3M05A

The crystal structure of a functionally unknown protein pepe_1480 from pediococcus pentosaceus atcc 25745
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
112
structure length
99
Chain Sequence
AMATKLVIAIVQDKDANYLSDQFIDQNVRATKLSTTGGFLQSGNTTFMIGIEEERVPEVLEIIKKASHTREEFMTPYPIKVQVGGATVLVLPVDQFERF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein PEPE_1480
publication title The crystal structure of a functionally unknown protein PEPE_1480 from Pediococcus pentosaceus ATCC 25745
rcsb
source organism Pediococcus pentosaceus
total genus 18
structure length 99
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m05A01
1V9OA 5D4LA 3T9ZA 4ZK7M 4CO3A 4IYQA 2GW8A 2J9EA 5D4NA 1VHFA 3TA2A 2RD5C 1UKUA 2NUUG 3O8WA 4USJC 1O51A 4WK1A 1OSCA 2ZOMA 2J9CA 2EG1A 3MHYA 3NCRA 2J9DA 3AA8A 3GSDA 4CO4A 2NUHA 2Z0GA 4CO1A 4CO5A 3CE8A 4YB6A 4USHA 4USIA 2VD3A 2CZ4A 2JJ4D 3X3UA 4RWWA 5DRKA 2O66A 5DS7A 3NCPA 4RX6A 1V3SA 2XULA 1J2VA 2EG2A 3O5TB 2DCLA 1QY7A 4RWXA 4AFFA 3TA0A 4NYOA 1NAQA 3TA1A 4C3LA 4D3GA 1HWUA 1UFLA 4CO2A 2NS1B 2O67A 3HLUA 4C3KA 1GNKA 2J9DE 4CNZA 1NH8A 1KR4A 1P1LA 3AH6A 1UL3A 2E66A 4C3MA 2XG8A 4R25A 4OZLA 4OZNA 4YB5A 2XZWA 1NH7A 5L9NA 1V6HA 1PILA 4RLEA 2PIIA 5D4OA 2V5HG 1V3RA 3L7PA 3AA9A 4Y65A 4E98A 3AHPA 2XBPA 1O5JA 4OZJA 1XK8A 3M05A 1UMJA 3LF0A 1NZAA 3DFEA 3BZQA 3NCQA 4CNYA 3OPKA 2GNKA 4Y6IA 4YB7A 4WK3A 4CO0A 1Q1KA 2GX8A 4D3HA 3N5BA 1H3DA 2ZFHA 1VFJA 4NYPA 5D4PA
chains in the Genus database with same CATH superfamily
2DEJA 8ATCB 5E3RA 4QWEA 1VQPS 3V6JA 4MKVA 3G6ES 2GCFA 4LF4J 3NOGA 5I42B 5AJ3F 1DQ8A 4CO1A 4X84A 2DGOA 2L08A 1IBLJ 3Q8VA 3RGIA 4BHQA 3CDWA 4ZVRB 4DEZA 5LSRA 1M5PC 2V2KA 3CCVS 4ED4A 3I0SA 5KFUA 4DR5F 4YEAA 3UE2A 4K4WA 4IG3A 4RW6A 2W9BA 3KK3B 4LRAA 2OELA 2MKJA 3SDEB 3T6JA 1FE4A 1C1CB 1X4EA 4EUVA 3IFEA 4YFUA 5KFOA 2NPIA 1RZMA 1SIZA 1PYTA 5F8IA 5KG3A 3N01A 1WHYA 3ONQA 3OHBA 4MK8A 1RAHB 2MGZA 1GT8A 2B4OA 2OPQA 3K5MA 4RW7A 5CXTA 2BW7A 3MM6B 1AW0A 2LEBA 2HS3A 3CXCR 4KE5A 1XMBA 2L9DA 3ETOA 1SQGA 2W8KA 5DLFA 2DXDA 3HF5A 3LP0A 3Q83A 1R0AA 3FQLA 3HVTA 1FKPB 3PYDA 2LDIA 2NXJA 4E8UA 3W8PA 3NCPA 1TV6A 3G87A 2PMZD 3OL6A 1IQTA 3PYFA 1UP1A 3MEEA 5ETPA 4KFBA 1EAYC 4ZIVA 2AWZA 4P2SA 3HSJA 3THTA 2OPSA 1XNQJ 3TUIC 4JUZA 2IC3B 5F9NA 1U02A 2G4BA 2JLEA 3VGVA 1JLAB 3AA9A 2PO4A 2XZDB 1MG7A 3DFEA 4DR7F 3G6XA 1SPBP 3A8EA 5A2QU 2CDRB 2VG5B 3T1YF 2F4VF 2FJEB 4TYAA 1U1KA 4IYQA 3HKWA 4UQGA 3ENVA 4NLTA 1NK0A 1MWQA 3J80Y 1YHQS 4RU9A 3CJQA 1WHWA 2V2ZA 2V68A 3GSDA 4LJMA 1CC8A 1S7HA 2JRSA 1KFSA 2QL5B 4EEYA 4WU3A 3SQGB 1TZ0A 1RUSA 2VFTA 3OFEA 3IAM9 5HI7A 1IR0A 1RWOB 2PD1A 4TYBA 3E51A 4K5RA 2JHEA 4XPEA 1HPZB 2YKOA 3HHEA 1Q81T 4LF2A 4MAKA 1R6YA 5IT0A 2YNIA 4JI4F 3DM2A 3A1YG 4ZITA 1S0OA 3VAFA 4B3SF 4UW2A 2JZ5A 2EK6A 1CSJA 1TKZA 3QZ7A 3JQMA 1UCNA 3SZ2A 2HHVA 1VQ5S 4IDKA 1HWLA 3BBCA 4LF8F 2VKZG 4X4TA 2CNOB 1RHMB 4PZVA 2Y1RI 3OV7A 5HROA 1F60B 5A0YB 3RB3A 2GFFA 1WF1A 3RTVA 2QLXA 1SV5A 1CJTB 2W9CA 3LPYA 1TUVA 4OJGA 3DU6A 5C2GA 2HHHJ 1S1VA 2AT1B 3TJAA 1SC6A 3LAKA 4DR3F 3CD6S 3O5TB 1S7IA 5J2MB 2C28A 3BGRB 3K89A 5HJXA 4LVOP 3BKTA 5AE1A 3W62A 4CI0B 4RBVA 3ILJA 2A6MA 4DL5A 1JLFA 3RG6A 5J1EB 4ED8A 4PQUB 3T9NA 2KVQE 4DX5A 3GR1A 4Y65A 3G82A 3R5CA 2C22A 1WKJA 4QIVA 4DBQA 1H7WA 4J9NA 2BJ3A 2BJEA 5DG9A 1NUEA 3FK4A 3W2VA 2XLJA 3KNAA 2LFVA 3ILIA 2NSBA 4EYHB 5ITHA 4PXBA 4C48A 5L1KA 1QD1A 1S1TA 4OZ3A 4ZN3A 2HAIA 4W90B 4X4UA 4HHJA 3I56S 1Q7LB 1TL1A 2RF2B 2CJBA 1O6XA 2K3KA 3I32A 3TUPA 1SI9A 2LQ8A 2MSSA 5L9XA 4DZ6A 3DI6A 1VQLS 4B3OA 2DY9A 2HBZB 2R8IA 1DY3A 4M63A 3MAAB 2Y1LB 4JV0A 2BEFA 2UVUA 3M9MB 4I68A 2PE8A 5CYQB 1B0TA 1JNZB 4V1Ak 4WKYA 1LWFA 4WJBA 3M6VA 5HN0A 5B0DA 3LWLA 2UUWA 4WP9A 4GKJJ 1FRKA 4ZVFA 1EJ7L 2IPOB 4K50A 3CCJS 1UA1A 4OX6A 3CDBA 3LP2B 4QYZK 3RUBL 1GEHA 3CT9A 3LANA 4DR6F 1FNOA 4TLQA 1S59A 3DOMB 4J9UE 4FVCA 4P2FA 1XMOJ 2O5DA 3D2WA 1VHFA 3HKZD 3ZTRA 2B5JA 2ROGA 3LGNA 2J5AA 2HBYB 5KFBA 4PQAA 2WVFA 3DRSB 1E6VA 1SKUB 2DGTA 1JLAA 3S8SA 3W2WA 2WSFC 3WIUA 5C42A 1SC4B 1UW9A 2CQ2A 1VDHA 3U02A 2VQEF 2B51A 4ZLPA 4CLLA 3KK2A 4X4SA 1FHTA 2F3JA 2DPJA 4DUYF 3GE9A 4FBUA 2HFOA 1RADB 4KH1B 4ETZA 1JJ4A 4CYUB 3D4JA 1RAJA 1Y0HA 2UUAF 3BGFA 1DQAA 2MZQA 5D0EA 2IA6A 2D3O1 3T19A 4W4MA 5J1PA 3W9IA 4EBEA 1R31A 3NLCA 1RTHA 4RUBA 3JAMU 2HMIB 5ETTA 1U1PA 4PCQA 2I2YA 4N77A 1S12A 2VHGA 3PRVA 3OL7A 1FRXA 3QWUA 3A13A 1KNZA 3EZOA 3ILOA 1W2IA 2CPIA 3G6VA 2GA7A 1X4AA 5GADU 2V9WA 1R8BA 3L95X 3K57A 2OMOA 3FCWA 4P73A 1NK4A 3BPSP 1OQ3A 1N56A 1IM6A 4P52A 1S6QA 3IO1A 2YKPA 1HWJA 2BANA 3WZ0A 3JSYA 3BR9A 3CD7A 4CP5A 3CJTA 2L3MA 2GNKA 5ETVA 5G0RB 4CTAA 3NWGA 2HAFA 4F36A 3J80U 4JI8F 1EP4A 3Q0AA 4M5DB 4LBHA 1JLEB 2RSQA 2YPZA 2VF3A 4LR9A 4UUXA 1NKCA 2BKNA 3H0PA 4RW8B 1N32F 4KBIA 4DV0F 4CH0S 3DLGA 3NGUA 2GC8A 4LREA 2JLFA 1U6ZA 2HURA 2C2DA 4X4QA 3QT7A 2CQ1A 2FDNA 1U26A 3I0RA 2UVWA 4PQUA 4PWUA 3FSIA 2UXCJ 1V3ZA 4EYIB 4A46A 5A8KB 3TNVA 3IBCB 2ZM6J 4I64A 3Q8RB 3W7BA 1ZBTA 3RBEA 5EGYA 4MKAA 3UR0A 3THVA 3KUEA 3MXHP 1M5HA 4ECRA 3AD7C 4HHHA 4PG5A 4C3MA 1M1HA 1NM2A 3HSZA 1X5SA 2D41A 3UD4P 4V19J 1URRA 5T7LB 3BQ2A 3M8YA 2WVCA 3HHLC 1EQMA 2XY6A 2JNJA 2CNKB 2UV8G 2F5GA 2RUSA 3MEDA 3IWXA 2WOMA 2E7XA 3PV8A 4QPTA 1HMVB 2EFPA 3EXYA 1Q53A 1RAIB 3MAAA 1X4BA 4DFMA 2CPYA 2Z2ZA 1KOOA 1TQLA 3PR4A 2EVZA 4MFBB 2J6UA 1KC8T 4NLRA 1Y10A 1TAQA 3C14B 2PC6A 3X3UA 4LFBF 4J9QA 4IH5A 4C11B 1LW2B 1QY7A 1WI6A 3H98A 2H51B 3H20A 5E3QA 2R7SA 5IWAJ 5HATA 3M8WA 2QZ8A 2CJ9A 4FYVB 4OZ5A 2KM8C 3M8QA 3JXOA 2NREA 1U0HA 3DOMA 3KJVA 2B6AB 2WB1D 2UUTA 3PCOB 2QIFA 4JI6J 1Q8BA 3V81A 3IM9A 2V8PA 1TUGB 3NP5A 3MCNA 2RU3A 1SH2A 4P6QA 1D9FA 2B43A 3Q8YA 3SSRA 3CSKA 2YXLA 5B0FA 4LRDA 4DDFA 3T6BA 4TY8A 1Y7PA 3GIMA 7AT1B 3B4MA 1YTYA 2CQBA 1YVFA 3I87A 2KXNB 2PDAA 4O44A 2R4FA 1VQ7S 1RP5A 2Z4PA 3EX7B 3QSYB 4MT1A 2ASYA 1RBOB 4QQBA 2DH7A 1MROA 2GAGC 4DPTA 4N5SA 3KXDA 1V5VA 2CYYA 2QL9B 2MMYA 2JJ4D 3BSNA 5CQGA 2KYZA 4L73A 2OFGX 4NEZA 2KHCA 4OQJA 4EO6A 2KRBA 3CB4A 2QA4S 2UXDF 2KFZA 3BN4A 4TU7A 2HVHA 2YKMA 1TK5A 2VL1A 1BQNA 3KTQA 3HK2A 1NZ8A 2LCWA 2YWEA 3ZZZA 2VUGA 3C6UA 2BDPA 4QBUA 2X51A 1FK9B 1X5TA 3TEHB 1JMTA 2PEBA 2DISA 1S6PA 1HD1A 5M2UA 1Z2ZA 3EPIA 1YDLA 3QMQA 4B17A 3PDNA 5FDLB 1WACA 3JSMB 4DCJB 2AEMA 1ZAXA 3OTOF 3C46A 1H98A 2HMIA 1PC4A 2K06A 1GK8A 3CC7S 1QE1A 5HVFA 1YKWA 1T9WA 3M8ZA 3TRGA 4DSFA 4YS2A 3RB0A 4X62J 3SQOP 2YQ1A 2ILYA 3B82A 3HD2A 3ISNC 5KFIA 2LVWA 1NJIT 4KPYA 3CC4S 4EU0A 1RT7A 3J7AN 3KOAA 4I69A 3NNCA 2F9DA 5LL6d 1RU1A 1R0CB 4HTIA 2V94A 1HBUA 4DZDA 3EZ5A 1JLBB 5G0RA 4BWMA 4J9LA 4ZLJA 2KZZA 1KP6A 2LQ9A 3DC2A 1RKIA 7FDRA 1CJVB 4M5DA 3IS9B 3RAXA 4K5SA 2N4DA 2P8IA 1XEZA 2QFIA 3BGUA 3DLEA 1DJ0A 1TELA 3ADAC 3IWLA 1WC6A 4PRFA 2IJRA 1VBYA 3RBDA 1WWHA 5D4NA 1MMLA 1PAUB 1BWEA 1FTRA 4U67Q 1R8AA 4WK1A 3UNGC 4O3RA 1KTVA 2J9CA 2ZVIA 2FZCB 2YWKA 3HHDA 1TKXB 1REVB 2HNZA 3L3CA 4KB7A 3KMSA 3W9JA 3OSPA 5LMUJ 5J2QB 4B9TA 2ZC3A 4Q8FA 5GAGU 2H4YB 3VGSA 4RZRA 1I94F 3PJWA 1GQEA 3BH6B 3RJMB 3QJLA 2MKKA 3NGTA 2RB7A 3CWJA 3LAMA 2ZBQA 1NBEB 2RAQA 2XG8A 1N33J 2DK2A 4OYBA 1VQNS 1RTJA 1D1UA 2GV1A 5GAEI 2AKWB 3RW7A 4Q5VA 1M0SA 2RHQB 2IAJA 3E01B 2ZH9A 3P5TL 2FZKB 4DPUA 4KTQA 2R7QA 2WSCC 3M6UA 3PJXA 1SL2A 3OTCA 2H3EB 4CNYA 1U49A 4Q2LA 3FCHA 2A1BA 3MR2A 1AFIA 5HP1A 1U8WA 1FRJA 2A3JA 2QSFA 4DV4F 2W4PA 3O2IA 2GX8A 3UPFA 2XS2A 3R7NB 1UVLA 3TARA 5AXNA 3AJDA 4YDDB 4WP3A 4IOAQ 1DLOB 3NCRA 4NMLA 2R2UA 2DY1A 4NCAA 4OX9J 1N36J 2HEKA 4ZVSB 2YQ3A 2BQRA 1TAUA 1SUQA 4J9MA 4NXNF 1K1QA 4RX6A 3UFCX 1KONA 4TQSA 2M8DB 3QIPB 1N88A 3R1HA 1VRUA 1KLMB 3LPEA 2YNHB 5MLCV 4ZA1A 4DL3A 4G1IA 4B3RJ 5KG2A 4YR0A 1FDNA 4R5PA 3T5HA 3GWCA 4F25A 2OH2A 5ETQA 3IG1B 1LWEB 4KV8A 3CJ4A 4RBTA 2CPHA 2CQCA 3BS9A 1WG4A 5KFEA 1RT6B 4OI2A 1T9UA 4MH8A 3PFOA 1A0OB 5DQIA 3W65A 1TUWA 4Q8EA 2OKQA 1HHQA 4H4MB 3D0GE 4NLUA 4Q2MA 2ZH4A 1JNRB 2CJKA 1X4GA 5CA5A 2R2RA 4QW9A 3UDVA 2L9NA 1S9EA 2V2QA 1FERA 5KT6A 2FY1A 4CLUA 4I4BA 2BACA 3POTB 5ETSA 3I55S 2G0IA 1NJYA 4DR1F 2W25A 3JSMA 2V8GA 4U9RA 2R42A 1XR7A 1IR1A 1ZPVA 1L3VA 3RR8A 3LH2S 4H4OA 4Q44A 1B3TA 1UVIA 1WDTA 4XPCA 2CADA 3F0NA 2ZHAA 1CC7A 4XAKA 3TQ1A 3MGJA 1G1XA 4U96A 3NMAA 2QMXA 1WHXA 1QJHA 3PO5A 4ZP8A 4HEA9 4ERDA 4ES3A 4TU8A 2FB0A 4USUA 2CUYA 3AFGA 4HR2A 5F8NA 2IRXA 1VQ9S 2XS7A 1X60A 2LQBA 4DCOB 4PXCA 2QGFB 3AXMA 3THPA 2W9AA 1UWAA 5K14B 1WG5A 2PA8D 3MF5A 5K8OA 4KSEB 1UFLA 4ICLB 2EWHA 2DPIA 4NCGB 2XNRA 2A2DA 4RNOA 2QTWA 4HDGA 4J90A 2JFDA 2H5EA 1VRTB 3NRBA 4MIWA 1X4FA 4ZP9A 3FQKA 5GAHI 3NMRA 5DM6Q 1SJ3P 5FJ4A 2BQ3A 2EI5A 4ZMMA 2COLA 4W92B 3PW2A 1Q8KA 4BBYA 2HVEA 3ITHA 1OWXA 3MI7X 3T1HJ 3ET6B 1VQ6S 4C8MA 4F26A 2VPZB 1QSLA 1FVQA 3MPVA 4I0WA 3KKFA 3R5JB 5J2QA 1FDBA 1FF2A 1VQOS 2GMHA 2QN6B 4NLDA 2DRAA 3M8RA 3CCMS 1H7XA 4CT8A 1WEYA 4DR4J 1KKHA 3N6MA 4J9OA 1RAFB 2RVJA 2ZBIA 4Q0BB 1TL7A 2W2PP 4USIA 4LSNA 2PFFB 3EYZA 2G2OA 1FFWB 1KS2A 3E01A 2HGNA 4PPDA 1N5YB 3UD5A 2PI5A 3CTRA 1W25A 2QJ3A 1T05B 3ZC4A 3I6PA 5KT2A 2P6SA 2EFVA 2ZHOA 4WWSA 4ES1A 1RT2B 3BO3A 4PEOA 4R25A 1VBKA 3QGHA 2HQCA 2C1EB 1IBKJ 5ETNA 2FLNA 5IS2A 4HHUA 6AT1B 3TI0A 4U7CA 1GTHA 3NEKA 2VOPA 3AY0A 2E9ZA 3E8OA 1CBKA 2I0XA 4OV1A 1DLOA 1M1GA 4UOHA 1YQHA 4FNIA 4JI3J 4YB7A 4IKAA 4OYIA 4O3OA 2CPFA 2KG0A 2YNFA 3CCLS 1HR0J 1Y5NB 3OUYA 2RDIA 4NCBA 4JI2F 1LQ9A 3I4HX 4IFVB 2F1FA 2MQLA 3U7JA 1RQ0A 3AAWB 3TJ8A 2GO8A 5KT4A 4ZOSA 1QTMA 4Z7YA 3RRKA 3AA8A 1CLFA 4IRDA 3IXQA 2X1BA 1U2CA 3NKYA 1LWCB 4TLRA 5DRKA 2XULA 3HX9A 1PG5B 1FRIA 2GIQA 4B9MA 2HHQA 2NS1B 1H6KX 1J5EJ 3PKMA 1S1WA 2XSJA 4CRJA 2LU2A 3D0IE 1HQUB 3LQVA 4GKKJ 4ZVOB 4K2JA 2R8HA 4DV6J 2X7IA 4ITSA 2PIIA 3M32A 1MWYA 2XMAA 3DYAB 4MMOA 2RKIA 2YWWA 2J7KA 4DL7A 2GVZB 4UOCA 3KLGA 4YY3J 3KHRA 1MWZA 4JV5J 3VAJA 3CCWA 3EDQB 1UA0A 1VCTA 4J37A 3KJQB 1EARA 4WFAQ 4N41A 3DMJB 1Q79A 2LXIA 1VFJA 1Y11A 4AYBD 5E41A 1SL0A 3CJ8A 1K1SA 2E7VA 3FUYA 3OR2A 1C0UB 4DV1F 3MMCB 5DO2A 4Z2XA 2JDJA 1NSPA 2CG4A 3MOJB 2B9YA 4OZ2A 2ZJQQ 4IG0B 5JVGQ 3BKUA 4M94A 2JEIA 4RPFA 3N4WA 5DETA 1NRKA 2MKCA 1S1XA 3CMQA 3Q8UA 2KT3A 5J2PB 4ZHRB 4UY85 3UN3A 5AJ3J 2RRAA 3EZUA 2MHEA 3OVAA 4QZVB 2ZBCA 3R2CJ 3KUHA 2O01C 2YTCA 3I5CA 4RNMA 4RU2A 1IKWA 5HK4A 2BE7D 3SEOA 3FFIA 3O1LA 4AXJA 4QCLA 5A8RB 3W5YA 2OPPB 3MECB 5LSLA 2CRLA 5KFWA 2NPFA 5DG8A 2ZOFA 1KBRA 2W24A 4DL6A 4A47A 2IJNA 2JWNA 3K7RA 2BBEA 5BYRA 2VG7B 2D1CA 5LSOA 3RBXA 4DN9A 3HD1A 3HP6A 1F1BB 2UXBJ 1V5IB 4LRFA 2EKNA 3F44A 2NSCA 2HRYA 4DQSA 1ZPWX 3A8JA 4I2PA 5CYMA 1R6VA 1NHKL 1HBOB 1X5PA 3WHIA 2HQDA 3N5FA 3PX6A 4ED0A 5KFRA 2JVOA 2HNDB 2LKZA 1HWUA 3KLVA 3A12A 4B3MF 4XDCA 4C6AA 1QDUB 1NDCA 1SQFA 2QLBB 3EUNA 1Q7YT 2OSRA 2OLWA 2LLZA 3BBBA 2DXFA 4L3NA 2WW8A 1M5KC 1N8RT 2R7RA 1A6LA 4BC9A 3DLKA 2ZITA 4PR6A 1SL1A 1ZA1B 4NXMJ 1IJEB 4ZPDA 1RISA 4M5KA 5BXIA 3K0JA 1I51B 1FDDA 3MM5A 1VQSA 4GVLA 1JLCB 1HNZF 1D9AA 5FLXY 2AJ2A 1RWMB 3D7SB 3VZHA 2MQQA 4CO0A 2FVQA 2I38A 3PZPA 2NXEA 3EPGA 2XNQA 4PWDB 2CJXB 4OJ3A 1UAWA 3QT8A 4CLWA 2RRBA 2JEGA 4WKRA 3R5DA 4R8UA 4DR7J 2MKSA 3FCVA 3L9ZA 4YP3A 1KFDA 1PYSB 2AJ0A 1QSYA 2IMOA 1RT2A 2DH8A 2V8HA 1MU2A 4ZP6A 4RWWA 2O66A 1HKAA 3UN2A 3VTIA 3TAPA 2KVIA 1K73T 4L76A 2F9JA 2HLUA 3HVRA 4ELVA 1B70B 2PEHA 4NI2A 5KT3A 4GVBB 1PJ5A 5BYQA 1XNRJ 2VBWA 2P9CA 3U27A 4O0IA 4LF6J 2DO4A 3VHQA 4IFVA 3L7PA 4JI5J 3QPIA 4B3TF 1O5JA 2E5LF 2CKWA 2DNQA 3UVJB 1KVKA 5HLFB 1VOMA 2HBRB 2HG4A 2XCAA 4JI4J 1VQYA 1S6UA 2CG8A 5IXUA 4J9SA 3CD5A 4CO3A 3AT1B 4LF4F 2HLTA 1FRHA 2XMJA 3DRPA 1KTQA 2DNOA 5CH7B 3UCZP 1U2FA 2C3PA 2X3DA 2JEFA 3U1LA 1L3UA 3ETMA 1RK8A 1HQUA 5SUHA 2VG6B 3NS5A 2D9PA 3OLBA 4NE9C 1PIEA 2CPZA 3AD9C 1QAJA 2FHOB 1RA6A 1VC6A 4FYWB 1A7GE 1BMQB 1YWXA 2NZCA 3CIZA 1U1LA 2NR0A 5HO4A 4O3SA 1HNIA 2RIJA 1U6FA 3G2XA 1FEEA 1WTFA 2BKOA 4I6WA 4DR3J 5D4OA 1V3RA 3FMWA 4FZVA 4K4SA 1C0UA 1HYSB 3MMCA 1PSDA 2NYHA 3NG8A 1QUPA 4IOBA 4QIGA 2L41A 3VV2B 1MN7A 5C25B 2ZH6A 2V9KA 1RT5B 4XTTA 3IBWA 3KLFB 3GV7B 2AQ4A 4J9PA 5HAOA 2N3OA 3QIDA 3MM8A 4F50A 1DFDA 2MXYA 2H54B 1T3OA 1E6YA 4Q43A 2AGPA 2HNYA 1CJUA 4Z37A 2CZ4A 4KAIA 4TVAB 4DUZJ 3IR6B 1GMVA 2GJFA 3ZTQA 2E5GA 1N5TA 4ZVPB 3H59A 1YJTA 2AV5A 2EFNA 2FYXA 5KT5A 3TAQA 3D6FB 2EKYA 4J91A 4Q7AA 3M8PA 4NMXA 3PX4A 1XNQF 3TAMB 3A4TA 2LQJA 3HZGA 2DXEA 1TL5A 2ZH3A 3C15B 4OI3A 3C2PA 3WIVA 2AP6A 1FE0A 4B08A 2ZZMA 4A8FA 4CM0A 3QGPA 3VALA 1NKEA 2MHNA 4G65A 1UWBA 1XK8A 4NZ7A 1OMSA 3ZXWA 3J7ZT 1FXDA 3KLEB 2I5JA 4Y6IA 1DTTB 2ZNYA 3VCDA 4NYPA 1VLOA 5KFZA 2HRUA 4H4KA 4N76A 3MR3A 1JJCB 1NJWA 4G3IA 2XWYA 2FUG9 3KLHB 2UP1A 1QAYA 1IKYB 4DX7A 3AQPA 1CULB 1XJWB 4RR5A 4OZ1A 4CLZA 3CJKA 2XQCA 2GQQA 2ILZA 1C1BB 4QWAA 9ATCB 1VQKS 3LTOA 4ANCA 3C19A 1N4LA 4EGLA 4D3GA 1U1NA 4TU9A 5LXRA 4DXLA 1I6JA 2NZ4A 1F6TA 2XB2D 4OYAA 3DGVA 5M2RA 3CC2S 1RT3B 4WFBQ 5IT4A 1CVJA 2WTFA 2G1DA 4J5OA 5DGAA 4NYZA 1Q4RA 2KFNA 3KYLA 4PUOB 4YDXA 3N6NA 4DF4A 2HQIA 1HQEB 3UO0A 3CCRS 1TR0A 4NRUA 2GGPB 2ZH1A 2IM2A 3PRDA 4TKTA 2HRTA 4DR2F 3H7HB 2DR8A 3C66A 2C3UA 2ERRA 4DS5A 3CJ2A 4O3PA 4OI0A 3TZXA 4IOCQ 3Q22A 2VH7A 2RJZA 3BM7A 2HHHF 2XHWA 1KQFB 5L38A 3ENWA 4P72A 1VISA 4BLGA 2HZCA 5CZXA 3I0SB 2K2PA 1YK9A 3OXFA 4ZPTR 3OFGA 5DDPC 5HLFA 4IG3B 4RW6B 4JV1A 2DIUA 1P1LA 3M1VB 1RKJA 3DXSX 2CPJA 1HI0P 5FLXU 2XY7A 3FBFA 2VFVA 3Q89A 1FEHA 5KG4A 2JC1A 2ZZTA 3V6KA 3D67A 2O1PA 1J5OA 2OPRA 2KT2A 3HFVA 4N7TA 4F2RA 2MGZB 4P7TA 4WK3A 2OPQB 2FJVA 2K3IA 1ZZFA 2XO6A 4RW7B 3DOLA 1K44A 3Q2TC 4FYDA 3QYYA 2J7WA 1YIJS 3V6DA 3OQ2A 4ES2A 4OYPA 1XWLA 4C8KA 4M1KA 2KDOA 3LP0B 3GG0A 2QT7A 2VICA 3PX0A 1R0AB 4CLTA 3MEKA 3HVTB 3MR6A 3I4PA 2ROEA 1Q95G 1WC1A 2F4FA 5K20B 1FRLA 4C7QA 3CPWR 3MAHA 4DV0J 3NL0A 1RWWB 4ECZA 2IY5B 2Z30B 2ZUGA 3DGPA 1EIYB 2YNGA 4KFBB 1H2TZ 4GKJF 1WC3A 2UU9J 4ECQA 2OPSB 3GIJA 4YR2A 3JTPA 1WDDA 3KK1A 3NNHA 4KGKA 1WSVA 4AL5A 3DU5A 5KFNA 2RUGA 2KB2A 3CDAA 3KLIA 1XMOF 2ALZA 3AOCA 4FKXA 3SMZA 2WBRA 2BW2A 4FYYB 1GXTA 2E1PA 4DPOA 4CCHA 2FLOA 4FNHA 1FESA 3IMQJ 1T03B 2DIVA 1HHSA 3I96A 4X66J 4XK8C 2X1AA 4DV7J 4K4XA 2DCLA 4AFFA 4C3LA 4R0JA 2PSZA 3D1QA 1AZSA 1K47A 3EICA 1RA7A 4WFNQ 4YB1P 2B9EA 1DTTA 2G2YA 3J81Y 5B7WA 2YNIB 2VFRA 3DM2B 3MPDA 4P7VA 5L9NA 2Q66A 1P8GA 4OX8A 4LFBJ 5FD1A 3HULA 1TKZB 1LFPA 1IKYA 3JYTA 3EGNA 2FQQB 2UVVA 2EC0A 5KG7A 4IDKB 3SIPB 4A8XA 1C1BA 5HQ8A 5KFFA 1OS5A 2VA2A 3OXLA 4RO0A 4K7QA 2V0NA 1T9XA 5HROB 3K5OA 2YKQA 4DX6A 3ZTPA 2DT9A 1RTIA 5L1JA 4RBUA 2DR7A 2J7UA 1TL3A 1PCAA 1GX5A 1EKSA 2YVSA 2W9CB 2CWXA 4ANDA 1GH8A 5DZ6A 4QIEA 5IM0A 2RNEA 4JI7J 1IR2A 2KTQA 3HHLB 1S1VB 1SJQA 2JH3A 1YBAA 3KDOA 1AUDA 3CCTA 5IT9Y 3PEJA 4K8RA 2C2EA 5AXMA 5F3ZA 1NNDA 5F8MA 2YKNB 5EDWA 5B0EA 2MYFA 1JLFB 1X4DA 4KO0A 1S48A 1N5VA 2VDIA 3G82B 3H4BA 4DL0C 3QWPA 1NPKA 1OY8A 5EHHA 1PC5A 2FLLA 3Q8PB 4OHYA 4G6VB 2XMVA 4DV5J 2KRRA 1AB8A 3CW2C 5JMNA 3W2VB 3AB2B 3TP2A 3MCMA 3H5SA 2KM8B 4L3KA 3IR7B 2B9WA 3OTOJ 2D9OA 4HLBA 2HQ3A 1NJZA 1S1TB 4ZPBA 2JEJA 2ASJA 3IGNA 3SCKE 4U7UD 4FP9A 4Z7CA 2M52A 2MTLA 3M1VA 4MYTA 4DFJA 1TL1B 2ZBRA 1EHWA 4G1QA 2ZM6F 1YRUA 1OPZA 5GMDA 1I3OB 3SSSA 3DI6B 1NAQA 2FZGB 2C2RA 1SH0A 4B3OB 1BE4A 4CWBA 5IQ6A 1OY9A 4CLKA 3MPYA 3L7OA 1GAOA 4NLGA 2MQNA 2CQGA 2RH3A 1KQSR 1LWFB 1VHIA 1VC0A 1FXLA 1YRXA 3QJPA 2N3LA 1EETA 1RCXB 2C2NA 5D0HA 1L3KA 3NCQA 1QSSA 4V19X 2UV8A 2DKOB 2WHOA 1LV5A 2H1YA 2HFUA 2J76E 1IBMJ 1FX4A 4FXVA 2VC1A 2GHWA 2QO3A 4MYUA 1B0VA 5C24A 5KAKA 4F0KA 1ZH5A 2YKAA 3TVYA 3BEGB 3PTWA 2NUUG 3B8HA 2EG1A 4LIWA 2M4MA 2XS5A 1RU2A 2B5JB 2PT0A 2LA6A 3MFHA 2ZKUA 1TK8A 2CFXA 2JFKA 4PG7A 2FTRA 3HVAA 2IHR1 1RAGB 4P2XA 1E6VB 5IWAF 2DHSA 1AYEA 3VQTA 3W2WB 3HXMA 2HHTA 5C42B 4IFYA 4N8OA 3LP1A 3N6LA 2XI2A 1TKTA 3WDOA 4JBCA 1HBNB 2P6TA 2ZUAA 4TXSA 2Q6BA 3KK2B 4JI6F 2M5YA 2HS4A 1WF2A 2HSEB 3OFHA 2CNNB 2I1RA 3JQKA 4E98A 2QLJB 3R8YA 5GADI 2HPUA 3LUYA 5LMNJ 1PBUA 3MD1A 5KG1A 4AUKA 4FXDA 1BLUA 5E0OA 1T03A 2Y3YA 4A8KA 1VC5A 1IXKA 4A8MP 1PJ6A 1X4CA 1RT4A 1UKUA 4ZJLA 4TN2A 5KFJA 1MMNA 1T9YA 1SBRA 2J9DA 4K0KF 3PKYA 1U45A 2QYGA 4BS2A 1LXJA 1RTHB 1QLNA 1S9GA 1F3FA 2ZH5A 4ID5B 2V4RA 3PM9A 1NEEA 2Y8WA 2C2MB 2IRYA 2FHKA 5D0GA 4OV6A 3AODA 3F41A 1T8EA 4RW9A 1MLAA 2G1HA 3O6QA 2HIQA 5GAHU 1T9TA 3IRXA 3OD2A 5ETRA 1JQGA 4FS2A 3IP0A 2NYIA 4NXNJ 3M2UA 3H5YA 4I56A 2RMLA 1NB2A 1S6QB 2DH9A 4WE1B 4QPXA 2V5HG 2MY8A 2DNLA 1WTBA 6FDRA 4UZCA 2M0GB 2FVSA 2BANB 4KHRA 2BVZA 4LF5F 3KG0A 3MURP 2YY3A 2IVFB 3H2UB 1J27A 1AROP 2ZE2A 1N6QA 2A6OA 4CTAB 3VAHA 1EP4B 4LF7F 3EVWA 3OR1A 5RUBA 4X62F 2I9SA 3HHLA 3EJMA 4FN5A 3QSIA 2NLWA 2Y8YA 4C8NA 3SFGA 1NDLA 2AZ3A 1IKXA 4IH6A 1S0NA 2HKEA 3DLGB 5C5JA 3P4UB 3MUTP 2YKNA 3TW0A 4HKQA 3I0RB 2DNMA 4QR0A 1QVGR 3I9ZA 3J81U 2UUBJ 1RWNB 3MOZA 3HLUA 4A8WA 2XZTB 3DRRB 1B7YB 1LK5A 4LT6A 4CNZA 4PYDA 1RTZA 1EX8A 2Y0BB 3FKBA 5IZHA 4LMZA 1WOSA 1B99A 1N0UA 4U7UK 1RYSA 4HDHA 4YQWA 3LOUA 4JYAJ 2GIRA 3DLJA 1V6HA 5T14A 4OLOA 4WYWA 4LFCJ 2XLIA 2FHMA 3LF0A 2NXUA 3W5XA 3UN5A 3C16A 5A6WA 3HFKA 1TKDA 1WC4A 2KXHA 4QYRA 2DNPA 4HH0A 1Z1ZA 3D3CJ 4F0MA 3MEDB 4ECSA 2WOMB 1M5OC 4P75A 3G6YA 2KT5A 4EMDA 1IKVA 3ZZYA 3D66A 2F65A 1Y9OA 1DZ5A 2ZDOA 3M30A 4ED7A 4DG1A 3UWTA 1HI1A 4LF9J 2XC9A 2W7OA 2N82B 5IT9U 4U95A 1H74A 1HA1A 1EZZB 2E29A 3DHWC 5IOLA 1NO8A 2WB4A 1U7LA 4O4GB 1VBZA 1SXLA 2QV6A 1X9MA 4KRWA 3LWMA 2W01A 1RLCL 2XM3A 4ZVQB 3M8QB 1P27B 3SV3A 5B09A 1U0HB 1NMEB 3B4DA 3KJVB 3GYGA 4Y2AA 3PACA 3GG1A 1U0SA 5ETMA 1FWLA 4NL5A 3FEXB 3V81B 4TNOA 2H65B 3O44A 5DLGA 3KJNB 3UCGA 2XMMA 2YH0A 4F3QA 1IWAA 2ALYB 1CPZA 1HIYA 3MM9B 2BRKA 4TY8B 4X65J 3H42A 3NGDA 2BXJA 5DDRC 4OX9F 1N36F 3R5GA 4O44B 2Q79A 1MW7A 2BOAA 4YUDA 3DDKA 2VQFJ 1Y00A 5KFSA 4ZJOA 1IJFB 3GSIA 1MROB 1HBNA 1ZOTA 2LDYA 4FKYA 3GCXP 3GZ7A 3CO0P 1JJHA 2MSTA 2LA4A 2C3YA 1H72C 5E7OB 3EWGA 2UUCJ 2HWHA 2O67A 4DQRA 2CQ0A 4B3RF 2YKMB 5MAOA 3RW6A 1FXRA 2BA9A 1BQNB 5LM7E 2ATCB 2HVIA 4DV2J 3EGZA 4JI1J 3C6UB 2CIMA 4I67A 2W2MP 2DNKA 3PW0A 1S6PB 2BJ9A 1JXVA 1R8CA 3SCIE 1C4CA 3NAIA 1VQMS 1LFWA 3R97A 5D15A 4DX8H 1H38A 3CIMA 3DRYA 4ID5A 1GMWA 4FPIA 4F0HA 1QE1B 2J0SD 3T9ZA 3P96A 5H9FJ 3ELHA 4NA1A 4USJC 3PNIA 2AHOB 4Y3CA 1FJGJ 2J0XA 3EGWB 4HACA 1ZAVA 2J8AA 3CE8A 4M5MA 1XMQJ 2SXLA 2VZ9A 2LEAA 2I8EA 3M2RA 2CJAA 1XQIA 1SKRA 4WE1A 5SZTA 1ZA2B 4JI0J 1UZDA 1PGZA 1RT7B 4AE5A 2AW0A 1IQZA 3GONA 1M5VC 3GV8B 4ECVA 1HBUB 2JX2A 3NGRA 3F56A 3K2YA 3MMBA 5HJYA 1YRTA 3HO1A 1FT8A 2XI3A 1WNEA 1IM4A 1LEOA 4EO8A 4NZ6A 3P6YC 3FBEA 2K1RA 5GAGI 2DHXA 3M6XA 1LNQA 2MLXA 3AHPA 3DLHA 2LXFA 5J2NB 2BQUA 1N48A 3DLEB 2A0FB 2KFYA 1F5BA 4ZCLA 1O0PA 1DQ9A 3C6TA 3OBIA 4BDPA 2XO7A 4OYMA 1HQ2A 2BRLA 4RUHA 3DOKA 4YHHJ 2C2OB 1NPRA 4P74A 3TA2A 4DSKA 2BZ2A 1NK9A 1OSDA 1RWPB 4F4YA 3QT5A 2ZOMA 5KFPA 3DRRA 1HLWA 4L75A 2KL8A 4O4RA 3J7YU 4ED3A 2HNZB 1QAIA 3J7A1 5A8WA 1VBXA 1DTQA 5A2QY 5H9EJ 2V50A 2FJXA 1C0TA 1H2UX 4KJIA 2W4DA 2J9DE 4RW4B 1FWPA 3JS9A 3OL9A 2DHGA 3D6TB 3CCQS 3VGTA 1YJWS 1XC9A 3AD8C 2LYVA 5F9LA 1RTJB 1K9MT 3IC1A 2OMLA 4EBCA 2ZHBA 3GPAA 1LWXA 2IAJB 3T1HF 1W2BR 1S76D 2MZRA 4K2XA 5KFMA 2IM1A 1NZAA 5EX3A 4C8ZA 1FJCA 5HP1B 4WXOA 4UOFA 1RSCA 2EPIA 2RHSB 4K59A 1RHJB 2CDQA 2OD4A 4DR4F 5M2PA 2BE2A 2XMWA 1M1KT 1UEVA 2MQPA 3MMJA 4NRTA 4O4GA 3EXCX 1X9SA 1F2HA 3CULA 4DS4A 3B6BA 3WC0A 3WQPA 4E0DA 1FFGB 1SUQB 5AT1B 2EG2A 4NLOA 3AQOA 4DV3F 1B64A 1ZAWA 3ZTSA 2IDLA 2BYCA 3TO8A 2NXNA 3HM9A 4X4RA 1VRUB 2JLGA 3D5MA 1W7WA 4ECUA 2RDJA 4URGA 1BUXA 2VJVA 1IBKF 2EBEA 2CPXA 2ZOGA 1CQNA 3L7UA 4R5PB 9RUBA 3HSGA 3SI8A 1RAOA 3MM9A 3D3BJ 2UZAA 4KV8B 1RHUB 4JI3F 4AD6A 3B54A 3CGIA 1HR0F 1RWXB 4QWBA 1U8SA 2MJNA 1RABB 1KD1T 3NAHA 2DJWA 3H8YA 1VRQC 1S0VA 1SH3A 2FLPA 4KGVB 1X31C 4USWA 4FDFA 4MJKA 3G71S 4Y0FA 3MHYA 4F02A 2Z0GA 2C2KB 4MTPA 3HHNB 2FJWA 5EX0A 3PY8A 1CG2A 1S9EB 4X64J 4HTJA 3NXZA 4M5HA 2E1AA 4FF2A 4GKKF 5A6PA 1AFJA 4DPWA 3AH6A 1N52B 1JLGA 4NLWA 4H4OB 2KKHA 5L1LA 2GS8A 3T3FA 1SVDA 1BGXT 4YY3F 4JV5F 2E7WA 2QSWA 1S72S 2QFJA 2IYIA 3KDNA 2FY8A 2DYAA 1VK3A 1XR5A 2E1MC 2CVEA 4LUBA 4UZBA 2A2CA 2HGLA 2R7TA 4KHPF 2GVDA 2HFSA 2HHUA 2V4JA 1QUVA 3G4SS 4AL7A 2K8GA 4CQ1A 3K5LA 1NSQA 3G9CA 3ZO7A 2FJBB 3MMAB 5HBMA 3P49B 2QA2A 4KGXB 2DGUA 2FD2A 3E2EA 1T11A 3J81j 3SSQA 3M2VA 5DS7A 4MK7A 3GB0A 5CCMA 1AXQA 2V4QA 2CQIA 3BREA 3SXLA 2CQPA 2R2TA 5J2NA 3EDRB 2OJ3A 1GNKA 3QAUA 1Q78A 1Y3KA 3N9UC 4ZVEA 1TVRA 1OO0B 1FNMA 2BUNA 2WBMA 3P5BP 3RYLA 2QG9B 3BDPA 3GYXB 5HMXA 3TZYA 4LR8A 3TJ9A 4YN3B 2XEXA 2ZD1A 3ITHB 2HYIB 2D3ZA 4I2QA 4NASA 2GJIA 3VAGA 2XYGB 1NHUA 4PABA 1WOOA 1FA0A 1H3DA 4PXEA 1RAEB 2IFXA 3DRXA 4P2MA 4F04B 2UXBF 3H2VE 1Q86T 2DRDA 4GO7X 4ZS6A 3H2LA 3MEGA 2R3VA 5KFLA 1UEUA 4LVNP 5E33A 2G0JA 2W4CA 3MCSA 4RW4A 4F4KA 1SC3B 1YJ7A 2QLFB 1Q82T 1TL7B 2ZZNA 3V4IA 1CS4B 4LSNB 2Y0SD 5CD4H 1HBMA 3NGKA 1U47A 2DNHA 1KEKA 3QLHA 1P6TA 3IN5A 4AQYJ 4ED6A 4FF3A 3D9BA 3I5BA 3MUVP 4WBFA 4ECYA 2Z2YB 3FZBA 3BYPA 2VPXB 2MEWA 4NXMF 3JAMY 3W60A 5GMKa 4L72B 2V34A 1F9EB 4JB8B 2XBPA 4OHXA 2X1FA 3R7BB 4NZ0A 5C7PA 3GLJA 2WVDA 3A3OB 1N34J 2W7PA 3CJRA 3MM7A 5H9FK 4BWJA 5CABA 1F9HA 1S77D 2IM0A 2VBYA 2OHDA 3OTDA 2YNFB 1KDNA 5G4DA 3OUYB 3FEZA 3HHLD 3KHGA 5F41A 1S57A 1NK5A 2IDEA 1ELOA 1KN6A 4OI4A 1BQXA 5IC4B 5ADZA 2DCUB 3MR7A 1VJQA 5BR8J 1HNXJ 4L74A 1HNWJ 3NBPA 3NOCA 1ZZNA 1WUUA 1UFWA 2CQHA 2OTLS 4AL6A 2KYXA 2A18A 1RXOB 4NLSA 3H5UA 1U1RA 1RTDB 4O3NA 2AX1A 4CH1A 2DR6A 3A3NB 1S1WB 2XSJB 1XNRF 3GIIA 3S7RA 4ZP7A 4LF6F 2DTJA 1YJVA 3CO9A 3M7VA 3Q24A 5CCLA 4JI5F 1K0TA 2DNNA 4NOHA 1RACB 1M90T 1Y3JA 1BD6A 2WK4A 3W8GA 3OT9A 2C3MA 1HW8A 3G86A 3M32B 2YQ0A 4F67A 2RKIB 1JKHB 1CEZA 2F8EX 3KLGB 4ZVTB 1N5SA 3JSRA 2JVRA 2V2VA 3M4XA 2RS2A 3TQEA 2F63A 2ZWOA 4C8LA 4DFKA 1X4HA 4Y34A 2FVPA 2EK1A 3OR2B 3QO9A 3FZ2A 1LW0A 2LP4A 4R0EA 5H9EK 2HHWA 3AOAA 2Z2LA 2U2FA 1C4AA 4DR2J 1GX6A 2LEPA 4KQZA 1FNXH 2KJVA 1KQGB 1NKBA 3J7Z5 4IO9Q 1S1XB 4MK9A 3TVKA 1DARA 2DHAA 1UFKA 3PFEA 1NDPA 4QWDA 4ZKAA 2IVYA 3TZZA 2D69A 4KKOA 5HQMA 4YB5A 2OEKA 1FCAA 1IKWB 4LSLA 4B9LA 3OTEA 3GYNA 3FFIB 2DEIA 1UMJA 2ASDA 3IWNC 1T02A 1VJWA 3MMAA 3X1LB 2AGOA 2ZFHA 3VVTA 2A10A 2R7UA 1WC5A 5AE3A 3DDNA 3TR5A 5I42A 4RL1A 4MKBA 4M5JA 3K58A 3GV5B 1HWIA 5JJBA 2IYGA 4WZMA 3GTYX 5CZVA 4DUZF 1WD6A 2AEFA 1APSA 3WX4A 2OFHX 4B9VA 3MPUB 4I2PB 2M3DA 5CYMB 2DO0A 3CUNA 3MD3A 2CWKA 1V3SA 5KT7A 3KK3A 3PIPQ 3RRGA 3SDEA 3ISND 2D3OR 1C1CA 2F40A 2XGPA 2YWFA 2POKA 2VIHA 4LRCA 2H5IB 3CEDA 3BBFA 3MAQA 2KJWA 1X8DA 3FVYA 3DLKB 3KG1A 3UDCA 5U47A 1BWVA 2QE5A 5CYJA 4QU6A 2VONA 3MM5B 3DLLQ 3BSCA 3P45B 1VQ8S 4UUWA 3MM6A 4QJVA 1AA1B 1GMWD 4DI6A 2DR9A 3D6HB 1CS4A 1K0VA 3O8WA 1O51A 2VODA 5K8NA 2V63A 4B02A 4R8UB 1FKPA 1JB0C 1PAEX 4ID8A 1SKWA 2Y1IA 4LF1A 1RLDA 4FF1A 4AT1B 4ILLA 3ULHA 2DNZA 1X9WA 1MU2B 3DLBA 2HFNA 5DQGA 2XSFA 5BYSA 4NPOA 3T41A 3V5RA 1VS3A 5IQQA 4HVZA 1ZM9A 2JOQA 3M9OB 1CJKB 2V8VA 3GJSB 3DKDA 4NI2B 4IRKA 1DBDA 1RE1B 3T1AA 2IC3A 2G9OA 2EFGA 4KHMA 1Y4ZB 3H40A 2YWGA 4ATNA 4DF8A 4W98A 1NXIA 1R43A 4ZIWA 3QFHA 1Y5IB 1R89A 5K8MA 1S49A 4A4JA 3JTNA 3HCXA 1HD0A 4ZPVR 3HVWA 4ELTA 3QRRA 2VG5A 2PA3A 2R7VA 4C97A 3BSAA 4PAAA 2BKPA 2PMWA 3GU0A 2HIYA 3WC2A 2LU1A 3DRPB 2PFDA 1RTDA 3CCUS 1FJ7A 3SQGA 4ZLLA 1NK6A 4M5LA 1Z4UA 4RKUC 2OO4A 3TUJC 2KN4A 1HPZA 3ZZTA 4WF9Q 2NXCA 1B7FA 2EXUA 1JKHA 2WSEC 3HMJG 3D54A 3TYTA 1U4BA 4GO5X 3ENQA 3KUGA 4DL4A 3ZZOA 1SC1B 1HNIB 1WEXA 2OAUA 3PYGA 2DD8S 2EW9A 1S10A 5EN1A 2HWIA 4DOZA 3A8IA 5L39A 1RYRA 2OP5A 5LJ3Y 1BY9A 3OTBA 4LFAJ 2XWXA 1ICEB 4Y2MA 1RWUA 3FRZA 2GW8A 4J9KA 2J9EA 5A0YA 2C3OA 5DM7Q 4EZ9A 1CJTA 2N7YA 4KY3A 3T5KA 1F9FA 3BH7B 3OJSA 3MM8B 2XLKA 3HFZB 1E6YB 1YZ6A 4DSJA 5E3PA 4NLQA 2F8MA 4ALZA 1FKOB 2HNYB 1CJUB 5J2MA 3PVXA 2AZ1A 1R8PA 3WX8A 2ZVSA 3BGRA 1UVNA 1BQMB 3BJYA 3PYEA 2C2ZB 2MZTA 4HT5A 3JQJA 3D68A 4C8YA 1QM9A 4DR5J 2XMKA 1HARA 3V4MA 3OFFA 2F8HA 4DPYA 2IMWP 8AT1B 2UU9F 3M8PB 1DHMA 2E5IA 3GILA 3BR8A 4EK2A 5J1EA 4MKYA 1VIOA 1YITS 5E2QA 4DUTA 2OUGA 2BMBA 1UJ4A 2HFZA 2L48A 1F2GA 1UWBB 4HI1A 5E3AA 3ZTOA 5LOQA 2RILA 3V2UC 5DJBA 5JXSA 1R27B 2I5JB 2XGQA 4KH0B 2PI4A 1UVMA 4G1PA 2WVBA 3SCJE 4L6V3 4RUAA 4IR9A 1X0FA 4X4OA 2J6TA 4AXIA 2HZVA 4HI2A 1RWKB 2RS8A 2RF2A 2NUHA 4X66F 3VF0B 4DV7F 1X0PA 3CJKB 1D8ZA 2H48B 5IC6B 5D0RA 3JTOA 3L09A 1U1MA 3M6WA 5D78A 1OYDA 4CO2A 5CYQA 3U1NA 1N5QA 1RT1B 4A8OA 2J6SA 2RU9A 1YLXA 2NCKL 2YBVA 5GVQA 2HBQB 3CCES 4LSZB 1NH7A 1YJ9S 3MPWA 3O3LA 3LP2A 4OI1A 3EMTA 3BZQA 3BGLA 2MQMA 5HANA 4PWWA 1UZHA 2IVMA 2R2SA 1VR6A 4CH7A 1FDAA 4EZ6A 2V6AA 2HQFA 4QU7A 3T1YJ 3H4DA 2BX6A 2F4VJ 4LBPA 3EM1A 4ZVHA 2VB6A 2PMHA 3ENAA 3OW2R 1SJ4P 4YOEA 3I82A 1CJKA 2ZBPA 3DRSA 1TMJA 4JI7F 1ROFA 1DURA 4DMZA 2BM0A 1NHVA 1Z2LA 3IA0A 4Q45A 3Q8SB 1H73A 3FEYB 2HWTA 4WCEQ 3DCAA 4WIQA 4UT4A 2JL9A 3NS7B 1VIXA 1L3SA 1FD2A 2FHJA 4K0KJ 4PG4A 5KTQA 3KG4A 4JP8A 2Z2MA 3DDIA 3PJ9A 3G8QA 2ZKTA 5HQLA 2AYEA 3DN9A 2VFUA 1JIHA 3R7SB 4B3SJ 4CYUA 2DVIA 2YH1A 4LQ9A 3CVKA 1U48A 1NJXA 1J5OB 2OPRB 2MLZA 4KGZB 4DV5F 1IBLF 1UETA 1RWVB 1ZS6A 4LF8J 2CAJA 4DFPA 3DOLB 2YX4A 1XBWA 1EKRA 1N0VC 2GHVC 2FC8A 2CA9A 1MMDA 1Q5VA 1B0PA 2EFOA 1OSCA 4NX9A 5D8HB 3BKFA 4ED5A 4LF5J 3V6DB 5D77A 4IO1A 1LOUA 1QTNB 1N54B 5KFKA 1ITPA 2J0QD 2AYGA 5IV4A 4OYOA 4ECTA 1G7CB 1G6BA 4LF7J 1WJ9A 4DQQA 1DRZA 3TUZC 2HHXA 2W2QP 3TA0A 3TA1A 1A9NB 5KFTA 3Q2SC 4FYXB 2ADCA 5DG7A 1KWMA 2VPWB 2VKRA 1KRPA 3OVSA 4B9NA 5IV3A 3GIKA 3PW5A 3DGPB 2YNGB 2GMLA 3S01A 3GJRB 3QGGA 1FFSB 3BYRA 2ZJPQ 3M9NB 2AF6A 2H5JB 4Y28C 3IAS9 3M05A 3UNYA 3KK1B 4TQRA 4FXWA 3VAMA 1IBMF 1RDRA 3OVBA 2I6WA 3HJVA 3KLIB 2Y9HA 1Q1KA 1JLEA 2ACMA 1U24A 4F2SA 1BXNA 1FKOA 3MTKA 5B0BA 3AXKA 4IR1A 1FX2A 4ED2A 2CZ9A 4B9SA 4RW8A 1BQMA 5BJRA 2FGOA 5E5NA 4C9DA 1D9DA 4WYLA 4DWIA 1IUJA 2J8SA 3CF5Q 2HK2A 1B4SA 5I4MA 1RB0A 1REGX 2MY7A 1YI2S 4ETXA 2B8PA 4ER8A 5A8KA 1S4EA 2JC0A 3FBBA 5DQHA 3IBFB 5KG0A 1UEKA 5K8PA 1JJ2R 1AZSB 1C2PA 4WIIA 1OQ6A 3V6HA 1FKAF 1Q16B 4PKDB 4OZNA 2XZWA 4TY9A 3HT3A 5T7LA 5LT5A 4JOUA 3CJ5A 4UOGA 2DGQA 3FGVA 5LMNF 3H90A 1RJJA 3JYTB 4LRBA 2O3DA 3W1YC 1T7PA 3RAMA 4DR6J 3NNAA 1HMVA 1UPPA 4ZPAA 1ZTWA 4F8RA 4ILMA 1X5OA 4ZCIA 2VPYB 3UD3P 1NCLA 2E44A 2B7CB 2H9ZA 1T0TV 1RT1A 2ZH7A 1G2EA 3S1TA 4MFBA 1RTIB 2CQ4A 4O23A 1RI7A 2OEJA 3AOBA 1TL3B 3C14A 3N0VA 4N47A 1WG1A 4C11A 2RQCA 4YR3A 1LW2A 3N79A 4URSA 3K5PA 5IM0B 2BR0A 1T95A 1HWKA 1NK7A 2G13A 2HZAA 4ELUA 1KR4A 2IM3A 4NLPA 4OYZA 2B6AA 4WP8A 4EI2A 1VQ4S 3BB5A 1NLKL 2VQEJ 1Q8LA 1OY6A 3R2DJ 5K9FA 2QMWA 4DUYJ 2EFQA 4OZJA 1VLYA 4M5NA 1SB6A 4J9VA 4KO0B 3MFIA 3R5AA 4MIBA 3UCUP 5B0CA 2BABA 4FBTA 1H2VZ 2UUAJ 2HFVA 3UDEA 2D74B 4DQPA 2DBBA 1TFYA 5HL7Q 1YBUA 1OIAA 2ZEJA 1YZ7A 2DGVA 2GQCA 5I3UB 2RQKA 4KGMA 3HPOA 3CDEA 4USHA 1YG0A 3IRWP 2DGSA 2F7VA 4OIXA 1IN0A 2UUBF 4C0OC 4G1QB 1WORA 4HL9A 3AJ2A 2AMCB 2FVRA 3HJFA 2WONB 2ZWPA 2E1CA 3W3SA 4DU7A 2XMUA 4NEYA 4JYAF 1NH8A 1FK9A 3NS6A 2V67A 4ZPCA 2DNRA 4IUFA 4LFCF 1PILA 1PO6A 3RB6A 1NU4A 2HVDA 3CJ0A 5FDLA 1L3TA 4UTGA 1EETB 2K7JA 2MLYA 1WELA 5L8RC 1FI4A 2B3TB 4KT0C 1WI8A 4JI8J 1GMUA 5B0AA 3CMAS 4CLFA 4K4VA 5T41A 2VOOA 5C24B 2M70A 2VDHA 1HHTP 1GXUA 1T3NA 3H25A 2W2NP 4DSIA 1KQKA 1N32J 1YGYA 4LF9F 4USTA 1GTEA 1D8YA 3CD0A 2ZNZA 4E2FB 1QVFR 2MDAA 1ACMB 3BGOP 1U1OA 2DITA 2CXEA 1T9VA 2AEJA 2XCPA 2VJUA 3SYZA 1CQMA 1JLBA 2FC9A 1IBCB 4IFYB 2RRNA 3LP1B 5ETKA 3BPDA 1CJVA 1HL6A 1TKTB 3IS9A 2PGCA 3F73A 1TU0B 2OI2A 4CM2A 3GQCA 4I6AA 5KFDA 2AJ4A 2AJQA 2AYMA 5AE2A 3ZZ0A 2KZMA 3RU0A 4Y2KA 2OGUA 3OPKA 1I1GA 1FO1A 5H1SV 3K8WA 3EGVA 2DHHA 1YJRA 3ZZRA 5D4LA 4WTYA 4X65F 3VGUA 1ZYQA 4ZK7M 1EQ0A 4PXDA 1YX2A 4OFZA 5EWGA 3CJSA 1TKXA 1REVA 3VR1A 1RT4B 2VQFF 2C42A 2LMIA 3HDSA 3W63A 1OJ4A 2FVCA 3G96A 4YB6A 2GZOA 4C0BA 1S9GB 2VC0A 1D0EA 3TANA 2ACYA 2VFSA 2UUCF 3QFWA 1VMBA 2QL7B 3RBZA 3QJJA 3BV8A 4RW9B 4QW8A 2XMTA 4DV2F 2XY5A 3PHEA 4JI1F 4I6YA 5CHCB 3TZWA 3IRXB 2AJ1A 4GRSA 4JV2A 1G4CA 3HHKA 4USVA 1ZETA 1H0HB 3M2UB 4QIWD 4GC7A 4DV3J 3RRHA 2GQ2A 4PG8A 4WFYA 1RCOB 2KH9A 1KSPA 3D0HE 4RNHA 5GMEA 4D3HA 2ZE2B 3CJ3A 4RNFA 1N6QB 4OYWA 3D6MB 2EEYA 3OR1B 3GFYA 3QATA 1FJGF 1S9FA 2QC3A 2PN6A 1XMQF 1KVJA 1TK0A 1IKXB 2IIHA 4IQMA 2DR5A 5GAEU 3OLAA 3QIPA 3T5LA 4JI0F 2U1AA 3C8YA 1KLMA 4NYOA 3G8TA 1UJ5A 3UR3C 1FVSA 2YNHA 3L4BC 1NB7A 2UXDJ 2B9XA 4KPCA 3LGHA 3HT0A 1XN9A 2ZDPA 3VZIA 4X4PA 2V69A 5DDOC 3B78A 5CD4A 3IG1A 1LWEA 5HMYA 3N28A 3LGMA 1QAXA 3W66A 1RT6A 2CQ3A 1WOPA 1VYAA 4HT7A 4HYKA 2ZC4A 5I3UA 2WZ1A 5AXKA 3C16B 2CVIA 2ZH2A 1P1TA 4YHHF 4H4MA 2R9LA 4IH7A 4EWTA 1JXLA 2UXCF 2N4CA 2RD5C 2HW3A 3ILLA 2B56A 3HZEA 2MZJA 5I3PA 3ISZA 2R7OA 4OHWA 1AUSL 1IKVB 4DLEA 1YJUA 3E3XA 2WONA 1YBTA 4CO5A 3C3LA 1U25A 3M30B 2VD3A 4DG1B 1VI7A 4C0HA 3POTA 1GFWB 4KHPJ 4ECXA 2CJQA 1K8AT 4FS1A 1SKSA 4C3KA 3BN7A 3MTJA 2JSXA 3UDLA 4PPZA 3W9HA 2WRMA 4F4XA 3KHLA 1UL3A 3UQSA 4ENOA 2EBGA 4BC7A 2DB1A 2E1RA 4F4AA 4XDDA 4UQTA 4GC6A 2CPDA 5HSPA 1U6BA 3JSBA 3I9V9 4ZPWR 4WFZA 1S99A 3HI9A 3QGIA 4RNNA 1LK7A 4ZN1A 2Z58B 1D09B 2QEXS 1WKLA 3GMGA 3KWMA 2Q43A 2KO1A 3FRYA 3TVZA 2V8DA 3KHHA 1RBAA 2DRBA 2MJUA 2W2OP 3U1MA 4DHVA 1UJ6A 4KR0B 5IFMA 2B7BB 5LJ5Y 1HFEL 2HGMA 3Q8QB 5K14A 1IWGA 4ICLA 4NCGA 2R8JA 2MB0B 1I94J 4OI6A 3K59A 1VRTA 3SV4A 4NLYA 2FHJD 4M5IA 1PKUA 3R1LA 4HH1A 3OL8A 2AJFE 4ZCMA 2AIRB 3QT6A 4OHZA 4OL8A 4URQU 3S6EA 1HW9A 3PEHA 1HNVB 2HQGA 2KG1A 4KYZA 1VK8A 3MUMP 3ET6A 3QRPA 3R6GB 3VWSA 4B9UA 3PW7A 1PYOB 3N5BA 3US5A 2GIFA 3FDSA 4DV4J 1NDKA 4DCPB 4ZLNA 1NK8A 1TFWA 2FIUA 4A8SA 3W5ZA 2BM1A 3ICLA 2RE1A 1SQEA 4I7FB 2ZH8A 1AT1B 2W8LA 3TX8A 4Q0BA 1JLQB 3FC9A 1JWWA 2ASLA 4X64F 5THWA 4A48A 5C2CA 3MR5A 3BO4A 2W1BA 4HACB 2M8HA 2B4PA 1KVIA 2B4VA 2B8QA 3M2RB 1N5YA 1D3WA 3VAKA 3QRQA 4EFAC 1T05A 1KLNA 1FJEB 2BJDA 2AX0A 1XIQA 3AJ1A 3MMBB 3J7YI 1S0MA 2KHDA 3A8KA 5LXYA 3CMES 3CNQP 1BC6A 3IR5B 3FSXA 2CZVC 1BHNA 2WVEA 3GCWP 3PG9A 1S1UB 4WFXA 4DU8A 2K1RB 2YPYA 1ZTTA 3FJ2A 1WEZA 2Y1JA 4U8YA 3K8VA 3GP9A 2QLWA 1WHVA 2MZSA 3G8SA 4RUCA 3FSYA 3C6TB 2HS0A 1MSWD 1U1QA 3DOKB 3OXGA 4M8LA 5JUMA 1GXLA 1RHQB 2E9RX 4CO4A 5KFHA 2R7WA 4WTOB 4P71A 4FVMA 2XYPB 1LWCA 3R9LA 7FD1A 2QYCA 1WC0A 5A8WB 1S4FA 2MKHA 1TL4A 5CAAA 2HHSA 5KFVA 1PJ7A 2YX7A 1DTQB 4PYAA 4CZCA 2QA4G 1C0TB 3D1HA 1RHKB 4NLXA 3UI3A 4DR1J 1RGVA 2BJ7A 2HVZA 3UW1A 3CDUA 2FPHX 2FJAB 2B0GA 4P10A 3DYAA 1UPMB 5J1NA 2GVZA 4K4YA 2QMUB 1FRMA 2WAQD 2LQ5A 2AU0A 3DMJA 5KOWA 5D3GB 2OEMA 2AYBA 3DXBA 2BV3A 5LMUF 4LIRA 5KFXA 2N7CA 4QR2A 4WXWA 4QIFA 1TTHB 3MWBA 2IBKA 4NWBA 2Z8QA 4CT9A 2BE2B 4IG0A 2ZJRQ 1YJNS 5JVHQ 1URNA 2QRRA 3QNWB 1Q5YA 2VV5A 3BSOA 4OHVA 2CPEA 3K17A 5F8LA 1N33F 2RT3A 2VU5A 2BOPA 1Y5LB 5KG5A 4X4NA 1J2VA 3I31A 1RAAB 2GAHC 3ZFVA 5J2PA 4ZHRA 4ECWA 1DAXA 4AQYF 4DSEA 2Q3PA 2OD6A 3PW4A 2D3UA 2X1GA 4K4ZA 2AD9A 4CLPA 1S97A 5D6GA 1FD8A 4QOTA 4LBIA 3BDEA 2E9TA 3CCSS 2M9KA 2L9WA 2UVRA 1G3OA 5A8RA 2OPPA 3MECA 5DZ7A 3EVMA 1VGYA 5B0GA 2MPUA 3BO2A 3W61A 3KNGA 1XERA 3WBZA 1N34F 3QZ8A 2B4UA 2DNGA 3I5AA 4IQXA 5AXLA 2XTJP 2IA0A 2YWHA 2VG7A 3RZAA 2ADBA 2IRUA 5HMWA 4WU2A 1LXNA 2IBOA 3P8BB 5KFAA 4ZJQA 4GMKA 1ZM4A 3FBCA 4CIOA 3MCOA 3JB9k 3H5XA 1LKZA 1U2RA 2KU7A 4OMFG 2WW4A 1OYEA 8RUCA 1HBOA 1RHRB 2BJ1A 5BR8F 4M95A 3ZNUA 1HNXF 2VBZA 1WKKA 1HNWF 3TWZA 2HNDA 5K5MA 4OJ1A 4X4VA 1HNVA 3KMQA 2GJ2A 3GJTB 3NWRA 2CJYB 1NSKL 4F4WA 4LR7A 2J0WA 1KHVA 4OZLA 1JLGB 4NA2A 4ILRA 5F8JA 4RLEA 1XTZA 2DNYA 4U8VA 1T94A 1JLCA 3QAEA 4OJHA 1MN9A 4I7FA 1UVJA 1S6OA 2HHPA 5ETLA 2RQ4A 1JLQA 4Y2IA 4A8YA 2VA3A 2FGCA 4USMA 5B08A 5HVGA 2DGWA 4PWDA 1SJRA 3GFHA 5ETOA 4N56A 1F0XA 5KFGA 2GVDB 3VVUA 4CDIA 2LXUA 4JI2J 2V4JB 4LQ3A 3TEGA 2QX0A 2ATLA 3QQCD 4EBDA 1R3NA 1TMMA 2ABYA 3AB4B 4I1TA 5HBMB 2VASA 5L1IA 2G0CA 3Q86A 3D28A 2CNLB 4ZCKA 4N8NA 4BCAA 3IGVA 4ANEA 1UW4A 3FMBA 3M2VB 3LO3A 1S1UA 3RR7A 4K4UA 3LW5C 4DLGA 3NGSA 4GVBA 5F8HA 2GHPA 3R5BA 4DSLA 2E66A 1TVRB 2OSQA 1Q8IA 3LALA 2AGQA 1HI8A 3Q23A 5I3QA 4ZVGA 4WZQA 1FWKA 3A3PB 3ZZPA 4FPRA 3VAIA 2Z56B 4WPAA 3UVJA 1KHWA 2W9BB 4F4ZA 2R8KA 4C98A 3SCLE 2ZD1B 4USKA 1U09A 3QBCA 2VBXA 3EE3A 4NLVA 4C8OA 1L5UA 4I2QB 2P5VA 2M88A 3PR5B 3DNCA 3PRBA 1X7VA 2K7KA 2IJFA 1F5CA 3GIRA 4MIAA 2P9GA 4A8QA 3M8SA 4PG6A 2H4WB 1FTCA 4X2BA 2E5JA 2BE9B 1SJ1A 1JK9B 3MEGB 4DV1J 4UF4A 2YX1A 3HSDA 3PXGa 3RAQA 2VG6A 2APOA 3BQ1A 1UVKA 3GJQB 4CLYA 2CQDA 5E3CA 4F3MA 3V4IB 1HBMB 3SFUA 4NA3A 2Q6CA 3TOQA 2MQOA 4K4TA 3QLHB 5D3GA 1YSJA 2BJ8A 3SBMA 1NSAA 2FJDB 1TV6B 5KG6A 2MKYA 1Q0NA 1HYSA 3DHXA 2XYHB 3NY0A 4M5GA 2Q1LA 4OLPA 2W7AA 4H54A 1ULRA 3MEEB 4OYXA 1EB0A 2ROPA 2RQMA 3CCZA 3PO4A 4YMEA 1SJFA 3KFWX 5C25A 1IVZA 5EUHA 1NPPA 4OZ0A 1V9OA 3ZZUA 3MM7B 2MQ8A 1RT5A 3FNNA 3KLFA 2P2CB 4KIAA 3LA0A 1OPIA 2LECA 1WSRA 3GR0A 3VQSA 2DGXA 6FD1A 1XR6A 1W26A 5DGBA 3OSNA 2KXFA 1R7IA 1WF0A 1UTAA 2M2BA 4C2MA 3BF4A 2R8GA 3R6LB 2D7SA 4J9RA 5HMZA 2M7SA 4S0MA 1TP7A 5KFYA 3NBPB 1R8HA 3TAMA 4C4WA 1R0BG 2OIHA 5KFQA 3D1OA 2EC2A 4Y00A 4B3MJ 3C15A 4XIUA 4QR1A 1ZM3A 1S79A 1JX4A 1F3VA 5F0UA 4ED1A 1RBLA 3KLEA 3KJFB 4O3QA 3R27A 1M5SA 3P3DA 4FF4A 1KOHA 4UY8T 5KFCA 1HNZJ 1P9QC 4QYZJ 1SIWB 5F0WA 3OJUA 2XHCA 2GO9A 4J7CA 2X3GA 5EWEA 2MZ1A 3IM8A 3KLHA 1F5AA 4Y2CA 5DDQC 2HK3A 1CULA 2R7XA 2OTJS 4IRCA 4QWCA 1J5EF 3QO9B 4F3OA 3BQ0A 2NQPA 2MKIA 4ZVUB 1LW0B 2Z57B 4RJVA 4U6PA 3EVOA 4CLSA 3MZIA 4DV6F 5EWFA 1S5ZA 2QA1A 5F3TA 4F7VA 5HVHA 5KOXA 5FIIA 1O8BA 4RWXA 3W64A 4DJBA 4DN0A 3R3TA 5L46A 1SV5B 4KC5A 1ZM2A 1I5OB 2WCXA 3T5JA 4DL2A 2GMJA 4P9SA 2G2ZA 4XO0A 1RT3A 1P9YA 1SCJB 3K5NA 3ZNJ1 4DQIA 1JXEA 4KKOB 3MDFA 4OX7A 4DPXA 3GFZA 4O0NA 4LSLB 2E5HA 3TX0A 4H4KC 4PUOA 3OHAA 4ZDNA 2RDDA 3PHTA 5F8GA 4LFAF 4B3TJ 2E5LJ 3RB4A 1HQEA 3PIOQ 2P9EA 2GGPA 1PBAA 2KI2A 3GFXA 1MNEA 5A76A 5D4PA
chains in the Genus database with same CATH topology
4F3QA 2YNFA 3CCLS 4F2SA 1Y5NB 1CPZA 1FKOA 3OUYA 2RDIA 3MTKA 5B0BA 4NCBA 5E3RA 1LQ9A 3I4HX 4JI2F 4IFVB 4QWEA 4IR1A 2F1FA 3MM9B 2MQLA 2BRKA 4TY8B 4ED2A 4RW8A 4B9SA 1BQMA 5BJRA 1VQPS 2FGOA 3V6JA 3NGDA 5E5NA 3U7JA 4C9DA 2BXJA 1RQ0A 3AAWB 3G6ES 2GCFA 5DDRC 2GO8A 1D9DA 4WYLA 4OX9F 4DWIA 5KT4A 4ZOSA 5I42B 1N36F 1IUJA 1QTMA 3RRKA 3CF5Q 5AJ3F 3AA8A 4O44B 1CLFA 2Q79A 1DQ8A 4CO1A 1MW7A 4YUDA 3DDKA 4X84A 1Y00A 5KFSA 5I4MA 2DGOA 2L08A 1IJFB 2MY7A 1YI2S 4ETXA 4BHQA 4IRDA 3CDWA 3IXQA 1MROB 4DEZA 2X1BA 1HBNA 3NKYA 1ZOTA 5LSRA 1M5PC 2V2KA 2LDYA 1LWCB 5A8KA 4TLRA 5DRKA 3CCVS 2XULA 3GZ7A 2JC0A 3I0SA 5KFUA 3HX9A 1JJHA 2MSTA 2LA4A 4DR5F 4YEAA 1FRIA 2C3YA 2GIQA 4B9MA 3UE2A 5E7OB 2HHQA 2NS1B 2HWHA 4K4WA 2O67A 5DQHA 4IG3A 4RW6A 5KG0A 2W9BA 4DQRA 2CQ0A 3KK3B 1H6KX 4B3RF 2MKJA 3SDEB 2YKMB 5MAOA 1S1WA 2XSJA 3PKMA 3RW6A 1FXRA 2BA9A 5K8PA 1JJ2R 2LU2A 3T6JA 3D0IE 1BQNB 1C2PA 1HQUB 1FE4A 4WIIA 1C1CB 1X4EA 3LQVA 4EUVA 1OQ6A 3V6HA 1FKAF 2HVIA 3IFEA 4YFUA 3EGZA 5KFOA 1Q16B 3C6UB 2CIMA 2NPIA 4PKDB 4OZNA 2R8HA 2XZWA 4I67A 4TY9A 1SIZA 2DNKA 3HT3A 3PW0A 4ITSA 2PIIA 1S6PB 5T7LA 3M32A 4JOUA 5LT5A 3CJ5A 5F8IA 1R8CA 1MWYA 3DYAB 5KG3A 3SCIE 4MMOA 3N01A 2DGQA 2RKIA 3FGVA 5LMNF 1C4CA 1WHYA 3ONQA 2J7KA 3NAIA 4DL7A 3OHBA 4UOCA 3KLGA 1VQMS 1LFWA 4MK8A 3KHRA 1MWZA 2MGZA 3VAJA 1GT8A 2B4OA 1RJJA 3CCWA 3JYTB 2OPQA 3K5MA 1UA0A 4DX8H 1H38A 4J37A 4RW7A 3CIMA 4WFAQ 5CXTA 3DRYA 4ID5A 2O3DA 4N41A 3DMJB 1Q79A 2LXIA 1VFJA 3MM6B 1AW0A 4AYBD 2LEBA 3RAMA 5E41A 1T7PA 1SL0A 3NNAA 1HMVA 1QE1B 1K1SA 2J0SD 3T9ZA 4ZPAA 1ZTWA 2HS3A 3P96A 4F8RA 3CXCR 4ILMA 4KE5A 5H9FJ 3OR2A 4NA1A 1XMBA 2L9DA 3ETOA 1X5OA 1C0UB 4ZCIA 4DV1F 2W8KA 2VPYB 4USJC 3UD3P 3MMCB 3PNIA 5DO2A 4Z2XA 2JDJA 2E44A 5DLFA 2B7CB 2H9ZA 2ZH7A 1RT1A 2CG4A 3HF5A 1G2EA 3MOJB 4Y3CA 2B9YA 3LP0A 2J0XA 3S1TA 3EGWB 2ZJQQ 4MFBA 1RTIB 2CQ4A 4IG0B 4O23A 1R0AA 1RI7A 3FQLA 1ZAVA 3HVTA 5JVGQ 2J8AA 1FKPB 3CE8A 1TL3B 3N0VA 4M94A 2JEIA 4N47A 2SXLA 2VZ9A 1WG1A 2LEAA 3N4WA 5DETA 2I8EA 3M2RA 2LDIA 2CJAA 4C11A 4E8UA 1NRKA 2RQCA 4YR3A 1LW2A 2MKCA 3N79A 4URSA 3NCPA 1TV6A 1SKRA 3K5PA 4WE1A 1S1XA 5SZTA 5IM0B 2PMZD 3OL6A 1T95A 2BR0A 1IQTA 1HWKA 1PGZA 1RT7B 4AE5A 2KT3A 2AW0A 1UP1A 1IQZA 5J2PB 1NK7A 2G13A 4ZHRB 3MEEA 1M5VC 3GV8B 4KFBA 4UY85 4ECVA 1HBUB 2JX2A 4ELUA 3F56A 3K2YA 3MMBA 2AWZA 1KR4A 2IM3A 4NLPA 2RRAA 3EZUA 2MHEA 4P2SA 3THTA 1YRTA 3OVAA 2B6AA 4QZVB 2OPSA 2ZBCA 3HO1A 2O01C 2YTCA 1FT8A 3I5CA 1VQ4S 4RNMA 4RU2A 2XI3A 3TUIC 4JUZA 1IKWA 3BB5A 1WNEA 1IM4A 2IC3B 4EO8A 5F9NA 4NZ6A 2G4BA 3SEOA 3P6YC 3FFIA 1Q8LA 3O1LA 2JLEA 2K1RA 1JLAB 5GAGI 4AXJA 4QCLA 3AA9A 5K9FA 2DHXA 2QMWA 5A8RB 2PO4A 3M6XA 2EFQA 3AHPA 4OZJA 3DLHA 1VLYA 2LXFA 2OPPB 3MECB 5J2NB 5LSLA 2CRLA 2BQUA 3DFEA 4DR7F 1SB6A 5KFWA 4KO0B 3G6XA 2NPFA 5DG8A 3MFIA 1N48A 3DLEB 2KFYA 2ZOFA 3R5AA 4MIBA 1F5BA 4ZCLA 3UCUP 5B0CA 2W24A 4DL6A 1O0PA 3A8EA 1DQ9A 2BABA 2IJNA 3C6TA 3OBIA 4A47A 4FBTA 4BDPA 2XO7A 2JWNA 1H2VZ 2VG5B 3K7RA 2BBEA 5BYRA 3T1YF 2BRLA 2F4VF 2VG7B 4RUHA 2D1CA 2FJEB 4TYAA 1U1KA 4IYQA 3HKWA 3DOKA 4UQGA 3ENVA 2D74B 5LSOA 4NLTA 4DN9A 4DQPA 3TA2A 4DSKA 2BZ2A 1NK9A 1NK0A 1OSDA 2DBBA 3HP6A 3J80Y 4F4YA 2ZOMA 5KFPA 1TFYA 5HL7Q 1YHQS 3DRRA 4RU9A 1OIAA 3F44A 1WHWA 2DGVA 2NSCA 2GQCA 2HRYA 4DQSA 3GSDA 5I3UB 2RQKA 1ZPWX 4KGMA 4LJMA 4O4RA 4I2PA 1CC8A 5CYMA 1S7HA 2JRSA 3J7YU 3HPOA 4ED3A 2HNZB 3CDEA 1QAIA 1KFSA 4USHA 1YG0A 1HBOB 1X5PA 3IRWP 3J7A1 5A8WA 4EEYA 4WU3A 2DGSA 2F7VA 3SQGB 3N5FA 1TZ0A 3PX6A 4ED0A 4OIXA 2VFTA 1IN0A 1VBXA 1DTQA 3OFEA 5A2QY 3IAM9 2UUBF 5KFRA 5H9EJ 5HI7A 2JVOA 4C0OC 2FJXA 2HNDB 1IR0A 4G1QB 2PD1A 4TYBA 4HL9A 3AJ2A 2LKZA 3E51A 2FVRA 4K5RA 3HJFA 2JHEA 1HWUA 1C0TA 3KLVA 1H2UX 4XPEA 4KJIA 1HPZB 4B3MF 2YKOA 4XDCA 2WONB 2W4DA 2E1CA 3HHEA 1Q81T 3W3SA 2J9DE 4RW4B 3EUNA 1R6YA 4MAKA 1Q7YT 2XMUA 2OLWA 2OSRA 3OL9A 2LLZA 1NH8A 5IT0A 4JYAF 1FK9A 2YNIA 2DHGA 3NS6A 4JI4F 3CCQS 4L3NA 3DM2A 4ZPCA 2WW8A 2DNRA 1M5KC 3A1YG 1N8RT 2R7RA 4IUFA 1YJWS 1XC9A 1A6LA 4LFCF 4BC9A 3DLKA 2LYVA 2ZITA 5F9LA 1S0OA 3VAFA 1PILA 4PR6A 3RB6A 1SL1A 1PO6A 4B3SF 1NU4A 1RTJB 3CJ0A 5FDLA 1L3TA 4UW2A 2JZ5A 1K9MT 3IC1A 2OMLA 4EBCA 1IJEB 2EK6A 4ZPDA 1RISA 2ZHBA 2IAJB 1CSJA 1TKZA 3QZ7A 3T1HF 1W2BR 1S76D 3K0JA 2MZRA 1EETB 1FDDA 2K7JA 4K2XA 3MM5A 1VQSA 2IM1A 1NZAA 5KFMA 1JLCB 3SZ2A 2HHVA 1HNZF 1VQ5S 1WELA 4IDKA 5L8RC 5EX3A 1HWLA 1D9AA 4C8ZA 5FLXY 2MQQA 3VZHA 2B3TB 1FJCA 5HP1B 4WXOA 4CO0A 4LF8F 2VKZG 4X4TA 2FVQA 2I38A 4KT0C 2Y1RI 3PZPA 3EPGA 2EPIA 2XNQA 1WI8A 3OV7A 4K59A 5B0AA 3CMAS 4PWDB 4K4VA 5T41A 2VOOA 4OJ3A 5HROA 5C24B 2M70A 1UAWA 2CDQA 2OD4A 4DR4F 5M2PA 2BE2A 2XMWA 1HHTP 1F60B 5A0YB 2RRBA 1M1KT 1GXUA 2JEGA 4WKRA 3R5DA 3RB3A 4R8UA 1UEVA 2MQPA 1T3NA 3MMJA 2MKSA 3H25A 2GFFA 4NRTA 4YP3A 1WF1A 3EXCX 4O4GA 3RTVA 1X9SA 1KFDA 2QLXA 1KQKA 4DSIA 1YGYA 4LF9F 1SV5A 2AJ0A 3CULA 1QSYA 2W9CA 3LPYA 2IMOA 1RT2A 1GTEA 1D8YA 3CD0A 2ZNZA 4DS4A 2DH8A 1TUVA 4OJGA 2V8HA 3DU6A 3WC0A 1QVFR 2MDAA 1MU2A 4ZP6A 4RWWA 1S1VA 4E0DA 2O66A 1U1OA 1SC6A 1SUQB 2DITA 3LAKA 4DR3F 3CD6S 3O5TB 2EG2A 5J2MB 3VTIA 2C28A 4NLOA 3AQOA 4DV3F 2KVIA 3TAPA 1K73T 3BGRB 2F9JA 1B64A 1ZAWA 2HLUA 3HVRA 4ELVA 2BYCA 2XCPA 2PEHA 3TO8A 3HM9A 3SYZA 1CQMA 5KT3A 1JLBA 4X4RA 1VRUB 4LVOP 2JLGA 2FC9A 4IFYB 2RRNA 3D5MA 3LP1B 5AE1A 4ECUA 4CI0B 4RBVA 2RDJA 4URGA 1HL6A 5BYQA 1TKTB 1IBKF 3IS9A 2EBEA 2PGCA 1JLFA 2CPXA 2ZOGA 4DL5A 1CQNA 5J1EB 4ED8A 4R5PB 3F73A 3GQCA 2VBWA 4PQUB 2P9CA 4I6AA 3T9NA 3U27A 4O0IA 3SI8A 2DO4A 4IFVA 5KFDA 3L7PA 3MM9A 2AJ4A 2AJQA 3GR1A 2AYMA 5AE2A 2UZAA 3QPIA 4Y65A 3ZZ0A 4B3TF 1O5JA 2E5LF 3R5CA 2KZMA 4KV8B 2CKWA 3RU0A 4Y2KA 2C22A 2DNQA 4JI3F 4QIVA 3OPKA 5HLFB 1I1GA 1FO1A 5H1SV 3K8WA 4DBQA 1VOMA 1YJRA 2HG4A 1H7WA 2XCAA 4J9NA 3CGIA 1HR0F 4QWBA 2BJEA 1VQYA 1U8SA 1S6UA 2MJNA 3ZZRA 5DG9A 1KD1T 5D4LA 4WTYA 5IXUA 4X65F 4J9SA 3NAHA 1ZYQA 3W2VA 2XLJA 2DJWA 4ZK7M 3CD5A 4CO3A 4PXDA 3KNAA 3H8YA 4OFZA 5EWGA 1S0VA 1SH3A 4LF4F 2NSBA 2FLPA 2HLTA 1FRHA 4EYHB 2XMJA 3DRPA 4MJKA 1TKXA 4PXBA 1REVA 3VR1A 5ITHA 3G71S 1RT4B 5L1KA 2VQFF 1KTQA 2C42A 2LMIA 1S1TA 2DNOA 3HDSA 3MHYA 5CH7B 2FVCA 4Y0FA 3UCZP 4F02A 3G96A 1U2FA 2C3PA 2HAIA 2JEFA 2Z0GA 3U1LA 4W90B 4X4UA 1L3UA 1RK8A 4HHJA 1HQUA 3I56S 4MTPA 1Q7LB 1TL1A 2RF2B 4YB6A 5SUHA 3HHNB 2CJBA 2K3KA 2VG6B 2FJWA 3NS5A 5EX0A 1CG2A 3PY8A 4C0BA 2D9PA 1S9GB 2VC0A 3I32A 3OLBA 1D0EA 2CPZA 1S9EB 3TANA 1SI9A 5L9XA 2MSSA 3DI6A 2ACYA 2VFSA 1VQLS 1QAJA 2FHOB 2UUCF 1RA6A 4B3OA 1VC6A 2R8IA 1A7GE 4M63A 1VMBA 4JV0A 4HTJA 1YWXA 3M9MB 2UVUA 3CIZA 3QJJA 1U1LA 2E1AA 4I68A 2PE8A 4RW9B 4FF2A 4QW8A 5CYQB 4GKKF 5A6PA 1B0TA 2XMTA 2NR0A 4DV2F 2XY5A 3PHEA 1JNZB 5HO4A 4JI1F 1AFJA 4I6YA 5CHCB 4WKYA 4O3SA 1LWFA 1HNIA 3AH6A 1N52B 3IRXB 1JLGA 2RIJA 2AJ1A 4WJBA 1U6FA 3M6VA 4NLWA 4H4OB 4JV2A 2KKHA 5HN0A 3HHKA 1FEEA 5B0DA 3LWLA 1ZETA 2UUWA 1WTFA 1H0HB 5L1LA 1FRKA 3T3FA 4ZVFA 4I6WA 3M2UB 4QIWD 4GC7A 5D4OA 1V3RA 1BGXT 3FMWA 4YY3F 4K50A 4FZVA 3CCJS 1UA1A 4JV5F 2E7WA 2QSWA 3RRHA 1C0UA 4K4SA 1HYSB 2GQ2A 4PG8A 4OX6A 1S72S 4WFYA 3MMCA 3CDBA 1PSDA 2KH9A 2QFJA 3LP2B 2IYIA 3NG8A 1KSPA 1QUPA 3D0HE 4RNHA 4IOBA 3CT9A 3LANA 4DR6F 1FNOA 1VK3A 4QIGA 4TLQA 1XR5A 2E1MC 2L41A 2CVEA 4LUBA 2A2CA 4D3HA 2HGLA 4FVCA 5C25B 2R7TA 2ZE2B 3CJ3A 4RNFA 1N6QB 4KHPF 2HHUA 2ZH6A 2O5DA 3D2WA 2V9KA 2V4JA 1VHFA 1RT5B 3OR1B 3GFYA 3IBWA 1QUVA 3G4SS 3HKZD 1FJGF 3KLFB 3GV7B 4AL7A 2K8GA 2AQ4A 4CQ1A 3K5LA 4J9PA 1S9FA 2B5JA 3G9CA 2N3OA 3QIDA 3MM8A 4F50A 1DFDA 2MXYA 2PN6A 2FJBB 3MMAB 1T3OA 5HBMA 1XMQF 2ROGA 1E6YA 3LGNA 3P49B 1KVJA 2QA2A 1TK0A 4Q43A 2AGPA 1IKXB 4IQMA 2J5AA 2HNYA 4Z37A 2CZ4A 4KAIA 5KFBA 2DR5A 4PQAA 2DGUA 2FD2A 3E2EA 5GAEU 3DRSB 3OLAA 1E6VA 3SSQA 3QIPA 3IR6B 3T5LA 3M2VA 5DS7A 4MK7A 4JI0F 3GB0A 2U1AA 2E5GA 2DGTA 1N5TA 3C8YA 3H59A 1YJTA 1JLAA 5CCMA 1AXQA 3S8SA 2V4QA 3W2WA 2AV5A 1KLMA 2EFNA 2WSFC 5C42A 4NYOA 3G8TA 1UJ5A 3UR3C 2CQIA 5KT5A 3BREA 3TAQA 3SXLA 1FVSA 2EKYA 2CQPA 2YNHA 2R2TA 5J2NA 2OJ3A 4Q7AA 1NB7A 1GNKA 2B9XA 3M8PA 3QAUA 1Q78A 1Y3KA 3N9UC 4ZVEA 2CQ2A 3PX4A 1XNQF