3MAHA

A putative c-terminal regulatory domain of aspartate kinase from porphyromonas gingivalis w83.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
145
structure length
139
Chain Sequence
DCIKAVAAKDGITVIKVKSSNKLLSWHFMRKLFEIFEFYQEPVDMVATSEVGVSLTIDNDKNLPDIVRALSDIGDVTVDKDMVIICIVGVGFEARIINALKGVPVRMISYGGSNYNVSVLVKAEDKKKALIALSNKLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aspartokinase
publication title A Putative C-Terminal Regulatory Domain of Aspartate Kinase from Porphyromonas Gingivalis W83.
rcsb
source organism Porphyromonas gingivalis
molecule tags Transferase
total genus 29
structure length 139
sequence length 145
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mahA01
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mahA02
3DHXA 1LK7A 4GO5X 3N0VA 2CDQA 2I9SA 2QSWA 1LK5A 1O8BA 4X84A 3TUJC 2P9EA 3DC2A 1XTZA 3ENQA 4LUBA 3IXQA 2JHEA 2JOQA 3OFHA 3HHEA 2J0XA 2QRRA 1M0SA 3DHWC 5FIIA 3AB4B 3ENVA 1UJ4A 3TUZC 4IO1A 3O1LA 3S1TA 3TUIC 3U7JA 2P9GA 3DDNA 5JJBA 1YBAA 3W7BA 1Y7PA 1UJ6A 3IBWA 4GO7X 3K5PA 1ZPVA 2J0WA 3P96A 3MWBA 1SC6A 2PA3A 3LOUA 1YGYA 5IT4A 2QMWA 2H9ZA 4NMLA 2DTJA 1KS2A 2PC6A 3KWMA 2KO1A 3OFGA 2ZHOA 2LVWA 1U8SA 2LQJA 2F8MA 2P9CA 3MTJA 5IT0A 2MDAA 2DT9A 3LUYA 4GMKA 4M8LA 4PWUA 3UW1A 3AAWB 3ENWA 2RQMA 5T41A 2F1FA 3L7OA 2FGCA 1PSDA 3CEDA 2QMXA 5IS2A 2NYIA 3NRBA 1RWUA 1UJ5A 3OFFA 1LKZA 3OBIA 3MAHA 2RE1A 3AB2B 2RQKA 3OFEA
chains in the Genus database with same CATH superfamily
3A3PB 2BVZA 1RWWB 5D6GA 1XIQA 2MTLA 5A6WA 3QGPA 3MTKA 1K1SA 2XMKA 1REGX 1EETB 3UQSA 3SQGA 5F0WA 1RT3B 1GXUA 3BGUA 2FUG9 4WBFA 2DXFA 2FVCA 2KL8A 2Q43A 5M2PA 4OFZA 2OIHA 2R3VA 1R8PA 1WOOA 3DRXA 5GMDA 4RNHA 3I6PA 1LV5A 2PMHA 1Q7YT 2XMMA 5D8HB 4G1IA 1FXLA 2J6SA 1OYDA 1MROA 4AL6A 2BKOA 3DYAB 2BJDA 4HT5A 5C5JA 1ZBTA 1VC5A 4KH1B 4KV8A 4EK2A 5KT2A 3SV3A 3MEEA 2HEKA 4DQSA 1ZA2B 2FGOA 1P9YA 4DR1J 4B3OA 4OI4A 3QT5A 1HWLA 3VAKA 4ANEA 1XQIA 3TX0A 2ACYA 2AZ3A 5IXUA 3RBDA 4RUBA 4F04B 4WU2A 4ECYA 1AZSB 2EXUA 1FDAA 3VQSA 1H7XA 3C8YA 3PFEA 2ZD1B 5F0UA 1OY6A 4W4MA 3HHLC 4OZ0A 2R4FA 2DGWA 3OFHA 2J0XA 1N8RT 1S76D 4KJIA 1L3KA 4TY8A 1IKXA 2CPXA 1SL2A 3M8PA 3NNAA 1WEXA 4X4RA 1RTIA 4ATNA 5KTQA 1VBYA 3DN9A 3BGRB 1RWPB 1KEKA 2V2ZA 2MY8A 1N32J 2SXLA 4I67A 1RLDA 1VHFA 2XM3A 1WC4A 1RHKB 4QIGA 1KN6A 1UVIA 1T95A 4OZ3A 4K4YA 1HNXJ 4IRKA 3QLHA 3ILLA 3G8SA 2PSZA 2JFDA 4ZS6A 5C2CA 1Q78A 3GTYX 1XMOJ 3PFOA 3ENAA 3LPEA 2O66A 1HR0F 3V6DB 3P3DA 2YWGA 4IQMA 1CEZA 1X5PA 1K47A 3NGDA 3TJAA 3EXYA 4WXWA 4I69A 3C15B 3MD3A 5A2QY 3OXLA 1PYSB 1H98A 2K7JA 2NZCA 4K0KF 5E0OA 4UT4A 3Q8SB 4CH1A 2IBKA 4QIEA 4CO4A 4ZP6A 2XS5A 4CRJA 1FXRA 3SMZA 5CYQB 3M6UA 1XNQF 3ICLA 1AFJA 5AJ3J 3QNWB 3MHYA 5HP1A 5B0CA 3KLVA 7AT1B 2MQLA 1C0UB 3M6WA 2IMWP 1S0NA 3KK3B 4KGVB 8AT1B 2GVDB 3J7ZT 5L1LA 1DBDA 1YKWA 4F67A 1VQ5S 2UV8G 4RU9A 1F9EB 3QBCA 2HS3A 3DNCA 2Q6BA 4MK9A 4C6AA 3IAM9 2FLNA 4FNIA 3NNHA 3QGIA 1FA0A 3CD5A 4C97A 2IY5B 4QBUA 4LF4J 1V6HA 1KHWA 3MEGB 2ABYA 1VOMA 4CIOA 3UFCX 3BO4A 5KFIA 4WFZA 3R7NB 4B9TA 5A8RA 5LL6d 2I5JA 2KZMA 2Z0GA 3OVBA 2JDJA 1N33F 3M9OB 3MMCB 1F5AA 2RF2A 3W65A 1NSPA 1K0TA 2E1AA 2MKJA 2B7CB 2VB6A 5FD1A 2AKWB 2UUWA 1RT2B 2LKZA 3LAMA 5LSRA 1UEUA 4B08A 1MMLA 2ZH5A 3H98A 2FLLA 3M1VA 3CCJS 4AXIA 3MWBA 3F73A 3R27A 3CCZA 4ELUA 1PC5A 5KFQA 3MPVA 3M2UB 2N4DA 3PHEA 3KHRA 5KFUA 2G1HA 5EHHA 4NI2B 3EM1A 2BRLA 5E3CA 2HNDA 2N4CA 1TQLA 4LFCF 3QWUA 3FEZA 4JYAJ 2AJ1A 3TOQA 1NPRA 2E1CA 2ZJPQ 3ITHA 3MAQA 3UNYA 4EZ9A 4LUBA 4WP9A 4OJHA 3LQVA 2CQHA 3HF5A 3FMBA 1RABB 2J76E 1IKWB 3R97A 4RW6B 4FNHA 3W2WB 4O4RA 2VFSA 3OL7A 5F3ZA 2B4VA 1WD6A 1IBKJ 2OPQA 4DG1B 4OMFG 1L3VA 5D3GB 2CWXA 1Q7LB 5E5NA 4OIXA 6AT1B 1FKOB 2Q79A 3CCRS 3ZTOA 1CBKA 1SCJB 5KFPA 4P2FA 4NLGA 3V81A 4YR0A 3D5MA 1PJ7A 2H1YA 3DLGB 3NP5A 2XYGB 5B09A 1IN0A 1S6QA 4URQU 2M4MA 1EIYB 1M5OC 2HBZB 4LSNB 2KI2A 2LDIA 2RDIA 1K73T 4IFVB 5HAOA 1RTDB 3P45B 2Q66A 2VOPA 3HFKA 3FFIA 1FCAA 4PXBA 1KLMB 3A8EA 2BKPA 1TL4A 2HBQB 3S01A 3KYLA 2JC1A 1TFWA 3QJJA 3BBBA 3ILIA 2ZH1A 1F5BA 2UUCF 2HHHF 3IM8A 1NKEA 1HBNB 3G6VA 4NWBA 4LRFA 1S1UB 1GX6A 2CADA 2G0IA 3CCUS 3TUPA 4KKOB 1VLOA 2KU7A 2A18A 2MYFA 3MPYA 4DF8A 3HSDA 3M2RA 3H40A 4DU8A 1HNWF 3RBZA 2AGOA 1RADB 2OFHX 5J2PB 1TR0A 2HNYA 5AXNA 2ZH2A 1UFKA 3PO4A 1NPKA 1UETA 4M5KA 2OP5A 3PRBA 3H59A 4QW9A 2PI5A 3G8QA 2XSJB 3EGZA 1ZM4A 5B0DA 2I9SA 2MLXA 2JEJA 3SCLE 3UCZP 1FFWB 4KHRA 3RRKA 2V94A 3W2VA 2ZH8A 1Q5VA 3KLIB 1SL1A 2CG8A 1P8GA 2ZNYA 4U8VA 2V8GA 4CLTA 3L4BC 1U4BA 3IC1A 3GPAA 4DSIA 5HVGA 2E9TA 2MKYA 2ZE2B 4LF6J 3ZO7A 1I3OB 2I0XA 2BOAA 1HI8A 3I4HX 3CE8A 1KWMA 2YKNB 3QZ8A 2QFJA 3BZQA 1XN9A 4LRAA 1ZAVA 1IKVB 3MM7B 1K44A 2W4CA 4LRBA 4NEYA 3KLHA 2HHTA 1YBUA 4OL8A 2DIVA 2H5JB 1JLAA 3IWLA 4F0KA 5J1EB 4QYZJ 1V5IB 4X64F 5IQ6A 4G65A 5D4NA 2CJ9A 3OJSA 5GAEI 3KG0A 2FY8A 3OHBA 5HO4A 3FMWA 1R31A 3OTDA 2DK2A 3MFHA 3POTA 1DY3A 4ED0A 2RKIB 3MM6B 1RWVB 5FLXY 4CO5A 4NLTA 4LFBJ 2KTQA 4IR9A 1HWKA 1GMWD 4WZQA 4ED7A 1UEVA 4NXNF 1XJWB 4P10A 2EW9A 1X4GA 2DO0A 1Q81T 4KRWA 2IVYA 2AHOB 2MJNA 4X4UA 4H4OB 4KHPF 2GAHC 5H1SV 4OHVA 4OJ3A 4DCPB 2D9OA 3TZXA 1ZH5A 2E5LJ 3K2YA 4NLVA 1C1CA 2CVIA 2HWHA 2MY7A 2QL5B 1FD8A 1YBAA 3PXGa 1SC1B 3DGPA 1IJFB 3OR2B 2ZM6F 3GJSB 3G6YA 3OV7A 1A9NB 3FJ2A 4IFYA 4OYWA 1MN7A 2VG5A 1RYSA 3PJXA 4OZ5A 2B56A 2B3TB 3UD4P 2CA9A 3HVAA 1TUWA 2FGCA 1VQSA 3FZBA 4AYBD 3G82A 3OVAA 4F50A 3WIVA 4NYZA 3A3NB 3BM7A 4NLYA 3D1HA 4FVMA 1S77D 1SV5A 3G9CA 4OZLA 3DU6A 3D67A 1LWEA 3BR9A 3G86A 1N6QA 3ELHA 2LLZA 1WUUA 4FKYA 2D1CA 2JH3A 1TK0A 1V5VA 1S1XA 2HNZA 1NK8A 2DKOB 1YJRA 2XYPB 4MK7A 3KLEA 1Q5YA 4EUVA 3DRRB 3T5KA 2L41A 4RNMA 3O6QA 4CP5A 3P5TL 2E9RX 5E41A 2K7KA 3GB0A 3M8SA 2F4VF 4P71A 1M5VC 3I0RA 4QOTA 3D4JA 4RNFA 1CSJA 4B3MJ 4IDKB 4YB6A 1NSQA 2HG4A 4P9SA 1RE1B 2KH9A 1VRUA 4UOFA 4A4JA 2FC9A 2BXJA 2OD6A 3CO9A 5KFGA 4IG0A 3KJNB 4PWWA 2HFOA 1OPZA 3IRXB 1WF2A 4EO8A 1BQMA 3P6YC 3PKYA 1JLCB 1P6TA 5L1KA 1S9EA 3QQCD 2XLJA 5AT1B 1EJ7L 4O23A 3D28A 3HP6A 2H5IB 2LEBA 5KFBA 3FBBA 1QVFR 2VG6B 3HVTA 2VZ9A 4MIBA 4NLWA 4KFBB 4N8OA 1UVLA 1NJIT 4PUOB 1FERA 4B3RJ 5HLFB 3GG0A 3WBZA 2CNLB 4DUZF 2HGNA 4ZVOB 2D3OR 4ZLJA 3LOUA 1CS4A 3LP2A 3DLBA 4IUFA 1F9HA 1VQKS 1TUVA 4NLQA 1ZTWA 1YVFA 3CDEA 4F3OA 2X1GA 2BQ3A 3ENWA 4JB8B 5CCLA 1H6KX 2QMXA 3ZZRA 2POKA 3MF5A 1RJJA 4DX5A 3UD5A 1S0OA 3NL0A 2RE1A 2ROPA 5HATA 1GH8A 5CCMA 2BABA 1KC8T 4Y2KA 2HVHA 3VGSA 3BDEA 3HFVA 3IS9B 3NGSA 3UDVA 4UY8T 1RT7A 3GIRA 1H38A 3R7BB 4USVA 2YWWA 4ILLA 4YR2A 5B0EA 3GR1A 4YN3B 2D3UA 3LP1B 2DNGA 2PN6A 4X4QA 1NH8A 3DDIA 2YWEA 3DRPB 4Z7CA 4YB5A 4V19J 3VZHA 4ZVTB 3JYTB 1RWNB 2V67A 1BD6A 1SBRA 4UOHA 2C3UA 3LW5C 3G8TA 4K0KJ 1UVJA 2ZC3A 4AQYJ 4ILRA 1FVQA 1J5EJ 2MGZA 1NK4A 3GIMA 3TAMB 2ZZMA 2PC6A 4QZVB 1JQGA 4F4YA 1S57A 2EI5A 3M2VB 1DJ0A 3FRZA 3CCVS 4I0WA 4ID5B 3RB3A 1S97A 5GMKa 1F3FA 1R0BG 4ZJOA 1MU2A 4Z7YA 1TVRA 4WTYA 1FVSA 4LR9A 2WOMA 1JXEA 2UVVA 2HIYA 4X4VA 1CQNA 2DGSA 4IOCQ 4ANDA 2GC8A 3OUYA 4K4WA 3VZIA 3MAAA 1W2BR 3OSNA 1NUEA 1U02A 4C3MA 1RU2A 2NQPA 2CJBA 3GQCA 1JLFA 4CDIA 3NBPA 2X1BA 1TKXA 3ETOA 4Q5VA 1R8HA 1FI4A 1KKHA 1A0OB 4MAKA 3CJTA 3TO8A 1YZ7A 4NA3A 4RW8A 1NJWA 1UZDA 3SIPB 2ZVIA 1M5PC 1QSSA 2A1BA 2YKQA 3W8PA 2IAJA 5D4LA 3H25A 2V4RA 2L9WA 2BDPA 4JI0F 2G2YA 4OHXA 1BQNA 4HDHA 4CH7A 4DL5A 5LMUF 2K1RA 1HD1A 1H2UX 4PYAA 5JMNA 1DTTB 3SFUA 3BN7A 5KFXA 5G0RB 3JTNA 2IM3A 3B54A 3PW5A 2GHVC 2DRAA 2NZ4A 4ZHRB 4JI4J 4ITSA 2AYBA 2MB0B 1EP4B 1HNIB 2RILA 2BE9B 4A8XA 1HBMB 2HQIA 4G6VB 3U1MA 3PNIA 3D1QA 3P49B 5HN0A 2R2SA 3THVA 3DOMA 5C24B 2GO9A 3N5FA 2ALZA 3DLJA 4RW7B 3U27A 2DR6A 2VOOA 4LR8A 1VIOA 3KHLA 3M8QB 1GK8A 3NS5A 4DR6J 3SFGA 4CO1A 3B4DA 4NOHA 3EICA 4O3OA 1PAUB 3GMGA 4NMLA 2M70A 2OGUA 1W25A 3C6TB 2XCAA 3TVKA 2EKYA 4F26A 2MPUA 2XBPA 4FF4A 2GCFA 4GMKA 2MSTA 1XR6A 4HACB 4G3IA 1UA1A 2E5HA 5KFHA 2FTRA 3JAMY 3W5XA 1IBMJ 5DDQC 3LP0B 4DV0J 3GG1A 1DQ9A 1R43A 3Q2SC 4USKA 2VU5A 2J7WA 1S6PA 1XR5A 1U26A 1FFGB 2NSBA 1PG5B 2YQ0A 4KQZA 3GFXA 2V8HA 5DDRC 2RHQB 3K57A 2JHEA 1DQAA 4DPYA 3FSYA 5LM7E 4G1QA 4ZN1A 2YKMB 2HHUA 1LOUA 1W7WA 2VD3A 4TVAB 1FWLA 3W7BA 2XMVA 2VPXB 3UN5A 1L5UA 1SH0A 4OX9F 4QWBA 4B3TJ 1M5KC 1TMMA 2CPZA 2G4BA 1KOOA 4YR3A 1REVA 2H9ZA 4IOBA 4LF7J 2K3KA 2W24A 4Q2MA 2E7XA 2B4OA 3I82A 2C2ZB 2E5GA 2EC0A 1X7VA 3HMJG 1RWXB 4ER8A 2Z8QA 4DSKA 5EDWA 2OKQA 2K06A 4MT1A 2OPSB 1HNWJ 1U1PA 1FWPA 1WHVA 1OMSA 1QE1B 3OFEA 4XIUA 1Q1KA 1UWBA 2FDNA 1ZTTA 4LQ9A 1TP7A 2P6TA 5ETVA 2XG8A 4O0IA 2Y1RI 3CJKB 3RB6A 2DRBA 4K8RA 3CC4S 1UL3A 5K9FA 2VG7B 3D0HE 3KNAA 4E98A 5CA5A 1J5OA 2OPPA 1KONA 2ZH3A 3BGFA 4F2RA 3QT7A 3V5RA 4ECQA 5IM0B 5LJ5Y 5HJXA 5KFLA 2XQCA 4IOAQ 5K20B 2LQBA 3PX4A 3OR1B 1Q4RA 3JQKA 3HK2A 3I55S 1OSDA 1AA1B 3WDOA 5HQLA 2JC0A 1M5HA 5KG5A 1EHWA 2ACMA 4GVBA 2MEWA 3DOLA 4FPIA 1HNVA 4K5RA 1S99A 4NYOA 3K7RA 1IR2A 4ICLB 2WVFA 1FEHA 2FHMA 1LWXA 3GSDA 4ECVA 4QWDA 1PYOB 1TL1A 4I6AA 3TI0A 4WE1B 2JEFA 4ZJQA 3CWJA 2JEIA 1QVGR 4LFAJ 2LU1A 5HQ8A 3OL6A 1UPMB 3IA0A 4B17A 5A8WB 2EFQA 4LVOP 1T9UA 4DQRA 3OTOJ 2OLWA 1T03A 3IFEA 1IM4A 3BKFA 4DL2A 2JLEA 5L1JA 1R0AB 4BHQA 1TKZB 2OEJA 4NXNJ 2RHSB 3T5HA 3M8WA 2LQ8A 4USWA 1HQEA 5HVHA 4C0OC 3JSBA 3QT6A 2D41A 2F8MA 1WSRA 1RUSA 4M5DA 2O01C 4JI1J 1FE0A 1M1HA 2QFIA 2W2OP 3I9V9 1LFWA 1CQMA 2F7VA 3B78A 1Y10A 3BYRA 4J9LA 1HQUB 3CJ8A 1DURA 2C3YA 3TWZA 1RTHA 2MHNA 1S1TA 4CQ1A 5L9XA 3QO9A 2B6AB 2IVMA 2Y1IA 1GXLA 1QTNB 4JI2F 4DR2F 2C1EB 4CCHA 3HCXA 4K4UA 3J7YU 3C6UB 3MGJA 2DHXA 3BQ2A 3FSIA 1CJUB 3BS9A 4DF4A 4MTPA 2DCUB 4TYBA 4FVCA 4HYKA 1WEZA 3DGVA 2OTLS 2CZ4A 1H2TZ 3ET6B 4UQTA 4P2SA 2J0WA 3MMAB 2ZDPA 3KDNA 5IC4B 4ETZA 4J91A 1BWVA 5L39A 4DR5J 2ZFHA 2ZDOA 4J9KA 4OI0A 2LYVA 1RYRA 4WKYA 1KR4A 3AD9C 4EZ6A 3CF5Q 3ZZUA 4Z37A 3A8KA 2JJ4D 2XMUA 2KN4A 3ADAC 2VA3A 4R25A 2DGTA 1AZSA 2B5JB 2BKNA 5EX3A 1XTZA 2AYMA 2MKKA 4U96A 1JXLA 3OPKA 4B9MA 3J7A1 5GAGI 4F3QA 3VVTA 1GFWB 2Y9HA 2R9LA 2DNNA 3CMES 3KK2B 5HBMA 3HDSA 5F8GA 1EQMA 3BGRA 1YX2A 2FJDB 1N0VC 5DG7A 1VQ9S 5BYSA 4QIVA 2HWTA 4ZK7M 1VK8A 2X3DA 4M5LA 4N41A 4DV6F 3UNGC 3W63A 2G2OA 3TRGA 4DPOA 3EMTA 3V4IB 3E8OA 2ZH7A 2YNIB 4DSLA 1MWYA 4LF8F 4L3NA 1N36J 3R7SB 3UVJB 5IT0A 2M88A 1KFDA 4TY9A 1X0PA 1QUPA 3K5OA 1UKUA 2HBYB 3KHGA 2BANA 2ZEJA 3OTBA 2KRRA 5KG0A 2UUBF 4WK1A 1ZA1B 3FGVA 5KG7A 5KFFA 3H5SA 2W4PA 4YDDB 2CDQA 1FRLA 2R8KA 4X65J 2Z2YB 1GAOA 3C15A 2MZQA 4DL7A 3SCKE 4D3HA 2DO4A 3T1HF 4QJVA 2CJAA 3IGVA 4URGA 2OJ3A 2HWIA 1UCNA 2J7KA 3K89A 2GZOA 4K5SA 3MM5B 2OH2A 5L38A 4MFBA 4E2FB 2MZRA 1U45A 3J80U 4EBEA 2F9DA 3FQKA 1VJWA 1WORA 4FP9A 3I56S 3AODA 2FLOA 3M8RA 5F8MA 4EYHB 4DQIA 3UR0A 4HL9A 4X4OA 2GVDA 2R8IA 4DL3A 2GGPA 5DDPC 1WG5A 1Y5IB 3PDNA 3RR8A 1UEKA 3HHDA 3NLCA 4OLOA 1IVZA 3CEDA 2BW2A 1R7IA 4CTAA 1IKYB 3D2WA 2YNHA 2Y1JA 4TXSA 2CWKA 2ILZA 1UZHA 5C42B 2KM8B 3NS7B 4C8YA 1VQYA 1S1WA 2ZOFA 1N52B 2C42A 1MW7A 1CULA 4WZMA 4WYWA 2BQUA 3TUJC 1JLBB 3THPA 2W01A 4GVLA 1DLOB 2XY7A 4L75A 2ZH6A 3MECB 4EYIB 4C3KA 1VS3A 2W25A 4DWIA 4LF2A 1V3ZA 5A0YB 3TUIC 2E7WA 3CCMS 5BYQA 3ZFVA 2RAQA 4M5JA 3H7HB 3W8GA 3ZZOA 2WVBA 3N9UC 2H48B 2W9AA 2FVPA 1RGVA 4DV5J 2HVEA 4OV6A 2ASYA 1Q8BA 1TAUA 3JTOA 1Y00A 4X2BA 3OTEA 4GKKF 5ETPA 4L76A 1DQ8A 5H9EJ 3GZ7A 3NRBA 1U1NA 3PW7A 4ECUA 2R7VA 2V4JA 4RO0A 2HQDA 2W1BA 3AB2B 2RQKA 5I3UA 1WKKA 4HHJA 1PYTA 5CYMB 3PEHA 1HD0A 1N5VA 1OQ3A 3FCVA 1F2HA 3A12A 3QT8A 4CO2A 3FCWA 4K50A 2ZJRQ 2LCWA 1X8DA 2ALYB 1HNXF 2J9CA 1TZ0A 2MQMA 3AB4B 2Z56B 4OYAA 3RZAA 2OEMA 2DR5A 1XMOF 4NCBA 2YBVA 3AT1B 4J90A 4DG1A 1KSPA 2XI3A 4OYOA 4DFJA 4JI7F 1MWZA 1IR0A 2XWYA 4RZRA 1T7PA 1BUXA 1N5YB 5B0FA 4D3GA 5CH7B 2A0FB 2BJ8A 2WVCA 1TL7A 1SL0A 3GJTB 2VDHA 1FNXH 4M8LA 3UW1A 4PYDA 2CIMA 2HURA 2HHVA 1KVIA 2Q3PA 3EPGA 5AJ3F 2HRTA 2YX7A 3CO0P 2OUGA 1O6XA 2DY1A 3CIZA 4DFMA 2O1PA 3VR1A 2R8HA 2KFZA 1BLUA 3RW7A 2NPFA 3NCRA 3BREA 2NCKL 5J2MB 1Q16B 1C1BB 3RTVA 2QLFB 1HARA 3HM9A 1D9AA 2Y3YA 2UXBF 4FXDA 4O4GB 5LOQA 4EWTA 1AROP 5KFYA 4I2QB 4FYWB 4L74A 2CNKB 4OI3A 3SCJE 1T9YA 2DH8A 4DV4J 1U25A 5CXTA 3C46A 2ZJQQ 3CJ5A 2BOPA 3QJPA 3TZYA 4LF4F 1FJGJ 1YBTA 4KSEB 1K9MT 3UPFA 3SQGB 1N0UA 5HMYA 4C11A 4DPTA 2QMWA 2W4DA 1JJHA 1TELA 5ETOA 4PKDB 4HI2A 3DI6A 1T9VA 1JKHA 4RBUA 4S0MA 2J7UA 4LJMA 3QSIA 3MPDA 1NB7A 1D1UA 4RUHA 5J2PA 2HLUA 4CH0S 5K5MA 4N76A 2VQFJ 4OX9J 1D9FA 2FJEB 4QR0A 2HYIB 2YKAA 3DLEA 1MROB 1NKBA 3SYZA 2DHHA 3RU0A 2ZOMA 5H9FJ 5K8MA 4DFKA 4KV8B 4USHA 1U7LA 1E6YA 2W9CA 3DU5A 3MEEB 3ZTRA 1FRHA 4DU7A 3MOJB 4RW4A 4R5PA 3JSYA 4B3OB 1O8BA 1PJ5A 3EPIA 2HAIA 3GCXP 2B7BB 3HT0A 4Y2MA 4K2XA 4ED8A 2IJFA 2YKOA 2V2KA 2CQ1A 4NCAA 4Z2XA 4EBDA 5B0BA 4W98A 3ZXWA 2ZKUA 4AT1B 2F8EX 1S6UA 1ZAWA 2P9GA 4YFUA 4YHHJ 1RT5A 1FTCA 4FPRA 3K8WA 5HMZA 4NZ0A 1M90T 4MJKA 2Y0SD 4EI2A 3MD1A 1K0VA 4A48A 4GC7A 4TY8B 2FZCB 1P1TA 2YTCA 4OJ1A 1QTMA 2LXFA 2ZWOA 1WHYA 2GMLA 5KG3A 1HIYA 3M8PB 2DITA 3M4XA 4WFYA 4CZCA 3LALA 3HLUA 3Q8QB 2IM2A 4WPAA 2GQQA 3EVWA 1IBKF 2E7VA 4DN9A 3OLAA 2AP6A 2Z57B 1LW0A 2MZTA 1JJCB 1H72C 2RKIA 3MM6A 3R5JB 4DZ6A 3T41A 3QLHB 4K4SA 2GVZA 2HHQA 1U2FA 1JWWA 2YPYA 1AYEA 2OMOA 4DR7J 1T8EA 1DAXA 1XMQJ 1RZMA 4DR3J 4LREA 4C98A 2WHOA 1SKUB 1YJNS 3DFEA 1FDNA 2AJ4A 3K5PA 1C0TA 3GFZA 3DM2A 3HJFA 3EGNA 2H54B 4KPCA 1R3NA 1S79A 3MMBA 4RU2A 2NXCA 2JVRA 4FXVA 3AOBA 3T1AA 3ZZTA 2D9PA 5HP1B 1ACMB 1SIWB 1NDPA 2QA2A 3RB0A 1QSYA 4OHYA 2FJAB 4USIA 1RDRA 3E3XA 4JOUA 3MM8A 1JJ2R 2BM1A 4I6YA 4C3LA 1WI8A 2J0QD 5GAGU 4Q0BA 4QR2A 1FX2A 4V19X 1VQOS 1SH2A 4P74A 2YNGA 2CQ3A 2CNNB 1D8YA 2DGOA 2WONA 1HWUA 3DRSA 3M6VA 3I9ZA 2YX1A 2KJVA 4Y2AA 2VFVA 2H5EA 1TMJA 2M52A 2Y0BB 2PO4A 5K8PA 3TZWA 2I5JB 4Q7AA 3EYZA 4EMDA 2WBMA 3D6MB 4DS5A 5EUHA 4H4KC 4CT9A 4FYXB 1XERA 2RF2B 2HVIA 2E29A 4B9LA 4ED6A 1TK5A 2PA3A 1T94A 2MKCA 3CJQA 1VIXA 2M0GB 4KB7A 1GMWA 2WW8A 2IRYA 2PEHA 2KT5A 3CIMA 2RQMA 2BBEA 4LF6F 1CJKA 1NZ8A 2NSCA 3I31A 3JQJA 2XZTB 2QE5A 3MEDB 3IR7B 3HXMA 2R42A 2KHDA 1FKPB 5D0RA 2XY5A 1JXVA 3D0IE 2BA9A 1B0TA 2KG0A 1B7YB 5BYRA 5A8KB 4CYUA 3HX9A 1GTHA 3VQTA 4DV1J 1OPIA 1TUGB 2B43A 2HNDB 3DDKA 1WWHA 3HHLD 1DTQB 2V8VA 2VPZB 2VG6A 3ITHB 1MSWD 4K4TA 3J7Z5 2CJKA 2XULA 5HLFA 4LFBF 1U09A 2NREA 4C0HA 1R8BA 4CLKA 1NU4A 2W9BB 3SI8A 2BACA 5DGBA 3TARA 1RKJA 4BLGA 3TA1A 4K4VA 2YXLA 2OPQB 1MG7A 1VMBA 1RHJB 4CLSA 2IM1A 2EVZA 2E5LF 3P4UB 1HI1A 3OHAA 5T7LA 1CG2A 4XPEA 1HL6A 2HAFA 3HO1A 1WKLA 1KOHA 4OI1A 1U1MA 1BWEA 2KXFA 3FSXA 1SQGA 2BV3A 2BEFA 3V81B 4GKJJ 3LO3A 1IXKA 3K58A 4OZ1A 4PABA 3MR5A 2F65A 4OI6A 2UV8A 1G2EA 4HI1A 3JSMA 3CVKA 5DM7Q 3HZGA 3MDFA 3QGGA 5T14A 1IQZA 3DHWC 5KFNA 3FFIB 4BC9A 4JV5J 2PFDA 2V68A 2VKRA 1RHRB 4ZVGA 3LTOA 5K14A 2E66A 2EWHA 2HZAA 1RBLA 1VRTB 1P1LA 4ZPVR 3N79A 2R8JA 2VL1A 4WP8A 1U6BA 3W64A 2WB4A 2ZNZA 5HANA 4LVNP 3MCNA 3HD2A 3PCOB 4X4TA 2C3OA 1X9SA 1WG4A 4JUZA 1NZAA 3HHLB 5DQIA 1AUDA 1AXQA 1HA1A 1NMEB 2H4WB 5FDLA 2CJXB 1FF2A 3GCWP 1VQPS 5B0GA 2XGQA 3W60A 2DGUA 2HNYB 2MQOA 3EX7B 3C16A 4B3MF 2AJ2A 3CDAA 1PCAA 1NJXA 2RRNA 3VV2B 2G13A 2HW3A 4A47A 3LGMA 1EARA 4QQBA 4IO1A 3DXSX 3OXFA 1RCOB 4OYIA 3L3CA 3W2VB 5KFVA 1YJVA 1RAOA 1Y0HA 3AXMA 3CW2C 3GE9A 4P72A 2GIQA 3HVRA 1JX4A 4ZVEA 2MQ8A 2ZHOA 1VQ8S 4UOGA 3GV5B 3MR3A 5KFRA 4L72B 1T05A 2IYGA 3BQ1A 4KGZB 3O5TB 4PWUA 5G0RA 1ZM3A 2ZUGA 3DXBA 2R2RA 1JLQA 1A6LA 4ZHRA 5LXRA 5IV4A 5KAKA 2RUGA 5THWA 2C2KB 4B3RF 3M05A 1MNEA 4FF3A 5I3PA 1G3OA 3KLHB 1SKSA 2DPJA 2VJUA 2V69A 1HNIA 5KFCA 4NLOA 4GKKJ 1B3TA 1QUVA 2GX8A 3NOCA 2M2BA 4LSZB 5F9LA 2HVZA 4IO9Q 3PTWA 5C25A 3LPYA 2NLWA 4J9OA 4CLUA 1QAXA 3UDCA 3KUGA 1PILA 3POTB 1JIHA 4TNOA 4CO0A 3T1YJ 2VKZG 1TKTA 2V9KA 4QPTA 2VBZA 4ZKAA 3M8QA 2WW4A 2XHCA 1RXOB 1SXLA 1TL3A 3VTIA 4U67Q 2RS8A 4PPDA 3Q8VA 1C1CB 1HPZB 4ED2A 3DGPB 2P9CA 1PJ6A 3MMJA 4AXJA 4ZN3A 4JI7J 2IIHA 2UP1A 2MXYA 4IFYB 2JFKA 3MOZA 3MCSA 4H4KA 2VG5B 2VC1A 3NCQA 2M3DA 4AQYF 3I87A 4I6WA 1J5EF 1WJ9A 3RRHA 4CM2A 3VAGA 3FEXB 1CLFA 2GS8A 1V3SA 3G82B 1NSKL 2KG1A 3GYXB 2QRRA 4XPCA 4LQ3A 1SV5B 3VF0B 1LWEB 1WC5A 4EGLA 1N6QB 2B9XA 4LSLA 5DDOC 2UXBJ 1RAAB 3F56A 4N8NA 3BSNA 4NCGA 1S1XB 3HVWA 1HBUA 2HVDA 4DSEA 2K8GA 4EU0A 4TQRA 2MJUA 4QWAA 3H2UB 4MIAA 1SC6A 2HFNA 3T6BA 2DGQA 2WB1D 5LJ3Y 3KLEB 4ELVA 4YP3A 2O5DA 3M30A 3N6MA 2VBXA 3R5CA 2BRKA 3RG6A 3R2DJ 1VBZA 1IJEB 1VQ7S 4U9RA 3FCHA 3KUHA 2R8GA 3BSOA 3F44A 1LXNA 1D3WA 3I0RB 2XEXA 2OPSA 4LRCA 2FJXA 2XNQA 3CMQA 2QTWA 3D6TB 1F9FA 1XWLA 3CJKA 3VHQA 4ZIVA 1VRUB 3FBCA 4HHHA 3ISND 5HROA 3K5MA 1SH3A 5A76A 2E9ZA 2EG1A 4IG0B 2VFRA 1RTJA 2EFGA 3OLBA 2QIFA 2KT3A 4JI4F 2FVSA 4CLWA 2K2PA 3EZOA 1PAEX 2GFFA 4FYVB 1LFPA 1UJ6A 2Y8YA 1WI6A 2NS1B 1YJUA 1IM6A 1RISA 3W9JA 4FBUA 4KO0A 1QAJA 4N47A 3W5ZA 2PEBA 3M9MB 3HVTB 1ZM2A 1WG1A 4DL6A 5F8JA 2DNHA 5HJYA 4DUYJ 1E6VA 4YB1P 1SC4B 2C2NA 4ZDNA 1WTFA 1VC0A 3OBIA 4DR6F 1FNMA 1CS4B 3LP2B 1YRUA 3QZ7A 2YVSA 4A8YA 2U1AA 4F25A 1BQXA 2PMWA 4J9MA 1FNOA 2E1RA 4JV0A 5KFDA 4KGMA 4HLBA 5A8WA 4O3RA 2QV6A 4N5SA 3CGIA 2DR7A 4LBPA 1YDLA 4QU6A 1TV6A 3DKDA 2PGCA 1IBMF 3NOGA 3C3LA 4DV0F 4KT0C 1WACA 1Y7PA 1G4CA 1Q0NA 2GJFA 5KFMA 1URNA 1VK3A 4KE5A 2Z30B 2W8LA 5KFZA 3WIUA 2DR9A 2DR8A 2XZDB 2R7WA 8ATCB 2CQ2A 3CT9A 3UN2A 3VGVA 4XDDA 3QYYA 1RT4B 1PKUA 3GR0A 3FNNA 3DLKA 4ZIWA 3KK1A 4HVZA 4O44B 1U0SA 2MGZB 2DXDA 2RU9A 4B3TF 2ZKTA 2BX6A 2WZ1A 3H4DA 1LK7A 3M8ZA 3BKTA 2QEXS 2V2QA 4LF7F 2N7YA 1FJCA 5D15A 2APOA 3C6UA 4JV2A 1MU2B 3HHEA 3J80Y 3SCIE 1NPPA 1VGYA 1NK0A 1TVRB 5C7PA 2AZ1A 5BR8J 4DUTA 3MZIA 2LXIA 2OELA 2WOMB 1S72S 1H2VZ 2HMIA 2GNKA 4DBQA 1P9QC 4DS4A 3OUYB 2QJ3A 3VGUA 1PIEA 3MAAB 5K8OA 1N4LA 1ZM9A 2V63A 3MMAA 5BJRA 4KGKA 5I42B 2MZ1A 3BGOP 3WX4A 1JLFB 5KOWA 1S6OA 3NBPB 1TKXB 4LIWA 2LEAA 3ZTPA 4F4XA 2YX4A 5KG6A 4RW8B 4F4AA 4F4ZA 4ENOA 3CJ4A 4Q2LA 4QWCA 4UY85 2IAJB 3ISNC 1VDHA 4PPZA 2N3OA 3RB4A 1RAJA 2HS0A 2HHWA 1ICEB 4ECRA 4KAIA 2ZOGA 2B5JA 4J9NA 3TA0A 3KDOA 3EVMA 1JLGB 2B4PA 4BBYA 2JEGA 2AEMA 1U6FA 1QLNA 3PYDA 4LF9J 2AIRB 4J37A 2R7OA 3IG1A 2GJIA 2VHGA 2AJ0A 1FTRA 1HHSA 4IR1A 3MR2A 5B7WA 2HQ3A 4ZPTR 3H20A 2YWFA 2HFSA 2LDYA 4OYBA 3G96A 3MI7X 4LFAF 4GO7X 4JI8F 1GTEA 2GV1A 3R5BA 8RUCA 4J9PA 1R27B 3MM9A 3N6LA 1R8AA 1KS2A 4ZVPB 3OTOF 3QWPA 2XC9A 4DFPA 4IG3A 1Z4UA 2LQJA 4AFFA 2IM0A 1Q95G 3IR5B 2CZ9A 4DL4A 2CPEA 3AFGA 4RUCA 3OW2R 2D3ZA 1RBOB 5GVQA 4DR4F 3SSQA 4ZCLA 4Y6IA 1LQ9A 3CCQS 3RBEA 2YWHA 1D8ZA 1ZZFA 1VBXA 3KG1A 2A2DA 2J9DE 5JUMA 5CYJA 2PMZD 4KTQA 2RQ4A 2GIFA 4P2MA 3MFIA 4J7CA 3A13A 1U1KA 1OYEA 4OX8A 3OQ2A 2EFOA 1B99A 4JI1F 4ED5A 3Q22A 2FVRA 1YZ6A 2JOQA 4A8MP 5IFMA 3PKMA 3AJ2A 5E3AA 5DJBA 5J1NA 1S6PB 4H54A 4AUKA 3VAIA 4RWXA 2L9DA 3PRVA 3U1LA 3OL9A 4F4WA 3PV8A 1VHIA 4I2PA 4I1TA 1NBEB 1GEHA 3VAFA 3P8BB 4G1QB 1NJYA 4PWDA 4PXCA 3OVSA 4DJBA 3W1YC 3WC0A 4KBIA 5KT5A 3IWXA 4FF2A 2DD8S 2LQ9A 4HR2A 1CC7A 3LUYA 1T9TA 1UVKA 2GHWA 5KFTA 1RB0A 2VFTA 1CJVB 1RT6A 3D7SB 1REVB 1M1KT 3PO5A 1WC0A 2BQRA 1LWCB 3QGHA 4YEAA 2P8IA 3KLGA 5GADI 3PJ9A 5KFJA 5LMNJ 1KNZA 3US5A 3I5AA 2B9YA 2Z58B 3EDQB 2UZAA 4JI5J 2AYGA 2IC3A 5D0HA 4DR5F 3J81j 1IUJA 2VPYB 1RA7A 3GP9A 1JLEA 1KRPA 2QA4G 3NMRA 2D7SA 1UWBB 2ZH9A 3CNQP 1YI2S 1QDUB 3S1TA 1YQHA 4XO0A 1U1RA 5KOXA 1J5OB 2OPPB 3AD7C 2XTJP 2GQCA 4DQQA 2CQPA 4ED3A 2DGVA 2R7RA 4ZPBA 1NLKL 4DPUA 5ETTA 3MTJA 4HTIA 2FZKB 3VAJA 3DOLB 3TA2A 1HNVB 1FKAF 2A10A 3TQEA 1LW2B 2YNFA 3EGVA 2XMAA 5DQHA 1SKWA 4DCJB 2GHPA 2P2CB 2HGLA 1RT1A 2FHJD 3DOKA 1N36F 3J7YI 3I0SA 2UVUA 2RJZA 1AFIA 2PDAA 1QJHA 4MYUA 5C2GA 4H4MA 4OHWA 1TL1B 3SDEA 3MR7A 2JZ5A 4DEZA 3W5YA 4DPXA 2X1AA 3QIDA 2BZ2A 4K7QA 1OY8A 2MQNA 3WQPA 4NMXA 4Q44A 2DNQA 1YITS 4X65F 4ELTA 1RTZA 3QIPA 1T03B 2XO7A 2MQQA 1YGYA 4UZBA 2BM0A 1FK9B 2HGMA 1I51B 2HFVA 4NPOA 4EBCA 5U47A 1RAFB 3Q8YA 5HL7Q 3ZTSA 1U1OA 3BPDA 2CNOB 3IGNA 1HQEB 5IC6B 3TW0A 4CM0A 3QAEA 2RS2A 2IHR1 4HTJA 4ZITA 3DHXA 3H2VE 5AE2A 5J2MA 1IBLF 2PA8D 2HK2A 4ETXA 2HZCA 1RLCL 4LF1A 3AOCA 4U95A 3NAIA 2G0JA 1WHWA 1PO6A 2ZH4A 1O51A 4NL5A 4P7VA 3CD6S 3DMJA 1RTHB 2EFPA 1S1TB 1GMVA 5CD4A 3QO9B 3BB5A 1IWAA 3D3BJ 3MPWA 1TFYA 4OZJA 1ZETA 5JJBA 2GJ2A 4PR6A 3BO3A 1HBOA 1N34J 2ROGA 1HYSA 2J6TA 2BMBA 3EXCX 5AXKA 2AEJA 2OSRA 2HQFA 3TX8A 1DHMA 3JSRA 2AMCB 1HW8A 5F8LA 3KWMA 4ZPCA 5J2NA 2CJQA 4HT7A 5HMWA 2D74B 3E01A 1Y3JA 2C2DA 3MCOA 9RUBA 1HMVA 2JLFA 1F2GA 2NYHA 4KR0B 1FRJA 1FD2A 2Z4PA 2B4UA 3UO0A 1VQNS 3GJRB 3N6NA 4W90B 3MR6A 2JWNA 2VFUA 4I7FA 5DG8A 4HEA9 3O3LA 3MUTP 3I5BA 4IQXA 4DV5F 4O3SA 1SQFA 3IBCB 5KT6A 5DRKA 4JI3J 2NUUG 4B9NA 3Q8RB 3CDWA 1CJTA 4FZVA 3THTA 4CLFA 1APSA 3DC2A 2D69A 1M5SA 2C3PA 4NRTA 2I38A 4Y0FA 3RRGA 3C14B 4TLRA 1X5SA 5E3RA 5L8RC 1S9GA 5DG9A 1I5OB 2GW8A 1SI9A 1KFSA 2BE2B 3SV4A 4NLUA 2XMWA 1NM2A 5IQQA 3HSJA 1K1QA 5EWGA 2I2YA 2LU2A 3QSYB 2IBOA 2UUAF 1FJ7A 1MMDA 5HBMB 1X4CA 5FJ4A 4RWWA 1SUQA 3TR5A 2J8AA 3MXHP 2NYIA 5KFSA 1U0HA 2KXHA 1VQMS 4WK3A 3BPSP 2ZBPA 3TZZA 3BN4A 4LIRA 2DH7A 3B6BA 2DNLA 5ETNA 4R8UA 3NGKA 4CLPA 1Y11A 2QSWA 3EVOA 3I32A 3H2LA 4LF5J 4PG7A 4X4SA 2BANB 1C4AA 1G7CB 5K8NA 1TK8A 4TU7A 1RHMB 4JBCA 3K59A 4A8WA 1MLAA 2Z2MA 3E51A 3TUZC 1G6BA 2QLJB 2BR0A 4M95A 2ZZNA 5MAOA 5J1PA 3W9IA 1BXNA 1VBKA 1RSCA 4QYZK 3C2PA 2OFGX 4USMA 5CHCB 1C2PA 1J2VA 4TKTA 4MFBB 1WF1A 4Y65A 4DV4F 3OFGA 3KJQB 3GWCA 2V0NA 2XY6A 1R8CA 1NDCA 2RT3A 3JQMA 2F9JA 4MMOA 5T41A 4W92B 3PW2A 1LWFA 1FJGF 5AE3A 1AUSL 1LEOA 2AQ4A 4L3KA 1SJFA 3KJFB 2GGPB 2EK6A 4X62J 4BCAA 2QA1A 3TP2A 2E5JA 3FBFA 3Q23A 2C3MA 1LK5A 4CWBA 4P6QA 3M32A 2OHDA 4CTAB 2YNHB 1I94J 3B4MA 1NAQA 2VQFF 3PY8A 5IZHA 2P6SA 2UVRA 1YRTA 2Q6CA 1S1WB 4NLPA 4Y28C 5BXIA 2A6MA 2CDRB 1CULB 4USTA 4C8MA 4U6PA 2L9NA 3QFHA 2WBRA 3CDBA 1WC3A 2N3LA 4MKYA 9ATCB 4K4XA 2C2EA 2CZVC 1Y9OA 3MUVP 5D0EA 3W61A 1HNZJ 2ERRA 3E2EA 3PEJA 3RUBL 2CQBA 3A3OB 3H4BA 4NXMJ 4P52A 1MN9A 3L7OA 3GSIA 4YHHF 4IH5A 3MEDA 2YPZA 1FKPA 3M9NB 3GU0A 4ZPAA 2CG4A 4DV3J 3L7UA 2BJEA 5A8KA 3TAQA 3MEKA 4OLPA 4Y2IA 3G87A 4NYPA 3HSZA 1U49A 2V4JB 4DQPA 1X5OA 4J9RA 2VQEJ 1VI7A 5I3UB 1DTQA 2X3GA 2DJWA 4XDCA 1IBCB 1T3OA 4RW9A 2DXEA 3W62A 2L08A 3HPOA 5DS7A 1NKCA 3U02A 2H4YB 1ROFA 2W9BA 1YK9A 2AYEA 3R1LA 1FRIA 4DR7F 1WKJA 4CI0B 5D4PA 2RU3A 1X4FA 2C2OB 1XMQF 2Z2ZA 4DR3F 3KLFA 3NGUA 5LSLA 1UVNA 1S1VA 4JI8J 6FDRA 5GADU 2VA2A 2EC2A 3PVXA 1U6ZA 2DRDA 5KT7A 1L3UA 3IP0A 3TYTA 3ULHA 1ULRA 3KUEA 1NSAA 1TL7B 2OPRB 5J2QB 2FJBB 3PZPA 3L9ZA 4RR5A 1SPBP 3PYFA 3CJSA 2FB0A 3GV7B 2W2MP 1V3RA 1WEYA 2WSCC 1Y5LB 4ZA1A 4DR4J 3FKBA 3H8YA 2FC8A 1EZZB 1JNRB 3PR5B 1VLYA 1X4HA 2XGPA 4EFAC 3Q83A 3RAQA 3H0PA 1SJ4P 3CJ3A 2HRUA 4XTTA 3V6JA 1VRTA 4OZ2A 2FJVA 2RIJA 1VC6A 3TVYA 1QD1A 3FBEA 3BGLA 1F3VA 1NHVA 2ZBCA 1ZPVA 3OD2A 3P5BP 2FD2A 2QYCA 1F5CA 4V1Ak 4F36A 2EKNA 4F4KA 5ETRA 1OY9A 2UU9J 3GIKA 4CO3A 2IRUA 5KG2A 3AAWB 5DETA 4C11B 4PQUB 3JS9A 2N82B 1YLXA 3HHLA 1EETA 1VRQC 1RAGB 2DPIA 4LMZA 3DI6B 1RT3A 2FHOB 1T02A 2RUSA 4JI6J 1JKHB 3LGHA 4PEOA 1XC9A 2R7SA 2QC3A 2V5HG 2C2RA 2U2FA 4OJGA 4DSFA 3PW4A 3DLEB 4ANCA 2FY1A 2DYAA 1H74A 2A2CA 1X4AA 1M0SA 2VH7A 2LA4A 1E6YB 4WFXA 1NK5A 2W9CB 4YY3J 3DYAA 4RW4B 4R5PB 2IMOA 1VFJA 4M63A 1U8WA 1X4DA 4DLEA 2UXDF 3ZTQA 3QRRA 4QYRA 3GLJA 4DV7J 2JVOA 3S8SA 3AOAA 4F2SA 1R6YA 4LT6A 2QLWA 1MWQA 5D0GA 3H42A 4DV1F 3IRWP 3ZZ0A 5IT9U 2LVWA 2IDEA 2PT0A 4NRUA 1RT5B 1UMJA 4YB7A 2FVQA 1T3NA 3EGWB 3CUNA 1NNDA 2KDOA 2WSFC 2HQGA 4DN0A 1YIJS 2ZD1A 2XMJA 3FK4A 2W7AA 2J9DA 5AE1A 2CRLA 3A8JA 1S0VA 2L3MA 4A8OA 4USUA 3BEGB 2LA6A 1X0FA 2R2UA 1SIZA 4ZLNA 2CKWA 3PW0A 4GC6A 4ID8A 2I1RA 1C4CA 2KVQE 2CQ0A 4A8KA 1LW0B 1NCLA 3MCMA 3V6KA 2KT2A 4ZP7A 1W26A 2COLA 3KJVB 5E3QA 3SSRA 5HSPA 3PR4A 1UAWA 2GMJA 2GVZB 4GKJF 3NMAA 4WIQA 4AL5A 3T19A 1XR7A 4AE5A 3ZC4A 4DX6A 3VAHA 3BQ0A 3EWGA 1NJZA 4RL1A 2FHKA 2XLKA 4J9QA 1HPZA 2H3EB 3V6DA 1QSLA 3D6FB 4ZVRB 2MLZA 4JV5F 3F0NA 2OD4A 2AU0A 2XHWA 1PSDA 3NXZA 1VCTA 1C0TB 1VJQA 1GQEA 2V8PA 3DM2B 1BE4A 2CQCA 2HFUA 1S0MA 3MMBB 4UOCA 5M2UA 5ITHA 1BHNA 3BR8A 1D0EA 5GAHI 1F0XA 5CYQA 2RSQA 1RACB 3FEYB 4Q45A 2UXCF 1Q53A 4M5HA 1FT8A 2IA0A 1WDDA 5CABA 3BKUA 2V50A 3MM8B 3D54A 2LP4A 1C0UA 5IV3A 1KTVA 2ADCA 4YMEA 3KK3A 1IBLJ 5EWFA 4Q0BB 1SVDA 1JJ4A 3U7JA 2CAJA 3UE2A 2YNGB 3GONA 3UDEA 2WONB 3DRSB 4WXOA 3TJ9A 2JLGA 4BS2A 2C2MB 3KHHA 2ASJA 1RQ0A 2FLPA 1GNKA 3X3UA 2V9WA 1HKAA 3D3CJ 3RJMB 2HQCA 4F0HA 4OHZA 1F6TA 3MEGA 3GFYA 1URRA 2VBYA 1T9WA 4CLYA 2PD1A 2NXEA 2BJ3A 1WDTA 1RWUA 1RU1A 4N77A 4FDFA 1FE4A 1LKZA 1RWKB 3MMCA 5D4OA 3TJ8A 2DEJA 2OO4A 2XCPA 5L1IA 3QRPA 1X60A 5DGAA 2MKIA 4QIWD 1RT2A 1U2RA 1X9WA 1CJKB 2FPHX 4QWEA 2P9EA 2XI2A 2I8EA 5I3QA 1SJQA 4FYDA 1B0PA 4PXEA 4A8SA 5FIIA 2W7PA 2F40A 3N01A 4CYUB 1HWIA 1SKRA 3AJDA 3M2UA 1KHVA 3HSGA 1X9MA 3FVYA 1ITPA 4KPYA 3T9ZA 4RBVA 4OYXA 3VGTA 2OSQA 1EKRA 3K8VA 3BBFA 4NI2A 1NK9A 4CNYA 5DLFA 2KYZA 1RI7A 4MYTA 3WZ0A 3AA8A 1Y4ZB 3LWLA 2OEKA 3AQPA 3J7AN 2VC0A 3T1YF 2DT9A 2HKEA 3L7PA 4WTOB 2ZBRA 2OI2A 4KYZA 2KZZA 4I64A 3SBMA 2J0SD 2UUAJ 2M7SA 2V34A 2AWZA 3Q24A 4TLQA 2VPWB 4QIFA 2DHGA 4M5IA 1IKWA 4RW6A 3AXKA 4YS2A 1ELOA 4WU3A 3W2WA 5T7LB 3R2CJ 3KMSA 4OYMA 2CPFA 1L3SA 2C28A 2QLXA 2YWKA 4ZPDA 3HT3A 4B9SA 5D3GA 3J81U 2MKHA 2AX1A 1FKOA 1UPPA 4OZNA 4B3SF 1Q8LA 2Q1LA 4UTGA 2CVEA 2DNYA 2HRYA 3FQLA 3O1LA 2M5YA 2GO8A 3D0GE 3JSMB 3V4MA 1N5SA 1R6VA 3PYGA 4ZLPA 2CQGA 1RAEB 3HD1A 3ILOA 3DLGA 1FO1A 4NLXA 1HR0J 4URSA 4U7CA 1BGXT 1DRZA 1RCXB 1NK7A 4LSNA 3KNGA 1L3TA 4IFVA 1JNZB 2IJNA 5K14B 1RTDA 3QRQA 4ZVQB 1EQ0A 1RT4A 2H51B 4ECWA 1WF0A 1KLMA 4E0DA 3DRYA 1FFSB 4O44A 2KRBA 1GX5A 4HH0A 2CUYA 1XNQJ 4FXWA 1HBNA 3I4PA 1AT1B 1X5TA 3FZ2A 2UUTA 1FJEB 4M94A 4KGXB 2CPIA 1S1UA 1YG0A 4UUWA 2DISA 4M5GA 4DV2F 3BSAA 4N56A 4NZ6A 4KKOA 2F8HA 2W2NP 4YUDA 5DQGA 4RUAA 5FDLB 1UWAA 1NHUA 2DNMA 4PCQA 3CMAS 2AJFE 3FRYA 2GAGC 4OX6A 1DFDA 3C16B 3D66A 3B82A 2YQ1A 1FDBA 4XAKA 5KT4A 2ILYA 5I42A 3S6EA 2OMLA 1RA6A 3KMQA 3WX8A 4DZDA 1ZOTA 3AQOA 3ZNUA 2XSJA 3R5GA 1N33J 1ZPWX 3R1HA 3HKZD 2HIQA 2IFXA 2JL9A 2R7TA 2HPUA 4ZCKA 2VONA 3KLIA 4DLGA 5DO2A 4WJBA 4J9SA 2UVWA 1AW0A 2HHPA 4RPFA 4E8UA 3JXOA 5AXLA 4EO6A 4FBTA 1VQ4S 2W2QP 2NPIA 1T05B 3M7VA 4DPWA 1JLGA 4R0JA 2IYIA 2ZE2A 3MPUB 5SZTA 3CTRA 2KVIA 1WC1A 1SQEA 1JLQB 1S59A 1OS5A 3NY0A 2WVDA 4PXDA 4PRFA 1U24A 2YKNA 5EGYA 1XK8A 1VQ6S 1S9FA 4DUYF 2DIUA 1IKVA 4EEYA 2YQ3A 3MM7A 3VCDA 1YWXA 1N56A 4PZVA 1IKXB 4QCLA 4IRCA 1OWXA 3KTQA 7FDRA 1T0TV 5C25B 2B9EA 3PIOQ 4WWSA 2FYXA 3BO2A 1RTIB 1XMBA 4O3NA 2QT7A 2AV5A 2M8DB 4RLEA 4ZVSB 5J1EA 2WK4A 4LFCJ 4NLRA 1NO8A 2RNEA 2DNOA 1TKTB 4M1KA 1SB6A 1B7FA 2XZWA 3LH2S 1NB2A 1B64A 1OQ6A 1YSJA 4P2XA 1H7WA 2QLBB 1TL3B 4GRSA 2WAQD 1OIAA 2CQDA 4H4OA 2BE7D 1LXJA 2CPDA 2D3O1 2ASLA 4QU7A 1X31C 1OO0B 4I4BA 3EJMA 2F4FA 3OR2A 3R8YA 1WNEA 2K3IA 1XNRF 4ZPWR 2XO6A 3C66A 4U7UK 3BH7B 2J6UA 5KT3A 1T9XA 2NR0A 5ETQA 3CDUA 3CPWR 5E7OB 4DX7A 2W7OA 1PBUA 2WCXA 4HKQA 2CFXA 2WRMA 3R6GB 5IWAF 3D9BA 3K0JA 3HI9A 2C22A 2IRXA 2XWXA 2M9KA 3G2XA 4UQGA 3P96A 4YOEA 2BJ7A 3LA0A 2OTJS 2ZHAA 2LMIA 3DCAA 4PG5A 7FD1A 4Q8FA 4X4PA 2GMHA 1WTBA 4LSLB 1U1LA 5BR8F 1FEEA 4NCGB 1HBUB 3GILA 4UF4A 3Q8PB 4C8OA 3FUYA 1XBWA 2UUCJ 2HHHJ 2VIHA 5KG1A 3M6XA 1CJVA 2JRSA 5EWEA 4Q43A 1HFEL 1RWMB 3M30B 1LWCA 5GAEU 5HQMA 1S4EA 1UFWA 2EEYA 2G1DA 3DRRA 1KBRA 3ZNJ1 2ADBA 1U48A 4ZJLA 2F5GA 2JNJA 5A8RB 5CQGA 1NH7A 2DBBA 3AY0A 3QFWA 3LF0A 1AB8A 4F0MA 1UVMA 2EFVA 4IDKA 5HROB 1OSCA 4NX9A 3IMQJ 3M1VB 1VISA 1IR1A 1RTJB 4LF9F 2QGFB 5F41A 3N4WA 2QZ8A 4DX8H 3QJLA 2PFFB 4LR7A 3IRXA 2G2ZA 4J9VA 2UXDJ 4ECZA 2BJ1A 1CPZA 4A8QA 2YKPA 1PGZA 2KHCA 5GAHU 4WKRA 4KO0B 3B8HA 1JLCA 4ERDA 3UR3C 4DSJA 4C4WA 3V6HA 2MLYA 1LW2A 1SC3B 3JTPA 5KFWA 1K8AT 1KVJA 1Z1ZA 3CJ2A 4U7UD 1E6VB 1HLWA 4KFBA 4PUOA 1O5JA 3BSCA 4PAAA 3I5CA 1UJ4A 1S5ZA 4IKAA 2KYXA 5A2QU 4PG6A 4X64J 3FC9A 5D78A 4NLSA 3WHIA 4ED1A 5M2RA 1FRMA 4KC5A 1VQLS 3UDLA 1T11A 1TV6B 1KP6A 4CT8A 1WC6A 1N48A 5H9EK 1FESA 1YRXA 4ZOSA 1FK9A 4ZP9A 3WC2A 3HHNB 3IS9A 5RUBA 3EE3A 4KHPJ 1S6QB 1N5TA 3LP1A 3R5AA 4YQWA 3HHKA 2ZUAA 4DOZA 3AA9A 2Y1LB 1M1GA 3LANA 2GIRA 4GO5X 3DRPA 2ZM6J 3K17A 4PQAA 2QL9B 3DLKB 3BF4A 2RVJA 3JYTA 3KK1B 1S7HA 2DNKA 4HDGA 1R89A 5DM6Q 2RRAA 4X66F 1D09B 4BWMA 2O3DA 3ENVA 3TAMA 3A8IA 5IOLA 1D9DA 2ROEA 3NNCA 2QO3A 5L9NA 3D1OA 3SEOA 3GYGA 2UXCJ 5LMNF 3M2VA 1W2IA 4ID5A 4JI5F 3Q0AA 4Y2CA 3M2RB 2VF3A 4NEZA 3PM9A 3CCSS 2HMIB 1YJWS 2FHJA 2HFZA 3CXCR 4CNZA 5I4MA 4CLLA 1GMUA 4RBTA 3S7RA 4KHMA 4QR1A 1SJRA 2NXUA 4A46A 3GV8B 2LQ5A 2CPHA 1TL5A 3MAHA 1P27B 1G1XA 1YJTA 4B9VA 3TANA 4C2MA 2DY9A 5MLCV 2F4VJ 2CYYA 2B9WA 3PX6A 1R0CB 2ATCB 4FN5A 1YTYA 3RAXA 1RHQB 2EPIA 5F3TA 3C14A 1YJ9S 3UCGA 1SJ1A 4ZP8A 2BJ9A 2BE2A 4KIAA 4ECSA 1DTTA 1FXDA 5CAAA 3W3SA 1YJ7A 3ETMA 3CD7A 4N7TA 2VASA 2DNRA 2XLIA 4MKVA 3IG1B 4DXLA 1RHUB 3JB9k 4USJC 4ALZA 2AJQA 2CQIA 2E1PA 4MIWA 2NXJA 2X7IA 2I6WA 4ES2A 5H9FK 1RAHB 3EZUA 3UN3A 1EP4A 1EKSA 2KJWA 3KFWX 2MDAA 2BYCA 1JLAB 4WYLA 1CC8A 2F3JA 3G6XA 1HBMA 2AGQA 1H3DA 5ETMA 4R0EA 3MM9B 4U8YA 4ZCMA 1Y5NB 4ED4A 5EX0A 4PG4A 5C24A 4IG3B 4DCOB 3X1LB 4F8RA 2RD5C 4ZMMA 1KD1T 4RW7A 2WTFA 3R3TA 2QX0A 4DUZJ 4NA2A 2AX0A 2V8DA 1Z2LA 2X1FA 3IXQA 2W2PP 3CJRA 4F02A 1HQ2A 1N54B 3VALA 1VR6A 5E33A 4LBIA 2FQQB 3TEGA 3LAKA 3SQOP 3C6TA 4BDPA 3W9HA 2X51A 1NDLA 1S48A 2DGXA 2M8HA 4HACA 2HHSA 2RDDA 4B3SJ 3K5NA 3HZEA 3NKYA 1CVJA 3LP0A 1RKIA 2DHSA 1ZYQA 3NWGA 2RDJA 3C19A 2HHXA 3OL8A 4I2PB 5DLGA 5LXYA 4PWDB 5KFOA 3NWRA 1N34F 3VWSA 2V2VA 1YHQS 4KY3A 3G6ES 2YKMA 1Q79A 2VODA 2DHAA 4DL0C 5KFAA 4ZVFA 1RT6B 3FDSA 4P7TA 1U47A 2HNZB 4A8FA 1KQKA 4AD6A 4K4ZA 5JVHQ 2XSFA 3IR6B 2HS4A 4AL7A 2MMYA 2DCLA 4KH0B 3KLGB 1PC4A 3CC7S 2DNPA 1QAYA 1S7IA 3O8WA 4DV2J 1JMTA 2IC3B 4J9UE 3DDNA 4WF9Q 2CPJA 4JI3F 2ATLA 2PIIA 1JLEB 4DR1F 3OSPA 2DVIA 2B8PA 1GXTA 3NGTA 2FZGB 5E3PA 4OYZA 4ZLLA 2N7CA 1V9OA 3BJYA 2KO1A 1QE1A 1EAYC 3R9LA 3BDPA 4DDFA 4C8ZA 1Z2ZA 3R6LB 2L48A 2VG7A 1N5QA 3DLLQ 1H0HB 3RYLA 1WOPA 3CCTA 4Y3CA 3OTCA 3OT9A 2KKHA 5IM0A 2ZITA 5HI7A 2MKSA 2IA6A 2XB2D 4L73A 5CZXA 1BQMB 3OR1A 4RJVA 4FS2A 2AD9A 3V2UC 5JXSA 4M5NA 1HWJA 4JI0J 2DNZA 5FLXU 2KM8C 4C9DA 3AJ1A 1S9EB 3CCES 1KDNA 2YNFB 5LMUJ 3CD0A 1IQTA 4RNNA 1N32F 5SUHA 3SSSA 4PG8A 2V4QA 5F8HA 1RT1B 3PX0A 2HLTA 3PJWA 3DOKB 1B0VA 2HK3A 3I0SB 5IT9Y 4H4MB 1UW9A 1EB0A 3IO1A 2LXUA 4ICLA 4LF5F 3SDEB 1U1QA 4NA1A 3CB4A 3QATA 5IT4A 5JVGQ 5KFKA 2G9OA 4WE1A 4ES1A 5KG4A 3QAUA 3QIPB 2ASDA 3T9NA 3TNVA 1TU0B 2FJWA 2AEFA 2MZSA 3LGNA 5J2QA 2O67A 2OPRA 2B51A 3GIIA 5D77A 1EX8A 4WP3A 2PI4A 5AXMA 3M8YA 2HZVA 1R0AA 1RT7B 1TKZA 2BUNA 4ZVUB 3BV8A 4MK8A 4J5OA 1KTQA 4OV1A 2RMLA 2R7UA 2E44A 2QL7B 2VDIA 2XS7A 4TYAA 2GQ2A 1IWGA 3ZZZA 4QW8A 2LECA 5LSOA 1HW9A 4FF1A 5F8NA 4X62F 1KQFB 3NG8A 2WVEA 3TAPA 5HVFA 3HJVA 2XS2A 1XNRJ 3DMJB 4UW2A 4WIIA 5KFEA 3CCLS 2MSSA 3OJUA 1KLNA 2DEIA 1I94F 3RR7A 2A3JA 3BBCA 1PBAA 1HQUA 2PE8A 2ZZTA 3CCWA 1UA0A 2RQCA 3IN5A 4NASA 4B9UA 3CULA 2JSXA 3UI3A 1HBOB 2B6AA 3W66A 1TAQA 5IWAJ 1WOSA 1X4EA 1HYSB 3BYPA 1BMQB 4ZVHA 3QMQA 1S49A 4PQUA 3PRDA 2ZWPA 3EZ5A 3T5JA 3BH6B 2RB7A 5GMEA 2YH0A 5J2NB 4Q8EA 3PIPQ 3E01B 3UCUP 5G4DA 4NE9C 1HMVB 1HNZF 1CJUA 3MURP 3SZ2A 4MKAA 3PG9A 4I7FB 3RAMA 1X4BA 3DLHA 4NXMF 3ET6A 4HHUA 2OAUA 3T5LA 4ECXA 1S10A 1CJTB 3NCPA 4B02A 4I68A 1I6JA 4DV3F 3TVZA 2VV5A 3KXDA 3IBWA 2NXNA 1UTAA 5F9NA 1JK9B 3GIJA 4DHVA 5ETSA 3H5XA 1S9GB 5DZ7A 3Q86A 2VQEF 1BQNB 1NDKA 4JYAF 4C8NA 1BC6A 2K1RB 4O0NA 2KXNB 2HSEB 2H65B 3TEHB 1N88A 2ZC4A 3TQ1A 3U1NA 3NAHA 1HI0P 1ZZNA 5IS2A 2Z2LA 1WELA 3HKWA 2XMTA 3N5BA 4JP8A 2ZVSA 3N0VA 3NEKA 5HMXA 3AH6A 3ISZA 1SJ3P 1SUQB 3O44A 2E1MC 3KK2A 3ENQA 1JB0C 1U0HB 2AW0A 1NEEA 4ILMA 1QY7A 2P5VA 3DOMB 3SXLA 3KJVA 1BY9A 4WFNQ 1MMNA 1NRKA 4R8UB 4WFBQ 4OQJA 4DI6A 3V4IA 1GT8A 5CZVA 2YNIA 3KOAA 1UFLA 3CJ0A 1S12A 2NUHA 3UVJA 2J8SA 1UW4A 4OX7A 3EUNA 2V6AA 3L09A 3HFZB 3H90A 2QG9B 2CJYB 2R7QA 2EG2A 1NHKL 2QSFA 1I1GA 1DZ5A 1FHTA 2RRBA 3T6JA 4C8LA 3AHPA 1Q8IA 3RW6A 4ZCIA 3GFHA 1TTHB 3G4SS 5ETLA 3KG4A 4P75A 1Y3KA 2KB2A 1S4FA 1B4SA 2G0CA 2F1FA 4HH1A 3O2IA 4XK8C 1HHTP 2IPOB 4TN2A 3G71S 3OFFA 3RBXA 3PHTA 2ZBQA 4ECTA 2MHEA 1NK6A 1QAIA 3LWMA 4IRDA 4UUXA 3J81Y 3MM5A 2J9EA 1LNQA 1U2CA 2UU9F 1F60B 1LWFB 2CXEA 3A1YG 1H73A 5DZ6A 4WCEQ 2XNRA 3UD3P 1ZAXA 2E5IA 4LRDA 1KVKA 2HBRB 3HULA 2CPYA 3Q89A 2LEPA 3IWNC 4BWJA 4JV1A 3ONQA 3M32B 4JI6F 2B0GA 5CD4H 1TKDA 4RKUC 4RX6A 1Q82T 1RWOB 1F1BB 1IKYA 2EFNA 4X66J 1WSVA 4FKXA 2J5AA 5L46A 3H5YA 2DTJA 5C42A 3I96A 2R7XA 4YY3F 4JI2J 4DR2J 2EBGA 4C0BA 3PYEA 1FX4A 2BW7A 3Q2TC 3D6HB 3PACA 1JLBA 3VAMA 1OJ4A 2LFVA 2R2TA 5E2QA 1DLOA 1WHXA 4IYQA 3L95X 4DV7F 3MECA 1DARA 3ZZYA 3QPIA 2VJVA 5B0AA 4M5MA 1Q8KA 4TQSA 2KFYA 2RH3A 3UWTA 2A6OA 4X4NA 5A0YA 4C8KA 3KKFA 4Y00A 4OYPA 4I56A 2IVFB 2F63A 4YDXA 2IDLA 1FRXA 2VICA 4QPXA 1UP1A 3RGIA 4F7VA 5HK4A 1RP5A 2JX2A 4FYYB 2XYHB 4TU9A 4RNOA 4L6V3 4F3MA 3OXGA 3K5LA 2AT1B 4GVBB 3VVUA 5EN1A 2YH1A 1J27A 2MQPA 2QMUB 1FWKA 4DMZA 2YY3A 2VUGA 2WSEC 4NZ7A 3Q8UA 1U8SA 4RW9B 2FIUA 3ILJA 5CYMA 3IAS9 4WFAQ 3T3FA 4TU8A 3IBFB 3CSKA 3EDRB 4P73A 4O3PA 2VBWA 1ZS6A 2MZJA 2QYGA 3NS6A 4C7QA 4MKBA 5ETKA 3NGRA 4O3QA 2ZHBA 2DH9A 5B08A 1O0PA 4IH6A 4K59A 4MH8A 3A4TA 1NXIA 3N28A 4BC7A 5F8IA 3KLFB 4NLDA 4Y34A 2DB1A 4X84A 1S1VB 2W8KA 3JAMU 3F41A 4DV6J 2KFNA 6FD1A 2EK1A 1RK8A 3AD8C 2AF6A 1FDDA 4LF8J 5A6PA 1QM9A 1A7GE 3ZZPA 1N5YA 2IJRA 3H5UA 1KQSR 2ZBIA 4LBHA 3GYNA 3R5DA 2GA7A 4K2JA 4G1PA 3IM9A 4UZCA 2AGPA 1KQGB 4ES3A 5LT5A 2UUBJ 1B70B 2QN6B 1XEZA 4FS1A 2B8QA 3D68A 4CLZA 2EBEA 2Y8WA 4OI2A 2QA4S 3T1HJ 1RBAA 2CQ4A 3GJQB 1RAIB 1HHQA 4M5DB 1VYAA 5ADZA 1C1BA 4C48A 4IH7A 1Q86T 3MUMP 4O4GA 1UJ5A 4I2QA 3CC2S 1FRKA
chains in the Genus database with same CATH topology
1S1TA 4B3TF 2ZKTA 1HBNA 3H4DA 3I4PA 4CQ1A 1LK7A 2BVZA 5L9XA 1X5TA 3QO9A 3FZ2A 2B6AB 5D6GA 2IVMA 2UUTA 1FJEB 4M94A 2CPIA 1S1UA 1YG0A 4UUWA 2DISA 5A6WA 4DV2F 2Y1IA 1GXLA 3BSAA 2QEXS 4N56A 4NZ6A 3QGPA 4LF7F 2N7YA 4JI2F 1FJCA 4DR2F 3MTKA 1K1SA 2F8HA 2XMKA 4KKOA 4CCHA 1EETB 2APOA 3UQSA 3C6UA 4YUDA 4JV2A 4K4UA 1MU2B 3J7YU 3SQGA 3C6UB 3HHEA 3J80Y 3MGJA 5F0WA 5DQGA 3SCIE 1VGYA 4RUAA 1RT3B 1NK0A 1TVRB 5FDLB 2DHXA 1GXUA 3BQ2A 1NHUA 3FSIA 3MZIA 3BGUA 2DNMA 2FUG9 4PCQA 2LXIA 2WOMB 2FVCA 3CMAS 2Q43A 5M2PA 4OFZA 2AJFE 1S72S 1H2VZ 3FRYA 2HMIA 4OX6A 2GNKA 3BS9A 4DF4A 2OIHA 4MTPA 4DBQA 1P9QC 1R8PA 4DS4A 2DCUB 3DRXA 1DFDA 3OUYB 4RNHA 4TYBA 4FVCA 5K8OA 3I6PA 4HYKA 3B82A 1N4LA 1WEZA 2OTLS 1FDBA 4XAKA 2CZ4A 1H2TZ 5KT4A 2PMHA 4UQTA 1LV5A 1ZM9A 2XMMA 4P2SA 1Q7YT 2ILYA 5I42A 3MMAA 5D8HB 5BJRA 4KGKA 2J0WA 4G1IA 3S6EA 5I42B 2OMLA 3MMAB 2MZ1A 2J6SA 1FXLA 2ZDPA 4ETZA 3WX4A 1JLFB 1RA6A 5KOWA 1MROA 3KMQA 4AL6A 1S6OA 3NBPB 3DYAB 2BJDA 4HT5A 5C5JA 1ZBTA 1ZOTA 1TKXB 1VC5A 5L39A 3AQOA 4KV8A 2LEAA 4LIWA 4F4XA 2ZFHA 5KT2A 3SV3A 2YX4A 5KG6A 4RW8B 2ZDOA 3MEEA 4F4ZA 2XSJA 4DQSA 2FGOA 4J9KA 1ZPWX 4OI0A 3R1HA 3CJ4A 4Q2LA 4QWCA 4B3OA 4UY85 3HKZD 2IAJB 2HIQA 2LYVA 3ISNC 4OI4A 2IFXA 2JL9A 2R7TA 1HWLA 2HPUA 4ZCKA 2VONA 3VAKA 3KLIA 4DLGA 5DO2A 1RYRA 4WKYA 4PPZA 4WJBA 1KR4A 4J9SA 2UVWA 4EZ6A 1AW0A 2HHPA 2N3OA 3CF5Q 3RB4A 4E8UA 3ZZUA 5AXLA 1RAJA 2HS0A 4Z37A 4EO6A 2JJ4D 2ACYA 5IXUA 2XMUA 1VQ4S 4FBTA 2HHWA 3RBDA 2NPIA 2KN4A 2VA3A 4WU2A 4R25A 4ECRA 1T05B 4KAIA 2DGTA 2ZOGA 2B5JA 4ECYA 4J9NA 3TA0A 2B5JB 1JLGA 4R0JA 2IYIA 2ZE2A 1FDAA 1JLGB 2B4PA 4BBYA 2JEGA 5SZTA 3CTRA 2KVIA 3VQSA 1H7XA 5EX3A 1XTZA 1SQEA 1JLQB 3C8YA 2AYMA 1OS5A 2MKKA 3PFEA 1U6FA 2ZD1B 5F0UA 4PXDA 4PRFA 3HHLC 1JXLA 4OZ0A 1U24A 1QLNA 2YKNA 5EGYA 1XK8A 2R4FA 2DGWA 3OPKA 1VQ6S 3OFHA 1S9FA 4B9MA 2J0XA 1N8RT 1S76D 4DUYF 3J7A1 1L3KA 4KJIA 4J37A 5GAGI 2R7OA 2DIUA 1IKVA 3IG1A 4EEYA 2GJIA 4TY8A 2YQ3A 3MM7A 2AJ0A 3VCDA 1IKXA 1FTRA 1HHSA 1YWXA 4F3QA 1N56A 3MR2A 4IR1A 1IKXB 4QCLA 2R9LA 4IRCA 5B7WA 1OWXA 3KTQA 2CPXA 2DNNA 3CMES 2HQ3A 4ZPTR 7FDRA 3KK2B 3H20A 1SL2A 2YWFA 3M8PA 5HBMA 3HDSA 5F8GA 3NNAA 5C25B 1WEXA 4X4RA 2LDYA 3G96A 1RTIA 3PIOQ 4ATNA 5KTQA 3BO2A 1VBYA 3BGRA 3MI7X 1RTIB 4LFAF 2FJDB 1XMBA 1N0VC 3DN9A 3BGRB 4O3NA 5BYSA 5DG7A 2QT7A 2AV5A 4QIVA 1VQ9S 4GO7X 2M8DB 4JI8F 4RLEA 1GTEA 2HWTA 5J1EA 1KEKA 2WK4A 4ZK7M 1VK8A 2GV1A 3R5BA 4N41A 4DV6F 2MY8A 3UNGC 2SXLA 4J9PA 1R27B 1NO8A 4NLRA 3TRGA 2RNEA 3MM9A 4DPOA 3N6LA 1R8AA 1KS2A 3V4IB 1VHFA 4I67A 3E8OA 3OTOF 3QWPA 2YNIB 2XC9A 2DNOA 2ZH7A 1TKTB 4DFPA 4IG3A 4M1KA 4DSLA 1MWYA 1SB6A 1Z4UA 4L3NA 2LQJA 4LF8F 4AFFA 4QIGA 2IM0A 2XZWA 1B7FA 3LH2S 5IT0A 2M88A 1KFDA 3IR5B 4TY9A 1B64A 4DL4A 1KN6A 1UVIA 1T95A 1OQ6A 1X0PA 1QUPA 2CPEA 3K5OA 4K4YA 4IRKA 1YSJA 4RUCA 1H7WA 3OW2R 2D3ZA 1UKUA 1TL3B 3QLHA 3G8SA 3KHGA 2PSZA 5GVQA 4DR4F 3SSQA 4ZCLA 2JFDA 2WAQD 4Y6IA 2BANA 1OIAA 4ZS6A 1Q78A 1LQ9A 3OTBA 3PFOA 3CCQS 3RBEA 2KRRA 1D8ZA 2YWHA 1HR0F 2O66A 1ZZFA 5KG0A 2UUBF 4WK1A 3V6DB 3P3DA 3FGVA 1VBXA 2CQDA 2YWGA 5KG7A 5KFFA 3KG1A 4H4OA 4IQMA 2A2DA 1CEZA 1LXJA 1X5PA 2CPDA 3H5SA 2W4PA 2J9DE 2CDQA 4YDDB 5CYJA 1FRLA 5JUMA 3NGDA 2ASLA 2R8KA 4QU7A 3EXYA 2PMZD 1GAOA 4KTQA 4WXWA 1OO0B 4I4BA 2RQ4A 2MZQA 4I69A 3MFIA 4DL7A 1U1KA 3SCKE 4D3HA 3MD3A 2DO4A 3T1HF 3OR2A 1WNEA 4OX8A 3OQ2A 2EFOA 2K3IA 4QJVA 4JI1F 4ED5A 5A2QY 3Q22A 1XNRF 3OXLA 2FVRA 4ZPWR 2CJAA 1H98A 2K7JA 2JOQA 3C66A 3IGVA 4K0KF 5E0OA 4A8MP 4U7UK 4URGA 2OJ3A 3Q8SB 2J6UA 5KT3A 5IFMA 2HWIA 4CH1A 2IBKA 2J7KA 2NR0A 4QIEA 3CDUA 4ZP6A 4CO4A 3PKMA 4K5SA 3AJ2A 3CPWR 5E7OB 3MM5B 5E3AA 2XS5A 2W7OA 2OH2A 5DJBA 2WCXA 5L38A 4MFBA 4HKQA 5J1NA 1S6PB 4H54A 4AUKA 1FXRA 2CFXA 3VAIA 2WRMA 3SMZA 5CYQB 3M6UA 1XNQF 2MZRA 1U45A 4EBEA 2F9DA 3FQKA 4RWXA 3ICLA 2L9DA 3U1LA 4JYAF 5IWAF 1AFJA 3K0JA 3OL9A 4F4WA 3HI9A 1VJWA 3PV8A 2C22A 3MHYA 4I2PA 5HP1A 2IRXA 4FP9A 4I1TA 2XWXA 2M9KA 5B0CA 4UQGA 3KLVA 3VAFA 4G1QB 3P96A 3I56S 2MQLA 2FLOA 1NJYA 3M8RA 4PXCA 3OVSA 4PWDA 4YOEA 5F8MA 1C0UB 4DJBA 4EYHB 3M6WA 3UR0A 4DQIA 4HL9A 2IMWP 4X4OA 1S0NA 3KK3B 2OTJS 2ZHAA 2LMIA 3DCAA 4PG5A 3WC0A 7FD1A 2R8IA 4DL3A 2GGPA 4Q8FA 4X4PA 2GMHA 3J7ZT 4KBIA 5KT5A 3IWXA 4LSLB 5L1LA 5DDPC 1WTBA 1U1LA 4FF2A 5BR8F 1WG5A 2DD8S 2LQ9A 1DBDA 1FEEA 4NCGB 4F67A 1Y5IB 1VQ5S 2UV8G 1CC7A 3LUYA 1HBUB 3PDNA 4RU9A 3GILA 3RR8A 3Q8PB 4C8OA 3HHDA 1XBWA 1UVKA 2HS3A 3DNCA 2GHWA 3NLCA 5KG1A 4OLOA 2Q6BA 3M6XA 5KFTA 3CEDA 4MK9A 2BW2A 3IAM9 2JRSA 5EWEA 2FLNA 4Q43A 1R7IA 2VFTA 1IKYB 4FNIA 4CTAA 3D2WA 3NNHA 1HFEL 2YNHA 2Y1JA 4TXSA 1RT6A 3QGIA 1FA0A 1REVB 3M30B 3CD5A 1LWCA 4C97A 1M1KT 3PO5A 2ILZA 2BQRA 1LWCB 5C42B 4QBUA 2KM8B 3QGHA 1V6HA 4C8YA 4YEAA 5GAEU 1KHWA 1VQYA 1UFWA 1S1WA 2ZOFA 1N52B 3KLGA 3MEGB 2G1DA 2ABYA 2C42A 5GADI 1VOMA 1MW7A 4CIOA 3DRRA 5KFJA 1KNZA 3UFCX 3US5A 3BO4A 4WZMA 5KFIA 4WFZA 3I5AA 2B9YA 2ADBA 1U48A 2UZAA 4WYWA 2BQUA 5A8RA 2AYGA 3TUJC 4B9TA 1JLBB 2IC3A 4DR5F 5A8RB 1IUJA 5LL6d 2VPYB 3THPA 2I5JA 1RA7A 1DLOB 2KZMA 5CQGA 2XY7A 2Z0GA 1NH7A 2JDJA 3OVBA 1N33F 2ZH6A 1JLEA 3M9OB 1KRPA 3MMCB 2QA4G 3NMRA 2DBBA 3AY0A 1F5AA 3MECB 4EYIB 2RF2A 3LF0A 1K0TA 4C3KA 2E1AA 2MKJA 2D7SA 2B7CB 1VS3A 1UWBB 2W25A 4DWIA 2VB6A 1V3ZA 5FD1A 2UUWA 1RT2B 2ZH9A 2LKZA 3LAMA 5A0YB 5LSRA 1YI2S 3S1TA 3TUIC 1UVMA 1UEUA 2E7WA 1YQHA 3CCMS 4XO0A 2EFVA 5BYQA 3ZFVA 4B08A 1MMLA 4IDKA 5HROB 1U1RA 5KOXA 1OSCA 2ZH5A 1J5OB 2OPPB 3ZZOA 3H98A 4NX9A 2FLLA 3N9UC 2W9AA 2FVPA 3M1VA 1RGVA 3CCJS 3M1VB 4AXIA 3MWBA 3F73A 2GQCA 3R27A 4DQQA 3CCZA 1RTJB 4ELUA 2ASYA 2CQPA 2DGVA 4ED3A 1PC5A 5KFQA 1Q8BA 3MPVA 4LF9F 1TAUA 3M2UB 2R7RA 4ZPBA 2N4DA 3JTOA 3N4WA 5F41A 1Y00A 4X2BA 2QZ8A 4DX8H 3QJLA 3OTEA 2PFFB 4GKKF 3MTJA 3PHEA 3KHRA 3IRXA 5KFUA 4ECZA 1CPZA 4A8QA 2YKPA 5EHHA 4HTIA 1PGZA 1DQ8A 3VAJA 2KHCA 5GAHU 3DOLB 4WKRA 3TA2A 5H9EJ 3GZ7A 4KO0B 3B8HA 3NRBA 1JLCA 1HNVB 3PW7A 1U1NA 1FKAF 4ERDA 3UR3C 4ECUA 4DSJA 4C4WA 2V4JA 2R7VA 2A10A 3V6HA 1LW2A 3AB2B 2BRLA 5E3CA 2HNDA 2RQKA 1LW2B 2YNFA 2N4CA 3JTPA 1TQLA 5I3UA 4HHJA 4LFCF 3QWUA 3FEZA 5CYMB 3PEHA 2AJ1A 3TOQA 5DQHA 1HD0A 5KFWA 1SKWA 1N5VA 2E1CA 2GHPA 1OQ3A 1K8AT 2ZJPQ 3ITHA 1KVJA 2HGLA 1RT1A 3MAQA 1Z1ZA 2FHJD 3CJ2A 3DOKA 4EZ9A 1E6VB 4CO2A 4K50A 1N36F 3J7YI 4KFBA 2ZJRQ 3I0SA 2LCWA 2UVUA 2RJZA 4LUBA 4PUOA 1AFIA 1O5JA 1QJHA 2PDAA 4MYUA 1X8DA 4H4MA 1HNXF 4OJHA 3LQVA 2CQHA 4OHWA 1TL1B 3HF5A 3FMBA 2J9CA 3BSCA 3I5CA 3SDEA 2J76E 1TZ0A 1IKWB 2JZ5A 2MQMA 3AB4B 4DEZA 1UJ4A 4RW6B 3RZAA 4IKAA 2DR5A 2X1AA 1XMOF 2KYXA 3QIDA 4FNHA 3W2WB 4O4RA 2VFSA 3OL7A 5F3ZA 4NCBA 4PG6A 2B4VA 2BZ2A 1WD6A 4DG1A 2OPQA 5D78A 4NLSA 1KSPA 4DG1B 2MQNA 2XI3A 4ED1A 4OMFG 4Q44A 1L3VA 5M2RA 4DFJA 5D3GB 2DNQA 4JI7F 1FRMA 1IR0A 1MWZA 4X65F 1YITS 4ELTA 1Q7LB 4KC5A 3QIPA 5E5NA 4OIXA 2XWYA 1T03B 2XO7A 4RZRA 1VQLS 1T7PA 1FKOB 2Q79A 2MQQA 3UDLA 1TV6B 5B0FA 4CT8A 1YGYA 1N48A 1N5YB 4D3GA 1FESA 1YRXA 4ZOSA 1FK9A 5CH7B 3CCRS 2BM0A 1FK9B 2HGMA 5KFPA 4ZP9A 4NPOA 1SL0A 3WC2A 4EBCA 4NLGA 5U47A 3HHNB 3V81A 3IS9A 4YR0A 5HL7Q 1FNXH 3D5MA 4M8LA 3UW1A 1U1OA 2CIMA 2HHVA 3DLGB 3NP5A 1KVIA 2Q3PA 3IGNA 1HQEB 5B09A 3EPGA 1IN0A 1S6QA 4URQU 2M4MA 1S6QB 1N5TA 5AJ3F 3LP1A 3TW0A 1M5OC 2YX7A 3R5AA 2KI2A 4LSNB 2LDIA 3QAEA 2RDIA 2RS2A 1K73T 4IFVB 4YQWA 3HHKA 3CIZA 2IHR1 4DFMA 2O1PA 4DOZA 3AA9A 4HTJA 1RTDB 2Q66A 3VR1A 2VOPA 2R8HA 2KFZA 1BLUA 3HFKA 3RW7A 3DHXA 3FFIA 2NPFA 3LANA 3NCRA 1FCAA 3H2VE 5AE2A 2GIRA 4GO5X 3DRPA 5J2MA 1IBLF 4PXBA 3BREA 1KLMB 2PA8D 3A8EA 5J2MB 4PQAA 4ETXA 1Q16B 1C1BB 1TL4A 2HZCA 3RTVA 3S01A 3KYLA 1HARA 2JC1A 1TFWA 3QJJA 3HM9A 1D9AA 2UXBF 3DLKB 3BF4A 2RVJA 3NAIA 3JYTA 4FXDA 4O4GB 3KK1B 4EWTA 1AROP 1S7HA 1WHWA 5KFYA 4I2QB 2ZH1A 4OI3A 2DNKA 3SCJE 1PO6A 2ZH4A 1O51A 4HDGA 4NL5A 4P7VA 1R89A 1F5BA 5DM6Q 3CD6S 2DH8A 3DMJA 2UUCF 2HHHF 1RTHB 1U25A 1NKEA 2RRAA 2EFPA 1S1TB 5CXTA 1HBNB 4X66F 3G6VA 3C46A 4BWMA 4NWBA 3QO9B 2O3DA 3CJ5A 2ZJQQ 3ENVA 2BOPA 3TAMA 3QJPA 1S1UB 3BB5A 1GX6A 4LF4F 1D9DA 2ROEA 3MPWA 1TFYA 4OZJA 3NNCA 1ZETA 2QO3A 5JJBA 5L9NA 2GJ2A 4PR6A 3CCUS 3D1OA 3BO3A 4KKOB 1HBOA 3SEOA 2KU7A 4KSEB 5LMNF 2ROGA 3M2VA 1K9MT 3UPFA 3SQGB 2A18A 1HYSA 1W2IA 2J6TA 2MYFA 3MPYA 4ID5A 1N0UA 5HMYA 4JI5F 3EXCX 4C11A 4DF8A 5AXKA 2OSRA 3TX8A 1DHMA 3M2RA 3Q0AA 3H40A 4Y2CA 2QMWA 3JSRA 2W4DA