4M5IA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
b'MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 45
structure length 159
sequence length 159
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5iA00
5ETKA 1TMMA 1RTZA 1TMJA 4M5LA 1RAOA 4CYUB 5ETMA 5ETSA 1F9HA 3KUGA 4M5JA 1EQ0A 1HKAA 3HCXA 1RU2A 4PZVA 1CBKA 3HT0A 3HSGA 3QBCA 1Q0NA 3KUEA 1KBRA 3IP0A 3HD1A 5ETOA 3KUHA 1EX8A 5ETNA 3UD5A 1RB0A 3MCMA 4CRJA 3ILLA 4AD6A 4M5NA 5ETQA 3UDVA 3MCOA 4F7VA 1HQ2A 4M5IA 5ETRA 4M5GA 3HSJA 5ETVA 2F63A 2F65A 1RU1A 1DY3A 4M5HA 1G4CA 2BMBA 4M5KA 5ETPA 3UDEA 4CYUA 3ILJA 5ETLA 4CWBA 3ILOA 3HSZA 3HSDA 1IM6A 1EQMA 2CG8A 2QX0A 4M5MA 3MCNA 5ETTA 3ILIA 3HD2A
chains in the Genus database with same CATH superfamily
3SFUA 3MZIA 3V81A 2CPIA 2Q66A 4IOCQ 3DGVA 1NK5A 3PYEA 2JOQA 1ACMB 1U8WA 3OBIA 3PACA 4U7UD 5T14A 3BN7A 2ZKUA 3UFCX 3RBXA 3AODA 2MPUA 4YY3J 2XO6A 3M8RA 1FEHA 4RW4B 3Q8YA 2DYAA 4ETZA 4KPYA 2K8GA 3VAJA 2BKPA 2DNLA 3E2EA 4YB6A 5J1NA 4RW4A 1Q1KA 1AXQA 2L48A 2MSSA 3VQTA 5KG6A 4KV8B 1U6FA 4J5OA 2GIRA 2LDYA 4HTJA 4Q8EA 4KV8A 1YLXA 3HHKA 3EPIA 4FNIA 1ZTWA 1NBEB 2VHGA 2AYMA 2MJNA 2R8GA 4MIWA 3NNHA 2IM1A 2NZCA 1CPZA 1G4CA 5CQGA 4PXEA 4L6V3 4IKAA 2CJXB 3OXFA 3U27A 1FWLA 4HI2A 1X7VA 2W01A 1FD8A 1PGZA 2AU0A 2D9OA 3ONQA 3LP0B 3FCHA 3S01A 4ELUA 3SMZA 4IR1A 1UPMB 1GMWA 2GCFA 2GVDB 1PBAA 3JTPA 2RS2A 4AL7A 1F5AA 3BQ2A 3KOAA 3HXMA 1D09B 1TL1B 1Y5NB 2QLFB 5A6WA 2AT1B 4L73A 2DKOB 2GVDA 4Y65A 1FTCA 1RT7B 2D3UA 4HVZA 1TKDA 1TL1A 4RL1A 3QYYA 4E98A 4RLEA 2JC0A 4TNOA 3W8PA 1RT7A 4F0HA 3UN2A 1S79A 2HRTA 2CNOB 3IWNC 3DLKB 3M2VB 5K5MA 2Q79A 2YQ1A 3EGZA 2HFOA 4M94A 1SVDA 5FIIA 2XHWA 2HMIB 5ETLA 1LFPA 4CLYA 4A8XA 2KRRA 1NEEA 5C24B 3KYLA 4P71A 2DCLA 2MKSA 2XTJP 2HMIA 4NL5A 1N36J 1N0UA 3PRBA 2WZ1A 5KFMA 2WOMB 1RA7A 1SC4B 1EP4B 4DX7A 3OV7A 4ZPTR 3JQJA 1UFLA 1WDDA 3TVKA 2V69A 3RRKA 3S6EA 1TK0A 1EP4A 4RBTA 4RW6B 4TQRA 2OEJA 3TUIC 1N36F 1NRKA 3TYTA 1H74A 2B4UA 1JLEB 3UN5A 1RHRB 2C2MB 4C98A 3QLHB 2RVJA 4YOEA 4RW6A 4K2XA 2V8DA 3D54A 2L9WA 1YBAA 1D9AA 2QSWA 1QSYA 3QLHA 4LFBF 2ZNZA 2L08A 3A3NB 2Y0BB 3J81Y 3NWGA 4KKOB 2DNNA 2CJYB 2ZHBA 1HBOB 1QUPA 4KKOA 2E5LF 4FN5A 3F44A 4LRBA 6FD1A 1HQUB 1S6PB 3CCSS 3W66A 5THWA 3A8KA 3KHGA 1N52B 3M9MB 1HQUA 1S6PA 2DNKA 1XR6A 4URQU 1WTFA 2GQ2A 1GNKA 1MROA 3ADAC 1PG5B 4YB1P 3ZNUA 4IFVB 2HFUA 3OTBA 1T0TV 4C8OA 1P9QC 2VFRA 1VC6A 1KVJA 4EWTA 5F41A 2AWZA 4IFVA 4DZ6A 4X64F 3JQKA 4Y2KA 2D41A 2QLXA 2MLXA 4DR6J 3PO5A 5SUHA 2CJAA 3KLFA 2AJFE 2XQCA 5B08A 4Y6IA 1NMEB 3CMQA 4P73A 3MI7X 2Z58B 4X4SA 4DR5J 1TKXB 2MSTA 3NCRA 2XS2A 5J2MB 2VFTA 4LF7J 4DR6F 1VQMS 4DQSA 4ELVA 3PHTA 1NSAA 1Q4RA 1TKXA 3NXZA 1FKPB 4M5KA 1VYAA 2RDIA 2M52A 1SV5B 3AQPA 1CJTB 4DR5F 4OYWA 1LWEB 1YITS 4LFAJ 2J6TA 5J2PA 1YI2S 2LQJA 4OZNA 4LF7F 2VDHA 3BGRA 5J1EA 1SV5A 4BBYA 1CJTA 1WSVA 2NCKL 1R31A 1LWEA 4ALZA 3C3LA 2K2PA 2HHSA 2LA4A 3J80Y 4LFAF 4XIUA 4NLSA 2FQQB 1FESA 2F4FA 4K5RA 4K8RA 4B3RJ 3KG1A 1RTZA 4KSEB 1RBAA 2IDEA 1J5OA 1YGYA 3K59A 2QGFB 3CJ8A 2LU2A 3THVA 5F8IA 3BDPA 1H7WA 1NLKL 2MKYA 4QW9A 2VBYA 4DQIA 1YG0A 1VQ8S 4DMZA 3KLEA 4B3RF 3I9V9 3MMJA 2W7AA 1YHQS 2IMOA 3QZ8A 3UDLA 2KL8A 1FRIA 3W8GA 1SIZA 3MR6A 3IS9A 4QYZJ 1DAXA 1RTJB 2V67A 2C2NA 1S0NA 4M5DB 4P2FA 4WFYA 4AE5A 5JXSA 2X51A 4M5DA 3DI6B 1UW4A 1PYSB 2KXFA 5L8RC 1VFJA 5D0EA 2VDIA 3NP5A 4E8UA 2G4BA 3DI6A 2QSFA 1J5EJ 2D7SA 1U6ZA 3FEXB 1U0HB 3BB5A 2FHJA 3C19A 4DJBA 4NOHA 4WZMA 3VVUA 3T9ZA 2X1AA 2A2CA 4F67A 1P9YA 1U0HA 2H4YB 4QPXA 5KT7A 4DU7A 2I5JB 2ATCB 3JSYA 1J5EF 1S12A 4M8LA 2N7YA 4ZOSA 1SJ3P 2I6WA 1VISA 2RRNA 2ZBCA 2ZVIA 2OP5A 2H9ZA 2PFDA 2HGNA 4I2PB 4AYBD 2DRDA 1RWUA 2M4MA 3PM9A 2CADA 2HAIA 4P2MA 1SBRA 3R8YA 2EXUA 4KGZB 1SI9A 2RF2B 2DH8A 2P5VA 1BGXT 4I2PA 1MWYA 4WYWA 1VK8A 1KFSA 3OHAA 2IIHA 4NLXA 4UTGA 2FZCB 4OI1A 2RF2A 1NHVA 3IGNA 3NBPA 3ITHB 3PO4A 4NMXA 1VBZA 3D66A 2K06A 4CO3A 3N79A 1B4SA 2UVUA 4TN2A 3CJ4A 4RNFA 1Y3JA 1WEXA 4DL6A 3OR1B 5D77A 4ED4A 5LXRA 3QT7A 2A6MA 3EZOA 2ZC4A 4JV5J 2NXJA 5F8JA 3OFEA 1J27A 1VQKS 3VAMA 2UU9J 2YKOA 1ZAWA 4XK8C 5CHCB 1NK9A 4QWDA 3GB0A 3CO0P 4CDIA 4YR3A 2LXIA 1VQPS 1NDPA 2ACYA 3I9ZA 4QR2A 1B7FA 2A10A 3IR5B 4PABA 4JV5F 1L5UA 1RTHB 2XYHB 3SCJE 4X4UA 2UU9F 4BHQA 4FKYA 2HHVA 1KP6A 1S1UA 2AW0A 2E7VA 1IWAA 1RTHA 4LSNB 3SEOA 2W2OP 1QD1A 2CVEA 2ZEJA 4OJGA 1RSCA 4LSZB 4OZ5A 1NKBA 5E33A 1UJ6A 2CFXA 1Q82T 1RCXB 4ED0A 1UETA 1A6LA 5M2RA 4JUZA 3DLHA 4QCLA 3V6KA 2WW4A 1OYEA 2B9YA 3JYTB 3MECB 2C2RA 2BJ7A 2A1BA 2RT3A 1UJ5A 3OXLA 1FE0A 4I56A 2HVEA 3RZAA 4WIQA 1QVGR 5A0YB 2IRYA 5IT0A 5GAHI 4KR0B 3MECA 6FDRA 2X7IA 2H1YA 2CZ9A 2DPJA 1NZ8A 3WIVA 2Y8WA 1P1LA 2P9EA 4WFNQ 5A0YA 4JI3J 4J9RA 2PEHA 2X1GA 2B43A 2VPZB 2MMYA 1WF2A 2ASDA 1F1BB 3W9HA 5LSOA 4OJHA 1M5VC 2N7CA 2V4QA 1JKHA 1BC6A 1XN9A 2BX6A 2GA7A 4WZQA 3FBFA 1EJ7L 5IM0A 2QMUB 3MR3A 4BLGA 2PD1A 4OI4A 2G0JA 2V2VA 2KZZA 3VR1A 3UQSA 3UN3A 3WQPA 4EK2A 2FVCA 4R25A 4K59A 4C8MA 4WWSA 2DEIA 1JLFB 3HSDA 4ES3A 4ZP8A 4M5LA 1FDDA 4K4WA 4J9NA 1L3SA 4S0MA 1HHSA 3BBFA 1PSDA 1VQ7S 2GMLA 3QNWB 1ZPVA 2R2RA 5AE1A 2KDOA 3SZ2A 1JK9B 2C3MA 3QZ7A 2GS8A 3FCVA 1F5CA 2J7WA 4DLEA 2XYGB 3CD7A 4WFBQ 4XPCA 2H5IB 2DPIA 4NLUA 1QE1B 1F3FA 4KT0C 2BKNA 3MM9B 4PWDA 3PW4A 2WB1D 4OYOA 1Y00A 4O4GA 2EBGA 2AEJA 2XMMA 4CRJA 2LQBA 4DR1F 4LR7A 2EPIA 4Q0BB 2VONA 3J7Z5 4HR2A 2E7XA 2ZH1A 1JJ4A 1RT6B 2AYEA 3D6FB 3H40A 3F56A 3HVTB 1HNZF 2HNDB 4C3MA 1UVNA 3NGKA 4Q0BA 1I6JA 2MZQA 1URNA 2I2YA 1K73T 1RB0A 2WVCA 1FTRA 3EMTA 4AUKA 1RT6A 1WORA 2ZD1A 1XNQF 3TAMB 4KQZA 3WX8A 4JI2J 2HNDA 3UDEA 3OR2A 4JYAF 3DRRB 1C0TA 1SQGA 4JI5F 3TAMA 4K2JA 3W64A 3SSRA 2EW9A 3M2RB 3DRRA 4DCJB 2XLKA 4JI2F 3MUTP 2J7KA 1KQSR 5IC4B 5ETSA 4U7CA 3UPFA 4WU2A 1XK8A 3M2RA 2KH9A 3Q0AA 3IXQA 4F2SA 1T9TA 5IV3A 3P3DA 3LP2B 2XMKA 2D74B 1IKVB 1TELA 1MLAA 1UVMA 1Z4UA 3VF0B 3EXCX 3IR7B 2AGPA 5DJBA 2QO3A 2XULA 5L1LA 1B64A 1IKVA 1Q8KA 4P75A 4KGVB 2HS3A 2H5JB 4RPFA 4Q44A 4NPOA 4LF1A 3RUBL 5I3UB 2BE9B 1H2UX 4PQUB 1MMLA 2KU7A 3ZTRA 2QLBB 3FMBA 5GAHU 4ATNA 1D9DA 3KFWX 1S9FA 3MEDA 4FKXA 3JS9A 4PQUA 2A0FB 1VRUB 4ZCKA 4ZITA 4K50A 2QLWA 3QRQA 1X9MA 3C66A 3OUYA 2LQ9A 5DQHA 2DHHA 4Y2MA 3NL0A 3TA0A 1VRUA 2B51A 1E6VA 4QYZK 1FNXH 1LQ9A 5KFUA 3G6ES 3QWUA 3L7PA 1N5VA 4Z7YA 3BQ0A 1ITPA 2M7SA 3CJ3A 4I64A 3CCQS 3V6DB 1TR0A 3CMES 3HSJA 3WX4A 1HBUB 4USTA 3VAHA 3V6DA 1VI7A 2WVEA 4ZPBA 5D4LA 2FVSA 1FXLA 2C2EA 1TKZA 1M5SA 2POKA 3D7SB 2KT2A 4GC6A 3D67A 1U1KA 2LVWA 1F9EB 3IBCB 5D78A 2QLJB 1IBMJ 3PIOQ 1Q78A 1U2RA 5K9FA 3M30A 2VKRA 2DGQA 3MR5A 2PO4A 1IBCB 5EWGA 1H38A 4OJ3A 4F2RA 2UV8G 1UKUA 4HL9A 5JVGQ 2G9OA 2ZZNA 2NZ4A 3TAPA 1OY6A 1IBMF 1RWWB 1HQ2A 2EFVA 1XNRF 3W5ZA 1D3WA 3MMCB 3RW6A 1HKAA 1S1WB 2ZJPQ 3CDUA 4Q43A 1GT8A 2GHVC 1HHQA 3A12A 3G87A 3BGUA 1S1WA 1JJCB 3D3BJ 5KG4A 3W9JA 2HQCA 2RAQA 3WBZA 3R6GB 3T41A 4AQYF 1ZYQA 1KLNA 4EUVA 1AUSL 2E1PA 5C2CA 3EE3A 1GXLA 4X62J 4DSFA 4ITSA 2JWNA 4CLWA 1VJWA 2AHOB 4WTYA 1YBTA 1LV5A 4WK1A 3SCLE 5AJ3J 2F5GA 1RHUB 4Y3CA 1YJVA 2RUSA 3G8SA 4X62F 1URRA 1PBUA 4FF4A 2JZ5A 2HZVA 2HNYB 1RWXB 2DO0A 3J7YI 1FJCA 5AJ3F 3KHHA 4UUWA 4CM2A 1KLMB 3TOQA 5L9NA 2C2KB 4DFJA 3F73A 3LH2S 2EG1A 3I6PA 3OVSA 5H9EK 2GIFA 1XQIA 2BW2A 5CYQB 2JFKA 4YUDA 1CBKA 5CCMA 1U1RA 3RR8A 1RAJA 1BE4A 2KXHA 2R7VA 3LWMA 4RW8A 2YNGB 1V3ZA 2PIIA 2RHQB 1JNRB 5A8WB 2V2KA 2HRUA 2PDAA 2XZWA 3K17A 1FDBA 1AUDA 2RDJA 3UD5A 2YNGA 4ZPWR 2ZWOA 3NNAA 1JLGB 3BPSP 2Q6BA 1Q86T 5A8WA 3OTOJ 3TQEA 5D0GA 2JVRA 1S6QB 2JLEA 3U1NA 2FTRA 3CW2C 3RR7A 5L9XA 1HWIA 1QVFR 1N0VC 3D6TB 1K44A 1VCTA 4MTPA 3RAXA 2JX2A 3CXCR 4JI0F 1KWMA 4ZP6A 2W4PA 4NLDA 3QRPA 4YHHJ 2PGCA 1T03B 1GX6A 4DF8A 2P6SA 1DHMA 2GO9A 2WSCC 4B08A 4M5HA 2XMUA 3SFGA 1T03A 2FZGB 4F36A 1PC4A 1S9GA 2C3UA 2GVZB 4MKYA 4RW7A 4YHHF 2EFQA 4N8NA 3FEYB 5KFOA 5EDWA 3GILA 3DRXA 3CDWA 5B0AA 2DR7A 3UR0A 4LF5J 4C9DA 1UZHA 1B7YB 2J5AA 1IJEB 2FJWA 3DMJA 1LEOA 1RI7A 3B82A 1B70B 2CXEA 1PYTA 5KFRA 2YXLA 1V5IB 4LF5F 2AEMA 2ZBQA 3I5AA 1NSPA 3QT8A 2H48B 1IKXB 1HNIB 1YBUA 4ELTA 1X4DA 4EYIB 3BZQA 5DO2A 4ECZA 1QLNA 3WHIA 4EFAC 1HNIA 3CTRA 2AX0A 3OLAA 1NJXA 4A8KA 2ATLA 1XR5A 2CNKB 1S4EA 2RQKA 4DUTA 4OFZA 2YTCA 1TK5A 4KGMA 4FVMA 3KHRA 1EIYB 2Z4PA 4OL8A 5LJ5Y 1N56A 3KTQA 3Q8PB 3RBDA 4I68A 4OYBA 3BSNA 2YX4A 1S9EB 4W92B 2BRLA 4A8SA 1F2GA 2JVOA 1S9EA 5LL6d 5BJRA 8RUCA 3TANA 5IC6B 3K0JA 2XMVA 2IM2A 1R6YA 1R8PA 4ZN3A 4NLPA 1FKOA 4ZPVR 4ZVTB 3ET6B 2WAQD 1KQFB 4O0NA 4Y00A 2XC9A 2HHXA 5IT4A 2DNGA 3G8QA 1YJRA 4I6AA 4CWBA 3B54A 4ZCMA 4NLRA 2E5IA 3G6VA 3K57A 3O1LA 3MMBA 2BDPA 3OTEA 1Y5LB 5B0DA 3BN4A 1KQGB 3M6XA 1FA0A 4AFFA 1LWCA 4DOZA 2DGWA 1WEZA 1R0AB 3J7YU 3ZZPA 2HNZA 2IJFA 3FQKA 4ECWA 5LJ3Y 2QFJA 3BH7B 3IR6B 1EB0A 1YWXA 3IAS9 4LREA 1R0AA 2VFVA 1HMVB 2BRKA 1FDNA 4QU6A 4TY8B 3PYGA 4UF4A 3BBBA 3TX0A 3QIDA 3CJ5A 4UQGA 2MQPA 1SKRA 1HMVA 4R0EA 3R3TA 3A1YG 1ZH5A 4TY8A 4DUYJ 3NWRA 3BSOA 1NB2A 2J9EA 3H8YA 3HSZA 4OZJA 3EDRB 4C8LA 2YWEA 4KGXB 4IQXA 3GP9A 4EO8A 2VH7A 1N34F 1RISA 4RBUA 3G8TA 2RNEA 2MGZB 2K7KA 3SV3A 1ICEB 3CO9A 1WSRA 2R7QA 3PJXA 1QDUB 2W25A 3POTB 5BYSA 3FEZA 1VHIA 2P6TA 5KFIA 3EGNA 5A6PA 2QTWA 2ROEA 1GMWD 1S10A 3POTA 1U4BA 4GVBA 3I55S 4OHVA 1DFDA 4YB7A 3OL8A 1RHQB 3KJVB 4KAIA 3PEJA 4ED5A 4C8NA 4ZVPB 3KWMA 2ZBPA 1WHXA 3PFEA 4F4ZA 5LSLA 2BJ9A 4EBCA 2Y1IA 3EVMA 3KJVA 1YJTA 5D3GB 3LW5C 3I5BA 4DL4A 5LM7E 5IXUA 5BYRA 3MM5A 1F2HA 2V8GA 1SJRA 5F9LA 1RAGB 4LRFA 1VQ5S 3VAKA 3SDEB 5D3GA 4HHUA 5FLXY 2V8VA 2LXFA 2KT3A 2Y1JA 3AAWB 4QIWD 4ECTA 3NG8A 1EAYC 3W5XA 1VQYA 2KKHA 4WP9A 1G3OA 3W3SA 1FRMA 2G13A 2ZZMA 3JQMA 1Y11A 5BR8J 4L3KA 2V8PA 4ES2A 5DLFA 1EZZB 5ETVA 3UE2A 2YKPA 3GJSB 4IFYB 1RT2B 3D0HE 1GQEA 5BR8F 1KC8T 4LIRA 2RE1A 1SKUB 4IFYA 2YX7A 1RT2A 1ZPWX 4F4KA 1T11A 4U95A 1VLOA 4LF6J 2ADCA 4C0HA 4NA2A 3N4WA 2JFDA 4OLPA 3MAQA 5GMDA 1JXVA 3NY0A 3BGLA 3CJTA 4DPOA 3ICLA 2M8HA 1M90T 1PILA 3RRGA 1S76D 3DXSX 2V9WA 4LF6F 3US5A 3GG0A 1DARA 3K5LA 1FI4A 2CQBA 3H42A 1S99A 1WOSA 2EBEA 2RQCA 2YH1A 3DCAA 4LRCA 4PEOA 4TYBA 1VMBA 2HSEB 3PYFA 3OL6A 2CAJA 4J7CA 4ECYA 5IT9U 1OY9A 3SV4A 3GIJA 2DEJA 4U8VA 1BMQB 1BD6A 1V5VA 3MTJA 4O0IA 1HD1A 1ULRA 3CD6S 2YWGA 5HQ8A 1G2EA 1QTMA 1RT3B 2GAGC 3OHBA 4ZLNA 4ED7A 2C42A 3TEGA 4TVAB 3OL7A 5LSRA 1SJQA 1E6YB 1AROP 2E29A 2OUGA 2Y8YA 1RT3A 1X4FA 4Q45A 1T05B 4L75A 2W7PA 3QGPA 3DRYA 3H98A 5EGYA 5GAEI 1X31C 4Q2LA 3ZXWA 2J76E 2R7XA 2VBWA 3U7JA 1FFWB 3D0IE 2RUGA 5L39A 3CCZA 1T8EA 2R2UA 2OHDA 3BSAA 4LUBA 5LXYA 3AXKA 4X65J 5A2QU 2IAJB 5LMNF 1WC4A 2WVDA 2J8SA 2FJXA 5M2PA 2F1FA 1FXRA 3BS9A 3IG1B 3N9UC 2IJRA 2KFNA 3PX0A 3MCMA 4DFMA 1T02A 2IAJA 4OX9J 3MAAA 3Q8VA 4F3MA 2DHSA 3BSCA 3IG1A 2VODA 2KZMA 2CQGA 2QX0A 3IMQJ 1RWNB 4X65F 2MY7A 5A76A 1XJWB 1ROFA 2GJIA 1YJWS 3IWXA 2NXCA 3GV5B 2RSQA 2DGOA 1I51B 4OZ2A 2DR5A 4OX9F 4OX8A 2KG1A 1NH7A 2OJ3A 3MF5A 2DGSA 3C14B 4NZ7A 3FCWA 1DJ0A 3R5AA 3BQ1A 3CF5Q 4ILRA 5G4DA 1Y3KA 5HROA 3RW7A 3T9NA 2IHR1 2Z2YB 2VA2A 3N28A 3OFFA 3LF0A 1RE1B 3GV7B 1HIYA 5B0FA 4ZPCA 1GTHA 3IBWA 4ZIVA 1WOPA 4N41A 3HHLA 2VF3A 3O3LA 2A3JA 3M1VB 4NYOA 1DQAA 2LU1A 1NNDA 5E3PA 2C2ZB 5F0WA 2PI4A 2ZFHA 2YKNB 2KO1A 2WRMA 4EO6A 1Q95G 5HP1B 3BF4A 4V19X 4CNZA 2CIMA 4C4WA 4DLGA 3GSDA 3KNAA 4O3NA 2YKNA 3CDAA 3R27A 3ZZRA 4BC7A 4J9MA 1X4BA 4EEYA 4ECUA 1UTAA 4USKA 3OXGA 4IG3B 1NO8A 1FRKA 2OPQA 2FHJD 1U0SA 4CIOA 3E8OA 5L1JA 4PAAA 2HHWA 4NWBA 2IRXA 4DEZA 5CZVA 1HD0A 2Z2MA 3DOLB 1JNZB 3HHDA 3I87A 5C25B 3M8PA 5KG1A 3FFIA 1ZETA 1RTDB 2ZOGA 5IOLA 1ZA1B 2ZH6A 4YR0A 1M1KT 4ENOA 5C25A 2LDIA 1RTDA 4H4MB 4QQBA 1JB0C 2CPEA 2EKYA 2Q3PA 3D6MB 4H4MA 1V6HA 2R4FA 1HYSB 2U2FA 1WC1A 2DJWA 4ZCIA 3Q24A 1M0SA 2W9CA 3DYAB 2FB0A 1HYSA 5DM6Q 4KHMA 5AXNA 1Z2ZA 4Y2IA 3ZFVA 5E3QA 4NYPA 3PFOA 2H65B 2PMHA 4M5JA 5BYQA 3VGUA 1V3SA 2ASJA 1RDRA 2M0GB 4LBHA 2MZTA 2KVIA 5KFPA 2BANB 2FJVA 4DR7J 4NXNJ 4F04B 1YJ9S 1T94A 5MAOA 3H2UB 2ROPA 4O3PA 2UUAJ 3T5JA 4MKBA 4DV4J 4L3NA 1FWPA 3HKZD 4O4RA 2CPYA 1WC0A 2CUYA 2LEAA 3DFEA 4Y34A 1IBKJ 4NXNF 3M9OB 3B4DA 2XY7A 4R8UB 1GH8A 4JP8A 1KR4A 1TL4A 5KFSA 4DV4F 3GV8B 2HHUA 5JMNA 1GXTA 1IBKF 3QAUA 1TAUA 4U8YA 1L3UA 2DRBA 2V68A 2WW8A 1ZAVA 2FHOB 4ILMA 1DURA 4ZP9A 4F4XA 3WIUA 2UXCJ 4IQMA 1G7CB 4PQAA 3SSQA 3PKYA 3ELHA 3DRSB 5C7PA 2JRSA 4ID8A 1REVB 3W61A 4A8OA 1QSSA 5AT1B 3EZUA 1FERA 4ANDA 3DRSA 2XEXA 1RBOB 4LQ9A 1AA1B 1REVA 2UXCF 4PG7A 2KVQE 1T9XA 3A13A 3GTYX 2VJVA 2LEBA 3B78A 4OIXA 2FUG9 4A8QA 3KK2B 3J7ZT 2HYIB 1FX2A 1RYRA 5B7WA 3HZGA 4B3SJ 1UL3A 1SC3B 1RK8A 5EN1A 1FNMA 2V63A 3I0RB 3KUGA 4DPWA 1FJEB 2Z56B 4Q8FA 3KK2A 4ED8A 3KKFA 2EK6A 2FJBB 4RUBA 1M5OC 1UVLA 1YJNS 3I0RA 2MQQA 4KJIA 4B3SF 2QC3A 3FMWA 3ENAA 4JI1J 4DV1J 4UZCA 1AW0A 4WXWA 4NX9A 7FD1A 1MMNA 1MWZA 3OJSA 2B0GA 1IKWB 4QIFA 5CYJA 3VV2B 3KHLA 2GHWA 3HT0A 4JI1F 1WELA 3GYXB 1IKWA 3V6HA 3C6TA 3NRBA 2BQ3A 2UXDJ 4FZVA 3R5JB 2XCPA 4MIAA 4QW8A 3SCIE 2KTQA 2VG5A 2HAFA 2B56A 1Q5YA 3UI3A 3AHPA 1C4CA 3HULA 4UQTA 3L3CA 3MMAB 5I42B 3AOBA 4C11B 2UXDF 1RTIA 1L3KA 1NJWA 3ZC4A 4CLFA 2R2SA 2E1MC 5IV4A 4K4TA 2DITA 3MMAA 3QO9B 5I42A 4OV1A 1WC6A 4AXIA 3Q83A 1OS5A 2IJNA 5B0GA 2MZRA 2OPRB 1N6QA 4KPCA 2XI3A 3LANA 3QO9A 1DQ9A 4D3GA 3FVYA 1HI1A 2GJFA 4U67Q 2OPRA 2ALZA 3MTKA 2OTJS 1PJ5A 1EETB 3BBCA 4NEYA 3KK1A 4NZ6A 2HIYA 1OPIA 4CLTA 1KKHA 4USHA 5L38A 3NGRA 1HBNB 2V4JA 3N6MA 2PT0A 4OI2A 4DUZJ 1O8BA 1XERA 1Q8IA 4E0DA 3L09A 3CCJS 1KSPA 2DXEA 1S48A 4B3MJ 3CT9A 2D3ZA 2DRAA 5LMUF 4WFXA 4FP9A 3HLUA 1IUJA 2RRBA 4OHYA 4AD6A 2V4RA 3P5BP 5B0EA 1Q8BA 3TA1A 4DUZF 1OWXA 3C15A 1NHUA 3J7AN 1JXLA 1QM9A 1LWXA 4B3MF 2ROGA 2DTJA 1VK3A 3L7OA 3MEEB 4YR2A 1VRTB 1NH8A 1KVKA 2UV8A 4HKQA 3MEEA 4BC9A 2XB2D 4HDGA 5T7LB 3TUJC 1ELOA 3IWLA 4FYYB 3VALA 4F0KA 2R8IA 1FNOA 2XMWA 4DI6A 1WG5A 3JTOA 4FYVB 3TZXA 1ZS6A 4PWUA 1WDTA 2ASLA 2RKIB 4G1QB 5KFTA 2HVHA 4BDPA 5E3RA 5F8NA 3QSIA 3W65A 3GFXA 2L3MA 4DR3J 3OVBA 1NPRA 1CJVB 2M5YA 2RKIA 4G1QA 1S57A 2PC6A 1OSDA 4U9RA 4L72B 4F0MA 3KLGB 1JX4A 4CYUB 1CJVA 3CSKA 4G3IA 3IRWP 1ZTTA 1DQ8A 3KLGA 5E41A 3BR8A 2VD3A 4F7VA 3QAEA 4RWXA 4CYUA 2YKMB 2MDAA 5DDRC 3NGUA 2B6AA 4QR0A 4CO0A 2OIHA 1F9HA 4QR1A 3MM8B 2CZ4A 2YKMA 3V81B 1RT1B 2F65A 2VC1A 2W9AA 3MM8A 5IQ6A 3ETMA 5KFJA 2MQLA 4LF2A 1RT1A 1UWBA 4OYAA 3LO3A 4R5PA 2DXDA 1RABB 3P49B 2ZJRQ 3NS7B 4DHVA 3PY8A 2VG6A 5J2NB 5JJBA 2K3KA 1B3TA 5K8NA 1GX5A 5CZXA 3CDEA 4NZ0A 2DXFA 4LIWA 3VAIA 1RAFB 1FFSB 5J2NA 1T3NA 3AD9C 4XTTA 1NB7A 3CNQP 4DL7A 4P2SA 3HFKA 4RUAA 3RB4A 4MYTA 4YY3F 2QZ8A 1FVSA 3IO1A 1SB6A 2AKWB 1IWGA 2C3OA 3LA0A 4ZJOA 2EFGA 1K0VA 1OPZA 2V94A 4IRKA 1NSKL 1YJUA 3JSRA 4RX6A 3IP0A 3OJUA 1EX8A 3W9IA 2ZM6J 3EYZA 3V4MA 5E2QA 2DO4A 1R8HA 4KO0A 2UUBJ 2MKHA 4DU8A 3FUYA 5HLFB 2RQ4A 4C3LA 5BXIA 2DH7A 2XM3A 2BOAA 2ZM6F 5HLFA 3CJSA 4PXBA 1X4CA 1CC8A 4QZVB 2UUBF 5SZTA 2LP4A 4NI2B 2J0SD 1PJ7A 5IWAJ 1YRXA 3CDBA 5HMWA 5MLCV 4MKVA 3BM7A 3R2CJ 5EUHA 2R9LA 4NI2A 1X0FA 3PCOB 2KFZA 1UPPA 1N5TA 3ISND 1VIXA 4PPZA 2OPSA 1R89A 5KFLA 2HG4A 5IWAF 1CG2A 4OYXA 4RR5A 1M5HA 2Z2LA 3CEDA 2BVZA 1SL0A 3AB2B 3BYPA 1SL1A 4DV0J 3DU5A 3QIPA 1CVJA 4CO4A 1VOMA 4ZHRB 2UXBJ 2YX1A 1BQXA 4PKDB 4MT1A 4P2XA 5A8RB 1NHKL 3TUPA 3NEKA 3FKBA 2FJDB 4ZHRA 4DV0F 2W4DA 4DL3A 5KT4A 2HWIA 1WI8A 4OV6A 5A8RA 4KY3A 3TO8A 4TQSA 2C2OB 2UXBF 2HHHJ 4LRDA 2QMWA 2XSJA 1PAUB 3CD0A 4DQQA 4I7FA 2MKKA 3A4TA 2BE2B 4X4RA 2DR9A 2VBXA 4Q7AA 1WWHA 3G82B 4TYAA 4M5GA 4XDDA 4Y0FA 3G2XA 3N01A 1G6BA 2BE2A 3N6NA 2HHHF 3G82A 1RAEB 3HFVA 1TL7A 4MAKA 4ZLPA 1C1CB 5D4OA 3L9ZA 3M8YA 4DG1B 1LW2A 3CJRA 4B3TJ 3A8EA 1C1CA 1GTEA 3V5RA 2E66A 2W2NP 4DG1A 4EU0A 3TP2A 5HO4A 4ERDA 1X5SA 2ERRA 1H7XA 1MROB 2P9GA 3U02A 5KFGA 4O3SA 2J6UA 3G86A 3FZ2A 1VQOS 2BJ8A 3IAM9 5DG9A 3M8QB 2FY1A 2FC8A 1LXJA 1FT8A 2LQ5A 1BHNA 4PWWA 5DRKA 3UCGA 3M8QA 3M4XA 3GLJA 3KLFB 5D4NA 4QIGA 1GEHA 5ETPA 3M8SA 2QG9B 4WJBA 5ETMA 4K4UA 1FKAF 1Q53A 1JQGA 3DGPA 3K5MA 1TAQA 3DLLQ 1WC3A 4IYQA 1RLDA 3C2PA 3MPWA 2BJ3A 2DNRA 4YFUA 2XI2A 2RQMA 4OHZA 2YQ3A 3O2IA 2VA3A 1FRLA 2JC1A 4PPDA 4M5IA 5J2PB 1UWAA 1U24A 2NXEA 3BGRB 4F50A 5J1EB 2BQRA 1NKEA 3EWGA 2HPUA 2C1EB 1CJUA 4C7QA 4DPTA 4U96A 2EFPA 4QPTA 1J2VA 1HWLA 2HHTA 1ZM9A 2B5JA 4UOHA 2QIFA 2HK3A 2LECA 4F3OA 2QA4S 3FQLA 3JB9k 1K1QA 3GCWP 4G1PA 3S1TA 4KH0B 3R2DJ 5CXTA 4UOCA 1U2FA 4RWWA 1S7IA 1J5OB 1RAAB 2WB4A 3PX6A 1HW9A 4QBUA 3TJAA 4B9VA 5I4MA 3W62A 1LFWA 2VB6A 5F8MA 3A8IA 2ILYA 2EKNA 2JEIA 3N6LA 3MD1A 1AZSB 4DV5J 2DNMA 3KLEB 2NSBA 4OX7A 5CCLA 4ILLA 4GKJJ 2CPHA 1AZSA 1WG1A 4DPYA 3IS9B 3MEGA 3PJ9A 3LPYA 2APOA 2CQIA 3ZTSA 4GKJF 4USJC 1BQNA 3KK3B 3LWLA 1H72C 2JHEA 2Z30B 1Q81T 2HFZA 4PG4A 4OHXA 2BE7D 2FJEB 4DV7J 2DGXA 3KK3A 5M2UA 3AA9A 1GMUA 1NKCA 2E7WA 3T3FA 1DRZA 4G65A 1W2BR 4DR2J 4DWIA 3R7NB 3NS5A 2XBPA 4DV7F 3QRRA 2WBMA 1RHJB 4KFBB 1YRTA 2OEMA 1UCNA 3M6WA 2O66A 5D0HA 3KDNA 2YNFB 1S4FA 4KFBA 2AGQA 2IDLA 3SCKE 1ZZNA 1IXKA 2QYCA 2QEXS 4FF3A 2CDRB 1VIOA 5CYMB 2OPPB 4FYXB 2JL9A 3DLGB 2YNFA 4HT5A 2Y3YA 1VC5A 4X4OA 4USVA 4NMLA 3UDVA 1ZM3A 3KJNB 2F63A 2IBOA 5CYMA 2OPPA 2XNRA 1S1XA 3DLGA 1NUEA 1NM2A 1N88A 4BS2A 3ULHA 3GFHA 3NBPB 4AXJA 3MFIA 2X1BA 6AT1B 2ZVSA 4PZVA 1SJFA 3HVAA 2RJZA 5KFYA 4HLBA 3KLVA 1APSA 3P6YC 4DX5A 4DQPA 1TVRA 2QV6A 4MKAA 2WONB 3EXYA 3AFGA 3RBZA 3AJDA 1T9YA 4RUHA 4IOAQ 2N3OA 3MM7A 2W2MP 3DNCA 3ZNJ1 1CULA 2CPDA 2WONA 5HATA 3AY0A 2KM8B 1IR1A 5K8MA 3KMQA 4X66J 2CKWA 4ECSA 2GMJA 3HFZB 1KHWA 2QL9B 3H90A 1QUVA 4JBCA 3X3UA 2IFXA 3DC2A 1EARA 5AE2A 3KDOA 2PMZD 2JH3A 1JJHA 1MSWD 3P5TL 2CPXA 3NGDA 1S1UB 4MH8A 2AJ0A 1SKSA 2AJQA 2BXJA 2F9JA 2W2PP 3KUEA 5F8LA 2ZNYA 4Z2XA 1OY8A 2N82B 4ECRA 2HHPA 3S8SA 4DV2J 3UCUP 1WTBA 4I2QB 2LEPA 5J1PA 1S77D 4F3QA 2QE5A 4OZ1A 4CLKA 4IRDA 2C22A 1FRHA 3BKTA 4I2QA 2FC9A 2BJEA 2HQ3A 2J9DE 3KLIB 5H9EJ 1H6KX 4LJMA 4A47A 2NQPA 4HDHA 1BLUA 3I31A 3HHLC 3KLIA 2FD2A 3IRXB 2RS8A 1IR0A 3AB4B 2AEFA 3G71S 3TAQA 4OYIA 3T5LA 2ZKTA 1KDNA 3GYNA 4DFPA 4KHPJ 3IRXA 3OFHA 4MJKA 1X4GA 3ENVA 3C8YA 4DL5A 4QOTA 4RW9B 3I96A 4EBEA 1I1GA 3OFGA 1JKHB 2IPOB 4DL0C 4RW9A 4M95A 2ABYA 1NU4A 4JI3F 5IM0B 4U7UK 1YTYA 3N0VA 4LT6A 2BOPA 1UAWA 1U47A 4KC5A 2N4DA 4H4KA 2HFVA 5ITHA 4XO0A 2E9ZA 2QRRA 2VQEJ 4I67A 1XR7A 3NLCA 4JV1A 1OO0B 1N32J 3Q2TC 1S5ZA 4NCAA 4G1IA 3HJVA 2B4OA 3QFWA 4EMDA 3MCNA 2MQNA 1U7LA 3CD5A 4GMKA 4ETXA 2N4CA 3CUNA 2IM0A 4LR9A 7AT1B 3F41A 3HVWA 1N32F 1R8CA 1D0EA 2FHKA 2QJ3A 3HZEA 1RAOA 3M2UB 2H5EA 2VFSA 3R9LA 4QWAA 1KEKA 3H2LA 3CJKB 4NLGA 3MCOA 4MK9A 2AJ1A 4NLOA 3R7BB 1F3VA 5HVGA 3M2UA 2D69A 1UW9A 4ANEA 2J0WA 3ZZOA 3P8BB 4LSLA 3EGVA 3CJKA 1EKRA 4PWDB 4LR8A 1RWMB 1SXLA 2OMLA 1LKZA 2HQGA 4O4GB 4MFBA 3LAKA 2CQ0A 4B3OB 2L9DA 1RWPB 4DDFA 5I3QA 2VPYB 2DVIA 1O51A 3GFZA 4B3OA 5JUMA 2M3DA 5CH7B 3FSIA 1NXIA 1VHFA 3E3XA 4GC7A 3UR3C 1SH0A 2H4WB 4OI3A 3H2VE 2BJ1A 2ZD1B 4J9KA 4LF9J 5D8HB 2YNHA 1CQNA 1WF0A 3T1AA 3M05A 4DN0A 5J2QB 3OR2B 2CWKA 3EJMA 3UW1A 4IUFA 1C0TB 1W7WA 1RUSA 4HI1A 5B09A 1V3RA 5E3AA 5E7OB 3HHLD 5HMXA 5J2QA 1RCOB 3HKWA 3CMAS 1SJ1A 4IDKA 1HLWA 4LF9F 3K8WA 5F9NA 3HI9A 4FBUA 2MQ8A 1H2VZ 5B0CA 2KHCA 2XZTB 5IQQA 4X4VA 4ZVHA 3G96A 5L1KA 5LT5A 1B0PA 4C6AA 2ZOFA 3QJPA 2GV1A 1AFIA 3FRYA 2DR6A 2R3VA 2HIQA 2CQCA 4TLQA 3AJ2A 3GZ7A 2GFFA 5KFZA 3ZZTA 1X5PA 1UEKA 4N7TA 3DHXA 4JI4J 5G0RA 1FEEA 4LF4J 3TJ9A 3H5YA 3MM6A 2G0CA 4OI0A 2P8IA 3TZWA 3G9CA 4IH7A 3QJLA 1U1OA 2L9NA 1TUVA 3MEDB 4EI2A 2B8PA 4W4MA 3GFYA 4PUOA 1VLYA 1VQSA 2K1RA 4JI4F 5HMZA 9RUBA 4GO5X 2ZH7A 1PC5A 3EDQB 3OUYB 1DTTA 4NEZA 1QAJA 2YKQA 2VU5A 1E6VB 3CPWR 4JV0A 1YKWA 4LF8J 4FXWA 4C8ZA 2Q6CA 2OD4A 1SH2A 3BDEA 3DOMB 2V5HG 3IM8A 3SYZA 3ENQA 1SL2A 4ZVQB 4MYUA 2RMLA 3DOMA 2EFOA 5T41A 2OSQA 1MU2B 1U02A 4LF8F 4PG6A 2EG2A 3KLHB 2I9SA 1YQHA 3Q8RB 2MQOA 2DY1A 2NYIA 1MU2A 4Z37A 2FDNA 4USWA 3KLHA 4C48A 2OSRA 1TKZB 3JAMU 4DV3J 1TUGB 1RBLA 3E51A 3NAIA 3R5BA 4NLWA 1MW7A 2FLNA 5KFHA 2BJDA 1FHTA 2AD9A 1WG4A 2GMHA 2CQPA 1JLCB 4UW2A 3M30B 3J81U 1LNQA 1TU0B 2RHSB 1X4AA 3NKYA 4DV3F 2BV3A 1JLCA 2CNLB 2NPFA 1FX4A 1N48A 4HH0A 5GMEA 2HWHA 2YWHA 2CPFA 4UUXA 4PYAA 1G1XA 3HSGA 1HNXJ 3RU0A 4ZVEA 3ZTOA 3LP0A 4DS5A 1MWQA 4YS2A 2WK4A 2XMJA 5LOQA 1HNXF 1Y10A 4IOBA 3RJMB 3THTA 2DBBA 2MZ1A 1KVIA 3R97A 3KG0A 3FBEA 2PE8A 3A3OB 2ZOMA 3C46A 5KFFA 1MN9A 4QJVA 5CA5A 3CC7S 3DLKA 3CE8A 3M2VA 4FF2A 1QY7A 4UOGA 1S97A 1C0UB 3NGSA 5HK4A 2OTLS 3D6HB 2HBZB 4CLPA 4BCAA 2AYBA 2M88A 3JXOA 4TXSA 1X60A 1C0UA 5C24A 4I1TA 2XYPB 4GKKJ 4USMA 2C3PA 1JWWA 3VZIA 2F3JA 2L41A 1SKWA 2UUTA 1VR6A 5AXKA 1RJJA 2WOMA 4ZJQA 2DD8S 2YBVA 4AL5A 2IBKA 2O01C 4LFBJ 3R7SB 4CLUA 1C1BB 1X4HA 2M9KA 4NYZA 5A8KB 2HBYB 4GKKF 2IM3A 4DCPB 2R7TA 3JAMY 1X8DA 3J80U 2J7UA 3MD3A 5F8HA 3LPEA 4CT9A 1C1BA 2XCAA 4NE9C 4ED3A 1R0CB 5A8KA 1PCAA 1JLEA 2E5LJ 3FSXA 3IFEA 2FLOA 4N56A 3MXHP 4RW8B 5HQLA 2IMWP 4UY85 2ZH4A 3TX8A 1ZA2B 3T19A 3D1HA 3D2WA 3MPDA 1AFJA 5ETRA 4DPXA 3H5UA 5KFKA 2ZC3A 3V2UC 3T6JA 5DM7Q 2R7RA 2UVRA 4H4OB 1HBOA 1FO1A 2ZWPA 4WXOA 4PXCA 4X64J 4OX6A 2YKAA 4CH1A 4H4OA 5IS2A 2G2ZA 4ZVUB 2CJ9A 1U2CA 2NLWA 4FPRA 5KFWA 2ACMA 1CJKB 2FPHX 3D1OA 4ANCA 3UVJB 3TZZA 1S0OA 1HA1A 3MAHA 5HAOA 2ILZA 1FXDA 2LA6A 1HL6A 5EWFA 1XMQJ 2ZH3A 2BMBA 1Y5IB 4RZRA 2HVIA 1CJKA 3FNNA 3RB0A 3UVJA 3C16B 1EQMA 3OTOF 1BXNA 1RACB 2ZDOA 4L76A 4BWJA 3EVOA 4N76A 2DR8A 3BKFA 3WC0A 1S9GB 3C16A 2AGOA 4RW7B 1AYEA 3DU6A 3M7VA 1XMQF 1WD6A 4CLSA 2G2OA 3OTCA 2I1RA 2AF6A 3VHQA 3PW0A 4CO5A 1SIWB 3HHEA 4JI6J 1Q7YT 5ETNA 5CD4H 3DMJB 2JDJA 2KHDA 1S72S 2LLZA 3BV8A 5J2MA 2VPXB 2NUUG 1XMOJ 2VKZG 2V0NA 2VC0A 2FY8A 3HHNB 3K5OA 1D8ZA 4JI6F 1FKPA 4ZA1A 2EC2A 3VCDA 4O3QA 2V2QA 4I69A 3MPVA 3ILJA 3EGWB 3MGJA 1QSLA 4F8RA 4NLVA 3ISZA 1XMOF 3BH6B 1ZAXA 4TU7A 3PVXA 3UNYA 2OELA 4B9MA 1X4EA 5EX3A 1HQEB 1R0BG 1NDLA 2CG8A 5KFVA 3VWSA 3VZHA 3LTOA 5KG7A 2ZH8A 4IR9A 1HQEA 2MB0B 2IYGA 2HQDA 4W98A 3UCZP 1RAIB 4HHHA 1DTQB 1TFYA 4I0WA 3RBEA 3QGHA 1DTQA 3ZTQA 1FKOB 3GONA 1U45A 4ED1A 1NJYA 2AZ1A 4LBPA 4M1KA 3A3PB 2KRBA 1RTJA 1MN7A 3MMBB 5KTQA 1IQZA 1X9SA 5EX0A 5L46A 4QIVA 2HQIA 1LWCB 1HARA 2OEKA 2GO8A 4GRSA 4X2BA 2PEBA 3CJ0A 1YVFA 2HNZB 3WC2A 1WHWA 3MFHA 1JLQB 4J37A 1U6BA 2FZKB 2PSZA 2VPWB 4UOFA 1B0VA 4FXDA 1T9VA 3FC9A 3QATA 1XC9A 1JLQA 1K9MT 3LAMA 4CZCA 2ADBA 3TA2A 4KBIA 1OMSA 3ZZYA 2XHCA 3HJFA 3ILOA 2XMTA 2I5JA 2XZDB 4CT8A 4J9SA 2ZZTA 2B3TB 5HVFA 1MNEA 2B4VA 4WYLA 3D1QA 2QA2A 2ZDPA 5CD4A 2WHOA 1TP7A 3VQSA 2C28A 2F9DA 4TY9A 1F60B 3P45B 3WZ0A 3D4JA 2UUCJ 3DLEB 4KB7A 1Z2LA 1N4LA 3CULA 2B8QA 2AIRB 5FJ4A 2VIHA 2MEWA 2E1CA 3LGHA 4DUYF 3DLEA 1L3VA 2Y0SD 2DNPA 2EFNA 5D0RA 5KFCA 3Q23A 2UUCF 3ITHA 4GVBB 3RAQA 4NLYA 1NSQA 4O3RA 3D5MA 2GHPA 1NJZA 1YZ6A 3V4IB 2AP6A 3OR1A 1P8GA 2PFFB 4X4PA 3GU0A 1RU2A 1YX2A 2GX8A 3GJQB 2WSFC 2A18A 2BBEA 3CCRS 3V4IA 3MM5B 1HWJA 2J9CA 3KJQB 1FCAA 5HANA 3UDCA 3GJTB 4J9OA 3KUHA 4F4YA 2PA3A 1YZ7A 4NASA 2BZ2A 4EYHB 3CCUS 3AJ1A 2HS0A 2CQ3A 5D6GA 2I8EA 1WUUA 4DF4A 1CC7A 2OAUA 2M2BA 2MKIA 2O5DA 4LSNA 4A8YA 1UEVA 4O3OA 2IC3B 2HHQA 1DZ5A 5DQGA 2O3DA 2RB7A 1VBYA 1UJ4A 3W63A 2NPIA 3NAHA 2DNHA 1HNWJ 1VC0A 2IC3A 4ICLB 1LOUA 2QL7B 2CQHA 3JYTA 2N3LA 4ED2A 4ZPDA 3FZBA 3VVTA 4ICLA 1UA0A 2KFYA 4LFCJ 1HNWF 1SUQB 2C2DA 4YDXA 5H9FJ 1ZM4A 5FDLB 5KG2A 2AJ2A 1T9UA 1SUQA 4EZ6A 1H2TZ 5KFEA 3VGTA 5FDLA 3ILLA 1YSJA 4AT1B 4LFCF 3CJQA 4FXVA 3H20A 4KHRA 4ES1A 1U49A 1HW8A 3I0SB 4RKUC 3MUMP 4XPEA 2GQQA 5GMKa 4O44B 2JLGA 1UVJA 3TWZA 3I0SA 2HGLA 2YPYA 4ZKAA 3TEHB 1K1SA 4K4YA 4O44A 1UP1A 1FRJA 1T9WA 4PR6A 4DS4A 2BACA 4N8OA 4ZP7A 1NK6A 4WFZA 2XLIA 1XTZA 1PKUA 2V6AA 1IN0A 3KJFB 1I94J 3KNGA 4R0JA 1AT1B 4C0BA 2MYFA 2W1BA 1JLFA 1LK7A 2KYXA 5ETQA 4GO7X 2O67A 3R5GA 5HVHA 1RADB 3QGIA 5E3CA 8ATCB 1K47A 5IZHA 4MIBA 1N54B 1KOHA 1I94F 4RU2A 1M1GA 2JNJA 4DR1J 1HWUA 4OMFG 4G6VB 1SCJB 2KJWA 2E5HA 3MAAB 1OSCA 1I3OB 1HNZJ 4NRTA 2MZSA 3OL9A 5GADI 2HFNA 1WI6A 1T3OA 1QE1A 2RD5C 3VTIA 1R6VA 1XNQJ 3MM9A 1HWKA 3LGMA 3IGVA 4DQRA 3CC2S 4B9LA 3PTWA 2XS5A 4JYAJ 4ZN1A 3AXMA 4JI5J 1KQKA 2ZUAA 2HZAA 1DLOB 4QWCA 1OQ3A 2AJ4A 2R7WA 5GVQA 5ETOA 2YNIB 4RJVA 3MDFA 1RP5A 2V2ZA 3AH6A 3HVTA 1DLOA 1BWVA 2YNIA 1WF1A 1A0OB 3DLJA 2VOPA 5HROB 1Y9OA 3IBFB 5HJXA 3K2YA 1JIHA 2KM8C 4Y28C 2G2YA 3HPOA 1D1UA 3MR2A 3X1LB 2FVPA 3R5CA 4P7TA 3IA0A 3NGTA 1U26A 4DSLA 1N5YB 2UUWA 4MMOA 5KG5A 1ZM2A 3B6BA 3DOKB 3J7A1 2VZ9A 4P52A 3JTNA 4EBDA 4MK7A 2CG4A 2G1DA 2YQ0A 3HHLB 3V6JA 1N5YA 4RNNA 2BKOA 5HMYA 3DOKA 1KS2A 1VJQA 1ZBTA 3T1YJ 2DB1A 5IT9Y 1RAHB 1TKTB 4J9LA 3HCXA 3CCTA 1HI8A 3H4DA 4M5NA 2QA4G 2DT9A 3LP2A 3SI8A 1TKTA 5I3PA 1OYDA 1VBKA 3T1YF 3N5FA 3G6YA 3GQCA 5D4PA 2DHAA 3LOUA 2OPQB 5I3UA 1NPKA 3DKDA 5HJYA 3UO0A 1VQLS 1RLCL 2HZCA 1OQ6A 4C8KA 2XSFA 3M8PB 3BGFA 3PJWA 3FFIB 5A2QY 3HMJG 3RTVA 2DIVA 2NYHA 3RGIA 3B8HA 2MXYA 4ZLJA 3HK2A 2QA1A 3OSNA 2CZVC 2XMAA 1TV6B 2CJKA 1M1HA 1TV6A 4H4KC 3TI0A 2XNQA 4I6WA 4K4XA 3PW5A 1FVQA 3AD7C 2KJVA 2AMCB 2W9CB 3GMGA 4B02A 3W1YC 3MOZA 4IH6A 2W8LA 2GAHC 4QU7A 3C6UB 3GJRB 3H5XA 2E5GA 1HBUA 2GGPB 2OO4A 5C2GA 1EHWA 3EICA 3BGOP 4CLZA 2XWYA 3C6UA 3MUVP 3CB4A 5GAGI 3PZPA 2GGPA 4ZVSB 4X84A 1EQ0A 2DCUB 4CI0B 4E2FB 1WKKA 3CGIA 2XGQA 3CIMA 5L1IA 1XNRJ 5KFAA 3P96A 2MHNA 3Q89A 2JEJA 5KG0A 1VQNS 3MOJB 5HQMA 4CH7A 4TU9A 4P74A 3FDSA 3N5BA 5DLGA 2RU9A 2R7SA 2GJ2A 4PRFA 3W2VB 3LUYA 2YY3A 1XWLA 2LMIA 1SH3A 3AOAA 4NCBA 4P6QA 4DR7F 2QFIA 3W2VA 5GADU 2AX1A 2Z0GA 1K8AT 3DRPB 1U25A 1TK8A 2EI5A 5JVHQ 4P9SA 3MMCA 4P72A 4HEA9 2UUAF 3G6XA 4AQYJ 3CCWA 3HX9A 4IO9Q 4ER8A 1RQ0A 3NCPA 4DBQA 3NMRA 3DRPA 2X3DA 1F9FA 4JI7J 2VJUA 2FLPA 2GZOA 3UWTA 4J9UE 3QMQA 1CS4B 1X5OA 4A8WA 1SC6A 1C2PA 1CS4A 3R5DA 4NXMJ 2BM1A 2VG7B 2NR0A 3QT6A 2F8EX 4JI7F 2QYGA 2D9PA 4JI8J 1WHYA 3NS6A 2KYZA 3MEKA 1TL3B 3NOCA 2VG7A 3SIPB 4ZVOB 1VBXA 4NXMF 2AQ4A 1NAQA 1TL3A 3Q8SB 1R43A 5F8GA 1N33J 1PIEA 4JI8F 4KTQA 4LQ3A 2IRUA 2DY9A 2XY6A 1A9NB 3GYGA 4NCGB 4DR4J 4USUA 3NCQA 2HW3A 1Q0NA 1JXEA 1S49A 4DSIA 1N33F 2M70A 2HNYA 3OLBA 3DDKA 3BJYA 4NCGA 5AXMA 3RB3A 4C8YA 1KLMA 4KRWA 1WC5A 4IO1A 1U1MA 2CPJA 4DR4F 2VOOA 2D3OR 2BM0A 1YRUA 2E9RX 3CCVS 4NLQA 2NXNA 5CYQA 5IFMA 2ZHAA 4HT7A 3JSBA 2HFSA 3C6TB 3H7HB 1RT4B 3M6VA 2MKCA 2W2QP 4DV1F 2X3GA 4J91A 4A4JA 4KH1B 5H9FK 2VG5B 2RRAA 3PRDA 1QAIA 3D68A 4QWEA 2OLWA 3QT5A 1RT4A 3TARA 3OT9A 4JI0J 2CQ4A 2BW7A 2H3EB 3Q22A 4OZ3A 3EVWA 1RTIB 3PV8A 1JLGA 3HD1A 4B9NA 1LWFB 3GSIA 3CCES 1S6QA 4I4BA 4DSEA 5E0OA 4FYDA 4DV6J 3LQVA 5ETKA 1S6OA 3ZZUA 3M8WA 5U47A 2DHXA 3VGSA 2GW8A 2WCXA 2MY8A 1LWFA 1N6QB 1TUWA 3EPGA 2VFUA 2OMOA 4X4TA 3HF5A 4N5SA 2Q43A 4RBVA 4NLTA 2EWHA 3BYRA 3KK1B 4DV6F 2JEFA 2ASYA 3PEHA 2Y9HA 2HVZA 4CP5A 4ZVGA 3TRGA 1KOOA 1HBMB 2JLFA 1S0MA 3B4MA 2V4JB 4FBTA 1B0TA 4OZLA 2GVZA 5GAGU 4NA1A 1WJ9A 4FS1A 4ZCLA 4V19J 1HBMA 3EM1A 2Q1LA 8AT1B 4C3KA 4DZDA 4A8MP 4LVNP 1TFWA 2E9TA 3ENWA 3KMSA 4CNYA 3AA8A 1PO6A 1IJFB 2F8HA 3H0PA 2WVBA 1D8YA 2GNKA 4WFAQ 4ZJLA 3AOCA 4WKRA 3C15B 1L3TA 3PDNA 3GR1A 4F4WA 3BO4A 5HBMB 1JJ2R 1VGYA 2W7OA 3L4BC 1U1NA 5K14B 3J81j 3TR5A 3M8ZA 1IKXA 2KT5A 5HBMA 2K3IA 1X5TA 1VQ6S 3UNGC 5HL7Q 3Q8QB 3PX4A 2CNNB 3UD3P 1OJ4A 4QIEA 3TUZC 5K14A 5KOXA 2OH2A 2NUHA 3O6QA 2KB2A 3T1HJ 1DY3A 9ATCB 1R3NA 4WK3A 3NMAA 1AB8A 2W24A 3O44A 4H54A 3P4UB 4PXDA 3RRHA 1R8AA 2KN4A 2JEGA 4U6PA 4CO1A 2H51B 3M32B 5HSPA 2VBZA 4BWMA 1YIJS 2P9CA 3T1HF 3HM9A 5DQIA 4WE1B 3GIRA 3EX7B 3M32A 4FS2A 2EEYA 2HBQB 5D15A 1GK8A 1TL5A 4WE1A 2ZUGA 1WNEA 5FLXU 3ISNC 1LW0B 3DHWC 3QSYB 5KOWA 1RKJA 3ET6A 3CWJA 4KYZA 2B6AB 1KBRA 4YB5A 1LW0A 4XDCA 3MPYA 4DR3F 1H73A 2XO7A 3HO1A 1A7GE 2A2DA 3OW2R 4ECXA 4Y2AA 1U48A 2NSCA 4ZK7M 4FNHA 2DGTA 4DX8H 1LXNA 2E1RA 1UWBB 3FGVA 2HVDA 3SXLA 3PXGa 3H59A 2OFGX 2ZH2A 2IYIA 2CRLA 4R5PB 3T5KA 1R27B 3THPA 2VG6B 4ZVFA 3W2WB 1N34J 2DIUA 1SQEA 4K4ZA 3K58A 4K4SA 3W2WA 3MWBA 1NDCA 1RHMB 3I5CA 3D0GE 3K7RA 3BREA 3HT3A 2IVFB 2DNYA 2YWWA 2FGOA 2UZAA 3QWPA 1C4AA 4ZLLA 1H98A 3HVRA 2GIQA 3GIKA 4FDFA 3RAMA 5KT5A 2WBRA 3OVAA 2MGZA 1KONA 5KG3A 1GFWB 2R8KA 1T95A 2XWXA 2DNZA 4B9SA 3FSYA 4FVCA 4C0OC 1FE4A 3RB6A 4UY8T 2YH0A 2RU3A 4KO0B 1VDHA 1RA6A 3WDOA 4RNHA 1ZOTA 4MK8A 1QTNB 2IY5B 2M8DB 2G0IA 2UP1A 2ZITA 4WCEQ 1UFWA 2R8HA 1KNZA 4DFKA 4WU3A 1P6TA 1NK7A 2MKJA 3O8WA 2A6OA 3SQOP 2IVYA 4TU8A 2HS4A 1FRXA 2HLUA 3SDEA 2K7JA 2HQFA 2PN6A 4ECQA 2V8HA 2OPSB 2KG0A 2PA8D 1TQLA 1O0PA 4GVLA 2HURA 2VICA 3VGVA 1NK0A 3ZTPA 2FLLA 3PW2A 4JOUA 5B0BA 3K8VA 2D1CA 3BKUA 2MTLA 5C42B 5F3TA 3QIPB 2B4PA 3I4PA 3K5PA 5C42A 4YDDB 2CYYA 3MHYA 2E5JA 1FFGB 2GC8A 5DS7A 3M6UA 2JJ4D 5KFDA 1GXUA 2HBRB 3GWCA 2FVRA 3E01B 2Y1RI 3BO2A 2HKEA 4M63A 5KFNA 2XSJB 2BYCA 1NDKA 2MZJA 4I7FB 1YK9A 2KXNB 4OZ0A 1RWVB 2R8JA 3E01A 5AXLA 3ILIA 3BEGB 3W5YA 4QWBA 3PHEA 1S7HA 5EWEA 3DLBA 1KFDA 1N8RT 2OGUA 2P2CB 2D3O1 3DDIA 4P10A 1TL7B 3K89A 1IR2A 2VV5A 1BWEA 4NA3A 4K0KJ 2VASA 3FRZA 4WF9Q 4WIIA 3T5HA 2HRYA 1BUXA 1LW2B 2V50A 2G1HA 2MLYA 3Q86A 1I5OB 1HHTP 4PYDA 4K0KF 3CVKA 3G4SS 3R6LB 4HYKA 1IM4A 2CJQA 1RT5B 4KIAA 2FGCA 4DCOB 2ZBIA 2YPZA 3UD4P 4WP8A 1IVZA 2NREA 5K8PA 1MG7A 4N47A 2X1FA 2DNOA 2Z57B 5LMNJ 1RZMA 3PG9A 2WVFA 1RT5A 1Q79A 3HD2A 1KTQA 1TMMA 1FK9B 2J8AA 4F25A 1F6TA 1E6YA 4B3TF 1S1VB 3IC1A 1T05A 4CQ1A 2LFVA 4PG8A 1FK9A 1W25A 4CCHA 3TW0A 1S1VA 3CIZA 5CABA 2BA9A 3TVYA 1HNVB 1YDLA 4QYRA 5KT3A 4B17A 4WTOB 1HFEL 5HI7A 1UZDA 2ZHOA 1FDAA 1HNVA 4DPUA 2IVMA 5KAKA 3GPAA 2QMXA 2LCWA 3DGPB 3BO3A 2DNQA 1H0HB 2YVSA 1SJ4P 3BR9A 2WSEC 1S0VA 3MCSA 3GIIA 4DX6A 2QT7A 3QGGA 4WP3A 5DDQC 4FF1A 3CC4S 3MR7A 3EUNA 1RYSA 4LRAA 3ETOA 4ZDNA 1QAXA 4WBFA 1CJUB 2GQCA 4UT4A 1IQTA 1EKSA 3HP6A 1H3DA 1O6XA 2R7OA 3TQ1A 4UZBA 3CCLS 2OFHX 1WKLA 4RNMA 2IA0A 2EVZA 4C97A 1O5JA 3C14A 2B5JB 2V9KA 1FJ7A 3PR5B 4B9TA 2J6SA 1X9WA 3PNIA 1R7IA 2ZH9A 2BR0A 2JSXA 4YN3B 4CTAB 3S7RA 3QJJA 1NK4A 1RGVA 3SQGB 1TZ0A 3TVZA 4IH5A 1FJGJ 2U1AA 5KT2A 2DHGA 2E1AA 1VS3A 4CTAA 3H4BA 5KFXA 4HACB 3SQGA 2HWTA 2ZJQQ 2BEFA 5HN0A 3M1VA 5KT6A 3MEGB 4HACA 4OYMA 1V9OA 3DXBA 5KFBA 1FJGF 3LP1B 3FJ2A 5HP1A 5RUBA 2EC0A 1U1LA 2ZE2B 4JV2A 4EZ9A 4FYWB 1S6UA 1UVKA 3GIMA 4YP3A 5H1SV 1BQNB 1PYOB 2ZH5A 4ID5B 1KRPA 4DSJA 1YJ7A 3LP1A 4DV5F 4DL2A 1HI0P 1KD1T 2AZ3A 2ZE2A 2CPZA 2B9WA 1JMTA 1N5QA 1VQ4S 4K7QA 4ID5A 4IG3A 2CQ2A 2UVWA 4L74A 1RHKB 1IKYB 1F0XA 5KFQA 1UA1A 2HEKA 2QL5B 1U1PA 1QJHA 4OJ1A 2CQDA 1IKYA 2W9BB 2CQ1A 3U1LA 3I4HX 1XEZA 4I6YA 3HDSA 3VAGA 4LVOP 3DOLA 3PRVA 2Y1LB 2ZBRA 2W9BA 3AT1B 5K20B 1CEZA 4OQJA 2DK2A 4OI6A 2CJBA 3Q2SC 4KE5A 3I32A 1Q5VA 3PIPQ 3ZO7A 3TNVA 3I82A 1TMJA 1UVIA 4N77A 4CH0S 5DGBA 4Z7CA 3RYLA 2VUGA 1BQMB 1W26A 1NZAA 1M5KC 4DR2F 1SC1B 1S1XB 3DYAA 3FK4A 2NXUA 4HTIA 3FBBA 2XG8A 1BQMA 3Q8UA 5DG8A 1FWKA 4OYZA 5DGAA 1F5BA 2HK2A 1WEYA 4PCQA 2XLJA 2R2TA 3AQOA 3NOGA 1FD2A 4M5MA 3OTDA 5DDPC 3OSPA 4YQWA 5GAEU 1CQMA 3L95X 1TVRB 1U1QA 4RUCA 2BANA 5FD1A 4B9UA 2J9DA 4TKTA 4K5SA 3MM7B 1CULB 3GE9A 1XMBA 4IG0B 3MPUB 1Y7PA 2B9XA 2MJUA 4IG0A 2C3YA 1ZZFA 2IA6A 2YWFA 1VQ9S 3LALA 4DN9A 2WTFA 5F0UA 4ZMMA 2RH3A 4R8UA 4URGA 3ZZ0A 4P7VA 2FVQA 3OD2A 4J9PA 2R7UA 4HH1A 1KTVA 4X4QA 3VAFA 4PG5A 2OD6A 4X66F 3PYDA 2J0QD 2BUNA 2F40A 3FBCA 1HR0J 5DG7A 2BABA 4AL6A 4ED6A 3OQ2A 3SSSA 1XBWA 4WPAA 4F4AA 5DZ6A 3L7UA 2W4CA 1SQFA 1T7PA 1Q8LA 3I56S 1JLAB 1HR0F 1UMJA 3SBMA 4F02A 5AE3A 3R1LA 3QQCD 2AYGA 4LBIA 5CAAA 4DV2F 4W90B 2AV5A 3CJ2A 1JLAA 2SXLA 3QBCA 2DH9A 2DGUA 4Q5VA 3O5TB 1NPPA 2YWKA 4RU9A 1RXOB 1NCLA 2CVIA 4KGKA 2CA9A 2PMWA 3H25A 4LMZA 2B7BB 1D9FA 4Q2MA 4V1Ak 1Y4ZB 2HLTA 1B99A 3D28A 1X0PA 2OKQA 2RILA 2Z2ZA 2OI2A 1BY9A 2EK1A 4KHPF 3A8JA 1REGX 3W7BA 4FPIA 2VL1A 1P27B 5F3ZA 3K5NA 4CM0A 1WKJA 2FIUA 2BQUA 1P1TA 2RDDA 3GG1A 2LQ8A 2V34A 2MLZA 3DDNA 3IM9A 3TJ8A 4CO2A 3F0NA 4Y2CA 3PKMA 1CSJA 5EHHA 2F7VA 1R8BA 3DM2B 5DZ7A 1IM6A 4USIA 2MHEA 1GAOA 2FHMA 2COLA 1UFKA 2LYVA 2DISA 4CLLA 4RO0A 3W60A 3DM2A 3EZ5A 2VQEF 4X4NA 4C11A 4C2MA 3RG6A 1KN6A 2MQMA 4ZVRB 2FJAB 3QFHA 5E5NA 4TLRA 3QPIA 4ZS6A 4LSLB 1IBLJ 4XAKA 4OHWA 4WKYA 4F26A 1NK8A 1U09A 4ECVA 5C5JA 1U8SA 4OLOA 3KG4A 1VRQC 5LMUJ 4MFBB 3DN9A 2LXUA 1Z1ZA 2QN6B 1EETA 3LGNA 4ZIWA 4YMEA 1IBLF 4DSKA 3MURP 3U1MA 1S1TB 4YEAA 4EGLA 2HGMA 2NS1B 4OYPA 2FYXA 1HBNA 4A48A 5K8OA 4JB8B 2J0XA 1DBDA 1S1TA 1PAEX 2YNHB 2I38A 2CWXA 2W8KA 2E44A 3CCMS 3GR0A 2UVVA 4A46A 2KI2A 1CLFA 3TZYA 2XGPA 1XIQA 2LKZA 1SPBP 2PI5A 4IDKB 2B7CB 1RWOB 1M5PC 5DDOC 1JLBB 1RU1A 3H5SA 4NRUA 5ETTA 2RIJA 3D9BA 1VRTA 4URSA 1LK5A 1FF2A 3AD8C 1NJIT 1JLBA 1S59A 3ZZZA 2B9EA 2I0XA 5T7LA 3OPKA 3PR4A 1WOOA 4J9QA 1MMDA 3R1HA 3T6BA 2Z8QA 1RKIA 1QAYA 1Y0HA 4J90A 7FDRA 3D3CJ 1N5SA 1TTHB 4K4VA 1Q7LB 1WHVA 1KHVA 2VQFJ 4J9VA 4O23A 1GMVA 3M9NB 4A8FA 4HHJA 3IN5A 2DGVA 1W2IA 1RWKB 5G0RB 2H54B 3JSMB 3MM6B 1Q16B 5ADZA 2F4VJ 2ALYB 2R42A 1WACA 2VQFF 3JSMA 1UEUA 4PUOB 3PW7A 1HPZB 2K1RB 4RNOA 4D3HA 4IRCA 5DETA 2CDQA 3NNCA 1PJ6A 2O1PA 2F4VF 1OIAA 2XY5A 3KXDA 2F8MA 3GCXP 4DXLA 1DTTB 1HPZA 4ZPAA 4LF4F 1K0TA 3BPDA 2XS7A
chains in the Genus database with same CATH topology
5ETKA 1TMMA 1RTZA 1TMJA 4M5LA 1RAOA 4CYUB 5ETMA 5ETSA 1F9HA 3KUGA 4M5JA 1EQ0A 1HKAA 3HCXA 1RU2A 4PZVA 1CBKA 3HT0A 3HSGA 3QBCA 1Q0NA 3KUEA 1KBRA 3IP0A 3HD1A 5ETOA 3KUHA 1EX8A 5ETNA 3UD5A 1RB0A 3MCMA 4CRJA 3ILLA 4AD6A 4M5NA 5ETQA 3UDVA 3MCOA 4F7VA 1HQ2A 4M5IA 5ETRA 4M5GA 3HSJA 5ETVA 2F63A 2F65A 1RU1A 1DY3A 4M5HA 1G4CA 2BMBA 4M5KA 5ETPA 3UDEA 4CYUA 3ILJA 5ETLA 4CWBA 3ILOA 3HSZA 3HSDA 1IM6A 1EQMA 2CG8A 2QX0A 4M5MA 3MCNA 5ETTA 3ILIA 3HD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETK A;  1TMM A;  1RTZ A;  1TMJ A;  4M5L A;  1RAO A;  4CYU B;  5ETM A;  5ETS A;  1F9H A;  3KUG A;  4M5J A;  1EQ0 A;  1HKA A;  3HCX A;  1RU2 A;  4PZV A;  1CBK A;  3HT0 A;  3HSG A;  3QBC A;  1Q0N A;  3KUE A;  1KBR A;  3IP0 A;  3HD1 A;  5ETO A;  3KUH A;  1EX8 A;  5ETN A;  3UD5 A;  1RB0 A;  3MCM A;  4CRJ A;  3ILL A;  4AD6 A;  4M5N A;  5ETQ A;  3UDV A;  3MCO A;  4F7V A;  1HQ2 A;  4M5I A;  5ETR A;  4M5G A;  3HSJ A;  5ETV A;  2F63 A;  2F65 A;  1RU1 A;  1DY3 A;  4M5H A;  1G4C A;  2BMB A;  4M5K A;  5ETP A;  3UDE A;  4CYU A;  3ILJ A;  5ETL A;  4CWB A;  3ILO A;  3HSZ A;  3HSD A;  1IM6 A;  1EQM A;  2CG8 A;  2QX0 A;  4M5M A;  3MCN A;  5ETT A;  3ILI A;  3HD2 A; 
#chains in the Genus database with same CATH topology
 3SFU A;  3MZI A;  3V81 A;  2CPI A;  2Q66 A;  4IOC Q;  3DGV A;  1NK5 A;  3PYE A;  2JOQ A;  1ACM B;  1U8W A;  3OBI A;  3PAC A;  4U7U D;  5T14 A;  3BN7 A;  2ZKU A;  3UFC X;  3RBX A;  3AOD A;  2MPU A;  4YY3 J;  2XO6 A;  3M8R A;  1FEH A;  4RW4 B;  3Q8Y A;  2DYA A;  4ETZ A;  4KPY A;  2K8G A;  3VAJ A;  2BKP A;  2DNL A;  3E2E A;  4YB6 A;  5J1N A;  4RW4 A;  1Q1K A;  1AXQ A;  2L48 A;  2MSS A;  3VQT A;  5KG6 A;  4KV8 B;  1U6F A;  4J5O A;  2GIR A;  2LDY A;  4HTJ A;  4Q8E A;  4KV8 A;  1YLX A;  3HHK A;  3EPI A;  4FNI A;  1ZTW A;  1NBE B;  2VHG A;  2AYM A;  2MJN A;  2R8G A;  4MIW A;  3NNH A;  2IM1 A;  2NZC A;  1CPZ A;  1G4C A;  5CQG A;  4PXE A;  4L6V 3;  4IKA A;  2CJX B;  3OXF A;  3U27 A;  1FWL A;  4HI2 A;  1X7V A;  2W01 A;  1FD8 A;  1PGZ A;  2AU0 A;  2D9O A;  3ONQ A;  3LP0 B;  3FCH A;  3S01 A;  4ELU A;  3SMZ A;  4IR1 A;  1UPM B;  1GMW A;  2GCF A;  2GVD B;  1PBA A;  3JTP A;  2RS2 A;  4AL7 A;  1F5A A;  3BQ2 A;  3KOA A;  3HXM A;  1D09 B;  1TL1 B;  1Y5N B;  2QLF B;  5A6W A;  2AT1 B;  4L73 A;  2DKO B;  2GVD A;  4Y65 A;  1FTC A;  1RT7 B;  2D3U A;  4HVZ A;  1TKD A;  1TL1 A;  4RL1 A;  3QYY A;  4E98 A;  4RLE A;  2JC0 A;  4TNO A;  3W8P A;  1RT7 A;  4F0H A;  3UN2 A;  1S79 A;  2HRT A;  2CNO B;  3IWN C;  3DLK B;  3M2V B;  5K5M A;  2Q79 A;  2YQ1 A;  3EGZ A;  2HFO A;  4M94 A;  1SVD A;  5FII A;  2XHW A;  2HMI B;  5ETL A;  1LFP A;  4CLY A;  4A8X A;  2KRR A;  1NEE A;  5C24 B;  3KYL A;  4P71 A;  2DCL A;  2MKS A;  2XTJ P;  2HMI A;  4NL5 A;  1N36 J;  1N0U A;  3PRB A;  2WZ1 A;  5KFM A;  2WOM B;  1RA7 A;  1SC4 B;  1EP4 B;  4DX7 A;  3OV7 A;  4ZPT R;  3JQJ A;  1UFL A;  1WDD A;  3TVK A;  2V69 A;  3RRK A;  3S6E A;  1TK0 A;  1EP4 A;  4RBT A;  4RW6 B;  4TQR A;  2OEJ A;  3TUI C;  1N36 F;  1NRK A;  3TYT A;  1H74 A;  2B4U A;  1JLE B;  3UN5 A;  1RHR B;  2C2M B;  4C98 A;  3QLH B;  2RVJ A;  4YOE A;  4RW6 A;  4K2X A;  2V8D A;  3D54 A;  2L9W A;  1YBA A;  1D9A A;  2QSW A;  1QSY A;  3QLH A;  4LFB F;  2ZNZ A;  2L08 A;  3A3N B;  2Y0B B;  3J81 Y;  3NWG A;  4KKO B;  2DNN A;  2CJY B;  2ZHB A;  1HBO B;  1QUP A;  4KKO A;  2E5L F;  4FN5 A;  3F44 A;  4LRB A;  6FD1 A;  1HQU B;  1S6P B;  3CCS S;  3W66 A;  5THW A;  3A8K A;  3KHG A;  1N52 B;  3M9M B;  1HQU A;  1S6P A;  2DNK A;  1XR6 A;  4URQ U;  1WTF A;  2GQ2 A;  1GNK A;  1MRO A;  3ADA C;  1PG5 B;  4YB1 P;  3ZNU A;  4IFV B;  2HFU A;  3OTB A;  1T0T V;  4C8O A;  1P9Q C;  2VFR A;  1VC6 A;  1KVJ A;  4EWT A;  5F41 A;  2AWZ A;  4IFV A;  4DZ6 A;  4X64 F;  3JQK A;  4Y2K A;  2D41 A;  2QLX A;  2MLX A;  4DR6 J;  3PO5 A;  5SUH A;  2CJA A;  3KLF A;  2AJF E;  2XQC A;  5B08 A;  4Y6I A;  1NME B;  3CMQ A;  4P73 A;  3MI7 X;  2Z58 B;  4X4S A;  4DR5 J;  1TKX B;  2MST A;  3NCR A;  2XS2 A;  5J2M B;  2VFT A;  4LF7 J;  4DR6 F;  1VQM S;  4DQS A;  4ELV A;  3PHT A;  1NSA A;  1Q4R A;  1TKX A;  3NXZ A;  1FKP B;  4M5K A;  1VYA A;  2RDI A;  2M52 A;  1SV5 B;  3AQP A;  1CJT B;  4DR5 F;  4OYW A;  1LWE B;  1YIT S;  4LFA J;  2J6T A;  5J2P A;  1YI2 S;  2LQJ A;  4OZN A;  4LF7 F;  2VDH A;  3BGR A;  5J1E A;  1SV5 A;  4BBY A;  1CJT A;  1WSV A;  2NCK L;  1R31 A;  1LWE A;  4ALZ A;  3C3L A;  2K2P A;  2HHS A;  2LA4 A;  3J80 Y;  4LFA F;  4XIU A;  4NLS A;  2FQQ B;  1FES A;  2F4F A;  4K5R A;  4K8R A;  4B3R J;  3KG1 A;  1RTZ A;  4KSE B;  1RBA A;  2IDE A;  1J5O A;  1YGY A;  3K59 A;  2QGF B;  3CJ8 A;  2LU2 A;  3THV A;  5F8I A;  3BDP A;  1H7W A;  1NLK L;  2MKY A;  4QW9 A;  2VBY A;  4DQI A;  1YG0 A;  1VQ8 S;  4DMZ A;  3KLE A;  4B3R F;  3I9V 9;  3MMJ A;  2W7A A;  1YHQ S;  2IMO A;  3QZ8 A;  3UDL A;  2KL8 A;  1FRI A;  3W8G A;  1SIZ A;  3MR6 A;  3IS9 A;  4QYZ J;  1DAX A;  1RTJ B;  2V67 A;  2C2N A;  1S0N A;  4M5D B;  4P2F A;  4WFY A;  4AE5 A;  5JXS A;  2X51 A;  4M5D A;  3DI6 B;  1UW4 A;  1PYS B;  2KXF A;  5L8R C;  1VFJ A;  5D0E A;  2VDI A;  3NP5 A;  4E8U A;  2G4B A;  3DI6 A;  2QSF A;  1J5E J;  2D7S A;  1U6Z A;  3FEX B;  1U0H B;  3BB5 A;  2FHJ A;  3C19 A;  4DJB A;  4NOH A;  4WZM A;  3VVU A;  3T9Z A;  2X1A A;  2A2C A;  4F67 A;  1P9Y A;  1U0H A;  2H4Y B;  4QPX A;  5KT7 A;  4DU7 A;  2I5J B;  2ATC B;  3JSY A;  1J5E F;  1S12 A;  4M8L A;  2N7Y A;  4ZOS A;  1SJ3 P;  2I6W A;  1VIS A;  2RRN A;  2ZBC A;  2ZVI A;  2OP5 A;  2H9Z A;  2PFD A;  2HGN A;  4I2P B;  4AYB D;  2DRD A;  1RWU A;  2M4M A;  3PM9 A;  2CAD A;  2HAI A;  4P2M A;  1SBR A;  3R8Y A;  2EXU A;  4KGZ B;  1SI9 A;  2RF2 B;  2DH8 A;  2P5V A;  1BGX T;  4I2P A;  1MWY A;  4WYW A;  1VK8 A;  1KFS A;  3OHA A;  2IIH A;  4NLX A;  4UTG A;  2FZC B;  4OI1 A;  2RF2 A;  1NHV A;  3IGN A;  3NBP A;  3ITH B;  3PO4 A;  4NMX A;  1VBZ A;  3D66 A;  2K06 A;  4CO3 A;  3N79 A;  1B4S A;  2UVU A;  4TN2 A;  3CJ4 A;  4RNF A;  1Y3J A;  1WEX A;  4DL6 A;  3OR1 B;  5D77 A;  4ED4 A;  5LXR A;  3QT7 A;  2A6M A;  3EZO A;  2ZC4 A;  4JV5 J;  2NXJ A;  5F8J A;  3OFE A;  1J27 A;  1VQK S;  3VAM A;  2UU9 J;  2YKO A;  1ZAW A;  4XK8 C;  5CHC B;  1NK9 A;  4QWD A;  3GB0 A;  3CO0 P;  4CDI A;  4YR3 A;  2LXI A;  1VQP S;  1NDP A;  2ACY A;  3I9Z A;  4QR2 A;  1B7F A;  2A10 A;  3IR5 B;  4PAB A;  4JV5 F;  1L5U A;  1RTH B;  2XYH B;  3SCJ E;  4X4U A;  2UU9 F;  4BHQ A;  4FKY A;  2HHV A;  1KP6 A;  1S1U A;  2AW0 A;  2E7V A;  1IWA A;  1RTH A;  4LSN B;  3SEO A;  2W2O P;  1QD1 A;  2CVE A;  2ZEJ A;  4OJG A;  1RSC A;  4LSZ B;  4OZ5 A;  1NKB A;  5E33 A;  1UJ6 A;  2CFX A;  1Q82 T;  1RCX B;  4ED0 A;  1UET A;  1A6L A;  5M2R A;  4JUZ A;  3DLH A;  4QCL A;  3V6K A;  2WW4 A;  1OYE A;  2B9Y A;  3JYT B;  3MEC B;  2C2R A;  2BJ7 A;  2A1B A;  2RT3 A;  1UJ5 A;  3OXL A;  1FE0 A;  4I56 A;  2HVE A;  3RZA A;  4WIQ A;  1QVG R;  5A0Y B;  2IRY A;  5IT0 A;  5GAH I;  4KR0 B;  3MEC A;  6FDR A;  2X7I A;  2H1Y A;  2CZ9 A;  2DPJ A;  1NZ8 A;  3WIV A;  2Y8W A;  1P1L A;  2P9E A;  4WFN Q;  5A0Y A;  4JI3 J;  4J9R A;  2PEH A;  2X1G A;  2B43 A;  2VPZ B;  2MMY A;  1WF2 A;  2ASD A;  1F1B B;  3W9H A;  5LSO A;  4OJH A;  1M5V C;  2N7C A;  2V4Q A;  1JKH A;  1BC6 A;  1XN9 A;  2BX6 A;  2GA7 A;  4WZQ A;  3FBF A;  1EJ7 L;  5IM0 A;  2QMU B;  3MR3 A;  4BLG A;  2PD1 A;  4OI4 A;  2G0J A;  2V2V A;  2KZZ A;  3VR1 A;  3UQS A;  3UN3 A;  3WQP A;  4EK2 A;  2FVC A;  4R25 A;  4K59 A;  4C8M A;  4WWS A;  2DEI A;  1JLF B;  3HSD A;  4ES3 A;  4ZP8 A;  4M5L A;  1FDD A;  4K4W A;  4J9N A;  1L3S A;  4S0M A;  1HHS A;  3BBF A;  1PSD A;  1VQ7 S;  2GML A;  3QNW B;  1ZPV A;  2R2R A;  5AE1 A;  2KDO A;  3SZ2 A;  1JK9 B;  2C3M A;  3QZ7 A;  2GS8 A;  3FCV A;  1F5C A;  2J7W A;  4DLE A;  2XYG B;  3CD7 A;  4WFB Q;  4XPC A;  2H5I B;  2DPI A;  4NLU A;  1QE1 B;  1F3F A;  4KT0 C;  2BKN A;  3MM9 B;  4PWD A;  3PW4 A;  2WB1 D;  4OYO A;  1Y00 A;  4O4G A;  2EBG A;  2AEJ A;  2XMM A;  4CRJ A;  2LQB A;  4DR1 F;  4LR7 A;  2EPI A;  4Q0B B;  2VON A;  3J7Z 5;  4HR2 A;  2E7X A;  2ZH1 A;  1JJ4 A;  1RT6 B;  2AYE A;  3D6F B;  3H40 A;  3F56 A;  3HVT B;  1HNZ F;  2HND B;  4C3M A;  1UVN A;  3NGK A;  4Q0B A;  1I6J A;  2MZQ A;  1URN A;  2I2Y A;  1K73 T;  1RB0 A;  2WVC A;  1FTR A;  3EMT A;  4AUK A;  1RT6 A;  1WOR A;  2ZD1 A;  1XNQ F;  3TAM B;  4KQZ A;  3WX8 A;  4JI2 J;  2HND A;  3UDE A;  3OR2 A;  4JYA F;  3DRR B;  1C0T A;  1SQG A;  4JI5 F;  3TAM A;  4K2J A;  3W64 A;  3SSR A;  2EW9 A;  3M2R B;  3DRR A;  4DCJ B;  2XLK A;  4JI2 F;  3MUT P;  2J7K A;  1KQS R;  5IC4 B;  5ETS A;  4U7C A;  3UPF A;  4WU2 A;  1XK8 A;  3M2R A;  2KH9 A;  3Q0A A;  3IXQ A;  4F2S A;  1T9T A;  5IV3 A;  3P3D A;  3LP2 B;  2XMK A;  2D74 B;  1IKV B;  1TEL A;  1MLA A;  1UVM A;  1Z4U A;  3VF0 B;  3EXC X;  3IR7 B;  2AGP A;  5DJB A;  2QO3 A;  2XUL A;  5L1L A;  1B64 A;  1IKV A;  1Q8K A;  4P75 A;  4KGV B;  2HS3 A;  2H5J B;  4RPF A;  4Q44 A;  4NPO A;  4LF1 A;  3RUB L;  5I3U B;  2BE9 B;  1H2U X;  4PQU B;  1MML A;  2KU7 A;  3ZTR A;  2QLB B;  3FMB A;  5GAH U;  4ATN A;  1D9D A;  3KFW X;  1S9F A;  3MED A;  4FKX A;  3JS9 A;  4PQU A;  2A0F B;  1VRU B;  4ZCK A;  4ZIT A;  4K50 A;  2QLW A;  3QRQ A;  1X9M A;  3C66 A;  3OUY A;  2LQ9 A;  5DQH A;  2DHH A;  4Y2M A;  3NL0 A;  3TA0 A;  1VRU A;  2B51 A;  1E6V A;  4QYZ K;  1FNX H;  1LQ9 A;  5KFU A;  3G6E S;  3QWU A;  3L7P A;  1N5V A;  4Z7Y A;  3BQ0 A;  1ITP A;  2M7S A;  3CJ3 A;  4I64 A;  3CCQ S;  3V6D B;  1TR0 A;  3CME S;  3HSJ A;  3WX4 A;  1HBU B;  4UST A;  3VAH A;  3V6D A;  1VI7 A;  2WVE A;  4ZPB A;  5D4L A;  2FVS A;  1FXL A;  2C2E A;  1TKZ A;  1M5S A;  2POK A;  3D7S B;  2KT2 A;  4GC6 A;  3D67 A;  1U1K A;  2LVW A;  1F9E B;  3IBC B;  5D78 A;  2QLJ B;  1IBM J;  3PIO Q;  1Q78 A;  1U2R A;  5K9F A;  3M30 A;  2VKR A;  2DGQ A;  3MR5 A;  2PO4 A;  1IBC B;  5EWG A;  1H38 A;  4OJ3 A;  4F2R A;  2UV8 G;  1UKU A;  4HL9 A;  5JVG Q;  2G9O A;  2ZZN A;  2NZ4 A;  3TAP A;  1OY6 A;  1IBM F;  1RWW B;  1HQ2 A;  2EFV A;  1XNR F;  3W5Z A;  1D3W A;  3MMC B;  3RW6 A;  1HKA A;  1S1W B;  2ZJP Q;  3CDU A;  4Q43 A;  1GT8 A;  2GHV C;  1HHQ A;  3A12 A;  3G87 A;  3BGU A;  1S1W A;  1JJC B;  3D3B J;  5KG4 A;  3W9J A;  2HQC A;  2RAQ A;  3WBZ A;  3R6G B;  3T41 A;  4AQY F;  1ZYQ A;  1KLN A;  4EUV A;  1AUS L;  2E1P A;  5C2C A;  3EE3 A;  1GXL A;  4X62 J;  4DSF A;  4ITS A;  2JWN A;  4CLW A;  1VJW A;  2AHO B;  4WTY A;  1YBT A;  1LV5 A;  4WK1 A;  3SCL E;  5AJ3 J;  2F5G A;  1RHU B;  4Y3C A;  1YJV A;  2RUS A;  3G8S A;  4X62 F;  1URR A;  1PBU A;  4FF4 A;  2JZ5 A;  2HZV A;  2HNY B;  1RWX B;  2DO0 A;  3J7Y I;  1FJC A;  5AJ3 F;  3KHH A;  4UUW A;  4CM2 A;  1KLM B;  3TOQ A;  5L9N A;  2C2K B;  4DFJ A;  3F73 A;  3LH2 S;  2EG1 A;  3I6P A;  3OVS A;  5H9E K;  2GIF A;  1XQI A;  2BW2 A;  5CYQ B;  2JFK A;  4YUD A;  1CBK A;  5CCM A;  1U1R A;  3RR8 A;  1RAJ A;  1BE4 A;  2KXH A;  2R7V A;  3LWM A;  4RW8 A;  2YNG B;  1V3Z A;  2PII A;  2RHQ B;  1JNR B;  5A8W B;  2V2K A;  2HRU A;  2PDA A;  2XZW A;  3K17 A;  1FDB A;  1AUD A;  2RDJ A;  3UD5 A;  2YNG A;  4ZPW R;  2ZWO A;  3NNA A;  1JLG B;  3BPS P;  2Q6B A;  1Q86 T;  5A8W A;  3OTO J;  3TQE A;  5D0G A;  2JVR A;  1S6Q B;  2JLE A;  3U1N A;  2FTR A;  3CW2 C;  3RR7 A;  5L9X A;  1HWI A;  1QVF R;  1N0V C;  3D6T B;  1K44 A;  1VCT A;  4MTP A;  3RAX A;  2JX2 A;  3CXC R;  4JI0 F;  1KWM A;  4ZP6 A;  2W4P A;  4NLD A;  3QRP A;  4YHH J;  2PGC A;  1T03 B;  1GX6 A;  4DF8 A;  2P6S A;  1DHM A;  2GO9 A;  2WSC C;  4B08 A;  4M5H A;  2XMU A;  3SFG A;  1T03 A;  2FZG B;  4F36 A;  1PC4 A;  1S9G A;  2C3U A;  2GVZ B;  4MKY A;  4RW7 A;  4YHH F;  2EFQ A;  4N8N A;  3FEY B;  5KFO A;  5EDW A;  3GIL A;  3DRX A;  3CDW A;  5B0A A;  2DR7 A;  3UR0 A;  4LF5 J;  4C9D A;  1UZH A;  1B7Y B;  2J5A A;  1IJE B;  2FJW A;  3DMJ A;  1LEO A;  1RI7 A;  3B82 A;  1B70 B;  2CXE A;  1PYT A;  5KFR A;  2YXL A;  1V5I B;  4LF5 F;  2AEM A;  2ZBQ A;  3I5A A;  1NSP A;  3QT8 A;  2H48 B;  1IKX B;  1HNI B;  1YBU A;  4ELT A;  1X4D A;  4EYI B;  3BZQ A;  5DO2 A;  4ECZ A;  1QLN A;  3WHI A;  4EFA C;  1HNI A;  3CTR A;  2AX0 A;  3OLA A;  1NJX A;  4A8K A;  2ATL A;  1XR5 A;  2CNK B;  1S4E A;  2RQK A;  4DUT A;  4OFZ A;  2YTC A;  1TK5 A;  4KGM A;  4FVM A;  3KHR A;  1EIY B;  2Z4P A;  4OL8 A;  5LJ5 Y;  1N56 A;  3KTQ A;  3Q8P B;  3RBD A;  4I68 A;  4OYB A;  3BSN A;  2YX4 A;  1S9E B;  4W92 B;  2BRL A;  4A8S A;  1F2G A;  2JVO A;  1S9E A;  5LL6 d;  5BJR A;  8RUC A;  3TAN A;  5IC6 B;  3K0J A;  2XMV A;  2IM2 A;  1R6Y A;  1R8P A;  4ZN3 A;  4NLP A;  1FKO A;  4ZPV R;  4ZVT B;  3ET6 B;  2WAQ D;  1KQF B;  4O0N A;  4Y00 A;  2XC9 A;  2HHX A;  5IT4 A;  2DNG A;  3G8Q A;  1YJR A;  4I6A A;  4CWB A;  3B54 A;  4ZCM A;  4NLR A;  2E5I A;  3G6V A;  3K57 A;  3O1L A;  3MMB A;  2BDP A;  3OTE A;  1Y5L B;  5B0D A;  3BN4 A;  1KQG B;  3M6X A;  1FA0 A;  4AFF A;  1LWC A;  4DOZ A;  2DGW A;  1WEZ A;  1R0A B;  3J7Y U;  3ZZP A;  2HNZ A;  2IJF A;  3FQK A;  4ECW A;  5LJ3 Y;  2QFJ A;  3BH7 B;  3IR6 B;  1EB0 A;  1YWX A;  3IAS 9;  4LRE A;  1R0A A;  2VFV A;  1HMV B;  2BRK A;  1FDN A;  4QU6 A;  4TY8 B;  3PYG A;  4UF4 A;  3BBB A;  3TX0 A;  3QID A;  3CJ5 A;  4UQG A;  2MQP A;  1SKR A;  1HMV A;  4R0E A;  3R3T A;  3A1Y G;  1ZH5 A;  4TY8 A;  4DUY J;  3NWR A;  3BSO A;  1NB2 A;  2J9E A;  3H8Y A;  3HSZ A;  4OZJ A;  3EDR B;  4C8L A;  2YWE A;  4KGX B;  4IQX A;  3GP9 A;  4EO8 A;  2VH7 A;  1N34 F;  1RIS A;  4RBU A;  3G8T A;  2RNE A;  2MGZ B;  2K7K A;  3SV3 A;  1ICE B;  3CO9 A;  1WSR A;  2R7Q A;  3PJX A;  1QDU B;  2W25 A;  3POT B;  5BYS A;  3FEZ A;  1VHI A;  2P6T A;  5KFI A;  3EGN A;  5A6P A;  2QTW A;  2ROE A;  1GMW D;  1S10 A;  3POT A;  1U4B A;  4GVB A;  3I55 S;  4OHV A;  1DFD A;  4YB7 A;  3OL8 A;  1RHQ B;  3KJV B;  4KAI A;  3PEJ A;  4ED5 A;  4C8N A;  4ZVP B;  3KWM A;  2ZBP A;  1WHX A;  3PFE A;  4F4Z A;  5LSL A;  2BJ9 A;  4EBC A;  2Y1I A;  3EVM A;  3KJV A;  1YJT A;  5D3G B;  3LW5 C;  3I5B A;  4DL4 A;  5LM7 E;  5IXU A;  5BYR A;  3MM5 A;  1F2H A;  2V8G A;  1SJR A;  5F9L A;  1RAG B;  4LRF A;  1VQ5 S;  3VAK A;  3SDE B;  5D3G A;  4HHU A;  5FLX Y;  2V8V A;  2LXF A;  2KT3 A;  2Y1J A;  3AAW B;  4QIW D;  4ECT A;  3NG8 A;  1EAY C;  3W5X A;  1VQY A;  2KKH A;  4WP9 A;  1G3O A;  3W3S A;  1FRM A;  2G13 A;  2ZZM A;  3JQM A;  1Y11 A;  5BR8 J;  4L3K A;  2V8P A;  4ES2 A;  5DLF A;  1EZZ B;  5ETV A;  3UE2 A;  2YKP A;  3GJS B;  4IFY B;  1RT2 B;  3D0H E;  1GQE A;  5BR8 F;  1KC8 T;  4LIR A;  2RE1 A;  1SKU B;  4IFY A;  2YX7 A;  1RT2 A;  1ZPW X;  4F4K A;  1T11 A;  4U95 A;  1VLO A;  4LF6 J;  2ADC A;  4C0H A;  4NA2 A;  3N4W A;  2JFD A;  4OLP A;  3MAQ A;  5GMD A;  1JXV A;  3NY0 A;  3BGL A;  3CJT A;  4DPO A;  3ICL A;  2M8H A;  1M90 T;  1PIL A;  3RRG A;  1S76 D;  3DXS X;  2V9W A;  4LF6 F;  3US5 A;  3GG0 A;  1DAR A;  3K5L A;  1FI4 A;  2CQB A;  3H42 A;  1S99 A;  1WOS A;  2EBE A;  2RQC A;  2YH1 A;  3DCA A;  4LRC A;  4PEO A;  4TYB A;  1VMB A;  2HSE B;  3PYF A;  3OL6 A;  2CAJ A;  4J7C A;  4ECY A;  5IT9 U;  1OY9 A;  3SV4 A;  3GIJ A;  2DEJ A;  4U8V A;  1BMQ B;  1BD6 A;  1V5V A;  3MTJ A;  4O0I A;  1HD1 A;  1ULR A;  3CD6 S;  2YWG A;  5HQ8 A;  1G2E A;  1QTM A;  1RT3 B;  2GAG C;  3OHB A;  4ZLN A;  4ED7 A;  2C42 A;  3TEG A;  4TVA B;  3OL7 A;  5LSR A;  1SJQ A;  1E6Y B;  1ARO P;  2E29 A;  2OUG A;  2Y8Y A;  1RT3 A;  1X4F A;  4Q45 A;  1T05 B;  4L75 A;  2W7P A;  3QGP A;  3DRY A;  3H98 A;  5EGY A;  5GAE I;  1X31 C;  4Q2L A;  3ZXW A;  2J76 E;  2R7X A;  2VBW A;  3U7J A;  1FFW B;  3D0I E;  2RUG A;  5L39 A;  3CCZ A;  1T8E A;  2R2U A;  2OHD A;  3BSA A;  4LUB A;  5LXY A;  3AXK A;  4X65 J;  5A2Q U;  2IAJ B;  5LMN F;  1WC4 A;  2WVD A;  2J8S A;  2FJX A;  5M2P A;  2F1F A;  1FXR A;  3BS9 A;  3IG1 B;  3N9U C;  2IJR A;  2KFN A;  3PX0 A;  3MCM A;  4DFM A;  1T02 A;  2IAJ A;  4OX9 J;  3MAA A;  3Q8V A;  4F3M A;  2DHS A;  3BSC A;  3IG1 A;  2VOD A;  2KZM A;  2CQG A;  2QX0 A;  3IMQ J;  1RWN B;  4X65 F;  2MY7 A;  5A76 A;  1XJW B;  1ROF A;  2GJI A;  1YJW S;  3IWX A;  2NXC A;  3GV5 B;  2RSQ A;  2DGO A;  1I51 B;  4OZ2 A;  2DR5 A;  4OX9 F;  4OX8 A;  2KG1 A;  1NH7 A;  2OJ3 A;  3MF5 A;  2DGS A;  3C14 B;  4NZ7 A;  3FCW A;  1DJ0 A;  3R5A A;  3BQ1 A;  3CF5 Q;  4ILR A;  5G4D A;  1Y3K A;  5HRO A;  3RW7 A;  3T9N A;  2IHR 1;  2Z2Y B;  2VA2 A;  3N28 A;  3OFF A;  3LF0 A;  1RE1 B;  3GV7 B;  1HIY A;  5B0F A;  4ZPC A;  1GTH A;  3IBW A;  4ZIV A;  1WOP A;  4N41 A;  3HHL A;  2VF3 A;  3O3L A;  2A3J A;  3M1V B;  4NYO A;  1DQA A;  2LU1 A;  1NND A;  5E3P A;  2C2Z B;  5F0W A;  2PI4 A;  2ZFH A;  2YKN B;  2KO1 A;  2WRM A;  4EO6 A;  1Q95 G;  5HP1 B;  3BF4 A;  4V19 X;  4CNZ A;  2CIM A;  4C4W A;  4DLG A;  3GSD A;  3KNA A;  4O3N A;  2YKN A;  3CDA A;  3R27 A;  3ZZR A;  4BC7 A;  4J9M A;  1X4B A;  4EEY A;  4ECU A;  1UTA A;  4USK A;  3OXG A;  4IG3 B;  1NO8 A;  1FRK A;  2OPQ A;  2FHJ D;  1U0S A;  4CIO A;  3E8O A;  5L1J A;  4PAA A;  2HHW A;  4NWB A;  2IRX A;  4DEZ A;  5CZV A;  1HD0 A;  2Z2M A;  3DOL B;  1JNZ B;  3HHD A;  3I87 A;  5C25 B;  3M8P A;  5KG1 A;  3FFI A;  1ZET A;  1RTD B;  2ZOG A;  5IOL A;  1ZA1 B;  2ZH6 A;  4YR0 A;  1M1K T;  4ENO A;  5C25 A;  2LDI A;  1RTD A;  4H4M B;  4QQB A;  1JB0 C;  2CPE A;  2EKY A;  2Q3P A;  3D6M B;  4H4M A;  1V6H A;  2R4F A;  1HYS B;  2U2F A;  1WC1 A;  2DJW A;  4ZCI A;  3Q24 A;  1M0S A;  2W9C A;  3DYA B;  2FB0 A;  1HYS A;  5DM6 Q;  4KHM A;  5AXN A;  1Z2Z A;  4Y2I A;  3ZFV A;  5E3Q A;  4NYP A;  3PFO A;  2H65 B;  2PMH A;  4M5J A;  5BYQ A;  3VGU A;  1V3S A;  2ASJ A;  1RDR A;  2M0G B;  4LBH A;  2MZT A;  2KVI A;  5KFP A;  2BAN B;  2FJV A;  4DR7 J;  4NXN J;  4F04 B;  1YJ9 S;  1T94 A;  5MAO A;  3H2U B;  2ROP A;  4O3P A;  2UUA J;  3T5J A;  4MKB A;  4DV4 J;  4L3N A;  1FWP A;  3HKZ D;  4O4R A;  2CPY A;  1WC0 A;  2CUY A;  2LEA A;  3DFE A;  4Y34 A;  1IBK J;  4NXN F;  3M9O B;  3B4D A;  2XY7 A;  4R8U B;  1GH8 A;  4JP8 A;  1KR4 A;  1TL4 A;  5KFS A;  4DV4 F;  3GV8 B;  2HHU A;  5JMN A;  1GXT A;  1IBK F;  3QAU A;  1TAU A;  4U8Y A;  1L3U A;  2DRB A;  2V68 A;  2WW8 A;  1ZAV A;  2FHO B;  4ILM A;  1DUR A;  4ZP9 A;  4F4X A;  3WIU A;  2UXC J;  4IQM A;  1G7C B;  4PQA A;  3SSQ A;  3PKY A;  3ELH A;  3DRS B;  5C7P A;  2JRS A;  4ID8 A;  1REV B;  3W61 A;  4A8O A;  1QSS A;  5AT1 B;  3EZU A;  1FER A;  4AND A;  3DRS A;  2XEX A;  1RBO B;  4LQ9 A;  1AA1 B;  1REV A;  2UXC F;  4PG7 A;  2KVQ E;  1T9X A;  3A13 A;  3GTY X;  2VJV A;  2LEB A;  3B78 A;  4OIX A;  2FUG 9;  4A8Q A;  3KK2 B;  3J7Z T;  2HYI B;  1FX2 A;  1RYR A;  5B7W A;  3HZG A;  4B3S J;  1UL3 A;  1SC3 B;  1RK8 A;  5EN1 A;  1FNM A;  2V63 A;  3I0R B;  3KUG A;  4DPW A;  1FJE B;  2Z56 B;  4Q8F A;  3KK2 A;  4ED8 A;  3KKF A;  2EK6 A;  2FJB B;  4RUB A;  1M5O C;  1UVL A;  1YJN S;  3I0R A;  2MQQ A;  4KJI A;  4B3S F;  2QC3 A;  3FMW A;  3ENA A;  4JI1 J;  4DV1 J;  4UZC A;  1AW0 A;  4WXW A;  4NX9 A;  7FD1 A;  1MMN A;  1MWZ A;  3OJS A;  2B0G A;  1IKW B;  4QIF A;  5CYJ A;  3VV2 B;  3KHL A;  2GHW A;  3HT0 A;  4JI1 F;  1WEL A;  3GYX B;  1IKW A;  3V6H A;  3C6T A;  3NRB A;  2BQ3 A;  2UXD J;  4FZV A;  3R5J B;  2XCP A;  4MIA A;  4QW8 A;  3SCI E;  2KTQ A;  2VG5 A;  2HAF A;  2B56 A;  1Q5Y A;  3UI3 A;  3AHP A;  1C4C A;  3HUL A;  4UQT A;  3L3C A;  3MMA B;  5I42 B;  3AOB A;  4C11 B;  2UXD F;  1RTI A;  1L3K A;  1NJW A;  3ZC4 A;  4CLF A;  2R2S A;  2E1M C;  5IV4 A;  4K4T A;  2DIT A;  3MMA A;  3QO9 B;  5I42 A;  4OV1 A;  1WC6 A;  4AXI A;  3Q83 A;  1OS5 A;  2IJN A;  5B0G A;  2MZR A;  2OPR B;  1N6Q A;  4KPC A;  2XI3 A;  3LAN A;  3QO9 A;  1DQ9 A;  4D3G A;  3FVY A;  1HI1 A;  2GJF A;  4U67 Q;  2OPR A;  2ALZ A;  3MTK A;  2OTJ S;  1PJ5 A;  1EET B;  3BBC A;  4NEY A;  3KK1 A;  4NZ6 A;  2HIY A;  1OPI A;  4CLT A;  1KKH A;  4USH A;  5L38 A;  3NGR A;  1HBN B;  2V4J A;  3N6M A;  2PT0 A;  4OI2 A;  4DUZ J;  1O8B A;  1XER A;  1Q8I A;  4E0D A;  3L09 A;  3CCJ S;  1KSP A;  2DXE A;  1S48 A;  4B3M J;  3CT9 A;  2D3Z A;  2DRA A;  5LMU F;  4WFX A;  4FP9 A;  3HLU A;  1IUJ A;  2RRB A;  4OHY A;  4AD6 A;  2V4R A;  3P5B P;  5B0E A;  1Q8B A;  3TA1 A;  4DUZ F;  1OWX A;  3C15 A;  1NHU A;  3J7A N;  1JXL A;  1QM9 A;  1LWX A;  4B3M F;  2ROG A;  2DTJ A;  1VK3 A;  3L7O A;  3MEE B;  4YR2 A;  1VRT B;  1NH8 A;  1KVK A;  2UV8 A;  4HKQ A;  3MEE A;  4BC9 A;  2XB2 D;  4HDG A;  5T7L B;  3TUJ C;  1ELO A;  3IWL A;  4FYY B;  3VAL A;  4F0K A;  2R8I A;  1FNO A;  2XMW A;  4DI6 A;  1WG5 A;  3JTO A;  4FYV B;  3TZX A;  1ZS6 A;  4PWU A;  1WDT A;  2ASL A;  2RKI B;  4G1Q B;  5KFT A;  2HVH A;  4BDP A;  5E3R A;  5F8N A;  3QSI A;  3W65 A;  3GFX A;  2L3M A;  4DR3 J;  3OVB A;  1NPR A;  1CJV B;  2M5Y A;  2RKI A;  4G1Q A;  1S57 A;  2PC6 A;  1OSD A;  4U9R A;  4L72 B;  4F0M A;  3KLG B;  1JX4 A;  4CYU B;  1CJV A;  3CSK A;  4G3I A;  3IRW P;  1ZTT A;  1DQ8 A;  3KLG A;  5E41 A;  3BR8 A;  2VD3 A;  4F7V A;  3QAE A;  4RWX A;  4CYU A;  2YKM B;  2MDA A;  5DDR C;  3NGU A;  2B6A A;  4QR0 A;  4CO0 A;  2OIH A;  1F9H A;  4QR1 A;  3MM8 B;  2CZ4 A;  2YKM A;  3V81 B;  1RT1 B;  2F65 A;  2VC1 A;  2W9A A;  3MM8 A;  5IQ6 A;  3ETM A;  5KFJ A;  2MQL A;  4LF2 A;  1RT1 A;  1UWB A;  4OYA A;  3LO3 A;  4R5P A;  2DXD A;  1RAB B;  3P49 B;  2ZJR Q;  3NS7 B;  4DHV A;  3PY8 A;  2VG6 A;  5J2N B;  5JJB A;  2K3K A;  1B3T A;  5K8N A;  1GX5 A;  5CZX A;  3CDE A;  4NZ0 A;  2DXF A;  4LIW A;  3VAI A;  1RAF B;  1FFS B;  5J2N A;  1T3N A;  3AD9 C;  4XTT A;  1NB7 A;  3CNQ P;  4DL7 A;  4P2S A;  3HFK A;  4RUA A;  3RB4 A;  4MYT A;  4YY3 F;  2QZ8 A;  1FVS A;  3IO1 A;  1SB6 A;  2AKW B;  1IWG A;  2C3O A;  3LA0 A;  4ZJO A;  2EFG A;  1K0V A;  1OPZ A;  2V94 A;  4IRK A;  1NSK L;  1YJU A;  3JSR A;  4RX6 A;  3IP0 A;  3OJU A;  1EX8 A;  3W9I A;  2ZM6 J;  3EYZ A;  3V4M A;  5E2Q A;  2DO4 A;  1R8H A;  4KO0 A;  2UUB J;  2MKH A;  4DU8 A;  3FUY A;  5HLF B;  2RQ4 A;  4C3L A;  5BXI A;  2DH7 A;  2XM3 A;  2BOA A;  2ZM6 F;  5HLF A;  3CJS A;  4PXB A;  1X4C A;  1CC8 A;  4QZV B;  2UUB F;  5SZT A;  2LP4 A;  4NI2 B;  2J0S D;  1PJ7 A;  5IWA J;  1YRX A;  3CDB A;  5HMW A;  5MLC V;  4MKV A;  3BM7 A;  3R2C J;  5EUH A;  2R9L A;  4NI2 A;  1X0F A;  3PCO B;  2KFZ A;  1UPP A;  1N5T A;  3ISN D;  1VIX A;  4PPZ A;  2OPS A;  1R89 A;  5KFL A;  2HG4 A;  5IWA F;  1CG2 A;  4OYX A;  4RR5 A;  1M5H A;  2Z2L A;  3CED A;  2BVZ A;  1SL0 A;  3AB2 B;  3BYP A;  1SL1 A;  4DV0 J;  3DU5 A;  3QIP A;  1CVJ A;  4CO4 A;  1VOM A;  4ZHR B;  2UXB J;  2YX1 A;  1BQX A;  4PKD B;  4MT1 A;  4P2X A;  5A8R B;  1NHK L;  3TUP A;  3NEK A;  3FKB A;  2FJD B;  4ZHR A;  4DV0 F;  2W4D A;  4DL3 A;  5KT4 A;  2HWI A;  1WI8 A;  4OV6 A;  5A8R A;  4KY3 A;  3TO8 A;  4TQS A;  2C2O B;  2UXB F;  2HHH J;  4LRD A;  2QMW A;  2XSJ A;  1PAU B;  3CD0 A;  4DQQ A;  4I7F A;  2MKK A;  3A4T A;  2BE2 B;  4X4R A;  2DR9 A;  2VBX A;  4Q7A A;  1WWH A;  3G82 B;  4TYA A;  4M5G A;  4XDD A;  4Y0F A;  3G2X A;  3N01 A;  1G6B A;  2BE2 A;  3N6N A;  2HHH F;  3G82 A;  1RAE B;  3HFV A;  1TL7 A;  4MAK A;  4ZLP A;  1C1C B;  5D4O A;  3L9Z A;  3M8Y A;  4DG1 B;  1LW2 A;  3CJR A;  4B3T J;  3A8E A;  1C1C A;  1GTE A;  3V5R A;  2E66 A;  2W2N P;  4DG1 A;  4EU0 A;  3TP2 A;  5HO4 A;  4ERD A;  1X5S A;  2ERR A;  1H7X A;  1MRO B;  2P9G A;  3U02 A;  5KFG A;  4O3S A;  2J6U A;  3G86 A;  3FZ2 A;  1VQO S;  2BJ8 A;  3IAM 9;  5DG9 A;  3M8Q B;  2FY1 A;  2FC8 A;  1LXJ A;  1FT8 A;  2LQ5 A;  1BHN A;  4PWW A;  5DRK A;  3UCG A;  3M8Q A;  3M4X A;  3GLJ A;  3KLF B;  5D4N A;  4QIG A;  1GEH A;  5ETP A;  3M8S A;  2QG9 B;  4WJB A;  5ETM A;  4K4U A;  1FKA F;  1Q53 A;  1JQG A;  3DGP A;  3K5M A;  1TAQ A;  3DLL Q;  1WC3 A;  4IYQ A;  1RLD A;  3C2P A;  3MPW A;  2BJ3 A;  2DNR A;  4YFU A;  2XI2 A;  2RQM A;  4OHZ A;  2YQ3 A;  3O2I A;  2VA3 A;  1FRL A;  2JC1 A;  4PPD A;  4M5I A;  5J2P B;  1UWA A;  1U24 A;  2NXE A;  3BGR B;  4F50 A;  5J1E B;  2BQR A;  1NKE A;  3EWG A;  2HPU A;  2C1E B;  1CJU A;  4C7Q A;  4DPT A;  4U96 A;  2EFP A;  4QPT A;  1J2V A;  1HWL A;  2HHT A;  1ZM9 A;  2B5J A;  4UOH A;  2QIF A;  2HK3 A;  2LEC A;  4F3O A;  2QA4 S;  3FQL A;  3JB9 k;  1K1Q A;  3GCW P;  4G1P A;  3S1T A;  4KH0 B;  3R2D J;  5CXT A;  4UOC A;  1U2F A;  4RWW A;  1S7I A;  1J5O B;  1RAA B;  2WB4 A;  3PX6 A;  1HW9 A;  4QBU A;  3TJA A;  4B9V A;  5I4M A;  3W62 A;  1LFW A;  2VB6 A;  5F8M A;  3A8I A;  2ILY A;  2EKN A;  2JEI A;  3N6L A;  3MD1 A;  1AZS B;  4DV5 J;  2DNM A;  3KLE B;  2NSB A;  4OX7 A;  5CCL A;  4ILL A;  4GKJ J;  2CPH A;  1AZS A;  1WG1 A;  4DPY A;  3IS9 B;  3MEG A;  3PJ9 A;  3LPY A;  2APO A;  2CQI A;  3ZTS A;  4GKJ F;  4USJ C;  1BQN A;  3KK3 B;  3LWL A;  1H72 C;  2JHE A;  2Z30 B;  1Q81 T;  2HFZ A;  4PG4 A;  4OHX A;  2BE7 D;  2FJE B;  4DV7 J;  2DGX A;  3KK3 A;  5M2U A;  3AA9 A;  1GMU A;  1NKC A;  2E7W A;  3T3F A;  1DRZ A;  4G65 A;  1W2B R;  4DR2 J;  4DWI A;  3R7N B;  3NS5 A;  2XBP A;  4DV7 F;  3QRR A;  2WBM A;  1RHJ B;  4KFB B;  1YRT A;  2OEM A;  1UCN A;  3M6W A;  2O66 A;  5D0H A;  3KDN A;  2YNF B;  1S4F A;  4KFB A;  2AGQ A;  2IDL A;  3SCK E;  1ZZN A;  1IXK A;  2QYC A;  2QEX S;  4FF3 A;  2CDR B;  1VIO A;  5CYM B;  2OPP B;  4FYX B;  2JL9 A;  3DLG B;  2YNF A;  4HT5 A;  2Y3Y A;  1VC5 A;  4X4O A;  4USV A;  4NML A;  3UDV A;  1ZM3 A;  3KJN B;  2F63 A;  2IBO A;  5CYM A;  2OPP A;  2XNR A;  1S1X A;  3DLG A;  1NUE A;  1NM2 A;  1N88 A;  4BS2 A;  3ULH A;  3GFH A;  3NBP B;  4AXJ A;  3MFI A;  2X1B A;  6AT1 B;  2ZVS A;  4PZV A;  1SJF A;  3HVA A;  2RJZ A;  5KFY A;  4HLB A;  3KLV A;  1APS A;  3P6Y C;  4DX5 A;  4DQP A;  1TVR A;  2QV6 A;  4MKA A;  2WON B;  3EXY A;  3AFG A;  3RBZ A;  3AJD A;  1T9Y A;  4RUH A;  4IOA Q;  2N3O A;  3MM7 A;  2W2M P;  3DNC A;  3ZNJ 1;  1CUL A;  2CPD A;  2WON A;  5HAT A;  3AY0 A;  2KM8 B;  1IR1 A;  5K8M A;  3KMQ A;  4X66 J;  2CKW A;  4ECS A;  2GMJ A;  3HFZ B;  1KHW A;  2QL9 B;  3H90 A;  1QUV A;  4JBC A;  3X3U A;  2IFX A;  3DC2 A;  1EAR A;  5AE2 A;  3KDO A;  2PMZ D;  2JH3 A;  1JJH A;  1MSW D;  3P5T L;  2CPX A;  3NGD A;  1S1U B;  4MH8 A;  2AJ0 A;  1SKS A;  2AJQ A;  2BXJ A;  2F9J A;  2W2P P;  3KUE A;  5F8L A;  2ZNY A;  4Z2X A;  1OY8 A;  2N82 B;  4ECR A;  2HHP A;  3S8S A;  4DV2 J;  3UCU P;  1WTB A;  4I2Q B;  2LEP A;  5J1P A;  1S77 D;  4F3Q A;  2QE5 A;  4OZ1 A;  4CLK A;  4IRD A;  2C22 A;  1FRH A;  3BKT A;  4I2Q A;  2FC9 A;  2BJE A;  2HQ3 A;  2J9D E;  3KLI B;  5H9E J;  1H6K X;  4LJM A;  4A47 A;  2NQP A;  4HDH A;  1BLU A;  3I31 A;  3HHL C;  3KLI A;  2FD2 A;  3IRX B;  2RS8 A;  1IR0 A;  3AB4 B;  2AEF A;  3G71 S;  3TAQ A;  4OYI A;  3T5L A;  2ZKT A;  1KDN A;  3GYN A;  4DFP A;  4KHP J;  3IRX A;  3OFH A;  4MJK A;  1X4G A;  3ENV A;  3C8Y A;  4DL5 A;  4QOT A;  4RW9 B;  3I96 A;  4EBE A;  1I1G A;  3OFG A;  1JKH B;  2IPO B;  4DL0 C;  4RW9 A;  4M95 A;  2ABY A;  1NU4 A;  4JI3 F;  5IM0 B;  4U7U K;  1YTY A;  3N0V A;  4LT6 A;  2BOP A;  1UAW A;  1U47 A;  4KC5 A;  2N4D A;  4H4K A;  2HFV A;  5ITH A;  4XO0 A;  2E9Z A;  2QRR A;  2VQE J;  4I67 A;  1XR7 A;  3NLC A;  4JV1 A;  1OO0 B;  1N32 J;  3Q2T C;  1S5Z A;  4NCA A;  4G1I A;  3HJV A;  2B4O A;  3QFW A;  4EMD A;  3MCN A;  2MQN A;  1U7L A;  3CD5 A;  4GMK A;  4ETX A;  2N4C A;  3CUN A;  2IM0 A;  4LR9 A;  7AT1 B;  3F41 A;  3HVW A;  1N32 F;  1R8C A;  1D0E A;  2FHK A;  2QJ3 A;  3HZE A;  1RAO A;  3M2U B;  2H5E A;  2VFS A;  3R9L A;  4QWA A;  1KEK A;  3H2L A;  3CJK B;  4NLG A;  3MCO A;  4MK9 A;  2AJ1 A;  4NLO A;  3R7B B;  1F3V A;  5HVG A;  3M2U A;  2D69 A;  1UW9 A;  4ANE A;  2J0W A;  3ZZO A;  3P8B B;  4LSL A;  3EGV A;  3CJK A;  1EKR A;  4PWD B;  4LR8 A;  1RWM B;  1SXL A;  2OML A;  1LKZ A;  2HQG A;  4O4G B;  4MFB A;  3LAK A;  2CQ0 A;  4B3O B;  2L9D A;  1RWP B;  4DDF A;  5I3Q A;  2VPY B;  2DVI A;  1O51 A;  3GFZ A;  4B3O A;  5JUM A;  2M3D A;  5CH7 B;  3FSI A;  1NXI A;  1VHF A;  3E3X A;  4GC7 A;  3UR3 C;  1SH0 A;  2H4W B;  4OI3 A;  3H2V E;  2BJ1 A;  2ZD1 B;  4J9K A;  4LF9 J;  5D8H B;  2YNH A;  1CQN A;  1WF0 A;  3T1A A;  3M05 A;  4DN0 A;  5J2Q B;  3OR2 B;  2CWK A;  3EJM A;  3UW1 A;  4IUF A;  1C0T B;  1W7W A;  1RUS A;  4HI1 A;  5B09 A;  1V3R A;  5E3A A;  5E7O B;  3HHL D;  5HMX A;  5J2Q A;  1RCO B;  3HKW A;  3CMA S;  1SJ1 A;  4IDK A;  1HLW A;  4LF9 F;  3K8W A;  5F9N A;  3HI9 A;  4FBU A;  2MQ8 A;  1H2V Z;  5B0C A;  2KHC A;  2XZT B;  5IQQ A;  4X4V A;  4ZVH A;  3G96 A;  5L1K A;  5LT5 A;  1B0P A;  4C6A A;  2ZOF A;  3QJP A;  2GV1 A;  1AFI A;  3FRY A;  2DR6 A;  2R3V A;  2HIQ A;  2CQC A;  4TLQ A;  3AJ2 A;  3GZ7 A;  2GFF A;  5KFZ A;  3ZZT A;  1X5P A;  1UEK A;  4N7T A;  3DHX A;  4JI4 J;  5G0R A;  1FEE A;  4LF4 J;  3TJ9 A;  3H5Y A;  3MM6 A;  2G0C A;  4OI0 A;  2P8I A;  3TZW A;  3G9C A;  4IH7 A;  3QJL A;  1U1O A;  2L9N A;  1TUV A;  3MED B;  4EI2 A;  2B8P A;  4W4M A;  3GFY A;  4PUO A;  1VLY A;  1VQS A;  2K1R A;  4JI4 F;  5HMZ A;  9RUB A;  4GO5 X;  2ZH7 A;  1PC5 A;  3EDQ B;  3OUY B;  1DTT A;  4NEZ A;  1QAJ A;  2YKQ A;  2VU5 A;  1E6V B;  3CPW R;  4JV0 A;  1YKW A;  4LF8 J;  4FXW A;  4C8Z A;  2Q6C A;  2OD4 A;  1SH2 A;  3BDE A;  3DOM B;  2V5H G;  3IM8 A;  3SYZ A;  3ENQ A;  1SL2 A;  4ZVQ B;  4MYU A;  2RML A;  3DOM A;  2EFO A;  5T41 A;  2OSQ A;  1MU2 B;  1U02 A;  4LF8 F;  4PG6 A;  2EG2 A;  3KLH B;  2I9S A;  1YQH A;  3Q8R B;  2MQO A;  2DY1 A;  2NYI A;  1MU2 A;  4Z37 A;  2FDN A;  4USW A;  3KLH A;  4C48 A;  2OSR A;  1TKZ B;  3JAM U;  4DV3 J;  1TUG B;  1RBL A;  3E51 A;  3NAI A;  3R5B A;  4NLW A;  1MW7 A;  2FLN A;  5KFH A;  2BJD A;  1FHT A;  2AD9 A;  1WG4 A;  2GMH A;  2CQP A;  1JLC B;  4UW2 A;  3M30 B;  3J81 U;  1LNQ A;  1TU0 B;  2RHS B;  1X4A A;  3NKY A;  4DV3 F;  2BV3 A;  1JLC A;  2CNL B;  2NPF A;  1FX4 A;  1N48 A;  4HH0 A;  5GME A;  2HWH A;  2YWH A;  2CPF A;  4UUX A;  4PYA A;  1G1X A;  3HSG A;  1HNX J;  3RU0 A;  4ZVE A;  3ZTO A;  3LP0 A;  4DS5 A;  1MWQ A;  4YS2 A;  2WK4 A;  2XMJ A;  5LOQ A;  1HNX F;  1Y10 A;  4IOB A;  3RJM B;  3THT A;  2DBB A;  2MZ1 A;  1KVI A;  3R97 A;  3KG0 A;  3FBE A;  2PE8 A;  3A3O B;  2ZOM A;  3C46 A;  5KFF A;  1MN9 A;  4QJV A;  5CA5 A;  3CC7 S;  3DLK A;  3CE8 A;  3M2V A;  4FF2 A;  1QY7 A;  4UOG A;  1S97 A;  1C0U B;  3NGS A;  5HK4 A;  2OTL S;  3D6H B;  2HBZ B;  4CLP A;  4BCA A;  2AYB A;  2M88 A;  3JXO A;  4TXS A;  1X60 A;  1C0U A;  5C24 A;  4I1T A;  2XYP B;  4GKK J;  4USM A;  2C3P A;  1JWW A;  3VZI A;  2F3J A;  2L41 A;  1SKW A;  2UUT A;  1VR6 A;  5AXK A;  1RJJ A;  2WOM A;  4ZJQ A;  2DD8 S;  2YBV A;  4AL5 A;  2IBK A;  2O01 C;  4LFB J;  3R7S B;  4CLU A;  1C1B B;  1X4H A;  2M9K A;  4NYZ A;  5A8K B;  2HBY B;  4GKK F;  2IM3 A;  4DCP B;  2R7T A;  3JAM Y;  1X8D A;  3J80 U;  2J7U A;  3MD3 A;  5F8H A;  3LPE A;  4CT9 A;  1C1B A;  2XCA A;  4NE9 C;  4ED3 A;  1R0C B;  5A8K A;  1PCA A;  1JLE A;  2E5L J;  3FSX A;  3IFE A;  2FLO A;  4N56 A;  3MXH P;  4RW8 B;  5HQL A;  2IMW P;  4UY8 5;  2ZH4 A;  3TX8 A;  1ZA2 B;  3T19 A;  3D1H A;  3D2W A;  3MPD A;  1AFJ A;  5ETR A;  4DPX A;  3H5U A;  5KFK A;  2ZC3 A;  3V2U C;  3T6J A;  5DM7 Q;  2R7R A;  2UVR A;  4H4O B;  1HBO A;  1FO1 A;  2ZWP A;  4WXO A;  4PXC A;  4X64 J;  4OX6 A;  2YKA A;  4CH1 A;  4H4O A;  5IS2 A;  2G2Z A;  4ZVU B;  2CJ9 A;  1U2C A;  2NLW A;  4FPR A;  5KFW A;  2ACM A;  1CJK B;  2FPH X;  3D1O A;  4ANC A;  3UVJ B;  3TZZ A;  1S0O A;  1HA1 A;  3MAH A;  5HAO A;  2ILZ A;  1FXD A;  2LA6 A;  1HL6 A;  5EWF A;  1XMQ J;  2ZH3 A;  2BMB A;  1Y5I B;  4RZR A;  2HVI A;  1CJK A;  3FNN A;  3RB0 A;  3UVJ A;  3C16 B;  1EQM A;  3OTO F;  1BXN A;  1RAC B;  2ZDO A;  4L76 A;  4BWJ A;  3EVO A;  4N76 A;  2DR8 A;  3BKF A;  3WC0 A;  1S9G B;  3C16 A;  2AGO A;  4RW7 B;  1AYE A;  3DU6 A;  3M7V A;  1XMQ F;  1WD6 A;  4CLS A;  2G2O A;  3OTC A;  2I1R A;  2AF6 A;  3VHQ A;  3PW0 A;  4CO5 A;  1SIW B;  3HHE A;  4JI6 J;  1Q7Y T;  5ETN A;  5CD4 H;  3DMJ B;  2JDJ A;  2KHD A;  1S72 S;  2LLZ A;  3BV8 A;  5J2M A;  2VPX B;  2NUU G;  1XMO J;  2VKZ G;  2V0N A;  2VC0 A;  2FY8 A;  3HHN B;  3K5O A;  1D8Z A;  4JI6 F;  1FKP A;  4ZA1 A;  2EC2 A;  3VCD A;  4O3Q A;  2V2Q A;  4I69 A;  3MPV A;  3ILJ A;  3EGW B;  3MGJ A;  1QSL A;  4F8R A;  4NLV A;  3ISZ A;  1XMO F;  3BH6 B;  1ZAX A;  4TU7 A;  3PVX A;  3UNY A;  2OEL A;  4B9M A;  1X4E A;  5EX3 A;  1HQE B;  1R0B G;  1NDL A;  2CG8 A;  5KFV A;  3VWS A;  3VZH A;  3LTO A;  5KG7 A;  2ZH8 A;  4IR9 A;  1HQE A;  2MB0 B;  2IYG A;  2HQD A;  4W98 A;  3UCZ P;  1RAI B;  4HHH A;  1DTQ B;  1TFY A;  4I0W A;  3RBE A;  3QGH A;  1DTQ A;  3ZTQ A;  1FKO B;  3GON A;  1U45 A;  4ED1 A;  1NJY A;  2AZ1 A;  4LBP A;  4M1K A;  3A3P B;  2KRB A;  1RTJ A;  1MN7 A;  3MMB B;  5KTQ A;  1IQZ A;  1X9S A;  5EX0 A;  5L46 A;  4QIV A;  2HQI A;  1LWC B;  1HAR A;  2OEK A;  2GO8 A;  4GRS A;  4X2B A;  2PEB A;  3CJ0 A;  1YVF A;  2HNZ B;  3WC2 A;  1WHW A;  3MFH A;  1JLQ B;  4J37 A;  1U6B A;  2FZK B;  2PSZ A;  2VPW B;  4UOF A;  1B0V A;  4FXD A;  1T9V A;  3FC9 A;  3QAT A;  1XC9 A;  1JLQ A;  1K9M T;  3LAM A;  4CZC A;  2ADB A;  3TA2 A;  4KBI A;  1OMS A;  3ZZY A;  2XHC A;  3HJF A;  3ILO A;  2XMT A;  2I5J A;  2XZD B;  4CT8 A;  4J9S A;  2ZZT A;  2B3T B;  5HVF A;  1MNE A;  2B4V A;  4WYL A;  3D1Q A;  2QA2 A;  2ZDP A;  5CD4 A;  2WHO A;  1TP7 A;  3VQS A;  2C28 A;  2F9D A;  4TY9 A;  1F60 B;  3P45 B;  3WZ0 A;  3D4J A;  2UUC J;  3DLE B;  4KB7 A;  1Z2L A;  1N4L A;  3CUL A;  2B8Q A;  2AIR B;  5FJ4 A;  2VIH A;  2MEW A;  2E1C A;  3LGH A;  4DUY F;  3DLE A;  1L3V A;  2Y0S D;  2DNP A;  2EFN A;  5D0R A;  5KFC A;  3Q23 A;  2UUC F;  3ITH A;  4GVB B;  3RAQ A;  4NLY A;  1NSQ A;  4O3R A;  3D5M A;  2GHP A;  1NJZ A;  1YZ6 A;  3V4I B;  2AP6 A;  3OR1 A;  1P8G A;  2PFF B;  4X4P A;  3GU0 A;  1RU2 A;  1YX2 A;  2GX8 A;  3GJQ B;  2WSF C;  2A18 A;  2BBE A;  3CCR S;  3V4I A;  3MM5 B;  1HWJ A;  2J9C A;  3KJQ B;  1FCA A;  5HAN A;  3UDC A;  3GJT B;  4J9O A;  3KUH A;  4F4Y A;  2PA3 A;  1YZ7 A;  4NAS A;  2BZ2 A;  4EYH B;  3CCU S;  3AJ1 A;  2HS0 A;  2CQ3 A;  5D6G A;  2I8E A;  1WUU A;  4DF4 A;  1CC7 A;  2OAU A;  2M2B A;  2MKI A;  2O5D A;  4LSN A;  4A8Y A;  1UEV A;  4O3O A;  2IC3 B;  2HHQ A;  1DZ5 A;  5DQG A;  2O3D A;  2RB7 A;  1VBY A;  1UJ4 A;  3W63 A;  2NPI A;  3NAH A;  2DNH A;  1HNW J;  1VC0 A;  2IC3 A;  4ICL B;  1LOU A;  2QL7 B;  2CQH A;  3JYT A;  2N3L A;  4ED2 A;  4ZPD A;  3FZB A;  3VVT A;  4ICL A;  1UA0 A;  2KFY A;  4LFC J;  1HNW F;  1SUQ B;  2C2D A;  4YDX A;  5H9F J;  1ZM4 A;  5FDL B;  5KG2 A;  2AJ2 A;  1T9U A;  1SUQ A;  4EZ6 A;  1H2T Z;  5KFE A;  3VGT A;  5FDL A;  3ILL A;  1YSJ A;  4AT1 B;  4LFC F;  3CJQ A;  4FXV A;  3H20 A;  4KHR A;  4ES1 A;  1U49 A;  1HW8 A;  3I0S B;  4RKU C;  3MUM P;  4XPE A;  2GQQ A;  5GMK a;  4O44 B;  2JLG A;  1UVJ A;  3TWZ A;  3I0S A;  2HGL A;  2YPY A;  4ZKA A;  3TEH B;  1K1S A;  4K4Y A;  4O44 A;  1UP1 A;  1FRJ A;  1T9W A;  4PR6 A;  4DS4 A;  2BAC A;  4N8O A;  4ZP7 A;  1NK6 A;  4WFZ A;  2XLI A;  1XTZ A;  1PKU A;  2V6A A;  1IN0 A;  3KJF B;  1I94 J;  3KNG A;  4R0J A;  1AT1 B;  4C0B A;  2MYF A;  2W1B A;  1JLF A;  1LK7 A;  2KYX A;  5ETQ A;  4GO7 X;  2O67 A;  3R5G A;  5HVH A;  1RAD B;  3QGI A;  5E3C A;  8ATC B;  1K47 A;  5IZH A;  4MIB A;  1N54 B;  1KOH A;  1I94 F;  4RU2 A;  1M1G A;  2JNJ A;  4DR1 J;  1HWU A;  4OMF G;  4G6V B;  1SCJ B;  2KJW A;  2E5H A;  3MAA B;  1OSC A;  1I3O B;  1HNZ J;  4NRT A;  2MZS A;  3OL9 A;  5GAD I;  2HFN A;  1WI6 A;  1T3O A;  1QE1 A;  2RD5 C;  3VTI A;  1R6V A;  1XNQ J;  3MM9 A;  1HWK A;  3LGM A;  3IGV A;  4DQR A;  3CC2 S;  4B9L A;  3PTW A;  2XS5 A;  4JYA J;  4ZN1 A;  3AXM A;  4JI5 J;  1KQK A;  2ZUA A;  2HZA A;  1DLO B;  4QWC A;  1OQ3 A;  2AJ4 A;  2R7W A;  5GVQ A;  5ETO A;  2YNI B;  4RJV A;  3MDF A;  1RP5 A;  2V2Z A;  3AH6 A;  3HVT A;  1DLO A;  1BWV A;  2YNI A;  1WF1 A;  1A0O B;  3DLJ A;  2VOP A;  5HRO B;  1Y9O A;  3IBF B;  5HJX A;  3K2Y A;  1JIH A;  2KM8 C;  4Y28 C;  2G2Y A;  3HPO A;  1D1U A;  3MR2 A;  3X1L B;  2FVP A;  3R5C A;  4P7T A;  3IA0 A;  3NGT A;  1U26 A;  4DSL A;  1N5Y B;  2UUW A;  4MMO A;  5KG5 A;  1ZM2 A;  3B6B A;  3DOK B;  3J7A 1;  2VZ9 A;  4P52 A;  3JTN A;  4EBD A;  4MK7 A;  2CG4 A;  2G1D A;  2YQ0 A;  3HHL B;  3V6J A;  1N5Y A;  4RNN A;  2BKO A;  5HMY A;  3DOK A;  1KS2 A;  1VJQ A;  1ZBT A;  3T1Y J;  2DB1 A;  5IT9 Y;  1RAH B;  1TKT B;  4J9L A;  3HCX A;  3CCT A;  1HI8 A;  3H4D A;  4M5N A;  2QA4 G;  2DT9 A;  3LP2 A;  3SI8 A;  1TKT A;  5I3P A;  1OYD A;  1VBK A;  3T1Y F;  3N5F A;  3G6Y A;  3GQC A;  5D4P A;  2DHA A;  3LOU A;  2OPQ B;  5I3U A;  1NPK A;  3DKD A;  5HJY A;  3UO0 A;  1VQL S;  1RLC L;  2HZC A;  1OQ6 A;  4C8K A;  2XSF A;  3M8P B;  3BGF A;  3PJW A;  3FFI B;  5A2Q Y;  3HMJ G;  3RTV A;  2DIV A;  2NYH A;  3RGI A;  3B8H A;  2MXY A;  4ZLJ A;  3HK2 A;  2QA1 A;  3OSN A;  2CZV C;  2XMA A;  1TV6 B;  2CJK A;  1M1H A;  1TV6 A;  4H4K C;  3TI0 A;  2XNQ A;  4I6W A;  4K4X A;  3PW5 A;  1FVQ A;  3AD7 C;  2KJV A;  2AMC B;  2W9C B;  3GMG A;  4B02 A;  3W1Y C;  3MOZ A;  4IH6 A;  2W8L A;  2GAH C;  4QU7 A;  3C6U B;  3GJR B;  3H5X A;  2E5G A;  1HBU A;  2GGP B;  2OO4 A;  5C2G A;  1EHW A;  3EIC A;  3BGO P;  4CLZ A;  2XWY A;  3C6U A;  3MUV P;  3CB4 A;  5GAG I;  3PZP A;  2GGP A;  4ZVS B;  4X84 A;  1EQ0 A;  2DCU B;  4CI0 B;  4E2F B;  1WKK A;  3CGI A;  2XGQ A;  3CIM A;  5L1I A;  1XNR J;  5KFA A;  3P96 A;  2MHN A;  3Q89 A;  2JEJ A;  5KG0 A;  1VQN S;  3MOJ B;  5HQM A;  4CH7 A;  4TU9 A;  4P74 A;  3FDS A;  3N5B A;  5DLG A;  2RU9 A;  2R7S A;  2GJ2 A;  4PRF A;  3W2V B;  3LUY A;  2YY3 A;  1XWL A;  2LMI A;  1SH3 A;  3AOA A;  4NCB A;  4P6Q A;  4DR7 F;  2QFI A;  3W2V A;  5GAD U;  2AX1 A;  2Z0G A;  1K8A T;  3DRP B;  1U25 A;  1TK8 A;  2EI5 A;  5JVH Q;  4P9S A;  3MMC A;  4P72 A;  4HEA 9;  2UUA F;  3G6X A;  4AQY J;  3CCW A;  3HX9 A;  4IO9 Q;  4ER8 A;  1RQ0 A;  3NCP A;  4DBQ A;  3NMR A;  3DRP A;  2X3D A;  1F9F A;  4JI7 J;  2VJU A;  2FLP A;  2GZO A;  3UWT A;  4J9U E;  3QMQ A;  1CS4 B;  1X5O A;  4A8W A;  1SC6 A;  1C2P A;  1CS4 A;  3R5D A;  4NXM J;  2BM1 A;  2VG7 B;  2NR0 A;  3QT6 A;  2F8E X;  4JI7 F;  2QYG A;  2D9P A;  4JI8 J;  1WHY A;  3NS6 A;  2KYZ A;  3MEK A;  1TL3 B;  3NOC A;  2VG7 A;  3SIP B;  4ZVO B;  1VBX A;  4NXM F;  2AQ4 A;  1NAQ A;  1TL3 A;  3Q8S B;  1R43 A;  5F8G A;  1N33 J;  1PIE A;  4JI8 F;  4KTQ A;  4LQ3 A;  2IRU A;  2DY9 A;  2XY6 A;  1A9N B;  3GYG A;  4NCG B;  4DR4 J;  4USU A;  3NCQ A;  2HW3 A;  1Q0N A;  1JXE A;  1S49 A;  4DSI A;  1N33 F;  2M70 A;  2HNY A;  3OLB A;  3DDK A;  3BJY A;  4NCG A;  5AXM A;  3RB3 A;  4C8Y A;  1KLM A;  4KRW A;  1WC5 A;  4IO1 A;  1U1M A;  2CPJ A;  4DR4 F;  2VOO A;  2D3O R;  2BM0 A;  1YRU A;  2E9R X;  3CCV S;  4NLQ A;  2NXN A;  5CYQ A;  5IFM A;  2ZHA A;  4HT7 A;  3JSB A;  2HFS A;  3C6T B;  3H7H B;  1RT4 B;  3M6V A;  2MKC A;  2W2Q P;  4DV1 F;  2X3G A;  4J91 A;  4A4J A;  4KH1 B;  5H9F K;  2VG5 B;  2RRA A;  3PRD A;  1QAI A;  3D68 A;  4QWE A;  2OLW A;  3QT5 A;  1RT4 A;  3TAR A;  3OT9 A;  4JI0 J;  2CQ4 A;  2BW7 A;  2H3E B;  3Q22 A;  4OZ3 A;  3EVW A;  1RTI B;  3PV8 A;  1JLG A;  3HD1 A;  4B9N A;  1LWF B;  3GSI A;  3CCE S;  1S6Q A;  4I4B A;  4DSE A;  5E0O A;  4FYD A;  4DV6 J;  3LQV A;  5ETK A;  1S6O A;  3ZZU A;  3M8W A;  5U47 A;  2DHX A;  3VGS A;  2GW8 A;  2WCX A;  2MY8 A;  1LWF A;  1N6Q B;  1TUW A;  3EPG A;  2VFU A;  2OMO A;  4X4T A;  3HF5 A;  4N5S A;  2Q43 A;  4RBV A;  4NLT A;  2EWH A;  3BYR A;  3KK1 B;  4DV6 F;  2JEF A;  2ASY A;  3PEH A;  2Y9H A;  2HVZ A;  4CP5 A;  4ZVG A;  3TRG A;  1KOO A;  1HBM B;  2JLF A;  1S0M A;  3B4M A;  2V4J B;  4FBT A;  1B0T A;  4OZL A;  2GVZ A;  5GAG U;  4NA1 A;  1WJ9 A;  4FS1 A;  4ZCL A;  4V19 J;  1HBM A;  3EM1 A;  2Q1L A;  8AT1 B;  4C3K A;  4DZD A;  4A8M P;  4LVN P;  1TFW A;  2E9T A;  3ENW A;  3KMS A;  4CNY A;  3AA8 A;  1PO6 A;  1IJF B;  2F8H A;  3H0P A;  2WVB A;  1D8Y A;  2GNK A;  4WFA Q;  4ZJL A;  3AOC A;  4WKR A;  3C15 B;  1L3T A;  3PDN A;  3GR1 A;  4F4W A;  3BO4 A;  5HBM B;  1JJ2 R;  1VGY A;  2W7O A;  3L4B C;  1U1N A;  5K14 B;  3J81 j;  3TR5 A;  3M8Z A;  1IKX A;  2KT5 A;  5HBM A;  2K3I A;  1X5T A;  1VQ6 S;  3UNG C;  5HL7 Q;  3Q8Q B;  3PX4 A;  2CNN B;  3UD3 P;  1OJ4 A;  4QIE A;  3TUZ C;  5K14 A;  5KOX A;  2OH2 A;  2NUH A;  3O6Q A;  2KB2 A;  3T1H J;  1DY3 A;  9ATC B;  1R3N A;  4WK3 A;  3NMA A;  1AB8 A;  2W24 A;  3O44 A;  4H54 A;  3P4U B;  4PXD A;  3RRH A;  1R8A A;  2KN4 A;  2JEG A;  4U6P A;  4CO1 A;  2H51 B;  3M32 B;  5HSP A;  2VBZ A;  4BWM A;  1YIJ S;  2P9C A;  3T1H F;  3HM9 A;  5DQI A;  4WE1 B;  3GIR A;  3EX7 B;  3M32 A;  4FS2 A;  2EEY A;  2HBQ B;  5D15 A;  1GK8 A;  1TL5 A;  4WE1 A;  2ZUG A;  1WNE A;  5FLX U;  3ISN C;  1LW0 B;  3DHW C;  3QSY B;  5KOW A;  1RKJ A;  3ET6 A;  3CWJ A;  4KYZ A;  2B6A B;  1KBR A;  4YB5 A;  1LW0 A;  4XDC A;  3MPY A;  4DR3 F;  1H73 A;  2XO7 A;  3HO1 A;  1A7G E;  2A2D A;  3OW2 R;  4ECX A;  4Y2A A;  1U48 A;  2NSC A;  4ZK7 M;  4FNH A;  2DGT A;  4DX8 H;  1LXN A;  2E1R A;  1UWB B;  3FGV A;  2HVD A;  3SXL A;  3PXG a;  3H59 A;  2OFG X;  2ZH2 A;  2IYI A;  2CRL A;  4R5P B;  3T5K A;  1R27 B;  3THP A;  2VG6 B;  4ZVF A;  3W2W B;  1N34 J;  2DIU A;  1SQE A;  4K4Z A;  3K58 A;  4K4S A;  3W2W A;  3MWB A;  1NDC A;  1RHM B;  3I5C A;  3D0G E;  3K7R A;  3BRE A;  3HT3 A;  2IVF B;  2DNY A;  2YWW A;  2FGO A;  2UZA A;  3QWP A;  1C4A A;  4ZLL A;  1H98 A;  3HVR A;  2GIQ A;  3GIK A;  4FDF A;  3RAM A;  5KT5 A;  2WBR A;  3OVA A;  2MGZ A;  1KON A;  5KG3 A;  1GFW B;  2R8K A;  1T95 A;  2XWX A;  2DNZ A;  4B9S A;  3FSY A;  4FVC A;  4C0O C;  1FE4 A;  3RB6 A;  4UY8 T;  2YH0 A;  2RU3 A;  4KO0 B;  1VDH A;  1RA6 A;  3WDO A;  4RNH A;  1ZOT A;  4MK8 A;  1QTN B;  2IY5 B;  2M8D B;  2G0I A;  2UP1 A;  2ZIT A;  4WCE Q;  1UFW A;  2R8H A;  1KNZ A;  4DFK A;  4WU3 A;  1P6T A;  1NK7 A;  2MKJ A;  3O8W A;  2A6O A;  3SQO P;  2IVY A;  4TU8 A;  2HS4 A;  1FRX A;  2HLU A;  3SDE A;  2K7J A;  2HQF A;  2PN6 A;  4ECQ A;  2V8H A;  2OPS B;  2KG0 A;  2PA8 D;  1TQL A;  1O0P A;  4GVL A;  2HUR A;  2VIC A;  3VGV A;  1NK0 A;  3ZTP A;  2FLL A;  3PW2 A;  4JOU A;  5B0B A;  3K8V A;  2D1C A;  3BKU A;  2MTL A;  5C42 B;  5F3T A;  3QIP B;  2B4P A;  3I4P A;  3K5P A;  5C42 A;  4YDD B;  2CYY A;  3MHY A;  2E5J A;  1FFG B;  2GC8 A;  5DS7 A;  3M6U A;  2JJ4 D;  5KFD A;  1GXU A;  2HBR B;  3GWC A;  2FVR A;  3E01 B;  2Y1R I;  3BO2 A;  2HKE A;  4M63 A;  5KFN A;  2XSJ B;  2BYC A;  1NDK A;  2MZJ A;  4I7F B;  1YK9 A;  2KXN B;  4OZ0 A;  1RWV B;  2R8J A;  3E01 A;  5AXL A;  3ILI A;  3BEG B;  3W5Y A;  4QWB A;  3PHE A;  1S7H A;  5EWE A;  3DLB A;  1KFD A;  1N8R T;  2OGU A;  2P2C B;  2D3O 1;  3DDI A;  4P10 A;  1TL7 B;  3K89 A;  1IR2 A;  2VV5 A;  1BWE A;  4NA3 A;  4K0K J;  2VAS A;  3FRZ A;  4WF9 Q;  4WII A;  3T5H A;  2HRY A;  1BUX A;  1LW2 B;  2V50 A;  2G1H A;  2MLY A;  3Q86 A;  1I5O B;  1HHT P;  4PYD A;  4K0K F;  3CVK A;  3G4S S;  3R6L B;  4HYK A;  1IM4 A;  2CJQ A;  1RT5 B;  4KIA A;  2FGC A;  4DCO B;  2ZBI A;  2YPZ A;  3UD4 P;  4WP8 A;  1IVZ A;  2NRE A;  5K8P A;  1MG7 A;  4N47 A;  2X1F A;  2DNO A;  2Z57 B;  5LMN J;  1RZM A;  3PG9 A;  2WVF A;  1RT5 A;  1Q79 A;  3HD2 A;  1KTQ A;  1TMM A;  1FK9 B;  2J8A A;  4F25 A;  1F6T A;  1E6Y A;  4B3T F;  1S1V B;  3IC1 A;  1T05 A;  4CQ1 A;  2LFV A;  4PG8 A;  1FK9 A;  1W25 A;  4CCH A;  3TW0 A;  1S1V A;  3CIZ A;  5CAB A;  2BA9 A;  3TVY A;  1HNV B;  1YDL A;  4QYR A;  5KT3 A;  4B17 A;  4WTO B;  1HFE L;  5HI7 A;  1UZD A;  2ZHO A;  1FDA A;  1HNV A;  4DPU A;  2IVM A;  5KAK A;  3GPA A;  2QMX A;  2LCW A;  3DGP B;  3BO3 A;  2DNQ A;  1H0H B;  2YVS A;  1SJ4 P;  3BR9 A;  2WSE C;  1S0V A;  3MCS A;  3GII A;  4DX6 A;  2QT7 A;  3QGG A;  4WP3 A;  5DDQ C;  4FF1 A;  3CC4 S;  3MR7 A;  3EUN A;  1RYS A;  4LRA A;  3ETO A;  4ZDN A;  1QAX A;  4WBF A;  1CJU B;  2GQC A;  4UT4 A;  1IQT A;  1EKS A;  3HP6 A;  1H3D A;  1O6X A;  2R7O A;  3TQ1 A;  4UZB A;  3CCL S;  2OFH X;  1WKL A;  4RNM A;  2IA0 A;  2EVZ A;  4C97 A;  1O5J A;  3C14 A;  2B5J B;  2V9K A;  1FJ7 A;  3PR5 B;  4B9T A;  2J6S A;  1X9W A;  3PNI A;  1R7I A;  2ZH9 A;  2BR0 A;  2JSX A;  4YN3 B;  4CTA B;  3S7R A;  3QJJ A;  1NK4 A;  1RGV A;  3SQG B;  1TZ0 A;  3TVZ A;  4IH5 A;  1FJG J;  2U1A A;  5KT2 A;  2DHG A;  2E1A A;  1VS3 A;  4CTA A;  3H4B A;  5KFX A;  4HAC B;  3SQG A;  2HWT A;  2ZJQ Q;  2BEF A;  5HN0 A;  3M1V A;  5KT6 A;  3MEG B;  4HAC A;  4OYM A;  1V9O A;  3DXB A;  5KFB A;  1FJG F;  3LP1 B;  3FJ2 A;  5HP1 A;  5RUB A;  2EC0 A;  1U1L A;  2ZE2 B;  4JV2 A;  4EZ9 A;  4FYW B;  1S6U A;  1UVK A;  3GIM A;  4YP3 A;  5H1S V;  1BQN B;  1PYO B;  2ZH5 A;  4ID5 B;  1KRP A;  4DSJ A;  1YJ7 A;  3LP1 A;  4DV5 F;  4DL2 A;  1HI0 P;  1KD1 T;  2AZ3 A;  2ZE2 A;  2CPZ A;  2B9W A;  1JMT A;  1N5Q A;  1VQ4 S;  4K7Q A;  4ID5 A;  4IG3 A;  2CQ2 A;  2UVW A;  4L74 A;  1RHK B;  1IKY B;  1F0X A;  5KFQ A;  1UA1 A;  2HEK A;  2QL5 B;  1U1P A;  1QJH A;  4OJ1 A;  2CQD A;  1IKY A;  2W9B B;  2CQ1 A;  3U1L A;  3I4H X;  1XEZ A;  4I6Y A;  3HDS A;  3VAG A;  4LVO P;  3DOL A;  3PRV A;  2Y1L B;  2ZBR A;  2W9B A;  3AT1 B;  5K20 B;  1CEZ A;  4OQJ A;  2DK2 A;  4OI6 A;  2CJB A;  3Q2S C;  4KE5 A;  3I32 A;  1Q5V A;  3PIP Q;  3ZO7 A;  3TNV A;  3I82 A;  1TMJ A;  1UVI A;  4N77 A;  4CH0 S;  5DGB A;  4Z7C A;  3RYL A;  2VUG A;  1BQM B;  1W26 A;  1NZA A;  1M5K C;  4DR2 F;  1SC1 B;  1S1X B;  3DYA A;  3FK4 A;  2NXU A;  4HTI A;  3FBB A;  2XG8 A;  1BQM A;  3Q8U A;  5DG8 A;  1FWK A;  4OYZ A;  5DGA A;  1F5B A;  2HK2 A;  1WEY A;  4PCQ A;  2XLJ A;  2R2T A;  3AQO A;  3NOG A;  1FD2 A;  4M5M A;  3OTD A;  5DDP C;  3OSP A;  4YQW A;  5GAE U;  1CQM A;  3L95 X;  1TVR B;  1U1Q A;  4RUC A;  2BAN A;  5FD1 A;  4B9U A;  2J9D A;  4TKT A;  4K5S A;  3MM7 B;  1CUL B;  3GE9 A;  1XMB A;  4IG0 B;  3MPU B;  1Y7P A;  2B9X A;  2MJU A;  4IG0 A;  2C3Y A;  1ZZF A;  2IA6 A;  2YWF A;  1VQ9 S;  3LAL A;  4DN9 A;  2WTF A;  5F0U A;  4ZMM A;  2RH3 A;  4R8U A;  4URG A;  3ZZ0 A;  4P7V A;  2FVQ A;  3OD2 A;  4J9P A;  2R7U A;  4HH1 A;  1KTV A;  4X4Q A;  3VAF A;  4PG5 A;  2OD6 A;  4X66 F;  3PYD A;  2J0Q D;  2BUN A;  2F40 A;  3FBC A;  1HR0 J;  5DG7 A;  2BAB A;  4AL6 A;  4ED6 A;  3OQ2 A;  3SSS A;  1XBW A;  4WPA A;  4F4A A;  5DZ6 A;  3L7U A;  2W4C A;  1SQF A;  1T7P A;  1Q8L A;  3I56 S;  1JLA B;  1HR0 F;  1UMJ A;  3SBM A;  4F02 A;  5AE3 A;  3R1L A;  3QQC D;  2AYG A;  4LBI A;  5CAA A;  4DV2 F;  4W90 B;  2AV5 A;  3CJ2 A;  1JLA A;  2SXL A;  3QBC A;  2DH9 A;  2DGU A;  4Q5V A;  3O5T B;  1NPP A;  2YWK A;  4RU9 A;  1RXO B;  1NCL A;  2CVI A;  4KGK A;  2CA9 A;  2PMW A;  3H25 A;  4LMZ A;  2B7B B;  1D9F A;  4Q2M A;  4V1A k;  1Y4Z B;  2HLT A;  1B99 A;  3D28 A;  1X0P A;  2OKQ A;  2RIL A;  2Z2Z A;  2OI2 A;  1BY9 A;  2EK1 A;  4KHP F;  3A8J A;  1REG X;  3W7B A;  4FPI A;  2VL1 A;  1P27 B;  5F3Z A;  3K5N A;  4CM0 A;  1WKJ A;  2FIU A;  2BQU A;  1P1T A;  2RDD A;  3GG1 A;  2LQ8 A;  2V34 A;  2MLZ A;  3DDN A;  3IM9 A;  3TJ8 A;  4CO2 A;  3F0N A;  4Y2C A;  3PKM A;  1CSJ A;  5EHH A;  2F7V A;  1R8B A;  3DM2 B;  5DZ7 A;  1IM6 A;  4USI A;  2MHE A;  1GAO A;  2FHM A;  2COL A;  1UFK A;  2LYV A;  2DIS A;  4CLL A;  4RO0 A;  3W60 A;  3DM2 A;  3EZ5 A;  2VQE F;  4X4N A;  4C11 A;  4C2M A;  3RG6 A;  1KN6 A;  2MQM A;  4ZVR B;  2FJA B;  3QFH A;  5E5N A;  4TLR A;  3QPI A;  4ZS6 A;  4LSL B;  1IBL J;  4XAK A;  4OHW A;  4WKY A;  4F26 A;  1NK8 A;  1U09 A;  4ECV A;  5C5J A;  1U8S A;  4OLO A;  3KG4 A;  1VRQ C;  5LMU J;  4MFB B;  3DN9 A;  2LXU A;  1Z1Z A;  2QN6 B;  1EET A;  3LGN A;  4ZIW A;  4YME A;  1IBL F;  4DSK A;  3MUR P;  3U1M A;  1S1T B;  4YEA A;  4EGL A;  2HGM A;  2NS1 B;  4OYP A;  2FYX A;  1HBN A;  4A48 A;  5K8O A;  4JB8 B;  2J0X A;  1DBD A;  1S1T A;  1PAE X;  2YNH B;  2I38 A;  2CWX A;  2W8K A;  2E44 A;  3CCM S;  3GR0 A;  2UVV A;  4A46 A;  2KI2 A;  1CLF A;  3TZY A;  2XGP A;  1XIQ A;  2LKZ A;  1SPB P;  2PI5 A;  4IDK B;  2B7C B;  1RWO B;  1M5P C;  5DDO C;  1JLB B;  1RU1 A;  3H5S A;  4NRU A;  5ETT A;  2RIJ A;  3D9B A;  1VRT A;  4URS A;  1LK5 A;  1FF2 A;  3AD8 C;  1NJI T;  1JLB A;  1S59 A;  3ZZZ A;  2B9E A;  2I0X A;  5T7L A;  3OPK A;  3PR4 A;  1WOO A;  4J9Q A;  1MMD A;  3R1H A;  3T6B A;  2Z8Q A;  1RKI A;  1QAY A;  1Y0H A;  4J90 A;  7FDR A;  3D3C J;  1N5S A;  1TTH B;  4K4V A;  1Q7L B;  1WHV A;  1KHV A;  2VQF J;  4J9V A;  4O23 A;  1GMV A;  3M9N B;  4A8F A;  4HHJ A;  3IN5 A;  2DGV A;  1W2I A;  1RWK B;  5G0R B;  2H54 B;  3JSM B;  3MM6 B;  1Q16 B;  5ADZ A;  2F4V J;  2ALY B;  2R42 A;  1WAC A;  2VQF F;  3JSM A;  1UEU A;  4PUO B;  3PW7 A;  1HPZ B;  2K1R B;  4RNO A;  4D3H A;  4IRC A;  5DET A;  2CDQ A;  3NNC A;  1PJ6 A;  2O1P A;  2F4V F;  1OIA A;  2XY5 A;  3KXD A;  2F8M A;  3GCX P;  4DXL A;  1DTT B;  1HPZ A;  4ZPA A;  4LF4 F;  1K0T A;  3BPD A;  2XS7 A; 
#chains in the Genus database with same CATH homology
 5ETK A;  1TMM A;  1RTZ A;  1TMJ A;  4M5L A;  1RAO A;  4CYU B;  5ETM A;  5ETS A;  1F9H A;  3KUG A;  4M5J A;  1EQ0 A;  1HKA A;  3HCX A;  1RU2 A;  4PZV A;  1CBK A;  3HT0 A;  3HSG A;  3QBC A;  1Q0N A;  3KUE A;  1KBR A;  3IP0 A;  3HD1 A;  5ETO A;  3KUH A;  1EX8 A;  5ETN A;  3UD5 A;  1RB0 A;  3MCM A;  4CRJ A;  3ILL A;  4AD6 A;  4M5N A;  5ETQ A;  3UDV A;  3MCO A;  4F7V A;  1HQ2 A;  4M5I A;  5ETR A;  4M5G A;  3HSJ A;  5ETV A;  2F63 A;  2F65 A;  1RU1 A;  1DY3 A;  4M5H A;  1G4C A;  2BMB A;  4M5K A;  5ETP A;  3UDE A;  4CYU A;  3ILJ A;  5ETL A;  4CWB A;  3ILO A;  3HSZ A;  3HSD A;  1IM6 A;  1EQM A;  2CG8 A;  2QX0 A;  4M5M A;  3MCN A;  5ETT A;  3ILI A;  3HD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...