2FHMA

Solution structure of bacillus subtilis acylphosphatase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
91
structure length
91
Chain Sequence
MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
publication title Solution structure and conformational heterogeneity of acylphosphatase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 28
structure length 91
sequence length 91
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2005-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhmA00
2ZDPA 1Y3JA 2VV5A 1W2IA 2XMJA 4OJHA 5B0FA 4Y2MA 4DL0C 1Q8LA 4Y2KA 3UDCA 1U7LA 2ROEA 1S6OA 2K1RA 3DCAA 2ACYA 3HX9A 1TL5A 3KG1A 2GGPB 1X8DA 4ZA1A 1YG0A 2W4PA 1GXTA 4HL9A 2HFOA 4OJ1A 1Q53A 3KG0A 2HIQA 1AW0A 2QIFA 2LXFA 4U9RA 2AJ1A 2HLTA 2IFXA 1CC8A 2PD1A 3I9ZA 2GGPA 2IYIA 3TNVA 1QUPA 2XMKA 1LQ9A 2ZDOA 1CPZA 3HDSA 1VQSA 4HH1A 2EW9A 3CJKB 2AP6A 4HI2A 4EFAC 2OD6A 1YJRA 5F0WA 5B0CA 3HHLD 5A6PA 5T7LB 2W4DA 2RMLA 2N4CA 3BF4A 3IWXA 2ROGA 3BB5A 1ULRA 3CJKA 1OSDA 2QLXA 3VTIA 2GFFA 4A48A 2OAUA 1Y9OA 2KT2A 3BR8A 5B08A 4YDXA 2OP5A 2BUNA 5T7LA 1URRA 4A46A 3T9NA 3BDEA 2OFGX 1TL4A 3F44A 3MCSA 4A4JA 2LDIA 5B09A 5B0EA 4Q2MA 1TR0A 5B0GA 4A47A 1OQ3A 1JK9B 2FIUA 1SQEA 3HF5A 3KKFA 1FE4A 2GV1A 3BM7A 1KVIA 1MWYA 1FVQA 3KNGA 1P6TA 2ASYA 3FMBA 4QOTA 1XBWA 4FNIA 1X0PA 2CRLA 3BN7A 2K7KA 5A6WA 2GCFA 3K7RA 2QYCA 1GXUA 2RSQA 1APSA 1N5SA 3HHLC 5F0UA 5B0DA 2KKHA 5KAKA 2W4CA 3LGMA 3WDOA 1YJTA 1YRXA 2K7JA 4DN9A 3FRYA 3BGUA 1Q4RA 2LQ9A 1RJJA 1TUVA 1X7VA 2LQBA 1OPZA 2KT3A 2QLWA 3LO3A 4NL5A 2HQIA 1MWZA 5B0AA 2HFNA 4HH0A 4F67A 2BJDA 4OJ3A 5IXUA 3QGPA 1V3ZA 1AFJA 1JWWA 2AW0A 1FESA 1CC7A 1TZ0A 5B0BA 2RILA 1P8GA 1YJUA 2FTRA 2OMOA 2OFHX 2GA7A 1N5VA 1WD6A 3LGNA 2XMUA 1SI9A 2IYGA 2GO8A 2N4DA 4OIXA 1FVSA 2N7YA 2G9OA 2RU9A 3QMQA 2BJEA 1KQKA 1N5QA 2XMMA 3DXSX 2BBEA 3HHLB 4OJGA 4Q2LA 4DPOA 2K2PA 2FB0A 2Q3PA 1FEEA 5K9FA 1FD8A 2PGCA 3GZ7A 2XMVA 2AJ0A 1Q8BA 2ROPA 1Y3KA 3TOQA 1N5TA 2OKQA 4HI1A 3TRGA 1IUJA 3HHLA 1YJVA 2OD4A 1AFIA 3MZIA 4ZOSA 1OQ6A 3FGVA 3IWLA 4NPOA 1FE0A 2VH7A 2BYCA 2XMWA 2L3MA 1Y0HA 2FHMA 1R6YA 1K0VA 2HLUA 1SB6A 4YEAA 2KYZA 3HFKA 1KVJA 4FNHA 4Y2IA 1S6UA 2K1RB 2JDJA 1VQYA 2XMTA 3E8OA
chains in the Genus database with same CATH superfamily
4OHVA 3TAPA 3OTCA 4QPTA 3D68A 2B4VA 1MROB 2QMWA 3EGNA 2R42A 4ZLJA 2D41A 2CQDA 1WI6A 2VBZA 4L76A 4DX7A 2YKQA 2M52A 4B9TA 3MWBA 1U1QA 1FJGF 1JIHA 3AODA 4HDGA 1NK4A 3CJ8A 2Z30B 4NCAA 1H2UX 3KLVA 4LF5F 4M94A 2DNPA 2LLZA 1NJZA 3O3LA 1JLCA 5J2QA 3JSMB 3KLHA 1T03A 2YWHA 2PEBA 3R7SB 1A6LA 2ZVIA 3ENAA 1P27B 4DR5J 3M32A 3NKYA 1NKEA 4LFBF 3PW5A 2VOOA 2GS8A 2QL5B 2ZDPA 2RRAA 2BVZA 2FPHX 4NYPA 3HI9A 1XQIA 3FBBA 1RTIB 4AFFA 1G7CB 3OFFA 4HHHA 1UEKA 3BGRA 2RB7A 3MMBB 4QU6A 2GMLA 1RI7A 2A0FB 2PIIA 3JSBA 4X4NA 3CCMS 5T7LA 3LP2B 1DRZA 4QYZJ 4DSLA 5BYSA 5KFWA 3QZ7A 3VGVA 4KGXB 1HR0F 3PJWA 1I51B 3K5NA 4I0WA 5E3PA 3OBIA 4ILRA 2B9WA 1RA7A 4ZIWA 4AD6A 3L4BC 3OLBA 4ED1A 2XCPA 3GCXP 4DCJB 1JLGB 1UEUA 1CC7A 2D3O1 2XZTB 1JJHA 4DL2A 2KXFA 4IFYA 4NEZA 4C7QA 1EARA 4AUKA 4ANDA 3NP5A 5HSPA 3W8PA 1N5TA 1OJ4A 3EE3A 1FRMA 4ZOSA 2L41A 4FF3A 2AIRB 5GAHU 3P49B 1PBUA 4ZP6A 2B0GA 5FLXU 1A9NB 1HNIA 3C6UA 4FS2A 3BO2A 4DSFA 2LVWA 2D9OA 1M5PC 1UFKA 3KG0A 3DGPB 1XMQF 1RSCA 5ETRA 3W2VA 5DO2A 4WBFA 2Z2MA 1R43A 1CJVB 1GMUA 3G6XA 5EWFA 1KQGB 3CCVS 1VK8A 3IM8A 3R97A 5HVFA 2O01C 2M8HA 1X0PA 3VGUA 2HAIA 4TYAA 3DI6B 2FJAB 3CDBA 2E5LF 1X7VA 2P9GA 3CWJA 4LRAA 3OPKA 1U0HA 4I2PA 2XYGB 4USJC 3ULHA 1UWAA 1KHVA 5CCMA 4K4TA 3HLUA 3DOKB 2R8KA 2YKNB 2CPZA 1J5EJ 3KHHA 3PW4A 4B3OB 4Z37A 1PCAA 5AXKA 1K73T 2C3YA 2CFXA 1RHKB 4KB7A 4LSLA 1SJRA 2MQ8A 1GH8A 5I3UB 4QYRA 2MKJA 4X2BA 3ZTPA 2PI4A 2QIFA 2AJ1A 1VQ9S 1HBMB 1ZM9A 2PD1A 4YFUA 1JB0C 3OV7A 5ETNA 4J9KA 3QT5A 2RKIB 1WNEA 2FC9A 3NCRA 2KG0A 4LSNB 1D8YA 5EGYA 3RRHA 1ICEB 5M2UA 4A8YA 2RDIA 2AX0A 3BH7B 4USMA 1PJ7A 2YQ3A 4M5NA 4ETXA 1N36F 4KGMA 4IKAA 3AXMA 2PC6A 4DUYJ 1U49A 4IG3A 2WW8A 4PG8A 2KT3A 4CO3A 1MWZA 2QL9B 3MM8B 2GMHA 2IAJA 1PO6A 2XMUA 1RP5A 4ED6A 1FX4A 3BQ1A 1RT3A 3GZ7A 2XMVA 2ROPA 4WTYA 5G0RA 5T41A 4B3MJ 3L95X 1AFIA 2CQ0A 1WF2A 2O5DA 3JQMA 3BREA 4BDPA 1H3DA 3LWMA 1WKJA 3J80U 1N0VC 1N6QB 1U02A 2MTLA 2VQFF 4O4GA 1CULB 2CJYB 2X1FA 2NSCA 2WAQD 1RAOA 1YWXA 4IRDA 2VFRA 1ZPWX 3OFHA 3PR5B 5B0GA 2BZ2A 3QWPA 4KH0B 4EO8A 5AT1B 3GU0A 1NCLA 4RUHA 2YPYA 1YZ6A 4FF1A 1IKYA 3BQ2A 2POKA 4X4VA 2VODA 4K4XA 5JJBA 1EAYC 2RAQA 2XY5A 2JFKA 4JI7F 1TQLA 2RH3A 2KM8B 1RAFB 2DGTA 2U1AA 3BO4A 4H4OB 1XNRF 3V4IA 2M7SA 3VAJA 2E44A 2MQPA 4N8OA 4ZMMA 2R8JA 2WVDA 2R3VA 1QAXA 3H59A 4DHVA 4MH8A 2XLJA 3GIJA 2LP4A 3N4WA 4Y2IA 4YR3A 1R0AB 2G1HA 4TQSA 4Y2KA 4DV6F 1N88A 3M30A 1TL5A 1YDLA 3DMJB 2YKPA 5EDWA 2VONA 2YNFB 4F2SA 2VFUA 4AYBD 3PFOA 4USHA 2VA2A 5KFSA 2QFIA 3LWLA 4DL3A 2QT7A 1YJRA 4ENOA 2BJ7A 4UW2A 5L1LA 1ZYQA 3V4MA 1JKHA 3I4PA 4C8LA 1S4FA 1WHXA 3SV4A 3IM9A 3HVTA 1IR1A 2W2MP 3L7OA 4DR6J 1BLUA 2BRKA 3ILIA 4JI4F 4GC7A 3PYFA 5C24A 1IWGA 3SYZA 3WC2A 2CAJA 2J0WA 2ZOGA 2GVZB 1OPZA 1V3RA 3DC2A 4X62F 1OO0B 2Z2ZA 3M05A 3G96A 3R5GA 3W65A 3CUNA 3PVXA 3MMCB 3DXSX 2AJ4A 1N0UA 2EC0A 1AXQA 3IGVA 1NDLA 4P9SA 5IZHA 2FQQB 5GMKa 5F9LA 2KFZA 5FD1A 3NGKA 2WVCA 3QO9A 4DL0C 2JL9A 2O3DA 1LNQA 1FRHA 2HFOA 1T02A 4DQRA 2R7TA 2LEPA 2HRUA 5GAGI 2AU0A 2YNIB 3V6DA 5A6PA 4JI0J 3BSOA 1X4HA 4WP3A 2I5JB 4J90A 1SL0A 2UVRA 4TY9A 4F0KA 5KT2A 1AROP 1AT1B 3SSQA 4ZVPB 3RW7A 2CZ4A 3GYNA 2PMHA 2ZBQA 4LIRA 4DL6A 5H9FK 1REVB 4DV0J 2E7XA 4B9UA 2VG6B 4QWCA 2ZM6J 4LF1A 1APSA 4CQ1A 2MGZA 2IM0A 2HVZA 4DZ6A 4C8KA 4ZJLA 3MD3A 2L9WA 4NCBA 4JV5J 3MECA 1FXLA 2OMLA 3G82B 3NGSA 2ZJRQ 2A3JA 1RWMB 3BGLA 3CIMA 2UV8A 3GIRA 1U26A 3CEDA 1LXNA 4QIWD 4BWMA 1RCOB 1OS5A 2YX7A 1EQ0A 2PFDA 1XC9A 2W2QP 2EG1A 5K20B 2G0JA 2H48B 2DR7A 1FDNA 1ZH5A 1VQMS 2EFGA 3PY8A 3KTQA 3K17A 2RQ4A 2FUG9 1QUPA 4K59A 2EW9A 5L39A 1H0HB 3PG9A 1LEOA 3QGGA 4DUZF 4O3NA 3J7ZT 1VDHA 2GIFA 4DF8A 3MDFA 2GVDA 1RB0A 4QQBA 4CO4A 3G71S 2ZWOA 2WVEA 3HO1A 5GADI 3M1VB 3TQEA 4NLSA 4AT1B 1WSVA 1ZM3A 1HWUA 2DEIA 1B0TA 2G0IA 4I69A 1SUQB 2W2OP 1EB0A 1HYSA 1KD1T 4WFAQ 5KFQA 4TQRA 3MM9A 3CNQP 3WX8A 1T9WA 3GIMA 3TA1A 2DTJA 1UVMA 3FUYA 1M1GA 2N4DA 1G2EA 3QMQA 3IG1A 3DFEA 2NQPA 4R8UB 1NHUA 4KAIA 2Q1LA 1BQNA 5ADZA 3UNYA 5F8IA 1DQ8A 2VL1A 5HK4A 3QLHA 2ZD1A 3TAMB 1QVGR 1REGX 3CCES 3KHGA 4U6PA 3W64A 2NUHA 4OX8A 2HBYB 2BJ9A 3OHBA 1OIAA 3M8ZA 4LUBA 3ZTOA 4ZVRB 1WC5A 1CPZA 4Y6IA 3CJ4A 3B4MA 4A8KA 3BF4A 1H7WA 5LT5A 3QIPB 1Y7PA 2F8HA 4HDHA 1OPIA 4U7CA 3PKMA 3MPDA 1C0TB 3IR7B 3HSZA 5LSRA 2BXJA 4QR2A 4DQIA 3TX0A 2CPXA 1ELOA 1SPBP 2BACA 2K7KA 5FDLA 1RT6B 1S99A 2V9KA 4LR7A 3PEHA 1N5SA 3OLAA 3WDOA 3ITHB 1FTRA 4ZLLA 4K2JA 1SC6A 1XMOF 4FZVA 3HHDA 4ECRA 1V3ZA 4MMOA 1SJ3P 4CO2A 2HQDA 5J2PA 1YRUA 3CD5A 1CQMA 1QSLA 4N41A 1TFYA 1KLMB 3OL7A 3QNWB 1H38A 2XEXA 2O66A 2GQQA 3GG1A 3E01A 1QSYA 1FEHA 1S6OA 4OV6A 4HL9A 2IBOA 2HS4A 5KFXA 2FY8A 2Y1JA 2B8PA 3QJJA 4N47A 2BQRA 3CDAA 1QE1B 4F2RA 2HFVA 2HHHJ 3LANA 4PR6A 1GX6A 2J7WA 1H6KX 2C28A 4ZHRB 3PW7A 4DPYA 1NJYA 1XWLA 2DHAA 1UWBB 2CQIA 1HNWF 1XBWA 3EYZA 4UOHA 4OYMA 5F3TA 3Q8YA 2QSFA 4RPFA 1NEEA 4OYZA 1TL1B 1PIEA 1U45A 4HHUA 5IXUA 1LWCB 2IMOA 1W2BR 1OWXA 2Z2LA 1Y10A 2AYGA 3DOMA 1JLAB 3FJ2A 1F5CA 2ZBRA 1NUEA 3N5BA 1RTJA 2MHNA 3LTOA 3HXMA 2FJEB 1U24A 1IBKJ 4N8NA 2B5JA 5DLFA 2HBQB 2VH7A 4OHYA 1VLYA 3GJTB 3MCMA 1X4AA 3I5CA 3HD1A 3TR5A 2XS5A 4BCAA 5D3GB 3J7A1 3ILOA 2JZ5A 3MXHP 5C2GA 2IYIA 4OV1A 4YP3A 4P75A 2LQ8A 1TAUA 3CJ0A 1TMMA 1QAJA 2W4DA 3VAFA 4ES3A 1F3FA 2UUAF 1EQMA 4B9NA 4OFZA 2ADCA 3ICLA 4HACA 4KKOA 1VQ6S 4O44A 3VCDA 3PFEA 3MEDB 3LPEA 3CC7S 4NLRA 2NS1B 5E3AA 1IBCB 1LFWA 1KRPA 1Q5VA 4DV7J 4U95A 4QIFA 3KJNB 2NZCA 4DS5A 4CCHA 3T1AA 2B4OA 2A6OA 3PDNA 3CMES 1RLCL 2KVIA 4CTAA 3SFGA 1VBZA 1Y0HA 2VG7A 3E51A 2JWNA 2ILZA 1HWIA 4I2QA 2LCWA 1W2IA 3AOAA 3GG0A 4IOAQ 5C42A 2X1AA 4J9RA 1O8BA 1FDBA 2FDNA 4C98A 3I56S 2LEBA 5KFJA 4DXLA 2D3OR 3BV8A 2RNEA 4KGZB 3SCKE 1JXVA 3N79A 3P96A 2EBGA 3MAAA 4LF7F 1HNXF 1S6PA 5FIIA 4OI1A 4PUOB 1UEVA 2FZCB 1FE4A 1VC6A 5C7PA 4CI0B 2RUGA 3NAIA 2DK2A 5HBMA 1S1WA 2B4PA 2WBMA 2RUSA 1S0NA 2JEJA 4QIEA 3ZXWA 1VIXA 2VC1A 1VS3A 4P2XA 3RZAA 1SH2A 4DPOA 2OLWA 3EDRB 4W98A 4TY8A 2JSXA 3HK2A 2AJ0A 1UZDA 1B0VA 1IN0A 1J5OB 1FKPB 1VISA 3I4HX 4X64F 2C2RA 4K4WA 4KO0B 1PAUB 5ETMA 3ZZ0A 5IV3A 2UUCJ 4Y3CA 2HHXA 4B3SF 1DTQB 2Y1IA 4F02A 1RBLA 3TVYA 4N5SA 4DI6A 1HQEB 1ROFA 1EETA 1DBDA 4JV2A 3TO8A 2HW3A 3JS9A 2AYBA 3MM6A 1I1GA 4OYWA 2W9BB 3P5TL 3IO1A 3W9IA 4DR2J 3GJRB 3V6HA 4NZ6A 2HWHA 2Q6BA 1X4BA 1I94J 1NSQA 1KC8T 4M5JA 1FCAA 1HA1A 3EUNA 2OPRB 1U1PA 2MDAA 2UXDF 2XM3A 3MAHA 3R7NB 4WJBA 5LSLA 2QN6B 4ECQA 1FVSA 1M5SA 5HMYA 3Q2TC 2QTWA 1P9YA 3BJYA 1WEYA 4X4OA 1RISA 2Q66A 3DRSA 4CYUA 2F3JA 1T05A 2EFVA 2OGUA 3G4SS 4OHXA 2DISA 1GX5A 2ZUGA 4KGKA 1U25A 5CAAA 4MIAA 1IKVA 1RWXB 2XO6A 2YWEA 2ZE2B 2DNHA 3ENQA 4UOFA 1WKKA 2ROGA 3BO3A 5HLFA 4OX7A 4K7QA 1FK9A 4A46A 2PMWA 4NLGA 2DIVA 2H4YB 2DCLA 3KK1B 3BM7A 1LOUA 2YBVA 1WC4A 2I9SA 2HFUA 3KMQA 3FFIB 2X3GA 2M70A 3DM2B 2CG4A 2OI2A 4J9LA 1V9OA 4MTPA 4EYIB 2QZ8A 1IBMJ 2OH2A 5DDOC 5KFHA 2ZHAA 1C4CA 4KC5A 3UVJB 3MR7A 4X65F 5KOXA 2CA9A 2CJKA 2CZ9A 3DHXA 3HSJA 5K9FA 1CJTA 2PGCA 3MR5A 1RHRB 1U48A 2W9CA 1QTMA 1F0XA 2UXCJ 4CIOA 2KDOA 2OTLS 1Y00A 4ID8A 3VWSA 2DGQA 4A8FA 1JLEB 3VAHA 4JI1J 1CQNA 2AEFA 2OHDA 2HGLA 4QU7A 4IRCA 1NHVA 1WEZA 4KTQA 4OL8A 3THVA 3TARA 4GMKA 2UUBF 1WUUA 3M8WA 2H5IB 2M0GB 3MOZA 1LW0A 3Q89A 3C66A 2KFYA 1RT7A 2A2DA 4LVOP 1F2GA 3EGVA 2VBYA 1WC6A 2QFJA 5KFOA 2V4JB 4RW6B 2ZH1A 1S0MA 4ECXA 1U6FA 3CJTA 3Q8QB 4YDDB 4DR7F 1BY9A 1GFWB 3NWRA 3TUIC 4FPIA 3L7PA 3AY0A 1RUSA 3Q8SB 1LW2A 3JTOA 2BJ8A 3HP6A 4E98A 4XAKA 4BC9A 4M5IA 1RAAB 4FYVB 4O3RA 1RT5B 1S1VB 4DFMA 5DRKA 3CJSA 2QA4G 2QMUB 3U27A 2RE1A 3MMAA 1KR4A 1VR6A 2W7OA 4UY85 3ZZPA 2E5GA 5ETTA 1WOPA 2OEMA 4XDCA 4L75A 4DU7A 4PG6A 4DEZA 5CYQB 1FNMA 1VRTB 4ZVSB 3D2WA 1YJWS 4OZ0A 1MROA 2E1AA 3MEEA 1S4EA 2KZMA 1WI8A 3H5YA 3HHNB 2XS7A 1KOOA 2GW8A 1R0CB 7AT1B 4NMLA 5IT9U 2PMZD 3VALA 1RAHB 3HCXA 2M5YA 2B9EA 2EFQA 4ES1A 4ZJOA 3LGMA 3OFGA 4Y00A 5F8GA 1F5AA 2F9JA 5I3PA 4QWBA 4JI8J 2R4FA 3A12A 1TV6A 3OXLA 4M5DB 4DV4J 2NZ4A 4B08A 3IS9A 2DY1A 3LA0A 3JSMA 3GV8B 1HNZF 3KLIB 1S9FA 2NR0A 4XTTA 2VQEJ 4NRUA 2OSQA 2AGOA 1I3OB 5LSOA 2CPEA 3H98A 4PG5A 5CHCB 1RU2A 1ZM2A 1NSPA 1B4SA 4NCGA 1RTIA 3OTEA 3KK3B 5IM0B 4FPRA 3Q23A 5L1KA 1GMWD 4F3OA 3UR3C 4RWXA 3LQVA 3MMBA 5CYMA 2UVWA 5F8MA 1SIZA 1HARA 2HHVA 3HFZB 2BUNA 4FP9A 3H5SA 4RUBA 5K14B 3LP2A 3UCUP 2KO1A 2JNJA 2CQGA 2HRYA 2H5JB 2W24A 4B9LA 2YKMB 3FSXA 4CDIA 4PG7A 1Y4ZB 3GSDA 3TUPA 1TUVA 1UCNA 3CJ2A 2IY5B 4OZJA 4MK8A 1WF0A 1YJUA 3PHTA 2HRTA 3OUYB 3T1HF 1JLGA 4NLXA 3C46A 4CLTA 4WK1A 4M1KA 1SIWB 1YX2A 2RT3A 1UVIA 4HI1A 2ZBIA 3L09A 3I32A 3MZIA 4QW8A 4LMZA 1FJGJ 2HGNA 1F5BA 1HL6A 4RU2A 1S97A 4NLDA 4HR2A 3DOLB 1TL3A 3KDOA 2E7WA 5D78A 6AT1B 4NA1A 3DGPA 2FVCA 2RMLA 2CJAA 3BN4A 3ADAC 2LXIA 2I6WA 2J0SD 3FC9A 1JK9B 1NJXA 4J9OA 3R5JB 3NNAA 3BN7A 2YH1A 2V5HG 4LFBJ 3W9JA 4O23A 1I5OB 1QAYA 1Q82T 1T9XA 4I6WA 4ECVA 1LFPA 3Q8UA 3C2PA 3PW0A 1BGXT 3FSYA 1WACA 1VMBA 4FXWA 2XG8A 2GO8A 2HHWA 2BE2A 3QRRA 2Q3PA 2Z8QA 1PKUA 3M2UB 2IC3B 2KB2A 1YTYA 2AV5A 2D7SA 3M2VB 3DOKA 1RT2B 1U2FA 2YKNA 2V67A 5A8RB 3R8YA 3NXZA 2XS2A 3HVWA 1HR0J 4P2FA 4FXVA 3QJLA 5KTQA 5F3ZA 3HZEA 2ZJQQ 2DR5A 1VRUB 4C97A 1FRLA 2HNZA 3O1LA 5E7OB 1FXDA 5I3UA 3HT0A 4EFAC 2MQOA 5DZ7A 1D9FA 1HBMA 2FHKA 4G6VB 2CPHA 1NDPA 2DGWA 2RKIA 1X31C 2NYHA 4RNOA 4LSNA 4A4JA 3Q8PB 4YQWA 2QE5A 3OTOF 1KFDA 2B6AA 4TN2A 4YY3F 3HMJG 1VFJA 2B56A 2YWWA 5ETLA 1O6XA 4PEOA 2UP1A 5KAKA 2A10A 4DR1J 1HI8A 5C25B 1FD2A 4OJ3A 1GQEA 5I3QA 1XMQJ 1PYTA 1H2VZ 2H4WB 2HQGA 3CE8A 3AFGA 1E6VB 2MYFA 4PPDA 2VDIA 2WW4A 3TX8A 2IJRA 2BKPA 2MQLA 1B64A 2GMJA 4OI6A 2FC8A 5LMUF 5JXSA 3FSIA 3UNGC 3JSRA 2LXFA 3OL6A 1XN9A 1TP7A 2VFTA 2VOPA 4EZ6A 2XNRA 3ISNC 2ZWPA 2J8AA 2DRDA 5D77A 1Y5IB 1CULA 3Q83A 2J7KA 2GO9A 4NZ0A 3Q8VA 1RTDA 4GKJJ 5J1EB 4TU7A 4YB6A 3HF5A 3ZZRA 1WTFA 4F4XA 2ZNZA 5IC4B 2B7CB 2JLGA 4YB7A 3CC2S 1ZAVA 4KHRA 3PX4A 4RNHA 2UXBF 2K3KA 1XTZA 4MK9A 4WK3A 4LFCF 3QT6A 4PABA 1WC1A 5K5MA 2NLWA 1SBRA 4C8OA 5EWEA 2W9AA 4A8WA 1RHUB 4FNHA 1D1UA 5E3RA 4XK8C 1U7LA 2IHR1 3BS9A 3KG1A 1N36J 1R0AA 2M3DA 4DWIA 1DAXA 3W2WA 3J7YI 3DMJA 2B7BB 2RJZA 2YNFA 3C14B 1T9VA 3P8BB 1JJ4A 3POTB 3W62A 2A2CA 5J2NB 1TR0A 2YX1A 3DU6A 1RA6A 4FVCA 4DX8H 1F1BB 3CMAS 3A8KA 1B99A 1DTTB 1FWPA 3S6EA 5BXIA 2EKYA 2G4BA 1AZSA 1C2PA 1NXIA 1TAQA 1UJ5A 2QLJB 4NL5A 4IR9A 2HFNA 1N33F 3H20A 5E5NA 3TUZC 4IH6A 1L3VA 1ZA2B 4ZCKA 3N6LA 2VQFJ 3AOBA 1UVNA 3DDKA 3MMCA 2KXNB 2UU9F 1GMWA 3CCQS 1YHQS 4HYKA 4H4KA 1UTAA 3AQOA 2E5HA 2C2DA 2I0XA 4J9PA 1U8SA 1WSRA 4WE1A 1M5VC 4F0HA 3TJ8A 5U47A 2DXDA 2EI5A 2FYXA 3L3CA 3KYLA 3UN5A 1EP4A 3KUEA 1U2RA 3JB9k 4JI7J 2HQCA 1E6YB 2YNIA 2UV8G 1S5ZA 1U1OA 1XNRJ 3T9NA 4DSJA 2CG8A 4A8SA 3R6LB 2NPFA 1S76D 2B9XA 1HBNA 2J9CA 3BEGB 3K2YA 3P5BP 2BOAA 1REVA 4ZVEA 1JXLA 2KL8A 3DRYA 2VG6A 3TZXA 3M9MB 5L8RC 3CCRS 4CO0A 5D4NA 4DX6A 1D0EA 4USVA 1VQ5S 2HBZB 2L48A 3HHLB 1IWAA 3BSNA 1ACMB 3G82A 3JAMY 4NXNJ 5IV4A 2R9LA 1V5IB 3SXLA 2BYCA 2D3UA 4TU9A 5IT4A 4U96A 3VZIA 3VAIA 3HFKA 3R7BB 1FF2A 4DX5A 4ZLNA 5IC6B 3OVAA 2CQBA 4JI4J 1UVKA 1LWXA 3GYXB 2ASDA 4C0OC 3EGZA 2DBBA 3IBWA 5IQQA 3K58A 4RBTA 2DITA 4X62J 3UO0A 2HKEA 4ED3A 4OYXA 5LJ3Y 3VTIA 4OYBA 2FHJD 1QM9A 4V19J 2DGUA 2XSJB 4ZVTB 1NK9A 2GHVC 1VHFA 4ECWA 1T3OA 4MJKA 4CWBA 2J9EA 4DPTA 3M1VA 4A8XA 1X9MA 3F56A 4O3OA 3KLGA 1SUQA 2KHDA 3C16A 1M0SA 2GA7A 1FKOB 3KMSA 2ZHBA 1BQMB 2YNGB 3G6YA 2NXJA 1KBRA 1XNQF 2AWZA 1Q78A 4YN3B 4KYZA 2J8SA 1FTCA 2MLXA 2XBPA 5A8KA 5D4LA 5J2QB 2KYXA 1D9DA 1Q8IA 4U8VA 3BBBA 1L3KA 2MHEA 1NRKA 2MY7A 3TAMA 4V19X 2MSTA 2MKKA 3K5OA 4V1Ak 1XIQA 2GGPB 4KFBB 1YK9A 3CD0A 4DFPA 5LOQA 1GXLA 4Q44A 2OO4A 2VPZB 4R25A 2XY7A 2XLKA 5LXRA 4ZPBA 2DD8S 2KT2A 4QWEA 2LA4A 3GFHA 1U1KA 3R1HA 2FJDB 4M5GA 3QIPA 3CJRA 5F8JA 5B09A 5D6GA 4A47A 4USIA 3W63A 4NOHA 4NYZA 1DY3A 4LR8A 2MXYA 1PYSB 5E0OA 5DM7Q 2J76E 2LDYA 3EJMA 3OJUA 1RU1A 1N5YA 4ETZA 3GQCA 5KG3A 5EX3A 1IR0A 2DKOB 1SH3A 3SFUA 1RT6A 1Q4RA 3F0NA 1FRKA 4DQSA 1TKXB 4Z2XA 2NREA 2E9TA 3AD9C 1DLOA 3GJSB 1LK5A 4B17A 3ITHA 4F0MA 5DDQC 3N01A 2OMOA 1SL1A 2XHWA 1YIJS 1MG7A 4J7CA 4NWBA 4IR1A 2P2CB 3VF0B 4CO5A 3U1MA 4KPYA 2P9CA 1VJQA 4GVLA 5F8LA 4WU3A 1GEHA 1SB6A 2JOQA 2FLOA 1QVFR 5GAEI 3OVBA 4LREA 3U02A 4F3QA 4PWUA 3MTKA 3T9ZA 5A2QU 1ZTTA 4JB8B 1WKLA 3CJKB 3G8SA 1S9EB 3EMTA 4X84A 4DUYF 3BPDA 3C6UB 5D0EA 2CXEA 1FFSB 1Y9OA 1QE1A 3THTA 2W01A 4WFYA 3U7JA 2E7VA 3A4TA 2BR0A 4O3SA 2XLIA 5BJRA 1H72C 5L9NA 2V8VA 4RR5A 4RW4B 3W7BA 4ERDA 1WJ9A 3IFEA 4B3MF 5HATA 2GZOA 2R7RA 3I82A 3KHLA 5B0AA 2CWKA 3B78A 2B4UA 1G1XA 4WYLA 1TL1A 1WORA 3PHEA 3TEGA 3D6FB 3I31A 1SJ1A 4NI2A 1U0HB 1JLAA 1R7IA 3MPYA 2Y9HA 2DGVA 5KFPA 2HGMA 1OQ6A 2XMWA 2COLA 1R6YA 2XULA 3IP0A 2QA2A 2JDJA 1ZS6A 3Q0AA 4CH1A 2WTFA 3IA0A 3GV7B 1R3NA 3RAXA 2PI5A 2P6TA 4IH5A 2LQ5A 3KG4A 3KXDA 1CS4A 2JLEA 2YX4A 3N6NA 4LSLB 3M9NB 4M95A 3GR0A 4UF4A 1N34F 1GTHA 3BR8A 2CNOB 1U4BA 1FRIA 2YQ1A 2Q79A 3ET6B 4CH7A 4QCLA 3RAQA 3KUHA 3AA8A 3BBCA 2CPJA 3DLHA 4ZP8A 3BKFA 4PWDB 4QOTA 2LECA 5DJBA 2RRNA 2ZH6A 4F4ZA 1SV5B 1N32F 1C0UB 3FRYA 3MEDA 1PAEX 4NYOA 2J6UA 4DPXA 4TU8A 5GAGU 4WTOB 4IG3B 3JYTB 4DCOB 1R6VA 3RR7A 3CIZA 2YY3A 4Q2LA 4F50A 1VQLS 4GVBA 2YPZA 1U6BA 2BQUA 1X5OA 2IAJB 3NS7B 4ECUA 3CXCR 2KXHA 3NG8A 2HHSA 3C3LA 1RT3B 2G0CA 3SCLE 1HNWJ 2A18A 3GONA 3PNIA 1RDRA 2V94A 1O5JA 3QATA 2DRAA 3A3OB 2E29A 3MD1A 4HI2A 2UVUA 2VC0A 4HTJA 2AT1B 2LMIA 2ZNYA 1H7XA 1PSDA 3C6TB 4AE5A 2GNKA 3F41A 2Q6CA 5DDRC 3FQKA 4N76A 1FWKA 4R0EA 1VRQC 2GIRA 4PUOA 1KS2A 5KFTA 3K7RA 4L6V3 3PACA 1VCTA 4OI0A 2HIYA 4D3GA 3RRGA 1WF1A 5E41A 4USUA 1FWLA 9ATCB 2RU9A 3FK4A 5JUMA 1CJUA 5L9XA 3KNAA 2G13A 3NLCA 3QQCD 1M5KC 4UY8T 3PRBA 4ECYA 4YHHF 4K4VA 2UUAJ 2CQ4A 1FE0A 2FHJA 5LJ5Y 3DNCA 1VI7A 2WB4A 1J5OA 5GADU 1UVJA 1FKPA 4Y2MA 1RHMB 4J9QA 2AYMA 4EBEA 4HVZA 3EX7B 2JRSA 4URQU 2UUWA 4K4SA 1CVJA 1OY6A 4DV0F 1HFEL 2YH0A 2MKHA 2I2YA 2R7QA 5KG6A 1W26A 1MWQA 2QV6A 3D0GE 1X5TA 4JOUA 1DTQA 3CO9A 4U8YA 3FBCA 1HQEA 1YBUA 2CQ3A 3BDEA 2JEGA 5KG2A 4K0KF 1JX4A 4JV5F 1J2VA 3AOCA 2XY6A 3M4XA 4L3KA 3KKFA 2KG1A 1FI4A 5DQIA 2W9BA 4FBUA 2LEAA 4JI6F 3P6YC 2IDEA 2BABA 5AE3A 2ZITA 4FKYA 3QGIA 3QFWA 5K8OA 2KKHA 1A7GE 2HVHA 4MK7A 2W8KA 1IBLF 2AMCB 2VIHA 1WDTA 3DYAB 3CTRA 4OQJA 3JSYA 5HQ8A 2SXLA 2EK6A 4W90B 1FD8A 1IUJA 2WRMA 3CCSS 4LF7J 5HROB 1HNXJ 4U7UD 1K0VA 3MTJA 4TLRA 1KEKA 1WOOA 3IBFB 4YR2A 3FZBA 4C8NA 3HX9A 3Q8RB 2IVMA 2V6AA 4Q5VA 5HP1B 5K8PA 1RQ0A 3OW2R 5AE2A 1RWKB 2N4CA 1NPKA 2ZE2A 2RHQB 2VJVA 4M8LA 1K47A 1T11A 1S49A 2QLFB 2RQMA 1OY9A 4C4WA 3M8QA 3G87A 2BA9A 4OYAA 2KN4A 4ID5A 4AL6A 3UDLA 2HZAA 2GCFA 4C3KA 1F9FA 3FFIA 3G86A 3NBPA 8AT1B 3DM2A 1U1LA 2HFSA 2LU1A 5BYQA 3IWNC 4P7VA 1RWPB 3FRZA 1OY8A 4B3SJ 4EK2A 1BQXA 1MN9A 2K2PA 9RUBA 3T6BA 2HZCA 1YJ7A 4RW7A 5D0RA 2OKQA 2V2VA 4M5KA 3TZWA 3FVYA 4I56A 4P2SA 1TK8A 4FYWB 1KWMA 3QBCA 2AYEA 5A0YB 2WSCC 4PYAA 4LSZB 5KT6A 5C2CA 1X8DA 4ZA1A 2V8GA 3ISND 1UA1A 2Y0BB 5F0WA 4OZ2A 4X4RA 2ERRA 4DPWA 2EEYA 4PRFA 1T9TA 2UXDJ 3PW2A 5KFAA 3SV3A 1YKWA 4ZITA 2FGOA 2R7WA 4P74A 4LBIA 3D3CJ 4IO1A 3FBFA 2XGQA 4Q45A 2DPJA 4KV8B 4I6AA 2C1EB 2DJWA 3GE9A 3GSIA 2LXUA 2V2QA 2GVDB 2V4JA 2EBEA 1KTQA 3VZHA 4CLYA 1CJKA 2CJBA 4ZVHA 2YKOA 3LALA 3MAQA 2F4FA 2JH3A 1T0TV 3AB2B 3LP0B 1RACB 1XERA 3K89A 1HYSB 4FYXB 2HHUA 3MM9B 1SKRA 2F40A 3RB0A 1UAWA 4MFBB 2H65B 4ZVUB 3W61A 3RYLA 2XQCA 1RT5A 4DR4F 4ITSA 3IG1B 2LU2A 4C48A 1BQNB 1BHNA 3J81U 2W4PA 2O67A 2ZD1B 4LBHA 1TL7A 4BHQA 2VD3A 1JQGA 1Y5LB 3PEJA 2VPWB 4KHPF 3NWGA 5JVHQ 4ANCA 2D74B 4CP5A 4OZ1A 5CYQA 1VRTA 2OAUA 1HBOA 1NJWA 1TTHB 1V6HA 1Q1KA 4QPXA 4X65J 2W2NP 1IXKA 2CDQA 4E8UA 4XPEA 5B0EA 3PV8A 1K8AT 3KLFA 5KG4A 2F5GA 3HZGA 1KN6A 1NKBA 3CJ3A 5HJYA 2Y0SD 3FCHA 5M2RA 2M4MA 4PG4A 4OYIA 4AXJA 1H74A 3E2EA 1BUXA 1RT4A 1FNOA 3HSDA 3R5CA 4WIIA 1N5VA 4K2XA 1F9EB 2HS3A 4LF8F 1R0BG 4M5DA 4Z7CA 4X4UA 3T41A 1MMNA 2VDHA 5J2PB 1EIYB 2UUBJ 4I64A 3TI0A 1NLKL 1S6UA 3LGHA 1JXEA 4Y28C 4XDDA 3G8QA 3QT7A 3WBZA 3SCJE 3OTBA 4CLPA 2FLNA 4DR7J 1AYEA 3E01B 4ZP7A 1IKXB 1NDCA 4LRFA 4AXIA 3KK3A 4UUWA 4YR0A 3MF5A 4A48A 2HWTA 4YDXA 2WOMB 3VGSA 3M8RA 4TKTA 3RBDA 4NXMF 1YVFA 4B3TJ 5SZTA 3AD8C 1IM6A 3N0VA 4CNYA 4KPCA 4OI2A 3W5YA 4DUTA 2GC8A 3UCZP 1FRJA 2J9DA 2YKMA 1ITPA 1KNZA 2H1YA 3GR1A 4ER8A 3V6KA 2DH8A 4W4MA 1HIYA 2NCKL 4NZ7A 4YOEA 2MQMA 1KOHA 1TKZA 4LF2A 3OUYA 1U2CA 1R27B 1VLOA 4WYWA 2PE8A 4ED0A 1RYSA 4AL5A 2LKZA 2ZUAA 4ANEA 2AZ1A 3JTNA 2HK2A 3TZYA 4KSEB 4DV5F 3BQ0A 2R7XA 4RO0A 2QSWA 2DNZA 2B5JB 1YBTA 2J5AA 3GV5B 2I1RA 1Q86T 2OD6A 1GK8A 3HHLD 2AGQA 1TMJA 2M2BA 1NM2A 3UN2A 1XR6A 1HBUB 4JI5F 2JVOA 4K5RA 4CLUA 2ASLA 3M2RB 1DFDA 3KHRA 2CRLA 1HNZJ 4C8ZA 2YNHB 3GJQB 1SL2A 2EPIA 1VBXA 3BZQA 4JUZA 4HACB 2OPSB 1UKUA 4HT7A 3HM9A 3PO5A 4O44B 1IKWB 1WDDA 2FJWA 2CPYA 3EICA 1SKUB 5I4MA 5H1SV 3VR1A 1JLFB 2E9ZA 4N77A 1GAOA 1J27A 3LPYA 3D4JA 3IR5B 1WG1A 1S7IA 2IC3A 1EKSA 1C1BA 4ZDNA 1TU0B 3M2VA 2MZRA 1RT2A 1AUSL 3OR2B 5H9FJ 1WOSA 3SQGB 2R7SA 5A8RA 4H4KC 2GAGC 4OI4A 5DM6Q 4MIBA 4CTAB 3H5XA 5AJ3F 3X1LB 3UCGA 3RUBL 4HT5A 4U9RA 3I0SA 4PZVA 1VRUA 4YB5A 2KRRA 5D4OA 2N3OA 2MLYA 3W3SA 5C42B 4DL7A 2HMIA 3PTWA 4H4MB 3T1HJ 2VPYB 3GMGA 2RDDA 4AL7A 1OQ3A 3CJQA 3OSPA 5DQGA 3US5A 2ZOMA 2VBXA 1DQAA 2PSZA 2DNQA 3D9BA 3MAAB 1S6PB 4KT0C 3CMQA 2HVIA 1B7YB 1RWWB 4DMZA 3QSIA 4C6AA 5J1NA 2W2PP 4F4AA 1RAIB 1R8BA 2CJXB 2VFVA 3MM7A 1UETA 4LBPA 1S79A 3R9LA 1HNVA 1E6VA 4QJVA 1ZA1B 2KYZA 2ROEA 4EUVA 3H4BA 4KHMA 4J9UE 3MR2A 3IAM9 3DRPA 2OELA 4HH1A 2CNKB 1YJ9S 1S1UB 4RNMA 2E1RA 5B0CA 4M63A 2X3DA 3V5RA 5L46A 4G1QB 4K50A 3D3BJ 3CD6S 1Q8KA 4F4WA 1LK7A 5HI7A 3MPVA 2ZFHA 5KT7A 2HZVA 3NL0A 1EETB 4ZPTR 2J0XA 4RW9A 2UVVA 3NOCA 3PXGa 2W8LA 4DPUA 5HQLA 1QAIA 4FXDA 2GHWA 4ED7A 2EK1A 4IRKA 3P4UB 2BJEA 3H40A 3BKUA 3G9CA 2BMBA 3MEGB 2DB1A 1TKTA 2Z57B 3TQ1A 5DG7A 4WP8A 3Q22A 1RK8A 4DFJA 3DHWC 2XHCA 2U2FA 2CYYA 3CO0P 4MAKA 3CSKA 1WHVA 3OTOJ 3Q24A 4YY3J 1Q81T 1O0PA 2C3OA 5KG5A 3DLEB 4P52A 4JBCA 3CDUA 2ADBA 4LRBA 3EM1A 1K1SA 1T05B 2KJVA 2Y1RI 3OR1B 2CVEA 4DL4A 3QZ8A 3G6VA 1FKAF 2FVQA 2FVSA 1NZAA 1IKVB 1NMEB 3D1HA 4ED4A 2HEKA 2DNKA 1YI2S 3FQLA 5DQHA 1CBKA 3PX0A 2MJUA 3POTA 5DETA 3AQPA 3NCQA 3D7SB 1N52B 2VF3A 5E3CA 3M9OB 1VIOA 3GCWP 4DR3F 5LMUJ 1S57A 4LQ9A 4QIVA 1LWFB 2DHSA 4PXDA 4KJIA 2YWGA 1DTTA 4USKA 2RF2A 1JLBA 2HHPA 1TZ0A 5CA5A 4CRJA 1WC3A 3EPIA 4RZRA 4GKKF 2KRBA 2XC9A 1XMBA 1ZZFA 1Y3KA 2V68A 3G2XA 1DARA 1N4LA 3PKYA 1QY7A 3HHKA 1KHWA 1RAJA 4IYQA 4DZDA 1CJTB 3T5LA 2XMJA 1Q7LB 2QLBB 1NAQA 2AQ4A 2W9CB 2XTJP 4WFXA 4I6YA 3DXBA 3NAHA 3TANA 2HAFA 1K1QA 1RHQB 2G2ZA 4W92B 3R6GB 3RR8A 1WG5A 4CM0A 2UXBJ 4NLQA 5KFMA 4LFCJ 3JTPA 1UJ4A 3V6JA 4J9MA 1F6TA 3C15A 4GRSA 2AEMA 2QA1A 2HVEA 4IO9Q 4GC6A 3MCSA 1F60B 2LDIA 3PYEA 3D5MA 2GIQA 3I9V9 1FVQA 3O6QA 3D6HB 1Q7YT 4J91A 2Z0GA 4D3HA 2VJUA 3R2CJ 3IBCB 2OPPA 2ZZTA 4BS2A 3LP1B 3MR3A 4IQMA 1GT8A 3IC1A 2IMWP 1IR2A 2V2ZA 4X66F 2G1DA 2R7OA 3W60A 2X51A 4JYAF 1ZBTA 4ED5A 3HHLA 2L3MA 4RBUA 3NOGA 1Y5NB 1ZOTA 4QR1A 4ZPVR 4DBQA 2E1PA 4OJHA 2GJFA 4TVAB 2EWHA 1TK5A 4DLGA 1CC8A 2Q43A 5D8HB 4EMDA 3GWCA 1YQHA 3H25A 3VVTA 2HNDB 2BANA 5L38A 1S59A 1N33J 3J7AN 3OL9A 3M6XA 3S1TA 5LL6d 4UQTA 1URRA 3G8TA 5DGAA 1L3TA 2L9NA 3VAGA 2B51A 4IG0B 2UU9J 2XSJA 3SSSA 1ZM4A 2DH7A 2N82B 1VBKA 3MEEB 4FVMA 2XYHB 2BJ1A 2DYAA 2W7AA 4IDKB 5J2MB 2HNYA 4RW8B 3RU0A 4EGLA 1FKOA 2I8EA 1BQMA 2YNGA 4RWWA 3TRGA 1TV6B 1M90T 4Y2AA 2BKNA 4DQQA 2WSFC 1KVKA 3T1YJ 2BEFA 3IS9B 3AB4B 1Y3JA 3WIUA 3QGHA 1UL3A 1KONA 2WVBA 2GGPA 4KFBA 3TVZA 4K4UA 2CPIA 5CQGA 2QGFB 1G4CA 1AB8A 2EVZA 4C3LA 1LWEA 2WONA 3DGVA 4XIUA 4NCGB 2Y8YA 1Q95G 5CYMB 3PX6A 4DLEA 2X7IA 1UW9A 3CT9A 2HQ3A 1MW7A 3SIPB 2B9YA 3GP9A 1VQ8S 1LV5A 2H54B 4FDFA 3NCPA 5A8WA 4WKYA 1HI1A 1RADB 4E0DA 1TKXA 3K5PA 1SJFA 2UUTA 1KLNA 4LF4F 2FJXA 4DQPA 2WSEC 5LMNF 2JVRA 2MEWA 2ACMA 3H0PA 4LF9F 1QUVA 4QYZK 3TOQA 1MMLA 5I42A 1HQUB 3QJPA 1HHTP 2DPIA 4F4YA 2GHPA 4ED2A 5KT4A 1RTHB 3VAKA 1SKWA 2F7VA 1SJ4P 4ZPCA 3QIDA 2D1CA 3D0HE 4KE5A 1YG0A 1GXTA 3IGNA 2DNMA 2ZJPQ 1HW9A 2BW2A 4WZMA 5FLXY 1YITS 3CJKA 1KTVA 1S9EA 4DR1F 4OYOA 1TL3B 4P71A 1TL4A 3F44A 3OHAA 3RBEA 1XNQJ 2CQ1A 1HMVA 2GV1A 1VGYA 2RHSB 1P6TA 3GPAA 4JI2F 3TJAA 2MQQA 5F0UA 4RW4A 2QLWA 3A3PB 3S8SA 3J7YU 5ETQA 2AW0A 1FESA 4OZLA 3FCWA 3ZZZA 3N6MA 1PJ5A 3OTDA 3D6TB 3MPWA 4QZVB 4M5MA 1FJ7A 3MOJB 1VYAA 5ETVA 4Q7AA 2FVPA 4LJMA 4PQUA 2BE2B 2R8GA 3DLLQ 2KTQA 4J9VA 4USTA 4EU0A 2DRBA 2AF6A 4GKJF 2CJ9A 1S6QB 1FJEB 3I9ZA 2NXNA 3DKDA 3N28A 4DV3F 1WWHA 3GLJA 2C3MA 1JLQB 3WZ0A 3PIOQ 3U1NA 2QG9B 3UDVA 1KKHA 2HNZB 1O51A 1FA0A 4O3PA 3DN9A 2IRYA 4ELVA 1JNZB 2FLLA 2KJWA 3ET6A 2VA3A 3FEZA 4WFBQ 3FZ2A 4PWDA 3NS6A 3J81Y 5HJXA 3FEXB 1S1TA 4Y2CA 4N56A 2B6AB 3M6VA 4LQ3A 4USWA 3AJDA 1SV5A 1P1LA 1C0UA 3P45B 3PYDA 3QGPA 4EO6A 4WFZA 2FGCA 1RT1A 5HMXA 4IFVA 3W1YC 4OJGA 4ILLA 3JYTA 3I0RB 4ICLB 4RUAA 2VZ9A 4ZVGA 5CZVA 2CJQA 1YBAA 2C2NA 2HS0A 3B82A 2VBWA 3AT1B 5KFEA 5KFGA 3ELHA 3Q2SC 4RL1A 1S10A 4BWJA 4LR9A 3PCOB 4MKYA 1X60A 3J80Y 1FDAA 1VC0A 4X4SA 5F41A 3K8VA 4OX9F 2CADA 2HBRB 2MY8A 2KZZA 3M8PB 3C6TA 4PQAA 2J9DE 2IM1A 1QTNB 2EXUA 1TFWA 4C11A 5KFBA 1RTDB 2W4CA 3K59A 3CDEA 3V81B 4CO1A 3UD4P 4AQYF 2VG5A 3EZ5A 2RDJA 1PGZA 2K3IA 4NLTA 5K8MA 5KFDA 4LF6F 3KFWX 4B9VA 4PAAA 6FD1A 1N34J 5F8NA 3VGTA 2AJQA 2H51B 4NPOA 3JQKA 2QRRA 4XO0A 2CKWA 3RB4A 5DG8A 3RW6A 5EUHA 1FJCA 2V9WA 4OHZA 3H90A 1NNDA 1N32J 1FX2A 1HWLA 5KFNA 2IDLA 1ZZNA 4HLBA 4Y34A 2FZKB 2E5IA 2XZDB 2GFFA 1X4CA 3W2WB 3DRXA 4GO7X 2WK4A 3T19A 4I7FB 4WU2A 3NNHA 1WHYA 4A8MP 1IQZA 1XR5A 3A8EA 1RLDA 4OZ5A 1EJ7L 3KDNA 5E3QA 4NXNF 2XYPB 4DN9A 1QJHA 3UQSA 2P5VA 1NHKL 2HQIA 3GFXA 4IOCQ 3IRXB 3OT9A 3PZPA 5ETKA 1U0SA 1SI9A 2IM3A 4OIXA 1AZSB 3AD7C 3T3FA 3DYAA 4F4KA 1FEEA 1XEZA 2VUGA 3M6WA 3CCWA 4CM2A 4I67A 3KJQB 1MLAA 2XWXA 1SH0A 1HPZB 3CW2C 3SZ2A 2ALYB 4MYTA 5HROA 4TLQA 2CWXA 4P73A 4KY3A 2DT9A 4DFKA 2JLFA 1RKIA 2F8MA 3WIVA 1AW0A 4ECZA 1NBEB 2V8HA 4G1IA 3QRQA 2XMKA 4WE1B 1VQSA 4OLOA 3NMAA 5HP1A 1TVRB 2FLPA 3KLEB 4ZIVA 3NY0A 1W7WA 2PO4A 4ELUA 3L9ZA 3K8WA 1R8AA 4NMXA 1EP4B 2JEFA 3GTYX 1Z1ZA 3QPIA 2DGXA 4YHHJ 4K4ZA 2P9EA 5AXMA 2DNOA 3UW1A 2XI2A 5GAEU 1UFLA 4DCPB 1K9MT 1AA1B 2KVQE 4FF4A 4O4RA 2J6TA 1HBNB 5LM7E 2JEIA 3WHIA 1PILA 3EPGA 3ONQA 4I1TA 2J0QD 5KFZA 1S7HA 3H8YA 3ENVA 2DVIA 2K06A 2NXEA 4LVNP 4ZKAA 3UDEA 3OD2A 3QRPA 4IH7A 4K0KJ 2CNNB 2HVDA 2ZH8A 4P10A 3VHQA 4LF5J 1F2HA 4FF2A 2DNYA 2ZH4A 3D1QA 1DJ0A 4JI6J 5A0YA 5H9EJ 1Q53A 2Z2YB 1F3VA 1CJVA 2RQCA 1CSJA 4I68A 4PYDA 1IBLJ 2R7VA 4WXOA 1HD1A 4F8RA 1N48A 4DS4A 4DV2F 2V4QA 2OFGX 4MKVA 3CPWR 3DI6A 4G65A 4Y65A 3RAMA 4Q8EA 2DO4A 5D0HA 3T5HA 1U47A 2XWYA 1JNRB 3T5JA 3RGIA 3FMBA 1IM4A 1M1HA 2IIHA 3I87A 3SDEB 4KV8A 1WTBA 3W5ZA 2B43A 2Z58B 5HO4A 1FDDA 4NASA 4B3OA 3D0IE 2ZZNA 4OLPA 2XSFA 2MZJA 3FDSA 5GMDA 1C1CB 3LP0A 5DS7A 3KLGB 1A0OB 3FBEA 3A8JA 2KI2A 3C16B 1NZ8A 2I38A 2DHGA 3KJVB 4MFBA 1X4DA 2IJFA 2ABYA 2K1RB 1R31A 4OJ1A 1QLNA 3H5UA 2HIQA 2P6SA 5A8KB 2OPQB 1MU2B 3I5BA 3MUVP 4C0HA 3D54A 3BH6B 3CCLS 1SJQA 4DG1B 3OVSA 4ZPWR 2H3EB 2IJNA 1KVIA 4IUFA 1UW4A 3MM8A 3N9UC 4R5PB 4MYUA 1DZ5A 2OUGA 2ZKTA 5E33A 2QYCA 4H54A 4OHWA 2RU3A 5IWAF 5T14A 4J9SA 4NA3A 3BR9A 3KK2B 3CD7A 1N5YB 1PG5B 1RAEB 1XK8A 1KQKA 4KIAA 2LQJA 5HAOA 1VQ4S 1DLOB 2MMYA 2HG4A 2ZOFA 1N6QA 3MM5B 2H5EA 4O0IA 4DL5A 4X4TA 3DLKB 2E5LJ 1M5HA 3RBXA 1LXJA 1RTZA 4TNOA 4DU8A 1Q8LA 5KT5A 1KQSR 4WWSA 4NE9C 1ZPVA 2JC1A 4NX9A 1R8HA 3MPUB 1NK6A 4F04B 2EKNA 2A6MA 3QFHA 3EVWA 4QW9A 1GMVA 1KP6A 3BB5A 4B9MA 2DNGA 3DRRB 1IKXA 2FVRA 1S9GB 3DLGB 5KFVA 2WOMA 7FDRA 4FYYB 5GAHI 2F4VF 1FO1A 2HHQA 4ZLPA 4JI3F 2MB0B 4DR4J 2AHOB 4H4OA 3CDWA 4QR0A 5HN0A 1PBAA 2LQBA 4P6QA 1N56A 4B3RF 3B6BA 4LFAF 1G6BA 2C3UA 3LGNA 2HHTA 1GTEA 1NKCA 2N7YA 3OL8A 4KHPJ 4DV1F 2YQ0A 4FS1A 2V8PA 4MKBA 5HVGA 2DNRA 1NB2A 2DR6A 4NI2B 2GJIA 4Y0FA 1UPMB 3E3XA 3TEHB 2W7PA 3WX4A 2EG2A 5IS2A 5F8HA 1AUDA 2D9PA 1X9WA 3CCJS 1SC3B 5BR8F 3TUJC 2AD9A 1KFSA 3FKBA 1CS4B 2M88A 4CLWA 3D66A 5KFKA 4LF8J 3I5AA 3RB3A 3GILA 2GVZA 5IFMA 3DDNA 1HBUA 1RWOB 5KFUA 3AAWB 2CNLB 3BBFA 3M2RA 5ETOA 2YNHA 2K7JA 2ZC4A 3EVOA 4RKUC 3ZZTA 1WELA 2N3LA 3JXOA 2OPSA 2ASJA 3QT8A 1IKWA 2VB6A 4CLLA 4RBVA 3R2DJ 2DH9A 3EXCX 5CXTA 4URSA 1N5QA 3BGOP 4TXSA 4WXWA 1JLFA 3HPOA 3HKZD 3A1YG 5RUBA 3GFZA 4DOZA 2HQFA 4NXMJ 4Q0BB 3IN5A 4HEA9 5KFLA 2R2RA 1H98A 2C2KB 3O8WA 3OR2A 4GVBB 4WKRA 1D09B 4PCQA 3SQGA 4CT8A 6FDRA 1FERA 2I5JA 1RGVA 4G3IA 1S1XB 3OQ2A 1LQ9A 3TA0A 3HDSA 2AP6A 3GFYA 4KQZA 1NPRA 4JP8A 2VU5A 2YXLA 2F8EX 1B0PA 5DGBA 4DR5F 4QWDA 4H4MA 4DV6J 1OSCA 1YSJA 3NEKA 5KG7A 4A8QA 4FNIA 1VQ7S 2DNLA 2HFZA 3JQJA 3IRWP 1NSAA 3A8IA 5KFYA 2RSQA 5E2QA 4F7VA 2V69A 3GYGA 1PYOB 4ECTA 3UWTA 1TUGB 2Y3YA 3JAMU 5L1JA 4DV5J 2VASA 4PPZA 1S77D 2LFVA 1JWWA 4BBYA 1DURA 2W25A 2R2TA 2QX0A 1Q0NA 4YUDA 4LRDA 5K8NA 2OD4A 2ZHOA 3M6UA 2RQKA 5IOLA 4ZJQA 4JI5J 5AXNA 2YKAA 4DDFA 1CJUB 3HHLC 3UDCA 1LKZA 5EWGA 2C42A 5HMWA 1YRTA 4ATNA 2RS2A 4NLOA 1T9UA 3MUMP 1MSWD 3ENWA 4NLUA 4RUCA 3KUGA 1S1UA 3R5BA 3R27A 2HURA 2WZ1A 3DLJA 1SQGA 1D8ZA 3NS5A 4K5SA 3PRVA 4G1QA 1QDUB 1RBAA 2ASYA 3PIPQ 4L73A 3H7HB 4B9SA 2AKWB 1YJTA 1YRXA 1UJ6A 2ZC3A 4R8UA 3EXYA 3AJ2A 1JLCB 5AJ3J 3KLHB 1T03B 1FHTA 2OFHX 3OXGA 4FYDA 3TAQA 4UQGA 3H42A 1FT8A 1VQNS 4X4QA 1U1MA 3M32B 3W5XA 3V2UC 2ZH7A 2N7CA 1SVDA 3MEGA 4KBIA 2VFSA 1DHMA 4MKAA 2VKZG 3BGRB 2AX1A 3D67A 2YTCA 1EZZB 2QYGA 4CH0S 2ZBPA 2IFXA 2NSBA 1C0TA 3TNVA 3DLEA 3I55S 2CQ2A 3H2VE 4GO5X 4C8MA 3CVKA 5T7LB 3OR1A 2DEJA 1NK0A 1IQTA 3TYTA 1J5EF 5CCLA 1BD6A 3EZOA 3W66A 1VK3A 2NXUA 2FIUA 1CG2A 4NLYA 4O0NA 3BKTA 2PN6A 4QBUA 4BC7A 3LOUA 2WBRA 3M8QB 2ZH5A 3R1LA 4DUZJ 4C2MA 3SBMA 1M5OC 4ID5B 1LWFA 4IFYB 2CIMA 3AXKA 4ZS6A 2KH9A 2XO7A 1KLMA 4P2MA 2MKYA 3NBPB 5KT3A 1VHIA 4PKDB 2VKRA 2OIHA 2CPFA 4UOCA 4C8YA 4EYHB 2LA6A 3ZZYA 1HNIB 1T3NA 5EX0A 3O5TB 5AE1A 4RW7B 3E8OA 3KJFB 1T95A 3VAMA 1X4FA 3H2UB 3CCTA 2BDPA 4FKXA 3W2VB 4F36A 1N8RT 4ZHRA 1HHSA 2BX6A 1CEZA 3G6ES 3MI7X 1UWBA 5KG0A 3N5FA 1U09A 1P9QC 3BSCA 3CF5Q 1NB7A 1UPPA 2IRUA 2OJ3A 4NRTA 1RWUA 1CLFA 1IVZA 1WC0A 3I96A 2QC3A 5D4PA 1LWCA 3NGUA 4I2PB 2MJNA 4NLWA 4NA2A 1SC1B 5THWA 3M7VA 5LXYA 1PC4A 1C4AA 3LP1A 3PRDA 7FD1A 2IYGA 3HD2A 5CYJA 3AH6A 1X9SA 3FMWA 2BBEA 4UZBA 5DLGA 3B54A 3HJVA 1CJKB 3D28A 5D3GA 1MNEA 1V5VA 5J1PA 1XMOJ 4URGA 2E66A 2EFOA 3R5AA 1IJEB 3MCOA 2VV5A 3TWZA 3K0JA 2JHEA 2ACYA 4DR3J 3ZO7A 4B3TF 2HYIB 5HL7Q 3SCIE 3HT3A 2J7UA 1HWKA 1U6ZA 5GMEA 3QAEA 2HNDA 4YMEA 2L08A 5B08A 1TL7B 2OP5A 1NDKA 4ZPDA 3DDIA 2QO3A 4GKKJ 4Q2MA 2EFNA 1IJFB 4CLZA 2MQNA 4S0MA 5F9NA 1HBOB 4IG0A 2MLZA 1FFWB 1RWNB 4UTGA 1X5PA 2RD5C 3NGTA 3U1LA 4EI2A 4DSKA 3KLFB 2R8IA 4U67Q 4ZP9A 5IT9Y 4IDKA 3UPFA 5IT0A 5J2MA 1B3TA 5KFIA 2BM1A 4RW8A 4WF9Q 3R3TA 4CT9A 1DQ9A 2Z56B 2FJVA 5G0RB 3NMRA 4N7TA 1D9AA 1RT4B 4DR6F 2CDRB 3PYGA 2OEKA 3RBZA 1YJVA 2APOA 3UN3A 2FHMA 2XZWA 4ALZA 2L9DA 4QWAA 3IAS9 4DSIA 2PT0A 2M8DB 2KFNA 4O4GB 4DF4A 2K8GA 3M8SA 1HQ2A 2KHCA 1UP1A 4RLEA 4J9NA 2DHXA 3RB6A 1VC5A 3HSGA 2FJBB 4X66J 4ZCLA 1S0VA 2M9KA 1HWJA 2O1PA 4JYAJ 1IKYB 1MWYA 4O3QA 5KOWA 1G3OA 3EDQB 4PXEA 2PEHA 2V0NA 3AJ1A 1I6JA 2WCXA 5BYRA 3QWUA 3QSYB 4ZPAA 5L1IA 3RG6A 3TW0A 3V4IB 4JI0F 2E1CA 2C2EA 2RILA 1P8GA 1WD6A 2YVSA 2FY1A 1T9YA 1R8PA 4KO0A 3ZTQA 3BSAA 2MZ1A 2YWKA 1YZ7A 2ZM6F 3QAUA 1TKZB 1VQKS 1HQUA 3M30B 2WVFA 2HPUA 1L5UA 1NO8A 2KU7A 2PA3A 4OYPA 2BE7D 1RTHA 1K44A 1RKJA 5G4DA 2V4RA 4NLPA 1X4GA 1YGYA 1JKHB 3ZZUA 4ZVFA 1HD0A 4L74A 2ZBCA 3B8HA 4JV0A 2KT5A 1WG4A 3EWGA 3ISZA 2DHHA 3HVTB 4F25A 1R89A 5C24B 3BDPA 2CUYA 1RE1B 8RUCA 2OPRA 3AA9A 2JFDA 1BC6A 3BYPA 2G2OA 2MKSA 1OMSA 3C8YA 4RNNA 2BE9B 1NH8A 4HH0A 2R8HA 2DCUB 3ILLA 4DSEA 2QA4S 3LF0A 2C2OB 1MN7A 2D69A 3W8GA 1BWEA 5H9EK 2MSSA 2AJ2A 2UZAA 2R2SA 2NYIA 3QO9B 3SI8A 3TP2A 4ZK7M 4XPCA 3S7RA 1XJWB 2RIJA 2VHGA 1C1BB 1HLWA 2HWIA 3V6DB 3MR6A 1S6QA 1Q79A 5MLCV 2FZGB 2QMXA 4J5OA 2CQPA 3KK1A 1Q16B 1B7FA 4WP9A 4X64J 1ULRA 1N54B 3PJXA 3C19A 2V63A 1JLQA 4C0BA 1UVLA 2IBKA 3I0SB 4LF4J 5LMNJ 3ETOA 4LF9J 2DNNA 2HMIB 1HI0P 3UVJA 4I4BA 2MGZB 1GNKA 2X1BA 3ZTRA 3ZNUA 5ETPA 4ZVQB 2V2KA 2MZTA 1RJJA 2ZH9A 4KRWA 3MECB 1NK7A 4WZQA 2HSEB 4ED8A 3THPA 1ZTWA 1RZMA 2R2UA 3NNCA 2J6SA 5KFRA 3RJMB 3LH2S 4M5LA 2FB0A 2MKCA 2IM2A 4U7UK 3I0RA 2XNQA 4ICLA 4E2FB 2IA6A 4EZ9A 1SKSA 1JLEA 1X0FA 3HFVA 1KVJA 3MM7B 2QL7B 3NRBA 4DN0A 2XMTA 3ZNJ1 1FXRA 4JI2J 1HNVB 2CQHA 2ZKUA 4RNFA 2WHOA 2P8IA 2DO0A 3I6PA 2F65A 2DXFA 5B7WA 2RVJA 1JJ2R 1RABB 2E1MC 4QIGA 3KOAA 3DRPB 4RW6A 2BOPA 2CPDA 4NEYA 3HHEA 4ZN1A 3FCVA 4UUXA 3M8PA 5A6WA 3CULA 2IA0A 2ZZMA 1Y11A 2ILYA 3Q86A 1GXUA 3KWMA 3AHPA 4X4PA 3H4DA 2MKIA 4G1PA 1S1VA 3ETMA 3V81A 4RW9B 3IR6B 2HHHF 2AZ3A 2GQCA 1TK0A 4DV3J 3OFEA 1H73A 4CLKA 2E9RX 4C3MA 2BW7A 3QLHB 3TJ9A 5FJ4A 3PM9A 1OYDA 5DG9A 2XMAA 4F26A 2BRLA 1Z2ZA 1TKTB 3CB4A 1FRXA 2HLTA 3PO4A 1JMTA 5D15A 2PFFB 1NH7A 3O2IA 4A8OA 4ELTA 1IBKF 3HKWA 3TVKA 2FHOB 1HHQA 3VVUA 1RBOB 1L3SA 2OTJS 2R7UA 2C3PA 3UFCX 3LAMA 5FDLB 4PWWA 1TUWA 3MHYA 4I7FA 3D1OA 2LQ9A 3T5KA 5D0GA 1URNA 2BV3A 1EHWA 1VOMA 3DLBA 5B0BA 1L3UA 1S48A 3KLIA 3OXFA 2W1BA 3IRXA 3DU5A 2RF2B 2JC0A 1SCJB 1JLBB 4IOBA 4OX9J 2GAHC 5KG1A 2JJ4D 2F9DA 2QJ3A 5IM0A 1HPZA 2AGPA 1VQOS 3NGDA 3ILJA 3L7UA 4LIWA 5JMNA 1H2TZ 5C5JA 4DV7F 5K14A 1OYEA 3IMQJ 2AJFE 3VQSA 1MMDA 4AQYJ 1TVRA 2DIUA 3KLEA 1KSPA 4LF6J 5KFFA 1R8CA 3PR4A 1TKDA 2PDAA 1B70B 2FD2A 3LUYA 2QEXS 3B4DA 3C15B 1V3SA 4KGVB 3UD5A 2Z4PA 4CNZA 3M8YA 1U1RA 1VBYA 3CCUS 2GX8A 2C2ZB 3ZTSA 3BGUA 1U1NA 2VPXB 3T1YF 3DOMB 2BJDA 2KM8C 3CJ5A 1RTJB 4OMFG 1K0TA 2G9OA 2YWFA 2OPPB 2OSRA 2BJ3A 1EX8A 2RS8A 1QSSA 3R5DA 1UA0A 3DOLA 4J37A 3OSNA 4HKQA 3K5MA 4Q43A 5JVGQ 3UI3A 1RYRA 4MT1A 4HTIA 3VQTA 3CC4S 1TELA 4FBTA 2XCAA 5KFCA 1PC5A 4OZ3A 3GIIA 4RX6A 3TZZA 1BMQB 2CZVC 1OSDA 2MZQA 5CH7B 1RWVB 4CLFA 4KKOB 3HJFA 2ZH3A 2BANB 4OX6A 4WCEQ 1T8EA 1SQEA 1W25A 4B02A 2PA8D 3ZC4A 3J7Z5 4EBCA 2Y1LB 1HW8A 2UUCF 5B0DA 1UMJA 3SDEA 1FNXH 1Z2LA 3M2UA 2H9ZA 3QYYA 3W9HA 1F9HA 2DXEA 5AXLA 2HNYB 5CZXA 2IPOB 4DR2F 2VG7B 1QD1A 1S12A 1WEXA 2AEJA 1RXOB 1C1CA 3HULA 3IWLA 4I2QB 2F63A 2ATLA 1KQFB 2A1BA 2Y8WA 4EEYA 1I94F 3SQOP 5HVHA 3KJVA 3MFIA 2K1RA 1YLXA 2EC2A 3RTVA 1RAGB 2XGPA 3MGJA 4L72B 3K57A 1X5SA 2OPQA 1MU2A 1T94A 3WC0A 1D3WA 1Q5YA 4BLGA 5HQMA 4DG1A 4UOGA 1UZHA 3ZZOA 4NLVA 2B8QA 4DJBA 3KNGA 5HBMB 3P3DA 2DY9A 1PJ6A 1S1WB 5C25A 8ATCB 1LWEB 3BYRA 4L3NA 2WONB 3TA2A 1S0OA 4KR0B 2DGOA 2IVFB 4R5PA 1Z4UA 3BGFA 1M1KT 4Z7YA 1SQFA 5IQ6A 5A76A 2CQCA 1ZAXA 4F67A 3X3UA 3UR0A 1UFWA 2FTRA 1KDNA 3KK2A 1WHWA 4TY8B 2XI3A 2XMMA 5A8WB 2GQ2A 3MUTP 4PXCA 1NU4A 4WPAA 2XB2D 2V50A 4DV2J 2HK3A 2IVYA 4R0JA 3IXQA 3MM5A 4LRCA 3DLKA 3EVMA 2BQ3A 5B0FA 3DCAA 1IBMF 2DR9A 5I42B 4K8RA 2C2MB 1NSKL 2RRBA 3A13A 5J1EA 4RJVA 3MM6B 4P7TA 4UZCA 3MCNA 2ALZA 3DRRA 2UXCF 5A2QY 1S72S 1S9GA 3DLGA 4OZNA 1XR7A 4Q8FA 2ZEJA 1HKAA 4OI3A 4JI1F 1X4EA 4WIQA 4ECSA 1HMVB 3H2LA 4ILMA 3FNNA 1SXLA 2ATCB 1P1TA 4ZCMA 3EGWB 2JX2A 2DGSA 1VJWA 2NPIA 3DRSB 3UD3P 5CD4A 3UE2A 3MEKA 4CYUB 5ETSA 4WFNQ 4YEAA 1RHJB 3D6MB 1EKRA 2V8DA 3C14A 4EBDA 4PXBA 3K5LA 5EHHA 1NK8A 2EFPA 1T7PA 4FN5A 4PQUB 3MFHA 5J2NA 2ZDOA 3EZUA 3LW5C 5HLFB 3WQPA 5IWAJ 3CGIA 1FK9B 2GJ2A 5CD4H 1ZETA 2CVIA 3PJ9A 2QLXA 4K4YA 4P72A 2ZVSA 3SSRA 2WB1D 3CCZA 3HVAA 2LYVA 2VICA 3GIKA 4ES2A 3LAKA 2DR8A 1VQPS 4M5HA 3O44A 3F73A 2F1FA 3FEYB 5DZ6A 5HMZA 1RCXB 1JJCB 2E5JA 5ITHA 5DDPC 3OJSA 3VV2B 1AFJA 4YB1P 3T6JA 5M2PA 1S1TB 4YS2A 3A3NB 2C22A 1Q8BA 3HVRA 4JV1A 4RU9A 3BPSP 2OEJA 1RT1B 2HLUA 2ZH2A 4IFVB 2MZSA 5SUHA 3FGVA 3GB0A 2F4VJ 4Q0BA 5CABA 1NK5A 4JI3J 1E6YA 4JI8F 2NXCA 1YJNS 5MAOA 4ZN3A 4DV4F 3RRKA 1S1XA 4ZCIA 3SEOA 4B3RJ 3J81j 4LFAJ 2BM0A 3IWXA 1BE4A 2D3ZA 1LW0B 2X1GA 1U8WA 4IQXA 1RT7B 1ZAWA 3MURP 4LT6A 4CZCA 2IRXA 2VQEF 4MIWA 4DV1J 2MPUA 1BXNA 5HANA 2NUUG 4UT4A 2V34A 1BWVA 1SC4B 2BKOA 4KH1B 4F3MA 5GVQA 3SMZA 4EWTA 1LW2B 3LO3A 2G2YA 2B3TB 4HHJA 4C11B 3S01A 5EN1A 3MMJA 4C9DA 2VG5B 5BR8J 1FFGB 3MMAB 4ZVOB 1NJIT 3NGRA 1NPPA 4CLSA 3ZFVA 1VQYA 4TYBA
chains in the Genus database with same CATH topology
4OHVA 3O8WA 4KSEB 5LSOA 4DV5F 2CPEA 3H98A 3BQ0A 2R7XA 3OR2A 4PG5A 4WKRA 2QSWA 5CHCB 2DNZA 2B5JB 3TAPA 4PCQA 3SQGA 1ZM2A 3OTCA 4CT8A 6FDRA 1FERA 2I5JA 2J5AA 4QPTA 1RGVA 4G3IA 1S1XB 3GV5B 4NCGA 3OQ2A 1RTIA 1LQ9A 3TA0A 2B4VA 3HDSA 1MROB 3OTEA 2AP6A 2I1RA 4FPRA 5IM0B 2QMWA 3KK3B 3Q23A 5L1KA 1Q86T 2OD6A 4F3OA 3GFYA 4KQZA 3EGNA 3UR3C 4RWXA 3LQVA 3MMBA 5CYMA 3HHLD 2UVWA 5F8MA 1SIZA 2AGQA 2D41A 2M2BA 1B0PA 1HARA 2CQDA 2F8EX 5DGBA 2HHVA 1WI6A 2VBZA 4DR5F 2YKQA 2BUNA 2M52A 3H5SA 4FP9A 4B9TA 3MWBA 1U1QA 4QWDA 1XR6A 5K14B 1FJGF 4H4MA 1JIHA 1HBUB 1OSCA 1YSJA 4JI5F 3LP2A 3UCUP 4HDGA 2JVOA 4K5RA 2KO1A 2ASLA 3M2RB 5KG7A 4A8QA 2CQGA 2HRYA 4FNIA 1VQ7S 1DFDA 3KHRA 2CRLA 2DNLA 2HFZA 4C8ZA 2YNHB 2W24A 4B9LA 2YKMB 3IRWP 1SL2A 5KFYA 3FSXA 2EPIA 1NK4A 2RSQA 4PG7A 1Y4ZB 3BZQA 3GSDA 5E2QA 1VBXA 4NCAA 4ECTA 3UWTA 4JUZA 1TUVA 2OPSB 5L1JA 1UKUA 4HT7A 1H2UX 3KLVA 2VASA 3HM9A 3CJ2A 3PO5A 4O44B 1IKWB 2FJWA 4LF5F 4PPZA 4OZJA 4M94A 2DNPA 4MK8A 2LLZA 2CPYA 1S77D 1NJZA 1JWWA 4BBYA 1DURA 2W25A 3O3LA 5I4MA 5H1SV 2R2TA 1WF0A 1YJUA 3OUYB 3T1HF 1JLCA 3VR1A 1JLFB 2E9ZA 4N77A 5J2QA 1JLGA 4NLXA 3JSMB 3C46A 3KLHA 1GAOA 1T03A 4WK1A 4M1KA 2YWHA 1SIWB 4YUDA 1A6LA 2RT3A 1UVIA 1P27B 3LPYA 5K8NA 4HI1A 2ZBIA 2OD4A 3IR5B 2ZHOA 3L09A 3I32A 1WG1A 3MZIA 4QW8A 4LMZA 3M32A 2IC3A 3M6UA 3NKYA 1NKEA 2RQKA 4LFBF 1C1BA 4ZDNA 2HGNA 3PW5A 3M2VA 1F5BA 2MZRA 1RT2A 1HL6A 3OR2B 5H9FJ 5AXNA 4RU2A 2YKAA 4DDFA 3SQGB 2VOOA 2R7SA 3HHLC 2ZDPA 5A8RA 2RRAA 1S97A 4H4KC 4NLDA 3UDCA 2BVZA 3DOLB 2FPHX 1LKZA 4NYPA 4OI4A 5DM6Q 2C42A 3HI9A 4MIBA 4CTAB 5EWGA 3H5XA 1RTIB 4AFFA 1G7CB 5HMWA 5AJ3F 3OFFA 3UCGA 3X1LB 1YRTA 1TL3A 4ATNA 2RS2A 4HT5A 3BGRA 4NLOA 4U9RA 2RB7A 3I0SA 2E7WA 1VRUA 4YB5A 5D78A 2KRRA 3MMBB 4QU6A 2GMLA 5D4OA 1RI7A 2N3OA 4NA1A 3DGPA 3MUMP 1MSWD 3ENWA 3W3SA 2FVCA 5C42B 2PIIA 2RMLA 3JSBA 4DL7A 4X4NA 4NLUA 4RUCA 2CJAA 2HMIA 1S1UA 3BN4A 3CCMS 4H4MB 2LXIA 3R5BA 5T7LA 3LP2B 2VPYB 3R27A 1DRZA 3GMGA 2J0SD 3DLJA 3NS5A 1D8ZA 4QYZJ 4DSLA 4K5SA 5BYSA 4G1QA 4AL7A 1OQ3A 5KFWA 1JK9B 3QZ7A 3OSPA 5DQGA 3US5A 1HR0F 1NJXA 4J9OA 3PJWA 3NNHA 2ZOMA 3NNAA 2VBXA 2ASYA 1DQAA 2PSZA 2DNQA 3K5NA 3BN7A 3PIPQ 2YH1A 2V5HG 4I0WA 5E3PA 4B9SA 4O23A 1S6PB 3OBIA 4KT0C 2HVIA 1QAYA 1Q82T 4ILRA 1YJTA 2B9WA 1YRXA 4DMZA 1RA7A 1UJ6A 4I6WA 4ECVA 1LFPA 2ZC3A 4R8UA 3EXYA 3AJ2A 3C2PA 3OLBA 4ED1A 3PW0A 2XCPA 1JLCB 5J1NA 1BGXT 1JLGB 1UEUA 3FSYA 3KLHB 1CC7A 1T03B 1WACA 1VMBA 1JJHA 1R8BA 4DL2A 1FHTA 2KXFA 2OFHX 4FXWA 2XG8A 3OXGA 4FYDA 4IFYA 2GO8A 2HHWA 4C7QA 4AUKA 2BE2A 3TAQA 2VFVA 3MM7A 1UETA 4UQGA 1FT8A 3NP5A 1VQNS 2Q3PA 2Z8QA 4X4QA 1U1MA 3M2UB 3M32B 1S79A 2IC3B 2KB2A 1YTYA 2AV5A 1N5TA 2D7SA 3V2UC 2ZH7A 3M2VB 2N7CA 1HNVA 3DOKA 1E6VA 1RT2B 1FRMA 4QJVA 4ZOSA 1U2FA 2YKNA 3MEGA 2L41A 5A8RB 4KBIA 4FF3A 2KYZA 3P49B 5GAHU 4ZP6A 2XS2A 3HVWA 3QJLA 2VFSA 2B0GA 4FXVA 1DHMA 4MKAA 5KTQA 5F3ZA 1A9NB 3HZEA 2VKZG 2ZJQQ 3BGRB 2AX1A 2YTCA 2ROEA 2DR5A 1HNIA 1VRUB 3C6UA 4EUVA 3H4BA 4FS2A 4C97A 4KHMA 3BO2A 4DSFA 2LVWA 2D9OA 1M5PC 1FRLA 2HNZA 3MR2A 3KG0A 4CH0S 3IAM9 3O1LA 5E7OB 1FXDA 2IFXA 2NSBA 5I3UA 1XMQF 3DRPA 1C0TA 3TNVA 3DLEA 3I55S 4HH1A 4EFAC 2MQOA 1YJ9S 1S1UB 2CQ2A 5DO2A 3W2VA 4RNMA 1D9FA 1HBMA 2E1RA 5B0CA 3H2VE 4GO5X 4M63A 4C8MA 3CVKA 2FHKA 4G6VB 5T7LB 3OR1A 2CPHA 1NK0A 2DGWA 3V5RA 2Z2MA 1R43A 1IQTA 3TYTA 2RKIA 1J5EF 4G1QB 5CCLA 1BD6A 4K50A 4RNOA 3CD6S 4LSNA 4A4JA 3Q8PB 3G6XA 4YQWA 2QE5A 4F4WA 1VK3A 2NXUA 5EWFA 1LK7A 1KQGB 2FIUA 1CG2A 5HI7A 4NLYA 3CCVS 1VK8A 3OTOF 1KFDA 2B6AA 2O01C 4TN2A 4YY3F 3MPVA 3HMJG 2M8HA 2ZFHA 2PN6A 5KT7A 1VFJA 3NL0A 1EETB 1X0PA 2B56A 4ZPTR 2J0XA 4RW9A 2UVVA 2UP1A 2HAIA 4QBUA 4TYAA 3DI6B 3LOUA 4BC7A 5KAKA 2A10A 3PXGa 2WBRA 3M8QB 2W8LA 2ZH5A 3R1LA 2FJAB 1QAIA 3CDBA 2E5LF 1X7VA 4FXDA 2P9GA 3CWJA 4C2MA 1M5OC 1HI8A 2GHWA 3OPKA 4ID5B 5C25B 1FD2A 1LWFA 4OJ3A 1GQEA 4IFYB 2CIMA 4ED7A 4I2PA 4USJC 3ULHA 2EK1A 4ZS6A 5I3QA 2KH9A 2XO7A 1KLMA 1KHVA 1H2VZ 2E9TA 5CCMA 3NBPB 4IRKA 5KT3A 2BJEA 3CE8A 3H40A 4K4TA 3HLUA 4PKDB 3G9CA 3DOKB 1E6VB 2MYFA 4PPDA 2VKRA 3MEGB 2YKNB 2R8KA 2DB1A 3TX8A 2OIHA 2CPZA 2CPFA 1TKTA 2MQLA 4UOCA 4C8YA 3KHHA 1B64A 3PW4A 2GMJA 4OI6A 4Z37A 4EYHB 4B3OB 2FC8A 3TQ1A 5DG7A 3Q22A 5AXKA 1RK8A 5LMUF 4DFJA 3DHWC 1K73T 2C3YA 2LA6A 2U2FA 2CYYA 3ZZYA 1HNIB 4MAKA 5JXSA 3CSKA 1WHVA 2CFXA 3O5TB 5EX0A 1T3NA 4KB7A 5AE1A 4RW7B 3E8OA 3Q24A 3FSIA 4LSLA 1SJRA 3UNGC 1Q81T 1GH8A 5I3UB 1O0PA 2C3OA 1T95A 4QYRA 5KG5A 3VAMA 2MKJA 3DLEB 4X2BA 1X4FA 3H2UB 3CCTA 3JSRA 2BDPA 4JBCA 2PI4A 3CDUA 2QIFA 2LXFA 3OL6A 3W2VB 2AJ1A 1XN9A 1TP7A 1VQ9S 1HBMB 1ZM9A 2PD1A 2VFTA 2ADBA 1N8RT 2VOPA 4YFUA 4ZHRA 4EZ6A 2XNRA 1K1SA 1JB0C 1HHSA 1T05B 2KJVA 2Y1RI 3OR1B 3OV7A 3ISNC 1CEZA 2CVEA 4DL4A 4J9KA 3QZ8A 3G6VA 2RKIB 3G6ES 1FKAF 3MI7X 1UWBA 2J8AA 2FVQA 1WNEA 5KG0A 5D77A 1Y5IB 1NZAA 2FC9A 3NCRA 2KG0A 2FVSA 4LSNB 1D8YA 1IKVB 3D1HA 3N5FA 2J7KA 5EGYA 3RRHA 2DNKA 1YI2S 3FQLA 5DQHA 1U09A 5M2UA 2GO9A 4A8YA 4NZ0A 1P9QC 3PX0A 2MJUA 3BSCA 3CF5Q 1NB7A 2RDIA 1RTDA 2AX0A 3POTA 2IRUA 5DETA 3AQPA 4NRTA 1RWUA 5J1EB 4TU7A 4YB6A 2OJ3A 3HF5A 3ZZRA 1WTFA 1CLFA 3NCQA 2YQ3A 1N52B 4ETXA 3I96A 5E3CA 3M9OB 5D4PA 4F4XA 2ZNZA 1N36F 1VIOA 4KGMA 1LWCA 4IKAA 2B7CB 4DR3F 2JLGA 4YB7A 3CC2S 1ZAVA 4KHRA 2PC6A 1U49A 4IG3A 3PX4A 4LQ9A 4QIVA 2WW8A 4RNHA 1LWFB 2DHSA 4PXDA 4PG8A 4KJIA 2K3KA 2YWGA 2UXBF 1DTTA 4I2PB 2MJNA 4NLWA 2KT3A 4CO3A 1MWZA 3MM8B 4NA2A 1XTZA 2RF2A 4MK9A 4WK3A 5THWA 4LFCF 2GMHA 1JLBA 2HHPA 1TZ0A 5CA5A 5LXYA 1PC4A 1C4AA 2IAJA 3EPIA 3LP1A 1PO6A 4RZRA 2XMUA 3PRDA 7FD1A 4GKKF 2IYGA 5K5MA 5CYJA 1RP5A 4ED6A 3AH6A 1X9SA 3FMWA 2BBEA 5DLGA 2NLWA 2KRBA 2XC9A 3BQ1A 1RT3A 1XMBA 3GZ7A 2XMVA 1ZZFA 2ROPA 1Y3KA 3D28A 1SBRA 4WTYA 4C8OA 5G0RA 5D3GA 5T41A 5EWEA 2W9AA 1MNEA 3L95X 1AFIA 2CQ0A 1WF2A 2O5DA 4A8WA 5J1PA 3BREA 4BDPA 1DARA 1N4LA 4URGA 1H3DA 2E66A 2EFOA 1QY7A 3PKYA 3HHKA 3LWMA 4FNHA 1KHWA 3R5AA 1RAJA 1D1UA 1IJEB 4IYQA 2VV5A 3T5LA 2XMJA 5E3RA 4XK8C 3K0JA 1Q7LB 1U7LA 2IHR1 1NAQA 1N0VC 3BS9A 2JHEA 3KG1A 2ACYA 4WFXA 2W9CB 4I6YA 3DXBA 1N6QB 1R0AA 2M3DA 3NAHA 3TANA 4DWIA 1DAXA 1K1QA 3W2WA 4B3TF 4W92B 3RR8A 1WG5A 3J7YI 2HYIB 3DMJA 2B7BB 3SCIE 5HL7Q 3HT3A 2RJZA 2VQFF 1HYSA 2J7UA 2YNFA 4O4GA 1HWKA 1U6ZA 2X1FA 2NSCA 4NLQA 5KFMA 2WAQD 3QAEA 3JTPA 1UJ4A 3V6JA 1YWXA 4J9MA 2HNDA 4IRDA 4YMEA 2L08A 2VFRA 1JJ4A 5B08A 1ZPWX 3OFHA 2OP5A 2QA1A 3POTB 2A2CA 3PR5B 4ZPDA 4IO9Q 5J2NB 2QO3A 4GC6A 3MCSA 1F60B 2LDIA 4Q2MA 1TR0A 5B0GA 2YX1A 2EFNA 2BZ2A 3QWPA 4EO8A 1IJFB 3D5MA 2GIQA 3DU6A 1RA6A 4FVCA 4DX8H 2MQNA 3I9V9 1FVQA 3O6QA 4RUHA 1Q7YT 5F9NA 2Z0GA 3CMAS 1HBOB 4IG0A 4FF1A 1IKYA 1X5PA 3BQ2A 2POKA 4D3HA 1DTTB 3S6EA 2RD5C 4X4VA 3U1LA 2EKYA 2G4BA 2VODA 4DSKA 3KLFB 1C2PA 2OPPA 4K4XA 1TAQA 1UJ5A 5JJBA 2R8IA 2XY5A 4NL5A 4U67Q 2JFKA 4IR9A 2HFNA 4JI7F 1N33F 4ZP9A 3H20A 4BS2A 5IT9Y 3LP1B 4IDKA 5E5NA 3UPFA 5IT0A 3MR3A 4IQMA 5J2MA 1GT8A 1TQLA 3TUZC 5KFIA 3IC1A 2RH3A 4IH6A 2BM1A 2IMWP 2KM8B 2DGTA 1L3VA 2U1AA 3BO4A 4RW8A 4ZCKA 4H4OB 3N6LA 1XNRF 4WF9Q 3R3TA 4CT9A 3V4IA 2M7SA 1DQ9A 4X66F 2G1DA 1UVNA 2FJVA 2R7OA 3VAJA 2E44A 3DDKA 5G0RB 2MQPA 3NMRA 4N8OA 2X51A 4JYAF 4ZMMA