2CQPA

Solution structure of the rna binding domain of rna-binding protein 12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
GSSGSSGASSGKPGPTIIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 12
publication title Solution structure of the RNA binding domain of RNA-binding protein 12
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqpA00
1X4AA 5JVHQ 2Q79A 2YH1A 1U1KA 3MXHP 2MYFA 3G71S 1M5VC 1U6FA 2XNRA 2MKKA 2KU7A 5HO4A 2JVRA 2CQPA 1U1OA 3DXBA 3L3CA 1FJ7A 2CPFA 1UAWA 2AD9A 1UFWA 1KC8T 3BO4A 3BO2A 4QU7A 2XNQA 1YTYA 1A7GE 2DITA 2HVZA 2L41A 4F25A 5HL7Q 3CC4S 3ZZYA 3BO3A 1VQ8S 2MZQA 2LCWA 3MURP 1XN9A 1H2VZ 1PO6A 1QM9A 1FJCA 2MY7A 1HA1A 2CPEA 4QU6A 2MY8A 2E44A 5DDRC 3J7YU 2MZSA 1N52B 1FXLA 2CQCA 2O3DA 3I56S 2N7CA 3BS9A 2BOPA 2J76E 3G96A 2EK6A 3IRWP 3ZZZA 4WKRA 1S79A 1VQNS 3MUMP 2D3OR 1YI2S 3K0JA 2J8AA 1VQ6S 1U1LA 1M90T 3NS6A 2M0GB 3MD3A 1YITS 5GMKa 1X5OA 2LKZA 2N3LA 2DNMA 5IFMA 3MUVP 1OIAA 2CPXA 4UQTA 2ADCA 1SJQA 3S01A 2MZRA 4UY8T 1A9NB 2J0QD 1U1PA 1H6KX 3R1HA 1VQ5S 2K3KA 1P1TA 2JX2A 5DM6Q 4IO9Q 2XSFA 3U1LA 1S72S 2F9DA 1SJ3P 1WG5A 2LEBA 2DNPA 3P3DA 3RW7A 1WG1A 2F3JA 3ULHA 1B7FA 5LXRA 2KRRA 1U1RA 2RUGA 1X4FA 5EN1A 4TU8A 4WFAQ 2VOPA 2RRBA 2MQOA 1N54B 3CCUS 1BY9A 2QFJA 2DGOA 1X4BA 1QVGR 2M7SA 4CQ1A 2ZJRQ 2X1GA 3UWTA 2SXLA 1YJWS 1SJ4P 3NNHA 2RQ4A 1VC0A 5MLCV 2VODA 2NLWA 2M70A 2AYEA 2MQPA 3CD6S 2MKIA 2V94A 2FPHX 3CCLS 2OSQA 2KM8C 2YH0A 1VQKS 2KRBA 2DNOA 3NNCA 5LJ3Y 1U1QA 1Q82T 2MJNA 2VONA 2CPJA 3OW2R 2RT3A 1X4EA 4IOAQ 2DIUA 3CMES 2KFYA 1VQ7S 3CTRA 1H2UX 2DNLA 3VAGA 4C7QA 3NMRA 3RW6A 1DHMA 5IQQA 1YIJS 1SJFA 2CJKA 1HL6A 1WEZA 2KG0A 1M5KC 2CQBA 1JJ4A 1VQPS 4YOEA 2DNQA 3JB9k 4FXVA 4TU9A 1WHXA 4PKDB 2ADBA 2MSSA 1Q86T 2X1BA 4LMZA 3LQVA 1NU4A 4YUDA 2OJ3A 1DBDA 4PR6A 4W90B 2DNYA 1WHWA 3MI7X 2YKAA 1Q81T 3CXCR 4PRFA 2DIVA 1VC6A 5DDQC 2DH9A 2HZCA 3G4SS 2FC8A 1YHQS 1U2FA 2L08A 2MGZB 2MB0B 3CCRS 5GAHU 4WFBQ 4ED5A 2MHNA 2DISA 1KQSR 2MKCA 3PIPQ 2DHGA 2DHAA 3US5A 1FJEB 5CA5A 2LYVA 5IM0B 4TU7A 3SDEB 2MKSA 2E5IA 3H2VE 1OWXA 3S6EA 1VBXA 3UCGA 2NZ4A 2XS2A 4ZKAA 1K8AT 2RQCA 1UP1A 5LSLA 2CQDA 1PGZA 5FJ4A 2RRAA 2LEAA 1W2BR 3TYTA 2RS2A 2MGZA 2DGXA 2MJUA 1DZ5A 2MQNA 3Q2TC 1H2TZ 1WI8A 2DGWA 2I38A 2MXYA 2MPUA 1WI6A 2HGNA 1D8ZA 2OSRA 5IM0A 4F26A 3CCMS 3SDEA 1IQTA 1KOHA 3THTA 3UD3P 2DGTA 1X5TA 5JVGQ 2G4BA 1VQOS 2DGVA 2LXIA 3H2UB 1JMTA 3SMZA 4WIIA 2MZJA 1YWXA 1WF0A 2DH8A 2AYMA 3TO8A 2KG1A 2AYBA 3CC7S 2M8DB 1WHVA 1U1NA 1M5OC 1HD1A 1OO0B 2M88A 1WEYA 1FNXH 2DGUA 1NO8A 1K9MT 1O0PA 2QEXS 3IWNC 2F9JA 3VAFA 3G9CA 2X1AA 2LXUA 4EGLA 1YJNS 4RU2A 4C4WA 3UCZP 2G1DA 2OTJS 3N9UC 2WBRA 3U1MA 1AUDA 1N88A 3CCQS 4QQBA 2MQMA 2MKHA 1ZH5A 1FHTA 2KVIA 1ZZFA 3S8SA 1U6BA 2LA4A 5CXTA 2OIHA 3S7RA 3VALA 2HGLA 4C0OC 3MDFA 1M5PC 2MQQA 1WF2A 1WWHA 2KT5A 4LIRA 5DM7Q 2ERRA 5DDOC 2CPHA 5CYJA 2CQIA 3VAHA 2G0CA 2GHPA 3LPYA 2KH9A 2DGSA 1URNA 2UP1A 3UE2A 4BS2A 2EVZA 3FEXB 2D9PA 3VAKA 1HD0A 2MQLA 5GADU 4P6QA 2QA4S 3PIOQ 1VBYA 3CMAS 2CPYA 3CCES 2M2BA 2DH7A 3EX7B 2I2YA 4W92B 2CPZA 5H1SV 1F9FA 4TLQA 4CH0S 4U67Q 2YWKA 1NJIT 2PEHA 2M9KA 3G6ES 2VOOA 1FO1A 2DNHA 2XS7A 2CQ3A 2E5HA 3DLLQ 2ZJQQ 2LQ5A 1M1KT 4V19X 2FY1A 5LXYA 4FXWA 2CQ1A 2MZTA 2LECA 3CCJS 3NS5A 5D77A 5DETA 1VQ4S 3P6YC 2D9OA 1X4HA 2FC9A 1FT8A 2GO9A 1OPIA 1R8HA 1WELA 3VF0B 2DHXA 2JVOA 4Z2XA 2DNRA 2B0GA 3VAMA 2DNKA 2KHCA 3UCUP 1DRZA 1X5PA 2CPDA 2XB2D 2MZ1A 3CF5Q 5GAGU 2KI2A 4LJMA 5ITHA 3EGNA 1WHYA 3Q2SC 2JWNA 2MSTA 2OTLS 3HHNB 1SXLA 2EK1A 2E5GA 2MMYA 1KD1T 4CH1A 1VQMS 2KXNB 1RKJA 2CQ0A 1VQLS 2RNEA 2A3JA 2HGMA 3R1LA 2DHSA 2KXHA 2XS5A 2E5JA 4WF9Q 2N3OA 4QPTA 2M8HA 3BEGB 3B4DA 1G2EA 2CQ4A 4M5DB 5LJ5Y 4J5OA 3EGZA 1X5SA 1ZZNA 1L3KA 5GAEU 4Y00A 2DNZA 2L9WA 4WCEQ 1X4GA 3CC2S 4IUFA 3SXLA 5GVQA 3V4MA 2BZ2A 3FEYB 1WTBA 3P49B 3B4MA 3D2WA 2HYIB 2AYGA 2RS8A 2U1AA 2RU3A 3CCSS 5LSOA 1VBZA 2DO0A 3HI9A 1KOOA 5BJRA 2DO4A 1WG4A 2DK2A 4YB1P 1JJ2R 2DB1A 2CQHA 2J0SD 4OZ0A 4A8XA 2LMIA 1D9AA 2CPIA 1JJHA 4IOCQ 2M4MA 1WEXA 1R8PA 2KN4A 4OZ1A 3G8SA 4ERDA 1U1MA 3CULA 1Q7YT 4Y0FA 2CQ2A 2FHOB 3CPWR 5DDPC 3THPA 2DNGA 1VQ9S 2KM8B 2CQGA 3R27A 2N82B 2JRSA 2YTCA 3I55S 3MUTP 2M52A 3VAJA 4F02A 1RK8A 2U2FA 3G8TA 1UW4A 3CUNA 2MKJA 1SJRA 2PE8A 1YJ9S 1X0FA 1N8RT 3UD4P 3MOJB 2ZJPQ 1X4DA 1WF1A 4WFNQ 3NNAA 1K73T 3P5TL 2LA6A 3VAIA 1P27B 3TP2A 1X4CA 5D78A 2X1FA 1VC5A 4CIOA 2DGQA 1CVJA 2DNNA 3J7ZT 2KYXA 3MD1A 2K8GA 1QVFR 2KXFA 3CCVS 2RVJA
chains in the Genus database with same CATH superfamily
1X4AA 2Q79A 3N79A 2KHDA 4CYUB 3DCAA 1UFWA 1KC8T 3I5AA 5EX0A 2ALZA 5HL7Q 1VQ8S 5M2UA 1PO6A 3MEGA 3AA8A 3J7YU 3C16A 2V9KA 3FSIA 3IWXA 2M5YA 3ZZZA 4WKRA 1S79A 5J1NA 4DPYA 4ILRA 4Y2AA 4ANDA 2RDIA 1T0TV 4NMXA 4L73A 4LR9A 2MLYA 3PKYA 4CLLA 2N4DA 2YKNB 2NYHA 4NI2A 5FIIA 1VRTB 2R2TA 2I5JA 1VQ5S 3U1LA 3D28A 5CQGA 1B7FA 1J2VA 3GFHA 1DTQA 2KRRA 1SL0A 1F5CA 2NS1B 1VHIA 4J9LA 1BHNA 2YQ1A 4LF9J 4DV3J 1AZSB 4BCAA 3FRYA 3LGHA 2XMUA 2NLWA 2GHWA 2Z58B 1OMSA 1Y5NB 3VCDA 1GQEA 4LRCA 3MCSA 2ZITA 4KO0A 2RT3A 3VZHA 4CLUA 2UUCJ 1VRUB 3CMES 3AOBA 2Q1LA 2CVEA 4C7QA 5C24B 3G8QA 1VQYA 5C2CA 4DDFA 2ZH5A 3JB9k 4FXVA 3IN5A 2BE7D 4YUDA 5EWEA 2OJ3A 4OI0A 4LRAA 2JEFA 1DBDA 2GQCA 3A12A 1DTTB 1D9FA 1RE1B 2Y0SD 5D0HA 4ZJOA 3TARA 2YNGB 3DC2A 3K17A 2HWIA 3SDEB 1QAYA 2RHQB 2C2NA 4A8YA 1K8AT 2XG8A 2AGOA 5CZVA 2R7QA 3Q89A 5LT5A 5B0DA 3MM5A 3OR1A 2OSRA 5GAGI 3R8YA 2YWHA 1H3DA 1VQOS 4O3NA 1K0TA 3TO8A 2DH8A 5HMWA 3FUYA 2QL7B 8AT1B 5EDWA 2OEJA 1HD1A 1WEYA 4GVLA 1RAOA 1RI7A 2BVZA 1C1CB 2V2ZA 1HMVA 3HP6A 3W60A 1O51A 5DM7Q 1QD1A 3DDNA 1QJHA 1AUSL 3LPYA 1FKOB 4CCHA 4YDXA 5J2NA 4DR5F 5EX3A 2ZDPA 1FNMA 2D69A 2HVEA 4ER8A 3LP1A 2GMHA 3IBFB 3CGIA 3E3XA 1KKHA 1F60B 5A8KB 4CH0S 4AD6A 3AFGA 4DR7F 4B02A 4QR2A 3DFEA 2ZJQQ 4I4BA 4F4ZA 1MWYA 3JSRA 6FDRA 2VPXB 3U1NA 2X3GA 4Z2XA 4NLXA 2CPDA 1U02A 3CF5Q 3BKFA 1S59A 2JWNA 2MSTA 2OTLS 2P6TA 4DV7F 2B51A 2ASJA 4ETXA 1Z2ZA 3EXCX 1PJ6A 1JWWA 4QPTA 2V8GA 4FZVA 4OYWA 1HQUA 2QLWA 3ET6B 3EGZA 2HRTA 4B9SA 2UUBF 4EYIB 4C8YA 2W4CA 1U8WA 4Y00A 2B5JA 1KVIA 2V8PA 4WCEQ 4PZVA 3BQ2A 2OD6A 2OMLA 4C9DA 4N8OA 2DKOB 4J37A 2JJ4D 1IN0A 3MPWA 3IXQA 2PEBA 1WEXA 2IM3A 2OPSB 3CULA 3H4BA 4DS4A 2CQGA 1LW0B 4LSNA 3TOQA 1NK0A 3VAJA 2QN6B 1R0AB 2GHVC 1N0VC 4Q7AA 2UUAF 2XCPA 3HSGA 2VFSA 4LRDA 1RTJA 1Y3JA 4F0HA 4K4YA 3DRRB 2IMOA 4DZDA 3MM9B 5L9XA 3UD5A 2XNRA 3C6UA 3L3CA 2CPFA 1V5IB 2RRNA 3VWSA 2WOMB 1YQHA 4QU7A 2XNQA 1A7GE 5LMUF 4A8KA 1N5VA 3ISZA 5F3ZA 3CD7A 3CC4S 4PWUA 1H2VZ 3DHWC 4DG1A 1SC3B 4GKKJ 4JI4F 3UW1A 1AA1B 4USUA 4Q2MA 8ATCB 3D6FB 1DARA 3QLHA 3IRWP 4HYKA 5KFHA 4MH8A 5C5JA 1FA0A 3FBCA 1AT1B 1M90T 2D3UA 4JI3J 4RZRA 3NGDA 1H7WA 1RTHA 2B6AA 2H1YA 1PC4A 3F73A 1IVZA 4KPCA 4TY9A 1A0OB 4UT4A 1MLAA 4TU8A 3W2WA 2HMIB 4JV5J 1M0SA 3BR9A 1XJWB 4O3PA 4WFZA 1IWAA 2IFXA 2RQ4A 5ETOA 4RNOA 3I87A 2YH0A 3G6XA 1S9FA 4MFBB 2EFPA 1X4EA 2GVZB 1RYRA 3N5FA 1M5KC 5FDLB 1WHXA 3QGPA 1KVKA 4YMEA 5IT9U 1CBKA 2XGPA 2QZ8A 1RISA 1S1XB 3KLFA 3MMAA 2Y1JA 1VYAA 1FVQA 3VGVA 1S9EB 5IOLA 2OUGA 5KT6A 1U4BA 3LAKA 3F44A 2IRXA 4KGZB 4LF4J 1UWBA 1FRHA 1Y00A 3J80U 5DQHA 1X7VA 2MPUA 5HMYA 1OQ6A 4ILLA 1X5TA 1V6HA 4MIAA 2JLEA 4OJHA 4O3RA 1RHRB 1OYEA 2VUGA 3CEDA 3SIPB 3UFCX 4WXWA 1O0PA 4B3MJ 3BQ1A 1FESA 4YHHJ 4FYYB 1TKXB 5C42B 3P45B 1U0SA 3S8SA 4WKYA 4OJ3A 5DDOC 3AY0A 1RT1A 4JV2A 2H9ZA 2V8DA 1Q4RA 4CWBA 3PIOQ 5I3UB 3AT1B 2FLOA 1RP5A 1NK6A 1EETA 3DGPA 1KHVA 2PO4A 4AXJA 4ZVUB 3MECB 2M2BA 1X8DA 1NJIT 3PJXA 1HWJA 3UN3A 1VS3A 4D3HA 2FJXA 1GK8A 2H4YB 1GH8A 3M2UB 1WKJA 3H4DA 5MAOA 4DV3F 1QAJA 1NMEB 3ZNJ1 4QWCA 4IDKA 3NGRA 4DR4F 4E8UA 1R8BA 4B3SJ 4JI0J 2JHEA 5KFMA 2GIFA 3VAMA 2FHMA 2UUCF 1JQGA 3PCOB 2HHPA 2J9CA 3PRVA 1U2CA 1SXLA 3KJVB 4NRTA 5HJYA 3J7A1 3KYLA 2YBVA 1QSSA 2E5JA 1TL4A 3VVUA 3BH7B 3RR7A 3Q8RB 1K0VA 1RAJA 2LDYA 1BLUA 4I2QA 3RB4A 3Q83A 1R31A 2HYIB 4MIBA 3QGHA 4WZQA 4DEZA 3W62A 2V2VA 1RT2A 2CRLA 4I6YA 4DV0J 1UWAA 4OX6A 2DR6A 1B3TA 4NLTA 2IAJA 3O8WA 2GX8A 2CQ2A 4CNYA 1RT5B 2DNGA 3OR2A 1J5EJ 4ZJLA 3TUPA 1FDNA 2VBZA 4WFNQ 2Y0BB 2W9CB 1BE4A 4CLSA 3MR2A 5F3TA 2F1FA 1KFDA 4CIOA 1HNIB 3K5NA 4NEZA 2DT9A 1QVFR 2KXFA 1N5YB 2RVJA 1H98A 4ECVA 1M5VC 2ZOMA 1IBLJ 3GR1A 3IS9A 2J6TA 2ZOFA 1HQEA 5G0RA 5J2MA 1TFWA 2MZQA 3I96A 2VQEF 4MKYA 4USKA 2IHR1 3NWRA 1N52B 2GCFA 3I4PA 2E5LF 1U0HB 2L48A 4NLQA 4WWSA 5HI7A 3KLVA 4M5KA 1NSAA 2CKWA 3KLGB 2F8HA 5LOQA 4S0MA 1VQ6S 4RL1A 1Y7PA 2OPPA 3M2RA 5KFIA 3I0RB 2Y8YA 2GFFA 2ZC4A 3MHYA 1EKRA 4A48A 4P2SA 4IO9Q 2H51B 4HKQA 2XYHB 2P2CB 3GU0A 1MG7A 3MM8A 3I0SA 1XMBA 3AOCA 3KLHA 1NH8A 2VOPA 3P5BP 2IBKA 4O0NA 1RTIB 4ID8A 1QVGR 3I32A 2A18A 1F2HA 1ZAXA 5IT9Y 3M9MB 4Q45A 1TKZA 5I3QA 2PA8D 2FTRA 4LR7A 2VBYA 1IM4A 4C11A 5J1PA 3ILJA 1UMJA 4OYXA 2KG0A 3HDSA 4FYDA 4JI7J 1F5AA 1TL5A 2XO6A 1H7XA 5HROB 3VR1A 3J80Y 2CFXA 3G2XA 3FJ2A 1YHQS 4TVAB 5B0CA 1YRTA 2MHNA 2HG4A 4DPWA 4UZBA 3WC2A 4TQSA 4YFUA 3NEKA 3NWGA 3S6EA 1Q95G 4NEYA 1RGVA 2AJ0A 2E66A 2NCKL 2MQNA 2G0IA 4KBIA 4MK9A 3VGUA 2LQJA 3BYPA 4X4RA 2GGPB 1IKXA 3BGUA 3C46A 5D4LA 2AYBA 4LF2A 4M5NA 1C0TA 1CJUA 5D6GA 3FSYA 4GKKF 3K89A 2AEFA 3G9CA 1UVLA 1VISA 4NL5A 4FN5A 1YJNS 4EBEA 2BDPA 2ATCB 3BN7A 3LPEA 5E41A 2V2QA 1AW0A 1KP6A 1P8GA 1TL1A 2V4JB 3NGTA 4C0OC 3OLBA 2KT5A 3PY8A 4ECYA 5CYJA 4JI3F 2VIHA 2KH9A 4DL2A 1VK8A 1N6QA 3PVXA 5HBMB 3ZZOA 2J6UA 3AA9A 4CTAA 4FXDA 3CCES 1C0UB 3BGFA 1KBRA 2B4VA 2EFNA 1IKVA 2QC3A 2XMTA 4IG3B 5DLGA 2XY6A 3NS5A 1AFJA 2GVDA 5BXIA 4C3KA 1RBOB 1UJ5A 3V2UC 1QTMA 3VGTA 4ZP9A 3MM5B 2DNKA 4I0WA 2JC1A 2FYXA 4KHPJ 3DYAB 3SQGA 1EKSA 4QW8A 2E9ZA 1P6TA 3AAWB 3VHQA 2MMYA 2PGCA 1VQMS 4LBPA 2RNEA 3K5OA 2R7VA 2C2RA 5L39A 2KXHA 3OJUA 2EFQA 3J7YI 4OHXA 4YB7A 4HT7A 2H65B 1QDUB 2JSXA 3WZ0A 5HVHA 2OEMA 3MPUB 3HLUA 2LQ9A 3OVBA 4U95A 3Q8PB 4LF4F 5A2QU 1WG4A 1GMWD 3GMGA 4NLYA 1Q16B 2R2RA 2WW8A 4ZS6A 1LK5A 1D9AA 2HBYB 1R0BG 1TV6A 1NPKA 1U1MA 4DU7A 4CO1A 2D74B 2VASA 1RADB 3I55S 2ZZTA 1CS4A 4HDHA 4X66F 1Q8LA 1WDDA 3GFYA 3UD4P 1QE1B 3KK2A 2QJ3A 2LA6A 1P27B 4F04B 4ZVHA 2EG1A 2E7XA 5B0GA 4R25A 3J7ZT 4LF5F 5DZ6A 2HAIA 2K8GA 1KHWA 2BJEA 1U1KA 2BANB 1NBEB 3OL7A 2JVRA 2RDDA 5D4NA 1ZTWA 1MNEA 1Y3KA 4PQUA 4F25A 2XYPB 3FBFA 2LCWA 3MM6B 2Z0GA 2E44A 3H5XA 2JFDA 5L1JA 1X9MA 3G86A 3TQ1A 2XZDB 3TEHB 2E1RA 1BUXA 1FRMA 4HACA 2VV5A 5ETVA 2EKYA 4QYZK 3BGRB 1GX6A 5HSPA 2D3OR 3BGOP 4KJIA 1JK9B 4N47A 3W2VA 4OL8A 3GFZA 1EJ7L 4K4VA 2ILYA 2ROGA 4TYBA 5H9FK 4ES2A 3TZYA 1XMOF 1IBMJ 4B3SF 4JI0F 1NUEA 2VDHA 4LFBJ 1UPMB 4PXCA 2OELA 4M5GA 4Q43A 1ZA2B 1RHJB 2K1RB 3MAAA 3T6BA 3ZTRA 2EC2A 2W1BA 3MCNA 3QGIA 3P3DA 4CDIA 3GCWP 3MR6A 4HVZA 5HQMA 3OVSA 1YBUA 4K4SA 2W4PA 1XERA 3GSIA 1P9YA 5MLCV 1ELOA 3LF0A 3G87A 1M1GA 4N41A 5LJ3Y 2E1MC 2WB4A 3DI6B 5HLFA 1BC6A 2D1CA 4FS1A 4ZLLA 2WVDA 1Q7LB 3DXSX 1VQPS 4DV0F 3W9IA 1TKDA 1SV5B 3E01A 4LMZA 1NU4A 3U27A 4DV5F 4QR1A 2BV3A 1S1VA 3IA0A 2AJ1A 1TKTB 3FVYA 2HZCA 1J5EF 4L6V3 5BYRA 4ZOSA 3V81B 1TL3B 3T1AA 4ED5A 4DCOB 4ELVA 2K7JA 2LYVA 1RT4A 3N28A 1RTHB 2HS4A 2B6AB 5FJ4A 1RA6A 4MIWA 3T5LA 3G82B 1OJ4A 3KLIA 1NB7A 2ZFHA 3T5KA 4Q8EA 1WI6A 1I5OB 5HK4A 5IM0A 2OKQA 1DFDA 3PW7A 1NSPA 1IBLF 3M8YA 3W2WB 1YJVA 1M1HA 1TMJA 1OY8A 4F50A 4WIIA 1YBTA 1JKHB 5J2QB 1TU0B 1N4LA 1PBUA 4YR3A 3UDEA 4QR0A 1UKUA 5KFTA 4ZIWA 4PUOB 2X1AA 3MFHA 3UCZP 2XSJB 3HSZA 2WBRA 3GE9A 1Q53A 1PCAA 3CCQS 1Y10A 2WSEC 2YNIB 5F9NA 2IVMA 1KLNA 2IMWP 4OI6A 3VAHA 4J7CA 4OYIA 4P72A 2UP1A 2BKPA 4N7TA 4ICLA 2HQIA 3BDEA 3N6NA 4ZPAA 3PJ9A 3CMAS 2QMWA 3QSIA 1LFWA 1T9XA 5KG5A 3FQLA 8RUCA 2I2YA 2CPZA 1F9FA 5SZTA 3DLLQ 2Y3YA 2HBQB 1OYDA 2KYZA 2KO1A 3CMQA 2LECA 1H73A 4RW8B 5IS2A 5A8RA 3DRYA 5HQ8A 2ZH6A 4DQQA 4NYPA 1N32J 2L9DA 2V68A 4DUYJ 3A1YG 3M8WA 3I31A 1DRZA 3EZUA 2HFSA 5ETSA 3OXFA 3I5CA 4WIQA 4ED0A 4J9KA 2EFVA 4C8OA 4JI7F 1RT6B 1S1UA 4ZPVR 3JTPA 4DSJA 2XS5A 2YKOA 5A2QY 4BDPA 3KJFB 4DLGA 3RG6A 5F8HA 4N56A 4E98A 5M2PA 5GAEU 2AZ1A 4OI2A 1PC5A 4NCAA 5KG4A 4QJVA 3CC2S 5GVQA 5K14B 2BZ2A 3P49B 4ZVQB 2JC0A 1KOOA 3J7AN 3TA1A 4J9RA 4P75A 2MEWA 2ABYA 5F0WA 2IYGA 1S9GA 1WUUA 1L3UA 4PG8A 3SZ2A 3X3UA 3RUBL 3GPAA 3AHPA 1XNRJ 1UEVA 4TLRA 4R8UB 2Y9HA 1U6ZA 3G8TA 4LFAF 3RAXA 5ETTA 2RDJA 5AE2A 3SFUA 3QO9B 3MD1A 5HMZA 3DOMA 3TUJC 3J7Z5 4OFZA 1NKEA 3OT9A 5AXLA 1U1OA 5T7LA 1NJZA 2CJAA 1JX4A 1T9TA 3SBMA 1SC1B 4UW2A 5J2PB 1BWEA 3C8YA 2L41A 4K5RA 3DMJB 1TAQA 5E3PA 2DVIA 3LUYA 1PBAA 1JLFA 3EPGA 2QRRA 3D3BJ 4PWDB 5LSRA 1N33J 1S1WA 3QRQA 4IFYA 3N6MA 2BOPA 2YWWA 2OP5A 5D0GA 3ZNUA 3QWUA 2J7UA 5D8HB 4X65J 3MZIA 4UTGA 2EW9A 4ITSA 1X5OA 4DCJB 3KOAA 2RD5C 4DOZA 4L75A 2IAJB 3R1HA 1KTVA 1FJGJ 1NJWA 2BBEA 3DM2A 2K3KA 4OZJA 1H74A 5DM6Q 2XSFA 4XAKA 2Y1IA 1WG5A 3FBEA 2XC9A 3KLEA 2FHJA 2AJ4A 2BJ1A 1S97A 3KNGA 4DFMA 1BY9A 2GIRA 1QY7A 5IQ6A 1LWEA 4CLWA 4O3QA 3CJSA 3LWLA 1LKZA 4LRFA 2ZEJA 1HNWF 2E7VA 2VFTA 1FRKA 2BRLA 3CCLS 4JUZA 1KVJA 4ZP7A 2DIUA 1DHMA 2E29A 4K50A 4DV2J 4RW6B 1QTNB 3M32B 2Z30B 1JJ4A 4X64J 3GR0A 2B9WA 1OS5A 1Q86T 3HMJG 1KQFB 4LSZB 3MOZA 4FNIA 2BR0A 3CXCR 3DGVA 5KG3A 3BB5A 2X51A 2RMLA 4ZK7M 2WVEA 2MGZB 4RUAA 4CO3A 4ED4A 2W2QP 2OPPB 5M2RA 2XMWA 5KFJA 2EPIA 1VBXA 4OZ3A 5B0BA 2XS2A 4LVOP 2CQDA 3H40A 3NBPB 3R5DA 2RS2A 2HHHJ 1FRIA 4B3RJ 1CJKA 5L46A 2F5GA 2W9BB 3A3NB 2OHDA 1NJXA 4NZ7A 1RAHB 3IG1B 3CCMS 3M6XA 1NCLA 5C2GA 1Q79A 2DGTA 1WC5A 2I1RA 5D0RA 4RBTA 1HHTP 3QATA 3SMZA 4ETZA 3TAQA 1RDRA 3KMSA 2XEXA 2DGUA 3Q24A 1VJWA 4DCPB 4WK3A 3OQ2A 4E0DA 1W7WA 1FKPB 1LWXA 2ZBQA 1TZ0A 1TKZB 3C6TB 2KT3A 4F4YA 2IM0A 4C11B 5DZ7A 1WWHA 4U8VA 2WZ1A 1IBMF 4LFBF 3FBBA 1UW9A 3FDSA 2DGSA 1NAQA 3D54A 2QA4S 3R9LA 2CAJA 3RBZA 4QIEA 1S4EA 3H25A 3EICA 3BKTA 2EWHA 1UZDA 3KHGA 1MMNA 4IH6A 2WRMA 3AJDA 2CQ3A 3LANA 5JUMA 4NXNF 1DQ9A 3BH6B 2JNJA 4NCGA 1X4HA 4K5SA 4I6WA 5E2QA 4FYVB 3CDAA 1DY3A 4CRJA 1PG5B 1WKKA 3UR3C 4Y2MA 2RF2B 2QYGA 3PYEA 3ILLA 1MROB 2D7SA 4UUWA 1CJUB 3MR3A 3I9ZA 1VR6A 4XPCA 2M8HA 3DLGA 2XCAA 4DQIA 1T05B 4K2XA 2MHEA 2DNZA 2BJDA 4RX6A 4Z37A 2AYGA 5LSOA 4DL0C 4HTIA 4OZ0A 2YNFA 4NLVA 2LXFA 1SBRA 4IQMA 3NP5A 1R8AA 4KPYA 4LFCF 1J5OB 4B9VA 1IKVB 2ZBRA 1OPZA 4CI0B 1RHQB 1T9VA 3W1YC 2QSFA 1JXEA 3DKDA 3BDPA 1RK8A 2QA4G 1T3OA 2QX0A 4BHQA 4YY3J 2A6OA 1HNZF 3DLEA 4F36A 1JLCA 3NG8A 1S4FA 4RW9B 3TEGA 3QPIA 4CLFA 5ETRA 4DX7A 2YX7A 1RAFB 5JXSA 4LF8J 4LSLA 3OVAA 3N01A 2RJZA 1UAWA 4KC5A 4ZCMA 2DRDA 1S6PB 1XN9A 1TP7A 3MTKA 2RSQA 5D3GB 1B99A 5ETNA 3M1VA 4QYZJ 2HPUA 2IVFB 3T1HJ 2DPJA 2MZSA 2E9TA 3DLKA 3EXYA 4KV8A 3PRBA 3R5CA 3EVWA 1HI0P 1KONA 1R27B 2QIFA 2J8AA 2OPRA 3PYGA 2R7RA 3NS6A 2XWXA 1S0MA 2WW4A 1ZM3A 3MUVP 2ADCA 4C8MA 3CJ8A 3ITHB 4FS2A 3W9HA 1RT3A 1CULB 4HDGA 3CCWA 2W9AA 1OSCA 3JQJA 2NXJA 2LU2A 4U96A 5EN1A 5T14A 4C8LA 1T9WA 1O5JA 1N36J 2ZJRQ 3QSYB 5KFCA 2OFHX 3RZAA 4F4AA 2DNOA 3Q22A 4Y2CA 2R7TA 1U2RA 4J9PA 3GONA 3MWBA 3RW6A 1NEEA 4QWBA 2CYYA 3CWJA 4TU9A 2YX4A 3EZOA 4RW4B 1SPBP 3CD5A 3GYXB 2B4OA 4W90B 2O01C 1KTQA 2BM1A 2WAQD 1RB0A 3OUYA 4F4KA 1UVIA 1XNRF 2LU1A 4GO7X 3HPOA 4G65A 2FLPA 2VA3A 2A6MA 3DLHA 4DL7A 2QE5A 4UOFA 1JLGA 2VL1A 3BGLA 2IC3A 3LH2S 4OZLA 2XZTB 3LP0A 4GMKA 2HNYB 3KK1B 1HBOB 1GXLA 1T03B 3L4BC 2AQ4A 3N6LA 1B0PA 3QIDA 2HQCA 2DGWA 2OLWA 4NZ6A 5KT2A 3V4IA 1SL1A 2HFZA 3OJSA 4OJ1A 2R2SA 2DD8S 4CO5A 1WF0A 4DUZJ 3V6DA 1UTAA 2M8DB 4X4QA 5HAOA 1FNXH 1Y9OA 2NPFA 3RRHA 2UVVA 2G1DA 4J9MA 1N33F 1ZH5A 3PX4A 1ZZFA 2BQRA 1WC4A 2EXUA 1U24A 1KRPA 5A0YB 1B0TA 2XGQA 2P9EA 3AODA 2HNZB 3CDWA 3UN2A 1BWVA 3MR5A 2EVZA 2OPQA 2I8EA 1NSQA 1FJGF 2MQLA 5GADU 2VHGA 4ZHRA 5J1EA 2CPYA 3SCJE 1WC6A 3PR4A 3HHDA 2FZGB 2UVWA 2FIUA 1FE4A 4ED1A 4KFBB 2XS7A 4DR2J 2WHOA 4W4MA 4N5SA 4X4PA 3MCOA 2RKIB 3CCJS 1G1XA 1S0VA 4CT9A 3FFIB 4NPOA 2ZZNA 3UCUP 3MMCB 3EGNA 1IWGA 4DV2F 3EJMA 4OZ5A 4CLZA 3W61A 4X64F 4OYPA 3GQCA 2GJIA 1FNOA 1EP4B 5HQLA 2HGMA 4EMDA 4PG7A 2R7WA 2AGPA 1JLAB 4LF1A 1FD2A 2RQKA 3NKYA 1CC7A 2BQ3A 4A8SA 2L9WA 4IO1A 3V4MA 4ECZA 4Q5VA 3B4MA 3NGUA 5KFDA 1JNZB 5BJRA 4FKYA 4BC9A 5EGYA 4G1QB 3THVA 2HHHF 3LO3A 4L72B 4USTA 4OX8A 2FDNA 4OZ1A 2E1PA 1TUVA 4OI1A 3SCKE 3KK3A 3MUTP 2YTCA 3DU6A 4P52A 1U25A 2MKJA 2DR8A 2APOA 4HH0A 3VQTA 2AF6A 1SQFA 1LEOA 1ZS6A 1SC4B 2NUUG 3MM7A 2Z2YB 4WZMA 4ZCLA 1IBKF 5HO4A 1IR1A 2ROEA 2AD9A 2PIIA 4AYBD 2X3DA 3FMBA 2F63A 1HWKA 4DQSA 2MQ8A 1RBAA 3EVMA 3V6KA 3FRZA 2VG5A 1T7PA 5AE3A 1RBLA 1HR0F 1M5HA 2CDQA 1FXLA 2JDJA 1NDCA 1JLQA 1HYSB 2EKNA 2N4CA 3EDRB 5FD1A 1VQNS 1GT8A 4M5HA 1UVNA 1BQNB 3BPSP 5KOWA 4WYWA 2Q6BA 3DLJA 2ZE2B 4RKUC 2CPXA 2GS8A 2C3PA 4EK2A 3MAHA 1UCNA 1FDAA 4DZ6A 2ZHAA 1FK9B 3Q23A 2ZVIA 4ED7A 5DQGA 1TVRA 3CDBA 4KSEB 1N54B 1HIYA 1S48A 3QMQA 2OO4A 1DLOB 2X1GA 1HPZB 3GG1A 2VG6B 1CQNA 1YRXA 3HULA 3IM8A 4MKAA 2WONB 2JEJA 2KFYA 5T7LB 3VAGA 2YVSA 1IJFB 3A3OB 1YIJS 4G1IA 4DPOA 1D8YA 4DL6A 3E8OA 4JI4J 1GX5A 3JTOA 1RXOB 4ATNA 3NCPA 2ZH8A 2O67A 1R6YA 3NGSA 3IC1A 2PA3A 1LQ9A 4IRKA 2CG4A 2DCUB 4OHZA 1VC6A 1F2GA 3R97A 3G4SS 2XQCA 2YX1A 3D6MB 2FJVA 4PAAA 2DHAA 5CAAA 3X1LB 5LSLA 2B9XA 2KFNA 1W2BR 3RTVA 4OLOA 5CCMA 3UDLA 4LUBA 4C2MA 4LF8F 2KL8A 2AX0A 2NREA 5F8GA 3THTA 3BSOA 3HVTA 1RACB 1X60A 2LXIA 5C25A 2AYMA 3UPFA 2HQFA 4QWDA 1M5OC 3D66A 2M88A 4JI2J 2G13A 4GKJJ 4DSKA 3K8VA 3N9UC 2HQ3A 2WK4A 5GAEI 2G9OA 1RTDB 2E7WA 4A4JA 3E2EA 4OYOA 3CJ5A 3JQKA 2NXNA 3H5UA 4Q44A 2ERRA 2VZ9A 4XPEA 2HS3A 4I1TA 1RWUA 1CJTB 1XNQF 3CJ0A 2DCLA 3MCMA 2DTJA 1MWZA 1YBAA 1BQMB 2W8KA 2YWKA 4I68A 2PFDA 4P7TA 4F3MA 4DSIA 4UF4A 2FVPA 4FBTA 2PSZA 5KT5A 3EMTA 5EUHA 2H5JB 2BE2A 4UOGA 2MZTA 1XBWA 1B64A 2ZH4A 5F0UA 3D1HA 4EZ9A 3ENQA 2DNRA 4R5PB 1X5PA 4NCBA 2XB2D 1S49A 4LJMA 4KKOB 3SCIE 3UDVA 2F8EX 2YKPA 2EK1A 2JL9A 2HFVA 3IM9A 2YKMB 2V4QA 1FCAA 1R7IA 3RRGA 2DHSA 4K7QA 2XBPA 5K8OA 4M5DB 5LJ5Y 4J5OA 2MLZA 4DPTA 1F3VA 4O23A 3DRSA 3PDNA 2EBGA 3ZC4A 3J81U 3OL6A 1R8CA 2ZD1B 4IQXA 4B3OA 2DK2A 2QMXA 2BJ9A 2C2EA 1Z1ZA 3ISND 9RUBA 3M4XA 3M2VA 4DFJA 2GZOA 1ACMB 2JLGA 2JRSA 4DR4J 1MWQA 4DUZF 1MN7A 1T94A 2IPOB 5CZXA 2PE8A 3NRBA 1FWLA 1SH2A 1UFLA 3NXZA 4DJBA 5AE1A 2FJBB 4DFKA 4GC7A 1N56A 4K4UA 3C14A 2X1FA 1VRQC 2IBOA 4NWBA 1PYTA 5I4MA 5KFGA 2FB0A 4YB5A 2CZ4A 4IOBA 4QBUA 1U09A 4Y34A 3W5YA 4NLPA 4CYUA 2ZM6J 3L7OA 1A6LA 4I56A 2O3DA 1NZ8A 2VG7B 3PTWA 1YJTA 3CDEA 2CADA 4DR2F 2HEKA 3MUMP 3T41A 2HFUA 3WIVA 3FC9A 5KFAA 4G3IA 2N3LA 4UQTA 3PACA 4WE1B 3S01A 1VMBA 3M8QA 3F41A 4A8QA 1URRA 1WKLA 1RT7B 2BRKA 2XHWA 2WSFC 4YR0A 1ZOTA 3JSMB 3RBEA 1F5BA 3CJTA 1VRTA 4DV6F 1Y4ZB 4ED2A 2BM0A 5THWA 1YJWS 5DLFA 3EDQB 2DRAA 5KFUA 4JOUA 4QPXA 3OFFA 4DSLA 3BBCA 2KM8C 2MTLA 3HHLB 2NQPA 1Q82T 2YPYA 2CPJA 2H5EA 1VQ7S 1AXQA 1H2UX 2DNLA 3NMRA 2VQEJ 1WEZA 2BKNA 3GP9A 2CQBA 2D3ZA 2E5LJ 3QWPA 1VRUA 4KGKA 1NPRA 2RE1A 5C24A 4V1Ak 3CJKA 3MTJA 2AHOB 5K8NA 3ENAA 4RJVA 1W2IA 4FPRA 2UXBF 2A10A 2VPYB 3HD2A 2H5IB 2E5IA 1DTTA 1ROFA 5A6WA 2VFRA 3M8PB 1DZ5A 3C3LA 2YNGA 3Q2TC 1H2TZ 1RT3B 2HGNA 2NXCA 1D8ZA 4MKVA 3SDEA 2VFVA 2C28A 4IR9A 1ZA1B 4RW7B 4ECWA 1YRUA 3H2UB 4ZVSB 2KG1A 4FKXA 1CG2A 5LL6d 4WU3A 4ECXA 1IR2A 4HR2A 4ID5B 1PKUA 1N88A 3G6YA 2MQMA 3QBCA 4KGXB 2IDLA 3EE3A 4Z7CA 5CXTA 2KZMA 1HBNA 3IWLA 4M8LA 4CO4A 1C1CA 4OZNA 3V6HA 2G0CA 2Z8QA 4ZLPA 1SKWA 3D6HB 2HRYA 3O5TB 4PXBA 4B9LA 3R2CJ 3IFEA 2KFZA 3DRPB 2R8HA 5B08A 2F4FA 1U45A 1X9WA 2HHXA 3OUYB 3FEZA 2ZOGA 3MEEB 4DFPA 5E3AA 1FKOA 3W3SA 4OQJA 2GQQA 2QSWA 4FF2A 5IT0A 1HNVB 2G2YA 2IC3B 5KG1A 2CQ1A 1NM2A 2JFKA 2XZWA 4K4XA 2FC9A 3K58A 2DPIA 4C48A 3OL8A 2C3MA 2XY7A 2C2KB 3TANA 3WIUA 2XTJP 3V4IB 4EYHB 3OXLA 1N0UA 3QJPA 4R0EA 2KI2A 5EWFA 2VU5A 3J81Y 3O6QA 1S6UA 4H4OB 5LM7E 5F8MA 1J27A 4WF9Q 4YP3A 4XK8C 1WSRA 4F4XA 2R8IA 2V67A 1FRXA 2CQ4A 1RWWB 4WYLA 3B8HA 1C1BB 1YZ6A 5D15A 2W8LA 1E6VB 1X4GA 2DR9A 3SXLA 1VBZA 2RU3A 3ET6A 3HI9A 2ZH2A 4C97A 2HSEB 4C0BA 5KFLA 1UA1A 2AJFE 3OL9A 2CQHA 1IKYB 2LMIA 5J1EB 1ZAVA 4DV4F 1JJHA 3AD9C 2NSCA 2GJ2A 1ICEB 5AXMA 1RHMB 1NLKL 3PHTA 3GILA 2BJ8A 2B9EA 3GJRB 4JI5F 1NKBA 1YJRA 4HH1A 3RAMA 5DGBA 4F02A 2ZHOA 1N8RT 4JI2F 2OPSA 2KDOA 4G1PA 1K73T 4GKJF 2C3YA 3P5TL 1X4CA 2Y1LB 2GAGC 5KT3A 3PJWA 5BR8J 3QZ7A 2HVHA 3KDNA 2IM1A 2WVBA 3SQOP 2YH1A 5B0AA 1LWFB 2C3OA 4RR5A 5DG8A 2HVDA 3DRRA 2ZH7A 3EM1A 1HA1A 2ZDOA 1EAYC 2L3MA 5F8LA 4WFYA 4F2SA 1Z2LA 3T1YJ 2H3EB 5GMEA 2WOMA 3HHEA 1RWVB 2VFUA 3D7SB 1NK4A 1TL7A 3QQCD 1HFEL 3M30B 1YI2S 1YITS 5IFMA 2BE9B 4USVA 3MAQA 4J9UE 2Z56B 3CE8A 3PM9A 4ZP8A 2CNNB 4X66J 3QFHA 2DNPA 3KK3B 4X4UA 2C3UA 3Q8YA 1X4FA 4UOCA 1ZM4A 3K7RA 3ZXWA 5AT1B 4ZIVA 2H48B 4LF5J 2DGOA 4Y6IA 2X7IA 1TUGB 3NMAA 2M7SA 4EZ6A 2RH3A 1ZBTA 2XY5A 2HLTA 1JNRB 4O44B 2Z2MA 1NXIA 2MJNA 4IOAQ 1OY9A 4TQRA 3NCQA 1HBMA 2PMHA 1JLEB 4KYZA 2XULA 3T9ZA 3IRXB 3QIPB 1LWCB 1IJEB 4QWEA 2UXDJ 4LQ9A 2UXCJ 4MFBA 2FGOA 5GADI 5HMXA 1V9OA 1HKAA 2GVZA 1D9DA 4HTJA 1WHWA 3MI7X 1JLQB 2KB2A 4URQU 5DDQC 5FDLA 2DH9A 4OJGA 1XMOJ 5GAHU 2HNDA 4EO6A 4OYAA 2DHGA 3MMJA 4B3TF 2AIRB 1EZZB 3H2VE 1REVB 1S1XA 3UCGA 4F0KA 1UP1A 2AGQA 5JJBA 2RRAA 3R5AA 4F67A 2YKQA 2MXYA 1S9EA 5AXKA 3ZO7A 5U47A 1LW2B 3QJJA 2KKHA 4CLKA 3NL0A 5I42B 3TJ9A 2QFIA 3A8EA 3WBZA 3A4TA 2KTQA 2XI3A 4TY8A 2BJ3A 2ZM6F 4USWA 1T8EA 1RYSA 3TAMA 4U7CA 2LXUA 3JXOA 3Q8SB 1Q5YA 1IUJA 3U1MA 2XM3A 1CPZA 4GC6A 1T02A 4K8RA 3T5HA 2R8JA 2OIHA 4C8ZA 3MDFA 1M5PC 1S7HA 2POKA 3D1QA 4DV5J 2GHPA 2B43A 5C42A 1EQ0A 3UE2A 3CDUA 3ZZTA 3J81j 1HD0A 5F8NA 2FHKA 1RA7A 5K5MA 1AYEA 4FYWB 4DR1F 2NZCA 5H1SV 2BABA 3BSNA 2BEFA 2PEHA 5IWAF 2DXEA 1PILA 5I3UA 2IJFA 4NMLA 1FERA 5CYQA 2C2DA 5KFEA 3MECA 3BF4A 5DETA 1VQ4S 4I67A 2QLXA 2F7VA 2OI2A 1CJVB 3M2UA 3AQOA 2XMJA 4P10A 4PCQA 1MU2A 1SI9A 1HBUB 1S76D 5DG9A 2OH2A 2OAUA 4Q0BB 2KXNB 4LT6A 1G6BA 2CZ9A 3ZZ0A 3GSDA 2HWHA 4JV1A 2HK3A 4I2PB 3JYTA 3KJVA 4A8FA 4MJKA 4LQ3A 1S1TA 3EYZA 4IRDA 1YX2A 2JH3A 2CIMA 2WSCC 2XLJA 2GIQA 1WTBA 1IBCB 5KFNA 2RS8A 2U1AA 2DO0A 1IKWA 1V5VA 1FX4A 3UVJB 3PXGa 3UO0A 4NE9C 1S6QA 2C2ZB 1YJUA 3GCXP 3ETMA 3HVRA 5CYMB 3MR7A 1N5TA 3G8SA 2WVCA 3Q8QB 3AB2B 4TKTA 1RHUB 4GVBB 4CH7A 3AD7C 5FLXU 2U2FA 2UV8A 1VK3A 4ZVFA 2BW7A 4ZVEA 4M1KA 4C8NA 1LXJA 2W7PA 1RT5A 3I6PA 3IAS9 2R8GA 3D3CJ 1NZAA 2RQMA 2KYXA 3D9BA 3CJRA 1TK0A 4MAKA 1SQGA 3H0PA 2A2DA 3MEGB 3C16B 4BWJA 1MMLA 5EHHA 3OHAA 2R7SA 3CJ4A 1YTYA 2VPZB 1N5YA 2FJWA 3CNQP 3IR6B 1QM9A 1FX2A 2FLNA 2AJQA 2BJ7A 5E3RA 4M5MA 3K2YA 3I56S 2WVFA 2ZNZA 2E9RX 3TRGA 3G96A 4NI2B 3TI0A 2I5JB 1FFWB 3MD3A 2GNKA 1U0HA 2DNMA 4FF1A 4USMA 1DURA 1UJ6A 1DTQB 1SJQA 3PEHA 4UY8T 3W66A 3KLGA 2DY9A 3O1LA 2QL9B 3R5GA 4P71A 3QFWA 3T6JA 4LR8A 1S72S 1T3NA 3I0RA 2UUWA 4LFAJ 2W2OP 3KUEA 3SV3A 4OHVA 3RJMB 4KO0B 2IDEA 2GAHC 3DHXA 2G2ZA 5DRKA 2V9WA 1VC0A 2VODA 1VQKS 3BSCA 3NNCA 1GTEA 4ENOA 4AT1B 1RTIA 2AWZA 2VONA 1NDPA 2VC1A 1V3RA 2HS0A 3R6LB 1S6OA 1Z4UA 4NLWA 2VC0A 4YOEA 2W4DA 2X1BA 2J9EA 3B82A 1GMVA 2YKAA 1VGYA 3GZ7A 4PRFA 1S12A 5KFKA 5HVFA 1VIOA 3LOUA 1Y5LB 1O6XA 4DR6J 2HHTA 2MKCA 3OR1B 1FJEB 2Z4PA 2B4PA 1OWXA 5HROA 1VI7A 2VPWB 4ZKAA 2RQCA 3M8QB 5BR8F 2BX6A 3A3PB 3IBWA 1BQXA 1WI8A 2J8SA 3RBXA 4O3OA 4F26A 2AJ2A 3BZQA 2B9YA 2DGVA 5CCLA 1HMVB 1HNWJ 2B3TB 2PI4A 2CA9A 3RYLA 3ADAC 1I3OB 4K4WA 3T1YF 2F9JA 2BACA 1R43A 1D1UA 2GGPA 2ZKTA 1AUDA 4EEYA 5J2NB 1NSKL 1FHTA 4QQBA 1ITPA 1XWLA 2MQQA 1S5ZA 3LP1B 4ECRA 2QLFB 1E6YA 2PD1A 2CQIA 3TR5A 3PW0A 3M8ZA 2PT0A 5KFRA 1W26A 2ZKUA 2Z2LA 1XC9A 5L1LA 2V4JA 3PO5A 1GXTA 2ZVSA 2EFOA 3ICLA 2V63A 3CJKB 4F7VA 3M9OB 3MEKA 4W92B 1UVKA 4HHHA 4U67Q 4RNFA 3WC0A 3UN5A 2DNHA 3TX8A 4DL4A 4K0KF 2FHJD 4MK7A 5HBMA 2V0NA 1FRLA 1C0UA 4XTTA 3DNCA 4DX5A 4I69A 4HI1A 4IG3A 1FXDA 4EBCA 3HFKA 1HNXJ 1DAXA 1HQUB 3LW5C 2UXDF 2UXCF 3R7BB 1U7LA 2QG9B 5AJ3J 2AKWB 1SIZA 2B5JB 3JQMA 3DYAA 1G4CA 2CJBA 2QTWA 4I7FA 1GMUA 3R2DJ 3TUZC 3B4DA 5HATA 2ZUAA 1TQLA 2FUG9 2CJ9A 1HBNB 4USJC 3GJTB 1I6JA 1KLMA 2DHHA 3TZWA 3CCSS 1FFGB 2CNKB 1JJ2R 1WACA 5FLXY 2J0SD 3PRDA 4A8XA 4LSNB 2IVYA 2CWXA 1N5QA 4IOCQ 2AEJA 4NXNJ 4ERDA 1D0EA 3EWGA 2JLFA 4LF7J 2GMJA 1RTJB 2NUHA 2M52A 4ANEA 3CUNA 1SIWB 4ED6A 4M5LA 3WQPA 2CUYA 1WF1A 5KFVA 3C6UB 2L9NA 2XO7A 3CCZA 3CJ3A 1NJYA 2DGQA 2W7AA 3CCVS 1RAGB 3UDCA 3LAMA 3MXHP 4M63A 1ZYQA 4M94A 1QE1A 4DG1B 4ZPWR 4I64A 4AL7A 3HFVA 3ZTPA 3HJFA 1Q8KA 2CNLB 2A2CA 1C4AA 2RB7A 1R6VA 3BO3A 3QLHB 3GIIA 1SVDA 4ZMMA 2BANA 4LF6F 1HW8A 4ZPBA 1QUPA 1RLCL 2IJNA 2AZ3A 2NSBA 1F3FA 4K4ZA 5SUHA 3MM6A 1B70B 1YKWA 1FF2A 3H90A 4A8OA 1NDKA 3K0JA 4KR0B 2EBEA 3TWZA 4Y2KA 2B7CB 3SCLE 1OIAA 4LFCJ 1A9NB 2DBBA 3BGRA 1VCTA 2UU9F 1H6KX 4CLYA 4USIA 3PZPA 4UY85 2GMLA 1SJ3P 2LEBA 4FPIA 1XK8A 5A8WA 4ZLNA 3RW7A 2ZBIA 3HXMA 2RUGA 4J9NA 4F8RA 1HNZJ 2RRBA 2K1RA 3EZ5A 1SH0A 4IG0A 3UWTA 2K06A 2JEIA 1G7CB 3RU0A 1VHFA 1RKIA 4LBHA 5C7PA 1U1QA 3OW2R 3KNAA 2ZNYA 3VGSA 2E1AA 2VKRA 4O4RA 5IQQA 3OXGA 1HL6A 2J5AA 1R0CB 3KLFB 1ZETA 3MMAB 3ILIA 4PKDB 4FNHA 3DI6A 3LQVA 4KH0B 3A13A 4FBUA 3PKMA 1TL7B 4UQGA 4W98A 1UWBB 3TVZA 2F4VJ 4DL3A 1S77D 1SV5A 3DOKA 3CCRS 4CP5A 1Q78A 2DISA 3K5MA 2IA0A 3LGMA 3US5A 2ZBCA 1TKTA 4CT8A 3TAPA 4U9RA 1YZ7A 7FD1A 1OSDA 2ATLA 4ECUA 1H72C 3QT6A 3V81A 1TL3A 2YXLA 2MDAA 2I38A 1GNKA 1IQTA 4QIWD 5ADZA 5ETPA 2JZ5A 1L3SA 1U47A 3NCRA 4XO0A 1JMTA 3G82A 3Q0AA 1YWXA 4ECTA 1VQSA 4F2RA 1R3NA 4O4GA 2CDRB 3BQ0A 5BYQA 2FJDB 1T95A 4C4WA 4WP9A 4DR3F 1NHKL 1JKHA 1RT1B 2KVIA 3BBFA 5J2QA 1HBMB 4DUTA 3UNGC 3S7RA 2JEGA 1EETB 5KFZA 4PUOA 3DGPB 5KFFA 2Q6CA 2XSJA 2ASDA 3VAKA 3FKBA 2YNIA 4WXOA 1B0VA 1VBKA 5HVGA 2LLZA 3GTYX 3LGNA 2Y1RI 2DH7A 3EX7B 4IDKB 2HW3A 1MN9A 1RU1A 5CD4H 3G6ES 2P9GA 4YR2A 3EVOA 2HNDB 2CNOB 4GO5X 1VLYA 1FWPA 2VF3A 4U7UK 2B56A 1HW9A 4X4VA 1U8SA 4OYZA 5HANA 4D3GA 1XQIA 2DHXA 2KJWA 4U7UD 4QWAA 1K47A 4ZPTR 1U49A 3MEDA 3UQSA 1I94J 3RR8A 3E51A 3HHNB 4RW8A 4NA2A 3RB0A 4UOHA 3DU5A 1SB6A 1KNZA 2A3JA 4I2QB 4TY8B 4CLTA 1SKSA 4OX7A 3AB4B 3TAMB 3Q8UA 7FDRA 1G2EA 2QT7A 1CSJA 1RT2B 1L3KA 3RGIA 4J91A 1RT6A 2ZWOA 1HWUA 5H9EJ 4URGA 1WD6A 1NK7A 2FY8A 4DR6F 4NZ0A 4IUFA 1UZHA 4HT5A 2IRUA 3D2WA 4O3SA 3KJNB 5GMDA 1RAEB 4DQRA 1VJQA 3OR2B 3D5MA 3T3FA 1VIXA 2R3VA 5K14A 3U7JA 1R8PA 2V50A 3W8GA 1WORA 2F65A 4P7VA 3DOLA 2Z57B 5DS7A 2IY5B 3THPA 1ULRA 1VQ9S 3R27A 2DR5A 3NLCA 4MTPA 3EGWB 5CYQB 2CG8A 3AXKA 2CJYB 1NHVA 2CXEA 3MPVA 5D78A 4QZVB 2VJVA 3IS9B 2COLA 4DPXA 4L74A 1CVJA 4R8UA 4LF9F 1HQEB 5G0RB 5J2MB 2K7KA 4WTYA 1HI8A 1MU2B 1NK8A 1U6FA 2W24A 4DBQA 3BO2A 3FSXA 3Q8VA 3QO9A 4F3OA 3PEJA 3M6VA 2VDIA 2DYAA 1F9HA 3JYTB 5KG0A 3ILOA 4USHA 5DDRC 2LVWA 1S1TB 5J2PA 4MT1A 3M2RB 5IT4A 2N7CA 2XMMA 4ZITA 3DMJA 1G3OA 5GAHI 3D4JA 3M05A 4AQYJ 3HKZD 1IKWB 4Y28C 1PAEX 5GMKa 4QOTA 2YWFA 4PWDA 3HT0A 3MM8B 5KG7A 1S6QB 3I0SB 3KLHB 2R7OA 2B8QA 2V6AA 1TFYA 2FQQB 2ALYB 2NXEA 1HNXF 3CT9A 4PWWA 1D3WA 2F9DA 4C0HA 4XIUA 1WC1A 5IZHA 2GQ2A 5AJ3F 3HCXA 1RU2A 2WTFA 3PFEA 3A8IA 3BV8A 5D4OA 3EGVA 3NNHA 3JSYA 2MQPA 1IBKJ 2MKIA 4WBFA 2OSQA 4DL5A 2VQFJ 4AE5A 3D67A 4FVCA 3D0IE 5T41A 4QIVA 5A6PA 4CNZA 4HLBA 2QV6A 3CCTA 5B0FA 1S99A 2R8KA 4MYTA 1HR0J 2HIQA 1JJCB 2MKYA 4C98A 2MSSA 1EIYB 2C2MB 3ZTQA 3I5BA 4DS5A 1BGXT 4MK8A 2IYIA 2XI2A 1FTCA 4RW6A 2I6WA 5E3CA 1RHKB 3M32A 1SC6A 4J9OA 4KTQA 4LF7F 1U2FA 1IM6A 1SJ1A 4DF4A 2G0JA 3PIPQ 1I1GA 1WDTA 1KSPA 3HO1A 2BA9A 4OI3A 3TJAA 3OSNA 2C2OB 2HK2A 2AX1A 2MGZA 2QL5B 1IKXB 1FVSA 3H7HB 1C0TB 1TAUA 1GFWB 1KOHA 3UD3P 3MFIA 5IC6B 3C15A 1OY6A 4NLGA 2G4BA 3NBPA 4R0JA 1UEKA 1WNEA 4P74A 4ZVTB 4JYAJ 3CSKA 2HKEA 2W9BA 2QLJB 1X0PA 4PXEA 2GJFA 4N76A 3IG1A 1TL1B 4KE5A 1JXVA 2DEIA 4EGLA 2Q3PA 4H4MA 3QRPA 2MKHA 4Y3CA 3NS7B 1U6BA 3MPYA 1RWOB 3GLJA 2AMCB 4TYAA 3VALA 1N6QB 1HHSA 2LEPA 3FZ2A 4K2JA 1FDDA 4CTAB 2CPHA 5D4PA 1SKRA 1TK5A 3ZTSA 1PJ7A 1O8BA 1FKPA 1FEEA 3FEXB 3NAHA 2D9PA 4J9QA 1LFPA 2BMBA 3C6TA 3HSJA 2HHVA 3OTCA 1MW7A 1VBYA 1BXNA 1PSDA 4FP9A 2GVDB 2FD2A 5KAKA 1JB0C 3O44A 2NXUA 1KR4A 2LQ5A 3BJYA 2PMZD 1B4SA 3JSBA 3SQGB 4KHMA 5D77A 5HP1A 3D0GE 4ZCKA 3H98A 3NOGA 4CLPA 1AFIA 2VJUA 3ZFVA 2W2PP 1RABB 2G1HA 4KRWA 4A8WA 1UVMA 3W9JA 3RB3A 1YGYA 3K5LA 1V3ZA 4QCLA 2VICA 1RSCA 2GV1A 3HD1A 3OFHA 2E5GA 4RWXA 3GYNA 1KD1T 3W63A 3WX8A 4CH1A 3ZZRA 3M8RA 4PG6A 3ELHA 3R1LA 1BMQB 4J9SA 2RF2A 4NLOA 2OMOA 3HHKA 3BSAA 1FRJA 1KFSA 1MROA 1YDLA 2F4VF 1VOMA 2XYGB 1XR6A 4G6VB 2V2KA 3QRRA 2D3O1 1E6YB 1XNQJ 3QYYA 1LOUA 3CW2C 1TV6B 2BYCA 2DO4A 1T05A 3G6VA 2VD3A 1GXUA 5I3PA 1C4CA 4HHJA 1CS4B 3LALA 3I4HX 2KN4A 3HF5A 3KK2B 1JIHA 3BBBA 3R7NB 1RWKB 3CPWR 2KM8B 1S7IA 3HHLC 4A46A 4EFAC 4IFVA 4FVMA 4H4KC 2PMWA 4JB8B 1J5OA 3NNAA 2W2NP 4ECSA 2BW2A 1VC5A 4JV5F 3H5YA 1P1LA 4PQUB 5DGAA 5JVHQ 2MYFA 1UEUA 2K2PA 4DV1J 1FJ7A 4HACB 2HVZA 4RW9A 2D41A 3HSDA 1UETA 2FLLA 4I7FB 4QU6A 1QLNA 5CABA 3W2VB 3W64A 2FZCB 3SI8A 2QMUB 2J76E 1S6PA 1KLMB 3KXDA 4JI1J 3KTQA 1WTFA 5D3GA 1ZTTA 4P2MA 2YQ3A 3MAAB 4WFXA 4NOHA 3A8JA 3O2IA 5K8MA 1FI4A 1NK5A 5KFQA 1U1PA 3HK2A 4ZDNA 2JX2A 3N0VA 2QA1A 1I94F 4OHYA 4OYMA 2HIYA 3ULHA 4OIXA 1U1RA 7AT1B 3W5ZA 3AJ2A 3ITHA 2XWYA 2MQOA 4WTOB 2QFJA 2IA6A 1CULA 4X2BA 5HLFB 3TX0A 4RUHA 1UPPA 4QW9A 2I0XA 2HZVA 2M70A 2AYEA 3GIJA 3CD6S 4ZVPB 1NDLA 1ZM2A 3QJLA 3L9ZA 3OLAA 1KS2A 2KRBA 2AEMA 3H59A 3E01B 4TN2A 4B3MF 2ROPA 3IMQJ 2NPIA 4YHHF 4P2XA 1WC3A 4QIFA 1S1VB 3GV5B 3GIMA 2P6SA 2P5VA 2HVIA 3T5JA 1XR7A 4KQZA 2DNYA 1RT4B 3BM7A 1FEHA 4LREA 4DX6A 4Q2LA 4HL9A 4RW4A 4WFBQ 3KLIB 4NYOA 4RNNA 5IM0B 1FXRA 2MKSA 1EHWA 3GB0A 3F0NA 3LP2A 3TYTA 4DX8H 1WOPA 3KG1A 4JI8J 2O1PA 3H2LA 5HN0A 5L9NA 4DV6J 5A8WB 3IGVA 3WDOA 2HNYA 3KK1A 1HBOA 1T03A 2DR7A 3M6UA 4F4WA 3MMBA 1YJ7A 4IG0B 4B9MA 4IRCA 3OSPA 3M9NB 1K9MT 2OTJS 4OZ2A 5B0EA 3PR5B 1GAOA 5F8JA 3AOAA 4AL5A 4ICLB 5ETQA 2LA4A 3SSSA 4NXMJ 4AQYF 2HFNA 1PIEA 3FZBA 2CWKA 4NRUA 3W7BA 2ZH9A 1TELA 3QT8A 4WK1A 1IQZA 1C2PA 3H8YA 2QGFB 3JAMU 1F6TA 4BS2A 4NA3A 4BC7A 2KZZA 4P6QA 5A0YA 1Q8IA 3CJ2A 3GV7B 2VBWA 2UXBJ 1S0OA 2HNZA 3DOKB 2LP4A 5A8RB 2YNHA 4ALZA 1FD8A 1UJ4A 2E5HA 1NNDA 4RUBA 4GRSA 4V19X 2FY1A 4UUXA 1FT8A 3FCHA 4KFBA 1R8HA 1WELA 4C3LA 5KOXA 4X62J 3KHRA 2VQFF 1NH7A 1S1UB 2O66A 2N7YA 2RKIA 1RUSA 1WHYA 3K57A 3FCVA 3FFIA 3IGNA 1VQLS 1LXNA 3MMCA 4O4GB 6FD1A 5EWGA 2N3OA 3CIMA 3OBIA 3AH6A 4F3QA 1LK7A 4PPDA 2YWGA 1X5SA 1ZZNA 1FWKA 3BPDA 3POTA 3FQKA 3B6BA 1EP4A 1Q8BA 5KG2A 4KHRA 1S9GB 2J9DA 2J0WA 3F56A 3FEYB 2UVRA 4ZP6A 1JLAA 2BOAA 4ELUA 2FJAB 4EUVA 5ETKA 1RWPB 2CPIA 5KT4A 4PYAA 2FVRA 4ZN1A 2LQBA 1XR5A 3Q86A 4RBUA 1SCJB 1SUQA 5IC4B 3HZEA 3AJ1A 4G1QA 2JOQA 4JYAF 2IIHA 3DOMB 4PQAA 4ZVOB 3SSRA 2ZJPQ 2AP6A 1Y11A 3ETOA 3TP2A 1RWMB 4ZCIA 4DQPA 1APSA 5A76A 2DNNA 5E33A 3MEDB 3CIZA 4WU2A 5DJBA 4XDDA 3TQEA 4L3NA 4OMFG 4DI6A 2CQPA 1JLFB 1P9QC 1MSWD 1HLWA 3FGVA 3AD8C 1S1WB 4IFYB 5AXNA 1NB2A 4MKBA 3ZZYA 4CM0A 1OQ3A 2CPEA 2MY8A 3KUGA 4OLPA 2PN6A 3OV7A 4MYUA 3PYDA 3R7SB 3HHLD 2LQ8A 3BS9A 1QUVA 3P96A 2KVQE 3DM2B 4AL6A 4DV4J 2M0GB 4HEA9 2LKZA 1HYSA 2IJRA 4NA1A 2MZRA 1HWLA 3KLEB 4JI5J 2ZZMA 3DOLB 1BQNA 3TUIC 1N48A 1LWEB 2YWEA 1XEZA 1KN6A 2ZE2A 1WG1A 2EFGA 5LXRA 4PXDA 1ZPWX 3QT7A 3K8WA 1SQEA 1JLBA 3HJVA 2OEKA 3JS9A 3QAEA 1FK9A 3C66A 4N77A 3D68A 1YSJA 3O3LA 2HQDA 4C3MA 1SJ4P 1KQKA 4P73A 1Y5IB 2FPHX 4OX9J 3EUNA 2ASYA 4DSEA 1CLFA 4BWMA 1HHQA 1DLOA 1ZPVA 3DLBA 1HPZA 5ETLA 1F1BB 1SJFA 3D1OA 2VG6A 3NAIA 1GTHA 5IV3A 3LTOA 4ZPDA 2DNQA 4QIGA 5KFPA 2ADBA 2WONA 4KT0C 4X4TA 4PABA 4DXLA 1WOSA 2CJXB 2DRBA 2ASLA 3GIRA 4LBIA 2DIVA 2P9CA 2FC8A 3EPIA 4MMOA 2R7XA 2L08A 4ELTA 3GJQB 3V5RA 4B9TA 1CJKB 3GV8B 2V4RA 3WHIA 4JI6J 3OTEA 5CA5A 3JTNA 4TU7A 3GFXA 1QSLA 3OHBA 2NZ4A 3GYGA 2J0XA 1GMWA 2LFVA 3BREA 3OD2A 2LEAA 5KTQA 5G4DA 3GIKA 4X84A 4DV1F 1YK9A 2ZH3A 3NY0A 1AROP 4M5IA 3CB4A 4KHPF 3LA0A 2MZJA 5JMNA 1GEHA 2V5HG 4B9NA 2GW8A 1OO0B 3JAMY 2FGCA 2QYCA 2QEXS 2HQGA 4IR1A 3K5PA 4UZCA 4JI1F 4LIRA 4RU9A 4KGVB 5DO2A 2XLIA 2HLUA 2UV8G 1RTDA 2ACYA 3MPDA 2XMVA 3KWMA 1AB8A 2W2MP 2VB6A 2OD4A 3W5XA 1UFKA 3TJ8A 1YG0A 4AFFA 2XHCA 4Y2IA 4NCGB 2VKZG 2M9KA 3BYRA 4B3TJ 5K20B 1CJTA 2E1CA 2VOOA 2ZH1A 2RUSA 2BXJA 2NYIA 1BQMA 2YQ0A 1VLOA 2GO9A 5E5NA 3RBDA 4DF8A 3D0HE 3OTOJ 1RWNB 5RUBA 3C15B 5GAGU 5ITHA 3Q2SC 4RWWA 3DLGB 2HRUA 3SFGA 5L1IA 4KH1B 4R5PA 4LIWA 2W01A 2VBXA 4C8KA 1YVFA 3PO4A 3L09A 4KKOA 3BEGB 4H4MB 5E7OB 1NPPA 1HWIA 3I82A 4TXSA 4KAIA 2W25A 2HZAA 2YKMA 2YNFB 1N34J 1H38A 1LNQA 2Z2ZA 4B9UA 2DEJA 4M5DA 1NK9A 1WJ9A 4YB1P 1SH3A 4DR1J 2IRYA 2ZHBA 2YKNA 4JI8F 5IWAJ 3BN4A 2J9DE 2M4MA 2BKOA 3MGJA 4ECQA 3SSQA 2GA7A 1U26A 2ZD1A 3N4WA 1H0HB 3DLEB 2V69A 1JLCB 2R9LA 4ED3A 1KWMA 1X0FA 3MOJB 5HP1B 4CO2A 4LSLB 2V8VA 5LMNJ 1AZSA 3VAIA 3VZIA 3KHHA 3OFGA 3RAQA 4M95A 4PPZA 2R2UA 5F8IA 4NXMF 3DN9A 3IBCB 1EQMA 3M1VB 4ILMA 3DLKB 4KV8B 1DJ0A 4FDFA 3L7PA 5ETMA 3QAUA 5CH7B 4ZVGA 4RPFA 3MURP 1QAXA 3L95X 2HHQA 1FJCA 2PC6A 2AW0A 4J90A 3KMQA 2OPRB 3ENVA 1HQ2A 3KKFA 2I9SA 2UZAA 3ENWA 1FDBA 2PDAA 3CD0A 2B7BB 4M5JA 1EARA 2VG7A 4X62F 2MLXA 1Q1KA 4OV6A 4NLDA 1P1TA 2HBZB 2RHSB 1L5UA 4B08A 2W7OA 2F3JA 3OPKA 4IH7A 4WE1A 4IFVB 1XMQJ 4P2FA 2H4WB 3CCUS 4OYBA 4YN3B 4HI2A 1RT7A 2HAFA 3T19A 5KG6A 4CQ1A 1CC8A 4DSFA 1RZMA 5D0EA 3JSMA 3VTIA 1Y0HA 3C2PA 3SEOA 1FE0A 3CTRA 1M5SA 5KT7A 3VQSA 3PV8A 1TR0A 5L38A 3HHLA 1REGX 4DN0A 1TTHB 3RRKA 4H4KA 5DQIA 5L8RC 3TA0A 4LVNP 4K59A 1JLGB 3PYFA 1Q81T 4DPUA 2A0FB 3LP0B 2R7UA 2NR0A 2XLKA 4OI4A 2OFGX 5A8KA 4WP8A 3TW0A 2MB0B 5KFYA 1XIQA 4ZN3A 1RCXB 3NGKA 1KQSR 3ZZPA 1S0NA 4CM2A 4EU0A 4NX9A 2VA2A 5KFSA 5H9FJ 1L3VA 1PGZA 2B8PA 2EEYA 3HT3A 3PW5A 1WOOA 3V6DB 1KEKA 2WBMA 1S57A 1N32F 1RTZA 4DUYF 3BR8A 2PI5A 3M8PA 2M3DA 1WHVA 2QLBB 4OHWA 3R5BA 1NO8A 4N8NA 4RW7A 3IWNC 2HHWA 1Q5VA 4LRBA 4RU2A 4YDDB 1S10A 4RNMA 5KFWA 2OPQB 4DU8A 2P8IA 3IO1A 1LV5A 3FMWA 2HGLA 4ZHRB 2H54B 1RJJA 4IH5A 4JV0A 2C1EB 2UUTA 1K1QA 4WP3A 4ID5A 4FF3A 2F40A 1URNA 3ZTOA 4FYXB 2QA2A 4KB7A 4RO0A 1HARA 3OTBA 3PX6A 4J9VA 4YS2A 2R42A 1BD6A 2ZBPA 4HHUA 2HBRB 1FO1A 3A8KA 3DRPA 3QZ8A 4ED8A 1LW0A 3HX9A 2WCXA 1NHUA 4FXWA 3AXMA 1R0AA 4YQWA 3MEEA 3LP2B 3OFEA 2D9OA 3M8SA 1NKCA 4RLEA 4OX9F 4YEAA 1HNVA 2KHCA 4JP8A 3MM9A 2MZ1A 1W25A 2HHUA 4ANCA 1QSYA 2F8MA 3VV2B 3MMBB 5BYSA 2YY3A 1YLXA 5IV4A 1MMDA 4KGMA 4OV1A 1EB0A 2OGUA 3TVYA 4EO8A 2LDIA 2A1BA 3ONQA 1CQMA 3WX4A 1UVJA 4ZA1A 1IR0A 3KFWX 2R4FA 4L3KA 4H4OA 2ZWPA 4JI6F 2RAQA 2VH7A 3L7UA 3KJQB 3K59A 5E0OA 3P4UB 4ZJQA 1C1BA 5K8PA 4X65F 1RAAB 1X31C 2XMAA 1E6VA 3DDKA 3B78A 3ZZUA 3TZXA 3HM9A 3KHLA 3SV4A 5B09A 4K0KJ 1DQ8A 2KT2A 2FVSA 4Y0FA 2IM2A 1SKUB 2YNHB 1T9YA 5DDPC 2DJWA 3QT5A 2N82B 1IKYA 1XTZA 1ZAWA 2HMIA 1UW4A 3MM7B 2DY1A 2FJEB 1X4DA 2Q66A 2ZC3A 3FK4A 2V8HA 3HVWA 5E3QA 1ZM9A 3M7VA 2RU9A 2BQUA 4DWIA 3KG4A 3DRXA 1SL2A 1F0XA 3PX0A 3G71S 2VG5B 2MKKA 2KU7A 4YB6A 1V3SA 3PG9A 3DXBA 2HFOA 4P9SA 4EI2A 3BO4A 3H20A 2DITA 2V34A 4AXIA 1R89A 3PW2A 3ISNC 2MY7A 5CD4A 2EG2A 1LWFA 2DXDA 3VVTA 3POTB 2CQCA 4PG4A 1Q0NA 1PYOB 4URSA 2EK6A 2PFFB 4X4OA 4F0MA 3FCWA 1U1LA 5L1KA 5KFBA 3KUHA 1JXLA 5DG7A 4IKAA 4X4NA 3SYZA 1TVRB 4DR5J 2ACMA 2J0QD 1N5SA 2C42A 1HI1A 4XDCA 3M30A 2Y8WA 3OTOF 1TK8A 4PEOA 4Z7YA 1SUQB 4O0IA 1DQAA 4B3RF 1PYSB 2FVCA 4Y65A 4DR7J 4Q8FA 4WFAQ 2GC8A 3UI3A 4WPAA 3UR0A 1I51B 4JBCA 4FF4A 3S1TA 5B7WA 1X4BA 5CHCB 3GG0A 2EI5A 2SXLA 3CO0P 1WC0A 2V94A 2CZVC 4H54A 1TKXA 2B4UA 5HJXA 1N34F 4ES3A 3H42A 2CJKA 2C22A 4DV7J 2CJQA 4LF6J 2BUNA 3R6GB 4BBYA 4ES1A 4O44A 2K3IA 1VFJA 4ZVRB 3IR5B 3NOCA 5IXUA 2WB1D 3RB6A 4PR6A 4CO0A 2HURA 1JLEA 4A47A 3IRXA 3QIPA 1LWCA 3PFOA 1CEZA 2UUBJ 1F9EB 3H5SA 4DN9A 2UU9J 3IAM9 2CVIA 5LMNF 3HVTB 3HKWA 1T9UA 1U48A 1K44A 2G2OA 4KY3A 5C25B 2DGXA 3PW4A 2MJUA 3CVKA 3C19A 1B7YB 3KG0A 1NRKA 1REVA 3I9V9 5JVGQ 2FVQA 4KIAA 1JLBB 3DDIA 2Q43A 4NLRA 3AQPA 3CC7S 1U1NA 1LW2A 4DMZA 4EWTA 4RNHA 2J7KA 4AUKA 3TVKA 3VAFA 3B54A 4PYDA 6AT1B 5I42A 2UUAJ 3W65A 3V6JA 1UA0A 3N5BA 3FNNA 5H9EK 1L3TA 2FZKB 1RAIB 1WF2A 1QAIA 4U8YA 2AV5A 2DXFA 3UNYA 4EBDA 2HWTA 3OTDA 4IYQA 2AU0A 4K4TA 3KDOA 3R3TA 5LMUJ 4BLGA 3PHEA 1EX8A 4TNOA 1UL3A 4NASA 3QGGA 3CJQA 4C6AA 2BE2B 4I6AA 3R5JB 1IXKA 4TLQA 1XMQF 5F9LA 3TNVA 4DLEA 3U02A 3IP0A 2ILZA 1M1KT 4NLUA 1TUWA 5LXYA 4PG5A 4ZLJA 3P6YC 1KDNA 1OPIA 4V19J 2W9CA 3TZZA 1FKAF 3VF0B 1T11A 2JVOA 2EC0A 2B0GA 1HNIA 3LWMA 4YY3F 4L76A 3P8BB 2QO3A 3PNIA 1D09B 2O5DA 5F41A 1RKJA 4A8MP 1CJVA 2CQ0A 4RUCA 3DRSB 2XMKA 4DR3J 1RLDA 4B17A 1HBUA 5KFXA 5K9FA 4B3OB 4Q0BA 1TMMA 1X9SA 3HZGA 2KJVA 4ZPCA 3T1HF 1VDHA 3GWCA 4E2FB 2UVUA 2J7WA 3IR7B 3D6TB 4NLSA 5KFOA 2ZUGA 3HFZB 4I2PA 1RWXB 4RBVA 4X4SA 1KQGB 3M6WA 3M2VB 3BKUA 2RIJA 4QYRA 2DB1A 3HVAA 3MF5A 1RCOB 1PJ5A 1RQ0A 3TA2A 2RILA 1Q7YT 2FHOB 4CZCA 2HHSA 3UVJA 3C14B 1FTRA 1PAUB 9ATCB 3W8PA 1FFSB 3QNWB 4WJBA 5CYMA 2GO8A 3CO9A 1SJRA 1YJ9S 4NYZA 2AT1B 2J6SA 1WSVA 3GJSB 1K1SA 4DHVA 4U6PA 4GVBA 2YPZA 3T9NA 1N36F
chains in the Genus database with same CATH topology
1X4AA 5JVHQ 2Q79A 3DOMA 3TUJC 2YH1A 3J7Z5 5B0AA 4OFZA 2MYFA 3N79A 1UEUA 1NKEA 2KHDA 2K2PA 5AXLA 1LWFB 2C3OA 1U1OA 3DCAA 1FJ7A 5T7LA 1NJZA 2CJAA 1UFWA 1JX4A 1KC8T 5DG8A 4UW2A 5J2PB 3I5AA 1BWEA 5EX0A 3C8YA 2HVZA 4RW9A 2D41A 2L41A 3DRRA 4K5RA 3DMJB 2ALZA 5HL7Q 1VQ8S 1UETA 5M2UA 2FLLA 2ZH7A 1PO6A 1TAQA 3MEGA 1HA1A 2ZDOA 4I7FB 4QU6A 2L3MA 1QLNA 5E3PA 2DVIA 5F8LA 3AA8A 3LUYA 4WFYA 3J7YU 4F2SA 1Z2LA 1JLFA 3W2VB 2V9KA 2WOMA 3EPGA 3HHEA 2QRRA 3FSIA 3SI8A 4PWDB 5LSRA 1S1WA 2VFUA 1NK4A 3IWXA 4IFYA 3N6MA 2J76E 2BOPA 2OP5A 2M5YA 1S6PA 3QWUA 1KLMB 3ZZZA 4WKRA 3KTQA 1WTFA 2J7UA 1S79A 5J1NA 5D3GA 5D8HB 1HFEL 3M30B 1ZTTA 1YI2S 4ILRA 3MZIA 4Y2AA 2EW9A 2YQ3A 4WFXA 4NOHA 4ITSA 2RDIA 3O2IA 1YITS 1X5OA 3KOAA 2RD5C 5IFMA 4DOZA 5K8MA 3PKYA 2N4DA 2YKNB 3MAQA 1NK5A 5FIIA 2IAJB 1VRTB 5KFQA 1U1PA 3R1HA 3HK2A 1KTVA 4ZDNA 2R2TA 2I5JA 1NJWA 3CE8A 2BBEA 3DM2A 1VQ5S 2K3KA 4OZJA 2JX2A 3N0VA 3PM9A 5DM6Q 2QA1A 2XSFA 4XAKA 4ZP8A 1I94F 4OHYA 3U1LA 2Y1IA 3D28A 5CQGA 1WG5A 2DNPA 1B7FA 1J2VA 3GFHA 3ULHA 3KK3B 1DTQA 4OIXA 2KRRA 1U1RA 2XC9A 1SL0A 4X4UA 2C3UA 4UOCA 1X4FA 1ZM4A 3KLEA 2FHJA 1F5CA 2NS1B 3AJ2A 2AJ4A 3ITHA 2XWYA 3K7RA 2MQOA 1S97A 4J9LA 3KNGA 4DFMA 1BY9A 2GIRA 2QFJA 2IA6A 1QY7A 4X2BA 2DGOA 5IQ6A 1LWEA 4Y6IA 4BCAA 3NMAA 2M7SA 4O3QA 5HLFB 3LWLA 1LKZA 3FRYA 4RUHA 4EZ6A 1HNWF 4QW9A 2I0XA 2XMUA 2NLWA 2M70A 2AYEA 2RH3A 3GIJA 3CD6S 2GHWA 2VFTA 1FRKA 1ZM2A 1ZBTA 2BRLA 1Y5NB 3VCDA 3CCLS 3QJLA 3OLAA 4JUZA 2XY5A 4ZP7A 1GQEA 2HLTA 1KVJA 1JNRB 1KS2A 2KRBA 2Z2MA 3MCSA 4O44B 3H59A 2MJNA 2ZITA 3E01B 2RT3A 4KO0A 4TN2A 3VZHA 4B3MF 2ROPA 4IOAQ 1VRUB 2NPIA 2DIUA 3CMES 2Q1LA 4TQRA 3NCQA 1HBMA 4YHHF 2CVEA 4C7QA 2PMHA 1DHMA 2E29A 5C24B 4K50A 1JLEB 3G8QA 4QIFA 1S1VB 4RW6B 2XULA 3T9ZA 3IRXB 3QIPB 1LWCB 1IJEB 1VQYA 4QWEA 3M32B 3GV5B 3GIMA 1JJ4A 4LQ9A 4MFBA 3GR0A 4DDFA 2ZH5A 2FGOA 4FXVA 5GADI 3IN5A 3JB9k 5HMXA 2B9WA 1OS5A 2P6SA 2P5VA 1Q86T 2HVIA 3T5JA 4YUDA 5EWEA 2OJ3A 4OI0A 2JEFA 1V9OA 3HMJG 1XR7A 1DBDA 1KQFB 3MOZA 4FNIA 2BR0A 4KQZA 4EBDA 2GQCA 1D9DA 2DNYA 4HTJA 1WHWA 3MI7X 1JLQB 2KB2A 3CXCR 1RT4B 4URQU 5DDQC 5FDLA 1DTTB 5KG3A 3BM7A 3BB5A 1D9FA 2DH9A 1FEHA 2X51A 4OJGA 2Y0SD 2RMLA 4ZK7M 3TARA 2MGZB 4Q2LA 4RUAA 4HL9A 5GAHU 4CO3A 4RW4A 4WFBQ 3KLIB 2HNDA 2YNGB 4EO6A 2OPPB 5M2RA 3DC2A 2DHGA 4NYOA 4RNNA 3MMJA 2HWIA 5IM0B 1FXRA 3SDEB 4B3TF 1QAYA 2MKSA 2XMWA 3H2VE 1REVB 1S1XA 5KFJA 2EPIA 1VBXA 3UCGA 3GB0A 5B0BA 2XS2A 4LVOP 3LP2A 4A8YA 1K8AT 1UP1A 2CQDA 3H40A 2AGQA 3NBPB 5JJBA 2RRAA 2XG8A 3R5DA 3TYTA 2RS2A 2AGOA 4DX8H 5CZVA 3R5AA 4F67A 1FRIA 2R7QA 3KG1A 2W9BB 5LT5A 2O1PA 5B0DA 2YKQA 3H2LA 3MM5A 5HN0A 2MXYA 1S9EA 5L9NA 3OR1A 5AXKA 1NJXA 2OSRA 5GAGI 4NZ7A 3IG1B 3CCMS 5U47A 1LW2B 3M6XA 5A8WB 3QJJA 3IGVA 1Q79A 2DGTA 2YWHA 3WDOA 2I1RA 4RBTA 1H3DA 2HNYA 3KK1A 2KKHA 1HBOA 4O3NA 1VQOS 3NL0A 1T03A 1HHTP 2DR7A 1K0TA 5I42B 3SMZA 3M6UA 4ETZA 4F4WA 3TAQA 1RDRA 3TO8A 2DH8A 3A8EA 5HMWA 3WBZA 2KTQA 3MMBA 4IG0B 5EDWA 4B9MA 2XI3A 4TY8A 3KMSA 2ZM6F 4IRCA 1HD1A 3OSPA 1WEYA 2XEXA 2DGUA 3Q24A 1T8EA 1VJWA 3M9NB 1RI7A 1K9MT 1RYSA 3TAMA 4U7CA 2BVZA 1C1CB 2LXUA 4WK3A 3OQ2A 5B0EA 3PR5B 2OTJS 3Q8SB 4E0DA 1HMVA 1GAOA 1FKPB 5F8JA 1IUJA 3U1MA 1TZ0A 4AL5A 4ICLB 1CPZA 4GC6A 2LA4A 1T02A 1TKZB 3C6TB 3T5HA 2R8JA 3SSSA 2KT3A 4AQYF 2OIHA 2HFNA 4C8ZA 3HP6A 4F4YA 2IM0A 3MDFA 1M5PC 1O51A 3FZBA 4NRUA 4C11B 1WWHA 3W7BA 2ZH9A 5DM7Q 4WK1A 1IQZA 1S7HA 2POKA 3DDNA 1C2PA 3H8YA 1IBMF 3D1QA 1QJHA 2GHPA 3LPYA 4LFBF 1FKOB 2B43A 5C42A 4CCHA 3FDSA 2DGSA 4YDXA 3UE2A 1NAQA 5J2NA 4BS2A 3CDUA 4DR5F 4NA3A 3ZZTA 1HD0A 5F8NA 2FHKA 1RA7A 4BC7A 5K5MA 2KZZA 5EX3A 3D54A 4P6QA 2QA4S 2ZDPA 5A0YA 1FNMA 1Q8IA 3LP1A 4QIEA 3CJ2A 4DR1F 2GMHA 3H25A 3GV7B 2VBWA 3CGIA 3E3XA 5H1SV 1S0OA 1F60B 2BABA 2HNZA 5A8KB 4CH0S 3BSNA 3DOKB 2PEHA 2EWHA 5A8RB 5IWAF 4DR7F 2YNHA 4ALZA 3KHGA 1MMNA 4IH6A 4B02A 1FD8A 1PILA 4QR2A 1UJ4A 2WRMA 5I3UA 2CQ3A 2E5HA 2IJFA 3LANA 1NNDA 3DFEA 4I4BA 4NMLA 1FERA 5CYQA 5JUMA 2ZJQQ 4NXNF 2C2DA 4V19X 2FY1A 4F4ZA 5KFEA 3MECA 3BF4A 1DQ9A 4UUXA 5DETA 1VQ4S 4I67A 2QLXA 4NCGA 1X4HA 1MWYA 1FT8A 2F7VA 3JSRA 3FCHA 4KFBA 1R8HA 4K5SA 6FDRA 2VPXB 1WELA 4C3LA 3U1NA 5KOXA 2X3GA 3KHRA 2VQFF 4Z2XA 4NLXA 4I6WA 5E2QA 3M2UA 1NH7A 1S1UB 3AQOA 3CDAA 2O66A 2XMJA 2CPDA 2N7YA 2RKIA 3CF5Q 3UR3C 4PCQA 1WHYA 1MU2A 2JWNA 2MSTA 2OTLS 1SI9A 4Y2MA 2P6TA 2RF2B 1HBUB 1S76D 3K57A 5DG9A 4DV7F 2B51A 2ASJA 2OH2A 4ETXA 1Z2ZA 1MROB 2OAUA 2D7SA 4UUWA 3FFIA 4Q0BB 2KXNB 3IGNA 4LT6A 1VQLS 3MR3A 3I9ZA 1LXNA 3EXCX 1G6BA 3MMCA 3ZZ0A 1JWWA 4O4GB 6FD1A 5EWGA 4XPCA 2N3OA 3GSDA 4QPTA 2V8GA 2HWHA 3CIMA 4FZVA 4JV1A 1HQUA 2M8HA 3DLGA 4I2PB 2QLWA 3JYTA 3KJVA 4A8FA 3OBIA 2XCAA 3AH6A 4F3QA 1LK7A 4DQIA 4MJKA 4LQ3A 1T05B 4K2XA 1S1TA 4PPDA 2YWGA 1X5SA 3EYZA 1ZZNA 4B9SA 3POTA 4IRDA 3EGZA 2UUBF 2JH3A 4EYIB 3FQKA 4C8YA 2W4CA 2MHEA 4Y00A 2B5JA 2DNZA 1EP4A