4CQ1A

Crystal structure of the neuronal isoform of ptb
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
191
Chain Sequence
NTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPRDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution and Crystal Structures of a C Terminal Fragment of the Neuronal Isoform of the Polypyrimidine Tract Binding Protein (Nptb)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords POLYPYRIMIDINE TRACT-BINDING PROTEIN 2
total genus 48
structure length 191
sequence length 195
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4cq1A02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4cq1A01
2F3JA 4PRFA 2U2FA 2DO4A 2DIVA 1K8AT 2DHSA 1B7FA 2KH9A 4IO9Q 1U1RA 2RU3A 1VQ8S 3RW6A 2MY8A 3CCRS 1URNA 2MKSA 5DDPC 2LXUA 4C7QA 4WFAQ 3VALA 3MDFA 4F02A 2ZJQQ 1D8ZA 2ADBA 1XN9A 2MJUA 2DGOA 3EGNA 3FEXB 2CPEA 4A8XA 5LXYA 2HGLA 2MZTA 4Y0FA 1YITS 3MD1A 2ZJPQ 2LXIA 3P3DA 1H6KX 1HL6A 1ZH5A 2CPFA 2E44A 5D77A 3CPWR 4BS2A 4WKRA 1WHXA 1FXLA 4CQ1A 3D2WA 2MKKA 3US5A 2CQHA 3K0JA 1S72S 3UD3P 2XS5A 2CQ1A 3CC4S 4YOEA 1YIJS 1AUDA 4IOAQ 3DXBA 2KFYA 1X5PA 3H2UB 1WWHA 1VQ5S 4TU8A 5GAGU 1YHQS 1VQ4S 3FEYB 5DM6Q 2CJKA 1SJFA 3VAJA 2AYEA 3VAHA 2KM8B 1WG1A 2B0GA 2AYBA 2HVZA 2O3DA 1PO6A 1FJCA 3VF0B 1NU4A 2DIUA 1U1LA 2XSFA 2DGVA 2K3KA 4QPTA 2MKIA 2DNGA 5GMKa 3MUMP 1SJ4P 1DHMA 5FJ4A 2OTJS 1Q82T 5DETA 1VBYA 1JJ4A 3U1MA 3UE2A 1VQLS 2DHXA 2CPXA 3VAMA 5LJ5Y 1DRZA 4TU7A 2HYIB 4UQTA 2ERRA 4W92B 3CD6S 2JVRA 3SXLA 3BEGB 2YKAA 3CUNA 5EN1A 4PKDB 4FXVA 2DNRA 3VAIA 2DGQA 2M88A 3IWNC 1M90T 4IUFA 4CIOA 3CCMS 4F25A 2KG0A 2FC9A 2XS2A 4ED5A 2M8DB 2CQDA 5LSOA 2M52A 3HI9A 3VAKA 1JMTA 2KXFA 2JWNA 1VQ6S 2CQ2A 2D9OA 3NNAA 1WEXA 1QM9A 1OPIA 3RW7A 2M4MA 2L41A 3UCZP 1WELA 2FHOB 3MOJB 2MSSA 2I2YA 2OSQA 2J0SD 2RS8A 3I56S 3TYTA 1W2BR 5CYJA 2DNNA 2MQPA 4WFNQ 5DDQC 2MGZB 2X1AA 3NNHA 2EK1A 1YJNS 1HA1A 1H2VZ 2YH1A 2BZ2A 2DH8A 3S01A 5LXRA 1X0FA 1U1KA 1VQNS 2BOPA 5ITHA 2A3JA 5GVQA 5HL7Q 2AD9A 2DISA 2CPZA 2J76E 2RUGA 1M1KT 1X5TA 3CCLS 1X4CA 2X1FA 3EX7B 1FT8A 2OSRA 5IQQA 1F9FA 2CQIA 1VQOS 2HGMA 1SJQA 1WF2A 1UAWA 2KXHA 1U1QA 5DM7Q 1D9AA 2PEHA 2M9KA 1X5SA 3V4MA 1WHVA 3UCGA 1X4FA 2DNHA 1M5VC 2VOPA 1VC5A 2CPDA 5GAEU 3BS9A 2RS2A 3MD3A 5LJ3Y 2QA4S 2D9PA 2K8GA 2XNRA 2N82B 1N88A 3S8SA 5DDOC 2D3OR 2MKCA 3CULA 2MQNA 3CCSS 1U1NA 3R1HA 4RU2A 2MKHA 1K9MT 2NLWA 1P27B 2M8HA 2KG1A 2XB2D 4Z2XA 1IQTA 3G4SS 5IFMA 2KHCA 1WHWA 5GADU 2HGNA 3G8SA 1JJ2R 1N54B 4F26A 2CQ3A 2LEBA 1VQMS 2M7SA 1N8RT 4YUDA 2GHPA 2LCWA 2DNPA 2F9DA 1U1OA 1WG5A 1KQSR 2MGZA 2M2BA 1ZZFA 3P5TL 1YJWS 2DB1A 3P6YC 1UFWA 1X4BA 1QVGR 1FJ7A 1WI8A 2KXNB 2FPHX 1M5OC 4V19X 2QFJA 1OWXA 2F9JA 3Q2TC 5JVGQ 2LA4A 1DBDA 1R8HA 5GAHU 2DK2A 2RQCA 2XS7A 2KYXA 2L08A 5BJRA 1U6BA 3G9CA 2CPHA 1FHTA 1O0PA 2X1GA 5MLCV 3G8TA 2DO0A 2EK6A 3THPA 1WG4A 2KVIA 2CPIA 1RKJA 1VBZA 1KOOA 1OIAA 1WF1A 1U1MA 2RQ4A 3G96A 4ZKAA 1M5PC 1WHYA 1KD1T 2GO9A 2MB0B 1G2EA 4LIRA 2CQPA 4OZ0A 2U1AA 3J7ZT 1X5OA 5H1SV 5CXTA 2DGSA 4Y00A 2DNKA 1VC6A 2CPYA 2DGTA 3THTA 2CPJA 1VQ7S 1UW4A 1U2FA 2DNZA 3R27A 1R8PA 1FNXH 1Q7YT 2MQMA 2DHAA 2KN4A 1U6FA 1X4GA 2E5GA 1X4DA 2LYVA 3LQVA 3B4DA 3PIOQ 1FJEB 2RRBA 2OJ3A 1P1TA 3S7RA 3HHNB 3CC7S 2DGXA 3CMAS 1QVFR 1SXLA 2I38A 2RRAA 1UP1A 4UY8T 1X4HA 2YWKA 2DH9A 3MUVP 1WF0A 1VQPS 2MQOA 4WIIA 2MHNA 2N3LA 1H2TZ 3UWTA 4WCEQ 4CH1A 3UCUP 2DHGA 2MY7A 2J0QD 2OTLS 2E5IA 2E5JA 2PE8A 3MI7X 2G4BA 3JB9k 1L3KA 2CQCA 3DLLQ 5IM0B 1HD0A 2JVOA 1WI6A 3R1LA 4LMZA 3VAFA 1YJ9S 1FO1A 5LSLA 3CCJS 5D78A 1OO0B 3LPYA 2LA6A 2SXLA 2N3OA 2MQLA 4U67Q 1SJRA 1DZ5A 1K73T 4TU9A 5DDRC 1HD1A 1WTBA 2QEXS 4P6QA 3SDEB 1YI2S 1SJ3P 1A9NB 2LEAA 3SDEA 3BO2A 2CQ4A 2LKZA 3TO8A 3H2VE 2M70A 3N9UC 2DH7A 2L9WA 2YH0A 1U1PA 3CTRA 3G6ES 3CXCR 5JVHQ 2EVZA 4J5OA 2MZJA 3VAGA 1KOHA 2MMYA 2MQQA 3SMZA 1KC8T 2DNLA 3EGZA 2FC8A 2DNOA 1YTYA 2RNEA 2VONA 2MYFA 3ZZZA 2FY1A 2DGUA 3B4MA 1H2UX 2VODA 1X4EA 3NS5A 2DGWA 1VC0A 2RVJA 5HO4A 2WBRA 4YB1P 3NS6A 3PIPQ 2G0CA 2NZ4A 2JX2A 1BY9A 4WF9Q 2MJNA 3CC2S 2XNQA 3L3CA 3TP2A 1JJHA 2N7CA 3P49B 1VQKS 1NJIT 2M0GB 2KM8C 3BO4A 2YTCA 2VOOA 3OW2R 2DNYA 2LMIA 2DNMA 2CQGA 2J8AA 2KRRA 4CH0S 3MUTP 3NNCA 4W90B 3J7YU 1NO8A 3S6EA 1Q81T 2KI2A 4C4WA 1ZZNA 2RT3A 2MPUA 4WFBQ 2MZQA 2HZCA 4LJMA 3G71S 1RK8A 2MSTA 4PR6A 1N52B 1X4AA 2DNQA 3CCVS 1S79A 2LECA 3UD4P 3CMES 2UP1A 2KT5A 3U1LA 2MKJA 1CVJA 2CQBA 2MZSA 2JRSA 1VQ9S 2MZ1A 3ZZYA 4IOCQ 4TLQA 3CCES 1WEYA 1YWXA 2KRBA 3CF5Q 4C0OC 2DITA 2LQ5A 4OZ1A 1M5KC 1VBXA 5CA5A 1PGZA 3MURP 3I55S 3NMRA 1Q86T 4ERDA 3BO3A 3MXHP 4QU7A 3CCQS 2CQ0A 4FXWA 1A7GE 2OIHA 2ZJRQ 4EGLA 2AYGA 2G1DA 2MXYA 3Q2SC 4QQBA 4M5DB 4QU6A 2V94A 3ULHA 2E5HA 1WEZA 2X1BA 3IRWP 2AYMA 2KU7A 2Q79A 3CCUS 2ADCA 2MZRA 5IM0A
chains in the Genus database with same CATH superfamily
4X4TA 2DEJA 1R27B 2KJVA 2QMXA 4IFVB 4B3MF 4JV1A 2IM3A 2EFPA 4WE1A 1K8AT 5KFWA 5KFJA 3CWJA 1NB7A 3D6FB 3AOAA 3GFXA 1S59A 2RU3A 3RW6A 4BC9A 3U02A 2MY8A 2C2KB 5H9FJ 1CS4A 1Q53A 3HVWA 4ECUA 3VALA 3V4IA 2IBKA 3L09A 4F02A 2B4VA 1U2CA 1F6TA 1D8ZA 2IVFB 2ADBA 3D3CJ 5F0UA 1N36F 2HQGA 5LOQA 3A4TA 1RTHB 2DGOA 2GMHA 2LQBA 3QO9B 3QO9A 1LV5A 2NUHA 3BN7A 4R0EA 3V81B 2FJXA 2CPEA 3HD1A 4K8RA 3UVJA 2V68A 4DV3F 4EK2A 4XO0A 4IR1A 4HL9A 3QRQA 1W25A 1Q8KA 4CLZA 1QE1A 2WB4A 3MD1A 4NPOA 4PQAA 3WZ0A 2JL9A 1GMWD 2A2CA 4ECZA 2NSBA 2IAJA 3NAIA 1ZH5A 4USWA 1Y5IB 2J8SA 4WKRA 5D77A 3PX4A 4M8LA 5J1EA 4GRSA 2LVWA 4H4OB 4CQ1A 3D2WA 1V5IB 5JVHQ 1C0TA 3DMJB 2OPQB 1I51B 1M0SA 3KJQB 5J2NB 1U47A 4YB6A 2ILZA 2ZH6A 1S76D 2XS5A 2Z30B 1MW7A 2BOAA 1HKAA 3R6LB 1E6YB 4P71A 1UFKA 3H2LA 3PM9A 4YOEA 3MPUB 4MIWA 5KFGA 5L9NA 2XTJP 3DXBA 2Q6BA 2I0XA 3EDRB 1YIJS 3QGHA 2UVVA 4IOAQ 1X31C 1X5PA 1NZ8A 3D1OA 1MN9A 2FZCB 4EZ9A 3ZTOA 2BKNA 2GQQA 1PJ7A 1WKKA 2ZWPA 2XG8A 4DBQA 3FEYB 2CJKA 3SV4A 1WJ9A 3WIUA 4ZPAA 3SSSA 3SZ2A 4ECSA 2FJWA 3VAJA 4IFYA 2GVZB 3OTOJ 1ZTTA 4QYRA 1EQMA 3J80Y 4FF1A 1XMQF 2Z58B 3AXMA 5F9NA 1ZOTA 3KLEA 3ILOA 2O3DA 5JUMA 3KLEB 1JLFA 4EWTA 1SBRA 4F36A 3VF0B 4X64F 1N5QA 4M1KA 1LWCB 1W7WA 3M8WA 2KT2A 4PYDA 4ECXA 2PI4A 2GO8A 2AJ4A 2CNLB 4QPTA 1RBLA 2DNGA 3MAHA 4ZIVA 3K59A 4PUOA 5KG6A 5L1LA 3MF5A 2YNHB 1NB2A 3MUMP 3PW7A 1RTDB 1DHMA 2LFVA 2UVRA 3O8WA 1U49A 4DUTA 2EEYA 1Q82T 1X8DA 3ENWA 3N5FA 4LVOP 3IS9A 3BYRA 2XCAA 1VQLS 4J9QA 1PBAA 5IWAJ 3H25A 1XMOF 2ACMA 2IFXA 2GAGC 3JSRA 4OZ3A 3IFEA 4OJ3A 4DI6A 3SV3A 1HI8A 3ETOA 4OHWA 1KFDA 2JVRA 5F41A 5C42A 3SEOA 1L3UA 3LP0A 3SXLA 2HMIA 2YKAA 4HVZA 4DU7A 4ICLB 4FXVA 4KJIA 1N5YB 2KDOA 2YNIB 3IWNC 3KUHA 4U7UK 2IHR1 1PG5B 4L73A 1N36J 3CCMS 1NHKL 4N76A 3BZQA 2ZBQA 3WHIA 3AB2B 3WX4A 3VAKA 4XPCA 3UR0A 3NLCA 3BDPA 1RT5A 2QL7B 2C3PA 4KE5A 2L3MA 4OZ2A 5A76A 2D9OA 4AQYF 3UDEA 4F0KA 2BE9B 5KFAA 3ICLA 1TK0A 2V8GA 2Z57B 5F8LA 3GQCA 2M4MA 1FJGJ 1HBMA 3QGIA 4ZVEA 4X4SA 2XLIA 2P9GA 4OIXA 2I2YA 3AXKA 3K5LA 3MEEB 3BH7B 1KWMA 4U96A 2Z8QA 4F0HA 3LH2S 3NWGA 2MQPA 1JLGB 4F2SA 3IXQA 2ZBPA 3W5XA 3TAQA 4I67A 2D69A 4NYOA 2EK1A 2BYCA 2XMVA 1MMLA 4ZK7M 2BZ2A 1U1KA 5LXRA 3IRXB 2VG6A 1VQNS 1FWPA 2Z2YB 1QTNB 1RT4B 2ZOGA 2ZKUA 2AKWB 1RT1A 2A3JA 2KYZA 2BOPA 2V6AA 1RP5A 4AUKA 4CO4A 2AD9A 1Y7PA 1PYTA 5CYMA 2BUNA 2CPZA 2RUGA 1AB8A 1U02A 3HZGA 3W7BA 1M1KT 1TUWA 2XI2A 2HVDA 2CG8A 1X9WA 2RD5C 3C46A 3EX7B 2JLGA 2KVQE 3K5MA 3JAMU 3UFCX 3C6TB 1E6VA 3L95X 5CZVA 4G6VB 1YBUA 1T3OA 2DJWA 2WVEA 1N0UA 3MM6A 1VQOS 1ZTWA 4DUYF 2HGMA 1SH0A 2J5AA 3LWMA 4DV0J 5F8HA 1VRTB 4RKUC 3E2EA 5HSPA 2W9CB 3OFEA 3DNCA 1GTHA 5DM7Q 1XR5A 1EKRA 1D9AA 3MCSA 3OFFA 5AXKA 1HWIA 3MM9B 3I4HX 2IJNA 3OBIA 2UV8A 1EETB 2JOQA 2PEHA 3BF4A 4DPTA 4DOZA 4ETZA 2L41A 1KBRA 2M9KA 5KFBA 1SL1A 2KZMA 4ZP9A 4P2SA 1IJFB 5HQLA 4ZPCA 1X4FA 3TEGA 2DNHA 2ZWOA 3M30A 8AT1B 4TQSA 4ED7A 2CDRB 3DYAB 4RNNA 2L9NA 1IKYB 3BS9A 3EICA 3IR6B 3MD3A 2EW9A 5A8RB 2NCKL 1JLCA 2I5JB 2MLXA 5A8KA 4OX9J 2H54B 1A0OB 3PEJA 4K2XA 4KHPJ 3NKYA 4YHHJ 5B0DA 2XNRA 1N88A 4PPDA 3H5YA 4Q2LA 1S4EA 1AT1B 2HW3A 1TVRA 3V6KA 2MQNA 1QLNA 1MROA 4RW6B 4C3KA 2O5DA 2V2VA 4N8NA 1VBYA 3PZPA 2DR8A 2J9CA 3OXGA 4DZ6A 3DGVA 2RH3A 3DLGA 3SYZA 2QYGA 2KG1A 3F56A 1RAAB 2PIIA 3C15A 3HHDA 5I3PA 4Z2XA 3PW5A 1IQTA 2HEKA 4QYZK 2W2MP 2C42A 4U6PA 4HTJA 4O23A 2JC0A 3LP1A 3JSMA 4IRCA 1WHWA 5GADU 4C48A 4ZCIA 1HBNB 3I5CA 5IT4A 4M5KA 4G3IA 4NCGA 1R3NA 1N32F 5D6GA 4B3TF 4FBTA 3W62A 1VQMS 2M7SA 4R5PB 2GHPA 5D0HA 4ZJOA 1XNRJ 5B0FA 4ES3A 5EWEA 1SCJB 4PCQA 2CNOB 2OMOA 4J7CA 1NK5A 4YB5A 2QL5B 1WG5A 5ETLA 3DRXA 1RT3A 1ZZFA 2EFQA 3LF0A 2CNKB 3AB4B 3CCWA 2R8KA 3D6MB 2MTLA 2HNDB 1REGX 1EX8A 1S6PA 2GIRA 5DGBA 5E7OB 2ABYA 1HQEB 3QAUA 1EP4A 1CJKB 1TKZA 3ISNC 4ZLNA 2N4CA 1TKDA 1VFJA 2XMJA 3BPSP 3NGUA 3TAPA 4IFVA 4KV8A 1OWXA 1S0NA 1Y0HA 3DCAA 1MU2A 1TL3A 5E41A 2DK2A 3OT9A 3DM2B 4RNHA 1Q8BA 4K50A 1RWMB 2IJRA 1PSDA 4USUA 5KG2A 4XPEA 1RTZA 2HWHA 2KYXA 3EWGA 4FYDA 3DLKA 1U6BA 4BLGA 5D4NA 3OTCA 3IO1A 5CCLA 4USTA 1L3VA 2O01C 1Q5YA 3PYDA 1O0PA 2X1GA 2YVSA 2ZKTA 3IAM9 1B3TA 4M5NA 2DY9A 2PA3A 5BYQA 3C16B 1MMNA 4DV2J 1FXDA 5T14A 4Q45A 2EK6A 3THPA 2KVIA 2ZOFA 1JNRB 2F4VF 2VPYB 1TR0A 2RB7A 3E01A 2FUG9 2B9EA 3B6BA 4PG6A 1KOOA 5DS7A 4U95A 4WP8A 4ZS6A 5K20B 1VBZA 4IRKA 1X60A 4MAKA 1VQYA 4G1PA 1T03A 2RHSB 1S48A 5F8MA 2VFTA 4DCPB 1WHYA 3G82B 4FPRA 5C2GA 1KTQA 4PXDA 4C9DA 3GV7B 3KHHA 1GMVA 5CD4A 3N4WA 4NLOA 5D0RA 5KFCA 4DSKA 2FGCA 4QR0A 3KJVB 2RDJA 4LIRA 2A0FB 3O5TB 2CRLA 2J6SA 4NXMJ 4DV3J 2WOMB 4BWJA 4HDHA 4IDKB 1RWPB 5H1SV 2PEBA 4OZNA 3O44A 5CXTA 1RHMB 2HNZB 2IA0A 2QT7A 1RA7A 1SQEA 3R7NB 3THTA 2CPJA 2QZ8A 1S49A 3CJTA 2L9DA 2X51A 3OPKA 5KG0A 4QIGA 2GNKA 1HPZB 4X66F 1IBMJ 4BDPA 3R27A 1TU0B 1TKXB 2N7YA 1GTEA 3I0SB 1Q7YT 4JV5J 1X4GA 4Y2KA 4ILLA 3WX8A 1AROP 3LQVA 5HQMA 4IFYB 5KFOA 1TKTA 3ISND 2RRBA 2OJ3A 1P1TA 3PXGa 1DQ8A 3W8PA 3CC7S 2XY7A 2VHGA 4ZPBA 1GXTA 3CMAS 1SXLA 4RW4B 1NDKA 4Y28C 1RKIA 1X4HA 4B3OA 2YWKA 5JMNA 1LOUA 2DXEA 2OGUA 4ZVOB 4ID8A 2H4WB 4YQWA 3FFIB 4C3LA 3VV2B 3TZYA 1VQPS 1DQAA 1ACMB 3EXCX 4RUHA 3TANA 4C8OA 1IKXB 2N3LA 2IY5B 1H2TZ 1SJ1A 1TAQA 2V4JA 3PO4A 2B4OA 1TV6B 3OR1B 1U09A 1CJVA 2J0QD 3CDEA 2HHSA 1NRKA 3K58A 3GR1A 4URQU 1BMQB 1UFLA 2BA9A 4O3QA 4XDCA 1VR6A 3MI7X 4UOHA 4AL7A 3JB9k 1FCAA 2CA9A 3QT5A 2EKNA 4DN9A 2P6SA 3VZIA 5GAHI 1AYEA 3G6YA 2AGPA 3R97A 1SL0A 1OO0B 2K7JA 3BGFA 1RT2B 4PWDB 2N3OA 1HR0F 2MQLA 1NK8A 1SJRA 8ATCB 1W26A 2BJDA 2R9LA 2P9CA 4TU9A 1IR1A 5DDRC 2YWEA 1RA6A 3AD8C 3FC9A 6AT1B 5HMYA 1WTBA 1UEVA 1SJ3P 2XI3A 1K1QA 4QW9A 3KK1B 3SDEA 2HFVA 2ZHOA 2B9YA 3E3XA 3TO8A 1BD6A 3PR4A 4F67A 2AT1B 2PDAA 3SSRA 4C98A 3B78A 5KFVA 2AJFE 4P72A 5LM7E 4CNYA 4UY85 2FD2A 2E1RA 2HMIB 4CO3A 3IG1A 3BREA 4RLEA 4Y6IA 2V8VA 3VGUA 3W64A 4HYKA 4KPYA 4NL5A 3FRYA 3ENVA 4WK1A 3G6ES 1S0MA 2WONA 1RYSA 1Q16B 3BSOA 3NGTA 3Q8PB 3M6WA 3OD2A 2IAJB 3GE9A 4WYWA 5HROB 1D1UA 5AXLA 2MQQA 2YWGA 3P45B 4DUZF 1UVIA 2GS8A 5KFKA 2XHCA 4J37A 2DR7A 1YTYA 4TVAB 4YY3J 3GIIA 2VONA 2CIMA 2MYFA 3PEHA 4IQMA 2HKEA 1HNXF 3M6XA 4JI5J 5THWA 5HVGA 1UEUA 2D1CA 4C3MA 5BR8F 5B0GA 2DGWA 1RHRB 3DDIA 4L76A 4ZVRB 1SV5A 3SCIE 4DV4J 3NG8A 1KDNA 1Y3KA 2BRKA 2RVJA 3FRZA 1F3VA 2IC3A 2I1RA 2P8IA 2WBRA 3GTYX 1CG2A 3GFZA 3VQSA 2W2PP 3NS6A 2G0CA 5AT1B 3PIPQ 2VD3A 4P2XA 5HATA 1T9WA 2JX2A 4QYZJ 4J9MA 4A8KA 2C22A 1YQHA 1RQ0A 4I6YA 4DPWA 4YR3A 3GILA 2C2RA 1V6HA 2XNQA 4JBCA 1GQEA 2N7CA 4RW9A 3GSIA 1KQGB 1RE1B 4CRJA 4AL6A 2GJIA 5KFLA 4RBTA 3UN5A 4RU9A 4B9SA 2HVHA 3ELHA 4LR8A 3K5PA 3LTOA 1RAEB 5KFUA 2C2DA 2G13A 3CMQA 3M9NB 4ED6A 1FNOA 2OO4A 2VQFF 1LW2B 3FFIA 3O1LA 3GJSB 1K1SA 3NP5A 3IRWP 3GV5B 2ZH9A 2LMIA 1NHUA 2NXCA 4DV1J 5IV3A 2XULA 1NO8A 4RNFA 4CTAB 1S1VA 2FVSA 4F4YA 2LP4A 2YPZA 1U8SA 5A0YA 2UUBJ 1RBOB 5ETVA 3EVOA 2RT3A 3L7OA 2IYIA 1KNZA 3OUYA 4ECVA 4F0MA 2MZQA 1S9EA 4GVLA 1LFWA 3M30B 1NJXA 4NRUA 1LWXA 1PC5A 3G82A 4ID5A 4LJMA 2EG1A 4ID5B 4PXCA 2AX1A 3VTIA 3FK4A 2HHVA 1OSDA 4KIAA 3UPFA 5LMUF 2DNQA 3CO0P 1S79A 4KGXB 4ECYA 5D15A 2HK2A 4FVMA 4J90A 1Q7LB 2FJBB 2MKJA 3Q83A 5KFSA 5J2NA 4FBUA 4C8KA 2ZHAA 1TL4A 3RB0A 2JDJA 4QIFA 5DQIA 1TUGB 4M5LA 3JSYA 4OYAA 3MPVA 4TLQA 1YWXA 3CIMA 3DHXA 4ED0A 4X84A 2RJZA 3GJQB 4ZVTB 3ZTRA 1VBKA 2B5JA 2XMAA 3VWSA 2BJ7A 4DL7A 2K06A 3LWLA 2UUAF 4OI4A 4GKJJ 5CABA 3C15B 3W3SA 4KO0B 1FI4A 2HRTA 2OEJA 2R3VA 1SIWB 2Y1LB 4LBHA 3SFGA 4DMZA 4FYVB 9ATCB 1ZM9A 4K4WA 1Q86T 2MKYA 5KG1A 4H54A 1H3DA 4QU7A 2Q3PA 3E8OA 2XMUA 2CQ0A 4OFZA 4NI2A 5DO2A 4CO0A 2D3O1 2G9OA 1A7GE 1RZMA 2E29A 4NXMF 4MKBA 3QYYA 4NLSA 1RWOB 3K8VA 3PRBA 2G1DA 4PG7A 2AJ0A 3D1QA 4ZP6A 1KVIA 1F5CA 2AMCB 1FRHA 4OYOA 4M5DB 1CBKA 3NEKA 2Q6CA 3EMTA 2RKIA 4P7VA 4ZPVR 3UDVA 2MEWA 3AODA 3QIPB 3D4JA 2E5HA 1WC1A 1URRA 4OYIA 3ULHA 4ANEA 2EXUA 4Q43A 4DSJA 3I32A 4HDGA 3ZZPA 5KOWA 1RT1B 4MKYA 1RTJA 2V5HG 2V8DA 4X4PA 2VV5A 4UZCA 1RTJB 2KU7A 1BQNB 2Q79A 2AWZA 4A8SA 3UCZP 3HHLB 1F9HA 4ZVGA 3R7SB 4CLYA 1Y11A 2F3JA 2AW0A 2B6AA 4HHJA 4NLRA 5JJBA 3D66A 3DOMB 3BSCA 2HHXA 1WC6A 2M3DA 4Q8FA 3KG4A 3CCRS 2FLNA 1RAJA 2MKSA 4JI1F 3DGPB 2G1HA 2W9AA 3V2UC 7FD1A 2DD8S 3I6PA 3EGWB 3MDFA 3QNWB 4XDDA 4W4MA 3TA1A 2CUYA 5CYQA 2XGPA 3KLHB 2ZJQQ 3V4IB 2UXDJ 1Z1ZA 3GSDA 2W8LA 2MJUA 1FDNA 3JS9A 2FQQB 4WBFA 4C8NA 2RMLA 5KFRA 3TNVA 1KTVA 3RRGA 2ZC3A 1I94J 4MFBA 2AJQA 2GHVC 4IG3B 3I4PA 2A6MA 4A8OA 4Y0FA 1YITS 1DAXA 1R6VA 4OI2A 1S7HA 2NYIA 1FE0A 3P3DA 1Q5VA 3JAMY 3JTNA 3UDCA 2GAHC 3UN2A 1HL6A 3HKWA 2HIYA 5HMXA 5D3GB 1XC9A 4KFBA 4WZQA 2RDDA 2E44A 3A13A 2HRUA 3P96A 1LXJA 4N5SA 3CPWR 1TMMA 1VMBA 5HANA 2AJ1A 1C2PA 4WWSA 5B0BA 2F1FA 3HP6A 3TZXA 3J81U 1XNRF 2W01A 2K2PA 2WOMA 2HS0A 3ZNJ1 5CQGA 1WNEA 2P9EA 4FPIA 1VJQA 1E6YA 2A1BA 2ROEA 4A8QA 5EX3A 3QJPA 4ECQA 1HNZF 2DHHA 3HT3A 3M2VB 1VQ5S 3QT8A 2I9SA 5GAGU 1P1LA 5A6WA 3QZ8A 2JFDA 5EWGA 4USMA 1SJFA 3M2UA 4LRDA 4WXOA 4IRDA 1UKUA 3PW0A 3BKTA 4PZVA 4ZVUB 4EUVA 3LP1B 4M95A 3T1HF 2B0GA 3FMWA 4GO7X 2HVZA 1NDLA 3DU6A 3PFOA 4P74A 5LMNF 4DR3F 2W7AA 1APSA 1T9TA 2CJAA 1FJCA 1F0XA 4DV7F 5HVFA 4J9NA 2DIUA 1J5EF 1PILA 2DGVA 5LL6d 1RTIA 4DLGA 3IR7B 3QZ7A 4XK8C 1PIEA 4CWBA 1RCOB 2ZH8A 5GMKa 3HHEA 3EZUA 3GB0A 1BQMA 2DR6A 2I8EA 5FJ4A 4CLTA 1WC3A 5BYSA 4NLQA 2YKMB 3W9HA 5KFFA 3RB4A 3AH6A 3CJSA 2W1BA 3U1MA 2FZKB 2ZDOA 2QYCA 5I42B 2ZEJA 3BQ2A 2YKOA 3OFGA 5LJ5Y 1G4CA 4HACB 2IA6A 4RJVA 4TN2A 4QWCA 3DYAA 3AD7C 3CGIA 1NPPA 2R8IA 4J9PA 4W92B 5C24A 1DLOB 4DR6J 1KP6A 1WC4A 2PSZA 3BEGB 4A47A 1IKVA 5EN1A 3W5YA 4PKDB 5A8KB 4FF3A 4U8VA 3AQPA 3FBCA 3NY0A 2BVZA 2DNRA 4G65A 3VAIA 4DV6J 3FZBA 2ASDA 2XCPA 1N34F 1KSPA 4IUFA 4B3RF 1JXEA 3HFKA 2VL1A 3J7Z5 4CIOA 2DR9A 4IG0B 4KHMA 2OLWA 4ED5A 4N41A 3HULA 3BM7A 1LFPA 1JLQB 2CQDA 4HLBA 2RAQA 1DURA 2MLZA 2M52A 3V81A 3EJMA 1QSLA 2KXFA 4MYTA 4TYBA 3PKYA 3A8IA 4C2MA 2CQ2A 3HCXA 2VDHA 1VCTA 2WONB 4DFPA 2BQRA 1WEXA 2XY6A 1N48A 2J7UA 4Y2CA 1OPIA 1Y4ZB 3RW7A 1TL1B 1HNWF 4EI2A 2HQ3A 2J0SD 2Y9HA 2RS8A 3TRGA 4NOHA 2AZ3A 2DNNA 2H9ZA 5KTQA 2KFNA 4N7TA 3O2IA 1ZAWA 1RADB 3LW5C 1S77D 2V9KA 2ZVSA 5KFDA 2R7TA 1XEZA 1J2VA 4NYZA 1YJNS 1HNZJ 2IDEA 1VIXA 1GXLA 3DN9A 3KUGA 3VGVA 3S01A 2WBMA 4DPUA 3OXLA 1VLYA 3Q86A 1RAOA 3TW0A 2BJ9A 5ITHA 5KFPA 5CYMB 2K7KA 4ZP8A 1EP4B 3SSQA 2BXJA 5IQ6A 1M5HA 1RHQB 3RJMB 2HRYA 5L9XA 3TUIC 4FP9A 2J76E 5AE2A 5C25A 1YGYA 3BGOP 5IWAF 4PEOA 4I4BA 1OJ4A 4ZVFA 3CCLS 2X1FA 3KMQA 2GVZA 1FA0A 2ZH3A 3ETMA 3KDOA 1OQ6A 4NEYA 3Q24A 1F9FA 4HEA9 2ROGA 2BE2B 3D0GE 3EZOA 2MQ8A 1S5ZA 4JI4F 5IC4B 3JTOA 1IM6A 3KG1A 5MAOA 2OP5A 2W9CA 4RW8B 3HJFA 2IYGA 1IBCB 1LW2A 1WF2A 3CDUA 3D3BJ 3PNIA 3BPDA 3THVA 2QMWA 1U1QA 3HFVA 2AU0A 4GKKJ 2R7UA 3T6BA 5LT5A 1SUQA 2RF2A 1NJZA 3WC2A 2HFUA 2Y1JA 4CTAA 1DQ9A 3D0HE 4QPXA 3OR1A 2VH7A 4IOBA 1LNQA 1UL3A 5KAKA 2OELA 3V4MA 3ET6A 1H38A 3QJLA 1TZ0A 3UCGA 4DR6F 1OS5A 1Q78A 1TMJA 1FTRA 5DJBA 1ELOA 1CPZA 4WK3A 2X3DA 2VOPA 2B8PA 1VC5A 2CPDA 4EFAC 5GAEU 1T9UA 4ZLJA 1WDTA 3MMAA 3QLHB 2ATLA 2DR5A 3ILJA 4CLFA 3FCVA 2W9BB 4IH6A 3QRRA 2HHHJ 3QWUA 1AFJA 2AGQA 4LF4J 4B08A 4B9NA 1UVJA 4DWIA 1Q79A 5IV4A 3G6VA 3S8SA 1S6QB 5DDOC 1XMQJ 4JV0A 1VYAA 1KRPA 2WVBA 4QWDA 2F8MA 2MKCA 4FKXA 1EHWA 1U1NA 1N32J 3R1HA 1RBAA 4KHRA 1ZETA 4ZMMA 1S12A 3QFHA 3T3FA 3POTA 3W61A 4LREA 2HHPA 3MR3A 3G2XA 3DRSA 1B0TA 5I4MA 2B56A 1TKTB 3G4SS 5IFMA 3DLEB 1CSJA 4K59A 5KFIA 2YPYA 4BWMA 1KLNA 1AZSA 2HGNA 4DL4A 2HSEB 2D7SA 1HBNA 3HLUA 4ZHRA 4OYMA 4ZOSA 4ZHRB 2CQ3A 2LEBA 5KT2A 3MR7A 4YUDA 1FFWB 4LF6F 4URSA 2F9DA 1SVDA 4RBUA 3A8JA 3I9V9 4MIAA 3PKMA 4MIBA 2MGZA 4Q0BA 1NKEA 2FHJD 3KOAA 5I3UB 2OPPA 4KT0C 3KJNB 1YJWS 2A2DA 3L4BC 3R6GB 1HI0P 4H4MB 4DQRA 2WB1D 3IS9B 3BH6B 2HIQA 3FBEA 4M5MA 1CC8A 3M8SA 1N6QB 1X4BA 2YQ3A 3HVAA 5E33A 1HHSA 3AY0A 2UUWA 2HFNA 1T9YA 4NZ0A 1M5OC 1TL5A 1H7WA 1WOPA 4LSZB 2F9JA 3NWRA 3Q2TC 1YRTA 2WSCC 5H9EK 5JVGQ 2GIFA 1R8HA 2EC2A 1HFEL 1IKWB 1WSVA 2E5LJ 4AL5A 2B9XA 3DRPA 3LA0A 4L75A 2Y8YA 1S99A 2YNFA 3J7A1 4ENOA 1D9DA 4KPCA 2C3UA 2MDAA 2WW8A 4O44B 2ZD1A 2POKA 1FTCA 3X1LB 3KLGA 5DRKA 2CJBA 4K5RA 3B54A 3G8TA 2ZHBA 5FDLB 4JI7F 4F3OA 1VOMA 4LQ3A 1QUVA 3PJ9A 2GX8A 2DO0A 3BBFA 1LXNA 5KT6A 4OYBA 1NSAA 2F5GA 1WG4A 4KC5A 5L1IA 4LQ9A 1FRMA 4V19J 2CPIA 1FERA 3ILLA 5HLFB 1OIAA 4FVCA 4KKOA 1MN7A 1Z2ZA 3M2RA 2YQ1A 4ZKAA 4RZRA 4ZA1A 3J7YI 1S1TA 4YEAA 3F73A 4I6AA 3A12A 1KD1T 5B0EA 3D7SB 1QY7A 3BGLA 5F8GA 4C97A 4LR7A 5J1EB 2LDIA 2OD6A 1U8WA 5D4PA 2CQPA 5HBMB 2O66A 4LF7J 2R4FA 5AJ3J 2OPQA 4KGVB 5HI7A 3GYGA 4X62J 1JKHA 3P4UB 1FX2A 3OTEA 5B08A 2IRUA 3HMJG 3RRHA 1RWKB 2DNZA 4PG4A 4XIUA 2Y8WA 3N6NA 1V5VA 3NRBA 4DQSA 1HNXJ 4JI4J 2IRYA 2XO7A 1U6FA 2E5GA 3R5CA 1DFDA 2ALZA 2ZBIA 4NCBA 3TZWA 3NAHA 2R7WA 4KY3A 3NOGA 3FCWA 2ZUGA 3N5BA 4QJVA 3QT7A 1N33J 3M8ZA 2JEFA 4WTOB 1NM2A 1REVB 5IOLA 2LU1A 1QVFR 2UXBJ 2BJ1A 2I38A 2UXCJ 2FVQA 1FRLA 3CJQA 1VRTA 4TY9A 1XIQA 2R7XA 4GO5X 1RTIB 3JQKA 3KUEA 4OYXA 1IVZA 4I56A 1FK9B 1HNVA 4JI0F 3UNYA 2KHDA 2GV1A 3H40A 4LF5J 3K5OA 4FYWB 1FRXA 1RT3B 2WVDA 3SCKE 4C11B 4ETXA 4NEZA 1AW0A 4WCEQ 3C2PA 3Q8RB 4C8ZA 2MY7A 4DR1F 4DX8H 2VG7A 5KFZA 2EWHA 3I9ZA 1S4FA 4KH0B 2W25A 4E2FB 4O0NA 2OTLS 4PXBA 4J9KA 2E5IA 2RRNA 4FZVA 1BQNA 2B7CB 4UOCA 4OI1A 2G0JA 3ZTQA 1T11A 4AE5A 2GGPB 1L3KA 2CQCA 3M8PA 1YZ7A 4Z37A 1HD0A 1LEOA 1WI6A 4LMZA 4RR5A 4ZIWA 1I5OB 3LPYA 4ZVSB 1HBUA 2NXJA 3IC1A 1HYSB 5K14B 4U67Q 1TL3B 4CNZA 3DRPB 3GWCA 4L3NA 2WHOA 3C14B 3FDSA 1S9FA 1HD1A 4LFCJ 1CS4B 4NRTA 3SDEB 5DLGA 1YI2S 3CDWA 4CYUA 2LEAA 3DXSX 4R0JA 5HJXA 5KT5A 4ECTA 2LKZA 3BDEA 1VC6A 4OX7A 1SL2A 1ULRA 4EBCA 1I94F 2XSJA 1RABB 4AXIA 2VBZA 3H4DA 3T5HA 2QLXA 2M70A 3EPGA 1R0BG 1MWQA 2ASLA 1PBUA 1FNMA 2DPJA 1K47A 1U1PA 1S7IA 2BJ8A 1ZBTA 5HAOA 2WZ1A 4KKOB 2ZDPA 1MWYA 4ED1A 7FDRA 4HKQA 1U7LA 1R89A 3VAGA 1RT6A 3DLJA 1NMEB 1KOHA 3PYGA 1K0TA 3ZZ0A 3R5DA 4PQUA 2MMYA 1UA1A 2FIUA 4MH8A 4K4XA 3SMZA 5EGYA 2FZGB 4FYYB 4PPZA 4Y2IA 5DZ6A 3K57A 1KC8T 4FS1A 4CLPA 3EGZA 4O4RA 4ILMA 3D28A 2FC8A 1JLGA 4DPOA 5HBMA 1KFSA 2DNOA 4O3SA 5IT9Y 4F4XA 4M5IA 2RNEA 3MTJA 3GFHA 3PX6A 3ISZA 4NZ6A 3ZZZA 2FY1A 5FLXU 1NBEB 3F41A 2BACA 2H1YA 3C6UB 3W2WB 1QUPA 3D9BA 2VODA 3C6UA 3NS5A 1UVMA 3W5ZA 4IH5A 1PC4A 1SC1B 4ZPDA 2DRAA 1MG7A 2AIRB 2WAQD 4DS4A 1N6QA 2HBRB 2ZH2A 3KLVA 3CJ5A 2C2EA 1R8BA 1TKZB 1GAOA 3EPIA 1X9SA 2E1CA 2NUUG 1BY9A 3AA8A 3H7HB 3N6MA 4WE1B 3HVTB 1Q8LA 2HK3A 4DL6A 3CC2S 1BXNA 1HW9A 1WC5A 2QMUB 3TP2A 2BW7A 4UF4A 4DR2J 1LW0B 1LWEA 1T0TV 2OHDA 3I82A 4DFKA 3QFWA 1YJUA 1YJVA 2F65A 2VG5A 3MPDA 4C8MA 2M0GB 5DG9A 1NJIT 1P8GA 1RI7A 2XHWA 1WKLA 3LUYA 2VFVA 4USIA 4AD6A 2KM8C 2XLJA 2VA3A 3OVSA 3UR3C 4OV6A 3R2DJ 2DNYA 5C2CA 4DQPA 2DNMA 2CQGA 2J8AA 4CH0S 3MUTP 1I6JA 1C1CB 2UXDF 2XLKA 4X4NA 2GA7A 2KI2A 2VZ9A 2VB6A 2WSEC 4C4WA 2EBGA 4RX6A 5A2QU 4AXJA 2GMLA 3IBWA 1RXOB 3R8YA 3M05A 3QGGA 3WDOA 3TJAA 3OLAA 1S10A 1T03B 1TFWA 1FXRA 4OX6A 4JB8B 1RK8A 2MSTA 1ZM3A 4PR6A 4DJBA 2FJAB 1N52B 1X4AA 3NS7B 3TJ9A 3CCVS 1T9XA 3UD4P 2OKQA 1NHVA 2UP1A 1C0TB 2KT5A 3DMJA 2JH3A 3BR8A 1JLCB 3HT0A 2ZM6F 4RNMA 3FVYA 2GJ2A 5E2QA 2QLFB 3C19A 4ICLA 4WU2A 4KTQA 2PFFB 2C3OA 1RAHB 2RQKA 1S97A 2PI5A 3PV8A 3F44A 1LQ9A 1DTQB 1VQ9S 4IOCQ 4P2FA 4UUXA 2C3MA 2DXFA 3CCES 4DV1F 1JLAA 2QG9B 3CF5Q 2QGFB 1DTTB 5B0CA 2O67A 2XY5A 2UU9J 4JUZA 3ADAC 4CDIA 4OZ1A 4A8WA 4JI8F 2HURA 2ZH5A 1SKRA 1OYEA 3ENQA 1XR7A 1VS3A 5CA5A 5U47A 2XM3A 3I55S 1PGZA 1N5SA 1NEEA 2IIHA 2GJFA 3MM8A 4G1QA 4NLVA 5G0RB 3MM8B 5G0RA 5DQHA 3PR5B 5F3TA 3MR6A 5T41A 4LFAF 4IH7A 5K8OA 3IGNA 4FXWA 4FS2A 5EUHA 3MECB 2OIHA 1Q95G 2AEMA 2E1AA 4ZJQA 5L8RC 4MKVA 3NXZA 4PXEA 3CDAA 2C3YA 3FBBA 1J5OA 2YNHA 2K1RB 1HIYA 4QU6A 1JLBB 1GT8A 2J0XA 2V94A 2FYXA 2HNYB 1S0OA 1IUJA 4ANDA 4DL0C 1NK6A 2QA2A 2AYMA 5D4OA 3K89A 3HHLA 1R8CA 1KEKA 2ADCA 5IM0A 5C25B 4P75A 4JV2A 1IBLJ 5CAAA 4U9RA 2ALYB 4IKAA 1DJ0A 4PRFA 1VI7A 2XMKA 3LGNA 4AYBD 2DO4A 2DIVA 4K5SA 3N28A 4NLWA 1QTMA 1B7FA 3MOJB 5M2PA 1UETA 4HT7A 4CCHA 3ZO7A 3U27A 1G1XA 1FEHA 3UI3A 1FRJA 5DDPC 4I0WA 2LXUA 4MT1A 5HMWA 5M2UA 2CXEA 5IZHA 2C2ZB 3DOLB 3EXYA 1RT7B 3ZXWA 4K4YA 1AFIA 1FEEA 2V2KA 3GMGA 1XN9A 5FDLA 2B4UA 1HQUB 1YLXA 2XMTA 1Q0NA 1YX2A 3FEXB 4A8XA 5LXYA 4J9SA 1KQKA 5KG3A 2HGLA 2B3TB 3FEZA 4OHXA 3QT6A 2EC0A 2IMOA 3TQ1A 2MZTA 3IN5A 2VBYA 2H3EB 2ZJPQ 3T5KA 2WCXA 1F2GA 4JYAJ 2LXIA 4K4VA 3HHLC 2HQCA 1MSWD 1QSYA 2NPFA 3OVBA 3MM7A 4U7UD 5HMZA 4LSLB 2QX0A 4QIEA 2CPFA 3FSXA 3ZTPA 2BQUA 1EAYC 3JXOA 2MKKA 2DEIA 5A2QY 3KJVA 1NAQA 1X9MA 4Z7YA 2DRBA 2ASYA 2AGOA 1JXLA 3G87A 4CLLA 1G7CB 2VFUA 2QSWA 2ZZTA 1D3WA 1F60B 2AJ2A 3QGPA 3TUPA 4O0IA 1SV5B 3TVZA 1AUDA 2ZZMA 4DX6A 1PAUB 5HP1A 1OMSA 2EFVA 4UQGA 3I0SA 4ATNA 2KZZA 4K7QA 3BKFA 2LQJA 4NMXA 1VQ4S 2JEJA 5DM6Q 4WTYA 2HFOA 2P6TA 2RIJA 1RHKB 3MPYA 4DEZA 4ZCMA 1HHTP 2GVDA 4GKKF 3GPAA 3Q8UA 4I2QB 2KM8B 3VAHA 1AZSB 2AYBA 4OHVA 1FKPA 1SJ4P 4LFCF 1OY9A 3HO1A 1FJGF 3OXFA 1RLDA 2RE1A 5D0EA 3WQPA 3AJDA 1U48A 1PO6A 3DLBA 3VCDA 4K4UA 2XSFA 2XYHB 5BR8J 2K3KA 4URGA 1M5SA 2UVUA 1RAIB 3M1VB 4Y3CA 1HBOA 1Y3JA 3BGRB 2H4YB 4OZLA 3VVUA 4Z7CA 3RB6A 3CJRA 3AJ1A 4H4KC 4WPAA 3RRKA 1IKXA 3EM1A 4YHHF 3GIKA 2W7PA 5HN0A 2ASJA 3PRVA 4CLKA 2VKZG 3MHYA 5DETA 2RUSA 1O51A 1UPMB 2PT0A 3GONA 4OI6A 3LAMA 1V3RA 4OLPA 4PYAA 1PYOB 3EYZA 2ILYA 2V63A 5I42A 1HQEA 2IPOB 1GNKA 2CPXA 4NLPA 3VAMA 5KFEA 2UVWA 2KFZA 1QJHA 4TU7A 3KK2A 2HYIB 4UQTA 1SC6A 1PJ6A 4NA1A 2HAIA 4F4AA 4F50A 1HYSA 2M5YA 4MJKA 2ERRA 3C3LA 3CD6S 3N6LA 5F0WA 1HBUB 4IYQA 1RT2A 3FMBA 2HFZA 5ETTA 3C14A 1UWAA 3MEDB 3ZZUA 3AQOA 1T94A 2YNIA 3D68A 3O6QA 2VIHA 3A8KA 4EBEA 2R8JA 2UXBF 2XMWA 1DTQA 1HLWA 2F4VJ 4YDDB 2VJUA 3T5LA 4LFBF 2BV3A 2XSJB 1UVKA 2FC9A 3VHQA 4RL1A 3NMAA 4NLTA 5I3QA 3HXMA 2XZTB 3HI9A 4MFBB 3IR5B 2JWNA 2HLUA 4IO1A 5E5NA 2UU9F 3HSDA 3E51A 3MFIA 4LF8F 2V34A 1KONA 2BW2A 1FFGB 2HS4A 1HWJA 3DI6B 4JI6F 1QM9A 3UW1A 1SKWA 1ZAXA 5KFTA 1N34J 1S9GA 2ZNZA 3CT9A 5D4LA 4NLXA 3BSAA 1V3SA 5IC6B 5KG4A 2PC6A 2FHOB 4L72B 4OMFG 5DQGA 5J2PB 1RISA 2FLOA 2MSSA 1B7YB 8RUCA 1IBLF 1FX4A 2OSQA 4KQZA 2BBEA 3I56S 1TFYA 3MPWA 4LF1A 2E66A 3Q22A 1OPZA 1RU1A 2E7WA 3VVTA 1U25A 3SCJE 4ELVA 4ALZA 4WFNQ 3MEKA 1H98A 3BSNA 1SKUB 3CJKA 3D54A 4NA3A 4USJC 3PX0A 3KLIB 1H2VZ 1HHQA 3GG0A 2BE7D 2DH8A 2IJFA 2CDQA 2G2YA 3H5UA 3PYFA 4PAAA 3A3NB 5C5JA 1X0FA 1UA0A 1U6ZA 5T7LA 1JXVA 4DR7J 1Q4RA 3MMBA 4C6AA 4P10A 1TKXA 5HL7Q 3V5RA 2DISA 3H90A 4EBDA 3FBFA 2B8QA 4LF2A 3W63A 1X5TA 3RR7A 1RYRA 3HVTA 2HZVA 3MMCA 2OPSB 3M6VA 2CYYA 3M2UB 1UEKA 1R0CB 3IA0A 2H5IB 2J9DA 1FT8A 2OSRA 2VF3A 5IQQA 4QW8A 3D6HB 1TAUA 1XK8A 1KN6A 1WC0A 5FD1A 2CQIA 4JI8J 1LWEB 2VBXA 1VGYA 3OQ2A 1UVNA 5JXSA 4DR4F 3IMQJ 5ETKA 3QJJA 4X4RA 1NNDA 1SJQA 1TL7A 1GX6A 1X0PA 2DY1A 4YDXA 4DX5A 1U45A 5EWFA 2AQ4A 2ACYA 1Y00A 3BN4A 3M1VA 1EIYB 2V69A 4DU8A 3ONQA 1MNEA 2BKPA 2Z0GA 4YR2A 1JX4A 1C1CA 2Q43A 1S1XB 2FY8A 2XYGB 3KG0A 3PG9A 3E01B 5A0YB 2J7WA 1F1BB 2R2SA 1S1VB 2EFNA 1VIOA 2VICA 4IR9A 4Q7AA 1X5SA 3B82A 3OFHA 3ZTSA 4DR4J 1XWLA 1UVLA 4FXDA 3RU0A 1TQLA 2AEFA 3PW4A 4WJBA 3CCTA 1RAGB 1OYDA 3MM7B 4ZVPB 2W8KA 1IBKF 2ZH7A 2RQMA 2AF6A 4JI2J 4Y65A 2RS2A 3GP9A 3HSZA 4NLUA 4ZCLA 2NPIA 1UJ6A 1U24A 3KFWX 2YNGB 1IKVB 2HQDA 4D3HA 2HHWA 3MZIA 3CJ8A 2VPXB 4DV2F 4ZN1A 1C4CA 2V67A 3R3TA 2VKRA 4TY8A 4CT9A 1S1UB 2D3OR 4B3SF 1IQZA 1S6QA 2V0NA 3M8QA 3AHPA 3M8QB 2BABA 1TVRB 3K2YA 2VUGA 1RWNB 2CVIA 2KJWA 4RU2A 4QOTA 5KT4A 3RAQA 3H4BA 1P27B 1NH8A 1Y10A 2YKQA 3I0RB 1RWVB 1R7IA 2GCFA 1JLEB 3D67A 3M32A 4USVA 3GIMA 2GVDB 2W7OA 4DR2F 2UV8G 3T6JA 2RILA 1YBAA 2D74B 2QTWA 3NGSA 1RHJB 4N8OA 2V4QA 4JI1J 2R7VA 3G8SA 1JJ2R 4F26A 4UUWA 4PG5A 3MEEA 4W98A 5DG8A 4K4TA 2DNPA 2DTJA 2C2OB 1VJWA 3GIRA 3LGHA 4ZVHA 3Q8QB 3H98A 3IWXA 3FSIA 1U1OA 3FUYA 4M5DA 2M2BA 3P5TL 4F04B 1JNZB 3QATA 4CZCA 1OY6A 3W2WA 2OPPB 2OFHX 4EYHB 4F4ZA 2VG7B 2DB1A 2Q66A 3BBBA 4CT8A 1SH3A 3P6YC 3TQEA 1UFWA 2AEJA 1JJCB 2L48A 1QVGR 1CJKA 3JSBA 2QLWA 3CCZA 3KTQA 2YBVA 3R2CJ 1FJ7A 2FGOA 2VDIA 2EFOA 4DR1J 1KLMA 4E0DA 4V19X 2QFJA 1IJEB 1SQGA 4MMOA 5K9FA 4V1Ak 4KR0B 2LA4A 4TNOA 1DBDA 4UT4A 2VQEJ 5GAHU 4LF5F 1IKWA 2E1PA 2RQCA 3GCXP 4CH7A 1LW0A 1FESA 2UZAA 3BGUA 4MTPA 1NK7A 3DLKB 3H5SA 4UZBA 2ZZNA 3UQSA 3EVWA 2YX1A 1FHTA 2CPHA 2E7VA 3OR2A 4RBVA 5D8HB 1ZAVA 4O44A 2J6UA 1UZHA 4M5JA 2GZOA 4O3PA 1RU2A 1VHIA 1D09B 4NLGA 4OI3A 4WYLA 3TEHB 1HQUA 3AOBA 5GMEA 1FWLA 4LRCA 4CLUA 2NREA 4KHPF 5SZTA 4IG3A 1S1XA 1T02A 2HVEA 3MCNA 1RKJA 3GLJA 1VHFA 4QWAA 4GMKA 1UTAA 4QR1A 3OL6A 1YRXA 3CEDA 1BQXA 4DV5F 4B3MJ 4RUAA 4X4UA 4LSLA 1HBMB 4OZ5A 1FF2A 2JHEA 1NXIA 1RDRA 2XWXA 5E3AA 1VRQC 4X4OA 3RTVA 2XYPB 1RAFB 2MHEA 2CKWA 1G2EA 2Q1LA 4CM2A 3MOZA 3ZFVA 4OZ0A 2U1AA 1Z2LA 3RBZA 1HNWJ 1X5OA 1YJ9S 3HVRA 1RHUB 2FLLA 1Q8IA 2DGSA 4TXSA 2DNKA 2OD4A 3CO9A 3IM8A 3SFUA 5GAEI 1M1GA 2DGTA 2YY3A 4NX9A 2JEIA 5E0OA 1VK8A 1VQ7S 1EARA 1U2FA 3N79A 5ETSA 2V8PA 4CI0B 5J2MB 1FFSB 2DYAA 1DTTA 3L9ZA 1N5TA 1PJ5A 2IC3B 4RWWA 5K8MA 2XO6A 2MQMA 2R7QA 2C1EB 4DLEA 2CWXA 3FKBA 3U7JA 2LQ8A 3QRPA 4NXNJ 4Y34A 1X4DA 2LYVA 1LK5A 1YKWA 3B4DA 3A8EA 4OV1A 4PWUA 4WP9A 2BEFA 3PIOQ 1JLEA 1OSCA 3M32B 1W2IA 3CD5A 1FJEB 2VQFJ 4DQIA 3V6DA 2RHQB 1REVA 4DL3A 5DG7A 1FKPB 4OZJA 4I1TA 4D3GA 3I5BA 1D8YA 2X7IA 3NOCA 4CLWA 3TI0A 3BYPA 3CSKA 3OTOF 1NCLA 4LUBA 2RRAA 4USKA 1FKAF 2XMMA 3HJVA 4NI2B 4P73A 4DPYA 2R2RA 1S1WA 2JSXA 5ETMA 2EPIA 3TWZA 3DOKA 4LSNA 2DH9A 1R31A 3KNGA 2JJ4D 3HX9A 5KG7A 4QWEA 3MUVP 1Y5LB 3MCMA 1WF0A 2VQEF 2OEKA 3ITHB 3NGDA 3T1HJ 2PN6A 2MHNA 3RBXA 5AXMA 4CH1A 4X62F 2DHGA 1CJVB 1BQMB 3RR8A 4DFMA 1Q1KA 3MAQA 2W2NP 2J0WA 4I2PB 4GVBB 2NXNA 3CDBA 3RGIA 2JNJA 4WKYA 2E5JA 2PE8A 2WK4A 2NXUA 3AT1B 1H7XA 1KS2A 4YS2A 3DLLQ 2G4BA 4Q2MA 5L1JA 3KK3B 3V6HA 2F4FA 2NSCA 3ZC4A 3KK2B 3KK3A 5DLFA 3VAFA 3HKZD 5LSLA 3MWBA 2H51B 2LA6A 1QSSA 2CJ9A 2SXLA 5RUBA 1DLOA 1S0VA 4OHYA 4L74A 1FD8A 3IGVA 4BC7A 2VJVA 4I7FA 5LMNJ 4E98A 1RWUA 4DCOB 3DLHA 1N5YA 2CJXB 3F0NA 3BQ0A 4FN5A 3GV8B 1AXQA 3CNQP 3JTPA 3KHRA 3H2VE 4YP3A 4O3NA 3POTB 1F5BA 9RUBA 3OL8A 2JLEA 1UPPA 1C0UA 2HQFA 2DH7A 2LU2A 3TX8A 4KGMA 4LR9A 2KB2A 3LOUA 3EZ5A 2L9WA 2YH0A 2XZWA 4DF4A 1RT5B 3CTRA 4KO0A 3W2VB 3FSYA 3CXCR 1HWUA 2EVZA 1ICEB 2MLYA 1UWBA 4J5OA 2ZFHA 4UTGA 2MZJA 2HQIA 2KKHA 2IM2A 2YXLA 4ES1A 4DSFA 1KHWA 5HROA 1XMOJ 5K5MA 1VISA 3CB4A 4MK8A 4B3SJ 2K3IA 3DHWC 3KKFA 3J81j 4EYIB 2W2OP 2QL9B 1T05A 5F8NA 5KT7A 3IBCB 4U7CA 3KLFA 2CWKA 1N0VC 5SUHA 1J5OB 1CULA 3TAMB 4HTIA 4M94A 1H2UX 2V2ZA 2B4PA 3I31A 3PFEA 2OMLA 2VFSA 2QA1A 1FRIA 1RCXB 1IXKA 2ZBCA 4TYAA 2CVEA 2QO3A 5F8JA 1IR2A 3M2VA 1LWFA 1T95A 2F7VA 2O1PA 4P7TA 2NZ4A 1KLMB 4QCLA 3M4XA 3MMCB 4DG1B 2LLZA 1ZYQA 2JLFA 3KMSA 1VDHA 4WF9Q 1JWWA 2MJNA 4LBIA 2Z2ZA 4F4KA 1NPKA 4PG8A 4OYPA 1ITPA 1E6VB 2D3ZA 1YSJA 1JJHA 2BKOA 1T9VA 2V2QA 2BE2A 2XWYA 2YNFB 4PWWA 4RW9B 3DDKA 1VQKS 2C2MB 2VG5B 2W24A 1HARA 1LWCA 3OR2B 3P8BB 3BO4A 2PA8D 3BR9A 3EVMA 3NBPB 2NR0A 2VOOA 4OL8A 3NBPA 3UD5A 3OW2R 3OHBA 3TUZC 3W60A 3DRRA 3K5NA 3TVYA 4LFBJ 4JI0J 4W90B 1EQ0A 3J7YU 2RF2B 2XGQA 3PW2A 4DS5A 1EETA 4LF4F 1ZM2A 1ZZNA 3J81Y 2HHHF 1XJWB 1NPRA 1HI1A 4ZJLA 3SQGB 3VR1A 1NKBA 3OHAA 1J27A 2WSFC 4ITSA 3W8GA 3EUNA 2W4DA 3G86A 1WDDA 1JK9B 3ENAA 3G71S 1F9EB 2FVRA 4KFBB 3QLHA 5C24B 5A8RA 2FLPA 2BMBA 2LECA 3LAKA 3T9NA 5ETNA 5HVHA 4E8UA 3U1LA 2DXDA 5AXNA 1CVJA 2DRDA 5E3CA 1L3SA 2CQBA 2XBPA 3CIZA 3K8WA 1S1UA 2BJ3A 2MZSA 3RUBL 5A6PA 3JYTB 2JRSA 3JYTA 4Q5VA 1EJ7L 2YX4A 2MZ1A 4B9LA 1SQFA 2VASA 1ZPWX 5KFXA 4EO8A 4DZDA 3QSYB 1JLAB 4FF4A 1WEYA 2DKOB 2KRBA 5ETQA 2UUAJ 4LF8J 4GKJF 1RGVA 1JLQA 2DITA 1Y5NB 4DUZJ 1GMWA 4CP5A 4DV5J 4A4JA 1HW8A 5GMDA 2QJ3A 4NA2A 3SIPB 1YK9A 2DPIA 2UUBF 1VBXA 3DLEA 3HF5A 1FDBA 2HBYB 1RACB 4I2QA 5EX0A 2Z56B 4CO2A 4G1QB 4B9MA 3NMRA 5F8IA 2F8HA 1BWVA 5J1NA 3Q8SB 3GCWP 3BO3A 3MXHP 4B3RJ 1TL1A 3MM5B 4ZLLA 1SIZA 4R5PA 2OFGX 5CZXA 4QWBA 5H9FK 4R25A 1DY3A 1HMVA 3CJ3A 2ZJRQ 2CJYB 4ZVQB 1BC6A 1U0HA 4ELTA 1HBOB 4FKYA 4QQBA 5A8WA 2V8HA 4DR5F 1VK3A 2F40A 3GIJA 2YQ0A 3QIPA 4H4MA 5KOXA 2ZBRA 4LT6A 5HJYA 1WEZA 2OH2A 2HNYA 4PABA 2YKMA 1UCNA 1CQMA 1RT4A 2N4DA 1UW9A 2AX0A 2X1BA 3DC2A 5T7LB 5EDWA 2AV5A 4DFJA 2B51A 1B4SA 2A18A 3NCRA 5AE1A 6FD1A 3CCUS 4LF9F 3RB3A 2JFKA 3I87A 1IWGA 4K2JA 1KHVA 4I64A 3SI8A 1CEZA 2J9DE 1NZAA 1QAXA 1SC4B 2WVCA 5B0AA 4DG1A 2HHUA 2U2FA 4USHA 1ZM4A 1N33F 4KAIA 2DHSA 4JI5F 1YVFA 2Y3YA 3CW2C 3MFHA 3ZNUA 1K0VA 1HQ2A 2KH9A 4IO9Q 3M9OB 2DT9A 1U1RA 1VQ8S 2HBZB 3LO3A 4L6V3 3BV8A 4IQXA 3RBDA 2NS1B 3W66A 1J5EJ 4K4ZA 1URNA 1PAEX 2ZE2A 2ZE2B 4C7QA 2HZAA 4Y2MA 3C66A 3DGPA 1RT7A 1AA1B 4OJ1A 5EHHA 1KR4A 5ADZA 4WFAQ 1U4BA 5CD4H 1GMUA 2BM1A 3C16A 4I69A 3HSGA 3EGNA 2JC1A 3QPIA 3W9JA 2R7OA 3RG6A 2DVIA 3CJ0A 2DBBA 4ILRA 3OTBA 2VA2A 2R2TA 3KYLA 3IWLA 4U8YA 5L38A 1HWKA 5CH7B 3DI6A 1VRUA 3ET6B 1UWBB 2COLA 1QE1B 2QFIA 2V50A 5BXIA 5KFNA 1RWWB 1RT6B 5H9EJ 2G0IA 1H6KX 3FJ2A 2VPWB 3TX0A 4C0BA 2IVMA 2A6OA 2R8GA 1U2RA 1KVKA 2CFXA 1WHXA 3CJ4A 1XNQJ 1FXLA 1FRKA 3GU0A 1FWKA 3US5A 2HVIA 2CQHA 4A46A 1S72S 3K0JA 1C1BB 3CD0A 3QBCA 3VQTA 4IDKA 2BRLA 1HR0J 4HI2A 3UD3P 3C8YA 3KLIA 4TY8B 4C8LA 2CQ1A 1FVQA 1H73A 4JI2F 1U26A 3H20A 3JQMA 3BJYA 3IBFB 3CC4S 1L5UA 1MROB 2CNNB 4JP8A 4RW6A 2EI5A 2VU5A 2HLTA 2KFYA 1FDDA 3H2UB 3RAMA 2ZOMA 4DV7J 1WWHA 3Q23A 1LKZA 4TU8A 1I3OB 1YHQS 5AJ3F 2IM0A 2CADA 4X4VA 2HFSA 1O8BA 4DR3J 2ATCB 2AYEA 2P5VA 3V6DB 4F4WA 4DX7A 1YG0A 3WIVA 1RB0A 1SB6A 1WG1A 2Y1RI 3NGRA 4JI3J 1JLFB 2AHOB 2NYHA 1YZ6A 5E3QA 1O5JA 2X3GA 4DV0F 1NU4A 1RWXB 2H5JB 1U1LA 1FK9A 1HNVB 3T9ZA 3T5JA 3LPEA 2MKIA 4NCAA 2KT3A 4B9TA 4DHVA 3H0PA 4M5GA 5A8WB 4WXWA 4Y2AA 4C11A 3OV7A 1IBKJ 4JI7J 1IN0A 2LDYA 4NE9C 4C0HA 4GC7A 2OTJS 1JJ4A 2PMWA 4FNHA 1NK4A 2YKNA 2WW4A 3PDNA 1S6PB 3JQJA 1R0AB 2ZH4A 3UE2A 4JV5F 2PFDA 2FB0A 2DHXA 4F3QA 4FYXB 2AP6A 3HHLD 1DRZA 4A8YA 4OYWA 5G4DA 3TZZA 2OEMA 3AAWB 2E1MC 3MMAB 4JOUA 2B9WA 3O3LA 3KNAA 2HHQA 3CUNA 5K14A 2VFRA 2PGCA 4QIWD 4UW2A 3HSJA 2QRRA 4CO5A 3T41A 4B9UA 1FD2A 1QAYA 4QIVA 4LIWA 2DGQA 2M88A 3MAAB 3PTWA 4RNOA 4ELUA 1M90T 3PCOB 1BLUA 1S57A 4ANCA 2DCLA 3HZEA 3DOLA 3MTKA 3KLGB 4ED3A 1XQIA 4B02A 3R9LA 4F25A 2KG0A 2XS2A 4X65F 4OI0A 3FGVA 2CZ4A 2M8DB 3J7AN 2H48B 3H59A 3VZHA 4EMDA 5LSOA 2QC3A 1G3OA 1P9QC 1GK8A 1JMTA 3MGJA 1VQ6S 1S6OA 3DDNA 3I0RA 2Y1IA 4LF6J 4NXNF 4K0KF 1IBMF 1TELA 3AFGA 3BBCA 2QE5A 3W2VA 1S6UA 3NNAA 4KSEB 3T1YF 4MKAA 3DU5A 1VQSA 5J2PA 4NZ7A 4JI3F 1WELA 3U1NA 3V6JA 3HM9A 1CC7A 3W1YC 5B09A 3PJXA 2ZITA 3A3PB 3TYTA 4YB7A 1W2BR 5CYJA 2ZM6J 2EG2A 4WU3A 2XQCA 5KFQA 1CULB 3TAMA 5DDQC 1PCAA 4BHQA 5F9LA 2MGZB 2K1RA 1FDAA 2X1AA 3NNHA 1XMBA 4Q0BB 1JKHB 3N01A 1CLFA 4A8FA 1HA1A 2ZNYA 2VG6B 4P2MA 4KH1B 2YH1A 3KJFB 3UNGC 1HPZA 3QIDA 5GVQA 5F3ZA 4YR0A 2PD1A 3RAXA 2KTQA 2CG4A 1NSQA 3P5BP 2JEGA 3HDSA 4ER8A 4LRFA 1X4CA 3FZ2A 1BWEA 2GMJA 2HHTA 4FNIA 1OY8A 2IRXA 3CD7A 3MM6B 1I1GA 2FHMA 4O3OA 2HG4A 2BX6A 4J9UE 2NXEA 4X65J 1TL7B 1R6YA 1V9OA 4J9RA 4MK7A 4ED8A 4UOFA 1UAWA 2KXHA 3PYEA 5HK4A 3KLHA 2D3UA 2J7KA 4X4QA 3PVXA 2BM0A 1YJ7A 1UJ5A 1T7PA 1G6BA 4DN0A 4P9SA 2HAFA 3OTDA 4M63A 4X2BA 1B70B 4DL5A 2FVCA 3GYNA 2CZVC 4RUBA 3A3OB 5J2QB 5K8PA 3W65A 1WHVA 4DV4F 1XR6A 1YJTA 2BQ3A 2OI2A 3GG1A 3M8PB 3R7BB 3UO0A 1TK8A 1M5VC 3KDNA 2FJEB 1KKHA 2F8EX 4HR2A 2W2QP 1TK5A 3GJTB 2Z4PA 3LGMA 3DFEA 1NJWA 1N5VA 4YY3F 5GADI 3D1HA 3X3UA 2YX7A 1B99A 3BQ1A 4H4KA 5BYRA 5LJ3Y 2QA4S 1N4LA 4J91A 3KHGA 1SKSA 1HWLA 2ZH1A 3PO5A 2D9PA 2QIFA 2K8GA 1EKSA 4ED4A 4RW7A 2N82B 2GHWA 3M7VA 4CYUB 2FJVA 3OVAA 2C28A 4O4GA 4NASA 3CULA 5KT3A 3K17A 4O4GB 4I6WA 4QZVB 3CCSS 4FF2A 4UY8T 2GW8A 4A48A 3ZZOA 4CO1A 1YDLA 2B5JB 4CM0A 1TTHB 2MKHA 1K9MT 1F3FA 2NLWA 3OSPA 3OL9A 4JYAF 2M8HA 2E9ZA 3AJ2A 1H74A 4Q44A 4ZITA 2XB2D 1EZZB 2UUCJ 2VBWA 4ZLPA 2XC9A 2KHCA 3CVKA 1H72C 3PY8A 2WVFA 3IP0A 2V4RA 3R5GA 1NKCA 1NDPA 2PMZD 4NCGB 3H5XA 1N54B 1ZA1B 3R5BA 1N8RT 1WACA 1Y9OA 2LCWA 1U0HB 3MECA 3I5AA 3W9IA 2E9RX 1HMVB 4DL2A 2GIQA 1F2HA 2G2ZA 3A1YG 3NGKA 1KQSR 4KRWA 1B64A 3VGTA 3K7RA 4WZMA 4BBYA 5K8NA 3FNNA 3OL7A 1R8AA 4ZPTR 3QMQA 3ZZRA 4K4SA 1NSPA 3I96A 1V3ZA 4DPXA 4DV6F 4WFZA 1WI8A 2AZ1A 3RYLA 4WP3A 2GGPA 2KXNB 2FPHX 3N0VA 1B0PA 4GC6A 4DSIA 3EGVA 3S1TA 2V9WA 2R8HA 3PJWA 2UUCF 4KGKA 1C4AA 4PWDA 3DM2A 1DARA 2GC8A 5CCMA 2QLBB 1M1HA 4RWXA 4FDFA 4DUYJ 2XS7A 2L08A 3EE3A 2IDLA 5BJRA 4R8UB 3G9CA 4K0KJ 1SI9A 4BS2A 4LFAJ 4N77A 4BCAA 5MLCV 1AUSL 3B8HA 3AA9A 3Q89A 1IM4A 5KG5A 4XTTA 1VLOA 3MM9A 2WRMA 5IS2A 3UVJB 4N56A 3WC0A 4S0MA 2LXFA 3SQOP 4DCJB 1WF1A 4F3MA 1FVSA 3MR2A 3SQGA 2RQ4A 1HNIB 5ETOA 3G96A 2DCUB 2IM1A 1S1TB 1HNIA 2QN6B 3TUJC 1BGXT 1IR0A 4ZN3A 2XZDB 1S9GB 2BR0A 1NK9A 1M5PC 1ROFA 4X66J 4F8RA 1R43A 4NYPA 3TR5A 1BHNA 3TA0A 4DXLA 5D3GA 2GO9A 2MB0B 4Q8EA 3Q8VA 1F5AA 4J9LA 1FE4A 4TKTA 4H4OA 2IMWP 2YNGA 4UOGA 1C1BA 3QAEA 3J7ZT 2ZVIA 5IXUA 2ZC4A 2UUTA 4KGZB 1T8EA 4Y00A 2CAJA 4P52A 2PMHA 2CPYA 4DR5J 2HNZA 3GFYA 4G1IA 2QV6A 4OQJA 3IRXA 3QQCD 3SCLE 5C7PA 1UW4A 2RSQA 3GZ7A 4AQYJ 3BB5A 4OJHA 1CJTA 4ES2A 1TP7A 5J2MA 1R8PA 4JI6J 3L7UA 5B7WA 1FNXH 5IT9U 2DHAA 2KN4A 1NUEA 4HHUA 1XERA 3DRSB 2YKPA 5AE3A 2Z2MA 1WUUA 1RJJA 2PO4A 3D6TB 4OX8A 2QSFA 3TA2A 3QWPA 4WFYA 3TVKA 3LP2A 1EB0A 1P6TA 3M8YA 4HHHA 2VPZB 3S7RA 3HHNB 2CJQA 3C6TA 3R5JB 4NMLA 4RW4A 2DGXA 2WTFA 2G2OA 3GJRB 4EU0A 1UP1A 3HK2A 1WD6A 4B17A 2GFFA 1JB0C 1X7VA 2HWIA 2Y0SD 4B3OB 4HT5A 4QR2A 1S1WB 4QBUA 2FHKA 1QAJA 2ROPA 2MQOA 3DRRB 4RUCA 4DF8A 4PUOB 4WIIA 3BGRA 2EFGA 2Y0BB 1RUSA 2RKIB 4J9VA 3RZAA 3UDLA 3UWTA 3UCUP 4KB7A 5KFYA 2W4CA 3Q0AA 1NJYA 2H5EA 3KHLA 1CQNA 4GVBA 5J2QA 4HH0A 2GQ2A 4DDFA 4I2PA 2J6TA 1T3NA 4YFUA 1BE4A 2Z2LA 3DKDA 6FDRA 4F2RA 2FTRA 4ECWA 1YJRA 5IM0B 3OLBA 3NCQA 2JVOA 3M8RA 3R1LA 3T1YJ 4HACA 4KV8B 1XNQF 2J9EA 2B6AB 3HFZB 1FO1A 4XAKA 1WORA 5D78A 5J1PA 3CCJS 2P2CB 2E7XA 3LP0B 4CLSA 2RDIA 1MU2B 3GYXB 4AFFA 5C42B 3RBEA 2FHJA 4EO6A 1H0HB 5ETRA 2H65B 4X64J 1K73T 1L3TA 1DZ5A 3T19A 2R7SA 4NLDA 3MEDA 2QEXS 3KK1A 4I7FB 4OLOA 4P6QA 4RW7B 1QAIA 1GX5A 1A9NB 4DSLA 3BO2A 2CQ4A 3D0IE 2B43A 4LBPA 4RO0A 2EKYA 1MLAA 4O3RA 1KVJA 2YWHA 3BKUA 2BANB 3MEGA 3N9UC 5LSRA 3CE8A 4HH1A 2OPRA 3OJUA 4F7VA 2BDPA 2VC1A 4EZ6A 3KLFB 3H42A 4N47A 2RU9A 1KQFB 3ILIA 2IVYA 1GH8A 3M2RB 3AD9C 3GR0A 5ETPA 3JSMB 1NK0A 4OYZA 5E3RA 2ZUAA 1UJ4A 2YWFA 3Q8YA 4KYZA 4PQUB 5M2RA 5D0GA 3PHEA 1D0EA 3H8YA 1T05B 4B9VA 2OUGA 3TJ8A 4ZDNA 1QDUB 2DNLA 3FCHA 3L7PA 4OJGA 4OX9F 4YMEA 1U1MA 2YWWA 3SBMA 4LF9J 3CJKB 1MMDA 2BJEA 1JIHA 2GQCA 1JLBA 3DRYA 2DGUA 2D41A 3B4MA 1WOOA 3PACA 1N56A 3AOCA 3OUYB 2VC0A 1X4EA 3OSNA 3UN3A 4A8MP 1SPBP 1VC0A 2KL8A 4KBIA 4NLYA 4LRAA 1BUXA 1LWFB 5HO4A 4YB1P 3TARA 3IM9A 1XBWA 3R5AA 4B3TJ 1WSRA 3KWMA 1GXUA 5LMUJ 3T1AA 3LP2B 1PKUA 1PYSB 2EBEA 2OPSA 3DOMA 1XTZA 3FQLA 3IAS9 3FQKA 3QSIA 4WFXA 4ZP7A 4ZPWR 3J80U 3L3CA 4DSEA 3NL0A 2APOA 1YBTA 5CHCB 1RLCL 5DZ7A 4YN3B 3P49B 4R8UA 2ZD1B 1FKOA 1QD1A 2YTCA 4NWBA 1FKOB 2LQ9A 3KXDA 1GEHA 4RW8A 1D9FA 5CYQB 3OJSA 2IBOA 5DGAA 3CJ2A 3ITHA 1RTHA 2I6WA 4DQQA 3ZZTA 2KRRA 3NNCA 1NSKL 1SUQB 2R7RA 2NQPA 3MMJA 3S6EA 1WTFA 1TV6A 1Q81T 1Z4UA 3TOQA 2YKNB 5HLFA 1R0AA 1UZDA 1OQ3A 2MPUA 4M5HA 3D5MA 5FIIA 4ZCKA 1VRUB 3PHTA 4WFBQ 4EEYA 2HBQB 1P9YA 5L46A 2HZCA 1SH2A 3PRDA 1S9EB 1ZS6A 3LANA 3WBZA 1UMJA 2FDNA 3MR5A 3M6UA 4TLRA 3HHKA 1IKYA 1B0VA 2C2NA 2W9BA 3CMES 5IT0A 4J9OA 4C8YA 3VGSA 2I5JA 3EDQB 2JZ5A 2HPUA 2XEXA 2UXCF 3MAAA 1A6LA 2HS3A 2FVPA 3ZZYA 4AT1B 1NDCA 4LVNP 2B7BB 1CJUB 1CJTB 4IG0A 4MK9A 1CJUA 4ED2A 2BANA 2LEPA 3DLGB 3MEGB 4C0OC 5HP1B 2R2UA 2F63A 2OPRB 5L39A 1C0UB 1O6XA 1TUVA 2LQ5A 3IG1B 2R42A 3LALA 1NLKL 2NZCA 1GFWB 2QLJB 4LRBA 5HQ8A 1M5KC 1U0SA 5GAGI 3MURP 1JQGA 4ERDA 4MYUA 1ZPVA 2KO1A 3MCOA 5KFHA 4ECRA 2CZ9A 3MM5A 3CCQS 3G6XA 3HPOA 2HWTA 3HD2A 1NH7A 2FJDB 1RSCA 4LF7F 3DOKB 4LSNB 4OHZA 4I68A 4EGLA 2E9TA 2AYGA 2MXYA 5L1KA 4HI1A 1YRUA 3Q2SC 1WOSA 4L3KA 1IWAA 4WIQA 4RPFA 7AT1B 1WKJA 5I3UA 1RTDA 4DR7F 2V4JB 2E5LF 3NCPA 2HNDA 5FLXY 2QA4G 2A10A 1ZA2B 2W4PA 1K44A 3G8QA 5KFMA 3M9MB 1SC3B 4TQRA 3MMBB 2OAUA 2MZRA 5E3PA 1MWZA 1LK7A
chains in the Genus database with same CATH topology
4X4TA 1R27B 2KJVA 2QMXA 4IFVB 4B3MF 4JV1A 2IM3A 2EFPA 4WE1A 1K8AT 5KFWA 5KFJA 3CWJA 1NB7A 3GFXA 2RU3A 3RW6A 4BC9A 3U02A 2MY8A 5H9FJ 1Q53A 3HVWA 4ECUA 3VALA 3V4IA 2IBKA 3L09A 4F02A 2B4VA 2IVFB 1D8ZA 2ADBA 5F0UA 1N36F 3QO9B 1RTHB 2DGOA 2GMHA 2LQBA 3QO9A 1LV5A 2NUHA 3BN7A 4R0EA 3V81B 2FJXA 2CPEA 4DV3F 4XO0A 4IR1A 4HL9A 1W25A 1QE1A 2WB4A 3MD1A 4NPOA 4PQAA 3WZ0A 2JL9A 2A2CA 4ECZA 2NSBA 2IAJA 3NAIA 1ZH5A 1Y5IB 4WKRA 5D77A 3PX4A 4M8LA 5J1EA 2LVWA 4H4OB 4CQ1A 3D2WA 1C0TA 3DMJB 2OPQB 1M0SA 5J2NB 1U47A 4YB6A 2ILZA 2ZH6A 1S76D 2XS5A 1MW7A 1E6YB 3H2LA 3PM9A 4YOEA 4MIWA 5KFGA 5L9NA 1YIJS 3DXBA 2Q6BA 2I0XA 2UVVA 4IOAQ 3QGHA 1X5PA 3D1OA 4EZ9A 2GQQA 4DBQA 2CJKA 2XG8A 3FEYB 3SV4A 4ZPAA 3SSSA 4ECSA 2FJWA 3VAJA 4IFYA 1ZTTA 4QYRA 3J80Y 4FF1A 1XMQF 5F9NA 1ZOTA 3KLEA 2O3DA 5JUMA 3KLEB 1JLFA 4EWTA 1SBRA 3VF0B 4X64F 1N5QA 4M1KA 1LWCB 2KT2A 4ECXA 2PI4A 2GO8A 2AJ4A 4QPTA 3MAHA 2DNGA 3K59A 4PUOA 5KG6A 5L1LA 3MF5A 2YNHB 3PW7A 3MUMP 1RTDB 1DHMA 2UVRA 3O8WA 1U49A 1Q82T 1X8DA 3ENWA 3N5FA 4LVOP 3IS9A 2XCAA 1VQLS 4J9QA 3H25A 1XMOF 2IFXA 3JSRA 3IFEA 4OJ3A 3SV3A 1HI8A 3ETOA 4OHWA 1KFDA 2JVRA 5F41A 5C42A 3SEOA 3LP0A 3SXLA 2HMIA 2YKAA 4HVZA 4KJIA 4ICLB 4FXVA 1N5YB 2KDOA 2YNIB 3IWNC 4U7UK 2IHR1 3CCMS 4N76A 3BZQA 3AB2B 3WX4A 3VAKA 4XPCA 3UR0A 3NLCA 3BDPA 1RT5A 2C3PA 4KE5A 2L3MA 2D9OA 4AQYF 5KFAA 3ICLA 1TK0A 2V8GA 5F8LA 3GQCA 2M4MA 1HBMA 3QGIA 4ZVEA 4X4SA 2XLIA 2P9GA 4OIXA 2I2YA 3K5LA 3MEEB 2Z8QA 2MQPA 3LH2S 3NWGA 1JLGB 4F2SA 3IXQA 3TAQA 4NYOA 2EK1A 2BYCA 2XMVA 1MMLA 4ZK7M 2BZ2A 1U1KA 5LXRA 3IRXB 2VG6A 1VQNS 2ZOGA 1RT4B 2ZKUA 2BOPA 1RT1A 2A3JA 2KYZA 1RP5A 4AUKA 4CO4A 2AD9A 1Y7PA 5CYMA 2BUNA 2CPZA 2RUGA 3W7BA 3HZGA 1M1KT 2XI2A 1X9WA 2RD5C 3C46A 3EX7B 2JLGA 3K5MA 3UFCX 3C6TB 1E6VA 3L95X 5CZVA 4G6VB 2DJWA 1T3OA 3MM6A 1ZTWA 1N0UA 1VQOS 4I67A 4DUYF 2HGMA 1SH0A 2J5AA 3LWMA 3E2EA 5F8HA 1VRTB 4RKUC 2W9CB 3OFEA 3DNCA 1GTHA 5DM7Q 1XR5A 1D9AA 3MCSA 3OFFA 5AXKA 1HWIA 3MM9B 3I4HX 2IJNA 3OBIA 2UV8A 1EETB 2JOQA 2PEHA 3BF4A 4DOZA 4ETZA 2L41A 2M9KA 5KFBA 1SL1A 2KZMA 4ZP9A 4P2SA 1IJFB 4ZPCA 1X4FA 2DNHA 3M30A 4TQSA 4ED7A 3DYAB 4RNNA 2L9NA 1IKYB 3BS9A 3IR6B 3MD3A 2EW9A 5A8RB 1JLCA 2I5JB 5A8KA 4K2XA 3PEJA 3NKYA 5B0DA 2XNRA 1N88A 4PPDA 3H5YA 4Q2LA 2HW3A 1TVRA 3V6KA 2MQNA 1QLNA 1MROA 4RW6B 4C3KA 2O5DA 4N8NA 3PZPA 2DR8A 2J9CA 3OXGA 2RH3A 3DLGA 2KG1A 3F56A 5I3PA 2PIIA 3HHDA 4Z2XA 3PW5A 1IQTA 2C42A 4U6PA 4HTJA 4O23A 2JC0A 3LP1A 3JSMA 4IRCA 1WHWA 5GADU 4G3IA 4ZCIA 1HBNB 3I5CA 5IT4A 1N32F 4NCGA 1R3NA 5D6GA 4B3TF 4FBTA 1VQMS 2M7SA 4R5PB 2GHPA 5B0FA 4ES3A 5EWEA 4PCQA 2OMOA 1NK5A 4YB5A 1WG5A 3DRXA 1RT3A 1ZZFA 2EFQA 3LF0A 3AB4B 3CCWA 2R8KA 2HNDB 1S6PA 2GIRA 5DGBA 5E7OB 2ABYA 1HQEB 3QAUA 1EP4A 1TKZA 3ISNC 2N4CA 1TKDA 1VFJA 2XMJA 3TAPA 4IFVA 4KV8A 1OWXA 1S0NA 1Y0HA 3DCAA 1MU2A 1TL3A 5E41A 2DK2A 3DM2B 4RNHA 1Q8BA 4K50A 1PSDA 5KG2A 4XPEA 4FYDA 2HWHA 2KYXA 3DLKA 1U6BA 5D4NA 3OTCA 3IO1A 5CCLA 1L3VA 2O01C 1O0PA 2X1GA 2YVSA 2ZKTA 3IAM9 5BYQA 2PA3A 1MMNA 1FXDA 5T14A 4Q45A 2EK6A 3THPA 2KVIA 2ZOFA 1JNRB 2F4VF 2VPYB 1TR0A 2RB7A 3E01A 2FUG9 4PG6A 5DS7A 3KLFA 1KOOA 4DUZF 1VBZA 4IRKA 4ZS6A 4MAKA 1VQYA 4G1PA 1T03A 1S48A 5F8MA 2VFTA 1WHYA 4FPRA 1KTQA 4PXDA 4C9DA 3GV7B 3KHHA 3N4WA 4NLOA 5KFCA 4DSKA 2FGCA 4QR0A 3KJVB 2RDJA 4LIRA 3O5TB 2J6SA 2CRLA 2WOMB 4BWJA 4HDHA 4IDKB 5H1SV 4OZNA 5CXTA 3O44A 2IA0A 2HNZB 2QT7A 1RA7A 1SQEA 3THTA 2CPJA 2QZ8A 1S49A 3OPKA 2L9DA 2X51A 5KG0A 4X66F 4QIGA 2GNKA 1HPZB 4BDPA 3R27A 1TKXB 2N7YA 1GTEA 3I0SB 1Q7YT 1X4GA 4Y2KA 4ILLA 1AROP 3LQVA 4IFYB 5KFOA 1TKTA 3ISND 2RRBA 2OJ3A 1P1TA 3PXGa 1DQ8A 3CC7S 2XY7A 4ZPBA 1GXTA 3CMAS 1SXLA 4RW4B 4Y28C 1RKIA 1X4HA 4B3OA 2YWKA 1LOUA 4ID8A 4YQWA 3FFIB 4C3LA 1VQPS 1DQAA 4RUHA 3EXCX 3TANA 4C8OA 1IKXB 2N3LA 1H2TZ 1SJ1A 1TAQA 2V4JA 3PO4A 2B4OA 1TV6B 3OR1B 1U09A 2J0QD 3CDEA 2HHSA 1NRKA 3K58A 3GR1A 4URQU 1UFLA 2BA9A 4O3QA 4XDCA 3MI7X 4AL7A 3JB9k 1FCAA 4DN9A 2P6SA 3VZIA 5GAHI 3G6YA 2AGPA 1SL0A 3BGFA 1OO0B 2K7JA 1RT2B 4PWDB 2N3OA 1HR0F 2MQLA 1NK8A 1SJRA 2R9LA 2BJDA 2P9CA 4TU9A 5DDRC 2YWEA 1RA6A 1WTBA 5HMYA 1UEVA 1SJ3P 2XI3A 1K1QA 4QW9A 3KK1B 3SDEA 2ZHOA 2B9YA 3E3XA 3TO8A 1BD6A 3PR4A 4F67A 2PDAA 3SSRA 4C98A 3B78A 5KFVA 2AJFE 4CNYA 4UY85 2FD2A 2E1RA 4CO3A 3IG1A 3BREA 4RLEA 4Y6IA 2V8VA 4KPYA 4HYKA 4NL5A 3FRYA 3ENVA 4WK1A 3G6ES 1S0MA 2WONA 1RYSA 1Q16B 3BSOA 3Q8PB 3M6WA 2IAJB 3GE9A 4WYWA 5HROB 1D1UA 5AXLA 2MQQA 2YWGA 5KFKA 4J37A 1YTYA 3GIIA 2VONA 2CIMA 2MYFA 3PEHA 4IQMA 1HNXF 3M6XA 5THWA 1UEUA 2D1CA 4C3MA 5BR8F 5B0GA 2DGWA 3SCIE 1SV5A 3NG8A 2BRKA 1Y3KA 2RVJA 3FRZA 4DPOA 3VQSA 2IC3A 2I1RA 2WBRA 1CG2A 3GFZA 3PIPQ 3NS6A 2G0CA 4QYZJ 2VD3A 2JX2A 4J9MA 4A8KA 2C22A 1YQHA 1RQ0A 4I6YA 4YR3A 3GILA 2C2RA 1V6HA 2XNQA 4JBCA 1GQEA 2N7CA 4RW9A 4AL6A 1KQGB 4B9SA 2GJIA