5HL7Q

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
publication title A novel pleuromutilin antibacterial compound, its binding mode and selectivity mechanism.
pubmed doi rcsb
total genus 12
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hl7Q00
1X4GA 3NNCA 1M5PC 3P5TL 1SJFA 2RQ4A 3S6EA 4W90B 1DRZA 3VAKA 2MY7A 2MKKA 2DO4A 1YJNS 1OPIA 5IQQA 2KU7A 5D78A 3IWNC 3CUNA 2GHPA 2G4BA 5MLCV 2RS2A 2I38A 3CC2S 2CQHA 2DNOA 1P27B 2D9PA 2DHXA 3IRWP 2CPDA 2N3OA 1FJEB 2XNQA 3UCZP 3P49B 3K0JA 2I2YA 4WFBQ 1WG5A 3R1LA 2AYEA 5DM6Q 4TU7A 1M5KC 3PIOQ 2CQPA 2X1FA 1X4HA 2D3OR 2DNKA 3N9UC 1YITS 2LA4A 4WCEQ 1FHTA 3I55S 2EK6A 4Y0FA 2EVZA 1N54B 1WWHA 2AD9A 5GAHU 2DGTA 2KRBA 1WEXA 3EGZA 2RT3A 2CPZA 1VQPS 2KH9A 1H2TZ 1OIAA 2L41A 4IO9Q 4UY8T 3CULA 3TYTA 1U1QA 3TP2A 4OZ0A 5D77A 2CQDA 1SJQA 4WIIA 4PR6A 3MDFA 1VQ4S 2FC8A 4QU6A 2RQCA 3RW6A 1F9FA 3NS5A 3G8SA 1B7FA 1ZZFA 1YJWS 2CPJA 2FPHX 1N52B 2JVOA 4Z2XA 1WELA 2XNRA 2L08A 3NNHA 2KG1A 3ZZZA 2MYFA 1KD1T 2PEHA 3LPYA 2MZQA 2V94A 4LIRA 1R8HA 2LKZA 3CCQS 2XS7A 1X4FA 3BO4A 1X5SA 1HL6A 4ZKAA 1VQKS 2KXFA 2XS2A 1XN9A 5HL7Q 4WKRA 2FC9A 1Q81T 2KG0A 3P6YC 1FT8A 2E5HA 3DLLQ 2MZ1A 3UD3P 1HA1A 1WHXA 2M52A 2MSTA 1UFWA 2M4MA 3SMZA 2QA4S 5GVQA 4F02A 1D8ZA 2DISA 4TLQA 1YJ9S 2RU3A 1Q82T 2DNLA 1X5TA 3VALA 5LJ3Y 1KOHA 1UAWA 1YWXA 2DGSA 2Q79A 1S72S 2MQNA 1L3KA 1H6KX 2MKCA 2DK2A 2DGUA 3MUTP 2JX2A 1X5PA 4OZ1A 2MKJA 1U1KA 1ZH5A 2KVIA 1JJ2R 1WG4A 1H2UX 3Q2SC 2MXYA 3Q2TC 2DIUA 2G1DA 1SJ3P 1WEZA 1YTYA 2J8AA 3ULHA 3THTA 4C7QA 1VBZA 3VAJA 3R27A 2O3DA 3UWTA 1FJCA 2RRBA 3VAGA 1HD1A 2MZRA 1U1LA 5JVHQ 2YWKA 1VBXA 4YOEA 1H2VZ 1DZ5A 1JJ4A 4V19X 1U1PA 4Y00A 1K8AT 2M0GB 2E5JA 3PIPQ 3FEYB 5JVGQ 3MD3A 2CQIA 1VQNS 4PRFA 1WF1A 2CPHA 2BOPA 2M2BA 5GAEU 2RVJA 1U6BA 1KQSR 1O0PA 2CJKA 2MQOA 2NZ4A 5IFMA 2J0QD 2KXHA 3DXBA 3RW7A 5DDOC 2DNZA 2N7CA 1VBYA 3P3DA 2RRAA 1M5OC 5DETA 4BS2A 2OSRA 2QEXS 3US5A 2ERRA 4WFAQ 2K3KA 2DHSA 1NJIT 2DGXA 2DNNA 2VOOA 2L9WA 2HVZA 5LSOA 2KYXA 5IM0B 1WEYA 1QM9A 4F26A 2ADCA 1VQ5S 3NNAA 2RUGA 1N8RT 1VQOS 3B4DA 4CIOA 2E5IA 5DDQC 4CQ1A 2UP1A 2MSSA 3V4MA 1W2BR 1R8PA 2MPUA 3MUMP 3SXLA 2CPFA 3TO8A 2XS5A 2N3LA 3G96A 2OJ3A 2E44A 2CQ3A 1P1TA 2RS8A 4WF9Q 5CA5A 3NMRA 5FJ4A 1VQMS 3CCVS 1N88A 2CPXA 3CMES 4C0OC 2M88A 2KFYA 3LQVA 3MUVP 3MOJB 2HZCA 3S7RA 1ZZNA 2YH1A 1X0FA 2DB1A 2HGMA 2M9KA 2PE8A 2J76E 3L3CA 2FY1A 1IQTA 1WI8A 1A9NB 1SJRA 5HO4A 1VQ8S 2LQ5A 3G71S 4U67Q 4UQTA 1U1NA 1UP1A 3J7YU 5DDRC 1VC0A 3G4SS 5GMKa 2K8GA 2CQ2A 2LEAA 1NO8A 2DNGA 2RNEA 2DNPA 1U1OA 2N82B 2DIVA 3HHNB 2BZ2A 5IM0A 2DNQA 1WI6A 1BY9A 2KN4A 1URNA 2M7SA 3MI7X 1OWXA 3MURP 4IOCQ 5EN1A 3FEXB 2MY8A 3BEGB 4IUFA 4C4WA 3J7ZT 2NLWA 1FJ7A 2DO0A 1FO1A 2ADBA 4FXVA 1X4BA 1VQ7S 3CCUS 2F9JA 3CCMS 2CQ4A 2ZJRQ 1VQLS 2CPEA 3ZZYA 2MKIA 2YH0A 1U1RA 2KT5A 4ED5A 3UCUP 4LMZA 2MMYA 2YKAA 2WBRA 3G9CA 3G8TA 2LXUA 1CVJA 2EK1A 2CPIA 1RK8A 4RU2A 2FHOB 2M8HA 2CPYA 4PKDB 5LJ5Y 2VODA 4TU9A 1M5VC 4TU8A 1DHMA 1WHVA 1DBDA 3CC4S 3CXCR 3EX7B 5GAGU 3CCES 3VAFA 2AYBA 3CMAS 3CTRA 4LJMA 2DITA 1X5OA 3UD4P 2MJNA 2M8DB 1HD0A 2X1AA 1X4CA 3VF0B 1Q86T 2ZJPQ 3OW2R 2A3JA 1VQ6S 3S01A 2SXLA 3BO3A 1QVGR 4IOAQ 2DH8A 1D9AA 4FXWA 2KXNB 1K73T 2B0GA 2DNHA 2LXIA 2JRSA 2CQ0A 1PO6A 3H2VE 2MGZB 2DGVA 2LCWA 2JWNA 2OTLS 2MQLA 1WF0A 5GADU 1VC6A 2X1GA 2VONA 2DNMA 3SDEB 4J5OA 2OSQA 3I56S 1WHYA 3JB9k 1NU4A 2M70A 2LEBA 2MHNA 2CQ1A 2HGNA 2MQMA 2CQBA 4M5DB 5ITHA 2AYGA 2U1AA 2MKHA 2MJUA 3CF5Q 2DH7A 2OIHA 2LA6A 3BS9A 1WG1A 1WTBA 4ERDA 5BJRA 2KRRA 2ZJQQ 5LXYA 2LMIA 3CPWR 5H1SV 4QU7A 2KM8C 1SJ4P 4WFNQ 3D2WA 1UW4A 1X4DA 4CH1A 1QVFR 2KI2A 5CXTA 2HYIB 1FXLA 2MKSA 3CCLS 1U6FA 1M1KT 2MQPA 1VC5A 3U1MA 2DGQA 1SXLA 2G0CA 3VAHA 3VAMA 3VAIA 3H2UB 5DDPC 2XSFA 1FNXH 2OTJS 2KM8B 1M90T 1X4EA 1U1MA 2GO9A 1A7GE 3CD6S 1JMTA 2AYMA 2KHCA 1VQ9S 3HI9A 3EGNA 2LECA 2MGZA 5CYJA 1RKJA 1YIJS 2LYVA 1JJHA 3SDEA 3THPA 1WHWA 1Q7YT 3UCGA 1YI2S 4CH0S 2VOPA 2J0SD 2XB2D 2HGLA 1K9MT 1U2FA 2E5GA 4QPTA 1KC8T 1OO0B 4YUDA 2DGWA 4YB1P 2CQCA 3S8SA 1PGZA 4EGLA 1X4AA 3CCRS 3MD1A 3CCJS 3BO2A 2DH9A 4A8XA 2MZSA 2F3JA 1G2EA 3UE2A 3CCSS 3R1HA 3NS6A 3U1LA 2DHAA 4F25A 5LXRA 5DM7Q 2DNYA 4QQBA 5LSLA 3CC7S 4P6QA 4W92B 1S79A 2DGOA 2MZJA 2F9DA 2D9OA 2DNRA 3MXHP 2MB0B 3G6ES 2X1BA 2QFJA 1KOOA 2MQQA 1WF2A 1YHQS 2MZTA 2CQGA 2U2FA 2JVRA 3B4MA 2DHGA 1AUDA 2YTCA
chains in the Genus database with same CATH superfamily
4HKQA 1KQGB 4MMOA 2JC0A 4OJGA 4G6VB 1T0TV 2HNZB 3KJNB 4W90B 2H48B 1OPIA 4IDKA 5D78A 3MM8A 2KVQE 1WC1A 4MKAA 2DHXA 5HVHA 4B3SJ 5KFIA 3Q8YA 2YWEA 1BQXA 5A8RA 2ACYA 3PFEA 2PA3A 4USUA 1VIOA 1FCAA 3M9OB 2UXBF 1ZETA 1OQ3A 4WCEQ 5A8KB 1N0VC 1FRXA 2HHPA 1C2PA 1C0UA 3OSPA 2GHVC 3OFGA 3DDNA 3LP1A 4ECVA 1VQ4S 4J9UE 1O5JA 1BD6A 4JP8A 3AHPA 1A0OB 2W9BB 2JLEA 4WXOA 4OFZA 4KHRA 1Q8KA 2XTJP 3GB0A 3DN9A 1WORA 2PMWA 3KLEA 4HYKA 2AEFA 4KT0C 4RUCA 1HA1A 4DV2J 4DL3A 2HQGA 4OYWA 2ZZNA 3MOZA 4CCHA 2J9DE 3BGUA 1OY9A 4K4WA 1W25A 4ZLNA 3CDWA 4K4VA 1I5OB 3SFUA 5HROA 1RT3B 3WC2A 3EE3A 3OUYA 1X0PA 4WU3A 2GHWA 2KJWA 3NBPA 4I2PB 2ASLA 1H0HB 4C98A 5G4DA 1NDKA 4V19X 2V2VA 3PW4A 1IKWA 1GTEA 3UNYA 4F36A 2QMXA 2K2PA 2QSFA 3M8ZA 1RT6A 5GAEU 4L73A 1NEEA 1TQLA 2XWXA 4JI8F 3O8WA 2R7RA 2EC2A 1S6PA 5KFOA 3Q8UA 1U47A 1H73A 2VOOA 1RU1A 3N6NA 2JSXA 1WNEA 3D6HB 3M8SA 3B4DA 2JC1A 4DS4A 1U49A 3R8YA 3PJ9A 2B6AB 1Y00A 3I0RA 3TUIC 1OQ6A 3G96A 1V6HA 2E9TA 1FE0A 4ZVPB 3TZWA 1EP4A 2QL5B 2HZCA 3PYGA 1ZZNA 5IWAJ 2PE8A 3K58A 4FBTA 1SJRA 5HO4A 5BYSA 3H0PA 2GJIA 1R0AA 5GMKa 4UQGA 1BXNA 5KFLA 1WI6A 1FD8A 3J81j 2F8EX 3KK1B 4OI1A 4PQAA 1FRJA 4NXMJ 3H5XA 3FMWA 1K1SA 2KT5A 1T9TA 4LMZA 3BGRA 2YKAA 2HWTA 2CPIA 2QV6A 3Q89A 2FHOB 2VB6A 3OD2A 1F3FA 2FVSA 4USMA 1WHVA 3CXCR 4LBIA 3TAMA 3MAAB 3OV7A 5I3UA 5L46A 3SCKE 4RW6B 1SI9A 4MFBB 3E2EA 2QFIA 2HAIA 3VHQA 4ED7A 1M0SA 1I1GA 3QO9B 4MJKA 2UUAJ 3O2IA 1GX6A 3IG1A 2FLLA 4C8ZA 1ZOTA 2C28A 3E51A 3JQJA 2XQCA 1R3NA 4YY3F 2KL8A 3U1NA 3EMTA 1W26A 1S76D 3GYGA 3ISND 1N56A 2HURA 2LMIA 3R7BB 2HHHJ 2DR6A 4TNOA 4ED6A 5M2RA 3S1TA 2MQPA 5EDWA 4MKVA 1F5AA 2IA6A 4XDCA 2QO3A 3M8QB 4NLQA 2AGOA 3VQSA 5KG7A 2J0WA 4BC7A 3EGNA 1UWAA 1NM2A 4J9OA 4F8RA 2GQCA 4ZP7A 2LYVA 3MEKA 4FYVB 3FJ2A 1T3OA 2IYGA 2DGWA 1RTHB 4DL0C 4NYPA 3KMSA 4P6QA 1V3RA 5E3PA 1L3TA 2F4VJ 2WONA 1NB2A 4IYQA 4KGVB 1XMOJ 3JXOA 5H9FJ 3ZC4A 3TUPA 4KV8A 3EZUA 2XZWA 5DRKA 1QE1B 1RYSA 1S1XA 5J2MB 1HPZA 3ONQA 4R0EA 1YBAA 1JLAA 4DR1J 4OLPA 3D67A 4YFUA 3W9HA 1PILA 3AJ1A 1RWOB 4DV0J 4ATNA 4M5MA 3KLIA 3WZ0A 5M2PA 1RHJB 2NS1B 4NLSA 5D8HB 4M94A 4NLDA 4YDXA 2YBVA 3DMJB 1RWWB 4OI2A 3NGSA 3QMQA 1MSWD 2EBEA 5CH7B 1Q1KA 3OL8A 2HFVA 1YG0A 3LGHA 4MT1A 4X62F 2E5LF 1RHQB 4IFVB 2IJNA 1OYEA 1T05A 5KFJA 3FSYA 2AGQA 4WIIA 3ZTOA 4FZVA 3HM9A 1C1CB 1SQEA 2CDRB 4PQUA 1ZZFA 4ENOA 3AD8C 2Y1RI 2CPJA 4IOBA 4ZLLA 1PBUA 1TL1B 2WCXA 3NNHA 3P96A 2HBZB 2ATLA 2MZQA 4QOTA 5K20B 4OV1A 1VQKS 2E9RX 5DO2A 1SKSA 2E66A 2M52A 4F02A 3GJTB 5EGYA 4AL5A 1KFDA 3H4BA 1RBOB 4Y28C 2CDQA 1H7WA 2HZVA 4L74A 1XNQJ 5J2NB 3MR3A 2C3YA 4OYPA 3THTA 4OJ3A 2BOAA 3D6TB 1C0TB 2YNHA 1BWEA 2K7KA 3IC1A 1HD1A 1U1LA 2EI5A 1XQIA 3H59A 3MEGA 3IRXB 2E7XA 5HLFA 1UZDA 3EICA 3G2XA 4A8MP 3QIPA 1FDAA 3IA0A 1T03B 1OMSA 3TUJC 2QLXA 4USTA 4RX6A 1F1BB 1D9DA 2KTQA 1S1TA 1Q7LB 3QFHA 1ZM9A 2CJAA 5AE2A 4LVNP 4M5KA 4ZVUB 4L3NA 3KG4A 3TO8A 5IT9Y 2ZH3A 3DXSX 2ZOFA 1P1TA 2JEJA 1Q8LA 3VTIA 2VUGA 2CPXA 2M88A 3BKFA 3Q24A 1JLGB 4O44B 4OL8A 4DF4A 2L9NA 2IHR1 4KY3A 1RISA 4QR2A 2C22A 3GCWP 3TVYA 2GVZB 2R8HA 1NO8A 2HVEA 2M5YA 3AODA 4JUZA 1QTNB 2HNDB 2MY8A 2IM0A 3BEGB 4IUFA 2NLWA 1J5OA 2VHGA 2OUGA 1X4BA 3L7PA 4K4YA 3ZZRA 3ZZYA 1UW9A 3QLHB 2W4CA 4ZMMA 1NAQA 4F2SA 3DYAA 1N36J 3JS9A 2UXBJ 3RB6A 1FRMA 1QSSA 4UY85 4EEYA 1VK3A 3AH6A 2VZ9A 2RDJA 2W01A 3C16A 2JLFA 5C24B 3W60A 2A2DA 3OSNA 2VJVA 5CHCB 1X9SA 3OVBA 2DH8A 1WSVA 2CQ0A 3PR5B 1PO6A 2Y0BB 4CO5A 2DGVA 1RYRA 3AA9A 5CYMA 1ZAWA 2V63A 4ZCKA 1AZSB 4USHA 5BR8F 2IC3B 2ILZA 2IVYA 5FDLB 4AFFA 2KKHA 2P8IA 5AXMA 1WTFA 2AF6A 1SJ4P 2RKIA 5J2PB 2V34A 2HYIB 1F2HA 1U6FA 3JYTB 2IVFB 3VAIA 4IH6A 2KFZA 2YNFB 3OHBA 3KK2B 2FZGB 3GIJA 1HHQA 1RAOA 3MPVA 3MM7B 4JV2A 2N4CA 2ASYA 3O6QA 4DLGA 3M2VA 5KFPA 2VOPA 2ZNYA 3M6WA 4X64F 2XWYA 2ZEJA 4M95A 3LGNA 2FLNA 4OYOA 1G1XA 5KFGA 4C8LA 4OJHA 4DL7A 1EB0A 5F0UA 3T5JA 3FC9A 2HHXA 3FNNA 2YWHA 3TQEA 4JI8J 3NRBA 3UDEA 2CNNB 3Q8SB 3H5YA 1C4CA 4JI7J 3DRXA 1YJ7A 3E3XA 4LRAA 2E1PA 3UQSA 4B17A 4LFBF 4ZPAA 3W8GA 3B6BA 4QWBA 3N01A 3UCZP 4ECTA 3R5AA 4DV3F 4CO1A 1KLMA 2X3DA 2B9EA 3A3PB 4ZPVR 4ZVGA 2DY1A 3PIOQ 2DBBA 3CJ2A 1RSCA 5L1LA 4HT5A 5ETQA 3JTNA 3BZQA 2Q3PA 3GU0A 3I55S 2L3MA 4I7FA 3T1YJ 2ASDA 3FUYA 4ECZA 4X4RA 3LAKA 3AFGA 3KLFB 2L9DA 1H2TZ 3M8WA 4IO9Q 3BQ1A 1QAJA 3PJXA 3TP2A 2FC8A 2B9XA 1S9GA 2ZBCA 1XTZA 1N52B 2CWXA 3BQ2A 2XNRA 2Q6CA 3OLBA 2V94A 4J9NA 2W24A 4ZKAA 1FTCA 5CABA 2ALZA 1HNXJ 2XS2A 4OYAA 2W7AA 1XMBA 1JNRB 2UVVA 2W1BA 3O5TB 3UD3P 2HFNA 1JX4A 1X60A 4O4GA 4NL5A 4F7VA 3H25A 5HMZA 1H6KX 2HKEA 1EETB 3QRRA 4KSEB 2KVIA 2R2SA 2RRNA 5HN0A 4M5IA 3POTB 3H98A 2D3ZA 1PJ5A 1ULRA 4O0IA 3CCTA 4QYRA 1HQEB 2WZ1A 3FBEA 1IKXB 3VAGA 2JDJA 2FJWA 4DR3F 5K9FA 1DURA 4I67A 2HRUA 2QMUB 1WF1A 3AXMA 2CPHA 2CADA 3W5ZA 4EU0A 2HIYA 2ABYA 3SI8A 1KQSR 1G3OA 2RDIA 2NZ4A 2BJEA 3OVSA 1KS2A 2CJ9A 2OELA 3D3CJ 2RRAA 2AKWB 3US5A 5KG2A 2DHSA 4DL2A 3NY0A 5HMYA 1TFYA 1U26A 1OSCA 3IS9B 4LR7A 1GFWB 4CIOA 2VICA 4QWEA 1BHNA 2GGPB 3OFEA 2JEIA 2KJVA 4C0BA 3TA1A 3HVTB 1R27B 5CA5A 1LXJA 2YQ0A 5KG1A 2YH1A 1CJKA 4YB7A 3QT8A 3LA0A 1CS4A 1MMDA 1U2RA 3V81A 2VKZG 4UTGA 4LSLB 3TANA 3BSNA 2RILA 3CD5A 1LWEB 3EZ5A 3DRPB 3RB0A 3GR1A 2IIHA 2ZUAA 2YKNA 2KT2A 3N79A 3V6DB 3MCSA 4EZ9A 4CNYA 5EWGA 1S1WA 3GV8B 4J7CA 5IS2A 3T9NA 2A6OA 2LXUA 3NGDA 3BDEA 2HAFA 4PKDB 4TU8A 4S0MA 2AP6A 3TX8A 3OR2B 3EJMA 2OPSB 1X4CA 3MMCB 2E5LJ 1D9AA 4V19J 4GO7X 5KG0A 1WF0A 1RADB 3LPEA 1NU4A 2HGNA 4URGA 1FI4A 2AYGA 3VQTA 1LK7A 4G3IA 3EGWB 5HANA 4URQU 3PJWA 4DWIA 2VASA 4EBCA 3VAMA 4YN3B 1U45A 2BQRA 2XSFA 2PMHA 2CXEA 3DRSA 1S0NA 4JYAF 1JMTA 5KT3A 3CE8A 1N5YA 1TUGB 1UVJA 3D9BA 2JHEA 5F8JA 4M5DA 3W9JA 3W63A 1R8AA 4FF4A 2XLIA 1VRTB 2FZCB 5H9EK 4PUOB 4JI2F 2R2TA 3PYFA 2V4RA 1UPPA 4USKA 5L39A 2X3GA 4RZRA 3F41A 1SH0A 2MQQA 4KO0B 3ZTQA 2X7IA 2GAGC 1UMJA 4MK8A 3ZZPA 3NNCA 1XC9A 2CNKB 2VV5A 1PC5A 2W9CB 3PO4A 3G82B 2BUNA 3VAKA 3NAHA 1NPPA 2E29A 1S49A 3TX0A 3CUNA 2POKA 1MW7A 5CYQA 2G4BA 2RS2A 3UVJA 4X4NA 3TZXA 1FJEB 4RPFA 1FNMA 4YMEA 1MWYA 2F8MA 2BE9B 4OYMA 3MR2A 2IBOA 3R1LA 3GFXA 3T9ZA 4X4SA 5E7OB 1DQAA 3C19A 2CRLA 5AT1B 2H65B 4RW9B 5F41A 2GCFA 1KHVA 2HNZA 1TVRA 2WSCC 2DRAA 4NI2B 1I94J 3I31A 1S48A 4KRWA 5D77A 4ZK7M 4J90A 3RW6A 3GLJA 1NH8A 1YJWS 2PMZD 3FSIA 1IM4A 4N41A 5KFZA 4ED4A 2IY5B 5C42B 3L95X 4M5GA 1HI1A 5A8KA 1H74A 4ED3A 2VG6B 4YB5A 1KSPA 4TN2A 4IH5A 4NA1A 1W7WA 1LKZA 5KTQA 2J6SA 1FXDA 3I5BA 1S72S 3TUZC 5I42B 2ZFHA 5E0OA 4Q43A 1XWLA 4B9UA 1JJ2R 3FBFA 1TUWA 2W9BA 2DT9A 4F67A 1ZAVA 3HHLC 3VAJA 5KFUA 2DY9A 4PYAA 2ZD1B 2R8JA 4Y00A 3M2RA 3OXFA 4HVZA 5JVGQ 2BBEA 3HFKA 3KHRA 4P71A 2M2BA 3L09A 4DL5A 1L3UA 4YHHF 2F1FA 4B3RF 3FQKA 3RZAA 1FRKA 2N7CA 1M5OC 2V2QA 3P3DA 2OSRA 2JNJA 3OTCA 4K4UA 4OZJA 4GVBB 1PJ7A 1Y9OA 4LF7F 3J7YI 3IGVA 4O3PA 4LF5F 4JI5J 1RWMB 2A0FB 3HVWA 1I3OB 1PJ6A 3DRYA 1S59A 3HSJA 4I2PA 4X66F 1SH3A 5LL6d 3J80U 3MFIA 4WF9Q 2J5AA 4FKXA 2N4DA 2KFYA 2VFVA 2ZC3A 5E5NA 2XMAA 3OQ2A 1DJ0A 1R0BG 2YKQA 4H4OB 3EDQB 3R5BA 4NZ6A 2RNEA 3M8RA 4DOZA 2GFFA 1SQFA 4NRUA 1P9QC 1S6OA 2BYCA 1S9EB 2CNLB 2ZH9A 4JB8B 4DV3J 5KT7A 4OI4A 4A8KA 3SSRA 4G65A 1E6YB 1P1LA 3G8QA 2FQQB 2ROPA 4IKAA 2XYGB 5LJ5Y 4CLTA 4AXIA 2XGPA 4ECXA 1K44A 2AEJA 3K5NA 4ILLA 1IJFB 3CWJA 3K89A 3D7SB 1IJEB 1NKEA 1ZA2B 3H5SA 4EMDA 4CLSA 5KFMA 3KK1A 1S77D 2UV8G 2MQLA 4PWDB 2VONA 2DNMA 2QA4G 4FN5A 1T11A 4DPUA 4LF6F 2U1AA 2DH7A 1F60B 2F8HA 2GVDB 2KRRA 2ZJQQ 3KUHA 2WRMA 1FFWB 2IYIA 5ETMA 2KI2A 2DXFA 3EZOA 4NLRA 3MAAA 1RTZA 1VQSA 4DF8A 3TR5A 4RW6A 4MFBA 2BDPA 2J0XA 1BMQB 3OJSA 1NJYA 1PAEX 3FCVA 3QO9A 3KG1A 1EX8A 5G0RB 2HQDA 1TL4A 1NSPA 5ADZA 3NGTA 4WYLA 1NCLA 3NKYA 1SIWB 2LQJA 5CAAA 3FZBA 1TK5A 4DR3J 2I5JB 4KH1B 3CCJS 2HWIA 5D4NA 3ZZ0A 3D0HE 4CDIA 4G1QB 3PM9A 5ETPA 4QR1A 4QQBA 2ZE2B 3CCZA 4ICLA 3DM2B 2OMOA 1WF2A 4J9VA 1YHQS 3M8QA 3D3BJ 2C2RA 1NRKA 3OTOF 1XNRJ 2E1CA 1DRZA 2KU7A 4JI6F 2DPIA 4ZITA 2W8LA 3ETOA 1TUVA 3Q83A 2CJXB 2W2QP 4MTPA 3IRWP 5DZ7A 3DLJA 2N3OA 2ROEA 3T1HJ 1RTHA 2YPYA 1KEKA 3T5HA 1MU2B 4LVOP 1WOSA 2E7WA 2AJQA 3V6HA 4OX9F 5ETSA 1VR6A 1RT7B 2UVUA 5IOLA 1UL3A 4ZN1A 4LRFA 3UDCA 3GFHA 4Y0FA 4DR5F 4ZHRB 3C6UB 2O01C 1QE1A 1XIQA 2G9OA 3KNAA 5KFBA 4CYUA 2Z2MA 5J2MA 3BN7A 4K8RA 1TR0A 3SCJE 1P9YA 2APOA 3CDEA 3PW0A 3MR6A 3RUBL 4I2QB 2DTJA 1QY7A 4O23A 2BXJA 2EXUA 2NREA 4FVMA 1ITPA 3LPYA 1FVQA 1QAIA 3CCQS 2XS7A 1Q8BA 2P6TA 1RDRA 1RA7A 1YK9A 2RSQA 4UZBA 2VJUA 2KXFA 1YZ7A 3O1LA 5EWFA 3DMJA 3SV3A 2E5HA 2HBQB 4FVCA 4UOHA 1JJCB 5T7LB 2H5IB 4Y3CA 4GKKF 2BR0A 3X3UA 1KKHA 2D41A 4IFVA 1YWXA 1U2CA 5KFAA 2ZITA 2QSWA 2MKCA 3PV8A 4K5SA 2IAJB 1NB7A 3VGVA 3FQLA 4NOHA 1C1CA 1WACA 3GZ7A 2QTWA 3DI6B 1U25A 3DOLB 2KZZA 1S4EA 1N34F 2RRBA 1HARA 1SUQB 4RL1A 3IWXA 1FESA 2GO8A 3AOCA 5A6PA 2WHOA 2Z58B 2V9KA 1GEHA 2PT0A 3AJDA 4NZ0A 4JYAJ 5J2NA 2QEXS 1RCXB 1FVSA 2HW3A 2K3KA 3BYPA 4DV4J 1R6VA 2ZOMA 3UR3C 1BQNB 3LP2B 1M1GA 5IM0B 4E0DA 1RHKB 1N33F 1C0TA 2J6UA 3IXQA 5DQIA 4XIUA 2CQ3A 2COLA 2VC0A 3HDSA 3AQPA 4UOFA 3OJUA 3QT6A 2M9KA 2W9AA 2HHSA 4K59A 1Y3KA 1EAYC 5GAGI 2ALYB 2CQ2A 4DPYA 3UN5A 5CZVA 4NZ7A 1BY9A 2XHCA 2W4PA 4NCGB 5KFRA 3PVXA 2CQ4A 4LSNB 1X31C 3ILLA 1ZTWA 3FCHA 3ISZA 2HQIA 4FPIA 2OD4A 1FNOA 1WDTA 5KFWA 2Q6BA 1DHMA 1JLGA 4O44A 3PZPA 3C6TB 3Q8PB 2R4FA 1IBMF 1HD0A 3MPWA 1AW0A 3MTJA 2GVZA 4EFAC 2B3TB 3CJKB 4F3OA 1SC4B 3LWMA 4ALZA 4FXWA 3IN5A 4P72A 4NEYA 3D4JA 2HNDA 2W4DA 1YBTA 4ELTA 4J5OA 3QLHA 1WHYA 1JQGA 2MQMA 2OAUA 2OIHA 3BS9A 2ZH7A 2DR7A 1WTBA 1UVKA 2Q43A 3HF5A 3IAS9 2ZKUA 4WFNQ 2VDIA 2XGQA 2V0NA 1M1KT 1F6TA 3HXMA 3E01B 3WDOA 3GILA 5IZHA 3PDNA 4OZLA 5EHHA 1JXLA 3DNCA 1NK7A 4RNOA 1FK9B 1T9VA 1RWXB 4P2XA 4DV6J 1J5EF 1AZSA 1YI2S 4MIAA 4KR0B 2OFHX 1TMMA 3BPSP 5B0CA 1JLBB 2OP5A 1HNWF 2UUBF 2QX0A 4DUYJ 2DHAA 4UUXA 1YJTA 3ITHB 5J2PA 2BJ3A 5C25B 2VL1A 3G6ES 4J9RA 4FP9A 1Q95G 4B3RJ 1MNEA 2DGTA 1M5PC 2YNFA 3B54A 3Q0AA 4FDFA 3KK2A 3IR5B 5KFHA 4LF5J 5IQQA 1FD2A 3MM7A 4J9KA 3R5GA 1HR0J 2VBWA 3HT0A 3CC2S 2HHVA 4K4TA 3F56A 2H5JB 2WOMB 3NLCA 3W8PA 1CJVB 4NLWA 4WFYA 3GIKA 2R7XA 3VZHA 1JK9B 2BVZA 1SB6A 4ES2A 4Y2MA 3JSMB 1FEHA 3PW5A 3FZ2A 2XYPB 4LF2A 2W2MP 4U8YA 4TYAA 2EVZA 4QIWD 4RBVA 1F3VA 1WEXA 4O0NA 1M5HA 1F0XA 1CC8A 5IT4A 1OIAA 5D4LA 1U1QA 3ZZTA 1SJQA 4I68A 1DARA 2KB2A 2P9CA 2WSEC 3I5CA 5KFNA 2QE5A 1YRTA 2HHUA 2AGPA 1F9HA 3K5OA 3MAQA 4I6WA 2D74B 1RB0A 1E6VB 3TOQA 2KG1A 4LFAJ 2VFSA 4AE5A 2BM0A 1B4SA 3HD2A 2AJ4A 2FC9A 1Q16B 4PXCA 3UR0A 3AAWB 3OBIA 4K0KF 2MZ1A 3PEJA 2DVIA 1RHUB 1UFWA 2M4MA 1JLCB 2QA4S 2B7BB 2QRRA 3NEKA 4J9QA 4ELUA 4YB6A 5D4PA 3KLFA 4DQSA 3VALA 5LJ3Y 2DGSA 2Q79A 4N76A 1RTJB 4XTTA 4UT4A 2HFOA 2HMIB 4F2RA 2J6TA 1REVA 4IR1A 3BYRA 4ECRA 5EWEA 2KT3A 3LP0B 5JJBA 4LF6J 2K06A 1Z4UA 3UWTA 2MZRA 2CG8A 1S0MA 1NHUA 2O5DA 3C46A 4H4MA 2QN6B 4RU9A 1BLUA 4RKUC 1RT4A 4DI6A 2H9ZA 1CJTA 3RW7A 1U48A 1S1UB 4OHYA 4JOUA 1EETA 3T5LA 1DLOB 2RU9A 2L9WA 2ZUGA 2RF2B 3D6FB 2ADCA 3POTA 1YZ6A 1Z2LA 2CJYB 4AT1B 2DEIA 4DL6A 5KG5A 2AJFE 4LSZB 1HQEA 2XBPA 2MKYA 3V4MA 1IKXA 4QYZJ 3ICLA 4FF1A 1X7VA 2F7VA 4QBUA 2OJ3A 3NWRA 4NXNF 1UETA 2NQPA 4NX9A 3LQVA 1FERA 1X0FA 3L3CA 4IRCA 1N5QA 2H4WB 3OTOJ 4DX5A 1VC0A 2XMJA 1CG2A 3THVA 3B82A 3TWZA 3IS9A 1RQ0A 3MI7X 3MM9B 5KT2A 2GGPA 5SUHA 1RTDB 3EM1A 2YH0A 4HDGA 4PXEA 1APSA 2VKRA 5DGAA 3G8TA 2F4FA 4C97A 3HVTA 4DDFA 2CPYA 3NCPA 2Z2ZA 3WX4A 4DR5J 2AHOB 2XMWA 1X5OA 4KGKA 2M8DB 2ZHOA 3FEZA 4LSLA 4DR7F 4WTYA 3BO3A 4LQ3A 1LWEA 1GMUA 1Q4RA 1FWPA 5LOQA 3DLEB 4CT8A 3ET6B 3MAHA 2OTLS 1RAIB 2X1GA 2DCUB 5L1JA 1S4FA 4P73A 4NA3A 4WZMA 3KLVA 4N8NA 4R5PB 1RBLA 3N0VA 4J91A 1NK8A 2XC9A 3EPIA 3C15A 2B4PA 2NXUA 1X4DA 4CH1A 5CXTA 4GKKJ 3OR2A 4KHMA 2OPSA 3U1MA 1YDLA 1SXLA 3MMCA 1F2GA 4UOCA 1Q53A 4ID5B 2FLPA 2Z4PA 3CJ3A 4Q8EA 1HNZJ 3GR0A 6FD1A 2CZVC 3V6JA 4O3SA 1T94A 4LUBA 5B0EA 2KZMA 4LQ9A 4H54A 2G13A 2XG8A 4CH0S 4F50A 1O8BA 3K17A 1PCAA 3KLHB 2XMVA 2GZOA 1B7YB 3NS6A 4LBHA 1KQKA 2FGCA 3I5AA 5IC4B 2DGOA 3K5MA 4DSFA 3J7A1 2WBMA 3KNGA 2CQGA 1B0PA 3HCXA 3M2UB 4Y6IA 2HZAA 1NSKL 4ZP6A 1WD6A 3HSZA 1XERA 4MIBA 2UU9F 1U0HB 3I96A 2GHPA 4DMZA 1N33J 3I4PA 5KFQA 3U7JA 1K0VA 4G1IA 3WQPA 3M30B 3IM8A 3RAQA 2VD3A 1VRTA 5KFTA 5KG3A 1VGYA 4H4KC 4PUOA 3DOKB 1IBLF 1HBOA 5L9XA 4NLGA 2ZHAA 1HHTP 2LA4A 1VRQC 5B0DA 1RTIA 4KO0A 1EARA 2V50A 4Z37A 3QJJA 3VVUA 4B9MA 3Q8VA 2BKNA 1LWFB 3DLGB 2W9CA 2F5GA 3G82A 3CULA 3PEHA 3QGHA 2FYXA 1R7IA 2P6SA 3GG0A 4PR6A 5KFCA 1Q8IA 5F3TA 1TELA 2IRUA 2UUCJ 4Z2XA 1WELA 4CM0A 3PR4A 3TW0A 1R8HA 1V9OA 1WKJA 3PKYA 2UXDF 2QA1A 5CQGA 4RW9A 3PX6A 2EKNA 2MLXA 4IH7A 5GVQA 1IBMJ 2MHEA 2RU3A 1FKOA 1PYOB 4WK3A 3KWMA 4HHJA 4NYOA 2NYHA 4NI2A 2MQNA 5ETTA 2W2OP 2AU0A 2OPQB 5K5MA 1ZH5A 4M5HA 2DIUA 3CIMA 4B3TF 3MR7A 3ULHA 4ZCMA 1ZPVA 5C42A 4DSJA 3KKFA 1VI7A 1MG7A 2R9LA 1J2VA 3CJ0A 2EFQA 4RBTA 5HK4A 5EUHA 3ISNC 4LF9F 5T41A 1TK8A 1RAAB 2VG6A 4DQPA 3M32B 1IN0A 2CJKA 5I42A 6AT1B 2OH2A 5KT5A 5LSRA 4HI2A 3W5XA 1WEYA 5KT6A 1HI8A 1J5EJ 1VQOS 4CLZA 2ZNZA 1QUVA 1KHWA 5CZXA 1W2BR 1JLQB 2CPFA 1HNWJ 3VVTA 1IM6A 2ZM6F 4P10A 4Y2IA 2Y1JA 3CCVS 1DTQB 2AJ1A 2DB1A 3CSKA 2W7PA 1A9NB 4JI0F 2YQ1A 2P2CB 3C2PA 4U67Q 2LU2A 3A3OB 4GVBA 5DG9A 4JI1F 1UKUA 4DFMA 4DV1F 2GIQA 4WXWA 1OWXA 4WP9A 3FEXB 4CLUA 2DO0A 1AA1B 2ZJRQ 2FVQA 2C2MB 4ZPTR 3UCUP 2MMYA 3DLHA 3RYLA 3DLKB 3TJ8A 3FBBA 3WIUA 4NRTA 1RAGB 1JB0C 3JQKA 4RUAA 1JNZB 3CMAS 1WC0A 2XI3A 4LJMA 4H4OA 4I1TA 3HO1A 4OIXA 2X1AA 2FVPA 1RT1B 3OW2R 2HK2A 4ILMA 3R7NB 3FRYA 4RW8B 4P75A 5F8NA 3R6LB 4Q0BA 2LCWA 3NL0A 1SIZA 1S9EA 1SH2A 1N32F 1UWBB 4U9RA 1U24A 1EJ7L 2XMUA 3NGUA 1E6YA 4WWSA 4XDDA 3NMAA 2OLWA 2C2OB 1C1BB 4C0HA 4QU7A 1IKVB 3HMJG 3JSRA 2MLZA 4K0KJ 2YKMB 2DJWA 1NH7A 5EX0A 2G0CA 5HATA 1LWCB 3TAMB 4Y2AA 2GO9A 4NEZA 2RDDA 2BMBA 3K8WA 2OMLA 1YIJS 4PWDA 3N6LA 3M9NB 4PCQA 2J0SD 5A2QU 1U2FA 2E5GA 1K0TA 1X4AA 3IG1B 5A2QY 5J2QB 2WW4A 3EXCX 1AUSL 2CNOB 4W92B 2ACMA 2DNRA 4E2FB 1H98A 4O3OA 3HX9A 4LFCJ 2FVCA 2XCPA 3B4MA 4QIGA 2Z2YB 1FX4A 4Z7YA 4HLBA 4JI4J 1RU2A 1SV5B 2MY7A 2MKKA 5HQLA 2FUG9 4QPXA 1NK4A 1X9WA 2FJXA 1TKTB 2ASJA 2ILYA 4TQSA 4PEOA 5K8OA 1TTHB 4KIAA 2YY3A 2I5JA 1UJ4A 2I8EA 4G1QA 1FWKA 1G7CB 4BBYA 2ZE2A 4LR9A 1V5IB 2XY6A 2ZH5A 2QT7A 3ZTRA 3DM2A 1VHIA 4ZOSA 1YSJA 3I32A 4DUZJ 5JUMA 4DLEA 5F8LA 3HHDA 1TP7A 3BBFA 1SVDA 1DFDA 2HNYB 4WBFA 2Z57B 1UCNA 1S1XB 4DV7J 2VFUA 2JVOA 1XMQJ 2L08A 1MU2A 1JLAB 3M8PB 2VA2A 4ZVRB 4R8UA 1SKRA 1X5SA 2DCLA 5CD4H 3FK4A 2R8KA 1RT7A 2AZ3A 3WX8A 4C2MA 1Q81T 2KG0A 3H40A 3HKWA 3RJMB 1FT8A 2CG4A 2Y1IA 2YNGB 4ZHRA 3C6UA 3IAM9 2R7UA 4TLQA 3EPGA 3QGPA 4DR7J 3UI3A 1GH8A 2IM1A 4CLKA 2ZH2A 4CP5A 4FYWB 4UOGA 4C8OA 3CGIA 3EGVA 2MQ8A 3T19A 4W98A 1VRUA 1WJ9A 4DR2F 1U4BA 4NMXA 3QFWA 4I2QA 3H2LA 4GVLA 4DPXA 3W2WA 2ZZMA 3DHWC 1B0TA 1HWUA 1Y3JA 1FJCA 3ZFVA 3BGOP 1VBXA 1HW9A 4Q44A 1G6BA 2CQIA 3HHLB 3MM5B 4RW7B 4ILRA 3CJTA 2MQOA 2J0QD 3JAMU 2O66A 1VBYA 1QD1A 4BS2A 1VFJA 4HTJA 3JAMY 2GNKA 3MHYA 3DI6A 4HDHA 3DOLA 2PDAA 2VBZA 2XSJB 3DRRB 4DSIA 3ZTSA 2FHKA 3MUMP 4DX6A 1SUQA 2B4OA 1VQMS 1N88A 1NK9A 1ZBTA 5J1EB 5C2GA 3NOGA 4YR3A 4X4TA 1U1NA 3AQOA 1DY3A 3J7YU 4DFKA 1BQNA 2N82B 3HHNB 3LP2A 2FB0A 5IM0A 3MPUB 1W2IA 2M7SA 5EN1A 1Y5LB 4IG3B 3W61A 1FO1A 4N5SA 4OX6A 1FKPB 4FNIA 2VQFF 1LOUA 1SL2A 5F0WA 1JXEA 4WKYA 1CVJA 2FJBB 3P4UB 3UD5A 2XMKA 4F4AA 2FJDB 2XULA 2QC3A 2QLFB 3L4BC 2VODA 2ZWOA 1SQGA 5KOWA 1QSLA 1F9EB 1Y7PA 3VAFA 3CTRA 2V4JB 3ZNUA 2J9EA 3MEDB 3EVOA 2C42A 1NK5A 3R6GB 2C2ZB 4IOAQ 2NSCA 1WOOA 3HULA 4DQRA 4LF4F 2B0GA 4C3KA 2JRSA 2FGOA 4BWMA 3H2VE 5L1KA 4NCGA 4HH0A 1UEKA 1RWVB 2HRTA 1ZPWX 4LSNA 4YR2A 3EUNA 2ZWPA 3R2DJ 3I56S 1RLCL 2M70A 1GMVA 4RNNA 4OYXA 2E1RA 1NBEB 3Q8RB 2UXDJ 2Z8QA 5LXYA 4O4RA 2HVIA 5IC6B 4JV1A 3C6TA 3KUEA 1WSRA 1ACMB 5DDPC 4CLFA 3CJKA 1RXOB 1CBKA 3GFZA 2CFXA 1TV6B 1M90T 3TEGA 5A0YA 4Z7CA 2KHCA 3HSDA 3FKBA 4B3TJ 4IR9A 3NCQA 4LRCA 1YRUA 2FIUA 2RHQB 1PGZA 2P5VA 2HBRB 2DH9A 3TVKA 3R1HA 2R7QA 2D9OA 3L7OA 4URSA 4ZJOA 3E01A 1NDLA 2YTCA 3A12A 4X4QA 2WW8A 2BW2A 3R97A 2EC0A 4USWA 1RWPB 2BM1A 3NXZA 2BJ8A 3IWNC 4B3OB 3LTOA 5E3RA 1JLBA 2XNQA 3CD0A 3P49B 3RU0A 3IBCB 2IMWP 1FRIA 2R42A 3QAUA 4YQWA 2OPRB 1QSYA 3HZGA 3KTQA 2BE2B 3GIMA 3M4XA 4RNFA 2XI2A 2BV3A 3ENAA 3MCOA 1VYAA 3EGZA 1N5VA 3I6PA 4K7QA 4DV1J 2JH3A 1TKZB 3GPAA 4NWBA 4QU6A 4DL4A 5F9NA 3BM7A 2WOMA 1FE4A 1CJVA 4F04B 2AX1A 2NYIA 4OZ2A 4DU8A 3E8OA 4DX7A 1H72C 4DU7A 2LDYA 2WB1D 3JSMA 1RI7A 3BBBA 1P8GA 1TL3B 3SQGB 2XYHB 4KH0B 3SMZA 3MECB 4USIA 3ZZOA 4B9LA 3D0GE 1KOHA 1UAWA 1LK5A 4DG1B 1HMVB 5IWAF 2DGUA 1TAUA 2BKPA 4K4ZA 1U1KA 2ZKTA 1BE4A 1N32J 1U7LA 2DR9A 1YTYA 2BRLA 1LNQA 1S6UA 1S9GB 5ETNA 2V5HG 3CDBA 3IBFB 1H2VZ 3HHEA 4NXMF 2AEMA 5AXNA 1Q78A 2WB4A 2RVJA 3RBDA 3DGVA 4TXSA 5DS7A 4U6PA 5IFMA 5D6GA 4DPOA 2J8SA 4N47A 4DBQA 1KR4A 2LLZA 2DNNA 5KFVA 2FJEB 3C14A 2FHJA 4OJ1A 2AIRB 9ATCB 2V68A 2KHDA 2YX4A 4JBCA 1F5CA 1JIHA 3H7HB 4HACB 3G86A 3GV5B 2G2OA 2HPUA 4DXLA 3W65A 3W3SA 1U8WA 5FJ4A 1NK6A 4RR5A 2LDIA 4UQTA 1UP1A 2HHHF 2K8GA 2JLGA 2DNPA 2DIVA 3Q23A 2RF2A 3BGFA 4A8WA 2XLKA 3FMBA 1FJ7A 1G4CA 2F9JA 4IO1A 2V2ZA 1K47A 5L1IA 5D0RA 1S6QB 1HNIB 2QLJB 4YEAA 1D09B 4RU2A 3OL7A 4ZIWA 2M8HA 4DN0A 4DCOB 1HNVB 4XK8C 5GAGU 2GIFA 4R25A 2UXCF 3NOCA 2ZJPQ 2GV1A 3S01A 2F4VF 3FCWA 1CJKB 4PPDA 1XMOF 1T95A 2LXIA 3T1AA 1NUEA 3FSXA 2CVIA 1RTDA 3RR7A 3GP9A 2DHHA 4NASA 3NS7B 4O3NA 2QL7B 2V67A 1N6QA 5K8NA 3R5JB 1FDDA 2NXJA 5T14A 4Q8FA 3CJ5A 4RUHA 4DR1F 2YKNB 1PSDA 5KAKA 2HRYA 4XO0A 1UA0A 1S7HA 2JEGA 3KLGB 2PI5A 1S1WB 1DAXA 2E7VA 1QJHA 1UVMA 3CCLS 2F63A 3OPKA 4DV0F 2RD5C 3LH2S 1JLEB 4FF2A 3NGRA 4QCLA 1HBUB 3CCWA 1JKHB 5F8HA 1VOMA 1X8DA 3BQ0A 1FTRA 2J7KA 4A48A 3DLEA 4DR2J 1QAYA 4HTIA 3KJVB 4R5PA 1O6XA 1KTVA 2YX7A 2R7SA 4PG4A 4WE1A 5E3AA 3D1OA 2BKOA 2DNYA 2HFZA 2V69A 1KQFB 5DQHA 3IR6B 4K2XA 4LRDA 1CPZA 3RGIA 1S0OA 4HI1A 3PO5A 2H1YA 1AUDA 1X4GA 3D6MB 4V1Ak 2XO7A 3L9ZA 4YY3J 1XNQF 4WP8A 3LGMA 3KLHA 4P74A 4ITSA 4WFBQ 1HW8A 4F4WA 2IRXA 2EEYA 2AYEA 2PSZA 1Q5VA 3NAIA 3F44A 1M5KC 4WYWA 1IBKF 3N9UC 1YITS 1RAJA 5LM7E 1UJ5A 4CO4A 4B9NA 2BANB 4I0WA 4NCBA 2RT3A 1VQPS 4ZJQA 3TYTA 1HKAA 4B9SA 2YWWA 3AOAA 5HQ8A 2RQCA 3OFFA 1R6YA 3EXYA 3IM9A 4J9LA 1B7FA 5B09A 2O1PA 3RTVA 3M30A 3SEOA 2VQFJ 2PD1A 4B9TA 4X65F 3ZZZA 3C3LA 2PEHA 3DOKA 1MN9A 4LREA 5CYQB 1Z1ZA 1FWLA 3DLLQ 4TYBA 1WHXA 1ZYQA 3OXGA 1CULA 2BX6A 1QDUB 1LWFA 5L38A 4C8KA 3DLGA 4USVA 2DXDA 4LF4J 2JX2A 4QR0A 1X5PA 2LQBA 3DGPB 2MXYA 1TVRB 2K1RB 4ED0A 2PEBA 3Q2TC 3QQCD 1GXUA 4IRKA 3PHEA 1AYEA 1S1VA 2QYCA 2YWKA 3IBWA 4IG0B 3UN3A 3I87A 3PACA 3N28A 3IO1A 4X62J 2GJ2A 1N36F 3GMGA 3N5BA 3D5MA 2CKWA 4O3QA 4Y2KA 3DXBA 5AXLA 2HIQA 1VJQA 2AW0A 3H42A 4ZVTB 2OPQA 1PKUA 1NJIT 2HVZA 3OL9A 5KFDA 2C3OA 3UO0A 2J9DA 5H9FK 4L75A 1H7XA 1R0CB 2XZDB 2OEJA 5D0EA 4C11B 1R8PA 2J9CA 3MMBB 2N3LA 3BB5A 1B3TA 1LW0B 4CTAB 2RS8A 3NMRA 4NE9C 3MUVP 3M32A 4EUVA 5HSPA 5A6WA 3M2RB 4IFYB 5HMXA 2HLTA 2LEAA 2AWZA 2BZ2A 3CT9A 3BV8A 5E2QA 2KN4A 1MMNA 3OT9A 4EYHB 4FXVA 3DDKA 3CCMS 1JLQA 4C8NA 3GJSB 3NWGA 1RZMA 3LWLA 2GS8A 1PBAA 3PNIA 1VQYA 4TU9A 1DTQA 3DCAA 4C8YA 1GXTA 3ADAC 3VV2B 5KFYA 1CEZA 3UDVA 2OFGX 1KWMA 2WSFC 1HBNB 5I3PA 4J9MA 2W7OA 2ZVIA 4C48A 3UFCX 3CD7A 4YDDB 1RE1B 4JI7F 4M8LA 3QRQA 5FD1A 2D3O1 2OSQA 1MMLA 1MWQA 3DLKA 4X4VA 3SV4A 4TLRA 3CF5Q 2CWKA 1YBUA 1FFSB 4DPTA 3P8BB 3CPWR 5AE1A 1FEEA 2KYZA 2PN6A 1LQ9A 1RT1A 2BJ1A 4BLGA 3VAHA 1V5VA 3UW1A 2XO6A 4RW8A 1IUJA 3T1YF 1Y10A 5CYJA 4QIEA 3ENWA 3GG1A 2IJFA 5HJYA 1XBWA 1UWBA 4ZN3A 1EZZB 1WHWA 3PHTA 3LAMA 1C1BA 4K50A 1IKVA 3ZNJ1 4PG7A 4ETXA 2YKMA 4GC6A 2MB0B 1HNXF 4Q7AA 1LWCA 3IR7B 5L8RC 4AL7A 3P5TL 4OV6A 1HLWA 1RAHB 1HWLA 3LW5C 3M9MB 3MF5A 4U7UK 4EYIB 3LUYA 5BR8J 4NPOA 3CB4A 3MPDA 4DR4F 5ETOA 5DG8A 1U0SA 5KG6A 1P27B 3TNVA 1IKYB 4J37A 3KOAA 2I2YA 1KLNA 5J2QA 3P5BP 3TJ9A 4C6AA 5GMDA 4G1PA 1Y4ZB 3T6BA 2DNKA 1FHTA 3W62A 3R5CA 4MK9A 1N54B 2NCKL 4R0JA 4F4XA 5AJ3F 2JZ5A 1T9XA 1M1HA 4X84A 2JFDA 2VPWB 7AT1B 3RBZA 2L48A 5AE3A 2EBGA 1RT3A 1F5BA 2GX8A 4ICLB 1SV5A 1XEZA 4TKTA 2CQDA 2OPPB 4X64J 2BE7D 1TKTA 4PAAA 3MCMA 3K59A 3OVAA 4RWWA 3HVRA 3EVWA 5IV4A 3J80Y 1HQUB 2MYFA 4Q2LA 4PWUA 1IBCB 1X4FA 2C3PA 2Y1LB 4QWDA 2NPFA 3RRGA 3F73A 2UXCJ 4ECWA 3RG6A 4OHXA 5IV3A 2WAQD 4EI2A 4LFBJ 3MM6B 2DNLA 3AA8A 3QNWB 4KPYA 4ECSA 2DK2A 3MUTP 4P2MA 3CDUA 4BWJA 2HNYA 1RT5B 3CO0P 2NXCA 2MKJA 2B6AA 1WG4A 1WC6A 4CYUB 1WEZA 1GK8A 2VG7B 3M8PA 5F8GA 4QWAA 2EFVA 1YLXA 1NSAA 4KE5A 1WOPA 4OI0A 2E5JA 4RWXA 3QSIA 2YNGA 4GRSA 2BOPA 2OEMA 4F0KA 1SKUB 1U6BA 4UZCA 4A8SA 2Y3YA 3BF4A 3G6XA 2ZDOA 3EWGA 2A2CA 4B3MF 2R7WA 1YQHA 2ERRA 3CJRA 4PXDA 4TY9A 5H9EJ 2YVSA 2A18A 1S97A 2GQQA 1R89A 2RUGA 2DR5A 5B0GA 1GMWD 5DDQC 1UZHA 1GT8A 3I0SB 4NA2A 1LXNA 2XS5A 5E33A 4A8FA 1JWWA 1NHKL 5K8MA 2RE1A 3OFHA 3HHLA 3MM5A 1Q79A 3CMES 2IFXA 2XEXA 4RW7A 1XK8A 3W5YA 5B7WA 3T41A 3KJQB 1SC6A 1HWIA 2XMTA 2DRDA 3TRGA 1YX2A 2JJ4D 4HEA9 4Q2MA 2XSJA 3DRRA 4C4WA 3J7ZT 3O44A 5B0FA 2VPYB 3QBCA 3Q22A 3SQOP 2QJ3A 2P9GA 1U1RA 1Y5IB 4ED5A 2HWHA 3W9IA 3G9CA 4CT9A 5GADI 2A1BA 4NLYA 1FA0A 1IBKJ 3RAMA 3V4IB 2G2YA 3RRHA 2VQEF 3UNGC 4GC7A 2AYBA 5A76A 5J1EA 5DJBA 2MJNA 2EG1A 5JMNA 3JTOA 2A3JA 3PTWA 2E9ZA 3H90A 1LV5A 1K73T 2DNHA 4AQYF 3PY8A 2MGZB 4IG3A 3HSGA 5LMUF 1FKPA 1VC6A 2BW7A 3SFGA 4X65J 4DS5A 3DKDA 2B5JB 1SJ1A 3DU6A 4ZCLA 3ILIA 1LFPA 1D3WA 2HEKA 2YPZA 5IT9U 2LXFA 1SBRA 3IFEA 4NYZA 2KM8C 3I82A 1OY6A 1NKCA 2V4JA 2XCAA 1VC5A 3MEDA 3ZXWA 3QAEA 1BQMB 1U02A 1RAFB 1D0EA 1U1MA 3CD6S 1VQ9S 2GA7A 4P2SA 5C7PA 4NLTA 4PZVA 5GMEA 4DN9A 2WVCA 2W2PP 1Q7YT 1I94F 2XB2D 1TL7B 1KC8T 3BR8A 3O3LA 2R7OA 3QRPA 3S8SA 4HT7A 4EGLA 3MD1A 3B8HA 2F3JA 3ZZUA 3CCSS 1RT2B 4KB7A 2F9DA 2QFJA 2QGFB 2FJAB 1YGYA 4QZVB 2U2FA 3TA0A 1BC6A 1TV6A 3DFEA 4AUKA 1VS3A 1EKSA 3IWLA 1SJFA 1S9FA 1TL1A 1LW2B 1WC4A 4WPAA 2QLBB 4F4YA 5HQMA 2YXLA 3MMJA 2D9PA 4CH7A 2VPZB 4DR6F 1YVFA 4LF8F 4CI0B 5J1PA 2FY8A 5A8WB 4TU7A 1JLFB 2QZ8A 3SYZA 3M6XA 2ATCB 4PPZA 2EK6A 3A8IA 4Q5VA 2AD9A 2ZH1A 5GAHU 2NPIA 3TAQA 4OI6A 1T9WA 3BH6B 3KDNA 3MMAB 2L41A 4BHQA 1TU0B 1OSDA 1ZM4A 3CIZA 4MYUA 4B3OA 4ANCA 3OLAA 1TKDA 1F9FA 5KFXA 4JI2J 2FPHX 1SKWA 3FRZA 3IRXA 2RB7A 5KG4A 1WC3A 3AT1B 4JI5F 2OPRA 2OO4A 3AXKA 1HL6A 5HVFA 4FS2A 2EFPA 2BE2A 2FLOA 1FF2A 5LT5A 2RQMA 1T03A 5HP1B 1CJUB 4DPWA 1L3VA 4MH8A 4LBPA 2H4YB 5D4OA 3BDPA 3D1HA 2OKQA 1CSJA 4A47A 1TKZA 1GXLA 3MTKA 4J9SA 3M1VB 2B7CB 4Y2CA 3A4TA 4PWWA 1ZTTA 1ICEB 2G1DA 1SJ3P 1X9MA 4GMKA 3FVYA 3W64A 2V2KA 2EFOA 3DOMB 3D68A 2QA2A 1RGVA 4CRJA 2VFRA 2I9SA 1DZ5A 5HJXA 1U1PA 3TARA 1NXIA 1SC1B 5BYQA 2M0GB 1TL3A 3SQGA 5E3CA 3PIPQ 3FEYB 5M2UA 1VQNS 3MECA 3VWSA 4JV0A 3ZO7A 1HBMB 4HL9A 4K5RA 5K8PA 4PXBA 4DG1A 1HMVA 1IWAA 1RP5A 4TQRA 2DGXA 4N56A 1MROB 2WVBA 5HBMB 2AX0A 2QMWA 3I9V9 4Y65A 2LEPA 4OI3A 3SCLE 2UP1A 3KXDA 2HHTA 2LP4A 2XHWA 1TKXB 1REVB 3ENVA 5C24A 3QIDA 1GTHA 4I56A 2XLJA 2RAQA 4C0OC 2J7UA 3MOJB 2B8QA 2J76E 2KO1A 2NUHA 3WC0A 3KFWX 1ROFA 4H4MB 2HHWA 2UV8A 2C2KB 4JV5F 4DR4J 5CD4A 1RT4B 4ANEA 2IC3A 1CJTB 1LFWA 5FDLA 4EBDA 2DXEA 3CCUS 5RUBA 1HYSB 3N4WA 1Z2ZA 4HACA 3D66A 3RB4A 2EK1A 4ZA1A 3JYTA 4ED8A 4YHHJ 1M5VC 2H3EB 1DBDA 4DFPA 3EX7B 1ELOA 2QL9B 2I1RA 2FHJD 1R43A 5AJ3J 4KHPF 3UD4P 4LF7J 4ZP9A 3VF0B 2B51A 4U96A 3QZ7A 3OR1B 2HLUA 1KDNA 4UUWA 4DEZA 2RMLA 3GFYA 3L7UA 4PYDA 3QWPA 4X66J 1URRA 2JWNA 4ZVSB 1NJXA 1XNRF 1T9UA 3SDEB 2YNIB 1FRHA 2IDEA 1BGXT 4PG6A 2MHNA 5ITHA 1S6QA 2MKHA 4F4KA 1HNIA 1YJRA 3PW2A 2LA6A 5FLXU 5BJRA 5F9LA 5IT0A 3DLBA 1HNVA 5FLXY 3T1HF 4DSLA 1QVFR 1FJGF 3MGJA 3BGLA 1U8SA 1FXLA 1IWGA 2DGQA 2YX1A 2PGCA 3QZ8A 1UVLA 3BSAA 2HFSA 4CLWA 1X4EA 1A7GE 3DHXA 2LECA 2OGUA 4OHVA 5HMWA 3PRBA 3UCGA 2IM3A 1FDBA 2UUTA 1Q5YA 2HSEB 3DU5A 5D3GB 3FFIB 4HR2A 3PX4A 3KLGA 2BJ7A 3CJ8A 2X1BA 1S57A 1JLEA 1HBUA 3C15B 2OTJS 2DHGA 4B3MJ 2Q66A 5ETRA 4I4BA 1JKHA 4NLOA 1O51A 2G2ZA 3S6EA 4ZIVA 2ZBIA 4F3QA 2B43A 2CYYA 2AJ0A 5EX3A 1S5ZA 1NZAA 2RJZA 1D8YA 3KJVA 1L5UA 2CQHA 3QJLA 3I4HX 3X1LB 3K0JA 2XMMA 2V9WA 1UVNA 3HK2A 2NUUG 2CQPA 2X1FA 2HVHA 2D3OR 4DZ6A 1ZM3A 2H51B 2EW9A 2GQ2A 2HK3A 3NGKA 3D1QA 4WTOB 2HS3A 2J7WA 4DZDA 3W1YC 2AQ4A 2PI4A 1HQ2A 2MEWA 2KH9A 2CAJA 3MWBA 1DTTB 3W2VB 4DX8H 1MWZA 4X4UA 3KJFB 3NS5A 3G8SA 1QLNA 5I4MA 5AXKA 2HBYB 4DV4F 3U02A 3P45B 3R3TA 1UVIA 2BABA 2LKZA 4IRDA 3BO4A 4WFZA 1XN9A 4KFBB 1FKAF 1D9FA 2VQEJ 1KONA 4KGXB 2BANA 4KJIA 5THWA 3PFOA 5K14B 2A6MA 4ANDA 1NPRA 1D8ZA 1Q82T 1RKIA 4JI6J 2HG4A 1HBOB 1DQ8A 5GAEI 1L3KA 2OEKA 1Y5NB 1RTIB 4N7TA 5LMNF 4AQYJ 4CO3A 1REGX 5LMUJ 5HVGA 3V5RA 9RUBA 3Q2SC 2PO4A 3K7RA 3LALA 4C7QA 2D1CA 4OX9J 3R27A 4K4SA 3BH7B 2VF3A 1A6LA 3ELHA 3BSCA 4FS1A 2FTRA 1K8AT 1R31A 1T02A 1H3DA 4OQJA 4TY8B 2CJQA 4X2BA 4XAKA 2CIMA 4WK1A 3H5UA 1T9YA 2W25A 3DRPA 3TJAA 1RHRB 2YWFA 2KXHA 2BRKA 2ZOGA 2DNZA 2PIIA 3KUGA 2NXEA 3V6DA 1N48A 1RCOB 1FKOB 2GJFA 3DGPA 1QM9A 2K1RA 1HIYA 5HI7A 4WFXA 1KVKA 1N8RT 1RAEB 2K7JA 3EYZA 1IR2A 2QLWA 3JSYA 2HS4A 1P6TA 4CQ1A 2MSSA 2MPUA 1T3NA 1MN7A 1UFLA 1YJVA 4L72B 3MEEB 3TEHB 2AT1B 4RBUA 4IG0A 4FYYB 2VG5B 1CQNA 3C8YA 2WVDA 8AT1B 4DQQA 2JL9A 2XY7A 4EZ6A 3S7RA 4FNHA 2Z0GA 1D1UA 3CDAA 4CM2A 3GJQB 3WHIA 3G71S 3BREA 4CWBA 2CVEA 1XR7A 1RABB 1KRPA 1AT1B 2W8KA 1N34J 4CO0A 1URNA 3A8JA 3MURP 3KK3B 3ILJA 3W66A 2R7VA 3PRDA 4GO5X 4LF1A 4C11A 1TL5A 2CPEA 2MKIA 3GYXB 4DR6J 3A1YG 3MMBA 1I6JA 2MTLA 4LF8J 1LW0A 1RHMB 2UVWA 3J7AN 3T5KA 3PCOB 4CTAA 4MIWA 4DV6F 4DFJA 3NCRA 5B0BA 3M8YA 2R2UA 1NMEB 3CCES 2FJVA 3HFVA 2DITA 4IFYA 4DUYF 1VK8A 2DYAA 2B4UA 2QG9B 4KKOB 4C3LA 5CCMA 2VH7A 3GONA 1QVGR 4ID8A 3VCDA 3HPOA 3NP5A 4OYZA 1GQEA 1CC7A 3T3FA 4MK7A 2RUSA 3WIVA 5U47A 3AY0A 6FDRA 1HI0P 3JB9k 1EIYB 1UJ6A 1EKRA 4CO2A 1HR0F 2GIRA 3FGVA 5CCLA 1WG1A 4RW4B 3M05A 4CLLA 4U8VA 3OTDA 2DRBA 5H1SV 5ETLA 2PFFB 2R3VA 2UVRA 1HBNA 1FNXH 2N7YA 1UPMB 3ILOA 4DCJB 3WBZA 3CNQP 3H8YA 1JJHA 4IDKB 3MM8B 4I6YA 2IMOA 4QWCA 4Q0BB 1OO0B 2CQCA 4NLXA 2YKOA 2MZSA 3UE2A 3U1LA 5DM7Q 5A8RB 4K4XA 3RBXA 3BR9A 3CC7S 1VIXA 4ES3A 2K3IA 3VR1A 4LFAF 1Q0NA 1KOOA 2JVRA 3QATA 3Q8QB 3HP6A 2LVWA 3AB2B 3TI0A 1ZA1B 1ZM2A 1C0UB 1ZS6A 3CW2C 1S12A 1WKKA 2V8GA 3LP1B 4FYDA 1VDHA 2ZVSA 3MR5A 1VLOA 1RA6A 5ETVA 3T6JA 2MDAA 2AMCB 2DNOA 4P9SA 1FX2A 5HAOA 3H4DA 1KP6A 1CQMA 4MKBA 2VIHA 5DM6Q 1X4HA 3KLEB 4QJVA 1NHVA 2IM2A 3RB3A 3GIRA 4QW8A 5D15A 1WWHA 2D69A 2KRBA 3R7SB 4K2JA 3J81U 4QW9A 4JV5J 2V8PA 4P7TA 5E41A 4UY8T 1HWKA 3J81Y 2Q1LA 4OZ0A 3MDFA 2ZD1A 2UUBJ 3G6YA 3VZIA 1S10A 1IKYA 5HROB 2RH3A 2BQ3A 4KC5A 3AD7C 3OUYB 3MCNA 2HQCA 3NBPB 4LIRA 4LIWA 5HL7Q 4WKRA 4D3HA 2VFTA 4PG5A 3HFZB 1IKWB 2JOQA 1PIEA 2YKPA 2ZC4A 4KHPJ 4H4KA 1V3SA 2DISA 4BCAA 1RT6B 1OS5A 3ENQA 4C3MA 4FPRA 4EBEA 1X5TA 4B02A 5IXUA 5DZ6A 3RAXA 4J9PA 1S6PB 1RWUA 2HVDA 2OPPA 4OZ1A 2ZBQA 4M5JA 3Q86A 2BACA 2ZBRA 4E98A 5ETKA 4O3RA 1H2UX 2NZCA 3JTPA 5KFKA 1AFJA 2ROGA 4RNHA 1HQUA 1EHWA 3MZIA 1UA1A 8ATCB 3HT3A 1XR6A 3I0RB 5JVHQ 1KTQA 4YOEA 1PC4A 1FJGJ 1EP4B 3MD3A 4PRFA 4R8UB 3MFHA 1SCJB 1O0PA 3MM6A 3SIPB 5DDOC 3PKMA 3UN2A 3CJQA 3QPIA 5DETA 1HFEL 3TVZA 1R0AB 1UEUA 1RT5A 3D0IE 1NNDA 3NNAA 2VG7A 4WJBA 3CVKA 3QT5A 2R8GA 3SXLA 1VRUB 2H5EA 4HH1A 3BGRB 4YS2A 3W2WB 3IMQJ 1H38A 4C9DA 1FFGB 2EPIA 1N5SA 1QAXA 2QIFA 1J27A 4HHUA 1IQTA 4B08A 5I3UB 4KGMA 2LQ5A 4EK2A 1VQ8S 2EWHA 4I69A 1TAQA 2DNGA 4ZPDA 2UZAA 3C66A 2EKYA 4UF4A 1SC3B 3SZ2A 2DNQA 4BC9A 4EO6A 5MAOA 4IOCQ 2EG2A 3KDOA 3HJVA 2VDHA 3CO9A 2GVDA 2ADBA 1VQ7S 2BJDA 3I0SA 1HNZF 2WK4A 2WBRA 4DV5F 3R2CJ 1XJWB 4ZCIA 2NR0A 2V6AA 4TVAB 3K5PA 3KHGA 4DCPB 4LRBA 2AV5A 3HZEA 1RUSA 5GAHI 2GMLA 5G0RA 3R9LA 4F3MA 4ED2A 2C2EA 2G0IA 2BQUA 3A8EA 3A3NB 4ZLPA 3LOUA 5KFSA 1TK0A 2BA9A 3HHLD 1IVZA 5DLFA 4RNMA 4PG8A 4NXNJ 4KGZB 3GWCA 3TZYA 4PABA 4OYIA 3V4IA 1I51B 2PA8D 3U27A 1FDNA 2WONB 2DPJA 1NLKL 1EQ0A 3M7VA 1NDPA 2C2DA 3H2UB 4KV8B 1IXKA 1R8BA 3JSBA 3M6VA 1KFSA 3D28A 2M3DA 5LMNJ 3GTYX 3I9ZA 3HI9A 3OTEA 2JFKA 1HPZB 2MGZA 1TFWA 4DSEA 1RKJA 1RJJA 4KAIA 4GKJF 2Y0SD 1RLDA 1HHSA 2BJ9A 3GCXP 2B5JA 3PRVA 1GMWA 3BO2A 2UUCF 1GNKA 5E3QA 3QGGA 2LFVA 5L9NA 2PC6A 2Y8WA 3KLIB 2MZJA 4OZNA 3OHAA 3MXHP 2V8HA 3EVMA 4KYZA 4QIVA 1BQMA 2IDLA 4QYZK 2MZTA 2FDNA 1VBKA 2F65A 1PAUB 3CMQA 4RJVA 1M5SA 4M1KA 5D0GA 1NPKA 4KBIA 1T05B 1B99A 2VA3A 4NCAA 2DO4A 2I0XA 4ELVA 5MLCV 2I38A 4PQUB 5A0YB 1TL7A 1NZ8A 4CZCA 4F4ZA 5KT4A 5T7LA 5C2CA 1RT2A 3NG8A 2NXNA 4M5NA 4OX8A 4DUTA 2IAJA 1OY8A 4MKYA 4M5LA 4UW2A 4FKYA 1UFKA 2CA9A 1TMJA 3A13A 2CPZA 2R7TA 1OJ4A 4OHWA 4JI3F 2D3UA 3M6UA 1LW2A 4ZVFA 1SL1A 2HFUA 3FDSA 1N4LA 2OD6A 4WP3A 4ECUA 1DQ9A 2YNHB 5A8WA 1JLFA 3HHKA 2PFDA 2RHSB 3F0NA 3MEGB 4ZVOB 3P6YC 1QTMA 4A8YA 3PXGa 5HLFB 2ZBPA 2MSTA 4WU2A 1T8EA 3H20A 1YJ9S 2UU9J 3PYDA 2V4QA 3QIPB 3MMAA 2IRYA 4L3KA 4DHVA 3TAPA 2XY5A 1RBAA 4NLPA 2R8IA 4ETZA 1IR1A 1S1TB 2HQFA 1VISA 4MAKA 4ZVEA 2Z2LA 3OXLA 1VBZA 1T7PA 1IBLJ 2QYGA 3BSOA 1YKWA 1RACB 4I64A 5HP1A 1CJUA 1KVJA 5FIIA 2AZ1A 4NLVA 4ECQA 3ZTPA 4M63A 2VPXB 2CZ4A 4WFAQ 3QT7A 2H54B 4N8OA 3M1VA 3DC2A 3K8VA 1BUXA 3GYNA 2OHDA 1L3SA 3D54A 2KYXA 1VQ5S 2GMJA 3N5FA 2P9EA 2MLYA 3BN4A 1J5OB 3G6VA 2E5IA 2IA0A 2A10A 4CLYA 3DOMA 1KN6A 4B3SF 2EFGA 1PYTA 2E1AA 2E44A 4NMLA 3QSYB 4DJBA 3DYAB 3AD9C 3K5LA 3R5DA 2FD2A 3HJFA 3QJPA 1HBMA 4RUBA 3C16B 1B70B 4FBUA 2B9YA 3B78A 2G1HA 4LT6A 5DDRC 3G4SS 1MROA 1U1OA 2DKOB 4ZJLA 4USJC 5HBMA 3A8KA 3PG9A 5CYMB 1ZAXA 3GSIA 1TKXA 4LF9J 5JXSA 3UDLA 3C14B 2F40A 1RK8A 5C5JA 3BPDA 2ZHBA 1HWJA 3SCIE 3CC4S 2RKIB 4ES1A 3KHLA 4DV2F 1FK9A 2DEJA 1VQ6S 4CLPA 1S99A 3W7BA 2C3UA 2YQ3A 3KG0A 4LFCF 1NSQA 1AXQA 2ZM6J 5GADU 1HYSA 4CNZA 2HS0A 3ITHA 4JI4F 1XR5A 1OYDA 1FRLA 3M2VB 4MYTA 5KFEA 3V2UC 2MJUA 5C25A 1NJZA 5B08A 1NJWA 4ERDA 1N0UA 4JI0J 3OTBA 3KHHA 2KFNA 1NK0A 2MKSA 4Y34A 4X4OA 4JI1J 2W2NP 2XZTB 2C3MA 4ZVQB 3OR1A 2R2RA 2V8VA 5SZTA 4ZLJA 7FD1A 1SL0A 2B4VA 2KM8B 3DDIA 4DUZF 4U7UD 1NKBA 2IPOB 1B64A 2ZZTA 1FXRA 4C8MA 3SDEA 2YNIA 4FXDA 3VGUA 5DG7A 3OL6A 4YB1P 4ZDNA 4Q45A 4DV7F 2B8PA 1G2EA 1KLMB 4DQIA 4F25A 5LXRA 2DD8S 1XMQF 1N6QB 3G87A 1WKLA 4P2FA 3TZZA 2LU1A 3RRKA 4I7FB 1S79A 1YJUA 4ECYA 4I6AA 1N5TA 2GW8A 4KPCA 2RQ4A 4EO8A 1S0VA 1S7IA 4BDPA 1YJNS 1E6VA 5BYRA 2CPDA 2CZ9A 2FZKB 2ZH4A 3SSQA 5D3GA 1WG5A 1NDCA 3FFIA 1JLCA 3QWUA 5IQ6A 4OZ5A 1RTJA 4WE1B 2C1EB 3CJSA 1GX5A 4O4GB 4OLOA 2HMIA 3BKTA 3J7Z5 4YR0A 4OX7A 2AJ2A 2XM3A 4U7CA 3LP0A 4IQMA 5I3QA 4ZVHA 3JQMA 2LQ9A 2UUAF 1LWXA 3IP0A 1RWKB 4OZ3A 2BEFA 3PW7A 2KDOA 1TZ0A 4OYBA 1YRXA 2B56A 4DV5J 1KD1T 4LR8A 5DLGA 2WVFA 2ZH8A 1B0VA 1KVIA 1MLAA 2GAHC 3GV7B 1S1UA 2YWGA 5DGBA 4F0MA 4IQXA 5BXIA 1DLOA 2VU5A 3RR8A 4P7VA 2HQ3A 1KBRA 1IR0A 1Y0HA 4KQZA 2UUWA 3HVAA 5J1NA 1DTTA 1SPBP 3W2VA 4QIFA 2B9WA 2X51A 3K2YA 3GIIA 4ED1A 4RLEA 1JXVA 3AB4B 4RO0A 3VGTA 2RQKA 2J8AA 3GE9A 2O3DA 4FF3A 2JEFA 4KFBA 3ETMA 1JJ4A 5F8IA 2EFNA 3BBCA 1BWVA 2VBYA 5K14A 1VJWA 1U6ZA 2RIJA 4A8OA 3GJRB 3RBEA 3MM9A 1CS4B 2HHQA 2CUYA 3AJ2A 1Y11A 3V81B 1AFIA 5LSOA 4A4JA 2VBXA 1CULB 4XPEA 4F26A 4GKJJ 1VHFA 3PYEA 3MPYA 3VGSA 2I6WA 1VMBA 4A8QA 2G0JA 1WUUA 1WDDA 3QYYA 4YP3A 4A46A 4AL6A 3CJ4A 3BJYA 3AOBA 1CLFA 2WVEA 4HHHA 7FDRA 5B0AA 4TY8A 4B9VA 1QUPA 2Y9HA 1S1VB 2HGMA 1U09A 2FY1A 1WI8A 4XPCA 4ZPWR 3ET6A 2Z56B 2GC8A 3K57A 4U95A 3QGIA 1AB8A 4ZPCA 3HD1A 3IGNA 4KTQA 1VQLS 3MEEA 2E1MC 5F3ZA 2VG5A 4OMFG 3SBMA 3LO3A 2VC1A 4L6V3 4OHZA 3KYLA 4ER8A 4ID5A 4L76A 2WTFA 1VCTA 8RUCA 5KOXA 1RWNB 3N6MA 1Q86T 4N77A 2ZDPA 3GQCA 4JI3J 4NLUA 1PYSB 1UTAA 4P52A 2SXLA 1LEOA 3DRSB 2KXNB 4W4MA 2FHMA 3KK3A 1N5YB 3GSDA 3PX0A 3V6KA 4X4PA 2IVMA 2LQ8A 2NSBA 2LEBA 2CQ1A 4M5DB 2CQBA 3TQ1A 2CJBA 4AXJA 1GAOA 4ZP8A 4ZS6A 4WIQA 1AROP 2IJRA 1OPZA 1VLYA 4EWTA 3D2WA 3M2UA 1UW4A 2Z30B 3HKZD 4AYBD 1K1QA 3FBCA 4AD6A 5D0HA 1EQMA 4KKOA 4DSKA 3LF0A 3KMQA 1U0HA 2C2NA 1IQZA 3SSSA 2AYMA 3BKUA 4D3GA 4ZPBA 1C4AA 2FVRA 2OI2A 2V8DA 3CEDA 4FYXB 2IBKA 3THPA 3HLUA 3UVJB 2HGLA 4E8UA 5DQGA 1K9MT 4QPTA 1KNZA 4YUDA 2Y8YA 1V3ZA 2D7SA 3CCRS 1R8CA 3LANA 4A8XA 3TA2A 4RW4A 3UPFA 1PG5B 2GMHA 4WZQA 5KFFA 5LSLA 1UEVA 1WC5A 2ZH6A 2DR8A 2O67A 3EDRB 5F8MA 4F0HA
chains in the Genus database with same CATH topology
4HKQA 1KQGB 4MMOA 4I4BA 1JKHA 1NRKA 3OTOF 2C2RA 4NLOA 2JC0A 4OJGA 4G6VB 4X4QA 1O51A 2HNZB 2WW8A 2BW2A 2EC0A 3S6EA 4W90B 2E1CA 2BM1A 2ZBIA 1DRZA 4F3QA 2B43A 2CYYA 1OPIA 4IDKA 2KU7A 4JI6F 2DPIA 5D78A 2AJ0A 2W8LA 3IWNC 5E3RA 4B3OB 3ETOA 1TUVA 5EX3A 1NZAA 2RJZA 3MM8A 1D8YA 3KJVA 1L5UA 2CQHA 4MKAA 3QJLA 2DHXA 4MTPA 3I4HX 3X1LB 3IRWP 3DLJA 2N3OA 2ROEA 1JLBA 2XNQA 1RTHA 3CD0A 1KEKA 3K0JA 3RU0A 3T5HA 3P49B 5KFIA 2XMMA 2IMWP 1MU2B 2V9WA 1FRIA 2E7WA 4LVOP 1UVNA 2YWEA 3QAUA 4YQWA 3HK2A 1BQXA 2OPRB 5A8RA 2ACYA 2AJQA 1QSYA 3PFEA 2NUUG 2PA3A 3HZGA 3V6HA 4OX9F 1VIOA 1FCAA 2CQPA 1RT7B 2UVUA 3M9OB 2BE2B 3KTQA 3GIMA 2D3OR 1OQ3A 1ZETA 1ZM3A 3M4XA 4RNFA 2XI2A 1UL3A 4WCEQ 2EW9A 2GQ2A 5A8KB 3NGKA 3UDCA 3D1QA 3GFHA 1N0VC 2BV3A 2HS3A 4Y0FA 4DR5F 2J7WA 4ZHRB 1FRXA 3C6UB 2O01C 1QE1A 2HHPA 2G9OA 2AQ4A 3EGZA 1N5VA 3KNAA 1C2PA 2PI4A 1C0UA 5KFBA 3OSPA 2Z2MA 5J2MA 3I6PA 2KH9A 3BN7A 1TR0A 2GHVC 3SCJE 3OFGA 3DDNA 3LP1A 2JH3A 3MWBA 1DTTB 4ECVA 2APOA 3W2VB 4DX8H 1TKZB 1VQ4S 1MWZA 4NWBA 4QU6A 1O5JA 4X4UA 1BD6A 4K4XA 4DL4A 3CDEA 3PW0A 3NS5A 5F9NA 3MR6A 3G8SA 3AHPA 3BM7A 1QLNA 2WOMA 5I4MA 4I2QB 2W9BB 1FE4A 2DTJA 5AXKA 1QY7A 2JLEA 4DV4F 4WXOA 3U02A 4O23A 2AX1A 4OFZA 2BXJA 2NYIA 4KHRA 3R3TA 2NREA 4FVMA 1UVIA 2BABA 3LPYA 1FVQA 2LKZA 1QAIA 3GB0A 3CCQS 3BO4A 4IRDA 2XS7A 3E8OA 1Q8BA 2P6TA 1RDRA 1RA7A 2RSQA 3DN9A 4WFZA 2KXFA 1XN9A 3KLEA 4KFBB 1FKAF 1D9FA 2LDYA 3O1LA 2WB1D 5EWFA 3DMJA 1RI7A 3JSMA 4HYKA 1KONA 4KT0C 2E5HA 1P8GA 3SV3A 1TL3B 3SQGB 2BANA 4FVCA 4KJIA 4RUCA 1HA1A 3PFOA 5K14B 5THWA 4DL3A 5T7LB 3MECB 3SMZA 1D8ZA 4USIA 4Y3CA 4GKKF 3ZZOA 1Q82T 2ZZNA 1RKIA 2BR0A 4B9LA 3X3UA 3D0GE 3MOZA 2HG4A 2D41A 1HBOB 4IFVA 1DQ8A 1KOHA 1UAWA 1YWXA 5KFAA 1LK5A 2ZITA 5GAEI 1L3KA 2QSWA 2MKCA 3PV8A 4K5SA 4CCHA 4DG1B 1HMVB 1Y5NB 2DGUA 5IWAF 1RTIB 2IAJB 5LMNF 1TAUA 2J9DE 3BGUA 1NB7A 4CO3A 4K4ZA 3FQLA 4NOHA 4K4WA 1U1KA 1C1CA 1W25A 1WACA 3V5RA 2ZKTA 3CDWA 3GZ7A 3Q2SC 2PO4A 4K4VA 3K7RA 3DI6B 3LALA 1U25A 1U7LA 3SFUA 5HROA 3DOLB 1RT3B 2DR9A 1YTYA 4C7QA 2D1CA 3WC2A 3R27A 3OUYA 2KZZA 1X0PA 4WU3A 2GHWA 2KJWA 3NBPA 1N34F 2BRLA 4K4SA 1S6UA 1S9GB 1A6LA 2RRBA 4I2PB 1HARA 2V5HG 3CDBA 3BSCA 2ASLA 4FS1A 1H0HB 1H2VZ 4C98A 1SUQB 5G4DA 3HHEA 4V19X 4NXMF 3PW4A 1IKWA 1GTEA 2FTRA 1K8AT 1R31A 1T02A 2QMXA 3IWXA 1FESA 2GO8A 1H3DA 4OQJA 4TY8B 2CJQA 2K2PA 4X2BA 2QSFA 4XAKA 5AXNA 5A6PA 1Q78A 2CIMA 1RT6A 4WK1A 2WB4A 2RVJA 2WHOA 3H5UA 5GAEU 3RBDA 2W25A 1NEEA 4TXSA 3DRPA 1TQLA 5DS7A 4U6PA 2XWXA 4JI8F 2V9KA 2YWFA 2PT0A 5IFMA 2KXHA 2BRKA 2ZOGA 4NZ0A 3O8WA 5D6GA 2DNZA 2R7RA 2PIIA 5J2NA 2QEXS 1S6PA 4DPOA 1FVSA 3V6DA 4N47A 2K3KA 5KFOA 1N48A 2HW3A 4DBQA 1KR4A 1U47A 2LLZA 2DNNA 2ZOMA 3UR3C 2VOOA 1BQNB 1FKOB 3N6NA 3LP2B 5KFVA 2FJEB 5IM0B 3DGPA 1QM9A 2K1RA 2JSXA 5HI7A 4WFXA 1WNEA 3M8SA 4E0DA 2FHJA 1N8RT 4OJ1A 2K7JA 3B4DA 3EYZA 2QLWA 3JSYA 2HS4A 2KHDA 2YX4A 1P6TA 4JBCA 4CQ1A 1F5CA 1JIHA 1N33F 2JC1A 2MSSA 2MPUA 1C0TA 1T3NA 2J6UA 4DS4A 3IXQA 1UFLA 1U49A 1YJVA 4L72B 3MEEB 5DQIA 3G86A 2B6AB 1Y00A 3I0RA 4RBUA 3TUIC 3GV5B 1OQ6A 4IG0A 3G96A 2HPUA 2VG5B 4XIUA 2CQ3A 2UXBF 3W3SA 1CQNA 3C8YA 1V6HA 2COLA 1FE0A 2VC0A 3HDSA 2E9TA 4DQQA 3AQPA 1EP4A 2JL9A 5FJ4A 2XY7A 4EZ6A 2HZCA 3S7RA 4FNHA 1ZZNA 3OJUA 2Z0GA 2M9KA 2PE8A 2W9AA 1NK6A 1D1UA 3K58A 4FBTA 3CDAA 2HHSA 1SJRA 4K59A 5HO4A 1Y3KA 5BYSA 3G71S 2LDIA 5GAGI 3BREA 4UQTA 1UP1A 2HHHF 2GJIA 1R0AA 5GMKa 2K8GA 2CQ2A 2CVEA 2JLGA 5CZVA 1XR7A 4UQGA 2DNPA 1KRPA 2DIVA 3Q23A 4NZ7A 2RF2A 5KFLA 2W8KA 1WI6A 1BY9A 3BGFA 4CO0A 1URNA 1FD8A 3MURP 4A8WA 2XLKA 3KK3B 2F8EX 2R7VA 3KK1B 4OI1A 3PRDA 3FMBA 2W4PA 4GO5X 4NCGB 1FJ7A 4PQAA 1FRJA 5KFRA 2F9JA 3PVXA 4C11A 3H5XA 2CQ4A 1TL5A 2CPEA 4IO1A 4LSNB 3FMWA 2MKIA 1K1SA 2KT5A 3GYXB 1ZTWA 3A1YG 3FCHA 3MMBA 4LMZA 3BGRA 3ISZA 1I6JA 2YKAA 2HQIA 1LW0A 5L1IA 2UVWA 2HWTA 3T5KA 1S6QB 1HNIB 4CTAA 4YEAA 2CPIA 4MIWA 2QV6A 4RU2A 4DV6F 2FHOB 2OD4A 2VB6A 3OL7A 1FNOA 4DFJA 2M8HA 3NCRA 4DN0A 5B0BA 5KFWA 2Q6BA 2FVSA 1HNVB 1DHMA 1JLGA 1WHVA 4XK8C 4O44A 3CXCR 5GAGU 2R2UA 3CCES 3PZPA 3TAMA 3C6TB 4R25A 2FJVA 3OV7A 2UXCF 5I3UA 2DITA 4IFYA 3Q8PB 2R4FA 4DUYF 1VK8A 3SCKE 2B4UA 1IBMF 1HD0A 3MPWA 1SI9A 3MTJA 4RW6B 4KKOB 4C3LA 4EFAC 1AW0A 4MFBB 5CCMA 2ZJPQ 2GV1A 2B3TB 2VH7A 3S01A 2F4VF 3CJKB 4F3OA 3LWMA 1QVGR 4ID8A 3VCDA 3HPOA 3E2EA 4PPDA 4ALZA 3NP5A 2HAIA 4FXWA 1XMOF 3IN5A 4ED7A 1GQEA 1T95A 1M0SA 1I1GA 2LXIA 3QO9B 1CC7A 3T1AA 4MJKA 3T3FA 2HNDA 3FSXA 2CVIA 4MK7A 3O2IA 5U47A 3AY0A 1GX6A 2W4DA 3IG1A 1RTDA 2FLLA 3RR7A 4C8ZA 6FDRA 4ELTA 1HI0P 4J5OA 3QLHA 1WHYA 1ZOTA 4O3NA 3JB9k 2C28A 1UJ6A 3E51A 1N6QA 1R3NA 2MQMA 5K8NA 1FDDA 5T14A 4Q8FA 3CJ5A 4YY3F 4RUHA 4DR1F 2OAUA 4CO2A 1HR0F 2GIRA 3U1NA 2OIHA 2YKNB 3FGVA 1PSDA 3BS9A 2HRYA 5CCLA 1WG1A 1UVKA 5KAKA 4XO0A 1S7HA