3M05A

The crystal structure of a functionally unknown protein pepe_1480 from pediococcus pentosaceus atcc 25745
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
112
structure length
99
Chain Sequence
AMATKLVIAIVQDKDANYLSDQFIDQNVRATKLSTTGGFLQSGNTTFMIGIEEERVPEVLEIIKKASHTREEFMTPYPIKVQVGGATVLVLPVDQFERF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein PEPE_1480
publication title The crystal structure of a functionally unknown protein PEPE_1480 from Pediococcus pentosaceus ATCC 25745
rcsb
source organism Pediococcus pentosaceus
molecule tags Structural genomics, unknown function
total genus 18
structure length 99
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m05A01
1PILA 3T9ZA 2XZWA 2VD3A 3O8WA 3O5TB 2XG8A 4WK3A 1XK8A 2EG1A 2J9DE 2ZFHA 1V6HA 3DFEA 1J2VA 2XULA 3M05A 4OZLA 5DS7A 1O5JA 1UFLA 3NCPA 4USIA 4CO2A 3NCQA 5D4PA 2E66A 2NUHA 1UKUA 2O67A 4RWWA 2GX8A 3NCRA 4YB6A 5L9NA 1HWUA 1V3SA 4RLEA 4E98A 3L7PA 4ZK7M 1NH7A 1O51A 1VFJA 1OSCA 4C3KA 4D3HA 1NZAA 5D4OA 4R25A 1NAQA 3TA0A 5DRKA 4CO1A 2JJ4D 1GNKA 3AHPA 2V5HG 3OPKA 4OZJA 2J9CA 4IYQA 3BZQA 4OZNA 4C3MA 1P1LA 4CO4A 4CNZA 2O66A 4USJC 3MHYA 4Y6IA 3TA2A 2ZOMA 3HLUA 3GSDA 1H3DA 3N5BA 2NS1B 4D3GA 4NYPA 4AFFA 4CO3A 1UL3A 3CE8A 1NH8A 1V9OA 2GW8A 2J9EA 3LF0A 1QY7A 2RD5C 2XBPA 2NUUG 3AA9A 2CZ4A 4Y65A 4WK1A 4RX6A 4CO0A 1Q1KA 3TA1A 5D4LA 1VHFA 2DCLA 5D4NA 2Z0GA 4C3LA 4YB7A 1UMJA 1KR4A 2J9DA 3AH6A 4USHA 4YB5A 2EG2A 3AA8A 4RWXA 3X3UA 1V3RA 2PIIA 4CNYA 4CO5A 2GNKA 4NYOA
chains in the Genus database with same CATH superfamily
3BF4A 1NDLA 4MAKA 1K47A 5EX0A 2IHR1 1IUJA 5KFFA 2E5HA 3PR4A 1KVJA 4JI3F 1ACMB 2DNOA 2VPXB 1HHQA 3C15B 2FHMA 2N3LA 3IAM9 2XM3A 4AT1B 2H48B 1NDKA 5DO2A 1LFPA 2N7YA 3C16A 2N82B 4KHRA 5J2QB 2ZDPA 1R7IA 4KQZA 5D3GA 4USJC 1YJ7A 1RLDA 2X1BA 1RT5B 2BACA 2RQCA 2ZZNA 1Q53A 2GHWA 2DH9A 2ZDOA 1JNZB 5B09A 4NMXA 2VBZA 1CEZA 3BKUA 4K4YA 1JLEA 3N6MA 3PYFA 2QC3A 1CJTB 2RKIB 4GKJF 1KQFB 2VV5A 3J7AN 3P3DA 4KGMA 2FJEB 4WE1B 2ZFHA 3HJVA 1CJUB 1VJWA 3BR8A 5D0EA 3CCTA 4NA2A 3Q2TC 2RRBA 3DMJB 2YKMA 3LW5C 1TUVA 1YJVA 1VRUB 3E01A 2KHCA 2HK2A 4HT5A 4NI2A 2ROGA 2E9ZA 2PA3A 3WIVA 4Y2CA 4CYUA 4QZVB 4RW6B 1X5OA 1IR2A 2IM3A 2ATCB 3WC0A 4USTA 4ZA1A 1RT7A 1ITPA 4AXIA 5KFJA 3OVBA 1YZ6A 4RW9A 3GIRA 2R2UA 3GV5B 1AFIA 4EI2A 3HHLC 3TVYA 4C8YA 1G7CB 2AYMA 4ETXA 5DLGA 1RE1B 1RAHB 2LXIA 1M5VC 3ZNJ1 3CDUA 1DLOA 2VDIA 5DDOC 2CNNB 2AYBA 1YITS 2FHJD 3TOQA 2ZD1B 3SXLA 3JB9k 4M5NA 5E41A 4KKOB 2C2NA 4CQ1A 4XPCA 4OMFG 1D9DA 1SXLA 2BX6A 1ZBTA 1WI6A 4CI0B 5FLXU 3KUGA 2B4OA 3CD5A 2SXLA 1L3VA 4CLKA 4GO7X 3W9IA 1WDDA 1BQNB 5AJ3F 4RLEA 4LFCJ 1NHKL 2CZVC 3R5AA 3NNCA 4CCHA 3PM9A 3QJLA 4HI1A 1KRPA 3W64A 1ZAWA 2BJ1A 4C8ZA 4EU0A 3HKWA 2IJRA 2O5DA 4ID5B 1BD6A 3G9CA 2I5JA 2FVRA 4PR6A 4DSLA 4PXBA 3M2UB 5KG0A 3VZHA 2UVRA 2HWHA 2HSEB 3RRHA 2RD5C 3KG0A 1E6YA 4OZ3A 1FE0A 5C24B 3CCES 1N34F 4YDDB 3TZZA 1FRIA 2QEXS 3JQJA 3M8QB 1YIJS 2HBRB 1T0TV 2FHOB 4ZVHA 5K8NA 2HHSA 1F0XA 4LRFA 2V8DA 1TUGB 2VH7A 2L9DA 1UFLA 1I1GA 3RBXA 4ECYA 3RB6A 3DOKA 2MSSA 1K0VA 3CT9A 4L3NA 4NXMF 2QLJB 4IRDA 4FPRA 1MW7A 3QFWA 3ZZYA 1DFDA 1F60B 4C7QA 4KPCA 1M0SA 2FJBB 3CIMA 2ZOGA 2AYGA 4PAAA 4C3KA 3GV7B 1LEOA 4XIUA 5D4OA 1PBUA 1N33F 4UQTA 1WG1A 2KI2A 4M1KA 1S0OA 5M2RA 1FKPA 2DNQA 4E0DA 6FDRA 1OIAA 1WEXA 4ATNA 3QWUA 1UZHA 2G2YA 4I67A 4OI2A 1H98A 4ZVGA 2CZ4A 2P9CA 3PX6A 1PYOB 2HHXA 5ITHA 4HH1A 4W98A 3JSYA 1F9FA 2HRYA 1U8WA 2BQRA 2PA8D 3RTVA 4LF4J 2UXDF 1KSPA 1LWFB 4Q5VA 4IG3A 4NYZA 3K5MA 1EP4A 4UZCA 3V6HA 5KT7A 4NX9A 3PEJA 2KT2A 3DM2A 2ZVSA 2MJUA 2YVSA 1NKBA 4DFKA 2MLZA 3W2WB 2AJ1A 4F8RA 4LF5J 3KFWX 2CPDA 1TL1A 1RDRA 4CLSA 3F41A 3EXCX 2AGQA 2VOPA 3NOCA 4ZK7M 4J9KA 3RBZA 2HIQA 1SC4B 2ZH4A 2FQQB 4F0KA 3QJJA 3GR0A 2VG6A 3SZ2A 3RGIA 1GH8A 1FEHA 2P6TA 1DTTB 3HK2A 3UCZP 3IR6B 2Q1LA 1RTJB 3HSJA 4N76A 1LQ9A 4I2PB 1XR6A 1N5QA 2XMVA 3I82A 2IM2A 1CULB 1HHTP 1RT4A 2OSRA 2WVCA 3PHEA 5KFZA 1N36J 4ER8A 3IG1A 1JB0C 2KXFA 4ZPWR 4X4VA 5F8MA 3CUNA 2OO4A 1N0UA 2CPYA 2YKNB 1RTZA 1WOPA 4ES2A 2OMOA 3BBCA 5FDLB 4RW7A 5T7LA 1IKXB 1JQGA 4RBTA 2W8LA 3S8SA 2XLIA 5KT2A 3MEGA 4O4GB 1S49A 2MZJA 5BR8F 2UUBF 1N5YA 1W25A 2AW0A 4J9NA 1TKTB 4DR4F 2KKHA 1HNIA 1TUWA 3C8YA 3PR5B 2AGOA 2CJKA 1ZPVA 5GAHU 2MB0B 3C6UA 1Y3KA 4FF2A 1VIOA 3I0SB 3OR1A 4U9RA 1RCOB 5K14A 1RHUB 4B3OB 2E44A 4ZOSA 1H3DA 3CJKA 4NLRA 2CFXA 4LRBA 2QGFB 2ADCA 4FYWB 1VMBA 3ZO7A 2HQ3A 3QO9B 2Z57B 1ZAXA 4LBIA 3JAMY 1C2PA 3TO8A 4DU8A 3TUZC 3MAQA 3ZFVA 4TLRA 4EZ6A 4OHWA 4JI7J 2J9DE 1CVJA 2ZWOA 5AXNA 2LEPA 3MM9A 2EEYA 1IXKA 1SJ4P 3G6ES 2J0QD 3RUBL 4KFBB 4DCJB 1A6LA 1BXNA 1S9GB 3GG1A 2PO4A 2YKQA 1S1WB 4QBUA 4C11B 3JS9A 3AFGA 2LQ8A 1EZZB 5DRKA 1SC3B 1YRTA 2JJ4D 2DRDA 2OUGA 3RB0A 3ZZTA 2VKZG 5E5NA 3T5HA 1O0PA 5KFKA 4IG0A 3PIOQ 4RW8B 3MCMA 2XSFA 3IR5B 1FDAA 2FVCA 3QMQA 1HNXF 4FPIA 1FDBA 2WVEA 4F0MA 4WK1A 5HVGA 4MIWA 3MM7B 2BE2B 5A8KB 3KK2A 5HSPA 2C2RA 5E3RA 1YVFA 1ZTWA 3KLFB 5KFRA 1OS5A 3GONA 4K4WA 3CMQA 4LSLB 4ZHRB 1FVSA 1RKJA 3LP0B 3HT0A 2XYPB 2AP6A 4OJGA 1T9UA 3BEGB 1LNQA 4OLOA 4CDIA 4ZP7A 4XAKA 5B7WA 4Q2MA 4NZ0A 2BV3A 2EFNA 4M5IA 1BQMB 2V63A 3EVWA 2F1FA 2IVMA 2FUG9 3MFHA 5ETMA 1DTQA 1YBUA 3B4DA 2FZCB 3M6UA 2XS5A 4H4OB 2WBMA 1SUQA 1WI8A 2QIFA 2W1BA 3J80Y 2LU2A 1UZDA 4WWSA 2IVFB 1JLQB 3AOCA 2VFVA 2ZOMA 1TVRB 3D54A 2VODA 3OT9A 4DV0J 3H90A 3WC2A 3M9OB 3MPUB 1RAEB 3QZ7A 4NCGB 4CM2A 3ICLA 1T05A 3LF0A 1KVIA 4IOCQ 1FNOA 3TAPA 3BO3A 5GMEA 2AJ0A 2HS4A 4PXEA 5LM7E 1D3WA 3PIPQ 3H5UA 4LFBF 1NSQA 1VDHA 5D4NA 3R27A 1HHSA 4ZCLA 1S9EB 4KTQA 1JLAA 5HANA 4LF6F 4C0BA 4BLGA 4YDXA 1XC9A 2LDIA 2MLYA 4IOBA 1U0HB 1N52B 3G8TA 2XYGB 2DNHA 2NREA 3W66A 4O44A 4X4QA 2VBYA 4DQQA 4B9TA 3JAMU 1GMUA 5KFIA 4YR2A 4O0NA 2BQUA 2ZE2A 1DARA 1XMOJ 1IBMF 3PW2A 2YH1A 4OI3A 4H4MB 1IKWB 5F41A 5C5JA 3M2RA 3FCWA 5ETKA 4Q7AA 1VCTA 4KYZA 2GJIA 3LO3A 1RT3A 4Z2XA 4X84A 1KKHA 3D2WA 4V19J 5HLFA 1B0TA 2BYCA 2RDJA 1U26A 4DS4A 4FZVA 2H1YA 1T3NA 2A10A 3FRZA 4PQUA 3M8SA 4B3TJ 4WCEQ 3HHNB 3H98A 1QVFR 1GQEA 4ZPTR 4OJ1A 1N5VA 5KG4A 2YQ3A 1EQMA 4DCPB 1YKWA 3EGZA 5A2QY 4UY8T 1U2FA 5H9EJ 4M8LA 4OYOA 2X1FA 2FZKB 2C28A 4JV0A 3EPGA 3OUYA 2LFVA 3OVAA 3ET6A 1UJ4A 3R1LA 4C48A 5J2NB 3TA2A 3HFKA 1X9SA 3HHDA 4HDGA 1N0VC 2ZBCA 4DOZA 2R8IA 3LWLA 2LEBA 2YQ1A 3POTA 3EGWB 5CYMA 3W62A 1N88A 3AAWB 4ECZA 2OPQB 4IQMA 4DPOA 2JHEA 3CCWA 2UVWA 4RNFA 1C4AA 4F7VA 2CNKB 1KR4A 3J80U 1IKYB 4PKDB 1A0OB 5J1EB 1PILA 3N0VA 4OYBA 1ZOTA 2VQEF 5ETPA 2WONA 4UZBA 1QTMA 5E2QA 1OO0B 2YKPA 4NLQA 2ERRA 3M7VA 3US5A 1OWXA 1HBOA 1SKUB 1S1TB 1QD1A 1J27A 4EZ9A 4J9SA 1I5OB 1XNQJ 4WFXA 2W2MP 1BWEA 1SIZA 1EARA 2E1AA 4R5PB 1CPZA 3G96A 2ZUGA 4U7UK 3J7Z5 2AZ1A 3BZQA 2XGPA 3DCAA 5BJRA 4URSA 1WG4A 2CQDA 2XYHB 4S0MA 1UVJA 3A4TA 3TZXA 2HNZB 2F9JA 1Y7PA 1KNZA 3CULA 2W24A 4ELVA 4A8MP 1JLCB 2CQCA 3IMQJ 4F4WA 2GGPB 1Q0NA 4ZLPA 3QT6A 3PKMA 2FY8A 3UE2A 1N6QA 4XTTA 5F9NA 3SDEA 4P2MA 3PO4A 2CADA 4DX5A 2PE8A 3W8GA 1RAAB 1AYEA 3OTOF 3W5XA 2H5EA 2W9CB 3H2LA 4X4OA 3P49B 2X1AA 2ROPA 2RU9A 2VU5A 3TUJC 5CZVA 1WF0A 4CO2A 7FDRA 2DH7A 1UWAA 3PY8A 3EMTA 4W90B 2CPZA 5IM0A 1KFDA 2XTJP 2YH0A 4PWDA 3K5NA 2DR5A 4F4ZA 3KK1A 2V8PA 1X4EA 4GMKA 3IBCB 1UW4A 1RHJB 2D3O1 4UOHA 1UVKA 2EFQA 2VHGA 3PYDA 1V5IB 3KKFA 2IJNA 5DQIA 3DLBA 1Q81T 4ZVUB 2OIHA 3M9NB 2YNIA 3PXGa 3UDCA 5A2QU 4ILRA 2W2PP 2AX0A 4L73A 3W61A 3TJ8A 3HPOA 4DSJA 2JEFA 2UP1A 4EBDA 2XNQA 1UMJA 4KGKA 3W2VA 2RS8A 3KHHA 4DR3J 4HDHA 4ENOA 3C14B 2MHEA 5CYQA 4ZDNA 2Q43A 4QYZK 2VG5A 1FVQA 1CS4B 1OY6A 1WHXA 3I32A 2BKNA 1PIEA 3AD7C 2R7WA 4M5GA 3D6TB 5H9FK 3MM5B 4EUVA 3CJSA 1VC5A 3FCHA 4D3HA 5KFHA 4UF4A 2NZ4A 7FD1A 1HQEB 1QAJA 2Z2YB 1AXQA 4IFYB 1R8BA 3GJQB 1PYSB 2YX7A 3J7YU 3TZWA 2QYGA 2DCUB 5AXMA 3R9LA 3UD3P 1EIYB 1UFWA 2A3JA 2ROEA 2ZHBA 3EDRB 3L3CA 4DL6A 1C1CB 3VR1A 3IRWP 2JFKA 2H4WB 4LF7F 2D1CA 5HBMB 3WQPA 1RHMB 1NO8A 4IO9Q 4ZS6A 4ZVOB 2KRRA 4HI2A 1PSDA 3MUVP 4KH0B 5IZHA 3TVKA 3OJUA 4DQSA 1Y4ZB 4MKYA 1TP7A 4P6QA 1TAQA 2XZWA 2VD3A 4DQRA 2FY1A 2ZC4A 1D1UA 3OFGA 1NM2A 4DR5F 4USKA 2A1BA 4FXWA 1CJTA 5B0GA 1YX2A 5D77A 1XNRF 1RWNB 3EYZA 3KDOA 1UKUA 3CMES 3EE3A 1T3OA 4KV8B 1TMJA 3TX8A 1KD1T 2O3DA 4Z7YA 5KG7A 2B9WA 2DBBA 1NK7A 4AXJA 4XPEA 3CD0A 4X66J 2HMIA 4MTPA 3DMJA 3N6LA 2AU0A 3TRGA 4CLUA 3NNAA 3ZTRA 2HQCA 5KG2A 3MM8B 4JV2A 3ZZPA 4ELUA 1T94A 3PCOB 4NZ7A 2V50A 1BQXA 4G65A 3AXKA 4PCQA 3IM8A 4ECXA 2QSFA 2JEGA 1SL0A 2RVJA 2KH9A 1C1BA 4F50A 2OSQA 1KLMA 3QFHA 4FS1A 1IM6A 2OHDA 1JK9B 1HWJA 1HMVB 5IQQA 1LWEA 3CDAA 3S01A 5DGAA 1AUSL 4LF9J 1EQ0A 5IXUA 2NPIA 2WAQD 2VC0A 2JC1A 1EB0A 2HS0A 5IQ6A 2XLJA 1EKSA 4N41A 5F0UA 2L9NA 5L9XA 1IR0A 5IT9Y 4DV3J 4N77A 2R7QA 1H7WA 2U2FA 1PYTA 2BR0A 4JI8J 2IIHA 2X3DA 3M9MB 2IMWP 4A8FA 1TKXA 3MDFA 2QA4S 1YTYA 2ZH1A 4HACA 2D74B 1SKWA 1B0VA 3DRSA 1KC8T 3M8PA 2QG9B 3D68A 4KRWA 4Y00A 5DGBA 5HP1A 1P9YA 4MYUA 4JI4F 1H73A 2ZH8A 2F8EX 2XMUA 2PEHA 2XY7A 1URRA 1X4GA 4WP3A 3M2UA 8AT1B 1S59A 1KVKA 1Y9OA 1T9WA 1Y5LB 3DRRB 4J9UE 4ED1A 3QRPA 3SEOA 5JVGQ 1YHQS 4DG1B 2Y1RI 2F5GA 4WFYA 3MTKA 1U25A 3GLJA 4PWUA 4ED0A 2KL8A 4DN0A 4E98A 2NXUA 4F0HA 2FB0A 3G6XA 3CPWR 3P45B 2V94A 2V68A 1R31A 2ZBIA 3DLGA 1URNA 4Q8FA 2HQDA 1WF1A 4QIWD 4DR1J 2PI5A 1JLFB 4ZVEA 1H6KX 2CVEA 2DXEA 3LQVA 1HBNA 2CJ9A 5E33A 5T41A 9ATCB 1K1SA 4B3RJ 2UVUA 1EAYC 2HS3A 3Q23A 2FC8A 2VFUA 4MIAA 2JX2A 4A8WA 5HI7A 2MY8A 1YBAA 3BJYA 2LMIA 4QJVA 1VQMS 2HKEA 3V4MA 2Y0SD 3SSRA 3PFEA 3BGRB 1XK8A 3OVSA 4I68A 4WXWA 2UUWA 1FDNA 1FA0A 1B7YB 2KYXA 3IRXB 2A0FB 2ILYA 3EX7B 1IVZA 5BXIA 1NDCA 2MGZA 3DGVA 3M8RA 4IOAQ 2QL7B 1FKOB 4L74A 3UI3A 1U49A 2G2OA 1CC8A 3W2WA 2UVVA 2E29A 2Q66A 2W01A 4OZNA 2R9LA 2XS7A 4CWBA 2EXUA 1ZS6A 3GFYA 4NLUA 5C25A 1SKSA 2B56A 4MK8A 1WHVA 1FKAF 3I5BA 1EETA 3FKBA 5IV4A 3D3CJ 3BV8A 3V2UC 4WYLA 4RUAA 1B64A 1KWMA 3T1HF 2HLUA 5F9LA 3BSNA 3MXHP 5IT9U 3Q8PB 4KC5A 3E3XA 2C3PA 1YJUA 4CNYA 1HNWF 1RTJA 1WSRA 4I2PA 4PXCA 4RNMA 2XY5A 1CULA 2NZCA 2CG8A 1C0UB 1F5AA 3FGVA 3M2VB 5A0YB 4PUOB 2VG7A 1Q78A 3FSXA 1OQ3A 3GZ7A 2YKNA 5FDLA 1IKXA 1RBAA 3GIKA 1XQIA 4IKAA 3H20A 2D9PA 1RXOB 2KXNB 1SIWB 3MPYA 1FERA 2CPXA 2XCAA 4DZDA 1XMBA 4BWMA 1FTCA 2HFSA 3FCVA 1QAXA 2H51B 2GV1A 1WF2A 3R7NB 1RYSA 3VALA 4DL7A 1TKTA 2VFTA 1O8BA 4NRUA 1NNDA 3EGNA 1T03B 3CDEA 3V6DA 3KLGA 3THVA 2F4VJ 3FFIB 4MFBA 2Z8QA 3Q8QB 5LOQA 3UWTA 3GE9A 2PGCA 2ZBRA 3N4WA 3I0SA 1D8YA 4X4NA 3Q0AA 4Q0BB 3G82B 1GK8A 2K1RB 3IWNC 2DGTA 1RLCL 5KFMA 1VQ7S 1VQOS 4CLLA 1JLBB 2GNKA 2KO1A 1U8SA 3O1LA 3Q2SC 4BBYA 1YLXA 5HMZA 1WORA 3UR0A 2RSQA 2YX4A 4DWIA 1F9HA 1ZM3A 2MQQA 1VC6A 2F63A 1LW0B 2W7OA 2J0WA 4ETZA 2BRKA 3GIMA 5F8GA 3RRGA 2AGPA 2HNDA 4B3MJ 1Q79A 2ZHOA 4DR6J 3KLEA 2KFNA 4RNOA 1IBKJ 2AHOB 4USUA 1T9XA 1R89A 1AT1B 3QLHB 4ZLLA 4QPTA 2CNLB 4FVCA 1TU0B 1HR0J 2OPRB 2LXUA 4LSZB 4WF9Q 4OX6A 3BH6B 2XZTB 1S1WA 3CJQA 5CXTA 2FIUA 4RUHA 3CB4A 2HZAA 4C11A 1NPPA 5DJBA 1VRTB 3DRPB 3KWMA 3BR9A 1FX2A 3SBMA 2V9WA 3M8WA 4X62J 1NXIA 4LQ9A 2OI2A 5JVHQ 2PMWA 2APOA 3A12A 5DDRC 2IA0A 4YEAA 1HIYA 1X60A 2W9AA 3I87A 1HA1A 4JI6J 4J90A 1U48A 2BJEA 5EX3A 5HMXA 2AZ3A 1VLOA 4U67Q 1NJWA 3AJDA 1NPKA 4LSLA 2BDPA 3BN7A 3AODA 3RBEA 4JI3J 2MEWA 1NJYA 4I56A 1RWPB 1R27B 2HRUA 2OH2A 3FRYA 1RB0A 5MAOA 1UA1A 3D9BA 3G87A 1BQMA 5KFEA 1R0AB 5HQLA 3CJ4A 1JKHB 2QMUB 4YY3J 2EI5A 4YOEA 1W2IA 2NXCA 3GJSB 4XDCA 3V81B 4J7CA 1G4CA 3ITHB 4B3SJ 4M5MA 5E3AA 2RB7A 2AKWB 1TVRA 2DGWA 2DK2A 3GV8B 1JNRB 2JLFA 2M70A 3BQ2A 3UVJB 2BQ3A 3C66A 1A9NB 3A8EA 2V2QA 3FJ2A 2HQGA 2YXLA 5H9EK 1U1MA 4LIWA 3JTOA 3JSRA 1REGX 3DHWC 3RJMB 1HNZF 2CIMA 1RTDA 2PMHA 4DXLA 4IO1A 4NLTA 1S9EA 3KDNA 1JLGA 3BSCA 3FQLA 5L39A 4CLTA 4LFCF 5C7PA 2KN4A 2GJ2A 1WD6A 4FVMA 1X4DA 3D1OA 1SH3A 2BJDA 3IGVA 4TY9A 3RAXA 2QL5B 2IDLA 1CJKB 3BBFA 3SV4A 3EUNA 1HW9A 3K59A 2G1DA 2BXJA 4EFAC 2YPYA 1YJNS 4DL4A 3BS9A 3ULHA 2W4CA 2D9OA 2GVZB 5IC6B 1FWPA 2DPIA 5DG7A 5HVHA 5F8JA 3TQ1A 2JLEA 4G1PA 4A47A 3RZAA 2DITA 2G9OA 2MPUA 3KMQA 5IT4A 3O8WA 4J9PA 1S1VB 3W5ZA 1GMVA 8ATCB 1DBDA 1CQMA 2EFVA 3L9ZA 2CJQA 4JB8B 4OYMA 1REVB 5JXSA 4LF2A 4C2MA 2XHWA 4DDFA 1OPZA 4M94A 1XEZA 4OYPA 2IDEA 4I1TA 2NUHA 2M9KA 4UOFA 3VWSA 4NLWA 1CG2A 4M63A 4ZCMA 2IRXA 3PRBA 2UV8A 1ZPWX 4R25A 4DV5F 2XB2D 4WU2A 4KGXB 2Y1LB 2V2ZA 3BGOP 1TKZB 2HNYA 5G0RA 2OPPB 2J9CA 3MMAB 2HVDA 5AJ3J 4A8XA 3PFOA 3VQSA 2JVRA 3TAMA 4CLWA 4ZP8A 1KS2A 4A8YA 2DGXA 1N32F 1MMLA 4OJHA 4R0EA 4RW4A 5C2GA 2UXBF 3F44A 3X1LB 2DEIA 3MPDA 3PEHA 3AD8C 4RJVA 3EZUA 2KJWA 1RWWB 4HR2A 5KFGA 4CT9A 4YR0A 3TAQA 1X4CA 4JI1F 2QA4G 3DLLQ 4UOCA 1H72C 4X64F 1Q8KA 2W2NP 2V2VA 1J2VA 1MNEA 1WHYA 1T11A 4LBHA 4XO0A 1S6PA 3HHLD 3TNVA 1M5KC 3G2XA 2WHOA 4PPZA 4G1QB 2QLFB 3BDPA 3MEEB 2LQ5A 1OYEA 3VAMA 3MM6B 3PNIA 4GVBB 4OI4A 2IAJB 4OZ0A 3UN5A 2XMWA 3QAEA 3M4XA 3D1QA 4P2FA 2YNGB 2DRBA 5J2MB 3I6PA 5JUMA 4NCBA 1U7LA 2UUAJ 4NXNJ 1WELA 4OIXA 4NWBA 4OYAA 2WBRA 5D0HA 5DDPC 4IH6A 4R5PA 1SQEA 3PO5A 1FT8A 4UQGA 5IT0A 4IUFA 5JMNA 1X5TA 4NLGA 4JI2F 1FDDA 1GXTA 1N36F 2LQBA 2EPIA 1UETA 1JJCB 1VQKS 4IQXA 2VZ9A 5KFNA 2PI4A 4Q43A 3J81j 3UPFA 3KG4A 4NA1A 2AV5A 3O5TB 4JP8A 1JLCA 3AT1B 3H0PA 2DNYA 1S7HA 4BC9A 2RT3A 1Q5VA 1NZ8A 2W7PA 4LVNP 1SV5B 4CT8A 2X3GA 2QT7A 4N7TA 1S6QB 1TV6B 2RDDA 3T1YJ 2X1GA 2MKIA 1GEHA 4NCAA 2C3YA 3CO9A 4X65F 3VAGA 4OZ2A 2ZNYA 4PG6A 5CCMA 3GP9A 4ECQA 1FRLA 2KG1A 4ANEA 3W1YC 3QYYA 1QDUB 1VK8A 1UWBB 1NLKL 4USWA 3R5CA 1LOUA 1A7GE 3CF5Q 2CQPA 5J2PB 3M8YA 3DOLB 2GC8A 5EHHA 2FVQA 4ECVA 1WC1A 3M1VB 5A8RB 1HBUB 3K2YA 2DRAA 4BS2A 2A6MA 2EG2A 2Y9HA 4C4WA 4F02A 5I3UB 4C98A 3G8QA 2W2QP 2R7VA 3LALA 2JZ5A 1PGZA 5DS7A 3GILA 3V6KA 1GX6A 3KLIA 2XWYA 2RE1A 4K5RA 1IKVB 4TVAB 1HBMB 2XCPA 4FKYA 2GFFA 4RWWA 2DPJA 5HROB 1K0TA 2HFZA 2CQGA 4LR7A 4U7UD 3FMBA 2V6AA 3D3BJ 3DYAB 4IR9A 3MF5A 5BR8J 5EWGA 5EGYA 2UUBJ 2NXJA 1PG5B 2DIUA 2K3IA 3AJ2A 2JLGA 4EO6A 2YWGA 5F8IA 5KT6A 1U24A 3DLEA 3GSDA 3HVTB 1JJ4A 2RUGA 3AB2B 2XSJB 3LA0A 1QTNB 3H4DA 3L09A 4OYZA 2IC3B 3CGIA 2DNMA 5D4LA 2EFOA 5CHCB 1D09B 1HNVB 5ETRA 3TZYA 3R7BB 1OJ4A 3KNAA 3OR2A 3FDSA 4Y3CA 5F8LA 3I96A 1B4SA 4C8LA 1SPBP 2K7JA 3QBCA 4J9OA 2I1RA 1F2GA 3QGGA 1IQZA 1PCAA 2Q79A 1ZAVA 4AQYJ 2RQKA 2AD9A 2E7XA 1UJ6A 2HIYA 3C16B 2BUNA 3JSMA 1NK8A 4Y2AA 1HPZB 3Q8YA 2ACMA 5D3GB 4RBVA 4K8RA 1RHRB 3WHIA 4WYWA 2M88A 3BO4A 1C0TA 5ETTA 2YKAA 4DV0F 3E2EA 5KFYA 2E5JA 4I6WA 4J91A 1RT2B 1U6ZA 2VOOA 1G2EA 2L3MA 2HRTA 1JLEB 4OX8A 4I64A 2MZRA 3DHXA 2VFRA 2XS2A 2B43A 3AD9C 1LXNA 4TU8A 2QV6A 4TU9A 3UD4P 1HNXJ 5F3ZA 2DVIA 2XHCA 1FJGJ 3ILIA 4DV2J 3FZ2A 4OJ3A 2EG1A 2ABYA 4I0WA 3T6JA 1VBYA 2YKMB 3LGHA 3ZZ0A 4NI2B 1P27B 5DLFA 4CYUB 4O3PA 1FXDA 1K1QA 4DSEA 4OYIA 2B6AA 4URQU 2CQIA 1HMVA 1NZAA 3NKYA 1RT7B 5KFSA 1MWYA 4DL3A 4CO1A 1XIQA 2HHWA 5L1KA 2J0XA 5A6PA 2UU9J 4DSIA 5L1JA 4RW9B 4OV1A 2BOPA 1HL6A 1WC5A 3HZGA 5KFOA 4ES1A 3NBPB 2UZAA 2M0GB 2NSCA 4U8YA 5DM7Q 1DLOB 4QW8A 2RF2A 4IFVA 2NSBA 1VGYA 3C2PA 1RWKB 1AUDA 2J0SD 4KH1B 3QWPA 2DB1A 4ECSA 1QUPA 2ALZA 1ROFA 2BE7D 3EPIA 2XC9A 3HFVA 2OLWA 2CPJA 4PRFA 3Q8RB 2R7SA 4B3TF 2RIJA 3I4PA 3ISZA 2KU7A 4LFBJ 3PKYA 4ZKAA 4I2QA 3QGIA 1LW2A 4ILMA 5KFTA 1S1XA 4LF6J 5SUHA 1B0PA 2RRNA 2M4MA 1CJVA 2CPIA 1RAIB 1EX8A 3DRRA 3BO2A 4ZITA 4FXDA 4NLXA 4XK8C 3NGDA 2Y3YA 3VVTA 4LIRA 4TY8B 5KFUA 2A18A 5CYJA 3WBZA 1XWLA 4E8UA 2B7BB 2D69A 2HVEA 2I5JB 3W60A 1OSDA 3LPYA 2CZ9A 3MAAA 2DO4A 2MZ1A 1WWHA 4N8OA 1E6YB 3IA0A 1U02A 3B78A 2W4PA 1EJ7L 5I42A 2YPZA 2AYEA 1B7FA 2IM0A 3TUPA 5A76A 5LJ5Y 2ADBA 1QAYA 2HHTA 4Y2KA 3FBBA 3OL8A 3QSYB 3KYLA 1FESA 2KT3A 3UNGC 2GZOA 2XULA 3AB4B 3DOKB 3FZBA 1RAFB 2DNNA 1ULRA 2XMJA 4C8MA 3CXCR 3NRBA 2R3VA 4JYAF 2W8KA 4ECWA 3CD6S 3LAMA 1RABB 4EGLA 2IFXA 2MMYA 3A8IA 4DLEA 3AY0A 2BJ3A 4FYVB 2BKOA 3T5LA 3LP1B 1MU2B 1GNKA 3P8BB 3NS5A 5HJXA 1FKPB 2MY7A 1PC5A 2WVDA 4RBUA 4EO8A 4PXDA 2R8JA 1WTFA 3TANA 1FKOA 1FTRA 1VYAA 2Z58B 2FC9A 2YNFA 3L4BC 4KBIA 1D9AA 4M5HA 4ANCA 2RHQB 1FJEB 4B9LA 3RBDA 1OQ6A 4P2SA 3UN2A 2M5YA 4PYAA 1UVIA 3CJRA 1PJ7A 3UW1A 1EP4B 3VVUA 2BE9B 3RG6A 4ZVTB 1TL3A 3PW5A 4LRAA 3DM2B 2UUCF 2FLLA 3BPDA 1E6VA 1L5UA 4X4RA 3H40A 4QOTA 1NSKL 1OMSA 1TL1B 3LP2A 3M30B 4OV6A 1TFWA 1Q8LA 1RTIA 3BN4A 4DPXA 2NXEA 2NYIA 4G6VB 2VG6B 4PUOA 4DV6F 1U6FA 2HYIB 1FK9A 5AXLA 1QM9A 4F26A 3TQEA 4H54A 2N3OA 2EK6A 2MQMA 1U1LA 2D3UA 2P9GA 2XLKA 3T5JA 1TTHB 1RT4B 2B8QA 4C6AA 3HVWA 3VGSA 3IG1B 1MN7A 4EBCA 3IS9B 4RR5A 3QPIA 3JTPA 3SV3A 3NMRA 2B0GA 2IY5B 1LKZA 4ICLA 4L72B 5T7LB 4RW7B 1DZ5A 5K20B 2BM0A 2B9XA 3TYTA 4TN2A 4KGVB 1AZSA 3I9ZA 1RT1A 5IFMA 1PBAA 3MEGB 2P9EA 3NGTA 2CAJA 2WVBA 2HHHF 4F3OA 5A8WA 2BM1A 2R8KA 2ZJPQ 3IWLA 3OTOJ 3N5FA 3A8JA 2Y8WA 3DC2A 3MR3A 4DR2J 1TZ0A 5K8OA 2OMLA 1VR6A 3OR1B 4WKRA 3ENQA 4J9MA 5K14B 3BREA 4QQBA 3MMBA 4F04B 3P5BP 4P9SA 3CJKB 3F73A 5BYSA 1AROP 1NB7A 5LL6d 2VDHA 2VONA 2HWIA 3T19A 3BPSP 1QAIA 3SI8A 4Y65A 2AF6A 4NASA 3FEXB 3TI0A 1MMDA 3I55S 4DL0C 2DR6A 2QMXA 3C6TB 3T9NA 2C1EB 4QU6A 4W4MA 2DD8S 1H74A 5DDQC 3VAFA 1HLWA 5DZ6A 1UEKA 1CBKA 1M1GA 4J37A 2B4PA 2MKYA 3B6BA 3PW7A 3NS6A 4DMZA 3MM9B 4ERDA 4LR9A 2KM8B 1Q4RA 4OZLA 1N5TA 4CH1A 1VBKA 5LSOA 2CWXA 4NE9C 2E5LF 2H3EB 2GMHA 3ILLA 1SJQA 1KEKA 1Q8BA 5HAOA 4DSKA 1WKLA 1TK0A 3TWZA 4QWAA 2VL1A 1QVGR 2X51A 2M7SA 2QZ8A 4WPAA 3KLHA 2ZH2A 5ETOA 3RW7A 4IG0B 4LT6A 2K2PA 1D9FA 1U1NA 1NJZA 2KTQA 3LANA 4NLOA 4D3GA 3N79A 2MTLA 3E8OA 2GO9A 3GSIA 2P2CB 2R2SA 4DV7J 2BOAA 1FNMA 5KG3A 4Q44A 2LEAA 4FXVA 2UXCJ 4QIFA 4RL1A 1FCAA 4QIVA 1R0AA 2MQLA 2KB2A 3SQGA 1JKHA 2W25A 1T95A 4LF7J 4M5JA 3ZXWA 1D0EA 4LMZA 2MQOA 2C2ZB 3IWXA 4WFBQ 2XGQA 1GTHA 2MKKA 3MUMP 2YTCA 4YB6A 4GVLA 1YDLA 1DTQB 3OXGA 1Q95G 2DKOB 2BA9A 3G8SA 1SUQB 5DM6Q 3K5OA 7AT1B 4QW9A 3UR3C 2MQ8A 4A8KA 4P7TA 2V8VA 4PABA 4DV3F 4JI5F 1R8PA 2GVDA 3BKFA 4CIOA 1UAWA 4K2XA 3D1HA 2HEKA 4JI8F 1R8CA 1TK5A 1NSAA 1SQGA 1T05B 2R7UA 1FJCA 1VJQA 2DYAA 2DNRA 3LTOA 1KONA 1VC0A 1MSWD 5I4MA 2I9SA 3E51A 1SH0A 1CSJA 3CO0P 4ANDA 3QATA 1S5ZA 3NNHA 4LFAF 3DLKA 2A2CA 1JLAB 4C0HA 4TQRA 4OHXA 2K7KA 4KO0A 2F8MA 3TEHB 1F9EB 3LAKA 3ENAA 2OPSA 3VQTA 3J7YI 1Q16B 4HHJA 3Q8VA 1WKKA 3H2VE 4WFAQ 4O44B 2U1AA 4NPOA 1R43A 3A3PB 1ZTTA 3CCVS 4JI0J 2QE5A 5I3QA 3CTRA 1WG5A 1G6BA 3D0HE 4NLYA 2Z30B 3L7PA 3NGRA 4K0KJ 1S1VA 5CH7B 1U47A 3QIDA 3M6XA 2ZE2B 3SCLE 2WOMA 2AEJA 2PSZA 2B9EA 5D0GA 4NLDA 4CNZA 2CQ3A 3CSKA 3KNGA 3HCXA 5ETLA 3NP5A 2COLA 5C42A 4DQIA 4B3RF 5HVFA 2PC6A 4ZCKA 3FBEA 3IO1A 2KXHA 2YNHB 5EDWA 4WFNQ 1RT3B 3NL0A 1PAUB 3KK3A 1Y00A 1X4FA 5HLFB 3MMAA 2GCFA 1QE1A 1RISA 1F6TA 1ELOA 3VV2B 3B4MA 1L3KA 4OI0A 4U8VA 2ZH3A 4PQUB 1ZYQA 1BWVA 4JI4J 1YJTA 1VQNS 2VJVA 4CP5A 2IRUA 2DT9A 1NBEB 2MYFA 3OHAA 2HWTA 3M6VA 2R8GA 4URGA 3UO0A 1H0HB 2VFSA 1J5OB 1FFGB 2ZITA 4DV4J 3F56A 2FJVA 4B02A 2B8PA 1O51A 2C2EA 3OUYB 4WJBA 4P52A 2HBZB 3ET6B 4N56A 3EXYA 3MR6A 3KLVA 3OSPA 4QWCA 4KIAA 1WHWA 2BRLA 2CYYA 3CWJA 4G1QA 2CNOB 3MEEA 3T6BA 1T02A 3NAIA 5M2UA 1VQPS 4MMOA 2JDJA 4OYWA 4DL2A 4OX9J 2I0XA 4KSEB 4A48A 1OY8A 3DI6A 4JV5F 1SKRA 2EKNA 3P4UB 3LGMA 2D7SA 4C3LA 4JOUA 4YB5A 4CLYA 1NK5A 4WZQA 3K57A 3RR8A 4CO5A 3H5YA 4M5DA 4A46A 2VB6A 3L95X 2H5JB 1DY3A 3HKZD 1M90T 3DRXA 3H5XA 4ED5A 2RS2A 1HBOB 2F65A 2YWKA 1X9MA 2YBVA 3VHQA 3EGVA 3FBCA 5HQ8A 4WIIA 1HWUA 2QSWA 4P2XA 2E9RX 2XMKA 3N6NA 2ZKTA 1YSJA 4L6V3 3CC7S 3CDBA 3TX0A 3HHLA 1MMNA 2OD4A 1TV6A 3MHYA 1WUUA 1XN9A 1R0BG 3MOZA 4A8OA 2W7AA 3R6GB 2FZGB 5BYRA 1FRHA 2VA3A 2I38A 3DGPA 3UFCX 5KG5A 2VBWA 4HEA9 3N01A 5B0FA 3OV7A 2F3JA 3CEDA 3R5BA 3JQKA 3SDEB 1Z1ZA 4MIBA 2VC1A 1UWBA 4KT0C 3JYTA 2EC0A 5KFLA 1ZH5A 1I3OB 3NAHA 4DUYJ 2Q6CA 1ZZNA 3KMSA 3DOLA 1S1UB 5IOLA 2DHSA 3R2DJ 3DFEA 4PG4A 3M05A 3MTJA 3PDNA 5EWFA 4NOHA 4ZVFA 1VBZA 3H2UB 5IM0B 4YHHJ 4KB7A 4Y34A 4PWDB 5LMNF 4O23A 3KK1B 2F8HA 4B3MF 4LVOP 2KM8C 4AL7A 3HULA 3T1AA 4C0OC 3GJTB 2J5AA 2M2BA 1WEYA 1NK4A 1CC7A 3D0IE 4TU7A 5J1NA 4OX7A 3BGLA 1NCLA 4CO4A 1P1LA 2LQ9A 1HBMA 3ZTOA 4UUXA 1HR0F 2DO0A 2CJBA 5HROA 1VQ4S 3RRKA 3MMCA 2CJYB 3V4IA 2YNIB 1RTHA 4AFFA 4CO3A 1T8EA 2RDIA 4EK2A 5EN1A 3DYAA 4G3IA 1F3VA 2RILA 2AWZA 5D0RA 1J5EJ 3AOAA 3WDOA 1XJWB 4C97A 2JL9A 4DX8H 3W2VB 3MECA 2RQMA 4ZPVR 3HVTA 3PHTA 2UUTA 4X62F 1W7WA 1Z2LA 2J8SA 4N8NA 1R3NA 1T9VA 5DQGA 3FK4A 4MKBA 3EDQB 2HQIA 1M5OC 5LMUF 4Y28C 3O44A 1L3SA 1FD8A 1KQSR 4DR7J 4UY85 1YJWS 4J9VA 2QA1A 4BCAA 2CJXB 5GADU 3FNNA 2VICA 3VAKA 1YK9A 2Y0BB 2B4VA 3VTIA 2CQHA 1XERA 5KOXA 2DGOA 1UVMA 3DXSX 2OKQA 3H8YA 4NLPA 3THPA 2Z2ZA 2KVIA 3CJTA 1LK5A 2FHKA 5C2CA 2QX0A 1F5BA 1SCJB 2XI2A 4YY3F 3P5TL 2GW8A 3ADAC 2IYIA 2V4JA 5B08A 3HM9A 1HPZA 1I51B 3W7BA 1KHWA 4B3SF 5L38A 2Q6BA 2DR7A 4K4SA 3DU5A 2W9BB 3D7SB 2RUSA 3UCUP 1R6YA 1GFWB 1TKDA 1RT2A 3GG0A 2ZH7A 1DRZA 5KFBA 5BYQA 3ZTPA 1FFWB 2IBOA 3ONQA 4ELTA 1JXVA 3OQ2A 1NH7A 2HMIB 3QSIA 3OD2A 2G1HA 1KTVA 4NL5A 3J7A1 1FXRA 1I6JA 4LRCA 3HLUA 2D41A 2HFVA 2HAFA 3KHGA 1PAEX 2XMTA 3GJRB 2M52A 4QYZJ 5HMWA 3KUEA 3NGKA 1AB8A 1RA7A 4CLZA 3GR1A 1JXEA 1WNEA 3M32A 4K5SA 2J6UA 2CQ1A 1C1BB 1VK3A 1FRMA 5H9FJ 1KLMB 1V5VA 4YFUA 3NBPA 1OPIA 3CC4S 1LWEB 2LA6A 1WACA 1S79A 2IA6A 4LSNB 1EHWA 5ETVA 3ISNC 2DGSA 2PFDA 4U7CA 1KLNA 4MYTA 2WTFA 4FN5A 5B0EA 3GCWP 3C15A 3G6YA 3OW2R 3PZPA 4YB1P 5E0OA 4HYKA 1N54B 1HNZJ 2B4UA 1UEVA 1UTAA 4BWJA 3CCZA 4LF1A 2HZVA 5J2QA 3OPKA 4OZJA 5F8HA 2QFJA 1TKXB 4LQ3A 3KJNB 4HACB 1DURA 1RT5A 3MMJA 2RH3A 3BSOA 3DRSB 4LBPA 1S4EA 3M8PB 1SC6A 4ZMMA 4TY8A 1FWLA 1WC4A 1ZA1B 4GC6A 5HP1B 1KQKA 3K58A 4LF8F 1LK7A 2V34A 3VGVA 3ZNUA 2Z0GA 3EVMA 4YS2A 3NWGA 2LYVA 2HVZA 3HMJG 1WOOA 1I94J 2RKIA 3HFZB 3R5DA 4K2JA 1KOHA 4BC7A 4FYXB 4HVZA 1BUXA 4XDDA 5GAGU 3BB5A 3HVAA 4WE1A 4QWEA 2G4BA 1CJUA 3ENVA 2AT1B 1S0MA 2E66A 3RB4A 1QSYA 5HO4A 2QLBB 5L9NA 2DR9A 4DX6A 3QGPA 1GXLA 1VRUA 3OHBA 3A3NB 1V3ZA 5LJ3Y 3DLGB 3D6MB 1FRKA 4J5OA 1X4HA 4RW6A 2EK1A 3FMWA 3NEKA 1YG0A 2UUAF 4I7FB 3NOGA 4NXNF 1HBNB 2W4DA 1XMQF 1B99A 4P74A 1X4AA 2R7XA 2VQFF 4M5KA 2GIRA 4DV5J 1X8DA 4C8NA 1U1RA 5HMYA 4ZJOA 1NU4A 3LP1A 1MU2A 4LUBA 2NCKL 3OTCA 2OP5A 4USHA 3H25A 2ZD1A 3MCSA 1N32J 2NR0A 1VQLS 2UXBJ 2AEMA 1ZZFA 4KKOA 2HFOA 2MZTA 1TL7B 3FVYA 1BLUA 4ED2A 5K8PA 4GKKF 4UUWA 4ES3A 4ED7A 4FF3A 1SJ1A 2HHUA 2G13A 3T1YF 3EZOA 3OJSA 4JI1J 2MGZB 5HJYA 3KG1A 1U6BA 1BQNA 4X64J 4FNHA 4KR0B 1H2UX 2YWFA 3JTNA 3M30A 3GWCA 2GAGC 3MUTP 5C25B 3UQSA 4ID5A 1K44A 1WDTA 2YWWA 1EETB 4ZPDA 5B0BA 1M1KT 4CTAB 4AL6A 1Q5YA 3O6QA 2XMMA 1XBWA 3V6JA 2BZ2A 3GFHA 5C24A 2DGUA 1V3RA 2MZQA 2P8IA 3JQMA 4ZLJA 2P6SA 4JI2J 3M8QA 4WBFA 4KAIA 4M5LA 1IBLJ 2F9DA 2VG7B 3IS9A 3OFHA 4F4AA 4J9RA 2Y1JA 5KFXA 3FUYA 3BM7A 5KG1A 4DUZF 1FX4A 3QGHA 2ASLA 3ENWA 1GXUA 1VS3A 4U95A 2ZNZA 1UCNA 2J76E 5I3PA 3HXMA 2GHPA 2HW3A 4WU3A 5GAEI 3GYXB 2Z4PA 2J6TA 4N5SA 3OTBA 2O66A 4AL5A 2DGQA 2RMLA 1FI4A 3I31A 3V6DB 3KLGB 4MK9A 4X65J 3MEDB 3CE8A 4MFBB 1S7IA 2MXYA 2MKSA 2NUUG 1BY9A 1LWCB 4O4RA 4KHPJ 4J9QA 1RAJA 2PD1A 1F5CA 2GA7A 1S4FA 2HQFA 3SCJE 2FJDB 2HHVA 2Y1IA 4DV1F 2CVIA 2H5IB 1LWFA 3N28A 3MZIA 4TXSA 4K7QA 1ZM9A 2GIFA 1IQTA 2DXDA 3NMAA 3SMZA 3SSQA 2HK3A 1VOMA 5D15A 3W3SA 2C3MA 3CJ3A 2HFUA 1BE4A 3KTQA 5K5MA 2G2ZA 3C6TA 3IGNA 4U96A 3SFUA 3MWBA 1X31C 2DISA 4AQYF 2QTWA 1X0FA 1YZ7A 4GC7A 2HNDB 2E1PA 3K8WA 4HLBA 4DPTA 3KLEB 4YR3A 3WX4A 1ICEB 2HHPA 2OFHX 5LXYA 3VAIA 1GX5A 2IM1A 4K50A 3OL9A 2HHQA 1DTTA 2O01C 3IXQA 1S48A 2PFFB 4RKUC 1UA0A 2CKWA 5KFVA 1HI8A 4B17A 4F3QA 3RW6A 1YRUA 1FNXH 4ZVQB 2E1CA 1WSVA 1RK8A 2AEFA 3AH6A 1Q7YT 4G1IA 2AJFE 5CQGA 4BHQA 2ZJQQ 2WSFC 1FJGF 3MCNA 4DV2F 4TLQA 3NG8A 6AT1B 1FRXA 3I56S 4H4KC 5IWAJ 3MOJB 2M3DA 1S0VA 1SL2A 4O4GA 1FFSB 4Z37A 3W8PA 4J9LA 5IS2A 1V3SA 3U1MA 2LLZA 5HQMA 2R2TA 1BC6A 5M2PA 1S57A 4MKAA 3CCSS 1HQ2A 1IJFB 5AE1A 1LFWA 2UU9F 1S99A 3QRRA 2M8DB 2F4FA 2DTJA 1IJEB 4MT1A 3B82A 4AD6A 3D4JA 5GVQA 1MWZA 4B3OA 2XNRA 2GQ2A 4Y0FA 3IM9A 4HTJA 4FBTA 2B5JB 1OY9A 3AA9A 1H7XA 2VPZB 5KT3A 2AMCB 4P7VA 2HGNA 3SCIE 1RP5A 4MH8A 1VHFA 5L1IA 5ETNA 1U1OA 4FDFA 1C4CA 3QO9A 3LPEA 1RAGB 1SB6A 3L7UA 5CA5A 2VA2A 3OSNA 2H54B 1H2VZ 1RTDB 4RUBA 4IDKB 4ALZA 1WTBA 1JLGB 2R7OA 3MD1A 2ZM6J 2PN6A 3MPVA 3NXZA 5CZXA 4RNNA 4FF1A 4KFBA 2DXFA 2YKOA 5GMKa 1XR5A 4DLGA 2FLOA 4K4UA 1S9GA 5LSRA 2JOQA 1P9QC 1VQSA 4R8UB 1L3UA 4PYDA 1H38A 3MPWA 4ZN3A 3ZTQA 4O3SA 4IYQA 4F25A 4F4XA 1D8ZA 2IVYA 4RW8A 3SQOP 2N7CA 4DFJA 4RU9A 3HP6A 2ZEJA 4DF4A 1YBTA 4X4SA 2E7VA 2CDRB 3MM7A 1YRXA 2BE2A 2LQJA 3OLAA 1X7VA 2GQQA 1JXLA 5A8KA 4GRSA 1FE4A 2FD2A 2CPHA 1FEEA 2D3OR 2FDNA 5LSLA 3T9ZA 3KLFA 1PC4A 4RO0A 2YNHA 1VQ5S 4EBEA 2B9YA 2VPWB 4ZHRA 5MLCV 2WVFA 4ECTA 1M5SA 1YJRA 3LP0A 3LH2S 5KFWA 3HVRA 2WZ1A 1DQAA 1RWVB 1U0SA 3NCRA 4DX7A 4WFZA 4ZVRB 2BJ7A 2RAQA 1KFSA 2POKA 1T7PA 4B9SA 2FGOA 4DZ6A 2UV8G 2HNYB 5G0RB 4NLSA 4H4OA 3I0RB 2QRRA 2QA2A 3GFXA 2E1RA 1F3FA 3ILJA 3PX4A 1SVDA 3TAMB 1J5OA 4Y6IA 5T14A 3J7ZT 3NLCA 1JLQA 3R3TA 4P71A 1X0PA 3R5GA 5CAAA 5J1PA 2EC2A 2YWEA 4NCGA 4A8QA 4DL5A 2EBEA 4RW4B 2WCXA 3CJ8A 3UD5A 3VF0B 4DJBA 2CDQA 2VJUA 1N5SA 1NK9A 2HGLA 2BMBA 2DNPA 5JJBA 3CCQS 4GKJJ 2HPUA 2VASA 2ZZTA 4WP8A 3JSBA 4DHVA 1KQGB 1TELA 1U0HA 1HQUB 1HWLA 1S6PB 5HK4A 4TYBA 3MI7X 5D4PA 1GMWD 5HL7Q 1R8HA 2YQ0A 1IN0A 3PRVA 2C2DA 1OSCA 4YMEA 3H4BA 3I4HX 4I6AA 2LP4A 3DXBA 3CNQP 4N47A 4JYAJ 1IWGA 3P6YC 1NB2A 3PJXA 1RT6B 1YQHA 4OI1A 2NPFA 1Z2ZA 3D0GE 2BANB 5K8MA 1S6UA 3IBFB 3DLHA 5KG6A 1PJ5A 2VF3A 4HTIA 4H4MA 1IKWA 2GS8A 1SJRA 1HFEL 1NMEB 3KJFB 1WKJA 2LDYA 3JXOA 4O3RA 1YWXA 2JFDA 4GO5X 3M8ZA 1TAUA 3MD3A 3OFEA 3ETMA 2J9DA 1KP6A 3W63A 4K4ZA 5ETSA 1RBOB 3OFFA 2QO3A 2G0CA 3OXLA 2MDAA 1Q7LB 3PVXA 4FF4A 1TFYA 2GAHC 2QMWA 3QQCD 3D5MA 3J81Y 1NHVA 2JSXA 4OI6A 1KTQA 1W26A 3OLBA 3ZZUA 5SZTA 3BH7B 4KJIA 3EICA 3GCXP 2GMLA 4I69A 2IBKA 1RYRA 2UUCJ 3G6VA 3ZZRA 1SQFA 4OHZA 1QUVA 2B51A 1S1UA 3MEKA 4DR2F 1O6XA 3EJMA 3ZTSA 4DFPA 4EYIB 3QT5A 3BYRA 2F40A 3R2CJ 3U27A 3QNWB 2ZH5A 1S97A 4P73A 1QJHA 2KYZA 3C3LA 1IBCB 4NEZA 3VGTA 5J2NA 3KJVB 4LF4F 1P8GA 4OLPA 3EVOA 4DV6J 1V9OA 1QY7A 4B08A 2P5VA 5FIIA 3TVZA 3IFEA 2V67A 5L8RC 2OPQA 4HHUA 4Q45A 2JEIA 1N34J 4LF5F 2HBYB 1IKYA 1G1XA 4WIQA 5J1EA 3IP0A 3N9UC 4CM0A 3KLIB 2HGMA 2DNKA 3DKDA 5THWA 4RNHA 1GAOA 1Y0HA 6FD1A 2DGVA 4KGZB 2QJ3A 1H2TZ 4WP9A 2GX8A 4NXMJ 1TL5A 4UOGA 5KFDA 1S1TA 4TKTA 2LKZA 2A6OA 2NXNA 1NPRA 3L7OA 2WW4A 4DUTA 2D3ZA 2HHHJ 2VPYB 3TUIC 2Y8YA 2J8AA 1JWWA 1N33J 4TYAA 4Y2MA 5DETA 1FXLA 3DLEB 1MROB 3VAJA 3NS7B 3BQ0A 2ALYB 3IBWA 1VLYA 2C42A 1HYSB 2QFIA 3KJQB 1ZM4A 2JWNA 2HNZA 4DV7F 2HG4A 2OAUA 5AE2A 2UXCF 4C9DA 3MURP 3OR2B 2GGPA 4RZRA 3I5AA 2I6WA 2UXDJ 1M5HA 2FVPA 5KAKA 2RQ4A 1TMMA 1ZETA 4OHVA 3ZZOA 2DNLA 4F67A 2W9CA 2A2DA 4JUZA 1NKEA 3PYGA 3FEZA 2GHVC 3K5LA 1SJFA 2L08A 4ZPAA 3CJ5A 1TL4A 5B0AA 4P72A 2W9BA 2WRMA 1NRKA 3K17A 5IC4B 4ITSA 4RUCA 3DRYA 1B70B 3EZ5A 4PG5A 2MQNA 2DY9A 3G71S 2LECA 4OZ1A 2FGCA 3JSMB 2HAIA 2EW9A 2E5LJ 4OZ5A 4O3QA 1IWAA 3H7HB 3J81U 3GU0A 4P10A 2V5HG 1AFJA 2MSTA 1L3TA 1C0TB 2I8EA 2XY6A 3NGSA 4P75A 2CPFA 2L9WA 4AE5A 4WTOB 2Q3PA 2VBXA 2ZUAA 3N5BA 2GIQA 2C3OA 3TW0A 1T9TA 1FF2A 2IRYA 4C8OA 4JI7F 3VAHA 3CJ0A 1RA6A 3SSSA 2H65B 5CD4A 2DCLA 4DU7A 4F36A 3FEYB 3U02A 4DEZA 3RR7A 1S77D 4YUDA 3BSAA 4B9VA 2AJQA 2VUGA 2R8HA 3OL7A 2WSEC 4L75A 3QIPB 3SYZA 3DOMB 3C14A 4H4KA 1WOSA 2XO7A 2QN6B 2K3KA 1UVNA 1SI9A 1CS4A 2KFZA 2O67A 4ED8A 4JI0F 2E9TA 4DBQA 2HVHA 2E1MC 4I6YA 3C46A 2EBGA 1UP1A 4NA3A 3CCLS 4DR4J 5KTQA 1TK8A 3H42A 2B6AB 4K0KF 3MM5A 2DHXA 2OEJA 2C2KB 1NK0A 5F8NA 4LSNA 3HO1A 1HQEA 4CLPA 3HD2A 1U1QA 1W2BR 3GB0A 4ZIVA 4IFYA 1RU1A 2WK4A 3S7RA 3O3LA 1FWKA 3CCUS 2Z56B 3G86A 3BGUA 2RF2B 1U1KA 1KDNA 4IFVB 2ZH6A 4A4JA 1C1CA 4JI5J 5LT5A 2BVZA 2G0JA 5HBMA 2JNJA 4ZP9A 1RQ0A 2ZH9A 5L46A 4ZIWA 4CH7A 2EFGA 3BDEA 3GYGA 2ZKUA 3GPAA 4K4XA 3A8KA 3DDIA 3WZ0A 4DQPA 1V6HA 4ZPBA 4I2QB 1HI0P 1RWOB 2LA4A 4LFAJ 3PRDA 3FBFA 1LW2B 3K0JA 1HKAA 1S1XB 5ETQA 2RNEA 3UDVA 3AQOA 1CJVB 4DV4F 4IR1A 3WIUA 2OJ3A 1S9FA 2W2OP 2R7TA 4F2SA 1VFJA 1SH2A 4KV8A 4LREA 2FHJA 2XO6A 4EMDA 1K8AT 2PEBA 1YJ9S 3QZ8A 2B7CB 5EWEA 1RHQB 4OFZA 1G3OA 3LWMA 1CQNA 3DLJA 1S10A 5GAHI 2VKRA 3MAAB 2DR8A 1Z4UA 3PW0A 1Y11A 1MG7A 1JMTA 3MM8A 2NYHA 1TQLA 4OX9F 2HVIA 2NLWA 1MWQA 3B8HA 5I42B 1S12A 4I7FA 3TR5A 2OTLS 2GQCA 3GMGA 3IN5A 1BMQB 2LU1A 4NZ6A 3E01B 2J7UA 3NY0A 1N4LA 3KUHA 3QT7A 4ZLNA 1BGXT 1DAXA 1SBRA 4F4KA 4WK3A 2L41A 4L3KA 2CQ2A 4LJMA 1UVLA 3VZIA 1VRQC 3W9JA 3RU0A 4PPDA 2BABA 4LR8A 2R42A 3A13A 3TARA 3D6HB 3ELHA 2ATLA 3OTEA 2MHNA 1XMOF 1P6TA 4Z7CA 3RB3A 4OHYA 1GT8A 3UDEA 4K4VA 4CZCA 2BKPA 4ZP6A 2N4CA 4NMLA 4QR2A 2AIRB 1SL1A 4UTGA 1UW9A 1TL7A 1HD0A 2I2YA 1RWMB 3GIIA 2RRAA 5KFQA 2MKHA 2KZMA 2QL9B 3T3FA 5KT5A 2HZCA 1N8RT 2KVQE 3CD7A 2FLPA 2C2OB 2V8HA 1NDPA 8RUCA 4ZN1A 5K9FA 4DSFA 1LV5A 2YNFB 3PYEA 2N4DA 1DJ0A 2RHSB 2XBPA 4USVA 2QYCA 1XTZA 4ZCIA 3TA1A 1AA1B 1FO1A 4ID8A 2YX1A 1DQ8A 3GYNA 1VISA 2C3UA 2DHHA 1TL3B 2EKYA 4PWWA 3BQ1A 4JBCA 1UPPA 3GTYX 4V1Ak 4DUYF 3UDLA 1E6VB 3Q8UA 4CTAA 1UPMB 4JV5J 3OBIA 3S6EA 2ZHAA 3LP2B 3R6LB 4WZMA 4DG1A 2FVSA 3IC1A 2R4FA 2PMZD 4YHHF 3THTA 1UFKA 1RTIB 4IH7A 5GMDA 2YY3A 4CH0S 2DJWA 1FJ7A 1X4BA 1PJ6A 3PX0A 3KHRA 1FK9B 3MR5A 3D67A 2JH3A 3EM1A 1APSA 3LUYA 4QPXA 1VQ6S 1IBMJ 4EWTA 1JLFA 4OL8A 2IYGA 4ECRA 1KN6A 1S0NA 1VI7A 1P1TA 1WC3A 3Q89A 1J5EF 4CLFA 2DHAA 2WSCC 2BW2A 1Q1KA 1IR1A 4ICLB 4QIEA 3CJ2A 3H5SA 1AZSB 2ILZA 4M95A 1RT1B 3T5KA 4ED3A 1UEUA 4QCLA 3MEDA 1RHKB 5H1SV 1N56A 4C8KA 4U6PA 1XNQF 1NJIT 1LWCA 2BEFA 3BGRA 1U09A 5A8WB 3V5RA 1FRJA 2IJFA 2J7WA 4ZPCA 3P96A 4DR7F 3LGNA 4IRCA 2C2MB 2JVOA 5ADZA 3MAHA 4ED4A 3IRXA 1MLAA 1NUEA 2ZJRQ 1M5PC 5HATA 1HW8A 2PDAA 1HARA 4X4UA 1NAQA 1U2RA 5KFAA 3MR7A 3CIZA 5EUHA 2IPOB 3MMBB 2OEKA 5LMNJ 2HFNA 1B3TA 4IG3B 1SJ3P 1F1BB 1Q8IA 3DNCA 2KFYA 4F2RA 3UN3A 1U45A 1X5PA 1Q86T 2DIVA 3SFGA 2BW7A 1ZA2B 4RWXA 4FYDA 3HZEA 3S1TA 5HN0A 2R7RA 4QU7A 2ACYA 3ETOA 3PACA 2CG4A 4WTYA 5CCLA 3HT3A 2VQEJ 2AX1A 1C0UA 1R0CB 1Y10A 3PV8A 2KHDA 1O5JA 3M2VA 5A0YA 1WC6A 4B9UA 3WX8A 4V19X 4PG8A 3MFIA 1NEEA 1SC1B 2EWHA 2BJ9A 2Z2LA 5KT4A 3KLHB 2BBEA 5L1LA 5LMUJ 3AXMA 3Q83A 5AT1B 4E2FB 4C3MA 3B54A 2CQ0A 1LWXA 3HHKA 5LXRA 3OTDA 1WJ9A 1Q82T 3NGUA 3CW2C 2KT5A 1YI2S 2V4QA 1TR0A 4DPYA 4DR3F 1U4BA 4ZJQA 1T03A 1AW0A 1JJ2R 3FFIA 1VIXA 2VIHA 4DN9A 4ECUA 1DHMA 2H9ZA 3BBBA 3FC9A 1N5YB 3C19A 2FJAB 4Q0BA 4YB7A 5KFPA 2MQPA 3G82A 2DEJA 3SQGB 2DY1A 3U7JA 2K1RA 2OD6A 1X5SA 4NYOA 1HNIB 3HSDA 1JLBA 2B5JA 2XEXA 3Q24A 2AJ2A 3C6UB 3CCMS 3CC2S 3AJ1A 2XMAA 3LOUA 3PG9A 1X9WA 1LW0A 4MJKA 2XI3A 2E7WA 1HD1A 1QSLA 1NJXA 3HSZA 4IDKA 2EFPA 1VBXA 3OXFA 1KHVA 4K59A 2GVDB 3AHPA 4B9MA 1GTEA 3QLHA 1VHIA 3F0NA 4DF8A 1N48A 2OPRA 3U1LA 2QLWA 4F4YA 2H4YB 4R8UA 3FSYA 3DN9A 1S72S 4YN3B 3T41A 1RSCA 4RX6A 5GADI 3DLKB 4OQJA 3R97A 2F7VA 1VRTA 3DRPA 3TJAA 1WC0A 1FHTA 1PKUA 4QR0A 3BGFA 4KO0B 5U47A 1I94F 2OPSB 5E7OB 2V4RA 4PEOA 4DCOB 3MGJA 4YP3A 2MZSA 4ZVSB 5KFCA 3PJWA 4W92B 1Y5IB 4MKVA 1OYDA 2XWXA 4X66F 2HBQB 3NCQA 3FSIA 1HI1A 1S6OA 2JRSA 4EYHB 3QRQA 3DU6A 1RWXB 5D78A 2ZVIA 5G4DA 3GIJA 3HDSA 2CQ4A 2FLNA 4QWBA 1R8AA 2WOMB 3TA0A 1RI7A 1WEZA 4QR1A 2OELA 2IMOA 3KK2B 4X4TA 3U1NA 1XR7A 1RCXB 5C42B 4RU2A 2L48A 1LXJA 4O3NA 2BJ8A 4TNOA 3Q8SB 1U2CA 3NWRA 3SCKE 3KK3B 4UW2A 3I0RA 2CWKA 2WB4A 1RWUA 3FQKA 3V81A 1QE1B 3ITHA 2DH8A 3SIPB 3AOBA 4HHHA 4O0IA 1RADB 3H59A 4QIGA 5CD4H 3X3UA 4LF9F 2PIIA 3TP2A 3R5JB 2ZBQA 3PJ9A 4DFMA 3UVJA 2XG8A 4LF8J 2ZBPA 3VCDA 3W65A 4JV1A 2GO8A 4NRTA 4X2BA 4DR5J 2O1PA 1RGVA 5GAEU 4AYBD 2FJWA 4I4BA 3K8VA 4USIA 1XNRJ 1JIHA 3HSGA 2QLXA 3I9V9 3UCGA 3OL6A 1UJ5A 3A1YG 3VGUA 1NSPA 3CMAS 3IAS9 2G0IA 1HQUA 5AXKA 1ZM2A 2V8GA 2ZC3A 3QJPA 2LXFA 1JJHA 2DNZA 1CJKA 5D6GA 5B0DA 4PQAA 2E5IA 1VQYA 3RAMA 3D6FB 2OFGX 4F3MA 3PTWA 3ISND 3HX9A 3DI6B 1M1HA 4CO0A 2KDOA 3HI9A 2E5GA 4LRDA 1F2HA 2GVZA 3GQCA 1RT6A 1XMQJ 3PW4A 5DQHA 2BANA 2VQFJ 1NK6A 5B0CA 4M5DB 3O2IA 2OGUA 2HURA 3MCOA 4Y2IA 2J7KA 1IM4A 4FNIA 3ZC4A 1IBLF 5CABA 1NKCA 4CRJA 3CCJS 1REVA 2ZZMA 4DR1F 2WW8A 2OEMA 4WXOA 1DQ9A 5A6WA 3M2RB 2KZZA 2V0NA 4MK7A 3HHLB 1RBLA 2C22A 1GMWA 4GKKJ 5D8HB 2JC0A 1TKZA 2LVWA 2OPPA 5GAGI 1S76D 5DG8A 2GMJA 4IRKA 4NYPA 1PO6A 3A3OB 4DPWA 3KOAA 3DGPB 2GJFA 3RAQA 2J9EA 2EVZA 3HHEA 2HLTA 3KXDA 2XQCA 5E3QA 3HF5A 3G4SS 4KHPF 4WKYA 4O3OA 1JX4A 2FTRA 3JYTB 4B9NA 5F3TA 4FBUA 3KJVA 3TEGA 1K73T 3GFZA 4BDPA 2YWHA 4KE5A 3RYLA 3K5PA 2AQ4A 1Y3JA 2CJAA 2ASJA 3MR2A 3CCRS 3QT8A 3K7RA 3NCPA 3TJ9A 2DHGA 2PT0A 4NLVA 1YGYA 2CA9A 4KHMA 2KJVA 4AUKA 5AE3A 3K89A 2AJ4A 4Q8EA 3MM6A 4GVBA 2IAJA 2JEJA 3POTB 4ZVPB 5CYMB 4X4PA 2ASYA 1VQ9S 4DUZJ 2ZWPA 2V2KA 2YNGA 5F0WA 4Q2LA 5J2MA 3MMCB 3V4IB 1RTHB 3Q86A 2RU3A 4DPUA 3D66A 2MKJA 1NH8A 4HH0A 2CXEA 3ZZZA 3IR7B 3Q22A 4ILLA 4USMA 2V69A 4HT7A 2WONB 1CLFA 3MECB 3D28A 1MROA 4FS2A 3AA8A 1VQ8S 9RUBA 3HJFA 1RJJA 1HYSA 4A8SA 1BHNA 1RUSA 2NQPA 3UNYA 2XZDB 5IWAF 5E3CA 1NHUA 4KY3A 4EEYA 3HD1A 4DV1J 2MKCA 1SV5A 5DZ7A 1S6QA 4RPFA 4UT4A 1QSSA 1HWKA 4DS5A 2CUYA 2ZOFA 2FPHX 1RAOA 3EWGA 2F4VF 2Z2MA 1T9YA 4K4TA 4ED6A 2ASDA 1RACB 3ILOA 5RUBA 2J6SA 1N6QB 2KRBA 5E3PA 1UL3A 4FYYB 1Y5NB 3KHLA 2V4JB 1R6VA 4HL9A 4OYXA 5J2PA 4PG7A 2KG0A 2X7IA 2OTJS 2MJNA 2LCWA 3T1HJ 1KOOA 3M1VA 3W9HA 2FJXA 4L76A 5A8RA 1HBUA 2CQBA 5FD1A 2M8HA 1HNWJ 3BKTA 5IV3A 5I3UA 3QAUA 4DR6F 4FP9A 4PZVA 1RZMA 1IBKF 2ZM6F 2K8GA 4DI6A 4NEYA 4QWDA 4R0JA 1IKVA 2V9KA 4ZJLA 1KBRA 2FYXA 3R1HA 4KPYA 3BYPA 3QIPA 3CVKA 3I5CA 2DNGA 3DOMA 2R2RA 3CDWA 3DDKA 1RU2A 2MLXA 1K9MT 1RKIA 4FKXA 1U1PA 2NS1B 3W5YA 4TQSA 3DDNA 2CRLA 4YQWA 5DG9A 3R7SB 2K06A 2XSJA 3M32B 5KOWA 5FLXY 4IH5A 5CYQB 1HWIA 1QLNA 2WB1D 2CPEA 2VG5B 4QYRA 2RJZA 2IC3A 1MN9A 3AQPA 1HNVA 3M6WA 5FJ4A 2B3TB 1EKRA 1FD2A 4HKQA 4JI6F 3R8YA
chains in the Genus database with same CATH topology
1T95A 2QO3A 2G0CA 3OXLA 1D0EA 3PFEA 3BF4A 2MDAA 1Q7LB 3BGRB 4MAKA 3PVXA 4FF4A 5EX0A 1TFYA 1XK8A 2QMWA 4LMZA 2IHR1 2MQOA 3D5MA 1IUJA 5KFFA 3J81Y 1NHVA 2E5HA 2JSXA 4OI6A 1KTQA 3OVSA 3IWXA 3PR4A 4I68A 4WXWA 3OLBA 3ZZUA 5SZTA 2UUWA 1KVJA 1FDNA 4JI3F 4KJIA 1FA0A 4WFBQ 2KYXA 2DNOA 2XGQA 1GTHA 2MKKA 3MUMP 2VPXB 3IRXB 2FHMA 2ILYA 2N3LA 2YTCA 4YB6A 2GMLA 3IAM9 3EX7B 4I69A 2IBKA 1RYRA 3G6VA 3ZZRA 1DTQB 3OXGA 2MGZA 4OHZA 3M8RA 4IOAQ 1QUVA 2B51A 1S1UA 1FKOB 1SUQB 2BA9A 3MEKA 5DO2A 3UI3A 3G8SA 4DR2F 1LFPA 5DM6Q 1U49A 2N7YA 2N82B 3K5OA 4QW9A 4DFPA 4EYIB 1CC8A 3W2WA 2UVVA 2E29A 2Q66A 4KHRA 3UR3C 4A8KA 5J2QB 4P7TA 2V8VA 2ZDPA 2F40A 1R7IA 4KQZA 4DV3F 3U27A 4JI5F 1R8PA 4OZNA 2ZH5A 2R9LA 2XS7A 1S97A 5D3GA 4USJC 1QJHA 4CIOA 2KYZA 3C3LA 1UAWA 4K2XA 3D1HA 5J2NA 4JI8F 3KJVB 3GFYA 4NLUA 1R8CA 5C25A 2X1BA 1TK5A 1RT5B 2BACA 2RQCA 1SKSA 4LF4F 1P8GA 2B56A 2ZZNA 4OLPA 1Q53A 2GHWA 4MK8A 1WHVA 2DH9A 2ZDOA 1JNZB 1FKAF 1T05B 5B09A 3I5BA 1EETA 1V9OA 2R7UA 2VBZA 1FJCA 1QY7A 2DNRA 3V2UC 1CEZA 1KONA 1VC0A 1MSWD 4WYLA 2I9SA 5I4MA 4B08A 3E51A 4K4YA 1JLEA 4RUAA 1B64A 2P5VA 3N6MA 5FIIA 1SH0A 1CSJA 3TVZA 3IFEA 3NNHA 5L8RC 3T1HF 4LFAF 2OPQA 2HLUA 3DLKA 2A2CA 4Q45A 2JEIA 1JLAB 5F9LA 4C0HA 3BSNA 3MXHP 2RKIB 4GKJF 3Q8PB 4LF5F 4KC5A 3E3XA 1KQFB 2VV5A 2C3PA 4TQRA 1YJUA 4CNYA 1HNWF 1RTJA 4OHXA 4I2PA 1IKYA 4PXCA 2K7KA 4KO0A 1G1XA 4RNMA 2F8MA 3P3DA 4KGMA 5J1EA 2XY5A 2FJEB 3LAKA 2OPSA 4WE1B 3VQTA 1C0UB 2ZFHA 3J7YI 1Q16B 4HHJA 1F5AA 3FGVA 3N9UC 3H2VE 3KLIB 4WFAQ 3M2VB 5A0YB 2HGMA 4PUOB 1VJWA 3BR8A 4O44B 3CCTA 4NA2A 3Q2TC 2VG7A 2U1AA 2DNKA 2RRBA 1R43A 4NPOA 3DMJB 1ZTTA 2YKMA 1Q78A 5THWA 4RNHA 1GAOA 3LW5C 1TUVA 1Y0HA 6FD1A 3FSXA 1OQ3A 1YJVA 3CCVS 2DGVA 2YKNA 3GZ7A 1H2TZ 1VRUB 2QE5A 3E01A 3CTRA 5FDLA 2KHCA 2GX8A 5I3QA 4HT5A 1IKXA 1WG5A 3GIKA 1TL5A 1G6BA 3D0HE 4IKAA 2ROGA 1S1TA 4NLYA 4TKTA 2LKZA 5KFDA 2E9ZA 3L7PA 2PA3A 3H20A 2D9PA 1S1VA 4Y2CA 3L7OA 5CH7B 2KXNB 1SIWB 4QZVB 4RW6B 2D3ZA 1U47A 3MPYA 3QIDA 2VPYB 1X5OA 3M6XA 3TUIC 2IM3A 3WC0A 1FERA 2CPXA 2J8AA 2XCAA 2ZE2B 1JWWA 4TYAA 4ZA1A 1XMBA 1RT7A 4BWMA 2WOMA 3SCLE 1FTCA 4AXIA 1QAXA 4Y2MA 5KFJA 3OVBA 5DETA 2GV1A 1FXLA 2PSZA 3DLEB 4RW9A 1WF2A 4NLDA 4CNZA 1RYSA 1MROB 3VAJA 3VALA 4DL7A 2CQ3A 3CSKA 3BQ0A 1TKTA 2VFTA 3KNGA 3IBWA 1VLYA 2C42A 3NP5A 1O8BA 2COLA 4NRUA 5C42A 2R2UA 3GV5B 1NNDA 4DQIA 1AFIA 4B3RF 3HHLC 3EGNA 1HYSB 1T03B 3TVYA 2PC6A 4ZCKA 3CDEA 3V6DA 3IO1A 3KLGA 3THVA 4C8YA 1G7CB 2AYMA 2KXHA 1ZM4A 2YNHB 2JWNA 3FFIB 4MFBA 2HNZA 2Z8QA 4ETXA 5DLGA 5EDWA 3Q8QB 2LXIA 4WFNQ 1M5VC 4DV7F 3CDUA 3UWTA 3GE9A 1DLOA 1RT3B 2HG4A 3NL0A 2PGCA 2OAUA 3N4WA 3I0SA 1D8YA 5DDOC 3KK3A 4X4NA 1Y00A 3Q0AA 5AE2A 2UXCF 4C9DA 4Q0BB 1X4FA 5HLFB 3MURP 3MMAA 3OR2B 2GGPA 4RZRA 2AYBA 1YITS 2FHJD 2GCFA 3TOQA 3I5AA 1QE1A 2ZD1B 1RISA 1M5HA 2K1RB 3SXLA 3IWNC 2FVPA 5KAKA 2DGTA 2RQ4A 3JB9k 5KFMA 1VQ7S 1VQOS 1ELOA 1JLBB 2GNKA 3B4MA 5E41A 1L3KA 4OHVA 1ZETA 4OI0A 2KO1A 3ZZOA 1U8SA 2ZH3A 4PQUB 1ZYQA 4KKOB 3O1LA 3Q2SC 4CQ1A 4BBYA 2DNLA 4F67A 2W9CA 2A2DA 4JUZA 5HMZA 1NKEA 4XPCA 4OMFG 3UR0A 1D9DA 1SXLA 2RSQA 3FEZA 1ZBTA 1WI6A 2GHVC 2YX4A 4DWIA 1YJTA 1VQNS 3K5LA 1SJFA 4CI0B 2IRUA 1ZM3A 2L08A 4ZPAA 2MQQA 1VC6A 2B4OA 2DT9A 3CD5A 1LW0B 2MYFA 1TL4A 2SXLA 3CJ5A 3OHAA 2W7OA 1L3VA 2HWTA 3M6VA 2R8GA 5B0AA 4URGA 2W9BA 2J0WA 2WRMA 4ETZA 1H0HB 1NRKA 4GO7X 2VFSA 1J5OB 4ITSA 2BRKA 3GIMA 4RUCA 2ZITA 3DRYA 1BQNB 5AJ3F 4RLEA 5F8GA 3RRGA 3R5AA 2CZVC 3F56A 3NNCA 3EZ5A 2AGPA 4CCHA 4PG5A 2HNDA 2FJVA 2MQNA 4B02A 3G71S 2LECA 1O51A 3PM9A 4OZ1A 1Q79A 2FGCA 3JSMB 2ZHOA 2C2EA 2HAIA 3QJLA 3OUYB 4WJBA 2EW9A 3KLEA 4HI1A 4RNOA 2KFNA 1KRPA 1ZAWA 4OZ5A 4O3QA 4C8ZA 4N56A 1R89A 3EXYA 3MR6A 3KLVA 3OSPA 3QLHB 4EU0A 2V5HG 4QPTA 4QWCA 3HKWA 1AFJA 2MSTA 4FVCA 4KIAA 1L3TA 1WHWA 1C0TB 2I8EA 2XY6A 2BRLA 2O5DA 2CYYA 2CPFA 4ID5B 2L9WA 3CWJA 4AE5A 1BD6A 3G9CA 2OPRB 4G1QA 2I5JA 2Q3PA 2VBXA 3MEEA 2LXUA 2FVRA 3T6BA 4WF9Q 3N5BA 4PR6A 4DSLA 4PXBA 4OX6A 1T02A 2GIQA 3NAIA 3M2UB 5M2UA 5KG0A 1S1WA 2C3OA 5CXTA 2FIUA 3VZHA 4RUHA 3CB4A 3TW0A 1VQPS 2HWHA 2UVRA 4C11A 4MMOA 2JDJA 1FF2A 3RRHA 2IRYA 2RD5C 4DL2A 2I0XA 4C8OA 4KSEB 3KG0A 4A48A 4JI7F 3VAHA 3CJ0A 3DI6A 4JV5F 1RA6A 5DJBA 3SSSA 1E6YA 1VRTB 1SKRA 3DRPB 3LGMA 3KWMA 2DCLA 3BR9A 1FE0A 5C24B 2D7SA 3FEYB 4C3LA 4JOUA 2V9WA 4YB5A 3U02A 1NK5A 3CCES 1N34F 4WZQA 4YDDB 4DEZA 3RR7A 1S77D 4YUDA 3K57A 3BSAA 1FRIA 3RR8A 4CO5A 4LQ9A 2QEXS 5JVHQ 3H5YA 4M5DA 4A46A 4B9VA 2VB6A 3M8QB 2AJQA 2VUGA 3L95X 2R8HA 1YIJS 2APOA 3OL7A 2WSEC 2FHOB 3HKZD 4ZVHA 5DDRC 5K8NA 2HHSA 3QIPB 2IA0A 1F0XA 3SYZA 1M90T 3DRXA 4H4KA 2XO7A 3H5XA 2V8DA 4ED5A 2VH7A 2L9DA 4YEAA 1UFLA 1I1GA 2RS2A 2K3KA 4ECYA 2W9AA 3DOKA 3RB6A 1HBOB 1UVNA 2MSSA 3I87A 1K0VA 2YWKA 1SI9A 1HA1A 3CT9A 1U48A 4L3NA 1X9MA 2KFZA 2BJEA 2O67A 4ED8A 4JI0F 5EX3A 5HQ8A 4WIIA 2E9TA 4DBQA 4NXMF 2E1MC 2HVHA 1HWUA 2QSWA 4I6YA 5HMXA 3C46A 2EBGA 1UP1A 4NA3A 4U67Q 3CCLS 2E9RX 1NJWA 4IRDA 2XMKA 4FPRA 3N6NA 5KTQA 1MW7A 1TK8A 4LSLA 2B6AB 3ZZYA 1DFDA 2BDPA 1F60B 4C7QA 4K0KF 2ZKTA 1M0SA 2FJBB 3BN7A 3MM5A 3CIMA 2DHXA 1YSJA 2ZOGA 2AYGA 4C3KA 3GV7B 4L6V3 3CC7S 4XIUA 5D4OA 3CDBA 3RBEA 1NK0A 5F8NA 3HHLA 4LSNA 1MMNA 3HO1A 1N33F 4UQTA 1NJYA 1WG1A 1HQEA 4I56A 2OD4A 2KI2A 4M1KA 1S0OA 1R27B 1U1QA 2HRUA 1W2BR 3GB0A 5M2RA 2OH2A 3FRYA 1FKPA 2DNQA 1TV6A 3MHYA 4IFYA 5MAOA 1UA1A 4E0DA 1BQMA 6FDRA 2WK4A 3S7RA 3O3LA 1OIAA 1WEXA 1XN9A 5KFEA 3CCUS 3MOZA 4A8OA 1R0AB 4ATNA 3CJ4A 3G86A 3BGUA 1JKHB 3QWUA 2RF2B 1U1KA 4I67A 2W7AA 4OI2A 1H98A 2EI5A 5BYRA 4YOEA 1W2IA 1FRHA 4IFVB 4ZVGA 2VA3A 2I38A 2ZH6A 2CZ4A 2P9CA 3DGPA 4XDCA 3UFCX 4A4JA 1C1CA 3PX6A 5KG5A 2HHXA 2VBWA 3V81B 5ITHA 4HH1A 4HEA9 5LT5A 3JSYA 3N01A 3ITHB 5B0FA 2BVZA 5HBMA 3OV7A 1F9FA 2F3JA 3CEDA 2HRYA 3R5BA 2BQRA 4ZP9A 1RQ0A 2PA8D 5E3AA 2ZH9A 2KH9A 3SDEB 3RTVA 1Z1ZA 4MIBA 2UXDF 1KSPA 2RB7A 2VC1A 1TVRA 1UWBA 2DGWA 2DK2A 1LWFB 4KT0C 4CH7A 3JYTA 4Q5VA 4IG3A 4NYZA 3GV8B 3K5MA 2EFGA 2EC0A 3BDEA 1JNRB 5KFLA 1ZH5A 1EP4A 2JLFA 2M70A 3BQ2A 3V6HA 2BQ3A 3C66A 1A9NB 2ZKUA 3A8EA 3NAHA 5KT7A 3FJ2A 4NX9A 4K4XA 3PEJA 1U1MA 2KT2A 2Q6CA 1ZZNA 3KMSA 3DM2A 4LIWA 3DOLA 2ZVSA 3WZ0A 2MJUA 2YVSA 4DQPA 1S1UB 1V6HA 2DHSA 4ZPBA 3DFEA 3JTOA 3JSRA 4I2QB 1HI0P 2LA4A 4PG4A 1NKBA 4DFKA 3PRDA 3M05A 3MTJA 3W2WB 3DHWC 3PDNA 1LW2B 1HNZF 3K0JA 2CIMA 1RTDA 2AJ1A 2PMHA 1S1XB 5EWFA 4NOHA 4F8RA 4ZVFA 4IO1A 3KFWX 1VBZA 4NLTA 2CPDA 3H2UB 1S9EA 5IM0B 4KB7A 4Y34A 1JLGA 1TL1A 2RNEA 3BSCA 3FQLA 1RDRA 3AQOA 5L39A 4PWDB 3F41A 4DV4F 3EXCX 4LFCF 2AGQA 4IR1A 5LMNF 4O23A 2OJ3A 3KK1B 2F8HA 2VOPA 1S9FA 4ZK7M 2R7TA 4F2SA 4J9KA 1VFJA 2KN4A 4B3MF 1SH2A 2GJ2A 4KV8A 4LVOP 2HIQA 2KM8C 4AL7A 2ZH4A 1WD6A 4FVMA 3T1AA 2FHJA 4C0OC 2J5AA 2M2BA 1X4DA 3D1OA 3QJJA 1WEYA 3GR0A 1SH3A 1NK4A 2BJDA 1CC7A 3IGVA 4TY9A 2VG6A 3D0IE 4TU7A 3SZ2A 1K8AT 1GH8A 5J1NA 1FEHA 1YJ9S 3QZ8A 4OX7A 2P6TA 2B7CB 3RAXA 3BGLA 5EWEA 1DTTB 4CO4A 3HK2A 1P1LA 2LQ9A 1HBMA 4OFZA 4UUXA 1HR0F 2DO0A 1G3OA 3LWMA 1CQNA 3UCZP 2CJBA 5HROA 1VQ4S 3RRKA 3IR6B 3DLJA 3MMCA 3SV4A 3V4IA 1S10A 5GAHI 2VKRA 2YNIB 3EUNA 1RTHA 2Q1LA 1RTJB 4AFFA 4CO3A 1T8EA 1HW9A 3K59A 2DR8A 2RDIA 2G1DA 1Z4UA 2BXJA 1LQ9A 4I2PB 3PW0A 4N76A 1XR6A 4EFAC 5EN1A 3DYAA 4G3IA 1N5QA 1YJNS 2XMVA 4DL4A 3I82A 1JMTA 3MM8A 2RILA 2IM2A 1TQLA 3BS9A 2AWZA 4OX9F 2HVIA 3ULHA 2NLWA 1RT4A 1HHTP 2OSRA 2W4CA 3PHEA 5KFZA 2D9OA 3B8HA 3WDOA 5I42B 2DPIA 4C97A 3IG1A 5DG7A 1JB0C 2KXFA 5F8JA 4ZPWR 4X4VA 4I7FA 2JL9A 4DX8H 3TR5A 5F8MA 3W2VB 3CUNA 3TQ1A 2JLEA 2GQCA 2OO4A 3GMGA 4G1PA 3MECA 2OTLS 3SQGA 4A47A 1N0UA 2CPYA 2RQMA 3RZAA 3IN5A 2LU1A 2YKNB 4ZPVR 3HVTA 4NZ6A 4ES2A 2DITA 2OMOA 3E01B 5FDLB 4RW7A 2J7UA 5T7LA 2G9OA 1IKXB 2UUTA 4X62F 2MPUA 4RBTA 1Z2LA 3KMQA 2W8LA 4N8NA 1N4LA 1R3NA 5IT4A 3S8SA 2XLIA 1BGXT 1DAXA 1SBRA 3O8WA 5DQGA 4J9PA 1S1VB 4F4KA 4WK3A 5KT2A 2L41A 1DBDA 2CQ2A 4LJMA 1UVLA 1CQMA 2EFVA 3VZIA 3MEGA 4MKBA 4O4GB 2HQIA 2CJQA 3RU0A 1S49A 1REVB 4PPDA 2MZJA 5JXSA 4C2MA 5BR8F 5LMUF 1M5OC 2XHWA 2BABA 4Y28C 4DDFA 1OPZA 2UUBF 3O44A 1W25A 1N5YA