4M5IA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 45
structure length 159
sequence length 159
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5iA00
1KBRA 5ETOA 2CG8A 4M5HA 3ILIA 3HSJA 4F7VA 3HSDA 3QBCA 3HSGA 4CYUA 1RU1A 4CRJA 4M5LA 1G4CA 5ETTA 1F9HA 3MCMA 5ETMA 3UD5A 3KUHA 4AD6A 1IM6A 3ILOA 2BMBA 4M5MA 2QX0A 5ETSA 5ETRA 3HCXA 1RU2A 3KUEA 1EX8A 5ETPA 5ETVA 1RB0A 4CWBA 3KUGA 4M5NA 1RTZA 1EQMA 3ILJA 1DY3A 3HD2A 3ILLA 4CYUB 2F63A 4M5GA 4M5IA 1TMJA 3MCNA 5ETNA 5ETKA 3HSZA 4PZVA 3UDVA 1EQ0A 1RAOA 1HKAA 3UDEA 4M5JA 5ETQA 1HQ2A 3HT0A 1CBKA 5ETLA 2F65A 1Q0NA 4M5KA 3MCOA 3HD1A 1TMMA 3IP0A
chains in the Genus database with same CATH superfamily
4DV3F 2I2YA 3KJVB 1RBLA 1HLWA 4HT5A 2U2FA 1HMVA 1NK8A 3NGSA 4NLSA 1OQ6A 5CAAA 1MU2B 2G0CA 3CCSS 3I9ZA 3EX7B 3V6HA 1U1NA 2G0IA 3G96A 5IV4A 3QO9B 3VF0B 5HANA 4CH1A 2ZH5A 2PFFB 2YQ0A 2AGQA 1Z4UA 3R7SB 3CMAS 1SC4B 4UZBA 3AQOA 4QW8A 1QAJA 4IRCA 3N79A 1KDNA 4YN3B 2HS3A 4EK2A 2AU0A 3JS9A 2HMIA 2RDJA 3Q8SB 2RHQB 1F3FA 3DGPA 5KFIA 1BLUA 3M8PB 3F56A 2AIRB 4C8YA 1DBDA 4DQQA 4LSZB 2LVWA 4CO0A 1YZ6A 3MECA 1HNZF 4DX6A 2YQ3A 3H5SA 4D3HA 5A8WB 1T9UA 2Z56B 2RU9A 1PBAA 2JOQA 4O3RA 2HFOA 1WC3A 4N5SA 4OX9F 1DTTB 2DVIA 2V6AA 2KH9A 4B3SJ 1JLCB 2HZAA 3BGRB 1KD1T 1KN6A 3FBCA 4U8YA 3K5LA 1TKXA 4UUXA 4LIRA 4LRCA 4EO6A 2CPDA 2VDHA 1IKVB 1KONA 2YTCA 3FCHA 2BE9B 2RB7A 3CCES 4JI8J 2F4VJ 5E2QA 5LM7E 5IC4B 2ZH7A 3IFEA 2HHSA 4H4OA 2IMWP 1BY9A 5CQGA 4NXMF 2OELA 3U02A 1NHVA 1HNXJ 4GO5X 2J9DE 3KK1B 1X5SA 4NYZA 1P27B 1FRKA 1SJQA 3H25A 4QWEA 4B9LA 5IT9U 1NNDA 2CPHA 1TUVA 2XULA 1CJKA 2AHOB 3HMJG 2RUGA 1A6LA 5J2QB 2ZH1A 4JUZA 1TMMA 1RT5B 2XEXA 3X3UA 2R8JA 3B82A 5KFKA 1UVMA 4DCOB 1GXLA 3TA2A 4JI2J 4IKAA 2J0QD 2DR5A 4AT1B 5FDLA 1HI8A 2Z58B 4ZVUB 4MAKA 1WI8A 4FDFA 1V3ZA 3T1HJ 3BS9A 1R6VA 3KK2B 4XK8C 3BDPA 4X4TA 1EETA 1VK8A 4NMLA 1Y0HA 1TMJA 2RQKA 4OZNA 3BREA 4X4SA 2MQMA 3MR2A 4JP8A 3CSKA 5KFDA 4B3TF 4RW6B 3K5NA 1S9EA 1FRLA 3OD2A 4DI6A 1KTVA 1LNQA 2NSCA 4J7CA 5C2CA 2WK4A 1G1XA 1FFSB 3PKMA 1Q81T 5FLXY 4C0OC 2HFZA 3ZZRA 5HLFB 3ZC4A 4U7UD 2DNGA 4A8OA 3FC9A 2Q1LA 1RT2A 4LSLB 3R5JB 4ZOSA 3VAHA 3QIPA 3EDRB 5JVHQ 1Q8IA 1UVIA 2PO4A 3LWMA 2DR7A 3UN2A 2WB1D 1IBMF 4K2XA 2VQEF 6FD1A 3OUYB 3ZNJ1 2LXFA 3V5RA 2EFOA 3BN4A 2HHHF 4D3GA 3N5FA 4DCJB 1YI2S 4Z7YA 1CS4B 3ZZYA 3NMRA 4ZVRB 1ZM9A 3Q23A 4KV8B 4M5DB 3GJTB 2IYIA 4TY8B 4P2XA 1KRPA 4ZCMA 2D69A 3ZTRA 3VAMA 5G0RB 3IBCB 5J2MB 1FK9A 3U27A 1N52B 4DWIA 2OSQA 2RMLA 2IBOA 2CQ0A 3D1QA 1RYSA 5K9FA 3G9CA 3C15A 4RR5A 1AB8A 3BN7A 2ERRA 4X4OA 4ZMMA 2VICA 1EKRA 4YR3A 5A0YB 4LSNB 2Z2MA 3CCZA 1IBLF 2I8EA 3ITHB 4YB7A 1ROFA 4DQRA 1PGZA 2QLXA 1R7IA 3DM2B 2XTJP 3DYAA 4JI3F 3HSDA 5E33A 1W2IA 2UXBF 3PNIA 3RRKA 2D9OA 4DV7F 4DUZJ 1VHFA 1R0AA 1MMNA 1RI7A 2LP4A 3PIOQ 1T7PA 2RT3A 1VFJA 2R2TA 2FYXA 3OBIA 2GVDB 4LQ9A 5K8PA 1UJ5A 3H4BA 3IAM9 1JJ4A 2MKSA 4NCBA 4WE1B 1DAXA 4HACA 2LQJA 4EU0A 3MHYA 2HHWA 4KE5A 3DRSB 2ZC3A 2ZOMA 2Y1RI 1Y11A 2HS0A 3PW7A 3GMGA 4R25A 2HZVA 3NLCA 4DS4A 1UWBB 1VQ4S 5KFZA 4RU2A 4XDCA 1NRKA 1V5IB 2Z2LA 4RW4A 4RBUA 2GS8A 3K7RA 1S1TA 5DGBA 1B0PA 4LF2A 5KOWA 1KR4A 1VRTA 5DQGA 2Y1LB 1RAHB 4ANDA 2DH7A 1QY7A 2B56A 3D1HA 5LJ3Y 1S6PB 4WTOB 4IUFA 3G86A 2EBGA 3W62A 1VQPS 3MOZA 3T1YJ 4J37A 4O0IA 2K3KA 4WP3A 2VD3A 2XHCA 1LW2A 4OZ0A 5DRKA 4F0KA 1S4EA 2YNFA 3H20A 4DV6J 2KB2A 1CC7A 4O3SA 2CWKA 4NCGA 1ULRA 2M70A 2OH2A 1NB2A 3CJQA 4A8SA 2XZTB 3V6DA 4P74A 3CCJS 4ZHRA 1WDTA 3N4WA 5D0HA 4DF8A 1E6YB 1J5OA 2G1HA 2KYXA 4ZLNA 7AT1B 4F67A 5A8KA 1JXVA 1N54B 1AYEA 3CXCR 3VAKA 3CMES 1HBUA 1KQKA 1H38A 2ZH2A 3RAMA 3GYGA 4I0WA 3WQPA 3AD8C 4CO4A 2CNKB 5IFMA 3EGZA 3VAIA 1TELA 3N5BA 2KN4A 2LQ8A 2ASDA 1PYTA 3FFIA 1X31C 3HHDA 4I6AA 4ZCIA 1HI1A 4H4MB 2GNKA 4JI8F 1N5YA 3C16B 2F4VF 4DPWA 3MOJB 2F4FA 4OHZA 2WZ1A 2M2BA 1CJUA 4U7CA 3MAAA 4N77A 3IN5A 1N32J 4ZLJA 5IT0A 1NSQA 4NI2A 5KTQA 2YNHA 2MQNA 2MMYA 3CJ5A 5J1NA 3GR0A 2ZKUA 4L6V3 3MR7A 4EBCA 2JLEA 5KT3A 3OL7A 4CLZA 5DZ7A 4RNMA 2RRNA 4LRDA 3DOKA 2AMCB 5C5JA 5SUHA 3AJ1A 4GO7X 1UWAA 4YY3J 4DSIA 2A2DA 1NK0A 1LWCA 3QZ8A 2MKIA 4RW7B 1RCXB 2QG9B 4FXDA 3K5PA 1VISA 3KG4A 4JI2F 2HK2A 4IQMA 2XMAA 3T1AA 4GC7A 2HAFA 4CWBA 2HFVA 4I4BA 2HAIA 2IA6A 3H0PA 3MPUB 4ZPDA 3OTOF 2OMOA 1KFSA 1TKZB 3HHLD 1QE1B 3T1HF 2FZGB 3HHKA 3RR8A 2R7VA 1MWQA 5AXMA 3QMQA 1KSPA 2L08A 5CYMB 3UWTA 2WONA 2DCUB 1S12A 2KVQE 5FIIA 2XCPA 1KOOA 2QZ8A 1FVSA 1FXDA 2XSJA 1IR1A 1J27A 1AUSL 4DSFA 2BJDA 3HKZD 4DU7A 5U47A 8AT1B 3BGLA 3O1LA 3T41A 4NRTA 3SMZA 1ZYQA 2JEJA 2CDQA 1JLFB 3DC2A 2BJ7A 3MMBB 4TU8A 1K1SA 1WHYA 1HW8A 3O2IA 2POKA 4UY85 4DV2J 1IKYA 1LWEA 1P8GA 1X4AA 4Q5VA 2HBZB 3OXGA 2OPQB 3F73A 2IAJA 5E3AA 4USWA 1QAIA 3OLBA 2BM1A 2EK1A 2Z2ZA 1FFWB 3ISNC 1T05B 2MGZB 3MUMP 3U1LA 3ZTOA 5F3TA 3KLHA 3RG6A 4FF4A 5CCLA 4NASA 1RKJA 4GVBB 1MWZA 4LFBJ 4WP8A 1N0UA 3GV5B 2VC1A 3R6LB 2H5JB 2GHPA 1NSAA 3CULA 1KP6A 2B5JA 1B7FA 2MJNA 1E6VA 1S77D 4OLOA 4ZPAA 2CPXA 1U0HA 4LF9J 1URNA 1F5CA 3RRGA 3P4UB 5ADZA 4KQZA 3QJJA 1YKWA 4A4JA 2PT0A 2FQQB 3RW7A 4CI0B 2BABA 4KH0B 4YDDB 1F60B 3THPA 1SL0A 1FWLA 2LEPA 4N8NA 3AODA 4F0HA 2DNYA 1HMVB 3MCOA 2PN6A 3IP0A 1Q5YA 4FF2A 5J2NA 2AJFE 2ZDOA 4WXOA 4LR9A 5HATA 5LSRA 2W25A 4BS2A 3IS9B 2VPWB 2RIJA 3GJSB 2BW7A 2Z2YB 1LXJA 1WG4A 4C8LA 1GEHA 5KFQA 1UPMB 3FQLA 2B7BB 2HMIB 3JYTB 3FZ2A 1EQ0A 2LEBA 3CCLS 2UV8A 5A8RB 4ZVFA 3ZZZA 3DGPB 3G6XA 1HBOA 2J0WA 2EFVA 3VAGA 4QR2A 2AD9A 3RUBL 1FJEB 2W8KA 3PXGa 4MYUA 1FNOA 2W4DA 1FNXH 2KYZA 2E1CA 3K59A 2JVOA 3LF0A 2QJ3A 2VOPA 2JC0A 1RWVB 3O6QA 2N7YA 1U1MA 1S7HA 3V81A 3O5TB 3MECB 2DHGA 1V5VA 3W2WA 3O3LA 2BX6A 4TU9A 2LMIA 3G8QA 2IM2A 2RQCA 2GMHA 1XNQF 4OJ1A 1CLFA 4ANEA 1WTBA 3T1YF 3MZIA 2QTWA 2B8QA 5F0UA 2GIFA 1ZOTA 1WJ9A 4QWBA 1Z2ZA 4N56A 2NPIA 1FE4A 1Z2LA 1EX8A 2CQ4A 4LJMA 2WW4A 4J9LA 1TKXB 3J7A1 1CQNA 2QL9B 1M1GA 4CT9A 1DJ0A 5HMYA 1V3SA 2R3VA 4OHYA 5L1KA 2IY5B 3MCSA 1WNEA 1Q78A 4H4OB 4YOEA 3KHGA 3RTVA 4DF4A 5DS7A 5J1EA 4LRFA 4WF9Q 4KH1B 2XI3A 2EG1A 4O23A 2C2EA 2FD2A 1WSRA 1MROA 5E3QA 5A6PA 2VB6A 1VQ9S 2YKNA 5HQLA 1CJKB 5HJXA 3QJLA 2EC0A 4O4GA 2F8MA 3NS6A 5HL7Q 3BSCA 1YBUA 4Y2KA 1OY8A 1DQ9A 2PC6A 3GFZA 2MLYA 4R5PA 1O0PA 3ENAA 2CZVC 4M5HA 2PDAA 4ECZA 2C2MB 2FC8A 2E9TA 3BGUA 1WEYA 3SSRA 1O5JA 4GVLA 3MM7A 3WX8A 4WCEQ 3QRQA 1HNIA 2OEJA 2VKRA 3EYZA 5EN1A 2RUSA 3UD3P 1EETB 5RUBA 3ZTPA 3C46A 4LF5J 4KGVB 2DY1A 1RQ0A 1EIYB 3QWUA 1S9EB 2UXCJ 2K7JA 2K7KA 1HL6A 4FN5A 2V50A 1R0BG 2O01C 3CCWA 3EM1A 2QV6A 1K73T 2COLA 3CJ3A 1TP7A 4GKJJ 1A0OB 3KOAA 1QJHA 4K4XA 4QBUA 5LSOA 1XQIA 2RS8A 2W2NP 3QIPB 2VFSA 5F8NA 2C2KB 3FDSA 4OYAA 4PXDA 3LP1A 1SH3A 1UAWA 3ETOA 3BBBA 3AOAA 4F50A 4W4MA 3IR7B 1P1LA 4JBCA 3QQCD 2YX4A 2ATCB 1HNWJ 3NS5A 1S6UA 2IC3A 4X62J 2HURA 5BYRA 3FEZA 2OIHA 1S0MA 2W2OP 4F25A 1HWLA 1YJWS 3W5XA 3M6UA 2W1BA 2QA1A 3TAPA 3NG8A 4NE9C 4M5LA 3W9JA 1WC1A 1FK9B 4I64A 2W2PP 2ZBCA 3CO9A 4DV2F 1PYSB 5HMWA 5LMNF 1CBKA 3RAXA 3F41A 1WACA 3C15B 4YMEA 3Q83A 3R9LA 3U1NA 4RNFA 2J76E 1LWFA 4PRFA 1Q7LB 1RT3A 2RKIA 3HT3A 3FVYA 3WDOA 1DFDA 3KXDA 2CXEA 4HI1A 4J9OA 2PMHA 3IAS9 3DDKA 2J9CA 2ZVIA 3DYAB 4NLGA 3CD6S 2AX1A 4LFBF 2B9WA 4PXEA 1U4BA 4Q0BA 5GADI 3CD0A 3JAMY 3PFEA 2ZE2B 3Q8YA 1RAAB 1R0AB 5M2PA 2FPHX 3SFGA 1NSKL 3DNCA 2R7XA 4ZKAA 3FRYA 2OPRA 4S0MA 5ITHA 2X1FA 2P6SA 1NJZA 1RBOB 3CD7A 2I9SA 4HACB 2EG2A 4C8NA 3K89A 4RW9A 2R8GA 1F2GA 1K0VA 2DNLA 2BEFA 2E5JA 5LL6d 2OJ3A 3H40A 4DL7A 2CQHA 1JLEB 2GV1A 1C2PA 1TAUA 2LCWA 4DFKA 5KFTA 3PW0A 5ETPA 1QSYA 2LQ5A 2DXFA 3O44A 3M8YA 2Q66A 2D3ZA 5CD4H 4RW4B 2PSZA 4B3RF 1S1TB 1VRTB 4N8OA 4YHHF 1KNZA 2J8SA 1XWLA 2BZ2A 4ID8A 4FKYA 4NLXA 2XMUA 4KT0C 3PM9A 2FHKA 3MMCA 1XN9A 1JXLA 1M5HA 1X4GA 4DR3J 3J7YI 2IMOA 1OY6A 3TYTA 8RUCA 2FTRA 2DTJA 2F40A 1NK5A 5C24A 1LW2B 2CPYA 3I96A 1TFYA 2YNFB 3JTPA 3GONA 2KM8C 2LQBA 4NCGB 5CH7B 3MM8A 4NZ6A 3EDQB 2DGTA 2CG4A 1RHUB 1OSCA 3QT8A 1BWVA 3NBPA 4RZRA 3V6DB 3M2RB 4ZHRB 3CE8A 2MHEA 2QX0A 4CNYA 1UMJA 1NJIT 1X4FA 1VC5A 2IDLA 4K0KJ 3MR6A 4KHRA 1ZTWA 2EI5A 5A8KB 3T6BA 3N6MA 3PW5A 1BQNA 3SSSA 3HHLA 2D3UA 2GC8A 1FTRA 1T03A 2WHOA 3VHQA 1FCAA 1N88A 3RGIA 4C48A 2MQQA 2G2OA 4UF4A 3NWGA 1NM2A 3ZTQA 4DL2A 2EKNA 2W7AA 1UVKA 3PJWA 4OZ2A 3FFIB 1FVQA 1EAYC 4ZVHA 3UW1A 3CCMS 1N5YB 3D3CJ 1ITPA 2XLKA 3EZUA 1M5PC 1PG5B 2AZ3A 3C6TA 1QM9A 1TL4A 3L95X 1B70B 4M95A 2DNKA 4X4RA 3OL8A 4Q8FA 1RYRA 1CJUB 4MTPA 4LBHA 3VQSA 2FJWA 3MAAB 2VV5A 2NLWA 1NJXA 3OW2R 1YJRA 4K5SA 2I0XA 5E41A 2YNHB 2QGFB 5EDWA 3AXKA 3G6ES 2BXJA 2ZD1A 2RVJA 2UUAF 3D9BA 2OKQA 4DV5F 1U1OA 2J0SD 2O1PA 2HHXA 3DOKB 5DLGA 1T9XA 4ED0A 2E7VA 1MMDA 1RTDA 4FVCA 5DJBA 4DV4J 2BOPA 1PJ5A 3PX6A 4ZIVA 1LWCB 3BF4A 4EBDA 2XLIA 1C4AA 3M05A 1NKBA 2AJ1A 2PI5A 4CP5A 2VUGA 1FT8A 2KTQA 4JI7F 3I0SA 5CYJA 2C2ZB 1HYSB 2IRUA 5JXSA 2DRAA 3OQ2A 1XBWA 5F8IA 1Q79A 5A2QY 2F8EX 2AF6A 3CJ8A 3D28A 4U95A 4CDIA 4LF4F 2J9DA 5L8RC 3TUZC 3DMJA 4A8QA 2WONB 2XYPB 4PR6A 1IWAA 5I3PA 2Y1JA 2DEJA 4JB8B 3AQPA 4PXCA 2XSJB 3MPWA 4RWXA 3VVTA 2HS4A 2VG7B 2ZH4A 4GKJF 1TL5A 2AT1B 3DLEA 3VVUA 3K5MA 2C2RA 1S97A 1U6ZA 2IYGA 4P2FA 1VQLS 3OT9A 3C14A 4PEOA 4AXIA 2BM0A 1IKYB 4HLBA 3A12A 4ECWA 3HJVA 3SCKE 3KJQB 1WELA 4IDKA 4NCAA 1NKEA 2IAJB 1VGYA 4MMOA 3TJ8A 4RX6A 4P10A 4NYPA 2Q6BA 1RWOB 4B3OA 4HL9A 1C4CA 3EGVA 3K5OA 4X62F 5L9NA 2W4CA 4DX5A 2WCXA 3KLHB 4JV1A 1W7WA 5DQIA 3OR1A 3T9NA 1LXNA 2HFUA 3CCUS 2CQPA 4OI6A 2AW0A 3SZ2A 3BDEA 1D9FA 2RQMA 3TR5A 4HHUA 2DITA 2OEKA 3HM9A 2MTLA 1IQZA 1RHQB 2B5JB 1N56A 1E6VB 3GZ7A 1U0HB 2R2UA 4DN9A 1BGXT 2VHGA 2JVRA 2FVRA 1UVJA 5B08A 2WBRA 4MKBA 2OI2A 3VZHA 4C11A 1N48A 2X1AA 4LUBA 2DNHA 3BBFA 1S57A 1FF2A 4DXLA 2G2YA 4OYOA 4X4UA 3M8SA 3A1YG 3D2WA 1ZTTA 3HK2A 1YJTA 1AA1B 3AY0A 2DK2A 4RUCA 4KY3A 1VBXA 4A8WA 4EGLA 1JK9B 5IXUA 1ZA2B 1ZZFA 5L1IA 2DO4A 5J2NB 2WVBA 3OR2B 4WFBQ 2MKCA 4PQUA 2WW8A 5GAGI 3HPOA 2WSCC 1L3UA 1RT4A 3KUEA 4ZPCA 3EVWA 3QGHA 1CJVA 2J7UA 3NOCA 1K1QA 3QATA 1VR6A 1RWMB 2AYEA 4X2BA 1X0FA 2VG5A 2MKYA 2LXIA 2KXFA 4QPXA 3VWSA 4A8KA 5AJ3F 3UDEA 3QNWB 1IQTA 1HD1A 2PA8D 2CJYB 1WTFA 1XNRJ 4U9RA 2DYAA 1IBKJ 5DDPC 2MQPA 3PJXA 1RP5A 3IBWA 3V81B 3GTYX 2IIHA 4AL7A 1RGVA 1Y5IB 1RISA 2J6SA 2FVCA 3GR1A 3S01A 4FYXB 3N6LA 1VQYA 2I6WA 1WKKA 3B54A 2D3OR 4DR3F 3W9HA 4O3NA 1XR6A 3CUNA 2O5DA 4NLPA 4OJHA 2K2PA 4XDDA 1SQFA 4RKUC 2CG8A 1U24A 1QSSA 3K8VA 2LFVA 2Q43A 5H9EJ 5KG1A 1MW7A 3PTWA 4FS2A 3LP0B 4JI1J 2ZZTA 3TQEA 2RE1A 1NCLA 1GMWD 3BH6B 2JFDA 3MAHA 4HHHA 2EEYA 4C8KA 2GIRA 3M8PA 3M8QA 3TAQA 3GB0A 4WU3A 2E9RX 3KDNA 5J1EB 1VBZA 2F5GA 4UQTA 1RLCL 2GO8A 1MROB 1NK4A 5HK4A 1TL3A 2QMWA 1FWKA 2YKNB 4JI4J 2R4FA 3A13A 4O4GB 4LFCJ 3RU0A 4DPXA 3J7AN 1DTTA 1NK7A 4DX8H 4R5PB 1RA7A 3GFYA 4F8RA 4NA1A 4DV0J 4URGA 1KHVA 2ATLA 1BHNA 3PHEA 3MM7B 3Q8QB 3TAMA 5EWFA 2DD8S 1BE4A 1HNIB 4PG4A 1BXNA 5ETSA 4OHVA 3Q22A 4WK1A 5DM6Q 3UR3C 2B0GA 2D74B 1T3OA 3VR1A 1REVA 2DBBA 1DLOB 2Q79A 5BJRA 5LMUF 2CNLB 1GFWB 3MR5A 2HW3A 2DJWA 1RAOA 1XMBA 1SJFA 2BJ9A 2Q6CA 2CZ9A 1ZAVA 1F2HA 5KG6A 7FD1A 2CPEA 4DZDA 4MKVA 4DPTA 3TANA 1RHRB 3AA8A 1Y4ZB 3RRHA 4FYWB 5B0BA 3LP1B 4ETZA 2RF2A 1RTJB 3QFHA 1NJYA 3CDWA 4DSEA 1S59A 2GGPA 2E5HA 4WFZA 2KT2A 2CQDA 3EUNA 4OYXA 2IC3B 3P6YC 2HVHA 1Y10A 3DOLA 3T5JA 2DGUA 1WHWA 3HVAA 1ZH5A 2GVZA 3CCQS 4CZCA 1XK8A 1UFWA 2EWHA 3EXYA 3K58A 2M8DB 5CABA 1F9EB 1PAUB 3WC2A 4CLSA 4KAIA 5ETQA 1WORA 1DTQA 4DN0A 1SKUB 3DFEA 5AXKA 2ADCA 1GTHA 3UD4P 4DL6A 1PYOB 2ROGA 1N5SA 3G82A 4K50A 2NR0A 4QPTA 3Q24A 3DKDA 3ENVA 3UCGA 5H9FK 3PYFA 4L3NA 4UT4A 1LWFB 2FJBB 1RT3B 2J6UA 2RKIB 4FZVA 3JQJA 4WYLA 1L3SA 1TK8A 4TY9A 2ILZA 3I31A 2BE2A 3DHXA 1NO8A 4HI2A 3R27A 4NYOA 2GQ2A 3R5DA 2VF3A 2OEMA 1UEUA 4C3MA 4LVNP 4Q0BB 3M30A 4QYRA 3KWMA 4LF1A 2JFKA 4DV1F 4OX7A 2FJEB 1S49A 4KHPJ 3JQKA 2OPRB 2OTLS 2J5AA 2DH8A 4X4PA 2PMZD 1CPZA 1RTZA 2R7OA 2YH1A 3R7BB 4RW9B 4Y65A 3GJQB 3NY0A 4F3MA 3VCDA 2PA3A 3P45B 4IQXA 2PI4A 4LRAA 3MF5A 4XO0A 2YNIB 4IO9Q 4HH1A 2MB0B 4P7TA 4ZPWR 5IC6B 4P73A 1WKJA 4YFUA 4V19X 4WWSA 1G6BA 2OTJS 3B4MA 4FPRA 5CXTA 4IOCQ 2OPPA 4LBPA 3GG0A 2NXJA 2B4VA 1SUQA 4JI5J 3PVXA 5IWAJ 2WRMA 1SQGA 1SJ3P 3KHRA 4CLUA 1TAQA 3MURP 4PG8A 2RRAA 5AE1A 2Y0SD 4NRUA 3MEDA 4PAAA 1I51B 3MMCB 1ZBTA 1KEKA 4KC5A 1YRTA 4HTJA 3L3CA 4AL5A 4CTAB 3G4SS 3ILOA 3ZZPA 1UA1A 1RE1B 1MWYA 4JOUA 1OS5A 5C24B 4RUBA 3VGVA 2DRDA 2GVDA 3MM9A 2C3UA 4X66J 1FJCA 2QYCA 3BPDA 2EFGA 5HVFA 4HT7A 4LR7A 2X51A 3MM8B 1RABB 1RHMB 4M94A 3NBPB 1XNRF 1IBKF 1BWEA 3R5CA 1XMQF 4DLGA 2BVZA 3TI0A 2H3EB 3PO4A 4RO0A 5D0GA 5F8GA 1U1RA 2YX7A 2XMTA 2B4OA 2QO3A 5HAOA 2JX2A 1K44A 1XMOJ 3HHLB 1T03B 2CPFA 1KC8T 1Q5VA 1VIXA 2L9NA 4ILMA 4OIXA 3KUGA 3DLHA 2RD5C 4CO3A 3OXFA 4IG0A 1H3DA 3C6TB 2CZ4A 2D7SA 4USTA 2GA7A 1OQ3A 4N76A 3P96A 4EUVA 2ILYA 2ZD1B 1TKTA 2YKAA 1FKOA 2XSFA 4ICLA 4MFBA 3PCOB 1E6YA 2MKKA 3FSXA 5DDQC 4K5RA 1OO0B 4USIA 2QT7A 5KG5A 4KJIA 1FERA 2BKNA 2BOAA 1RTDB 3KG0A 2V4QA 1T02A 2GCFA 4QIWD 4M5NA 1XC9A 3HZEA 4K4VA 3D0IE 3G8SA 1QUVA 1L3KA 2J7WA 2CPIA 2KL8A 3MM5B 4ED1A 2L41A 3W3SA 3I0SB 3KNGA 3MTKA 4UY8T 3D67A 4DV0F 4CYUA 5KFVA 3M4XA 2I5JA 2JSXA 4PWWA 3QAEA 2MQLA 3C19A 4X4QA 4CT8A 2XZWA 2HNYA 1PIEA 2NZ4A 2L48A 1SB6A 4RU9A 1GMVA 2AWZA 1MN7A 3DMJB 4OJ3A 5T7LB 1YITS 5GAHI 1S9GA 2HGNA 3ISND 2CQCA 1VQKS 4LF6F 2CVIA 4ZPVR 3UDVA 4ED7A 1PJ7A 4NXNJ 4I2QA 1RT7A 5KT5A 4X4VA 3B4DA 5KT7A 1VI7A 3HCXA 1ZAWA 3CD5A 2CJXB 3C14B 3M32A 3M8RA 4TVAB 4PCQA 4DCPB 2DNOA 3AB2B 3W64A 4QWAA 1GXUA 5F8HA 4N41A 4IDKB 2C2DA 5L46A 2B9EA 2ZFHA 2DNRA 2CYYA 4ID5A 3F44A 2FJXA 3IBFB 4P2SA 3TNVA 4B3OB 4WPAA 4TU7A 4DFJA 3AHPA 3OVAA 2IM1A 5KG3A 4P52A 3Q8PB 5CA5A 2UVVA 1VIOA 4KIAA 3OR1B 4LIWA 2W2QP 4LQ3A 2KRBA 2J9EA 1SBRA 2CJAA 1U49A 4I1TA 2UU9J 5MLCV 3GYXB 3CIMA 2HNDB 9RUBA 1X7VA 2RILA 1X4CA 3H90A 3IG1B 1D3WA 2ZH6A 3M2UA 4DOZA 3HD1A 5GMDA 1H2VZ 3IRWP 2CQ2A 2KVIA 3HULA 2GZOA 2NCKL 2HVIA 2WVCA 4C11B 1VBYA 4WBFA 3B6BA 1UA0A 2H48B 2N4DA 2FGOA 2H4YB 4ZVTB 3NWRA 4ZVEA 2M5YA 4UOCA 1HWJA 2BMBA 1VDHA 4URSA 2BR0A 1PCAA 2AZ1A 2XMKA 4OYZA 4RBTA 1NB7A 2CA9A 4B3MJ 2BKOA 3BV8A 1Q86T 1ZA1B 5HQ8A 1RBAA 3P3DA 1FX4A 2VPYB 5DG7A 1FX2A 4K2JA 1HWKA 2M88A 2KKHA 1GH8A 5K14A 2HBRB 4ECXA 2ABYA 5D4PA 3DRXA 2GAGC 2XYHB 1KFDA 1CJVB 1GMWA 2K3IA 1WD6A 2UUCJ 3K57A 4ZVGA 4IH7A 4DSJA 3EZOA 1S0OA 1GQEA 2WVEA 2VG5B 3HHEA 4LMZA 3PW2A 2HWIA 3M6XA 3AJ2A 3ETMA 1DARA 1S1XA 2EVZA 1RXOB 3FGVA 5ETKA 5HBMA 4MKAA 1YLXA 4Z37A 2MYFA 4G1QA 3JB9k 2VA2A 4R0EA 3MPVA 2XC9A 2A1BA 5DDRC 4Y2CA 1U09A 3J7YU 2B7CB 5FLXU 2BQ3A 1JXEA 3Q8VA 3H7HB 3AA9A 2LU2A 5CYQA 2XNRA 1IUJA 1HQUA 3POTA 3R97A 2VC0A 3E2EA 3IS9A 3DOMA 4F4AA 2BQUA 3I5BA 1Q8KA 4IRKA 1CJTB 4DR7F 4FYDA 1GX5A 2V4RA 4WFAQ 4WKYA 3NOGA 3P8BB 1YJUA 2YNGA 2N7CA 4DR6J 3JYTA 4ED2A 4F04B 4YS2A 1XTZA 5A8RA 2YY3A 5B0DA 1QDUB 2YKMA 3RBDA 3OHBA 4HHJA 3M8QB 3SV4A 1X4DA 1UW4A 2QE5A 2G9OA 2UUTA 1XMOF 1TL3B 1H73A 3C2PA 1W25A 2DCLA 2QLFB 3QGPA 5B0AA 2HQGA 2XB2D 1RAGB 1B3TA 1TFWA 2JEGA 1IN0A 1H0HB 1T11A 2BE7D 1M5VC 4B02A 4FXWA 2LU1A 4NEYA 4G3IA 3K17A 3TAMB 1YSJA 2X3DA 3FMWA 3LAKA 2GW8A 5L1LA 2ADBA 2IHR1 3L7UA 1RTIA 2KHDA 1HW9A 5E7OB 3DLKA 2ZUGA 3NXZA 3D66A 2DGWA 1TVRA 3TQ1A 2RHSB 3CWJA 1IR0A 1REVB 2KZMA 3GU0A 3E01A 4ES2A 1SH2A 5E3RA 2E1RA 1S0NA 2YH0A 5F0WA 2MZTA 1YRXA 2VL1A 1KHWA 1NPPA 2UVRA 1YRUA 4PWUA 2BRKA 5E5NA 5KFSA 4DR1J 3UD5A 4X65F 4ETXA 1QTMA 2GMJA 4Z7CA 2JEIA 5HP1A 1XERA 2OGUA 1H2TZ 2V9KA 3ENWA 1JLAA 4BWMA 5KFXA 1RTHA 1C0UA 4I6WA 2RF2B 3BYRA 4C4WA 1F1BB 4IFYA 5LJ5Y 2NXCA 1FRIA 2GGPB 4K4WA 2H4WB 3DDNA 1RA6A 2ZOFA 2QN6B 4BWJA 2AV5A 5KFMA 1XR7A 4NXNF 4C97A 3DOLB 2HRUA 2GVZB 4Z2XA 4YP3A 1UEVA 3J7Z5 3TA0A 3WZ0A 2DH9A 5CCMA 4USHA 1OWXA 2V68A 4GC6A 4UUWA 2XGPA 1DTQB 4UQGA 3LQVA 3I4HX 2MEWA 2D1CA 1S6QA 3CJTA 4KPCA 4NLOA 1S1UA 1NKCA 1UVLA 1AW0A 1NJWA 2HGMA 3G82B 1NH7A 3TO8A 2ZM6J 1HPZA 5KFHA 5J2PA 1FI4A 3DLLQ 5KFGA 2B9YA 3AD7C 2E5IA 3ZNUA 2ASJA 2FJDB 5GVQA 2B4PA 2QA4S 2IRXA 3KHLA 2DNQA 4WKRA 2B51A 2BE2B 1FDAA 3UN3A 2HKEA 1VQ7S 4RNOA 1H6KX 4K7QA 4Q43A 1R27B 3DLGA 3HVTA 3M30B 2YPYA 3I4PA 4ZN1A 2M8HA 2RU3A 3GCWP 5KG7A 5T41A 3FSYA 2W9AA 3GIJA 4M5GA 1UCNA 1BC6A 4FF3A 4TNOA 3W60A 1VRUA 4DFMA 3UPFA 3OPKA 4C3KA 1X8DA 3K2YA 3UN5A 1YK9A 2JJ4D 1LW0A 4I2PA 1HWIA 2JRSA 4B9MA 1T9VA 1MSWD 4BHQA 2QMUB 4I7FA 3CCVS 4B9UA 4MIAA 4OFZA 1V9OA 2OPPB 5GAGU 2DGOA 1V3RA 1QVGR 1SUQB 3L4BC 2DR9A 1SL2A 3HFZB 2EFPA 3KLIA 4DLEA 3R8YA 3P5TL 2Y8YA 1VYAA 1YQHA 2HIYA 1T9YA 3CW2C 1I94F 2WSFC 1U2RA 3RR7A 1OSDA 3MEDB 2AGPA 1S79A 1HR0J 2ZE2A 3LO3A 2FVSA 1J5EJ 3GV7B 2GO9A 4NA3A 2HHTA 4TN2A 3MM9B 4EO8A 2QSWA 1NAQA 4JV5F 1R43A 3V4MA 4FPIA 1Q8LA 2MZRA 2NPFA 2FUG9 3MTJA 3CJ2A 2ZBIA 1NPRA 3ILIA 4ATNA 1C1CA 1KVJA 2CUYA 5B0FA 1JLEA 2ZBPA 3HDSA 1HARA 1HBMA 2C3PA 2BJ8A 1U2CA 4RWWA 4F36A 3UNGC 4KTQA 3H2UB 4ECUA 1RUSA 3MCMA 1VS3A 5C25A 4ECRA 4LREA 1SJ4P 3HI9A 3CIZA 4KGMA 2V2ZA 1OPZA 2UP1A 3RYLA 3OTDA 4FNIA 1F5BA 3HX9A 4A8YA 5AE3A 3R1HA 3NL0A 2FC9A 2V69A 4B9TA 4IG0B 4O3QA 4ZVPB 4HDGA 4DR6F 2ZKTA 2W2MP 5D8HB 4F4XA 3K8WA 1S99A 3U1MA 1VC0A 2HNZA 2UUBJ 5ETVA 1S9FA 2VH7A 3GFXA 4NZ7A 1NK6A 3M2RA 1BQMA 1TKTB 4ZJLA 4L73A 1FKOB 4NLWA 2P6TA 4ICLB 4MFBB 2PMWA 2BYCA 3UFCX 1RDRA 1PAEX 1T3NA 4MKYA 4QIVA 3MD1A 3R1LA 2M7SA 2RJZA 4LF7J 3VV2B 3V4IA 3SCJE 3TVZA 2VFVA 4TLRA 3J81U 1U2FA 3Q86A 2HFNA 4B3SF 5ETMA 1JLQA 2ZWPA 1WOPA 2HGLA 4OLPA 4CYUB 3E8OA 2I5JB 4DV3J 3G6VA 2VQFJ 4J91A 2GMLA 2GJFA 2HNYB 4DL0C 2KI2A 2K1RA 1R8PA 4FVMA 4MIBA 3WHIA 5F8JA 4DR4J 3M8WA 2OPSA 5C2GA 2DB1A 4NLQA 1S9GB 3EPGA 2DRBA 2Y8WA 1S48A 3EXCX 1HNXF 4I2QB 3QRPA 1RT7B 1UJ6A 1HD0A 1WHXA 4OI0A 3FBFA 2VFTA 1U1PA 3L09A 3VGTA 4DR1F 5I3UA 1S1WA 2F9DA 3M32B 1M5KC 2XCAA 3GPAA 3RB0A 4ERDA 4C0BA 3H2VE 1YDLA 2ZNYA 3FEXB 1HNZJ 1KTQA 1U7LA 2I1RA 3QRRA 4ID5B 5ETTA 5JMNA 3D1OA 1IKXB 1HYSA 4EBEA 3WIVA 4DSKA 3I0RA 3RB4A 4QYZJ 4MK8A 1HKAA 3IR5B 3NNAA 1F3VA 2CWXA 1RAEB 3TZWA 5B09A 3PACA 1UTAA 1SH0A 4OX9J 4F26A 3IGVA 1JLGA 1M5OC 2VODA 1N6QA 1DQAA 3Q0AA 4TXSA 4U67Q 2MHNA 1GT8A 1MMLA 1DZ5A 3NNHA 2FHJD 2CIMA 4CQ1A 1ZETA 2ALYB 4Y28C 5EUHA 2VG7A 1WF2A 2UV8G 4NLUA 4W92B 3M2UB 5F9NA 1B0VA 3HFKA 3HHNB 4B9VA 1UFKA 3A3OB 3SEOA 2ZM6F 3R6GB 1YJ7A 2L9DA 3ELHA 3SIPB 1NEEA 4OZ5A 1WG1A 3OTBA 2HHQA 2Z30B 4WZQA 4USJC 3LGHA 1N36J 5L9XA 4DPUA 3BQ2A 4G6VB 2MDAA 1FXRA 2IPOB 1HQEA 2VU5A 4C9DA 2ROEA 4ZP6A 5EX3A 3EVOA 3NAIA 2GAHC 2CRLA 4C8MA 3PRDA 2GJ2A 5LXRA 4HVZA 2IJRA 1H98A 1S7IA 1JJCB 5JVGQ 2KRRA 3D6TB 3NAHA 2GJIA 5K14B 2A10A 2E1AA 5I3QA 2BACA 2W4PA 5KG0A 2Y3YA 2HG4A 3GYNA 3BO2A 4O44B 4P72A 4MIWA 2Z57B 4Q8EA 2G4BA 1NHKL 2DKOB 4C6AA 1SXLA 3KUHA 4QIEA 3PV8A 3I56S 2OO4A 4PABA 1YIJS 1U1KA 3RBXA 2CVEA 2V5HG 2OLWA 1S1XB 2VIHA 4NOHA 2V9WA 5HBMB 5J1PA 1N8RT 2HQ3A 2SXLA 4G1QB 3OLAA 3RZAA 3I87A 4R8UA 3HXMA 2NSBA 3TUPA 3FK4A 4DJBA 4O3OA 3A8JA 2V34A 2HZCA 5IOLA 3FRZA 3SDEB 1HR0F 1ZAXA 3U7JA 1OYEA 3VZIA 2UUWA 1KVIA 4DUZF 1Y5LB 1EP4A 5CYQB 5KFLA 3OR2A 4ECVA 2HK3A 2I38A 1HQUB 2HYIB 2VQEJ 1C1BB 3POTB 2KT3A 2LXUA 2VBYA 4ELUA 4CLTA 3DOMB 3NNCA 1HQ2A 2O67A 2HHHJ 1SJRA 2EXUA 5KFBA 4ED8A 4KGZB 3OXLA 1RWKB 3CVKA 2PEBA 3M6VA 3MEGA 3GE9A 4QZVB 2YNGB 1U8SA 3AAWB 3LANA 3MFIA 5HN0A 3DRPB 2A18A 2YKMB 4I56A 4BC7A 5F8MA 3DXSX 2DHXA 4DEZA 3TUJC 4EMDA 3TP2A 1S10A 1DY3A 3MI7X 3QIDA 1VQ8S 1AFIA 3QSIA 5M2UA 2H5IB 3PX0A 1HHSA 3CPWR 1PKUA 1UZHA 1VQOS 4RBVA 3BPSP 4I6YA 1REGX 1Y7PA 2XNQA 2BKPA 3NCPA 5B0EA 2HRTA 2HWTA 4F4WA 1AZSB 4ZVQB 1IBLJ 2ZC4A 1M90T 3R2DJ 2XS5A 1TK0A 2V4JA 2BRLA 4DV6F 1WEXA 3G87A 1VCTA 1SJ1A 1H74A 2UUBF 2FLNA 3CDBA 1OPIA 1TU0B 1KBRA 5GAEI 4DUYJ 3LP0A 3KK3A 1QLNA 1RTIB 2C2OB 2FLOA 2XS2A 3DLKB 1TVRB 2BA9A 3FCVA 5HQMA 2RAQA 3E01B 3PFOA 2HWHA 3R7NB 1GMUA 3MDFA 2JHEA 3T5LA 2YVSA 2UZAA 2AEJA 1IM6A 3W5ZA 3D5MA 1HHQA 3NGKA 1U1LA 3JXOA 3PRBA 2LEAA 3ZZ0A 1JQGA 1Y3KA 2XGQA 2JEFA 3WC0A 1UP1A 3QGIA 3KTQA 4YQWA 1SI9A 2VQFF 5HP1B 1FA0A 1JX4A 1JLAB 1RTHB 4C2MA 1C0UB 4Q7AA 3FMBA 5GAHU 1H7XA 3MPYA 4NPOA 3NCQA 4DR4F 4IFYB 1RSCA 2M52A 1N32F 1RADB 3CJKB 2LDIA 4M5IA 4A47A 4JI0J 1U45A 2HRYA 2V67A 1JKHB 1PSDA 4PKDB 1S76D 4ECQA 1X60A 3LA0A 3BBCA 1DLOA 3VGSA 1YJVA 5G4DA 2FHOB 3PYDA 1S6QB 1CEZA 3PR4A 4YY3F 1S1UB 4Y2IA 2Q3PA 3CEDA 2C2NA 3MEKA 2VFUA 1HPZB 3NMAA 4KYZA 2D41A 5J2PB 4U96A 4FBUA 2J8AA 3IGNA 4F4ZA 2O3DA 1IXKA 2FLLA 1FE0A 1ZM4A 2PEHA 4CLWA 2AP6A 1HBNB 4GMKA 4NZ0A 4ITSA 1LOUA 4ZP9A 4EFAC 4USUA 1RTJA 2E29A 4NWBA 1WC6A 2QLJB 3SBMA 4OV1A 2X3GA 3IM8A 3DLGB 3HVTB 4FS1A 1L5UA 4YB5A 2CADA 4PWDA 3HFVA 4HYKA 2M9KA 1A7GE 1DQ8A 4M1KA 5L1JA 4DU8A 1RWPB 2FB0A 2QFIA 3US5A 1GAOA 4J9KA 1VRUB 4J9UE 2DGXA 3C6UA 3UCZP 1N36F 3PEHA 1JMTA 3QWPA 2P8IA 3IA0A 4LFAJ 1NDKA 5D4OA 3TJ9A 2MZ1A 2ZDPA 1LW0B 2AJ0A 2MLXA 4I2PB 1Q16B 4FKXA 5HI7A 2W9CA 2HBYB 3CDEA 2Z0GA 3MEEA 3C66A 4I7FB 2DXDA 5KFPA 4NX9A 1PJ6A 2LQ9A 3OSNA 4DHVA 2CJ9A 1LK7A 4X84A 4OI2A 3KLIB 1N0VC 5IM0A 2P9EA 1NBEB 2HQIA 3SFUA 3QSYB 2R8HA 3T6JA 4CLPA 4ZPTR 1RKIA 3CCTA 2ROPA 3EVMA 4KB7A 1WHVA 3EGNA 3OTOJ 4JYAJ 2XBPA 3NCRA 3A8EA 3RW6A 4H4KC 4ZP7A 1UKUA 4J9PA 4LF9F 4AFFA 5A2QU 1Q1KA 4UOFA 1D8ZA 1YVFA 4YUDA 3H42A 4ZN3A 1RWXB 3W61A 1EQMA 3GILA 1C1CB 2HVZA 2CQGA 1SCJB 3R2CJ 5CD4A 3J80U 1EHWA 1KS2A 2YNIA 1HBMB 2CJQA 4L72B 4IOBA 4EZ9A 4DR5J 1D9AA 2DT9A 2YKPA 1GX6A 1H7WA 1TL1A 1EJ7L 3PJ9A 1FEHA 3RJMB 5C25B 1M1HA 2VONA 5KFAA 1DHMA 1VJWA 2KHCA 1TL7A 3I9V9 4P2MA 4MJKA 4FF1A 1FD2A 2APOA 3ILLA 2IFXA 3HLUA 3BGOP 1RAFB 3BZQA 5HVHA 2DEIA 4CTAA 1YJ9S 1OIAA 1SKSA 2ZJPQ 1HHTP 4UZCA 5CHCB 1IKWB 2MY8A 1P9QC 1Q82T 2V8HA 1NDCA 4OZLA 1Q4RA 1SIWB 2HNZB 4K4SA 5EX0A 3LWLA 2BANA 3S1TA 4F3QA 3CF5Q 1SC1B 1BQMB 2RH3A 3GP9A 3DGVA 1IR2A 2XS7A 5DDOC 5JUMA 2RSQA 3ENQA 1T94A 4WP9A 1UW9A 2B6AA 2CQIA 1LFPA 4M5KA 2ZHAA 4TQRA 4TQSA 3V4IB 4QQBA 1PBUA 1UEKA 4YB6A 2QEXS 3QT5A 5IV3A 1U02A 3G2XA 3LOUA 4E2FB 2QMXA 1JLQB 3H2LA 4MH8A 4MT1A 1FKAF 4IO1A 1FESA 2N3LA 3M1VA 3BH7B 1FRMA 2BJEA 1YX2A 4F3OA 3DCAA 4DUYF 3SSQA 2V8PA 2FHJA 2K1RB 2E5LJ 2IRYA 3B78A 4E8UA 3AFGA 2OPSB 2DPJA 1I3OB 2A6OA 1IJFB 1Y3JA 5IT9Y 4ES1A 3KMQA 5DZ6A 2MQ8A 3NGRA 3FJ2A 5D15A 1M1KT 1ACMB 3TOQA 1OMSA 5I3UB 1S1WB 3PR5B 2HSEB 1LQ9A 2MZQA 3I5CA 4HR2A 3DLJA 2R8KA 2W8LA 1U8WA 1FKPA 3D6FB 2YPZA 3GIIA 3CJ4A 3MM5A 3UO0A 1BD6A 3HT0A 3R5BA 4NLRA 3I0RB 1FDNA 1CC8A 1NUEA 1X5OA 3K0JA 1FFGB 4A48A 1XNQJ 4JI0F 3DDIA 4YR0A 2B3TB 4LF5F 3THVA 3T5KA 2CNNB 4OZJA 3R3TA 1JLGB 1N6QB 5T7LA 1TTHB 1NMEB 2UXCF 1ZS6A 3TUIC 3JTNA 1FWPA 2NYHA 4F4KA 1WC4A 5B0GA 1O8BA 2CJBA 2IDEA 5H1SV 3NEKA 1AXQA 3N0VA 2BBEA 5IS2A 1AUDA 4RLEA 4Y00A 3UQSA 4AUKA 4ED6A 4AYBD 1RU1A 3QT7A 3GIMA 4C8OA 4TYBA 2MSTA 3G6YA 3IWXA 1DURA 1KLMA 2Y9HA 2CDRB 5KFWA 3UE2A 2U1AA 4ZVSB 1SIZA 1XJWB 2EBEA 1OY9A 1HQEB 4OZ1A 1YBAA 1HNWF 2KFZA 1X4EA 4PZVA 4QIFA 2PGCA 5B0CA 3PW4A 3LGMA 1J2VA 2FZCB 4RW8A 1RACB 2DGQA 1PC4A 2JDJA 1RAJA 4DL4A 2L9WA 1JWWA 3ADAC 1I5OB 1WEZA 4BLGA 3AOBA 2HNDA 3IG1A 2LYVA 1YJNS 1UPPA 5ETOA 1S1VA 2H65B 5KOXA 4CH7A 3E51A 1F9HA 4F2SA 4LFAF 3QYYA 5DGAA 1EKSA 2DNZA 1F6TA 4Q2MA 4HKQA 4BBYA 2NYIA 2HPUA 4RJVA 2RDIA 3PKYA 2KZZA 3TVKA 3PYGA 5LXYA 3BM7A 3JSBA 5KAKA 1JB0C 2DGVA 3GSDA 3ZZUA 2V2VA 3MUTP 2F9JA 4R8UB 2V0NA 1KWMA 1NPKA 2R2SA 4CLFA 2NUHA 2XY7A 2G2ZA 4NEZA 3OVBA 4IH6A 1NDPA 5HMXA 3KYLA 3KLFA 2AJQA 3MM6A 2NQPA 4JYAF 3MXHP 2XLJA 1EP4B 2NXNA 2LLZA 3M9OB 5HVGA 1ZM2A 4OI3A 3IM9A 5KG4A 2R9LA 1RHJB 3HSZA 4ZK7M 3T5HA 1WG5A 3MEGB 4NL5A 2AKWB 3TEHB 4ZS6A 3UVJA 2XO7A 1I1GA 5K20B 3OL9A 2ZH3A 2DPIA 4ECTA 4C98A 4FP9A 1B99A 4DR5F 2B43A 4YR2A 3DU5A 3ZTSA 4UOHA 4XPEA 3BQ1A 3EZ5A 1T95A 4LT6A 1U6BA 3LGNA 5LMNJ 4F0MA 2CQBA 2ZZMA 4KFBB 4DZ6A 1N5VA 3SI8A 4O4RA 4ELTA 2GQCA 2NXUA 4B08A 1TK5A 5F3ZA 3LP2A 3CC7S 1T8EA 5DLFA 5IQ6A 1YTYA 4BDPA 2OSRA 3TRGA 2R7WA 3UR0A 5D4LA 1WOSA 3CDAA 1NHUA 1RWWB 3JQMA 1G3OA 4AXJA 2VKZG 4DBQA 3E3XA 3EWGA 2B9XA 3WIUA 4CLLA 2V4JB 3W63A 3W1YC 2CPJA 2DO0A 1CJTA 2CAJA 3A8KA 5GMKa 1B4SA 4C0HA 1QD1A 1SL1A 2H9ZA 1KQGB 3W5YA 3D3BJ 4YB1P 3T3FA 3KK3B 1RT6A 5ETNA 1TV6A 2B8PA 2GFFA 1IBCB 3CC2S 3S7RA 4K0KF 3VALA 3IRXA 3IO1A 4ILRA 3J81Y 2QL5B 3LTOA 1U47A 3J7ZT 3BYPA 2YWEA 1UVNA 3DXBA 3BSAA 4P7VA 1NLKL 3KLVA 1Z1ZA 1S0VA 2YQ1A 3L7PA 1D1UA 5KFCA 2GQQA 4XTTA 3PG9A 5E3CA 2ZH9A 3CNQP 5DM7Q 4WJBA 4BC9A 5ETLA 3LALA 1X4BA 3G71S 2E5LF 4A8XA 5SZTA 3H98A 4B3RJ 3PHTA 4YHHJ 3V2UC 4ZLPA 5KFFA 2E7XA 3RAQA 2A2CA 2E44A 3OFFA 2P2CB 4PXBA 4Y2MA 3GFHA 3MWBA 2MKHA 1KQSR 1G4CA 4FXVA 4GRSA 3L9ZA 4DV4F 2KM8B 3J81j 4IFVA 2QYGA 4WFXA 3DHWC 2F8HA 3IC1A 4USVA 2PD1A 4IG3A 3SYZA 1APSA 5H9EK 2K06A 3C3LA 1RAIB 2VPXB 5EGYA 4RNNA 4R0JA 1FNMA 1RU2A 2VDIA 2HQCA 1VQNS 2QA4G 1TUGB 3OJSA 4ENOA 2VBZA 1SV5A 3TA1A 3MFHA 3BKTA 1R8AA 2R8IA 2FJVA 3BEGB 2EW9A 4XIUA 4J9VA 4PWDB 2ZUAA 4DR2J 2DHSA 2KDOA 1JLBA 4OYPA 1RLDA 4QCLA 4M63A 1D09B 4AL6A 3W8GA 3BKFA 3C6UB 1UZDA 3ICLA 3I82A 3H4DA 4AQYJ 4IYQA 1SC3B 2A0FB 4L75A 1FHTA 2V94A 4WU2A 2UUAJ 3MMAA 3Q2SC 3KG1A 1YGYA 2VZ9A 3QT6A 2W9CB 2R7RA 4DV5J 2OD4A 5E0OA 4KSEB 4JI6J 3MEEB 1WUUA 3IR6B 3OFHA 2KFNA 2R42A 4A8MP 4OL8A 4U7UK 2PFDA 3W8PA 5IM0B 2YWHA 1K8AT 1U26A 4DUTA 3OSPA 4DMZA 5DETA 4JI7J 1WF0A 5K8NA 4ZLLA 2BUNA 5FDLB 3BB5A 2IA0A 1LKZA 1N34J 2WVDA 4XAKA 5D6GA 3OV7A 4LF4J 5HROA 2BW2A 3SV3A 4EZ6A 4EYHB 1HNVA 5KFJA 2ZOGA 2H54B 5I42A 2MSSA 5E3PA 1VQ5S 2RDDA 2VOOA 1VMBA 4WIQA 3CC4S 4KO0A 3TJAA 3G8TA 3GSIA 3W2VA 4W98A 4KHMA 1RT2B 2W7OA 1WDDA 4WK3A 3OHAA 1QAYA 3DRYA 4O0NA 1Q0NA 4PG5A 1RHKB 1TL1B 3TX8A 2LDYA 3AB4B 4HEA9 2AYMA 4ZCLA 3W66A 3EGWB 1HA1A 3M9MB 1FDBA 1TL7B 2IM3A 3TZXA 2XMJA 3FQKA 4MK9A 5GMEA 2DR6A 3LUYA 1XR5A 3GCXP 2E7WA 5KT6A 5ETRA 2R7TA 5KFUA 1TR0A 1RJJA 4CO1A 3S8SA 1WI6A 3CTRA 2FIUA 4DG1A 1XEZA 3OFEA 5DQHA 3PEJA 3NGUA 1QSLA 2N3OA 1FJGJ 1Y9OA 2C42A 2XG8A 2BANB 2RS2A 4L76A 2GX8A 2OMLA 3KJFB 3B8HA 2KG1A 5KT2A 2NS1B 4IR9A 1WC0A 2B6AB 2CQ1A 2EK6A 1JJHA 4Y0FA 2N4CA 2HQDA 1WSVA 3RB6A 1VQMS 4OI1A 3IMQJ 2UVWA 1BMQB 3H5YA 5BYSA 2BJ3A 2V8GA 5C42A 1SPBP 2FVPA 2W9BA 3ET6A 3DI6A 5GAEU 3M1VB 2P9GA 3HD2A 3UCUP 1UFLA 1WF1A 1N4LA 3SCIE 2CFXA 2W01A 5DG8A 3W7BA 1F0XA 4JI1F 5A6WA 4WZMA 2HQFA 5LSLA 1GK8A 1YHQS 3GIKA 3V6KA 1N5TA 2AYBA 4Y3CA 1R8CA 3CCRS 3MCNA 1IWGA 2MPUA 4K8RA 1NSPA 2XMVA 4JV2A 2MQOA 3NP5A 4K4TA 2BDPA 4DQPA 2HLUA 4N7TA 4L3KA 4JI4F 2QC3A 3DRRA 1M0SA 3Q8UA 1FKPB 5AJ3J 4LFCF 4AD6A 4NLYA 3KNAA 2ZEJA 3TWZA 3THTA 1AT1B 4ZJOA 4ED4A 4PYDA 4CNZA 2JWNA 2CKWA 2CQ3A 1QAXA 2IJNA 4F4YA 4DDFA 4USKA 3UDLA 3M2VA 4DFPA 5A76A 4QU6A 3MAQA 1EARA 4RNHA 2PE8A 2GIQA 2F1FA 4OHXA 4QWDA 2VBXA 4NLDA 1B64A 1GNKA 1X0PA 1MN9A 3ILJA 2WBMA 2YWWA 3D6MB 2F63A 3R5GA 2C1EB 4P75A 2DGSA 1WKLA 4PPDA 1OYDA 4Q45A 1HFEL 3KLGA 1QVFR 1J5OB 3BR9A 3ZZTA 3KFWX 5KFYA 1KLMB 3R5AA 3QAUA 1R3NA 3HSGA 3WBZA 4QJVA 1HBUB 2OUGA 3A3NB 1L3TA 3SXLA 2IVYA 1IKXA 4DPOA 5LT5A 2A6MA 3W65A 4MYTA 3QPIA 2OP5A 1WWHA 4DR2F 4RW8B 1HIYA 3DN9A 4RUHA 3BSOA 2V8VA 2MZSA 5D3GA 1W26A 2O66A 3JSMA 3D4JA 4B9NA 2QFJA 2FZKB 2ZJRQ 2LECA 1S1VB 4J9SA 4AQYF 4ECYA 3WX4A 2C3OA 2IM0A 4NI2B 4HDHA 4C8ZA 3AD9C 1U48A 2UXDJ 3QFWA 1RCOB 1N33J 2AQ4A 5JJBA 2F3JA 1HWUA 4Y6IA 4JI6F 1KVKA 4GKKJ 1FRJA 3HKWA 2ALZA 5LMUJ 4AE5A 3D54A 2N82B 4WYWA 2EC2A 3GG1A 3I6PA 4LRBA 1P6TA 4Q44A 2VJVA 2WTFA 5D0RA 5GADU 2H51B 1UL3A 1QTNB 2AX0A 3KLFB 3MM6B 4U6PA 4LF8J 1N34F 1W2BR 4TYAA 2XWXA 4J5OA 4U8VA 4KHPF 5HMZA 2G1DA 5BR8J 3TARA 4ED5A 4ZITA 3X1LB 3W9IA 3PO5A 3RBEA 2Z8QA 1X9SA 4FBTA 2QL7B 4I68A 4WFNQ 2X1BA 3J80Y 3QGGA 2WSEC 3EE3A 3UVJB 3CO0P 4O44A 4XPCA 3P5BP 2B4UA 5T14A 1YZ7A 1B0TA 1NXIA 1T0TV 3IXQA 2HHVA 2R7SA 1MNEA 4OZ3A 2V2KA 4KKOA 3I55S 2QIFA 3SQGA 4ZJQA 2M0GB 1LWEB 4JI5F 2HVDA 3VQTA 3N9UC 5IWAF 2XY5A 3AXMA 4OV6A 4WXWA 3HVRA 2RRBA 1R0CB 2KXHA 3LP2B 4CH0S 3JSRA 2MXYA 2CJKA 3QLHA 3SDEA 3BO4A 4PG6A 2ZZNA 4QW9A 4OI4A 2PIIA 1C1BA 2V2QA 2WVFA 1G7CB 2F7VA 4X66F 3OL6A 3AOCA 2J6TA 4PUOA 4KGKA 3KLEA 1KQFB 1FJGF 3SQOP 4DX7A 3VAJA 2Y1IA 3M6WA 1RT6B 2W24A 3CB4A 2M3DA 3TEGA 1TV6B 1NU4A 1QUPA 2WOMA 4DV1J 5D4NA 3PYEA 3DRPA 1V6HA 1HI0P 2KJVA 3BKUA 2VG6A 3IRXB 1LEOA 4PYAA 1S6OA 4BCAA 5KT4A 1VLOA 3HJFA 4X4NA 2KFYA 4DL5A 1R89A 2FJAB 2VBWA 2ZNZA 1A9NB 4P6QA 3HHLC 1LWXA 1JJ2R 2DY9A 2OFGX 1O6XA 2DIVA 3HP6A 3BO3A 4G65A 1IJEB 4ZA1A 2NXEA 2KXNB 1AZSA 4O3PA 4JV0A 2QA2A 3T19A 2P9CA 2Z4PA 2OD6A 4NLTA 3C8YA 1SKRA 4QR0A 4V19J 2EFQA 1S5ZA 5BXIA 1TUWA 4G1IA 2LKZA 4DQIA 3BR8A 4OJGA 5C7PA 3M9NB 4OQJA 9ATCB 1SQEA 2R7QA 4G1PA 1MG7A 2AJ2A 2ACYA 1IVZA 1HBOB 1ZPWX 3M7VA 2IVMA 3H5UA 5BYQA 1FRHA 4IRDA 1TKDA 4IFVB 1CULA 3PIPQ 1RT1A 1XMQJ 4IG3B 2NZCA 1F5AA 1JIHA 1C0TA 4ELVA 3W2WB 3FUYA 2OAUA 2ZHBA 3KJVA 2ZVSA 4FYVB 1S4FA 1EZZB 4K4UA 4CIOA 2E9ZA 4NMXA 4PG7A 5AXLA 3CJRA 1SV5B 1MU2A 3RBZA 2IJFA 4EYIB 3TZZA 3GQCA 3GWCA 1FXLA 2AEMA 1Y5NB 3QO9A 3CJKA 1LFWA 5KG2A 3LPEA 3HO1A 1Y00A 1H2UX 1JKHA 3LW5C 1JNRB 1JLBB 2G0JA 4OX8A 1X5TA 1CG2A 3UI3A 3FCWA 3UNYA 1Q8BA 2QLWA 5MAOA 5L39A 3PY8A 5EWEA 2VFRA 3HF5A 2MY7A 4F02A 1UETA 5AE2A 5FJ4A 3MPDA 3MMAB 2AJ4A 2C28A 3QBCA 5A8WA 4ANCA 4M5MA 7FDRA 4MK7A 5THWA 4PPZA 2X7IA 2HHUA 4EEYA 2IVFB 4PQAA 2YKQA 1HBNA 3AH6A 5M2RA 2K8GA 4FYYB 4CRJA 1VLYA 3LAMA 4ER8A 1RWUA 3MMJA 2CPZA 2DNNA 2UU9F 1I6JA 4ZVOB 1JLCA 2FDNA 2BJ1A 1ELOA 3BGRA 1K47A 2RQ4A 1GXTA 1U1QA 3FBBA 1IKVA 2KT5A 5H9FJ 5HO4A 2UXDF 5KFEA 5HROB 1N33F 2IBKA 5L38A 3CJSA 2V8DA 1HNVB 1KLNA 4GKKF 1G2EA 5I42B 4LF6J 2OHDA 2XMMA 1P1TA 2R2RA 3KK1A 1SVDA 4KO0B 5DO2A 1KKHA 3W2VB 1CQMA 4RPFA 1VC6A 4EWTA 5D78A 2DNMA 4P71A 1VJQA 4B3MF 5J2QA 4CLYA 1IM4A 4ZDNA 1RT5A 3OTCA 5AT1B 4LF8F 3UDCA 5KFRA 3HZGA 1U6FA 3QJPA 1LK5A 4DSLA 5BR8F 1R31A 4OYIA 1RZMA 4OX6A 2R7UA 4LBIA 3Q8RB 3I32A 4CM0A 2ZHOA 2UUCF 2E66A 3CMQA 1U0SA 2KJWA 3O8WA 5F9LA 3KK2A 1FD8A 2JLFA 1R8BA 2E1MC 1YWXA 5K8OA 4DG1B 5F41A 4I67A 4WTYA 5FD1A 4RW6A 3BJYA 1D8YA 3N28A 3A4TA 5CZXA 1SC6A 3OVSA 3NS7B 4OYMA 1FRXA 2V63A 1K9MT 3M8ZA 2FGCA 3RB3A 5HLFA 4LSLA 1R8HA 3HSJA 2BQRA 1VOMA 2MLZA 2X1GA 3I5AA 5C42B 2VA3A 4Q2LA 2BV3A 4B9SA 3OUYA 3TVYA 2W9BB 3ET6B 3NKYA 3DI6B 4LR8A 5IQQA 4J9MA 1S72S 1D0EA 1CS4A 4EI2A 2ASYA 4KV8A 4M5DA 2C3YA 3KDOA 2GHWA 4TY8A 1IKWA 1FEEA 4IH5A 4N47A 4E0DA 3LH2S 4CLKA 5F8LA 3S6EA 2ZBQA 3T9ZA 4Y34A 5G0RA 1PO6A 5J2MA 3IWLA 1Q53A 3FKBA 3CGIA 1RK8A 3DLBA 2XQCA 2XHWA 2YWGA 4H54A 4YEAA 2QLBB 2VPZB 1LV5A 2DR8A 2JC1A 4B17A 5HJYA 3DRRB 2XWYA 1RB0A 3D6HB 3Q89A 5A0YA 4LSNA 4X64J 1NK9A 4W90B 1ZPVA 4J90A 2HVEA 4A8FA 4Y2AA 4K4YA 2DHAA 3ITHA 1CSJA 4RL1A 4V1Ak 3NGTA 1FO1A 2LA6A 2XO6A 2JZ5A 3KHHA 3DM2A 3ONQA 3JTOA 3AJDA 6AT1B 1M5SA 5I4MA 3M2VB 4OMFG 3PRVA 4QR1A 2A3JA 3CDUA 2YKOA 5B7WA 3ULHA 3IWNC 3FZBA 4UOGA 2ZWOA 4M5JA 4QU7A 2HFSA 4WE1A 1T9TA 2OFHX 3BGFA 1U25A 4DR7J 3CJ0A 5HSPA 1VQ6S 3Q2TC 3N01A 3DRSA 1T9WA 1R6YA 2ASLA 4KBIA 1NZAA 2P5VA 2DISA 3DU6A 4ALZA 1PC5A 2E5GA 4C7QA 3KLGB 4ZCKA 2D3O1 1TQLA 2D9PA 4FNHA 1YBTA 1UWBA 4ECSA 1X9WA 2HBQB 1BQNB 1N5QA 2FVQA 2ZH8A 4J9RA 2DHHA 2AYGA 3TX0A 4F7VA 1NH8A 3JSYA 3A8IA 3KKFA 1NZ8A 3KJNB 3L7OA 2KU7A 4K4ZA 1XIQA 1SKWA 2CNOB 2XM3A 4E98A 3EICA 2C22A 1S6PA 5D3GB 2AGOA 2ZJQQ 1FTCA 4OYWA 3GIRA 3JSMB 3OTEA 1AROP 1EB0A 4DL3A 4L74A 1YG0A 2QRRA 1GTEA 4ZP8A 3PDNA 4DPYA 3QZ7A 5D0EA 1VHIA 1VK3A 4TLQA 2NUUG 4TKTA 1H72C 1AFJA 2JH3A 4NXMJ 2H5EA 1F9FA 2AEFA 2WB4A 2HIQA 3F0NA 3TW0A 3MR3A 2E1PA 1TZ0A 2W7PA 2M4MA 4RUAA 1WC5A 4IOAQ 5D77A 4X65J 4IR1A 3FBEA 2RNEA 2YX1A 3PX4A 3H8YA 2MZJA 4ED3A 3SCLE 2VJUA 4I69A 4H4MA 3V6JA 2C3MA 1Q95G 3C16A 5AXNA 1NDLA 3P49B 3N6NA 4KR0B 3PZPA 4ZPBA 4USMA 2XI2A 3FEYB 3ZXWA 2FLPA 2EFNA 1O51A 2H1YA 2EPIA 4F2RA 2YWKA 4QYZK 4J9NA 1FDDA 3VAFA 3DLEB 4DS5A 1ICEB 4B3TJ 4KKOB 4YDXA 5IT4A 3EJMA 5EWGA 3SQGB 3EMTA 3KMSA 2G13A 3FNNA 3D0HE 2NREA 1BUXA 2KO1A 3EPIA 5DG9A 1K0TA 2QSFA 2J7KA 2DIUA 4OYBA 4RW7A 2XYGB 3ISZA 5EHHA 1DRZA 1UJ4A 2GHVC 1KOHA 1L3VA 4CO2A 1X9MA 2MKJA 3BSNA 4HTIA 4HH0A 3QLHB 3MUVP 3GLJA 2XY6A 1TKZA 1QE1A 1IBMJ 1P9YA 2L3MA 1J5EF 1Q7YT 2ZITA 4QWCA 4ES3A 8ATCB 5CYMA 2VASA 4CM2A 4KGXB 2ACMA 4ILLA 4PUOB 4CCHA 3KLEB 1PILA 1B7YB 2YBVA 2JLGA 4K59A 4KRWA 5CZVA 3VGUA 2WOMB 1VRQC 2EKYA 4NA2A 3OJUA 1URRA 4KPYA 4A46A 1FJ7A 2JL9A 3LPYA 2VG6B 1JLFA 4QIGA 3MMBA 4URQU 4LVOP 3ZO7A 2JNJA 4UW2A 2UVUA 3MGJA 3NGDA 3VTIA 2DNPA 1VBKA 4UTGA 2WAQD 1JNZB 4P9SA 3GV8B 4KFBA 2OPQA 2J0XA 3H5XA 1ZZNA 4OHWA 3TZYA 3BQ0A 1ZM3A 4J9QA 1T05A 2MGZA 1WOOA 4WIIA 5K8MA 1BQXA 2LA4A 2HLTA 4WFYA 3GJRB 4CO5A 3FSIA 3D0GE 3HVWA 4C3LA 2KG0A 1CVJA 4JI3J 4PQUB 5KFOA 4GVBA 2FHMA 3NRBA 1RT4B 1I94J 2UXBJ 3D68A 2FY1A 2Y0BB 2YWFA 1X4HA 4M8LA 3MD3A 2XZDB 4NLVA 5K5MA 4QOTA 4DV7J 2MJUA 1RWNB 4H4KA 2HEKA 3AT1B 3JAMU 2F65A 1OJ4A 4LF7F 4JV5J 4DQSA 1MLAA 3A3PB 4X64F 3ZZOA 5KFNA 3OFGA 1VQSA 2DXEA 3H59A 4ZIWA 1D9DA 6FDRA 3D7SB 1CULB 1RT1B 5LOQA 2HHPA 5IZHA 1C0TB 2ZBRA 1X5PA 2FY8A 2XMWA 3CT9A 2YXLA 3ZFVA
chains in the Genus database with same CATH topology
1KBRA 5ETOA 2CG8A 4M5HA 3ILIA 3HSJA 4F7VA 3HSDA 3QBCA 3HSGA 4CYUA 1RU1A 4CRJA 4M5LA 1G4CA 5ETTA 1F9HA 3MCMA 5ETMA 3UD5A 3KUHA 4AD6A 1IM6A 3ILOA 2BMBA 4M5MA 2QX0A 5ETSA 5ETRA 3HCXA 1RU2A 3KUEA 1EX8A 5ETPA 5ETVA 1RB0A 4CWBA 3KUGA 4M5NA 1RTZA 1EQMA 3ILJA 1DY3A 3HD2A 3ILLA 4CYUB 2F63A 4M5GA 4M5IA 1TMJA 3MCNA 5ETNA 5ETKA 3HSZA 4PZVA 3UDVA 1EQ0A 1RAOA 1HKAA 3UDEA 4M5JA 5ETQA 1HQ2A 3HT0A 1CBKA 5ETLA 2F65A 1Q0NA 4M5KA 3MCOA 3HD1A 1TMMA 3IP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBR A;  5ETO A;  2CG8 A;  4M5H A;  3ILI A;  3HSJ A;  4F7V A;  3HSD A;  3QBC A;  3HSG A;  4CYU A;  1RU1 A;  4CRJ A;  4M5L A;  1G4C A;  5ETT A;  1F9H A;  3MCM A;  5ETM A;  3UD5 A;  3KUH A;  4AD6 A;  1IM6 A;  3ILO A;  2BMB A;  4M5M A;  2QX0 A;  5ETS A;  5ETR A;  3HCX A;  1RU2 A;  3KUE A;  1EX8 A;  5ETP A;  5ETV A;  1RB0 A;  4CWB A;  3KUG A;  4M5N A;  1RTZ A;  1EQM A;  3ILJ A;  1DY3 A;  3HD2 A;  3ILL A;  4CYU B;  2F63 A;  4M5G A;  4M5I A;  1TMJ A;  3MCN A;  5ETN A;  5ETK A;  3HSZ A;  4PZV A;  3UDV A;  1EQ0 A;  1RAO A;  1HKA A;  3UDE A;  4M5J A;  5ETQ A;  1HQ2 A;  3HT0 A;  1CBK A;  5ETL A;  2F65 A;  1Q0N A;  4M5K A;  3MCO A;  3HD1 A;  1TMM A;  3IP0 A; 
#chains in the Genus database with same CATH topology
 4DV3 F;  2I2Y A;  3KJV B;  1RBL A;  1HLW A;  4HT5 A;  2U2F A;  1HMV A;  1NK8 A;  3NGS A;  4NLS A;  1OQ6 A;  5CAA A;  1MU2 B;  2G0C A;  3CCS S;  3I9Z A;  3EX7 B;  3V6H A;  1U1N A;  2G0I A;  3G96 A;  5IV4 A;  3QO9 B;  3VF0 B;  5HAN A;  4CH1 A;  2ZH5 A;  2PFF B;  2YQ0 A;  2AGQ A;  1Z4U A;  3R7S B;  3CMA S;  1SC4 B;  4UZB A;  3AQO A;  4QW8 A;  1QAJ A;  4IRC A;  3N79 A;  1KDN A;  4YN3 B;  2HS3 A;  4EK2 A;  2AU0 A;  3JS9 A;  2HMI A;  2RDJ A;  3Q8S B;  2RHQ B;  1F3F A;  3DGP A;  5KFI A;  1BLU A;  3M8P B;  3F56 A;  2AIR B;  4C8Y A;  1DBD A;  4DQQ A;  4LSZ B;  2LVW A;  4CO0 A;  1YZ6 A;  3MEC A;  1HNZ F;  4DX6 A;  2YQ3 A;  3H5S A;  4D3H A;  5A8W B;  1T9U A;  2Z56 B;  2RU9 A;  1PBA A;  2JOQ A;  4O3R A;  2HFO A;  1WC3 A;  4N5S A;  4OX9 F;  1DTT B;  2DVI A;  2V6A A;  2KH9 A;  4B3S J;  1JLC B;  2HZA A;  3BGR B;  1KD1 T;  1KN6 A;  3FBC A;  4U8Y A;  3K5L A;  1TKX A;  4UUX A;  4LIR A;  4LRC A;  4EO6 A;  2CPD A;  2VDH A;  1IKV B;  1KON A;  2YTC A;  3FCH A;  2BE9 B;  2RB7 A;  3CCE S;  4JI8 J;  2F4V J;  5E2Q A;  5LM7 E;  5IC4 B;  2ZH7 A;  3IFE A;  2HHS A;  4H4O A;  2IMW P;  1BY9 A;  5CQG A;  4NXM F;  2OEL A;  3U02 A;  1NHV A;  1HNX J;  4GO5 X;  2J9D E;  3KK1 B;  1X5S A;  4NYZ A;  1P27 B;  1FRK A;  1SJQ A;  3H25 A;  4QWE A;  4B9L A;  5IT9 U;  1NND A;  2CPH A;  1TUV A;  2XUL A;  1CJK A;  2AHO B;  3HMJ G;  2RUG A;  1A6L A;  5J2Q B;  2ZH1 A;  4JUZ A;  1TMM A;  1RT5 B;  2XEX A;  3X3U A;  2R8J A;  3B82 A;  5KFK A;  1UVM A;  4DCO B;  1GXL A;  3TA2 A;  4JI2 J;  4IKA A;  2J0Q D;  2DR5 A;  4AT1 B;  5FDL A;  1HI8 A;  2Z58 B;  4ZVU B;  4MAK A;  1WI8 A;  4FDF A;  1V3Z A;  3T1H J;  3BS9 A;  1R6V A;  3KK2 B;  4XK8 C;  3BDP A;  4X4T A;  1EET A;  1VK8 A;  4NML A;  1Y0H A;  1TMJ A;  2RQK A;  4OZN A;  3BRE A;  4X4S A;  2MQM A;  3MR2 A;  4JP8 A;  3CSK A;  5KFD A;  4B3T F;  4RW6 B;  3K5N A;  1S9E A;  1FRL A;  3OD2 A;  4DI6 A;  1KTV A;  1LNQ A;  2NSC A;  4J7C A;  5C2C A;  2WK4 A;  1G1X A;  1FFS B;  3PKM A;  1Q81 T;  5FLX Y;  4C0O C;  2HFZ A;  3ZZR A;  5HLF B;  3ZC4 A;  4U7U D;  2DNG A;  4A8O A;  3FC9 A;  2Q1L A;  1RT2 A;  4LSL B;  3R5J B;  4ZOS A;  3VAH A;  3QIP A;  3EDR B;  5JVH Q;  1Q8I A;  1UVI A;  2PO4 A;  3LWM A;  2DR7 A;  3UN2 A;  2WB1 D;  1IBM F;  4K2X A;  2VQE F;  6FD1 A;  3OUY B;  3ZNJ 1;  2LXF A;  3V5R A;  2EFO A;  3BN4 A;  2HHH F;  4D3G A;  3N5F A;  4DCJ B;  1YI2 S;  4Z7Y A;  1CS4 B;  3ZZY A;  3NMR A;  4ZVR B;  1ZM9 A;  3Q23 A;  4KV8 B;  4M5D B;  3GJT B;  2IYI A;  4TY8 B;  4P2X A;  1KRP A;  4ZCM A;  2D69 A;  3ZTR A;  3VAM A;  5G0R B;  3IBC B;  5J2M B;  1FK9 A;  3U27 A;  1N52 B;  4DWI A;  2OSQ A;  2RML A;  2IBO A;  2CQ0 A;  3D1Q A;  1RYS A;  5K9F A;  3G9C A;  3C15 A;  4RR5 A;  1AB8 A;  3BN7 A;  2ERR A;  4X4O A;  4ZMM A;  2VIC A;  1EKR A;  4YR3 A;  5A0Y B;  4LSN B;  2Z2M A;  3CCZ A;  1IBL F;  2I8E A;  3ITH B;  4YB7 A;  1ROF A;  4DQR A;  1PGZ A;  2QLX A;  1R7I A;  3DM2 B;  2XTJ P;  3DYA A;  4JI3 F;  3HSD A;  5E33 A;  1W2I A;  2UXB F;  3PNI A;  3RRK A;  2D9O A;  4DV7 F;  4DUZ J;  1VHF A;  1R0A A;  1MMN A;  1RI7 A;  2LP4 A;  3PIO Q;  1T7P A;  2RT3 A;  1VFJ A;  2R2T A;  2FYX A;  3OBI A;  2GVD B;  4LQ9 A;  5K8P A;  1UJ5 A;  3H4B A;  3IAM 9;  1JJ4 A;  2MKS A;  4NCB A;  4WE1 B;  1DAX A;  4HAC A;  2LQJ A;  4EU0 A;  3MHY A;  2HHW A;  4KE5 A;  3DRS B;  2ZC3 A;  2ZOM A;  2Y1R I;  1Y11 A;  2HS0 A;  3PW7 A;  3GMG A;  4R25 A;  2HZV A;  3NLC A;  4DS4 A;  1UWB B;  1VQ4 S;  5KFZ A;  4RU2 A;  4XDC A;  1NRK A;  1V5I B;  2Z2L A;  4RW4 A;  4RBU A;  2GS8 A;  3K7R A;  1S1T A;  5DGB A;  1B0P A;  4LF2 A;  5KOW A;  1KR4 A;  1VRT A;  5DQG A;  2Y1L B;  1RAH B;  4AND A;  2DH7 A;  1QY7 A;  2B56 A;  3D1H A;  5LJ3 Y;  1S6P B;  4WTO B;  4IUF A;  3G86 A;  2EBG A;  3W62 A;  1VQP S;  3MOZ A;  3T1Y J;  4J37 A;  4O0I A;  2K3K A;  4WP3 A;  2VD3 A;  2XHC A;  1LW2 A;  4OZ0 A;  5DRK A;  4F0K A;  1S4E A;  2YNF A;  3H20 A;  4DV6 J;  2KB2 A;  1CC7 A;  4O3S A;  2CWK A;  4NCG A;  1ULR A;  2M70 A;  2OH2 A;  1NB2 A;  3CJQ A;  4A8S A;  2XZT B;  3V6D A;  4P74 A;  3CCJ S;  4ZHR A;  1WDT A;  3N4W A;  5D0H A;  4DF8 A;  1E6Y B;  1J5O A;  2G1H A;  2KYX A;  4ZLN A;  7AT1 B;  4F67 A;  5A8K A;  1JXV A;  1N54 B;  1AYE A;  3CXC R;  3VAK A;  3CME S;  1HBU A;  1KQK A;  1H38 A;  2ZH2 A;  3RAM A;  3GYG A;  4I0W A;  3WQP A;  3AD8 C;  4CO4 A;  2CNK B;  5IFM A;  3EGZ A;  3VAI A;  1TEL A;  3N5B A;  2KN4 A;  2LQ8 A;  2ASD A;  1PYT A;  3FFI A;  1X31 C;  3HHD A;  4I6A A;  4ZCI A;  1HI1 A;  4H4M B;  2GNK A;  4JI8 F;  1N5Y A;  3C16 B;  2F4V F;  4DPW A;  3MOJ B;  2F4F A;  4OHZ A;  2WZ1 A;  2M2B A;  1CJU A;  4U7C A;  3MAA A;  4N77 A;  3IN5 A;  1N32 J;  4ZLJ A;  5IT0 A;  1NSQ A;  4NI2 A;  5KTQ A;  2YNH A;  2MQN A;  2MMY A;  3CJ5 A;  5J1N A;  3GR0 A;  2ZKU A;  4L6V 3;  3MR7 A;  4EBC A;  2JLE A;  5KT3 A;  3OL7 A;  4CLZ A;  5DZ7 A;  4RNM A;  2RRN A;  4LRD A;  3DOK A;  2AMC B;  5C5J A;  5SUH A;  3AJ1 A;  4GO7 X;  1UWA A;  4YY3 J;  4DSI A;  2A2D A;  1NK0 A;  1LWC A;  3QZ8 A;  2MKI A;  4RW7 B;  1RCX B;  2QG9 B;  4FXD A;  3K5P A;  1VIS A;  3KG4 A;  4JI2 F;  2HK2 A;  4IQM A;  2XMA A;  3T1A A;  4GC7 A;  2HAF A;  4CWB A;  2HFV A;  4I4B A;  2HAI A;  2IA6 A;  3H0P A;  3MPU B;  4ZPD A;  3OTO F;  2OMO A;  1KFS A;  1TKZ B;  3HHL D;  1QE1 B;  3T1H F;  2FZG B;  3HHK A;  3RR8 A;  2R7V A;  1MWQ A;  5AXM A;  3QMQ A;  1KSP A;  2L08 A;  5CYM B;  3UWT A;  2WON A;  2DCU B;  1S12 A;  2KVQ E;  5FII A;  2XCP A;  1KOO A;  2QZ8 A;  1FVS A;  1FXD A;  2XSJ A;  1IR1 A;  1J27 A;  1AUS L;  4DSF A;  2BJD A;  3HKZ D;  4DU7 A;  5U47 A;  8AT1 B;  3BGL A;  3O1L A;  3T41 A;  4NRT A;  3SMZ A;  1ZYQ A;  2JEJ A;  2CDQ A;  1JLF B;  3DC2 A;  2BJ7 A;  3MMB B;  4TU8 A;  1K1S A;  1WHY A;  1HW8 A;  3O2I A;  2POK A;  4UY8 5;  4DV2 J;  1IKY A;  1LWE A;  1P8G A;  1X4A A;  4Q5V A;  2HBZ B;  3OXG A;  2OPQ B;  3F73 A;  2IAJ A;  5E3A A;  4USW A;  1QAI A;  3OLB A;  2BM1 A;  2EK1 A;  2Z2Z A;  1FFW B;  3ISN C;  1T05 B;  2MGZ B;  3MUM P;  3U1L A;  3ZTO A;  5F3T A;  3KLH A;  3RG6 A;  4FF4 A;  5CCL A;  4NAS A;  1RKJ A;  4GVB B;  1MWZ A;  4LFB J;  4WP8 A;  1N0U A;  3GV5 B;  2VC1 A;  3R6L B;  2H5J B;  2GHP A;  1NSA A;  3CUL A;  1KP6 A;  2B5J A;  1B7F A;  2MJN A;  1E6V A;  1S77 D;  4OLO A;  4ZPA A;  2CPX A;  1U0H A;  4LF9 J;  1URN A;  1F5C A;  3RRG A;  3P4U B;  5ADZ A;  4KQZ A;  3QJJ A;  1YKW A;  4A4J A;  2PT0 A;  2FQQ B;  3RW7 A;  4CI0 B;  2BAB A;  4KH0 B;  4YDD B;  1F60 B;  3THP A;  1SL0 A;  1FWL A;  2LEP A;  4N8N A;  3AOD A;  4F0H A;  2DNY A;  1HMV B;  3MCO A;  2PN6 A;  3IP0 A;  1Q5Y A;  4FF2 A;  5J2N A;  2AJF E;  2ZDO A;  4WXO A;  4LR9 A;  5HAT A;  5LSR A;  2W25 A;  4BS2 A;  3IS9 B;  2VPW B;  2RIJ A;  3GJS B;  2BW7 A;  2Z2Y B;  1LXJ A;  1WG4 A;  4C8L A;  1GEH A;  5KFQ A;  1UPM B;  3FQL A;  2B7B B;  2HMI B;  3JYT B;  3FZ2 A;  1EQ0 A;  2LEB A;  3CCL S;  2UV8 A;  5A8R B;  4ZVF A;  3ZZZ A;  3DGP B;  3G6X A;  1HBO A;  2J0W A;  2EFV A;  3VAG A;  4QR2 A;  2AD9 A;  3RUB L;  1FJE B;  2W8K A;  3PXG a;  4MYU A;  1FNO A;  2W4D A;  1FNX H;  2KYZ A;  2E1C A;  3K59 A;  2JVO A;  3LF0 A;  2QJ3 A;  2VOP A;  2JC0 A;  1RWV B;  3O6Q A;  2N7Y A;  1U1M A;  1S7H A;  3V81 A;  3O5T B;  3MEC B;  2DHG A;  1V5V A;  3W2W A;  3O3L A;  2BX6 A;  4TU9 A;  2LMI A;  3G8Q A;  2IM2 A;  2RQC A;  2GMH A;  1XNQ F;  4OJ1 A;  1CLF A;  4ANE A;  1WTB A;  3T1Y F;  3MZI A;  2QTW A;  2B8Q A;  5F0U A;  2GIF A;  1ZOT A;  1WJ9 A;  4QWB A;  1Z2Z A;  4N56 A;  2NPI A;  1FE4 A;  1Z2L A;  1EX8 A;  2CQ4 A;  4LJM A;  2WW4 A;  4J9L A;  1TKX B;  3J7A 1;  1CQN A;  2QL9 B;  1M1G A;  4CT9 A;  1DJ0 A;  5HMY A;  1V3S A;  2R3V A;  4OHY A;  5L1K A;  2IY5 B;  3MCS A;  1WNE A;  1Q78 A;  4H4O B;  4YOE A;  3KHG A;  3RTV A;  4DF4 A;  5DS7 A;  5J1E A;  4LRF A;  4WF9 Q;  4KH1 B;  2XI3 A;  2EG1 A;  4O23 A;  2C2E A;  2FD2 A;  1WSR A;  1MRO A;  5E3Q A;  5A6P A;  2VB6 A;  1VQ9 S;  2YKN A;  5HQL A;  1CJK B;  5HJX A;  3QJL A;  2EC0 A;  4O4G A;  2F8M A;  3NS6 A;  5HL7 Q;  3BSC A;  1YBU A;  4Y2K A;  1OY8 A;  1DQ9 A;  2PC6 A;  3GFZ A;  2MLY A;  4R5P A;  1O0P A;  3ENA A;  2CZV C;  4M5H A;  2PDA A;  4ECZ A;  2C2M B;  2FC8 A;  2E9T A;  3BGU A;  1WEY A;  3SSR A;  1O5J A;  4GVL A;  3MM7 A;  3WX8 A;  4WCE Q;  3QRQ A;  1HNI A;  2OEJ A;  2VKR A;  3EYZ A;  5EN1 A;  2RUS A;  3UD3 P;  1EET B;  5RUB A;  3ZTP A;  3C46 A;  4LF5 J;  4KGV B;  2DY1 A;  1RQ0 A;  1EIY B;  3QWU A;  1S9E B;  2UXC J;  2K7J A;  2K7K A;  1HL6 A;  4FN5 A;  2V50 A;  1R0B G;  2O01 C;  3CCW A;  3EM1 A;  2QV6 A;  1K73 T;  2COL A;  3CJ3 A;  1TP7 A;  4GKJ J;  1A0O B;  3KOA A;  1QJH A;  4K4X A;  4QBU A;  5LSO A;  1XQI A;  2RS8 A;  2W2N P;  3QIP B;  2VFS A;  5F8N A;  2C2K B;  3FDS A;  4OYA A;  4PXD A;  3LP1 A;  1SH3 A;  1UAW A;  3ETO A;  3BBB A;  3AOA A;  4F50 A;  4W4M A;  3IR7 B;  1P1L A;  4JBC A;  3QQC D;  2YX4 A;  2ATC B;  1HNW J;  3NS5 A;  1S6U A;  2IC3 A;  4X62 J;  2HUR A;  5BYR A;  3FEZ A;  2OIH A;  1S0M A;  2W2O P;  4F25 A;  1HWL A;  1YJW S;  3W5X A;  3M6U A;  2W1B A;  2QA1 A;  3TAP A;  3NG8 A;  4NE9 C;  4M5L A;  3W9J A;  1WC1 A;  1FK9 B;  4I64 A;  2W2P P;  2ZBC A;  3CO9 A;  4DV2 F;  1PYS B;  5HMW A;  5LMN F;  1CBK A;  3RAX A;  3F41 A;  1WAC A;  3C15 B;  4YME A;  3Q83 A;  3R9L A;  3U1N A;  4RNF A;  2J76 E;  1LWF A;  4PRF A;  1Q7L B;  1RT3 A;  2RKI A;  3HT3 A;  3FVY A;  3WDO A;  1DFD A;  3KXD A;  2CXE A;  4HI1 A;  4J9O A;  2PMH A;  3IAS 9;  3DDK A;  2J9C A;  2ZVI A;  3DYA B;  4NLG A;  3CD6 S;  2AX1 A;  4LFB F;  2B9W A;  4PXE A;  1U4B A;  4Q0B A;  5GAD I;  3CD0 A;  3JAM Y;  3PFE A;  2ZE2 B;  3Q8Y A;  1RAA B;  1R0A B;  5M2P A;  2FPH X;  3SFG A;  1NSK L;  3DNC A;  2R7X A;  4ZKA A;  3FRY A;  2OPR A;  4S0M A;  5ITH A;  2X1F A;  2P6S A;  1NJZ A;  1RBO B;  3CD7 A;  2I9S A;  4HAC B;  2EG2 A;  4C8N A;  3K89 A;  4RW9 A;  2R8G A;  1F2G A;  1K0V A;  2DNL A;  2BEF A;  2E5J A;  5LL6 d;  2OJ3 A;  3H40 A;  4DL7 A;  2CQH A;  1JLE B;  2GV1 A;  1C2P A;  1TAU A;  2LCW A;  4DFK A;  5KFT A;  3PW0 A;  5ETP A;  1QSY A;  2LQ5 A;  2DXF A;  3O44 A;  3M8Y A;  2Q66 A;  2D3Z A;  5CD4 H;  4RW4 B;  2PSZ A;  4B3R F;  1S1T B;  1VRT B;  4N8O A;  4YHH F;  1KNZ A;  2J8S A;  1XWL A;  2BZ2 A;  4ID8 A;  4FKY A;  4NLX A;  2XMU A;  4KT0 C;  3PM9 A;  2FHK A;  3MMC A;  1XN9 A;  1JXL A;  1M5H A;  1X4G A;  4DR3 J;  3J7Y I;  2IMO A;  1OY6 A;  3TYT A;  8RUC A;  2FTR A;  2DTJ A;  2F40 A;  1NK5 A;  5C24 A;  1LW2 B;  2CPY A;  3I96 A;  1TFY A;  2YNF B;  3JTP A;  3GON A;  2KM8 C;  2LQB A;  4NCG B;  5CH7 B;  3MM8 A;  4NZ6 A;  3EDQ B;  2DGT A;  2CG4 A;  1RHU B;  1OSC A;  3QT8 A;  1BWV A;  3NBP A;  4RZR A;  3V6D B;  3M2R B;  4ZHR B;  3CE8 A;  2MHE A;  2QX0 A;  4CNY A;  1UMJ A;  1NJI T;  1X4F A;  1VC5 A;  2IDL A;  4K0K J;  3MR6 A;  4KHR A;  1ZTW A;  2EI5 A;  5A8K B;  3T6B A;  3N6M A;  3PW5 A;  1BQN A;  3SSS A;  3HHL A;  2D3U A;  2GC8 A;  1FTR A;  1T03 A;  2WHO A;  3VHQ A;  1FCA A;  1N88 A;  3RGI A;  4C48 A;  2MQQ A;  2G2O A;  4UF4 A;  3NWG A;  1NM2 A;  3ZTQ A;  4DL2 A;  2EKN A;  2W7A A;  1UVK A;  3PJW A;  4OZ2 A;  3FFI B;  1FVQ A;  1EAY C;  4ZVH A;  3UW1 A;  3CCM S;  1N5Y B;  3D3C J;  1ITP A;  2XLK A;  3EZU A;  1M5P C;  1PG5 B;  2AZ3 A;  3C6T A;  1QM9 A;  1TL4 A;  3L95 X;  1B70 B;  4M95 A;  2DNK A;  4X4R A;  3OL8 A;  4Q8F A;  1RYR A;  1CJU B;  4MTP A;  4LBH A;  3VQS A;  2FJW A;  3MAA B;  2VV5 A;  2NLW A;  1NJX A;  3OW2 R;  1YJR A;  4K5S A;  2I0X A;  5E41 A;  2YNH B;  2QGF B;  5EDW A;  3AXK A;  3G6E S;  2BXJ A;  2ZD1 A;  2RVJ A;  2UUA F;  3D9B A;  2OKQ A;  4DV5 F;  1U1O A;  2J0S D;  2O1P A;  2HHX A;  3DOK B;  5DLG A;  1T9X A;  4ED0 A;  2E7V A;  1MMD A;  1RTD A;  4FVC A;  5DJB A;  4DV4 J;  2BOP A;  1PJ5 A;  3PX6 A;  4ZIV A;  1LWC B;  3BF4 A;  4EBD A;  2XLI A;  1C4A A;  3M05 A;  1NKB A;  2AJ1 A;  2PI5 A;  4CP5 A;  2VUG A;  1FT8 A;  2KTQ A;  4JI7 F;  3I0S A;  5CYJ A;  2C2Z B;  1HYS B;  2IRU A;  5JXS A;  2DRA A;  3OQ2 A;  1XBW A;  5F8I A;  1Q79 A;  5A2Q Y;  2F8E X;  2AF6 A;  3CJ8 A;  3D28 A;  4U95 A;  4CDI A;  4LF4 F;  2J9D A;  5L8R C;  3TUZ C;  3DMJ A;  4A8Q A;  2WON B;  2XYP B;  4PR6 A;  1IWA A;  5I3P A;  2Y1J A;  2DEJ A;  4JB8 B;  3AQP A;  4PXC A;  2XSJ B;  3MPW A;  4RWX A;  3VVT A;  2HS4 A;  2VG7 B;  2ZH4 A;  4GKJ F;  1TL5 A;  2AT1 B;  3DLE A;  3VVU A;  3K5M A;  2C2R A;  1S97 A;  1U6Z A;  2IYG A;  4P2F A;  1VQL S;  3OT9 A;  3C14 A;  4PEO A;  4AXI A;  2BM0 A;  1IKY B;  4HLB A;  3A12 A;  4ECW A;  3HJV A;  3SCK E;  3KJQ B;  1WEL A;  4IDK A;  4NCA A;  1NKE A;  2IAJ B;  1VGY A;  4MMO A;  3TJ8 A;  4RX6 A;  4P10 A;  4NYP A;  2Q6B A;  1RWO B;  4B3O A;  4HL9 A;  1C4C A;  3EGV A;  3K5O A;  4X62 F;  5L9N A;  2W4C A;  4DX5 A;  2WCX A;  3KLH B;  4JV1 A;  1W7W A;  5DQI A;  3OR1 A;  3T9N A;  1LXN A;  2HFU A;  3CCU S;  2CQP A;  4OI6 A;  2AW0 A;  3SZ2 A;  3BDE A;  1D9F A;  2RQM A;  3TR5 A;  4HHU A;  2DIT A;  2OEK A;  3HM9 A;  2MTL A;  1IQZ A;  1RHQ B;  2B5J B;  1N56 A;  1E6V B;  3GZ7 A;  1U0H B;  2R2U A;  4DN9 A;  1BGX T;  2VHG A;  2JVR A;  2FVR A;  1UVJ A;  5B08 A;  2WBR A;  4MKB A;  2OI2 A;  3VZH A;  4C11 A;  1N48 A;  2X1A A;  4LUB A;  2DNH A;  3BBF A;  1S57 A;  1FF2 A;  4DXL A;  2G2Y A;  4OYO A;  4X4U A;  3M8S A;  3A1Y G;  3D2W A;  1ZTT A;  3HK2 A;  1YJT A;  1AA1 B;  3AY0 A;  2DK2 A;  4RUC A;  4KY3 A;  1VBX A;  4A8W A;  4EGL A;  1JK9 B;  5IXU A;  1ZA2 B;  1ZZF A;  5L1I A;  2DO4 A;  5J2N B;  2WVB A;  3OR2 B;  4WFB Q;  2MKC A;  4PQU A;  2WW8 A;  5GAG I;  3HPO A;  2WSC C;  1L3U A;  1RT4 A;  3KUE A;  4ZPC A;  3EVW A;  3QGH A;  1CJV A;  2J7U A;  3NOC A;  1K1Q A;  3QAT A;  1VR6 A;  1RWM B;  2AYE A;  4X2B A;  1X0F A;  2VG5 A;  2MKY A;  2LXI A;  2KXF A;  4QPX A;  3VWS A;  4A8K A;  5AJ3 F;  3UDE A;  3QNW B;  1IQT A;  1HD1 A;  2PA8 D;  2CJY B;  1WTF A;  1XNR J;  4U9R A;  2DYA A;  1IBK J;  5DDP C;  2MQP A;  3PJX A;  1RP5 A;  3IBW A;  3V81 B;  3GTY X;  2IIH A;  4AL7 A;  1RGV A;  1Y5I B;  1RIS A;  2J6S A;  2FVC A;  3GR1 A;  3S01 A;  4FYX B;  3N6L A;  1VQY A;  2I6W A;  1WKK A;  3B54 A;  2D3O R;  4DR3 F;  3W9H A;  4O3N A;  1XR6 A;  3CUN A;  2O5D A;  4NLP A;  4OJH A;  2K2P A;  4XDD A;  1SQF A;  4RKU C;  2CG8 A;  1U24 A;  1QSS A;  3K8V A;  2LFV A;  2Q43 A;  5H9E J;  5KG1 A;  1MW7 A;  3PTW A;  4FS2 A;  3LP0 B;  4JI1 J;  2ZZT A;  3TQE A;  2RE1 A;  1NCL A;  1GMW D;  3BH6 B;  2JFD A;  3MAH A;  4HHH A;  2EEY A;  4C8K A;  2GIR A;  3M8P A;  3M8Q A;  3TAQ A;  3GB0 A;  4WU3 A;  2E9R X;  3KDN A;  5J1E B;  1VBZ A;  2F5G A;  4UQT A;  1RLC L;  2GO8 A;  1MRO B;  1NK4 A;  5HK4 A;  1TL3 A;  2QMW A;  1FWK A;  2YKN B;  4JI4 J;  2R4F A;  3A13 A;  4O4G B;  4LFC J;  3RU0 A;  4DPX A;  3J7A N;  1DTT A;  1NK7 A;  4DX8 H;  4R5P B;  1RA7 A;  3GFY A;  4F8R A;  4NA1 A;  4DV0 J;  4URG A;  1KHV A;  2ATL A;  1BHN A;  3PHE A;  3MM7 B;  3Q8Q B;  3TAM A;  5EWF A;  2DD8 S;  1BE4 A;  1HNI B;  4PG4 A;  1BXN A;  5ETS A;  4OHV A;  3Q22 A;  4WK1 A;  5DM6 Q;  3UR3 C;  2B0G A;  2D74 B;  1T3O A;  3VR1 A;  1REV A;  2DBB A;  1DLO B;  2Q79 A;  5BJR A;  5LMU F;  2CNL B;  1GFW B;  3MR5 A;  2HW3 A;  2DJW A;  1RAO A;  1XMB A;  1SJF A;  2BJ9 A;  2Q6C A;  2CZ9 A;  1ZAV A;  1F2H A;  5KG6 A;  7FD1 A;  2CPE A;  4DZD A;  4MKV A;  4DPT A;  3TAN A;  1RHR B;  3AA8 A;  1Y4Z B;  3RRH A;  4FYW B;  5B0B A;  3LP1 B;  4ETZ A;  2RF2 A;  1RTJ B;  3QFH A;  1NJY A;  3CDW A;  4DSE A;  1S59 A;  2GGP A;  2E5H A;  4WFZ A;  2KT2 A;  2CQD A;  3EUN A;  4OYX A;  2IC3 B;  3P6Y C;  2HVH A;  1Y10 A;  3DOL A;  3T5J A;  2DGU A;  1WHW A;  3HVA A;  1ZH5 A;  2GVZ A;  3CCQ S;  4CZC A;  1XK8 A;  1UFW A;  2EWH A;  3EXY A;  3K58 A;  2M8D B;  5CAB A;  1F9E B;  1PAU B;  3WC2 A;  4CLS A;  4KAI A;  5ETQ A;  1WOR A;  1DTQ A;  4DN0 A;  1SKU B;  3DFE A;  5AXK A;  2ADC A;  1GTH A;  3UD4 P;  4DL6 A;  1PYO B;  2ROG A;  1N5S A;  3G82 A;  4K50 A;  2NR0 A;  4QPT A;  3Q24 A;  3DKD A;  3ENV A;  3UCG A;  5H9F K;  3PYF A;  4L3N A;  4UT4 A;  1LWF B;  2FJB B;  1RT3 B;  2J6U A;  2RKI B;  4FZV A;  3JQJ A;  4WYL A;  1L3S A;  1TK8 A;  4TY9 A;  2ILZ A;  3I31 A;  2BE2 A;  3DHX A;  1NO8 A;  4HI2 A;  3R27 A;  4NYO A;  2GQ2 A;  3R5D A;  2VF3 A;  2OEM A;  1UEU A;  4C3M A;  4LVN P;  4Q0B B;  3M30 A;  4QYR A;  3KWM A;  4LF1 A;  2JFK A;  4DV1 F;  4OX7 A;  2FJE B;  1S49 A;  4KHP J;  3JQK A;  2OPR B;  2OTL S;  2J5A A;  2DH8 A;  4X4P A;  2PMZ D;  1CPZ A;  1RTZ A;  2R7O A;  2YH1 A;  3R7B B;  4RW9 B;  4Y65 A;  3GJQ B;  3NY0 A;  4F3M A;  3VCD A;  2PA3 A;  3P45 B;  4IQX A;  2PI4 A;  4LRA A;  3MF5 A;  4XO0 A;  2YNI B;  4IO9 Q;  4HH1 A;  2MB0 B;  4P7T A;  4ZPW R;  5IC6 B;  4P73 A;  1WKJ A;  4YFU A;  4V19 X;  4WWS A;  1G6B A;  2OTJ S;  3B4M A;  4FPR A;  5CXT A;  4IOC Q;  2OPP A;  4LBP A;  3GG0 A;  2NXJ A;  2B4V A;  1SUQ A;  4JI5 J;  3PVX A;  5IWA J;  2WRM A;  1SQG A;  1SJ3 P;  3KHR A;  4CLU A;  1TAQ A;  3MUR P;  4PG8 A;  2RRA A;  5AE1 A;  2Y0S D;  4NRU A;  3MED A;  4PAA A;  1I51 B;  3MMC B;  1ZBT A;  1KEK A;  4KC5 A;  1YRT A;  4HTJ A;  3L3C A;  4AL5 A;  4CTA B;  3G4S S;  3ILO A;  3ZZP A;  1UA1 A;  1RE1 B;  1MWY A;  4JOU A;  1OS5 A;  5C24 B;  4RUB A;  3VGV A;  2DRD A;  2GVD A;  3MM9 A;  2C3U A;  4X66 J;  1FJC A;  2QYC A;  3BPD A;  2EFG A;  5HVF A;  4HT7 A;  4LR7 A;  2X51 A;  3MM8 B;  1RAB B;  1RHM B;  4M94 A;  3NBP B;  1XNR F;  1IBK F;  1BWE A;  3R5C A;  1XMQ F;  4DLG A;  2BVZ A;  3TI0 A;  2H3E B;  3PO4 A;  4RO0 A;  5D0G A;  5F8G A;  1U1R A;  2YX7 A;  2XMT A;  2B4O A;  2QO3 A;  5HAO A;  2JX2 A;  1K44 A;  1XMO J;  3HHL B;  1T03 B;  2CPF A;  1KC8 T;  1Q5V A;  1VIX A;  2L9N A;  4ILM A;  4OIX A;  3KUG A;  3DLH A;  2RD5 C;  4CO3 A;  3OXF A;  4IG0 A;  1H3D A;  3C6T B;  2CZ4 A;  2D7S A;  4UST A;  2GA7 A;  1OQ3 A;  4N76 A;  3P96 A;  4EUV A;  2ILY A;  2ZD1 B;  1TKT A;  2YKA A;  1FKO A;  2XSF A;  4ICL A;  4MFB A;  3PCO B;  1E6Y A;  2MKK A;  3FSX A;  5DDQ C;  4K5R A;  1OO0 B;  4USI A;  2QT7 A;  5KG5 A;  4KJI A;  1FER A;  2BKN A;  2BOA A;  1RTD B;  3KG0 A;  2V4Q A;  1T02 A;  2GCF A;  4QIW D;  4M5N A;  1XC9 A;  3HZE A;  4K4V A;  3D0I E;  3G8S A;  1QUV A;  1L3K A;  2J7W A;  2CPI A;  2KL8 A;  3MM5 B;  4ED1 A;  2L41 A;  3W3S A;  3I0S B;  3KNG A;  3MTK A;  4UY8 T;  3D67 A;  4DV0 F;  4CYU A;  5KFV A;  3M4X A;  2I5J A;  2JSX A;  4PWW A;  3QAE A;  2MQL A;  3C19 A;  4X4Q A;  4CT8 A;  2XZW A;  2HNY A;  1PIE A;  2NZ4 A;  2L48 A;  1SB6 A;  4RU9 A;  1GMV A;  2AWZ A;  1MN7 A;  3DMJ B;  4OJ3 A;  5T7L B;  1YIT S;  5GAH I;  1S9G A;  2HGN A;  3ISN D;  2CQC A;  1VQK S;  4LF6 F;  2CVI A;  4ZPV R;  3UDV A;  4ED7 A;  1PJ7 A;  4NXN J;  4I2Q A;  1RT7 A;  5KT5 A;  4X4V A;  3B4D A;  5KT7 A;  1VI7 A;  3HCX A;  1ZAW A;  3CD5 A;  2CJX B;  3C14 B;  3M32 A;  3M8R A;  4TVA B;  4PCQ A;  4DCP B;  2DNO A;  3AB2 B;  3W64 A;  4QWA A;  1GXU A;  5F8H A;  4N41 A;  4IDK B;  2C2D A;  5L46 A;  2B9E A;  2ZFH A;  2DNR A;  2CYY A;  4ID5 A;  3F44 A;  2FJX A;  3IBF B;  4P2S A;  3TNV A;  4B3O B;  4WPA A;  4TU7 A;  4DFJ A;  3AHP A;  3OVA A;  2IM1 A;  5KG3 A;  4P52 A;  3Q8P B;  5CA5 A;  2UVV A;  1VIO A;  4KIA A;  3OR1 B;  4LIW A;  2W2Q P;  4LQ3 A;  2KRB A;  2J9E A;  1SBR A;  2CJA A;  1U49 A;  4I1T A;  2UU9 J;  5MLC V;  3GYX B;  3CIM A;  2HND B;  9RUB A;  1X7V A;  2RIL A;  1X4C A;  3H90 A;  3IG1 B;  1D3W A;  2ZH6 A;  3M2U A;  4DOZ A;  3HD1 A;  5GMD A;  1H2V Z;  3IRW P;  2CQ2 A;  2KVI A;  3HUL A;  2GZO A;  2NCK L;  2HVI A;  2WVC A;  4C11 B;  1VBY A;  4WBF A;  3B6B A;  1UA0 A;  2H48 B;  2N4D A;  2FGO A;  2H4Y B;  4ZVT B;  3NWR A;  4ZVE A;  2M5Y A;  4UOC A;  1HWJ A;  2BMB A;  1VDH A;  4URS A;  2BR0 A;  1PCA A;  2AZ1 A;  2XMK A;  4OYZ A;  4RBT A;  1NB7 A;  2CA9 A;  4B3M J;  2BKO A;  3BV8 A;  1Q86 T;  1ZA1 B;  5HQ8 A;  1RBA A;  3P3D A;  1FX4 A;  2VPY B;  5DG7 A;  1FX2 A;  4K2J A;  1HWK A;  2M88 A;  2KKH A;  1GH8 A;  5K14 A;  2HBR B;  4ECX A;  2ABY A;  5D4P A;  3DRX A;  2GAG C;  2XYH B;  1KFD A;  1CJV B;  1GMW A;  2K3I A;  1WD6 A;  2UUC J;  3K57 A;  4ZVG A;  4IH7 A;  4DSJ A;  3EZO A;  1S0O A;  1GQE A;  2WVE A;  2VG5 B;  3HHE A;  4LMZ A;  3PW2 A;  2HWI A;  3M6X A;  3AJ2 A;  3ETM A;  1DAR A;  1S1X A;  2EVZ A;  1RXO B;  3FGV A;  5ETK A;  5HBM A;  4MKA A;  1YLX A;  4Z37 A;  2MYF A;  4G1Q A;  3JB9 k;  2VA2 A;  4R0E A;  3MPV A;  2XC9 A;  2A1B A;  5DDR C;  4Y2C A;  1U09 A;  3J7Y U;  2B7C B;  5FLX U;  2BQ3 A;  1JXE A;  3Q8V A;  3H7H B;  3AA9 A;  2LU2 A;  5CYQ A;  2XNR A;  1IUJ A;  1HQU A;  3POT A;  3R97 A;  2VC0 A;  3E2E A;  3IS9 A;  3DOM A;  4F4A A;  2BQU A;  3I5B A;  1Q8K A;  4IRK A;  1CJT B;  4DR7 F;  4FYD A;  1GX5 A;  2V4R A;  4WFA Q;  4WKY A;  3NOG A;  3P8B B;  1YJU A;  2YNG A;  2N7C A;  4DR6 J;  3JYT A;  4ED2 A;  4F04 B;  4YS2 A;  1XTZ A;  5A8R A;  2YY3 A;  5B0D A;  1QDU B;  2YKM A;  3RBD A;  3OHB A;  4HHJ A;  3M8Q B;  3SV4 A;  1X4D A;  1UW4 A;  2QE5 A;  2G9O A;  2UUT A;  1XMO F;  1TL3 B;  1H73 A;  3C2P A;  1W25 A;  2DCL A;  2QLF B;  3QGP A;  5B0A A;  2HQG A;  2XB2 D;  1RAG B;  1B3T A;  1TFW A;  2JEG A;  1IN0 A;  1H0H B;  1T11 A;  2BE7 D;  1M5V C;  4B02 A;  4FXW A;  2LU1 A;  4NEY A;  4G3I A;  3K17 A;  3TAM B;  1YSJ A;  2X3D A;  3FMW A;  3LAK A;  2GW8 A;  5L1L A;  2ADB A;  2IHR 1;  3L7U A;  1RTI A;  2KHD A;  1HW9 A;  5E7O B;  3DLK A;  2ZUG A;  3NXZ A;  3D66 A;  2DGW A;  1TVR A;  3TQ1 A;  2RHS B;  3CWJ A;  1IR0 A;  1REV B;  2KZM A;  3GU0 A;  3E01 A;  4ES2 A;  1SH2 A;  5E3R A;  2E1R A;  1S0N A;  2YH0 A;  5F0W A;  2MZT A;  1YRX A;  2VL1 A;  1KHW A;  1NPP A;  2UVR A;  1YRU A;  4PWU A;  2BRK A;  5E5N A;  5KFS A;  4DR1 J;  3UD5 A;  4X65 F;  4ETX A;  1QTM A;  2GMJ A;  4Z7C A;  2JEI A;  5HP1 A;  1XER A;  2OGU A;  1H2T Z;  2V9K A;  3ENW A;  1JLA A;  4BWM A;  5KFX A;  1RTH A;  1C0U A;  4I6W A;  2RF2 B;  3BYR A;  4C4W A;  1F1B B;  4IFY A;  5LJ5 Y;  2NXC A;  1FRI A;  2GGP B;  4K4W A;  2H4W B;  3DDN A;  1RA6 A;  2ZOF A;  2QN6 B;  4BWJ A;  2AV5 A;  5KFM A;  1XR7 A;  4NXN F;  4C97 A;  3DOL B;  2HRU A;  2GVZ B;  4Z2X A;  4YP3 A;  1UEV A;  3J7Z 5;  3TA0 A;  3WZ0 A;  2DH9 A;  5CCM A;  4USH A;  1OWX A;  2V68 A;  4GC6 A;  4UUW A;  2XGP A;  1DTQ B;  4UQG A;  3LQV A;  3I4H X;  2MEW A;  2D1C A;  1S6Q A;  3CJT A;  4KPC A;  4NLO A;  1S1U A;  1NKC A;  1UVL A;  1AW0 A;  1NJW A;  2HGM A;  3G82 B;  1NH7 A;  3TO8 A;  2ZM6 J;  1HPZ A;  5KFH A;  5J2P A;  1FI4 A;  3DLL Q;  5KFG A;  2B9Y A;  3AD7 C;  2E5I A;  3ZNU A;  2ASJ A;  2FJD B;  5GVQ A;  2B4P A;  2QA4 S;  2IRX A;  3KHL A;  2DNQ A;  4WKR A;  2B51 A;  2BE2 B;  1FDA A;  3UN3 A;  2HKE A;  1VQ7 S;  4RNO A;  1H6K X;  4K7Q A;  4Q43 A;  1R27 B;  3DLG A;  3HVT A;  3M30 B;  2YPY A;  3I4P A;  4ZN1 A;  2M8H A;  2RU3 A;  3GCW P;  5KG7 A;  5T41 A;  3FSY A;  2W9A A;  3GIJ A;  4M5G A;  1UCN A;  1BC6 A;  4FF3 A;  4TNO A;  3W60 A;  1VRU A;  4DFM A;  3UPF A;  3OPK A;  4C3K A;  1X8D A;  3K2Y A;  3UN5 A;  1YK9 A;  2JJ4 D;  1LW0 A;  4I2P A;  1HWI A;  2JRS A;  4B9M A;  1T9V A;  1MSW D;  4BHQ A;  2QMU B;  4I7F A;  3CCV S;  4B9U A;  4MIA A;  4OFZ A;  1V9O A;  2OPP B;  5GAG U;  2DGO A;  1V3R A;  1QVG R;  1SUQ B;  3L4B C;  2DR9 A;  1SL2 A;  3HFZ B;  2EFP A;  3KLI A;  4DLE A;  3R8Y A;  3P5T L;  2Y8Y A;  1VYA A;  1YQH A;  2HIY A;  1T9Y A;  3CW2 C;  1I94 F;  2WSF C;  1U2R A;  3RR7 A;  1OSD A;  3MED B;  2AGP A;  1S79 A;  1HR0 J;  2ZE2 A;  3LO3 A;  2FVS A;  1J5E J;  3GV7 B;  2GO9 A;  4NA3 A;  2HHT A;  4TN2 A;  3MM9 B;  4EO8 A;  2QSW A;  1NAQ A;  4JV5 F;  1R43 A;  3V4M A;  4FPI A;  1Q8L A;  2MZR A;  2NPF A;  2FUG 9;  3MTJ A;  3CJ2 A;  2ZBI A;  1NPR A;  3ILI A;  4ATN A;  1C1C A;  1KVJ A;  2CUY A;  5B0F A;  1JLE A;  2ZBP A;  3HDS A;  1HAR A;  1HBM A;  2C3P A;  2BJ8 A;  1U2C A;  4RWW A;  4F36 A;  3UNG C;  4KTQ A;  3H2U B;  4ECU A;  1RUS A;  3MCM A;  1VS3 A;  5C25 A;  4ECR A;  4LRE A;  1SJ4 P;  3HI9 A;  3CIZ A;  4KGM A;  2V2Z A;  1OPZ A;  2UP1 A;  3RYL A;  3OTD A;  4FNI A;  1F5B A;  3HX9 A;  4A8Y A;  5AE3 A;  3R1H A;  3NL0 A;  2FC9 A;  2V69 A;  4B9T A;  4IG0 B;  4O3Q A;  4ZVP B;  4HDG A;  4DR6 F;  2ZKT A;  2W2M P;  5D8H B;  4F4X A;  3K8W A;  1S99 A;  3U1M A;  1VC0 A;  2HNZ A;  2UUB J;  5ETV A;  1S9F A;  2VH7 A;  3GFX A;  4NZ7 A;  1NK6 A;  3M2R A;  1BQM A;  1TKT B;  4ZJL A;  4L73 A;  1FKO B;  4NLW A;  2P6T A;  4ICL B;  4MFB B;  2PMW A;  2BYC A;  3UFC X;  1RDR A;  1PAE X;  1T3N A;  4MKY A;  4QIV A;  3MD1 A;  3R1L A;  2M7S A;  2RJZ A;  4LF7 J;  3VV2 B;  3V4I A;  3SCJ E;  3TVZ A;  2VFV A;  4TLR A;  3J81 U;  1U2F A;  3Q86 A;  2HFN A;  4B3S F;  5ETM A;  1JLQ A;  2ZWP A;  1WOP A;  2HGL A;  4OLP A;  4CYU B;  3E8O A;  2I5J B;  4DV3 J;  3G6V A;  2VQF J;  4J91 A;  2GML A;  2GJF A;  2HNY B;  4DL0 C;  2KI2 A;  2K1R A;  1R8P A;  4FVM A;  4MIB A;  3WHI A;  5F8J A;  4DR4 J;  3M8W A;  2OPS A;  5C2G A;  2DB1 A;  4NLQ A;  1S9G B;  3EPG A;  2DRB A;  2Y8W A;  1S48 A;  3EXC X;  1HNX F;  4I2Q B;  3QRP A;  1RT7 B;  1UJ6 A;  1HD0 A;  1WHX A;  4OI0 A;  3FBF A;  2VFT A;  1U1P A;  3L09 A;  3VGT A;  4DR1 F;  5I3U A;  1S1W A;  2F9D A;  3M32 B;  1M5K C;  2XCA A;  3GPA A;  3RB0 A;  4ERD A;  4C0B A;  3H2V E;  1YDL A;  2ZNY A;  3FEX B;  1HNZ J;  1KTQ A;  1U7L A;  2I1R A;  3QRR A;  4ID5 B;  5ETT A;  5JMN A;  3D1O A;  1IKX B;  1HYS A;  4EBE A;  3WIV A;  4DSK A;  3I0R A;  3RB4 A;  4QYZ J;  4MK8 A;  1HKA A;  3IR5 B;  3NNA A;  1F3V A;  2CWX A;  1RAE B;  3TZW A;  5B09 A;  3PAC A;  1UTA A;  1SH0 A;  4OX9 J;  4F26 A;  3IGV A;  1JLG A;  1M5O C;  2VOD A;  1N6Q A;  1DQA A;  3Q0A A;  4TXS A;  4U67 Q;  2MHN A;  1GT8 A;  1MML A;  1DZ5 A;  3NNH A;  2FHJ D;  2CIM A;  4CQ1 A;  1ZET A;  2ALY B;  4Y28 C;  5EUH A;  2VG7 A;  1WF2 A;  2UV8 G;  4NLU A;  4W92 B;  3M2U B;  5F9N A;  1B0V A;  3HFK A;  3HHN B;  4B9V A;  1UFK A;  3A3O B;  3SEO A;  2ZM6 F;  3R6G B;  1YJ7 A;  2L9D A;  3ELH A;  3SIP B;  1NEE A;  4OZ5 A;  1WG1 A;  3OTB A;  2HHQ A;  2Z30 B;  4WZQ A;  4USJ C;  3LGH A;  1N36 J;  5L9X A;  4DPU A;  3BQ2 A;  4G6V B;  2MDA A;  1FXR A;  2IPO B;  1HQE A;  2VU5 A;  4C9D A;  2ROE A;  4ZP6 A;  5EX3 A;  3EVO A;  3NAI A;  2GAH C;  2CRL A;  4C8M A;  3PRD A;  2GJ2 A;  5LXR A;  4HVZ A;  2IJR A;  1H98 A;  1S7I A;  1JJC B;  5JVG Q;  2KRR A;  3D6T B;  3NAH A;  2GJI A;  5K14 B;  2A10 A;  2E1A A;  5I3Q A;  2BAC A;  2W4P A;  5KG0 A;  2Y3Y A;  2HG4 A;  3GYN A;  3BO2 A;  4O44 B;  4P72 A;  4MIW A;  2Z57 B;  4Q8E A;  2G4B A;  1NHK L;  2DKO B;  4C6A A;  1SXL A;  3KUH A;  4QIE A;  3PV8 A;  3I56 S;  2OO4 A;  4PAB A;  1YIJ S;  1U1K A;  3RBX A;  2CVE A;  2V5H G;  2OLW A;  1S1X B;  2VIH A;  4NOH A;  2V9W A;  5HBM B;  5J1P A;  1N8R T;  2HQ3 A;  2SXL A;  4G1Q B;  3OLA A;  3RZA A;  3I87 A;  4R8U A;  3HXM A;  2NSB A;  3TUP A;  3FK4 A;  4DJB A;  4O3O A;  3A8J A;  2V34 A;  2HZC A;  5IOL A;  3FRZ A;  3SDE B;  1HR0 F;  1ZAX A;  3U7J A;  1OYE A;  3VZI A;  2UUW A;  1KVI A;  4DUZ F;  1Y5L B;  1EP4 A;  5CYQ B;  5KFL A;  3OR2 A;  4ECV A;  2HK3 A;  2I38 A;  1HQU B;  2HYI B;  2VQE J;  1C1B B;  3POT B;  2KT3 A;  2LXU A;  2VBY A;  4ELU A;  4CLT A;  3DOM B;  3NNC A;  1HQ2 A;  2O67 A;  2HHH J;  1SJR A;  2EXU A;  5KFB A;  4ED8 A;  4KGZ B;  3OXL A;  1RWK B;  3CVK A;  2PEB A;  3M6V A;  3MEG A;  3GE9 A;  4QZV B;  2YNG B;  1U8S A;  3AAW B;  3LAN A;  3MFI A;  5HN0 A;  3DRP B;  2A18 A;  2YKM B;  4I56 A;  4BC7 A;  5F8M A;  3DXS X;  2DHX A;  4DEZ A;  3TUJ C;  4EMD A;  3TP2 A;  1S10 A;  1DY3 A;  3MI7 X;  3QID A;  1VQ8 S;  1AFI A;  3QSI A;  5M2U A;  2H5I B;  3PX0 A;  1HHS A;  3CPW R;  1PKU A;  1UZH A;  1VQO S;  4RBV A;  3BPS P;  4I6Y A;  1REG X;  1Y7P A;  2XNQ A;  2BKP A;  3NCP A;  5B0E A;  2HRT A;  2HWT A;  4F4W A;  1AZS B;  4ZVQ B;  1IBL J;  2ZC4 A;  1M90 T;  3R2D J;  2XS5 A;  1TK0 A;  2V4J A;  2BRL A;  4DV6 F;  1WEX A;  3G87 A;  1VCT A;  1SJ1 A;  1H74 A;  2UUB F;  2FLN A;  3CDB A;  1OPI A;  1TU0 B;  1KBR A;  5GAE I;  4DUY J;  3LP0 A;  3KK3 A;  1QLN A;  1RTI B;  2C2O B;  2FLO A;  2XS2 A;  3DLK B;  1TVR B;  2BA9 A;  3FCV A;  5HQM A;  2RAQ A;  3E01 B;  3PFO A;  2HWH A;  3R7N B;  1GMU A;  3MDF A;  2JHE A;  3T5L A;  2YVS A;  2UZA A;  2AEJ A;  1IM6 A;  3W5Z A;  3D5M A;  1HHQ A;  3NGK A;  1U1L A;  3JXO A;  3PRB A;  2LEA A;  3ZZ0 A;  1JQG A;  1Y3K A;  2XGQ A;  2JEF A;  3WC0 A;  1UP1 A;  3QGI A;  3KTQ A;  4YQW A;  1SI9 A;  2VQF F;  5HP1 B;  1FA0 A;  1JX4 A;  1JLA B;  1RTH B;  4C2M A;  1C0U B;  4Q7A A;  3FMB A;  5GAH U;  1H7X A;  3MPY A;  4NPO A;  3NCQ A;  4DR4 F;  4IFY B;  1RSC A;  2M52 A;  1N32 F;  1RAD B;  3CJK B;  2LDI A;  4M5I A;  4A47 A;  4JI0 J;  1U45 A;  2HRY A;  2V67 A;  1JKH B;  1PSD A;  4PKD B;  1S76 D;  4ECQ A;  1X60 A;  3LA0 A;  3BBC A;  1DLO A;  3VGS A;  1YJV A;  5G4D A;  2FHO B;  3PYD A;  1S6Q B;  1CEZ A;  3PR4 A;  4YY3 F;  1S1U B;  4Y2I A;  2Q3P A;  3CED A;  2C2N A;  3MEK A;  2VFU A;  1HPZ B;  3NMA A;  4KYZ A;  2D41 A;  5J2P B;  4U96 A;  4FBU A;  2J8A A;  3IGN A;  4F4Z A;  2O3D A;  1IXK A;  2FLL A;  1FE0 A;  1ZM4 A;  2PEH A;  4CLW A;  2AP6 A;  1HBN B;  4GMK A;  4NZ0 A;  4ITS A;  1LOU A;  4ZP9 A;  4EFA C;  4USU A;  1RTJ A;  2E29 A;  4NWB A;  1WC6 A;  2QLJ B;  3SBM A;  4OV1 A;  2X3G A;  3IM8 A;  3DLG B;  3HVT B;  4FS1 A;  1L5U A;  4YB5 A;  2CAD A;  4PWD A;  3HFV A;  4HYK A;  2M9K A;  1A7G E;  1DQ8 A;  4M1K A;  5L1J A;  4DU8 A;  1RWP B;  2FB0 A;  2QFI A;  3US5 A;  1GAO A;  4J9K A;  1VRU B;  4J9U E;  2DGX A;  3C6U A;  3UCZ P;  1N36 F;  3PEH A;  1JMT A;  3QWP A;  2P8I A;  3IA0 A;  4LFA J;  1NDK A;  5D4O A;  3TJ9 A;  2MZ1 A;  2ZDP A;  1LW0 B;  2AJ0 A;  2MLX A;  4I2P B;  1Q16 B;  4FKX A;  5HI7 A;  2W9C A;  2HBY B;  3CDE A;  2Z0G A;  3MEE A;  3C66 A;  4I7F B;  2DXD A;  5KFP A;  4NX9 A;  1PJ6 A;  2LQ9 A;  3OSN A;  4DHV A;  2CJ9 A;  1LK7 A;  4X84 A;  4OI2 A;  3KLI B;  1N0V C;  5IM0 A;  2P9E A;  1NBE B;  2HQI A;  3SFU A;  3QSY B;  2R8H A;  3T6J A;  4CLP A;  4ZPT R;  1RKI A;  3CCT A;  2ROP A;  3EVM A;  4KB7 A;  1WHV A;  3EGN A;  3OTO J;  4JYA J;  2XBP A;  3NCR A;  3A8E A;  3RW6 A;  4H4K C;  4ZP7 A;  1UKU A;  4J9P A;  4LF9 F;  4AFF A;  5A2Q U;  1Q1K A;  4UOF A;  1D8Z A;  1YVF A;  4YUD A;  3H42 A;  4ZN3 A;  1RWX B;  3W61 A;  1EQM A;  3GIL A;  1C1C B;  2HVZ A;  2CQG A;  1SCJ B;  3R2C J;  5CD4 A;  3J80 U;  1EHW A;  1KS2 A;  2YNI A;  1HBM B;  2CJQ A;  4L72 B;  4IOB A;  4EZ9 A;  4DR5 J;  1D9A A;  2DT9 A;  2YKP A;  1GX6 A;  1H7W A;  1TL1 A;  1EJ7 L;  3PJ9 A;  1FEH A;  3RJM B;  5C25 B;  1M1H A;  2VON A;  5KFA A;  1DHM A;  1VJW A;  2KHC A;  1TL7 A;  3I9V 9;  4P2M A;  4MJK A;  4FF1 A;  1FD2 A;  2APO A;  3ILL A;  2IFX A;  3HLU A;  3BGO P;  1RAF B;  3BZQ A;  5HVH A;  2DEI A;  4CTA A;  1YJ9 S;  1OIA A;  1SKS A;  2ZJP Q;  1HHT P;  4UZC A;  5CHC B;  1IKW B;  2MY8 A;  1P9Q C;  1Q82 T;  2V8H A;  1NDC A;  4OZL A;  1Q4R A;  1SIW B;  2HNZ B;  4K4S A;  5EX0 A;  3LWL A;  2BAN A;  3S1T A;  4F3Q A;  3CF5 Q;  1SC1 B;  1BQM B;  2RH3 A;  3GP9 A;  3DGV A;  1IR2 A;  2XS7 A;  5DDO C;  5JUM A;  2RSQ A;  3ENQ A;  1T94 A;  4WP9 A;  1UW9 A;  2B6A A;  2CQI A;  1LFP A;  4M5K A;  2ZHA A;  4TQR A;  4TQS A;  3V4I B;  4QQB A;  1PBU A;  1UEK A;  4YB6 A;  2QEX S;  3QT5 A;  5IV3 A;  1U02 A;  3G2X A;  3LOU A;  4E2F B;  2QMX A;  1JLQ B;  3H2L A;  4MH8 A;  4MT1 A;  1FKA F;  4IO1 A;  1FES A;  2N3L A;  3M1V A;  3BH7 B;  1FRM A;  2BJE A;  1YX2 A;  4F3O A;  3DCA A;  4DUY F;  3SSQ A;  2V8P A;  2FHJ A;  2K1R B;  2E5L J;  2IRY A;  3B78 A;  4E8U A;  3AFG A;  2OPS B;  2DPJ A;  1I3O B;  2A6O A;  1IJF B;  1Y3J A;  5IT9 Y;  4ES1 A;  3KMQ A;  5DZ6 A;  2MQ8 A;  3NGR A;  3FJ2 A;  5D15 A;  1M1K T;  1ACM B;  3TOQ A;  1OMS A;  5I3U B;  1S1W B;  3PR5 B;  2HSE B;  1LQ9 A;  2MZQ A;  3I5C A;  4HR2 A;  3DLJ A;  2R8K A;  2W8L A;  1U8W A;  1FKP A;  3D6F B;  2YPZ A;  3GII A;  3CJ4 A;  3MM5 A;  3UO0 A;  1BD6 A;  3HT0 A;  3R5B A;  4NLR A;  3I0R B;  1FDN A;  1CC8 A;  1NUE A;  1X5O A;  3K0J A;  1FFG B;  4A48 A;  1XNQ J;  4JI0 F;  3DDI A;  4YR0 A;  2B3T B;  4LF5 F;  3THV A;  3T5K A;  2CNN B;  4OZJ A;  3R3T A;  1JLG B;  1N6Q B;  5T7L A;  1TTH B;  1NME B;  2UXC F;  1ZS6 A;  3TUI C;  3JTN A;  1FWP A;  2NYH A;  4F4K A;  1WC4 A;  5B0G A;  1O8B A;  2CJB A;  2IDE A;  5H1S V;  3NEK A;  1AXQ A;  3N0V A;  2BBE A;  5IS2 A;  1AUD A;  4RLE A;  4Y00 A;  3UQS A;  4AUK A;  4ED6 A;  4AYB D;  1RU1 A;  3QT7 A;  3GIM A;  4C8O A;  4TYB A;  2MST A;  3G6Y A;  3IWX A;  1DUR A;  1KLM A;  2Y9H A;  2CDR B;  5KFW A;  3UE2 A;  2U1A A;  4ZVS B;  1SIZ A;  1XJW B;  2EBE A;  1OY9 A;  1HQE B;  4OZ1 A;  1YBA A;  1HNW F;  2KFZ A;  1X4E A;  4PZV A;  4QIF A;  2PGC A;  5B0C A;  3PW4 A;  3LGM A;  1J2V A;  2FZC B;  4RW8 A;  1RAC B;  2DGQ A;  1PC4 A;  2JDJ A;  1RAJ A;  4DL4 A;  2L9W A;  1JWW A;  3ADA C;  1I5O B;  1WEZ A;  4BLG A;  3AOB A;  2HND A;  3IG1 A;  2LYV A;  1YJN S;  1UPP A;  5ETO A;  1S1V A;  2H65 B;  5KOX A;  4CH7 A;  3E51 A;  1F9H A;  4F2S A;  4LFA F;  3QYY A;  5DGA A;  1EKS A;  2DNZ A;  1F6T A;  4Q2M A;  4HKQ A;  4BBY A;  2NYI A;  2HPU A;  4RJV A;  2RDI A;  3PKY A;  2KZZ A;  3TVK A;  3PYG A;  5LXY A;  3BM7 A;  3JSB A;  5KAK A;  1JB0 C;  2DGV A;  3GSD A;  3ZZU A;  2V2V A;  3MUT P;  2F9J A;  4R8U B;  2V0N A;  1KWM A;  1NPK A;  2R2S A;  4CLF A;  2NUH A;  2XY7 A;  2G2Z A;  4NEZ A;  3OVB A;  4IH6 A;  1NDP A;  5HMX A;  3KYL A;  3KLF A;  2AJQ A;  3MM6 A;  2NQP A;  4JYA F;  3MXH P;  2XLJ A;  1EP4 B;  2NXN A;  2LLZ A;  3M9O B;  5HVG A;  1ZM2 A;  4OI3 A;  3IM9 A;  5KG4 A;  2R9L A;  1RHJ B;  3HSZ A;  4ZK7 M;  3T5H A;  1WG5 A;  3MEG B;  4NL5 A;  2AKW B;  3TEH B;  4ZS6 A;  3UVJ A;  2XO7 A;  1I1G A;  5K20 B;  3OL9 A;  2ZH3 A;  2DPI A;  4ECT A;  4C98 A;  4FP9 A;  1B99 A;  4DR5 F;  2B43 A;  4YR2 A;  3DU5 A;  3ZTS A;  4UOH A;  4XPE A;  3BQ1 A;  3EZ5 A;  1T95 A;  4LT6 A;  1U6B A;  3LGN A;  5LMN J;  4F0M A;  2CQB A;  2ZZM A;  4KFB B;  4DZ6 A;  1N5V A;  3SI8 A;  4O4R A;  4ELT A;  2GQC A;  2NXU A;  4B08 A;  1TK5 A;  5F3Z A;  3LP2 A;  3CC7 S;  1T8E A;  5DLF A;  5IQ6 A;  1YTY A;  4BDP A;  2OSR A;  3TRG A;  2R7W A;  3UR0 A;  5D4L A;  1WOS A;  3CDA A;  1NHU A;  1RWW B;  3JQM A;  1G3O A;  4AXJ A;  2VKZ G;  4DBQ A;  3E3X A;  3EWG A;  2B9X A;  3WIU A;  4CLL A;  2V4J B;  3W63 A;  3W1Y C;  2CPJ A;  2DO0 A;  1CJT A;  2CAJ A;  3A8K A;  5GMK a;  1B4S A;  4C0H A;  1QD1 A;  1SL1 A;  2H9Z A;  1KQG B;  3W5Y A;  3D3B J;  4YB1 P;  3T3F A;  3KK3 B;  1RT6 A;  5ETN A;  1TV6 A;  2B8P A;  2GFF A;  1IBC B;  3CC2 S;  3S7R A;  4K0K F;  3VAL A;  3IRX A;  3IO1 A;  4ILR A;  3J81 Y;  2QL5 B;  3LTO A;  1U47 A;  3J7Z T;  3BYP A;  2YWE A;  1UVN A;  3DXB A;  3BSA A;  4P7V A;  1NLK L;  3KLV A;  1Z1Z A;  1S0V A;  2YQ1 A;  3L7P A;  1D1U A;  5KFC A;  2GQQ A;  4XTT A;  3PG9 A;  5E3C A;  2ZH9 A;  3CNQ P;  5DM7 Q;  4WJB A;  4BC9 A;  5ETL A;  3LAL A;  1X4B A;  3G71 S;  2E5L F;  4A8X A;  5SZT A;  3H98 A;  4B3R J;  3PHT A;  4YHH J;  3V2U C;  4ZLP A;  5KFF A;  2E7X A;  3RAQ A;  2A2C A;  2E44 A;  3OFF A;  2P2C B;  4PXB A;  4Y2M A;  3GFH A;  3MWB A;  2MKH A;  1KQS R;  1G4C A;  4FXV A;  4GRS A;  3L9Z A;  4DV4 F;  2KM8 B;  3J81 j;  4IFV A;  2QYG A;  4WFX A;  3DHW C;  2F8H A;  3IC1 A;  4USV A;  2PD1 A;  4IG3 A;  3SYZ A;  1APS A;  5H9E K;  2K06 A;  3C3L A;  1RAI B;  2VPX B;  5EGY A;  4RNN A;  4R0J A;  1FNM A;  1RU2 A;  2VDI A;  2HQC A;  1VQN S;  2QA4 G;  1TUG B;  3OJS A;  4ENO A;  2VBZ A;  1SV5 A;  3TA1 A;  3MFH A;  3BKT A;  1R8A A;  2R8I A;  2FJV A;  3BEG B;  2EW9 A;  4XIU A;  4J9V A;  4PWD B;  2ZUA A;  4DR2 J;  2DHS A;  2KDO A;  1JLB A;  4OYP A;  1RLD A;  4QCL A;  4M63 A;  1D09 B;  4AL6 A;  3W8G A;  3BKF A;  3C6U B;  1UZD A;  3ICL A;  3I82 A;  3H4D A;  4AQY J;  4IYQ A;  1SC3 B;  2A0F B;  4L75 A;  1FHT A;  2V94 A;  4WU2 A;  2UUA J;  3MMA A;  3Q2S C;  3KG1 A;  1YGY A;  2VZ9 A;  3QT6 A;  2W9C B;  2R7R A;  4DV5 J;  2OD4 A;  5E0O A;  4KSE B;  4JI6 J;  3MEE B;  1WUU A;  3IR6 B;  3OFH A;  2KFN A;  2R42 A;  4A8M P;  4OL8 A;  4U7U K;  2PFD A;  3W8P A;  5IM0 B;  2YWH A;  1K8A T;  1U26 A;  4DUT A;  3OSP A;  4DMZ A;  5DET A;  4JI7 J;  1WF0 A;  5K8N A;  4ZLL A;  2BUN A;  5FDL B;  3BB5 A;  2IA0 A;  1LKZ A;  1N34 J;  2WVD A;  4XAK A;  5D6G A;  3OV7 A;  4LF4 J;  5HRO A;  2BW2 A;  3SV3 A;  4EZ6 A;  4EYH B;  1HNV A;  5KFJ A;  2ZOG A;  2H54 B;  5I42 A;  2MSS A;  5E3P A;  1VQ5 S;  2RDD A;  2VOO A;  1VMB A;  4WIQ A;  3CC4 S;  4KO0 A;  3TJA A;  3G8T A;  3GSI A;  3W2V A;  4W98 A;  4KHM A;  1RT2 B;  2W7O A;  1WDD A;  4WK3 A;  3OHA A;  1QAY A;  3DRY A;  4O0N A;  1Q0N A;  4PG5 A;  1RHK B;  1TL1 B;  3TX8 A;  2LDY A;  3AB4 B;  4HEA 9;  2AYM A;  4ZCL A;  3W66 A;  3EGW B;  1HA1 A;  3M9M B;  1FDB A;  1TL7 B;  2IM3 A;  3TZX A;  2XMJ A;  3FQK A;  4MK9 A;  5GME A;  2DR6 A;  3LUY A;  1XR5 A;  3GCX P;  2E7W A;  5KT6 A;  5ETR A;  2R7T A;  5KFU A;  1TR0 A;  1RJJ A;  4CO1 A;  3S8S A;  1WI6 A;  3CTR A;  2FIU A;  4DG1 A;  1XEZ A;  3OFE A;  5DQH A;  3PEJ A;  3NGU A;  1QSL A;  2N3O A;  1FJG J;  1Y9O A;  2C42 A;  2XG8 A;  2BAN B;  2RS2 A;  4L76 A;  2GX8 A;  2OML A;  3KJF B;  3B8H A;  2KG1 A;  5KT2 A;  2NS1 B;  4IR9 A;  1WC0 A;  2B6A B;  2CQ1 A;  2EK6 A;  1JJH A;  4Y0F A;  2N4C A;  2HQD A;  1WSV A;  3RB6 A;  1VQM S;  4OI1 A;  3IMQ J;  2UVW A;  1BMQ B;  3H5Y A;  5BYS A;  2BJ3 A;  2V8G A;  5C42 A;  1SPB P;  2FVP A;  2W9B A;  3ET6 A;  3DI6 A;  5GAE U;  3M1V B;  2P9G A;  3HD2 A;  3UCU P;  1UFL A;  1WF1 A;  1N4L A;  3SCI E;  2CFX A;  2W01 A;  5DG8 A;  3W7B A;  1F0X A;  4JI1 F;  5A6W A;  4WZM A;  2HQF A;  5LSL A;  1GK8 A;  1YHQ S;  3GIK A;  3V6K A;  1N5T A;  2AYB A;  4Y3C A;  1R8C A;  3CCR S;  3MCN A;  1IWG A;  2MPU A;  4K8R A;  1NSP A;  2XMV A;  4JV2 A;  2MQO A;  3NP5 A;  4K4T A;  2BDP A;  4DQP A;  2HLU A;  4N7T A;  4L3K A;  4JI4 F;  2QC3 A;  3DRR A;  1M0S A;  3Q8U A;  1FKP B;  5AJ3 J;  4LFC F;  4AD6 A;  4NLY A;  3KNA A;  2ZEJ A;  3TWZ A;  3THT A;  1AT1 B;  4ZJO A;  4ED4 A;  4PYD A;  4CNZ A;  2JWN A;  2CKW A;  2CQ3 A;  1QAX A;  2IJN A;  4F4Y A;  4DDF A;  4USK A;  3UDL A;  3M2V A;  4DFP A;  5A76 A;  4QU6 A;  3MAQ A;  1EAR A;  4RNH A;  2PE8 A;  2GIQ A;  2F1F A;  4OHX A;  4QWD A;  2VBX A;  4NLD A;  1B64 A;  1GNK A;  1X0P A;  1MN9 A;  3ILJ A;  2WBM A;  2YWW A;  3D6M B;  2F63 A;  3R5G A;  2C1E B;  4P75 A;  2DGS A;  1WKL A;  4PPD A;  1OYD A;  4Q45 A;  1HFE L;  3KLG A;  1QVF R;  1J5O B;  3BR9 A;  3ZZT A;  3KFW X;  5KFY A;  1KLM B;  3R5A A;  3QAU A;  1R3N A;  3HSG A;  3WBZ A;  4QJV A;  1HBU B;  2OUG A;  3A3N B;  1L3T A;  3SXL A;  2IVY A;  1IKX A;  4DPO A;  5LT5 A;  2A6M A;  3W65 A;  4MYT A;  3QPI A;  2OP5 A;  1WWH A;  4DR2 F;  4RW8 B;  1HIY A;  3DN9 A;  4RUH A;  3BSO A;  2V8V A;  2MZS A;  5D3G A;  1W26 A;  2O66 A;  3JSM A;  3D4J A;  4B9N A;  2QFJ A;  2FZK B;  2ZJR Q;  2LEC A;  1S1V B;  4J9S A;  4AQY F;  4ECY A;  3WX4 A;  2C3O A;  2IM0 A;  4NI2 B;  4HDH A;  4C8Z A;  3AD9 C;  1U48 A;  2UXD J;  3QFW A;  1RCO B;  1N33 J;  2AQ4 A;  5JJB A;  2F3J A;  1HWU A;  4Y6I A;  4JI6 F;  1KVK A;  4GKK J;  1FRJ A;  3HKW A;  2ALZ A;  5LMU J;  4AE5 A;  3D54 A;  2N82 B;  4WYW A;  2EC2 A;  3GG1 A;  3I6P A;  4LRB A;  1P6T A;  4Q44 A;  2VJV A;  2WTF A;  5D0R A;  5GAD U;  2H51 B;  1UL3 A;  1QTN B;  2AX0 A;  3KLF B;  3MM6 B;  4U6P A;  4LF8 J;  1N34 F;  1W2B R;  4TYA A;  2XWX A;  4J5O A;  4U8V A;  4KHP F;  5HMZ A;  2G1D A;  5BR8 J;  3TAR A;  4ED5 A;  4ZIT A;  3X1L B;  3W9I A;  3PO5 A;  3RBE A;  2Z8Q A;  1X9S A;  4FBT A;  2QL7 B;  4I68 A;  4WFN Q;  2X1B A;  3J80 Y;  3QGG A;  2WSE C;  3EE3 A;  3UVJ B;  3CO0 P;  4O44 A;  4XPC A;  3P5B P;  2B4U A;  5T14 A;  1YZ7 A;  1B0T A;  1NXI A;  1T0T V;  3IXQ A;  2HHV A;  2R7S A;  1MNE A;  4OZ3 A;  2V2K A;  4KKO A;  3I55 S;  2QIF A;  3SQG A;  4ZJQ A;  2M0G B;  1LWE B;  4JI5 F;  2HVD A;  3VQT A;  3N9U C;  5IWA F;  2XY5 A;  3AXM A;  4OV6 A;  4WXW A;  3HVR A;  2RRB A;  1R0C B;  2KXH A;  3LP2 B;  4CH0 S;  3JSR A;  2MXY A;  2CJK A;  3QLH A;  3SDE A;  3BO4 A;  4PG6 A;  2ZZN A;  4QW9 A;  4OI4 A;  2PII A;  1C1B A;  2V2Q A;  2WVF A;  1G7C B;  2F7V A;  4X66 F;  3OL6 A;  3AOC A;  2J6T A;  4PUO A;  4KGK A;  3KLE A;  1KQF B;  1FJG F;  3SQO P;  4DX7 A;  3VAJ A;  2Y1I A;  3M6W A;  1RT6 B;  2W24 A;  3CB4 A;  2M3D A;  3TEG A;  1TV6 B;  1NU4 A;  1QUP A;  2WOM A;  4DV1 J;  5D4N A;  3PYE A;  3DRP A;  1V6H A;  1HI0 P;  2KJV A;  3BKU A;  2VG6 A;  3IRX B;  1LEO A;  4PYA A;  1S6O A;  4BCA A;  5KT4 A;  1VLO A;  3HJF A;  4X4N A;  2KFY A;  4DL5 A;  1R89 A;  2FJA B;  2VBW A;  2ZNZ A;  1A9N B;  4P6Q A;  3HHL C;  1LWX A;  1JJ2 R;  2DY9 A;  2OFG X;  1O6X A;  2DIV A;  3HP6 A;  3BO3 A;  4G65 A;  1IJE B;  4ZA1 A;  2NXE A;  2KXN B;  1AZS A;  4O3P A;  4JV0 A;  2QA2 A;  3T19 A;  2P9C A;  2Z4P A;  2OD6 A;  4NLT A;  3C8Y A;  1SKR A;  4QR0 A;  4V19 J;  2EFQ A;  1S5Z A;  5BXI A;  1TUW A;  4G1I A;  2LKZ A;  4DQI A;  3BR8 A;  4OJG A;  5C7P A;  3M9N B;  4OQJ A;  9ATC B;  1SQE A;  2R7Q A;  4G1P A;  1MG7 A;  2AJ2 A;  2ACY A;  1IVZ A;  1HBO B;  1ZPW X;  3M7V A;  2IVM A;  3H5U A;  5BYQ A;  1FRH A;  4IRD A;  1TKD A;  4IFV B;  1CUL A;  3PIP Q;  1RT1 A;  1XMQ J;  4IG3 B;  2NZC A;  1F5A A;  1JIH A;  1C0T A;  4ELV A;  3W2W B;  3FUY A;  2OAU A;  2ZHB A;  3KJV A;  2ZVS A;  4FYV B;  1S4F A;  1EZZ B;  4K4U A;  4CIO A;  2E9Z A;  4NMX A;  4PG7 A;  5AXL A;  3CJR A;  1SV5 B;  1MU2 A;  3RBZ A;  2IJF A;  4EYI B;  3TZZ A;  3GQC A;  3GWC A;  1FXL A;  2AEM A;  1Y5N B;  3QO9 A;  3CJK A;  1LFW A;  5KG2 A;  3LPE A;  3HO1 A;  1Y00 A;  1H2U X;  1JKH A;  3LW5 C;  1JNR B;  1JLB B;  2G0J A;  4OX8 A;  1X5T A;  1CG2 A;  3UI3 A;  3FCW A;  3UNY A;  1Q8B A;  2QLW A;  5MAO A;  5L39 A;  3PY8 A;  5EWE A;  2VFR A;  3HF5 A;  2MY7 A;  4F02 A;  1UET A;  5AE2 A;  5FJ4 A;  3MPD A;  3MMA B;  2AJ4 A;  2C28 A;  3QBC A;  5A8W A;  4ANC A;  4M5M A;  7FDR A;  4MK7 A;  5THW A;  4PPZ A;  2X7I A;  2HHU A;  4EEY A;  2IVF B;  4PQA A;  2YKQ A;  1HBN A;  3AH6 A;  5M2R A;  2K8G A;  4FYY B;  4CRJ A;  1VLY A;  3LAM A;  4ER8 A;  1RWU A;  3MMJ A;  2CPZ A;  2DNN A;  2UU9 F;  1I6J A;  4ZVO B;  1JLC A;  2FDN A;  2BJ1 A;  1ELO A;  3BGR A;  1K47 A;  2RQ4 A;  1GXT A;  1U1Q A;  3FBB A;  1IKV A;  2KT5 A;  5H9F J;  5HO4 A;  2UXD F;  5KFE A;  5HRO B;  1N33 F;  2IBK A;  5L38 A;  3CJS A;  2V8D A;  1HNV B;  1KLN A;  4GKK F;  1G2E A;  5I42 B;  4LF6 J;  2OHD A;  2XMM A;  1P1T A;  2R2R A;  3KK1 A;  1SVD A;  4KO0 B;  5DO2 A;  1KKH A;  3W2V B;  1CQM A;  4RPF A;  1VC6 A;  4EWT A;  5D78 A;  2DNM A;  4P71 A;  1VJQ A;  4B3M F;  5J2Q A;  4CLY A;  1IM4 A;  4ZDN A;  1RT5 A;  3OTC A;  5AT1 B;  4LF8 F;  3UDC A;  5KFR A;  3HZG A;  1U6F A;  3QJP A;  1LK5 A;  4DSL A;  5BR8 F;  1R31 A;  4OYI A;  1RZM A;  4OX6 A;  2R7U A;  4LBI A;  3Q8R B;  3I32 A;  4CM0 A;  2ZHO A;  2UUC F;  2E66 A;  3CMQ A;  1U0S A;  2KJW A;  3O8W A;  5F9L A;  3KK2 A;  1FD8 A;  2JLF A;  1R8B A;  2E1M C;  1YWX A;  5K8O A;  4DG1 B;  5F41 A;  4I67 A;  4WTY A;  5FD1 A;  4RW6 A;  3BJY A;  1D8Y A;  3N28 A;  3A4T A;  5CZX A;  1SC6 A;  3OVS A;  3NS7 B;  4OYM A;  1FRX A;  2V63 A;  1K9M T;  3M8Z A;  2FGC A;  3RB3 A;  5HLF A;  4LSL A;  1R8H A;  3HSJ A;  2BQR A;  1VOM A;  2MLZ A;  2X1G A;  3I5A A;  5C42 B;  2VA3 A;  4Q2L A;  2BV3 A;  4B9S A;  3OUY A;  3TVY A;  2W9B B;  3ET6 B;  3NKY A;  3DI6 B;  4LR8 A;  5IQQ A;  4J9M A;  1S72 S;  1D0E A;  1CS4 A;  4EI2 A;  2ASY A;  4KV8 A;  4M5D A;  2C3Y A;  3KDO A;  2GHW A;  4TY8 A;  1IKW A;  1FEE A;  4IH5 A;  4N47 A;  4E0D A;  3LH2 S;  4CLK A;  5F8L A;  3S6E A;  2ZBQ A;  3T9Z A;  4Y34 A;  5G0R A;  1PO6 A;  5J2M A;  3IWL A;  1Q53 A;  3FKB A;  3CGI A;  1RK8 A;  3DLB A;  2XQC A;  2XHW A;  2YWG A;  4H54 A;  4YEA A;  2QLB B;  2VPZ B;  1LV5 A;  2DR8 A;  2JC1 A;  4B17 A;  5HJY A;  3DRR B;  2XWY A;  1RB0 A;  3D6H B;  3Q89 A;  5A0Y A;  4LSN A;  4X64 J;  1NK9 A;  4W90 B;  1ZPV A;  4J90 A;  2HVE A;  4A8F A;  4Y2A A;  4K4Y A;  2DHA A;  3ITH A;  1CSJ A;  4RL1 A;  4V1A k;  3NGT A;  1FO1 A;  2LA6 A;  2XO6 A;  2JZ5 A;  3KHH A;  3DM2 A;  3ONQ A;  3JTO A;  3AJD A;  6AT1 B;  1M5S A;  5I4M A;  3M2V B;  4OMF G;  3PRV A;  4QR1 A;  2A3J A;  3CDU A;  2YKO A;  5B7W A;  3ULH A;  3IWN C;  3FZB A;  4UOG A;  2ZWO A;  4M5J A;  4QU7 A;  2HFS A;  4WE1 A;  1T9T A;  2OFH X;  3BGF A;  1U25 A;  4DR7 J;  3CJ0 A;  5HSP A;  1VQ6 S;  3Q2T C;  3N01 A;  3DRS A;  1T9W A;  1R6Y A;  2ASL A;  4KBI A;  1NZA A;  2P5V A;  2DIS A;  3DU6 A;  4ALZ A;  1PC5 A;  2E5G A;  4C7Q A;  3KLG B;  4ZCK A;  2D3O 1;  1TQL A;  2D9P A;  4FNH A;  1YBT A;  1UWB A;  4ECS A;  1X9W A;  2HBQ B;  1BQN B;  1N5Q A;  2FVQ A;  2ZH8 A;  4J9R A;  2DHH A;  2AYG A;  3TX0 A;  4F7V A;  1NH8 A;  3JSY A;  3A8I A;  3KKF A;  1NZ8 A;  3KJN B;  3L7O A;  2KU7 A;  4K4Z A;  1XIQ A;  1SKW A;  2CNO B;  2XM3 A;  4E98 A;  3EIC A;  2C22 A;  1S6P A;  5D3G B;  2AGO A;  2ZJQ Q;  1FTC A;  4OYW A;  3GIR A;  3JSM B;  3OTE A;  1ARO P;  1EB0 A;  4DL3 A;  4L74 A;  1YG0 A;  2QRR A;  1GTE A;  4ZP8 A;  3PDN A;  4DPY A;  3QZ7 A;  5D0E A;  1VHI A;  1VK3 A;  4TLQ A;  2NUU G;  4TKT A;  1H72 C;  1AFJ A;  2JH3 A;  4NXM J;  2H5E A;  1F9F A;  2AEF A;  2WB4 A;  2HIQ A;  3F0N A;  3TW0 A;  3MR3 A;  2E1P A;  1TZ0 A;  2W7P A;  2M4M A;  4RUA A;  1WC5 A;  4IOA Q;  5D77 A;  4X65 J;  4IR1 A;  3FBE A;  2RNE A;  2YX1 A;  3PX4 A;  3H8Y A;  2MZJ A;  4ED3 A;  3SCL E;  2VJU A;  4I69 A;  4H4M A;  3V6J A;  2C3M A;  1Q95 G;  3C16 A;  5AXN A;  1NDL A;  3P49 B;  3N6N A;  4KR0 B;  3PZP A;  4ZPB A;  4USM A;  2XI2 A;  3FEY B;  3ZXW A;  2FLP A;  2EFN A;  1O51 A;  2H1Y A;  2EPI A;  4F2R A;  2YWK A;  4QYZ K;  4J9N A;  1FDD A;  3VAF A;  3DLE B;  4DS5 A;  1ICE B;  4B3T J;  4KKO B;  4YDX A;  5IT4 A;  3EJM A;  5EWG A;  3SQG B;  3EMT A;  3KMS A;  2G13 A;  3FNN A;  3D0H E;  2NRE A;  1BUX A;  2KO1 A;  3EPI A;  5DG9 A;  1K0T A;  2QSF A;  2J7K A;  2DIU A;  4OYB A;  4RW7 A;  2XYG B;  3ISZ A;  5EHH A;  1DRZ A;  1UJ4 A;  2GHV C;  1KOH A;  1L3V A;  4CO2 A;  1X9M A;  2MKJ A;  3BSN A;  4HTI A;  4HH0 A;  3QLH B;  3MUV P;  3GLJ A;  2XY6 A;  1TKZ A;  1QE1 A;  1IBM J;  1P9Y A;  2L3M A;  1J5E F;  1Q7Y T;  2ZIT A;  4QWC A;  4ES3 A;  8ATC B;  5CYM A;  2VAS A;  4CM2 A;  4KGX B;  2ACM A;  4ILL A;  4PUO B;  4CCH A;  3KLE B;  1PIL A;  1B7Y B;  2YBV A;  2JLG A;  4K59 A;  4KRW A;  5CZV A;  3VGU A;  2WOM B;  1VRQ C;  2EKY A;  4NA2 A;  3OJU A;  1URR A;  4KPY A;  4A46 A;  1FJ7 A;  2JL9 A;  3LPY A;  2VG6 B;  1JLF A;  4QIG A;  3MMB A;  4URQ U;  4LVO P;  3ZO7 A;  2JNJ A;  4UW2 A;  2UVU A;  3MGJ A;  3NGD A;  3VTI A;  2DNP A;  1VBK A;  4UTG A;  2WAQ D;  1JNZ B;  4P9S A;  3GV8 B;  4KFB A;  2OPQ A;  2J0X A;  3H5X A;  1ZZN A;  4OHW A;  3TZY A;  3BQ0 A;  1ZM3 A;  4J9Q A;  1T05 A;  2MGZ A;  1WOO A;  4WII A;  5K8M A;  1BQX A;  2LA4 A;  2HLT A;  4WFY A;  3GJR B;  4CO5 A;  3FSI A;  3D0G E;  3HVW A;  4C3L A;  2KG0 A;  1CVJ A;  4JI3 J;  4PQU B;  5KFO A;  4GVB A;  2FHM A;  3NRB A;  1RT4 B;  1I94 J;  2UXB J;  3D68 A;  2FY1 A;  2Y0B B;  2YWF A;  1X4H A;  4M8L A;  3MD3 A;  2XZD B;  4NLV A;  5K5M A;  4QOT A;  4DV7 J;  2MJU A;  1RWN B;  4H4K A;  2HEK A;  3AT1 B;  3JAM U;  2F65 A;  1OJ4 A;  4LF7 F;  4JV5 J;  4DQS A;  1MLA A;  3A3P B;  4X64 F;  3ZZO A;  5KFN A;  3OFG A;  1VQS A;  2DXE A;  3H59 A;  4ZIW A;  1D9D A;  6FDR A;  3D7S B;  1CUL B;  1RT1 B;  5LOQ A;  2HHP A;  5IZH A;  1C0T B;  2ZBR A;  1X5P A;  2FY8 A;  2XMW A;  3CT9 A;  2YXL A;  3ZFV A; 
#chains in the Genus database with same CATH homology
 1KBR A;  5ETO A;  2CG8 A;  4M5H A;  3ILI A;  3HSJ A;  4F7V A;  3HSD A;  3QBC A;  3HSG A;  4CYU A;  1RU1 A;  4CRJ A;  4M5L A;  1G4C A;  5ETT A;  1F9H A;  3MCM A;  5ETM A;  3UD5 A;  3KUH A;  4AD6 A;  1IM6 A;  3ILO A;  2BMB A;  4M5M A;  2QX0 A;  5ETS A;  5ETR A;  3HCX A;  1RU2 A;  3KUE A;  1EX8 A;  5ETP A;  5ETV A;  1RB0 A;  4CWB A;  3KUG A;  4M5N A;  1RTZ A;  1EQM A;  3ILJ A;  1DY3 A;  3HD2 A;  3ILL A;  4CYU B;  2F63 A;  4M5G A;  4M5I A;  1TMJ A;  3MCN A;  5ETN A;  5ETK A;  3HSZ A;  4PZV A;  3UDV A;  1EQ0 A;  1RAO A;  1HKA A;  3UDE A;  4M5J A;  5ETQ A;  1HQ2 A;  3HT0 A;  1CBK A;  5ETL A;  2F65 A;  1Q0N A;  4M5K A;  3MCO A;  3HD1 A;  1TMM A;  3IP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...