3JTNA

Crystal structure of the c-terminal domain of ypbh
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
89
structure length
89
Chain Sequence
DIIYQFHSFEDIIQLSESLQRIGITGGTVYHYDGQYFLSLEDLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVETIQTHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Adapter protein mecA 2
publication title Crystal Structure of the MecA degradation tag
rcsb
source organism Bacillus subtilis
total genus 21
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jtnA00
3JTOA 3JTPA 2Y1RI 3PXGa 3JTNA
chains in the Genus database with same CATH superfamily
2J6TA 4YY3J 4Q44A 4B9TA 1B70B 4WFBQ 1JLBB 2G13A 4LFAJ 2JEGA 2DPJA 3BBCA 3VF0B 2R8JA 4ID5B 2PN6A 1SQFA 4IQXA 2J9DE 1RA6A 3H0PA 2XMVA 4I2PB 3TJ8A 3K58A 2VQFF 2ACMA 2XSFA 7AT1B 4JI4F 1Y00A 1HYSA 5LJ3Y 5LMUJ 4NLOA 5G0RA 3OUYB 2R2TA 3DC2A 2FVRA 2HBZB 3NCQA 4DPUA 2AV5A 3A4TA 4ECXA 5E2QA 2UU9J 1VOMA 5IQ6A 2BW7A 1RHKB 5IWAJ 4J9KA 2UUWA 1NK0A 1W2IA 4W90B 2QG9B 4XAKA 5F8IA 3GJQB 3M8RA 4A8SA 3AOAA 1NH8A 1IWAA 3AD8C 1IN0A 1YBTA 4OLPA 4DPYA 1KQGB 3CF5Q 2V2KA 3H5UA 3K5OA 1WKLA 4K0KJ 4CH7A 1SIZA 2W9CB 2EC2A 4DUYJ 3N4WA 1YJTA 4F36A 3H4DA 1SC4B 1KFSA 3QWUA 3RJMB 4ES3A 2MSSA 1D09B 2D74B 1XJWB 4PUOA 2ZZTA 2H5JB 4C98A 3VQSA 2YKNB 2DNGA 3G8QA 1YJNS 3KLIB 1F9FA 2QSWA 4UOCA 3MOZA 1RTHA 3CB4A 4IOAQ 4GMKA 3P45B 5CABA 4ZIVA 3EUNA 1X9SA 2RDDA 5D0HA 1KWMA 1DLOB 1WOPA 2JDJA 5T41A 1FJEB 3P5BP 1R8HA 3LTOA 2XM3A 1C4CA 3UN2A 2BXJA 2M3DA 2CADA 2KO1A 1X60A 4NI2B 5AE3A 1NK4A 3TA0A 1M0SA 2FHKA 4X4NA 4G65A 5GAHI 1H7XA 1TVRA 2GZOA 4JI5F 1RWPB 2RMLA 1QAYA 3V2UC 4I1TA 4DEZA 1NZ8A 2AZ3A 3QO9A 2DGTA 3QIPB 4MTPA 5E33A 2JRSA 3AOCA 2LEPA 1Z4UA 2FJEB 1VQSA 1AT1B 1RHRB 3MM5A 1FEEA 2E5LF 3OV7A 2ZKTA 4WIIA 2AX0A 5L46A 2WOMA 1RBLA 4B9MA 3GR1A 3GFHA 2D9PA 5ETKA 2RU3A 2FTRA 1CS4A 4LF4J 3BR9A 2J9CA 4F3MA 1CG2A 3BPDA 1HNVA 3UCZP 1FTRA 2M0GB 4YOEA 4HT5A 3MEEA 3C19A 2H65B 5H1SV 3PKMA 5HMYA 4LF5J 2K2PA 4I0WA 1Z1ZA 2CQHA 3CJ4A 1IBKF 3QSYB 1I6JA 4IDKB 1U1RA 5CCMA 1M1KT 1X4DA 4KRWA 5EX0A 4DPWA 2VFUA 3QGIA 5EUHA 2VA3A 4L74A 2LXIA 3FC9A 4DR1F 3Q8QB 3M4XA 2ZWOA 3MCSA 1UVMA 4XDDA 4IRDA 4KQZA 3QO9B 1RWMB 1BY9A 2HHQA 2V2VA 1F9HA 2MKIA 2AF6A 3ZO7A 2BX6A 3FSXA 1BLUA 2ZJRQ 2DEIA 4OZNA 2UXCJ 1GK8A 4NXNF 2DYAA 3DNCA 4H4KA 2OI2A 2CG8A 2O66A 4DV7F 2ZEJA 1H3DA 1X4BA 4DG1B 4ED5A 2EFNA 3SEOA 1Y3JA 1TFWA 4O4RA 2FLNA 4ZIWA 4WP9A 2MY7A 1V3ZA 2BMBA 2Q66A 4KHMA 1ZTTA 2AZ1A 4P74A 4WFNQ 1WG5A 1VQYA 1VFJA 2PIIA 2KJWA 1H74A 2BQ3A 1Y11A 1SXLA 2EFPA 2DXDA 1S97A 1FJCA 1LFWA 1FWKA 1FNMA 2DBBA 3KUGA 3NS5A 4J9MA 5B0FA 1S7IA 4NA2A 1SH2A 1WHWA 1PBUA 2VQEF 3FKBA 1CJTB 2W2MP 3TA2A 3L7PA 2MQ8A 4DBQA 4A8FA 4R0JA 3W60A 1UFLA 5E3CA 1WKKA 3QT5A 3TW0A 3O8WA 4R8UA 3AXKA 3HHLA 4B3OA 1QE1B 1HHSA 2B56A 1NJIT 3H5XA 1KVIA 2D41A 1MU2A 2VFVA 1EQ0A 2JLEA 3HCXA 3UDCA 1X9MA 1JJHA 5CAAA 2K1RA 2A3JA 1EARA 3DGVA 3CTRA 2PFFB 2I5JA 2C2OB 3OJUA 1LQ9A 1PJ5A 2QA4G 4WF9Q 2BRLA 4C48A 4FYWB 1NSPA 1R8BA 4LR9A 2CNLB 1LW0A 1MNEA 3CCVS 1RLDA 2A6OA 5J2QA 4NCAA 2YWGA 3Q24A 1NDCA 2ZE2A 2RSQA 4NLDA 5E3RA 2BACA 2XLIA 2P9EA 4F4XA 1R8CA 3KUHA 1K9MT 4HEA9 3D2WA 1CULB 1H2UX 4R5PA 5LMNJ 3GB0A 4ER8A 4PG4A 1QTNB 4C11A 3SFUA 3NMRA 4DR2F 3ZTPA 3AB4B 5JXSA 2VG6B 1VQKS 5EN1A 3CC4S 3GFYA 2VBZA 2XS2A 3FNNA 3DLEA 2HBRB 1G2EA 3G6YA 1DARA 4USJC 1CBKA 4C2MA 4OI1A 2ASYA 4HH0A 4PEOA 3T6JA 5EDWA 3HHLB 2ZJQQ 1RT4A 4B9LA 4O3OA 4UTGA 3FCHA 4HHJA 2NPFA 1SQEA 1MU2B 1HNIA 4L72B 3BQ2A 3HP6A 1T9UA 5HMXA 1RDRA 3I4HX 1D9DA 4J9RA 2HSEB 1RABB 3OT9A 4KH0B 2MYFA 1H2TZ 3FUYA 1IUJA 3P3DA 4YDXA 2GVZA 3CDEA 2VH7A 4KR0B 2BJEA 1LW0B 1SH3A 2M8DB 2ZDPA 1QJHA 3D9BA 1RTJB 1R3NA 2AQ4A 4QWAA 5ETRA 4L76A 1JXLA 1ZM3A 4XO0A 4K4UA 2ZH5A 4IO1A 1NHUA 4ECSA 5I3QA 4HACB 2V8DA 4ITSA 2NLWA 2DGQA 2W2OP 4RZRA 4X66F 3G8TA 2BE2A 3JTPA 1YGYA 3ICLA 4DR6J 2ZNZA 4QWEA 4ECTA 2B5JA 1REGX 1Y3KA 4RW6B 4M94A 2H9ZA 2JC1A 1RT3A 1AUSL 1AZSA 2RKIB 3MR7A 1Y7PA 2G2YA 1FVQA 4LMZA 4XPCA 1IM4A 2OD4A 3TVYA 1HNIB 1CJVB 3M2VB 3KHHA 3IRXA 2XY6A 5E0OA 1O5JA 1HARA 4NEYA 2YX1A 4WU3A 4IH7A 4IRKA 5F3ZA 2C2MB 2VBXA 3NGDA 4O4GA 4ZVGA 3C15A 3PACA 1S79A 3IWNC 1MWZA 1UPPA 4J9QA 1PBAA 4LF8J 3D6HB 4O0NA 2QV6A 2B9EA 3W5XA 3DRRB 3KDOA 1UETA 4QR2A 3R5GA 4OIXA 1TMMA 1VGYA 4USTA 1U6ZA 1R31A 3KLEA 2CKWA 2XB2D 1XMBA 4E8UA 4HL9A 3QGGA 3R5AA 2U2FA 2BE2B 2QEXS 3C6TA 2Y9HA 3JXOA 4NLWA 4DSIA 4JP8A 2ZH8A 5ETVA 4EBCA 1U4BA 4C8KA 2XQCA 3CCZA 1OS5A 3MM8B 2RU9A 4NPOA 3MZIA 3IS9B 3T3FA 2HZVA 4Y2IA 4ZVSB 3M32A 4J9LA 1C0UA 1HQUB 5CXTA 2CWXA 1SC3B 5CD4H 1AFJA 3HF5A 3UW1A 3C15B 3KKFA 5KFRA 4TQRA 4J37A 2MEWA 3W66A 2AU0A 2IMOA 1RE1B 4GC6A 2BVZA 3P4UB 3QSIA 9RUBA 2LEBA 3BN7A 4WP8A 3PX6A 4ILLA 2BJDA 1JLCB 2NCKL 3MPYA 4CLTA 2YKMA 1TUWA 2ZHAA 3KLEB 2A1BA 2ZWPA 3DLJA 2R8IA 3UDLA 3DRPB 2W25A 1HWIA 2Y8WA 2LQ5A 1M1HA 1UJ4A 1WHVA 3CDUA 4WFAQ 2RVJA 4Y6IA 2LP4A 2ZUGA 5ETOA 3LP0B 2W2NP 2XHWA 4NYOA 4FYYB 1S99A 2KYXA 2W24A 3KWMA 3MMCA 3BGLA 2HS4A 3M32B 2RRAA 3PY8A 3CEDA 3P96A 2Y8YA 3F73A 4HTJA 2XMKA 3G87A 3ET6A 2KFNA 1C2PA 4WYWA 2XI3A 1BQXA 3TUJC 1UW4A 3HVTA 3MPWA 1SI9A 3KK3A 2DNLA 4GKKJ 4ES1A 3MEGA 4ELUA 2DNPA 2FQQB 1EETA 2JLGA 4CT9A 3AODA 2VB6A 3T6BA 1NJXA 3TANA 4ZLPA 2ZC3A 4DCOB 2GHPA 5A2QY 4PQAA 4WP3A 4KIAA 3LO3A 1TKTB 5K14B 1N88A 1YQHA 1RWOB 2AKWB 4UT4A 3IGNA 2CUYA 2HLTA 3EVMA 1UVLA 4DV3F 4NXMF 5C24A 4X65F 2HLUA 1KTVA 2AJ1A 2DY1A 5K20B 3UDVA 3VWSA 2CVEA 1U49A 2OFHX 3BYRA 4DSJA 5HP1A 4B9SA 2EKYA 2H5IB 1LWFB 2EC0A 3MUTP 4LSNA 1UEKA 2WVCA 2IJFA 4FS1A 1I3OB 3EDQB 3ZZZA 4P2SA 1WWHA 1EQMA 3HVTB 2FHJA 1RTDA 4G1QB 2PDAA 5KG1A 2Q79A 4PXDA 2VL1A 5F41A 1FKAF 3RGIA 2HRUA 1LWEB 1FJ7A 3NWRA 3UD3P 5L9XA 2KXNB 4U8YA 1RT6B 3RG6A 2BM1A 2E29A 2YNGA 3V81B 4DR4F 4M8LA 4FXWA 3GG1A 3M1VA 1YJ7A 3D6TB 2DVIA 3H8YA 5IT9Y 3G96A 4RO0A 1QAXA 3M6WA 1XNQF 5LSLA 5C24B 4USVA 5DM6Q 5M2PA 4LJMA 4ANCA 5J1EB 3E3XA 2JHEA 5E7OB 1J5OA 2P8IA 1EKSA 4O23A 1OJ4A 2WVDA 2VJUA 4K59A 3GJSB 5IC6B 5JJBA 3PYDA 4CTAB 2ZUAA 3BGOP 2DGUA 4YQWA 2XNRA 3MM6A 4TYAA 2GAGC 4OYIA 3V4MA 1FF2A 1URRA 4RUAA 4GVLA 4IH5A 4OHZA 1F3VA 4HT7A 3IA0A 3FFIA 5HN0A 1GXUA 3RRHA 3NOCA 5M2UA 2DTJA 3KG4A 2ZDOA 1OIAA 5BXIA 1K0VA 3A12A 2QO3A 3I0SA 2DO4A 2MSTA 3E2EA 1QVGR 3FSYA 2AWZA 3IMQJ 1KVJA 3BKUA 4S0MA 3M1VB 3DM2B 2E9RX 1S7HA 1KR4A 3R3TA 3C6UA 2CDQA 4B3MF 2QX0A 3KJNB 1TL7B 1JMTA 2OSRA 2E7WA 1WC0A 4ZPDA 3MCNA 4LSLB 3T5KA 2KXFA 2EEYA 2XMJA 2LDYA 4RR5A 3D0HE 1VC6A 4DHVA 4B17A 4KC5A 3CMQA 1GXTA 1R8AA 4M5DA 1CJUA 1SJ3P 1YJUA 1IWGA 3POTB 1X9WA 2BV3A 5HLFB 2EXUA 6AT1B 2E7XA 1WD6A 2OUGA 4AL5A 4WBFA 1VLYA 4C8OA 3DLKA 4ZP9A 2IVYA 4TU8A 3UN3A 1MLAA 3K89A 2IMWP 2DNKA 5MLCV 3S1TA 1YZ6A 1ZS6A 2OSQA 2YQ3A 1C1CA 1N36F 3I0RB 4PPDA 3AD7C 3LF0A 4YB5A 4DZ6A 4DQIA 3CC7S 5IM0B 1VQ8S 3MOJB 5AJ3F 5HJXA 2CPXA 4JOUA 4LF6J 3V4IA 3C6UB 3LP2A 1FNXH 2HEKA 2E5JA 1S1TA 3VALA 2IYIA 5HO4A 1P9YA 2W7PA 4YMEA 1P27B 1DAXA 4K8RA 2HHPA 4X2BA 3THVA 1V5VA 2C3YA 3PRDA 3CNQP 3TI0A 1CJUB 4B3TF 2K7KA 2Z56B 1Y10A 3MMAA 2FY8A 2F7VA 3ZZYA 2ABYA 3D28A 3DLKB 4I2QA 1LFPA 2PI4A 3IWLA 1LW2B 4J9SA 3J80Y 5IS2A 2DH7A 1RT1B 2FJWA 2Z4PA 1BWEA 4BBYA 4PWWA 3J7YU 1IXKA 4C8LA 5J2NB 2YNHB 1C1CB 4JI7F 1HI1A 4RNNA 4AL6A 1OO0B 5I42B 5DG7A 4IUFA 1RAOA 4J9PA 4O44A 2WVFA 3ISNC 2D9OA 2VFTA 1S9GB 3LP2B 4EO8A 1RAGB 4DPOA 2WONA 1S1TB 3IC1A 2V8GA 1SKUB 4ATNA 1GH8A 1VQPS 3RW7A 2NS1B 1RAIB 4U6PA 1WEYA 5EWEA 3MPUB 1X0FA 5D8HB 1UFWA 5F8NA 4F50A 5B0EA 3BF4A 3FDSA 5D4NA 5IQQA 4B9UA 1VC5A 2CQ2A 5IV4A 3I5AA 4NMLA 3MMAB 2IRYA 3IR5B 4K5RA 1DTTB 4WKRA 4FS2A 1HFEL 1PJ6A 2FYXA 4LT6A 3PM9A 5IFMA 5GMDA 3EZUA 1BQMB 3D3CJ 4I6WA 1L3TA 3PFEA 4DQPA 1RUSA 2GHWA 2P5VA 2DRBA 3O44A 4LRCA 1JLAB 4JYAF 3PDNA 1TK8A 2HNZB 2R8KA 3R7NB 4WTOB 2IIHA 2AJ2A 5C7PA 4U7CA 4JI0J 2OLWA 4DMZA 1R6YA 2MJUA 1UEUA 2PMWA 1IKXA 4ECYA 4B02A 2UUAJ 4F2RA 4WCEQ 3DCAA 4BWJA 4ZVHA 2NREA 2VD3A 4FKYA 1RA7A 1SKRA 1S6PA 1UTAA 3GU0A 4CLUA 2FVCA 2EPIA 2YWKA 1BHNA 2Z0GA 2P9CA 4RW9B 4RNFA 2ZC4A 4DR7J 4ZVOB 1GTEA 2DIVA 1AW0A 2RDIA 2NQPA 2G2ZA 1NJYA 3MTKA 5BYRA 3ZZOA 1U6BA 5L8RC 3NOGA 1UFKA 1S0OA 3QLHA 5HVFA 2YWFA 1L3UA 1XK8A 1FRKA 2KXHA 2QC3A 4KO0A 2AT1B 4C0HA 1PJ7A 4CYUB 3SV3A 3D3BJ 4RBVA 2Z2YB 1WF2A 1U2CA 3IM9A 3MMJA 3OHAA 2UVRA 2CFXA 1N5YA 1B3TA 1FWPA 5CYQB 3BDEA 3HZEA 3IG1A 4P6QA 4LQ9A 1HL6A 2XLJA 1AXQA 2FJXA 3IO1A 4DV5F 2X1FA 4MFBA 3HSGA 2L48A 3FZ2A 3T1YJ 3P5TL 2AYEA 2ILZA 4Q45A 1UPMB 2M70A 4DL6A 4KYZA 2UXDJ 1NKCA 3PJXA 2N3LA 2CRLA 3TZZA 4ZPBA 4LFBF 4C8YA 1REVB 2XULA 3TZWA 2YVSA 4KGKA 4KY3A 2JH3A 3HVRA 4OV6A 2HKEA 5BR8F 4C8MA 2GIFA 4K2XA 1CPZA 5F0WA 2YPZA 3DLGB 4IRCA 3FEXB 1OQ3A 4TYBA 3C14A 3I56S 1ZPVA 1FKOB 4K4SA 3VAJA 5GMKa 1D3WA 5B7WA 1N5YB 2XLKA 2ZHBA 5LT5A 4X62J 4F2SA 2XEXA 2GA7A 1WORA 3O6QA 1PO6A 4RW4A 3EM1A 2E9TA 1RHJB 3GWCA 3H4BA 1JJCB 1YTYA 4BCAA 1PC5A 1U6FA 2MQMA 3DRSA 5L39A 5JVHQ 4CRJA 2H5EA 1K1SA 4AE5A 3KK2A 4JI1J 3PNIA 1TMJA 1SCJB 3QJPA 1HQ2A 4FPIA 4QWCA 4L6V3 4YEAA 1JLGA 2HURA 1BQNA 3WQPA 1PC4A 1FNOA 4TQSA 3LP1B 1KQKA 2V4QA 1DRZA 3W3SA 1JJ4A 4J90A 2HBQB 5HJYA 2ZOGA 4F0MA 1Z2LA 1H2VZ 5CYMA 3BZQA 1E6YB 3MMBB 2V9WA 4FF3A 2YPYA 4OX9J 3QAUA 2KKHA 4RJVA 3QT7A 2GC8A 7FDRA 4RNHA 2UP1A 2BABA 2B43A 1L3VA 1WC6A 4DFMA 4CM2A 3M9OB 1OMSA 2LYVA 4QIGA 1XNRJ 3I4PA 1YJWS 3DDIA 3TO8A 3GFXA 2Y1IA 1X5SA 4CLKA 3H5SA 1S72S 3BH6B 4Z7CA 3DHXA 3R8YA 3D7SB 4DR3F 5DO2A 3M8PA 4NX9A 4ZHRB 2DJWA 2ZH7A 2APOA 2HHHJ 1F5BA 4DL5A 3Q83A 4WZMA 1TTHB 2QTWA 2RRBA 2MY8A 3NGUA 3QRQA 1BQNB 2XMUA 3G8SA 3VGSA 1S0MA 2MLYA 4HKQA 4XTTA 1UL3A 2C22A 2HGLA 5AE2A 3DOMA 3SCKE 5KFGA 2XSJA 4PWDB 2Z57B 4L3NA 3EPIA 2UUCJ 2DHHA 2D3OR 2HIQA 4MH8A 2X1GA 1X4GA 1T9YA 3UD4P 3OVSA 2R8HA 1U8WA 4DV0F 4UQTA 3CWJA 2P9GA 3HXMA 3MAQA 4RPFA 1YI2S 1M5HA 2KDOA 5D77A 4Q2LA 4JI2F 3NL0A 4WJBA 3W9IA 3PJ9A 3ZTQA 3MPDA 3MWBA 5KFEA 2AEMA 1Q8IA 1ZYQA 2V8HA 1P9QC 4KHPJ 1YRXA 3KTQA 4LF7J 2KU7A 3EGVA 1KLMA 2ZH2A 5I4MA 3KYLA 4DU7A 4KFBA 2CJBA 3DRXA 3CJ2A 1R0AB 1VHFA 3C2PA 4NLSA 3TAMB 1RI7A 2I1RA 1FDBA 5J2PA 3SDEB 4UOGA 2Q6BA 2IM3A 2CQ1A 4A8WA 2NXCA 4P71A 4TVAB 1GMUA 2RILA 2H54B 1EHWA 2WAQD 4TY8B 1VQLS 1FRJA 3NAIA 4Z7YA 5CD4A 2PI5A 3R5DA 1WSRA 3BGUA 2W4DA 2BKPA 4B3RJ 3C16B 2WHOA 3M2RB 2C3OA 5H9FJ 2GX8A 1AYEA 5F3TA 1S1WB 3OR2A 1UZHA 1FO1A 4DV4J 2E5HA 4UZCA 3ZZRA 2BANB 2HHXA 3B6BA 1Y5NB 4X4SA 2J7UA 3CJTA 3W61A 1NM2A 1WF0A 2WZ1A 2OPSB 2QYCA 3M05A 2AIRB 3DDNA 5D78A 1Y5LB 1RHQB 2IAJB 3PW7A 5CCLA 3J80U 3AOBA 4CLLA 2RHQB 1RAJA 1ZAWA 2VZ9A 4A8KA 4QW9A 3CCUS 1Q79A 1NLKL 3D68A 4F3OA 2J9EA 2D7SA 3I31A 1UW9A 4RBTA 2V2ZA 4NLTA 1MMDA 2L3MA 3A3PB 5DLFA 3ZZTA 1IBLF 3X1LB 2XMWA 2N4CA 2GCFA 2VHGA 1BUXA 4Y2KA 2BEFA 1OQ6A 1X7VA 1RLCL 3ZTRA 4KJIA 5HROA 4ANDA 3UCUP 2V94A 2CJ9A 2F1FA 1FJGF 3TAQA 3CT9A 1Y9OA 1S1XA 1E6VA 5E3AA 4DUZF 2WCXA 4BS2A 4XDCA 1JB0C 3N6NA 2CPDA 2JFKA 3NMAA 1S9FA 3LWLA 1WC1A 2KM8C 4IFVA 4YDDB 1WF1A 2DCLA 5DJBA 2V9KA 3HHEA 3MEDA 2DNQA 3BO3A 1S6OA 2DXEA 4PG8A 1T9VA 4O3SA 1N32J 4NLGA 1TL1A 3HLUA 4JV1A 5L1LA 3W65A 4DV1F 3GONA 5BJRA 3B4MA 1BXNA 3FBEA 2CZ4A 2FGOA 1RZMA 1T3OA 1KD1T 1QVFR 4OJHA 4AYBD 1FX4A 2CQPA 5SZTA 1EP4B 1R27B 2GVDA 3CDBA 2DNRA 1O8BA 2GGPA 4CM0A 4KBIA 3CJ0A 2VUGA 3N28A 2VJVA 2ZD1A 3M8YA 3MECA 2QZ8A 1QAJA 2HFVA 4ZCLA 2AYMA 1Q78A 2CXEA 2LA6A 2PSZA 4ZP6A 3KJVB 4QZVB 2ZJPQ 2W2PP 5E5NA 4JBCA 2VQFJ 2BBEA 4JI4J 5LL6d 1Q86T 4WPAA 2XYGB 3VTIA 1JLEB 3RRKA 3JSMA 4KSEB 2RH3A 1HMVA 2HGNA 4PRFA 4Z2XA 5E41A 4P2XA 4WFXA 1DBDA 3CD7A 5LXRA 4IFVB 2VV5A 5IT4A 4USIA 1WTFA 2WVEA 5B0BA 5F8LA 1EX8A 2XWYA 2W1BA 1XR7A 3WDOA 1KLNA 4B3SF 2ZH3A 3VZHA 2ASDA 1FFSB 4M1KA 1UJ5A 3MFIA 3EICA 2HMIA 1Q1KA 2CZVC 3GJTB 5E3QA 4QCLA 2QLXA 2OP5A 1FRHA 1KC8T 3FCWA 1NAQA 2DGOA 3M6XA 4YR2A 2XCPA 1FHTA 2ZD1B 3RTVA 3OVBA 1N54B 1BE4A 2C3PA 1WC5A 4GKJF 2HNDB 1HPZB 4QBUA 4RWWA 3NGTA 1YJ9S 1RP5A 3LGMA 2HIYA 1UEVA 1FKPA 3W62A 3MAAB 3FSIA 2Q1LA 3DOLA 3IAS9 2UVVA 4LFCJ 5D0GA 2BJ3A 4HR2A 1FD2A 2OEJA 1D9AA 4C97A 1FRXA 4BDPA 2QLFB 2OD6A 1TL4A 3PVXA 3T1HF 1RXOB 3ILIA 1NJZA 4O3NA 2WSEC 3DGPA 1F0XA 1FXRA 2KZZA 5A76A 2CQ0A 1F3FA 3ULHA 2VG7A 3GV8B 4QU6A 4ERDA 3GQCA 2AMCB 3K8VA 3OXFA 5KG2A 2DKOB 4YB6A 3OL7A 2AJ4A 3H2UB 3ZTSA 1B0PA 1LXJA 4JI5J 1ZM9A 3EVOA 3TUIC 3BO4A 4KGZB 2F8MA 4G3IA 4U7UD 5KT2A 1KDNA 3T41A 1UA1A 1U48A 3BB5A 1N34F 3TZYA 3GSDA 1M90T 2XG8A 5FDLA 2J6UA 3FVYA 2N3OA 1A9NB 2E5LJ 3BS9A 1OWXA 2DT9A 2NR0A 5CA5A 1KOHA 3W8PA 5B08A 1HIYA 5T7LB 3SSRA 1TKZA 2BQUA 2HVIA 5ETQA 4BHQA 2BJ1A 2LQBA 1EAYC 2AJQA 2DGSA 3HSJA 2IRXA 2LXUA 3DMJA 1A7GE 3QJJA 3RB6A 1K8AT 1T0TV 3TARA 3R7SB 3MM7A 4AD6A 5MAOA 2YH0A 4KTQA 2DGWA 2DR9A 1IBKJ 4LUBA 2OTJS 4WYLA 3LAKA 2FHMA 1WUUA 1CSJA 5ETPA 5AXLA 2ADCA 2ADBA 4K7QA 2W9BA 2EVZA 1U1KA 2VKRA 1Q5YA 3EGNA 1S76D 4TU7A 1ZBTA 2KVIA 3HFKA 3H20A 4PG5A 1QY7A 2YY3A 1NPPA 4CLSA 5AXNA 5H9EK 3RR8A 3R6GB 3UR3C 5FDLB 1CLFA 2HAIA 3D6MB 2CG4A 4DF4A 1TKDA 4NXNJ 4LF9F 2R7SA 3KFWX 2N82B 4N47A 3MR6A 2BUNA 4P2MA 4GO5X 1F60B 2E1CA 4DSLA 4DV7J 1L3KA 2PD1A 5BYSA 4LIRA 3B78A 2NXNA 4J9UE 4C9DA 4YN3B 1RKJA 4AQYF 4IR1A 1SV5B 5KFTA 2KG1A 2RS8A 4ED2A 5F0UA 2D1CA 5D4OA 2FZKB 4ZKAA 3AD9C 1NNDA 2MKJA 1S9EA 4LSZB 2DB1A 3GILA 5IV3A 4ELTA 3TOQA 2CA9A 5KFDA 5KG4A 2HAFA 2V69A 4FYVB 1T9TA 2KT3A 1I94F 1UAWA 2R2UA 1NK7A 1YVFA 2IM1A 1YIJS 1FRLA 4ECQA 1JLBA 4ZA1A 1Y0HA 1TKXA 4DN9A 3NKYA 3PZPA 5KFCA 4V1Ak 2G0IA 4Q8EA 2VQEJ 4PYDA 3LPEA 5B0GA 4N76A 2BW2A 2E1PA 3GP9A 4DV2F 4X64F 1JXEA 1EIYB 4I2PA 1C0TA 4FXVA 2B9YA 4KV8B 3R97A 5EHHA 1JLFA 2YX7A 5FD1A 2YX4A 2POKA 1ZZFA 1VRTB 4YUDA 2R4FA 2FHOB 1MMNA 1JKHB 5KFUA 3FMWA 2QLJB 3UNYA 2H4WB 4IG0B 1IKVA 2JSXA 2QT7A 4OZ1A 2F63A 1GMVA 2XTJP 1QSSA 1JXVA 1XMOF 4TY9A 4K4XA 1KTQA 3B82A 3UR0A 4F0KA 1QM9A 4MT1A 2KRBA 5KFLA 2B9XA 5HQMA 5GAEU 4DR5J 5I3PA 4IO9Q 1S57A 3H7HB 4X4PA 1JLQB 4QQBA 5ETLA 1GX5A 1VHIA 3OLAA 2HG4A 4DV6F 3R7BB 3BO2A 4EZ9A 2W9CA 4ID8A 1K0TA 4I6YA 5DS7A 3BV8A 1G6BA 2VPZB 2MJNA 1TKXB 1GQEA 1RU1A 4DR2J 2EW9A 5JVGQ 3CVKA 3QRRA 3CMES 1C0TB 4V19X 2LQ9A 8RUCA 3GIRA 1JLFB 2YKNA 3JQMA 3FMBA 3HI9A 1FX2A 3T5JA 3TX8A 2C2KB 3KLIA 2HZAA 3NEKA 3EZ5A 1LWCB 4WFZA 1NSKL 2OJ3A 3FEZA 3CJSA 2F5GA 2PMHA 3CCRS 5L9NA 3E8OA 4N41A 4QWBA 3NP5A 1G4CA 1IKVB 1DLOA 1TR0A 2DR8A 3KLGB 2G1HA 3VVTA 3ENAA 1LK5A 2VF3A 5IT0A 4NI2A 3DLBA 4ES2A 3AQOA 2W4CA 3R2DJ 3CD5A 4QYZJ 2VA2A 1N4LA 1X4EA 3QIPA 2E1RA 3KMQA 1B7YB 3ENWA 5KFJA 4DL4A 2ATLA 5HSPA 4CI0B 2QMWA 4DX5A 4ZLNA 4ECZA 2JFDA 1ZAXA 2NSBA 5A8WB 4X66J 1FEHA 2R7VA 5DETA 3FBCA 3JTOA 1VBZA 4KPCA 1B0VA 3P49B 1SJ1A 4LF6F 3WX4A 1HBMB 4OFZA 2J76E 1LOUA 4O3QA 1XMQF 3Q2TC 2H48B 1GNKA 4JI6F 4URQU 3N01A 2JX2A 4HI2A 2L08A 2VIHA 4N8OA 3RBZA 3BM7A 2H1YA 1NSAA 3BPSP 4C0OC 1TL5A 5LJ5Y 3EXCX 3J81Y 2MHEA 5KTQA 3JQKA 4DUTA 1L3SA 3FRYA 4IDKA 4M95A 4CH0S 3CCQS 3K5NA 2BZ2A 1UVJA 3BSAA 4Z37A 1NK6A 2HFSA 2IY5B 1IQTA 3PHTA 3A8EA 2PMZD 2HFUA 4DWIA 1AUDA 2ALYB 4JV5F 4QOTA 4ALZA 2E44A 3QT8A 1X5PA 2JEFA 3KNGA 1FESA 3F0NA 4C8ZA 2J7KA 3PRBA 2OO4A 2GHVC 4QU7A 3QPIA 3CCTA 1H98A 2V4RA 1YDLA 4TKTA 1GMWA 2W7OA 2QLWA 3N6LA 2X1BA 4U95A 4EO6A 4DPXA 2FVPA 5GAGI 4YR0A 4B9NA 4UF4A 2KFZA 4DG1A 1X4CA 1Q7LB 2ZH6A 3US5A 4F0HA 3FJ2A 3HFZB 5G4DA 2WW4A 3O2IA 3VAKA 1AA1B 2NUHA 1AFIA 3W1YC 1SBRA 3AHPA 3AT1B 2AEFA 3VHQA 3OTBA 1RAHB 3F56A 5K9FA 1HA1A 4MMOA 2HYIB 1YJRA 4DFKA 3W5ZA 2Z2MA 1MROB 3T1AA 2HHWA 2QLBB 3RBEA 4P7TA 4NWBA 5KG0A 4QR0A 3OJSA 4C3LA 3JYTB 4DFJA 3AB2B 4AL7A 2CNKB 4OX7A 2GIRA 2X3GA 1CJTA 1CJKA 4F3QA 1RHUB 3EGZA 2CQGA 2AGOA 3QAEA 3GIMA 1I51B 2B4UA 4F25A 2MKYA 2R7QA 4UUXA 2B8PA 2FVSA 3M30A 4CLZA 1QE1A 3HHNB 1NDKA 2PC6A 3K57A 1Q95G 1HWUA 4X84A 3SZ2A 2D69A 2B7CB 5LXYA 4ZMMA 3GIIA 1NU4A 1T9WA 3LANA 1WHXA 1DFDA 1LEOA 2OPPA 3KG0A 2IM0A 1RWWB 4OQJA 4QIWD 4N5SA 2W2QP 4C8NA 5IXUA 2FJVA 5LOQA 5DGAA 3TWZA 2MQLA 2K3KA 2DNYA 3IBCB 3KMSA 1CULA 1D0EA 2DR7A 1D1UA 4DSEA 4I7FB 2JJ4D 2ZZNA 4J9VA 3MAHA 2DR6A 1CJKB 2VG6A 3CCES 3EXYA 2GFFA 1RT2A 3ZNJ1 4LVNP 1U7LA 3GYXB 3RAMA 4NCGB 2WSFC 4USWA 5HATA 2IFXA 3U02A 2ZFHA 3M30B 3FQLA 3KOAA 1UKUA 4DV3J 4NXMJ 3TZXA 4X65J 1TP7A 2B6AB 2L9WA 1VJQA 3PXGa 2GS8A 4K4VA 1R8PA 4A46A 5FJ4A 1X8DA 4GVBB 4DS5A 4M5JA 3NS6A 4FDFA 4OJGA 5IC4B 4RBUA 1YHQS 3ILLA 3AXMA 2XYHB 5J2MA 2V4JB 2OPPB 4DOZA 1F2GA 2IJRA 2FC9A 1VCTA 3PIOQ 2FC8A 3VCDA 2DD8S 1X0PA 5HANA 5IZHA 3KLVA 5K8OA 3IR6B 1EB0A 4ZCKA 1RTJA 1TAUA 2AW0A 5HMWA 3NAHA 3VAHA 1DJ0A 2WBMA 3QNWB 1KNZA 2E5IA 3SI8A 2IC3A 2ROEA 2CJKA 2J6SA 3HO1A 2ZVSA 3AAWB 2BYCA 2UXDF 4HACA 3S01A 4QYZK 3UE2A 2QFJA 2BA9A 2R2SA 1URNA 2B3TB 4DL7A 2DGXA 1RT2B 4I6AA 1YK9A 2JL9A 4DR4J 4RW6A 4DL3A 3VV2B 2RKIA 1HD0A 3M8QB 3JSYA 4CNYA 1XNQJ 4NLVA 4DX6A 3L3CA 1CJVA 3M2VA 4KAIA 4FF2A 2IBOA 4NOHA 1FXDA 2WVBA 1H73A 4ZPWR 2NXEA 4DL2A 2KHCA 4PXCA 2R7UA 4FNIA 5J2MB 4OYXA 3QMQA 3S6EA 2OIHA 2D3O1 5DZ7A 4CDIA 1WNEA 1ULRA 3DRRA 2FPHX 1V5IB 2E9ZA 2E5GA 5GAHU 1V9OA 2BOPA 2NYIA 2KYZA 4ED8A 1IBCB 1K73T 4DCJB 3BN4A 5D0RA 5L1KA 2IC3B 1N33F 4OHWA 4PAAA 3T19A 1RT5B 3UWTA 3PHEA 3R27A 1DQ9A 3NS7B 4LREA 5A0YA 3ZTOA 5ADZA 3HM9A 2ZH9A 5KFSA 2RB7A 2HWTA 3U27A 4ZCMA 3MM8A 1S1VB 3ISZA 4J7CA 5GAGU 3IS9A 4B3MJ 2BE9B 2QRRA 3HHKA 3GJRB 1H72C 2J5AA 2EBEA 1TU0B 2GQ2A 2F40A 2XO6A 4OZ0A 6FD1A 4DJBA 1HQUA 1PKUA 4RNOA 4FN5A 4CLWA 2XCAA 1HNXF 2V5HG 3BYPA 1RTIA 3UN5A 1HBNB 1ZH5A 3OTDA 4OX8A 4MK8A 1ZTWA 2YNIA 3KG1A 1V3SA 3QYYA 5ETSA 3EDRB 3OVAA 1WEXA 1N0UA 2GNKA 1HNZF 1X4HA 1HW9A 1JLCA 2UUBF 1U26A 1T3NA 4HDGA 4KGVB 2MQPA 1T9XA 4USKA 3I96A 3DRPA 4F4YA 4Q8FA 3BSCA 1HWLA 2OKQA 5HL7Q 2VONA 3DYAB 2HK2A 2UV8G 4MAKA 1N36J 5A0YB 3TVKA 3G71S 4P10A 3BDPA 2KG0A 4Y0FA 3LP0A 1C1BB 3SMZA 2M8HA 5AJ3J 1HBOA 4EMDA 4Q2MA 1YZ7A 3PRVA 1BGXT 2HRYA 1S4EA 5C2GA 2IA0A 3SV4A 3SIPB 5C42B 4OZ2A 2ZVIA 2QA2A 1VQ9S 4LRFA 3BKFA 1PG5B 1RTIB 1SVDA 4M5GA 3CJ5A 1RQ0A 3Q8SB 2QGFB 4WE1B 3KK1B 2YNIB 4ZVUB 4HI1A 1U0HB 5D4PA 4B3TJ 4LQ3A 4CLYA 2VASA 1X4AA 2WSCC 3PR5B 3N79A 4ZVEA 5A8RA 2KM8B 5KG6A 5ITHA 3RBXA 3KUEA 3KHRA 1TKTA 2HWIA 5K14A 4EWTA 1NH7A 2H4YB 4NRTA 4J9OA 4YS2A 2G0JA 3ILJA 4Q0BA 1R43A 3OLBA 1ZM4A 2X1AA 1RACB 2RNEA 4JI7J 1SPBP 3R5CA 2J7WA 3ETOA 3OPKA 1CC7A 1XTZA 2KTQA 1OYDA 3THPA 4N8NA 4ZVPB 4E0DA 3C46A 3W2VB 2KI2A 1S49A 4NMXA 3L4BC 3NWGA 1HBOB 3K17A 2C3UA 1G1XA 3GIKA 3RBDA 1VI7A 3ADAC 4FVMA 1Q82T 4F4KA 4TN2A 1M1GA 1LWFA 5KFAA 3CJKB 3NGKA 3F41A 5C2CA 1KN6A 3S7RA 2HPUA 2U1AA 5A8KB 4C4WA 3N9UC 1NK9A 1SL1A 4G1QA 2MZSA 1NJWA 1S6QB 3AJ2A 2CPYA 5C25B 1T05B 2ZOMA 4CO1A 4WWSA 3DXBA 3HK2A 1LWEA 2J9DA 1QDUB 2AYBA 3UPFA 4DF8A 5A8RB 1SL0A 3SQOP 1DTQB 1RT6A 1VK3A 5K8PA 1NUEA 3V81A 1CC8A 2UV8A 3BH7B 4Q0BB 2JOQA 4G6VB 3VVUA 3R9LA 4FF4A 3PYEA 1CQNA 4JYAJ 1UP1A 3QZ7A 2CZ9A 3THTA 5D15A 5J1EA 3KDNA 5KFMA 3T9ZA 1IR2A 4G1IA 3IN5A 3G6VA 1HR0F 4PPZA 1ICEB 5KFZA 2KJVA 1MWQA 1OY8A 2MZ1A 4CTAA 1MSWD 5IOLA 2RF2A 3VQTA 2HK3A 3TUPA 1KFDA 3D66A 1VQOS 3C3LA 5DM7Q 2DNHA 3HMJG 4OYOA 3M9NB 4K4ZA 3GE9A 4WTYA 2GQQA 4LRBA 2HNYB 9ATCB 3HD1A 2G4BA 1TV6B 2RIJA 3CGIA 1QUPA 1WSVA 2OHDA 4OYMA 1N8RT 2M2BA 2MHNA 1RCOB 3DM2A 3EVWA 3QT6A 2MMYA 4OHYA 3OFFA 1TL7A 1O0PA 1IBMF 2BKOA 2YQ1A 4LSLA 3T9NA 2X7IA 2ASJA 4IKAA 4YHHF 3MGJA 4OYAA 3HHLD 3A8KA 2F8EX 4N7TA 1F5AA 3CO9A 2P2CB 3FGVA 1SKSA 2GW8A 1WC3A 3KJFB 1G3OA 3AA8A 2RF2B 4UQGA 3POTA 1FERA 4DV5J 5HLFA 4FNHA 2UUTA 3RR7A 4K4TA 2RQCA 4DXLA 3DI6A 2YQ0A 3BGRB 3SSSA 3D1OA 3OR1B 2CNNB 4PZVA 3HX9A 3CCJS 2XY7A 2DPIA 3FEYB 2XZWA 4BC7A 3I0RA 3OTOF 2ZHOA 2DNZA 5ETTA 2AJ0A 2FIUA 4LFBJ 5IM0A 1IJFB 4MYUA 2Z2ZA 2A18A 3GG0A 2WW8A 3H98A 1NHVA 2GO9A 5BR8J 3M2UB 4IOCQ 2XI2A 3GYNA 4E2FB 2CDRB 1B4SA 1LK7A 2QYGA 3RUBL 3L7OA 4NLXA 1VQMS 2UVUA 2F3JA 2HQIA 3HJFA 4NL5A 4NLUA 1FXLA 2Q43A 1VIXA 3WC0A 2MPUA 2IHR1 2R2RA 3J81j 1GTHA 1QLNA 3W64A 4C6AA 5K8MA 4LFCF 1LXNA 1HYSB 5DG8A 2MLZA 4ZLLA 2X51A 2DISA 5G0RB 3GCXP 3CJQA 3AY0A 4OLOA 3DI6B 2R7WA 3NRBA 5HK4A 4OL8A 4F4AA 2Y3YA 2VODA 3OSPA 4FZVA 1LW2A 2GAHC 1RT1A 1WI8A 2VOOA 3A1YG 3DLLQ 5J2NA 2YNHA 1RHMB 2BE7D 3EJMA 1RGVA 3UVJA 5I42A 2R3VA 1SJQA 3FK4A 3BR8A 2OFGX 1ZA1B 1RWXB 4OI4A 2AYGA 3LW5C 3IRWP 4X4QA 2F4VF 4ENOA 3TA1A 3AA9A 1S9GA 3HT0A 4PG6A 4QIFA 3ZC4A 4C3KA 5JMNA 2WB4A 4MK9A 2NXJA 2R42A 2OAUA 3OFGA 2I9SA 3PV8A 2XMTA 3CJ3A 1TQLA 2K06A 4DX8H 2XS5A 3PEHA 2ZITA 1CVJA 2KN4A 4PUOB 3MDFA 2RQKA 3CUNA 5DLGA 1OSDA 2QL7B 4NCBA 1IVZA 2CQIA 4DR3J 4DI6A 4FBUA 1R89A 1CQMA 4QYRA 1SKWA 1RTHB 2B51A 5KFKA 4HH1A 1DTTA 2H51B 2PGCA 4M63A 3OFHA 3IBWA 2CPFA 1KSPA 4PR6A 1BQMA 2MKSA 2V0NA 2HW3A 4NLYA 3D0IE 4ELVA 3TP2A 3D67A 1PYTA 1NPKA 1JLAA 3UVJB 3BEGB 5D4LA 4X4RA 3QJLA 1TVRB 2HNZA 3GSIA 1A6LA 2XMMA 2ZH4A 2QIFA 5F8GA 3U7JA 1NB7A 4UUWA 4NZ7A 4CNZA 1K47A 1LWXA 2ASLA 1HI8A 1TL3A 4DV0J 1U24A 3MM5B 3QIDA 3CULA 4FVCA 3KNAA 4JI2J 2MXYA 3HSDA 1OY9A 2WOMB 4LRDA 1U0SA 3G82A 1CS4B 3D1QA 1J27A 4F8RA 2NZCA 5L38A 3CSKA 4RW9A 2UXBF 2C2EA 1HNVB 3RB4A 2VC0A 3PTWA 1UZDA 2UZAA 2K3IA 5KT6A 3MEEB 2YKAA 3ELHA 1S48A 5SUHA 3GLJA 3JB9k 2IA6A 3D54A 3SXLA 3IR7B 3M6UA 1C4AA 2RQMA 2QMUB 4GRSA 3G6ES 4CYUA 3PW0A 3WIVA 1QD1A 3HHDA 4IR9A 3CIMA 1MN7A 2HVZA 3N6MA 5AE1A 4ECRA 5CYQA 1TL3B 2VBYA 4JI8F 2AD9A 3HSZA 1FT8A 1EJ7L 3OW2R 3Q23A 3Q86A 2ZH1A 4UOFA 3ILOA 1DURA 4EBEA 1TELA 1U45A 3G82B 1J5EF 3TUZC 4ZK7M 5A6WA 5B09A 2N4DA 1WI6A 2C2ZB 2IDLA 4I64A 4JI3F 2V68A 1PILA 4DR5F 2CQBA 1DHMA 4HDHA 3OL6A 1REVA 4AUKA 1TK5A 2GQCA 3GPAA 5KT4A 1NSQA 3RYLA 1HNWF 2ZBCA 1SUQA 2HVDA 2DRAA 1T8EA 2ZM6F 2BM0A 3DLGA 2W8LA 3FRZA 1IBLJ 4CH1A 2NZ4A 5D3GA 5KFQA 1F2HA 4YY3F 1FKOA 2MQQA 1JQGA 4KH1B 5KFOA 4Y34A 4LFAF 1SC6A 2PEBA 3DRYA 4RNMA 2K8GA 1U1OA 4ZP7A 4QJVA 2Z8QA 1FJGJ 1U2RA 4R8UB 3NNAA 1NRKA 5LMUF 3B4DA 1WDTA 4B3OB 4DUZJ 1D8YA 3WZ0A 3WC2A 2M52A 2LEAA 4CCHA 2PT0A 3D5MA 1SL2A 2UU9F 2ACYA 2DHXA 4FP9A 2K1RB 3L95X 2HQFA 4ED0A 1KS2A 5A2QU 3TR5A 5IWAF 2FZGB 2I5JB 4ILRA 5DQHA 2B0GA 3LP1A 1TUVA 1HKAA 2FHJD 3VGUA 4EZ6A 5HI7A 4QIVA 3CC2S 3OTEA 2RHSB 3HPOA 4DV1J 2GIQA 3NG8A 3MF5A 1HW8A 1E6YA 2DH8A 3MMBA 4WU2A 1VJWA 4Y2CA 5J2QB 4L73A 7FD1A 5KFVA 1SUQB 2A0FB 2ZE2B 1NKBA 2Y1RI 2QMXA 3ZZPA 4A8QA 3O5TB 1BD6A 4WXOA 4K0KF 2PE8A 5D3GB 1R7IA 4DUYF 4R5PB 4ECVA 1Q8BA 1KP6A 4C11B 3Q22A 3E01A 2WRMA 2VICA 3I5CA 3A3OB 3DLEB 2FUG9 2J8SA 4LBIA 1RT4B 4EGLA 2RUSA 1JK9B 1S10A 4BC9A 4ZHRA 3E51A 4D3HA 4QR1A 2MKCA 2EFGA 3WX8A 4PXEA 4ED3A 5J1NA 3TEGA 3T5LA 3FBFA 1O6XA 3D6FB 1N5QA 4D3GA 4ECWA 3X3UA 1HLWA 2KHDA 4MYTA 3PW2A 1XN9A 5KG7A 3FCVA 3K7RA 4B3SJ 4BLGA 3MURP 4OX6A 2GVZB 4PWDA 4U8VA 1NKEA 4F4WA 3BREA 3IFEA 1FFWB 5IT9U 4ICLA 4N56A 1JIHA 2GJFA 1P6TA 2V67A 4ZN1A 1VRQC 1FRIA 2VG5A 2DIUA 2W7AA 2IM2A 3MR2A 2DRDA 1U02A 2J0SD 4USHA 2MKKA 2AEJA 3BKTA 2G1DA 5B0AA 3E01B 4CQ1A 4O3PA 2HVHA 4ZLJA 4GKJJ 4ZVQB 3CIZA 3UDEA 3L7UA 1KQFB 1ZOTA 2B5JB 4DSFA 1WELA 2IVFB 4LF4F 1HWJA 3RAXA 4URSA 1RT3B 4N77A 2FY1A 2FJBB 4OMFG 1VLOA 1AZSB 3FZBA 4EI2A 1R0AA 1IQZA 1VBXA 3ENQA 1U47A 3HZGA 3TAMA 3IRXB 4LF5F 2MZRA 3IP0A 3T1HJ 2DR5A 3B8HA 1NXIA 1W26A 3SDEA 3UO0A 1Q4RA 2F65A 4O4GB 4NRUA 1RT7A 4FF1A 4ED7A 4TLRA 4CP5A 4ZJLA 3QATA 2G0CA 4TY8A 2XNQA 5KOXA 3G6XA 3GV5B 1I1GA 1ROFA 4ICLB 3BJYA 3B54A 1Q8KA 2QA1A 5KFWA 3OHBA 1NEEA 2C3MA 5CQGA 4Y2AA 3H2VE 3C16A 2QSFA 4ZPCA 3M2RA 4P72A 2VG5B 1N34J 3LQVA 3UNGC 4NLPA 5B0CA 1YKWA 1VBKA 5EGYA 4NLQA 3CPWR 2UXCF 4FBTA 1S1WA 4RU2A 3C6TB 1U25A 2Y0SD 2VPXB 2LXFA 1SIWB 3HVAA 3I9ZA 4OI6A 4RKUC 3RRGA 2BANA 3Q89A 4HYKA 5HQ8A 4JV0A 3MEKA 1ZA2B 2ZNYA 3CMAS 2OPSA 4OI2A 4NYZA 5KOWA 2QJ3A 3TRGA 4ZS6A 2IAJA 4U96A 1V6HA 1UJ6A 1MWYA 4KKOA 1C0UB 2H3EB 1LV5A 1JNZB 3AJ1A 3EZOA 1RT7B 3HFVA 3UCGA 4DDFA 2ERRA 5K8NA 4AXIA 1WTBA 3RU0A 3LOUA 5JUMA 4QWDA 2HHVA 1SH0A 4Y2MA 1T7PA 1ELOA 3FQKA 1TFYA 2YBVA 2N7YA 4MKVA 1VBYA 2IPOB 4ZJQA 3QGPA 4RUCA 2YKMB 4M5LA 4WKYA 1RAFB 2M5YA 1KVKA 3TYTA 1FE0A 3J7YI 4NASA 4Q43A 3KHLA 5AXMA 3BSNA 4LF9J 2CJXB 4PXBA 2HBYB 3K59A 2XS7A 3Q8VA 1ZZNA 1YLXA 3GV7B 2AX1A 2CNOB 4UY85 1P1LA 4JV2A 1HBUA 3ONQA 4RUHA 3MMCB 3Q8UA 3CCSS 2MLXA 1KONA 3OBIA 3RB0A 4AQYJ 3H2LA 2HQCA 5GADI 5KAKA 4KKOB 3ET6B 1VK8A 1B99A 1SQGA 3W7BA 3NNHA 1D8ZA 4ED6A 2VBWA 3KK3B 2DHSA 3HULA 1GXLA 3V6JA 2RAQA 3PW5A 3SCLE 2CPHA 2I6WA 3MEGB 5H9EJ 1M5PC 2VC1A 1EP4A 3KJQB 1I94J 3NY0A 1UVIA 3IM8A 2BOAA 1EETB 2CIMA 5LMNF 1NDPA 4H4OA 4ZCIA 4I56A 2QFIA 3HVWA 3TAPA 5F8JA 2EFOA 2ZOFA 4ED4A 3KJVA 4Y3CA 4F02A 1FDDA 4FPRA 4DV2J 4X64J 1U1LA 4OYBA 5HMZA 5DDQC 3PG9A 4RW7A 3Q8RB 1IJEB 3H42A 2M7SA 1DQ8A 1JLEA 2Q6CA 2IRUA 3CD0A 4PWUA 2MZJA 5KFBA 4LF2A 1F1BB 4LBHA 3EMTA 1HBUB 2V8PA 1XMOJ 4AFFA 5HP1B 2MZQA 2CJYB 2PO4A 2V2QA 3GR0A 4LSNB 1R6VA 2PA8D 4OJ1A 5KFIA 1P8GA 4PCQA 2RE1A 1M5KC 2X3DA 3BGFA 1RKIA 3FBBA 2MTLA 3M8ZA 1RTDB 1FCAA 2Z2LA 3AFGA 3OSNA 1XR6A 2LFVA 2RDJA 1ZAVA 4DV6J 1WOOA 3R5BA 1U1PA 1WEZA 4F4ZA 4H4OB 3BBFA 3NNCA 1F9EB 4OZJA 2HNDA 1HPZA 4DR6F 4ZITA 4OZ5A 2YNGB 3MR3A 2ZBRA 5D6GA 1B64A 3MAAA 3G2XA 4RX6A 4RW7B 3I87A 2DITA 4IYQA 2VU5A 1FI4A 1F6TA 3QWPA 3K2YA 3BQ1A 4HHUA 3LALA 5K5MA 2LU1A 4P73A 1J5OB 3DLHA 2JWNA 2Z30B 2FD2A 2CAJA 3JAMY 1XC9A 3M8WA 4ZPVR 2FGCA 4LF8F 2XMAA 2DXFA 6FDRA 5KFYA 1YX2A 2XGQA 3R2CJ 3OL8A 4W4MA 3MM6B 4IOBA 5LSOA 1VISA 3VAMA 1RYSA 4X4VA 1IKWA 1FDNA 3FFIB 2MB0B 4RLEA 2I2YA 1GAOA 2RD5C 1W7WA 3N0VA 2R7OA 4LF1A 2HHTA 4YFUA 1NBEB 2IDEA 2QL5B 4ZDNA 1VR6A 3I0SB 1S0NA 3UFCX 5E3PA 4MKYA 3IXQA 3U1NA 3W2WA 4QPTA 4YP3A 3GZ7A 2YWWA 1R0CB 5T7LA 4B08A 2FB0A 1UMJA 4DZDA 3K5LA 4KPYA 3VZIA 1XMQJ 1VQ4S 2LMIA 2W8KA 1KHVA 4JI6J 4I67A 3RZAA 2QA4S 4RL1A 2HFOA 3MUVP 3OL9A 2CQ3A 1Q0NA 2J0QD 1WHYA 2JNJA 3W63A 3J7AN 1UWBA 2BKNA 4LVOP 2MZTA 1QTMA 2HRTA 4LRAA 4M5DB 1WKJA 2DNNA 4B9VA 1FA0A 3ZXWA 4ZVFA 4K4WA 4HVZA 4JV5J 4LR7A 4I4BA 3LUYA 2KH9A 5DZ6A 4HLBA 4DQSA 2V6AA 5HAOA 1IKWB 4C3MA 2R7XA 1H7WA 4RWXA 2CYYA 2M9KA 3CW2C 2HFZA 3QFHA 2BQRA 4FKXA 3D0GE 3NCPA 4ETZA 3W2WB 2HQ3A 3OQ2A 4HHHA 2HHSA 5KFPA 4DPTA 4RU9A 2DCUB 5A6PA 2HS0A 3V4IB 4IQMA 3QGHA 3MM9A 1RB0A 1YWXA 2KFYA 2YWEA 3P6YC 2KRRA 1SV5A 1R0BG 4J9NA 3UQSA 4EYIB 5GADU 2ZBPA 4OZ3A 3A3NB 1GFWB 2XBPA 1GT8A 5ETMA 1HI0P 5DQIA 4GKKF 1UWBB 2E1MC 1Y5IB 4OYWA 3K5PA 3R6LB 2B4OA 4TU9A 5KT7A 1FRMA 2R9LA 1IR0A 1QSLA 3ENVA 2BRKA 4DR1J 3M8SA 1HHTP 1WJ9A 3BBBA 3WBZA 3CCLS 4WIQA 1Q16B 1ITPA 4I2QB 2G2OA 2B8QA 1JJ2R 2R7RA 3H40A 1NMEB 2W4PA 3IGVA 2CJQA 5KFXA 3GTYX 5EWGA 4KV8A 1VS3A 2LA4A 5HVGA 2CPZA 3MD3A 3CO0P 3ZFVA 3TNVA 1VRTA 4X4TA 2KVQE 1NDLA 1JKHA 4ZOSA 2YKOA 2YXLA 1RYRA 4A8XA 1RSCA 2L9DA 3KXDA 1PSDA 4O44B 4IG0A 4DFPA 2Y0BB 2W01A 2A6MA 3MM9B 3G4SS 2BJ9A 3PIPQ 3QRPA 4E98A 2WB1D 3LWMA 1FE4A 2WONB 4UZBA 1AROP 2CJAA 2CQ4A 3Q8YA 5AT1B 1VYAA 3MPVA 2VPYB 1MMLA 2LVWA 3G86A 1NHKL 3DHWC 4P2FA 1XIQA 4YR3A 1JLQA 1AB8A 1NO8A 1YRUA 2D3ZA 1S12A 2NSCA 2FJDB 1L5UA 3MFHA 8ATCB 3GFZA 1U1NA 1RU2A 3R5JB 3QZ8A 2VPWB 4KGMA 4KE5A 3DU5A 1U2FA 2EG2A 3SBMA 2LDIA 3T5HA 3PX0A 3IBFB 4I69A 2RUGA 1LWCA 3MUMP 2V50A 3PCOB 1K1QA 2NUUG 4F67A 4NE9C 2F9DA 3HJVA 3PO4A 4IG3A 2XZTB 2HWHA 5CZXA 1S59A 4C0BA 3U1LA 5D0EA 4V19J 3KLGA 2RT3A 4UY8T 1IKXB 3HDSA 4UW2A 4DCPB 4PQUA 5DQGA 1S6PB 4MIWA 2LCWA 3JTNA 3ZZ0A 2VKZG 1OY6A 3JSRA 3MXHP 3RAQA 2HZCA 3NGSA 2XZDB 2ROGA 3I82A 1H0HB 3V6HA 2HQGA 1SJFA 4DSKA 1S4FA 2Y1JA 5A8WA 4OYZA 2RRNA 2VDIA 1F5CA 3I55S 1YBAA 2NXUA 2YWHA 1NK8A 3ETMA 3L09A 3QLHB 2GO8A 5I3UA 2LKZA 2O67A 1OSCA 3GYGA 4CWBA 4OI3A 3WHIA 1HBMA 1IM6A 4KO0B 5DDOC 1NCLA 4Q5VA 3Q2SC 3OTCA 3DKDA 2HVEA 2JC0A 2EBGA 2DH9A 3MR5A 4CO5A 2XYPB 4A8YA 4WK3A 4CO0A 4IG3B 2M4MA 1ZM2A 2BJ7A 2DNMA 1RBOB 1YITS 1LKZA 3IG1B 2BR0A 2DO0A 4X4UA 4ED1A 2LQ8A 3MCOA 2ZBQA 3M9MB 1FTCA 1XR5A 4PQUB 3PX4A 4Y65A 1RAEB 4MFBB 3SCIE 1W2BR 1Q5VA 3VR1A 2P6SA 4NEZA 1JWWA 1KQSR 3MCMA 1N33J 2ATCB 2B4VA 2CPJA 2O5DA 2FZCB 1VC0A 5L1IA 2EK6A 1PGZA 1WACA 1XBWA 1M5SA 5I3UB 1Q8LA 4WZQA 3VAFA 4H4KC 2VFSA 2RQ4A 3GMGA 1Z2ZA 2ILYA 4OZLA 2FVQA 3JQJA 3EE3A 2L9NA 1KOOA 2CQCA 2XWXA 3C14B 5U47A 4H54A 2W9AA 3CXCR 2EWHA 5F8MA 1HNXJ 3A8IA 3JSBA 5EX3A 1T03A 1WG4A 2Q3PA 2COLA 2UVWA 4RW4B 1S1UA 4EYHB 1MROA 1N6QA 5DDRC 3I6PA 4PG7A 3W5YA 1VQ5S 5KG3A 2DNOA 3DRSB 4ECUA 2FLOA 1T11A 3JYTA 3KK2B 2AJFE 1HNZJ 2MGZA 2LQJA 2UUBJ 4A4JA 1S5ZA 1JLGB 1M5OC 2LLZA 3H59A 2FLPA 2CPEA 1PYOB 5FLXY 1ZETA 3UD5A 4M5HA 3HHLC 5CYMB 1W25A 4BWMA 4EK2A 2GJIA 3SFGA 3V6DA 5AXKA 5M2RA 1JNRB 3AQPA 4ILMA 4A8OA 3HKZD 3CJ8A 1XQIA 2DHAA 1YBUA 4EEYA 3UI3A 2AP6A 3JAMU 2RS2A 4GO7X 5DDPC 4UOHA 8AT1B 5GVQA 2YNFA 2IBKA 2JVRA 4AXJA 3OFEA 1T03B 2HFNA 3N5FA 1X4FA 4OJ3A 1S1UB 1N6QB 1ZPWX 2OMLA 3CDWA 3M8PB 2YKQA 1NZAA 1QUVA 1N5VA 2B7BB 1SJRA 3H90A 4I7FA 2AGPA 3EX7B 2MGZB 1T95A 1NK5A 2OPQA 3KHGA 1LNQA 5J1PA 2WTFA 4LR8A 3K8WA 2KL8A 4CT8A 3Q0AA 4NCGA 3IAM9 4EU0A 4OV1A 1RWUA 3DOMB 2XSJB 4O3RA 2R8GA 2GMJA 4FYXB 2B6AA 1NB2A 3VGVA 2LU2A 5HBMA 3DN9A 5T14A 1EZZB 4GVBA 4TNOA 3CE8A 3C8YA 1N0VC 3KLFA 4XK8C 3V6DB 1CEZA 4RUBA 4JI0F 3CCMS 1SJ4P 3KLHA 4MJKA 4J91A 2V4JA 4ZPAA 2UUAF 5ETNA 3ZZUA 2AGQA 4DL0C 5KT3A 1N56A 3J7Z5 5C5JA 3PFOA 3H5YA 3SYZA 2ZBIA 3GCWP 2QL9B 2J0WA 2YNFB 4QIEA 3A8JA 2C2DA 4CO2A 1WC4A 1KLMB 4P75A 1RADB 4L3KA 4M5KA 2E1AA 2WK4A 3HKWA 4KFBB 4I68A 4DR7F 3GIJA 4FXDA 1OPZA 3NGRA 1TAQA 4RW8A 5J2PB 2ALZA 4OHXA 2OPQB 4DS4A 3SQGA 2C28A 4WXWA 1RWNB 1RCXB 1RTZA 2VFRA 2PFDA 1HHQA 1S0VA 3M8QA 4NYPA 2C42A 2XO7A 3QBCA 4AT1B 1PYSB 3DXSX 5DGBA 4K5SA 3VAGA 5HBMB 2IYGA 2ZZMA 4Y28C 1N48A 2M88A 5FIIA 3KLFB 3WIUA 3LA0A 1Q53A 1HR0J 2O01C 1NPRA 3KLHB 2YTCA 3VAIA 1VRUA 3W9JA 2BDPA 4MKAA 3OR2B 2E66A 3R1HA 2F9JA 4IFYA 2QN6B 4USUA 2DEJA 4PKDB 2PA3A 1WDDA 3T1YF 3CJRA 4MIBA 2EFVA 1VIOA 3DU6A 3PW4A 1RT5A 4QW8A 1RBAA 4OYPA 2GMHA 4RW8B 1BC6A 3LGNA 2L41A 2DGVA 4EBDA 2JEIA 3SQGB 1RJJA 4TLQA 3DOKA 4XPEA 1S1VA 2HGMA 1SB6A 2GV1A 4MK7A 1FK9A 2YH1A 1Q81T 1KRPA 1N52B 1DY3A 3TEHB 1YSJA 2QE5A 1ACMB 1WOSA 2DY9A 3MHYA 2CWKA 2CVIA 1IBMJ 4X4OA 4DU8A 4ZVRB 5KT5A 4DN0A 3N5BA 2JLFA 1VQ7S 5HROB 2R7TA 4NZ6A 4YHHJ 4XIUA 1HBNA 4X62F 5RUBA 5KFNA 2HQDA 5F9NA 2DK2A 3MD1A 2OGUA 3EGWB 3D1HA 3ISND 1S1XB 3K5MA 1E6VB 1VRUB 4LIWA 1MN9A 2OELA 3C66A 4P9SA 3TQEA 4IFYB 1XEZA 3RW6A 2E7VA 5HQLA 1HQEA 1PIEA 3LH2S 4JI1F 1VMBA 3AH6A 3Q8PB 2A2CA 4J5OA 2PEHA 1A0OB 4ETXA 2RJZA 3O3LA 1PAUB 2OMOA 4CLPA 3MEDB 1UVKA 2IJNA 2NYHA 4F26A 3F44A 2VDHA 3DYAA 3OD2A 1TL1B 3LAMA 1MW7A 5GAEI 3J7A1 3TQ1A 3OTOJ 2KB2A 1TK0A 1T02A 5THWA 4WK1A 1C1BA 2MKHA 5CHCB 4KT0C 1KBRA 3DOKB 4ZVTB 4OX9F 4G1PA 4PYAA 5F8HA 1FK9B 1QAIA 4NLRA 4OI0A 5DRKA 2GVDB 2GGPB 2EG1A 5CZVA 4PABA 5C42A 4R0EA 3MECB 1B7FA 4NA1A 3I5BA 3P8BB 4U7UK 1XNRF 1N5TA 3TJ9A 1H38A 3DFEA 3HT3A 5KFFA 4WE1A 3KK1A 4DQQA 2OTLS 4LBPA 1KHWA 5CH7B 1U0HA 1UCNA 3JSMB 1N5SA 1BWVA 1UVNA 1HMVB 2B9WA 1Q7YT 2YKPA 1QSYA 2A2DA 3PYGA 2HHHF 1HQEB 3QFWA 3ZNUA 1V3RA 4DX7A 4NZ0A 3M6VA 4DQRA 4W98A 2G9OA 2BJ8A 2Y1LB 2I0XA 1IKYA 1HD1A 2ROPA 1FVSA 3LGHA 1DQAA 4ZN3A 2XC9A 1FDAA 1Y4ZB 4TXSA 4ZP8A 1FD8A 1S6UA 2SXLA 2UUCF 4ZJOA 1YJVA 2O1PA 3W2VA 3QQCD 1O51A 1RISA 1RWKB 2HMIB 2F4VJ 5KG5A 2J0XA 3IWXA 4QPXA 4O0IA 3EYZA 2AHOB 3VGTA 4H4MA 1UA0A 4A48A 4P7VA 3MTJA 1RK8A 3A13A 2KT5A 4F7VA 5GMEA 3CJKA 2V34A 4GC7A 5CYJA 3OXLA 4YB1P 1K44A 5A8KA 5L1JA 4KHPF 1OYEA 4M5NA 1VDHA 4P52A 4EFAC 4LF7F 1VQ6S 1S6QA 1U1MA 1FKPB 1T94A 3SSQA 1TUGB 3DOLB 5H9FK 3O1LA 5C25A 4Q7AA 1OPIA 2LECA 2CQDA 1T05A 1IR1A 3L9ZA 1B0TA 1I5OB 3DGPB 1DTQA 1IKYB 1RAAB 5DG9A 1FFGB 1YRTA 5BYQA 4KB7A 1X5TA 1FWLA 4EUVA 2EK1A 3U1MA 2VG7B 1U8SA 4W92B 1P1TA 4IH6A 1X5OA 3NBPA 3CDAA 4MKBA 4U9RA 3RB3A 4JB8B 4U67Q 2C1EB 4USMA 3DDKA 4K2JA 5KFHA 2MDAA 4KGXB 2JZ5A 4KHRA 1GEHA 1G7CB 4MIAA 3BSOA 2GJ2A 4B3RF 2KZMA 3OXGA 2Z58B 2OH2A 3CD6S 4DLEA 2I8EA 4CZCA 2C2RA 4H4MB 4WFYA 4K50A 3J81U 2VOPA 1GMWD 2EI5A 3PO5A 2HS3A 2OPRA 3PEJA 4F04B 4CO3A 2MQOA 4DV4F 2EFQA 2K7JA 2OEKA 2EKNA 2NPIA 1JX4A 1M5VC 3MI7X 1TKZB 2J8AA 4CIOA 2XGPA 2UXBJ 2F8HA 4ANEA 3PR4A 3I9V9 3W8GA 5EWFA 1MG7A 2HNYA 3DMJB 4R25A 1VQNS 2KT2A 3AJDA 2I38A 3NLCA 4CO4A 4FYDA 1TV6A 3MM7B 1PCAA 1PAEX 3ITHA 1TZ0A 3PJWA 5FLXU 2JVOA 2XHCA 1X31C 4A47A 3EPGA 1SC1B 3M7VA 2D3UA 3NBPB 5HVHA 2ZKUA 2XY5A 3G9CA 4JUZA 1XERA 2W9BB 5F9LA 1KEKA 1BMQB 4M5IA 2MQNA 1RWVB 3K0JA 5LSRA 2IVMA 2P6TA 4ID5A 2F4FA 4URGA 1KKHA 2WBRA 3PYFA 3V5RA 3S8SA 4JI8J 1H6KX 2V8VA 3I32A 5LM7E 3LPYA 3NCRA 2C2NA 2OPRB 3D4JA 3R1LA 4K4YA 4CLFA 1YG0A 3OUYA 1XWLA 1U1QA 3BQ0A 4HTIA 1HWKA 3TJAA 3J7ZT 2FDNA 1DZ5A 3HD2A 4NA3A 3TX0A 4YB7A 2A10A 3BGRA 2HHUA 1J5EJ 1UWAA 3JS9A 3CCWA 4C7QA 3OR1A 1S77D 2FJAB 1U09A 1EKRA 3PKYA 2GMLA 1GX6A 1N32F 3W9HA 4JI3J 3V6KA 2JEJA 4DLGA 1WG1A 4M5MA 3H25A 4OHVA 2N7CA 3SCJE 2O3DA 3ITHB 5B0DA 2V63A 3NXZA 1S9EB 2DHGA 1HNWJ 2FLLA 2CPIA 3M2UA 4Y00A 2OEMA 2ZM6J 1J2VA 1APSA 3EWGA 4L75A 3TVZA 2B4PA 4A8MP 1D9FA 4ZPTR
chains in the Genus database with same CATH topology
2J6TA 4Q44A 2PO4A 4RW6A 4B9TA 4DL3A 4WFBQ 2L48A 1JLBB 3FZ2A 3P5TL 3GR0A 2AYEA 2ILZA 2RKIA 2G13A 4LSNB 1HD0A 2DPJA 2PA8D 3M8QB 4OJ1A 5KFIA 4Q45A 2JEGA 1P8GA 2M70A 4PCQA 2RE1A 4DL6A 3JSYA 3VF0B 2R8JA 4CNYA 1M5KC 3BGFA 2PN6A 4ID5B 4IQXA 1RKIA 4NLVA 3L3CA 2J9DE 1RA6A 4I2PB 2XMVA 3M2VA 1RTDB 3K58A 2VQFF 4KAIA 4FF2A 1FCAA 2XSFA 2Z2LA 4JI4F 3OSNA 1XR6A 2IBOA 4NOHA 1FXDA 2RDJA 1NKCA 1Y00A 3PJXA 1ZAVA 1HYSA 2N3LA 2CRLA 5LJ3Y 3R5BA 4ZPBA 4LFBF 1U1PA 4ZPWR 4C8YA 1REVB 2XULA 4NLOA 5G0RA 3OUYB 2R2TA 4DL2A 2YVSA 4KGKA 2JH3A 3DC2A 2KHCA 4PXCA 2R7UA 2FVRA 4FNIA 1WEZA 3NCQA 3HVRA 4F4ZA 4H4OB 2AV5A 5J2MB 4ECXA 5BR8F 3QMQA 4C8MA 5E2QA 3S6EA 2OIHA 3NNCA 4K2XA 1CPZA 4OZJA 5F0WA 1WNEA 2HNDA 1HPZA 1VOMA 1ULRA 4DR6F 3DLGB 4OZ5A 3DRRA 5IQ6A 4IRCA 2FPHX 3FEXB 1OQ3A 2YNGB 4TYBA 2E9ZA 2E5GA 5GAHU 3MR3A 3I56S 1ZPVA 5D6GA 1V9OA 2BOPA 1FKOB 2NYIA 2KYZA 4ED8A 4J9KA 1B64A 2UUWA 1NK0A 4K4SA 1W2IA 3VAJA 5GMKa 1K73T 4RX6A 4RW7B 4W90B 3I87A 3BN4A 1D3WA 4XAKA 2DITA 5F8IA 5B7WA 5L1KA 4IYQA 2IC3B 2ZHBA 1N5YB 2XLKA 1N33F 3M8RA 5LT5A 4A8SA 1NH8A 3QWPA 4OHWA 3K2YA 1IN0A 3T19A 4F2SA 1RT5B 2XEXA 3UWTA 4OLPA 3BQ1A 2GA7A 3PHEA 3LALA 3O6QA 1PO6A 1KQGB 4RW4A 3CF5Q 5K5MA 3R27A 2LU1A 2E9TA 1DQ9A 2ZH9A 5A0YA 5ADZA 2V2KA 3HM9A 1J5OB 3H5UA 3GWCA 3H4BA 3DLHA 2JWNA 3K5OA 5KFSA 2RB7A 1YTYA 4BCAA 1PC5A 1U6FA 4CH7A 2FD2A 1SIZA 2W9CB 2HWTA 2MQMA 3JAMY 3U27A 1XC9A 4ZPVR 3DRSA 4ZCMA 2FGCA 5L39A 5JVHQ 4LF8F 3N4WA 1YJTA 2H5EA 3H4DA 1K1SA 4AE5A 3KK2A 3MM8A 5KFYA 6FDRA 1KFSA 1S1VB 3ISZA 3PNIA 5GAGU 2XGQA 3QWUA 3IS9A 3QJPA 3OL8A 4QWCA 2QRRA 3HHKA 4L6V3 3MM6B 4YEAA 4ES3A 2J5AA 2MSSA 2EBEA 1JLGA 4IOBA 2D74B 4PUOA 1BQNA 5LSOA 1PC4A 1FNOA 2GQ2A 3VAMA 4TQSA 1RYSA 4C98A 3LP1B 2F40A 1KQKA 4X4VA 3VQSA 2V4QA 1DRZA 3W3SA 4OZ0A 2YKNB 4DJBA 6FD1A 1HQUA 2DNGA 1IKWA 1FDNA 3FFIB 3G8QA 4FN5A 4RNOA 3KLIB 4RLEA 1YJNS 1JJ4A 2MB0B 1F9FA 2QSWA 4UOCA 2XCAA 1HNXF 3MOZA 2ZOGA 2I2YA 1Z2LA 2V5HG 1GAOA 1RTIA 1H2VZ 2RD5C 5CYMA 3BZQA 1E6YB 1RTHA 3MMBB 3CB4A 3N0VA 2R7OA 2V9WA 1HBNB 4FF3A 2HHTA 4IOAQ 1ZH5A 3OTDA 4GMKA 4OX8A 4YFUA 4MK8A 1ZTWA 4ZDNA 2YNIA 3EUNA 3I0SB 3QAUA 3KG1A 1S0NA 1X9SA 1V3SA 3UFCX 2KKHA 5E3PA 4MKYA 1DLOB 3QYYA 2JDJA 3IXQA 3U1NA 3W2WA 4QPTA 5T41A 1FJEB 2GC8A 4YP3A 1R8HA 3OVAA 7FDRA 1C4CA 4RNHA 3GZ7A 2BXJA 1WEXA 2M3DA 2KO1A 5T7LA 1N0UA 2UP1A 2BABA 2GNKA 2B43A 1HNZF 4B08A 1L3VA 5AE3A 1X4HA 1HW9A 1NK4A 3TA0A 1JLCA 1M0SA 2FB0A 2FHKA 4DFMA 1UMJA 3M9OB 2UUBF 2LYVA 4X4NA 3K5LA 1U26A 1T3NA 4KPYA 3VZIA 4QIGA 1VQ4S 2LMIA 2W8KA 4HDGA 3I4PA 1KHVA 5GAHI 1H7XA 2MQPA 3TO8A 3GFXA 1TVRA 1YJWS 4I67A 3I96A 4JI5F 3DRPA 4F4YA 4Q8FA 2RMLA 1QAYA 3RZAA 3BSCA 2QA4S 3V2UC 4I1TA 1HWLA 2OKQA 2Y1IA 4DEZA 5HL7Q 1X5SA 2VONA 3DYAB 3QO9A 2UV8G 2DGTA 4MAKA 3H5SA 3QIPB 1S72S 4MTPA 5E33A 2JRSA 2HFOA 3MUVP 3DHXA 2LEPA 5A0YB 3OL9A 4DR3F 1Z4UA 2FJEB 3TVKA 3G71S 1VQSA 5DO2A 3M8PA 3BDPA 2CQ3A 2KG0A 4Y0FA 4NX9A 3LP0A 3MM5A 4ZHRB 2DJWA 1FEEA 1WHYA 2ZH7A 2E5LF 2J0QD 1C1BB 3OV7A 2APOA 3SMZA 2ZKTA 4WIIA 1F5BA 1UWBA 4LVOP 2MZTA 2AX0A 2M8HA 4DL5A 1QTMA 1HBOA 4Q2MA 1BGXT 4M5DB 2HRYA 2WOMA 4B9MA 2DNNA 4B9VA 4WZMA 3GR1A 3GFHA 2RRBA 2MY8A 4JV0A 2D9PA 2IA0A 1FA0A 1BQNB 2FTRA 2RU3A 3SV4A 4ZVFA 4K4WA 2XMUA 3G8SA 1S0MA 5C42B 4HKQA 4HVZA 3BR9A 4I4BA 3LUYA 2KH9A 2J9CA 4HLBA 4F3MA 1UL3A 4DQSA 2C22A 1CG2A 1HNVA 1IKWB 2HGLA 2QA2A 3DOMA 3SCKE 5AE2A 3UCZP 5KFGA 2XSJA 4C3MA 4PWDB 1FTRA 2M0GB 1H7WA 4RWXA 2R7XA 4YOEA 4L3NA 2CYYA 1VQ9S 2M9KA 4HT5A 3EPIA 1RTIB 3MEEA 3CJ5A 2D3OR 2HIQA 1RQ0A 2HFZA 4MH8A 2X1GA 3Q8SB 2BQRA 4WE1B 5H1SV 3PKMA 1X4GA 5HMYA 2YNIB 3KK1B 3D0GE 2K2PA 4I0WA 3NCPA 3UD4P 4ETZA 4HI1A 1Z1ZA 5D4PA 4LQ3A 3W2WB 2CQHA 3OVSA 2R8HA 2VASA 2HQ3A 3OQ2A 4DV0F 3CJ4A 1IBKF 4UQTA 2HHSA 3CWJA 2P9GA 1X4AA 2WSCC 3HXMA 3PR5B 1I6JA 4IDKB 3MAQA 3N79A 1YI2S 5KFPA 4ZVEA 1M5HA 1U1RA 5CCMA 4RU9A 2KDOA 5D77A 4Q2LA 4JI2F 1X4DA 1M1KT 4KRWA 5A8RA 2DCUB 5A6PA 5EX0A 3NL0A 4WJBA 2KM8B 2HS0A 3V4IB 4IQMA 3QGHA 2VFUA 3QGIA 3MWBA 5EUHA 5KFEA 3MM9A 5KG6A 5ITHA 3KHRA 1Q8IA 1YWXA 2KFYA 1TKTA 2HWIA 2V8HA 5K14A 4EWTA 2YWEA 1ZYQA 2VA3A 1NH7A 2LXIA 1P9QC 4DR1F 3Q8QB 3P6YC 3M4XA 1YRXA 4NRTA 4J9OA 2KRRA 3MCSA 1UVMA 3KTQA 1SV5A 4J9NA 4Q0BA 2KU7A 4XDDA 3UQSA 1R43A 1KLMA 3OLBA 4KQZA 1ZM4A 2ZH2A 4EYIB 4IRDA 5GADU 3QO9B 5I4MA 2X1AA 3KYLA 1BY9A 2RNEA 2HHQA 3R5CA 2MKIA 4KFBA 2AF6A 2CJBA 2XBPA 2J7WA 3DRXA 3CJ2A 1R0AB 3ETOA 3OPKA 1CC7A 1XTZA 2KTQA 1VHFA 1GT8A 3FSXA 1HI0P 1BLUA 3THPA 4N8NA 3C2PA 5DQIA 4NLSA 4E0DA 3C46A 2ZJRQ 3W2VB 3TAMB 2KI2A 4GKKF 1S49A 1UWBB 4OZNA 2E1MC 1Y5IB 3NWGA 3K5PA 1RI7A 1HBOB 2B4OA 2I1RA 2C3UA 1FDBA 5KT7A 4TU9A 5J2PA 1FRMA 4NXNF 1G1XA 2R9LA 1IR0A 3SDEB 1QSLA 3ENVA 3GIKA 3RBDA 1VI7A 2Q6BA 2IM3A 2CQ1A 2BRKA 3DNCA 4A8WA 4H4KA 4FVMA 1Q82T 2O66A 4F4KA 4TN2A 2RILA 3M8SA 4DV7F 1HHTP 1LWFA 1H3DA 5KFAA 3WBZA 3CCLS 3CJKB 3NGKA 1X4BA 4DG1B 3F41A 4ED5A 1Q16B 2WAQD 4TY8B 1VQLS 2EFNA 1KN6A 4I2QB 1JJ2R 2R7RA 3S7RA 3SEOA 1Y3JA 1TFWA 2HPUA 3H40A 2U1AA 1FRJA 5A8KB 2W4PA 4O4RA 3NAIA 2PI5A 4C4WA 3N9UC 3R5DA 2FLNA 1NK9A 1SL1A 3IGVA 2CJQA 4G1QA 5KFXA 5EWGA 2MZSA 1NJWA 2MY7A 1S6QB 4KV8A 1VS3A 2LA4A 2CPZA 1V3ZA 2Q66A 3MD3A 3BGUA 4KHMA 2W4DA 1ZTTA 3ZFVA 3AJ2A 3TNVA 1VRTA 2CPYA 5C25B 4X4TA 4WFNQ 1WG5A 2WHOA 1JKHA 1VQYA 1VFJA 2YKOA 2PIIA 3M2RB 4ZOSA 1T05B 2KJWA 2ZOMA 4CO1A 3DXBA 1RYRA 4A8XA 3HK2A 2L9DA 1LWEA 2J9DA 2C3OA 2BQ3A 1PSDA 4O44B 2AYBA 4IG0A 5H9FJ 2GX8A 3UPFA 4DFPA 4DF8A 5A8RB 1SL0A 1SXLA 2EFPA 5F3TA 1S97A 1S1WB 1DTQB 1RT6A 1VK3A 3OR2A 3MM9B 1FO1A 3G4SS 5K8PA 3PIPQ 1FJCA 1LFWA 4E98A 2WB1D 3LWMA 3V81A 1CC8A 1FNMA 2DBBA 1FE4A 2E5HA 3NS5A 2WONB 2UV8A 4J9MA 5B0FA 3ZZRA 4Q0BB 1AROP 2CJAA 2CQ4A 2BANB 2HHXA 2JOQA 3MPVA 4NA2A 2VPYB 4G6VB 1Y5NB 4X4SA 1MMLA 2J7UA 2LVWA 1SH2A 1WHWA 3G86A 2VQEF 4FF4A 1CQNA 3TA2A 1UP1A 3DHWC 1WF0A 3QZ7A 3L7PA 2OPSB 2QYCA 3M05A 3DDNA 5D78A 4DBQA 1Y5LB 3THTA 4A8FA 4YR3A 4R0JA 1JLQA 2IAJB 1UFLA 1NO8A 5E3CA 3PW7A 5CCLA 3TW0A 5J1EA 5KFMA 3O8WA 1YRUA 4R8UA 2D3ZA 3T9ZA 2NSCA 1RAJA 3HHLA 4G1IA 1ZAWA 4B3OA 1QE1B 1HHSA 2VZ9A 4A8KA 3IN5A 4QW9A 3CCUS 3G6VA 2B56A 1NJIT 1HR0F 3H5XA 4PPZA 2FJDB 1L5UA 5KFZA 3MFHA 1Q79A 1KVIA 2D41A 1MU2A 2VFVA 4F3OA 2JLEA 2J9EA 2D7SA 3I31A 3GFZA 4RBTA 3UDCA 2KJVA 4NLTA 1U1NA 1X9MA 1JJHA 1MMDA 2MZ1A 2L3MA 4CTAA 1MSWD 2K1RA 2A3JA 3QZ8A 2RF2A 5DLFA 3ZZTA 3VQTA 1IBLF 3X1LB 1KFDA 3CTRA 2XMWA 2VPWB 2PFFB 4KGMA 1VQOS 5DM7Q 3C3LA 2N4CA 2I5JA 2GCFA 4KE5A 3DU5A 1U2FA 3OJUA 2EG2A 2LDIA 3T5HA 4Y2KA 1OQ6A 1X7VA 2DNHA 3HMJG 1LQ9A 2QA4G 3PX0A 3M9NB 4WF9Q 4K4ZA 3GE9A 4I69A 2RUGA 1LWCA 2BRLA 4KJIA 5HROA 4WTYA 3MUMP 3UCUP 1R8BA 2GQQA 1LW0A 1MNEA 2V94A 2CJ9A 3CCVS 5J2QA 2HNYB 1K1QA 2F1FA 4NCAA 2NUUG 2YWGA 4F67A 1FJGF 3Q24A 2ZE2A 2RSQA 4NLDA 5E3RA 3TAQA 3CT9A 2BACA 2F9DA 1Y9OA 2G4BA 1S1XA 1TV6B 3PO4A 1E6VA 2RIJA 3CGIA 2XLIA 4IG3A 1QUPA 2HWHA 5CZXA 2P9EA 5E3AA 4DUZF 4F4XA 4C0BA 3U1LA 1R8CA 4V19J 2WCXA 4BS2A 3KLGA 1N8RT 2RT3A 4XDCA 1K9MT 2M2BA 1JB0C 4HEA9 4UY8T 3D2WA 2MHNA 1H2UX 3N6NA 4R5PA 3GB0A 4PG4A 1IKXB 3DM2A 2CPDA 4C11A 2JFKA 3SFUA 3HDSA 2MMYA 4UW2A 3NMAA 3NMRA 1S9FA 3LWLA 4DR2F 4OHYA 3AB4B 4PQUA 5JXSA 2KM8C 2VG6B 3OFFA 4IFVA 4YDDB 5DQGA 1WF1A 2DCLA 1VQKS 3CC4S 5DJBA 5EN1A 2V9KA 1O0PA 3HHEA 1S6PB 4MIWA 3MEDA 2LCWA 2DNQA 3BO3A 3GFYA 2VBZA 3JTNA 1S6OA 4PG8A 2XS2A 3FNNA 3DLEA 1IBMF 4O3SA 3ZZ0A 4NLGA 1G2EA 1TL1A 4LSLA 3G6YA 1DARA 3HLUA 4JV1A 2VKZG 4USJC 5L1LA 4C2MA 3T9NA 4OI1A 2ASYA 3JSRA 4HH0A 3T6JA 5EDWA 3MXHP 3HHLB 2ZJQQ 1RT4A 4B9LA 4DV1F 3RAQA 4O3OA 2HZCA 5BJRA 2ASJA 3B4MA 4IKAA 3FCHA 4YHHF 2ROGA 3I82A 3MGJA 4HHJA 3HHLD 2NPFA 1SQEA 1MU2B 2CZ4A 1H0HB 3V6HA 1HNIA 2FGOA 4L72B 1SJFA 2F8EX 4DSKA 1T3OA 1S4FA 2Y1JA 1KD1T 1QVFR 3BQ2A 4OJHA 4AYBD 3HP6A 5A8WA 1F5AA 3CO9A 5HMXA 3FGVA 1RDRA 1SKSA 2GW8A 2RRNA 1F5CA 1G3OA 3I55S 2CQPA 1YBAA 2NXUA 3I4HX 2YWHA 3AA8A 1NK8A 2RF2B 5SZTA 1EP4B 3L09A 3POTA 1FERA 3QLHB 4UQGA 4J9RA 1D9DA 1R27B 3CDBA 2DNRA 1O8BA 2GGPA 4FNHA 2UUTA 5HLFA 3RR7A 2GO8A 4K4TA 2RQCA 5I3UA 4KBIA 2LKZA 2O67A 3CJ0A 1OSCA 2VUGA 3N28A 2ZD1A 3DI6A 3BGRB 3MECA 4OI3A 2MYFA 3SSSA 2QZ8A 3D1OA 1QAJA 1HBMA 1H2TZ 4ZCLA 1IUJA 4KO0B 3P3DA 5DDOC 2AYMA 1Q78A 2LA6A 3OR1B 4YDXA 2PSZA 3CDEA 4ZP6A 4Q5VA 2VH7A 3KJVB 4QZVB 2ZJPQ 3Q2SC 3OTCA 3HX9A 2JC0A 4KR0B 2BJEA 1LW0B 1SH3A 2EBGA 3CCJS 2DH9A 2XY7A 2M8DB 3MR5A 2ZDPA 1QJHA 4CO5A 5E5NA 4JBCA 1RTJB 1R3NA 2BBEA 2DPIA 2AQ4A 5LL6d 3FEYB 4A8YA 2XZWA 4WK3A 4BC7A 4QWAA 1Q86T 4CO0A 3I0RA 3OTOF 1JXLA 2ZHOA 4IG3B 2DNZA 3VTIA 1JLEB 2M4MA 3RRKA 3JSMA 4KSEB 1ZM3A 4XO0A 2AJ0A 2RH3A 1ZM2A 1HMVA 2FIUA 2HGNA 4K4UA 2ZH5A 4PRFA 4Z2XA 1IJFB 1NHUA 2DNMA 4IO1A 5IM0A 4ECSA 1YITS 4MYUA 1LKZA 3IG1B 5I3QA 5E41A 2BR0A 2A18A 2DO0A 3GG0A 2V8DA 4ITSA 2NLWA 4WFXA 1DBDA 2DGQA 2WW8A 4RZRA 4X4UA 3H98A 4ED1A 4X66F 1NHVA 2GO9A 3G8TA 3M2UB 2BE2A 3M9MB 1FTCA 4IOC