4CQ1A

Crystal structure of the neuronal isoform of ptb
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
191
Chain Sequence
b'NTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPRDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYPYRIMIDINE TRACT-BINDING PROTEIN 2
publication title Solution and Crystal Structures of a C Terminal Fragment of the Neuronal Isoform of the Polypyrimidine Tract Binding Protein (Nptb)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 48
structure length 191
sequence length 195
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4cq1A02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4cq1A01
2MPUA 3CCES 2V94A 1K8AT 3P6YC 3MOJB 4CH1A 2CQ1A 1AUDA 2MZSA 2DNLA 1WI6A 2KXNB 2RQCA 2LXIA 2JX2A 1Q81T 2LEAA 5CYJA 5MLCV 3G6ES 2MJNA 5GMKa 1H6KX 1FNXH 2HVZA 2L9WA 4OZ0A 1VQ7S 5D78A 2KG0A 1KOHA 3IRWP 5JVHQ 2UP1A 1VQLS 3MUMP 2AYGA 1YJWS 3ZZZA 2LA4A 2CQBA 3FEYB 5ITHA 3NS6A 1VQ6S 2E5HA 3R27A 1WHXA 5JVGQ 2FC9A 1YIJS 1W2BR 3H2UB 1HD0A 2YWKA 2MKHA 4QPTA 2DITA 4IOAQ 2MQNA 2OSQA 1YITS 1R8PA 2DGVA 2EK6A 1Q82T 3BO2A 2D3OR 1P27B 3CULA 3UCGA 2YH1A 3G9CA 1A7GE 1X5TA 1X4HA 2KG1A 3VALA 4C0OC 2D9OA 1FO1A 2KVIA 1WI8A 1FJ7A 1KC8T 3LQVA 2CPHA 2E5GA 1YTYA 2VODA 2CPZA 3THTA 1WTBA 2DNPA 1VQ9S 2D9PA 3R1LA 2RVJA 3B4MA 3P5TL 1PO6A 3NMRA 2RQ4A 3MD1A 2DGQA 1QVFR 2KXHA 3N9UC 3D2WA 2U1AA 3CCUS 3I56S 1VC6A 3IWNC 1X0FA 2X1BA 3ULHA 2OTLS 2MHNA 3P49B 4Z2XA 1DZ5A 2X1GA 3OW2R 4PRFA 1RK8A 1YJ9S 3MXHP 3S01A 2QEXS 4IUFA 2LCWA 2B0GA 3MD3A 3CC2S 2G4BA 1L3KA 2I38A 1UP1A 3CMES 2QFJA 4YOEA 2MGZA 1U2FA 2DGUA 2FPHX 1QM9A 1M5VC 1VQOS 3CC7S 1VQ4S 1PGZA 1SJRA 2RS2A 1JMTA 1WEYA 2EK1A 2YH0A 2ADCA 1WF0A 4WFAQ 1SJ3P 3UWTA 2OJ3A 1U6BA 2XB2D 4UQTA 2DNYA 3L3CA 2DNMA 3THPA 2XS7A 3UD4P 1K9MT 1O0PA 1FJCA 2MY8A 2N7CA 2MXYA 2MZTA 1JJ2R 5DDOC 2N3LA 4C7QA 4F25A 1JJ4A 2DH7A 3K0JA 5LXRA 3CPWR 3NNCA 1WELA 1ZZFA 1NU4A 5GAGU 2NLWA 5LJ3Y 1N52B 3P3DA 2VOPA 3CC4S 2DK2A 1P1TA 1D9AA 2E5IA 2O3DA 4M5DB 1U1OA 5EN1A 2F3JA 1WHWA 2CPIA 4QQBA 2G0CA 2PE8A 4YUDA 2LQ5A 3VAJA 2CPXA 4Y0FA 2GHPA 2DGWA 3CD6S 1ZH5A 4WKRA 4J5OA 3HHNB 2NZ4A 2DH8A 3VF0B 3JB9k 2MGZB 3MI7X 1U1RA 2DGXA 2MSSA 1KD1T 1S79A 3CTRA 2DNHA 2KU7A 1M5KC 1X5OA 1DBDA 1X4EA 3EGNA 2DO0A 2JWNA 2MQPA 3UCUP 1X4FA 2M4MA 2ADBA 3G8TA 2XS5A 1VQ8S 4WFBQ 1U1QA 4RU2A 2DISA 4QU6A 2MQOA 4BS2A 1WEZA 2RRAA 2X1AA 1FJEB 2CPDA 2MKSA 5GAHU 4PR6A 2JVOA 2MSTA 2M88A 5DM6Q 2DHXA 3HI9A 2RU3A 2E44A 5LSLA 2MKKA 4W90B 2KRRA 1VQPS 2DGOA 3Q2TC 4WIIA 1VC0A 3U1LA 1F9FA 2DNGA 2E5JA 4OZ1A 2EVZA 3CXCR 2DNKA 4ERDA 4FXWA 5CXTA 1G2EA 2LECA 2N3OA 2MZQA 1UFWA 1M5PC 2DGTA 1SXLA 1SJQA 1YWXA 2CPYA 5IQQA 3TYTA 4TU7A 3U1MA 2CJKA 1OO0B 2RUGA 2CQ2A 1U1PA 5CA5A 4ZKAA 1NO8A 3VAIA 5LXYA 2HGMA 3VAMA 1CVJA 2DHGA 3ZZYA 1KQSR 1N54B 1Q7YT 5DDPC 2MZRA 2KYXA 4IOCQ 2WBRA 1U1NA 3CF5Q 2MZ1A 2DNOA 1WF2A 3EX7B 2J8AA 2KH9A 2KHCA 5IM0A 2J0SD 2KM8B 3UD3P 2XSFA 3G8SA 2AD9A 5LSOA 2MYFA 2YTCA 2FY1A 1WF1A 2M8DB 2FC8A 5DM7Q 3NNHA 4CQ1A 1U1KA 2DH9A 4F02A 1U1MA 2ZJPQ 3G71S 2LYVA 1N88A 1N8RT 2MKIA 2DGSA 2CQDA 1OWXA 4C4WA 2DNQA 3BEGB 2GO9A 4EGLA 4TLQA 2BOPA 4ED5A 2OSRA 2M9KA 2M52A 2CQCA 1FXLA 2M7SA 5GAEU 5D77A 2XS2A 1BY9A 2CPJA 2CQGA 2DO4A 2SXLA 1XN9A 1UAWA 2PEHA 3Q2SC 3BO3A 4WFNQ 1D8ZA 1RKJA 1UW4A 2MKCA 3CCRS 2M8HA 1VQMS 4PKDB 5FJ4A 2VOOA 3CCVS 1VQ5S 2CQ3A 3FEXB 4P6QA 2XNRA 2AYEA 1H2TZ 1VBZA 1WHYA 1A9NB 2K3KA 1IQTA 3G96A 1WG5A 4TU8A 3NNAA 4WCEQ 4LMZA 5IM0B 4UY8T 3CCLS 4WF9Q 1M5OC 3MDFA 2K8GA 3RW6A 5LJ5Y 3EGZA 1FHTA 3VAHA 3R1HA 3I55S 3NS5A 1R8HA 1WG4A 1FT8A 2A3JA 1U6FA 2KFYA 2CQ4A 3SXLA 2L41A 2VONA 2CQIA 5DETA 5H1SV 3S8SA 2Q79A 3CCQS 2MMYA 1SJFA 1JJHA 2N82B 3VAGA 2DNRA 1WEXA 3S7RA 2CPEA 2BZ2A 3S6EA 2FHOB 1YI2S 2MJUA 2MKJA 2G1DA 2MY7A 5GVQA 1X5SA 2LEBA 1YHQS 1VQNS 2M70A 2U2FA 2HGNA 2KXFA 5IFMA 2RS8A 3CCJS 4LIRA 3CMAS 4TU9A 3TO8A 3BO4A 1U1LA 1X4GA 2RT3A 1VQKS 2DIUA 4CIOA 2LKZA 3MURP 2ZJQQ 1X4CA 1HD1A 2AYBA 3MUVP 3DLLQ 2KT5A 3VAFA 2HGLA 1WG1A 1URNA 2DNZA 5HO4A 3SDEA 3J7ZT 1WHVA 1OPIA 1HA1A 2KN4A 5GADU 2KI2A 3PIPQ 2J0QD 5DDQC 1OIAA 3TP2A 3DXBA 3SMZA 2KM8C 2DIVA 3PIOQ 2CPFA 3UE2A 4CH0S 1KOOA 4A8XA 3J7YU 5HL7Q 3H2VE 1S72S 4V19X 2OTJS 2DNNA 3V4MA 1B7FA 2HZCA 1DHMA 2M0GB 2CQPA 2RNEA 2MQLA 3G4SS 3CCMS 2JVRA 1DRZA 3LPYA 3US5A 2CQ0A 4U67Q 1ZZNA 1HL6A 1VBYA 3RW7A 2QA4S 1YJNS 2MZJA 2AYMA 4QU7A 4IO9Q 2ZJRQ 2LMIA 2RRBA 3CCSS 2YKAA 1VBXA 5BJRA 1X5PA 1Q86T 2X1FA 1H2VZ 2DHSA 2ERRA 2MB0B 4LJMA 2LXUA 3UCZP 3BS9A 1QVGR 4W92B 2DHAA 2CQHA 2F9JA 2XNQA 1WWHA 2L08A 5DDRC 3VAKA 1VC5A 2M2BA 2I2YA 1M1KT 3B4DA 2J76E 2LA6A 4YB1P 1M90T 2OIHA 1X4AA 2HYIB 1X4DA 2KRBA 3CUNA 4Y00A 2JRSA 1SJ4P 1H2UX 1X4BA 1NJIT 2MQQA 4FXVA 3SDEB 2F9DA 2MQMA 3MUTP 2DB1A 1K73T 4F26A
chains in the Genus database with same CATH superfamily
4DQSA 3QPIA 4Q45A 1ZBTA 3DLKA 3X1LB 4KO0B 5H9EK 2QGFB 5CHCB 3NWRA 3HVWA 5MLCV 1EZZB 2H5JB 4OZ0A 1VQ7S 5KFVA 5HJXA 1WNEA 2A1BA 2K1RB 3I0RA 1RJJA 3R27A 3TAMA 1K47A 1JWWA 3D1QA 2JEGA 1RT6A 4ZPWR 1N56A 2DGVA 3SSQA 1BD6A 3TAPA 4M94A 1X5TA 2R7TA 4WP3A 4YY3J 2HVDA 4J91A 1NK0A 2VODA 3OR1A 5I3UA 3OJUA 3UVJB 3IXQA 1VISA 1HIYA 4B9VA 3DGVA 1X0FA 3IR6B 3IRXA 3PYGA 1UVLA 1NK4A 1CPZA 1TVRA 5ETTA 4CWBA 2MGZA 4B9MA 5KFDA 1RB0A 3O1LA 3DRPA 4AT1B 2BUNA 2YNFB 4A8FA 2EK1A 1SPBP 1RTJB 4WFAQ 3E01B 3AB4B 4MYUA 3G2XA 3GSDA 4DV3J 1JLCB 3ISND 2MXYA 3J81U 2GS8A 3N6LA 5DDOC 2PI4A 2DXFA 3QSIA 2DH7A 2J9DE 2ZVSA 2E66A 2ZFHA 1F9HA 1YX2A 1SL2A 1PYOB 3KFWX 2Z30B 2F3JA 4UZBA 1IBCB 1NUEA 2QMUB 1ZH5A 4WKRA 1HHSA 4ZP7A 1SH3A 2VFTA 5E3CA 3R5DA 2FVSA 3JB9k 2EFGA 3PJXA 2DGXA 9RUBA 1S79A 2KU7A 3CWJA 1HNXJ 4DV3F 2JWNA 2UUWA 5A6WA 1ZPWX 2RILA 2VBYA 3D0IE 2ZZMA 1C0UB 1UVKA 3BJYA 2X1AA 1S1XB 6FDRA 4ZP8A 4J9KA 1VQPS 5B0AA 1UVJA 2ZE2B 3O2IA 1FKPA 5D0GA 5IQQA 1VRTB 2IBKA 1NO8A 1AB8A 4I69A 2KHDA 5DRKA 2RSQA 2FLOA 4ZK7M 2QMXA 3NOGA 2VQFJ 5KFUA 1ACMB 4J9OA 1VRUB 3EXYA 5LSOA 3KMQA 3SYZA 2DH9A 5DS7A 3RB4A 1U25A 2R3VA 3TA1A 1HNIB 2GVZA 3NCPA 1R43A 4WYWA 4GVBB 2OSRA 2CQCA 4IYQA 1CJVA 3GB0A 3PO4A 5T7LB 2ZH1A 4DL4A 1XN9A 1G3OA 2VQFF 2RQKA 3LTOA 1IQTA 2IVYA 5B0DA 2XCAA 1GXTA 3L9ZA 3SV4A 4R8UA 1GFWB 4OX9J 3MAHA 1CJTB 3KDNA 4I2QA 3PFEA 4ELUA 4OX8A 1ZPVA 2L41A 5KFXA 5DETA 3W8GA 3CCQS 5M2RA 4QIFA 3VAGA 2DNRA 4O44B 1TELA 3IO1A 4CNZA 5KFSA 4F4YA 4ECRA 3U7JA 3T6JA 4HVZA 4L75A 4FF3A 4DPUA 2CG4A 1PSDA 4R5PA 3QT8A 4OX9F 4LQ3A 1LWXA 1MSWD 1F2GA 1T3OA 2DNZA 3J7ZT 1N5YB 4YR0A 3M32B 3DLEA 4HHHA 1HA1A 5J2QB 3SMZA 3GQCA 1MWYA 1VI7A 2RDDA 2HNDB 2YKNA 3N6NA 2EXUA 3BDEA 4DCPB 1FFSB 3UN3A 4CO5A 4ZVEA 1R6YA 4J9PA 1P6TA 4HTIA 4QU7A 3LP2B 1V5VA 4OX6A 3BZQA 4RUBA 5IWAF 4ZCLA 1GH8A 1CBKA 1WACA 4NLTA 2GX8A 1RLCL 1M1KT 1WORA 2HAFA 4YB1P 1JXEA 1S1WB 2QN6B 4OYPA 1Y9OA 1WJ9A 4ZLNA 4ZVGA 2OPPA 1NK5A 2DKOB 4OZLA 3LOUA 3PM9A 3LP0B 2IA6A 2KDOA 1VS3A 3OTDA 3GIIA 3QIPB 2JX2A 5CYJA 5KG1A 4AE5A 5THWA 3PRVA 3WDOA 1VHFA 2BM0A 2GZOA 1NH8A 1RWUA 5D3GB 2OHDA 4ZCIA 3BGFA 2IC3B 4HDGA 4QPTA 1PC5A 5F8IA 1YBUA 2RF2A 4DFJA 3Q86A 4IH7A 1LFPA 4QOTA 1RU1A 3G9CA 3HDSA 2GMHA 2D9OA 2PFDA 3KLHB 3TW0A 3LQVA 3QQCD 1F5CA 4OLOA 7AT1B 2RVJA 1AYEA 5GMDA 2DGQA 2OPQB 3R7SB 1RABB 1SC1B 3PEJA 4IFYB 3CCUS 1RTHA 1UA1A 3HX9A 3M1VA 2XC9A 1PIEA 1HHQA 1DZ5A 2X1GA 4NXNF 4WP9A 1YJ9S 5G0RB 2I38A 4C3LA 1VHIA 1KFSA 1K0TA 4LT6A 2D3O1 2DR5A 4K4ZA 2BE2A 2HWIA 2DJWA 1HYSA 1FESA 4N8OA 3K17A 1WEYA 3HHEA 1S1UB 1WF0A 1UWBB 4DJBA 3SIPB 2CDRB 2DNYA 3L3CA 4DFMA 4ED1A 4JUZA 3BH6B 1TL7B 3EMTA 1VQSA 1PG5B 3L4BC 8ATCB 3BKUA 3L09A 2Y8WA 2MLZA 2GIRA 3VZIA 3VR1A 4LRFA 2YBVA 2YKMA 2G0CA 1KFDA 4I2PB 4F2SA 1VRQC 3CNQP 2Z2YB 3J7Z5 3HZEA 2BACA 3C19A 4U7UK 2AJ4A 1OY8A 4X4PA 3TA2A 2CNLB 5GMEA 5HBMA 2VPYB 3TZZA 3DOLB 1H38A 1KRPA 2MKKA 2DPJA 1N5SA 3D1OA 2J0WA 5IT0A 2YWGA 1WC4A 1D8YA 3AH6A 3R6LB 1S9EB 1YBAA 1NJYA 3KLIB 1VDHA 1IBMJ 4A8KA 1Y5NB 3SCKE 3VQSA 3W66A 5K8MA 4I7FA 4F0HA 5IM0A 4QPXA 2ZITA 4B08A 1O8BA 2GCFA 2W2PP 4HT7A 2GNKA 1SQFA 2J9DA 1RWOB 2FD2A 1N88A 5CYQA 3M30A 3G6YA 1OWXA 3MECA 3MOZA 5K8PA 1LW2B 4KQZA 5F8GA 5A2QU 2BOPA 1HI0P 3M2VB 1YGYA 2COLA 1FXLA 2NXCA 1KLNA 2BOAA 2CPJA 5K14A 3K5NA 4O23A 3FVYA 2ACYA 3Q2SC 2CNNB 4KE5A 4WYLA 2O66A 2QSFA 2K3KA 3VVUA 2NCKL 3NNAA 1QSSA 8RUCA 5IZHA 1M5OC 4A46A 2EFQA 4JYAJ 2AZ1A 4U7CA 3I55S 4HACA 1SB6A 3DU6A 2A10A 4DV5J 3SXLA 2CQIA 3TUZC 2EC0A 5JUMA 2MMYA 1NDCA 3M8QB 4WTOB 1T11A 4LFCJ 1HBUA 2XSJA 5CD4H 4BBYA 2WW8A 4R0JA 2PMWA 4NLOA 2RS8A 3B82A 3PJWA 4JYAF 2YWWA 3LANA 2F8EX 1X4GA 2DIUA 2ZDPA 1X4CA 1CEZA 2Q6BA 4G1QB 2KN4A 5C24A 4EU0A 3I4HX 4PWDA 4IFVB 2DIVA 3PIOQ 4NLGA 2GAHC 3RRHA 1JXLA 5HL7Q 2FJEB 3O3LA 4HL9A 3OXGA 2RNEA 3MMCB 1J5OA 4P7TA 4LF5J 2BE7D 3TJ8A 4L6V3 4IO9Q 1LWCB 4FYXB 4C3KA 2LMIA 3J80U 2QLJB 3OL8A 2DVIA 4D3HA 4EBEA 4P9SA 1EIYB 3ZXWA 4PCQA 3SFGA 1RT5A 3A13A 2HYIB 1KLMB 4K59A 2AEJA 3TUIC 1JLQB 4B3MJ 2YX1A 4DX7A 2BJ7A 2XHCA 3DLGB 1DURA 3GSIA 3QO9A 2BRKA 4NXMJ 3KJVA 4LF5F 2LXIA 5CCLA 1OY6A 4QWEA 4RUCA 5D0HA 3VTIA 1JLFB 4CDIA 1KOHA 4X4SA 2VFVA 3G8QA 1NXIA 2OPSB 4PWWA 2IIHA 3T1HJ 1WHXA 2B5JB 4NA2A 5JVGQ 1F0XA 2YWKA 2DITA 2PN6A 2OUGA 1TK8A 3PX0A 4B3MF 4RW4B 3K7RA 3BO2A 4P2SA 4IR9A 2HFZA 4P74A 4NXMF 2ROEA 3ZZOA 4NOHA 4B9NA 3T6BA 3KG4A 4X4VA 4OI0A 2E5LJ 4CLSA 1I94J 1IXKA 4KBIA 4UOCA 3I56S 3IWNC 5AT1B 2MHNA 1TL4A 2RAQA 2HRUA 2VFSA 3Q89A 2W9CA 1YQHA 4CYUA 2HBYB 3PJ9A 1NHUA 2BKNA 2M3DA 2M5YA 3W64A 2EFNA 3HJVA 4KRWA 4QR0A 2VBXA 3ETMA 1JX4A 4AL5A 3UD4P 4ECYA 1I94F 1CC8A 1R0CB 2CUYA 1IVZA 2G2OA 1VFJA 3HVRA 1VBKA 1B0VA 3KHLA 3K0JA 4LR9A 5HJYA 1SQGA 5IOLA 1RA7A 4JB8B 4OQJA 2B9XA 3T1YF 3UD5A 3VAJA 1XQIA 4WIQA 4WTYA 4NLSA 1EB0A 4OV6A 2PFFB 1DY3A 2DH8A 2O1PA 3CTRA 1S1TB 4IO1A 1S0VA 1X4EA 5CAAA 2FLLA 2GJIA 1Y5IB 2NSCA 3KUEA 4O3RA 5E5NA 4CLZA 3SSRA 4EYHB 2E44A 4F4WA 2B56A 4F4XA 4JI6J 2VL1A 1Y11A 2H1YA 3FRYA 1NJXA 1VK3A 3VAIA 4RW7B 5HROA 4XPEA 3FSIA 2G0IA 2ZH5A 2ZOMA 1TKXB 1KQSR 5HSPA 1U1NA 1FFWB 3IS9A 2RDIA 2AD9A 4H4MA 3TA0A 3GILA 3ENVA 3R5BA 2M8DB 2FC8A 3TI0A 5DM7Q 4MMOA 2JLGA 4MKYA 1WKJA 5A0YA 1H0HB 4ECZA 3HSDA 2DNQA 4QR1A 4YP3A 4EGLA 2ZEJA 4CLLA 3M8PB 3QIDA 4Y2IA 1HPZA 4J9MA 1RHRB 3W61A 3KK3B 3QJLA 2Y1JA 2ASYA 2O5DA 4CLFA 4RWWA 1H2TZ 4KGZB 1AXQA 1WG5A 3JAMU 5FLXU 2DD8S 2R4FA 4IR1A 4BWMA 4MAKA 4YMEA 1OYDA 5U47A 3S8SA 5E33A 3QGHA 3DRYA 1Y5LB 4RNOA 2N82B 1S0OA 2IFXA 1WEXA 1GTEA 3NKYA 2IAJB 1YI2S 3C66A 1D9FA 4F8RA 1Y10A 3E8OA 2W1BA 4LIRA 3QYYA 2YNGB 3TO8A 3FFIA 1HFEL 1CULA 2RT3A 4K4XA 2QIFA 3VAFA 4OHZA 2CFXA 1UTAA 3T5HA 2IJFA 2IY5B 2XYGB 2ZKUA 1NLKL 3RZAA 4Y65A 4DL3A 4PPZA 3J7YU 3FJ2A 2HS3A 2XI2A 2JL9A 5ETNA 3WQPA 4ES3A 2Y9HA 1F5AA 2WB4A 4NEYA 1MNEA 2EBGA 1ZETA 5CYMA 1SV5A 1FRLA 3PG9A 2CQHA 1WWHA 4K4SA 1FTCA 1ZAWA 1S9GB 4LFBJ 1SJ4P 3QJPA 4DLEA 1R6VA 3I0SB 4WXOA 3MEEB 3HLUA 4NMXA 4DZ6A 2VASA 1C1BA 4KGVB 4HEA9 3WHIA 4DUYJ 4G65A 3TWZA 1HWKA 4CI0B 3TOQA 1RQ0A 2GAGC 5CZXA 1YJWS 4ZPTR 2I8EA 2BYCA 4RW8B 1GNKA 3OL7A 4NYOA 3G6VA 2LFVA 4FNHA 1IKXA 2ACMA 4F7VA 2EK6A 2CRLA 3UDLA 3M8RA 3VALA 2CWXA 1DTTA 2GVDA 4E8UA 1FRIA 4YHHJ 2IM3A 1YTYA 1LWFA 2EKYA 4ZP6A 3NMRA 1CLFA 3MPWA 3M8WA 5EWEA 3CDEA 2I0XA 1Q5VA 4ZMMA 4ZP9A 4ZVFA 3PW5A 3D0HE 2W9BB 2LDIA 2K3IA 1GMUA 5LOQA 1NZAA 3F56A 4O3QA 5KFGA 2POKA 1KQGB 2AKWB 2DGUA 4QR2A 3PTWA 2FPHX 2OLWA 4OLPA 2R8KA 1S97A 3GR0A 2QG9B 4P73A 3PY8A 1C4AA 4YHHF 3IAS9 4LVNP 4DPWA 3CJ8A 3BKTA 1NKEA 4RR5A 2YPZA 4PUOA 4LIWA 3DC2A 2V8PA 2QA1A 5DG8A 3QAEA 4JV2A 5LXRA 4TYBA 3CPWR 2HHHJ 5GAGU 1N52B 3MTKA 4WP8A 1D9AA 1UPPA 3BDPA 1RCXB 4QW9A 3HM9A 2H5EA 2HAIA 3MCSA 4NPOA 2EEYA 4JV0A 3VF0B 1Q5YA 1VCTA 4PXDA 1X4FA 3HD2A 2UUTA 2RUSA 1VQ8S 2HHHF 4C0HA 5RUBA 3QGPA 1XERA 4ETZA 3T3FA 2CPDA 4PR6A 3CJKA 3ELHA 1Q8KA 1TV6B 3LA0A 2WZ1A 4NLVA 2VKZG 4FS2A 3PR5B 1UZDA 1QE1B 2VKRA 2WSFC 3TZXA 4X84A 2QYCA 3QWUA 2K7JA 2KJWA 3OLAA 4K0KF 1RA6A 3M8ZA 2HHSA 2D69A 1HKAA 4O3OA 1Q7YT 1HBMA 4I6YA 2AIRB 1KONA 4G3IA 4KJIA 5L8RC 1WOSA 5E41A 2WOMA 2B9EA 3OUYB 5KFEA 5L46A 2VFRA 1V9OA 1XR6A 1UZHA 3G71S 1YLXA 2HBZB 3H59A 2RB7A 4N7TA 2ALYB 5IT4A 4QWDA 5SUHA 4PXEA 1R89A 5HQ8A 4X4QA 2HNZB 2FJDB 3BGLA 2IA0A 4XDDA 2M52A 4AXIA 2J9CA 3C14A 4NASA 3P8BB 1T95A 2SXLA 3GWCA 1D8ZA 3FCHA 1TKZB 4DL6A 3KLHA 2D3UA 3CO0P 4IG0B 3KK1A 5EWGA 2GMJA 2H54B 2OD4A 2FLNA 2NYIA 4IFYA 4IH6A 2HEKA 2L9NA 2YQ3A 4Y6IA 3NGTA 3MM8B 2C2DA 3OJSA 1UA0A 2V0NA 2E1MC 3H5SA 4DDFA 2P9CA 1HMVA 4DEZA 4QJVA 4B3RF 2W4CA 4LR7A 2V67A 1TAUA 2Z58B 1WDDA 1CJKA 1FEHA 5KG3A 2CXEA 5I3QA 1FTRA 2M70A 2U2FA 2OEJA 2KJVA 4NCAA 2KXFA 1BQNA 4QIVA 2YNIA 1ZTTA 1AFJA 1U7LA 1VQKS 3QGIA 3R5AA 3UQSA 2KT5A 4IOBA 3HHDA 4PQUB 4ECSA 2J0QD 1RTDB 1RHQB 3HKWA 2DY1A 2XZWA 5C25A 2ATCB 1HQEA 3DRRB 1RWKB 1PBUA 3CT9A 1FDAA 2YWEA 2FLPA 3QLHA 4KKOA 1FKOB 3IA0A 5KFPA 3HFVA 3MM5A 2AYMA 3R9LA 3CCSS 3OL6A 1NSAA 1RCOB 4OYAA 1NB7A 1NDPA 2ZC3A 4URQU 3UCZP 3SBMA 1P9YA 2LA6A 1M90T 4B9LA 4KPYA 1NK9A 2K06A 1Q0NA 1X4BA 2JJ4D 1NJIT 1HLWA 3W2VA 2WVDA 5ETRA 4XO0A 3IG1B 4X4OA 3DOMA 3JS9A 4WJBA 3DHXA 2FUG9 2DNLA 4USJC 3GCWP 4FVCA 1RWWB 5K8NA 3IRWP 3I6PA 5JVHQ 4IRDA 1VQLS 2AYGA 1N5TA 2GQQA 5ITHA 3WC0A 2DR8A 4P2MA 2XEXA 2Y3YA 3M2RB 5T14A 3C15B 4JI3J 2R2SA 2V2KA 4MFBA 4WFYA 4DG1B 3BGOP 1WI8A 4CLKA 3RJMB 1REVB 3TZYA 1Q8LA 3ZNUA 3W3SA 3DLKB 3N9UC 4OYZA 2F4VJ 3OSPA 4MH8A 4X65F 2RDJA 2FJVA 2RHQB 4JI3F 2BVZA 5C42A 3I0RB 4YOEA 3TAMB 1RT6B 2VUGA 3RB3A 4N8NA 4NCGA 3D6HB 1PGZA 2KL8A 4DV2F 5KFCA 2XB2D 2LP4A 3FSYA 3W63A 2R7XA 2F4VF 1UVNA 5BYSA 5F8JA 3OR1B 5I3UB 1ZZFA 5LJ3Y 2CNOB 3POTA 3Q23A 2HHUA 3OL9A 2CPIA 5A6PA 1RBOB 3D6TB 3IRXB 2ZBRA 4K4WA 4GMKA 3KNGA 4Y2KA 3PCOB 1TVRB 2HHXA 3RR8A 1UKUA 2MGZB 1QUPA 5KFHA 4N76A 3V5RA 3DRPB 3UNYA 4OZ3A 1X31C 2W4PA 1E6VA 1JLBA 1FRMA 3FZ2A 3Q8SB 2JEIA 3D7SB 2BM1A 2MSTA 3CDWA 4OMFG 2OP5A 1LWCA 3Q2TC 4X64J 4U6PA 3B54A 3U1LA 4ERDA 2XZDB 3I5CA 2HBRB 1G2EA 3LP1A 3MM9A 3D9BA 2A0FB 4LUBA 3DDNA 2RUGA 1U1PA 4CP5A 3ZZYA 2WBRA 2CWKA 2W25A 1FD8A 2DRBA 2RD5C 5IQ6A 4TQRA 4ZN3A 2E9TA 3BN4A 4Q8FA 3ZTQA 3UN2A 3MPDA 3OQ2A 1KHWA 2DGSA 1VJWA 3UW1A 2VA3A 2KFNA 4HH1A 4QW8A 2RHSB 4UOFA 4F3OA 5D77A 1FKPB 3G82A 3BO3A 2AT1B 1OSDA 2XMKA 2QZ8A 5D4OA 4MIAA 2JFKA 2CQ3A 1A9NB 4AD6A 3U02A 4DQRA 4WCEQ 5L39A 4ZLJA 3RW6A 2DR7A 1YRXA 4KV8A 4DSIA 4X4UA 3EVMA 3RB0A 1D9DA 4X62J 3OD2A 3MTJA 4HR2A 1SJFA 2GVZB 5KOWA 3LAMA 3HF5A 3MCMA 1D0EA 3S7RA 1RT2A 3FUYA 2BJ9A 2PIIA 2AJQA 1CJVB 3BQ2A 2JH3A 1Q8BA 1NJWA 2ZOGA 4ECTA 3I5AA 6FD1A 1HD1A 5ETQA 2BKPA 2BJDA 2HGLA 3NGSA 1URNA 5HO4A 4R8UB 3DDKA 4X62F 2AZ3A 4I2QB 4RNFA 1T8EA 2LLZA 3FDSA 1S72S 2DNNA 3IBFB 2XO6A 2MQLA 2HZAA 2HLUA 2QA4S 1LKZA 5E3RA 4DSFA 3NG8A 4ES2A 1YJTA 2RMLA 3ILJA 1GX6A 3BREA 1WSVA 4R5PB 4DV4J 3NGRA 3IP0A 5ETVA 3JYTA 1S1VA 1JNZB 2KVQE 2P9EA 3PKMA 2DB1A 3DLEB 3I5BA 3MEDA 3TARA 5KFNA 4ID8A 3MMBA 5KT7A 4K7QA 3BSOA 2YKNB 1FNXH 2HVZA 3MM7A 5D78A 4NI2A 2CQBA 5D4LA 4DPXA 1NHVA 4DV4F 3IN5A 1UMJA 2OSQA 3HPOA 3K5MA 2OKQA 2D3OR 2BR0A 2QJ3A 5J2NA 2OPPB 4LF2A 2E5GA 3HMJG 1QAXA 1WTBA 2DNPA 2D41A 3M8PA 3R1LA 4P2FA 4ZDNA 4FYYB 3OTOJ 1J27A 1AUSL 3G86A 4EFAC 3FMBA 3CDBA 1KVKA 2AX0A 3BSNA 1N36J 3MZIA 4KGXB 5C5JA 3HT3A 4A8YA 4J9LA 1RBLA 1B70B 2DHHA 1ZS6A 1BE4A 4JI2J 2RF2B 3AJDA 3ZZRA 1F9EB 5GADI 2AGQA 1IKYA 2HS0A 1APSA 3ZZUA 2XY7A 1FXRA 1JK9B 1GMVA 3NCQA 3N5BA 1N36F 2DK2A 1HWUA 2J9EA 2OPRA 5KTQA 4RW9A 1RTHB 1RAFB 3Q8QB 4QQBA 2NUUG 5CABA 3M1VB 1TR0A 5DQGA 1NM2A 1TL5A 5J1PA 3UDCA 4JI2F 1R3NA 2H65B 2EG2A 4USTA 3CCTA 4PQAA 4CLPA 3QSYB 2BE2B 4QIGA 1HYSB 4DV7J 1BHNA 2M4MA 2Z4PA 5A8RA 4WZQA 3F0NA 5KT5A 1FCAA 3MMJA 2GGPA 4OI6A 2RRAA 3D28A 2JVOA 4ZVOB 3GU0A 3RG6A 2WSCC 1VC0A 1IKVA 1YSJA 1S6OA 3CXCR 3HSGA 1FX2A 2YKMB 3BR9A 2MQ8A 1YWXA 3I32A 2UUBJ 5CA5A 1RTZA 3PRDA 3C6TA 4ALZA 4DX5A 1UL3A 3BYRA 2J5AA 2RKIA 3PRBA 4ILRA 5DLGA 3EX7B 2DNOA 2J8AA 2KH9A 1L3UA 1FDNA 2ZWPA 2XSFA 3QZ7A 3GE9A 4UQGA 1WF1A 3MAAA 5HBMB 4KIAA 4C11A 2LYVA 4A47A 4V1Ak 3CDUA 1M1HA 4KTQA 1GXUA 4DF4A 1CQNA 3GV5B 2UUBF 2CDQA 3MHYA 2UXBF 2KTQA 2OAUA 2XS2A 1R8AA 4Z37A 3TEGA 4IQXA 3RU0A 2ZH9A 1IUJA 2M8HA 1VQMS 3H25A 2C42A 3A3PB 4QBUA 1UVMA 4I7FB 3ET6A 3C2PA 5IM0B 4F04B 3GIJA 2Y1RI 3NS5A 1NH7A 4LF7J 5CYQB 4XAKA 3M30B 3I96A 3RBZA 1P1LA 4DR2J 1JJHA 3MECB 4F3QA 2VHGA 4N47A 1FVQA 4GKJJ 1XR5A 2MY7A 2IMWP 5K14B 2LU1A 2L48A 1FRJA 2KZZA 1U1LA 2DXEA 5AE2A 2DR6A 4LF7F 4ANCA 3UN5A 4U9RA 3HHLC 1IM6A 4HACB 4PYAA 3KNAA 3V6JA 2W2NP 2N4CA 2UUAJ 2C3YA 4GKJF 2C28A 2CQPA 2KT3A 1HBUB 2XSJB 5EUHA 3JQMA 4OYOA 4F50A 1LFWA 2B4OA 1IR0A 3UNGC 1T02A 4K2XA 3D0GE 2X1FA 2DHSA 5F9NA 3OPKA 4OI3A 2XGQA 1T9XA 1SKSA 3IWLA 3A8EA 3KUGA 3ETOA 1X4AA 1AROP 3QAUA 1TV6A 3ENAA 3CUNA 2VG5A 2UV8G 3DU5A 2OFGX 2VF3A 2UUAF 5D0EA 5C24B 2VDIA 4PWDB 2V94A 2JFDA 2YX4A 2CZ4A 3KLFA 4OYWA 1WI6A 3HULA 3RAQA 1WUUA 2UU9J 5AJ3F 2L9WA 3CJ4A 1J5OB 5KFKA 4HKQA 1UEVA 2W7AA 3O6QA 1FK9A 1W2BR 3TX0A 4GKKF 4LF1A 3FKBA 3UCGA 1RT5B 3IMQJ 4JI1F 3UI3A 1RAGB 2X3DA 3TQ1A 2VQEF 4Z7CA 3SV3A 1VQ9S 2LEPA 3JQJA 2D9PA 2OELA 3PX4A 3QO9B 4NEZA 1S6UA 5KFBA 1LV5A 3KJVB 4CT9A 3NAIA 2LQJA 4U8VA 2WVCA 1IWGA 2E7WA 1QM9A 1KVIA 3A8JA 1VQOS 3CC7S 5EX0A 2YH0A 4URSA 1F60B 4PXBA 2LQ9A 4DSKA 1F1BB 2BANA 3P4UB 1T7PA 1U0HA 1NK7A 5D0RA 1YZ7A 4FBUA 1I51B 3QATA 4PG6A 1XNRJ 3AQPA 1FDBA 4W98A 1WHWA 5BR8F 3DNCA 3MR6A 2CPXA 3W2WA 2XLKA 2W9CB 3AOBA 4ZHRA 4CYUB 2ZBIA 2ZHOA 1Y0HA 3CE8A 4DU7A 3EGNA 2NSBA 1OQ6A 2NUHA 3WIVA 4ZIVA 2UUCJ 1RYSA 4MKVA 1XNRF 5GAHU 2QX0A 2IMOA 1TL1A 1TKTA 3LO3A 2KRRA 2DGOA 4G6VB 1RAHB 2AQ4A 5F0UA 3VV2B 4FBTA 2VB6A 2DGTA 5IS2A 3AXMA 3U1MA 4L73A 3L7PA 2W2MP 3DKDA 2GC8A 1N54B 2RU9A 4X66J 4Q43A 3KKFA 4ILLA 1WF2A 2UXCJ 2UUCF 3L7UA 5C7PA 1HBNA 4S0MA 2HQGA 2ZJPQ 3H20A 3N79A 2B7BB 4FYVB 3RTVA 4E98A 4DR7J 5D15A 1R27B 2IM2A 3ILOA 4GRSA 4X66F 2V69A 2FZGB 2I9SA 3O44A 2UXCF 3GIKA 3V4IA 3O5TB 5HROB 3A8KA 4CO2A 2FJAB 3FRZA 5FJ4A 2E1CA 2B8PA 1TZ0A 3HK2A 1U0SA 3IS9B 1DQAA 4WE1A 1R0BG 4LMZA 4UY8T 2P8IA 3RB6A 1VMBA 4H4MB 4ZA1A 4DQQA 3K5LA 1OPZA 3T5LA 4DR7F 1YJRA 2KFYA 4USWA 1S59A 5A0YB 2BW2A 2B7CB 4DSLA 3GR1A 2J7WA 4P10A 1HI8A 1GT8A 4C8ZA 3KXDA 2YPYA 5IT9Y 2MJUA 1ZTWA 2H51B 1MWZA 2V2ZA 1HPZB 1TFWA 1PKUA 1CG2A 4RNMA 1NCLA 3LW5C 1RWXB 3C6UA 1FDDA 2ZJQQ 4CO4A 1FE4A 3OVBA 1OPIA 1S77D 2CPFA 5I3PA 4OZJA 2Q1LA 3K59A 4BHQA 2QLXA 1GTHA 1CS4A 1YRTA 1WSRA 1DRZA 2HZVA 2CQ0A 1ZZNA 4NLWA 1VBYA 5E3QA 3H42A 1FRXA 1MG7A 1Q16B 2DCLA 1LWEA 4LJMA 2H48B 1DQ9A 1QVGR 3FFIB 3B4DA 1CULB 3GYGA 1T9YA 2KRBA 3ZZ0A 1JKHA 1BQMA 1PC4A 2V5HG 3NAHA 5G4DA 4J9RA 2HSEB 3DRSA 3V6DA 5K9FA 1IJFB 2MQMA 2MPUA 3KG1A 3PO5A 3MOJB 3M05A 4RJVA 5CQGA 1U24A 2XYPB 4O0NA 4EBCA 4LFAJ 2PI5A 2V8VA 5KG6A 4YQWA 4ECVA 3W65A 4DPTA 1VK8A 1RU2A 4OJHA 1VQ6S 3NOCA 5IV3A 1RAJA 2J6SA 3VGSA 5CYMB 3EWGA 3C8YA 1SV5B 2V8DA 3BSCA 3TZWA 3WC2A 3N0VA 4OHXA 1AW0A 1X4HA 3FNNA 4ZOSA 3TVKA 2CAJA 4LFAF 2GJFA 1KTVA 1VGYA 3HKZD 1C1BB 4ZVHA 1QVFR 3RYLA 2OTLS 3W5ZA 1N5VA 4ED3A 2K7KA 4Q5VA 4WXWA 3Q8YA 5KFJA 4F4AA 2B0GA 3MD3A 4ZJLA 3OHAA 4UY85 3CMES 3QRPA 1JIHA 3FGVA 2GV1A 3NEKA 1MN7A 2IYGA 1F5BA 1P8GA 1IKXB 1GMWD 2ASLA 3MMAA 4DL2A 3IBCB 1DTTB 5HMWA 2GVDB 2N7CA 3Q8RB 1WKKA 2C3OA 1E6YA 2G0JA 3AOCA 4UT4A 1JJ4A 3TJ9A 4DUTA 1LWFB 2V2VA 3FEZA 2H4YB 3RAMA 2G1HA 4ZPBA 3CC4S 1DAXA 4DOZA 5EN1A 4Q0BA 3WX4A 1IBLJ 4Y0FA 3TAQA 3CMQA 1U49A 5J1EA 2JEFA 4WK1A 3CD6S 1ZM9A 4Q44A 5BXIA 5B7WA 2MSSA 1TK5A 1GEHA 3PV8A 4JI0J 4OJ3A 2YNHA 1A0OB 2GO8A 3NGUA 4PUOB 5I42A 2VDHA 4ZVPB 3GLJA 2DEJA 3H0PA 4CLWA 1S76D 2RU3A 1IBLF 4W90B 1P9QC 1M0SA 4ZVUB 2IDLA 3EVOA 4C2MA 3KJQB 1NRKA 4JI0F 3H4DA 1VIOA 5H9FK 2Z2ZA 5IWAJ 1SKRA 3JTOA 3DGPA 5KFLA 2VPZB 1H73A 3JXOA 3VQTA 2V4JA 2FVPA 4OYBA 4TXSA 2CYYA 4WPAA 2H9ZA 3D54A 3MAQA 1ZAXA 2C3MA 1ZA1B 1QAYA 3TX8A 2E9ZA 3ONQA 4RU9A 4DN9A 3CJKB 2MKIA 2L9DA 4UTGA 3MR3A 2GO9A 3KHGA 2N4DA 2R8JA 1N32J 2PO4A 1I1GA 4RPFA 5GAEU 2KT2A 2XY6A 3N01A 5F8LA 2DO4A 3BV8A 4GC7A 1UAWA 2R8HA 4R0EA 4ZPDA 1JNRB 1HBMB 2BMBA 2AEFA 2AYEA 1NAQA 1FERA 1QLNA 2WOMB 1KR4A 5LJ5Y 3CCZA 5A2QY 1FT8A 4WKYA 2CQ4A 1N32F 1I5OB 1LW0A 1UEKA 2Z2MA 3DOKA 2XMAA 1ZA2B 1QSLA 2LQ8A 2BZ2A 2FHOB 4NXNJ 3ZC4A 4ICLA 1HNZJ 1VQNS 3C14B 3CGIA 3MFIA 3FMWA 2F4FA 1ZYQA 1Q8IA 1REGX 5H9FJ 3LGNA 2ZVIA 3KK1B 2EFOA 4NYZA 4ZJQA 1HBOA 2PC6A 3ENQA 2FY8A 4ZLPA 5F0WA 1BQXA 3LGHA 4UUXA 1NDLA 1SIZA 1HNZF 2V4RA 1HMVB 4AQYJ 3MR5A 4YEAA 1X9WA 1YJNS 1S6QA 1CJKB 3O8WA 1N0VC 2EWHA 3K8VA 2Y0SD 4B9SA 4E0DA 1BQNB 2YNIB 5HQMA 2KB2A 2XNQA 3GIRA 2AX1A 4Y00A 4ED7A 1H2UX 1Z2ZA 2MQQA 3Q22A 3GJTB 3MUTP 3U27A 1Y4ZB 2ZDOA 4ZCMA 3HFKA 4G1IA 4AQYF 3MGJA 5C25B 2FGCA 1HQEB 4EBDA 1SVDA 4DL0C 4B17A 4JV5J 1F6TA 5GMKa 4FDFA 4NZ7A 3AY0A 3QLHB 3MWBA 4KKOB 3MUMP 3MM5B 1EX8A 4TY8A 5KT6A 1EAYC 1OSCA 6AT1B 4LREA 4WK3A 2AGPA 1Y7PA 4LSLA 1FWPA 4DX8H 4WBFA 3KJFB 1GMWA 3V6HA 3Q8PB 4LF4F 2KVIA 4C97A 4L3NA 3KHHA 3W2VB 4HH0A 5J2PA 2C1EB 4JV5F 3DOMB 2P6TA 4M5DA 4HTJA 2OMLA 2AJ1A 3HJFA 1Y00A 3UO0A 1XR7A 5F8NA 1MMDA 2QEXS 4ATNA 2ZOFA 4KSEB 4KHRA 2W8LA 2DCUB 4J9VA 4XK8C 2DY9A 3VZHA 4MFBB 3MFHA 1O0PA 3NS7B 3DI6A 1IQZA 1UJ6A 1HW8A 4K50A 1RXOB 5B0BA 1WELA 2D1CA 3A4TA 1T03A 1TQLA 2OFHX 1BUXA 4TQSA 1IJEB 3J7AN 4EYIB 1UWAA 4ZVRB 1X9SA 2BV3A 3DMJA 2GHPA 4OYXA 5C42B 4LF8J 1AZSA 4J5OA 4P2XA 2NREA 2DNHA 1M5KC 4M5LA 1RTIA 4MT1A 2MQPA 4NCGB 3V6KA 2HK3A 3KK2A 2D3ZA 2DISA 3OR2A 1WEZA 1LQ9A 2I6WA 2M88A 4CLTA 3HI9A 3GIMA 2ZH4A 3KJNB 2WAQD 1RI7A 4CLUA 2W7PA 4OJ1A 4CM2A 5AXKA 3POTB 2NR0A 4LF9J 4LF8F 2OMOA 4FXWA 5CXTA 4RW6A 2FIUA 5KFIA 4RBTA 4TYAA 4I56A 2W01A 2JLEA 3N5FA 1NB2A 3PHTA 2XLIA 2QLWA 2KHCA 2QV6A 1JXVA 1T05A 1NPRA 4OI2A 2MYFA 1E6VB 1JLBB 3MEGA 4FKYA 1U1MA 4LF9F 3QFWA 3V81A 1RAIB 2K2PA 3PDNA 2EC2A 4DV0J 2QLBB 3CW2C 4FYDA 5BYRA 1O51A 2M9KA 1FVSA 5A8WA 1VJQA 1YKWA 3LP1B 3MM9B 4ENOA 3GTYX 3HXMA 2V9KA 1RT1A 2MKCA 4PKDB 3CCVS 1BWVA 2JOQA 3GJSB 2NXNA 2XNRA 2FJBB 3HT0A 3CSKA 1W2IA 1V3RA 2ZBQA 2OD6A 4DV0F 1S99A 1B0TA 3CIMA 1S9FA 3PX6A 2VONA 2Y1LB 4GC6A 3WBZA 3B6BA 1LK5A 1S6PA 5KT2A 3W1YC 2RQMA 4ED0A 3LAKA 1WTFA 2CPEA 3S6EA 4DBQA 2CA9A 1R0AA 3RR7A 1Q1KA 1IN0A 1N6QA 3G82B 5I4MA 1FFGB 5AXNA 3CMAS 3AD9C 2W7OA 1KS2A 1NSPA 3MUVP 1ZAVA 1SKUB 3N6MA 2RRNA 2CVEA 2QL7B 4FVMA 4KV8B 2UVWA 1O5JA 4X4RA 2XY5A 2Y8YA 1ITPA 1YBTA 3R3TA 3R5CA 4ECQA 3EVWA 3T1YJ 3LPYA 4U67Q 4F0KA 1EKSA 3FBEA 1RT2B 1ZOTA 1NEEA 2WVEA 3IR5B 1RWNB 4KYZA 5KFOA 1FEEA 4ZVTB 1H2VZ 2PD1A 1UJ5A 2L08A 3VAKA 2M2BA 2R7UA 1S4EA 1EHWA 3BGRA 4QZVB 4WU3A 2EI5A 4USUA 5D8HB 2WONA 1K8AT 2JSXA 4EEYA 4KFBA 4CH1A 3DM2A 1YJVA 2A2CA 4NA1A 2EG1A 1TL3A 4O4GA 4NLYA 1KN6A 2XG8A 4ES1A 3ZZZA 1AA1B 4J9UE 5KFZA 1PYSB 3OBIA 2F5GA 1YITS 5ETSA 3W5XA 1B4SA 2OO4A 5L9NA 3CULA 5C2CA 4OIXA 3SZ2A 3MEKA 1FJGF 4KGMA 3GJRB 3JYTB 1S1VB 3U1NA 1HHTP 1G7CB 2EKNA 2HMIB 3SQGA 3THTA 3R7NB 3MEDB 3PVXA 4LRAA 3MMBB 3VVTA 1MLAA 1XMQF 2U1AA 1M1GA 5KFMA 1BC6A 2HVHA 3ULHA 4USMA 1CC7A 2ZBPA 1VIXA 4X4TA 3I87A 1C1CA 3MM7B 3TR5A 4HHUA 4NI2B 4P72A 1MROA 1UP1A 2B3TB 1U2FA 3KLGA 4A4JA 5KFRA 3FCVA 3JTNA 3R8YA 2BQ3A 4ELVA 3UDEA 3CIZA 4O4RA 1SJRA 3JSMA 2FJWA 2OJ3A 3THPA 5J2NB 1K9MT 4CZCA 1LK7A 1KSPA 2NPIA 4NCBA 4M5HA 5ETPA 2MZTA 3BSAA 3ENWA 3BGUA 1VLYA 1MU2A 1NU4A 1DTQA 3P3DA 1EETA 3GZ7A 2J7UA 3PNIA 3D5MA 4BC7A 3D68A 2LQ5A 1RT4A 1UCNA 4L72B 1ROFA 2DGWA 2C2OB 2BXJA 2G2YA 3KLEA 4KGKA 4CRJA 1NPPA 2GW8A 5KFQA 2VG7A 1DBDA 2J8SA 4LR8A 1X8DA 5DG9A 1XEZA 2LU2A 4BS2A 5M2PA 1IM4A 1L3SA 1DLOA 4XIUA 1IKYB 4DR4J 2LDYA 2MKSA 4LQ9A 1IKWA 5CD4A 2CJQA 2QA4G 1B99A 5SZTA 2OGUA 3ICLA 2OPRB 4RW9B 4OZ1A 2G9OA 4I6AA 1M5PC 1W26A 3TYTA 1CSJA 5E2QA 3A12A 2R8IA 3VAMA 1S10A 2ZH7A 3IC1A 3FQKA 4DR4F 3N28A 2KM8B 4DF8A 3UD3P 3H2LA 5A8RB 4DPYA 1Q4RA 4YY3F 2XM3A 1AFIA 1G1XA 2GGPB 2I5JA 1HNWJ 4MK8A 2E1RA 1WOPA 1N8RT 2CQDA 3OV7A 1Z4UA 4C4WA 4FYWB 5LMNJ 1URRA 4KT0C 1IKVB 4Y34A 2X7IA 4OJGA 1V5IB 1FWLA 1JLGA 3C6TB 3NLCA 5H9EJ 4UOGA 3W9HA 4GO7X 1UETA 2IPOB 2RKIB 5IXUA 2YQ1A 5J2MA 1F2HA 3D1HA 3OXLA 5K5MA 1TMMA 1XNQJ 3OLBA 1H98A 1HNWF 3AAWB 4NMLA 3MDFA 1JJCB 4ETXA 1NJZA 2HHWA 1CJUA 5GAGI 3MAAB 3R1HA 3LGMA 2WK4A 5LMNF 4HDHA 1WC0A 4YDDB 2A3JA 4A8MP 4C11B 3Q0AA 2XCPA 2PMZD 3ITHA 3GMGA 2Q79A 5HK4A 4ZVQB 1UFLA 2E9RX 3KOAA 2OH2A 2G1DA 3HFZB 3TJAA 1XNQF 2Z2LA 4TU9A 1HNXF 3FCWA 4LRDA 4DR6J 3CVKA 2R7VA 2LKZA 2W4DA 3ET6B 4MK7A 3OSNA 1RT3A 1WHVA 3W5YA 3M6XA 3T19A 4Q2LA 4I68A 2HQIA 2VJVA 1SC4B 2AMCB 1DHMA 2NYHA 3G4SS 2R7OA 2XQCA 1C0TA 4A8SA 2ZD1A 4X4NA 3M9OB 1TUWA 3T9NA 2MZJA 3EPIA 4D3GA 2QYGA 4DR6F 4I1TA 4ED2A 4HI2A 3FBCA 4W92B 3QZ8A 3K8WA 3EGWB 3NP5A 1U4BA 4CO3A 5DDRC 2I2YA 4N77A 2JEJA 2RH3A 2BA9A 3LPEA 5IT9U 4U8YA 3ZO7A 2XMWA 2PDAA 1K1QA 2F9DA 2FVRA 3CEDA 4DFKA 3PACA 2OEMA 4YS2A 4ZN1A 2B6AA 2Q6CA 2HNYA 4NLDA 2LA4A 2PEBA 2E5HA 4K0KJ 3DYAA 1G6BA 5L9XA 4FS1A 2CIMA 4OI1A 5JJBA 4M5IA 3VGVA 1SUQA 2BW7A 3KUHA 4OHYA 1QJHA 3EUNA 1A7GE 2KG1A 4H4OA 1SC3B 4OHWA 4C0OC 5L38A 3R5GA 2VG5B 1RAAB 3AA9A 3BH7B 2IM1A 3QGGA 4YN3B 2RQ4A 1UVIA 3KLFB 1XC9A 2E1PA 4NRUA 3BBFA 4M5JA 1IR2A 2R7SA 1X7VA 4PRFA 3S01A 3GP9A 2V50A 2BDPA 2QFJA 1PJ6A 4YR2A 1FK9B 1SIWB 2ZHBA 5T41A 3OFFA 1JMTA 3EM1A 4XPCA 3SEOA 1SJ3P 3PR4A 3Q8UA 1FJCA 3HD1A 2XMMA 1JJ2R 4C7QA 5KFYA 3M2UA 3OTCA 1NBEB 1FE0A 2EPIA 2CJYB 4NWBA 3OXFA 3AFGA 3EGVA 3PEHA 1VYAA 4EMDA 4B3RJ 1RHKB 3ILLA 3KG0A 1A6LA 1B0PA 3MI7X 3MM6A 1KD1T 5HQLA 5JXSA 1H72C 4RU2A 2DEIA 1PJ7A 1JLEA 5DZ7A 3WX8A 2QT7A 3G87A 4ZPCA 2BANB 4Q8EA 3DRXA 5E3AA 4EK2A 2DHXA 1U0HB 4A8OA 5LSLA 4NLXA 3PYEA 1FA0A 2V4QA 2H4WB 5F41A 3CJ5A 4M8LA 1PYTA 2N3OA 1UFWA 4C8OA 1SJ1A 1SXLA 4DQIA 2QFIA 4TU7A 1FD2A 3W2WB 2CJKA 4QCLA 4USHA 4B3OA 1RWMB 2ILYA 5BYQA 4ZHRB 2B4UA 3CF5Q 4OI4A 3HHLD 3IFEA 1U8SA 2VJUA 1T9WA 3NBPA 3VWSA 2ZH6A 2DYAA 1HR0J 1ELOA 1R7IA 2VICA 1TL1B 1TKTB 4K4UA 2WSEC 3TUPA 2RE1A 1JLAA 1BWEA 3HVTA 3H8YA 2BQRA 2CQGA 1SQEA 2AJ2A 5IC6B 4DSEA 2VOOA 3R6GB 2QE5A 2Z8QA 3T5JA 1WHYA 3G96A 4DCOB 1D1UA 3R2CJ 1YJUA 1HR0F 1IR1A 1UW9A 3CJQA 1HBNB 2K8GA 3VAHA 1R8HA 4AYBD 1S12A 4ZITA 2IRUA 3LWLA 5B0GA 2BE9B 4JOUA 1EP4A 4X65J 2GA7A 2MKJA 4USVA 5GVQA 2LEBA 2VG6A 2P6SA 4FN5A 1WD6A 4HHJA 1NNDA 3UR0A 4ED6A 4F67A 1RGVA 3V4IB 2WW4A 3BO4A 4MKBA 1T3NA 2W24A 1OQ3A 4DV2J 3NY0A 4WE1B 4M5KA 2QA2A 4CO1A 3SDEA 4F0MA 5A76A 1TAQA 3TQEA 1HQUA 1KOOA 4EUVA 5HP1A 1SKWA 4NL5A 4Y28C 2APOA 1HARA 4KC5A 3DN9A 2JVRA 3W8PA 3VHQA 4RUHA 1YK9A 5DJBA 2IDEA 2HBQB 1K44A 2H5IB 1IBMF 2Y0BB 3BS9A 2F9JA 1RSCA 4DR1J 3C6UB 3KYLA 3W7BA 3MCNA 3RBEA 1ULRA 3R5JB 3W62A 2DPIA 2ATLA 5CCMA 2HFSA 4CTAA 4F26A 4MYTA 3OTEA 4OZ2A 1AUDA 3H5XA 2KXNB 3IGVA 2J6TA 3H90A 2MJNA 1H6KX 1CS4B 5KOXA 2JDJA 4DS5A 3GFHA 3EPGA 3NS6A 3DLJA 4EZ6A 1C4CA 4DR1F 3H2UB 1LWEB 5FDLA 5D4NA 1OY9A 4ID5A 1P27B 1V3ZA 2YH1A 3PW2A 4F36A 2R2TA 2QMWA 3C16A 4KY3A 1JKHB 1BQMB 2UV8A 3DRSB 2AWZA 3V6DB 3OVSA 2CPZA 1RUSA 3QT5A 4DV5F 4PG8A 2ABYA 5A8KA 4PEOA 2JC0A 2FZCB 1S48A 4DLGA 5HN0A 3A8IA 3P49B 3QWPA 4LFCF 4Z2XA 5C2GA 3ZFVA 4Y3CA 3CD0A 2MTLA 2CJXB 4NLUA 3TUJC 4K4VA 1EARA 4KAIA 5KFTA 4DSJA 3GCXP 4M5GA 2J7KA 1TMJA 1NKCA 4URGA 3UR3C 5L1LA 4O0IA 1YZ6A 2AU0A 2CJBA 2ZZNA 2YXLA 4C8NA 1U8WA 3SQOP 4FZVA 2NLWA 1YVFA 4JBCA 1S4FA 5L1KA 4RZRA 3P45B 1TK0A 3W60A 2GIFA 2PE8A 2A18A 4N5SA 3GG1A 4DMZA 4I64A 1SCJB 2ILZA 2NXJA 1FRKA 2KYZA 4YB6A 3OVAA 3HHLA 4K5RA 3T41A 1U1QA 3MMAB 2MQOA 2H3EB 3CD5A 4ED4A 1E6YB 4GO5X 3BQ1A 4DS4A 1WC1A 2HHPA 4L74A 2DNGA 2E5JA 2HHQA 3GFZA 4Q0BB 3M8SA 2MEWA 2MZQA 1NSKL 4FF2A 1SJQA 2CPYA 1MN9A 5J1EB 3T1HF 3IM8A 1L5UA 2VPXB 1UJ4A 2AJFE 1N5QA 1TP7A 2UVUA 2R8GA 1XK8A 3SCJE 4UW2A 3G8SA 3UDVA 2BJ8A 2C2NA 2YNHB 4Y2AA 1U09A 5CH7B 3NNHA 3BBBA 4CO0A 5I42B 2P5VA 4TNOA 1XJWB 2B4VA 1HNVA 1VLOA 2HLTA 4DU8A 3FBFA 5HMZA 2E5LF 3JQKA 4LSNA 5HMXA 3MR2A 3QJJA 3ISNC 2A6MA 5HLFA 3IAM9 3NMAA 3Q83A 1L3TA 2ZUAA 1RE1B 3WZ0A 2F7VA 2M7SA 2HVEA 4YB7A 4DUZJ 2PEHA 2ZUGA 4IDKA 1TFYA 3ZNJ1 5K8OA 4AUKA 1UW4A 1LOUA 3DGPB 2HMIA 2C2KB 4RNHA 3BR8A 2F63A 2V4JB 2ZNZA 4M5MA 4WF9Q 1S0MA 1EJ7L 4DCJB 1EQ0A 3RBDA 1T0TV 2B8QA 4DN0A 3DFEA 1J5EJ 1R31A 3DDIA 4B9UA 1XWLA 2BBEA 1YRUA 4IG3A 4DUZF 1RAEB 2VA2A 1YDLA 2W2QP 1RT7A 3CJTA 5IFMA 2FGOA 2VC0A 3D4JA 4ZIWA 4PG5A 2QL9B 4F3MA 2VBWA 3MURP 1WC6A 2YY3A 2AYBA 3DLLQ 4OV1A 2QRRA 1J5EF 4OFZA 3PIPQ 5DDQC 3DXBA 5HVHA 4KO0A 4JI6F 4HI1A 3V4MA 1LW0B 4C98A 5KT3A 3SSSA 3DOKB 1V3SA 5D4PA 3K5PA 5LM7E 2DTJA 3US5A 2XWYA 3PFOA 2K1RA 2HFOA 3M8YA 3D3CJ 1NMEB 4ICLB 2IJRA 3B78A 2YKAA 1BGXT 5BJRA 1X5PA 1C2PA 5DO2A 1RLDA 4DX6A 2PSZA 2BX6A 4MKAA 5DG7A 3AT1B 2QL5B 1X4DA 4FXDA 1HBOB 3ZTRA 1Q79A 1GAOA 2PA3A 4ER8A 1EQMA 3UVJA 2CQ1A 2MZSA 3Q8VA 3CJ0A 3I9ZA 4AL6A 2HFVA 2HQDA 2E29A 4MIWA 2FYXA 2R7WA 4J7CA 4J9NA 2FTRA 1S6QB 2J0XA 1HD0A 3PW4A 3H7HB 1R8PA 2YNFA 2FHMA 1RTJA 3L95X 3E01A 2P2CB 4FPIA 1JLCA 4OZNA 2GFFA 3P5TL 1S0NA 5KFWA 5KG7A 2CZVC 3FQLA 5B0CA 3OW2R 2UXBJ 2JC1A 1WC5A 2IRYA 3GG0A 4CM0A 1B3TA 2G4BA 4KHMA 4TY8B 3RRKA 2B43A 5EHHA 1PCAA 2FZKB 1M5VC 3EZUA 2R7QA 1UPMB 4LSLB 2XMJA 4F4KA 1Z2LA 3TRGA 3BBCA 2GIQA 3UWTA 5HAOA 1C0UA 2XS7A 4ILMA 4OL8A 3NRBA 2HQFA 3K5OA 1KTQA 2N3LA 4F25A 1S1XA 5J2PB 3NNCA 4QWAA 3CO9A 1UEUA 2GHWA 4NYPA 3KHRA 3R97A 1P1TA 2O3DA 4M5DB 2ZE2A 1MMNA 4JI7J 5DZ6A 4YUDA 1SC6A 5KG2A 1VRTA 3PYFA 4NE9C 5B09A 4BCAA 1MWQA 2LQBA 1H74A 2LVWA 2C2EA 8AT1B 2Q43A 1X5OA 2DO0A 2ADBA 3D3BJ 1VRUA 2F8HA 4LFBF 2GQCA 4XTTA 4KPCA 1WKLA 1NDKA 1RYRA 4DL5A 2ZC4A 3DI6B 1ICEB 3F41A 1PAUB 1HNIA 3QFHA 4JI7F 4DUYF 1T03B 3PXGa 2HVIA 2NXEA 4GVBA 1F9FA 4YFUA 3H40A 5T7LA 3DMJB 4I67A 5EDWA 3M7VA 2DHGA 1AZSB 2MZRA 2KZMA 3IGNA 4IOCQ 3CJ3A 4C9DA 4M95A 4C8MA 2RJZA 3IBWA 5KT4A 4HT5A 1RTIB 2BRLA 2AP6A 3AXKA 3KK2B 1CJTA 2F8MA 3OR2B 5AE1A 4KH1B 2IRXA 4CQ1A 1U1KA 1DQ8A 2ZBCA 1T9UA 4EO8A 3EE3A 2C22A 1XBWA 3BEGB 2B9YA 3I82A 3KTQA 1Q53A 2OEKA 2WBMA 4O44A 5AJ3J 2O67A 3D6MB 3UFCX 3HSJA 4RW6B 1TUVA 4MTPA 3NXZA 1RWVB 3EICA 3M9MB 4WFNQ 3VGUA 4GKKJ 3CCRS 4KHPJ 4A8QA 4P6QA 1SBRA 2XMUA 3HCXA 2HW3A 1VBZA 2GJ2A 3THVA 3GPAA 4JI1J 1N5YA 1M5HA 1T05B 3M32A 1BLUA 2GMLA 5KFFA 5J2QA 3MEGB 1B64A 1WG4A 2VQEJ 2HNDA 4FF4A 4WWSA 2VIHA 3V81B 2VD3A 2Y1IA 5H1SV 2YWHA 1PJ5A 2CADA 2Z57B 4ECXA 3MCOA 1D09B 2C3PA 4B3SJ 4ZVSB 2XO7A 3QRQA 3LP2A 5A8WB 3JTPA 4KHPF 3M6WA 2XULA 1RT1B 1QTNB 4B02A 3L7OA 1S7IA 2X3GA 3LALA 2L3MA 1X0PA 1S1WA 3OFHA 4OZ5A 4RKUC 4LBPA 5GAHI 2HQ3A 4OYMA 4ZJOA 3FSXA 4QWCA 2KI2A 1OIAA 3QNWB 3LP0A 2XMTA 4IQMA 3H2VE 3QIPA 2IVFB 4B3SF 1S6PB 4DR5J 5BR8J 5ADZA 5D3GA 2JNJA 1PBAA 1KEKA 2DRDA 1U26A 2ZJRQ 2RRBA 1R0AB 4UZCA 1F3FA 1N6QB 1VBXA 2IC3A 2ASJA 1LNQA 3KDOA 1OMSA 5DQIA 4FPRA 4L3KA 3T1AA 4WZMA 4FXVA 5HI7A 4J90A 1F3VA 4DR5F 2OPQA 1J2VA 4UF4A 4C6AA 2VV5A 2RQCA 2HRYA 2HPUA 4AL7A 1HW9A 3RRGA 4C8YA 4X2BA 5KG4A 3SFUA 2KG0A 2QSWA 5G0RA 3CB4A 3J81Y 3GONA 4WFXA 3VCDA 1YIJS 5ETMA 2C2MB 3FC9A 2MQNA 1T9TA 2JZ5A 3BM7A 1S1UA 3GV7B 1Q82T 1UWBA 4J9SA 2V63A 1Y3JA 3C3LA 1W25A 3BGRB 1TL7A 1U48A 2FVCA 1KC8T 2HIQA 2WONB 4N41A 1ZM4A 3MR7A 4KFBB 2KXHA 1NZ8A 3TVYA 3DM2B 1VC6A 1RKIA 2X1BA 4EWTA 1KNZA 4Y2MA 1TL3B 4O4GB 3R2DJ 2VH7A 4I2PA 1W7WA 1NKBA 4ANEA 3CJRA 3T9ZA 2BJ3A 1L3KA 3X3UA 1BMQB 4IH5A 3AD7C 4QWBA 2HIYA 4IKAA 1QAIA 1FKAF 5KG0A 2HFNA 1G4CA 3GJQB 2BEFA 2DNMA 2FQQB 4BLGA 3D66A 3FK4A 1RADB 3P96A 3SQGB 3DOLA 4DFPA 4YDXA 2B51A 2XWXA 3AOAA 4C0BA 4P7VA 2VOPA 4F4ZA 4DXLA 1VQYA 3QRRA 3I9V9 5HATA 1C1CB 1S9EA 4LF6J 1CQMA 1SI9A 1MROB 3KLIA 2NZ4A 2D7SA 3JSYA 7FDRA 2D74B 1DJ0A 4BC9A 5EWFA 3KLGB 1S49A 1RISA 3G8TA 2X51A 3JSMB 5L1IA 4DR3J 2HHVA 2ALZA 4QU6A 3BF4A 1B7YB 5CZVA 2B9WA 4USKA 2NQPA 5DM6Q 1MU2B 1DTQB 1D3WA 1EETB 4LF6F 2F65A 3E2EA 1LW2A 5AE3A 3M2VA 3P5BP 4LBIA 4BWJA 3A3OB 4K5SA 1H7XA 1RT4B 4KH0B 5FD1A 1OO0B 2CQ2A 4ZKAA 1FWKA 2V2QA 2AJ0A 2ROPA 3KLEB 5ETLA 5E7OB 3LH2S 4DR3F 1MW7A 3NCRA 2V34A 3NL0A 2MZ1A 2VU5A 2VG7B 3CCWA 2J0SD 1N34J 2YTCA 3NGKA 3AODA 1X60A 4F02A 1DLOB 3OT9A 2JLFA 2CZ9A 2YKPA 1RP5A 2DR9A 1IKWB 4FNIA 5IC4B 4QIEA 3NWGA 4YB5A 3M8QA 4DL7A 2Q66A 5DLFA 1R8CA 2FDNA 2ZKTA 4WU2A 5ETOA 4NX9A 3G6XA 2WCXA 2ASDA 3DLBA 3IWXA 5ETKA 1RZMA 3QT7A 4ZPVR 1RKJA 5EX3A 2QC3A 2ZM6J 2VZ9A 1N34F 3WIUA 4OHVA 3RUBL 1Z1ZA 2DBBA 2OI2A 1KP6A 4G1QA 2LXFA 1K1SA 4IFVA 5HANA 2YKQA 5B0FA 2NS1B 2XGPA 4H54A 2I5JB 4XDCA 3FBBA 4ZCKA 3PHEA 1KDNA 3MMCA 4O3SA 4FP9A 2G13A 1NHKL 4TLRA 3I31A 4Q7AA 2XLJA 2ZM6F 4PG4A 3TEHB 2IBOA 1TU0B 2XBPA 3BB5A 1JLGB 1GXLA 3AQOA 2C3UA 5E0OA 3IR7B 1OS5A 5J2MB 1KLMA 5LMUJ 2W8KA 4EI2A 1JLQA 1IBKJ 3AJ1A 3BKFA 2F1FA 3MPUB 4L76A 1CJUB 3DLGA 4DWIA 1FI4A 1RDRA 2W2OP 4OX7A 2Q3PA 2UVRA 3W9IA 1FNOA 4DHVA 1B7FA 3ITHB 4X64F 2R9LA 2UXDJ 1JLFA 4J37A 2JHEA 1RBAA 3BQ0A 3GYXB 2OPSA 3RW7A 3C46A 2FHKA 4ECWA 1N4LA 1U2RA 2B5JA 3M9NB 5LMUF 1Q86T 2ZH2A 2FVQA 3H98A 3EJMA 2ERRA 4C3MA 2LXUA 2HWTA 1WC3A 5AXLA 1IBKF 4RW4A 2AHOB 3I4PA 1VC5A 5DQHA 1TTHB 1I3OB 1T94A 2J76E 2OIHA 3A1YG 2JRSA 4CLYA 3BPSP 4NLRA 2IHR1 1RT3B 2FHJD 4JI5J 2UXDF 2A2DA 5LT5A 4TKTA 2HWHA 1QY7A 1LXJA 3BN7A 4RBVA 4K2JA 4C48A 1Q81T 1GQEA 5GAEI 3BPDA 3G6ES 2QO3A 3OHBA 4PG7A 1C0TB 4NLQA 2ZD1B 4DV1J 2PA8D 3M6UA 3BYPA 2DRAA 4DI6A 4TY9A 2HG4A 3PZPA 1LXNA 4B3TJ 5J1NA 4JI5F 1XTZA 3D67A 3W9JA 5L1JA 1PAEX 2W9AA 2F40A 2CJAA 3AA8A 3B4MA 3A3NB 1V6HA 4DV1F 1QDUB 4LBHA 2NZCA 1WDTA 5B0EA 1GK8A 2B4PA 2B6AB 2V6AA 5E3PA 4O3NA 1FRHA 1YJ7A 2HNYB 3MXHP 4I0WA 3CC2S 4LVOP 2G2ZA 4B3TF 1UFKA 4P52A 3PW0A 1S1TA 3DYAB 4PZVA 1NK8A 1SUQB 2PT0A 4NZ0A 1U6BA 4H4OB 1U47A 1S57A 3NGDA 2XMVA 3GV8B 4DZDA 4ELTA 3H5YA 4AFFA 4CCHA 3E3XA 4A48A 3VGTA 1U1OA 1U2CA 1QTMA 3ILIA 1KVJA 4H4KA 4CH7A 2XTJP 4ECUA 1PILA 4RW7A 4ZPAA 4QIWD 1NPKA 4K4TA 1TKXA 4LSZB 1SL1A 3UCUP 2ZWOA 3JSRA 4RBUA 4WFBQ 4J9QA 4HYKA 1FNMA 2GHVC 2V8HA 3LWMA 4W4MA 4NRTA 1XMBA 2J6UA 1N33J 4ITSA 5HMYA 2IVMA 3M2UB 1VR6A 3K89A 5EGYA 2V68A 4WIIA 1KBRA 1TKDA 3QBCA 4P75A 2DXDA 3HVAA 3T5KA 3MF5A 4NA3A 4BDPA 4M5NA 3KK3A 4RO0A 5LXYA 4QYZK 3M4XA 3IM9A 3B8HA 5DDPC 2YQ0A 3MM6B 4WFZA 4RNNA 4Z7YA 1N33F 2C2ZB 2ZNYA 3GFXA 4DV6J 2AF6A 4RLEA 2FY1A 2AW0A 3CD7A 1RHMB 2XYHB 2R2UA 1JLEB 2EW9A 4I4BA 4MIBA 3EZ5A 2XI3A 3UPFA 3OTOF 3MPYA 3ADAC 1EKRA 2IAJA 4JI4J 4YR3A 1KQKA 4ED5A 4RUAA 1SL0A 3SCLE 1KKHA 2MLYA 3PW7A 4B3OB 1X9MA 4LRBA 2YNGA 1SH2A 4DV6F 2BJEA 1VQ5S 4DPOA 3HSZA 1O6XA 3CCLS 4LF4J 2E7XA 1FHTA 4AXJA 1GX5A 3NBPB 4IRKA 3J80Y 3EXCX 4P71A 1U6FA 4JI4F 3TNVA 3QMQA 2BJ1A 5F8HA 1Q78A 4QYRA 1JLAB 4M63A 5FIIA 1IWAA 3HVTB 4I6WA 1X5SA 4KB7A 4MJKA 3CJ2A 3SCIE 3F44A 1KWMA 3CCJS 3ISZA 4DV7F 3PKYA 2WRMA 1AT1B 1S9GA 4U7UD 4QYZJ 2ROGA 1QUVA 2KKHA 3I0SA 2KO1A 1WG1A 1N48A 3MEEA 2FHJA 3DHWC 5GADU 4TN2A 2MHEA 4RL1A 7FD1A 1JQGA 1FX4A 1SH0A 3EDQB 2A6OA 1HI1A 2OTJS 2HZCA 2M0GB 4NLPA 1EP4B 3ZTPA 1HWLA 4ED8A 3K2YA 1XMOJ 2YX7A 1QD1A 4RW8A 4UUWA 2VG6B 5LL6d 3H4BA 2AGOA 2MB0B 9ATCB 3N4WA 2DHAA 1QSYA 2IYIA 3LUYA 4EZ9A 2WTFA 3RBXA 1XIQA 4A8WA 1QAJA 3F73A 2ZH8A 2AV5A 3SDEB 3JSBA 3TANA 1NSQA 2EFPA 4PPDA 1ZM3A 3CCES 3P6YC 3K58A 4JV1A 1HQUB 3J81j 5K20B 5HP1B 1XMOF 2LEAA 2W9BA 1TUGB 4PXCA 3TVZA 2UP1A 2I1RA 3FEYB 2GQ2A 2FC9A 2XHWA 2MKHA 1KHVA 2BQUA 4IOAQ 3OTBA 4DQPA 3M6VA 3LF0A 3R7BB 1FO1A 2WB1D 2DT9A 1FJ7A 4Q2MA 2CPHA 3OFEA 4CTAB 4IRCA 1JB0C 1PO6A 3MD1A 2HK2A 3Q24A 1Q7LB 2QLFB 2HKEA 3D2WA 4DR2F 4RX6A 2HS4A 4GVLA 2PMHA 2CJ9A 4TVAB 2FJXA 2PGCA 1RK8A 1Y3KA 4IUFA 2LCWA 3FZBA 5IV4A 2N7YA 2E1AA 2QTWA 4EO6A 1FF2A 1H3DA 3AHPA 1VQ4S 2MDAA 2EFVA 2HHTA 5FDLB 2RS2A 4R25A 2MKYA 2ADCA 4ID5B 3AJ2A 3C16B 4UQTA 5DGAA 4ZS6A 5MAOA 2MY8A 1NK6A 1RAOA 3S1TA 3ZZPA 3HZGA 2V9WA 2NPFA 1HWJA 5A8KB 4USIA 2E5IA 2V8GA 5JMNA 4ZLLA 1QE1A 5B08A 2ZHAA 4C8LA 1R8BA 3PYDA 4O3PA 1K0VA 4PAAA 5DGBA 3SI8A 2NXUA 1U02A 3HHNB 2YVSA 1U1RA 4PWUA 3OFGA 4PYDA 5KFAA 1ZM2A 3RGIA 3HO1A 3EYZA 2YWFA 2RIJA 2XS5A 4CNYA 3OUYA 1DFDA 2WVBA 1Q95G 1HWIA 3GFYA 1VOMA 2VFUA 3RAXA 4Y2CA 4M1KA 1FJEB 1WOOA 2HURA 3HP6A 2R2RA 3CDAA 3E51A 2HNZA 2UU9F 2EVZA 2DNKA 4ANDA 1RHUB 4H4KC 3JAMY 2LECA 1T9VA 5FLXY 2CVIA 3D6FB 2XZTB 2CG8A 1KQFB 2HGMA 1CVJA 4NZ6A 1TKZA 5KG5A 2KYXA 4IG0A 4B9TA 3HHLB 2HQCA 3KMSA 3H5UA 1RHJB 3ZTSA 1LEOA 3MM8A 3KLVA 4U96A 5F9LA 5HVFA 3ZTOA 3KWMA 1RACB 2MLXA 4TLQA 4MK9A 4F2RA 4FKXA 5F8MA 3GYNA 1BY9A 2Z0GA 1YG0A 5F3TA 5HVGA 2HRTA 2ZZTA 5LSRA 3FEXB 5D6GA 4LRCA 2AEMA 4TU8A 2UVVA 3ZZTA 1FJGJ 4PQUA 2BABA 4JI8J 1M5SA 3K57A 3DCAA 5AXMA 3EGZA 1RTDA 1OJ4A 2IM0A 2R42A 4CT8A 2C2RA 2R7RA 1HNVB 3DRRA 1U6ZA 4K8RA 1XMQJ 4LSNB 1OYEA 1L3VA 4FF1A 2VC1A 1U45A 5HLFB 1FKOA 5M2UA 4RWXA 3J7A1 4G1PA 2ZH3A 2P9GA 1S5ZA 1RWPB 1YHQS 5F3ZA 3AB2B 3QT6A 3EZOA 4E2FB 2HGNA 3HHKA 4IDKB 4PABA 4JI8F 4C8KA 2E7VA 1N0UA 4CIOA 2O01C 2VBZA 1BXNA 1DARA 3DLHA 4U95A 3IG1A 1FXDA 3CJSA 2IJNA 3TP2A 2KM8C 3UE2A 4CH0S 4KR0B 2FB0A 4A8XA 1HQ2A 2Z56B 4V19X 4V19J 4K4YA 1H7WA 3AD8C 3V2UC 2WVFA 3CCMS 2VPWB 2UZAA 4IG3B 4OYIA 1HL6A 2YKOA 4JP8A 2CKWA 1RT7B 5KAKA 2CNKB 3EDRB 3M2RA 3C15A 1S7HA 4N56A 3MPVA 3J7YI 2BKOA 4HLBA 4UOHA 4DG1A 2HFUA 3DXSX 1MMLA 1REVA 2KFZA 1I6JA 2EBEA 1K73T 2WHOA
chains in the Genus database with same CATH topology
1Y4ZB 3DOMA 2ZDOA 4ZCMA 4DQSA 3QPIA 4WJBA 3DHXA 3HFKA 4G1IA 2FUG9 4Q45A 4AQYF 3MGJA 5C25B 1ZBTA 2FGCA 2CQ1A 3DLKA 2MZSA 2DNLA 1HQEB 3X1LB 3CJ0A 3I9ZA 4KO0B 4EBDA 4AL6A 5CHCB 4DL0C 3HVWA 4USJC 2E29A 4MIWA 4B17A 5MLCV 5GMKa 4NZ7A 4FVCA 2R7WA 3AY0A 4OZ0A 3QLHB 5K8NA 1VQ7S 3IRWP 5KFVA 3I6PA 3MWBA 4KKOB 5JVHQ 1VQLS 4IRDA 3MUMP 3MM5B 2AYGA 1N5TA 1WNEA 2A1BA 4TY8A 2FTRA 5KT6A 2K1RB 3I0RA 4J9NA 1OSCA 1S6QB 2GQQA 3WC0A 5ITHA 2DR8A 1RJJA 3R27A 2J0XA 3TAMA 4WK3A 1JWWA 3D1QA 2JEGA 2AGPA 1RT6A 1HD0A 1Y7PA 2XEXA 4LSLA 3PW4A 3M2RB 5T14A 4DX8H 2R2SA 4ZPWR 1R8PA 2YNFA 2FHMA 1RTJA 2DGVA 3L95X 2V2KA 3SSQA 1N56A 4MFBA 1BD6A 3E01A 3V6HA 3TAPA 4M94A 3Q8PB 1X5TA 2R7TA 4LF4F 4WFYA 4DG1B 2KVIA 1JLCA 4C97A 1WI8A 4L3NA 3KHHA 1NK0A 1REVB 3W2VB 2VODA 4HH0A 5J2PA 3OR1A 1Q8LA 4OZNA 5I3UA 2GFFA 4JV5F 3OJUA 3P5TL 3W3SA 3IXQA 2P6TA 1S0NA 5KFWA 4B9VA 3DLKB 4M5DA 3N9UC 4HTJA 2OMLA 2AJ1A 3OSPA 3HJFA 1X0FA 5KG7A 4MH8A 4X65F 3IR6B 3IRXA 1Y00A 2RDJA 2FJVA 2CZVC 1XR7A 3FQLA 1UVLA 5B0CA 3OW2R 2JC1A 2IRYA 3GG0A 1NK4A 5F8NA 1CPZA 1MMDA 2QEXS 4JI3F 2BVZA 4ATNA 2G4BA 2ZOFA 5C42A 1TVRA 4KHMA 4KSEB 4KHRA 4TY8B 3I0RB 3RRKA 4YOEA 2MGZA 2B43A 5EHHA 4B9MA 5KFDA 3TAMB 1M5VC 3EZUA 3O1LA 1RT6B 2R7QA 4LSLB 3DRPA 2VUGA 3RB3A 4N8NA 2XMJA 4NCGA 2W8LA 2BUNA 2DCUB 1PGZA 4F4KA 2YNFB 4DV2F 4XK8C 1Z2LA 4A8FA 2EK1A 1RTJB 3TRGA 3VZHA 5KFCA 4WFAQ 2GIQA 3E01B 4MFBB 3UWTA 3AB4B 4MYUA 2XB2D 1C0UA 2XS7A 3MFHA 3FSYA 3GSDA 4ILMA 1O0PA 4OL8A 1JLCB 3ISND 3NRBA 2R7XA 2MXYA 3DI6A 1IQZA 2F4VF 3N6LA 3K5OA 5DDOC 1UVNA 1KTQA 2PI4A 2N3LA 4F25A 1S1XA 1UJ6A 1HW8A 5BYSA 4K50A 5F8JA 2DH7A 5J2PB 2J9DE 2ZVSA 3OR1B 5I3UB 2E66A 2ZFHA 5B0BA 1WELA 4QWAA 1ZZFA 3CO9A 1UEUA 5LJ3Y 3NNCA 2D1CA 2GHWA 3POTA 4NYPA 3Q23A 1T03A 3KHRA 1TQLA 1P1TA 2O3DA 1SL2A 2OFHX 4M5DB 2HHUA 2ZE2A 3KFWX 3OL9A 2F3JA 4TQSA 1IJEB 2CPIA 5A6PA 1MMNA 3IRXB 4EYIB 4YUDA 4K4WA 1X9SA 4GMKA 3KNGA 2BV3A 1SC6A 3DMJA 5KG2A 4Y2KA 1VRTA 2GHPA 5B09A 4BCAA 1ZH5A 4WKRA 5C42B 1TVRB 2HHXA 1HHSA 4ZP7A 1SH3A 2VFTA 4J5OA 5E3CA 2LQBA 2NREA 3RR8A 1UKUA 3R5DA 2FVSA 2LVWA 2MGZB 3JB9k 2EFGA 3PJXA 2DGXA 1S79A 2C2EA 2DNHA 2KU7A 1M5KC 1QUPA 5KFHA 2Q43A 3CWJA 1X5OA 1RTIA 4N76A 3V5RA 3DRPB 4DV3F 2DO0A 2MQPA 2JWNA 4NCGB 3V6KA 2W4PA 2ADBA 3KK2A 1VRUA 2D3ZA 2F8HA 2UUWA 4LFBF 2GQCA 5A6WA 1ZPWX 2DISA 2RILA 1E6VA 1JLBA 3OR2A 1FRMA 1RYRA 1WEZA 2VBYA 3D0IE 4DL5A 2ZZMA 1C0UB 3FZ2A 1UVKA 2ZC4A 3Q8SB 3BJYA 2X1AA 2JEIA 3DI6B 1LQ9A 3F41A 1S1XB 2BM1A 2MSTA 2M88A 6FDRA 4ZP8A 3CDWA 3HI9A 4J9KA 1HNIA 3GIMA 2ZH4A 4OMFG 4JI7F 4DUYF 2WAQD 1RI7A 1VQPS 2OP5A 4OJ1A 2W7PA 5AXKA 1LWCA 3POTB 5B0AA 1T03B 2NR0A 3Q2TC 3PXGa 2HVIA 4U6PA 3U1LA 1UVJA 1F9FA 2ZE2B 4LF8F 2OMOA 3O2IA 4ERDA 3I5CA 4FXWA 4YFUA 5CXTA 1G2EA 3LP1A 3MM9A 4RW6A 1FKPA 3H40A 5T7LA 4LUBA 5IQQA 3DDNA 3DMJB 1VRTB 4I67A 2RUGA 1U1PA 2IBKA 2FIUA 1NO8A 5EDWA 5KFIA 4I69A 2DHGA 2KHDA 4RBTA 4TYAA 4I56A 3ZZYA 5DRKA 2RSQA 2FLOA 2JLEA 2MZRA 3N5FA 2KZMA 3IGNA 4IOCQ 3CJ3A 4C9DA 2WBRA 4ZK7M 2XLIA 4M95A 4C8MA 2RJZA 2QLWA 3IBWA 2W25A 1FD8A 5KT4A 2QMXA 4HT5A 2KHCA 2QV6A 1RTIB 2BRLA 2DRBA 5KFUA 2AP6A 2RD5C 3KK2B 4J9OA 1T05A 1VRUB 3EXYA 5IQ6A 5LSOA 4OI2A 4TQRA 2E9TA 2F8MA 2MYFA 3OR2B 1E6VB 1JLBB 3MEGA 5AE1A 3KMQA 3BN4A 3SYZA 4Q8FA 2IRXA 4CQ1A 2DH9A 1DQ8A 5DS7A 1U1KA 1U1MA 3RB4A 4LF9F 2ZBCA 3V81A 1U25A 2K2PA 4EO8A 2C22A 3OQ2A 1KHWA 2DGSA 3PDNA 3TA1A 1XBWA 1HNIB 1VJWA 3BEGB 3NCPA 3UW1A 2B9YA 3I82A 1R43A 3KTQA 1Q53A 2VA3A 2WBMA 4O44A 4WYWA 2KFNA 4FYDA 4HH1A 5BYRA 1O51A 2O67A 4QW8A 2OSRA 2M9KA 3UFCX 1FVSA 5A8WA 2CQCA 4F3OA 5D77A 3LP1B 3MM9B 4IYQA 1TUVA 4RW6B 1FKPB 3GB0A 3PO4A 5T7LB 4MTPA 2ZH1A 4DL4A 1XN9A 1G3OA 3BO3A 2VQFF 3M9MB 2RQKA 4WFNQ 1OSDA 2V9KA 3HXMA 2XMKA 1RT1A 2MKCA 2QZ8A 3CCRS 5D4OA 4PKDB 4MIAA 3CCVS 2JOQA 2JFKA 4A8QA 2CQ3A 4P6QA 1SBRA 2XNRA 2XMUA 2FJBB 2HW3A 1VBZA 2GJ2A 3THVA 1A9NB 3U02A 1IQTA 4DQRA 4WCEQ 2IVYA 5B0DA 3CSKA 5L39A 2XCAA 1GXTA 3SV4A 4R8UA 1M5HA 1N5YA 1W2IA 1T05B 3M32A 1V3RA 1BLUA 3MAHA 2GMLA 5KFFA 2DR7A 3RW6A 2OD6A 4DV0F 5J2QA 1YRXA 3MEGB 1S99A 4I2QA 4KV8A 1B64A 4DSIA 1WG4A 3PFEA 2HNDA 4ELUA 1B0TA 3CIMA 4FF4A 4X4UA 1S9FA 3V81B 3PX6A 4OX8A 1ZPVA 2L41A 2VONA 5KFXA 2VD3A 5DETA 4GC6A 3WBZA 5H1SV 2Y1IA 3RB0A 1D9DA 2YWHA 1LK5A 3MTJA 1S6PA 5KT2A 3CCQS 5M2RA 1SJFA 4QIFA 5KOWA 2RQMA 4ED0A 3LAMA 3LAKA 3VAGA 3HF5A 2DNRA 4ECXA 4O44B 1D0EA 3S7RA 1RT2A 1WTFA 2CPEA 3IO1A 3S6EA 4CNZA 4DBQA 5KFSA 2C3PA 4F4YA 2XO7A 3LP2A 5A8WB 1R0AA 2PIIA 3JTPA 4ECRA 3RR7A 4KHPF 2AJQA 1Q1KA 1IN0A 3U7JA 1N6QA 3T6JA 4HVZA 3M6WA 4FF3A 2CG4A 1PSDA 5I4MA 3BQ2A 4R5PA 2JH3A 5AXNA 1Q8BA 3CMAS 2XULA 1NJWA 1RT1B 4B02A 3L7OA 2X3GA 3LALA 4OX9F 2ZOGA 2W7OA 4LQ3A 2L3MA 4ECTA 1X0PA 1KS2A 1S1WA 3I5AA 6FD1A 3OFHA 1MSWD 1F2GA 4OZ5A 4RKUC 1HD1A 3MUVP 2BJDA 1T3OA 1ZAVA 2HGLA