4CQ1A

Crystal structure of the neuronal isoform of ptb
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
191
Chain Sequence
NTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPRDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords POLYPYRIMIDINE TRACT-BINDING PROTEIN 2
publication title Solution and Crystal Structures of a C Terminal Fragment of the Neuronal Isoform of the Polypyrimidine Tract Binding Protein (Nptb)
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 191
sequence length 195
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4cq1A02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4cq1A01
2DGTA 4UY8T 2N82B 1X5SA 2CQ1A 2L9WA 2MQMA 2MZQA 2CPEA 2HZCA 2MXYA 2HGNA 1WWHA 2RT3A 2DNOA 1WG5A 2CPYA 3BO2A 2HVZA 3D2WA 2I2YA 2XS7A 1NO8A 3FEXB 2CJKA 2LQ5A 2DHAA 3NS5A 3MD3A 2M0GB 5LXYA 2XNQA 4BS2A 2F9DA 2CQCA 1X5TA 1M5KC 3P5TL 4PKDB 5IM0B 2DGVA 4YOEA 2HGMA 2KXFA 3S01A 1X4GA 1DBDA 1N8RT 4LIRA 2MGZB 2E5IA 2RRBA 2OTJS 3U1LA 2XS5A 4IO9Q 2DO0A 1YJWS 1WELA 1WHYA 2MKHA 2DNYA 5LSLA 1VQNS 1IQTA 3B4DA 2ZJRQ 1URNA 3U1MA 4F02A 1X0FA 2YKAA 2DH8A 3H2VE 1VQOS 5IQQA 1WG1A 4P6QA 1WHXA 5MLCV 4QQBA 1SXLA 2FC9A 2CQGA 2KM8B 2RUGA 3MUVP 1YITS 1FJCA 2PEHA 2MQLA 4OZ0A 4IUFA 2MJNA 1FXLA 3G9CA 3I55S 3MI7X 3VAKA 3TO8A 1OO0B 1VC6A 2QFJA 2E44A 1KD1T 3BEGB 3RW7A 1SJ3P 2ZJQQ 3CTRA 5FJ4A 3H2UB 5LXRA 3CCLS 2LMIA 2O3DA 3OW2R 1HD1A 3UCUP 3TP2A 5IM0A 1U1OA 2JVOA 3NNHA 2AYBA 1Q86T 1VBZA 3S7RA 2X1AA 2DNRA 1M5OC 2U2FA 4PR6A 2AYGA 1FNXH 2JVRA 1H2VZ 3K0JA 2DISA 3G4SS 3US5A 5GAEU 2YH1A 2KU7A 2SXLA 3P49B 1Q81T 2KFYA 5GMKa 1WI8A 2KYXA 1VQLS 1VQ6S 1N52B 4PRFA 4ZKAA 1L3KA 4OZ1A 5CA5A 2FY1A 2XS2A 2BZ2A 2FHOB 1YWXA 2DHGA 1SJ4P 2KI2A 5LJ5Y 3MUMP 1U1PA 3MDFA 3EX7B 2LCWA 1M90T 2EK6A 1U1LA 2MHNA 2MMYA 3NNCA 2DB1A 2MKCA 2CPZA 3CF5Q 2FPHX 1YJ9S 2HGLA 3MOJB 3UCZP 1HD0A 4WIIA 1KQSR 1DRZA 3SMZA 2XSFA 2KM8C 2MY7A 2ADBA 1WI6A 1VQ9S 2CQ4A 1YI2S 2HYIB 4Y0FA 1N54B 4U67Q 2XB2D 4ERDA 1U1QA 2J76E 4WFAQ 1SJQA 2F9JA 2MKIA 5DDRC 1VC5A 3UD4P 2XNRA 3ZZYA 3G8SA 2MJUA 2CPFA 2L08A 2DNPA 1SJFA 2MQQA 1WTBA 2X1BA 2D9PA 3IRWP 1JMTA 5GADU 2FC8A 1U1NA 2AYMA 2MZRA 1NU4A 3CMES 2K3KA 2LA6A 1D8ZA 1H2UX 2E5GA 3SXLA 2DNMA 2MQNA 3MD1A 1HA1A 3Q2SC 2KXHA 3R27A 1U6FA 2GHPA 3BS9A 1Q82T 5LSOA 5JVHQ 2N3OA 2VOPA 2M2BA 3MUTP 3VAGA 1VQ7S 1JJ2R 1Q7YT 1QVGR 5DM7Q 3NS6A 1RK8A 1K73T 3UE2A 3THTA 1QM9A 3SDEB 3V4MA 1U1KA 2MZSA 2MSTA 2X1FA 2DGOA 1R8PA 2CQPA 1SJRA 3L3CA 1FHTA 2E5HA 2GO9A 2KHCA 2AD9A 2WBRA 1X4FA 4Z2XA 2DNNA 4TU7A 3UD3P 2ADCA 4W90B 3DXBA 1WG4A 3CCUS 1UAWA 2RQCA 1ZZFA 1WHWA 5DDOC 2CPJA 1JJHA 2DNLA 2DNZA 1H6KX 4YUDA 4QU6A 1R8HA 3ULHA 3THPA 2J8AA 1OIAA 1WF2A 3UCGA 3NMRA 2JX2A 2D9OA 2DNGA 3CD6S 2CPHA 2MGZA 3BO4A 4A8XA 1WF0A 2G1DA 3HI9A 4WCEQ 2MQOA 2J0QD 1X4EA 3B4MA 3TYTA 3CCES 1W2BR 3CCVS 1OPIA 3SDEA 3CMAS 2DIVA 2CQIA 2M52A 5DDPC 2L41A 3HHNB 1WEXA 1DHMA 1U1RA 1U1MA 1WEZA 2M9KA 1AUDA 2OTLS 4EGLA 5EN1A 3G8TA 2E5JA 2M4MA 5LJ3Y 1VQ5S 2DH9A 5HL7Q 4W92B 5GAHU 2CQHA 2MPUA 2MZJA 2QEXS 2NZ4A 2DO4A 1KOHA 1K9MT 1H2TZ 5ITHA 3CCRS 2DITA 3G6ES 1S72S 4UQTA 1N88A 4C7QA 2DGQA 4F25A 4J5OA 4LJMA 2MKJA 2K8GA 3MURP 4C0OC 2MKSA 2VONA 1JJ4A 1F9FA 3CC2S 4CIOA 3J7ZT 3BO3A 2X1GA 1YJNS 5DETA 1VBYA 4YB1P 4TU8A 2MZTA 1PO6A 4WFNQ 4V19X 2KRRA 3ZZZA 5DM6Q 1FJEB 2CQ0A 3I56S 2KN4A 1VQMS 5D77A 2RVJA 3G96A 2RS8A 2LXIA 3VALA 2V94A 2CQ2A 4TLQA 5DDQC 3S8SA 2VOOA 3Q2TC 2OSRA 4C4WA 2M88A 2I38A 4IOCQ 1XN9A 2MSSA 3VAJA 3PIPQ 2M70A 3N9UC 4CQ1A 2B0GA 2CPIA 3IWNC 2QA4S 4WF9Q 5BJRA 1O0PA 1M5PC 2BOPA 2LEAA 1UW4A 3FEYB 2MQPA 2UP1A 4TU9A 3EGZA 2DGWA 1A7GE 2MKKA 2VODA 1CVJA 1M5VC 1U2FA 2EVZA 1BY9A 2RNEA 1YTYA 2DGSA 3UWTA 2LKZA 2YTCA 2KRBA 2OSQA 2CPXA 1X4BA 2LA4A 3VAIA 2ERRA 1ZH5A 5JVGQ 4F26A 2N7CA 2LXUA 2Q79A 2RU3A 1RKJA 2N3LA 1UFWA 2LYVA 1YIJS 3CCJS 5CXTA 3CPWR 3MXHP 5HO4A 3RW6A 2CQ3A 2DGUA 2OJ3A 2DGXA 4RU2A 2CQDA 2KXNB 4QU7A 2D3OR 5IFMA 4CH1A 4Y00A 2KG1A 1D9AA 1A9NB 2KVIA 3J7YU 1YHQS 2G0CA 1QVFR 1G2EA 2DH7A 4IOAQ 3R1HA 3VAMA 2LECA 3CUNA 3CCMS 1X4AA 3R1LA 1M1KT 2MB0B 1HL6A 4CH0S 3P3DA 3CXCR 1X4DA 3LQVA 1DZ5A 3P6YC 4ED5A 1FJ7A 4WFBQ 2KG0A 1B7FA 2RRAA 1NJIT 3NNAA 3CCSS 2YWKA 2PE8A 2YH0A 1K8AT 1VQKS 1KC8T 4FXWA 3VAHA 2JWNA 1VC0A 1PGZA 4LMZA 2DHXA 2MY8A 2KH9A 1VQ4S 2RS2A 4QPTA 3S6EA 2CQBA 2MYFA 1OWXA 3LPYA 2J0SD 2G4BA 4WKRA 2DHSA 3G71S 1ZZNA 3CC7S 3PIOQ 2KT5A 5H1SV 2JRSA 2M7SA 1VQ8S 2DNKA 2ZJPQ 1FT8A 1KOOA 1X5PA 2DIUA 1P1TA 1VBXA 2DK2A 1FO1A 5GVQA 2DNHA 5GAGU 3EGNA 1S79A 5D78A 5CYJA 3DLLQ 2U1AA 1WHVA 2CPDA 2RQ4A 3JB9k 1X4CA 2LEBA 4M5DB 3CCQS 1X5OA 1UP1A 2NLWA 3VAFA 1WEYA 3VF0B 1P27B 2EK1A 3CULA 2M8DB 3CC4S 2AYEA 1U6BA 2F3JA 2DNQA 4FXVA 2OIHA 2M8HA 1WF1A 1VQPS 2A3JA 2MZ1A 1X4HA
chains in the Genus database with same CATH superfamily
1S1XB 5H9EK 3ZTOA 2FHJA 4PAAA 3V4IB 3KMSA 1WG5A 1QUVA 5GAHI 4J91A 2KKHA 4UOGA 3DLEA 3TZWA 3DRSA 4X65J 4NCGA 1XERA 2ZOMA 3QT8A 2CYYA 4LRDA 4QIEA 2OD6A 1U26A 2ZJRQ 3GSDA 3RAMA 5HROB 4FYWB 1JKHB 2JLGA 3EWGA 4DX6A 5DQIA 2VB6A 3LP0B 4QQBA 1AXQA 4ZN3A 3SQOP 3N79A 3G9CA 5A0YA 2H4YB 2NYHA 1NXIA 2ZJQQ 4ANEA 1HQEA 3I4PA 1U1OA 1K0VA 5CZXA 1SCJB 3NNHA 2VC0A 5L1KA 4CCHA 4USTA 1Q4RA 2DISA 3G4SS 3US5A 5KFVA 1M1HA 3R3TA 3KJVA 4NLGA 3CDWA 3DFEA 1ZAXA 3CJSA 2WOMB 2FVSA 4ZMMA 5J2QB 4F0KA 3QGGA 1CJVB 1U1PA 1U4BA 1F5CA 1S76D 4PWDB 2EKNA 2LCWA 4DZDA 1F2GA 3Q8QB 2DB1A 3TZZA 3VHQA 2G1HA 5A76A 4XO0A 1V5IB 1AUSL 3T1HF 4C8NA 2J9DA 2BBEA 2M3DA 4PG8A 1U0HA 2XNRA 2XBPA 3PKMA 1FXRA 2R9LA 3QLHA 1CS4B 3GLJA 2ZH4A 4X64F 4ZVFA 4DQRA 4O3PA 1C1BB 1RT7A 2YNHA 2K3KA 1HFEL 1K1SA 1FE0A 1SIWB 2AMCB 4U95A 4B08A 1B0PA 8AT1B 3DM2A 1JJ2R 1TK0A 1YKWA 3TEGA 1HARA 2AKWB 2BANB 3C2PA 1NHKL 4JI4J 1ITPA 2GIFA 2F8EX 4YB5A 2XY5A 1FHTA 3R97A 1I6JA 2DR6A 4YHHF 1P9QC 3UD3P 3L4BC 1UVJA 2ZNYA 2DKOB 2VIHA 1OYDA 4J9LA 1ELOA 2MHEA 2ZM6F 1TAQA 2W4CA 3GPAA 4F4ZA 1RQ0A 2G1DA 3HI9A 4P71A 2IHR1 2DCLA 4OI4A 2PA8D 4B3RF 1U1RA 3KLHB 3LO3A 5HL7Q 2KZZA 4FBUA 4M5NA 3BSCA 5HQLA 4DL3A 1FERA 2W2NP 3M6XA 3TARA 3HT0A 4CO2A 1NPPA 4Y2MA 3HLUA 4H4KC 2HFOA 2OH2A 4CIOA 3DRSB 2G0IA 2YNIB 2HNYA 4G1PA 1TELA 1X31C 1F2HA 3GILA 5I3UA 4RKUC 4BBYA 2D74B 3CT9A 4IOCQ 2MSSA 1GMWD 3O6QA 4WIQA 2IM1A 3AHPA 2KHDA 2B0GA 5BJRA 1EKSA 2XHWA 4KGXB 4RNNA 4IO1A 2BJEA 2UP1A 4KTQA 3D66A 2YQ0A 4CLYA 1UEKA 1Q5VA 4J90A 4CNZA 1WUUA 2QYGA 5HK4A 2AU0A 4TYBA 3KK1B 4HKQA 4IH7A 3MPYA 5BXIA 5BR8F 2Q6BA 3KLFA 4HTJA 1RT3A 4I6AA 3KJVB 2YBVA 1KVIA 4NPOA 1RACB 2BVZA 3J7A1 3PRDA 2FLLA 2LECA 3DHWC 1X4DA 4GVBA 1FJ7A 4QWCA 4K5SA 1W26A 2J8SA 1CQNA 1NJIT 2KFZA 3EVOA 4DN9A 3LWMA 3OXFA 4GKKJ 2V2VA 4FXWA 4PG4A 4NASA 1WC3A 4DUZJ 2K7KA 4OX7A 4B9TA 5DRKA 1U0HB 4AE5A 3QIPB 2BM0A 3D1HA 4N41A 5A8RA 3OSNA 1N32J 4JYAF 1UWBB 2KTQA 4DR2F 3PR5B 2W4DA 3K5NA 1RT7B 1U7LA 1IKYB 2KB2A 4O3RA 2WK4A 4RUAA 4MFBB 4QYRA 4EO8A 3ISNC 4B3SJ 1ZM3A 2EK1A 3OUYA 1H72C 3DM2B 2VH7A 4ED2A 1V3ZA 1KVKA 4DPUA 1VQPS 3QRQA 1WOPA 2ALZA 4Y2KA 5JJBA 2HBYB 3V2UC 1Y11A 4WZQA 3DGPA 1HW9A 1W25A 1WWHA 3PFEA 2IA0A 4Q5VA 1R8AA 1S12A 3DRRB 1PJ6A 2XNQA 4MT1A 1PIEA 2CQCA 2VA3A 5IM0B 4DL4A 2HQFA 4ED8A 2QMWA 4IO9Q 3GG0A 1YJWS 1WELA 3JTOA 3C66A 4AYBD 2BKOA 4F02A 3L7UA 2ZH3A 3QWUA 4DV0J 4CDIA 5MLCV 1BHNA 4RWWA 4WK3A 1ZTTA 3R2DJ 4O44A 1PBAA 3I55S 2VFTA 4OZ2A 4MJKA 5IS2A 3FSIA 4TQRA 5E3RA 2IRUA 1RHJB 3DLGA 4AL6A 5DS7A 4ZVSB 3QT7A 4WTOB 2X3DA 5DZ6A 4DUYF 1G6BA 1H2VZ 3K5OA 2HQ3A 2W8LA 3TAPA 3P49B 2ZHOA 5GMKa 5F9LA 4K4WA 5I3UB 4OZ1A 2G13A 2YVSA 2VPWB 1L3SA 4WBFA 3IGNA 2KI2A 4NXNF 5LMNJ 2EK6A 1FVSA 2QSWA 4U6PA 3AFGA 1IBMJ 1CG2A 4V19J 3V6DB 4ZCLA 3LA0A 4C11B 5FIIA 1IBLJ 1U1QA 5DO2A 1VC5A 1UJ5A 4ZDNA 5HQMA 3NCPA 5KOXA 5IC4B 3IWLA 5FD1A 4NLSA 4ETZA 3MMBA 1RT3B 2P2CB 3U1NA 3EPGA 2MZRA 1NU4A 1NSAA 2K7JA 5T41A 2BKPA 4K4UA 2XSJB 2HAIA 1X0PA 1FRMA 1OQ3A 3TUJC 1REGX 3V4MA 3SDEB 1N0UA 2FLOA 3EUNA 2V69A 1HNXF 3POTA 1RAJA 1TKZB 5DLGA 1NSKL 4JI5J 4KGVB 2PIIA 2BE2A 1BQMA 2UVWA 4QU6A 4J9RA 3LGNA 2Y1IA 4K0KJ 2B6AB 3P8BB 2CPHA 1TL1B 4QW8A 4ENOA 1S48A 4F4KA 5MAOA 2Z2MA 2OEKA 1NH8A 5DDPC 3HHNB 2XMUA 3UDLA 2E5JA 3Q86A 5LJ3Y 3QSYB 5EX0A 5L9XA 2J9EA 1Q16B 2CDQA 2DO4A 4H4KA 4DR1J 1K9MT 2C3YA 3QFWA 1TP7A 3ONQA 2C2DA 4I2PB 2OPRB 2BABA 2DTJA 4X62J 1F9EB 2GMLA 2LQ8A 2ASDA 2MKSA 3CIZA 2E9RX 4K2JA 4UQGA 3Q83A 3KLEA 1N6QA 8ATCB 1KRPA 3IGVA 1ZBTA 5D77A 2RQKA 3VALA 4LR8A 4JI1F 3ET6B 2A1BA 1WKKA 2R8GA 3W2WA 2V5HG 2OGUA 3OXGA 1IM6A 2C2ZB 4OZ3A 2HVEA 5HBMA 1BWEA 1CJUA 2W9BB 2EBEA 4HHUA 3M05A 3O3LA 3PO5A 4MYTA 5D6GA 4ES1A 2CAJA 2ERRA 1SV5B 3PV8A 4B3TJ 1D3WA 3W61A 4I6YA 1LK7A 3CCJS 1GXUA 1Y00A 4B9MA 3EVWA 3LUYA 2YKMA 1GXLA 1RUSA 2GAGC 2IVFB 3VAMA 1PJ5A 2VDHA 5JXSA 4CH0S 3P3DA 4NYZA 3P6YC 2ASYA 1R43A 1F6TA 1OQ6A 4IFVA 3LF0A 2QLJB 2XWXA 3HVTB 4UUXA 3ZTSA 3J7AN 2H9ZA 5HLFA 2CNKB 2VBZA 2J0SD 2NREA 3PHEA 2C2MB 2KT5A 3W62A 3BBBA 3BYPA 2EBGA 2ZJPQ 4DV6J 3QT5A 3IMQJ 4JI6J 1RYSA 4ECRA 4LIWA 1VOMA 1FRIA 2CNOB 5I3QA 2RMLA 2D69A 3PZPA 4C8ZA 3P4UB 5C7PA 4DR5J 4CLTA 1SH3A 4TXSA 2RDIA 3N0VA 3G6VA 4RW9B 2CA9A 3N5BA 2R7QA 4UF4A 2YWHA 1LFWA 2JEFA 3KK2A 1PAUB 1A0OB 3NY0A 2CPYA 3D6TB 4PQUB 4FYDA 1NO8A 2CJKA 4IOBA 4ECQA 2IVMA 4FYVB 2AEFA 4P73A 2HWIA 3WZ0A 1N8RT 4MTPA 3ZZTA 4NLQA 1NDKA 2XS5A 2EFNA 4A8WA 4JOUA 4I64A 2BX6A 1QLNA 3H2VE 1VQOS 3QAEA 3W63A 1UA0A 2J0XA 2RH3A 3JTPA 3LP2B 1VR6A 3W8PA 1UVLA 7AT1B 3K17A 3FRYA 3EZ5A 1KD1T 4YN3B 5J2NA 2ZD1B 4L72B 1NJXA 4Z7CA 4QWBA 1FDNA 4PXBA 4HTIA 3MMAA 4LF7J 3J81j 3KLEB 5KFJA 1HI1A 4H4MA 3CJ8A 1S9FA 2V2KA 4C97A 1UEUA 1RAFB 1H98A 3C16B 1YWXA 2DHGA 4A8FA 1SKSA 3EX7B 1S9GA 1JLAA 5KFRA 3NNCA 5B08A 2LQBA 1V3SA 3L09A 5H9FJ 4QIVA 4IDKA 1NK8A 4KC5A 2KM8C 4UY85 3AJ1A 4Y0FA 4EYHB 3E51A 5FLXU 1HHTP 1XQIA 1GMVA 4IRDA 1SJFA 2IBKA 3GIIA 4LBIA 1D8YA 2XGPA 2FC8A 4LQ3A 1S1TA 5C42A 1N5YB 4QWDA 4DSFA 4B3OA 2YKMB 3OTCA 4G65A 4OV6A 3C6TA 3M30B 4JI7J 1NM2A 5K14A 3OT9A 5L1JA 1DJ0A 3GYXB 3HJVA 1Q95G 3UE2A 4DV7J 3JAMY 1B99A 4IFVB 1WOOA 2PGCA 3AODA 1OMSA 1X4FA 3JAMU 2Y8YA 4Z2XA 3O1LA 3DXBA 5HLFB 1ZZFA 5DDOC 2CPJA 4DFJA 3NXZA 2R2SA 4YUDA 1S1VA 2CXEA 1TV6B 2DNGA 3ZTRA 4JB8B 3CD6S 5I42B 3BO4A 2VG7B 4TQSA 4ID8A 1W2BR 1Q79A 1FX2A 3NWGA 2M52A 4DOZA 5E0OA 2ZOFA 1WEZA 2B9YA 2WONB 3TVYA 2HVDA 3CJ2A 1L5UA 1YVFA 4I68A 3G8TA 3M2UA 1K44A 4DDFA 1IKVA 3AB4B 3NRBA 1T94A 3BR8A 3J80U 4TLRA 3SCLE 5K20B 3T9ZA 3ADAC 1CEZA 3R6GB 4ZIWA 3M32B 4TU8A 3MMCA 4ELUA 4ELTA 2V34A 1D0EA 3MAQA 1S97A 4Q2LA 1T9WA 3IG1A 1AROP 3BDPA 4Y2CA 5KFNA 1V3RA 1GTEA 4JUZA 2JZ5A 5AXMA 2GW8A 4OZJA 4K8RA 1XMQF 3EXYA 4CO5A 4URSA 5AE2A 2XLIA 3A8JA 1CVJA 2FHKA 3HMJG 1R6YA 1CSJA 1QE1A 3MEGB 4ZPWR 2FJDB 1FTRA 4USWA 2OPQB 3BQ2A 3MPDA 1FKOA 4OZ5A 2R7RA 1RKJA 3DCAA 2BJDA 3BH6B 4XAKA 3CPWR 1AYEA 1B7YB 1NLKL 1IVZA 3MEKA 2XI3A 3GIKA 4DFKA 5HVHA 4QU7A 4CLSA 3FC9A 2R2UA 1TL5A 3ITHA 1NBEB 1RT1A 3VQTA 2AP6A 2EFOA 5KT7A 2LDYA 3CCSS 1WSVA 3MTKA 1DTTB 4LMZA 2ZVIA 1DLOB 2MY8A 4WTYA 3JS9A 4WFYA 3OTOJ 4TNOA 3K59A 5KFGA 3BQ1A 2XY7A 2CQBA 4LF4J 3VGSA 2W2QP 4WKRA 3A3PB 3HF5A 2MDAA 1Y5NB 4NOHA 5CD4H 5AJ3J 2HRTA 4TY8A 2WVDA 3LH2S 3EGNA 4X4TA 1S79A 2E1RA 3UNYA 1RWUA 2CPDA 5C42B 3R7BB 2ROEA 1XIQA 4B3OB 4C8MA 3AT1B 4LFBF 2VQEJ 1BQNA 3CD0A 2B5JA 3PJ9A 2NXCA 9ATCB 2F1FA 1IKWB 4ZPTR 2DGTA 1RHRB 2Q43A 1Q8IA 4JV0A 3GCXP 1T05A 3VVTA 1F60B 4FXDA 3MWBA 2FGOA 3DOMB 2W9CA 4CYUA 1M5KC 4J9KA 1P9YA 1JLGA 3S01A 3RGIA 4CNYA 3EPIA 2YKNB 1EETB 1J5EF 1KHWA 1N33F 2R7XA 2H54B 1VRTA 3KLIA 2AF6A 2Y9HA 2YKAA 2H5IB 4DG1B 5HI7A 3Q8VA 3UVJB 3CJ0A 4ZHRA 2MJNA 5AXKA 1SPBP 3M2UB 2YNGA 1IKVB 3UPFA 3V6HA 2QA4G 2ZH5A 1YJRA 4G1QA 4O4RA 4DCJB 2F4VJ 2GVDB 4J9UE 3HHEA 4PRFA 3ZTQA 1J2VA 3IG1B 2VFRA 5KFSA 2HRYA 4LT6A 2YWWA 3MUMP 1T03A 3OJUA 3NOGA 2JEIA 2MMYA 5F3TA 2ZKUA 4OHZA 2UXBJ 3MM9A 3UN3A 1R3NA 3A3OB 1DRZA 4DL5A 1BLUA 1JLBA 3K2YA 2AZ3A 1HWIA 1S0VA 1S6QB 2D3O1 4OHYA 2BXJA 1FKOB 2Z2LA 4KV8A 5J1EB 1SKWA 3OTBA 4WP3A 2X1BA 3IM8A 1U1NA 4A8MP 1LWXA 3RB6A 4DQQA 3F56A 2OMOA 4O4GB 1R31A 5F8HA 1RK8A 2ZBQA 3JSMA 1TAUA 3CJKA 5D3GA 2GNKA 2V8DA 5L38A 2AGQA 4IR9A 2E5HA 4MMOA 2GO9A 5CZVA 2DNNA 4RW4A 4CTAB 4K7QA 1XR5A 2DNLA 4I2QB 3V5RA 1TUVA 2MGZA 1R7IA 1NZ8A 1WF0A 1KBRA 4ETXA 4J9MA 3DYAA 1RA6A 5A8WA 5J2MA 2YWEA 4JI8J 2CQIA 3TA2A 4M63A 4ZLPA 1AUDA 3RU0A 1LW0A 2QE5A 1RAGB 1YBAA 5GAHU 2MPUA 2QEXS 3KDNA 3BF4A 2C3MA 2Q1LA 3CGIA 3BKFA 4U8YA 2LXFA 3HFZB 4QWAA 3KG1A 4ZJQA 3NCRA 4P75A 4LF6F 5G4DA 4N56A 1Q7LB 3EGVA 2X1GA 2R3VA 4DPOA 5F41A 4OLOA 1FKPB 3NL0A 3UFCX 1WNEA 4OYIA 3PIPQ 3TZYA 3PYGA 4PWUA 2GHVC 2GA7A 4IKAA 4YB6A 3U02A 4NLUA 3D1OA 1DTQB 1U6ZA 1UKUA 4C8KA 4RU9A 1RHMB 3IAM9 2YTCA 2YKOA 1JLCA 4DN0A 4PCQA 3MEEB 2OI2A 3V6KA 1S0NA 4NLXA 2N3LA 2V4JB 3N5FA 4ZPBA 4C3KA 4QJVA 3SCIE 4DLGA 2YX7A 2CQDA 2J7UA 3BKUA 5CH7B 2D3ZA 4DU7A 3Q8YA 5HATA 1GFWB 3MM8A 2L9DA 3SEOA 4BWMA 1WD6A 1YSJA 4WFBQ 2C2OB 2KG0A 4K59A 1P1LA 2XI2A 3MM9B 1HBNB 2UUAJ 2CJ9A 4X4SA 2C2RA 3OXLA 4QIGA 1LW2A 2AV5A 1FNMA 5K8MA 1PGZA 4M94A 3OTEA 1J5OA 1S1UA 2W8KA 2QC3A 2JRSA 3KHRA 1KOOA 1X5PA 4KHPF 1FO1A 1IBKF 5L1LA 3JQKA 2FDNA 2E7VA 5DQGA 5F3ZA 1X4CA 4M5DB 4QYZK 2UUTA 3X3UA 2M8DB 4YP3A 2GQCA 1IR0A 4FF3A 1FWKA 5ETKA 4UY8T 1S10A 1Y3JA 2HGNA 4KBIA 4RW4B 3OSPA 1IWAA 3A4TA 3FQKA 2LVWA 3MD3A 3H59A 5LXYA 3CDAA 4K50A 3D67A 2M5YA 2JHEA 1S4FA 2BMBA 1BD6A 3HHLC 4NL5A 2MGZB 4LFAF 4ZVHA 2DO0A 5A8WB 1MROB 2DYAA 1FF2A 2E5LF 3WIVA 3Q23A 4L75A 4FS2A 2ZZMA 4DV4F 1S6UA 4FP9A 2GHWA 1KQGB 1N0VC 3KUEA 2GCFA 4IUFA 2GIQA 4G1IA 1HHQA 4KPCA 3MTJA 3E2EA 4Q8FA 2FTRA 2LMIA 3RB3A 2Z8QA 2WRMA 3JQMA 5KT6A 3DI6A 2KJVA 1FNXH 3Q24A 1HBMA 4KKOA 4TN2A 2KYXA 2H3EB 3MR5A 3FGVA 1N52B 3IR6B 5KFIA 5ETMA 5KFLA 3CDBA 1RHQB 2DEIA 5KFKA 4M5LA 4FYYB 4FS1A 3DNCA 3CF5Q 5C24B 3OJSA 3BGUA 5GMDA 1OY8A 3VQSA 1RTHA 3HSJA 1WI6A 4ZVGA 2XO6A 2X51A 4NZ7A 1KKHA 2V8GA 4CLKA 4ZP9A 1MMNA 2PI5A 3FK4A 4A47A 2D9PA 1JMTA 3D0GE 4ZN1A 5B0CA 1T11A 2H65B 3SFGA 3CE8A 3OVSA 3I31A 3NWRA 2HNZA 3HK2A 1QM9A 3EVMA 3IBWA 2MSTA 2X1FA 3TAQA 5L39A 1Y0HA 1LW2B 5EWGA 1R8CA 1S99A 2OKQA 2PA3A 4W90B 2W2OP 5IV4A 2JEJA 1I3OB 3C3LA 3MECA 4R0EA 3KJNB 2PC6A 3DRPA 5A6WA 2JX2A 3J81Y 3TA1A 1RTIB 3BZQA 1TMJA 1NH7A 1X4EA 3NGTA 4DSLA 4I7FB 3MEDA 1YDLA 2VF3A 2KO1A 3I5BA 4IFYA 2IAJA 4ZIVA 2DT9A 1HI8A 4OHXA 4F8RA 1XJWB 3GONA 1QAJA 2IC3A 1HWUA 3E3XA 4P2FA 4O0IA 1VFJA 3AQOA 4NI2B 2MKJA 4X84A 2QTWA 3MURP 2OLWA 1F9FA 1RT2B 2KFNA 1KLMA 4LF5F 4C3MA 1VBYA 2JLFA 1ZA1B 2LDIA 3KNGA 3IA0A 5DM6Q 1FXDA 2CFXA 3G96A 1NCLA 4N8NA 4TLQA 2I38A 5D4OA 2GJ2A 5GAEI 3T1HJ 3LPEA 1HW8A 3KTQA 2LEAA 4J9QA 2V2QA 3ZNUA 3R5DA 1A7GE 2MKKA 3M4XA 2VODA 1DFDA 4DR4F 2EVZA 1YTYA 2R8JA 3TQ1A 4CT9A 1RADB 4X64J 2OSQA 4K2XA 5C25A 2QO3A 3N01A 2LQJA 3DI6B 5CYMA 2RU3A 2HHTA 1HBMB 4X4VA 2WSEC 4L6V3 1NUEA 4J9PA 2AEJA 2G2OA 2DGUA 1RHKB 2P8IA 4USIA 2KXNB 5AE1A 1Q8BA 2NR0A 1QVFR 7FDRA 4CLLA 2BDPA 1WDTA 2RDJA 3HZEA 4YHHJ 4A8SA 4ID5A 3OL9A 2JEGA 3CCZA 1DZ5A 3C46A 1U2RA 2HNDB 3GIRA 4LF9J 4YR3A 1ZM2A 2ZE2B 1KC8T 1U47A 3DMJA 2ZM6J 4Q44A 2YPYA 1KLNA 4F0MA 4AT1B 1H3DA 5FDLA 3QZ7A 4B3RJ 2GVZB 1TL3B 4J9VA 3J7Z5 3I5AA 1FD8A 1IM4A 1XMOJ 3I32A 4DX7A 3LGMA 3MOZA 3W7BA 1UMJA 5F8LA 1WEYA 3DU5A 4DX8H 1QAXA 2VDIA 3GFYA 3T6JA 4ICLA 3D3BJ 3HHLA 2CQ1A 2E1AA 4DZ6A 2DNOA 1ZAWA 4DL2A 3OVAA 3FEXB 2RKIA 4PZVA 3IXQA 1O6XA 3CCWA 2A0FB 4BS2A 2F9DA 1X5TA 2KXFA 2QLWA 3ZNJ1 3FMWA 5EX3A 2PFFB 1DY3A 1RU2A 1HNZF 2V8HA 2E5IA 4JI2F 4WXWA 4L73A 3MR7A 4A8KA 3TNVA 3MM7B 1W2IA 1LXJA 3FZBA 1EP4A 3CSKA 5LSLA 3MEDB 2IY5B 2VG5B 2CJYB 2V8VA 4DR3J 1RHUB 3GFHA 2ZBRA 5KT3A 3L9ZA 4NXMJ 2E1PA 3DU6A 1OO0B 3KLGB 5BR8J 3OPKA 3TP2A 4PWWA 2JVOA 3HCXA 2V4RA 1TKXA 5KTQA 4DR7J 1EZZB 4ZP7A 3HX9A 1BMQB 1KLMB 3VGUA 4RW7A 2HWHA 1U25A 1U24A 2XM3A 5L46A 1WSRA 3WQPA 2JLEA 8RUCA 4ZLJA 3CD7A 4B3MF 2OELA 3I4HX 1R0AA 2WCXA 5SZTA 2AW0A 1G4CA 3OR2A 2Y0BB 4FDFA 4LQ9A 1EQ0A 2VFSA 4OX9F 3RB0A 4F50A 2OPPB 2JFDA 2HMIA 1HQ2A 4JYAJ 1HBOB 1S9EA 4DR2J 4ZVOB 1Z1ZA 1DARA 2HFNA 5F8GA 3UD4P 4O3NA 2GMJA 2AJ4A 2V67A 4LRFA 4KR0B 3D0HE 1QSYA 2XLKA 4FF1A 5HSPA 1RTJA 3UDCA 2FUG9 3UI3A 3E01B 4OIXA 2UXCJ 4IYQA 5KT4A 2EKYA 3G8QA 4ZCMA 1B0TA 4UTGA 3LP1B 1XNQF 1K73T 4ID5B 4K4XA 1WACA 2MZSA 1I5OB 2ZH1A 1VRUA 4DWIA 2ADCA 3RBZA 1I94F 1RTDB 2W25A 4OYOA 3HVWA 2RQCA 3KK3A 4L3KA 3JYTA 2APOA 4NZ6A 1H6KX 1Q5YA 3TJ9A 1TK8A 3KHLA 5CYQA 1VGYA 3NKYA 1HNVB 2NUUG 3HKWA 3QO9A 1CULA 1E6YA 4DQIA 2Z57B 3NGDA 2R7WA 5GMEA 1Q53A 2QV6A 4OYZA 2UZAA 2ZUAA 3OHAA 3AJDA 3G6ES 4DUYJ 5HMZA 3MPWA 1WKLA 2BYCA 2GIRA 5ETSA 2RSQA 2XMVA 1EHWA 2VG6A 2ZNZA 3ETMA 2J0WA 4NXNJ 1AFIA 1V9OA 4ZLNA 2ZUGA 4RW6A 3MCNA 4K4ZA 2RVJA 2LXIA 2RRNA 3S8SA 4C4WA 5H9EJ 3EMTA 2M70A 2LU1A 2FQQB 3H4DA 4BC7A 2IM0A 1UW4A 3H90A 4ZVTB 3Q8PB 2ZHAA 2VQFF 3MPVA 3PY8A 2K3IA 5E41A 1ZH5A 3I87A 1NEEA 1XEZA 1NZAA 1JLFA 1RAIB 2DCUB 2WVBA 1GX5A 2FIUA 3A8KA 4U8VA 2OJ3A 2GJFA 2MEWA 1X8DA 4Y00A 3F0NA 1HNXJ 4USUA 2QIFA 1ICEB 4P74A 4IQXA 2UUCJ 3UNGC 1FNOA 2MB0B 1S4EA 3W2VA 3CXCR 4LF8F 3OR2B 5KG1A 4ED0A 3DLJA 1N5VA 2BW7A 5B09A 2PE8A 1S1WB 5DGBA 3VAHA 4IH6A 3P45B 4LBHA 1NK9A 1T0TV 3BM7A 3S6EA 4ZJOA 1Y9OA 3W9HA 2ASLA 2G4BA 2DHSA 2IYIA 4XK8C 2QN6B 3SFUA 4LSLA 2M7SA 5H9FK 4OZNA 3T6BA 1WDDA 2VKZG 4MK8A 2U1AA 4GO7X 1RTJB 1QD1A 5KFFA 2HBZB 1HPZA 2DBBA 2QYCA 2XZWA 4ATNA 3BREA 3GR1A 1S49A 4FXVA 2VJUA 3Q22A 2I5JB 2LLZA 3SQGB 5HP1A 2CZVC 5F8JA 4IG3B 2HHSA 2FZKB 2RT3A 3D2WA 3KK3B 4NLWA 3K58A 4DV0F 2M0GB 4KH1B 4JI1J 1CC8A 3P5TL 1E6VA 1RLDA 3M8QA 5KFHA 4LIRA 5CYQB 3FFIB 5IZHA 3DHXA 1E6YB 4QIWD 1YBTA 4NX9A 4GKJJ 1N36F 2OMLA 3RYLA 3Q0AA 1CJKB 1S1XA 1NHVA 5IQQA 3L95X 1FDAA 2VJVA 3V4IA 5F9NA 3I0RA 1JLEB 2IJFA 4OJ3A 1SL2A 2P9CA 3OW2R 4EBCA 3ZZRA 5LMNF 2X1AA 3C8YA 2BJ3A 2JVRA 3CVKA 2BJ9A 2XQCA 1SH0A 4N5SA 3PX0A 4JV5F 1ZOTA 2D1CA 1RBAA 3W9JA 2NZCA 3LP0A 2XS2A 5DZ7A 6FDRA 1IBLF 3T9NA 1K47A 2EXUA 2QLBB 4LFCF 3JQJA 3FUYA 2E1MC 1NSQA 1IKXB 4FYXB 3GFZA 1DAXA 2QRRA 1FFSB 3MR2A 4X4NA 3D3CJ 3J7YI 2JNJA 2RD5C 4ED7A 2UVVA 2HYIB 2J76E 1SJQA 2E7WA 5KFZA 5F0UA 1HNWF 4ECZA 2MQQA 2AGOA 3BGOP 5E5NA 1KNZA 2WOMA 5J2QA 4HHJA 1CJVA 4PWDA 2DNMA 4M1KA 1UZHA 4B9LA 2ZHBA 2EEYA 1FRHA 4H4OB 3TVKA 3ZZ0A 2BQUA 3FNNA 3VGVA 4YFUA 2J5AA 5HQ8A 3KJQB 4PUOB 3ILIA 3T1YF 3R5CA 3HFKA 2EFVA 3BSAA 2F8HA 1MN7A 3T19A 4LSLB 4EZ6A 1NK0A 4PEOA 4QOTA 3GU0A 4IG0B 3RRKA 3IR7B 2J0QD 2BANA 1WC1A 3CMAS 3H5UA 2X7IA 3W1YC 1NDPA 1MU2A 5I4MA 1U1MA 2GQ2A 3O5TB 4HACB 5ITHA 3T5HA 3SV3A 3DOKB 2RF2B 2Z0GA 1JK9B 4EUVA 4R0JA 1B70B 5LMUF 1VDHA 3RAXA 2Z4PA 2VONA 1YZ6A 1BGXT 3QAUA 3J7ZT 1YJNS 2HQDA 3M8QB 4ED1A 5HAOA 1HWLA 3ZZZA 4F4AA 2KN4A 5HN0A 4PG6A 5F0WA 2CQ2A 3DC2A 3KLHA 2B43A 2POKA 2OSRA 1B0VA 2BJ8A 5T7LB 3OL6A 1XNRJ 2Z58B 5KFDA 3NS7B 3SSSA 3PR4A 3W5ZA 1UL3A 3I0RB 3H7HB 1C0TA 4CLWA 4NYOA 2DGSA 3M9NB 3IFEA 2YNIA 4MIBA 4HDHA 4NA3A 3DOLA 1Y3KA 1ZTWA 2QMXA 5EUHA 2FLPA 1HQUA 2V68A 2WVCA 2QX0A 2LP4A 1WORA 1SC3B 1RBLA 1UTAA 2ZEJA 2G0CA 1Y5LB 4IOAQ 2ZH9A 3R1HA 2QZ8A 3K7RA 5GADI 2BV3A 4I0WA 3DLBA 4NLDA 4YR2A 2RU9A 3QRPA 1CC7A 4RR5A 4ECXA 2HQIA 2WAQD 2LU2A 2V8PA 2EWHA 2RB7A 3KK1A 4F4YA 2ZOGA 1VQ4S 3LPYA 3PIOQ 1X60A 1PBUA 1RA7A 1SUQB 3MM5A 3H8YA 1Z4UA 2W7PA 2EW9A 1D9DA 3HZGA 5CYJA 2NSCA 2ZBCA 4HL9A 2VUGA 7FD1A 2UUBF 3D6MB 1IBCB 3CNQP 2LEPA 4ED6A 2WZ1A 3MFIA 3OFFA 2HS0A 4OZLA 4QZVB 2N82B 2A6OA 3QIPA 1QSLA 4ITSA 3O44A 5K8OA 2NSBA 1XWLA 1UWBA 1IKYA 3PRBA 2F7VA 4NLYA 5AXLA 4MFBA 2B56A 1FVQA 3OLAA 2H51B 3C15A 2IJNA 2DNYA 1IQZA 1XMQJ 1MU2B 4IQMA 4P2XA 1JIHA 4ZOSA 1QAIA 2LQ9A 3RTVA 4LF7F 2PEHA 3FEZA 1LEOA 1SIZA 4WPAA 1GXTA 1ZYQA 5C2CA 2RIJA 3CTRA 3DRRA 5D15A 1NPRA 3JXOA 5IM0A 2AQ4A 4KFBA 1OPZA 3TUZC 2A2DA 1YBUA 3CIMA 2KU7A 3SYZA 1Q81T 3N6MA 1XC9A 2AX1A 4UOCA 2DR9A 5A8KB 3KFWX 2ZWPA 4ECYA 2FHJD 4DJBA 3HD1A 4JBCA 4EWTA 1C0TB 3HPOA 2KL8A 2A10A 3EM1A 2C2KB 3PHTA 1U8SA 3ZZOA 1FX4A 3OFEA 2AEMA 3BGLA 4CRJA 2C3UA 3DOLB 4G6VB 3GV8B 4LFBJ 4KJIA 4DL0C 1VJQA 1HQUB 3CDUA 3SCJE 3OFHA 3R27A 1G3OA 1TTHB 3TEHB 2VOPA 2W01A 5EWFA 3VAGA 5DM7Q 3V6DA 4C11A 1U1KA 3BKTA 2OEJA 1MN9A 3JSRA 3MCSA 3R5JB 4LSNB 5LM7E 2DY9A 2KJWA 1LNQA 1WG4A 3VZIA 1N33J 3QSIA 4F04B 1OIAA 3UCGA 3MM5B 2XSJA 1YZ7A 1AA1B 4EZ9A 3HKZD 1OPIA 3SDEA 2BUNA 1DQ9A 4E8UA 2GAHC 3ZC4A 4ZK7M 1TKZA 2NZ4A 1L3UA 4I69A 2DD8S 2AGPA 1RT5B 4NLRA 2VKRA 2QA2A 3IRXA 2ALYB 4LJMA 1RTZA 1MSWD 2B6AA 1TL1A 4C0OC 4B02A 5A2QY 2HS4A 4YB1P 4Q0BB 5A2QU 1T9VA 4ZITA 2V94A 3PJWA 5DDQC 3KOAA 3PNIA 2HS3A 3C15B 3Q2TC 2PD1A 4KY3A 3M1VB 4DSJA 3MAAB 1XTZA 2DR7A 5DG8A 2BJ1A 4I2PA 2OPRA 3EGZA 1UVKA 3H5XA 5I3PA 2IA6A 4ZPDA 4KGKA 1SH2A 1M5SA 2KRBA 2H5JB 4KFBB 4EMDA 3KJFB 4PXDA 4CM0A 5E3AA 4OI2A 3ET6A 1YRXA 4NLOA 3AY0A 5M2UA 4QCLA 3CO9A 5T14A 3T3FA 5KG7A 5BYQA 1FK9B 2HHUA 4ZP6A 2DGXA 3GV7B 2HEKA 4O3SA 3DRXA 1S59A 3FCHA 2W9BA 3VTIA 4XDCA 3MCMA 2QL5B 1AZSB 2CG8A 1SV5A 1BE4A 4TY9A 3BN7A 4ES2A 2PN6A 2R4FA 4AQYF 2XGQA 4CH7A 2BE9B 2Z56B 4UOFA 2PT0A 1ZZNA 4NLTA 2HVIA 1OSDA 5K8NA 5KFTA 2DIUA 1LV5A 3M9OB 4PPZA 2I0XA 2XYPB 3WHIA 3FKBA 5HMXA 2RE1A 3JB9k 5ETQA 1NKCA 4F3MA 4FBTA 1VIOA 2ASJA 3CULA 2KYZA 1S7HA 2F3JA 2A3JA 4LF1A 5IWAJ 3PW0A 3HVTA 1UVNA 2P5VA 4LF6J 4ILLA 1J27A 1KSPA 2RAQA 1EAYC 3TANA 2MXYA 4LRAA 4M8LA 2HVZA 2I2YA 2DHAA 3N6NA 3CW2C 3GP9A 2NXEA 1T9XA 1REVA 1UEVA 4HT7A 2B4VA 1VS3A 3U1LA 2CWXA 5AE3A 2F65A 2HHQA 3ZZPA 3B4DA 1CLFA 4RW9A 4ECSA 1NSPA 4P9SA 4CT8A 4F3QA 2CNNB 2IRXA 1EJ7L 2VPXB 4AXJA 2FVRA 2ROPA 4PQUA 3HP6A 5ETRA 2ZZTA 2YPZA 3PVXA 3W8GA 5G0RA 3IRXB 1V5VA 4DLEA 3KG0A 2IFXA 2Q6CA 1SQEA 5GAEU 4DV3F 4FNIA 3AD8C 4OYWA 4KGZB 2MTLA 3CJQA 3OHBA 2AJ0A 2K1RA 2O67A 4EO6A 2N4DA 2COLA 3I0SB 1T8EA 3LP2A 2WVEA 1NB7A 1R6VA 2MHNA 2ZD1A 3AA9A 2CPZA 3T1AA 4MKVA 4LREA 4F67A 1WC0A 1D9FA 3M8PB 4KHPJ 2ZH2A 3NEKA 4KSEB 5EDWA 4RUBA 4PYAA 3HSDA 2CPFA 1TKTB 3LAMA 1ZPVA 2G9OA 4J9OA 3O2IA 3OBIA 3C16A 3AAWB 1D8ZA 1H2UX 2L3MA 3NGRA 3BS9A 2EC2A 3JSYA 5D4PA 1QVGR 3HVRA 1LWFB 3M6VA 3SZ2A 2CQPA 3FMBA 1ULRA 1I1GA 1LWEA 3QJJA 1UCNA 4EFAC 3IAS9 3M2RB 4RX6A 4LFAJ 4FZVA 3BBFA 4M5MA 1HBUB 2CNLB 4BHQA 1N5YA 1HYSB 2E5LJ 2IM3A 2RDDA 3H5SA 3I82A 4DV4J 2HFUA 5HJYA 3FQLA 4P7VA 3M30A 3CCVS 3DGVA 2EFGA 4DV1F 3BV8A 1VK3A 2OTLS 4NA2A 1XBWA 2RHSB 4B9SA 1RT6B 2WHOA 2VFVA 2ZDOA 2DRDA 3P5BP 1S72S 1U8WA 5LSRA 3ELHA 1FRKA 5J1PA 1AFJA 2KZMA 1TV6A 5I42A 1B4SA 1K1QA 3SSRA 2VG7A 2V4QA 4N47A 1REVB 1VCTA 2XMAA 3BO3A 1T9UA 3ZFVA 3PKYA 4HHHA 4QR1A 3EDQB 2RS8A 3TJAA 2WONA 2BQ3A 5KT5A 2BRLA 5B0AA 4WE1B 1VHFA 4BDPA 1PCAA 2GMHA 3GJSB 1VYAA 5B0GA 3GZ7A 2PMWA 1M5VC 3PACA 4Q45A 5G0RB 4GC7A 3M32A 4FNHA 2VHGA 3PW2A 2HLTA 2N7YA 4PXEA 3RBDA 1UFKA 3EJMA 2Q79A 4MKAA 3VR1A 4YS2A 1UFWA 2RJZA 4ILMA 2K1RB 1AW0A 4ELVA 3M8ZA 3CEDA 3W66A 2WB1D 3KMQA 3OR1B 3KDOA 4KIAA 4EBEA 1KFDA 1WKJA 4RNOA 1IR1A 3K8VA 1SB6A 3DLHA 3ILLA 3MEGA 2JL9A 1JJCB 3UQSA 4ECWA 2OPQA 2CJQA 4S0MA 3H20A 4U7UD 1OWXA 3A8IA 3G71S 2WW4A 3F41A 1S5ZA 2P6TA 1VBXA 3C14B 2DNHA 3NAIA 5D78A 2G2YA 2HFVA 4L3NA 2VD3A 2CVEA 1DQ8A 5ETLA 1H74A 4AXIA 1DQAA 2W1BA 3PTWA 2VZ9A 6AT1B 1DTTA 5B0FA 1VIXA 4OQJA 1DLOA 1X4HA 5FLXY 3LWLA 2ZBPA 2B8PA 1TL7B 2UU9F 1U48A 3R5GA 1C4AA 1BUXA 5KG0A 1LWEB 4LF5J 2FZGB 2ZWOA 5C5JA 3BO2A 5ADZA 4RWXA 3W65A 2XEXA 2QG9B 5BYSA 3RRGA 4RW8B 2VICA 4OMFG 3H25A 3FJ2A 3OLBA 2QGFB 5ETOA 2ZC3A 2VBYA 1IKWA 2DH8A 4Y34A 5B0BA 2PEBA 4DR4J 4Y2AA 3HFVA 3LW5C 4UOHA 2V9KA 3ISND 3DOMA 2AIRB 5LXRA 4DR6F 3CCLS 1FKAF 4HH0A 2YWGA 2HK3A 5DG7A 2YKNA 1EETA 2YQ1A 1HMVA 3ENAA 4OX8A 3FSYA 3B8HA 2OPSB 2OD4A 2KFYA 2VV5A 2JH3A 4MIAA 3AQPA 4DG1A 2GZOA 3RB4A 5DQHA 3UVJA 5D0EA 1U45A 3W64A 4F3OA 3J80Y 1YX2A 2FGCA 4DSEA 1HD0A 4DX5A 1KQSR 5KFAA 3RZAA 2L9NA 4OJHA 2WVFA 4FKYA 4A8OA 2GVDA 1NK6A 1RWMB 1UW9A 3HJFA 3KG4A 2Z30B 4Y28C 1TR0A 4X66J 2P6SA 3HD2A 3MD1A 1HA1A 3Q2SC 4R8UB 3EDRB 1U6FA 1TVRB 3D6HB 2M2BA 2WB4A 3QPIA 2XC9A 3UO0A 2W4PA 5CHCB 3THTA 1GMWA 5DJBA 3QATA 1FJGF 2HQGA 2DGOA 4LR9A 1S6QA 3UDVA 3H2LA 3LANA 3AA8A 4DL7A 3PJXA 5J1EA 1HNZJ 4JI2J 5J2PB 4ALZA 1FDBA 1KP6A 3NBPB 1OY6A 4FF4A 2D7SA 4NA1A 4O4GA 2GGPB 1M0SA 3W60A 3CCES 5KG4A 3W3SA 3DLKA 2L41A 1T3NA 1DHMA 2R8KA 3K89A 1TFYA 1CJTB 3B82A 1O5JA 4CTAA 1F1BB 2VL1A 4ZVEA 2C2EA 3RAQA 2HPUA 2FYXA 2Y8WA 4I2QA 1YJ7A 4OFZA 3I9ZA 2FVQA 2ZZNA 3G82B 1HKAA 4QYZJ 4B3MJ 1VLYA 1L3VA 1LFPA 3G6XA 1PO6A 3CDEA 2DRAA 1SL0A 4ED3A 2EFQA 4LBPA 4OX9J 1KFSA 4F2SA 4NYPA 1NDCA 1O0PA 4KGMA 2BOPA 2FJXA 4CI0B 3VZHA 4TU9A 5DG9A 4Z7YA 5J1NA 1QJHA 2CJAA 1O51A 4AFFA 1HNIB 2LKZA 4KYZA 1R0BG 2CWKA 1C0UA 3EGWB 1JQGA 3H40A 5B7WA 5JVGQ 3OFGA 1FKPA 1HMVB 2B4OA 4P2SA 2UXDJ 1HWJA 1R0CB 4LF9F 2GS8A 2HIQA 2XWYA 1XNQJ 5ETTA 1LOUA 1IXKA 2VA2A 3FDSA 4NE9C 4J7CA 1A9NB 3J7YU 1G2EA 1DTQA 1I94J 1FEEA 4D3HA 2RRAA 1HIYA 2ABYA 1XMOF 2JWNA 3MEEA 2FVPA 2E66A 4ZCIA 4F0HA 2V4JA 4DXLA 3IBCB 5KG2A 2XHCA 1VQ8S 5GVQA 4DCOB 4KHMA 4KT0C 3DLEB 3IM9A 3GSIA 3VAFA 2QLXA 4NCGB 4YY3F 1HBNA 1Z2ZA 2HFSA 3TUIC 1Y10A 1KHVA 3RR7A 2NQPA 3KUHA 4DS4A 5KG6A 1H7WA 2MQMA 2HZCA 3GQCA 2A6MA 4PXCA 5A0YB 3I96A 2IJRA 1SC6A 2HVHA 4DR3F 2C42A 1HQEB 1GT8A 4HEA9 3UD5A 4PKDB 3EXCX 4M5DA 1DBDA 4NXMF 2BE7D 5D0HA 4HI1A 3DLKB 1HR0F 4DR7F 3G87A 2FJVA 2VQFJ 1SXLA 4DL6A 1RP5A 3N4WA 1YITS 3QQCD 1C4CA 2MQLA 4RNFA 3MI7X 1VC6A 1PAEX 2O3DA 3THVA 3FSXA 2EI5A 4RBTA 5E3QA 2DNRA 2AYGA 1WC4A 3ETOA 1MROA 2SXLA 3KUGA 5HMYA 1SJ1A 3FRZA 1VLOA 4ECUA 1L3KA 4USVA 3QLHB 4LF8J 5HMWA 3IN5A 3FVYA 2FHOB 1WJ9A 2YNHB 2FJEB 5EHHA 4A4JA 1VISA 3K5PA 4Y3CA 2FPHX 4X2BA 3MOJB 2JSXA 5CQGA 4WIIA 4F2RA 2UXCF 2XULA 3Q89A 3EZUA 1C0UB 5DDRC 2O5DA 1D09B 2DJWA 3TX0A 3ZO7A 1KWMA 4ZS6A 5GADU 4WK1A 3G86A 3FBBA 1UVIA 2HHHF 2LA6A 2E5GA 4RZRA 5D0GA 1RWXB 3MUTP 4LRBA 5C24A 3SCKE 1RJJA 2L48A 2OAUA 4ECTA 2UV8G 3AH6A 2KHCA 1EARA 3FBFA 4K4YA 1UJ4A 3QGIA 2BQRA 4TU7A 1TKDA 2NXJA 3AXKA 4HYKA 2O01C 1D1UA 3QYYA 3CCUS 2B3TB 1R8HA 3ULHA 4C9DA 3THPA 3GCWP 4B9UA 1N36J 2D9OA 2E7XA 4A8XA 3R6LB 4QWEA 2HNYB 5KT2A 2AHOB 4C48A 1WEXA 4Y6IA 2DXFA 4W92B 3QMQA 1XR6A 3CJ5A 4DF4A 3CD5A 2E29A 5A6PA 1U49A 4FPRA 5C2GA 5KFMA 5JUMA 4JV5J 4GVLA 2BR0A 5K8PA 1RTIA 1JJ4A 1UWAA 2JC0A 4UT4A 4ZVPB 4I7FA 2CZ9A 3GE9A 3GJTB 3P96A 4RUHA 3UDEA 2IBOA 1FJEB 1VQMS 4LFCJ 3KLFB 3BGRA 1MMLA 1TK5A 4GRSA 5KFEA 1RE1B 3NGUA 4H54A 2CPIA 2IRYA 2QA4S 4WF9Q 3SIPB 4DV2F 3H0PA 5F8MA 4DFPA 1KQFB 4WZMA 2F40A 2IYGA 4NI2A 3PW7A 1HNWJ 2RNEA 2RUSA 4GVBB 4OLPA 2V63A 3UWTA 1RT2A 5IT4A 3AOAA 1MNEA 4DMZA 1VI7A 2UUCF 2N4CA 2Y3YA 4X4UA 1N34J 2XTJP 2WBMA 3RW6A 1G7CB 2G2ZA 4NMLA 1TUWA 4NLVA 1RLCL 1KONA 2QLFB 5A8RB 4RU2A 4D3GA 5KFPA 3NOCA 2KG1A 2XMWA 3PRVA 3CCMS 4MIWA 4JI0J 3T1YJ 1RAAB 3HDSA 3OUYB 2C2NA 4DQPA 3T5KA 3GIMA 1ZPWX 2RS2A 4UW2A 4DV5F 2R2TA 3DGPB 5D0RA 2BA9A 2CJBA 4C2MA 4WP8A 1X9MA 3D1QA 3GIJA 2HHWA 4O3OA 4CM2A 4Q8EA 1OSCA 1UP1A 3VF0B 1P27B 2ZITA 2HNDA 3AXMA 3M6UA 4WU2A 2ZE2A 2IMWP 5KG3A 1OS5A 3PCOB 2V0NA 2C1EB 5LMUJ 1YG0A 2HFZA 2GV1A 4OYAA 2L9WA 4ZLLA 1FTCA 2NCKL 4GKJF 4DQSA 4O44B 2GVZA 2XS7A 1RWKB 1TL3A 1F9HA 3DLGB 1IN0A 1X4GA 1IJFB 3B78A 4EI2A 2YX1A 1P8GA 2HIYA 4HDGA 1FJCA 3WX8A 4JI3F 3SSQA 2BACA 2HG4A 3TOQA 2EPIA 4P2MA 1Q86T 2VASA 4DPYA 3QRRA 4PR6A 4A8QA 1RDRA 2FJBB 3MM7A 1L3TA 1FA0A 1C1CA 1WI8A 3UR3C 4DU8A 1VQLS 5KFOA 3BQ0A 3SV4A 2VG5A 4B17A 4ECVA 3MMBB 3BGRB 5EGYA 2BZ2A 1SI9A 4OYMA 1SJ4P 5LJ5Y 3ILOA 1UFLA 3Q8SB 1M90T 2XYGB 3KLGA 4KQZA 2EC0A 3QJLA 3T5LA 2B8QA 1YJ9S 2CJXB 1GX6A 4IRCA 3PYDA 5K5MA 3SMZA 2MLXA 1YQHA 1H38A 2MY7A 3LOUA 1NK7A 3POTB 2HSEB 4GMKA 1NB2A 2HBQB 3G8SA 4JP8A 2UUBJ 2BE2B 1BQMB 2AYMA 1IR2A 2NUHA 4C0HA 3KLVA 1VRQC 2DVIA 3SXLA 1S7IA 3TQEA 5LSOA 2YQ3A 1T95A 2NPFA 1NK5A 5GAGI 1YLXA 2OPPA 4DEZA 5LL6d 1HBOA 1SJRA 2OO4A 2AD9A 4ANCA 3HO1A 3MHYA 3QJPA 1UAWA 1WHWA 1HHSA 3SI8A 4N77A 1LKZA 2ZDPA 1WF2A 3PO4A 3E01A 4DPXA 4J9SA 3JSBA 1FFGB 4O0NA 4LR7A 2PDAA 3KHHA 3R5BA 3LP1A 3B4MA 2GX8A 1N6QB 4MAKA 3EICA 3L7OA 2M9KA 3FCWA 3UN2A 2CQHA 3W2WB 3NP5A 1RTDA 1YJVA 1H2TZ 3MFHA 2BOAA 1GQEA 1GH8A 3DXSX 5HBMB 1CJUB 2DGQA 4YEAA 4BLGA 1EKRA 4JV2A 2MKYA 1HNVA 1XNRF 4CWBA 3CC2S 4OJ1A 1LQ9A 1WC5A 5IQ6A 2AX0A 1YK9A 4ZPAA 2W9AA 1XN9A 4W4MA 2XZTB 2I8EA 4X65F 1Q0NA 4HR2A 3OL7A 4LVOP 2PMZD 2PMHA 3CO0P 5KG5A 1PC4A 4DFMA 4E0DA 2E9TA 2EG1A 2F4FA 4J9NA 1U2FA 3HVAA 2O1PA 1EIYB 2CPXA 2R7OA 4ZCKA 3GYGA 4F26A 2GFFA 3WDOA 2YNFA 4QR0A 1C1CB 1Q1KA 2CRLA 3IO1A 4YQWA 2CQ3A 2QT7A 2W24A 5THWA 1ZM9A 4O23A 3DDNA 4OI0A 2ZFHA 3TUPA 1D9AA 3IWXA 3CUNA 2YKPA 1ACMB 1M1KT 1LWCA 3H98A 3LQVA 4UZBA 1NNDA 1Q8LA 4C3LA 1JWWA 1QAYA 3NNAA 2YH0A 4CLZA 1VC0A 4W98A 4KH0B 4QW9A 3HHKA 4M5JA 3M8RA 1RWVB 3KK2B 1KR4A 3EE3A 5H1SV 4USJC 1T9YA 1P1TA 2DK2A 2OUGA 1RU1A 1BC6A 3MGJA 3QGPA 2Q66A 2UUWA 2AZ1A 3BJYA 2BJ7A 1PYTA 3QBCA 2LEBA 3CCQS 2DR5A 4HT5A 4MKBA 4IH5A 1JXLA 1U6BA 3OL8A 1XMBA 2M8HA 3NAHA 1S1WA 2MZ1A 4K4SA 1QTNB 2XZDB 4I4BA 3FBEA 4HI2A 1X5SA 2ZH6A 1CBKA 2CG4A 4DS5A 5IT9Y 4K4VA 3M2VA 1RWPB 4KPYA 2NPIA 3HT3A 1NHUA 1R8BA 3M9MB 5IT9U 4M5IA 4JI4F 3TA0A 1PKUA 5J2NB 4I1TA 4CP5A 3KWMA 4YOEA 4UUWA 3LAKA 2DPJA 2OTJS 4QBUA 1VJWA 5IT0A 3MMAB 3B6BA 1PYOB 3CJ4A 2IM2A 2I5JA 3SQGA 3ZZUA 4H4MB 2IMOA 4DPTA 2NXUA 1WG1A 4P6QA 5LT5A 4IG3A 2FC9A 4ZVUB 2CQGA 3MUVP 1FESA 4YR0A 2P9EA 2F63A 1FXLA 1FRLA 2DXDA 1S9GB 1JLAB 3RR8A 4ED4A 1XK8A 4IDKB 1HD1A 4FKXA 3TZXA 1NDLA 4XTTA 1VBZA 3OV7A 1M5OC 3FFIA 3K8WA 3OVBA 4ZPCA 2B9XA 1H7XA 3VV2B 3WIUA 1SQGA 5IOLA 3LGHA 1CJKA 2GJIA 1SKUB 2KDOA 2YKQA 1GTHA 4LSZB 1MW7A 1UZDA 2D3UA 2X3GA 3Q8UA 1S1TB 3KKFA 3M7VA 4ILRA 4ANDA 3HHLD 1JLEA 4Y2IA 4AQYJ 1UPMB 2B7BB 3A1YG 3C6TB 4I6WA 1JNZB 3D9BA 3TI0A 5K14B 2NYIA 3PM9A 1QTMA 5IC6B 2K2PA 1YI2S 1N54B 4U67Q 1IWGA 4WFAQ 2MLZA 2MKIA 1PSDA 1ZS6A 1VQSA 3PXGa 1M5HA 2XG8A 3GJQB 1T02A 2YNFB 4C0BA 4A8YA 3V6JA 1S1VB 2KVQE 2KXHA 2GHPA 5JVHQ 2N3OA 1IKXA 2DHHA 1N5QA 1LWCB 3U27A 4MK7A 1R8PA 2HLUA 2WBRA 3A13A 4URQU 2PFDA 4PABA 4GKKF 2DNZA 2J8AA 5RUBA 4DUZF 4G3IA 4KAIA 3WC2A 3QGHA 5D4LA 4H4OA 3HM9A 3WBZA 4PG7A 4WJBA 4AL7A 4XPEA 4OV1A 3T41A 3MMCB 4DCPB 1N32F 4WP9A 2EG2A 5KAKA 1BWVA 1NK4A 1UVMA 2ILYA 2AJQA 4PUOA 2DH9A 1KDNA 1S0MA 4B3SF 2NXNA 2XMTA 3M2VB 5EWEA 3W9IA 4DV3J 1VMBA 2WW8A 4UQTA 4F25A 5IXUA 3N6LA 2J7KA 1X7VA 1NRKA 4IG0A 3FCVA 3U7JA 3BN4A 1QE1B 2KT3A 4PPDA 4DBQA 4WFNQ 2R7UA 1C2PA 4CLPA 4ZPVR 3I56S 3R5AA 4DSIA 4HACA 3VAJA 1OJ4A 4CQ1A 4F36A 3DOKA 3B54A 1QUPA 2RF2A 3FEYB 3BYRA 2HHVA 2BM1A 3ITHB 3F73A 1Q78A 2FD2A 1RT1B 1DURA 2YX4A 1OY9A 3BBCA 2PI4A 3UW1A 5E3PA 4K4TA 1RCOB 1IUJA 2N7CA 5L1IA 3HSGA 2I6WA 2LXUA 1IJEB 2EFPA 3TJ8A 1RWWB 5DGAA 5T7LA 2ATCB 4V1Ak 3GR0A 4CH1A 4Q7AA 3GMGA 3PEHA 1MMDA 4TY8B 3TX8A 4USKA 4RBVA 2FY8A 4TVAB 2DH7A 1ZETA 2AJ1A 4M95A 4R5PA 1N56A 1TZ0A 4ED5A 1BQNB 2B5JB 4KE5A 4EK2A 5HVGA 1K8AT 2YWKA 3M6WA 4AL5A 4E2FB 3C6UA 4K5RA 4B9VA 3X1LB 4RNHA 1IBMF 2B7CB 3CC7S 1T05B 2OFHX 2G0JA 2ZVSA 5IWAF 1T9TA 3G2XA 4MKYA 3M8SA 3ENWA 1F5BA 4DV1J 2W9CB 4FVMA 2ZH8A 4CYUB 2AJFE 2OP5A 3HXMA 1WHVA 3K5MA 1JLGB 4TKTA 4AD6A 4LF2A 1PILA 1QSSA 1UJ6A 3VGTA 1VRTB 3KLIB 3DN9A 3R9LA 1SC1B 3BPDA 3ISZA 3T5JA 3W5YA 4ZHRB 5F8IA 2V50A 3RBEA 4Q2MA 1SUQA 2CKWA 3UR0A 3QIDA 2HZAA 2LQ5A 2YNGB 5M2PA 2ILZA 3C19A 1R89A 4JI5F 2RRBA 2XMKA 1RSCA 3PG9A 4G1QB 2Y0SD 4K0KF 1VQNS 6FD1A 1IQTA 4LVNP 2HHPA 1URNA 5ETVA 3U1MA 1U09A 4HVZA 3CCTA 1QY7A 2KM8B 2CDRB 1T03B 5U47A 3TO8A 3OQ2A 1O8BA 3RW7A 1SJ3P 2J6TA 3RRHA 3QNWB 2H1YA 4FPIA 4DR1F 4EBDA 4C8LA 2U2FA 2AWZA 1JLBB 2E9ZA 1G1XA 1V6HA 2J9CA 4X62F 3AJ2A 3R8YA 4KV8B 4XPCA 1SQFA 3GB0A 1BXNA 2B4PA 1KTVA 2R8IA 2QSFA 1ZA2B 5KFCA 4WFZA 2MKCA 1M1GA 3H5YA 2Y1RI 1TU0B 5L8RC 2HBRB 1JXEA 3JSMB 3CJKB 2IPOB 5D3GB 3HSZA 1SVDA 4IRKA 4ERDA 4NEYA 3BDEA 3D7SB 1WTBA 5A8KA 5LOQA 4NCBA 2QL9B 4M5KA 4ZVQB 3CMES 4B3TF 3RUBL 4WKYA 2KT2A 1MWQA 2UU9J 4AUKA 1VQ7S 5CD4A 3DYAB 5J2MB 4R5PB 4OYPA 2FJWA 5KFXA 1LW0B 2VU5A 1WTFA 3C6UB 1U2CA 1TQLA 2CVIA 2HWTA 1BQXA 3D6FB 4R25A 1MLAA 1PJ7A 4OI1A 1PG5B 2CUYA 2MQOA 4LUBA 3TYTA 1TL4A 4DV6F 3I6PA 4Q43A 1NJZA 4JI6F 4BCAA 2O66A 2QJ3A 3WC0A 5JMNA 4DR6J 2M4MA 4N7TA 4USMA 4ER8A 4LSNA 1SBRA 3JTNA 1MG7A 4OI3A 1CQMA 4OL8A 1ROFA 2DITA 4DR5F 4M5GA 1Z2LA 4NLPA 1N88A 4C7QA 1T7PA 4RBUA 2R7VA 3KHGA 4P72A 3WX4A 4ZA1A 2K8GA 3PW5A 1EX8A 2V2ZA 4OJGA 5DETA 5AXNA 3VCDA 4V19X 1JLCB 3MPUB 2MQ8A 1JNRB 2VBXA 2M88A 2D41A 5BYRA 9RUBA 1F3FA 3IWNC 2HHXA 1NKBA 5B0EA 3CJ3A 1M5PC 5HANA 1NJWA 3K57A 2MQPA 1RT5A 1FWLA 4DUTA 3MZIA 3ENQA 3MM8B 1LK5A 3AD7C 1KEKA 3O8WA 1BY9A 2PO4A 2VPZB 1H0HB 3QFHA 3VWSA 2LA4A 3VAIA 2F8MA 4Q0BA 5E7OB 4CO0A 4YDDB 1KS2A 3AD9C 3D0IE 2PSZA 4UZCA 2IDLA 1YIJS 3L7PA 5CAAA 1J5OB 1S1UB 3MXHP 3EYZA 3M1VA 3I9V9 5HO4A 4WU3A 1VK8A 3MAAA 4DF8A 1FJGJ 4N76A 2D3OR 1VQYA 3D68A 4PYDA 1NAQA 3QT6A 1GK8A 1YJUA 3J81U 3KYLA 1X4AA 2ZBIA 2WTFA 1HL6A 3IC1A 5E33A 4CZCA 1VQKS 5ETPA 2HAFA 1FRXA 2R7SA 2KH9A 3GWCA 4BWJA 2OEMA 4XIUA 1RXOB 1FK9A 5KFQA 3Q8RB 3CJRA 2AT1B 3PDNA 1SL1A 4OHVA 2HK2A 4KRWA 3A8EA 4FN5A 2FB0A 1W7WA 2JC1A 1KVJA 2R2RA 4MYUA 4ZP8A 2NLWA 5F8NA 1AZSA 1WC6A 2I1RA 4WFXA 2B9WA 2AYEA 4X4QA 3DRYA 2DNQA 3PEJA 4GO5X 3BB5A 1WF1A 4A48A 1QDUB 3G6YA 4KB7A 3GTYX 3AB2B 1APSA 2GO8A 4JI7F 3NLCA 2MZQA 2CPEA 4OI6A 1R27B 2XMJA 2DPIA 4DV7F 3NS5A 3IBFB 1K0TA 4OX6A 2Z2YB 2WSCC 4EU0A 3E8OA 1UA1A 2HGMA 1RAEB 3CMQA 2FZCB 2MKHA 3TRGA 1RGVA 4KKOB 3IS9A 1X0FA 1TFWA 1RABB 3A3NB 1Y5IB 1U02A 1WHXA 3MCOA 1CPZA 2RUGA 4U96A 1X9WA 4X4RA 2HKEA 3PX6A 3EZOA 3TVZA 3CJTA 1J5EJ 1EB0A 2UVRA 2XYHB 2AYBA 1RAHB 5M2RA 2HZVA 2YWFA 2XLJA 1RTHB 4QPXA 1XR7A 3BH7B 1RISA 4QR2A 4P52A 1VQ6S 3R7SB 3TWZA 4ZKAA 4FVCA 2ZKTA 1NJYA 1RT4A 1RWOB 3S1TA 2JFKA 2IDEA 2OFGX 2XY6A 4NRUA 1U1LA 4A46A 2NS1B 2DEJA 1I51B 4X66F 2HGLA 1N48A 2HNZB 1ZAVA 3VVUA 1U0SA 2XSFA 4I67A 1HLWA 4CLUA 4HH1A 2F9JA 3ZZYA 1S6PA 4RO0A 1JXVA 4YY3J 4DHVA 3MECB 3I0SA 2CZ4A 4C8YA 4WYWA 3DRPB 2MQNA 3GFXA 1X9SA 3MR6A 1UPPA 5D4NA 1Q7YT 3NS6A 5KFUA 3ZTPA 3TW0A 3AOBA 4IFYB 2IAJB 3M8PA 1P6TA 4NRTA 4M5HA 1TKTA 1URRA 3ENVA 3KNAA 2IC3B 4F7VA 3D54A 1Y4ZB 4OYXA 3NMRA 3OTOF 1N5SA 5B0DA 4LF4F 4L74A 2DXEA 1HR0J 2DRBA 1FD2A 3LTOA 2DIVA 1HI0P 1VBKA 3K5LA 1LWFA 5AJ3F 2YXLA 4C98A 1RCXB 1AB8A 2QA1A 2BKNA 3BR9A 1ZM4A 3PYFA 4EGLA 1VQ5S 5AT1B 2MZJA 3PYEA 4ES3A 3M2RA 2VQEF 1KOHA 3MM6A 3CCRS 5HVFA 2RILA 1HBUA 3NGKA 2RHQB 4XDDA 4CO4A 2Z2ZA 4YDXA 1HYSA 4J37A 2HURA 2C28A 2IVYA 4ZVRB 3AOCA 2MLYA 2CADA 3BPSP 5E3CA 2MZTA 5C25B 2R8HA 3TAMA 2ROGA 1GNKA 3UN5A 4F4WA 2CQ0A 5CYMB 3HHDA 2JDJA 2VOOA 1S57A 4WWSA 4EYIB 1EQMA 2XCAA 3LALA 3IS9B 1HWKA 1RT6A 3SBMA 1KN6A 4F4XA 2XCPA 3NMAA 4YB7A 2UXDF 3RBXA 2K06A 3DDKA 2DY1A 1X4BA 2ZC4A 2HHHJ 3DMJB 3GJRB 1N5TA 3MMJA 1H73A 1LXNA 2LYVA 3M8WA 5CXTA 4WYLA 2C22A 5FDLB 4WE1A 2QL7B 1RT4B 2F4VF 2VC1A 2YY3A 4YMEA 4RUCA 4N8OA 4NZ0A 2AJ2A 4KO0A 4LRCA 2WSFC 3R1LA 2B9EA 2Y1LB 1MWZA 3BSOA 2QFIA 1RI7A 3BSNA 2A18A 4P10A 3OD2A 1UETA 1S6OA 3MF5A 3H42A 4ICLB 2UXBF 3HHLB 3RG6A 5CCMA 1Y7PA 5KFYA 1FCAA 1S6PB 1RAOA 2DNKA 1FT8A 3I5CA 4OYBA 1OYEA 5GAGU 2RKIB 3HULA 3OR1A 1T3OA 2BEFA 3DDIA 3DLLQ 1YRUA 2I9SA 2XMMA 1PC5A 2C3PA 1GAOA 3QWPA 1B64A 1NMEB 2OIHA 1EP4B 1NKEA 3D5MA 1IBKJ 5L9NA 1FEHA 2F5GA 4MH8A 1FFWB 4P7TA 3F44A 2R42A 1RKIA 1S77D 5E2QA 5K9FA 2E1CA 4HLBA 3C14A 4U7CA 1SC4B 3NCQA 4WXOA 1GMUA 4PQAA 3R2CJ 2DGVA 2HW3A 1TKXB 2GQQA 3ILJA 3QZ8A 1TMMA 4DV2J 1FI4A 2ACYA 1WHYA 3D4JA 1YRTA 4URGA 4I56A 4RW7B 3RJMB 3GV5B 3ICLA 1TL7A 3PW4A 1R0AB 4OZ0A 4JI8F 2FHMA 5KFBA 3VAKA 3MM6B 2QFJA 2E44A 2FJAB 2DR8A 3BEGB 4RW8A 5FJ4A 1RWNB 3H2UB 3DKDA 3OTDA 3UCUP 2VPYB 5HJXA 4QIFA 4GC6A 2UV8A 3S7RA 1JB0C 3ZXWA 2HMIB 3K0JA 2YH1A 1S9EB 2V6AA 1RB0A 3TAMB 4RLEA 1YJTA 2ZH7A 5CA5A 4DSKA 3BGFA 1JLQA 3V81A 1F0XA 2FY1A 4FF2A 2FVCA 5CABA 1SKRA 4C8OA 2HQCA 5IV3A 3MDFA 2Q3PA 1RZMA 4DV5J 1FWPA 1GEHA 3UCZP 2A2CA 2ADBA 2GC8A 1RYRA 1VQ9S 2CQ4A 2BRKA 2XB2D 2OPSA 1VRUB 1FDDA 2B51A 2MJUA 1N4LA 1FRJA 2L08A 2DNPA 1NPKA 3IRWP 2BW2A 3JYTB 3FZ2A 4RJVA 3MR3A 3W5XA 3R7NB 2JJ4D 2UVUA 2J6SA 2LFVA 3CWJA 1Q82T 4PG5A 1F3VA 2P9GA 4U9RA 4CO3A 5SUHA 4KO0B 3QO9B 1CULB 4Z37A 5ETNA 1B3TA 1YGYA 3L3CA 4CLFA 4X4PA 4Y65A 4O3QA 1KTQA 4U7UK 3GG1A 4NWBA 3CB4A 2ATLA 4DI6A 2UUAF 1JJHA 1VHIA 2HRUA 2Y1JA 2VG6B 4R8UA 1TVRA 5KOWA 5DLFA 1WOSA 4WCEQ 4L76A 4C6AA 4JI3J 3PFOA 4RW6B 5HROA 1JKHA 5EN1A 4CO1A 1S0OA 1AT1B 2ACMA 5KFWA 3N28A 4B9NA 5J2PA 3NBPA 4NMXA 4J5OA 3M8YA 2JOQA 4NCAA 2GGPA 3KXDA 3NG8A 4KHRA 3IR5B 2KRRA 4IR1A 4NEZA 1A6LA 4EEYA 2J6UA 1JLFB 2FLNA 3PX4A 2J7WA 2W7AA 1F5AA 3TR5A 4MK9A 3N9UC 1CJTA 2W7OA 3H4BA 2QMUB 4BC9A 2VBWA 1MWYA 1N34F 2DGWA 4X4OA 2VFUA 4ZJLA 1RBOB 3W2VB 3G82A 2OHDA 2B4UA 1KQKA 3FBCA 3A12A 4JI0F 1FE4A 4OHWA 1CS4A 5CCLA 3MAHA 1C1BA 2W2PP 3GYNA 1PYSB 1JLQB 3V81B 5IFMA 2CIMA 2W2MP 4RNMA 4RPFA 2H48B 2KVIA 1YHQS 2H5EA 1HPZB 3D28A 2C3OA 3NGSA 1HNIA 1B7FA 4DPWA 2H4WB 4TYAA 2DHXA 5HP1B 4QPTA 2IIHA 2MYFA 4JV1A 3IP0A 1JX4A 2V9WA 2RQ4A 1E6VB 1X5OA 4USHA 4E98A 1TUGB 1Q8KA 4RL1A 2XO7A 3CC4S 5D8HB 2J9DE 2RQMA 2R7TA
chains in the Genus database with same CATH topology
2P5VA 4I4BA 1S1XB 4HI2A 4UY8T 4ILLA 1X5SA 2ZH6A 1KSPA 2FHJA 2CG4A 4DS5A 1S10A 1Y3JA 3TANA 2MXYA 4K4VA 2HGNA 3M2VA 5IT9Y 3V4IB 3KMSA 4KPYA 2NPIA 4M8LA 3HT3A 4KBIA 1NHUA 1R8BA 1WG5A 4RW4B 3M9MB 3OSPA 2HVZA 2I2YA 3FQKA 4JI4F 1QUVA 2DHAA 2LVWA 3MD3A 5GAHI 3TA0A 2KKHA 5J2NB 3H59A 3N6NA 5LXYA 3CDAA 4I1TA 3DLEA 4K50A 1REVA 2M5YA 1UEVA 4HT7A 2JHEA 3KWMA 1S4FA 4YOEA 3DRSA 4UUWA 3LAKA 1BD6A 3HHLC 4NCGA 1XERA 2ZOMA 2B4VA 2DPJA 2CYYA 4NL5A 2MGZB 4LFAF 4QIEA 1VS3A 2OTJS 4QBUA 3U1LA 4ZVHA 1VJWA 5IT0A 2DO0A 5AE3A 2OD6A 3MMAB 5A8WB 1MROB 2HHQA 3ZZPA 1FF2A 2E5LF 1U26A 3B4DA 2ZJRQ 3CJ4A 2IM2A 3Q23A 1CLFA 2I5JA 3SQGA 3GSDA 4FS2A 4RW9A 3ZZUA 4DV4F 4ECSA 1S6UA 3RAMA 2ZZMA 4H4MB 2IMOA 5HROB 1JKHB 2JLGA 4CT8A 4FP9A 2NXUA 2GHWA 1WG1A 4P6QA 4F3QA 1KQGB 5DQIA 1N0VC 2VB6A 3LP0B 4QQBA 5LT5A 4IG3A 2FC9A 1AXQA 2CQGA 2GCFA 3MUVP 2IRXA 1FESA 2VPXB 4AXJA 4YR0A 4IUFA 2P9EA 2FVRA 2GIQA 1FXLA 2ROPA 3N79A 4G1IA 5A0YA 1FRLA 3G9CA 4PQUA 1S9GB 1JLAB 3RR8A 3HP6A 3MTJA 3E2EA 2ZJQQ 4Q8FA 1HQEA 1XK8A 2FTRA 2LMIA 4IDKB 3RB3A 2Z8QA 1HD1A 3PVXA 3I4PA 1U1OA 2WRMA 5G0RA 1K0VA 3IRXB 5CZXA 5KT6A 3NNHA 1VBZA 3OV7A 1M5OC 3DI6A 3FFIA 2VC0A 4DLEA 3K8WA 5L1KA 4CCHA 3KG0A 2KJVA 1FNXH 3OVBA 2IFXA 1Q4RA 2DISA 4ZPCA 2Q6CA 3G4SS 3Q24A 1SQEA 2B9XA 3US5A 5GAEU 4DV3F 1H7XA 4FNIA 1HBMA 4KKOA 5KFVA 3R3TA 4TN2A 2KYXA 3KJVA 3OHBA 2AJ0A 2K1RA 3MR5A 3FGVA 2GJIA 4NLGA 2KDOA 1N52B 2YKQA 2O67A 3IR6B 1GTHA 3CDWA 3DFEA 1ZAXA 5KFIA 4EO6A 2N4DA 2COLA 5KFLA 1MW7A 2WOMB 3CDBA 2D3UA 2X3GA 2FVSA 4ZMMA 5J2QB 1S1TB 3I0SB 3QGGA 1U1PA 1U4BA 1F5CA 3KKFA 4ILRA 3LP2A 1T8EA 5KFKA 1S76D 4PWDB 2LCWA 3HHLD 1NB7A 1JLEA 1F2GA 3Q8QB 2MHNA 4FS1A 4Y2IA 2DB1A 2ZD1A 3AA9A 2B7BB 3A1YG 3DNCA 2CPZA 3CF5Q 3C6TB 4I6WA 1JNZB 3T1AA 3TI0A 5C24B 4F67A 3OJSA 3BGUA 5K14B 4XO0A 1D9FA 2NYIA 3T1HF 4C8NA 3PM9A 3VQSA 1RTHA 1QTMA 2J9DA 1WI6A 4ZVGA 3M8PB 2K2PA 2BBEA 1YI2S 2ZH2A 2M3DA 1N54B 4PG8A 4U67Q 4KSEB 2X51A 4NZ7A 4WFAQ 2MKIA 5EDWA 1PSDA 2XNRA 2V8GA 4ZP9A 1VQSA 2XBPA 1MMNA 2PI5A 3PXGa 1FXRA 2CPFA 1M5HA 3PKMA 1TKTB 2XG8A 3LAMA 2R9LA 1T02A 3QLHA 2YNFB 2D9PA 4A47A 1ZPVA 2ZH4A 2G9OA 4J9OA 1JMTA 3O2IA 3OBIA 3D0GE 4C0BA 4ZVFA 4X64F 4DQRA 4O3PA 4A8YA 1C1BB 1RT7A 3V6JA 5B0CA 2YNHA 2K3KA 1HFEL 1S1VB 1K1SA 1FE0A 3AAWB 1D8ZA 1H2UX 1SIWB 2L3MA 4B08A 3SFGA 1B0PA 2KXHA 3CE8A 3BS9A 2GHPA 3OVSA 2N3OA 1IKXA 5JVHQ 3JSYA 5D4PA 3DM2A 3I31A 1JJ2R 1QVGR 1TK0A 3HVRA 1N5QA 1HARA 2HNZA 2BANB 1LWCB 3HK2A 3U27A 1QM9A 3IBWA 1LWFB 2MSTA 2X1FA 3TAQA 3M6VA 3C2PA 4MK7A 5L39A 3SZ2A 1R8PA 2CQPA 2F8EX 4YB5A 2XY5A 1FHTA 1Y0HA 2HLUA 1LW2B 5EWGA 1R8CA 3FMBA 2WBRA 1S99A 1I6JA 1ULRA 1I1GA 1LWEA 4YHHF 1P9QC 2OKQA 2PA3A 4URQU 3UD3P 3QJJA 4W90B 4EFAC 3IAS9 3M2RB 4RX6A 4FZVA 2JEJA 1UVJA 3C3LA 3MECA 4GKKF 2DNZA 2ZNYA 1HBUB 4R0EA 4J9LA 1ELOA 4BHQA 2J8AA 1N5YA 2MHEA 2PC6A 2ZM6F 1HYSB 2IM3A 1TAQA 3DRPA 5A6WA 2JX2A 4DUZF 3H5SA 2W4CA 4G3IA 3J81Y 3I82A 4F4ZA 4KAIA 3WC2A 3QGHA 5D4LA 3TA1A 1RTIB 3FQLA 3BZQA 1RQ0A 4H4OA 4P7VA 2G1DA 3HI9A 3WBZA 4PG7A 4WJBA 3M30A 3HM9A 1NH7A 2IHR1 2DCLA 1X4EA 4OI4A 4XPEA 4AL7A 4DSLA 4OV1A 4I7FB 2PA8D 4B3RF 3MMCB 3MEDA 3CCVS 1N32F 2EG2A 5KAKA 2KO1A 2EFGA 3I5BA 4IFYA 4DV1F 2IAJA 1NK4A 1U1RA 1UVMA 1VK3A 2DT9A 1HI8A 2OTLS 3KLHB 4OHXA 2ILYA 4NA2A 4F8RA 2AJQA 1XBWA 3LO3A 4PUOA 2DH9A 5HL7Q 1S0MA 1QAJA 2KZZA 4FBUA 4B9SA 1RT6B 2IC3A 1HWUA 3BSCA 3E3XA 2WHOA 4DL3A 4B3SF 1FERA 2VFVA 2ZDOA 2XMTA 3M6XA 1S72S 4O0IA 3TARA 5LSRA 1VFJA 3M2VB 5EWEA 1FRKA 1VMBA 2WW8A 3AQOA 4UQTA 5J1PA 4F25A 1AFJA 4CO2A 2KZMA 5IXUA 1TV6A 2J7KA 3N6LA 1X7VA 2MKJA 2BQRA 4Y2MA 4X84A 1K1QA 5I42A 3SSRA 2VG7A 1NRKA 4IG0A 3HLUA 2V4QA 3U7JA 4N47A 3MURP 3BN4A 2OLWA 4H4KC 2HFOA 1REVB 1F9FA 1RT2B 2OH2A 1QE1B 1KLMA 4CIOA 3BO3A 3DRSB 2KT3A 4C3MA 4LF5F 2KFNA 4PPDA 1VBYA 2YNIB 2JLFA 2HNYA 4G1PA 2LDIA 4DBQA 4WFNQ 2R7UA 3KNGA 3ZFVA 3PKYA 3IA0A 5DM6Q 1C2PA 1FXDA 4QR1A 3GILA 2CFXA 4ZPVR 3I56S 5I3UA 3G96A 2RS8A 4N8NA 4TLQA 4RKUC 2WONA 4BBYA 2BQ3A 2D74B 3R5AA 3CT9A 5KT5A 2BRLA 2I38A 4DSIA 4IOCQ 2MSSA 3O6QA 5B0AA 3VAJA 5D4OA 4WE1B 2IM1A 2GJ2A 3AHPA 2KHDA 4CQ1A 2B0GA 5GAEI 1VHFA 5BJRA 2XHWA 4RNNA 3DOKA 4BDPA 4IO1A 1HW8A 3KTQA 2GMHA 2LEAA 1QUPA 2RF2A 3FEYB 4J9QA 2BJEA 2UP1A 3R5DA 1A7GE 2MKKA 3M4XA 5B0GA 3GZ7A 4KTQA 2VODA 2HHVA 2BM1A 1DFDA 3ITHB 3F73A 1Q78A 1M5VC 4DR4F 2FD2A 2EVZA 3PACA 1RT1B 1YTYA 2R8JA 1DURA 2YX4A 3TQ1A 4CT9A 4Q45A 5G0RB 4CNZA 2OSQA 4K2XA 4GC7A 2PI4A 3M32A 4FNHA 3UW1A 5E3PA 5C25A 2QO3A 3PW2A 2HLTA 2N7YA 2LQJA 3N01A 3DI6B 4PXEA 4TYBA 4K4TA 2AU0A 1IUJA 3KK1B 3RBDA 2N7CA 4HKQA 4IH7A 5L1IA 5CYMA 2LXUA 3MPYA 1IJEB 2Q79A 2RU3A 4MKAA 3VR1A 5BR8F 2Q6BA 3KLFA 2EFPA 1HBMB 1RT3A 4HTJA 4I6AA 2HHTA 4X4VA 1UFWA 2RJZA 3KJVB 5DGAA 2WSEC 5T7LA 4NPOA 1KVIA 4L6V3 4ILMA 2K1RB 1AW0A 4J9PA 2DGUA 4ELVA 3CEDA