4M5IA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 159
sequence length 159
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5iA00
4CRJA 1RTZA 4M5JA 3UD5A 2F65A 5ETLA 1CBKA 3HSJA 3KUGA 1F9HA 3KUEA 4M5GA 5ETTA 1RAOA 1RB0A 3ILJA 5ETMA 5ETVA 3ILOA 4M5LA 4PZVA 1EQ0A 1RU2A 3UDEA 3HD2A 5ETQA 3ILIA 4CYUA 4F7VA 4M5MA 3HD1A 3UDVA 3HSGA 3KUHA 3MCMA 3HSZA 3QBCA 1Q0NA 2F63A 2QX0A 3HSDA 3MCNA 5ETKA 4M5KA 5ETOA 1IM6A 3HCXA 1EQMA 5ETRA 4M5NA 5ETSA 3HT0A 1TMMA 4CWBA 3ILLA 1HQ2A 2BMBA 1EX8A 3MCOA 1RU1A 1G4CA 4AD6A 4M5IA 2CG8A 1HKAA 3IP0A 4CYUB 5ETNA 1DY3A 5ETPA 1KBRA 4M5HA 1TMJA
chains in the Genus database with same CATH superfamily
1VRUB 4DPXA 3F44A 3AB2B 2XYGB 4OI3A 4O3RA 3A3PB 3OHAA 2G4BA 4JI8F 2ZOFA 2WBRA 3Q2SC 4DX7A 3L09A 1SJ1A 2OEMA 4KKOA 1TMJA 3DRSA 1Y7PA 3HJFA 2F4FA 3ILJA 1FT8A 4CO2A 2BE9B 1P6TA 3M6XA 4RKUC 2B4PA 1XK8A 1T9TA 2MGZA 5KFGA 3MAQA 1FEHA 2ROEA 1ZAWA 3Q8PB 5CH7B 4DR2J 4OYWA 5A2QY 1JLCB 3MAHA 1HFEL 1CLFA 4DPOA 3VHQA 2D7SA 3HFVA 1S9EB 5DG9A 1DQ9A 4DUYF 4HVZA 2B5JA 3IR5B 3OJUA 4HT7A 1QAXA 3D7SB 4WYLA 2EFNA 3ZO7A 2M0GB 1QE1B 4DV2F 1WEYA 1IKYA 2PI5A 4OYOA 4USMA 4MT1A 2V68A 4B3SF 1RABB 3PG9A 4A8XA 2GQQA 1RTHA 2YKAA 4AT1B 3SDEB 1YDLA 2G0IA 2QIFA 3NY0A 1J5EF 2I9SA 3TA0A 2DO0A 4RZRA 1M5HA 4IQXA 3GG1A 5GAEI 3BO2A 4O4GB 4U8YA 1TP7A 3QO9A 1WC0A 4J9UE 4LVNP 2F5GA 2E1RA 5CYMB 5L8RC 4DV7J 1RAHB 5JJBA 4LRCA 3P3DA 4JBCA 4LFAF 4X2BA 1GNKA 1E6VB 1NH8A 2WVEA 1K8AT 1KRPA 5KG2A 3GJSB 3QQCD 5F8GA 3JS9A 1UJ4A 1WI8A 3P49B 4AD6A 4DLGA 1S76D 2VODA 1SQFA 1HQUB 2DH7A 2DPJA 1BQNA 1PJ6A 3POTB 1U0HB 2DVIA 4OHYA 4IOCQ 4ECYA 3J7ZT 3Q8QB 3BYRA 1CQMA 1TKTA 2BW7A 1DJ0A 3M9MB 2AX0A 3B54A 3FNNA 3MEEB 2DHGA 2OIHA 1PYTA 3PYDA 2P9CA 4RR5A 3EZUA 4A47A 2JC1A 2HFVA 2QRRA 1Q95G 2QMWA 1FX2A 1EKRA 2BANB 2W2NP 2FZKB 2DNQA 2E9TA 3C16B 1U1LA 5FD1A 3N01A 4M5MA 4F4WA 2V8PA 4NEZA 3M30A 4DR6F 3W1YC 3BEGB 2G13A 5D77A 5A0YB 5K14B 2IFXA 2YWWA 1MNEA 3HLUA 2BA9A 2YBVA 2EK1A 4UOCA 2FZGB 2CA9A 4NLOA 1NPPA 4CO4A 1UL3A 4IG0B 1AFJA 1JLAA 1KONA 2W9BA 1SVDA 1YJRA 1TUWA 3V4IA 2DR9A 3PX4A 2UUBJ 4M8LA 1IR1A 2V4JA 2LQ9A 5KOXA 3D6TB 3GYGA 1KSPA 4PWDB 3WC0A 4Y2AA 4GMKA 3MCOA 1XNQJ 3R5AA 1S9GB 1FJEB 2E7VA 1RLDA 4L3KA 4FF3A 2PT0A 4L3NA 1R8BA 1S57A 3I0SA 1DTQA 2GGPA 2UVRA 4NCGA 3I96A 2J7KA 4HACB 3IA0A 1VQPS 3W61A 5ETVA 3M1VA 5C7PA 1S9EA 2OPQA 2APOA 2XC9A 2M9KA 2EVZA 5KFNA 1HNVA 3PV8A 3GPAA 1Z4UA 2VFSA 1ZETA 4ES3A 3ZTPA 2NZCA 3PO5A 2EBGA 2AKWB 3R7BB 4CRJA 4LF8J 2FVQA 3LPYA 1R0AB 2HZVA 2RF2B 2M3DA 1N5YB 5DDQC 1RCXB 5J2PB 3KLFB 5CYQA 4DQQA 2CPHA 1KLNA 2DNPA 1X5SA 2GMHA 3D6FB 4HDHA 5CAAA 4AL6A 2B6AB 4QR0A 3AT1B 4AUKA 1V3SA 2NPFA 5KFUA 5C2CA 2HURA 4GRSA 2QL5B 1HHQA 3NNHA 4PPDA 3D0IE 1RAJA 5GAGU 1HNZJ 3OR2B 4Z7CA 2R8KA 3ET6A 2DNRA 2OH2A 3H42A 3OTBA 1TTHB 4K2JA 5LT5A 3R5DA 2Y8YA 5B7WA 1NXIA 2LDYA 3R27A 3KDOA 3I87A 4LF1A 5HMXA 3LP2A 1ZAXA 5IS2A 5LMNJ 4UTGA 2RUSA 3AB4B 1U47A 1TMMA 1K0TA 2K2PA 1CULB 1FDNA 5IC6B 3M4XA 4B9SA 2C2NA 3DOLB 3BM7A 3GE9A 3PJWA 2KYZA 3CF5Q 4KT0C 4PQAA 4LBHA 1RWNB 5GMKa 4PAAA 4U96A 3RBZA 4NCAA 4PYAA 2NXNA 2ZH5A 4HYKA 3HO1A 1Q53A 2YNIB 3C16A 2AJ1A 4DFKA 5DDPC 4DR1J 2LQ8A 4QYZJ 3W2WA 3LH2S 1URRA 5A0YA 1FE4A 5KFHA 2NYIA 5HQLA 3OV7A 3T1AA 4DZDA 2RQ4A 2GJ2A 4I56A 2HWTA 5DO2A 1VC0A 2ZH7A 3WC2A 4GKKJ 1GFWB 1LW0B 4ER8A 4ZVQB 2E5IA 4YR2A 2CQ0A 4X4VA 4OQJA 3CJKB 3JYTB 3ISZA 3FSXA 2FHMA 1MROB 2CQ2A 2MSTA 3KUEA 1VHIA 2ZOGA 2FHJD 1TL5A 3QGGA 2EKYA 2HMIA 3T9ZA 2DHHA 3MPYA 3J7YU 2DGTA 3HF5A 4AXIA 4IRKA 1R31A 4JI5J 4PG7A 2KZMA 1NB7A 2R7QA 5EN1A 3NS5A 4F7VA 4GKJJ 4IR1A 3IGNA 4FS2A 2BXJA 1VC6A 2HHVA 5KFPA 4HH1A 3JSYA 1OPIA 3HVTB 3BSAA 3S01A 5CCLA 1NK0A 3G82B 3D68A 3IO1A 4WP8A 4ZVGA 4X4QA 4DWIA 3GG0A 2VHGA 4MKVA 3IMQJ 4EZ6A 4KB7A 1VI7A 2WONA 2RT3A 3CVKA 1NDLA 5T7LB 2X1GA 3EPIA 1VQ4S 1S6OA 3V6DA 2HVDA 1VRTA 4CLTA 1QSYA 2FTRA 3HMJG 2CAJA 1MLAA 7FD1A 1RTIA 2C2DA 3DOKA 2L41A 2ZZMA 2RF2A 4RUAA 1FRMA 2KRBA 2OI2A 3R8YA 2FLPA 5IT0A 2GHWA 2GO8A 4O44B 3FVYA 3HHKA 1X0PA 2OPRA 1Y5IB 4URGA 4ED4A 3D67A 1CC8A 1FTRA 2PFDA 3I6PA 4YY3F 1FNMA 4CO3A 4X66F 3QLHB 4MMOA 4Q5VA 3L3CA 3HP6A 2KFNA 2C22A 1LEOA 3FK4A 2BOAA 1IUJA 3FDSA 3VV2B 2VB6A 4NX9A 4AFFA 4K4WA 2ZZNA 2LP4A 2EPIA 4EK2A 6FDRA 2HVZA 2VH7A 2YNFA 1LWFB 5LXYA 2JHEA 1SQGA 5LXRA 5G0RA 4B17A 1Q0NA 4RO0A 1VOMA 5IV3A 4P7VA 2B8PA 5H9FK 3CCRS 4JI1J 3PM9A 1VQSA 2XSFA 3FRYA 4FNHA 4ECWA 4NI2A 5KT7A 1IBLF 2J0XA 1NKEA 2QA1A 3HVRA 1X4AA 1YZ7A 2ALYB 2XYPB 3OTCA 2V63A 4NL5A 4JI6J 4B3TJ 5K20B 1HPZB 3KDNA 1N32F 1GTHA 3DI6B 4ZVFA 3D66A 2ROGA 1PKUA 4OX9F 2L9DA 4NXMJ 4QZVB 4Q2LA 2IA6A 1VRQC 3BN4A 5EDWA 4J9VA 4ZIWA 3UD4P 2H5IB 4FYXB 4ED7A 3K59A 2C3PA 3AJ2A 1XC9A 4ECXA 1WG5A 1Q81T 3DRPA 1FRIA 2GA7A 4ES2A 3KLGB 3T9NA 2HHHJ 3KG0A 4HI2A 3H5SA 1SC3B 4P6QA 4NLGA 3ZZTA 5C42A 4QWDA 1IBMJ 4O3SA 3GJRB 1CBKA 4G6VB 2VC0A 1VMBA 2VPWB 1EJ7L 3DU6A 2M2BA 2J5AA 4CH0S 2MYFA 1LW0A 4PR6A 3P6YC 2ZUAA 3W63A 2JOQA 3CJKA 4FYVB 4DL7A 3RTVA 4OYBA 3BSCA 2HFZA 4YB5A 1CSJA 5AT1B 3KLEA 4CWBA 1WACA 3KK3B 2J9CA 4PG4A 5AJ3F 4J90A 1U4BA 4ZN1A 3QJPA 3QPIA 4X64J 4OZNA 2VG7A 1RT1A 4H4OB 4M1KA 2KJVA 1G7CB 4NYOA 2HNYA 3AA9A 1BGXT 4RPFA 3RR8A 1F5AA 4OZ2A 1NJYA 1S1WB 4CLFA 3SV3A 4KAIA 5I3PA 3Q8UA 3HVTA 4GO7X 4F3OA 1DARA 2OMOA 3J7Z5 4RL1A 4NLDA 2FDNA 4ED5A 1SB6A 1BQMA 3HM9A 1F3VA 2AYMA 4RW6B 4MFBB 2CQHA 1ZM2A 2QSFA 4I2PB 5F8HA 2DB1A 1H74A 3T6BA 4ID8A 4NMLA 3W8PA 2PIIA 4EI2A 4EEYA 1NUEA 1NSAA 2E5LF 5KFKA 5BYRA 2OTJS 3UW1A 2EG1A 4IH6A 2KXNB 2HQ3A 1WSVA 1HHTP 2OMLA 3RR7A 1N36J 2E1CA 1D3WA 3AH6A 4A8MP 2MJNA 2HG4A 1I51B 4ZVRB 4DV0J 2MQNA 2IPOB 2UU9J 4JUZA 4EZ9A 2DXFA 2FLOA 5DETA 5D6GA 1S6PB 3Q86A 5ETOA 1YIJS 5K5MA 3T5JA 3I5AA 1U02A 4G65A 4BWJA 2CNNB 4TY9A 2ZH1A 2DHXA 4C11A 1J5OA 4FVCA 2QMUB 2AIRB 5IOLA 1R8HA 2LKZA 5DDOC 1RT6B 2LQBA 5CA5A 4X4NA 4ATNA 4OHZA 4DSJA 4ZP7A 1RKIA 1H7WA 4KHRA 3RB3A 2QEXS 4TLRA 1Q8LA 3TWZA 3Q8SB 2KB2A 2HVHA 2OEJA 2DGQA 4EFAC 2L48A 4IDKB 5ETRA 4LVOP 3D2WA 2RKIA 2K7JA 3GIJA 4JI3J 2Z2ZA 3TAMB 2MTLA 2CZVC 2YKPA 3DRRA 4Q43A 4OYXA 2PSZA 1S5ZA 4F3QA 4CTAA 3M2RA 1X4GA 3D3BJ 5KFAA 2FYXA 2MSSA 2BABA 2VG5A 3DM2A 4DV4F 4TYBA 4RW8A 3D28A 1HWIA 1WJ9A 2G2YA 3I56S 3BDEA 4C8MA 1LXJA 3NGUA 3E3XA 2B4OA 4YDXA 1LFWA 1FNOA 4PXDA 1TL1B 2FGCA 4DS4A 1RA6A 3GQCA 2V6AA 3FQKA 2RUGA 4NCBA 3KHHA 1RBLA 3M32A 2UUTA 4ZJQA 1WC5A 5SUHA 2QGFB 4AL5A 2V2ZA 4HHJA 1X8DA 2LEPA 3QT7A 4AQYJ 1TL3B 3CW2C 4ECQA 3VAGA 4ES1A 3TX8A 2LECA 4WP3A 3D6MB 2UUAF 3G86A 1JJHA 2VQEJ 2MY8A 3MM5A 2AYEA 4DQPA 1H98A 2OFGX 1CC7A 2ZVSA 3E01A 2W9CB 3OTEA 4RNNA 3IGVA 1S1XB 1LWXA 4ZLNA 2LVWA 2NUHA 5HMYA 1VFJA 5D3GB 2B4UA 6AT1B 2C42A 2MB0B 2GVZA 3L7UA 4PZVA 4U7UD 5D0GA 2O01C 4OX8A 4JI0J 2IVFB 2YKOA 3GYNA 2BRLA 1TKDA 2ZBPA 2XO6A 3GMGA 4B3RJ 1PBAA 2BJ3A 4USKA 5I3UB 2ZC3A 3PDNA 5D78A 1XMQJ 1PAUB 3R2DJ 1SIWB 3C6TA 2YWHA 4DR7F 1N6QB 4DV6F 2IHR1 2MY7A 5IWAJ 1L3KA 3HPOA 1HQEB 2V94A 3KUHA 3J80Y 2IYGA 4LFCJ 1K44A 1UKUA 4L73A 4WKRA 3H2VE 4AYBD 4ZPWR 4O3QA 5LSLA 2QJ3A 3AJDA 1JLBA 2JWNA 2K3KA 1RK8A 3IM8A 3DHXA 3JAMY 1N33F 2YH1A 4NPOA 3DOMB 2VA2A 3UPFA 1ZBTA 2HQDA 2BQRA 4R5PB 2HVEA 2A2CA 1AT1B 2HIQA 3IM9A 2M4MA 4R25A 1IBCB 2GNKA 3AJ1A 3R6GB 2YKMB 3NBPB 5KFXA 2BEFA 3A8KA 2JRSA 3AD8C 1NH7A 1N5TA 5BR8J 1FERA 1N0VC 4WJBA 1YZ6A 2FVPA 2OSQA 2IY5B 5HLFA 4TYAA 3QT5A 4M5KA 1GH8A 1ULRA 1B99A 1SJRA 3IP0A 1S1UB 3GFZA 1QUVA 2DGXA 3Q23A 3S1TA 3IBWA 1NO8A 2FY1A 3MMAA 4DBQA 3AD9C 2HW3A 4TU7A 1YLXA 1Z2LA 1NM2A 5C2GA 2QL7B 3MEKA 2D3ZA 2L9NA 4YN3B 4ALZA 3RRKA 2JNJA 4DHVA 3ZZYA 3CO0P 2F4VF 2D3OR 2PMWA 2IDEA 4LBPA 3PKMA 3UCGA 1NHVA 4L75A 3TI0A 1FHTA 1QSSA 1LFPA 3MECA 4USVA 3GFHA 3B4DA 1FVQA 3Q2TC 4WYWA 2ZD1A 3Q8YA 1Q82T 3GR1A 2H4YB 2DR6A 3BH6B 4ZVHA 3RU0A 4I1TA 3MDFA 2YNGA 3FZ2A 4TY8B 2OPSB 1DY3A 2ZH9A 4NMXA 3OL7A 2ASDA 4ZLPA 5J1PA 1UA0A 4R8UB 1AUSL 2CPFA 1UP1A 3OUYA 5HATA 5KFTA 1WKJA 2R4FA 4N77A 4K4YA 1SKRA 2DGVA 4OI0A 1T9UA 1TL4A 4BBYA 1BQXA 2WW8A 4DCJB 1D0EA 5LJ3Y 1IQTA 2R2RA 1HR0F 5A8RA 4QIEA 1IVZA 4LSZB 1NKBA 2VJVA 2WCXA 1CJVB 2XS2A 5KFDA 1S0OA 5IT9U 4X4RA 2OUGA 3C66A 4P74A 3V6HA 1S1TA 1ITPA 2M5YA 2DY1A 4RNFA 2XMVA 1TAQA 4PQUA 2CNOB 1MMDA 3A3NB 5D3GA 1S0VA 3MMBB 3GSIA 1EB0A 5KT2A 3GTYX 4PYDA 3ZNUA 4W98A 1E6YB 4K4XA 4X4PA 1GX6A 1YBTA 2CRLA 1YTYA 3TJ8A 2XSJA 2HZAA 1KQSR 1Y3KA 1RU1A 4OZ3A 4OYIA 4G3IA 1S0MA 3M05A 1RWKB 2QA4S 5DLGA 3ZZRA 1KNZA 1XR6A 4KHPF 3NNCA 1U0SA 2IJNA 3PW7A 1RUSA 1F3FA 3P4UB 3V6KA 4XIUA 4K7QA 1TK8A 3GCXP 2EFQA 3NOGA 3ISNC 2F9JA 2DK2A 2GV1A 1NAQA 1TKZA 4WXOA 4Q8FA 4A4JA 2AEJA 2KN4A 4LSLA 3BSNA 4LQ9A 3LPEA 8RUCA 3CDUA 1X7VA 4PG8A 3SI8A 5F8MA 5D0RA 1ZPVA 2HRUA 1VDHA 1KFDA 4O3NA 3HSDA 2LMIA 9ATCB 3DMJB 2K06A 4DR2F 2DR7A 2J0WA 1TVRA 1RT7B 2WHOA 2L3MA 1Q16B 4DL5A 4KGXB 1JK9B 3LAKA 2KJWA 3ETMA 5JVHQ 4RWWA 3CJSA 2XY7A 3S6EA 2BM1A 3B4MA 3CD7A 1TU0B 2B9WA 4EU0A 2BE2B 4EWTA 3UN3A 2R7UA 4C9DA 3MZIA 1S7HA 2KM8B 1OQ3A 1DURA 1RWMB 3IC1A 4KE5A 1GMVA 3NAHA 3M9NB 2MZJA 4UQTA 3DRYA 1REGX 1UW9A 2ZBIA 1EIYB 2CADA 3CGIA 3EUNA 3BKFA 5U47A 2XTJP 2NSBA 2AJ0A 5KFZA 2JLGA 4I67A 2AWZA 2AP6A 4RW4B 1CPZA 4DV7F 2BBEA 2DIVA 1SH0A 4OI4A 3KJVA 1HNXJ 3BN7A 4JI2J 1W2IA 2KVIA 1JLQA 3W2VA 5B0GA 3TJ9A 4G1QB 2GHPA 4X4OA 1ZZNA 4KPYA 4KHMA 2DEIA 3M2UB 4CLPA 1IR2A 3GU0A 1GXLA 1WI6A 3VF0B 1A9NB 4L6V3 2QL9B 2GIFA 1T95A 1BD6A 1FRHA 2AZ1A 3U27A 2A0FB 4MTPA 2HK3A 1D8ZA 3PNIA 1NJXA 4IFYA 3U7JA 1N4LA 4DXLA 2IM1A 4LBIA 1K1QA 3D1QA 3CJ4A 1CJTA 3IRWP 4NWBA 3RG6A 4DSLA 2BDPA 4C0HA 4JOUA 1YJ7A 2BJDA 2DISA 4X65J 4DPYA 4TNOA 4IG3B 3K5MA 4FBUA 2DRBA 3W5ZA 5IT4A 2RVJA 3EPGA 1GMWD 1Q86T 2IMWP 1YJ9S 2NS1B 4B3OA 1KTQA 3TANA 3VGTA 3MAAA 4K8RA 2QG9B 4WP9A 3CDAA 4B08A 1R3NA 2ADBA 4H4MB 4OX6A 4IOBA 4TU9A 4MK9A 3IRXB 3V2UC 3QRPA 3BO4A 4PUOB 3H90A 4P2FA 2IRXA 2VBXA 4LF7J 2MQOA 2IC3A 4JV1A 3JTPA 4Q0BA 4A8YA 1SH2A 2XZDB 2UUBF 3P8BB 3DN9A 2J0QD 2LDIA 1FFGB 4DSIA 2M70A 3ZTOA 2HQCA 1JLEA 5KFVA 1T9XA 3QIDA 5CCMA 1M5OC 3KLHB 1U6FA 3LP1B 2E9ZA 4FVMA 3CNQP 1XNQF 3HD1A 3H5UA 4DL0C 3UR0A 1UVKA 4XDCA 3NWGA 1RCOB 2CPIA 2FJDB 2PD1A 3OVSA 5F8NA 4CQ1A 4ED3A 2QYCA 3NMAA 4WK1A 4XAKA 1EP4A 1F9EB 3CDBA 1HKAA 2J0SD 4KGVB 1RT4B 2GW8A 2D1CA 2IDLA 5I42A 2V8HA 1S1VB 3UVJA 4CLWA 1JNZB 5DQHA 4LF8F 1CS4B 2HWHA 1VR6A 5DGBA 3SZ2A 2HK2A 1FK9A 4ZA1A 4ECSA 3A12A 2ZE2A 4ELTA 3KLIA 3MMJA 3OTDA 4FDFA 3CCJS 2VASA 2CPEA 2V0NA 3HXMA 2YTCA 1XR7A 2LYVA 1FRLA 3H7HB 3U02A 3M6VA 2LXFA 1AYEA 1A0OB 3ZTQA 3EVOA 2KT5A 3SQGA 3CJRA 4BDPA 1KBRA 3W62A 4UUWA 1HNZF 3AQPA 4KJIA 4F4AA 4BCAA 4WFZA 1ZTTA 4QIWD 1T03B 1OYEA 2W1BA 4DQIA 5KG4A 1GXTA 1TL7A 2XS5A 2YY3A 3F0NA 5EX0A 1PCAA 4ID5A 2F8EX 5GVQA 4RW9B 3HHNB 4C48A 3W9HA 4ZITA 1T3NA 1ZH5A 2B43A 1HYSA 5LMNF 3R97A 1NJIT 4B9TA 1F9HA 1YRXA 3OR1B 2UV8A 1UVJA 2FC8A 4ECTA 1K1SA 3G96A 1JQGA 2AF6A 2WAQD 1OWXA 1FFSB 5F9NA 4HL9A 2XMMA 3MM8B 3DLGB 3MCSA 1HBOA 5J1EA 2HNDA 3A4TA 3IG1B 4ZDNA 3SFGA 3PXGa 4DR1F 3CJ0A 2BJ9A 4B9MA 3RRGA 1HNIA 2IBKA 1V9OA 1B7YB 2CJKA 5D8HB 4J9NA 2P5VA 3KK2A 3R5GA 1AW0A 5HBMB 2MKKA 4ZPCA 4ZPTR 4ZCKA 4PXCA 4I2QB 1NSPA 1MN7A 2BW2A 4GKKF 2MEWA 1XWLA 3AXKA 1QSLA 1VIOA 2CKWA 2ZHAA 2AEFA 1ZYQA 2QSWA 2ZOMA 1X5TA 4P9SA 1JMTA 3DC2A 1T05B 2DXDA 1KQKA 4OHWA 3MOZA 1P8GA 3NS7B 2XEXA 2PMHA 2BQ3A 4CT9A 4JI5F 2LEBA 4GKJF 5DQIA 2DITA 4FPRA 3HDSA 1KQGB 1AXQA 2CQ1A 2PEBA 4QWEA 2HGLA 3M8SA 1R0BG 2VV5A 2JLEA 2X3DA 5L9XA 2DKOB 5G4DA 1SL0A 4C8ZA 3JQJA 1VLYA 4YOEA 3QBCA 5A2QU 1YKWA 1TZ0A 1RT4A 3HZEA 4ZLJA 4P72A 2DYAA 2Y1RI 4QYRA 5KFQA 1HWKA 2AU0A 2Y0SD 5BYSA 3ENWA 4LUBA 1WEZA 2NUUG 4USTA 3NKYA 1SIZA 3LTOA 2UUWA 1M5KC 3SCKE 2MKYA 3D9BA 1LW2B 4V19X 2R8HA 4A8SA 1NJWA 2UP1A 4R0JA 1UVIA 1CJKB 1TQLA 1UEKA 4YR3A 4D3HA 4NZ6A 2W4PA 3MEGB 1Q78A 1C1BA 2AYGA 1XERA 2CQ3A 4KGMA 2XMTA 5BJRA 5GMEA 2HQGA 1HI1A 2J7UA 2O1PA 1X4EA 1PYSB 1IKWA 2GQCA 1HI0P 2M7SA 1NK5A 3LUYA 1SKUB 5KG5A 1U48A 1IQZA 3ENVA 2VIHA 1HMVB 1NK6A 3MUVP 4JI1F 4IRCA 2WSEC 4LIRA 3N4WA 1BE4A 3BGRB 2IYIA 1SUQA 4OV1A 3PR4A 1RAOA 4J37A 4NXNJ 2K7KA 2HHWA 4JI6F 4B3TF 4YR0A 1S0NA 2D69A 2R9LA 3VGVA 4F2RA 4Y34A 5CZVA 4JP8A 4NXMF 1JJ2R 4C6AA 2WVCA 1NPRA 3MM8A 3BGOP 5HP1A 2XHWA 5D4OA 3AOCA 4L76A 3DGVA 5L1KA 1TV6B 4ITSA 1QD1A 4DPTA 1JXVA 3QFWA 2HHHF 4RX6A 2NXCA 4U6PA 2HNZA 4DN9A 4ZHRB 2H3EB 2Z2YB 1IBMF 1H72C 2QO3A 2P8IA 1KWMA 2VL1A 3R1LA 1X4BA 1Y5LB 5HBMA 1DTTB 1X31C 5E0OA 2Q3PA 3C14B 4ZKAA 1LWEB 3NCPA 1F60B 3TAPA 1YJVA 2R7VA 2OPPA 1AUDA 4Q44A 1MSWD 4RNHA 4OFZA 4HEA9 1C1CB 2KG1A 1T05A 1J5EJ 2AV5A 2DNKA 1U1RA 2HZCA 4MIAA 2R7SA 1YHQS 5MLCV 4GO5X 1H38A 5HROB 5RUBA 4P71A 2AW0A 2V4RA 2MKHA 4X64F 3PEHA 3SSQA 1MG7A 1HBMB 2NXUA 1SKWA 3KOAA 1QTMA 5B0CA 3H5XA 3MFIA 2OLWA 1KLMA 1RQ0A 4DFMA 3PVXA 4KTQA 3VR1A 3OL8A 3GSDA 2DJWA 4QU7A 3IBFB 3C6UA 2J6SA 4USIA 3G2XA 1SL1A 1S10A 4KKOB 4CLUA 3MM9A 2DH9A 1N54B 1VISA 2DGSA 3DRSB 4GVBA 4X62J 4DR3J 2UUCJ 4MIBA 1MU2A 4ECVA 2Z30B 4MK7A 1U25A 2MGZB 2VICA 1GEHA 3MD3A 3DXBA 2GJFA 4ICLA 2UVWA 2MZSA 5KFWA 4F0KA 2G9OA 1N36F 2ZBRA 3VAHA 2B5JB 4DV0F 3SQOP 4IKAA 2UU9F 2Q66A 5EHHA 4UOGA 4O4RA 4U67Q 1IKYB 3AA8A 4HI1A 3KLVA 4QJVA 2VBZA 1RTZA 4WIIA 3BSOA 5EWFA 5GAEU 1I3OB 4F0MA 2MHEA 1RTHB 1SPBP 3JQMA 4H4KC 4FXWA 5DQGA 3H40A 3FCHA 2CFXA 4TU8A 2V8VA 3D54A 3X3UA 4DR4J 3N79A 4ILMA 1HHSA 3ZZZA 4NRUA 3T41A 3AFGA 4BC7A 4DS5A 1S6QA 1BY9A 3OFFA 3QFHA 1U2RA 1VQ8S 2K8GA 1NBEB 1NSQA 3V5RA 1VYAA 3QO9B 1GQEA 2B9YA 1QJHA 4ANDA 3DLEA 1NU4A 2YH0A 4KH1B 4C3KA 2RU9A 4JI3F 2RD5C 4CYUA 1IWAA 4X4TA 2FGOA 2JJ4D 1C0UB 4NYZA 4PEOA 2VG6A 3RB0A 3UD5A 2E5JA 4PXBA 3R6LB 2R7RA 3DLHA 4M63A 1URNA 2OFHX 5IV4A 1RWXB 3BH7B 3SMZA 3JSMA 5I3QA 1BQNB 1PSDA 3GV5B 2V4QA 2BKNA 1D8YA 2AGQA 3O44A 4NZ7A 4PKDB 2VDHA 1REVA 3P5TL 4PRFA 1TKTB 4P52A 2OD4A 3SSSA 4F4YA 3T3FA 3BGUA 2V67A 4ZHRA 3MR7A 3TUJC 2DBBA 3ZXWA 3QGHA 4AQYF 1R43A 3RW7A 3PJXA 3QT6A 3VAIA 1WF0A 3QATA 3PR5B 2VQEF 1VK3A 2HFSA 3S7RA 5F3TA 4LF9J 2ZH4A 1U6BA 4NLTA 4CLLA 1GT8A 4N41A 2AX1A 3RGIA 2M8DB 2OHDA 3M30B 1X4FA 2I5JA 3UNYA 4DDFA 1RE1B 2ZBQA 5L1IA 3PYGA 5KT6A 5ETTA 4WE1A 4JI0F 1UA1A 2IM3A 2CQPA 3DLJA 2KVQE 4B3RF 1XMQF 2AMCB 1JLAB 2W9BB 3G6VA 2BKPA 2MZRA 3PO4A 3V4IB 2R7TA 2EBEA 1IKXA 4OX7A 4KO0A 5HMWA 5IWAF 1VQOS 4MKBA 3M8QA 2V4JB 3CIZA 4WFXA 2FVRA 4FF4A 4JI7F 3UDLA 1G1XA 4LFCF 1UEVA 2M52A 4WPAA 1FKAF 1VBKA 3N28A 3VAJA 3CDWA 5A8WA 3VCDA 4HTIA 3TA2A 3ZTSA 3I0SB 1DTQB 3T1YJ 3N6NA 1RHQB 2GGPB 3HSJA 4M95A 4NCGB 1EHWA 3KXDA 3MD1A 1BWVA 3M6WA 1N34J 4Y2IA 2V50A 2ABYA 3M1VB 3LWLA 1U09A 1XMOJ 1M1KT 5KFMA 2OPQB 3QAEA 4DR5J 1HNVB 3OLBA 2W9AA 2BR0A 4CCHA 4J7CA 4LF4J 1ZZFA 1O8BA 2H4WB 5E7OB 3ENAA 2R7WA 1RTDA 2CQ4A 1RZMA 1FXLA 2HRTA 5BR8F 1Z2ZA 1PC4A 1WKLA 2C2EA 4KGKA 2P9EA 4IYQA 2IJFA 4QPTA 2WVDA 1NSKL 4CZCA 5CYQB 4DU8A 1JXLA 3GCWP 1C2PA 1FJ7A 4U7CA 3U1LA 4EBEA 4RU9A 4OV6A 2MKCA 2FHKA 1WTFA 2HPUA 3BJYA 3C15A 4H4KA 2CQGA 5KFCA 4DL4A 2PA3A 4Z37A 5EGYA 4MIWA 3VGUA 1C0UA 1RYRA 2V2VA 1K73T 4UZBA 4UQGA 4ED1A 1SV5A 3NGKA 1UFKA 3ET6B 1B7FA 5HAOA 3J81j 1X60A 2V69A 3BO3A 5FLXY 2ZH6A 2RILA 2BRKA 4C97A 1WC6A 1U24A 1VBXA 3LP2B 1GTEA 4ETZA 2D3UA 4CLKA 3KMQA 4I6AA 3DYAA 2YNHA 2F40A 4NLQA 1WOSA 4XK8C 1RT2A 3K8VA 2HFNA 2FHOB 2D3O1 1UWBA 2E9RX 1APSA 2ASYA 4USUA 1VHFA 2VKRA 1R6YA 2BX6A 4WF9Q 4C3LA 3M8PA 3HFZB 4F02A 1HBUA 2MMYA 2VQFJ 2W7OA 6FD1A 3KJFB 3LWMA 3W7BA 3CD5A 2ROPA 1S4FA 1JLFA 3G8SA 3OVAA 2MPUA 5GMDA 3W2WB 2EK6A 2F1FA 4A46A 1X5OA 4UZCA 1UTAA 4C8KA 1FKPA 2AJ2A 2F63A 5HVHA 1HNWJ 4KQZA 4MYTA 4ZVUB 1IM4A 4QW8A 2OKQA 3Q22A 1R6VA 1A7GE 4YDDB 5CZXA 2GIRA 2E44A 4DX6A 5H9EK 2VZ9A 3TR5A 2HMIB 4RBVA 1S72S 3L4BC 3QAUA 5A6PA 4J9LA 3W60A 2Q79A 2DNNA 1AROP 3DGPA 4WK3A 3X1LB 3GYXB 2X3GA 3IWXA 3MF5A 3GLJA 4KPCA 4E0DA 2EFPA 3NL0A 1VQMS 3KJNB 4TQRA 4DMZA 1KN6A 3DXSX 4O3OA 1UZHA 4HTJA 3WZ0A 5ETPA 3I4HX 3BQ2A 1B0TA 4IFVA 2JFDA 3K17A 1F6TA 2WONB 1VLOA 1Q8IA 3MM6A 2FJAB 3V6DB 3ZFVA 4IOAQ 1T3OA 3SXLA 5HO4A 1VRTB 1U7LA 4N8NA 2ZHBA 1JXEA 4WFYA 3DDKA 1HWLA 1ZM4A 5GADI 3CCES 1RTIB 1YG0A 1RT3A 3DOKB 1RACB 1T0TV 1U1KA 2OGUA 1D9AA 3T1HJ 2FQQB 4C8OA 2OPRB 2ZH2A 1NPKA 3BPDA 3CCMS 1RHKB 3FQLA 4DFPA 3AHPA 1IBKJ 4DL3A 3FFIB 3WDOA 5DM6Q 1GK8A 1VC5A 3U1MA 4K59A 2ATCB 8AT1B 3KHGA 2YNFB 2O5DA 2DR8A 2HS3A 3H98A 2A6MA 5G0RB 1JNRB 2CQCA 1NB2A 1HNXF 2VFUA 1RKJA 4JI2F 3PHTA 1DAXA 3BV8A 2Q6BA 3NGSA 3D0HE 3TP2A 1TFWA 4WTYA 3BPSP 4NI2B 1RHUB 5F8IA 2H1YA 1NDPA 2VA3A 3C2PA 1RLCL 3EVMA 1XR5A 1DRZA 2N4CA 3EVWA 4K0KJ 1F2HA 2LXUA 3MTKA 5T14A 5CYJA 3KK1A 4WFBQ 3O5TB 1U8WA 3GFXA 4CO1A 4EGLA 5ADZA 2R2UA 4DG1A 4BHQA 4UY8T 1FRXA 1JLGA 1XIQA 4A8OA 4X65F 3ADAC 3ELHA 5HI7A 1KS2A 3DRPB 3G6XA 1VBZA 3PHEA 4DFJA 4M5GA 4LF5J 2W4CA 3V81A 5DS7A 1YVFA 5C42B 4CO0A 4B9VA 2QT7A 2JH3A 5FDLA 1SH3A 1JKHA 5I4MA 1YJWS 5LSRA 2GAGC 2WSFC 3I9ZA 2AT1B 3QGPA 1V6HA 2DXEA 3T5LA 2R3VA 2G2OA 4FYWB 2XYHB 1WC4A 4LF7F 2NLWA 3KLEB 1M5VC 4K4ZA 2P9GA 3DU5A 4Q7AA 4P7TA 2QE5A 5CD4A 2VG7B 1RT1B 3I5BA 5F3ZA 4EYIB 4PWWA 2Y3YA 3IWLA 2HNYB 2RRBA 3GWCA 3PYFA 3AAWB 2B4VA 4B9UA 4J9RA 1LNQA 1NZAA 3DLKA 1TAUA 2A6OA 4O3PA 1UVMA 4EYHB 3NNAA 3J80U 1SBRA 5C25A 3MUTP 3TUPA 3D0GE 1MMNA 2WVFA 1U26A 1BQMB 4DCPB 4I7FA 3VZHA 2BMBA 5E2QA 1RJJA 5B0DA 5B0BA 2W25A 4QIFA 2VPZB 1VQ7S 3HHLC 3QSIA 3BR9A 1Q8KA 2Y1IA 2J9DA 4DI6A 1M1GA 5A8KA 3Q83A 2ZJRQ 4AE5A 4J9QA 2MQ8A 2G0CA 1OSDA 2HHXA 2DPIA 2A10A 2Z4PA 3KFWX 4QIVA 4I68A 4CNYA 5E3RA 4ECUA 2W2PP 1DBDA 2NR0A 1FXRA 2Y0BB 2ZFHA 3M8ZA 4DSEA 3LAMA 2YWEA 3FFIA 4QU6A 3QIPA 4EUVA 1OQ6A 2J9EA 1W25A 4V1Ak 1C0TA 5ETSA 2CIMA 4MYUA 2JSXA 1R8AA 4C11B 1R89A 3MM7A 1J5OB 1PILA 2PE8A 3CMQA 2QA4G 2N3OA 1FWPA 3MR5A 5HVFA 2RQCA 5IQ6A 1FKOA 4PCQA 4IO9Q 4QWCA 1G6BA 2QFIA 4U7UK 4ILRA 1RP5A 5J2QA 3P45B 3IS9A 2F8MA 2RKIB 4CI0B 2HAFA 4Y0FA 2QX0A 1P9YA 3DRRB 4ZVPB 5LSOA 3RZAA 1FO1A 4NYPA 4CTAB 3M2RB 1R0CB 4RNOA 1WEXA 4LSNA 1RA7A 1ZAVA 1WF1A 3QYYA 4FN5A 2VG5B 3DM2B 3MWBA 4RW8B 4JYAJ 2ATLA 3PKYA 1B0PA 1XN9A 4FPIA 4PABA 3ZC4A 3CDEA 1FJCA 3TJAA 4ZP6A 2UXBJ 4KFBA 5KFIA 4N76A 4DSKA 4MKYA 2VBWA 3TRGA 4ETXA 4EBCA 2XS7A 3Q0AA 5DG7A 4C4WA 3I55S 2JLFA 4ED0A 4Z7YA 3SYZA 4HT5A 3M32B 4J9OA 3TOQA 2IBOA 2WOMA 3RBXA 4CM0A 3HD2A 2AGPA 2V2QA 5KFJA 3IN5A 3I82A 3VQSA 3LGMA 3MMCA 5KFFA 2XLJA 2CJBA 3MM5B 3MR2A 1XNRJ 3E01B 5B0AA 2GHVC 5CD4H 2MQMA 5IM0A 2RMLA 4B3MJ 3N0VA 3ULHA 1IKVA 3SCJE 4A8KA 4DV1J 4MAKA 1BHNA 2GVZB 2B8QA 2CPYA 1D09B 1S12A 3R1HA 3LGHA 1MWYA 1BMQB 4WTOB 1T11A 1UPMB 1RT5A 3W8GA 3ZTRA 4DV5J 4OL8A 5GAHI 4ED6A 4C8NA 2DNLA 4OMFG 4ERDA 2MKIA 4OHXA 4NA1A 2H5JB 4EBDA 3C6TB 4OI6A 4KYZA 3GIRA 4C2MA 3HK2A 1EETA 4KV8A 3BYPA 3TW0A 4RW7A 3HT0A 4KBIA 5HVGA 3RUBL 4Y2KA 1FVSA 3PJ9A 3M6UA 3CC4S 2VF3A 3HT3A 2IAJA 3JSRA 2B56A 2KO1A 1FA0A 4LREA 1OY8A 1JLBB 1HQ2A 2Z57B 4RLEA 2HYIB 1RTJA 1EKSA 4K5SA 1B4SA 2YKNA 1H7XA 4DEZA 3E51A 4KC5A 2X51A 1I5OB 2PO4A 4RUBA 3C19A 1L3UA 3HHLA 2YWFA 2VKZG 2Z2LA 4JB8B 4RNMA 2R8IA 5ETQA 5H1SV 4ECRA 2YPZA 2FD2A 5J2MA 1Y5NB 4ED2A 3PIOQ 1TKXA 3MR3A 4I0WA 5HLFB 1WG1A 2LA6A 2BUNA 2POKA 3DKDA 4P2XA 2XB2D 2XI3A 3RJMB 1W2BR 3ITHA 4GC7A 1S77D 4YUDA 1J2VA 3A8JA 4K4UA 5ETLA 2KFZA 3MMAB 3TX0A 3NG8A 3UE2A 3GJQB 3PEJA 3M8WA 3MEDA 5F0WA 1YITS 2GVDA 1WWHA 5MAOA 4M5IA 4DPUA 1GXUA 3M7VA 3L95X 2LU1A 2ZDOA 1XQIA 4OIXA 1RWPB 1X9WA 1ZS6A 4ZPVR 3UD3P 1N88A 4C3MA 4CLSA 1F5BA 3EGVA 4OZ1A 3MECB 4F4KA 4QQBA 1U6ZA 3R5BA 4NXNF 4YB7A 2X7IA 2ZD1B 2DCUB 3S8SA 3R7NB 2ZUGA 5B0EA 2HGMA 5J2NA 2YNGB 3MCMA 2MZ1A 4YP3A 3WX8A 2MQLA 4I6WA 5AE2A 3NXZA 1DZ5A 3QJLA 2DNYA 2HWIA 3KTQA 3OUYB 3PACA 2IM0A 1TUGB 4MH8A 1S79A 2HS0A 2GIQA 1SJFA 1PO6A 5JUMA 3LA0A 3FGVA 1RWWB 4ZCMA 3CCZA 4JV0A 2HEKA 5A8RB 3BQ0A 1AA1B 4URQU 3UCUP 1FDAA 3BDPA 3HI9A 3GZ7A 4HLBA 1S1TB 1H2VZ 2ZC4A 4YHHJ 3PRDA 5KFYA 3FMBA 4PQUB 2RDIA 2WTFA 2H48B 4QR1A 1DLOA 1CJUA 3R5JB 3QGIA 1DQAA 4NLUA 2JFKA 1WC1A 4DUZJ 1RDRA 2RRNA 5L46A 1CQNA 2VONA 3R7SB 3GJTB 1YJTA 2ZM6J 3BBCA 2B7BB 3NWRA 4DLEA 1IXKA 2XSJB 2XCAA 4WFNQ 1KP6A 1I94J 1FDDA 1AZSA 2DD8S 1TFYA 3HX9A 5KT5A 5ETNA 1PJ5A 3DLLQ 1IJFB 3CCTA 2RU3A 2VOOA 3TO8A 4Q45A 2Z2MA 5IC4B 2CPJA 1W26A 2CQDA 3FEXB 1JJ4A 2CPZA 5C24A 2C3MA 1TKZB 4X62F 4DR3F 2UUCF 5KAKA 4LSLB 4IUFA 4UY85 3PCOB 2RHSB 1Y4ZB 4YEAA 1Y3JA 2YXLA 3DCAA 3AD7C 2DGWA 1VQKS 1LWCA 4FYYB 2C1EB 3LP0A 5KTQA 3OQ2A 2EKNA 4RBTA 1TVRB 4UW2A 2U2FA 4FBTA 3NRBA 3H2LA 3BGLA 4OJHA 3FBCA 2G1DA 2RS8A 2HLTA 3OBIA 1CVJA 5EWGA 2BVZA 5F8JA 2K1RB 3CC7S 2G2ZA 3OTOJ 2IVYA 4EO6A 1DFDA 4X4UA 1JX4A 3PFEA 1QVFR 4UT4A 1YK9A 4NA3A 3LQVA 4DR4F 2QMXA 2J6TA 3KNGA 2B3TB 1AB8A 5E5NA 3A8EA 4ZPAA 3KHRA 3FEZA 3OFHA 1MW7A 3DFEA 4D3GA 4ZVSB 1VRUA 1D9DA 2HGNA 1S9FA 5K8OA 4JV2A 3BREA 1ZA1B 2ZH3A 1H3DA 2H5EA 3ISND 4OYPA 4XDDA 1XBWA 3KJVB 1S7IA 2MLZA 2EI5A 2HBYB 2B0GA 2HHTA 2N7YA 1VQYA 1PIEA 4S0MA 2R8GA 1YGYA 5KG1A 1ELOA 1JLQB 3W2VB 5DZ7A 3J7AN 4LF2A 2FVCA 2YX1A 2ZKTA 1NRKA 5KT3A 2KFYA 4FNIA 3QZ8A 3OL9A 4W90B 4DF8A 3K5PA 3VQTA 1JLCA 2KU7A 4NLYA 3IR6B 3LOUA 2EG2A 3W64A 4Y2MA 4F4ZA 1SJQA 1VGYA 1MWZA 4IFYB 2FJBB 3A8IA 2B9XA 4LRBA 1CJTB 2D9PA 4N8OA 2KZZA 1QE1A 4CLZA 2Q6CA 4OLOA 4B9NA 3TUZC 2ALZA 2E29A 1QLNA 4LF9F 3GIIA 3ICLA 3SCLE 1T9WA 4B3OB 3SDEA 3GB0A 4QCLA 3ETOA 1KDNA 3MAAB 2E5GA 2ZHOA 3HKZD 4FP9A 3UN5A 3CMES 1IJEB 3Q89A 2JX2A 1LK5A 4W4MA 2XY5A 2L9WA 4O4GA 2NQPA 2C3YA 4C8YA 1P1TA 1K0VA 3FCWA 2ZJPQ 2ZNYA 2VDIA 2DGUA 5CYMA 4UUXA 4ZPDA 1FJGJ 2MQPA 2IC3B 1NDKA 2XZWA 4Q0BB 5E3AA 1E6VA 1VK8A 4LMZA 3K89A 1H2TZ 1T94A 4USHA 1QAIA 4TKTA 2XBPA 4BLGA 2MXYA 2NYHA 4O0NA 3LW5C 3JXOA 4NZ0A 5F41A 1G2EA 1JLEB 2BJ7A 2Y1JA 1HQUA 2CJ9A 3POTA 3ILLA 1FDBA 4RJVA 1U0HA 4FXVA 2WVBA 4DJBA 4OYZA 5KFLA 1FTCA 3LALA 3K5LA 3MEEA 1QAJA 4LR7A 3T1YF 1Q4RA 2RNEA 3WBZA 1NK8A 5LMUJ 3UN2A 1N34F 5AXNA 2M88A 1WHYA 3AOBA 1XMOF 1LK7A 2WRMA 1EP4B 4DR5F 2BANA 1UVNA 3PRVA 5KT4A 1UEUA 4LF4F 4CM2A 5I42B 2K1RA 3KHLA 3UVJB 5SZTA 2CUYA 3E8OA 5E3CA 3FUYA 2YKQA 2HFUA 3FSIA 1FK9B 2DNZA 5K14A 2DNGA 3A1YG 1L5UA 1WHXA 3EGZA 2ZE2B 2F7VA 3QWUA 2C3UA 3JQKA 1O0PA 3KLIB 1VJQA 4KH0B 1ZOTA 4I4BA 2FIUA 2QTWA 2IA0A 3ILIA 4NRTA 1S6UA 4F0HA 4DV3J 5ETKA 2AD9A 5K9FA 3PX6A 4IG0A 4QYZK 3HZGA 4OI1A 1YJNS 1WOOA 1EAYC 3SQGB 4LRFA 3OXFA 2DH8A 1VQ9S 2VC1A 1HW8A 4E8UA 2IVMA 3I32A 2IMOA 4PWDA 2MLXA 3GP9A 4NLPA 3MHYA 1EZZB 3SCIE 1S9GA 1VJWA 4A8QA 1TL7B 4WU2A 3K2YA 1X9MA 5AE3A 3TA1A 4HH0A 3F41A 4RWXA 4ID5B 3SV4A 2JVOA 2YPYA 4HACA 4WWSA 4BWMA 3ZZ0A 3OSPA 1HYSB 3W3SA 3FJ2A 4ELVA 3GIKA 3PRBA 2OO4A 2V2KA 2BJEA 4N47A 4QIGA 4DZ6A 2A2DA 4QR2A 3GILA 4J9SA 1PYOB 1RAEB 2PI4A 2MDAA 3W9JA 2VQFF 2PN6A 4PXEA 5CHCB 1K47A 1HBOB 5J1EB 2HNDB 3AY0A 3K8WA 1R0AA 5M2UA 3NMRA 5IQQA 2R2TA 2GC8A 1N5YA 4J91A 4DOZA 5J2PA 1GX5A 3PTWA 2W8LA 3KLFA 3OW2R 1HNIB 3CT9A 3H5YA 3R5CA 3AQOA 2A3JA 4Y28C 1TUVA 2C2KB 1IN0A 4NLVA 3KK2B 1G4CA 2NZ4A 1RHRB 2UXCJ 4ZN3A 2JEJA 5DJBA 4B9LA 3AODA 2B6AA 3SEOA 1HNWF 1RHMB 5EX3A 2ZITA 5AE1A 1RISA 2GS8A 4XO0A 1OPZA 2W8KA 4ZIVA 4Y65A 3IWNC 2VFRA 2ASLA 3VVUA 2CVIA 1RYSA 2H51B 4NLXA 4ZVEA 3RYLA 2KXFA 3OR2A 2UZAA 4M5LA 2PC6A 2MHNA 3BF4A 2CVEA 2V5HG 4ZJOA 2GCFA 1OYDA 2YX4A 2WB4A 3ZNJ1 1HL6A 1PAEX 1TR0A 3NGDA 2DCLA 2HS4A 2ZNZA 4Q8EA 4ANCA 5AXLA 5GAGI 1V5VA 2DGOA 5LJ5Y 3PW2A 4ZS6A 3NLCA 4ANEA 1J27A 3OD2A 2HIYA 2H65B 1GAOA 3QNWB 4K5RA 2KH9A 2QA2A 4WFAQ 3UDEA 2KG0A 1CULA 4OJGA 3DOLA 3MPDA 2V9WA 4OZJA 4WZQA 2BZ2A 2CG8A 1C4CA 1JJCB 2W4DA 2YNIA 1SKSA 1WKKA 1ACMB 4XTTA 2GQ2A 1FE0A 2DRAA 2XGQA 2EFVA 3ZZUA 3FBFA 1YJUA 3OFEA 1VCTA 3UDVA 1ICEB 5THWA 2X1FA 3T1HF 4NLSA 3BZQA 1SC6A 4ZK7M 3J81U 1U2CA 2LA4A 2HHPA 3AXMA 1RWOB 2QN6B 4OYAA 2MQQA 1C1BB 1Q5YA 2R2SA 2KI2A 3JYTA 4DU7A 1IBKF 4CP5A 2R7XA 1YRTA 1MROA 2J76E 1PJ7A 1VQNS 3KG4A 4K4TA 4HDGA 4LT6A 1UPPA 1R7IA 2VFVA 2C28A 3HFKA 4I69A 2EFGA 4Y2CA 1IKWB 3TZWA 2KHDA 1U8SA 2I6WA 1VS3A 4OZ5A 1HARA 3MUMP 5D4PA 4LIWA 4F25A 1WDDA 3HULA 2VJUA 3H0PA 2MZTA 4ZMMA 3MPUB 2HFOA 3HVAA 3G82A 2HKEA 3N5FA 1SUQB 3EGNA 1YQHA 5FIIA 2FLNA 3J7YI 4F4XA 2CXEA 3N5BA 3UI3A 1NK9A 4IQMA 2YQ1A 5L39A 2B51A 2C2MB 4IH7A 4K0KF 3D1HA 3IFEA 4DQRA 4ZJLA 4C0OC 1RB0A 4F04B 2RDDA 1N5VA 5T7LA 2BM0A 3OVBA 3VALA 1HIYA 3HCXA 4MKAA 3CE8A 5HP1B 1JWWA 2XMAA 3HJVA 2CWXA 2JVRA 2XWXA 3CJQA 2XMUA 4DCOB 2WW4A 4LF5F 4O44A 2HNZB 2ZWOA 4M5HA 1Y11A 2CQIA 2KXHA 4OZ0A 1F9FA 2DT9A 2CJXB 1KKHA 3QLHA 1OIAA 1UMJA 3NEKA 5HJYA 4F36A 2KKHA 1D9FA 4TLQA 2OPPB 1EQ0A 2I38A 3RBDA 1RI7A 2HAIA 2KRRA 1LWFA 1V3RA 2N4DA 5KG3A 1TELA 3W66A 3KG1A 5DGAA 3O1LA 2KDOA 2KHCA 1HWJA 1L3VA 2UXDJ 3G6ES 2KT3A 5HANA 1UAWA 5L1LA 2LU2A 2EC2A 3M8YA 5K8MA 3OXLA 1N0UA 3V6JA 2D74B 1X4CA 3G71S 4GC6A 1M5PC 1KLMB 2QYGA 2RDJA 2KT2A 1WF2A 3CEDA 3UR3C 1WDTA 2FHJA 1FWKA 1HPZA 3JB9k 3J7A1 3C6UB 3DI6A 2OD6A 2V8DA 3CJTA 2YWKA 3MM9B 4KGZB 1B64A 4LF6J 3KUGA 5ETMA 5HQ8A 1YRUA 1WHVA 4GVBB 2D9OA 3CXCR 1F1BB 5HMZA 3MCNA 1MU2B 4F67A 5EWEA 4K4VA 2P6SA 2CPDA 4Z2XA 2R8JA 4L72B 3JSBA 3KLGA 3US5A 4Q2MA 2VFTA 5D15A 1KD1T 4USWA 2ZVIA 3D4JA 4ICLB 2XG8A 4C98A 3CIMA 1XMBA 1IM6A 3TUIC 4WBFA 3W5YA 4LFBJ 4P2MA 1L3SA 2NPIA 3BB5A 3VAKA 2I1RA 1OMSA 4JI4J 5CQGA 3CULA 2V9KA 1Y10A 3FKBA 3IAM9 2NREA 4JV5J 5KG7A 2H54B 2IRUA 3DLBA 2E7WA 3KK3A 4TN2A 1BUXA 1TK5A 1PG5B 4N5SA 1HWUA 1X9SA 2AHOB 3BKTA 2F3JA 4H4OA 4WIQA 1T8EA 1S6QB 5AXKA 5E41A 2CZ4A 1FCAA 1S1WA 2C2OB 2ZWPA 4KR0B 3ENQA 3DLEB 4M5NA 1QUPA 4O0IA 4CYUB 3QRRA 5A6WA 4JI8J 5FLXU 2GFFA 4RW6A 2VG6B 4JI7J 4MFBA 2DEJA 4YB1P 2FB0A 3G8QA 4I2PA 1BC6A 1FNXH 3O3LA 1L3TA 4JYAF 1LOUA 1V5IB 1Q5VA 1NHUA 1ROFA 1BWEA 4RUCA 3JSMB 2DHSA 3PZPA 4TVAB 2NCKL 2CJYB 2UXBF 2DNHA 2BV3A 1REVB 2FPHX 5IFMA 4OI2A 1UVLA 3MI7X 2CWKA 4X4SA 2CDRB 2B9EA 2AQ4A 4UOFA 1S4EA 2COLA 5BXIA 3CO9A 1YWXA 4YS2A 4DUYJ 3CJ8A 1WUUA 1F0XA 1LQ9A 2W2MP 2WBMA 1EX8A 4KIAA 3T19A 4DV2J 2QC3A 1SI9A 3I4PA 1U1MA 1UW4A 1S6PA 3OL6A 4MK8A 4WXWA 1FWLA 3GFYA 1OSCA 1U45A 3DRXA 4QWBA 5LM7E 2AJ4A 4B3SJ 1RAFB 3WIUA 1XNRF 2PFFB 1FD2A 2UV8G 4B3MF 5KFEA 2HHQA 3FZBA 3CCLS 4DV1F 2CYYA 2PMZD 2VPYB 2I5JB 2RQKA 1RT6A 3VAFA 5L1JA 3QT8A 3HVWA 1WG4A 3ZZPA 3SFUA 1KVJA 3MFHA 4OYMA 4Y00A 4N56A 2F8HA 2KTQA 4WE1B 4FF1A 1GMUA 5C5JA 2IJRA 4L74A 4DV5F 4IDKA 4AXJA 4H54A 1FD8A 3TAMA 3MURP 4IH5A 3TQEA 2AJFE 1UETA 3MTJA 4LFAJ 2OP5A 2Z56B 5J1NA 1RADB 2ACYA 2XMWA 2WZ1A 1IKXB 4KO0B 3M8QB 3BS9A 3K57A 3TVKA 1PBUA 2E5HA 4YFUA 1B0VA 2ERRA 1I1GA 3TAQA 2GMJA 4KSEB 3BBBA 4V19J 3PW4A 3MR6A 2RRAA 2IRYA 2Q1LA 1TL1A 2ZEJA 4DL6A 1R8CA 2A18A 4RBUA 4RUHA 5A8WB 1F2GA 1YBUA 5DLFA 2FY8A 5D4LA 1ZTWA 3QWPA 1KVKA 3I0RB 4F2SA 4WZMA 1RBOB 1X5PA 1TL3A 3GONA 3OPKA 2XZTB 4DPWA 3CJ2A 1WHWA 3UO0A 3W9IA 3M2VB 2X1AA 1KOHA 3CC2S 3KWMA 3R3TA 2W9CA 3Q8VA 3O6QA 1RTDB 3VWSA 4EMDA 2CG4A 2WK4A 2ZZTA 1S1XA 5E3PA 2BE7D 4DR6J 5DG8A 4A8WA 1KOOA 1FX4A 4QOTA 2RB7A 1N5QA 2Z58B 3T5HA 2VD3A 2RAQA 1Q8BA 3N9UC 2GZOA 1S48A 5KFBA 1QM9A 3NOCA 5I3UA 7AT1B 3NGRA 3FC9A 2IM2A 3C15B 1S99A 1RSCA 3N6LA 2Z0GA 1N6QA 2GJIA 2HHUA 2BKOA 3U1NA 3KMSA 1NKCA 1HQEA 5F0UA 1SV5B 2R42A 2V34A 1KQFB 1KTVA 2M8HA 2OJ3A 4G1PA 2DO4A 1UWAA 2E1AA 1P27B 2HBZB 1IR0A 1SJ4P 1T02A 3DOMA 2HSEB 5BYQA 3CCQS 3FMWA 2PDAA 3ILOA 2CPXA 3UWTA 2QLFB 4R5PA 5A76A 2CQBA 2CZ9A 3DYAB 3Q8RB 4ILLA 2YNHB 1RT2B 3EZ5A 1UWBB 2OTLS 2YKMA 3NBPA 5DZ6A 3K5NA 3M8PB 2KM8C 3H25A 3ZZOA 1SJ3P 1HBUB 1M5SA 1N48A 1CG2A 3RB4A 4ZP9A 4NE9C 4J9MA 2AJQA 3F56A 4K4SA 3UFCX 1JLFB 5KFOA 3B8HA 4N7TA 3H2UB 4YHHF 1RU2A 4TQSA 1S1UA 4AL7A 3RB6A 2FVSA 1MWQA 2OELA 2EW9A 2JZ5A 3BBFA 3MPWA 1YI2S 2DNMA 4FKXA 4LR8A 2Y1LB 3G87A 4DUZF 1FKPB 2KL8A 1KR4A 2RH3A 1N5SA 2ZM6F 4XPCA 4FF2A 1WELA 2VPXB 3C8YA 2MJUA 1I94F 1KHVA 2YQ3A 1R27B 1QAYA 4EO8A 4NA2A 3RAMA 1B3TA 3NCRA 1H0HB 3KKFA 4ZP8A 1Q7LB 4TY8A 3HSGA 2OPSA 3B78A 1M1HA 3SBMA 3DGPB 1NK4A 4R8UA 3N6MA 1BLUA 3RBEA 3I0RA 2Q43A 3NCQA 4ZOSA 2AYBA 2W2OP 5GADU 4PG6A 3DNCA 2NSCA 1KC8T 4IFVB 2XI2A 2XGPA 3D6HB 2GX8A 3M2VA 4J5OA 3R9LA 5FJ4A 3MM6B 3D5MA 1CJVA 4G1IA 3EWGA 2VBYA 1OS5A 4W92B 3MMBA 3DHWC 3OTOF 1RT3B 3QJJA 4C8LA 1E6YA 2AGOA 2XM3A 3GIMA 2CJQA 1U1OA 2BJ1A 5T41A 3LO3A 4FZVA 5HSPA 1QDUB 1NZ8A 4QWAA 2G1HA 1YX2A 1XTZA 3I31A 2R7OA 4U9RA 4WKYA 3C46A 3VTIA 3CJ5A 3CUNA 1UFLA 4DUTA 1UFWA 3HHEA 2I2YA 5IZHA 2W2QP 5B08A 1G3OA 1YSJA 1AFIA 1P9QC 4FYDA 3MPVA 1WSRA 3NGTA 2FJVA 3CB4A 1WOPA 4QW9A 4LJMA 1IWGA 4NEYA 1JIHA 4QBUA 3D1OA 4ZVOB 4DX5A 3Q24A 2F9DA 2OAUA 2KYXA 1WC3A 2XULA 2QLWA 1NCLA 2U1AA 1CEZA 2DTJA 3EXYA 2QLXA 4ECZA 3L7OA 3KNAA 4IRDA 4A48A 5L38A 3TQ1A 3DMJA 2L08A 3FRZA 4ZPBA 3TVYA 2W24A 4C0BA 3TZXA 4HHHA 1MMLA 1RT7A 1ZPWX 4CH1A 5KG0A 3KK1B 3AOAA 1NLKL 1ZM3A 4DG1B 3M9OB 1JLGB 4CIOA 2DHAA 3UQSA 1T7PA 2CDQA 4P73A 4KRWA 2LCWA 4ED8A 1PC5A 3EGWB 1SL2A 2XO7A 2HHSA 4ENOA 3QRQA 2MZQA 3K7RA 1RAGB 2BE2A 3V81B 2ZBCA 5HN0A 5KOWA 2CNLB 5H9EJ 4YY3J 1RWVB 4K50A 4X66J 5FDLB 2WB1D 1JKHB 1O5JA 5HK4A 5F8LA 3RAXA 1FRJA 4QPXA 8ATCB 3RW6A 4U95A 4M5DB 2NXJA 2LFVA 4HKQA 2G0JA 1BXNA 5K8NA 4I6YA 4DL2A 3VVTA 1RAIB 4RW4A 3THTA 1FJGF 2BYCA 2WSCC 2LQJA 2ZH8A 3SIPB 2N82B 2HBRB 4WCEQ 3K5OA 3CD6S 4G1QA 2ZKUA 1HA1A 4K2XA 1U1NA 1D1UA 1FRKA 3EX7B 1SQEA 4J9KA 2XCPA 1IBLJ 3DLKB 2CJAA 3M2UA 3PW5A 2P2CB 5AXMA 2XQCA 3ONQA 2EC0A 3FBEA 3JTOA 2C2RA 1QVGR 3EJMA 5C25B 1N32J 1NJZA 1Y0HA 4U8VA 2OSRA 2ILYA 2W7PA 4OX9J 1KEKA 1NHKL 4CLYA 1M0SA 4NLWA 4I7FB 5LMUF 2JEGA 1UJ6A 3UDCA 1NMEB 1NNDA 4WU3A 3OSNA 4ZCIA 3PYEA 4IG3A 4CH7A 1VIXA 1O51A 3K58A 5A8KB 2AEMA 3F73A 4B02A 5HJXA 5DRKA 1S49A 2LLZA 1W7WA 5IT9Y 1U2FA 4UOHA 4LR9A 1X4HA 3FEYB 2ADCA 3THPA 2ILZA 4H4MA 3CPWR 2RS2A 3IRXA 3DDNA 4ZCLA 4P75A 4FS1A 4PUOA 4F26A 2YVSA 3P96A 3QIPB 3H4DA 4DV3F 3VZIA 1N56A 1C0TB 1Q79A 3G6YA 4NASA 5AJ3J 2J8AA 3MM7B 2QV6A 2XNRA 4P2SA 2JL9A 3EDQB 3CMAS 1FKOB 4F8RA 2RHQB 4O23A 1S97A 1U1PA 1X0FA 2HVIA 2C3OA 1N8RT 4IO1A 3KLHA 1F5CA 5J2QB 1S59A 3RAQA 3LP1A 1RXOB 1QTNB 3IS9B 4LRDA 3OJSA 1O6XA 1P1LA 3M8RA 2FUG9 1K9MT 3H59A 4NOHA 2QLBB 4KY3A 3TEHB 1WD6A 5LOQA 4LSNB 2O3DA 3BQ1A 2D41A 1Y00A 2N3LA 1EARA 2X1BA 1OO0B 3UCZP 3HHLD 5B0FA 3R2CJ 2EFOA 3WIVA 2E5LJ 4KFBB 1KVIA 2J7WA 2XLIA 1S1VA 1X4DA 4BC9A 1FFWB 3G8TA 1H6KX 4NLRA 1CS4A 2YWGA 4PG5A 3FSYA 3MXHP 2DIUA 2E7XA 2AZ3A 4R0EA 2BOPA 5CXTA 2FJWA 1LXNA 2WOMB 3HHDA 3FBBA 2MLYA 3H4BA 1HBNB 5DM7Q 2GAHC 2Y8WA 2J6UA 3CCSS 4CT8A 3MMCB 3MGJA 2JDJA 4M5DA 2UXCF 1UJ5A 3BGFA 5GAHU 3CWJA 5IM0B 3FCVA 2BJ8A 1I6JA 1GMWA 1IKVB 1HD0A 4M5JA 2F65A 3TNVA 2QLJB 4YB6A 3QZ7A 3GV7B 1C4AA 5ITHA 1OY9A 4E98A 1YBAA 3GR0A 3IXQA 5HQMA 5LL6d 3NS6A 5E3QA 1TK0A 1U1QA 2RE1A 4LQ3A 1RT5B 3L9ZA 1T03A 4FXDA 3QMQA 2O66A 4CO5A 4OJ3A 1MN9A 2FC9A 3HSZA 5M2RA 3IR7B 3G4SS 2Z8QA 1B70B 2Y9HA 2XMJA 2LEAA 3PW0A 3CCWA 4OHVA 1EETB 2RIJA 4KV8B 4RW9A 1UZDA 2XLKA 2K3IA 4RW7B 4DV4J 1HW9A 5F9LA 3JAMU 1OJ4A 2MKSA 4HHUA 3OR1A 2FJXA 5D0EA 3KYLA 2IAJB 2JEIA 2N7CA 3EMTA 1FEEA 3VAMA 3PY8A 3WHIA 5JXSA 1N52B 5D0HA 1DQ8A 3NP5A 4OJ1A 3DLGA 1V3ZA 2XY6A 3UNGC 1RTJB 3OFGA 2E1PA 4A8FA 3TYTA 1NEEA 3IG1A 5EUHA 2YQ0A 2YKNB 3PX0A 1LKZA 4DQSA 3V4MA 4OZLA 3LGNA 4E2FB 3TVZA 2XNQA 2UUAJ 5CABA 3HHLB 2VUGA 2ZJQQ 3CTRA 2BQUA 5H9FJ 2FZCB 4I2QA 3D3CJ 5J2MB 3BR8A 3TZZA 2PGCA 3W65A 1TKXB 1Z1ZA 4DF4A 3B6BA 3EXCX 4X84A 1RWUA 4DSFA 1PGZA 1FF2A 2XHCA 3ITHB 3IBCB 3C3LA 2DR5A 1XJWB 1SC4B 2VOPA 2QZ8A 1VQ6S 3B82A 2LQ5A 4URSA 3MEDB 3CSKA 5K8PA 1M90T 4DR7J 1H73A 2GVDB 1VQ5S 1QY7A 1FI4A 4DV6J 2ZDPA 3WQPA 1RAAB 4I64A 4J9PA 4HR2A 3K0JA 1DHMA 1HD1A 2W01A 2ACMA 2E1MC 3RRHA 3T5KA 2E66A 1JB0C 4F50A 3T6JA 3E2EA 2CNKB 4ELUA 1N33J 5J2NB 2LXIA 9RUBA 2JEFA 2H9ZA 2SXLA 2P6TA 3KJQB 5JVGQ 5B09A 2RQMA 3OHBA 2C2ZB 2NXEA 3LF0A 1Y9OA 1FXDA 4CDIA 1SXLA 1UCNA 1LW2A 2W7AA 1HBNA 3H8YA 4DX8H 2DY9A 3I9V9 1NDCA 1CJKA 2VU5A 1FESA 2UVUA 3CJ3A 4LRAA 5JMNA 3MEGA 3DDIA 2OEKA 2HBQB 1VBYA 2MKJA 4USJC 3IAS9 3G9CA 1RGVA 2B7CB 3WX4A 2PEHA 4CNZA 3VGSA 2XWYA 3J81Y 1HI8A 3W5XA 1EQMA 3EDRB 3P5BP 4TXSA 1DLOB 1CJUB 2EWHA 2DRDA 5M2PA 5IXUA 2V8GA 4IR9A 4DN0A 2YX7A 4OLPA 1WORA 1RHJB 4C7QA 4YQWA 2UXDF 4P10A 3I5CA 3L7PA 3CD0A 5L9NA 1HMVA 3A3OB 3SSRA 2F4VJ 2DNOA 1RBAA 2RJZA 1AZSB 2EEYA 1ZM9A 3BGRA 4RU2A 1Q1KA 2HLUA 2A1BA 1VQLS 1T9VA 1OY6A 1NK7A 3TEGA 5DDRC 1KFSA 4GVLA 5HL7Q 3THVA 1XEZA 2I8EA 4ZVTB 2IIHA 4PPZA 1LV5A 5C24B 2J8SA 2UVVA 4LF6F 2JC0A 2GO9A 3O8WA 4MJKA 1U49A 3PIPQ 3O2IA 2QFJA 3CCUS 2EXUA 3EZOA 4YMEA 1R8PA 1TV6A 1WNEA 3EICA 3H20A 1LWCB 3TZYA 4F3MA 3LP0B 2J9DE 4ZLLA 5D4NA 3OXGA 4UF4A 1T9YA 2HQFA 3JTNA 2ASJA 4BS2A 5KFSA 1HR0J 1DTTA 4FKYA 3BKUA 1HLWA 4LFBF 1H2UX 3C14A 3TARA 1LWEA 1ZA2B 3NAIA 4JI4F 3OT9A 2HQIA 2XMKA 2HRYA 4Y3CA 3HKWA 5KG6A 4JV5F 2BACA 2PA8D 2RSQA 1C1CA 1SC1B 1SCJB 1A6LA 1Q7YT 2FJEB 3A13A 3OLAA 5HROA 4PWUA 4XPEA 2FLLA 3EE3A 4M94A 3EYZA 3CCVS 3QSYB 3PFOA 1HBMA 2GMLA 2O67A 5E33A 7FDRA 1KHWA 3EM1A 1WTBA 3GV8B 5KFRA 3MOJB 3LANA 2I0XA 4Y6IA 4KHPJ
chains in the Genus database with same CATH topology
4CRJA 1RTZA 4M5JA 3UD5A 2F65A 5ETLA 1CBKA 3HSJA 3KUGA 1F9HA 3KUEA 4M5GA 5ETTA 1RAOA 1RB0A 3ILJA 5ETMA 5ETVA 3ILOA 4M5LA 4PZVA 1EQ0A 1RU2A 3UDEA 3HD2A 5ETQA 3ILIA 4CYUA 4F7VA 4M5MA 3HD1A 3UDVA 3HSGA 3KUHA 3MCMA 3HSZA 3QBCA 1Q0NA 2F63A 2QX0A 3HSDA 3MCNA 5ETKA 4M5KA 5ETOA 1IM6A 3HCXA 1EQMA 5ETRA 4M5NA 5ETSA 3HT0A 1TMMA 4CWBA 3ILLA 1HQ2A 2BMBA 1EX8A 3MCOA 1RU1A 1G4CA 4AD6A 4M5IA 2CG8A 1HKAA 3IP0A 4CYUB 5ETNA 1DY3A 5ETPA 1KBRA 4M5HA 1TMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRJ A;  1RTZ A;  4M5J A;  3UD5 A;  2F65 A;  5ETL A;  1CBK A;  3HSJ A;  3KUG A;  1F9H A;  3KUE A;  4M5G A;  5ETT A;  1RAO A;  1RB0 A;  3ILJ A;  5ETM A;  5ETV A;  3ILO A;  4M5L A;  4PZV A;  1EQ0 A;  1RU2 A;  3UDE A;  3HD2 A;  5ETQ A;  3ILI A;  4CYU A;  4F7V A;  4M5M A;  3HD1 A;  3UDV A;  3HSG A;  3KUH A;  3MCM A;  3HSZ A;  3QBC A;  1Q0N A;  2F63 A;  2QX0 A;  3HSD A;  3MCN A;  5ETK A;  4M5K A;  5ETO A;  1IM6 A;  3HCX A;  1EQM A;  5ETR A;  4M5N A;  5ETS A;  3HT0 A;  1TMM A;  4CWB A;  3ILL A;  1HQ2 A;  2BMB A;  1EX8 A;  3MCO A;  1RU1 A;  1G4C A;  4AD6 A;  4M5I A;  2CG8 A;  1HKA A;  3IP0 A;  4CYU B;  5ETN A;  1DY3 A;  5ETP A;  1KBR A;  4M5H A;  1TMJ A; 
#chains in the Genus database with same CATH topology
 1VRU B;  4DPX A;  3F44 A;  3AB2 B;  2XYG B;  4OI3 A;  4O3R A;  3A3P B;  3OHA A;  2G4B A;  4JI8 F;  2ZOF A;  2WBR A;  3Q2S C;  4DX7 A;  3L09 A;  1SJ1 A;  2OEM A;  4KKO A;  1TMJ A;  3DRS A;  1Y7P A;  3HJF A;  2F4F A;  3ILJ A;  1FT8 A;  4CO2 A;  2BE9 B;  1P6T A;  3M6X A;  4RKU C;  2B4P A;  1XK8 A;  1T9T A;  2MGZ A;  5KFG A;  3MAQ A;  1FEH A;  2ROE A;  1ZAW A;  3Q8P B;  5CH7 B;  4DR2 J;  4OYW A;  5A2Q Y;  1JLC B;  3MAH A;  1HFE L;  1CLF A;  4DPO A;  3VHQ A;  2D7S A;  3HFV A;  1S9E B;  5DG9 A;  1DQ9 A;  4DUY F;  4HVZ A;  2B5J A;  3IR5 B;  3OJU A;  4HT7 A;  1QAX A;  3D7S B;  4WYL A;  2EFN A;  3ZO7 A;  2M0G B;  1QE1 B;  4DV2 F;  1WEY A;  1IKY A;  2PI5 A;  4OYO A;  4USM A;  4MT1 A;  2V68 A;  4B3S F;  1RAB B;  3PG9 A;  4A8X A;  2GQQ A;  1RTH A;  2YKA A;  4AT1 B;  3SDE B;  1YDL A;  2G0I A;  2QIF A;  3NY0 A;  1J5E F;  2I9S A;  3TA0 A;  2DO0 A;  4RZR A;  1M5H A;  4IQX A;  3GG1 A;  5GAE I;  3BO2 A;  4O4G B;  4U8Y A;  1TP7 A;  3QO9 A;  1WC0 A;  4J9U E;  4LVN P;  2F5G A;  2E1R A;  5CYM B;  5L8R C;  4DV7 J;  1RAH B;  5JJB A;  4LRC A;  3P3D A;  4JBC A;  4LFA F;  4X2B A;  1GNK A;  1E6V B;  1NH8 A;  2WVE A;  1K8A T;  1KRP A;  5KG2 A;  3GJS B;  3QQC D;  5F8G A;  3JS9 A;  1UJ4 A;  1WI8 A;  3P49 B;  4AD6 A;  4DLG A;  1S76 D;  2VOD A;  1SQF A;  1HQU B;  2DH7 A;  2DPJ A;  1BQN A;  1PJ6 A;  3POT B;  1U0H B;  2DVI A;  4OHY A;  4IOC Q;  4ECY A;  3J7Z T;  3Q8Q B;  3BYR A;  1CQM A;  1TKT A;  2BW7 A;  1DJ0 A;  3M9M B;  2AX0 A;  3B54 A;  3FNN A;  3MEE B;  2DHG A;  2OIH A;  1PYT A;  3PYD A;  2P9C A;  4RR5 A;  3EZU A;  4A47 A;  2JC1 A;  2HFV A;  2QRR A;  1Q95 G;  2QMW A;  1FX2 A;  1EKR A;  2BAN B;  2W2N P;  2FZK B;  2DNQ A;  2E9T A;  3C16 B;  1U1L A;  5FD1 A;  3N01 A;  4M5M A;  4F4W A;  2V8P A;  4NEZ A;  3M30 A;  4DR6 F;  3W1Y C;  3BEG B;  2G13 A;  5D77 A;  5A0Y B;  5K14 B;  2IFX A;  2YWW A;  1MNE A;  3HLU A;  2BA9 A;  2YBV A;  2EK1 A;  4UOC A;  2FZG B;  2CA9 A;  4NLO A;  1NPP A;  4CO4 A;  1UL3 A;  4IG0 B;  1AFJ A;  1JLA A;  1KON A;  2W9B A;  1SVD A;  1YJR A;  1TUW A;  3V4I A;  2DR9 A;  3PX4 A;  2UUB J;  4M8L A;  1IR1 A;  2V4J A;  2LQ9 A;  5KOX A;  3D6T B;  3GYG A;  1KSP A;  4PWD B;  3WC0 A;  4Y2A A;  4GMK A;  3MCO A;  1XNQ J;  3R5A A;  1S9G B;  1FJE B;  2E7V A;  1RLD A;  4L3K A;  4FF3 A;  2PT0 A;  4L3N A;  1R8B A;  1S57 A;  3I0S A;  1DTQ A;  2GGP A;  2UVR A;  4NCG A;  3I96 A;  2J7K A;  4HAC B;  3IA0 A;  1VQP S;  3W61 A;  5ETV A;  3M1V A;  5C7P A;  1S9E A;  2OPQ A;  2APO A;  2XC9 A;  2M9K A;  2EVZ A;  5KFN A;  1HNV A;  3PV8 A;  3GPA A;  1Z4U A;  2VFS A;  1ZET A;  4ES3 A;  3ZTP A;  2NZC A;  3PO5 A;  2EBG A;  2AKW B;  3R7B B;  4CRJ A;  4LF8 J;  2FVQ A;  3LPY A;  1R0A B;  2HZV A;  2RF2 B;  2M3D A;  1N5Y B;  5DDQ C;  1RCX B;  5J2P B;  3KLF B;  5CYQ A;  4DQQ A;  2CPH A;  1KLN A;  2DNP A;  1X5S A;  2GMH A;  3D6F B;  4HDH A;  5CAA A;  4AL6 A;  2B6A B;  4QR0 A;  3AT1 B;  4AUK A;  1V3S A;  2NPF A;  5KFU A;  5C2C A;  2HUR A;  4GRS A;  2QL5 B;  1HHQ A;  3NNH A;  4PPD A;  3D0I E;  1RAJ A;  5GAG U;  1HNZ J;  3OR2 B;  4Z7C A;  2R8K A;  3ET6 A;  2DNR A;  2OH2 A;  3H42 A;  3OTB A;  1TTH B;  4K2J A;  5LT5 A;  3R5D A;  2Y8Y A;  5B7W A;  1NXI A;  2LDY A;  3R27 A;  3KDO A;  3I87 A;  4LF1 A;  5HMX A;  3LP2 A;  1ZAX A;  5IS2 A;  5LMN J;  4UTG A;  2RUS A;  3AB4 B;  1U47 A;  1TMM A;  1K0T A;  2K2P A;  1CUL B;  1FDN A;  5IC6 B;  3M4X A;  4B9S A;  2C2N A;  3DOL B;  3BM7 A;  3GE9 A;  3PJW A;  2KYZ A;  3CF5 Q;  4KT0 C;  4PQA A;  4LBH A;  1RWN B;  5GMK a;  4PAA A;  4U96 A;  3RBZ A;  4NCA A;  4PYA A;  2NXN A;  2ZH5 A;  4HYK A;  3HO1 A;  1Q53 A;  2YNI B;  3C16 A;  2AJ1 A;  4DFK A;  5DDP C;  4DR1 J;  2LQ8 A;  4QYZ J;  3W2W A;  3LH2 S;  1URR A;  5A0Y A;  1FE4 A;  5KFH A;  2NYI A;  5HQL A;  3OV7 A;  3T1A A;  4DZD A;  2RQ4 A;  2GJ2 A;  4I56 A;  2HWT A;  5DO2 A;  1VC0 A;  2ZH7 A;  3WC2 A;  4GKK J;  1GFW B;  1LW0 B;  4ER8 A;  4ZVQ B;  2E5I A;  4YR2 A;  2CQ0 A;  4X4V A;  4OQJ A;  3CJK B;  3JYT B;  3ISZ A;  3FSX A;  2FHM A;  1MRO B;  2CQ2 A;  2MST A;  3KUE A;  1VHI A;  2ZOG A;  2FHJ D;  1TL5 A;  3QGG A;  2EKY A;  2HMI A;  3T9Z A;  2DHH A;  3MPY A;  3J7Y U;  2DGT A;  3HF5 A;  4AXI A;  4IRK A;  1R31 A;  4JI5 J;  4PG7 A;  2KZM A;  1NB7 A;  2R7Q A;  5EN1 A;  3NS5 A;  4F7V A;  4GKJ J;  4IR1 A;  3IGN A;  4FS2 A;  2BXJ A;  1VC6 A;  2HHV A;  5KFP A;  4HH1 A;  3JSY A;  1OPI A;  3HVT B;  3BSA A;  3S01 A;  5CCL A;  1NK0 A;  3G82 B;  3D68 A;  3IO1 A;  4WP8 A;  4ZVG A;  4X4Q A;  4DWI A;  3GG0 A;  2VHG A;  4MKV A;  3IMQ J;  4EZ6 A;  4KB7 A;  1VI7 A;  2WON A;  2RT3 A;  3CVK A;  1NDL A;  5T7L B;  2X1G A;  3EPI A;  1VQ4 S;  1S6O A;  3V6D A;  2HVD A;  1VRT A;  4CLT A;  1QSY A;  2FTR A;  3HMJ G;  2CAJ A;  1MLA A;  7FD1 A;  1RTI A;  2C2D A;  3DOK A;  2L41 A;  2ZZM A;  2RF2 A;  4RUA A;  1FRM A;  2KRB A;  2OI2 A;  3R8Y A;  2FLP A;  5IT0 A;  2GHW A;  2GO8 A;  4O44 B;  3FVY A;  3HHK A;  1X0P A;  2OPR A;  1Y5I B;  4URG A;  4ED4 A;  3D67 A;  1CC8 A;  1FTR A;  2PFD A;  3I6P A;  4YY3 F;  1FNM A;  4CO3 A;  4X66 F;  3QLH B;  4MMO A;  4Q5V A;  3L3C A;  3HP6 A;  2KFN A;  2C22 A;  1LEO A;  3FK4 A;  2BOA A;  1IUJ A;  3FDS A;  3VV2 B;  2VB6 A;  4NX9 A;  4AFF A;  4K4W A;  2ZZN A;  2LP4 A;  2EPI A;  4EK2 A;  6FDR A;  2HVZ A;  2VH7 A;  2YNF A;  1LWF B;  5LXY A;  2JHE A;  1SQG A;  5LXR A;  5G0R A;  4B17 A;  1Q0N A;  4RO0 A;  1VOM A;  5IV3 A;  4P7V A;  2B8P A;  5H9F K;  3CCR S;  4JI1 J;  3PM9 A;  1VQS A;  2XSF A;  3FRY A;  4FNH A;  4ECW A;  4NI2 A;  5KT7 A;  1IBL F;  2J0X A;  1NKE A;  2QA1 A;  3HVR A;  1X4A A;  1YZ7 A;  2ALY B;  2XYP B;  3OTC A;  2V63 A;  4NL5 A;  4JI6 J;  4B3T J;  5K20 B;  1HPZ B;  3KDN A;  1N32 F;  1GTH A;  3DI6 B;  4ZVF A;  3D66 A;  2ROG A;  1PKU A;  4OX9 F;  2L9D A;  4NXM J;  4QZV B;  4Q2L A;  2IA6 A;  1VRQ C;  3BN4 A;  5EDW A;  4J9V A;  4ZIW A;  3UD4 P;  2H5I B;  4FYX B;  4ED7 A;  3K59 A;  2C3P A;  3AJ2 A;  1XC9 A;  4ECX A;  1WG5 A;  1Q81 T;  3DRP A;  1FRI A;  2GA7 A;  4ES2 A;  3KLG B;  3T9N A;  2HHH J;  3KG0 A;  4HI2 A;  3H5S A;  1SC3 B;  4P6Q A;  4NLG A;  3ZZT A;  5C42 A;  4QWD A;  1IBM J;  4O3S A;  3GJR B;  1CBK A;  4G6V B;  2VC0 A;  1VMB A;  2VPW B;  1EJ7 L;  3DU6 A;  2M2B A;  2J5A A;  4CH0 S;  2MYF A;  1LW0 A;  4PR6 A;  3P6Y C;  2ZUA A;  3W63 A;  2JOQ A;  3CJK A;  4FYV B;  4DL7 A;  3RTV A;  4OYB A;  3BSC A;  2HFZ A;  4YB5 A;  1CSJ A;  5AT1 B;  3KLE A;  4CWB A;  1WAC A;  3KK3 B;  2J9C A;  4PG4 A;  5AJ3 F;  4J90 A;  1U4B A;  4ZN1 A;  3QJP A;  3QPI A;  4X64 J;  4OZN A;  2VG7 A;  1RT1 A;  4H4O B;  4M1K A;  2KJV A;  1G7C B;  4NYO A;  2HNY A;  3AA9 A;  1BGX T;  4RPF A;  3RR8 A;  1F5A A;  4OZ2 A;  1NJY A;  1S1W B;  4CLF A;  3SV3 A;  4KAI A;  5I3P A;  3Q8U A;  3HVT A;  4GO7 X;  4F3O A;  1DAR A;  2OMO A;  3J7Z 5;  4RL1 A;  4NLD A;  2FDN A;  4ED5 A;  1SB6 A;  1BQM A;  3HM9 A;  1F3V A;  2AYM A;  4RW6 B;  4MFB B;  2CQH A;  1ZM2 A;  2QSF A;  4I2P B;  5F8H A;  2DB1 A;  1H74 A;  3T6B A;  4ID8 A;  4NML A;  3W8P A;  2PII A;  4EI2 A;  4EEY A;  1NUE A;  1NSA A;  2E5L F;  5KFK A;  5BYR A;  2OTJ S;  3UW1 A;  2EG1 A;  4IH6 A;  2KXN B;  2HQ3 A;  1WSV A;  1HHT P;  2OML A;  3RR7 A;  1N36 J;  2E1C A;  1D3W A;  3AH6 A;  4A8M P;  2MJN A;  2HG4 A;  1I51 B;  4ZVR B;  4DV0 J;  2MQN A;  2IPO B;  2UU9 J;  4JUZ A;  4EZ9 A;  2DXF A;  2FLO A;  5DET A;  5D6G A;  1S6P B;  3Q86 A;  5ETO A;  1YIJ S;  5K5M A;  3T5J A;  3I5A A;  1U02 A;  4G65 A;  4BWJ A;  2CNN B;  4TY9 A;  2ZH1 A;  2DHX A;  4C11 A;  1J5O A;  4FVC A;  2QMU B;  2AIR B;  5IOL A;  1R8H A;  2LKZ A;  5DDO C;  1RT6 B;  2LQB A;  5CA5 A;  4X4N A;  4ATN A;  4OHZ A;  4DSJ A;  4ZP7 A;  1RKI A;  1H7W A;  4KHR A;  3RB3 A;  2QEX S;  4TLR A;  1Q8L A;  3TWZ A;  3Q8S B;  2KB2 A;  2HVH A;  2OEJ A;  2DGQ A;  4EFA C;  2L48 A;  4IDK B;  5ETR A;  4LVO P;  3D2W A;  2RKI A;  2K7J A;  3GIJ A;  4JI3 J;  2Z2Z A;  3TAM B;  2MTL A;  2CZV C;  2YKP A;  3DRR A;  4Q43 A;  4OYX A;  2PSZ A;  1S5Z A;  4F3Q A;  4CTA A;  3M2R A;  1X4G A;  3D3B J;  5KFA A;  2FYX A;  2MSS A;  2BAB A;  2VG5 A;  3DM2 A;  4DV4 F;  4TYB A;  4RW8 A;  3D28 A;  1HWI A;  1WJ9 A;  2G2Y A;  3I56 S;  3BDE A;  4C8M A;  1LXJ A;  3NGU A;  3E3X A;  2B4O A;  4YDX A;  1LFW A;  1FNO A;  4PXD A;  1TL1 B;  2FGC A;  4DS4 A;  1RA6 A;  3GQC A;  2V6A A;  3FQK A;  2RUG A;  4NCB A;  3KHH A;  1RBL A;  3M32 A;  2UUT A;  4ZJQ A;  1WC5 A;  5SUH A;  2QGF B;  4AL5 A;  2V2Z A;  4HHJ A;  1X8D A;  2LEP A;  3QT7 A;  4AQY J;  1TL3 B;  3CW2 C;  4ECQ A;  3VAG A;  4ES1 A;  3TX8 A;  2LEC A;  4WP3 A;  3D6M B;  2UUA F;  3G86 A;  1JJH A;  2VQE J;  2MY8 A;  3MM5 A;  2AYE A;  4DQP A;  1H98 A;  2OFG X;  1CC7 A;  2ZVS A;  3E01 A;  2W9C B;  3OTE A;  4RNN A;  3IGV A;  1S1X B;  1LWX A;  4ZLN A;  2LVW A;  2NUH A;  5HMY A;  1VFJ A;  5D3G B;  2B4U A;  6AT1 B;  2C42 A;  2MB0 B;  2GVZ A;  3L7U A;  4PZV A;  4U7U D;  5D0G A;  2O01 C;  4OX8 A;  4JI0 J;  2IVF B;  2YKO A;  3GYN A;  2BRL A;  1TKD A;  2ZBP A;  2XO6 A;  3GMG A;  4B3R J;  1PBA A;  2BJ3 A;  4USK A;  5I3U B;  2ZC3 A;  3PDN A;  5D78 A;  1XMQ J;  1PAU B;  3R2D J;  1SIW B;  3C6T A;  2YWH A;  4DR7 F;  1N6Q B;  4DV6 F;  2IHR 1;  2MY7 A;  5IWA J;  1L3K A;  3HPO A;  1HQE B;  2V94 A;  3KUH A;  3J80 Y;  2IYG A;  4LFC J;  1K44 A;  1UKU A;  4L73 A;  4WKR A;  3H2V E;  4AYB D;  4ZPW R;  4O3Q A;  5LSL A;  2QJ3 A;  3AJD A;  1JLB A;  2JWN A;  2K3K A;  1RK8 A;  3IM8 A;  3DHX A;  3JAM Y;  1N33 F;  2YH1 A;  4NPO A;  3DOM B;  2VA2 A;  3UPF A;  1ZBT A;  2HQD A;  2BQR A;  4R5P B;  2HVE A;  2A2C A;  1AT1 B;  2HIQ A;  3IM9 A;  2M4M A;  4R25 A;  1IBC B;  2GNK A;  3AJ1 A;  3R6G B;  2YKM B;  3NBP B;  5KFX A;  2BEF A;  3A8K A;  2JRS A;  3AD8 C;  1NH7 A;  1N5T A;  5BR8 J;  1FER A;  1N0V C;  4WJB A;  1YZ6 A;  2FVP A;  2OSQ A;  2IY5 B;  5HLF A;  4TYA A;  3QT5 A;  4M5K A;  1GH8 A;  1ULR A;  1B99 A;  1SJR A;  3IP0 A;  1S1U B;  3GFZ A;  1QUV A;  2DGX A;  3Q23 A;  3S1T A;  3IBW A;  1NO8 A;  2FY1 A;  3MMA A;  4DBQ A;  3AD9 C;  2HW3 A;  4TU7 A;  1YLX A;  1Z2L A;  1NM2 A;  5C2G A;  2QL7 B;  3MEK A;  2D3Z A;  2L9N A;  4YN3 B;  4ALZ A;  3RRK A;  2JNJ A;  4DHV A;  3ZZY A;  3CO0 P;  2F4V F;  2D3O R;  2PMW A;  2IDE A;  4LBP A;  3PKM A;  3UCG A;  1NHV A;  4L75 A;  3TI0 A;  1FHT A;  1QSS A;  1LFP A;  3MEC A;  4USV A;  3GFH A;  3B4D A;  1FVQ A;  3Q2T C;  4WYW A;  2ZD1 A;  3Q8Y A;  1Q82 T;  3GR1 A;  2H4Y B;  2DR6 A;  3BH6 B;  4ZVH A;  3RU0 A;  4I1T A;  3MDF A;  2YNG A;  3FZ2 A;  4TY8 B;  2OPS B;  1DY3 A;  2ZH9 A;  4NMX A;  3OL7 A;  2ASD A;  4ZLP A;  5J1P A;  1UA0 A;  4R8U B;  1AUS L;  2CPF A;  1UP1 A;  3OUY A;  5HAT A;  5KFT A;  1WKJ A;  2R4F A;  4N77 A;  4K4Y A;  1SKR A;  2DGV A;  4OI0 A;  1T9U A;  1TL4 A;  4BBY A;  1BQX A;  2WW8 A;  4DCJ B;  1D0E A;  5LJ3 Y;  1IQT A;  2R2R A;  1HR0 F;  5A8R A;  4QIE A;  1IVZ A;  4LSZ B;  1NKB A;  2VJV A;  2WCX A;  1CJV B;  2XS2 A;  5KFD A;  1S0O A;  5IT9 U;  4X4R A;  2OUG A;  3C66 A;  4P74 A;  3V6H A;  1S1T A;  1ITP A;  2M5Y A;  2DY1 A;  4RNF A;  2XMV A;  1TAQ A;  4PQU A;  2CNO B;  1MMD A;  3A3N B;  5D3G A;  1S0V A;  3MMB B;  3GSI A;  1EB0 A;  5KT2 A;  3GTY X;  4PYD A;  3ZNU A;  4W98 A;  1E6Y B;  4K4X A;  4X4P A;  1GX6 A;  1YBT A;  2CRL A;  1YTY A;  3TJ8 A;  2XSJ A;  2HZA A;  1KQS R;  1Y3K A;  1RU1 A;  4OZ3 A;  4OYI A;  4G3I A;  1S0M A;  3M05 A;  1RWK B;  2QA4 S;  5DLG A;  3ZZR A;  1KNZ A;  1XR6 A;  4KHP F;  3NNC A;  1U0S A;  2IJN A;  3PW7 A;  1RUS A;  1F3F A;  3P4U B;  3V6K A;  4XIU A;  4K7Q A;  1TK8 A;  3GCX P;  2EFQ A;  3NOG A;  3ISN C;  2F9J A;  2DK2 A;  2GV1 A;  1NAQ A;  1TKZ A;  4WXO A;  4Q8F A;  4A4J A;  2AEJ A;  2KN4 A;  4LSL A;  3BSN A;  4LQ9 A;  3LPE A;  8RUC A;  3CDU A;  1X7V A;  4PG8 A;  3SI8 A;  5F8M A;  5D0R A;  1ZPV A;  2HRU A;  1VDH A;  1KFD A;  4O3N A;  3HSD A;  2LMI A;  9ATC B;  3DMJ B;  2K06 A;  4DR2 F;  2DR7 A;  2J0W A;  1TVR A;  1RT7 B;  2WHO A;  2L3M A;  1Q16 B;  4DL5 A;  4KGX B;  1JK9 B;  3LAK A;  2KJW A;  3ETM A;  5JVH Q;  4RWW A;  3CJS A;  2XY7 A;  3S6E A;  2BM1 A;  3B4M A;  3CD7 A;  1TU0 B;  2B9W A;  4EU0 A;  2BE2 B;  4EWT A;  3UN3 A;  2R7U A;  4C9D A;  3MZI A;  1S7H A;  2KM8 B;  1OQ3 A;  1DUR A;  1RWM B;  3IC1 A;  4KE5 A;  1GMV A;  3NAH A;  3M9N B;  2MZJ A;  4UQT A;  3DRY A;  1REG X;  1UW9 A;  2ZBI A;  1EIY B;  2CAD A;  3CGI A;  3EUN A;  3BKF A;  5U47 A;  2XTJ P;  2NSB A;  2AJ0 A;  5KFZ A;  2JLG A;  4I67 A;  2AWZ A;  2AP6 A;  4RW4 B;  1CPZ A;  4DV7 F;  2BBE A;  2DIV A;  1SH0 A;  4OI4 A;  3KJV A;  1HNX J;  3BN7 A;  4JI2 J;  1W2I A;  2KVI A;  1JLQ A;  3W2V A;  5B0G A;  3TJ9 A;  4G1Q B;  2GHP A;  4X4O A;  1ZZN A;  4KPY A;  4KHM A;  2DEI A;  3M2U B;  4CLP A;  1IR2 A;  3GU0 A;  1GXL A;  1WI6 A;  3VF0 B;  1A9N B;  4L6V 3;  2QL9 B;  2GIF A;  1T95 A;  1BD6 A;  1FRH A;  2AZ1 A;  3U27 A;  2A0F B;  4MTP A;  2HK3 A;  1D8Z A;  3PNI A;  1NJX A;  4IFY A;  3U7J A;  1N4L A;  4DXL A;  2IM1 A;  4LBI A;  1K1Q A;  3D1Q A;  3CJ4 A;  1CJT A;  3IRW P;  4NWB A;  3RG6 A;  4DSL A;  2BDP A;  4C0H A;  4JOU A;  1YJ7 A;  2BJD A;  2DIS A;  4X65 J;  4DPY A;  4TNO A;  4IG3 B;  3K5M A;  4FBU A;  2DRB A;  3W5Z A;  5IT4 A;  2RVJ A;  3EPG A;  1GMW D;  1Q86 T;  2IMW P;  1YJ9 S;  2NS1 B;  4B3O A;  1KTQ A;  3TAN A;  3VGT A;  3MAA A;  4K8R A;  2QG9 B;  4WP9 A;  3CDA A;  4B08 A;  1R3N A;  2ADB A;  4H4M B;  4OX6 A;  4IOB A;  4TU9 A;  4MK9 A;  3IRX B;  3V2U C;  3QRP A;  3BO4 A;  4PUO B;  3H90 A;  4P2F A;  2IRX A;  2VBX A;  4LF7 J;  2MQO A;  2IC3 A;  4JV1 A;  3JTP A;  4Q0B A;  4A8Y A;  1SH2 A;  2XZD B;  2UUB F;  3P8B B;  3DN9 A;  2J0Q D;  2LDI A;  1FFG B;  4DSI A;  2M70 A;  3ZTO A;  2HQC A;  1JLE A;  5KFV A;  1T9X A;  3QID A;  5CCM A;  1M5O C;  3KLH B;  1U6F A;  3LP1 B;  2E9Z A;  4FVM A;  3CNQ P;  1XNQ F;  3HD1 A;  3H5U A;  4DL0 C;  3UR0 A;  1UVK A;  4XDC A;  3NWG A;  1RCO B;  2CPI A;  2FJD B;  2PD1 A;  3OVS A;  5F8N A;  4CQ1 A;  4ED3 A;  2QYC A;  3NMA A;  4WK1 A;  4XAK A;  1EP4 A;  1F9E B;  3CDB A;  1HKA A;  2J0S D;  4KGV B;  1RT4 B;  2GW8 A;  2D1C A;  2IDL A;  5I42 A;  2V8H A;  1S1V B;  3UVJ A;  4CLW A;  1JNZ B;  5DQH A;  4LF8 F;  1CS4 B;  2HWH A;  1VR6 A;  5DGB A;  3SZ2 A;  2HK2 A;  1FK9 A;  4ZA1 A;  4ECS A;  3A12 A;  2ZE2 A;  4ELT A;  3KLI A;  3MMJ A;  3OTD A;  4FDF A;  3CCJ S;  2VAS A;  2CPE A;  2V0N A;  3HXM A;  2YTC A;  1XR7 A;  2LYV A;  1FRL A;  3H7H B;  3U02 A;  3M6V A;  2LXF A;  1AYE A;  1A0O B;  3ZTQ A;  3EVO A;  2KT5 A;  3SQG A;  3CJR A;  4BDP A;  1KBR A;  3W62 A;  4UUW A;  1HNZ F;  3AQP A;  4KJI A;  4F4A A;  4BCA A;  4WFZ A;  1ZTT A;  4QIW D;  1T03 B;  1OYE A;  2W1B A;  4DQI A;  5KG4 A;  1GXT A;  1TL7 A;  2XS5 A;  2YY3 A;  3F0N A;  5EX0 A;  1PCA A;  4ID5 A;  2F8E X;  5GVQ A;  4RW9 B;  3HHN B;  4C48 A;  3W9H A;  4ZIT A;  1T3N A;  1ZH5 A;  2B43 A;  1HYS A;  5LMN F;  3R97 A;  1NJI T;  4B9T A;  1F9H A;  1YRX A;  3OR1 B;  2UV8 A;  1UVJ A;  2FC8 A;  4ECT A;  1K1S A;  3G96 A;  1JQG A;  2AF6 A;  2WAQ D;  1OWX A;  1FFS B;  5F9N A;  4HL9 A;  2XMM A;  3MM8 B;  3DLG B;  3MCS A;  1HBO A;  5J1E A;  2HND A;  3A4T A;  3IG1 B;  4ZDN A;  3SFG A;  3PXG a;  4DR1 F;  3CJ0 A;  2BJ9 A;  4B9M A;  3RRG A;  1HNI A;  2IBK A;  1V9O A;  1B7Y B;  2CJK A;  5D8H B;  4J9N A;  2P5V A;  3KK2 A;  3R5G A;  1AW0 A;  5HBM B;  2MKK A;  4ZPC A;  4ZPT R;  4ZCK A;  4PXC A;  4I2Q B;  1NSP A;  1MN7 A;  2BW2 A;  4GKK F;  2MEW A;  1XWL A;  3AXK A;  1QSL A;  1VIO A;  2CKW A;  2ZHA A;  2AEF A;  1ZYQ A;  2QSW A;  2ZOM A;  1X5T A;  4P9S A;  1JMT A;  3DC2 A;  1T05 B;  2DXD A;  1KQK A;  4OHW A;  3MOZ A;  1P8G A;  3NS7 B;  2XEX A;  2PMH A;  2BQ3 A;  4CT9 A;  4JI5 F;  2LEB A;  4GKJ F;  5DQI A;  2DIT A;  4FPR A;  3HDS A;  1KQG B;  1AXQ A;  2CQ1 A;  2PEB A;  4QWE A;  2HGL A;  3M8S A;  1R0B G;  2VV5 A;  2JLE A;  2X3D A;  5L9X A;  2DKO B;  5G4D A;  1SL0 A;  4C8Z A;  3JQJ A;  1VLY A;  4YOE A;  3QBC A;  5A2Q U;  1YKW A;  1TZ0 A;  1RT4 A;  3HZE A;  4ZLJ A;  4P72 A;  2DYA A;  2Y1R I;  4QYR A;  5KFQ A;  1HWK A;  2AU0 A;  2Y0S D;  5BYS A;  3ENW A;  4LUB A;  1WEZ A;  2NUU G;  4UST A;  3NKY A;  1SIZ A;  3LTO A;  2UUW A;  1M5K C;  3SCK E;  2MKY A;  3D9B A;  1LW2 B;  4V19 X;  2R8H A;  4A8S A;  1NJW A;  2UP1 A;  4R0J A;  1UVI A;  1CJK B;  1TQL A;  1UEK A;  4YR3 A;  4D3H A;  4NZ6 A;  2W4P A;  3MEG B;  1Q78 A;  1C1B A;  2AYG A;  1XER A;  2CQ3 A;  4KGM A;  2XMT A;  5BJR A;  5GME A;  2HQG A;  1HI1 A;  2J7U A;  2O1P A;  1X4E A;  1PYS B;  1IKW A;  2GQC A;  1HI0 P;  2M7S A;  1NK5 A;  3LUY A;  1SKU B;  5KG5 A;  1U48 A;  1IQZ A;  3ENV A;  2VIH A;  1HMV B;  1NK6 A;  3MUV P;  4JI1 F;  4IRC A;  2WSE C;  4LIR A;  3N4W A;  1BE4 A;  3BGR B;  2IYI A;  1SUQ A;  4OV1 A;  3PR4 A;  1RAO A;  4J37 A;  4NXN J;  2K7K A;  2HHW A;  4JI6 F;  4B3T F;  4YR0 A;  1S0N A;  2D69 A;  2R9L A;  3VGV A;  4F2R A;  4Y34 A;  5CZV A;  4JP8 A;  4NXM F;  1JJ2 R;  4C6A A;  2WVC A;  1NPR A;  3MM8 A;  3BGO P;  5HP1 A;  2XHW A;  5D4O A;  3AOC A;  4L76 A;  3DGV A;  5L1K A;  1TV6 B;  4ITS A;  1QD1 A;  4DPT A;  1JXV A;  3QFW A;  2HHH F;  4RX6 A;  2NXC A;  4U6P A;  2HNZ A;  4DN9 A;  4ZHR B;  2H3E B;  2Z2Y B;  1IBM F;  1H72 C;  2QO3 A;  2P8I A;  1KWM A;  2VL1 A;  3R1L A;  1X4B A;  1Y5L B;  5HBM A;  1DTT B;  1X31 C;  5E0O A;  2Q3P A;  3C14 B;  4ZKA A;  1LWE B;  3NCP A;  1F60 B;  3TAP A;  1YJV A;  2R7V A;  2OPP A;  1AUD A;  4Q44 A;  1MSW D;  4RNH A;  4OFZ A;  4HEA 9;  1C1C B;  2KG1 A;  1T05 A;  1J5E J;  2AV5 A;  2DNK A;  1U1R A;  2HZC A;  4MIA A;  2R7S A;  1YHQ S;  5MLC V;  4GO5 X;  1H38 A;  5HRO B;  5RUB A;  4P71 A;  2AW0 A;  2V4R A;  2MKH A;  4X64 F;  3PEH A;  3SSQ A;  1MG7 A;  1HBM B;  2NXU A;  1SKW A;  3KOA A;  1QTM A;  5B0C A;  3H5X A;  3MFI A;  2OLW A;  1KLM A;  1RQ0 A;  4DFM A;  3PVX A;  4KTQ A;  3VR1 A;  3OL8 A;  3GSD A;  2DJW A;  4QU7 A;  3IBF B;  3C6U A;  2J6S A;  4USI A;  3G2X A;  1SL1 A;  1S10 A;  4KKO B;  4CLU A;  3MM9 A;  2DH9 A;  1N54 B;  1VIS A;  2DGS A;  3DRS B;  4GVB A;  4X62 J;  4DR3 J;  2UUC J;  4MIB A;  1MU2 A;  4ECV A;  2Z30 B;  4MK7 A;  1U25 A;  2MGZ B;  2VIC A;  1GEH A;  3MD3 A;  3DXB A;  2GJF A;  4ICL A;  2UVW A;  2MZS A;  5KFW A;  4F0K A;  2G9O A;  1N36 F;  2ZBR A;  3VAH A;  2B5J B;  4DV0 F;  3SQO P;  4IKA A;  2UU9 F;  2Q66 A;  5EHH A;  4UOG A;  4O4R A;  4U67 Q;  1IKY B;  3AA8 A;  4HI1 A;  3KLV A;  4QJV A;  2VBZ A;  1RTZ A;  4WII A;  3BSO A;  5EWF A;  5GAE U;  1I3O B;  4F0M A;  2MHE A;  1RTH B;  1SPB P;  3JQM A;  4H4K C;  4FXW A;  5DQG A;  3H40 A;  3FCH A;  2CFX A;  4TU8 A;  2V8V A;  3D54 A;  3X3U A;  4DR4 J;  3N79 A;  4ILM A;  1HHS A;  3ZZZ A;  4NRU A;  3T41 A;  3AFG A;  4BC7 A;  4DS5 A;  1S6Q A;  1BY9 A;  3OFF A;  3QFH A;  1U2R A;  1VQ8 S;  2K8G A;  1NBE B;  1NSQ A;  3V5R A;  1VYA A;  3QO9 B;  1GQE A;  2B9Y A;  1QJH A;  4AND A;  3DLE A;  1NU4 A;  2YH0 A;  4KH1 B;  4C3K A;  2RU9 A;  4JI3 F;  2RD5 C;  4CYU A;  1IWA A;  4X4T A;  2FGO A;  2JJ4 D;  1C0U B;  4NYZ A;  4PEO A;  2VG6 A;  3RB0 A;  3UD5 A;  2E5J A;  4PXB A;  3R6L B;  2R7R A;  3DLH A;  4M63 A;  1URN A;  2OFH X;  5IV4 A;  1RWX B;  3BH7 B;  3SMZ A;  3JSM A;  5I3Q A;  1BQN B;  1PSD A;  3GV5 B;  2V4Q A;  2BKN A;  1D8Y A;  2AGQ A;  3O44 A;  4NZ7 A;  4PKD B;  2VDH A;  1REV A;  3P5T L;  4PRF A;  1TKT B;  4P52 A;  2OD4 A;  3SSS A;  4F4Y A;  3T3F A;  3BGU A;  2V67 A;  4ZHR A;  3MR7 A;  3TUJ C;  2DBB A;  3ZXW A;  3QGH A;  4AQY F;  1R43 A;  3RW7 A;  3PJX A;  3QT6 A;  3VAI A;  1WF0 A;  3QAT A;  3PR5 B;  2VQE F;  1VK3 A;  2HFS A;  3S7R A;  5F3T A;  4LF9 J;  2ZH4 A;  1U6B A;  4NLT A;  4CLL A;  1GT8 A;  4N41 A;  2AX1 A;  3RGI A;  2M8D B;  2OHD A;  3M30 B;  1X4F A;  2I5J A;  3UNY A;  4DDF A;  1RE1 B;  2ZBQ A;  5L1I A;  3PYG A;  5KT6 A;  5ETT A;  4WE1 A;  4JI0 F;  1UA1 A;  2IM3 A;  2CQP A;  3DLJ A;  2KVQ E;  4B3R F;  1XMQ F;  2AMC B;  1JLA B;  2W9B B;  3G6V A;  2BKP A;  2MZR A;  3PO4 A;  3V4I B;  2R7T A;  2EBE A;  1IKX A;  4OX7 A;  4KO0 A;  5HMW A;  5IWA F;  1VQO S;  4MKB A;  3M8Q A;  2V4J B;  3CIZ A;  4WFX A;  2FVR A;  4FF4 A;  4JI7 F;  3UDL A;  1G1X A;  4LFC F;  1UEV A;  2M52 A;  4WPA A;  1FKA F;  1VBK A;  3N28 A;  3VAJ A;  3CDW A;  5A8W A;  3VCD A;  4HTI A;  3TA2 A;  3ZTS A;  3I0S B;  1DTQ B;  3T1Y J;  3N6N A;  1RHQ B;  2GGP B;  3HSJ A;  4M95 A;  4NCG B;  1EHW A;  3KXD A;  3MD1 A;  1BWV A;  3M6W A;  1N34 J;  4Y2I A;  2V50 A;  2ABY A;  3M1V B;  3LWL A;  1U09 A;  1XMO J;  1M1K T;  5KFM A;  2OPQ B;  3QAE A;  4DR5 J;  1HNV B;  3OLB A;  2W9A A;  2BR0 A;  4CCH A;  4J7C A;  4LF4 J;  1ZZF A;  1O8B A;  2H4W B;  5E7O B;  3ENA A;  2R7W A;  1RTD A;  2CQ4 A;  1RZM A;  1FXL A;  2HRT A;  5BR8 F;  1Z2Z A;  1PC4 A;  1WKL A;  2C2E A;  4KGK A;  2P9E A;  4IYQ A;  2IJF A;  4QPT A;  2WVD A;  1NSK L;  4CZC A;  5CYQ B;  4DU8 A;  1JXL A;  3GCW P;  1C2P A;  1FJ7 A;  4U7C A;  3U1L A;  4EBE A;  4RU9 A;  4OV6 A;  2MKC A;  2FHK A;  1WTF A;  2HPU A;  3BJY A;  3C15 A;  4H4K A;  2CQG A;  5KFC A;  4DL4 A;  2PA3 A;  4Z37 A;  5EGY A;  4MIW A;  3VGU A;  1C0U A;  1RYR A;  2V2V A;  1K73 T;  4UZB A;  4UQG A;  4ED1 A;  1SV5 A;  3NGK A;  1UFK A;  3ET6 B;  1B7F A;  5HAO A;  3J81 j;  1X60 A;  2V69 A;  3BO3 A;  5FLX Y;  2ZH6 A;  2RIL A;  2BRK A;  4C97 A;  1WC6 A;  1U24 A;  1VBX A;  3LP2 B;  1GTE A;  4ETZ A;  2D3U A;  4CLK A;  3KMQ A;  4I6A A;  3DYA A;  2YNH A;  2F40 A;  4NLQ A;  1WOS A;  4XK8 C;  1RT2 A;  3K8V A;  2HFN A;  2FHO B;  2D3O 1;  1UWB A;  2E9R X;  1APS A;  2ASY A;  4USU A;  1VHF A;  2VKR A;  1R6Y A;  2BX6 A;  4WF9 Q;  4C3L A;  3M8P A;  3HFZ B;  4F02 A;  1HBU A;  2MMY A;  2VQF J;  2W7O A;  6FD1 A;  3KJF B;  3LWM A;  3W7B A;  3CD5 A;  2ROP A;  1S4F A;  1JLF A;  3G8S A;  3OVA A;  2MPU A;  5GMD A;  3W2W B;  2EK6 A;  2F1F A;  4A46 A;  1X5O A;  4UZC A;  1UTA A;  4C8K A;  1FKP A;  2AJ2 A;  2F63 A;  5HVH A;  1HNW J;  4KQZ A;  4MYT A;  4ZVU B;  1IM4 A;  4QW8 A;  2OKQ A;  3Q22 A;  1R6V A;  1A7G E;  4YDD B;  5CZX A;  2GIR A;  2E44 A;  4DX6 A;  5H9E K;  2VZ9 A;  3TR5 A;  2HMI B;  4RBV A;  1S72 S;  3L4B C;  3QAU A;  5A6P A;  4J9L A;  3W60 A;  2Q79 A;  2DNN A;  1ARO P;  3DGP A;  4WK3 A;  3X1L B;  3GYX B;  2X3G A;  3IWX A;  3MF5 A;  3GLJ A;  4KPC A;  4E0D A;  2EFP A;  3NL0 A;  1VQM S;  3KJN B;  4TQR A;  4DMZ A;  1KN6 A;  3DXS X;  4O3O A;  1UZH A;  4HTJ A;  3WZ0 A;  5ETP A;  3I4H X;  3BQ2 A;  1B0T A;  4IFV A;  2JFD A;  3K17 A;  1F6T A;  2WON B;  1VLO A;  1Q8I A;  3MM6 A;  2FJA B;  3V6D B;  3ZFV A;  4IOA Q;  1T3O A;  3SXL A;  5HO4 A;  1VRT B;  1U7L A;  4N8N A;  2ZHB A;  1JXE A;  4WFY A;  3DDK A;  1HWL A;  1ZM4 A;  5GAD I;  3CCE S;  1RTI B;  1YG0 A;  1RT3 A;  3DOK B;  1RAC B;  1T0T V;  1U1K A;  2OGU A;  1D9A A;  3T1H J;  2FQQ B;  4C8O A;  2OPR B;  2ZH2 A;  1NPK A;  3BPD A;  3CCM S;  1RHK B;  3FQL A;  4DFP A;  3AHP A;  1IBK J;  4DL3 A;  3FFI B;  3WDO A;  5DM6 Q;  1GK8 A;  1VC5 A;  3U1M A;  4K59 A;  2ATC B;  8AT1 B;  3KHG A;  2YNF B;  2O5D A;  2DR8 A;  2HS3 A;  3H98 A;  2A6M A;  5G0R B;  1JNR B;  2CQC A;  1NB2 A;  1HNX F;  2VFU A;  1RKJ A;  4JI2 F;  3PHT A;  1DAX A;  3BV8 A;  2Q6B A;  3NGS A;  3D0H E;  3TP2 A;  1TFW A;  4WTY A;  3BPS P;  4NI2 B;  1RHU B;  5F8I A;  2H1Y A;  1NDP A;  2VA3 A;  3C2P A;  1RLC L;  3EVM A;  1XR5 A;  1DRZ A;  2N4C A;  3EVW A;  4K0K J;  1F2H A;  2LXU A;  3MTK A;  5T14 A;  5CYJ A;  3KK1 A;  4WFB Q;  3O5T B;  1U8W A;  3GFX A;  4CO1 A;  4EGL A;  5ADZ A;  2R2U A;  4DG1 A;  4BHQ A;  4UY8 T;  1FRX A;  1JLG A;  1XIQ A;  4A8O A;  4X65 F;  3ADA C;  3ELH A;  5HI7 A;  1KS2 A;  3DRP B;  3G6X A;  1VBZ A;  3PHE A;  4DFJ A;  4M5G A;  4LF5 J;  2W4C A;  3V81 A;  5DS7 A;  1YVF A;  5C42 B;  4CO0 A;  4B9V A;  2QT7 A;  2JH3 A;  5FDL A;  1SH3 A;  1JKH A;  5I4M A;  1YJW S;  5LSR A;  2GAG C;  2WSF C;  3I9Z A;  2AT1 B;  3QGP A;  1V6H A;  2DXE A;  3T5L A;  2R3V A;  2G2O A;  4FYW B;  2XYH B;  1WC4 A;  4LF7 F;  2NLW A;  3KLE B;  1M5V C;  4K4Z A;  2P9G A;  3DU5 A;  4Q7A A;  4P7T A;  2QE5 A;  5CD4 A;  2VG7 B;  1RT1 B;  3I5B A;  5F3Z A;  4EYI B;  4PWW A;  2Y3Y A;  3IWL A;  2HNY B;  2RRB A;  3GWC A;  3PYF A;  3AAW B;  2B4V A;  4B9U A;  4J9R A;  1LNQ A;  1NZA A;  3DLK A;  1TAU A;  2A6O A;  4O3P A;  1UVM A;  4EYH B;  3NNA A;  3J80 U;  1SBR A;  5C25 A;  3MUT P;  3TUP A;  3D0G E;  1MMN A;  2WVF A;  1U26 A;  1BQM B;  4DCP B;  4I7F A;  3VZH A;  2BMB A;  5E2Q A;  1RJJ A;  5B0D A;  5B0B A;  2W25 A;  4QIF A;  2VPZ B;  1VQ7 S;  3HHL C;  3QSI A;  3BR9 A;  1Q8K A;  2Y1I A;  2J9D A;  4DI6 A;  1M1G A;  5A8K A;  3Q83 A;  2ZJR Q;  4AE5 A;  4J9Q A;  2MQ8 A;  2G0C A;  1OSD A;  2HHX A;  2DPI A;  2A10 A;  2Z4P A;  3KFW X;  4QIV A;  4I68 A;  4CNY A;  5E3R A;  4ECU A;  2W2P P;  1DBD A;  2NR0 A;  1FXR A;  2Y0B B;  2ZFH A;  3M8Z A;  4DSE A;  3LAM A;  2YWE A;  3FFI A;  4QU6 A;  3QIP A;  4EUV A;  1OQ6 A;  2J9E A;  1W25 A;  4V1A k;  1C0T A;  5ETS A;  2CIM A;  4MYU A;  2JSX A;  1R8A A;  4C11 B;  1R89 A;  3MM7 A;  1J5O B;  1PIL A;  2PE8 A;  3CMQ A;  2QA4 G;  2N3O A;  1FWP A;  3MR5 A;  5HVF A;  2RQC A;  5IQ6 A;  1FKO A;  4PCQ A;  4IO9 Q;  4QWC A;  1G6B A;  2QFI A;  4U7U K;  4ILR A;  1RP5 A;  5J2Q A;  3P45 B;  3IS9 A;  2F8M A;  2RKI B;  4CI0 B;  2HAF A;  4Y0F A;  2QX0 A;  1P9Y A;  3DRR B;  4ZVP B;  5LSO A;  3RZA A;  1FO1 A;  4NYP A;  4CTA B;  3M2R B;  1R0C B;  4RNO A;  1WEX A;  4LSN A;  1RA7 A;  1ZAV A;  1WF1 A;  3QYY A;  4FN5 A;  2VG5 B;  3DM2 B;  3MWB A;  4RW8 B;  4JYA J;  2ATL A;  3PKY A;  1B0P A;  1XN9 A;  4FPI A;  4PAB A;  3ZC4 A;  3CDE A;  1FJC A;  3TJA A;  4ZP6 A;  2UXB J;  4KFB A;  5KFI A;  4N76 A;  4DSK A;  4MKY A;  2VBW A;  3TRG A;  4ETX A;  4EBC A;  2XS7 A;  3Q0A A;  5DG7 A;  4C4W A;  3I55 S;  2JLF A;  4ED0 A;  4Z7Y A;  3SYZ A;  4HT5 A;  3M32 B;  4J9O A;  3TOQ A;  2IBO A;  2WOM A;  3RBX A;  4CM0 A;  3HD2 A;  2AGP A;  2V2Q A;  5KFJ A;  3IN5 A;  3I82 A;  3VQS A;  3LGM A;  3MMC A;  5KFF A;  2XLJ A;  2CJB A;  3MM5 B;  3MR2 A;  1XNR J;  3E01 B;  5B0A A;  2GHV C;  5CD4 H;  2MQM A;  5IM0 A;  2RML A;  4B3M J;  3N0V A;  3ULH A;  1IKV A;  3SCJ E;  4A8K A;  4DV1 J;  4MAK A;  1BHN A;  2GVZ B;  2B8Q A;  2CPY A;  1D09 B;  1S12 A;  3R1H A;  3LGH A;  1MWY A;  1BMQ B;  4WTO B;  1T11 A;  1UPM B;  1RT5 A;  3W8G A;  3ZTR A;  4DV5 J;  4OL8 A;  5GAH I;  4ED6 A;  4C8N A;  2DNL A;  4OMF G;  4ERD A;  2MKI A;  4OHX A;  4NA1 A;  2H5J B;  4EBD A;  3C6T B;  4OI6 A;  4KYZ A;  3GIR A;  4C2M A;  3HK2 A;  1EET A;  4KV8 A;  3BYP A;  3TW0 A;  4RW7 A;  3HT0 A;  4KBI A;  5HVG A;  3RUB L;  4Y2K A;  1FVS A;  3PJ9 A;  3M6U A;  3CC4 S;  2VF3 A;  3HT3 A;  2IAJ A;  3JSR A;  2B56 A;  2KO1 A;  1FA0 A;  4LRE A;  1OY8 A;  1JLB B;  1HQ2 A;  2Z57 B;  4RLE A;  2HYI B;  1RTJ A;  1EKS A;  4K5S A;  1B4S A;  2YKN A;  1H7X A;  4DEZ A;  3E51 A;  4KC5 A;  2X51 A;  1I5O B;  2PO4 A;  4RUB A;  3C19 A;  1L3U A;  3HHL A;  2YWF A;  2VKZ G;  2Z2L A;  4JB8 B;  4RNM A;  2R8I A;  5ETQ A;  5H1S V;  4ECR A;  2YPZ A;  2FD2 A;  5J2M A;  1Y5N B;  4ED2 A;  3PIO Q;  1TKX A;  3MR3 A;  4I0W A;  5HLF B;  1WG1 A;  2LA6 A;  2BUN A;  2POK A;  3DKD A;  4P2X A;  2XB2 D;  2XI3 A;  3RJM B;  1W2B R;  3ITH A;  4GC7 A;  1S77 D;  4YUD A;  1J2V A;  3A8J A;  4K4U A;  5ETL A;  2KFZ A;  3MMA B;  3TX0 A;  3NG8 A;  3UE2 A;  3GJQ B;  3PEJ A;  3M8W A;  3MED A;  5F0W A;  1YIT S;  2GVD A;  1WWH A;  5MAO A;  4M5I A;  4DPU A;  1GXU A;  3M7V A;  3L95 X;  2LU1 A;  2ZDO A;  1XQI A;  4OIX A;  1RWP B;  1X9W A;  1ZS6 A;  4ZPV R;  3UD3 P;  1N88 A;  4C3M A;  4CLS A;  1F5B A;  3EGV A;  4OZ1 A;  3MEC B;  4F4K A;  4QQB A;  1U6Z A;  3R5B A;  4NXN F;  4YB7 A;  2X7I A;  2ZD1 B;  2DCU B;  3S8S A;  3R7N B;  2ZUG A;  5B0E A;  2HGM A;  5J2N A;  2YNG B;  3MCM A;  2MZ1 A;  4YP3 A;  3WX8 A;  2MQL A;  4I6W A;  5AE2 A;  3NXZ A;  1DZ5 A;  3QJL A;  2DNY A;  2HWI A;  3KTQ A;  3OUY B;  3PAC A;  2IM0 A;  1TUG B;  4MH8 A;  1S79 A;  2HS0 A;  2GIQ A;  1SJF A;  1PO6 A;  5JUM A;  3LA0 A;  3FGV A;  1RWW B;  4ZCM A;  3CCZ A;  4JV0 A;  2HEK A;  5A8R B;  3BQ0 A;  1AA1 B;  4URQ U;  3UCU P;  1FDA A;  3BDP A;  3HI9 A;  3GZ7 A;  4HLB A;  1S1T B;  1H2V Z;  2ZC4 A;  4YHH J;  3PRD A;  5KFY A;  3FMB A;  4PQU B;  2RDI A;  2WTF A;  2H48 B;  4QR1 A;  1DLO A;  1CJU A;  3R5J B;  3QGI A;  1DQA A;  4NLU A;  2JFK A;  1WC1 A;  4DUZ J;  1RDR A;  2RRN A;  5L46 A;  1CQN A;  2VON A;  3R7S B;  3GJT B;  1YJT A;  2ZM6 J;  3BBC A;  2B7B B;  3NWR A;  4DLE A;  1IXK A;  2XSJ B;  2XCA A;  4WFN Q;  1KP6 A;  1I94 J;  1FDD A;  1AZS A;  2DD8 S;  1TFY A;  3HX9 A;  5KT5 A;  5ETN A;  1PJ5 A;  3DLL Q;  1IJF B;  3CCT A;  2RU3 A;  2VOO A;  3TO8 A;  4Q45 A;  2Z2M A;  5IC4 B;  2CPJ A;  1W26 A;  2CQD A;  3FEX B;  1JJ4 A;  2CPZ A;  5C24 A;  2C3M A;  1TKZ B;  4X62 F;  4DR3 F;  2UUC F;  5KAK A;  4LSL B;  4IUF A;  4UY8 5;  3PCO B;  2RHS B;  1Y4Z B;  4YEA A;  1Y3J A;  2YXL A;  3DCA A;  3AD7 C;  2DGW A;  1VQK S;  1LWC A;  4FYY B;  2C1E B;  3LP0 A;  5KTQ A;  3OQ2 A;  2EKN A;  4RBT A;  1TVR B;  4UW2 A;  2U2F A;  4FBT A;  3NRB A;  3H2L A;  3BGL A;  4OJH A;  3FBC A;  2G1D A;  2RS8 A;  2HLT A;  3OBI A;  1CVJ A;  5EWG A;  2BVZ A;  5F8J A;  2K1R B;  3CC7 S;  2G2Z A;  3OTO J;  2IVY A;  4EO6 A;  1DFD A;  4X4U A;  1JX4 A;  3PFE A;  1QVF R;  4UT4 A;  1YK9 A;  4NA3 A;  3LQV A;  4DR4 F;  2QMX A;  2J6T A;  3KNG A;  2B3T B;  1AB8 A;  5E5N A;  3A8E A;  4ZPA A;  3KHR A;  3FEZ A;  3OFH A;  1MW7 A;  3DFE A;  4D3G A;  4ZVS B;  1VRU A;  1D9D A;  2HGN A;  1S9F A;  5K8O A;  4JV2 A;  3BRE A;  1ZA1 B;  2ZH3 A;  1H3D A;  2H5E A;  3ISN D;  4OYP A;  4XDD A;  1XBW A;  3KJV B;  1S7I A;  2MLZ A;  2EI5 A;  2HBY B;  2B0G A;  2HHT A;  2N7Y A;  1VQY A;  1PIE A;  4S0M A;  2R8G A;  1YGY A;  5KG1 A;  1ELO A;  1JLQ B;  3W2V B;  5DZ7 A;  3J7A N;  4LF2 A;  2FVC A;  2YX1 A;  2ZKT A;  1NRK A;  5KT3 A;  2KFY A;  4FNI A;  3QZ8 A;  3OL9 A;  4W90 B;  4DF8 A;  3K5P A;  3VQT A;  1JLC A;  2KU7 A;  4NLY A;  3IR6 B;  3LOU A;  2EG2 A;  3W64 A;  4Y2M A;  4F4Z A;  1SJQ A;  1VGY A;  1MWZ A;  4IFY B;  2FJB B;  3A8I A;  2B9X A;  4LRB A;  1CJT B;  2D9P A;  4N8O A;  2KZZ A;  1QE1 A;  4CLZ A;  2Q6C A;  4OLO A;  4B9N A;  3TUZ C;  2ALZ A;  2E29 A;  1QLN A;  4LF9 F;  3GII A;  3ICL A;  3SCL E;  1T9W A;  4B3O B;  3SDE A;  3GB0 A;  4QCL A;  3ETO A;  1KDN A;  3MAA B;  2E5G A;  2ZHO A;  3HKZ D;  4FP9 A;  3UN5 A;  3CME S;  1IJE B;  3Q89 A;  2JX2 A;  1LK5 A;  4W4M A;  2XY5 A;  2L9W A;  4O4G A;  2NQP A;  2C3Y A;  4C8Y A;  1P1T A;  1K0V A;  3FCW A;  2ZJP Q;  2ZNY A;  2VDI A;  2DGU A;  5CYM A;  4UUX A;  4ZPD A;  1FJG J;  2MQP A;  2IC3 B;  1NDK A;  2XZW A;  4Q0B B;  5E3A A;  1E6V A;  1VK8 A;  4LMZ A;  3K89 A;  1H2T Z;  1T94 A;  4USH A;  1QAI A;  4TKT A;  2XBP A;  4BLG A;  2MXY A;  2NYH A;  4O0N A;  3LW5 C;  3JXO A;  4NZ0 A;  5F41 A;  1G2E A;  1JLE B;  2BJ7 A;  2Y1J A;  1HQU A;  2CJ9 A;  3POT A;  3ILL A;  1FDB A;  4RJV A;  1U0H A;  4FXV A;  2WVB A;  4DJB A;  4OYZ A;  5KFL A;  1FTC A;  3LAL A;  3K5L A;  3MEE A;  1QAJ A;  4LR7 A;  3T1Y F;  1Q4R A;  2RNE A;  3WBZ A;  1NK8 A;  5LMU J;  3UN2 A;  1N34 F;  5AXN A;  2M88 A;  1WHY A;  3AOB A;  1XMO F;  1LK7 A;  2WRM A;  1EP4 B;  4DR5 F;  2BAN A;  1UVN A;  3PRV A;  5KT4 A;  1UEU A;  4LF4 F;  4CM2 A;  5I42 B;  2K1R A;  3KHL A;  3UVJ B;  5SZT A;  2CUY A;  3E8O A;  5E3C A;  3FUY A;  2YKQ A;  2HFU A;  3FSI A;  1FK9 B;  2DNZ A;  5K14 A;  2DNG A;  3A1Y G;  1L5U A;  1WHX A;  3EGZ A;  2ZE2 B;  2F7V A;  3QWU A;  2C3U A;  3JQK A;  1O0P A;  3KLI B;  1VJQ A;  4KH0 B;  1ZOT A;  4I4B A;  2FIU A;  2QTW A;  2IA0 A;  3ILI A;  4NRT A;  1S6U A;  4F0H A;  4DV3 J;  5ETK A;  2AD9 A;  5K9F A;  3PX6 A;  4IG0 A;  4QYZ K;  3HZG A;  4OI1 A;  1YJN S;  1WOO A;  1EAY C;  3SQG B;  4LRF A;  3OXF A;  2DH8 A;  1VQ9 S;  2VC1 A;  1HW8 A;  4E8U A;  2IVM A;  3I32 A;  2IMO A;  4PWD A;  2MLX A;  3GP9 A;  4NLP A;  3MHY A;  1EZZ B;  3SCI E;  1S9G A;  1VJW A;  4A8Q A;  1TL7 B;  4WU2 A;  3K2Y A;  1X9M A;  5AE3 A;  3TA1 A;  4HH0 A;  3F41 A;  4RWX A;  4ID5 B;  3SV4 A;  2JVO A;  2YPY A;  4HAC A;  4WWS A;  4BWM A;  3ZZ0 A;  3OSP A;  1HYS B;  3W3S A;  3FJ2 A;  4ELV A;  3GIK A;  3PRB A;  2OO4 A;  2V2K A;  2BJE A;  4N47 A;  4QIG A;  4DZ6 A;  2A2D A;  4QR2 A;  3GIL A;  4J9S A;  1PYO B;  1RAE B;  2PI4 A;  2MDA A;  3W9J A;  2VQF F;  2PN6 A;  4PXE A;  5CHC B;  1K47 A;  1HBO B;  5J1E B;  2HND B;  3AY0 A;  3K8W A;  1R0A A;  5M2U A;  3NMR A;  5IQQ A;  2R2T A;  2GC8 A;  1N5Y A;  4J91 A;  4DOZ A;  5J2P A;  1GX5 A;  3PTW A;  2W8L A;  3KLF A;  3OW2 R;  1HNI B;  3CT9 A;  3H5Y A;  3R5C A;  3AQO A;  2A3J A;  4Y28 C;  1TUV A;  2C2K B;  1IN0 A;  4NLV A;  3KK2 B;  1G4C A;  2NZ4 A;  1RHR B;  2UXC J;  4ZN3 A;  2JEJ A;  5DJB A;  4B9L A;  3AOD A;  2B6A A;  3SEO A;  1HNW F;  1RHM B;  5EX3 A;  2ZIT A;  5AE1 A;  1RIS A;  2GS8 A;  4XO0 A;  1OPZ A;  2W8K A;  4ZIV A;  4Y65 A;  3IWN C;  2VFR A;  2ASL A;  3VVU A;  2CVI A;  1RYS A;  2H51 B;  4NLX A;  4ZVE A;  3RYL A;  2KXF A;  3OR2 A;  2UZA A;  4M5L A;  2PC6 A;  2MHN A;  3BF4 A;  2CVE A;  2V5H G;  4ZJO A;  2GCF A;  1OYD A;  2YX4 A;  2WB4 A;  3ZNJ 1;  1HL6 A;  1PAE X;  1TR0 A;  3NGD A;  2DCL A;  2HS4 A;  2ZNZ A;  4Q8E A;  4ANC A;  5AXL A;  5GAG I;  1V5V A;  2DGO A;  5LJ5 Y;  3PW2 A;  4ZS6 A;  3NLC A;  4ANE A;  1J27 A;  3OD2 A;  2HIY A;  2H65 B;  1GAO A;  3QNW B;  4K5R A;  2KH9 A;  2QA2 A;  4WFA Q;  3UDE A;  2KG0 A;  1CUL A;  4OJG A;  3DOL A;  3MPD A;  2V9W A;  4OZJ A;  4WZQ A;  2BZ2 A;  2CG8 A;  1C4C A;  1JJC B;  2W4D A;  2YNI A;  1SKS A;  1WKK A;  1ACM B;  4XTT A;  2GQ2 A;  1FE0 A;  2DRA A;  2XGQ A;  2EFV A;  3ZZU A;  3FBF A;  1YJU A;  3OFE A;  1VCT A;  3UDV A;  1ICE B;  5THW A;  2X1F A;  3T1H F;  4NLS A;  3BZQ A;  1SC6 A;  4ZK7 M;  3J81 U;  1U2C A;  2LA4 A;  2HHP A;  3AXM A;  1RWO B;  2QN6 B;  4OYA A;  2MQQ A;  1C1B B;  1Q5Y A;  2R2S A;  2KI2 A;  3JYT A;  4DU7 A;  1IBK F;  4CP5 A;  2R7X A;  1YRT A;  1MRO A;  2J76 E;  1PJ7 A;  1VQN S;  3KG4 A;  4K4T A;  4HDG A;  4LT6 A;  1UPP A;  1R7I A;  2VFV A;  2C28 A;  3HFK A;  4I69 A;  2EFG A;  4Y2C A;  1IKW B;  3TZW A;  2KHD A;  1U8S A;  2I6W A;  1VS3 A;  4OZ5 A;  1HAR A;  3MUM P;  5D4P A;  4LIW A;  4F25 A;  1WDD A;  3HUL A;  2VJU A;  3H0P A;  2MZT A;  4ZMM A;  3MPU B;  2HFO A;  3HVA A;  3G82 A;  2HKE A;  3N5F A;  1SUQ B;  3EGN A;  1YQH A;  5FII A;  2FLN A;  3J7Y I;  4F4X A;  2CXE A;  3N5B A;  3UI3 A;  1NK9 A;  4IQM A;  2YQ1 A;  5L39 A;  2B51 A;  2C2M B;  4IH7 A;  4K0K F;  3D1H A;  3IFE A;  4DQR A;  4ZJL A;  4C0O C;  1RB0 A;  4F04 B;  2RDD A;  1N5V A;  5T7L A;  2BM0 A;  3OVB A;  3VAL A;  1HIY A;  3HCX A;  4MKA A;  3CE8 A;  5HP1 B;  1JWW A;  2XMA A;  3HJV A;  2CWX A;  2JVR A;  2XWX A;  3CJQ A;  2XMU A;  4DCO B;  2WW4 A;  4LF5 F;  4O44 A;  2HNZ B;  2ZWO A;  4M5H A;  1Y11 A;  2CQI A;  2KXH A;  4OZ0 A;  1F9F A;  2DT9 A;  2CJX B;  1KKH A;  3QLH A;  1OIA A;  1UMJ A;  3NEK A;  5HJY A;  4F36 A;  2KKH A;  1D9F A;  4TLQ A;  2OPP B;  1EQ0 A;  2I38 A;  3RBD A;  1RI7 A;  2HAI A;  2KRR A;  1LWF A;  1V3R A;  2N4D A;  5KG3 A;  1TEL A;  3W66 A;  3KG1 A;  5DGA A;  3O1L A;  2KDO A;  2KHC A;  1HWJ A;  1L3V A;  2UXD J;  3G6E S;  2KT3 A;  5HAN A;  1UAW A;  5L1L A;  2LU2 A;  2EC2 A;  3M8Y A;  5K8M A;  3OXL A;  1N0U A;  3V6J A;  2D74 B;  1X4C A;  3G71 S;  4GC6 A;  1M5P C;  1KLM B;  2QYG A;  2RDJ A;  2KT2 A;  1WF2 A;  3CED A;  3UR3 C;  1WDT A;  2FHJ A;  1FWK A;  1HPZ A;  3JB9 k;  3J7A 1;  3C6U B;  3DI6 A;  2OD6 A;  2V8D A;  3CJT A;  2YWK A;  3MM9 B;  4KGZ B;  1B64 A;  4LF6 J;  3KUG A;  5ETM A;  5HQ8 A;  1YRU A;  1WHV A;  4GVB B;  2D9O A;  3CXC R;  1F1B B;  5HMZ A;  3MCN A;  1MU2 B;  4F67 A;  5EWE A;  4K4V A;  2P6S A;  2CPD A;  4Z2X A;  2R8J A;  4L72 B;  3JSB A;  3KLG A;  3US5 A;  4Q2M A;  2VFT A;  5D15 A;  1KD1 T;  4USW A;  2ZVI A;  3D4J A;  4ICL B;  2XG8 A;  4C98 A;  3CIM A;  1XMB A;  1IM6 A;  3TUI C;  4WBF A;  3W5Y A;  4LFB J;  4P2M A;  1L3S A;  2NPI A;  3BB5 A;  3VAK A;  2I1R A;  1OMS A;  4JI4 J;  5CQG A;  3CUL A;  2V9K A;  1Y10 A;  3FKB A;  3IAM 9;  2NRE A;  4JV5 J;  5KG7 A;  2H54 B;  2IRU A;  3DLB A;  2E7W A;  3KK3 A;  4TN2 A;  1BUX A;  1TK5 A;  1PG5 B;  4N5S A;  1HWU A;  1X9S A;  2AHO B;  3BKT A;  2F3J A;  4H4O A;  4WIQ A;  1T8E A;  1S6Q B;  5AXK A;  5E41 A;  2CZ4 A;  1FCA A;  1S1W A;  2C2O B;  2ZWP A;  4KR0 B;  3ENQ A;  3DLE B;  4M5N A;  1QUP A;  4O0I A;  4CYU B;  3QRR A;  5A6W A;  4JI8 J;  5FLX U;  2GFF A;  4RW6 A;  2VG6 B;  4JI7 J;  4MFB A;  2DEJ A;  4YB1 P;  2FB0 A;  3G8Q A;  4I2P A;  1BC6 A;  1FNX H;  3O3L A;  1L3T A;  4JYA F;  1LOU A;  1V5I B;  1Q5V A;  1NHU A;  1ROF A;  1BWE A;  4RUC A;  3JSM B;  2DHS A;  3PZP A;  4TVA B;  2NCK L;  2CJY B;  2UXB F;  2DNH A;  2BV3 A;  1REV B;  2FPH X;  5IFM A;  4OI2 A;  1UVL A;  3MI7 X;  2CWK A;  4X4S A;  2CDR B;  2B9E A;  2AQ4 A;  4UOF A;  1S4E A;  2COL A;  5BXI A;  3CO9 A;  1YWX A;  4YS2 A;  4DUY J;  3CJ8 A;  1WUU A;  1F0X A;  1LQ9 A;  2W2M P;  2WBM A;  1EX8 A;  4KIA A;  3T19 A;  4DV2 J;  2QC3 A;  1SI9 A;  3I4P A;  1U1M A;  1UW4 A;  1S6P A;  3OL6 A;  4MK8 A;  4WXW A;  1FWL A;  3GFY A;  1OSC A;  1U45 A;  3DRX A;  4QWB A;  5LM7 E;  2AJ4 A;  4B3S J;  1RAF B;  3WIU A;  1XNR F;  2PFF B;  1FD2 A;  2UV8 G;  4B3M F;  5KFE A;  2HHQ A;  3FZB A;  3CCL S;  4DV1 F;  2CYY A;  2PMZ D;  2VPY B;  2I5J B;  2RQK A;  1RT6 A;  3VAF A;  5L1J A;  3QT8 A;  3HVW A;  1WG4 A;  3ZZP A;  3SFU A;  1KVJ A;  3MFH A;  4OYM A;  4Y00 A;  4N56 A;  2F8H A;  2KTQ A;  4WE1 B;  4FF1 A;  1GMU A;  5C5J A;  2IJR A;  4L74 A;  4DV5 F;  4IDK A;  4AXJ A;  4H54 A;  1FD8 A;  3TAM A;  3MUR P;  4IH5 A;  3TQE A;  2AJF E;  1UET A;  3MTJ A;  4LFA J;  2OP5 A;  2Z56 B;  5J1N A;  1RAD B;  2ACY A;  2XMW A;  2WZ1 A;  1IKX B;  4KO0 B;  3M8Q B;  3BS9 A;  3K57 A;  3TVK A;  1PBU A;  2E5H A;  4YFU A;  1B0V A;  2ERR A;  1I1G A;  3TAQ A;  2GMJ A;  4KSE B;  3BBB A;  4V19 J;  3PW4 A;  3MR6 A;  2RRA A;  2IRY A;  2Q1L A;  1TL1 A;  2ZEJ A;  4DL6 A;  1R8C A;  2A18 A;  4RBU A;  4RUH A;  5A8W B;  1F2G A;  1YBU A;  5DLF A;  2FY8 A;  5D4L A;  1ZTW A;  3QWP A;  1KVK A;  3I0R B;  4F2S A;  4WZM A;  1RBO B;  1X5P A;  1TL3 A;  3GON A;  3OPK A;  2XZT B;  4DPW A;  3CJ2 A;  1WHW A;  3UO0 A;  3W9I A;  3M2V B;  2X1A A;  1KOH A;  3CC2 S;  3KWM A;  3R3T A;  2W9C A;  3Q8V A;  3O6Q A;  1RTD B;  3VWS A;  4EMD A;  2CG4 A;  2WK4 A;  2ZZT A;  1S1X A;  5E3P A;  2BE7 D;  4DR6 J;  5DG8 A;  4A8W A;  1KOO A;  1FX4 A;  4QOT A;  2RB7 A;  1N5Q A;  2Z58 B;  3T5H A;  2VD3 A;  2RAQ A;  1Q8B A;  3N9U C;  2GZO A;  1S48 A;  5KFB A;  1QM9 A;  3NOC A;  5I3U A;  7AT1 B;  3NGR A;  3FC9 A;  2IM2 A;  3C15 B;  1S99 A;  1RSC A;  3N6L A;  2Z0G A;  1N6Q A;  2GJI A;  2HHU A;  2BKO A;  3U1N A;  3KMS A;  1NKC A;  1HQE A;  5F0U A;  1SV5 B;  2R42 A;  2V34 A;  1KQF B;  1KTV A;  2M8H A;  2OJ3 A;  4G1P A;  2DO4 A;  1UWA A;  2E1A A;  1P27 B;  2HBZ B;  1IR0 A;  1SJ4 P;  1T02 A;  3DOM A;  2HSE B;  5BYQ A;  3CCQ S;  3FMW A;  2PDA A;  3ILO A;  2CPX A;  3UWT A;  2QLF B;  4R5P A;  5A76 A;  2CQB A;  2CZ9 A;  3DYA B;  3Q8R B;  4ILL A;  2YNH B;  1RT2 B;  3EZ5 A;  1UWB B;  2OTL S;  2YKM A;  3NBP A;  5DZ6 A;  3K5N A;  3M8P B;  2KM8 C;  3H25 A;  3ZZO A;  1SJ3 P;  1HBU B;  1M5S A;  1N48 A;  1CG2 A;  3RB4 A;  4ZP9 A;  4NE9 C;  4J9M A;  2AJQ A;  3F56 A;  4K4S A;  3UFC X;  1JLF B;  5KFO A;  3B8H A;  4N7T A;  3H2U B;  4YHH F;  1RU2 A;  4TQS A;  1S1U A;  4AL7 A;  3RB6 A;  2FVS A;  1MWQ A;  2OEL A;  2EW9 A;  2JZ5 A;  3BBF A;  3MPW A;  1YI2 S;  2DNM A;  4FKX A;  4LR8 A;  2Y1L B;  3G87 A;  4DUZ F;  1FKP B;  2KL8 A;  1KR4 A;  2RH3 A;  1N5S A;  2ZM6 F;  4XPC A;  4FF2 A;  1WEL A;  2VPX B;  3C8Y A;  2MJU A;  1I94 F;  1KHV A;  2YQ3 A;  1R27 B;  1QAY A;  4EO8 A;  4NA2 A;  3RAM A;  1B3T A;  3NCR A;  1H0H B;  3KKF A;  4ZP8 A;  1Q7L B;  4TY8 A;  3HSG A;  2OPS A;  3B78 A;  1M1H A;  3SBM A;  3DGP B;  1NK4 A;  4R8U A;  3N6M A;  1BLU A;  3RBE A;  3I0R A;  2Q43 A;  3NCQ A;  4ZOS A;  2AYB A;  2W2O P;  5GAD U;  4PG6 A;  3DNC A;  2NSC A;  1KC8 T;  4IFV B;  2XI2 A;  2XGP A;  3D6H B;  2GX8 A;  3M2V A;  4J5O A;  3R9L A;  5FJ4 A;  3MM6 B;  3D5M A;  1CJV A;  4G1I A;  3EWG A;  2VBY A;  1OS5 A;  4W92 B;  3MMB A;  3DHW C;  3OTO F;  1RT3 B;  3QJJ A;  4C8L A;  1E6Y A;  2AGO A;  2XM3 A;  3GIM A;  2CJQ A;  1U1O A;  2BJ1 A;  5T41 A;  3LO3 A;  4FZV A;  5HSP A;  1QDU B;  1NZ8 A;  4QWA A;  2G1H A;  1YX2 A;  1XTZ A;  3I31 A;  2R7O A;  4U9R A;  4WKY A;  3C46 A;  3VTI A;  3CJ5 A;  3CUN A;  1UFL A;  4DUT A;  1UFW A;  3HHE A;  2I2Y A;  5IZH A;  2W2Q P;  5B08 A;  1G3O A;  1YSJ A;  1AFI A;  1P9Q C;  4FYD A;  3MPV A;  1WSR A;  3NGT A;  2FJV A;  3CB4 A;  1WOP A;  4QW9 A;  4LJM A;  1IWG A;  4NEY A;  1JIH A;  4QBU A;  3D1O A;  4ZVO B;  4DX5 A;  3Q24 A;  2F9D A;  2OAU A;  2KYX A;  1WC3 A;  2XUL A;  2QLW A;  1NCL A;  2U1A A;  1CEZ A;  2DTJ A;  3EXY A;  2QLX A;  4ECZ A;  3L7O A;  3KNA A;  4IRD A;  4A48 A;  5L38 A;  3TQ1 A;  3DMJ A;  2L08 A;  3FRZ A;  4ZPB A;  3TVY A;  2W24 A;  4C0B A;  3TZX A;  4HHH A;  1MML A;  1RT7 A;  1ZPW X;  4CH1 A;  5KG0 A;  3KK1 B;  3AOA A;  1NLK L;  1ZM3 A;  4DG1 B;  3M9O B;  1JLG B;  4CIO A;  2DHA A;  3UQS A;  1T7P A;  2CDQ A;  4P73 A;  4KRW A;  2LCW A;  4ED8 A;  1PC5 A;  3EGW B;  1SL2 A;  2XO7 A;  2HHS A;  4ENO A;  3QRQ A;  2MZQ A;  3K7R A;  1RAG B;  2BE2 A;  3V81 B;  2ZBC A;  5HN0 A;  5KOW A;  2CNL B;  5H9E J;  4YY3 J;  1RWV B;  4K50 A;  4X66 J;  5FDL B;  2WB1 D;  1JKH B;  1O5J A;  5HK4 A;  5F8L A;  3RAX A;  1FRJ A;  4QPX A;  8ATC B;  3RW6 A;  4U95 A;  4M5D B;  2NXJ A;  2LFV A;  4HKQ A;  2G0J A;  1BXN A;  5K8N A;  4I6Y A;  4DL2 A;  3VVT A;  1RAI B;  4RW4 A;  3THT A;  1FJG F;  2BYC A;  2WSC C;  2LQJ A;  2ZH8 A;  3SIP B;  2N82 B;  2HBR B;  4WCE Q;  3K5O A;  3CD6 S;  4G1Q A;  2ZKU A;  1HA1 A;  4K2X A;  1U1N A;  1D1U A;  1FRK A;  3EX7 B;  1SQE A;  4J9K A;  2XCP A;  1IBL J;  3DLK B;  2CJA A;  3M2U A;  3PW5 A;  2P2C B;  5AXM A;  2XQC A;  3ONQ A;  2EC0 A;  3FBE A;  3JTO A;  2C2R A;  1QVG R;  3EJM A;  5C25 B;  1N32 J;  1NJZ A;  1Y0H A;  4U8V A;  2OSR A;  2ILY A;  2W7P A;  4OX9 J;  1KEK A;  1NHK L;  4CLY A;  1M0S A;  4NLW A;  4I7F B;  5LMU F;  2JEG A;  1UJ6 A;  3UDC A;  1NME B;  1NND A;  4WU3 A;  3OSN A;  4ZCI A;  3PYE A;  4IG3 A;  4CH7 A;  1VIX A;  1O51 A;  3K58 A;  5A8K B;  2AEM A;  3F73 A;  4B02 A;  5HJX A;  5DRK A;  1S49 A;  2LLZ A;  1W7W A;  5IT9 Y;  1U2F A;  4UOH A;  4LR9 A;  1X4H A;  3FEY B;  2ADC A;  3THP A;  2ILZ A;  4H4M A;  3CPW R;  2RS2 A;  3IRX A;  3DDN A;  4ZCL A;  4P75 A;  4FS1 A;  4PUO A;  4F26 A;  2YVS A;  3P96 A;  3QIP B;  3H4D A;  4DV3 F;  3VZI A;  1N56 A;  1C0T B;  1Q79 A;  3G6Y A;  4NAS A;  5AJ3 J;  2J8A A;  3MM7 B;  2QV6 A;  2XNR A;  4P2S A;  2JL9 A;  3EDQ B;  3CMA S;  1FKO B;  4F8R A;  2RHQ B;  4O23 A;  1S97 A;  1U1P A;  1X0F A;  2HVI A;  2C3O A;  1N8R T;  4IO1 A;  3KLH A;  1F5C A;  5J2Q B;  1S59 A;  3RAQ A;  3LP1 A;  1RXO B;  1QTN B;  3IS9 B;  4LRD A;  3OJS A;  1O6X A;  1P1L A;  3M8R A;  2FUG 9;  1K9M T;  3H59 A;  4NOH A;  2QLB B;  4KY3 A;  3TEH B;  1WD6 A;  5LOQ A;  4LSN B;  2O3D A;  3BQ1 A;  2D41 A;  1Y00 A;  2N3L A;  1EAR A;  2X1B A;  1OO0 B;  3UCZ P;  3HHL D;  5B0F A;  3R2C J;  2EFO A;  3WIV A;  2E5L J;  4KFB B;  1KVI A;  2J7W A;  2XLI A;  1S1V A;  1X4D A;  4BC9 A;  1FFW B;  3G8T A;  1H6K X;  4NLR A;  1CS4 A;  2YWG A;  4PG5 A;  3FSY A;  3MXH P;  2DIU A;  2E7X A;  2AZ3 A;  4R0E A;  2BOP A;  5CXT A;  2FJW A;  1LXN A;  2WOM B;  3HHD A;  3FBB A;  2MLY A;  3H4B A;  1HBN B;  5DM7 Q;  2GAH C;  2Y8W A;  2J6U A;  3CCS S;  4CT8 A;  3MMC B;  3MGJ A;  2JDJ A;  4M5D A;  2UXC F;  1UJ5 A;  3BGF A;  5GAH U;  3CWJ A;  5IM0 B;  3FCV A;  2BJ8 A;  1I6J A;  1GMW A;  1IKV B;  1HD0 A;  4M5J A;  2F65 A;  3TNV A;  2QLJ B;  4YB6 A;  3QZ7 A;  3GV7 B;  1C4A A;  5ITH A;  1OY9 A;  4E98 A;  1YBA A;  3GR0 A;  3IXQ A;  5HQM A;  5LL6 d;  3NS6 A;  5E3Q A;  1TK0 A;  1U1Q A;  2RE1 A;  4LQ3 A;  1RT5 B;  3L9Z A;  1T03 A;  4FXD A;  3QMQ A;  2O66 A;  4CO5 A;  4OJ3 A;  1MN9 A;  2FC9 A;  3HSZ A;  5M2R A;  3IR7 B;  3G4S S;  2Z8Q A;  1B70 B;  2Y9H A;  2XMJ A;  2LEA A;  3PW0 A;  3CCW A;  4OHV A;  1EET B;  2RIJ A;  4KV8 B;  4RW9 A;  1UZD A;  2XLK A;  2K3I A;  4RW7 B;  4DV4 J;  1HW9 A;  5F9L A;  3JAM U;  1OJ4 A;  2MKS A;  4HHU A;  3OR1 A;  2FJX A;  5D0E A;  3KYL A;  2IAJ B;  2JEI A;  2N7C A;  3EMT A;  1FEE A;  3VAM A;  3PY8 A;  3WHI A;  5JXS A;  1N52 B;  5D0H A;  1DQ8 A;  3NP5 A;  4OJ1 A;  3DLG A;  1V3Z A;  2XY6 A;  3UNG C;  1RTJ B;  3OFG A;  2E1P A;  4A8F A;  3TYT A;  1NEE A;  3IG1 A;  5EUH A;  2YQ0 A;  2YKN B;  3PX0 A;  1LKZ A;  4DQS A;  3V4M A;  4OZL A;  3LGN A;  4E2F B;  3TVZ A;  2XNQ A;  2UUA J;  5CAB A;  3HHL B;  2VUG A;  2ZJQ Q;  3CTR A;  2BQU A;  5H9F J;  2FZC B;  4I2Q A;  3D3C J;  5J2M B;  3BR8 A;  3TZZ A;  2PGC A;  3W65 A;  1TKX B;  1Z1Z A;  4DF4 A;  3B6B A;  3EXC X;  4X84 A;  1RWU A;  4DSF A;  1PGZ A;  1FF2 A;  2XHC A;  3ITH B;  3IBC B;  3C3L A;  2DR5 A;  1XJW B;  1SC4 B;  2VOP A;  2QZ8 A;  1VQ6 S;  3B82 A;  2LQ5 A;  4URS A;  3MED B;  3CSK A;  5K8P A;  1M90 T;  4DR7 J;  1H73 A;  2GVD B;  1VQ5 S;  1QY7 A;  1FI4 A;  4DV6 J;  2ZDP A;  3WQP A;  1RAA B;  4I64 A;  4J9P A;  4HR2 A;  3K0J A;  1DHM A;  1HD1 A;  2W01 A;  2ACM A;  2E1M C;  3RRH A;  3T5K A;  2E66 A;  1JB0 C;  4F50 A;  3T6J A;  3E2E A;  2CNK B;  4ELU A;  1N33 J;  5J2N B;  2LXI A;  9RUB A;  2JEF A;  2H9Z A;  2SXL A;  2P6T A;  3KJQ B;  5JVG Q;  5B09 A;  2RQM A;  3OHB A;  2C2Z B;  2NXE A;  3LF0 A;  1Y9O A;  1FXD A;  4CDI A;  1SXL A;  1UCN A;  1LW2 A;  2W7A A;  1HBN A;  3H8Y A;  4DX8 H;  2DY9 A;  3I9V 9;  1NDC A;  1CJK A;  2VU5 A;  1FES A;  2UVU A;  3CJ3 A;  4LRA A;  5JMN A;  3MEG A;  3DDI A;  2OEK A;  2HBQ B;  1VBY A;  2MKJ A;  4USJ C;  3IAS 9;  3G9C A;  1RGV A;  2B7C B;  3WX4 A;  2PEH A;  4CNZ A;  3VGS A;  2XWY A;  3J81 Y;  1HI8 A;  3W5X A;  1EQM A;  3EDR B;  3P5B P;  4TXS A;  1DLO B;  1CJU B;  2EWH A;  2DRD A;  5M2P A;  5IXU A;  2V8G A;  4IR9 A;  4DN0 A;  2YX7 A;  4OLP A;  1WOR A;  1RHJ B;  4C7Q A;  4YQW A;  2UXD F;  4P10 A;  3I5C A;  3L7P A;  3CD0 A;  5L9N A;  1HMV A;  3A3O B;  3SSR A;  2F4V J;  2DNO A;  1RBA A;  2RJZ A;  1AZS B;  2EEY A;  1ZM9 A;  3BGR A;  4RU2 A;  1Q1K A;  2HLU A;  2A1B A;  1VQL S;  1T9V A;  1OY6 A;  1NK7 A;  3TEG A;  5DDR C;  1KFS A;  4GVL A;  5HL7 Q;  3THV A;  1XEZ A;  2I8E A;  4ZVT B;  2IIH A;  4PPZ A;  1LV5 A;  5C24 B;  2J8S A;  2UVV A;  4LF6 F;  2JC0 A;  2GO9 A;  3O8W A;  4MJK A;  1U49 A;  3PIP Q;  3O2I A;  2QFJ A;  3CCU S;  2EXU A;  3EZO A;  4YME A;  1R8P A;  1TV6 A;  1WNE A;  3EIC A;  3H20 A;  1LWC B;  3TZY A;  4F3M A;  3LP0 B;  2J9D E;  4ZLL A;  5D4N A;  3OXG A;  4UF4 A;  1T9Y A;  2HQF A;  3JTN A;  2ASJ A;  4BS2 A;  5KFS A;  1HR0 J;  1DTT A;  4FKY A;  3BKU A;  1HLW A;  4LFB F;  1H2U X;  3C14 A;  3TAR A;  1LWE A;  1ZA2 B;  3NAI A;  4JI4 F;  3OT9 A;  2HQI A;  2XMK A;  2HRY A;  4Y3C A;  3HKW A;  5KG6 A;  4JV5 F;  2BAC A;  2PA8 D;  2RSQ A;  1C1C A;  1SC1 B;  1SCJ B;  1A6L A;  1Q7Y T;  2FJE B;  3A13 A;  3OLA A;  5HRO A;  4PWU A;  4XPE A;  2FLL A;  3EE3 A;  4M94 A;  3EYZ A;  3CCV S;  3QSY B;  3PFO A;  1HBM A;  2GML A;  2O67 A;  5E33 A;  7FDR A;  1KHW A;  3EM1 A;  1WTB A;  3GV8 B;  5KFR A;  3MOJ B;  3LAN A;  2I0X A;  4Y6I A;  4KHP J; 
#chains in the Genus database with same CATH homology
 4CRJ A;  1RTZ A;  4M5J A;  3UD5 A;  2F65 A;  5ETL A;  1CBK A;  3HSJ A;  3KUG A;  1F9H A;  3KUE A;  4M5G A;  5ETT A;  1RAO A;  1RB0 A;  3ILJ A;  5ETM A;  5ETV A;  3ILO A;  4M5L A;  4PZV A;  1EQ0 A;  1RU2 A;  3UDE A;  3HD2 A;  5ETQ A;  3ILI A;  4CYU A;  4F7V A;  4M5M A;  3HD1 A;  3UDV A;  3HSG A;  3KUH A;  3MCM A;  3HSZ A;  3QBC A;  1Q0N A;  2F63 A;  2QX0 A;  3HSD A;  3MCN A;  5ETK A;  4M5K A;  5ETO A;  1IM6 A;  3HCX A;  1EQM A;  5ETR A;  4M5N A;  5ETS A;  3HT0 A;  1TMM A;  4CWB A;  3ILL A;  1HQ2 A;  2BMB A;  1EX8 A;  3MCO A;  1RU1 A;  1G4C A;  4AD6 A;  4M5I A;  2CG8 A;  1HKA A;  3IP0 A;  4CYU B;  5ETN A;  1DY3 A;  5ETP A;  1KBR A;  4M5H A;  1TMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...