A 3T1AA 2P9EA 3FNNA 2AV5A 3UPFA 1SV5B 3KK2A 4M5DA 1HWJA 4DBQA 5GVQA 2R4FA 1KLMB 4EZ9A 4ILRA 5CYJA 2H5EA 5IQ6A 2W9CB 4LFAF 2AGQA 1R8PA 4JI7F 3HLUA 4Q2MA 4ZLPA 3MM7A 2X51A 1EP4B 2LVWA 4AFFA 3Q8SB 2RF2A 3EPGA 4AE5A 3MR2A 4PQAA 2HNZB 5KFVA 3H5YA 3HVWA 2LA6A 2J9EA 2CPJA 4PKDB 4DSLA 3K2YA 1X0FA 1BD6A 1YBAA 1HQEA 2B4PA 4U7CA 3OJUA 3VAFA 5I3QA 5KFZA 4PXBA 3LANA 3RR8A 1RT6A 3DGPA 2V8DA 1TK8A 2PA8D 1VK3A 2R7VA 4J9OA 2KJWA 4YDDB 1S1VA 3Q23A 3L09A 4ZVGA 2CIMA 2Z2MA 3MOZA 4RW8A 3CPWR 1BQMB 4NA3A 4X4TA 1S6PB 1HHSA 1C4CA 3DRYA 2ASYA 1HFEL 5KFFA 1IBLF 4JBCA 3FRZA 2ZNYA 1B7FA 4DMZA 4URGA 1YJRA 2CZ4A 2XSJA 3ETOA 2RU9A 1VOMA 4RW4B 4DQQA 3N6MA 2E9ZA 1SQEA 3G6ES 3QO9B 1TUVA 3HO1A 1RT4A 1IJEB 5L8RC 5B0GA 1ZBTA 3HVRA 1Y4ZB 5KG3A 3MXHP 2DH9A 3IRXB 1FT8A 3V81A 2DPIA 3M2UB 4Q43A 4R0EA 2ZUGA 4ATNA 4NLGA 1SL2A 2HLTA 1FF2A 1Q8IA 4Y0FA 4RW6A 1JLCA 2B7CB 5KFNA 2KXNB 1M90T 3R1LA 2HZCA 1N0UA 4NA2A 3DRRB 1TKTA 3OVAA 2VODA 4DQRA 2XS5A 3HJFA 2YH0A 2YWKA 2X1AA 4E8UA 1HD1A 2W4DA 4MIBA 2XMJA 3QGHA 1HBMB 1HWUA 1UMJA 2W9AA 3OLBA 2LEPA 1YJ9S 4B9MA 2R8GA 1TVRA 3ZZOA 3PO4A 3NMRA 5KG0A 2ZVSA 4P6QA 3MEDA 2DBBA 4OLOA 1ZETA 5DQHA 2ZNZA 1SBRA 1M1KT 3I4HX 2XBPA 1TFWA 4DV2F 3RBDA 3TW0A 1GT8A 1RYSA 3L7OA 4EUVA 1U6FA 3VAMA 5G4DA 4IG0A 3DLEA 5HROB 2XC9A 2LXUA 3NNAA 4EYHB 2AJFE 4J9RA 2AJ0A 2IA6A 2XI2A 1FNMA 5CZVA 2YKMA 2DVIA 4NPOA 1HA1A 5L9NA 2GHWA 3OFEA 1YITS 2EI5A 4N56A 2U1AA 4MIWA 4LMZA 2EFOA 1TKZB 1N0VC 2E5GA 3NCQA 4H4OB 1HBOB 1T94A 4LF5F 2XCAA 5IFMA 1KC8T 4QOTA 4KFBA 2DNGA 3MCSA 3C2PA 2HFNA 3E01A 4NYPA 2MQQA 5A8KA 2UVWA 1LWFA 1Y9OA 2LDIA 2Q43A 4ICLA 1QAJA 2EG1A 3DOLB 4C8YA 4QYZJ 3TP2A 3CD5A 1M5VC 5AXNA 2E1AA 3CD0A 2DCUB 1R8AA 3GZ7A 2U2FA 3OR2A 1VC5A 5DETA 4JUZA 4OV1A 4CO3A 4OJ3A 1FKAF 4JI1F 1C1BB 3IA0A 1TL3A 1GTHA 1HQUB 3CJKA 1KEKA 5KT3A 1JB0C 1J5OB 5B0AA 3AJ2A 1F0XA 4EO6A 2ZH1A 2KFZA 1U7LA 5KAKA 1R89A 2MQOA 3F56A 5DDRC 5F0WA 1DJ0A 3CJ4A 3MD3A 3ZZUA 2HNDB 2ZE2A 3KYLA 3F41A 4ZKAA 3T5HA 2BUNA 1N34F 2M8DB 4OMFG 1UVJA 2J6SA 1IKWA 1ZOTA 3IXQA 3M9NB 1Q82T 3QLHB 1RGVA 2KTQA 1Q7LB 2JLGA 2IYIA 2HGMA 4TLQA 2PEHA 3MEKA 2GFFA 3D1QA 4ZHRB 1X4BA 3IR6B 2EPIA 3ISNC 1BGXT 4AXJA 1AUDA 3OL8A 1XERA 4J9KA 2E5IA 4ID5B 1UA1A 4ZP7A 2FVCA 5A8WB 3JTNA 3POTA 5HL7Q 2MQLA 1WELA 1TZ0A 3ITHA 3M2RA 3BSCA 1JKHA 2MZQA 3TVKA 3UE2A 4YEAA 4KV8B 3H5SA 1LW2A 5IT0A 2GMHA 2OPRB 3EUNA 4PPDA 3DLLQ 5GAGI 2RMLA 4OX6A