4M5IA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 45
structure length 159
sequence length 159
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5iA00
1Q0NA 5ETOA 1RU2A 3UD5A 1TMMA 1F9HA 3ILJA 5ETSA 1RU1A 3HSJA 5ETKA 3UDEA 3QBCA 3UDVA 2F65A 3HSZA 3KUEA 4M5LA 3HSDA 4PZVA 3HD1A 1CBKA 4M5NA 1HKAA 4CRJA 5ETRA 1G4CA 1EQ0A 4M5MA 1EQMA 3HSGA 3KUGA 3IP0A 3KUHA 3MCNA 1KBRA 2BMBA 4M5KA 4M5GA 4AD6A 3HCXA 1DY3A 3MCMA 4CYUB 1RTZA 4CWBA 1RB0A 1HQ2A 3ILOA 5ETNA 4CYUA 4M5IA 3HT0A 5ETLA 3ILLA 3HD2A 4M5JA 2QX0A 1EX8A 3MCOA 1IM6A 5ETTA 5ETMA 5ETPA 5ETQA 5ETVA 4F7VA 2CG8A 3ILIA 1TMJA 1RAOA 2F63A 4M5HA
chains in the Genus database with same CATH superfamily
4PQUA 3DGPA 4FVCA 2VPZB 2KN4A 4NYZA 3RYLA 2FHMA 2M9KA 1S6QA 1T03B 1LXJA 4QU6A 3JQKA 1M1GA 3G96A 4X4SA 2XQCA 2B9XA 1KLMB 1QM9A 3CJ5A 2G9OA 3GIJA 2DHSA 3MWBA 2LQBA 2I5JB 2GV1A 3Q8QB 4ILMA 3GJTB 1T9UA 5J2MB 1HWUA 3IM8A 2XS7A 2Z57B 4Y28C 2X51A 4ANDA 5IC4B 4L75A 4B9UA 1KLNA 1BGXT 2ILYA 5HI7A 2ZH1A 1UCNA 5I4MA 3OLBA 4DV6J 1S0MA 1EZZB 1REGX 4LT6A 2VC1A 2X3DA 3K8VA 2C2ZB 2N4DA 4YB1P 2ZH4A 3DLKB 1HYSB 4XO0A 3GZ7A 2MKJA 5KFGA 1GK8A 1U1OA 3CW2C 2LKZA 1F5CA 5ETKA 1DRZA 3N28A 3HSZA 2DIUA 2RDJA 4E98A 4NA1A 1FKPB 1S97A 4KT0C 3D54A 4P2SA 3NMAA 2DNKA 1KQKA 3R3TA 5EX0A 3OXFA 5THWA 1FCAA 5LSOA 2ACMA 3J7AN 3DLBA 1EP4A 2HGNA 2DITA 2IY5B 3M8ZA 2AIRB 4IOAQ 2D9OA 2OPRA 2CJ9A 3FVYA 4LF9F 1VQMS 4KHMA 4DV2J 1HNXJ 2DBBA 2CAJA 5KFRA 4WP9A 2W4PA 4ELTA 5IWAJ 1Y3KA 1NPKA 2RVJA 5DLGA 4MAKA 2MGZB 2HFNA 4NXMF 5HBMB 3TR5A 3MI7X 3BDPA 2KRBA 1KFDA 3UR0A 5EDWA 2AW0A 1HI1A 3PW0A 1RT4A 4P73A 1YJWS 3C6UB 1N34F 2RMLA 1B7FA 4YMEA 3HSDA 2V5HG 2EXUA 3R5BA 1KTQA 2KM8B 1YI2S 3PYDA 4AD6A 2MY7A 3KWMA 3QAUA 5IV4A 3HD2A 1T05B 2FJEB 5SZTA 2HZAA 2Y9HA 4ZA1A 3GP9A 5GAGU 2Y1JA 5A0YA 3OL8A 2VOOA 4IFVA 2BEFA 1M0SA 3K5LA 3MFHA 2UUAF 1U1KA 3ZTQA 3W60A 4RUBA 2HPUA 3FSXA 5B08A 1CBKA 4LREA 2E1RA 5HQLA 3BSNA 5DGAA 4DL7A 1NM2A 1UJ5A 4GRSA 4CNZA 2VPWB 4LFBJ 1MLAA 2R7XA 4DR1J 3F73A 1HLWA 5F8LA 2QIFA 1U1QA 3UN5A 3DOMA 4ILRA 5A8KB 3BKUA 3GTYX 1G3OA 3KK2A 3V81A 2LEPA 1KS2A 1LEOA 5A8RB 4CP5A 4HH0A 1VLYA 1RTIB 3KJQB 2GMHA 3HP6A 3CDUA 4RBUA 5CYMB 3EX7B 3DCAA 4ZIWA 3TNVA 1WORA 1UA1A 2ZH2A 4M5JA 2EFQA 3H8YA 1Q0NA 2R7OA 3W64A 3WIVA 4YY3F 3PVXA 3TW0A 2E1CA 3C66A 4DUZF 1Q81T 3QIPB 1U1PA 2BZ2A 1G6BA 4RNHA 5DETA 2OEMA 1LWCA 1M1HA 5RUBA 1S77D 1T95A 3PW7A 1FNXH 2AU0A 3QNWB 5M2UA 1UWAA 4Y2CA 2IYIA 2MKSA 2D7SA 1KBRA 3R7BB 2V0NA 3GIIA 5GAHU 3BZQA 5L8RC 4KO0B 2V8PA 1FNMA 1JLGB 3C14A 1FKOA 3P5TL 2B6AA 4N8OA 1OMSA 4K4YA 3NGTA 5KT5A 2XGQA 2I6WA 1G4CA 5KTQA 3H2VE 3GU0A 4B3TF 3PEHA 4OYIA 3AB4B 1RYRA 3JTOA 1Q53A 4O44B 3LANA 1FESA 2BVZA 2IRYA 3FC9A 4EBDA 1RT3B 1MW7A 1P9YA 4CNYA 2BANB 2ADCA 2RU9A 4LSNB 1X5TA 3DXBA 2LXIA 1RACB 3MEDB 4ECYA 4LRAA 1YK9A 4UY85 7AT1B 4QW9A 5HVFA 2ERRA 1RGVA 4LF9J 3SFUA 1HR0F 3X1LB 2QV6A 2EKNA 4OI0A 2BJ3A 2V63A 1VQNS 1LWFB 2HHQA 2HZCA 5B0BA 2FLLA 4NXMJ 1HNIA 1U25A 1HD1A 4I2QB 4ZVTB 5JVGQ 1N36F 2MMYA 3IR6B 1WKLA 3ENQA 4MTPA 1YIJS 1SC1B 2ATLA 1JK9B 2ZDPA 3PKYA 1SL1A 4OI2A 2NS1B 5E3QA 2KDOA 1BMQB 2XMMA 1UJ4A 1N34J 1CVJA 1IKYA 3ZNJ1 3GSIA 1JLAB 3SQGB 3RGIA 1BQNA 2AEFA 3BPSP 3MGJA 3J7Z5 1OPZA 5EWGA 1X9WA 1S9GA 3BO2A 3VAIA 2AD9A 3MAQA 4Y2IA 4O4GA 5KFIA 1GTEA 4CYUA 1OY6A 4NE9C 3O6QA 1RAEB 4WK1A 4ZCKA 2CQ0A 2UUAJ 4B9TA 5KFUA 2DGWA 3ZC4A 4ZN1A 3N6LA 5L39A 4OZ5A 4OX9F 3Q2TC 3Q8UA 1SIZA 1NZAA 4A48A 2AV5A 2MQNA 4AYBD 1YSJA 1RAFB 2W1BA 3SZ2A 3KKFA 2FHOB 3IXQA 1HPZB 2YPZA 4M8LA 4DSKA 1KHVA 2QGFB 5EUHA 1GQEA 3CD6S 2HHUA 3NBPB 2DTJA 2KB2A 1FJGF 3N79A 4RX6A 5KFBA 3PRDA 3G6YA 1YTYA 1SJFA 1F5AA 2M2BA 4ID8A 4CIOA 2GVDA 5F3ZA 8ATCB 3NGKA 3W62A 3BREA 2MZRA 5ETSA 2MHNA 3FCHA 2RHSB 2HRTA 4OHXA 3D67A 4K2JA 3VZHA 1NUEA 4CT9A 2YNHB 4X4RA 1PBAA 4ECZA 1MROA 5I3UA 1PAUB 3EGNA 2JX2A 1GXUA 1VQ7S 1Q8BA 3T9NA 4Q44A 4QYZJ 4QR2A 1FF2A 2WVBA 3CJSA 4B3RF 3D0HE 1IR2A 3QGIA 3MFIA 5HK4A 3D6MB 1SXLA 2B5JA 4I68A 4DS5A 3HDSA 2FTRA 5T41A 3DU6A 4MKAA 4WFAQ 5DGBA 1U2CA 2IM3A 2KT2A 4WE1B 1MN9A 3N9UC 5IC6B 4B3TJ 3W2WB 2B8QA 2QZ8A 1T7PA 1VRTB 3LPYA 3PCOB 5A2QY 3D7SB 3FK4A 1M5PC 5D6GA 4K4WA 4IDKA 3EVWA 2H51B 3OXGA 1GH8A 2B9YA 5C5JA 4O3NA 3DDNA 4NLYA 4FXWA 3MM5A 3RTVA 1I51B 4U6PA 4FF4A 5H9FK 4KH1B 3H98A 5ETPA 4B9NA 4A46A 4AL6A 3OR1A 4ZVSB 4G1QA 4OZ3A 3CVKA 1RWMB 1J2VA 1RTHB 3DMJB 2QSFA 3QFHA 2UP1A 2CPYA 2YX7A 1K44A 2KFNA 3NRBA 1FWLA 4UY8T 4LMZA 3PJXA 1SIWB 5KG2A 5DZ7A 3W66A 2EBGA 1V5VA 2ZKUA 1RCXB 2CQ4A 3LP2A 3AAWB 2DR6A 2J7WA 4AT1B 1WEXA 2VC0A 3Q0AA 2NYHA 1CJKB 2G0CA 4NL5A 4CLKA 2KT3A 1N52B 3CCSS 1N36J 2XS2A 4GC6A 1IBLJ 4TLQA 4RW8A 4FYDA 4LRDA 4KE5A 2FIUA 1KKHA 1RXOB 4MIWA 3Q22A 2VBYA 3EICA 4CI0B 4USMA 3J7ZT 4QWDA 2M4MA 4NZ6A 4JI0J 4WIQA 4QIFA 4P2MA 3CDEA 1Y11A 1X9SA 4DV7F 2XBPA 4DV0J 2F9JA 2V6AA 2ZH8A 4LF8F 1WSRA 2F7VA 3T5KA 2DPIA 4XTTA 4OJ3A 4TQRA 1ZM2A 3RUBL 1SC4B 3QGGA 5B7WA 4ZPAA 3VVTA 1Z4UA 2DYAA 1EQ0A 1KD1T 1IXKA 2L9NA 4NLGA 5KFYA 2WOMA 4OX8A 3HZEA 4PG5A 4S0MA 3CMQA 3KYLA 4O4RA 2ZBQA 4LSLA 2FPHX 1NLKL 1C1CA 2WVDA 5J1PA 4QCLA 1PJ6A 3RW7A 2B4UA 2XO7A 2YKOA 2H4YB 2GJ2A 5IT9U 1DTTB 3MR6A 4X62F 2EI5A 4URSA 3IC1A 3B4DA 1S1UB 4A8SA 2J6UA 3AXMA 1WACA 3B54A 4C9DA 3G82A 2GIFA 2NUHA 3PYEA 2WONB 4X4NA 2GVZB 3M1VA 1LFWA 2EFVA 1YBTA 5FLXY 2IM1A 1KONA 3OLAA 2XGPA 4LQ9A 3DM2A 2V2KA 1GX6A 4IKAA 4RO0A 1C0TA 3B6BA 3ICLA 2FGCA 5G0RB 4EBEA 4O3OA 3RRHA 2NPFA 1IN0A 4JP8A 2LU2A 1N5TA 2V4QA 1D1UA 2BW7A 2QMXA 4HEA9 3QRRA 1TUVA 2NSCA 1SUQA 1ZS6A 2MB0B 4GO5X 2VFUA 3EDRB 1QY7A 4Y6IA 2MZTA 1EQMA 2DPJA 4M5KA 1HBMA 2BM0A 4G65A 1FDAA 3TA0A 2KTQA 2ZD1B 4XDDA 4ICLA 3JSRA 4M5GA 4DQPA 4CLLA 2DRDA 5F3TA 3MR7A 2GHPA 3O2IA 2DXFA 3TOQA 2XMVA 3DGVA 4P7VA 5L9NA 3D5MA 3RJMB 2XCAA 4J7CA 1HI8A 1L5UA 2HHXA 3LP0B 3TAPA 1R8HA 4DLEA 1SKSA 1N33J 1WF0A 2FZKB 4OI4A 4OV1A 3WQPA 1VFJA 2CJXB 2M7SA 1WNEA 3NS6A 1ZZFA 3BSAA 2VJUA 3RB6A 3HSJA 2BR0A 2MKKA 3VHQA 3AT1B 3HVTA 4C0HA 2HVIA 4DX5A 3S1TA 4RUHA 1RAAB 2C28A 1RISA 4QQBA 5LXYA 5DM6Q 1A9NB 3BQ1A 1S1VA 1FRKA 1X5OA 4UOCA 5SUHA 4O3PA 2YNIA 2XHWA 4LF6F 3NG8A 2A2DA 2CZ4A 4OI1A 2MEWA 2NCKL 4DX6A 1RP5A 5BXIA 4JI4F 1TKXA 4HDHA 4WP3A 4NMXA 5CA5A 3D4JA 4ZP6A 4WTOB 3ZZRA 3D0IE 4OZNA 2JSXA 4P9SA 4RPFA 3TZWA 2EC0A 1FRHA 4HR2A 3E3XA 4USUA 4DV1F 2EFPA 1TMMA 3NEKA 5HROB 3DLHA 4DV7J 2R2UA 3Q8SB 3MMJA 3M05A 3VAMA 1XC9A 4LF4J 2XSJB 4ZVRB 3OVAA 1TV6B 4P2XA 5KFQA 1RI7A 3CE8A 5F8GA 2F4VF 4X65J 4K0KF 3HLUA 4R5PB 3PTWA 3OHBA 1OWXA 2UXDJ 3BYPA 1UVMA 3WBZA 3OTCA 3QJJA 1KR4A 1N0UA 1VC6A 1KN6A 3JAMY 2IA6A 2XZWA 4M5MA 5KFXA 5KT2A 2JFDA 3LP1B 1U6ZA 5KFJA 3CJRA 1OY9A 3QRQA 4X64J 2RU3A 2FDNA 3HJVA 3QZ7A 3F56A 1FO1A 3KUEA 2QLJB 2B3TB 4QYRA 4BLGA 5M2RA 4F2RA 4RU9A 3DOLB 3RAXA 2KFYA 5J2PA 5CXTA 1FE0A 2QMUB 2RDIA 2K1RA 2KO1A 1T8EA 3EXCX 1DQAA 2NXCA 1F2HA 2YPYA 2IRXA 2LYVA 2UXCF 2AP6A 3HKZD 1RHUB 3CMES 3BPDA 3BJYA 5HQMA 3VAHA 2RAQA 1PCAA 4YOEA 2KH9A 1RJJA 2FY1A 2MJNA 3UW1A 2ZNZA 3M6XA 4DF4A 1K8AT 3FFIA 5EWFA 2ZHBA 3OL7A 1S9EB 1RSCA 2DNGA 4DDFA 3OJSA 4F4KA 4DQRA 2AX1A 2CXEA 2OMLA 3CMAS 3V6DB 1XTZA 3EYZA 1NEEA 1DQ8A 1T03A 2M8DB 3I31A 3KUHA 4DCJB 4PPDA 2BRKA 1NDPA 1TL4A 2HAIA 5IOLA 2CYYA 3F44A 3ELHA 3MOJB 2GO9A 4Z37A 2I5JA 1QSLA 5J2MA 3GG0A 3MTKA 3P45B 1Y4ZB 2F8EX 1CC7A 2K8GA 3GIKA 1NK7A 1NU4A 4WU3A 2IAJB 4DR2F 2WK4A 2UUBF 1T3OA 4RW6B 2EVZA 1TKZB 3QSYB 3CSKA 5ETRA 4P74A 1JLBB 1PYOB 2FY8A 3DLKA 1JJ2R 1HYSA 2DR7A 4K4TA 4ZVQB 4NPOA 2W9CA 5KFTA 2J8AA 4B3MJ 1I1GA 3M6VA 4GVBA 1AT1B 4ANCA 2WW8A 4KQZA 3WX4A 2CFXA 3PX6A 1B0TA 2APOA 3SSRA 1FI4A 3GFHA 4KRWA 4CT8A 1T9TA 2V8HA 4Q2LA 2HWIA 3HVWA 2JLEA 4WCEQ 5IXUA 2YNFB 4LF6J 2BM1A 4C8MA 4BC7A 4LJMA 2Z2MA 5E3RA 4J9LA 4WZQA 2XLJA 1B0PA 4DL4A 1IKXB 2H5IB 2MGZA 2LXUA 4F4XA 1F0XA 2BJEA 2BQUA 3PZPA 2JRSA 3LH2S 5D3GB 2IM2A 1OJ4A 3QATA 1TAQA 4FKYA 4A4JA 1HNVB 3MUTP 3C6UA 2XI2A 3Q8VA 2BBEA 3KK3B 2C42A 2YTCA 1U24A 3DLGB 1S6PB 3DC2A 3K58A 3R1HA 1UP1A 1X4AA 4IR1A 5A8WA 2MQLA 2F4VJ 1T05A 3AD9C 4K0KJ 4C3LA 1SKWA 3O3LA 5B09A 3L09A 3SDEA 5E3PA 2WSFC 2AJQA 4RNMA 2XSFA 3M2UB 2W9BB 1XERA 4RBVA 3G6VA 4MKYA 1RK8A 4KPCA 1NAQA 3VVUA 2IJFA 2J9DE 1YJRA 2OD6A 4IG3B 1MSWD 3JQMA 3QT7A 1AA1B 1VJQA 1M1KT 3UD5A 1SH3A 4WWSA 5AXKA 4YR3A 2HQIA 2KXNB 2UXBJ 4P52A 1NB2A 3ZZPA 3EPGA 1AROP 3MM6B 2NUUG 3BB5A 2VFRA 2FJAB 3V6HA 2BQRA 5EN1A 5A8KA 2HIQA 2VKZG 3HD1A 2KHCA 2PEBA 5A8RA 1RTIA 5CYMA 3KJFB 3HULA 2HAFA 4F3QA 2J0QD 1C4AA 2E5LJ 3OFGA 2W7AA 3BH6B 4PG6A 2V4JA 4DJBA 1L3SA 3VCDA 3QIPA 2QJ3A 3NCQA 1VIOA 2VFSA 1D8YA 3DRYA 1YJ7A 1RA7A 1NHVA 5LJ5Y 4E2FB 2R2RA 1Y5NB 5H9FJ 1PGZA 2BKNA 3BR8A 2OEJA 4LFCF 1JLEB 2H9ZA 2KI2A 1X5PA 2GGPB 2AJ4A 4KO0A 1FFGB 4LFAF 5KFNA 1JLGA 5CABA 1IKWB 1R0AB 1TR0A 1FK9B 3NCRA 3CCLS 1UKUA 1PJ5A 2XZTB 1CQNA 3IR7B 1NJZA 4Q43A 4AQYJ 1HBOB 3A13A 4FPRA 5HO4A 4USIA 3MAAB 2ZH3A 2P6TA 1U49A 3T41A 3ENVA 4O44A 3HPOA 1IBCB 2OPPB 1RT3A 1R3NA 1X5SA 3KLHB 4QW8A 1RWVB 4DSFA 1H98A 1WC4A 2ASYA 1H7WA 3CEDA 2BANA 3BS9A 1GTHA 1Y5LB 4KR0B 4C8KA 2HNDA 2BMBA 2GX8A 3QT5A 2L48A 1BWEA 3V4IB 1S48A 3MEDA 4J9RA 4C8ZA 4I6AA 4MIBA 1SBRA 2P6SA 1VQ6S 3DFEA 2PMWA 4TY9A 4GMKA 5F41A 3LGMA 1P9QC 2CRLA 4MKBA 5MAOA 5LJ3Y 5IT0A 1H0HB 2H1YA 5JJBA 2O1PA 1QUVA 1M5SA 1FX2A 1LWFA 1U02A 2B4VA 3R27A 2Q6CA 4ZVOB 3KFWX 4OYBA 3M8SA 2MDAA 4USTA 1UJ6A 3U27A 2CWKA 3GV8B 1A0OB 2PO4A 2DISA 3HMJG 4U7UD 2RT3A 5KAKA 2DH8A 4N77A 1RWKB 3W9JA 3E8OA 4DPTA 3K57A 4NRUA 1QJHA 2ZITA 3IN5A 2DK2A 3BGRB 2N3OA 2YWFA 4ZCLA 3QO9B 1JLAA 4KBIA 3BKFA 1UA0A 3OVSA 2B9EA 2FQQB 2FLNA 5DDPC 4G6VB 4C98A 5LMUJ 1KFSA 1U0HB 3CD7A 2Y0BB 3BBBA 4O3SA 5KG6A 1K1QA 4BC9A 2WTFA 1BC6A 3MR2A 3EPIA 4DCPB 2B8PA 2MSSA 3GFXA 2JLGA 3M8RA 5D4NA 1KTVA 2LQJA 5D77A 4UQGA 1JLFB 2J0WA 1L3UA 2OHDA 1AZSB 2DNZA 1G7CB 3ITHB 1NK4A 5ADZA 4MT1A 2K2PA 1HPZA 1FFWB 4ECXA 3T9ZA 1TVRB 1FRLA 4IOBA 4TQSA 2HHTA 1D0EA 2MQMA 4L76A 3NBPA 1O51A 1U7LA 2DGOA 2R8IA 3G4SS 2MQQA 2ROPA 1RTJA 3GR1A 1CS4B 3D3CJ 4KFBB 2QRRA 1RDRA 2OJ3A 1AXQA 2E44A 3K8WA 1NK0A 2G2YA 1FDDA 1YHQS 3CO0P 1D9AA 1FJCA 3JS9A 4IOCQ 2ZJPQ 4FBTA 3J80Y 2YNHA 3M8QB 4DBQA 1E6YB 4ZJLA 4Y2AA 2DGVA 3PRVA 4QPTA 3KG1A 4CLZA 4KGMA 2UZAA 1TFYA 1GXLA 1FE4A 3PDNA 2AHOB 4JI2F 1T3NA 2PFFB 4JV5J 2AF6A 2FJVA 4ZPTR 1XMOF 2WBRA 3D1HA 3QQCD 2W7PA 5HMYA 4DSLA 3C3LA 2C3OA 2ASDA 3KMSA 2W8KA 1R31A 2DJWA 1M5VC 2XI3A 1UFKA 1LW0B 2UVUA 4FP9A 1ICEB 4DMZA 2VDIA 3W2WA 1TZ0A 4FYXB 1WEZA 1VRTA 1F3VA 3DKDA 3NY0A 4URGA 1NK8A 3QJLA 1EX8A 5DM7Q 3RAQA 2ZH9A 4IR9A 1DLOB 1RAIB 4MFBB 4ZLPA 3LUYA 2C2EA 2J7KA 3RW6A 1VQ5S 5GAEU 3LOUA 2KVIA 2NXNA 1WC3A 4ED3A 4V19X 1S10A 4JI6F 1RHKB 4I69A 3IBFB 2MKIA 3KG4A 1HQUB 1RTHA 3ENWA 2B4OA 3NL0A 3DMJA 2CQDA 4RWXA 2VFTA 3H5SA 5KFHA 2WSEC 2AJFE 5IQQA 4Z7YA 1DQ9A 5KFOA 3P49B 4BCAA 3TEHB 1FVQA 2NYIA 1DAXA 2FJXA 1PILA 5IZHA 4IO1A 1NRKA 3PW5A 4AL7A 1CJKA 5H1SV 3WDOA 1TQLA 3CJQA 1HA1A 2DNPA 4KHPJ 1NNDA 4OLOA 1X9MA 2RD5C 5F8HA 3PNIA 4O0NA 4LIWA 3JTPA 2BOPA 1SL0A 4LIRA 4OHZA 3H4DA 1NJXA 1RA6A 4O23A 3KLFB 2XNQA 4ED4A 3CJ3A 1NSAA 1NSKL 3VGSA 2DNQA 3FDSA 2DY9A 4ETXA 2GJFA 2VQFF 4F0MA 1H73A 1RLCL 1R6VA 4MK7A 3C19A 2Z0GA 2KXHA 3MPWA 3C6TA 1FXLA 4C7QA 1D3WA 3T19A 3CJ8A 5LSLA 2HK2A 3I0SB 1F60B 4WJBA 4B17A 1F5BA 2LP4A 1RB0A 3CCZA 4J9KA 3M6WA 3TRGA 2HURA 1ZPWX 1VR6A 1RWPB 2RILA 1W2BR 3U1MA 3Q83A 1HL6A 2LFVA 2AEMA 2HLTA 4DV5F 5HLFB 2JC0A 5GMEA 5B0EA 3OSNA 3ZZYA 3FCVA 1HW9A 3MMBB 4GKKF 2MKHA 1DTTA 1LWXA 4CLTA 5HMXA 1S1UA 2AJ0A 3R7NB 5KFAA 4OX6A 4DR4F 2HZVA 4K5RA 5ETTA 1ZM4A 3FUYA 2WONA 1J5OB 2GVZA 4HTJA 2HSEB 4ZLJA 4R25A 4NEZA 3KOAA 2ZUGA 2H54B 4TY8A 4OYOA 2N7YA 2DGSA 1VQOS 1QSSA 2F9DA 5G0RA 2PFDA 4A8MP 1OSDA 3DDKA 4OYMA 4FXVA 4K4VA 3FQKA 5L46A 2MSTA 2D9PA 3AJ1A 3T5LA 2XY7A 2NZ4A 3MD1A 4UQTA 3LQVA 3CCVS 4FNIA 2IMWP 3FRYA 4JI5F 2NSBA 3TEGA 1MMLA 2N3LA 3UWTA 3SSQA 1R89A 3FSIA 1I94J 2XULA 4RUCA 1P8GA 2E7WA 2F4FA 4OI6A 3X3UA 2VQEF 3V2UC 4ZJQA 4ED5A 3W61A 1H2TZ 1C0UB 3CWJA 1CJVB 3FKBA 2ZNYA 4OHWA 3GE9A 4DV3J 3M9NB 2HFOA 5JVHQ 2HQDA 1UWBA 5K8NA 5ETOA 1YX2A 2MTLA 1HARA 2HKEA 1HQEB 4OZ0A 3H5UA 3LP0A 4QU7A 3PHEA 3T3FA 1Q4RA 3QAEA 4ZPVR 5E2QA 3O8WA 1H7XA 2IRUA 4J9UE 4I2PB 2CQPA 4P71A 1VK3A 2YWKA 3DHXA 3SYZA 5GADU 1RT5B 3A8KA 1I6JA 3HHLC 3PW4A 1YJNS 2R2SA 2AGOA 1NSPA 2HBRB 4LBPA 3M2VB 5HN0A 2HQCA 1HMVB 1U8SA 1RCOB 3MM8B 4Y3CA 3CGIA 1S49A 1OIAA 2IC3B 1N32J 5B0CA 2DCLA 2COLA 4DL6A 5ETMA 2OUGA 2ZWOA 1SPBP 4JB8B 4HT7A 2CUYA 2BKOA 2P9GA 5J2QB 5LSRA 4F4ZA 2DVIA 4W92B 1IKVA 4ECRA 5L1LA 1XWLA 4M5IA 5HANA 1CULB 2ZH6A 2C2RA 5FIIA 4M5HA 3POTB 2VBZA 4HTIA 2VBWA 5HROA 2DEIA 3EXYA 3MCMA 1R0BG 3HHKA 3KLIB 4FDFA 2ZUAA 4FN5A 3CCRS 4CLYA 3NAHA 4QYZK 1TK8A 1KQFB 2MY8A 3E01A 1RE1B 1TV6A 3RRKA 2DNHA 2JOQA 4F8RA 2D1CA 2MZSA 2E66A 3W1YC 1TL7B 3QYYA 2XO6A 4R5PA 1UEVA 3DGPB 4Q7AA 1IR1A 1XNRF 2JL9A 4K2XA 1SQFA 1S6QB 2DRBA 1FD8A 2HFVA 3PACA 3KJNB 3CCWA 4DV5J 4DPXA 3LP1A 1VBXA 5CZXA 2WW4A 3UCZP 2LA6A 4U8YA 4GVLA 5IQ6A 2BRLA 4JV1A 4GKKJ 2RDDA 1LWEA 3KLEA 1SJ4P 3GILA 4URQU 5F8JA 2YWEA 1TU0B 2J8SA 4ZLLA 3T5JA 5KFWA 4DR5J 2ZHOA 5KFZA 4DR4J 3TZZA 4ZP8A 1NBEB 1R27B 2RE1A 2W01A 4X2BA 1VQ8S 3JYTA 2RQKA 3H20A 4M94A 2Q66A 5A76A 3TI0A 1OO0B 3PJ9A 6FDRA 2YQ1A 2VB6A 1C2PA 4EFAC 2MYFA 2Y8WA 2QFIA 1XR7A 1V3RA 1S9EA 4YFUA 3CTRA 1XQIA 2VKRA 1VHIA 3I9ZA 3R97A 1SI9A 2BJ1A 2POKA 2PN6A 5DJBA 5KFPA 3TWZA 5GMDA 2XLKA 3V6DA 4MH8A 3EWGA 3C16B 4UOHA 2GMLA 4JI5J 3LPEA 8AT1B 4NYOA 1JJ4A 4LRBA 2L08A 2ZDOA 3JXOA 2CNLB 4I56A 1VQLS 3OPKA 1KOOA 4PAAA 4R8UB 2YQ0A 3I5AA 2DGTA 4NLTA 1UAWA 1BHNA 4ECQA 3K5MA 3CJKB 2Z2YB 3OTEA 2IAJA 3DOKB 2CQBA 4LF1A 4ES2A 4RW6A 1UVIA 4XIUA 4WBFA 4FF3A 1TKZA 1ZH5A 4WTYA 3FBCA 4KSEB 1CQMA 2CJBA 5AXMA 3M9OB 1NK6A 1SV5B 2AMCB 1JLBA 3R7SB 2PT0A 4B02A 3HFKA 2C3PA 2L41A 1X4HA 2IYGA 2OEKA 4DUTA 2IBKA 2ZWPA 2C3MA 4G1IA 2V4RA 1I3OB 4A8KA 3RRGA 1CEZA 3TVKA 3PV8A 5AJ3J 2R8GA 2BV3A 2WRMA 3S6EA 2LA4A 4KGKA 5CYQA 1NKCA 1Z2LA 4UZCA 2YNFA 3VAGA 4DL5A 2EEYA 3MR5A 2QLWA 2CQGA 5F0UA 4WXOA 9ATCB 2ALZA 5K14B 2XWXA 4ZVFA 2P2CB 3U1NA 4K4XA 4PG4A 3FNNA 4BWJA 1IKXA 3GCWP 1YRXA 3B8HA 5KT6A 3I0RB 1L3VA 1YZ6A 2IDLA 5D3GA 3A4TA 4L72B 3IAS9 1IBMJ 2LDIA 1IUJA 1S79A 2FHJA 2YKNB 2O01C 3EGWB 4LUBA 2NREA 3NGUA 3HSGA 3QT8A 3CJ4A 4KV8B 3PX0A 4DR6J 1S6PA 1NB7A 1OQ6A 4TU7A 3MMCA 1BE4A 1O8BA 5JXSA 1Q5VA 1XNRJ 4KYZA 2JFKA 3M2UA 2DIVA 4FS1A 4CLSA 3FRZA 3Q86A 4DR7F 5E0OA 1S6OA 1HWKA 2OO4A 2WSCC 1S7IA 5ETQA 4I7FB 1ZOTA 3SCLE 4KKOB 2HMIB 2XLIA 3L7OA 5F8NA 5H9EJ 2P8IA 2V94A 1HWJA 1TKTB 4C8YA 3ET6B 3MM6A 3H59A 4ES3A 3CC7S 3MEEB 5LMNF 2CPFA 4DFJA 2ZVSA 4ETZA 1PO6A 1WHVA 2QN6B 1KSPA 1NJIT 1BY9A 4A47A 3TAMB 2K7KA 3A3OB 3RB4A 4F67A 2VDHA 4IG0B 2D74B 4TLRA 4WK3A 1RBAA 2C3YA 3SV3A 4C8NA 4DFPA 1AFIA 4KGVB 2HNZB 4RW7B 3WC0A 1MMDA 4EI2A 4NXNJ 2HFUA 2CQIA 1JLEA 5L1JA 2ZVIA 1NMEB 2B43A 4PWUA 4XAKA 1U2RA 1IKWA 2A10A 1R0AA 4PCQA 4ED1A 2BJ8A 2QA4G 2E1AA 2LQ8A 1MWQA 4ALZA 1KC8T 4OV6A 2AYBA 1HBOA 4NASA 3OTBA 2F3JA 4J9MA 3I55S 2HQ3A 3MAAA 1F9HA 1P6TA 2MPUA 2VFVA 5KG0A 3OL9A 4FZVA 2X1BA 2V2QA 3CJTA 4Z2XA 4ZK7M 1IKYB 2VUGA 2OPPA 3TARA 3CDWA 5HMZA 3KLGB 1YQHA 2VIHA 1YDLA 3H0PA 2G0IA 2NLWA 2RF2B 1S59A 1S9GB 1VRUA 2DR9A 3BR9A 4L3KA 2ZJQQ 2E5HA 4NA3A 4CYUB 1WC0A 3BYRA 5EX3A 3V4IA 1HNWF 1ROFA 4JI7J 1TUWA 2DEJA 1S1TB 1TL3A 4CLUA 5GMKa 2A3JA 4NA2A 1YGYA 4I4BA 1U26A 1UL3A 1U6BA 3V4MA 2R7WA 4NCGB 3T1HF 2XTJP 4TKTA 2CWXA 5CAAA 3W8PA 1W26A 1YJTA 4U67Q 1N54B 4YP3A 4NLPA 2PMZD 2LEAA 4EU0A 4G3IA 2F5GA 2GVDB 2HFSA 4M5DA 4HVZA 4CH0S 3OBIA 1Q86T 2PIIA 1S72S 4PWDB 1WDTA 4P75A 2MLZA 4XPCA 3BGRA 1PC4A 2ZC3A 3RZAA 5DG8A 2MLXA 3QO9A 2CPJA 6FD1A 1K73T 3PEJA 1NK5A 1XR5A 4RW9B 1XJWB 4RLEA 4DQSA 3PHTA 4IH6A 3K89A 1U0HA 4A8OA 2OI2A 1MROB 1HIYA 2ZM6F 3G8QA 4IH7A 2HS4A 2CPIA 1ZA2B 1RTDB 3M4XA 1GAOA 2Q6BA 4CO4A 2BW2A 1JLFA 5C25B 3K5OA 4JBCA 2DR8A 5KOWA 5C42B 3HFZB 1AZSA 3H40A 3ITHA 3IGNA 3UCUP 1JLCB 3TUPA 1HNZF 3H90A 1F2GA 1MNEA 3N0VA 1TVRA 2YWWA 3PIPQ 3OTOF 4QOTA 5C2GA 3CCES 4N8NA 4CDIA 2KU7A 4PR6A 3J7YU 5BR8F 1RHJB 1VQPS 3OW2R 4F2SA 2PA3A 3JAMU 4ECWA 3I4PA 2DRAA 1O6XA 3UD3P 1JXVA 4QWEA 5E7OB 1LV5A 5KG5A 1WSVA 2BOAA 3B4MA 1AUDA 3LWLA 3ZO7A 1Q8LA 2C1EB 2XYHB 1ACMB 4F36A 1KOHA 1G2EA 2IHR1 4USJC 3I6PA 2W25A 2XMAA 4C8LA 4H4KA 2W2NP 1E6YA 3W5ZA 2ZFHA 3UDCA 2YKAA 3MM9B 1DARA 4RWWA 3I96A 1RBLA 4DL2A 2C3UA 2DKOB 3HX9A 2FJWA 1GNKA 4TYAA 2C2KB 3EE3A 4F04B 2X3GA 1BLUA 3I56S 4FS2A 5HVHA 2N7CA 4J5OA 3AB2B 4GKJF 4A8XA 2XZDB 3CXCR 5CD4A 3ZZOA 3ETOA 1KDNA 5DZ6A 1AUSL 1LW0A 3PX4A 1WKJA 2GQQA 4YR0A 1Z2ZA 2QTWA 4E8UA 2E9RX 4F4WA 2KT5A 4ZJOA 4RW8B 1ZAWA 3CPWR 4TVAB 4DL3A 1UVLA 1O0PA 4ZVHA 2YBVA 1IBKF 4CM0A 4OYZA 1JWWA 1DLOA 4MFBA 5HATA 2WVFA 6AT1B 2Z8QA 4LQ3A 1NZ8A 2W4CA 1I5OB 1VYAA 2LXFA 4OYAA 3TVZA 4OI3A 1F6TA 3OFHA 3MMAA 4IFYB 4Y2KA 3QWUA 1CC8A 3BSOA 2VL1A 1HNWJ 1HQUA 8RUCA 2PI4A 4RKUC 3AQPA 4YEAA 2RKIA 4YY3J 1OS5A 1S0VA 4CM2A 4K7QA 2XS5A 4DV4F 1QSYA 1JX4A 5IS2A 4FBUA 2ZBPA 4DUZJ 4WKYA 4F25A 4RR5A 5J2NB 1FRXA 4NLUA 2WOMB 4MIAA 1MU2A 1GX5A 3T1HJ 1MWZA 4I0WA 1ZPVA 2QG9B 3P96A 1C1CB 1DJ0A 3D3BJ 2GQ2A 3EZUA 3KXDA 2VV5A 4IH5A 1S5ZA 5BYQA 3VR1A 4B9VA 3KLFA 2M5YA 3C46A 2G1HA 4WIIA 1FJ7A 2J76E 3N5BA 5M2PA 3VGVA 3ZZTA 5KFVA 2MZJA 1ZAVA 3M1VB 3WHIA 2B0GA 3GONA 3BQ0A 3KJVB 4LF7F 1U2FA 1VBKA 3I0SA 3H7HB 4OZ1A 4LBIA 4UW2A 2ZM6J 2MQOA 3G71S 3ISNC 2XYGB 3IWXA 3H4BA 3DRSB 3J81Y 1RT1A 4P2FA 5FJ4A 5C7PA 5U47A 4RU2A 2G1DA 3HO1A 4C3KA 2CPZA 3SBMA 4B9MA 1RWXB 4QIGA 2E1MC 1SKRA 1UETA 3BN4A 3QWPA 1WTBA 3VAKA 3BO4A 3OFEA 2M88A 1HR0J 1R43A 2GQCA 2OH2A 2J9DA 3NLCA 3S01A 1HNZJ 2JH3A 1UVNA 3CNQP 4TXSA 1LOUA 5HLFA 1SQGA 4XPEA 3GWCA 4X4TA 4LSZB 3OHAA 1OQ3A 4P10A 4HACA 2ROEA 5LOQA 5BR8J 2UVRA 2DY1A 1Q79A 5HJYA 1TTHB 3GYNA 3H25A 4LRFA 4OX7A 2VG6B 2EC2A 2E9TA 2E5IA 5DQIA 2KL8A 1VBYA 5FDLB 5LL6d 1H6KX 4DV6F 2ZE2B 1NPPA 1S76D 4NEYA 1J5OA 2RQCA 1X4FA 4X4OA 3G6XA 2BYCA 3BF4A 3ZXWA 2ATCB 3NNHA 3TZXA 5F9LA 1FFSB 5GVQA 2W9AA 4DFMA 3BM7A 1BQMA 2DH9A 2W2MP 3ENAA 2UU9F 2HWHA 5HL7Q 4ED7A 3MCNA 3JSYA 5DDOC 4NX9A 1YJ9S 2CJAA 1YJVA 1LXNA 2D41A 4IQMA 4GKJJ 2AEJA 2W8LA 4OX9J 2UVVA 2P5VA 3UR3C 4CLWA 2HS0A 1SQEA 2XMJA 4Q45A 1N48A 2JHEA 2WB1D 5IWAF 1NDLA 1TKXB 2DXEA 3THPA 2QC3A 3EGZA 4RW4B 1FJGJ 3HFVA 3D28A 1VHFA 1CJVA 3T1AA 1IBKJ 3HJFA 1SB6A 4ZCMA 4CH1A 3CJ2A 2A2CA 4U95A 3GR0A 1E6VB 1FNOA 2GW8A 4OLPA 3SCIE 3A1YG 1HKAA 1HQEA 3QT6A 3ISZA 4QWAA 3UPFA 1TK0A 2EG1A 1D09B 4LVOP 2OKQA 2V50A 2IVMA 3D6HB 2ZC4A 3D1OA 4RBTA 4HHJA 4I2PA 2G2ZA 4JI1F 2LVWA 4YUDA 3UQSA 5CCLA 2BX6A 3JQJA 1FRMA 2OSQA 2O3DA 5EHHA 4O3RA 1GFWB 5L9XA 1YLXA 3A12A 4YB6A 2KVQE 5HP1B 3M2VA 1XMBA 2B7CB 1LNQA 3Q23A 5KFCA 3L7PA 3PM9A 1MN7A 5CH7B 4B3RJ 3MM8A 3SFGA 4TYBA 2IC3A 5HSPA 2AKWB 3CULA 1K9MT 3NGDA 1VISA 4ZCIA 1M90T 1GMWD 1VQSA 5J2QA 5JUMA 1FTCA 4F3MA 4LFBF 1U47A 2WVCA 1NK9A 3DI6B 3TP2A 4DR1F 4ZVEA 3IBWA 5K8MA 1KEKA 1CULA 1X7VA 3POTA 4HH1A 4H4KC 1ULRA 1FHTA 2AZ3A 2JC1A 2HLUA 1TP7A 4LF7J 2PD1A 3VAFA 3JTNA 2M52A 3W2VB 4V1Ak 2JVOA 3KLIA 2VASA 1TL1B 4NI2B 4DPWA 2BKPA 5KFSA 2X7IA 3AH6A 2CZ9A 1JLQA 1JJCB 3DU5A 3QSIA 2AJ2A 1TL7A 1IM6A 3OTDA 5HJXA 2XMTA 1T9VA 2FVQA 2EG2A 4CZCA 3FEXB 3D66A 4DHVA 2CPHA 3PYGA 4ATNA 4WFXA 5HMWA 3MM7A 3CC4S 2Q79A 5ETVA 1YBAA 1FT8A 4WFYA 3CCMS 4EYIB 2DHAA 4J9VA 1CJUB 3UE2A 2AX0A 1H74A 4JI3F 4D3GA 2WB4A 1LK5A 3R5DA 3IGVA 1RHMB 5GAGI 2DGQA 1VQ9S 2B51A 1XR6A 2HWTA 3UNGC 1RT6A 3PIOQ 2HFZA 5AE3A 1O5JA 4DG1B 2HG4A 1S4EA 4L74A 2Z58B 2J7UA 2W9CB 3LA0A 1YKWA 1FX4A 3IG1B 5C2CA 3V6JA 1JKHB 4GVBB 3AFGA 3WIUA 5K8PA 3CCUS 2HW3A 3K2YA 4DWIA 1YVFA 4LF8J 2Y1LB 2SXLA 4NLVA 2UU9J 1SJ1A 2FHKA 2QFJA 4FYWB 4N41A 4FF2A 3TUIC 4B08A 4KB7A 2MKCA 2KZZA 2LU1A 4M95A 5D0EA 3C16A 3CJ0A 3MAHA 3P4UB 3VQSA 4NCBA 3Q89A 3ILIA 3J80U 3M32B 3FQLA 5KFDA 4J91A 1EKRA 4R8UA 1KVJA 2F1FA 5CD4H 3A3NB 4F50A 2CDQA 4X84A 2DNLA 2JVRA 3THVA 3A8IA 3CJKA 4OJHA 2OD4A 4PXEA 4M1KA 1IWAA 3DOKA 2VF3A 1HW8A 2M70A 5DQGA 3RB0A 4IYQA 3PR4A 4PYDA 2OGUA 3N6NA 4X62J 4PXDA 4ZN3A 2YX4A 1SV5A 4FF1A 3AJ2A 5FD1A 5KG4A 4DZ6A 2WAQD 5GAHI 4C11B 4PUOB 3EZ5A 3T1YF 2IJNA 4KTQA 3TUZC 5AT1B 2AYEA 2P9CA 3BQ2A 4JI1J 5A8WB 3FMBA 1REVB 4PKDB 2X1GA 5C24B 2D3UA 2LMIA 3NNCA 3SDEB 1YJUA 2N82B 4DPOA 4QR1A 2UVWA 4DSIA 2G0JA 4RNFA 2IM0A 1HFEL 2HVDA 5CYJA 1RU2A 4OZ2A 1X0FA 1CG2A 4NLRA 2XC9A 4J9QA 3MEGB 1LW2B 3IP0A 2XG8A 4JUZA 5K14A 1V3SA 1YWXA 2VG7B 2HBYB 2XB2D 2UUCF 1KLMA 3W5YA 3I0RA 2FZGB 4DQIA 4DX8H 3O5TB 4DCOB 3AJDA 1WC6A 4X4UA 1VQKS 1WJ9A 4YS2A 1CPZA 2W4DA 3BH7B 4DN0A 2CG8A 3ZTSA 5G4DA 3Q8RB 4F0HA 3R8YA 2YKNA 1N5YB 1NKBA 1TELA 2J0SD 1N6QB 3EJMA 2JWNA 3J7YI 1VMBA 4OMFG 2GIRA 4ZKAA 5E5NA 4KV8A 2L9WA 4QIEA 3GYGA 3S7RA 2V4JB 3P8BB 4OYPA 3ONQA 1FKPA 4I64A 4LRCA 1VC5A 4A8YA 2YNGB 2RH3A 1DZ5A 1HWLA 5HVGA 4DQQA 3ZZUA 1KVKA 1CSJA 2QA1A 3AOBA 3D6FB 3DRPB 4YDXA 2O67A 3LO3A 3GLJA 3TZYA 2HRYA 1X4EA 4BHQA 2H5JB 2LQ5A 4NCAA 1B0VA 1U6FA 3OQ2A 1FDNA 4DXLA 3DRRB 4JI3J 2QA4S 2BJDA 4I7FA 1JMTA 1U1NA 2CQ3A 1HBUB 3IWLA 4KKOA 2DGUA 2HMIA 2EK1A 1ZM3A 2GJIA 2XCPA 2JZ5A 1WWHA 4JI4J 1WG1A 5HBMA 4XK8C 1T9YA 3AY0A 4X4PA 3BDEA 3IR5B 1TKTA 2F63A 3ET6A 3S8SA 2OPSB 4ED8A 4DLGA 3MD3A 2CJQA 3MEEA 4DV1J 4KC5A 3GV7B 3CD5A 1JNRB 4NZ7A 3ADAC 2IBOA 1FERA 3KHHA 5CCMA 3T6JA 4Q0BB 2YH0A 1WKKA 3TAMA 1HHSA 2HNDB 2YX1A 5KFKA 2H5EA 4ZDNA 4IG0A 1MMNA 4C4WA 1B64A 3HHLD 3IM9A 2BACA 1NH8A 3L9ZA 4X66F 1WOPA 4QIWD 2HNZA 4RW7A 3VGTA 1R6YA 3G2XA 1RTZA 3TQEA 1UMJA 4TN2A 1VOMA 2HYIB 2ZOGA 4WKRA 4HT5A 2KJVA 1FKAF 1QAYA 3C15B 2AYMA 1EB0A 2U2FA 1IBLF 2JJ4D 2PSZA 1ZA1B 3Q24A 2KYZA 3FZBA 4EO6A 2CADA 2CQ2A 1EKSA 2AQ4A 4XDCA 2VICA 2V69A 3T1YJ 2N4CA 3KLGA 4EK2A 2RSQA 2BUNA 4JI0F 2RF2A 3RBXA 1C4CA 1R8CA 5B0DA 2QYCA 2UXCJ 3NWRA 4DV0F 2O5DA 2M3DA 3D1QA 2R7TA 1X4BA 4BDPA 3HT0A 3KG0A 4H4MB 3GYXB 3MECB 3HK2A 1P1TA 4OZLA 5KFLA 2V68A 4B3OB 2KHDA 4CQ1A 1LQ9A 3MR3A 1Y3JA 2VG5B 1FXDA 1J27A 5D0HA 1S1TA 5LM7E 3N01A 2HBQB 2KYXA 1VJWA 3IA0A 2GHWA 2JEIA 2YKMB 5KFMA 4HYKA 2HHWA 4NCGA 1SH2A 2I8EA 3PO4A 2UUCJ 1CLFA 3HF5A 3HHLB 1QE1B 4ED0A 5K9FA 3PYFA 2DXDA 1F3FA 3EUNA 2R7VA 2GFFA 2BXJA 3IS9B 3EGVA 4BS2A 3CT9A 3FCWA 4DR2J 2MQ8A 4JV0A 3O1LA 2UUBJ 2IA0A 3TA1A 4J9OA 4J37A 1RTJB 3EVOA 4ZIVA 4Q5VA 1WOOA 3HXMA 5T7LB 4PWDA 1AW0A 4OJGA 3IBCB 1QVFR 3G9CA 3AOAA 2F40A 5I42B 3K59A 4ECTA 1H3DA 1NJWA 3CDBA 2ZZMA 4N5SA 4RW9A 3AHPA 1SH0A 4PG7A 2C22A 3SQOP 1HI0P 1WF2A 4LSNA 4AXIA 5F0WA 1Y9OA 1NDKA 2NXUA 1IR0A 5AE2A 2DD8S 1RQ0A 1RTDA 5BYSA 3L95X 1C1BB 3GB0A 1VI7A 4WZMA 2VU5A 2OAUA 4F4YA 3DYAB 4WF9Q 2R2TA 1X31C 2XNRA 5C25A 4J9NA 2OPQB 5C42A 1RT7B 1RZMA 1JLCA 2GCFA 3W9IA 3KHLA 3DLLQ 3CCTA 3UFCX 3TJAA 1TK5A 4DN9A 2RUSA 3QMQA 3SIPB 4CO3A 5E3CA 3ZZ0A 2YVSA 3EMTA 2RRNA 4RJVA 5LXRA 4I2QA 3THTA 2AJ1A 2ADBA 5E3AA 3KK1B 1PC5A 3TVYA 4C0OC 4DU8A 1UW9A 4ED2A 4WFNQ 2YH1A 3BBFA 2XWYA 3BBCA 2HVZA 3E51A 3M8PB 7FD1A 3H42A 4ED6A 2U1AA 1QAJA 4EO8A 2QT7A 2XEXA 2E5GA 3SQGA 4IRCA 3JSMB 2OMOA 3MTJA 2ZH5A 1N33F 3ZTRA 3UDEA 4M5LA 3T5HA 3MM9A 2OLWA 3SCJE 1P27B 7FDRA 1KNZA 2HQFA 1S0OA 3A8EA 4X66J 3VQTA 2EWHA 1R7IA 3UVJB 2BE2B 3GJSB 4L73A 3GV5B 5DG9A 2CQ1A 3AD7C 5ITHA 3Q2SC 3MZIA 3IRXB 3NXZA 2HQGA 3BGLA 3BKTA 3GFZA 2ZKTA 1IWGA 2Y8YA 4CTAB 2LCWA 1U1RA 3OUYB 1BWVA 2Z2ZA 1VGYA 3CIMA 2F8HA 1WC1A 2J6TA 1JJHA 4ZPCA 2DO0A 5DQHA 4QIVA 3HT3A 3L4BC 4ANEA 2KKHA 2V2ZA 2JEFA 3IO1A 3V5RA 1UZHA 4WYLA 1QTNB 2I2YA 2PE8A 3C6TB 2ZBIA 1HBNB 4I1TA 1JXLA 2H3EB 1RLDA 1XN9A 2V9KA 1U45A 4C3MA 4HL9A 2R7RA 1OY8A 3M2RB 4IFYA 4PABA 4LF4F 3BGOP 3K0JA 4OL8A 2LDYA 4ZOSA 1K1SA 2WZ1A 5DG7A 2XY5A 2XYPB 1IM4A 1K0VA 3R5JB 2OFHX 4X65F 2K7JA 5J2NA 2UXDF 4N76A 1U1MA 5H9EK 2Q1LA 2Z4PA 4LFCJ 1RT2B 1NXIA 2BABA 2K06A 4LFAJ 3GMGA 2GS8A 4X64F 2KRRA 2DHHA 4IO9Q 3M8WA 2PEHA 1R8AA 2ZZNA 3D68A 4WE1A 5K5MA 1A6LA 1T0TV 3ETMA 4I6WA 4YB7A 4ID5B 1AYEA 4QJVA 1X0PA 4ZS6A 3SXLA 3B82A 1Y5IB 2E7VA 4PRFA 1IVZA 1VRQC 2JEGA 4MJKA 2L3MA 2KM8C 2RUGA 1BUXA 2HHHF 4F4AA 3FSYA 4UUXA 1DHMA 3KJVA 4DSJA 3KNAA 4YN3B 2ZOMA 4TY8B 1QVGR 3R2CJ 2OFGX 1N56A 1RWOB 1URRA 3R5AA 2I0XA 2ACYA 5J1EB 1S1XB 3PG9A 4NLDA 3EVMA 1NHUA 4RZRA 3DRSA 1PG5B 3I32A 4DUYF 1N5QA 4WYWA 4JV2A 4IRDA 2BE9B 2HS3A 2ZJRQ 1VQYA 2EFOA 1MG7A 3KMQA 4ZHRB 1KP6A 3R1LA 2G2OA 9RUBA 3QGPA 2C2OB 4CO1A 4R0EA 4EYHB 2V8DA 4H54A 4NRTA 1OYEA 2VODA 2AGQA 4UOFA 3UN3A 5L1KA 1D9FA 2BJ7A 1RU1A 1BD6A 1B70B 4W98A 2VG6A 2K3KA 4UUWA 4CCHA 2RRAA 1AB8A 5FDLA 1UEUA 3NGRA 1UWBB 2CA9A 2Z56B 3VALA 2ZE2A 4CH7A 5A6PA 4OYXA 2I38A 4BWMA 3WZ0A 4B3MF 4W4MA 4OFZA 2ABYA 4ELVA 2KG0A 1FDBA 3ILJA 4WXWA 1UPPA 2PI5A 5D0GA 4K59A 4K4ZA 3L7UA 4UTGA 3BGFA 4NLWA 4DSEA 2HHSA 2A1BA 2QMWA 5HQ8A 4Z7CA 1U0SA 2GAGC 5L38A 4ZPBA 2EK6A 3CUNA 2B4PA 4F0KA 4EBCA 2YY3A 1VS3A 1V6HA 2QLBB 3KLVA 3NWGA 2ZBCA 3HVRA 2OELA 4WFZA 1NKEA 3VTIA 2IMOA 1TFWA 1NPRA 4YQWA 4P7TA 4B9LA 1ZETA 2QO3A 4N7TA 4RW4A 1IKVB 5DRKA 2D69A 1E6VA 3HVAA 1QD1A 1T11A 2ILZA 1G1XA 1WI6A 2KXFA 1GXTA 1Z1ZA 4ITSA 3E01B 1S9FA 1SJRA 4AFFA 3RAMA 5IM0B 2I9SA 2VA2A 1R8BA 3BN7A 3IFEA 2CQCA 4JI2J 2CIMA 3MF5A 3NOCA 3QRPA 2EW9A 1Q16B 5HP1A 4PPZA 2VONA 1XMOJ 1CJTB 3AOCA 3PW2A 5I3PA 3D6TB 3A3PB 5AXLA 3ZNUA 4MK8A 1WHWA 1U48A 2HNYB 2PC6A 1N5VA 4JYAF 1SJQA 2H4WB 4WU2A 1SJ3P 1LWEB 3KLEB 3QGHA 2UXBF 3DI6A 3C2PA 2LQ9A 4K50A 3R5CA 4FPIA 2RIJA 5D4PA 1ZZNA 1KQGB 4HHUA 2XMKA 4TU9A 4UT4A 2ZD1A 2HHHJ 2DO4A 3VZIA 1UVKA 2NZCA 3JYTB 4OZJA 2CNNB 1DTQB 4ERDA 4HI2A 1EETB 1K0TA 3PR5B 2HEKA 3W2VA 1PYSB 2XMWA 1GMVA 1M5HA 1TL1A 2AWZA 4NI2A 1Q1KA 4JI6J 3R2DJ 3CIZA 2B9WA 2E5LF 4F02A 3HHNB 3QLHB 2IJRA 1P1LA 2VBXA 4FVMA 4DUYJ 4FXDA 1ZYQA 3VWSA 3HHEA 3OR2B 2QL5B 4NLXA 4DF8A 2NQPA 2RQMA 2M8HA 2BE7D 1KHWA 2Y1IA 3LGNA 2J9EA 2QYGA 1JB0C 4RNNA 3VF0B 4I6YA 2A6MA 1CJUA 1YRUA 3NKYA 1Y0HA 2FHJD 1PAEX 5F9NA 3IAM9 3ZZZA 1QAIA 1WTFA 4OYWA 3KDOA 1ITPA 4PYAA 3B78A 4AQYF 2RJZA 4B9SA 2CPEA 2VPYB 3DLEB 1YBUA 4DG1A 3MPVA 2VQFJ 3TO8A 5DS7A 1UFLA 1RWNB 3BO3A 5MLCV 3TUJC 4NYPA 1GMWA 3H5XA 1HD0A 2Y1RI 3RR8A 2ALYB 3IG1A 2C2DA 2DGXA 1JKHA 3RBDA 4EZ6A 2V9WA 4H4OB 3D0GE 2IFXA 1RKIA 2XSJA 1OSCA 1S6UA 1FWKA 4NMLA 3AD8C 5CYQB 4KPYA 3ZTPA 3GQCA 2VPXB 1RAGB 2R8HA 3M30B 1S1WB 1FWPA 2FVRA 1ZTTA 1NSQA 2BQ3A 4PQUB 1RWWB 4X4QA 4O0IA 3M32A 1RAHB 1J5EF 4CO5A 3PFOA 2FZCB 4A8QA 1UZDA 4LR8A 4J90A 4LF5F 2FGOA 1FTRA 1K47A 2W2OP 1WUUA 1T02A 1V9OA 2V8VA 2HGLA 3QFWA 3OXLA 4HDGA 1GMUA 2CPDA 3DXSX 3TANA 5KG1A 1WHXA 2XMUA 3OSPA 3UI3A 3L3CA 3J7A1 2EFGA 1RADB 1S99A 3MPYA 4EGLA 3CF5Q 2JEJA 1L3KA 3DRXA 3DOLA 2MZ1A 1WC5A 3RR7A 2UUTA 2FB0A 2UV8A 5B0FA 4C11A 4PUOA 3DLJA 1UFWA 4DR3F 2QL9B 2C2MB 2CG4A 4BBYA 3OD2A 4F3OA 3ISND 1HHTP 4F7VA 2CQHA 5D15A 1REVA 2NR0A 5C24A 3UDVA 5LMUF 1SCJB 4KAIA 2PGCA 3MMCB 4U8VA 5F8MA 2FYXA 3AODA 4N56A 2AZ1A 1EP4B 4O3QA 2DHXA 3HZGA 4JI8F 3HM9A 1T9XA 3MURP 5KT4A 3M7VA 2OPRB 4OHYA 3MEGA 1EIYB 4AL5A 1LW2A 1OPIA 1SKUB 4JYAJ 5AXNA 5ETNA 4U9RA 2AGPA 2VG7A 1Q78A 3US5A 2D3O1 3VV2B 4EMDA 3BEGB 3RBZA 2VQEJ 2CDRB 1S4FA 3GG1A 1TAUA 4ZP9A 2GA7A 5LT5A 4RNOA 4PG8A 1YZ7A 2I1RA 1B99A 1QTMA 3I4HX 1WOSA 3BV8A 4CLFA 4C2MA 1WD6A 1N5YA 1RT4B 4NLQA 1N6QA 1N0VC 3G8TA 2VD3A 1TL5A 2L9DA 1F9EB 5CZVA 3TJ8A 1RUSA 2QEXS 4USHA 3KDNA 4NLOA 1R8PA 2YNGA 4DPYA 5D4OA 5A2QU 2R8KA 5CHCB 2YKQA 1U1LA 4KHRA 5A0YB 4JV5F 2CPXA 3DRPA 4IFVB 4P72A 2A0FB 1RYSA 2V34A 5IT9Y 3G86A 3CCQS 4PXBA 2JNJA 1XNQF 3W63A 3NP5A 4KGZB 2MJUA 4GO7X 3DRRA 2O66A 4J9PA 4MKVA 1FRJA 3N6MA 2M0GB 2CVEA 1HBUA 3UCGA 3J81U 3V6KA 3EZOA 2QA2A 4OIXA 2FD2A 2DCUB 4K4SA 3G8SA 1YITS 2Q3PA 2HGMA 1S57A 2IIHA 2OPSA 1D8ZA 3ZTOA 3P6YC 4ES1A 3DDIA 4KGXB 3CDAA 2GHVC 2E1PA 5ETLA 2D3ZA 1GT8A 3DOMB 3GFYA 3J81j 1HNVA 2QLFB 3KK2B 1VRUB 3V81B 2J6SA 3U7JA 4M5NA 4Q0BA 3KK3A 4LF2A 2Y3YA 1GEHA 2YXLA 5KOXA 1FRIA 2DH7A 3JSBA 3DLGA 4AXJA 1URNA 1TL3B 1N8RT 1RABB 4QBUA 1PIEA 1PSDA 1KQSR 2RS2A 4HI1A 1J5EJ 1KWMA 1A7GE 2W9BA 3PFEA 1LWCB 4PQAA 4LF5J 2K3IA 5BJRA 4DEZA 2AYGA 4WP8A 1FD2A 3C15A 2MLYA 2RNEA 4KHPF 1FVSA 3MPDA 4IG3A 2Z2LA 5CQGA 3G6ES 4K5SA 3C14B 1DBDA 1FKOB 2B6AB 3I87A 2J9CA 5EGYA 2E5JA 2V67A 1W2IA 3DNCA 2FVCA 2DNOA 4M5DB 3ULHA 1RBOB 3OJUA 1X4DA 2FLOA 4USKA 4DR3J 2RB7A 2R7UA 1H2VZ 1UVJA 1WF1A 1QDUB 3I5CA 5KG3A 2HK3A 2HVEA 1N88A 5BYRA 4UOGA 2QX0A 4H4MA 3MECA 5DLFA 4B3OA 3H2LA 4DFKA 4IQXA 2VG5A 1X8DA 2EKYA 4FKXA 3TX8A 2J5AA 4Y0FA 1XEZA 4JI8J 2G4BA 5GAEI 4X4VA 2YKMA 1PKUA 5FLXU 3HHLA 3LAKA 1QE1A 3U02A 4DU7A 2Q43A 2MXYA 2WBMA 2GGPA 1EAYC 1YG0A 1VLOA 3RU0A 1HNIB 1FK9A 3KHRA 1VC0A 3IS9A 3DHWC 2CNKB 5IV3A 2ZHAA 4Y65A 4EZ9A 3I5BA 4OJ1A 2HHPA 2WVEA 3ILOA 1Y00A 4KY3A 4L3NA 1SC3B 1WI8A 5T7LA 3LTOA 4ER8A 3SEOA 5IT4A 2DT9A 2MQPA 5I42A 2XY6A 1U4BA 2WCXA 4CRJA 1ZM9A 4YHHF 3BGUA 2KG1A 1SL2A 1ELOA 1BQNB 2CJYB 2V2VA 4MYTA 2GC8A 3SSSA 3KLHA 1DFDA 1OYDA 4QR0A 3K5PA 1BXNA 1ZTWA 4C97A 4C6AA 1M5KC 4O4GB 5KFFA 2R4FA 3GIMA 3LALA 4USVA 3MXHP 2C2NA 1C1BA 4QWBA 4R0JA 3D2WA 3PKMA 3DYAA 4DI6A 1LK7A 2OPQA 3N4WA 3NAIA 4A8WA 2ZH7A 4YDDB 2GZOA 1XNQJ 3UD4P 4QZVB 2IVFB 1RT7A 4DL0C 4DX7A 1YRTA 3VAJA 3CCJS 5KFEA 3HHDA 1HHQA 2LLZA 1I94F 2FVPA 3MUMP 2PDAA 3TA2A 2YWGA 3SMZA 2VA3A 2VJVA 3DN9A 3KK1A 3K5NA 5E41A 4QWCA 3I9V9 4M63A 4NWBA 2XM3A 2F65A 1U8WA 4DV3F 4C8OA 2B56A 3RB3A 3M8PA 2V8GA 2EFNA 3OT9A 1FEHA 3JSMA 4Y2MA 1AFJA 4NLSA 3MMAB 3MPUB 5HAOA 1RKJA 3FEYB 3MOZA 4DZDA 3W3SA 1LFPA 2HHVA 5F8IA 4CO0A 2RKIB 2Z30B 2PA8D 4RL1A 1Q7YT 4DS4A 4ZPDA 5I3UB 3UVJA 2BE2A 2R7SA 2NXJA 1FEEA 2FVSA 3QIDA 1W25A 1Q95G 1VCTA 3O44A 3RG6A 4ZITA 4I67A 3IRXA 1MU2B 4Q8FA 1PJ7A 4DR7J 3FBBA 1EJ7L 4USWA 3MEKA 5KT3A 4Y00A 1ZAXA 3CO9A 2B5JB 1N32F 1WDDA 3R9LA 4CTAA 5AE1A 1UPMB 3OUYA 2QE5A 4KH0B 4UZBA 2D3OR 3LGHA 2FC8A 2FUG9 2X1AA 4U96A 3LF0A 2BA9A 1BQXA 3NOGA 3K7RA 1FJEB 5LMNJ 5I3QA 1DURA 4IDKB 1FA0A 1HBNA 2GO8A 1CS4A 2J0XA 3LAMA 2R42A 4KFBA 3UN2A 3PO5A 4LBHA 3W8GA 4A8FA 3CD0A 4K4UA 3MM5B 3GIRA 3M2RA 3M9MB 4U7CA 2IDEA 3QZ8A 3I82A 1APSA 3M8YA 4B3SF 2CJKA 3OR1B 2VH7A 4HLBA 1X60A 3M8QA 1RT1B 4G1QB 1H38A 4IUFA 4TNOA 3BSCA 5K20B 5DO2A 4F26A 1KRPA 3HCXA 5D78A 3HKWA 4N47A 4GC7A 2OTLS 2KFZA 3LP2B 2E9ZA 4Y34A 2A6OA 1RT2A 1U09A 3OVBA 3OL6A 1Q7LB 2ZOFA 4HACB 4C48A 4CWBA 3H2UB 3SV4A 1V5IB 2ASLA 1IJFB 2NXEA 5GADI 2EPIA 1FXRA 4EUVA 3FBEA 4ID5A 3KUGA 4DR5F 3AXKA 4FYVB 2LECA 5IFMA 2F8MA 2MKYA 4QPXA 1IQTA 3TX0A 3G87A 4NZ0A 4PEOA 3EM1A 4YHHJ 5K8OA 2JDJA 2YQ3A 2Y0SD 2YKPA 1EARA 1S12A 1F1BB 3SCKE 4ZVUB 5J1EA 1H2UX 1S1XA 1RWUA 3OFFA 1X4GA 4ELUA 1BQMB 4K8RA 4W90B 4NOHA 1QAXA 3K17A 1NHKL 3TYTA 3FGVA 2DNYA 3Q8YA 4PWWA 2UV8G 4MYUA 5JMNA 2DNRA 4ZHRA 2H65B 4HHHA 2R9LA 4CLPA 1XIQA 2HRUA 2ZZTA 3H5YA 4L6V3 4KJIA 2XHCA 3UNYA 3A8JA 1JXEA 4EWTA 2X1FA 2VZ9A 2OP5A 4LSLB 2NPIA 2HBZB 2IPOB 3FEZA 2GNKA 2DR5A 4EEYA 2BJ9A 1UEKA 1VDHA 1NJYA 4ECVA 4Q2MA 5EWEA 1Q82T 3LW5C 2R3VA 2ZBRA 1VK8A 2R7QA 2W7OA 2MZQA 3G82B 2P9EA 4HKQA 4P6QA 2GIQA 3DM2B 3E2EA 2DHGA 5DDQC 5AJ3F 3NNAA 3PJWA 1C0TB 1ZBTA 1MWYA 1XMQF 3IWNC 4TU8A 5D4LA 1NH7A 2MHEA 3QBCA 3R6GB 4FYYB 4G1PA 2BDPA 1VQ4S 1SUQB 3MCOA 1RHQB 5L1IA 1V3ZA 2FJDB 1R0CB 3OTOJ 2A18A 3AA9A 3KHGA 1Q5YA 2E7XA 1HBMB 3CB4A 1XBWA 3AQOA 3ZFVA 3VGUA 3P3DA 3SI8A 1UTAA 1UW4A 1QLNA 3IMQJ 1IQZA 1IBMF 3MMBA 4OQJA 3R6LB 3W9HA 2ASJA 4ICLB 1TUGB 3P5BP 3GJQB 2CVIA 5B0AA 2QLXA 2GAHC 4YB5A 4C0BA 5B0GA 1L3TA 4PXCA 3NGSA 1M5OC 3FBFA 2CKWA 4ILLA 2RS8A 3F41A 2HIYA 4FNHA 4B3SJ 4DR6F 3TAQA 2QL7B 5IM0A 1JLQB 4ZLNA 1SVDA 3NMRA 4DOZA 1WG5A 3UO0A 1X4CA 3FZ2A 3PXGa 3HI9A 1TMJA 2OTJS 2AT1B 2W24A 1NO8A 3TQ1A 1QUPA 1PYTA 2RHQB 2E29A 4U7UK 4V19J 1B4SA 2ROGA 1CJTA 3HVTB 3MM7B 2W2PP 3LWMA 4YR2A 4ECUA 3PY8A 3ILLA 1WEYA 1IJEB 1RAOA 1S1VB 2FLPA 3EDQB 2HNYA 2YNIB 1HWIA 4DV2F 1HNXF 1T94A 2FJBB 4DPUA 1JNZB 3MUVP 1DY3A 3N5FA 3W5XA 2DB1A 1RT6B 2B7BB 3F0NA 4OHVA 4ZVPB 4ZVGA 1KVIA 1JQGA 1C0UA 1VBZA 1T9WA 4UF4A 3CC2S 4ENOA 1XK8A 1WG4A 1Q8KA 2RRBA 3RBEA 1S7HA 4LR9A 1DTQA 1Q8IA 5D8HB 1EETA 4ECSA 4KIAA 2IVYA 1S0NA 4LVNP 3OV7A 3FJ2A 4LR7A 3GJRB 1EHWA 2W2QP 5KT7A 5A6WA 4D3HA 3QLHA 5J1NA 3AA8A 3MCSA 2JLFA 2YWHA 3MHYA 3T6BA 1WHYA 4AUKA 3OR2A 4WPAA 4DV4J 4PZVA 2VHGA 2VOPA 2G13A 3M6UA 4RUAA 2ZEJA 1RAJA 1NDCA 2FC9A 3NCPA 2OSRA 3W65A 1HQ2A 4JOUA 1RT5A 1W7WA 2HVHA 2DNMA 3NS5A 4IRKA 1NCLA 3KTQA 4NXNF 2QSWA 1HMVA 4AE5A 3R5GA 4WFBQ 2RQ4A 1H72C 1PBUA 1N5SA 1SC6A 1F9FA 5DDRC 3WC2A 5D0RA 4CO2A 4J9SA 1Y10A 2OIHA 2CZVC 4ZP7A 3TJ9A 5KG7A 1B3TA 4MMOA 1Y7PA 1D9DA 3W7BA 2GMJA 5T14A 3C8YA 3DLEA 3MDFA 4E0DA 1VIXA 5E33A 1N4LA 5J2PB 4Q8EA 1WELA 4ZPWR 2R8JA 1RHRB 2DNNA 2K1RB 2WHOA 3Q8PB 3QJPA 3FMWA 4H4OA 2KZMA 3NS7B 2PMHA 2H48B 3PRBA 2UUWA 2KJWA 2EBEA 3WX8A 3QPIA 4ZMMA 4MK9A 1XMQJ 3D9BA 1JIHA 3KNGA 4JI7F 3FFIB 2CNOB 3JB9k 2LEBA 3IRWP 1LKZA 3GCXP 3UDLA 1B7YB 3U1LA 3GSDA 1TKDA 3M30A 1S1WA 3GPAA
chains in the Genus database with same CATH topology
1Q0NA 5ETOA 1RU2A 3UD5A 1TMMA 1F9HA 3ILJA 5ETSA 1RU1A 3HSJA 5ETKA 3UDEA 3QBCA 3UDVA 2F65A 3HSZA 3KUEA 4M5LA 3HSDA 4PZVA 3HD1A 1CBKA 4M5NA 1HKAA 4CRJA 5ETRA 1G4CA 1EQ0A 4M5MA 1EQMA 3HSGA 3KUGA 3IP0A 3KUHA 3MCNA 1KBRA 2BMBA 4M5KA 4M5GA 4AD6A 3HCXA 1DY3A 3MCMA 4CYUB 1RTZA 4CWBA 1RB0A 1HQ2A 3ILOA 5ETNA 4CYUA 4M5IA 3HT0A 5ETLA 3ILLA 3HD2A 4M5JA 2QX0A 1EX8A 3MCOA 1IM6A 5ETTA 5ETMA 5ETPA 5ETQA 5ETVA 4F7VA 2CG8A 3ILIA 1TMJA 1RAOA 2F63A 4M5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0N A;  5ETO A;  1RU2 A;  3UD5 A;  1TMM A;  1F9H A;  3ILJ A;  5ETS A;  1RU1 A;  3HSJ A;  5ETK A;  3UDE A;  3QBC A;  3UDV A;  2F65 A;  3HSZ A;  3KUE A;  4M5L A;  3HSD A;  4PZV A;  3HD1 A;  1CBK A;  4M5N A;  1HKA A;  4CRJ A;  5ETR A;  1G4C A;  1EQ0 A;  4M5M A;  1EQM A;  3HSG A;  3KUG A;  3IP0 A;  3KUH A;  3MCN A;  1KBR A;  2BMB A;  4M5K A;  4M5G A;  4AD6 A;  3HCX A;  1DY3 A;  3MCM A;  4CYU B;  1RTZ A;  4CWB A;  1RB0 A;  1HQ2 A;  3ILO A;  5ETN A;  4CYU A;  4M5I A;  3HT0 A;  5ETL A;  3ILL A;  3HD2 A;  4M5J A;  2QX0 A;  1EX8 A;  3MCO A;  1IM6 A;  5ETT A;  5ETM A;  5ETP A;  5ETQ A;  5ETV A;  4F7V A;  2CG8 A;  3ILI A;  1TMJ A;  1RAO A;  2F63 A;  4M5H A; 
#chains in the Genus database with same CATH topology
 4PQU A;  3DGP A;  4FVC A;  2VPZ B;  2KN4 A;  4NYZ A;  3RYL A;  2FHM A;  2M9K A;  1S6Q A;  1T03 B;  1LXJ A;  4QU6 A;  3JQK A;  1M1G A;  3G96 A;  4X4S A;  2XQC A;  2B9X A;  1KLM B;  1QM9 A;  3CJ5 A;  2G9O A;  3GIJ A;  2DHS A;  3MWB A;  2LQB A;  2I5J B;  2GV1 A;  3Q8Q B;  4ILM A;  3GJT B;  1T9U A;  5J2M B;  1HWU A;  3IM8 A;  2XS7 A;  2Z57 B;  4Y28 C;  2X51 A;  4AND A;  5IC4 B;  4L75 A;  4B9U A;  1KLN A;  1BGX T;  2ILY A;  5HI7 A;  2ZH1 A;  1UCN A;  5I4M A;  3OLB A;  4DV6 J;  1S0M A;  1EZZ B;  1REG X;  4LT6 A;  2VC1 A;  2X3D A;  3K8V A;  2C2Z B;  2N4D A;  4YB1 P;  2ZH4 A;  3DLK B;  1HYS B;  4XO0 A;  3GZ7 A;  2MKJ A;  5KFG A;  1GK8 A;  1U1O A;  3CW2 C;  2LKZ A;  1F5C A;  5ETK A;  1DRZ A;  3N28 A;  3HSZ A;  2DIU A;  2RDJ A;  4E98 A;  4NA1 A;  1FKP B;  1S97 A;  4KT0 C;  3D54 A;  4P2S A;  3NMA A;  2DNK A;  1KQK A;  3R3T A;  5EX0 A;  3OXF A;  5THW A;  1FCA A;  5LSO A;  2ACM A;  3J7A N;  3DLB A;  1EP4 A;  2HGN A;  2DIT A;  2IY5 B;  3M8Z A;  2AIR B;  4IOA Q;  2D9O A;  2OPR A;  2CJ9 A;  3FVY A;  4LF9 F;  1VQM S;  4KHM A;  4DV2 J;  1HNX J;  2DBB A;  2CAJ A;  5KFR A;  4WP9 A;  2W4P A;  4ELT A;  5IWA J;  1Y3K A;  1NPK A;  2RVJ A;  5DLG A;  4MAK A;  2MGZ B;  2HFN A;  4NXM F;  5HBM B;  3TR5 A;  3MI7 X;  3BDP A;  2KRB A;  1KFD A;  3UR0 A;  5EDW A;  2AW0 A;  1HI1 A;  3PW0 A;  1RT4 A;  4P73 A;  1YJW S;  3C6U B;  1N34 F;  2RML A;  1B7F A;  4YME A;  3HSD A;  2V5H G;  2EXU A;  3R5B A;  1KTQ A;  2KM8 B;  1YI2 S;  3PYD A;  4AD6 A;  2MY7 A;  3KWM A;  3QAU A;  5IV4 A;  3HD2 A;  1T05 B;  2FJE B;  5SZT A;  2HZA A;  2Y9H A;  4ZA1 A;  3GP9 A;  5GAG U;  2Y1J A;  5A0Y A;  3OL8 A;  2VOO A;  4IFV A;  2BEF A;  1M0S A;  3K5L A;  3MFH A;  2UUA F;  1U1K A;  3ZTQ A;  3W60 A;  4RUB A;  2HPU A;  3FSX A;  5B08 A;  1CBK A;  4LRE A;  2E1R A;  5HQL A;  3BSN A;  5DGA A;  4DL7 A;  1NM2 A;  1UJ5 A;  4GRS A;  4CNZ A;  2VPW B;  4LFB J;  1MLA A;  2R7X A;  4DR1 J;  3F73 A;  1HLW A;  5F8L A;  2QIF A;  1U1Q A;  3UN5 A;  3DOM A;  4ILR A;  5A8K B;  3BKU A;  3GTY X;  1G3O A;  3KK2 A;  3V81 A;  2LEP A;  1KS2 A;  1LEO A;  5A8R B;  4CP5 A;  4HH0 A;  1VLY A;  1RTI B;  3KJQ B;  2GMH A;  3HP6 A;  3CDU A;  4RBU A;  5CYM B;  3EX7 B;  3DCA A;  4ZIW A;  3TNV A;  1WOR A;  1UA1 A;  2ZH2 A;  4M5J A;  2EFQ A;  3H8Y A;  1Q0N A;  2R7O A;  3W64 A;  3WIV A;  4YY3 F;  3PVX A;  3TW0 A;  2E1C A;  3C66 A;  4DUZ F;  1Q81 T;  3QIP B;  1U1P A;  2BZ2 A;  1G6B A;  4RNH A;  5DET A;  2OEM A;  1LWC A;  1M1H A;  5RUB A;  1S77 D;  1T95 A;  3PW7 A;  1FNX H;  2AU0 A;  3QNW B;  5M2U A;  1UWA A;  4Y2C A;  2IYI A;  2MKS A;  2D7S A;  1KBR A;  3R7B B;  2V0N A;  3GII A;  5GAH U;  3BZQ A;  5L8R C;  4KO0 B;  2V8P A;  1FNM A;  1JLG B;  3C14 A;  1FKO A;  3P5T L;  2B6A A;  4N8O A;  1OMS A;  4K4Y A;  3NGT A;  5KT5 A;  2XGQ A;  2I6W A;  1G4C A;  5KTQ A;  3H2V E;  3GU0 A;  4B3T F;  3PEH A;  4OYI A;  3AB4 B;  1RYR A;  3JTO A;  1Q53 A;  4O44 B;  3LAN A;  1FES A;  2BVZ A;  2IRY A;  3FC9 A;  4EBD A;  1RT3 B;  1MW7 A;  1P9Y A;  4CNY A;  2BAN B;  2ADC A;  2RU9 A;  4LSN B;  1X5T A;  3DXB A;  2LXI A;  1RAC B;  3MED B;  4ECY A;  4LRA A;  1YK9 A;  4UY8 5;  7AT1 B;  4QW9 A;  5HVF A;  2ERR A;  1RGV A;  4LF9 J;  3SFU A;  1HR0 F;  3X1L B;  2QV6 A;  2EKN A;  4OI0 A;  2BJ3 A;  2V63 A;  1VQN S;  1LWF B;  2HHQ A;  2HZC A;  5B0B A;  2FLL A;  4NXM J;  1HNI A;  1U25 A;  1HD1 A;  4I2Q B;  4ZVT B;  5JVG Q;  1N36 F;  2MMY A;  3IR6 B;  1WKL A;  3ENQ A;  4MTP A;  1YIJ S;  1SC1 B;  2ATL A;  1JK9 B;  2ZDP A;  3PKY A;  1SL1 A;  4OI2 A;  2NS1 B;  5E3Q A;  2KDO A;  1BMQ B;  2XMM A;  1UJ4 A;  1N34 J;  1CVJ A;  1IKY A;  3ZNJ 1;  3GSI A;  1JLA B;  3SQG B;  3RGI A;  1BQN A;  2AEF A;  3BPS P;  3MGJ A;  3J7Z 5;  1OPZ A;  5EWG A;  1X9W A;  1S9G A;  3BO2 A;  3VAI A;  2AD9 A;  3MAQ A;  4Y2I A;  4O4G A;  5KFI A;  1GTE A;  4CYU A;  1OY6 A;  4NE9 C;  3O6Q A;  1RAE B;  4WK1 A;  4ZCK A;  2CQ0 A;  2UUA J;  4B9T A;  5KFU A;  2DGW A;  3ZC4 A;  4ZN1 A;  3N6L A;  5L39 A;  4OZ5 A;  4OX9 F;  3Q2T C;  3Q8U A;  1SIZ A;  1NZA A;  4A48 A;  2AV5 A;  2MQN A;  4AYB D;  1YSJ A;  1RAF B;  2W1B A;  3SZ2 A;  3KKF A;  2FHO B;  3IXQ A;  1HPZ B;  2YPZ A;  4M8L A;  4DSK A;  1KHV A;  2QGF B;  5EUH A;  1GQE A;  3CD6 S;  2HHU A;  3NBP B;  2DTJ A;  2KB2 A;  1FJG F;  3N79 A;  4RX6 A;  5KFB A;  3PRD A;  3G6Y A;  1YTY A;  1SJF A;  1F5A A;  2M2B A;  4ID8 A;  4CIO A;  2GVD A;  5F3Z A;  8ATC B;  3NGK A;  3W62 A;  3BRE A;  2MZR A;  5ETS A;  2MHN A;  3FCH A;  2RHS B;  2HRT A;  4OHX A;  3D67 A;  4K2J A;  3VZH A;  1NUE A;  4CT9 A;  2YNH B;  4X4R A;  1PBA A;  4ECZ A;  1MRO A;  5I3U A;  1PAU B;  3EGN A;  2JX2 A;  1GXU A;  1VQ7 S;  1Q8B A;  3T9N A;  4Q44 A;  4QYZ J;  4QR2 A;  1FF2 A;  2WVB A;  3CJS A;  4B3R F;  3D0H E;  1IR2 A;  3QGI A;  3MFI A;  5HK4 A;  3D6M B;  1SXL A;  2B5J A;  4I68 A;  4DS5 A;  3HDS A;  2FTR A;  5T41 A;  3DU6 A;  4MKA A;  4WFA Q;  5DGB A;  1U2C A;  2IM3 A;  2KT2 A;  4WE1 B;  1MN9 A;  3N9U C;  5IC6 B;  4B3T J;  3W2W B;  2B8Q A;  2QZ8 A;  1T7P A;  1VRT B;  3LPY A;  3PCO B;  5A2Q Y;  3D7S B;  3FK4 A;  1M5P C;  5D6G A;  4K4W A;  4IDK A;  3EVW A;  2H51 B;  3OXG A;  1GH8 A;  2B9Y A;  5C5J A;  4O3N A;  3DDN A;  4NLY A;  4FXW A;  3MM5 A;  3RTV A;  1I51 B;  4U6P A;  4FF4 A;  5H9F K;  4KH1 B;  3H98 A;  5ETP A;  4B9N A;  4A46 A;  4AL6 A;  3OR1 A;  4ZVS B;  4G1Q A;  4OZ3 A;  3CVK A;  1RWM B;  1J2V A;  1RTH B;  3DMJ B;  2QSF A;  3QFH A;  2UP1 A;  2CPY A;  2YX7 A;  1K44 A;  2KFN A;  3NRB A;  1FWL A;  4UY8 T;  4LMZ A;  3PJX A;  1SIW B;  5KG2 A;  5DZ7 A;  3W66 A;  2EBG A;  1V5V A;  2ZKU A;  1RCX B;  2CQ4 A;  3LP2 A;  3AAW B;  2DR6 A;  2J7W A;  4AT1 B;  1WEX A;  2VC0 A;  3Q0A A;  2NYH A;  1CJK B;  2G0C A;  4NL5 A;  4CLK A;  2KT3 A;  1N52 B;  3CCS S;  1N36 J;  2XS2 A;  4GC6 A;  1IBL J;  4TLQ A;  4RW8 A;  4FYD A;  4LRD A;  4KE5 A;  2FIU A;  1KKH A;  1RXO B;  4MIW A;  3Q22 A;  2VBY A;  3EIC A;  4CI0 B;  4USM A;  3J7Z T;  4QWD A;  2M4M A;  4NZ6 A;  4JI0 J;  4WIQ A;  4QIF A;  4P2M A;  3CDE A;  1Y11 A;  1X9S A;  4DV7 F;  2XBP A;  4DV0 J;  2F9J A;  2V6A A;  2ZH8 A;  4LF8 F;  1WSR A;  2F7V A;  3T5K A;  2DPI A;  4XTT A;  4OJ3 A;  4TQR A;  1ZM2 A;  3RUB L;  1SC4 B;  3QGG A;  5B7W A;  4ZPA A;  3VVT A;  1Z4U A;  2DYA A;  1EQ0 A;  1KD1 T;  1IXK A;  2L9N A;  4NLG A;  5KFY A;  2WOM A;  4OX8 A;  3HZE A;  4PG5 A;  4S0M A;  3CMQ A;  3KYL A;  4O4R A;  2ZBQ A;  4LSL A;  2FPH X;  1NLK L;  1C1C A;  2WVD A;  5J1P A;  4QCL A;  1PJ6 A;  3RW7 A;  2B4U A;  2XO7 A;  2YKO A;  2H4Y B;  2GJ2 A;  5IT9 U;  1DTT B;  3MR6 A;  4X62 F;  2EI5 A;  4URS A;  3IC1 A;  3B4D A;  1S1U B;  4A8S A;  2J6U A;  3AXM A;  1WAC A;  3B54 A;  4C9D A;  3G82 A;  2GIF A;  2NUH A;  3PYE A;  2WON B;  4X4N A;  2GVZ B;  3M1V A;  1LFW A;  2EFV A;  1YBT A;  5FLX Y;  2IM1 A;  1KON A;  3OLA A;  2XGP A;  4LQ9 A;  3DM2 A;  2V2K A;  1GX6 A;  4IKA A;  4RO0 A;  1C0T A;  3B6B A;  3ICL A;  2FGC A;  5G0R B;  4EBE A;  4O3O A;  3RRH A;  2NPF A;  1IN0 A;  4JP8 A;  2LU2 A;  1N5T A;  2V4Q A;  1D1U A;  2BW7 A;  2QMX A;  4HEA 9;  3QRR A;  1TUV A;  2NSC A;  1SUQ A;  1ZS6 A;  2MB0 B;  4GO5 X;  2VFU A;  3EDR B;  1QY7 A;  4Y6I A;  2MZT A;  1EQM A;  2DPJ A;  4M5K A;  1HBM A;  2BM0 A;  4G65 A;  1FDA A;  3TA0 A;  2KTQ A;  2ZD1 B;  4XDD A;  4ICL A;  3JSR A;  4M5G A;  4DQP A;  4CLL A;  2DRD A;  5F3T A;  3MR7 A;  2GHP A;  3O2I A;  2DXF A;  3TOQ A;  2XMV A;  3DGV A;  4P7V A;  5L9N A;  3D5M A;  3RJM B;  2XCA A;  4J7C A;  1HI8 A;  1L5U A;  2HHX A;  3LP0 B;  3TAP A;  1R8H A;  4DLE A;  1SKS A;  1N33 J;  1WF0 A;  2FZK B;  4OI4 A;  4OV1 A;  3WQP A;  1VFJ A;  2CJX B;  2M7S A;  1WNE A;  3NS6 A;  1ZZF A;  3BSA A;  2VJU A;  3RB6 A;  3HSJ A;  2BR0 A;  2MKK A;  3VHQ A;  3AT1 B;  3HVT A;  4C0H A;  2HVI A;  4DX5 A;  3S1T A;  4RUH A;  1RAA B;  2C28 A;  1RIS A;  4QQB A;  5LXY A;  5DM6 Q;  1A9N B;  3BQ1 A;  1S1V A;  1FRK A;  1X5O A;  4UOC A;  5SUH A;  4O3P A;  2YNI A;  2XHW A;  4LF6 F;  3NG8 A;  2A2D A;  2CZ4 A;  4OI1 A;  2MEW A;  2NCK L;  4DX6 A;  1RP5 A;  5BXI A;  4JI4 F;  1TKX A;  4HDH A;  4WP3 A;  4NMX A;  5CA5 A;  3D4J A;  4ZP6 A;  4WTO B;  3ZZR A;  3D0I E;  4OZN A;  2JSX A;  4P9S A;  4RPF A;  3TZW A;  2EC0 A;  1FRH A;  4HR2 A;  3E3X A;  4USU A;  4DV1 F;  2EFP A;  1TMM A;  3NEK A;  5HRO B;  3DLH A;  4DV7 J;  2R2U A;  3Q8S B;  3MMJ A;  3M05 A;  3VAM A;  1XC9 A;  4LF4 J;  2XSJ B;  4ZVR B;  3OVA A;  1TV6 B;  4P2X A;  5KFQ A;  1RI7 A;  3CE8 A;  5F8G A;  2F4V F;  4X65 J;  4K0K F;  3HLU A;  4R5P B;  3PTW A;  3OHB A;  1OWX A;  2UXD J;  3BYP A;  1UVM A;  3WBZ A;  3OTC A;  3QJJ A;  1KR4 A;  1N0U A;  1VC6 A;  1KN6 A;  3JAM Y;  2IA6 A;  2XZW A;  4M5M A;  5KFX A;  5KT2 A;  2JFD A;  3LP1 B;  1U6Z A;  5KFJ A;  3CJR A;  1OY9 A;  3QRQ A;  4X64 J;  2RU3 A;  2FDN A;  3HJV A;  3QZ7 A;  3F56 A;  1FO1 A;  3KUE A;  2QLJ B;  2B3T B;  4QYR A;  4BLG A;  5M2R A;  4F2R A;  4RU9 A;  3DOL B;  3RAX A;  2KFY A;  5J2P A;  5CXT A;  1FE0 A;  2QMU B;  2RDI A;  2K1R A;  2KO1 A;  1T8E A;  3EXC X;  1DQA A;  2NXC A;  1F2H A;  2YPY A;  2IRX A;  2LYV A;  2UXC F;  2AP6 A;  3HKZ D;  1RHU B;  3CME S;  3BPD A;  3BJY A;  5HQM A;  3VAH A;  2RAQ A;  1PCA A;  4YOE A;  2KH9 A;  1RJJ A;  2FY1 A;  2MJN A;  3UW1 A;  2ZNZ A;  3M6X A;  4DF4 A;  1K8A T;  3FFI A;  5EWF A;  2ZHB A;  3OL7 A;  1S9E B;  1RSC A;  2DNG A;  4DDF A;  3OJS A;  4F4K A;  4DQR A;  2AX1 A;  2CXE A;  2OML A;  3CMA S;  3V6D B;  1XTZ A;  3EYZ A;  1NEE A;  1DQ8 A;  1T03 A;  2M8D B;  3I31 A;  3KUH A;  4DCJ B;  4PPD A;  2BRK A;  1NDP A;  1TL4 A;  2HAI A;  5IOL A;  2CYY A;  3F44 A;  3ELH A;  3MOJ B;  2GO9 A;  4Z37 A;  2I5J A;  1QSL A;  5J2M A;  3GG0 A;  3MTK A;  3P45 B;  1Y4Z B;  2F8E X;  1CC7 A;  2K8G A;  3GIK A;  1NK7 A;  1NU4 A;  4WU3 A;  2IAJ B;  4DR2 F;  2WK4 A;  2UUB F;  1T3O A;  4RW6 B;  2EVZ A;  1TKZ B;  3QSY B;  3CSK A;  5ETR A;  4P74 A;  1JLB B;  1PYO B;  2FY8 A;  3DLK A;  1JJ2 R;  1HYS A;  2DR7 A;  4K4T A;  4ZVQ B;  4NPO A;  2W9C A;  5KFT A;  2J8A A;  4B3M J;  1I1G A;  3M6V A;  4GVB A;  1AT1 B;  4ANC A;  2WW8 A;  4KQZ A;  3WX4 A;  2CFX A;  3PX6 A;  1B0T A;  2APO A;  3SSR A;  1FI4 A;  3GFH A;  4KRW A;  4CT8 A;  1T9T A;  2V8H A;  4Q2L A;  2HWI A;  3HVW A;  2JLE A;  4WCE Q;  5IXU A;  2YNF B;  4LF6 J;  2BM1 A;  4C8M A;  4BC7 A;  4LJM A;  2Z2M A;  5E3R A;  4J9L A;  4WZQ A;  2XLJ A;  1B0P A;  4DL4 A;  1IKX B;  2H5I B;  2MGZ A;  2LXU A;  4F4X A;  1F0X A;  2BJE A;  2BQU A;  3PZP A;  2JRS A;  3LH2 S;  5D3G B;  2IM2 A;  1OJ4 A;  3QAT A;  1TAQ A;  4FKY A;  4A4J A;  1HNV B;  3MUT P;  3C6U A;  2XI2 A;  3Q8V A;  2BBE A;  3KK3 B;  2C42 A;  2YTC A;  1U24 A;  3DLG B;  1S6P B;  3DC2 A;  3K58 A;  3R1H A;  1UP1 A;  1X4A A;  4IR1 A;  5A8W A;  2MQL A;  2F4V J;  1T05 A;  3AD9 C;  4K0K J;  4C3L A;  1SKW A;  3O3L A;  5B09 A;  3L09 A;  3SDE A;  5E3P A;  2WSF C;  2AJQ A;  4RNM A;  2XSF A;  3M2U B;  2W9B B;  1XER A;  4RBV A;  3G6V A;  4MKY A;  1RK8 A;  4KPC A;  1NAQ A;  3VVU A;  2IJF A;  2J9D E;  1YJR A;  2OD6 A;  4IG3 B;  1MSW D;  3JQM A;  3QT7 A;  1AA1 B;  1VJQ A;  1M1K T;  3UD5 A;  1SH3 A;  4WWS A;  5AXK A;  4YR3 A;  2HQI A;  2KXN B;  2UXB J;  4P52 A;  1NB2 A;  3ZZP A;  3EPG A;  1ARO P;  3MM6 B;  2NUU G;  3BB5 A;  2VFR A;  2FJA B;  3V6H A;  2BQR A;  5EN1 A;  5A8K A;  2HIQ A;  2VKZ G;  3HD1 A;  2KHC A;  2PEB A;  5A8R A;  1RTI A;  5CYM A;  3KJF B;  3HUL A;  2HAF A;  4F3Q A;  2J0Q D;  1C4A A;  2E5L J;  3OFG A;  2W7A A;  3BH6 B;  4PG6 A;  2V4J A;  4DJB A;  1L3S A;  3VCD A;  3QIP A;  2QJ3 A;  3NCQ A;  1VIO A;  2VFS A;  1D8Y A;  3DRY A;  1YJ7 A;  1RA7 A;  1NHV A;  5LJ5 Y;  4E2F B;  2R2R A;  1Y5N B;  5H9F J;  1PGZ A;  2BKN A;  3BR8 A;  2OEJ A;  4LFC F;  1JLE B;  2H9Z A;  2KI2 A;  1X5P A;  2GGP B;  2AJ4 A;  4KO0 A;  1FFG B;  4LFA F;  5KFN A;  1JLG A;  5CAB A;  1IKW B;  1R0A B;  1TR0 A;  1FK9 B;  3NCR A;  3CCL S;  1UKU A;  1PJ5 A;  2XZT B;  1CQN A;  3IR7 B;  1NJZ A;  4Q43 A;  4AQY J;  1HBO B;  3A13 A;  4FPR A;  5HO4 A;  4USI A;  3MAA B;  2ZH3 A;  2P6T A;  1U49 A;  3T41 A;  3ENV A;  4O44 A;  3HPO A;  1IBC B;  2OPP B;  1RT3 A;  1R3N A;  1X5S A;  3KLH B;  4QW8 A;  1RWV B;  4DSF A;  1H98 A;  1WC4 A;  2ASY A;  1H7W A;  3CED A;  2BAN A;  3BS9 A;  1GTH A;  1Y5L B;  4KR0 B;  4C8K A;  2HND A;  2BMB A;  2GX8 A;  3QT5 A;  2L48 A;  1BWE A;  3V4I B;  1S48 A;  3MED A;  4J9R A;  4C8Z A;  4I6A A;  4MIB A;  1SBR A;  2P6S A;  1VQ6 S;  3DFE A;  2PMW A;  4TY9 A;  4GMK A;  5F41 A;  3LGM A;  1P9Q C;  2CRL A;  4MKB A;  5MAO A;  5LJ3 Y;  5IT0 A;  1H0H B;  2H1Y A;  5JJB A;  2O1P A;  1QUV A;  1M5S A;  1FX2 A;  1LWF A;  1U02 A;  2B4V A;  3R27 A;  2Q6C A;  4ZVO B;  3KFW X;  4OYB A;  3M8S A;  2MDA A;  4UST A;  1UJ6 A;  3U27 A;  2CWK A;  3GV8 B;  1A0O B;  2PO4 A;  2DIS A;  3HMJ G;  4U7U D;  2RT3 A;  5KAK A;  2DH8 A;  4N77 A;  1RWK B;  3W9J A;  3E8O A;  4DPT A;  3K57 A;  4NRU A;  1QJH A;  2ZIT A;  3IN5 A;  2DK2 A;  3BGR B;  2N3O A;  2YWF A;  4ZCL A;  3QO9 B;  1JLA A;  4KBI A;  3BKF A;  1UA0 A;  3OVS A;  2B9E A;  2FQQ B;  2FLN A;  5DDP C;  4G6V B;  4C98 A;  5LMU J;  1KFS A;  1U0H B;  3CD7 A;  2Y0B B;  3BBB A;  4O3S A;  5KG6 A;  1K1Q A;  4BC9 A;  2WTF A;  1BC6 A;  3MR2 A;  3EPI A;  4DCP B;  2B8P A;  2MSS A;  3GFX A;  2JLG A;  3M8R A;  5D4N A;  1KTV A;  2LQJ A;  5D77 A;  4UQG A;  1JLF B;  2J0W A;  1L3U A;  2OHD A;  1AZS B;  2DNZ A;  1G7C B;  3ITH B;  1NK4 A;  5ADZ A;  4MT1 A;  2K2P A;  1HPZ A;  1FFW B;  4ECX A;  3T9Z A;  1TVR B;  1FRL A;  4IOB A;  4TQS A;  2HHT A;  1D0E A;  2MQM A;  4L76 A;  3NBP A;  1O51 A;  1U7L A;  2DGO A;  2R8I A;  3G4S S;  2MQQ A;  2ROP A;  1RTJ A;  3GR1 A;  1CS4 B;  3D3C J;  4KFB B;  2QRR A;  1RDR A;  2OJ3 A;  1AXQ A;  2E44 A;  3K8W A;  1NK0 A;  2G2Y A;  1FDD A;  1YHQ S;  3CO0 P;  1D9A A;  1FJC A;  3JS9 A;  4IOC Q;  2ZJP Q;  4FBT A;  3J80 Y;  2YNH A;  3M8Q B;  4DBQ A;  1E6Y B;  4ZJL A;  4Y2A A;  2DGV A;  3PRV A;  4QPT A;  3KG1 A;  4CLZ A;  4KGM A;  2UZA A;  1TFY A;  1GXL A;  1FE4 A;  3PDN A;  2AHO B;  4JI2 F;  1T3N A;  2PFF B;  4JV5 J;  2AF6 A;  2FJV A;  4ZPT R;  1XMO F;  2WBR A;  3D1H A;  3QQC D;  2W7P A;  5HMY A;  4DSL A;  3C3L A;  2C3O A;  2ASD A;  3KMS A;  2W8K A;  1R31 A;  2DJW A;  1M5V C;  2XI3 A;  1UFK A;  1LW0 B;  2UVU A;  4FP9 A;  1ICE B;  4DMZ A;  2VDI A;  3W2W A;  1TZ0 A;  4FYX B;  1WEZ A;  1VRT A;  1F3V A;  3DKD A;  3NY0 A;  4URG A;  1NK8 A;  3QJL A;  1EX8 A;  5DM7 Q;  3RAQ A;  2ZH9 A;  4IR9 A;  1DLO B;  1RAI B;  4MFB B;  4ZLP A;  3LUY A;  2C2E A;  2J7K A;  3RW6 A;  1VQ5 S;  5GAE U;  3LOU A;  2KVI A;  2NXN A;  1WC3 A;  4ED3 A;  4V19 X;  1S10 A;  4JI6 F;  1RHK B;  4I69 A;  3IBF B;  2MKI A;  3KG4 A;  1HQU B;  1RTH A;  3ENW A;  2B4O A;  3NL0 A;  3DMJ A;  2CQD A;  4RWX A;  2VFT A;  3H5S A;  5KFH A;  2WSE C;  2AJF E;  5IQQ A;  4Z7Y A;  1DQ9 A;  5KFO A;  3P49 B;  4BCA A;  3TEH B;  1FVQ A;  2NYI A;  1DAX A;  2FJX A;  1PIL A;  5IZH A;  4IO1 A;  1NRK A;  3PW5 A;  4AL7 A;  1CJK A;  5H1S V;  3WDO A;  1TQL A;  3CJQ A;  1HA1 A;  2DNP A;  4KHP J;  1NND A;  4OLO A;  1X9M A;  2RD5 C;  5F8H A;  3PNI A;  4O0N A;  4LIW A;  3JTP A;  2BOP A;  1SL0 A;  4LIR A;  4OHZ A;  3H4D A;  1NJX A;  1RA6 A;  4O23 A;  3KLF B;  2XNQ A;  4ED4 A;  3CJ3 A;  1NSA A;  1NSK L;  3VGS A;  2DNQ A;  3FDS A;  2DY9 A;  4ETX A;  2GJF A;  2VQF F;  4F0M A;  1H73 A;  1RLC L;  1R6V A;  4MK7 A;  3C19 A;  2Z0G A;  2KXH A;  3MPW A;  3C6T A;  1FXL A;  4C7Q A;  1D3W A;  3T19 A;  3CJ8 A;  5LSL A;  2HK2 A;  3I0S B;  1F60 B;  4WJB A;  4B17 A;  1F5B A;  2LP4 A;  1RB0 A;  3CCZ A;  4J9K A;  3M6W A;  3TRG A;  2HUR A;  1ZPW X;  1VR6 A;  1RWP B;  2RIL A;  1W2B R;  3U1M A;  3Q83 A;  1HL6 A;  2LFV A;  2AEM A;  2HLT A;  4DV5 F;  5HLF B;  2JC0 A;  5GME A;  5B0E A;  3OSN A;  3ZZY A;  3FCV A;  1HW9 A;  3MMB B;  4GKK F;  2MKH A;  1DTT A;  1LWX A;  4CLT A;  5HMX A;  1S1U A;  2AJ0 A;  3R7N B;  5KFA A;  4OX6 A;  4DR4 F;  2HZV A;  4K5R A;  5ETT A;  1ZM4 A;  3FUY A;  2WON A;  1J5O B;  2GVZ A;  4HTJ A;  2HSE B;  4ZLJ A;  4R25 A;  4NEZ A;  3KOA A;  2ZUG A;  2H54 B;  4TY8 A;  4OYO A;  2N7Y A;  2DGS A;  1VQO S;  1QSS A;  2F9D A;  5G0R A;  2PFD A;  4A8M P;  1OSD A;  3DDK A;  4OYM A;  4FXV A;  4K4V A;  3FQK A;  5L46 A;  2MST A;  2D9P A;  3AJ1 A;  3T5L A;  2XY7 A;  2NZ4 A;  3MD1 A;  4UQT A;  3LQV A;  3CCV S;  4FNI A;  2IMW P;  3FRY A;  4JI5 F;  2NSB A;  3TEG A;  1MML A;  2N3L A;  3UWT A;  3SSQ A;  1R89 A;  3FSI A;  1I94 J;  2XUL A;  4RUC A;  1P8G A;  2E7W A;  2F4F A;  4OI6 A;  3X3U A;  2VQE F;  3V2U C;  4ZJQ A;  4ED5 A;  3W61 A;  1H2T Z;  1C0U B;  3CWJ A;  1CJV B;  3FKB A;  2ZNY A;  4OHW A;  3GE9 A;  4DV3 J;  3M9N B;  2HFO A;  5JVH Q;  2HQD A;  1UWB A;  5K8N A;  5ETO A;  1YX2 A;  2MTL A;  1HAR A;  2HKE A;  1HQE B;  4OZ0 A;  3H5U A;  3LP0 A;  4QU7 A;  3PHE A;  3T3F A;  1Q4R A;  3QAE A;  4ZPV R;  5E2Q A;  3O8W A;  1H7X A;  2IRU A;  4J9U E;  4I2P B;  2CQP A;  4P71 A;  1VK3 A;  2YWK A;  3DHX A;  3SYZ A;  5GAD U;  1RT5 B;  3A8K A;  1I6J A;  3HHL C;  3PW4 A;  1YJN S;  2R2S A;  2AGO A;  1NSP A;  2HBR B;  4LBP A;  3M2V B;  5HN0 A;  2HQC A;  1HMV B;  1U8S A;  1RCO B;  3MM8 B;  4Y3C A;  3CGI A;  1S49 A;  1OIA A;  2IC3 B;  1N32 J;  5B0C A;  2DCL A;  2COL A;  4DL6 A;  5ETM A;  2OUG A;  2ZWO A;  1SPB P;  4JB8 B;  4HT7 A;  2CUY A;  2BKO A;  2P9G A;  5J2Q B;  5LSR A;  4F4Z A;  2DVI A;  4W92 B;  1IKV A;  4ECR A;  5L1L A;  1XWL A;  4M5I A;  5HAN A;  1CUL B;  2ZH6 A;  2C2R A;  5FII A;  4M5H A;  3POT B;  2VBZ A;  4HTI A;  2VBW A;  5HRO A;  2DEI A;  3EXY A;  3MCM A;  1R0B G;  3HHK A;  3KLI B;  4FDF A;  2ZUA A;  4FN5 A;  3CCR S;  4CLY A;  3NAH A;  4QYZ K;  1TK8 A;  1KQF B;  2MY8 A;  3E01 A;  1RE1 B;  1TV6 A;  3RRK A;  2DNH A;  2JOQ A;  4F8R A;  2D1C A;  2MZS A;  2E66 A;  3W1Y C;  1TL7 B;  3QYY A;  2XO6 A;  4R5P A;  1UEV A;  3DGP B;  4Q7A A;  1IR1 A;  1XNR F;  2JL9 A;  4K2X A;  1SQF A;  1S6Q B;  2DRB A;  1FD8 A;  2HFV A;  3PAC A;  3KJN B;  3CCW A;  4DV5 J;  4DPX A;  3LP1 A;  1VBX A;  5CZX A;  2WW4 A;  3UCZ P;  2LA6 A;  4U8Y A;  4GVL A;  5IQ6 A;  2BRL A;  4JV1 A;  4GKK J;  2RDD A;  1LWE A;  3KLE A;  1SJ4 P;  3GIL A;  4URQ U;  5F8J A;  2YWE A;  1TU0 B;  2J8S A;  4ZLL A;  3T5J A;  5KFW A;  4DR5 J;  2ZHO A;  5KFZ A;  4DR4 J;  3TZZ A;  4ZP8 A;  1NBE B;  1R27 B;  2RE1 A;  2W01 A;  4X2B A;  1VQ8 S;  3JYT A;  2RQK A;  3H20 A;  4M94 A;  2Q66 A;  5A76 A;  3TI0 A;  1OO0 B;  3PJ9 A;  6FDR A;  2YQ1 A;  2VB6 A;  1C2P A;  4EFA C;  2MYF A;  2Y8W A;  2QFI A;  1XR7 A;  1V3R A;  1S9E A;  4YFU A;  3CTR A;  1XQI A;  2VKR A;  1VHI A;  3I9Z A;  3R97 A;  1SI9 A;  2BJ1 A;  2POK A;  2PN6 A;  5DJB A;  5KFP A;  3TWZ A;  5GMD A;  2XLK A;  3V6D A;  4MH8 A;  3EWG A;  3C16 B;  4UOH A;  2GML A;  4JI5 J;  3LPE A;  8AT1 B;  4NYO A;  1JJ4 A;  4LRB A;  2L08 A;  2ZDO A;  3JXO A;  2CNL B;  4I56 A;  1VQL S;  3OPK A;  1KOO A;  4PAA A;  4R8U B;  2YQ0 A;  3I5A A;  2DGT A;  4NLT A;  1UAW A;  1BHN A;  4ECQ A;  3K5M A;  3CJK B;  2Z2Y B;  3OTE A;  2IAJ A;  3DOK B;  2CQB A;  4LF1 A;  4ES2 A;  4RW6 A;  1UVI A;  4XIU A;  4WBF A;  4FF3 A;  1TKZ A;  1ZH5 A;  4WTY A;  3FBC A;  4KSE B;  1CQM A;  2CJB A;  5AXM A;  3M9O B;  1NK6 A;  1SV5 B;  2AMC B;  1JLB A;  3R7S B;  2PT0 A;  4B02 A;  3HFK A;  2C3P A;  2L41 A;  1X4H A;  2IYG A;  2OEK A;  4DUT A;  2IBK A;  2ZWP A;  2C3M A;  4G1I A;  2V4R A;  1I3O B;  4A8K A;  3RRG A;  1CEZ A;  3TVK A;  3PV8 A;  5AJ3 J;  2R8G A;  2BV3 A;  2WRM A;  3S6E A;  2LA4 A;  4KGK A;  5CYQ A;  1NKC A;  1Z2L A;  4UZC A;  2YNF A;  3VAG A;  4DL5 A;  2EEY A;  3MR5 A;  2QLW A;  2CQG A;  5F0U A;  4WXO A;  9ATC B;  2ALZ A;  5K14 B;  2XWX A;  4ZVF A;  2P2C B;  3U1N A;  4K4X A;  4PG4 A;  3FNN A;  4BWJ A;  1IKX A;  3GCW P;  1YRX A;  3B8H A;  5KT6 A;  3I0R B;  1L3V A;  1YZ6 A;  2IDL A;  5D3G A;  3A4T A;  4L72 B;  3IAS 9;  1IBM J;  2LDI A;  1IUJ A;  1S79 A;  2FHJ A;  2YKN B;  2O01 C;  3EGW B;  4LUB A;  2NRE A;  3NGU A;  3HSG A;  3QT8 A;  3CJ4 A;  4KV8 B;  3PX0 A;  4DR6 J;  1S6P A;  1NB7 A;  1OQ6 A;  4TU7 A;  3MMC A;  1BE4 A;  1O8B A;  5JXS A;  1Q5V A;  1XNR J;  4KYZ A;  2JFK A;  3M2U A;  2DIV A;  4FS1 A;  4CLS A;  3FRZ A;  3Q86 A;  4DR7 F;  5E0O A;  1S6O A;  1HWK A;  2OO4 A;  2WSC C;  1S7I A;  5ETQ A;  4I7F B;  1ZOT A;  3SCL E;  4KKO B;  2HMI B;  2XLI A;  3L7O A;  5F8N A;  5H9E J;  2P8I A;  2V94 A;  1HWJ A;  1TKT B;  4C8Y A;  3ET6 B;  3MM6 A;  3H59 A;  4ES3 A;  3CC7 S;  3MEE B;  5LMN F;  2CPF A;  4DFJ A;  2ZVS A;  4ETZ A;  1PO6 A;  1WHV A;  2QN6 B;  1KSP A;  1NJI T;  1BY9 A;  4A47 A;  3TAM B;  2K7K A;  3A3O B;  3RB4 A;  4F67 A;  2VDH A;  4IG0 B;  2D74 B;  4TLR A;  4WK3 A;  1RBA A;  2C3Y A;  3SV3 A;  4C8N A;  4DFP A;  1AFI A;  4KGV B;  2HNZ B;  4RW7 B;  3WC0 A;  1MMD A;  4EI2 A;  4NXN J;  2HFU A;  2CQI A;  1JLE A;  5L1J A;  2ZVI A;  1NME B;  2B43 A;  4PWU A;  4XAK A;  1U2R A;  1IKW A;  2A10 A;  1R0A A;  4PCQ A;  4ED1 A;  2BJ8 A;  2QA4 G;  2E1A A;  2LQ8 A;  1MWQ A;  4ALZ A;  1KC8 T;  4OV6 A;  2AYB A;  1HBO A;  4NAS A;  3OTB A;  2F3J A;  4J9M A;  3I55 S;  2HQ3 A;  3MAA A;  1F9H A;  1P6T A;  2MPU A;  2VFV A;  5KG0 A;  3OL9 A;  4FZV A;  2X1B A;  2V2Q A;  3CJT A;  4Z2X A;  4ZK7 M;  1IKY B;  2VUG A;  2OPP A;  3TAR A;  3CDW A;  5HMZ A;  3KLG B;  1YQH A;  2VIH A;  1YDL A;  3H0P A;  2G0I A;  2NLW A;  2RF2 B;  1S59 A;  1S9G B;  1VRU A;  2DR9 A;  3BR9 A;  4L3K A;  2ZJQ Q;  2E5H A;  4NA3 A;  4CYU B;  1WC0 A;  3BYR A;  5EX3 A;  3V4I A;  1HNW F;  1ROF A;  4JI7 J;  1TUW A;  2DEJ A;  1S1T B;  1TL3 A;  4CLU A;  5GMK a;  2A3J A;  4NA2 A;  1YGY A;  4I4B A;  1U26 A;  1UL3 A;  1U6B A;  3V4M A;  2R7W A;  4NCG B;  3T1H F;  2XTJ P;  4TKT A;  2CWX A;  5CAA A;  3W8P A;  1W26 A;  1YJT A;  4U67 Q;  1N54 B;  4YP3 A;  4NLP A;  2PMZ D;  2LEA A;  4EU0 A;  4G3I A;  2F5G A;  2GVD B;  2HFS A;  4M5D A;  4HVZ A;  4CH0 S;  3OBI A;  1Q86 T;  2PII A;  1S72 S;  4PWD B;  1WDT A;  4P75 A;  2MLZ A;  4XPC A;  3BGR A;  1PC4 A;  2ZC3 A;  3RZA A;  5DG8 A;  2MLX A;  3QO9 A;  2CPJ A;  6FD1 A;  1K73 T;  3PEJ A;  1NK5 A;  1XR5 A;  4RW9 B;  1XJW B;  4RLE A;  4DQS A;  3PHT A;  4IH6 A;  3K89 A;  1U0H A;  4A8O A;  2OI2 A;  1MRO B;  1HIY A;  2ZM6 F;  3G8Q A;  4IH7 A;  2HS4 A;  2CPI A;  1ZA2 B;  1RTD B;  3M4X A;  1GAO A;  2Q6B A;  4CO4 A;  2BW2 A;  1JLF A;  5C25 B;  3K5O A;  4JBC A;  2DR8 A;  5KOW A;  5C42 B;  3HFZ B;  1AZS A;  3H40 A;  3ITH A;  3IGN A;  3UCU P;  1JLC B;  3TUP A;  1HNZ F;  3H90 A;  1F2G A;  1MNE A;  3N0V A;  1TVR A;  2YWW A;  3PIP Q;  3OTO F;  4QOT A;  5C2G A;  3CCE S;  4N8N A;  4CDI A;  2KU7 A;  4PR6 A;  3J7Y U;  5BR8 F;  1RHJ B;  1VQP S;  3OW2 R;  4F2S A;  2PA3 A;  3JAM U;  4ECW A;  3I4P A;  2DRA A;  1O6X A;  3UD3 P;  1JXV A;  4QWE A;  5E7O B;  1LV5 A;  5KG5 A;  1WSV A;  2BOA A;  3B4M A;  1AUD A;  3LWL A;  3ZO7 A;  1Q8L A;  2C1E B;  2XYH B;  1ACM B;  4F36 A;  1KOH A;  1G2E A;  2IHR 1;  4USJ C;  3I6P A;  2W25 A;  2XMA A;  4C8L A;  4H4K A;  2W2N P;  1E6Y A;  3W5Z A;  2ZFH A;  3UDC A;  2YKA A;  3MM9 B;  1DAR A;  4RWW A;  3I96 A;  1RBL A;  4DL2 A;  2C3U A;  2DKO B;  3HX9 A;  2FJW A;  1GNK A;  4TYA A;  2C2K B;  3EE3 A;  4F04 B;  2X3G A;  1BLU A;  3I56 S;  4FS2 A;  5HVH A;  2N7C A;  4J5O A;  3AB2 B;  4GKJ F;  4A8X A;  2XZD B;  3CXC R;  5CD4 A;  3ZZO A;  3ETO A;  1KDN A;  5DZ6 A;  1AUS L;  1LW0 A;  3PX4 A;  1WKJ A;  2GQQ A;  4YR0 A;  1Z2Z A;  2QTW A;  4E8U A;  2E9R X;  4F4W A;  2KT5 A;  4ZJO A;  4RW8 B;  1ZAW A;  3CPW R;  4TVA B;  4DL3 A;  1UVL A;  1O0P A;  4ZVH A;  2YBV A;  1IBK F;  4CM0 A;  4OYZ A;  1JWW A;  1DLO A;  4MFB A;  5HAT A;  2WVF A;  6AT1 B;  2Z8Q A;  4LQ3 A;  1NZ8 A;  2W4C A;  1I5O B;  1VYA A;  2LXF A;  4OYA A;  3TVZ A;  4OI3 A;  1F6T A;  3OFH A;  3MMA A;  4IFY B;  4Y2K A;  3QWU A;  1CC8 A;  3BSO A;  2VL1 A;  1HNW J;  1HQU A;  8RUC A;  2PI4 A;  4RKU C;  3AQP A;  4YEA A;  2RKI A;  4YY3 J;  1OS5 A;  1S0V A;  4CM2 A;  4K7Q A;  2XS5 A;  4DV4 F;  1QSY A;  1JX4 A;  5IS2 A;  4FBU A;  2ZBP A;  4DUZ J;  4WKY A;  4F25 A;  4RR5 A;  5J2N B;  1FRX A;  4NLU A;  2WOM B;  4MIA A;  1MU2 A;  1GX5 A;  3T1H J;  1MWZ A;  4I0W A;  1ZPV A;  2QG9 B;  3P96 A;  1C1C B;  1DJ0 A;  3D3B J;  2GQ2 A;  3EZU A;  3KXD A;  2VV5 A;  4IH5 A;  1S5Z A;  5BYQ A;  3VR1 A;  4B9V A;  3KLF A;  2M5Y A;  3C46 A;  2G1H A;  4WII A;  1FJ7 A;  2J76 E;  3N5B A;  5M2P A;  3VGV A;  3ZZT A;  5KFV A;  2MZJ A;  1ZAV A;  3M1V B;  3WHI A;  2B0G A;  3GON A;  3BQ0 A;  3KJV B;  4LF7 F;  1U2F A;  1VBK A;  3I0S A;  3H7H B;  4OZ1 A;  4LBI A;  4UW2 A;  2ZM6 J;  2MQO A;  3G71 S;  3ISN C;  2XYG B;  3IWX A;  3H4B A;  3DRS B;  3J81 Y;  1RT1 A;  4P2F A;  5FJ4 A;  5C7P A;  5U47 A;  4RU2 A;  2G1D A;  3HO1 A;  4C3K A;  2CPZ A;  3SBM A;  4B9M A;  1RWX B;  4QIG A;  2E1M C;  1SKR A;  1UET A;  3BN4 A;  3QWP A;  1WTB A;  3VAK A;  3BO4 A;  3OFE A;  2M88 A;  1HR0 J;  1R43 A;  2GQC A;  2OH2 A;  2J9D A;  3NLC A;  3S01 A;  1HNZ J;  2JH3 A;  1UVN A;  3CNQ P;  4TXS A;  1LOU A;  5HLF A;  1SQG A;  4XPE A;  3GWC A;  4X4T A;  4LSZ B;  3OHA A;  1OQ3 A;  4P10 A;  4HAC A;  2ROE A;  5LOQ A;  5BR8 J;  2UVR A;  2DY1 A;  1Q79 A;  5HJY A;  1TTH B;  3GYN A;  3H25 A;  4LRF A;  4OX7 A;  2VG6 B;  2EC2 A;  2E9T A;  2E5I A;  5DQI A;  2KL8 A;  1VBY A;  5FDL B;  5LL6 d;  1H6K X;  4DV6 F;  2ZE2 B;  1NPP A;  1S76 D;  4NEY A;  1J5O A;  2RQC A;  1X4F A;  4X4O A;  3G6X A;  2BYC A;  3BF4 A;  3ZXW A;  2ATC B;  3NNH A;  3TZX A;  5F9L A;  1FFS B;  5GVQ A;  2W9A A;  4DFM A;  3BM7 A;  1BQM A;  2DH9 A;  2W2M P;  3ENA A;  2UU9 F;  2HWH A;  5HL7 Q;  4ED7 A;  3MCN A;  3JSY A;  5DDO C;  4NX9 A;  1YJ9 S;  2CJA A;  1YJV A;  1LXN A;  2D41 A;  4IQM A;  4GKJ J;  2AEJ A;  2W8L A;  4OX9 J;  2UVV A;  2P5V A;  3UR3 C;  4CLW A;  2HS0 A;  1SQE A;  2XMJ A;  4Q45 A;  1N48 A;  2JHE A;  2WB1 D;  5IWA F;  1NDL A;  1TKX B;  2DXE A;  3THP A;  2QC3 A;  3EGZ A;  4RW4 B;  1FJG J;  3HFV A;  3D28 A;  1VHF A;  1CJV A;  3T1A A;  1IBK J;  3HJF A;  1SB6 A;  4ZCM A;  4CH1 A;  3CJ2 A;  2A2C A;  4U95 A;  3GR0 A;  1E6V B;  1FNO A;  2GW8 A;  4OLP A;  3SCI E;  3A1Y G;  1HKA A;  1HQE A;  3QT6 A;  3ISZ A;  4QWA A;  3UPF A;  1TK0 A;  2EG1 A;  1D09 B;  4LVO P;  2OKQ A;  2V50 A;  2IVM A;  3D6H B;  2ZC4 A;  3D1O A;  4RBT A;  4HHJ A;  4I2P A;  2G2Z A;  4JI1 F;  2LVW A;  4YUD A;  3UQS A;  5CCL A;  2BX6 A;  3JQJ A;  1FRM A;  2OSQ A;  2O3D A;  5EHH A;  4O3R A;  1GFW B;  5L9X A;  1YLX A;  3A12 A;  4YB6 A;  2KVQ E;  5HP1 B;  3M2V A;  1XMB A;  2B7C B;  1LNQ A;  3Q23 A;  5KFC A;  3L7P A;  3PM9 A;  1MN7 A;  5CH7 B;  4B3R J;  3MM8 A;  3SFG A;  4TYB A;  2IC3 A;  5HSP A;  2AKW B;  3CUL A;  1K9M T;  3NGD A;  1VIS A;  4ZCI A;  1M90 T;  1GMW D;  1VQS A;  5J2Q A;  5JUM A;  1FTC A;  4F3M A;  4LFB F;  1U47 A;  2WVC A;  1NK9 A;  3DI6 B;  3TP2 A;  4DR1 F;  4ZVE A;  3IBW A;  5K8M A;  1KEK A;  1CUL A;  1X7V A;  3POT A;  4HH1 A;  4H4K C;  1ULR A;  1FHT A;  2AZ3 A;  2JC1 A;  2HLU A;  1TP7 A;  4LF7 J;  2PD1 A;  3VAF A;  3JTN A;  2M52 A;  3W2V B;  4V1A k;  2JVO A;  3KLI A;  2VAS A;  1TL1 B;  4NI2 B;  4DPW A;  2BKP A;  5KFS A;  2X7I A;  3AH6 A;  2CZ9 A;  1JLQ A;  1JJC B;  3DU5 A;  3QSI A;  2AJ2 A;  1TL7 A;  1IM6 A;  3OTD A;  5HJX A;  2XMT A;  1T9V A;  2FVQ A;  2EG2 A;  4CZC A;  3FEX B;  3D66 A;  4DHV A;  2CPH A;  3PYG A;  4ATN A;  4WFX A;  5HMW A;  3MM7 A;  3CC4 S;  2Q79 A;  5ETV A;  1YBA A;  1FT8 A;  4WFY A;  3CCM S;  4EYI B;  2DHA A;  4J9V A;  1CJU B;  3UE2 A;  2AX0 A;  1H74 A;  4JI3 F;  4D3G A;  2WB4 A;  1LK5 A;  3R5D A;  3IGV A;  1RHM B;  5GAG I;  2DGQ A;  1VQ9 S;  2B51 A;  1XR6 A;  2HWT A;  3UNG C;  1RT6 A;  3PIO Q;  2HFZ A;  5AE3 A;  1O5J A;  4DG1 B;  2HG4 A;  1S4E A;  4L74 A;  2Z58 B;  2J7U A;  2W9C B;  3LA0 A;  1YKW A;  1FX4 A;  3IG1 B;  5C2C A;  3V6J A;  1JKH B;  4GVB B;  3AFG A;  3WIU A;  5K8P A;  3CCU S;  2HW3 A;  3K2Y A;  4DWI A;  1YVF A;  4LF8 J;  2Y1L B;  2SXL A;  4NLV A;  2UU9 J;  1SJ1 A;  2FHK A;  2QFJ A;  4FYW B;  4N41 A;  4FF2 A;  3TUI C;  4B08 A;  4KB7 A;  2MKC A;  2KZZ A;  2LU1 A;  4M95 A;  5D0E A;  3C16 A;  3CJ0 A;  3MAH A;  3P4U B;  3VQS A;  4NCB A;  3Q89 A;  3ILI A;  3J80 U;  3M32 B;  3FQL A;  5KFD A;  4J91 A;  1EKR A;  4R8U A;  1KVJ A;  2F1F A;  5CD4 H;  3A3N B;  4F50 A;  2CDQ A;  4X84 A;  2DNL A;  2JVR A;  3THV A;  3A8I A;  3CJK A;  4OJH A;  2OD4 A;  4PXE A;  4M1K A;  1IWA A;  3DOK A;  2VF3 A;  1HW8 A;  2M70 A;  5DQG A;  3RB0 A;  4IYQ A;  3PR4 A;  4PYD A;  2OGU A;  3N6N A;  4X62 J;  4PXD A;  4ZN3 A;  2YX4 A;  1SV5 A;  4FF1 A;  3AJ2 A;  5FD1 A;  5KG4 A;  4DZ6 A;  2WAQ D;  5GAH I;  4C11 B;  4PUO B;  3EZ5 A;  3T1Y F;  2IJN A;  4KTQ A;  3TUZ C;  5AT1 B;  2AYE A;  2P9C A;  3BQ2 A;  4JI1 J;  5A8W B;  3FMB A;  1REV B;  4PKD B;  2X1G A;  5C24 B;  2D3U A;  2LMI A;  3NNC A;  3SDE B;  1YJU A;  2N82 B;  4DPO A;  4QR1 A;  2UVW A;  4DSI A;  2G0J A;  4RNF A;  2IM0 A;  1HFE L;  2HVD A;  5CYJ A;  1RU2 A;  4OZ2 A;  1X0F A;  1CG2 A;  4NLR A;  2XC9 A;  4J9Q A;  3MEG B;  1LW2 B;  3IP0 A;  2XG8 A;  4JUZ A;  5K14 A;  1V3S A;  1YWX A;  2VG7 B;  2HBY B;  2XB2 D;  2UUC F;  1KLM A;  3W5Y A;  3I0R A;  2FZG B;  4DQI A;  4DX8 H;  3O5T B;  4DCO B;  3AJD A;  1WC6 A;  4X4U A;  1VQK S;  1WJ9 A;  4YS2 A;  1CPZ A;  2W4D A;  3BH7 B;  4DN0 A;  2CG8 A;  3ZTS A;  5G4D A;  3Q8R B;  4F0H A;  3R8Y A;  2YKN A;  1N5Y B;  1NKB A;  1TEL A;  2J0S D;  1N6Q B;  3EJM A;  2JWN A;  3J7Y I;  1VMB A;  4OMF G;  2GIR A;  4ZKA A;  5E5N A;  4KV8 A;  2L9W A;  4QIE A;  3GYG A;  3S7R A;  2V4J B;  3P8B B;  4OYP A;  3ONQ A;  1FKP A;  4I64 A;  4LRC A;  1VC5 A;  4A8Y A;  2YNG B;  2RH3 A;  1DZ5 A;  1HWL A;  5HVG A;  4DQQ A;  3ZZU A;  1KVK A;  1CSJ A;  2QA1 A;  3AOB A;  3D6F B;  3DRP B;  4YDX A;  2O67 A;  3LO3 A;  3GLJ A;  3TZY A;  2HRY A;  1X4E A;  4BHQ A;  2H5J B;  2LQ5 A;  4NCA A;  1B0V A;  1U6F A;  3OQ2 A;  1FDN A;  4DXL A;  3DRR B;  4JI3 J;  2QA4 S;  2BJD A;  4I7F A;  1JMT A;  1U1N A;  2CQ3 A;  1HBU B;  3IWL A;  4KKO A;  2DGU A;  2HMI A;  2EK1 A;  1ZM3 A;  2GJI A;  2XCP A;  2JZ5 A;  1WWH A;  4JI4 J;  1WG1 A;  5HBM A;  4XK8 C;  1T9Y A;  3AY0 A;  4X4P A;  3BDE A;  3IR5 B;  1TKT A;  2F63 A;  3ET6 A;  3S8S A;  2OPS B;  4ED8 A;  4DLG A;  3MD3 A;  2CJQ A;  3MEE A;  4DV1 J;  4KC5 A;  3GV7 B;  3CD5 A;  1JNR B;  4NZ7 A;  3ADA C;  2IBO A;  1FER A;  3KHH A;  5CCM A;  3T6J A;  4Q0B B;  2YH0 A;  1WKK A;  3TAM A;  1HHS A;  2HND B;  2YX1 A;  5KFK A;  2H5E A;  4ZDN A;  4IG0 A;  1MMN A;  4C4W A;  1B64 A;  3HHL D;  3IM9 A;  2BAC A;  1NH8 A;  3L9Z A;  4X66 F;  1WOP A;  4QIW D;  2HNZ A;  4RW7 A;  3VGT A;  1R6Y A;  3G2X A;  1RTZ A;  3TQE A;  1UMJ A;  4TN2 A;  1VOM A;  2HYI B;  2ZOG A;  4WKR A;  4HT5 A;  2KJV A;  1FKA F;  1QAY A;  3C15 B;  2AYM A;  1EB0 A;  2U2F A;  1IBL F;  2JJ4 D;  2PSZ A;  1ZA1 B;  3Q24 A;  2KYZ A;  3FZB A;  4EO6 A;  2CAD A;  2CQ2 A;  1EKS A;  2AQ4 A;  4XDC A;  2VIC A;  2V69 A;  3T1Y J;  2N4C A;  3KLG A;  4EK2 A;  2RSQ A;  2BUN A;  4JI0 F;  2RF2 A;  3RBX A;  1C4C A;  1R8C A;  5B0D A;  2QYC A;  2UXC J;  3NWR A;  4DV0 F;  2O5D A;  2M3D A;  3D1Q A;  2R7T A;  1X4B A;  4BDP A;  3HT0 A;  3KG0 A;  4H4M B;  3GYX B;  3MEC B;  3HK2 A;  1P1T A;  4OZL A;  5KFL A;  2V68 A;  4B3O B;  2KHD A;  4CQ1 A;  1LQ9 A;  3MR3 A;  1Y3J A;  2VG5 B;  1FXD A;  1J27 A;  5D0H A;  1S1T A;  5LM7 E;  3N01 A;  2HBQ B;  2KYX A;  1VJW A;  3IA0 A;  2GHW A;  2JEI A;  2YKM B;  5KFM A;  4HYK A;  2HHW A;  4NCG A;  1SH2 A;  2I8E A;  3PO4 A;  2UUC J;  1CLF A;  3HF5 A;  3HHL B;  1QE1 B;  4ED0 A;  5K9F A;  3PYF A;  2DXD A;  1F3F A;  3EUN A;  2R7V A;  2GFF A;  2BXJ A;  3IS9 B;  3EGV A;  4BS2 A;  3CT9 A;  3FCW A;  4DR2 J;  2MQ8 A;  4JV0 A;  3O1L A;  2UUB J;  2IA0 A;  3TA1 A;  4J9O A;  4J37 A;  1RTJ B;  3EVO A;  4ZIV A;  4Q5V A;  1WOO A;  3HXM A;  5T7L B;  4PWD A;  1AW0 A;  4OJG A;  3IBC B;  1QVF R;  3G9C A;  3AOA A;  2F40 A;  5I42 B;  3K59 A;  4ECT A;  1H3D A;  1NJW A;  3CDB A;  2ZZM A;  4N5S A;  4RW9 A;  3AHP A;  1SH0 A;  4PG7 A;  2C22 A;  3SQO P;  1HI0 P;  1WF2 A;  4LSN A;  4AXI A;  5F0W A;  1Y9O A;  1NDK A;  2NXU A;  1IR0 A;  5AE2 A;  2DD8 S;  1RQ0 A;  1RTD A;  5BYS A;  3L95 X;  1C1B B;  3GB0 A;  1VI7 A;  4WZM A;  2VU5 A;  2OAU A;  4F4Y A;  3DYA B;  4WF9 Q;  2R2T A;  1X31 C;  2XNR A;  5C25 A;  4J9N A;  2OPQ B;  5C42 A;  1RT7 B;  1RZM A;  1JLC A;  2GCF A;  3W9I A;  3KHL A;  3DLL Q;  3CCT A;  3UFC X;  3TJA A;  1TK5 A;  4DN9 A;  2RUS A;  3QMQ A;  3SIP B;  4CO3 A;  5E3C A;  3ZZ0 A;  2YVS A;  3EMT A;  2RRN A;  4RJV A;  5LXR A;  4I2Q A;  3THT A;  2AJ1 A;  2ADB A;  5E3A A;  3KK1 B;  1PC5 A;  3TVY A;  4C0O C;  4DU8 A;  1UW9 A;  4ED2 A;  4WFN Q;  2YH1 A;  3BBF A;  2XWY A;  3BBC A;  2HVZ A;  3E51 A;  3M8P B;  7FD1 A;  3H42 A;  4ED6 A;  2U1A A;  1QAJ A;  4EO8 A;  2QT7 A;  2XEX A;  2E5G A;  3SQG A;  4IRC A;  3JSM B;  2OMO A;  3MTJ A;  2ZH5 A;  1N33 F;  3ZTR A;  3UDE A;  4M5L A;  3T5H A;  3MM9 A;  2OLW A;  3SCJ E;  1P27 B;  7FDR A;  1KNZ A;  2HQF A;  1S0O A;  3A8E A;  4X66 J;  3VQT A;  2EWH A;  1R7I A;  3UVJ B;  2BE2 B;  3GJS B;  4L73 A;  3GV5 B;  5DG9 A;  2CQ1 A;  3AD7 C;  5ITH A;  3Q2S C;  3MZI A;  3IRX B;  3NXZ A;  2HQG A;  3BGL A;  3BKT A;  3GFZ A;  2ZKT A;  1IWG A;  2Y8Y A;  4CTA B;  2LCW A;  1U1R A;  3OUY B;  1BWV A;  2Z2Z A;  1VGY A;  3CIM A;  2F8H A;  1WC1 A;  2J6T A;  1JJH A;  4ZPC A;  2DO0 A;  5DQH A;  4QIV A;  3HT3 A;  3L4B C;  4ANE A;  2KKH A;  2V2Z A;  2JEF A;  3IO1 A;  3V5R A;  1UZH A;  4WYL A;  1QTN B;  2I2Y A;  2PE8 A;  3C6T B;  2ZBI A;  1HBN B;  4I1T A;  1JXL A;  2H3E B;  1RLD A;  1XN9 A;  2V9K A;  1U45 A;  4C3M A;  4HL9 A;  2R7R A;  1OY8 A;  3M2R B;  4IFY A;  4PAB A;  4LF4 F;  3BGO P;  3K0J A;  4OL8 A;  2LDY A;  4ZOS A;  1K1S A;  2WZ1 A;  5DG7 A;  2XY5 A;  2XYP B;  1IM4 A;  1K0V A;  3R5J B;  2OFH X;  4X65 F;  2K7J A;  5J2N A;  2UXD F;  4N76 A;  1U1M A;  5H9E K;  2Q1L A;  2Z4P A;  4LFC J;  1RT2 B;  1NXI A;  2BAB A;  2K06 A;  4LFA J;  3GMG A;  2GS8 A;  4X64 F;  2KRR A;  2DHH A;  4IO9 Q;  3M8W A;  2PEH A;  1R8A A;  2ZZN A;  3D68 A;  4WE1 A;  5K5M A;  1A6L A;  1T0T V;  3ETM A;  4I6W A;  4YB7 A;  4ID5 B;  1AYE A;  4QJV A;  1X0P A;  4ZS6 A;  3SXL A;  3B82 A;  1Y5I B;  2E7V A;  4PRF A;  1IVZ A;  1VRQ C;  2JEG A;  4MJK A;  2L3M A;  2KM8 C;  2RUG A;  1BUX A;  2HHH F;  4F4A A;  3FSY A;  4UUX A;  1DHM A;  3KJV A;  4DSJ A;  3KNA A;  4YN3 B;  2ZOM A;  4TY8 B;  1QVG R;  3R2C J;  2OFG X;  1N56 A;  1RWO B;  1URR A;  3R5A A;  2I0X A;  2ACY A;  5J1E B;  1S1X B;  3PG9 A;  4NLD A;  3EVM A;  1NHU A;  4RZR A;  3DRS A;  1PG5 B;  3I32 A;  4DUY F;  1N5Q A;  4WYW A;  4JV2 A;  4IRD A;  2BE9 B;  2HS3 A;  2ZJR Q;  1VQY A;  2EFO A;  1MG7 A;  3KMQ A;  4ZHR B;  1KP6 A;  3R1L A;  2G2O A;  9RUB A;  3QGP A;  2C2O B;  4CO1 A;  4R0E A;  4EYH B;  2V8D A;  4H54 A;  4NRT A;  1OYE A;  2VOD A;  2AGQ A;  4UOF A;  3UN3 A;  5L1K A;  1D9F A;  2BJ7 A;  1RU1 A;  1BD6 A;  1B70 B;  4W98 A;  2VG6 A;  2K3K A;  4UUW A;  4CCH A;  2RRA A;  1AB8 A;  5FDL A;  1UEU A;  3NGR A;  1UWB B;  2CA9 A;  2Z56 B;  3VAL A;  2ZE2 A;  4CH7 A;  5A6P A;  4OYX A;  2I38 A;  4BWM A;  3WZ0 A;  4B3M F;  4W4M A;  4OFZ A;  2ABY A;  4ELV A;  2KG0 A;  1FDB A;  3ILJ A;  4WXW A;  1UPP A;  2PI5 A;  5D0G A;  4K59 A;  4K4Z A;  3L7U A;  4UTG A;  3BGF A;  4NLW A;  4DSE A;  2HHS A;  2A1B A;  2QMW A;  5HQ8 A;  4Z7C A;  1U0S A;  2GAG C;  5L38 A;  4ZPB A;  2EK6 A;  3CUN A;  2B4P A;  4F0K A;  4EBC A;  2YY3 A;  1VS3 A;  1V6H A;  2QLB B;  3KLV A;  3NWG A;  2ZBC A;  3HVR A;  2OEL A;  4WFZ A;  1NKE A;  3VTI A;  2IMO A;  1TFW A;  1NPR A;  4YQW A;  4P7T A;  4B9L A;  1ZET A;  2QO3 A;  4N7T A;  4RW4 A;  1IKV B;  5DRK A;  2D69 A;  1E6V A;  3HVA A;  1QD1 A;  1T11 A;  2ILZ A;  1G1X A;  1WI6 A;  2KXF A;  1GXT A;  1Z1Z A;  4ITS A;  3E01 B;  1S9F A;  1SJR A;  4AFF A;  3RAM A;  5IM0 B;  2I9S A;  2VA2 A;  1R8B A;  3BN7 A;  3IFE A;  2CQC A;  4JI2 J;  2CIM A;  3MF5 A;  3NOC A;  3QRP A;  2EW9 A;  1Q16 B;  5HP1 A;  4PPZ A;  2VON A;  1XMO J;  1CJT B;  3AOC A;  3PW2 A;  5I3P A;  3D6T B;  3A3P B;  5AXL A;  3ZNU A;  4MK8 A;  1WHW A;  1U48 A;  2HNY B;  2PC6 A;  1N5V A;  4JYA F;  1SJQ A;  2H4W B;  4WU2 A;  1SJ3 P;  1LWE B;  3KLE B;  3QGH A;  2UXB F;  3DI6 A;  3C2P A;  2LQ9 A;  4K50 A;  3R5C A;  4FPI A;  2RIJ A;  5D4P A;  1ZZN A;  1KQG B;  4HHU A;  2XMK A;  4TU9 A;  4UT4 A;  2ZD1 A;  2HHH J;  2DO4 A;  3VZI A;  1UVK A;  2NZC A;  3JYT B;  4OZJ A;  2CNN B;  1DTQ B;  4ERD A;  4HI2 A;  1EET B;  1K0T A;  3PR5 B;  2HEK A;  3W2V A;  1PYS B;  2XMW A;  1GMV A;  1M5H A;  1TL1 A;  2AWZ A;  4NI2 A;  1Q1K A;  4JI6 J;  3R2D J;  3CIZ A;  2B9W A;  2E5L F;  4F02 A;  3HHN B;  3QLH B;  2IJR A;  1P1L A;  2VBX A;  4FVM A;  4DUY J;  4FXD A;  1ZYQ A;  3VWS A;  3HHE A;  3OR2 B;  2QL5 B;  4NLX A;  4DF8 A;  2NQP A;  2RQM A;  2M8H A;  2BE7 D;  1KHW A;  2Y1I A;  3LGN A;  2J9E A;  2QYG A;  1JB0 C;  4RNN A;  3VF0 B;  4I6Y A;  2A6M A;  1CJU A;  1YRU A;  3NKY A;  1Y0H A;  2FHJ D;  1PAE X;  5F9N A;  3IAM 9;  3ZZZ A;  1QAI A;  1WTF A;  4OYW A;  3KDO A;  1ITP A;  4PYA A;  3B78 A;  4AQY F;  2RJZ A;  4B9S A;  2CPE A;  2VPY B;  3DLE B;  1YBU A;  4DG1 A;  3MPV A;  2VQF J;  3TO8 A;  5DS7 A;  1UFL A;  1RWN B;  3BO3 A;  5MLC V;  3TUJ C;  4NYP A;  1GMW A;  3H5X A;  1HD0 A;  2Y1R I;  3RR8 A;  2ALY B;  3IG1 A;  2C2D A;  2DGX A;  1JKH A;  3RBD A;  4EZ6 A;  2V9W A;  4H4O B;  3D0G E;  2IFX A;  1RKI A;  2XSJ A;  1OSC A;  1S6U A;  1FWK A;  4NML A;  3AD8 C;  5CYQ B;  4KPY A;  3ZTP A;  3GQC A;  2VPX B;  1RAG B;  2R8H A;  3M30 B;  1S1W B;  1FWP A;  2FVR A;  1ZTT A;  1NSQ A;  2BQ3 A;  4PQU B;  1RWW B;  4X4Q A;  4O0I A;  3M32 A;  1RAH B;  1J5E F;  4CO5 A;  3PFO A;  2FZC B;  4A8Q A;  1UZD A;  4LR8 A;  4J90 A;  4LF5 F;  2FGO A;  1FTR A;  1K47 A;  2W2O P;  1WUU A;  1T02 A;  1V9O A;  2V8V A;  2HGL A;  3QFW A;  3OXL A;  4HDG A;  1GMU A;  2CPD A;  3DXS X;  3TAN A;  5KG1 A;  1WHX A;  2XMU A;  3OSP A;  3UI3 A;  3L3C A;  3J7A 1;  2EFG A;  1RAD B;  1S99 A;  3MPY A;  4EGL A;  3CF5 Q;  2JEJ A;  1L3K A;  3DRX A;  3DOL A;  2MZ1 A;  1WC5 A;  3RR7 A;  2UUT A;  2FB0 A;  2UV8 A;  5B0F A;  4C11 A;  4PUO A;  3DLJ A;  1UFW A;  4DR3 F;  2QL9 B;  2C2M B;  2CG4 A;  4BBY A;  3OD2 A;  4F3O A;  3ISN D;  1HHT P;  4F7V A;  2CQH A;  5D15 A;  1REV A;  2NR0 A;  5C24 A;  3UDV A;  5LMU F;  1SCJ B;  4KAI A;  2PGC A;  3MMC B;  4U8V A;  5F8M A;  2FYX A;  3AOD A;  4N56 A;  2AZ1 A;  1EP4 B;  4O3Q A;  2DHX A;  3HZG A;  4JI8 F;  3HM9 A;  1T9X A;  3MUR P;  5KT4 A;  3M7V A;  2OPR B;  4OHY A;  3MEG A;  1EIY B;  4AL5 A;  1LW2 A;  1OPI A;  1SKU B;  4JYA J;  5AXN A;  5ETN A;  4U9R A;  2AGP A;  2VG7 A;  1Q78 A;  3US5 A;  2D3O 1;  3VV2 B;  4EMD A;  3BEG B;  3RBZ A;  2VQE J;  2CDR B;  1S4F A;  3GG1 A;  1TAU A;  4ZP9 A;  2GA7 A;  5LT5 A;  4RNO A;  4PG8 A;  1YZ7 A;  2I1R A;  1B99 A;  1QTM A;  3I4H X;  1WOS A;  3BV8 A;  4CLF A;  4C2M A;  1WD6 A;  1N5Y A;  1RT4 B;  4NLQ A;  1N6Q A;  1N0V C;  3G8T A;  2VD3 A;  1TL5 A;  2L9D A;  1F9E B;  5CZV A;  3TJ8 A;  1RUS A;  2QEX S;  4USH A;  3KDN A;  4NLO A;  1R8P A;  2YNG A;  4DPY A;  5D4O A;  5A2Q U;  2R8K A;  5CHC B;  2YKQ A;  1U1L A;  4KHR A;  5A0Y B;  4JV5 F;  2CPX A;  3DRP A;  4IFV B;  4P72 A;  2A0F B;  1RYS A;  2V34 A;  5IT9 Y;  3G86 A;  3CCQ S;  4PXB A;  2JNJ A;  1XNQ F;  3W63 A;  3NP5 A;  4KGZ B;  2MJU A;  4GO7 X;  3DRR A;  2O66 A;  4J9P A;  4MKV A;  1FRJ A;  3N6M A;  2M0G B;  2CVE A;  1HBU A;  3UCG A;  3J81 U;  3V6K A;  3EZO A;  2QA2 A;  4OIX A;  2FD2 A;  2DCU B;  4K4S A;  3G8S A;  1YIT S;  2Q3P A;  2HGM A;  1S57 A;  2IIH A;  2OPS A;  1D8Z A;  3ZTO A;  3P6Y C;  4ES1 A;  3DDI A;  4KGX B;  3CDA A;  2GHV C;  2E1P A;  5ETL A;  2D3Z A;  1GT8 A;  3DOM B;  3GFY A;  3J81 j;  1HNV A;  2QLF B;  3KK2 B;  1VRU B;  3V81 B;  2J6S A;  3U7J A;  4M5N A;  4Q0B A;  3KK3 A;  4LF2 A;  2Y3Y A;  1GEH A;  2YXL A;  5KOX A;  1FRI A;  2DH7 A;  3JSB A;  3DLG A;  4AXJ A;  1URN A;  1TL3 B;  1N8R T;  1RAB B;  4QBU A;  1PIE A;  1PSD A;  1KQS R;  2RS2 A;  4HI1 A;  1J5E J;  1KWM A;  1A7G E;  2W9B A;  3PFE A;  1LWC B;  4PQA A;  4LF5 J;  2K3I A;  5BJR A;  4DEZ A;  2AYG A;  4WP8 A;  1FD2 A;  3C15 A;  2MLY A;  2RNE A;  4KHP F;  1FVS A;  3MPD A;  4IG3 A;  2Z2L A;  5CQG A;  3G6E S;  4K5S A;  3C14 B;  1DBD A;  1FKO B;  2B6A B;  3I87 A;  2J9C A;  5EGY A;  2E5J A;  2V67 A;  1W2I A;  3DNC A;  2FVC A;  2DNO A;  4M5D B;  3ULH A;  1RBO B;  3OJU A;  1X4D A;  2FLO A;  4USK A;  4DR3 J;  2RB7 A;  2R7U A;  1H2V Z;  1UVJ A;  1WF1 A;  1QDU B;  3I5C A;  5KG3 A;  2HK3 A;  2HVE A;  1N88 A;  5BYR A;  4UOG A;  2QX0 A;  4H4M A;  3MEC A;  5DLF A;  4B3O A;  3H2L A;  4DFK A;  4IQX A;  2VG5 A;  1X8D A;  2EKY A;  4FKX A;  3TX8 A;  2J5A A;  4Y0F A;  1XEZ A;  4JI8 J;  2G4B A;  5GAE I;  4X4V A;  2YKM A;  1PKU A;  5FLX U;  3HHL A;  3LAK A;  1QE1 A;  3U02 A;  4DU7 A;  2Q43 A;  2MXY A;  2WBM A;  2GGP A;  1EAY C;  1YG0 A;  1VLO A;  3RU0 A;  1HNI B;  1FK9 A;  3KHR A;  1VC0 A;  3IS9 A;  3DHW C;  2CNK B;  5IV3 A;  2ZHA A;  4Y65 A;  4EZ9 A;  3I5B A;  4OJ1 A;  2HHP A;  2WVE A;  3ILO A;  1Y00 A;  4KY3 A;  4L3N A;  1SC3 B;  1WI8 A;  5T7L A;  3LTO A;  4ER8 A;  3SEO A;  5IT4 A;  2DT9 A;  2MQP A;  5I42 A;  2XY6 A;  1U4B A;  2WCX A;  4CRJ A;  1ZM9 A;  4YHH F;  3BGU A;  2KG1 A;  1SL2 A;  1ELO A;  1BQN B;  2CJY B;  2V2V A;  4MYT A;  2GC8 A;  3SSS A;  3KLH A;  1DFD A;  1OYD A;  4QR0 A;  3K5P A;  1BXN A;  1ZTW A;  4C97 A;  4C6A A;  1M5K C;  4O4G B;  5KFF A;  2R4F A;  3GIM A;  3LAL A;  4USV A;  3MXH P;  2C2N A;  1C1B A;  4QWB A;  4R0J A;  3D2W A;  3PKM A;  3DYA A;  4DI6 A;  1LK7 A;  2OPQ A;  3N4W A;  3NAI A;  4A8W A;  2ZH7 A;  4YDD B;  2GZO A;  1XNQ J;  3UD4 P;  4QZV B;  2IVF B;  1RT7 A;  4DL0 C;  4DX7 A;  1YRT A;  3VAJ A;  3CCJ S;  5KFE A;  3HHD A;  1HHQ A;  2LLZ A;  1I94 F;  2FVP A;  3MUM P;  2PDA A;  3TA2 A;  2YWG A;  3SMZ A;  2VA3 A;  2VJV A;  3DN9 A;  3KK1 A;  3K5N A;  5E41 A;  4QWC A;  3I9V 9;  4M63 A;  4NWB A;  2XM3 A;  2F65 A;  1U8W A;  4DV3 F;  4C8O A;  2B56 A;  3RB3 A;  3M8P A;  2V8G A;  2EFN A;  3OT9 A;  1FEH A;  3JSM A;  4Y2M A;  1AFJ A;  4NLS A;  3MMA B;  3MPU B;  5HAO A;  1RKJ A;  3FEY B;  3MOZ A;  4DZD A;  3W3S A;  1LFP A;  2HHV A;  5F8I A;  4CO0 A;  2RKI B;  2Z30 B;  2PA8 D;  4RL1 A;  1Q7Y T;  4DS4 A;  4ZPD A;  5I3U B;  3UVJ A;  2BE2 A;  2R7S A;  2NXJ A;  1FEE A;  2FVS A;  3QID A;  1W25 A;  1Q95 G;  1VCT A;  3O44 A;  3RG6 A;  4ZIT A;  4I67 A;  3IRX A;  1MU2 B;  4Q8F A;  1PJ7 A;  4DR7 J;  3FBB A;  1EJ7 L;  4USW A;  3MEK A;  5KT3 A;  4Y00 A;  1ZAX A;  3CO9 A;  2B5J B;  1N32 F;  1WDD A;  3R9L A;  4CTA A;  5AE1 A;  1UPM B;  3OUY A;  2QE5 A;  4KH0 B;  4UZB A;  2D3O R;  3LGH A;  2FC8 A;  2FUG 9;  2X1A A;  4U96 A;  3LF0 A;  2BA9 A;  1BQX A;  3NOG A;  3K7R A;  1FJE B;  5LMN J;  5I3Q A;  1DUR A;  4IDK B;  1FA0 A;  1HBN A;  2GO8 A;  1CS4 A;  2J0X A;  3LAM A;  2R42 A;  4KFB A;  3UN2 A;  3PO5 A;  4LBH A;  3W8G A;  4A8F A;  3CD0 A;  4K4U A;  3MM5 B;  3GIR A;  3M2R A;  3M9M B;  4U7C A;  2IDE A;  3QZ8 A;  3I82 A;  1APS A;  3M8Y A;  4B3S F;  2CJK A;  3OR1 B;  2VH7 A;  4HLB A;  1X60 A;  3M8Q A;  1RT1 B;  4G1Q B;  1H38 A;  4IUF A;  4TNO A;  3BSC A;  5K20 B;  5DO2 A;  4F26 A;  1KRP A;  3HCX A;  5D78 A;  3HKW A;  4N47 A;  4GC7 A;  2OTL S;  2KFZ A;  3LP2 B;  2E9Z A;  4Y34 A;  2A6O A;  1RT2 A;  1U09 A;  3OVB A;  3OL6 A;  1Q7L B;  2ZOF A;  4HAC B;  4C48 A;  4CWB A;  3H2U B;  3SV4 A;  1V5I B;  2ASL A;  1IJF B;  2NXE A;  5GAD I;  2EPI A;  1FXR A;  4EUV A;  3FBE A;  4ID5 A;  3KUG A;  4DR5 F;  3AXK A;  4FYV B;  2LEC A;  5IFM A;  2F8M A;  2MKY A;  4QPX A;  1IQT A;  3TX0 A;  3G87 A;  4NZ0 A;  4PEO A;  3EM1 A;  4YHH J;  5K8O A;  2JDJ A;  2YQ3 A;  2Y0S D;  2YKP A;  1EAR A;  1S12 A;  1F1B B;  3SCK E;  4ZVU B;  5J1E A;  1H2U X;  1S1X A;  1RWU A;  3OFF A;  1X4G A;  4ELU A;  1BQM B;  4K8R A;  4W90 B;  4NOH A;  1QAX A;  3K17 A;  1NHK L;  3TYT A;  3FGV A;  2DNY A;  3Q8Y A;  4PWW A;  2UV8 G;  4MYU A;  5JMN A;  2DNR A;  4ZHR A;  2H65 B;  4HHH A;  2R9L A;  4CLP A;  1XIQ A;  2HRU A;  2ZZT A;  3H5Y A;  4L6V 3;  4KJI A;  2XHC A;  3UNY A;  3A8J A;  1JXE A;  4EWT A;  2X1F A;  2VZ9 A;  2OP5 A;  4LSL B;  2NPI A;  2HBZ B;  2IPO B;  3FEZ A;  2GNK A;  2DR5 A;  4EEY A;  2BJ9 A;  1UEK A;  1VDH A;  1NJY A;  4ECV A;  4Q2M A;  5EWE A;  1Q82 T;  3LW5 C;  2R3V A;  2ZBR A;  1VK8 A;  2R7Q A;  2W7O A;  2MZQ A;  3G82 B;  2P9E A;  4HKQ A;  4P6Q A;  2GIQ A;  3DM2 B;  3E2E A;  2DHG A;  5DDQ C;  5AJ3 F;  3NNA A;  3PJW A;  1C0T B;  1ZBT A;  1MWY A;  1XMQ F;  3IWN C;  4TU8 A;  5D4L A;  1NH7 A;  2MHE A;  3QBC A;  3R6G B;  4FYY B;  4G1P A;  2BDP A;  1VQ4 S;  1SUQ B;  3MCO A;  1RHQ B;  5L1I A;  1V3Z A;  2FJD B;  1R0C B;  3OTO J;  2A18 A;  3AA9 A;  3KHG A;  1Q5Y A;  2E7X A;  1HBM B;  3CB4 A;  1XBW A;  3AQO A;  3ZFV A;  3VGU A;  3P3D A;  3SI8 A;  1UTA A;  1UW4 A;  1QLN A;  3IMQ J;  1IQZ A;  1IBM F;  3MMB A;  4OQJ A;  3R6L B;  3W9H A;  2ASJ A;  4ICL B;  1TUG B;  3P5B P;  3GJQ B;  2CVI A;  5B0A A;  2QLX A;  2GAH C;  4YB5 A;  4C0B A;  5B0G A;  1L3T A;  4PXC A;  3NGS A;  1M5O C;  3FBF A;  2CKW A;  4ILL A;  2RS8 A;  3F41 A;  2HIY A;  4FNH A;  4B3S J;  4DR6 F;  3TAQ A;  2QL7 B;  5IM0 A;  1JLQ B;  4ZLN A;  1SVD A;  3NMR A;  4DOZ A;  1WG5 A;  3UO0 A;  1X4C A;  3FZ2 A;  3PXG a;  3HI9 A;  1TMJ A;  2OTJ S;  2AT1 B;  2W24 A;  1NO8 A;  3TQ1 A;  1QUP A;  1PYT A;  2RHQ B;  2E29 A;  4U7U K;  4V19 J;  1B4S A;  2ROG A;  1CJT A;  3HVT B;  3MM7 B;  2W2P P;  3LWM A;  4YR2 A;  4ECU A;  3PY8 A;  3ILL A;  1WEY A;  1IJE B;  1RAO A;  1S1V B;  2FLP A;  3EDQ B;  2HNY A;  2YNI B;  1HWI A;  4DV2 F;  1HNX F;  1T94 A;  2FJB B;  4DPU A;  1JNZ B;  3MUV P;  1DY3 A;  3N5F A;  3W5X A;  2DB1 A;  1RT6 B;  2B7B B;  3F0N A;  4OHV A;  4ZVP B;  4ZVG A;  1KVI A;  1JQG A;  1C0U A;  1VBZ A;  1T9W A;  4UF4 A;  3CC2 S;  4ENO A;  1XK8 A;  1WG4 A;  1Q8K A;  2RRB A;  3RBE A;  1S7H A;  4LR9 A;  1DTQ A;  1Q8I A;  5D8H B;  1EET A;  4ECS A;  4KIA A;  2IVY A;  1S0N A;  4LVN P;  3OV7 A;  3FJ2 A;  4LR7 A;  3GJR B;  1EHW A;  2W2Q P;  5KT7 A;  5A6W A;  4D3H A;  3QLH A;  5J1N A;  3AA8 A;  3MCS A;  2JLF A;  2YWH A;  3MHY A;  3T6B A;  1WHY A;  4AUK A;  3OR2 A;  4WPA A;  4DV4 J;  4PZV A;  2VHG A;  2VOP A;  2G13 A;  3M6U A;  4RUA A;  2ZEJ A;  1RAJ A;  1NDC A;  2FC9 A;  3NCP A;  2OSR A;  3W65 A;  1HQ2 A;  4JOU A;  1RT5 A;  1W7W A;  2HVH A;  2DNM A;  3NS5 A;  4IRK A;  1NCL A;  3KTQ A;  4NXN F;  2QSW A;  1HMV A;  4AE5 A;  3R5G A;  4WFB Q;  2RQ4 A;  1H72 C;  1PBU A;  1N5S A;  1SC6 A;  1F9F A;  5DDR C;  3WC2 A;  5D0R A;  4CO2 A;  4J9S A;  1Y10 A;  2OIH A;  2CZV C;  4ZP7 A;  3TJ9 A;  5KG7 A;  1B3T A;  4MMO A;  1Y7P A;  1D9D A;  3W7B A;  2GMJ A;  5T14 A;  3C8Y A;  3DLE A;  3MDF A;  4E0D A;  1VIX A;  5E33 A;  1N4L A;  5J2P B;  4Q8E A;  1WEL A;  4ZPW R;  2R8J A;  1RHR B;  2DNN A;  2K1R B;  2WHO A;  3Q8P B;  3QJP A;  3FMW A;  4H4O A;  2KZM A;  3NS7 B;  2PMH A;  2H48 B;  3PRB A;  2UUW A;  2KJW A;  2EBE A;  3WX8 A;  3QPI A;  4ZMM A;  4MK9 A;  1XMQ J;  3D9B A;  1JIH A;  3KNG A;  4JI7 F;  3FFI B;  2CNO B;  3JB9 k;  2LEB A;  3IRW P;  1LKZ A;  3GCX P;  3UDL A;  1B7Y B;  3U1L A;  3GSD A;  1TKD A;  3M30 A;  1S1W A;  3GPA A; 
#chains in the Genus database with same CATH homology
 1Q0N A;  5ETO A;  1RU2 A;  3UD5 A;  1TMM A;  1F9H A;  3ILJ A;  5ETS A;  1RU1 A;  3HSJ A;  5ETK A;  3UDE A;  3QBC A;  3UDV A;  2F65 A;  3HSZ A;  3KUE A;  4M5L A;  3HSD A;  4PZV A;  3HD1 A;  1CBK A;  4M5N A;  1HKA A;  4CRJ A;  5ETR A;  1G4C A;  1EQ0 A;  4M5M A;  1EQM A;  3HSG A;  3KUG A;  3IP0 A;  3KUH A;  3MCN A;  1KBR A;  2BMB A;  4M5K A;  4M5G A;  4AD6 A;  3HCX A;  1DY3 A;  3MCM A;  4CYU B;  1RTZ A;  4CWB A;  1RB0 A;  1HQ2 A;  3ILO A;  5ETN A;  4CYU A;  4M5I A;  3HT0 A;  5ETL A;  3ILL A;  3HD2 A;  4M5J A;  2QX0 A;  1EX8 A;  3MCO A;  1IM6 A;  5ETT A;  5ETM A;  5ETP A;  5ETQ A;  5ETV A;  4F7V A;  2CG8 A;  3ILI A;  1TMJ A;  1RAO A;  2F63 A;  4M5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...