4LF7F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lf7F00
2UXDF 3R3TA 1XMOF 4JI0F 4DR6F 5IWAF 2B7BB 1N36F 1I94F 4DR3F 4KHPF 4LFAF 1FKAF 4DV6F 2KJWA 4X65F 4X64F 5BR8F 4X62F 4X66F 1N32F 5AJ3F 4JI6F 1G7CB 2ZM6F 1FJGF 2F4VF 2BVZA 1IJFB 1XMQF 4DV3F 3T1HF 1IBLF 4DV7F 1HNZF 3ZZPA 1VMBA 2HHHF 5LMNF 1IBMF 4B3MF 1XNQF 1J5EF 1QJHA 3OTOF 4NXMF 4NXNF 1CQNA 2KJVA 2UUAF 4JI1F 4DUZF 4DV1F 4B3RF 4LFBF 4K0KF 2E5LF 2UU9F 4JYAF 1N33F 4JI8F 4LF5F 1IBKF 1CQMA 2YY3A 4DV5F 1HNWF 2VQEF 1F60B 4DR1F 1B64A 4B3SF 1IJEB 4DR2F 4JI4F 4LF9F 4LFCF 4JI2F 1N34F 4JI3F 4DV0F 5LMUF 4JV5F 3T1YF 1G1XA 4GKKF 4LF4F 4DV2F 4B3TF 1HR0F 1LOUA 4DUYF 4JI5F 2UUBF 1GH8A 2RJZA 4OX9F 4LF7F 4DR7F 2UXCF 4LF6F 4DR5F 4AQYF 4DV4F 1HNXF 4YHHF 4YY3F 2B7CB 4JI7F 2UXBF 1RISA 4DR4F 2UUCF 4GKJF 2BXJA 1XNRF 2J5AA 4LF8F 2VQFF
chains in the Genus database with same CATH superfamily
1R6YA 2WHOA 1NLKL 2LQBA 1HNXJ 5K14A 1GMUA 3ELHA 4DPUA 5F8NA 3CJQA 5D4LA 1XJWB 1CC8A 4ZPCA 1VIXA 1CJUA 2PE8A 5CAAA 1T9VA 2DNOA 3H4DA 5AE2A 1IBMJ 1XMQF 4IUFA 5G0RB 4QPTA 2D3UA 3N6MA 1YGYA 4X64J 3PJXA 1YRUA 1REGX 1QDUB 4PUOB 2KM8B 3THTA 2YWHA 3IA0A 4K4UA 1JLGB 2YNFA 5E3AA 2M70A 5GAEU 4JI1F 3F41A 2FTRA 4MKYA 2CQDA 3SXLA 1FX4A 1MN7A 2CPXA 2UU9F 2KH9A 3MM5B 1RA7A 4KGXB 4C98A 4P2FA 1H7XA 1S9GA 2DGWA 5C24B 4PPZA 4Y2MA 3IM9A 4KE5A 2OTJS 4LF6F 1ELOA 4DR5F 3HHEA 3MM8A 2XMMA 2HBQB 1S4FA 1FE0A 3P45B 3NGUA 1SUQB 5G4DA 5KFCA 3G8TA 3FRZA 4DR7J 1YBAA 3PYGA 4P2XA 2XO6A 4DV6J 1R3NA 4Y3CA 3RB4A 1WKKA 4NPOA 5D6GA 5HJYA 3H98A 2Q1LA 4LF8J 1W25A 2V2KA 1CJKA 3RW6A 1KVKA 2F8HA 1TL4A 4DSJA 3EM1A 4H4KC 2R2TA 4RU9A 3H20A 2VJVA 3PXGa 4P72A 1DHMA 4CLZA 1R31A 1ZETA 3HKWA 3R2DJ 4F4WA 3CC2S 2ZVSA 4J9LA 1RAGB 3LP1B 2NPIA 3DN9A 1U1MA 2GHWA 1SC3B 2QN6B 3NL0A 1HNWF 4Z7CA 3VAKA 3E3XA 2MQ8A 3MFHA 2KG1A 4OHZA 4A8OA 3H8YA 4JV5F 1JK9B 2QYCA 2PEBA 4DL5A 4TY9A 4K4YA 3R7SB 1Q79A 4WWSA 4RUHA 4ZLLA 2Y1JA 1FERA 4P2MA 4XIUA 1L3SA 3QIPA 1YVFA 2V50A 4ZVEA 2XS7A 2ZH9A 2FYXA 3DOMB 1KLNA 4LRFA 1HPZB 4DF8A 3R5CA 1S6QB 3W2WA 2DCLA 3UNYA 3HHNB 4O23A 1NU4A 2JVRA 2ZOMA 3JSMB 3MD1A 2AYEA 4WFZA 1D9AA 4FYDA 5HBMB 2RUSA 4FDFA 5D0RA 1FXLA 1XEZA 3Q86A 1R8CA 3BQ2A 2ZFHA 2ZBRA 1YI2S 1QSSA 2BRLA 2XZTB 3O3LA 2JC0A 2PMZD 3VQSA 2BKOA 1VRUA 4NXMF 4DCPB 2FJAB 3M6VA 3CO9A 1S5ZA 3DKDA 1N5VA 4K0KF 2WCXA 2FLPA 3T1AA 2MZRA 5LL6d 1J5EJ 5F0WA 2OHDA 3M1VB 3M2UA 1HR0F 1WHXA 5ETNA 2ZWOA 3SCLE 1ZAVA 4PWUA 3T19A 2UVWA 2ALYB 2H3EB 4YB7A 3TO8A 1NSQA 1DFDA 1Y4ZB 3N4WA 3OT9A 2Z2YB 3R8YA 2MPUA 1C0TB 3OR1B 2OAUA 1F9FA 3H7HB 2OUGA 1APSA 3BGRA 2QG9B 1SL0A 3N5FA 3K8VA 2AWZA 2LYVA 4RUCA 3CDAA 2IA6A 3GG1A 1X4FA 1I51B 5K8OA 1G4CA 2A6MA 1TK5A 1MWYA 4KO0B 5AE1A 4WFBQ 3KJVB 1G3OA 1ZBTA 1QJHA 2XZWA 3HP6A 3V2UC 2E44A 2BM1A 2MKKA 4EBEA 2NPFA 1FFSB 1JLBA 3MEDB 5K5MA 4LFCF 2OTLS 2QX0A 2A1BA 2XZDB 2OPSB 2KVQE 2LDYA 2UXCF 2HHSA 3IR6B 4O44B 1RCXB 5KT3A 1IM4A 5IT4A 3NEKA 1BC6A 4QWBA 1OIAA 2J7KA 1XMOF 4QYZK 5IOLA 1EETA 3FSYA 2UXBJ 5GMEA 1R8BA 4ZP6A 3EGNA 5CYQB 2IJFA 4KV8B 2ZH7A 1FK9B 1QY7A 2K2PA 3TUIC 4ECVA 5GAGI 4LF1A 3LOUA 4U67Q 4ZVHA 4W4MA 3THPA 5KFAA 3C14A 5DZ7A 3DLEA 1RTDB 4N8OA 1KVJA 3G2XA 1MNEA 2PSZA 3OTCA 2HQCA 4O3OA 3UN5A 2ZD1A 4B3OB 3IR7B 1JWWA 5HROB 4ECYA 3SEOA 2IFXA 3AQPA 1RT7A 2X1AA 4UF4A 2AEMA 2XYGB 4GO5X 4A8SA 3IBCB 2JC1A 1Y9OA 1U2CA 2A10A 5HATA 2VH7A 3QLHA 2CQ3A 4USWA 3KLIA 4B3SJ 2EKYA 2WVCA 4M63A 4CH1A 3CCUS 2D3OR 4ZN1A 1A7GE 4WJBA 1WC1A 1KONA 2WK4A 2RKIA 2QEXS 3BDPA 2AYBA 2Y1RI 5BYRA 3BSNA 4ENOA 3GSIA 3DLGA 3KK1A 3VHQA 1U0HB 4RWXA 3CC7S 5ETQA 1PJ7A 3GIJA 2DITA 4DV7F 3QYYA 1AT1B 2HAIA 1RT4B 4FYYB 3I0RA 2R8GA 2RDDA 3ITHB 1VHIA 3KWMA 3GJTB 1DURA 2IBOA 2BACA 4F0MA 3VALA 4RO0A 2EFVA 4NRTA 4EUVA 3WZ0A 4OL8A 4B3RJ 2HFSA 1HIYA 2G0JA 1RLCL 2MZSA 2V8HA 1FNMA 2QL5B 3T1YJ 1YDLA 5IZHA 1JLEB 3AODA 2G1HA 3G6XA 1EZZB 3J7YU 1KQKA 1REVB 2J7WA 2N4CA 4C8YA 3SV4A 1YJWS 5L1JA 2LA6A 2HZVA 4PG4A 2DGQA 2HVZA 1MG7A 2GV1A 1M1KT 4J9SA 1BY9A 3MEGB 5B0GA 4GVBB 2BJ8A 3U02A 1D1UA 4HACB 4O0IA 4GC6A 3OL6A 1IBCB 3Q8RB 2FB0A 4DS4A 1HW9A 4YB1P 1WHYA 2W9CB 4N41A 3ONQA 2V4JB 4URSA 4NMXA 2A2DA 1LK5A 2KJVA 2ZC3A 2DNGA 4OYPA 5T7LA 2GJFA 1X0FA 3FEXB 4LF5F 5EX0A 1YZ6A 4DR1F 2GQQA 4IFYA 1F3VA 1UFLA 2KRBA 4RW4B 2MQLA 3SCJE 3WQPA 2EEYA 3CCVS 4ETZA 1NDPA 1UVIA 5CABA 4JI3J 4O4GA 1NM2A 4CLFA 5M2UA 1WG5A 5DG8A 4U6PA 1TK0A 2QA1A 3W9IA 4P75A 1WHVA 4TXSA 3D5MA 1WC3A 1M90T 2MJUA 1M5KC 3AOAA 2DR9A 4CYUB 1JLAB 4NEZA 2BJ7A 2FLNA 2E1RA 2HPUA 2M7SA 1PYSB 4OI6A 3DI6A 2LU1A 2I38A 2DNKA 3QZ7A 3HHLA 2WSEC 1FJGJ 2KXFA 1UWAA 2DHGA 3W5ZA 1JLCB 4R8UA 1CULA 3G8QA 2MHNA 2FVCA 2ZVIA 2YY3A 5J1EA 1ZM3A 2SXLA 4JI2F 3P5BP 1HWUA 2HVHA 4DLEA 3AJ1A 2B6AB 4ZCIA 1OMSA 3HULA 2VQEJ 4OYAA 3MMBA 5HO4A 2UUCF 4A4JA 3QJJA 1UVJA 3R5GA 2F63A 5E3CA 1R8PA 3Q8SB 3GP9A 3AB2B 2AW0A 1Z2LA 5A8RB 4PXBA 2Z2ZA 2RH3A 1HNVB 1NH8A 2FC8A 2DNPA 3K5LA 2A2CA 3MMCB 2QT7A 2XLIA 1Y5LB 1NJXA 3UVJA 3EZUA 3UD5A 1SC4B 1S1WB 3GE9A 5IC6B 1S57A 1FNOA 5KFHA 2V94A 2HHWA 2KXNB 5KFMA 1BLUA 5CYMA 3CJSA 1EARA 1VLYA 3CDUA 4RUBA 4MFBA 2DPJA 2P8IA 2OEJA 4I2QA 3VVTA 3I31A 4ZJQA 2I9SA 2HFOA 3FQLA 5J2NA 1T05A 4B9VA 2M52A 2P5VA 3CCRS 5ETRA 2V8VA 3EDRB 4J9UE 3R9LA 2DNHA 4C11B 5HAOA 1ZZNA 1AFJA 1ZM4A 3OW2R 2DB1A 1VFJA 4TY8B 5GAHI 1PBAA 2R7QA 3T9NA 2C2DA 2H9ZA 1LFWA 3NOCA 2JJ4D 4DV0J 2H54B 1RT1B 4QWAA 4WPAA 2RSQA 1UPMB 5I3UA 4OIXA 1SJQA 3EX7B 4PQAA 4USHA 1WDDA 5A2QY 1U1NA 5DG9A 1DJ0A 5F8HA 4NA1A 1K44A 2VDIA 2BKNA 3LF0A 4NWBA 2G0CA 2N82B 3QAUA 5DDOC 4Q43A 2Y9HA 2YQ1A 4RPFA 2E7WA 4I2PB 3CCES 1WKLA 1H2TZ 3AXMA 3PVXA 2F5GA 2L9DA 4ZPBA 1S79A 2H48B 4TKTA 4IRKA 4CT9A 4HHHA 3BKFA 2RHSB 4AUKA 5D0GA 2H4WB 4HT7A 2J9CA 2HHHJ 4MIAA 2OEKA 4LFBF 2DHSA 4F26A 3FCVA 1R27B 4B9TA 4IG0A 1IBKF 1TUVA 5M2RA 2A0FB 4DL0C 2BJ3A 4FKYA 1RBOB 2C3UA 2BR0A 4LVNP 2LQJA 3DU5A 3MM9B 2W8KA 4ZCMA 5EUHA 3OUYB 5CD4H 3HDSA 2V9KA 2IBKA 1WOOA 4M5GA 4DZDA 3AXKA 5D0EA 2C22A 2DTJA 2RAQA 3TQ1A 1U8SA 3GIIA 4YP3A 2MSSA 3OV7A 1GNKA 2OD6A 1SL2A 5D77A 1SJFA 3MPWA 4C3LA 4DI6A 3I56S 1E6YA 3ZZ0A 2QFJA 3IBWA 3J81j 4CTAB 1TKTA 1U48A 4EZ9A 3TI0A 1RE1B 3NGDA 2R2RA 2XGQA 5FDLA 3J7AN 1FJEB 1IVZA 3GFHA 4PG7A 3ULHA 1GT8A 4LFAJ 2C2ZB 2BJDA 3CD7A 3KLGA 1MU2B 1HHSA 2EVZA 1FWPA 2EC0A 3W64A 2QYGA 4WBFA 3WC0A 1VQPS 1RT5B 4OZNA 1VRTA 3NAIA 3QT5A 2VC0A 1XBWA 2E5LF 4EU0A 4FBTA 5KFOA 1RHUB 4DL7A 3ISNC 4LF9F 3W7BA 2VA2A 4JYAJ 1OY9A 4LBIA 3G9CA 3HO1A 4DX7A 1KFSA 1J5OB 1ZS6A 5GVQA 1QE1A 3LW5C 3I6PA 4U8YA 2XMTA 1Y10A 3PV8A 4PRFA 1C1BB 2KB2A 1N0UA 3E01B 4N7TA 3AA9A 1YJ9S 2XYPB 1VDHA 3J7Z5 1YZ7A 2BX6A 2KHCA 2HNDA 1TQLA 3R5AA 2HIQA 3SIPB 3PW5A 2MTLA 1RHRB 5D8HB 2AJ0A 2BRKA 3ENAA 2HHVA 2GQ2A 3OTOF 3M8YA 4KPCA 1S99A 2DO4A 1R0AA 3OVBA 2GNKA 1FF2A 3MM7A 1PGZA 4X4QA 2Z56B 5LMNJ 4ED5A 4IG3A 3GFZA 5B0EA 4OZ2A 4J9KA 2K3IA 1UPPA 4F4ZA 1DAXA 3VAIA 3QRRA 1OSCA 3CJ0A 3V4IA 3HD2A 3MMJA 3FZ2A 2OELA 2F3JA 3PRDA 4GKKF 2GAHC 5H1SV 4LIWA 4B3TF 5KOXA 4TU7A 4K7QA 2OMOA 3FGVA 1IKWA 2AJ2A 1WEZA 2C2NA 2R7WA 1FDDA 3CCMS 2KZZA 4USTA 3PYFA 4OJ3A 2AZ3A 3GB0A 1RTZA 3PW4A 2HHPA 2JSXA 4KGMA 1RT6B 3ZZUA 3M2RA 5LSRA 1TVRB 2FZGB 4DL3A 3DLKA 4N8NA 4AL7A 1N52B 3H25A 2VG5A 1Q8KA 1FXRA 2XMJA 3BKUA 4LT6A 4QQBA 2F4VF 3Q8PB 2E66A 1XWLA 3TAMB 2N4DA 5KG5A 3RR8A 3TR5A 3KLHA 4LBHA 4Q44A 4ILRA 3BO2A 3IWXA 2J9EA 1U24A 4BC7A 3HSDA 5LJ3Y 2VOOA 4RW6B 2AU0A 2MYFA 4FXDA 1RU1A 4Y2IA 3OSNA 1WG4A 2CXEA 3V81A 4HH0A 2IDLA 2O1PA 3CCZA 2IAJA 4UQGA 3MR2A 3FZBA 5HMZA 3W5XA 4CIOA 1SPBP 1N56A 1B0PA 3HFZB 4FN5A 2B4OA 1B4SA 1E6VB 3EXCX 2W2MP 4LBPA 1B3TA 1VQNS 1PILA 1T9XA 1HLWA 3OVAA 1M0SA 1LV5A 1BWEA 3M6XA 4HHUA 3G6YA 1SKRA 4ILMA 1G6BA 2YXLA 4P71A 2ZHBA 4H4MA 4BCAA 1TMMA 4PCQA 1JKHA 1KP6A 1WELA 4ELVA 1SJ4P 3AA8A 1NHVA 2GO9A 1Q86T 4WZMA 4TVAB 1HNZJ 3KLFA 2VZ9A 5GAGU 2KKHA 1PO6A 2CJ9A 5HLFA 2M2BA 4DFPA 3W3SA 4R5PA 1NK9A 3CCSS 1B7FA 3GTYX 3LANA 2MY8A 1JJ2R 3MR6A 2E9ZA 2R7RA 3Q89A 3PTWA 4I67A 3O6QA 4USKA 2JLGA 2VFVA 2G13A 3W8GA 1I1GA 3SQOP 3W61A 1S1TA 4MYTA 2JOQA 3V6DB 1WOPA 3LGNA 2OSQA 1W7WA 4B17A 2O66A 3O8WA 4KQZA 4JI0F 4HEA9 1NXIA 2V4QA 4FS1A 1VQLS 3PG9A 4UQTA 3CE8A 3GFXA 1UP1A 2DRBA 1LW0B 1HNIB 1MN9A 2KFNA 3ZZPA 3VWSA 2M3DA 1KHVA 3DRSB 1S1UB 3MPUB 4USVA 3ZZTA 2W4DA 3LTOA 1X31C 4A8QA 3C8YA 1WF2A 2KYXA 2CADA 1S6PB 1S49A 4ES2A 1WC4A 4QCLA 1F2HA 2VDHA 5ETLA 2XS5A 3LWMA 4BHQA 4GKKJ 4HH1A 2Q3PA 2HS0A 2HNYB 2R4FA 2M9KA 4H4OA 1HI0P 3FBEA 1O8BA 4USUA 1HQEB 2WOMA 3QGHA 1S59A 4UOGA 1HL6A 2OD4A 3BS9A 1HWKA 5HP1A 4HHJA 4WFYA 2XGPA 1SC1B 4P7TA 2RVJA 2ATLA 3DOKA 1S72S 4ZVRB 4EWTA 2BE2B 4NA2A 2YWWA 5L38A 2GGPA 1CJTA 2CVIA 4KHMA 2WBMA 1OYEA 4KKOB 3I0SB 2YVSA 2PN6A 1JB0C 3X1LB 2ZBQA 1HI8A 2R9LA 2D7SA 3P96A 1JLFB 1LWEB 4CO0A 1FKPB 4LRDA 4JP8A 1FRMA 2LLZA 3IGNA 2VV5A 2MZQA 1JNZB 3RZAA 2HNZB 3UD4P 1RWXB 1U02A 4A48A 3AJ2A 3HD1A 4CH7A 4YDDB 4OYOA 4F4YA 2CNNB 1P9QC 3ZZRA 2KXHA 3K89A 2AX1A 3AHPA 3H5YA 4YOEA 2YKAA 1EX8A 3HHDA 3IN5A 3G6VA 2PGCA 4JV1A 2AMCB 4DS5A 5I4MA 4X66F 1JQGA 2K06A 4V19J 1CJVB 3OFFA 4M5DB 1QVGR 1DLOB 5G0RA 2ZUAA 4ZVOB 2D3O1 4OLOA 4PUOA 2R7OA 5JVGQ 2W25A 2DXDA 2K1RB 1JLGA 2DH8A 3GJSB 5F3ZA 2C2KB 3MM5A 2J8SA 1QLNA 3M8PB 3NCRA 4FBUA 2BV3A 2HHUA 3K17A 5C24A 1SXLA 1X4DA 3JYTB 3PX6A 1X5OA 2FJVA 1GX5A 2W9BB 3LP0B 1ZPWX 3HT3A 4WZQA 3B6BA 5BYQA 2NREA 2XNRA 1SUQA 1DQAA 5HMXA 4W92B 3P6YC 1U1RA 4ECXA 3C16B 4YHHJ 1TP7A 2G2OA 4DR6F 4DHVA 4C8MA 1UW9A 2QMUB 2EKNA 1NHKL 4F7VA 2YKOA 2YQ3A 3KK2B 3GONA 3RRHA 2HQDA 1IM6A 1T9YA 2XLJA 3CXCR 3NWGA 3EVOA 2QSFA 3DLBA 3ILLA 1LEOA 2DEIA 2MZJA 2XG8A 3GV5B 4FF1A 5I42A 4H54A 1ACMB 2GVDB 3MEEA 2MGZB 3LP1A 1DRZA 2WAQD 4F4XA 4CO3A 1NZAA 4NEYA 1K1SA 3PJ9A 4ZVUB 2HEKA 1CLFA 1OYDA 4M5LA 3PX4A 1BUXA 2QMXA 4DZ6A 2Z2MA 2W8LA 1G1XA 3D6TB 1NCLA 2MLZA 2CQBA 2WRMA 5DETA 4DV4F 3AY0A 1FKOB 3ETMA 2YBVA 3AJDA 4PWWA 2XMWA 2J5AA 3CB4A 4CLLA 4KH0B 1H3DA 1RHKB 2BQUA 2AGPA 1O51A 4QIVA 5GAHU 3DOMA 2F4FA 1HPZA 1S6QA 1YKWA 2VBWA 4OZLA 4X65F 3TARA 1VRQC 3JSMA 5HL7Q 4UUXA 5IV3A 1N36J 1FX2A 5JVHQ 2XMVA 4DV3F 3MGJA 5HBMA 2LFVA 2DHAA 4KY3A 5FD1A 1QSLA 2VKZG 4V19X 2JLEA 2H5IB 2R7VA 2RMLA 5F9NA 2CRLA 3CJTA 4DL6A 3ZNJ1 2CDRB 2DR7A 2POKA 1EJ7L 3GQCA 1AW0A 3CW2C 1OPIA 1VOMA 2APOA 1KKHA 3M1VA 4JI4F 2G0IA 2KYZA 1N34F 4IDKB 4KBIA 5HSPA 2CPIA 1U47A 3BBFA 4K4TA 3IFEA 3LPYA 5KFYA 1HHQA 2XB2D 2YNIB 4NLQA 4Y34A 2YNGB 2AHOB 2UVRA 1HBOB 3UN2A 2WVEA 3QQCD 3GSDA 4XDDA 3SZ2A 2B56A 4S0MA 1RABB 1C0TA 3OR1A 4C8OA 3ILJA 4J7CA 3LPEA 3K0JA 1ZZFA 4ZLPA 4QJVA 2AEJA 5BR8F 3NLCA 1IWAA 2XYHB 3TJAA 2W01A 4LJMA 3BB5A 3D6HB 1RWVB 3M8RA 2X1GA 2C28A 4J9MA 4KO0A 3VR1A 2MXYA 3KJVA 3TWZA 1IBLJ 2CQPA 3MDFA 1LNQA 5LSOA 2MY7A 1VJQA 4WE1B 3KMSA 3ILIA 1KHWA 2WBRA 2OP5A 4NXNJ 3F73A 3BV8A 3I5BA 3OBIA 3BDEA 4CO1A 2P2CB 1HA1A 4OX9F 2OPSA 4R0JA 2IRUA 4O44A 4CNYA 3IC1A 4HI2A 4YDXA 2PA8D 3KFWX 1QTNB 4F25A 4C6AA 2J0SD 3GILA 1RWMB 3W62A 1XR6A 1URNA 3IRXB 1GX6A 2CWKA 1NK0A 2VQFJ 4M5MA 5CYQA 2ACYA 5J2MB 2BOPA 4KV8A 1FK9A 2D41A 1XK8A 5EWEA 3L4BC 3S8SA 5AJ3F 4DJBA 3WBZA 1U1KA 2MKCA 3TX8A 2RQCA 4CZCA 3H5SA 2GIFA 4A8XA 2YWKA 2LU2A 4DFJA 1HQ2A 5F8LA 5C42B 1PIEA 1NDLA 3D68A 4ECUA 1RTDA 3W2VB 1WEXA 1KOHA 2E1AA 3W8PA 1AROP 1N33F 1GXUA 4RL1A 4B3OA 3H42A 5HROA 3OR2B 3Q83A 2BUNA 4KYZA 1IKVB 2NXCA 2RF2B 2GS8A 3MTKA 3UW1A 3JXOA 4HLBA 2R8IA 1YRTA 1S1XB 3HFVA 1Y11A 5E3PA 3RRGA 4ZVGA 4DSKA 3PJWA 2OJ3A 4G1QB 4HTJA 4KAIA 2ZDOA 1YG0A 2RU9A 2HMIB 1U09A 2J8AA 4IR1A 2WVDA 3ZO7A 2PFFB 3FMWA 1U0HA 1CG2A 2IVFB 1NK5A 4I6AA 3OSPA 2YWGA 2OPQB 1WUUA 4M5JA 4HI1A 1RKIA 1IKXB 2HZCA 4ZVPB 4DLGA 3QFHA 5EN1A 3RYLA 3NS7B 2VBZA 4LSNB 1XNQF 5F0UA 4DPWA 1KC8T 4IR9A 1VQ6S 5D3GA 2KL8A 3ITHA 4OHXA 4OI4A 2Z8QA 2IRYA 2AGOA 3HSGA 1UL3A 5K9FA 3TUPA 2KT2A 4UZBA 2AGQA 1GMWD 1K73T 1VQ7S 5DM7Q 2FJEB 4ZVQB 3TUZC 4DV5J 3U27A 2FVQA 5CYJA 4I1TA 4MTPA 3FJ2A 3U1MA 3T5JA 1VQYA 1JLEA 3MCMA 3US5A 2BABA 4YY3J 1XQIA 2QRRA 2ZITA 3P3DA 2FZCB 1REVA 4L74A 2HBRB 4MK8A 4ZPVR 2UXDJ 2YKQA 4KSEB 2P9EA 3DRYA 1WC5A 2WZ1A 1CSJA 3MXHP 3PY8A 1DY3A 3PCOB 4L73A 4GVBA 4HACA 3V5RA 2IIHA 1D09B 4EYIB 3OHAA 1WOSA 4LRCA 1Q0NA 2YPYA 4Y28C 2W9CA 2XCAA 2V4JA 2B51A 1SKUB 2IM0A 2LECA 2CPFA 4ZPDA 4CO4A 1UWBB 4DFMA 3HFKA 1V3ZA 4TU9A 5M2PA 2PI5A 3JSRA 3AOCA 4ZCKA 1X4CA 4F4KA 4DR2F 4RU2A 3ETOA 2ZZMA 2VFUA 2LDIA 2R7TA 4OV1A 1T0TV 3HKZD 2E7XA 4RW4A 4JB8B 2G2YA 4FS2A 2ZJRQ 2AIRB 3LGHA 5EHHA 4HDHA 1T3NA 1NRKA 5D78A 4LF7J 2IYGA 4K8RA 2RIJA 3D67A 3ENWA 2KRRA 3H40A 1V3RA 2LQ5A 2VA3A 1W2IA 2PIIA 4OI3A 4AD6A 4B08A 3MECB 2OO4A 1OS5A 1VQMS 4CYUA 3M2VB 1JLAA 4UZCA 5HANA 1G7CB 1Q16B 5HQLA 1C0UB 1M1GA 1Y5NB 2VFRA 1YJUA 2HQFA 4DX5A 5BYSA 4B3MF 4L76A 2XMKA 3MCOA 2VPYB 1FI4A 4WXWA 1F5CA 4Q2LA 2QZ8A 3EGWB 2Y0BB 2OFGX 1JLCA 5LXYA 2GO8A 2XO7A 4QIEA 2E9RX 2C3PA 3CJKB 2W2PP 1DTQB 3CD0A 4P10A 5KFQA 4DUZJ 1X9WA 2QA4G 3I5CA 3N5BA 4RKUC 1MW7A 4QIFA 3GPAA 5F41A 1RTHA 1X5SA 2B6AA 4DDFA 3OQ2A 2P9GA 4RW8B 3DLLQ 1KS2A 1HNXF 2F7VA 1MSWD 1VJWA 2QLBB 4CQ1A 3PYEA 2KTQA 1EB0A 4DX6A 2GZOA 5A8RA 2AT1B 1BGXT 2HWHA 1N5TA 1HNVA 3MMCA 2YH0A 2CPJA 2HW3A 2WSCC 3PW0A 4K4XA 1S1WA 4X64F 4V1Ak 2ABYA 1HBUB 1D9DA 1QAXA 4KHPJ 1VQ9S 1L3UA 5KFBA 5KFWA 1LWCB 2DNRA 3MR5A 2EBEA 3PIPQ 3EZOA 2YNHB 2DRDA 1ZAWA 2DJWA 3HPOA 2GW8A 2HVDA 2B4UA 5IXUA 4C11A 1U45A 3R27A 4Q7AA 4KFBB 3TANA 2MQQA 2FPHX 3FBCA 4OJHA 3BSAA 2JEGA 2NS1B 4M8LA 4TY8A 1SKWA 4DV1J 3Q8YA 4DQQA 1XN9A 2IVYA 1U2RA 4P52A 4DR7F 3C46A 3H2UB 2XM3A 5KG6A 1WJ9A 3V6HA 1EP4B 2E1MC 1U1OA 7FD1A 1RT1A 4DV2J 4KPYA 4LF8F 3T5KA 5JUMA 4DL2A 3NNAA 1FDAA 1N6QA 2BMBA 4P2SA 3LUYA 5L1LA 4G3IA 2FHKA 2CYYA 2O5DA 5B08A 4Y2CA 4PQUB 4QR2A 3PZPA 4RUAA 1U6FA 3VAMA 1YJTA 4TN2A 2EFQA 3FUYA 1N5SA 3P5TL 2OPPB 2V9WA 2BVZA 2OFHX 1SJRA 4I2PA 1NEEA 1DARA 3M9OB 3BJYA 2RQ4A 2CPDA 2HBYB 1VC6A 3MI7X 2XMUA 2P9CA 4NLTA 1QM9A 4WIQA 4O3SA 1SH0A 3WDOA 2ZOFA 2W7PA 2HG4A 2LMIA 4L75A 1U4BA 2GMHA 3UE2A 1IJEB 4XTTA 2ROGA 3L9ZA 3I4PA 1CS4B 4WKYA 4DFKA 3D6MB 4IH7A 3O44A 4LSLB 3MM9A 3OUYA 4A8FA 4YUDA 3RBDA 2AYMA 3R1HA 2VPXB 1R6VA 1U49A 4CTAA 1H74A 4PWDB 3IMQJ 1MWZA 4PEOA 4FPIA 1KD1T 4X84A 3KOAA 1C4CA 3ZFVA 1TMJA 2F65A 2A3JA 3HXMA 5HK4A 3TOQA 3LWLA 3Q22A 4BWJA 3R2CJ 5KFTA 1MU2A 4G1PA 4KHRA 3TUJC 3KK1B 5MAOA 3QNWB 2KU7A 3ZC4A 1J5EF 2J6SA 2ZM6J 3HJFA 2QL9B 4MH8A 3E51A 5L8RC 2COLA 4ZVFA 1D8YA 4ZJLA 1RT5A 2DGUA 4ZVSB 2A6OA 2MKYA 2WONB 1WC0A 3OL9A 1FCAA 3RW7A 3JQMA 5E33A 3EGZA 1FNXH 1RA6A 4UW2A 2F9DA 2E5IA 4J9PA 5HQMA 5KT2A 1GXTA 4USIA 3SDEB 3KJQB 3U1LA 4AXIA 5A8WB 3SFGA 1J5OA 2LKZA 5DZ6A 4WIIA 1ZM2A 2BXJA 2V5HG 5E7OB 3GR1A 3K2YA 3D9BA 1N48A 4AQYJ 3E01A 4AL5A 1NSAA 4USMA 3GWCA 3P49B 2DNNA 5H9FK 3C3LA 4ETXA 1YX2A 1VLOA 2NUUG 2J9DA 5H9EK 3V4MA 1GMVA 1RLDA 2BKPA 3RBXA 3IWNC 4F04B 4DMZA 3T5HA 1WWHA 3GG0A 1YJNS 2NZ4A 4LRBA 3I32A 4DXLA 2MB0B 3KG0A 5D4NA 4B9SA 1BQXA 3LP2B 4NLPA 3KNGA 2R3VA 5KG1A 2OI2A 5CD4A 4ERDA 2I5JB 1T03B 1RT3B 2FD2A 3TEHB 5HVGA 1R8AA 1KQSR 1M5VC 1WNEA 2IMOA 1SI9A 4PXDA 3NGRA 1TL1B 2UXBF 4LRAA 3R3TA 3T9ZA 2KT3A 5A0YB 1IUJA 1H6KX 3CF5Q 1RT6A 3TP2A 2BW7A 2RQKA 3N01A 1RTIA 3ZNUA 2A18A 4W90B 1TVRA 3Q0AA 1TTHB 1KSPA 1X5TA 5L9XA 3OXGA 2EK1A 3DLJA 1T94A 3TAMA 1J2VA 2CPEA 3OJUA 3SCKE 5KT7A 2RUGA 5GAEI 3BGOP 4XPCA 1P9YA 2HRTA 3MR3A 4Q2MA 4X4PA 1LFPA 1UCNA 3KKFA 2L9WA 5KFPA 5ETTA 2G1DA 4YN3B 4I69A 4RW6A 4B3SF 1RI7A 5ETSA 3MD3A 2F9JA 3MM6B 2PA3A 2CJBA 2FC9A 2AJ1A 4OJGA 2FY8A 3KLEB 4TLQA 4ZJOA 2J9DE 3MAQA 5HN0A 3HVWA 1HBNB 2FVSA 2CKWA 3FKBA 4AFFA 3HK2A 1UFWA 2EFOA 3JQJA 2W2OP 5A8KB 2KN4A 4OYXA 3B4DA 3IP0A 2ASDA 3U1NA 4RWWA 1VS3A 4ES3A 1E6VA 3I55S 3UDEA 1UTAA 1PG5B 2QO3A 1WHWA 2W2QP 4J90A 2W24A 2PC6A 2MQOA 4L3KA 2PFDA 2B9YA 4OHWA 1RWPB 3KK3A 2B4PA 3QT8A 4YR3A 1DTTB 1A9NB 4MKVA 1VQ4S 3NS6A 4K2XA 1OPZA 3T1HJ 2L3MA 4FKXA 3CSKA 4P74A 3EMTA 5B0DA 3F44A 4RBVA 3UPFA 4B3RF 1VQSA 3BO3A 4M5HA 1H7WA 3T1YF 3BREA 1KN6A 4RNFA 3KUHA 3CJ2A 3N0VA 5IT0A 2YTCA 2UV8G 3TRGA 1VK8A 1HD1A 2VFTA 1DZ5A 1WACA 5LT5A 3V6DA 5C25B 4URQU 1FJ7A 4RW9B 1Q8IA 2HGMA 2ILYA 1Q5YA 2LCWA 1P1TA 2B9EA 3PHEA 2D3ZA 4OI1A 3PDNA 4YR0A 2HHQA 2ZOGA 4DSEA 4JV2A 1RWKB 3PFEA 1LW0A 1HNIA 1KEKA 1FRLA 3DRSA 1S1UA 3CUNA 4ZITA 1H2VZ 4Y0FA 4MKBA 1CQNA 2XWXA 1CC7A 4CLTA 4DQPA 1M1HA 1Y0HA 2N3LA 2HK3A 3NMAA 4NYZA 3JSBA 3ZXWA 4WP9A 1F60B 3D0HE 2UUAJ 3HVAA 4JI3F 1T9WA 1Z1ZA 2R2UA 3PRBA 2MKHA 2HNYA 1GH8A 1JJ4A 2E5GA 4C3MA 2DGTA 1HQEA 5ETPA 1S0OA 1PCAA 5T14A 4UTGA 4OX6A 3RBEA 4OFZA 5KOWA 3DYAB 2CJQA 2KFZA 6FD1A 3W9JA 2AZ1A 3R5BA 2YPZA 2B7BB 2DNZA 3DMJB 1WF1A 4OZ3A 3O5TB 2R7SA 1NPPA 1NO8A 1N88A 4IQMA 4OYZA 2BE2A 1FTRA 1N8RT 2VG6B 1WD6A 3OJSA 1FJGF 4HT5A 2XHCA 2H4YB 1UVNA 3M6WA 4KKOA 3I0SA 4P7VA 3J7ZT 4FXWA 2H1YA 2VODA 4EYHB 1LWEA 3TQEA 1FKPA 1X7VA 4ICLB 2XSJB 3MCSA 5AXKA 2Z57B 2VQEF 4O4RA 3VTIA 3BM7A 3GZ7A 1EKRA 4DPXA 5B09A 4K5SA 4AE5A 1T9UA 3GIMA 2HNZA 1TKZB 1HBMB 3WHIA 2BA9A 3HVRA 3D0IE 4FXVA 1IR0A 4OZ0A 4GVLA 2HAFA 4C7QA 2UVVA 4FYXB 4WK3A 4DF4A 1SBRA 2FJWA 2PMWA 2Z4PA 2MZTA 2DYAA 1N5YB 3FRYA 1Y00A 1NKEA 4N47A 3TA2A 3EDQB 2JWNA 2HK2A 3UQSA 2NXEA 4E2FB 3R5DA 4NLVA 3D66A 2V69A 4DG1B 1BQMB 2QIFA 5DQIA 4Z7YA 4NLSA 2IM1A 3M32B 4KGZB 1CJVA 1XMBA 4ZLNA 3MCNA 1DLOA 1NJWA 2BANB 4K4ZA 5IC4B 3RGIA 1TL3B 2JDJA 4R0EA 3D0GE 4DX8H 5DRKA 2EFNA 1PJ6A 2K1RA 3PR5B 1VBZA 2VF3A 3OTBA 5CA5A 1RAOA 1Z2ZA 2U1AA 3OL8A 2ZBPA 1YJVA 4DUTA 4DV0F 1X4EA 4J91A 3M8PA 3CO0P 1WORA 1FRIA 2HZAA 3MEKA 2DGSA 3JYTA 2MLXA 1Q5VA 5KFFA 2W9BA 3LP0A 4LSZB 5GMDA 1WI6A 3LO3A 2PO4A 1L5UA 5HMWA 1IKWB 3CTRA 3D7SB 3C16A 4TNOA 2DXEA 3DLHA 1RGVA 1QUPA 5T41A 3KK2A 9RUBA 2BE7D 3PIOQ 3PW7A 1VI7A 1RZMA 1RAEB 2HHHF 3D28A 4Q0BB 1SH3A 4OYMA 4OV6A 2IJNA 2DKOB 3NWRA 4RNOA 1FE4A 2VKRA 2KDOA 1ICEB 2GVDA 3SQGB 4ZOSA 4KT0C 3CMES 2MGZA 4CLPA 5JXSA 2GMJA 3JSYA 3MPVA 1QTMA 2JEFA 7AT1B 2GIQA 2PMHA 3DNCA 3H0PA 2NLWA 4PKDB 3MOZA 1VQ8S 1S48A 1U6BA 1S0VA 1FKOA 2L41A 4N5SA 4DUYJ 3FC9A 2GX8A 4HDGA 3R7BB 1NAQA 4GKJJ 3RTVA 4OHYA 4LFAF 3MPDA 2GFFA 3RUBL 1NSKL 3DGVA 3M6UA 1S7HA 3QSIA 1UJ4A 2C2EA 3WIVA 1TAQA 1DQ8A 4MK9A 4D3HA 3G6ES 2FHMA 2LA4A 4UOFA 3A1YG 2V63A 4YB6A 4ANCA 2GHVC 3I9V9 2XNQA 4FF3A 1ZYQA 3L09A 1UA1A 4JYAF 1WDTA 1T7PA 1B64A 1TKDA 4C8LA 5KFVA 4O3RA 2OPRB 4IFVB 3C6UB 4IDKA 4RNHA 3ZZYA 2DPIA 2DGVA 4LUBA 1LXNA 4O3QA 5D4OA 5LMUJ 3QBCA 1GTHA 3SMZA 2YNIA 4LF4J 4M94A 4ER8A 2YNGA 5IV4A 2HRUA 1HBOA 3PNIA 1WI8A 3J7A1 5DGAA 4AXJA 3IXQA 3M4XA 3HHKA 5J2QB 4ZS6A 2EG1A 4KGKA 4O3PA 3QZ8A 3PO5A 4FNIA 4Q5VA 2BE9B 3NCQA 4DR3J 2V2VA 3CCLS 4TQRA 4KGVB 5JMNA 1MMDA 5LMNF 1NK8A 4I64A 4QPXA 3GV7B 2ZJQQ 2J6UA 1T3OA 1FWKA 1S77D 2WSFC 2BZ2A 2D1CA 5IQQA 4IOBA 5I3QA 2LP4A 3D1OA 2F8EX 1FJCA 4NRUA 1U1PA 4I7FB 4WE1A 2HFNA 1ZAXA 3CVKA 3KYLA 1B70B 1GMWA 3KHHA 4C0HA 1F1BB 1RB0A 3ISZA 4ELTA 2DXFA 3C15A 2J0XA 2MJNA 3TA0A 4PAAA 3SCIE 4FYVB 3KHLA 2RNEA 3BH6B 4K59A 1SV5B 2I8EA 1EQMA 1FDBA 2D74B 1SIWB 1IXKA 3S6EA 3NAHA 3IRWP 5LM7E 2RRNA 4NL5A 4KJIA 3QO9B 3I87A 1VC0A 3IRXA 1IN0A 2LXUA 3MAAB 1TZ0A 2RE1A 4OI2A 2MQNA 2GHPA 3HHLC 1PAUB 1SQEA 1HYSB 2E29A 1JNRB 3VAHA 3TAQA 3KG4A 3QGPA 3CIZA 1T95A 3N6NA 4UY85 2O67A 2G4BA 4X62J 1N32J 5C42A 4BBYA 5J2PB 4JI6J 1VK3A 4WU2A 4MYUA 1KRPA 2JL9A 1BXNA 5HI7A 4H4KA 1KTQA 3A8IA 1VR6A 2CNOB 5KG2A 2DCUB 1UETA 3BO4A 5KFLA 2ASJA 2FUG9 3Q24A 1OSDA 1OWXA 1B0VA 2MEWA 3MF5A 3OR2A 3C66A 5D4PA 2KVIA 4J37A 4ANDA 5A76A 3WC2A 1IKVA 3DRRB 1ZOTA 3DXBA 1F2GA 2RF2A 4KTQA 3G86A 3MURP 5DDPC 4ZHRB 2CNKB 1S1XA 2CPZA 2F40A 2YH1A 2UUWA 4LIRA 2F1FA 2MHEA 3Q23A 1FESA 4XPEA 1Y7PA 1P1LA 4I68A 4ATNA 4G1QA 4GO7X 4IYQA 3M7VA 3IS9A 4DU7A 3K8WA 1XNRJ 2HMIA 4F2RA 1UA0A 2V6AA 2VUGA 3TZWA 4ZP7A 1WF0A 1OQ3A 1V6HA 2OSRA 3G96A 1FA0A 4EMDA 2OPQA 4BC9A 3VGVA 2B0GA 1IKXA 1HNZF 3K5NA 1ZA2B 4OZ1A 5CZVA 2CDQA 2J0WA 1F3FA 3LAMA 4G65A 5KFKA 2Q6BA 4X2BA 4LSNA 3NGSA 4IRCA 2VBXA 2RT3A 5AXMA 3POTB 1F5AA 2HGLA 5E3QA 1AZSB 4QIWD 2HYIB 2G9OA 1M5SA 4UOCA 5E5NA 2IA0A 1KLMB 1BQNB 3V6JA 2ZZNA 3FBFA 1D9FA 2DO0A 2AJQA 4ED8A 2NQPA 2DNMA 3UN3A 1MLAA 2Q66A 2UUBJ 5GMKa 5DG7A 2HVIA 3RJMB 3BGUA 2IC3B 3BR9A 2GMLA 2J7UA 1YBUA 1RTJB 3AD9C 2V4RA 1UFKA 4AT1B 4WP8A 2HWIA 3A8JA 4OMFG 2M0GB 2V68A 4QR0A 4U95A 5IM0B 4MAKA 3C6TA 4JOUA 3GR0A 2YX7A 3CJ5A 3B78A 3HT0A 2MLYA 3RG6A 2QE5A 5LJ5Y 1TL5A 2X1FA 1L3TA 3Q2TC 1AUDA 4ALZA 3M8QB 1O5JA 1K9MT 4FNHA 2P6SA 3KUEA 1UWBA 1N4LA 5DDQC 4U96A 4EZ6A 5LXRA 3D1HA 5I42B 3W66A 4KC5A 3GFYA 2C2RA 3MEEB 3C2PA 1KQGB 5FJ4A 2Y0SD 5IQ6A 3O2IA 3FNNA 5A2QU 2RQMA 4ID5A 1O6XA 2DT9A 1CEZA 3S1TA 4JI5J 1HHTP 1PYOB 3CJ3A 4BS2A 1NB2A 2EFPA 3DGPB 3J81Y 1Q82T 1TKXB 3MMAB 5E0OA 4ED1A 4DN9A 2EW9A 3FK4A 3BGFA 1HW8A 2BJ9A 2FJXA 3CJ8A 2DIVA 3CMQA 2GVZB 3BH7B 5EWFA 3MECA 1PSDA 2QV6A 1BWVA 4IRDA 4M5IA 3M2VA 4BWMA 1I94J 1C0UA 4LQ3A 2EWHA 2GAGC 1NPKA 4ECTA 1FT8A 4JV0A 4TU8A 2VFSA 5F9LA 4EGLA 2BQ3A 2H5EA 2RDIA 3IO1A 1R0CB 3DDIA 4X4TA 4X4RA 2DGOA 2NXJA 3ENQA 5KFUA 2GQCA 3DU6A 3CJKA 2BW2A 1DTQA 2NYIA 3MUMP 4QW8A 4J9QA 4JI8J 4IH6A 4OYBA 1QD1A 2UVUA 2X3DA 4RW8A 4NI2B 5KFDA 2Y1IA 2FHJD 4NASA 4NLGA 4ES1A 3BZQA 3IG1B 4JI7J 4DR4J 4WTOB 1U7LA 2N7CA 3T3FA 8ATCB 3SYZA 2V0NA 1RWWB 3BYPA 2VHGA 2DR5A 1HBUA 1RU2A 2CQ0A 4DU8A 1FEHA 1LXJA 4NCGB 1HFEL 1LWCA 3NBPB 1JXVA 4Y2KA 1S76D 2YNHA 1XMQJ 2NXUA 1AUSL 2EPIA 1F9EB 1GTEA 3LA0A 4ID8A 3EE3A 3KDOA 4KFBA 3M30B 3BR8A 2QJ3A 2QSWA 4DCOB 2C42A 4YQWA 1UZHA 3QMQA 4JI1J 4Z2XA 1JLQB 1T8EA 3BSOA 2UU9J 3NNHA 1NMEB 1RWUA 3L7PA 4YHHF 1EP4A 3RBZA 1OY6A 4Y2AA 3JS9A 3LH2S 2ZH8A 2FQQB 4B02A 3TA1A 2HS3A 4TYBA 3PKMA 4LF6J 5KTQA 1UVKA 4DR5J 1LWFB 1NZ8A 3PACA 1RYRA 2L48A 1RCOB 2B5JB 4OZJA 3FMBA 4NLWA 4WFAQ 1YTYA 3D2WA 1U8WA 4LR7A 4ZDNA 4RJVA 4PQUA 1M5OC 2HRYA 3KNAA 2GIRA 2VG7B 1HARA 5EDWA 4YEAA 1Q8LA 3PM9A 3CJRA 5KFSA 3FDSA 2FZKB 2HGNA 1BMQB 2OPPA 2DHHA 4U7UK 2HQIA 3OFGA 2B4VA 5C2GA 4WKRA 2RDJA 3RU0A 2LVWA 4EI2A 1YHQS 3W63A 4CWBA 3K5MA 1TL7B 2QC3A 2I1RA 1Q81T 4XO0A 2BYCA 2PT0A 1VBYA 5CXTA 4A47A 5KG3A 2BEFA 2J76E 3KLVA 3NY0A 1CS4A 2QA4S 4LSLA 1C1CB 1HNWJ 1EHWA 4JV5J 3NKYA 1EQ0A 3E8OA 3FVYA 1NUEA 4RLEA 1PKUA 4CO2A 1XERA 4OYWA 2JHEA 3R7NB 3BGLA 1K0VA 3KXDA 4NLUA 2E1PA 1N36F 4X4UA 2LEBA 1VBXA 1Z4UA 8AT1B 4ECWA 4ED2A 4PWDA 2ERRA 1Q78A 2ZH1A 3VCDA 2KG0A 3J81U 3BQ0A 2OLWA 2IMWP 1XR7A 2K8GA 1TFYA 2W4PA 4HVZA 2CJYB 3DC2A 2XMAA 5CCLA 3KHRA 1FD8A 4PYDA 1U2FA 1V5IB 2EG2A 3WX8A 2AF6A 1OO0B 3L7OA 4L6V3 2WONA 4NXMJ 1QAJA 3BBCA 4ED4A 5D3GB 4K0KJ 2RS8A 4TYAA 5CH7B 2E5JA 1S97A 2YQ0A 1VBKA 2K7KA 1P27B 4ZPWR 5AE3A 4K4WA 4NOHA 1ZTWA 3EUNA 3SDEA 1RISA 5A8WA 3AD7C 2ALZA 1TELA 3PW2A 1HR0J 4X4VA 4ZLJA 1RDRA 1GFWB 3KHGA 3PO4A 4RZRA 3RB3A 4IKAA 4WXOA 3HX9A 4B9NA 3QGGA 4HYKA 1XTZA 3LGMA 3ICLA 4RW7B 3VZIA 3G82B 1RT2B 1IBLF 3NMRA 2XHWA 1V5VA 4PG6A 4NE9C 3CDEA 4DPOA 2Y8WA 1U26A 2ZKUA 2WB1D 3A4TA 4NXNF 3N6LA 4J9RA 3UCUP 2L08A 4BLGA 1NBEB 1CVJA 3CWJA 3LP2A 3VVUA 3K57A 4F3MA 2AV5A 1S1VB 2I5JA 1T03A 1D0EA 5L1KA 1RT3A 3CDWA 4NLDA 1JJHA 1OQ6A 3MTJA 1FRHA 1IR2A 2ACMA 3DFEA 1YSJA 3LAKA 3ZZZA 1NKCA 4LFCJ 1UVMA 5IS2A 3CD6S 2DY1A 2BQRA 2HFUA 5AT1B 1TL1A 3D3CJ 3T6BA 2VQFF 4FVMA 5EGYA 2V2ZA 2UXCJ 2V2QA 3V6KA 5A0YA 3QT6A 2D9PA 3OFEA 2DNLA 2YKMB 1LW2B 1YJ7A 1NKBA 1HMVB 5BXIA 2BJ1A 1AFIA 1XMOJ 2ZDPA 1RAHB 4P6QA 4ZVTB 3K58A 3UFCX 1U1LA 2CG4A 4ECRA 2DNQA 1B0TA 3VGTA 1SC6A 1R7IA 3T5LA 2NUHA 1FHTA 2PEHA 1U0SA 3W9HA 4DPTA 2VPWB 4DL4A 3HLUA 2HFZA 2OIHA 4C8NA 3IGVA 2JRSA 4F36A 3LALA 3MM6A 2CWXA 4UT4A 2IM3A 5L39A 3PYDA 3KLEA 2VL1A 3DM2B 1FRXA 2DIUA 2AD9A 4X4NA 2MQPA 1HBNA 3MUVP 3ZTRA 3GV8B 2IDEA 3AAWB 5A8KA 4CP5A 4I4BA 1WC6A 1EAYC 1RTHB 5IWAF 4W98A 5DO2A 4CLSA 1YRXA 3OD2A 4QBUA 4K2JA 2KM8C 3SSSA 1PAEX 4NLYA 1JXLA 1ITPA 3IAS9 1N54B 2CPYA 3DRPB 2CNLB 5LOQA 5DQGA 2B8QA 4N77A 4N56A 1DTTA 2HWTA 1FTCA 1N0VC 2LQ8A 1MMNA 4DV7J 2CQGA 1YJRA 4DPYA 2XLKA 5J1PA 5DDRC 2D69A 2YKNB 4DV5F 4DQSA 2VD3A 5I3PA 1X4AA 3R1LA 2IPOB 5E3RA 1PBUA 4ECQA 4ED3A 5K8NA 2N3OA 4YY3F 2JEIA 3QFWA 2VPZB 2KHDA 5F8MA 3QWPA 2UXDF 5C25A 2ZE2B 4RW9A 1QAYA 3L7UA 3VZHA 2RS2A 3R6LB 3L3CA 3EWGA 3UDVA 4DQRA 1HQUB 1SKSA 2NSCA 2QTWA 3TX0A 1UKUA 2H5JB 4TLRA 3VGSA 1LK7A 4Z37A 3M9NB 2CJAA 1P6TA 1N6QB 1ZH5A 1TV6B 2E9TA 2WW8A 1MROB 3DOLB 1S6OA 1GQEA 3BYRA 2CQ2A 3JTNA 3MEDA 2Q79A 3CD5A 3F56A 1KTVA 2XQCA 3D4JA 1FVSA 4ANEA 1KQFB 5K8PA 1S9EB 2Q6CA 2VU5A 3FBBA 4LF5J 4LF7F 3RB0A 4DR1J 3ET6B 4J9OA 2OEMA 4URGA 3FFIB 2R42A 1UW4A 1TUGB 3EPGA 2R7UA 4NCAA 2LEAA 1MWQA 5KFEA 3DYAA 4EFAC 4YR2A 2ILZA 1SL1A 3HVTB 4IH5A 1RACB 1AB8A 3DMJA 3DHWC 3CT9A 2L9NA 2ASYA 2EI5A 2ZEJA 1A0OB 5H9FJ 3MFIA 2VG6A 4M5NA 4QOTA 5AXNA 3QSYB 1H72C 2ASLA 5H9EJ 4WYLA 2R8JA 1AXQA 3BF4A 3EVMA 4KIAA 4PR6A 3H2VE 2ZHAA 4LMZA 1H2UX 2BJEA 4DUZF 4X4SA 3GJRB 5A6WA 2DBBA 4X4OA 4ICLA 3CJ4A 2XSJA 3O1LA 2JLFA 2FGOA 1FD2A 3THVA 1IKYB 4FF2A 4PXEA 2U2FA 3NCPA 1TKZA 1HBMA 3T41A 1X4HA 4JI2J 4NLRA 2MKIA 3MZIA 4PXCA 2DD8S 1FEEA 1J27A 2FVRA 5IWAJ 1I6JA 2FY1A 1N5YA 1OY8A 5K14B 2CPHA 3QATA 2W2NP 2UUCJ 2IVMA 4PZVA 4KHPF 3CCQS 5HVFA 5ITHA 4F4AA 1RT4A 1CJUB 2HHTA 2AYGA 1VQOS 3PKYA 2X1BA 3T6JA 3HM9A 4DG1A 2I6WA 1BQMA 2BDPA 3Q8UA 3M32A 3WX4A 2MKSA 4ECSA 2OMLA 3CIMA 5DGBA 2Y1LB 5C2CA 4DSLA 2BANA 4F3QA 1NK4A 1FRKA 1TL3A 2YNFB 3BEGB 2XI3A 2QGFB 4M1KA 4DV1F 3TVYA 3TZXA 4G6VB 1F9HA 3QPIA 3M8WA 1RXOB 3UR0A 1S9GB 5AXLA 2ZH6A 4E8UA 4DV2F 3TAPA 3HF5A 3MM8B 1YWXA 1B99A 1YITS 1TU0B 2QFIA 3MEGA 3SI8A 3ZTQA 1K47A 3R5JB 2FJDB 4MKAA 4NZ0A 2CQHA 5THWA 2C3YA 5KT4A 3A12A 4HTIA 3FSXA 1CJKB 3ILOA 4NA3A 4LF2A 2R2SA 2XCPA 4UOHA 5L1IA 4F2SA 1CPZA 4Q8EA 1VHFA 1X9SA 4OJ1A 1RTIB 4KR0B 3VF0B 4NLXA 4Q0BA 4P9SA 2JNJA 3RB6A 1R0BG 3DDNA 3TYTA 2HSEB 3OVSA 2CZ4A 3K7RA 4DBQA 4CLKA 3M9MB 2R8HA 3SQGA 1NDKA 1UEVA 4LFBJ 1RBAA 2G2ZA 5J1NA 4AL6A 1IBKJ 2GC8A 2LXIA 5L9NA 4J9NA 1KR4A 5DS7A 2ZWPA 2CZVC 4UUWA 3NNCA 3QIPB 1SVDA 1U1QA 1LWXA 3PX0A 4E98A 5KFIA 4NZ6A 4CLUA 3W2WB 4NZ7A 3EICA 3DHXA 3N9UC 2ZZTA 1Y5IB 2DH9A 2ZJPQ 2CG8A 1C4AA 2ZM6F 2IHR1 3EYZA 2AKWB 3GMGA 3GCXP 2NXNA 2XC9A 4I6WA 4GRSA 4KH1B 2VBYA 3EPIA 1VRUB 4MMOA 5KT6A 2B8PA 1M5HA 5KFRA 4Y65A 1JX4A 4B9UA 4RR5A 2UP1A 4RNNA 5D0HA 1M5PC 4FP9A 4CI0B 3KK3B 5B0CA 2ZNZA 4DOZA 4QZVB 3A8KA 3M2UB 3K59A 2ROEA 2OPRA 2E5LJ 3GYNA 5SZTA 3NGTA 4IFVA 4YS2A 3BN4A 3C6UA 2RJZA 3Q8VA 2QLXA 4AQYF 3OLAA 4LF9J 3EVWA 1KVIA 2VONA 2YX1A 3WIUA 2ATCB 4ITSA 1YLXA 5C5JA 2FLOA 5CQGA 3M05A 4I0WA 1S4EA 2AP6A 5D15A 3H90A 4CM2A 2M8HA 5IT9Y 3BGRB 1FKAF 3HSJA 5KFGA 1XC9A 5HQ8A 5J2QA 3VV2B 4ZP8A 3W1YC 4N76A 1RWOB 4PG5A 1FFGB 4ELUA 1BE4A 2FIUA 5CHCB 3KJNB 1LKZA 4DSIA 5HJXA 4QU7A 1UEUA 1D8ZA 1VIOA 4Y6IA 3D1QA 1S6UA 1JLBB 1T02A 1GAOA 3QJPA 3P8BB 3OTOJ 1RSCA 3MUTP 4I7FA 1VCTA 1JXEA 2E1CA 2CQ4A 4WTYA 4IOAQ 3QAEA 2FHOB 1PC5A 2WVFA 3UWTA 4IO9Q 3MOJB 2VIHA 1SH2A 3TW0A 1RHQB 3AT1B 3SV3A 5HVHA 4B3TJ 5K8MA 1EETB 4CH0S 2ZHOA 1SV5A 4NYPA 1NSPA 4ECZA 2CA9A 3QO9A 1VYAA 1RHMB 4QWEA 3MAAA 2K3KA 3W65A 2QLFB 2QA2A 4ZK7M 1HYSA 3IAM9 1RJJA 1XR5A 2ZH5A 4LR9A 3DDKA 3K5PA 3C14B 4ZA1A 1WKJA 2H51B 2QMWA 3KUGA 2RD5C 3DLEB 3OL7A 2LEPA 3CGIA 1H38A 2B9WA 3ZZOA 5J2PA 3GJQB 2F4VJ 2LQ9A 3PEHA 1NPRA 3DRXA 2ZD1B 1F0XA 7FDRA 5FLXY 4DWIA 2ZH4A 6FDRA 1RT7B 2Z58B 3OLBA 2HBZB 1JMTA 3K5OA 2HQGA 2EFGA 4GMKA 3QLHB 3DRRA 3KLIB 3I82A 2VB6A 3JTOA 3PHTA 4C2MA 2X3GA 3UCGA 1FWLA 4P73A 4ZHRA 2NYHA 3KJFB 2RKIB 2V8PA 3NGKA 1PJ5A 1NDCA 2MKJA 1RQ0A 5GADI 1HKAA 4PPDA 1RAIB 3BPSP 4QWCA 4IQXA 3DLGB 4MIWA 2KJWA 1SB6A 3VAFA 1FVQA 2EBGA 4I56A 4QIGA 2N7YA 4KB7A 4LQ9A 2Z0GA 3DCAA 2XBPA 1S10A 1VC5A 1IJFB 3T1HF 1XIQA 1VMBA 2DRAA 1L3KA 2HS4A 2ZBCA 4F67A 3I0RB 3IBFB 4U9RA 1QSYA 2OKQA 2X7IA 1AYEA 3IM8A 1UVLA 3POTA 4CLYA 1AZSA 3MWBA 3I4HX 2RRAA 4ILLA 1KBRA 4USJC 1X4BA 2KT5A 2VICA 4O0NA 1EIYB 1C1BA 1KLMA 1BQNA 4ZIVA 3BPDA 3PEJA 3QJLA 5C7PA 3SSRA 4FYWB 5DJBA 2FHJA 2RHQB 1FRJA 4ZPTR 1Q4RA 2O3DA 3H59A 3ADAC 1VQ5S 2DGXA 1GEHA 2M5YA 2M88A 5CCMA 3FSIA 3NXZA 3GIRA 4DCJB 2ZNYA 3ENVA 3HCXA 2GA7A 2IC3A 3KMQA 1T9TA 1QUVA 4C48A 4RX6A 2ADBA 3HMJG 1RWNB 3G71S 4E0DA 1YK9A 1RTJA 4Y00A 4WYWA 3RR7A 4JI0J 2B43A 3GYGA 5IT9U 1YIJS 1NJYA 4OQJA 1ZTTA 5IM0A 5F8JA 4O3NA 8RUCA 5DM6Q 3OPKA 1NH7A 3N79A 3TJ8A 1IQZA 2XI2A 3G8SA 4CM0A 2UUAF 1RADB 2WTFA 2XS2A 4C0OC 1SJ1A 1VQKS 3M8QA 5T7LB 3EZ5A 1QAIA 5F8IA 3HSZA 1TR0A 3QRPA 5ETVA 3H4BA 1UEKA 4IFYB 2B3TB 4F0HA 5JJBA 2IYIA 3TZYA 2AJ4A 2B9XA 2JVOA 4F0KA 2CJXB 5BJRA 2CZ9A 2P6TA 3D6FB 4O4GB 5L46A 5SUHA 4C4WA 2XY7A 1S0NA 1DQ9A 1PYTA 2DISA 1F6TA 1GXLA 1X5PA 2OH2A 3KTQA 3DGPA 2Z2LA 4FZVA 2Y8YA 5DQHA 1TKXA 3MMAA 3E2EA 1WTFA 4TQSA 2XTJP 1UAWA 2GJ2A 2GVZA 3UI3A 3BSCA 4GC7A 3DI6B 1YBTA 5KFJA 4YMEA 3J80Y 2ZC4A 4G1IA 1O0PA 3HHLB 4ZKAA 1YQHA 4CT8A 3OHBA 4NYOA 1JIHA 3CNQP 2DNYA 3A3NB 5LSLA 4ED7A 5KT5A 5E41A 4ZIWA 1SCJB 4R8UB 2V34A 1ZPVA 1CULB 1Y3KA 3NG8A 5J1EB 3NRBA 3I5AA 1X0PA 2WB4A 3AB4B 2CJKA 2AJFE 2MDAA 2EK6A 5FLXU 3HZGA 4KRWA 5E2QA 4RNMA 4Q45A 2EC2A 2C3OA 3JTPA 2DR8A 4F8RA 3MMBB 4XDCA 4NI2A 5DLFA 1VGYA 2HHXA 4C0BA 2J0QD 3IG1A 3TVKA 1UJ6A 3B82A 2E5HA 4WU3A 1I3OB 3UVJB 3S7RA 1K1QA 2UZAA 4JUZA 1WSVA 2ZH2A 1L3VA 1U25A 1LQ9A 2HQ3A 5CYMB 5MLCV 3QRQA 4C8KA 1URRA 3H5UA 4PYAA 3KG1A 2ZH3A 1KWMA 2PD1A 4MFBB 1BHNA 4NLOA 4I2QB 3N28A 2CAJA 3IWLA 4NCGA 4X66J 5J2NB 1T05B 2NSBA 6AT1B 4QW9A 3NBPA 3NS5A 3D3BJ 1BD6A 1P8GA 4MT1A 1R43A 3FEYB 4WF9Q 3AQOA 2E7VA 2PDAA 2W7OA 1RP5A 1HI1A 2UUTA 3IR5B 3M30A 3MR7A 4UY8T 4CNZA 5B0BA 5K20B 2DR6A 2WW4A 3AFGA 1JLQA 1V3SA 5ETMA 3W60A 1IR1A 1UJ5A 1RYSA 2ZKTA 1TK8A 1HWIA 2Z30B 4Q8FA 5ETKA 5I3UB 4OLPA 1ROFA 3G87A 3KDNA 4NCBA 1H0HB 3C15B 4C8ZA 1LWFA 3FCHA 1NB7A 2B5JA 2W9AA 1X60A 4M5KA 3TEGA 2VOPA 3AH6A 2VG7A 3BN7A 4OX8A 3Q2SC 4DR6J 2MMYA 1RUSA 1RHJB 1FXDA 5RUBA 4EK2A 1S6PA 4C97A 2HLTA 4RBTA 5DLGA 4J5OA 4FVCA 3G4SS 4L72B 3HHLD 3P4UB 4OZ5A 1U6ZA 2GCFA 4ZN3A 3VAJA 4CLWA 3PRVA 3OXFA 4WK1A 1KFDA 2J6TA 4BDPA 1N5QA 1TL7A 4J9VA 4IG0B 2XY6A 3HZEA 3A3PB 2R7XA 2WVBA 4CDIA 2IY5B 5KFNA 3QIDA 2ZBIA 1DBDA 4DUYF 4ZCLA 3CDBA 3GYXB 3AD8C 1C1CA 4MK7A 2MSTA 4EBDA 3EXYA 4ED6A 1UZDA 1RBLA 4GKJF 3TNVA 4OX7A 1KNZA 1NK6A 1E6YB 3TVZA 4DV4J 3FQKA 1TKTB 4F3OA 2IM2A 5FDLB 2HIYA 4WP3A 3RAQA 2BM0A 1JLFA 4IO1A 4U7UD 4RBUA 1UMJA 1S7IA 1HD0A 3KLGB 3IS9B 1NNDA 2R8KA 4X65J 4B9LA 3VAGA 1V9OA 2W1BA 2I2YA 5IFMA 4QWDA 4A8YA 4M95A 3SSQA 3J80U 2F8MA 2UV8A 4LR8A 4DV3J 2Y3YA 3CULA 1VRTB 3GCWP 1K8AT 2O01C 3B4MA 3ZTOA 3AOBA 2V8DA 3RAXA 1X8DA 3HJVA 3ISND 2IRXA 3B8HA 5LMUF 2FGCA 2HFVA 4FPRA 4LF4F 2XULA 3QT7A 2QL7B 4YFUA 1G2EA 2HLUA 1QE1B 1QVFR 4JI4J 2FLLA 1N34J 2D9OA 3MPYA 4AYBD 1H98A 2MZ1A 2NZCA 4PABA 2C2OB 1W2BR 4M5DA 1TFWA 2AEFA 4DR3F 4K4SA 3SFUA 2HNDB 2DEJA 3H2LA 5EWGA 4U7CA 2C3MA 3A13A 3R97A 2DK2A 4RW7A 3GIKA 2JH3A 3G82A 1RT2A 3NP5A 3JAMY 1SJ3P 1A6LA 1D3WA 3VGUA 5BR8J 2RB7A 4WFNQ 3UCZP 5U47A 1R0AB 3MM7B 4IG3B 3CPWR 3C6TB 2XSFA 4XAKA 1CQMA 3V4IB 1W26A 1HWJA 1S1VA 3UD3P 2V8GA 4C3KA 3NOGA 1Y3JA 2I0XA 3BBBA 3PFOA 4FF4A 4OHVA 4XK8C 1T11A 1IQTA 4DQIA 1FFWB 2HVEA 4EEYA 1EKSA 2H65B 2XEXA 4OX9J 4F50A 4ZP9A 4CO5A 3M2RB 5KG7A 3DLKB 3L95X 2YKMA 1LW2A 3UDCA 2CUYA 2W4CA 3EGVA 4ID5B 1HMVA 2CQCA 4HL9A 4WFXA 4QYRA 2VG5B 4X62F 1N32F 3TZZA 2KFYA 4NX9A 4JI6F 3UDLA 3A8EA 5KAKA 4F02A 1NK7A 3SBMA 3S01A 4IOCQ 2RU3A 2YWFA 2DH7A 3KLHB 5AJ3J 3TJ9A 2Q43A 4A8KA 3D54A 4K5RA 3HI9A 1F5BA 5F8GA 3X3UA 4ZPAA 2YWEA 4I6YA 5B0FA 1AA1B 3J7YI 3RAMA 1KOOA 1Q7LB 3V81B 1X4GA 1RK8A 1N33J 1LOUA 5A6PA 2ZUGA 5EX3A 3CCJS 4C9DA 3M8SA 1PC4A 3JQKA 4EBCA 2IAJB 3DM2A 3CCWA 1R8HA 1XNRF 3GU0A 2JZ5A 4QU6A 2KI2A 3UO0A 4EO6A 3GLJA 2PI4A 4U8VA 5KG0A 2K7JA 2CQIA 4DSFA 4CRJA 2KZMA 1B7YB 2CQ1A 3M8ZA 3U7JA 4H4MB 1JKHB 2NR0A 4QYZJ 2RILA 3DRPA 1IBMF 4MJKA 3ZTPA 4PG8A 2GJIA 1HWLA 1KDNA 2DY9A 3OTDA 3KLFB 2RRBA 4A8WA 1TAUA 3FEZA 5HLFB 2JFDA 4R5PB 1XNQJ 2YKNA 2OGUA 1I5OB 1ULRA 3UR3C 3BKTA 1RAFB 1NHUA 3QGIA 2JX2A 2UUBF 4D3GA 1GK8A 2M4MA 3I9ZA 2BBEA 3FCWA 5HMYA 2B7CB 3MAHA 4L3NA 1NJZA 1S1TB 2XY5A 2IJRA 3R6GB 2KO1A 1Q95G 3A3OB 2ZE2A 3JB9k 1WEYA 1IWGA 3I96A 2VC1A 4DV6F 3CEDA 1HQUA 1WSRA 2X51A 3CCTA 2JEJA 5B7WA 1ZA1B 4DN0A 1TV6A 1K0TA 1TUWA 2CVEA 2QLWA 4EO8A 5KFXA 1MROA 3DOLA 4CCHA 3F0NA 4LREA 1WTBA 5GADU 3RRKA 2VJUA 2DHXA 4HKQA 2CIMA 3JAMU 2NCKL 1C2PA 1Q7YT 3B54A 3EJMA 4K50A 1VISA 1SQFA 2AX0A 3VQTA 3OTEA 4JBCA 3ZTSA 1FDNA 1JJCB 4K4VA 3QWUA 1S9EA 2V67A 4A8MP 2CFXA 4H4OB 3W5YA 2EXUA 4JI5F 2C2MB 1OJ4A 1RKJA 2WOMB 1RAJA 4ZMMA 2YKPA 3H5XA 1ZM9A 3Q8QB 2ADCA 4LVOP 4DR2J 2DVIA 4QR1A 3ET6A 1R89A 2FJBB 2FDNA 2QLJB 2HKEA 2FVPA 4B9MA 4WCEQ 5J2MA 2LXFA 4OI0A 2MQMA 5HP1B 3FFIA 4DEZA 4OYIA 2ROPA 1CBKA 1Q1KA 5ETOA 1RAAB 2JFKA 3DOKB 4A46A 1I94F 2AQ4A 1SQGA 3HVTA 9ATCB 4R25A 3W2VA 1FO1A 3MHYA 5CZXA 4MIBA 3PR4A 2GGPB 3OXLA 1NJIT 1CJTB 2XWYA 1Q53A 2C1EB 1S12A 3OFHA 1WG1A 5FIIA 3LQVA 1S9FA 5ADZA 4YB5A 1X9MA 3CC4S 1H73A 5KG4A 5F3TA 3C19A 4ED0A 4B3MJ 3BQ1A 4JI8F 5KFZA 2W7AA 1Q8BA 2YX4A 2M8DB 1IKYA 3DXSX 2BOAA 1MMLA 1S0MA 1SIZA 4NMLA 3UNGC 2VASA 3CMAS 5B0AA 4HR2A 4JI7F 4DR4F 2HURA
chains in the Genus database with same CATH topology
1R6YA 1I6JA 2WHOA 1P9QC 2MZTA 2Z4PA 2FY1A 3ZZRA 1N5YB 3FRYA 2KXHA 1Y00A 1N5YA 5K14B 2LQBA 1NKEA 2CPHA 4N47A 3TA2A 5K14A 2AX1A 3AHPA 3H5YA 4YOEA 5F8NA 2YKAA 5D4LA 2IVMA 2JWNA 4KHPF 3CCQS 5ITHA 1CC8A 3HHDA 3UQSA 1RT4A 3IN5A 4ZPCA 2PGCA 3G6VA 2HHTA 3R5DA 2AYGA 1VIXA 4NLVA 4JV1A 4DS5A 5I4MA 4X66F 2PE8A 1VQOS 4DG1B 2X1BA 3PKYA 3T6JA 3H4DA 2DNOA 3HM9A 4DG1A 5AE2A 1BQMB 2QIFA 4V19J 1XMQF 1BQMA 3OFFA 4IUFA 5DQIA 5G0RB 4NLSA 2IM1A 2D3UA 3M32B 1XMBA 4M5DB 4QPTA 3N6MA 1QVGR 1DLOB 1YGYA 5G0RA 3M32A 3WX4A 2MKSA 4ECSA 1DLOA 3PJXA 1YRUA 2OMLA 3CIMA 5DGBA 4PUOB 1NJWA 2BANB 4K4ZA 2KM8B 4OLOA 3THTA 4PUOA 1TL3B 4DSLA 2R7OA 2BANA 5JVGQ 2W25A 2YWHA 4F3QA 3IA0A 1NK4A 2JDJA 1FRKA 1TL3A 4R0EA 2YNFB 3D0GE 4DX8H 5DRKA 3BEGB 2XI3A 4K4UA 1JLGB 2YNFA 2EFNA 5E3AA 2K1RB 2M70A 1JLGA 5GAEU 2DH8A 4M1KA 2K1RA 4JI1F 3F41A 2FTRA 4MKYA 2CQDA 4DV1F 3SXLA 3TVYA 3PR5B 1VBZA 4G6VB 2CPXA 2UU9F 2KH9A 3OTBA 3MM5B 5CA5A 5F3ZA 1Z2ZA 2U1AA 3MM5A 1QLNA 3OL8A 3QPIA 3UR0A 1RA7A 1YJVA 1S9GB 4C98A 3M8PB 3NCRA 4DV0F 1X4EA 5AXLA 1H7XA 2ZH6A 1S9GA 4FBUA 4E8UA 3M8PA 2BV3A 2DGWA 4DV2F 5C24B 2HHUA 3TAPA 4PPZA 3HF5A 4Y2MA 5C24A 1FRIA 1SXLA 1X4DA 3JYTB 3MEKA 3MM8B 4KE5A 2OTJS 4LF6F 2DGSA 3JYTA 1ELOA 1YWXA 3HHEA 4DR5F 3PX6A 3MM8A 1X5OA 2XMMA 1YITS 2FJVA 1GX5A 1S4FA 1FE0A 5KFFA 2W9BB 3LP0B 1ZPWX 3HT3A 4WZQA 5BYQA 2W9BA 3LP0A 2NREA 1SUQB 2XNRA 5G4DA 1SUQA 1DQAA 1WI6A 5HMXA 3LO3A 3FRZA 5KFCA 3G8TA 1YBAA 2PO4A 3MEGA 5HMWA 1L5UA 4W92B 3SI8A 3P6YC 1U1RA 4ECXA 1TP7A 1IKWB 3CTRA 1R3NA 4Y3CA 3RB4A 4DR6F 4DHVA 4C8MA 4NPOA 4TNOA 2FJDB 4MKAA 4NZ0A 5D6GA 2CQHA 5THWA 2C3YA 3H98A 5KT4A 2Q1LA 4HTIA 3FSXA 1W25A 4NA3A 3DLHA 2V2KA 2YKOA 2R2SA 1RGVA 2XCPA 2YQ3A 1QUPA 3RW6A 3KK2B 5L1IA 5T41A 2F8HA 1TL4A 4DSJA 4F2SA 3KK2A 3RRHA 4H4KC 1CPZA 2R2TA 2XLJA 4RU9A 3CXCR 4Q8EA 3NWGA 1VHFA 1X9SA 3H20A 4OJ1A 3PIOQ 1RTIB 3PW7A 1VI7A 2QSFA 3DLBA 2HHHF 4KR0B 3D28A 3PXGa 3VF0B 1DHMA 4Q0BB 1SH3A 4NLXA 1R31A 4Q0BA 2MZJA 3RB6A 2IJNA 3HKWA 1ZETA 2XG8A 3DDNA 4F4WA 4RNOA 3GV5B 1FE4A 3CC2S 4FF1A 3TYTA 2ZVSA 4J9LA 5I42A 2VKRA 4H54A 3OVSA 2CZ4A 3K7RA 2KDOA 3LP1B 4DBQA 3MEEA 2NPIA 3DN9A 2MGZB 3M9MB 1U1MA 2GHWA 3LP1A 4ZOSA 3SQGB 4KT0C 3CMES 2MGZA 2R8HA 3SQGA 1DRZA 2WAQD 4F4XA 4CO3A 5JXSA 1NZAA 1HNWF 3NL0A 2GMJA 3JSYA 1UEVA 1K1SA 3MPVA 3VAKA 1QTMA 1CLFA 3PX4A 2JEFA 3E3XA 2QMXA 3MFHA 2KG1A 2Z2MA 4OHZA 2GIQA 3H8YA 4A8OA 2W8LA 4JV5F 1G1XA 1JK9B 5J1NA 2PMHA 3DNCA 2QYCA 4AL6A 2NLWA 4PKDB 4DL5A 4TY9A 4K4YA 2CQBA 2WRMA 2GC8A 1Q79A 2LXIA 5DETA 3MOZA 5L9NA 1VQ8S 4DV4F 4RUHA 1S48A 3AY0A 1FKOB 4J9NA 2Y1JA 1U6BA 1FERA 1KR4A 1S0VA 5DS7A 1FKOA 2L41A 2CZVC 2XMWA 4UUWA 3NNCA 4XIUA 2J5AA 3QIPB 1U1QA 3CB4A 4N5SA 1L3SA 3QIPA 1YVFA 1H3DA 3PX0A 2GX8A 4ZVEA 4E98A 2ZH9A 2AGPA 5KFIA 2BQUA 1O51A 2XS7A 4QIVA 4HDGA 4NZ6A 1KLNA 5GAHU 1NAQA 1HPZB 3DOMA 3W2WB 4DF8A 3R5CA 1S6QB 4NZ7A 1HPZA 3DHXA 3RTVA 3W2WA 4OHYA 3N9UC 1S6QA 4LFAF 2GFFA 2DCLA 2VBWA 4OZLA 3HHNB 3M6UA 4O23A 4X65F 3TARA 1NU4A 1Y5IB 2JVRA 2ZOMA 3JSMB 1S7HA 2DH9A 3MD1A 3JSMA 2ZJPQ 5HL7Q 2AYEA 4WFZA 4UUXA 1D9AA 1UJ4A 2C2EA 1C4AA 2ZM6F 4FYDA 5JVHQ 1TAQA 5HBMB 2XMVA 1DQ8A 4DV3F 4MK9A 3MGJA 5HBMA 2IHR1 4D3HA 2DHAA 5FD1A 1FXLA 1XEZA 1QSLA 2VKZG 3EYZA 4V19X 1R8CA 2JLEA 3BQ2A 2ZFHA 3GMGA 3G6ES 1YI2S 1QSSA 2BRLA 2R7VA 3O3LA 2XC9A 4I6WA 2JC0A 2FHMA 2LA4A 2RMLA 2VBYA 2PMZD 3EPIA 3A1YG 1VRUB 4MMOA 3VQSA 5F9NA 2CRLA 4YB6A 1VRUA 5KT6A 2GHVC 4DL6A 4NXMF 2FJAB 1M5HA 3M6VA 3I9V9 2XNQA 5KFRA 4FF3A 1ZYQA 4Y65A 3CO9A 1JX4A 3L09A 4B9UA 1N5VA 2DR7A 4K0KF 2POKA 2UP1A 2WCXA 4RNNA 3GQCA 1UA1A 2FLPA 3T1AA 1M5PC 4FP9A 4JYAF 2MZRA 1AW0A 5LL6d 4CI0B 3KK3B 1T7PA 5F0WA 1B64A 1OPIA 5B0CA 1VOMA 1TKDA 3M1VB 4C8LA 5KFVA 2APOA 2ZNZA 4O3RA 4DOZA 4QZVB 3M2UB 3M1VA 4JI4F 3K59A 2KYZA 1N34F 3M2UA 2OPRB 4IDKB 4KBIA 4IFVB 2ROEA 2OPRA 2CPIA 3C6UB 3GYNA 4IDKA 4IFVA 5SZTA 1HR0F 4RNHA 1WHXA 3BN4A 3C6UA 3ZZYA 1U47A 2RJZA 3SCLE 2DPIA 2DGVA 1ZAVA 4PWUA 2QLXA 4LUBA 1LXNA 4O3QA 5D4OA 3T19A 3OLAA 4AQYF 2UVWA 4K4TA 3IFEA 3LPYA 5KFYA 2XB2D 2YNIB 4NLQA 1KVIA 1GTHA 3SMZA 2YNIA 4Y34A 4M94A 2YX1A 4YB7A 2VONA 2YNGB 2UVRA 4ITSA 3TO8A 1HBOB 2YNGA 2HRUA 1Y4ZB 5C5JA 1DFDA 1HBOA 3GSDA 3PNIA 4XDDA 1WI8A 3N4WA 2FLOA 5CQGA 3SZ2A 3M05A 3J7A1 4I0WA 2AP6A 5DGAA 2B56A 4AXJA 3IXQA 2MPUA 1C0TB 3OR1B 2OAUA 2M8HA 1C0TA 3OR1A 1F9FA 3M4XA 3BGRB 4C8OA 5IT9Y 1FKAF 5KFGA 1APSA 3BGRA 1ZZFA 3HHKA 5J2QB 1XC9A 3K0JA 4ZS6A 4ZLPA 2EG1A 5HQ8A 1SL0A 4QJVA 5J2QA 4KGKA 4O3PA 5BR8F 3NLCA 4ZP8A 3QZ8A 3N5FA 3K8VA 2AWZA 3PO5A 4FNIA 4Q5VA 2LYVA 4N76A 4RUCA 3CDAA 4LJMA 4PG5A 3BB5A 2IA6A 3NCQA 3GG1A 1X4FA 3M8RA 4ELUA 3CCLS 4TQRA 2X1GA 2FIUA 5CHCB 5K8OA 1TK5A 1MWYA 1MMDA 2C28A 4KO0B 4J9MA 5LMNF 5AE1A 4WFBQ 1LKZA 1NK8A 4DSIA 4I64A 4KO0A 1G3OA 1ZBTA 3VR1A 4QPXA 3KJVB 1UEUA 1D8ZA 3GV7B 4QU7A 2ZJQQ 2MXYA 3KJVA 2J6UA 1QJHA 1T3OA 2XZWA 3HP6A 1VIOA 4Y6IA 3V2UC 1S77D 2WSFC 2BZ2A 2E44A 2CQPA 2BM1A 2D1CA 3MDFA 5IQQA 3D1QA 1S6UA 4IOBA 5LSOA 2MKKA 5I3QA 1JLBB 4EBEA 2NPFA 2MY7A 3D1OA 1T02A 1JLBA 2F8EX 1FJCA 4WE1B 1GAOA 3QJPA 3KMSA 4NRUA 1U1PA 4I7FB 4WE1A 2HFNA 3MUTP 1KHWA 1ZAXA 2WBRA 2OP5A 3CVKA 4I7FA 3MEDB 3KYLA 3F73A 1JXEA 5K5MA 2E1CA 3I5BA 3OBIA 4LFCF 3KHHA 2CQ4A 4C0HA 2OTLS 4WTYA 4IOAQ 3ISZA 3BDEA 3QAEA 4ELTA 2A1BA 2FHOB 2OPSB 4CO1A 2LDYA 1PC5A 1HA1A 2J0XA 4OX9F 2OPSA 2MJNA 3TA0A 2UXCF 2HHSA 3UWTA 4R0JA 2IRUA 4IO9Q 3MOJB 3IR6B 4O44B 1SH2A 3SCIE 3TW0A 3SV3A 5KT3A 4O44A 4CNYA 3IC1A 4HI2A 4YDXA 1IM4A 2PA8D 3KHLA 5IT4A 2RNEA 3KFWX 4K59A 1BC6A 4F25A 4QWBA 5K8MA 1OIAA 2J0SD 2J7KA 3GILA 1EETB 1SV5B 4CH0S 2I8EA 2ZHOA 1XMOF 1FDBA 2D74B 1SIWB 1IXKA 1EETA 1SV5A 1XR6A 3NAHA 4NYPA 3S6EA 3IRWP 1URNA 2RRNA 3FSYA 4NL5A 4KJIA 3IRXB 3QO9B 1GX6A 3I87A 4ECZA 1R8BA 4ZP6A 3IRXA 1VC0A 1IN0A 3EGNA 5CYQB 3QO9A 2IJFA 2LXUA 4KV8B 2ZH7A 1FK9B 1QY7A 2K2PA 1TZ0A 5CYQA 2ACYA 2RE1A 4OI2A 3TUIC 5J2MB 4QWEA 2MQNA 4KV8A 2BOPA 1FK9A 2GHPA 2D41A 2K3KA 3HHLC 1XK8A 5GAGI 2QA2A 1SQEA 1HYSB 5EWEA 3S8SA 4ZK7M 3LOUA 2E29A 5AJ3F 4U67Q 1HYSA 1JNRB 3IAM9 4ZVHA 4DJBA 3WBZA 3VAHA 1RJJA 1XR5A 3THPA 2ZH5A 3TAQA 1U1KA 2MKCA 3KG4A 3TX8A 3DDKA 5KFAA 2RQCA 3QGPA 3K5PA 3H5SA 4CZCA 4ZA1A 3CIZA 4A8XA 1T95A 2QMWA 2RD5C 2YWKA 3DLEB 2LU2A 3N6NA 4DFJA 4UY85 3OL7A 5F8LA 5C42B 3DLEA 2O67A 2G4BA 1RTDB 4N8OA 2LEPA 5C42A 1KVJA 4BBYA 3CGIA 5J2PB 2B9WA 4ECUA 3ZZOA 1H38A 1VK3A 1RTDA 4WU2A 3W2VB 4MYUA 5J2PA 1MNEA 1WEXA 2PSZA 2LQ9A 1KRPA 2JL9A 1KOHA 5HI7A 3PEHA 4H4KA 3DRXA 3OTCA 1KTQA 2ZD1B 1F0XA 4O3OA 7FDRA 2E1AA 5FLXY 2ZD1A 4DWIA 4B3OB 3IR7B 1JWWA 1AROP 5KG2A 2DCUB 1N33F 1GXUA 1UETA 5HROB 3BO4A 5KFLA 2ZH4A 2FUG9 3Q24A 2ASJA 4B3OA 1OSDA 1OWXA 1B0VA 6FDRA 4ECYA 3SEOA 1RT7B 5HROA 3OR2B 2IFXA 3AQPA 3OLBA 1RT7A 3MF5A 3OR2A 3C66A 2X1AA 1JMTA 2BUNA 4GO5X 5D4PA 2KVIA 4J37A 1IKVB 4A8SA 2JC1A 3K5OA 3WC2A 1IKVA 1Y9OA 3DRRB 2RF2B 2EFGA 4GMKA 1ZOTA 2A10A 3DXBA 3MTKA 3QLHB 1F2GA 2VH7A 3DRRA 3UW1A 2RF2A 3KLIB 4KTQA 3I82A 2VB6A 3G86A 3JTOA 3QLHA 2CQ3A 4HLBA 4C2MA 3KLIA 3MURP 2R8IA 2X3GA 1YRTA 2EKYA 5DDPC 1S1XB 4ZHRB 3UCGA 4M63A 4CH1A 3CCUS 1S1XA 2CPZA 4ZHRA 2D3OR 1A7GE 4WJBA 2F40A 5E3PA 1KONA 2YH1A 3RRGA 2WK4A 2UUWA 4LIRA 2RKIB 3NGKA 4ZVGA 2F1FA 2MHEA 3Q23A 1FESA 4DSKA 2RKIA 3PJWA 2OJ3A 4XPEA 4G1QB 1Y7PA 4HTJA 1P1LA 1RQ0A 2MKJA 4I68A 4ATNA 2QEXS 4G1QA 4GO7X 4KAIA 3BDPA 2ZDOA 5GADI 4IYQA 4PPDA 1YG0A 2AYBA 2Y1RI 2RU9A 4QWCA 3IS9A 2HMIB 4IQXA 3K8WA 1U09A 5BYRA 2HMIA 3DLGB 4MIWA 3BSNA 1UA0A 4F2RA 3DLGA 2J8AA 2KJWA 1SB6A 3VAFA 1FVQA 2VUGA 4IR1A 3KK1A 4ZP7A 1WF0A 2EBGA 1OQ3A 4I56A 4QIGA 2PFFB 4RWXA 1V6HA 3FMWA 2N7YA 3CC7S 2OSRA 1CG2A 4KB7A 3G96A 1FA0A 4LQ9A 2Z0GA 2IVFB 1NK5A 3DCAA 4I6AA 3OSPA 2YWGA 3GIJA 2XBPA 2OPQB 1S10A 1VC5A 1IJFB 2DITA 4HI1A 2OPQA 1RKIA 1IKXB 4BC9A 3T1HF 2HZCA 4DV7F 3QYYA 4DLGA 2B0GA 1IKXA 1HNZF 3K5NA 2DRAA 1VMBA 5EN1A 4OZ1A 5CZVA 1L3KA 2CDQA 2HS4A 2HAIA 2J0WA 3RYLA 2ZBCA 4F67A 1RT4B 3LAMA 5KFKA 2VBZA 3I0RB 4LSNB 2Q6BA 1XNQF 4X2BA 3I0RA 4U9RA 4LSNA 5F0UA 1KC8T 2R8GA 4IR9A 1QSYA 2OKQA 4IRCA 1VQ6S 3ITHB 5D3GA 2VBXA 3ITHA 4OHXA 1UVLA 2RT3A 4OI4A 5AXMA 2Z8QA 2IRYA 3KWMA 3POTB 1F5AA 2HGLA