2CQPA

Solution structure of the rna binding domain of rna-binding protein 12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
b'GSSGSSGASSGKPGPTIIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 12
publication title Solution structure of the RNA binding domain of RNA-binding protein 12
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqpA00
2MMYA 1U6FA 2DNRA 2VODA 2GO9A 3OW2R 3CCJS 3IWNC 1PO6A 2XS7A 2JWNA 2J0SD 2MZTA 2N82B 4P6QA 2DGXA 1OIAA 1S72S 1VQ4S 2MZ1A 2AD9A 1YWXA 2XB2D 1M90T 2EK6A 1URNA 2CPJA 3RW7A 1K8AT 2KRBA 1HD0A 3THTA 4UQTA 1NJIT 2XS2A 3LQVA 1U1OA 3MOJB 3UD4P 4C7QA 2DNOA 1Q82T 1VQOS 1VQ6S 1O0PA 2DITA 3VAHA 2QFJA 1CVJA 2J76E 3P49B 3DXBA 1HA1A 2YKAA 5LSLA 5DM7Q 2MQMA 1VC6A 3UCZP 3B4DA 5GMKa 2QA4S 2MQQA 2OIHA 4IOAQ 3K0JA 3P3DA 2RQCA 3L3CA 1VQNS 2DH9A 3FEXB 3U1LA 2HZCA 3G8SA 5LJ3Y 4W92B 1G2EA 2DNGA 2DHSA 1M1KT 2KH9A 2CQPA 1R8PA 3CCQS 1D8ZA 2RVJA 1M5OC 2K8GA 2DNQA 2J8AA 1YI2S 5GAHU 2MQNA 4CH0S 2DH8A 2OTLS 3R1HA 4V19X 1VBZA 3CCVS 5IQQA 2KM8C 2E5HA 2CQCA 2ZJPQ 2CQHA 3V4MA 1SJFA 2MSSA 2YWKA 3VAFA 1K9MT 3MUVP 2DNYA 4WFAQ 4W90B 1WHYA 5LJ5Y 1QVFR 2ADCA 3S6EA 2D9OA 1YJNS 3TO8A 2CPEA 1AUDA 2CPZA 3CULA 1X5PA 3D2WA 1WG1A 5GVQA 3BO2A 3H2VE 2SXLA 1P27B 1U1PA 1VQKS 3ZZZA 3CD6S 3J7YU 2KG1A 1H2VZ 2DO4A 4IO9Q 3CCUS 5DDQC 2MGZB 1FJEB 1UFWA 2N3LA 2D3OR 2DHGA 2MHNA 5IM0A 1N88A 2DGQA 2RU3A 2DNZA 1X4DA 1WEXA 3SDEB 1YIJS 2K3KA 3CCRS 3BO4A 2B0GA 3CC4S 1FO1A 2LYVA 4OZ1A 3S7RA 2XSFA 1M5PC 3G9CA 1VC0A 1Q7YT 2BOPA 2MZSA 3VAKA 1BY9A 2E5IA 2MSTA 1U1MA 2A3JA 1YTYA 2DO0A 1OO0B 2DGUA 1DRZA 1WI8A 1X4GA 1N8RT 3J7ZT 2NLWA 2M70A 2XNRA 2LA4A 4TU8A 3CC7S 2G1DA 2KYXA 1WF2A 2OSRA 1DBDA 2F3JA 2DNKA 2MZJA 4TLQA 5IFMA 3G8TA 3ULHA 5HL7Q 2M2BA 2N3OA 2RQ4A 3B4MA 4IUFA 1K73T 2RRAA 1U6BA 2M7SA 2M52A 3S01A 4PRFA 1B7FA 2E5GA 2DB1A 2FC9A 3THPA 1H2TZ 1XN9A 3CXCR 1M5VC 2E44A 5BJRA 1X4CA 4C0OC 1KOHA 3VALA 1WHVA 3CTRA 2CQ1A 3FEYB 5DDPC 1U1LA 1U2FA 3VAIA 1X4HA 3R27A 3VAMA 4YUDA 2DGOA 2KXFA 4QPTA 4ERDA 2JVRA 1WI6A 3NNCA 1X5SA 1UP1A 3Q2TC 4CH1A 2EVZA 4RU2A 2HVZA 2XS5A 2X1GA 2U2FA 1S79A 1WEZA 5HO4A 1U1RA 5GADU 1U1NA 4F02A 1WHWA 1L3KA 2RRBA 2MB0B 3I55S 2VOOA 1WF1A 3VAGA 3MUTP 4WFBQ 2G4BA 1HD1A 2KHCA 4OZ0A 4U67Q 4CIOA 1N54B 5LXRA 3HHNB 3NS6A 1M5KC 2MY8A 5FJ4A 1DHMA 2ZJRQ 4Y00A 2UP1A 2M0GB 2X1BA 2E5JA 2FY1A 5EN1A 2KG0A 3CF5Q 1ZZFA 3G71S 2RS2A 1VQMS 1YHQS 1FHTA 1KD1T 1WG4A 4TU7A 2L41A 4WF9Q 2DK2A 2QEXS 1WTBA 5CA5A 2LKZA 2MZRA 2I2YA 1QM9A 5DETA 4EGLA 1VQ9S 2L08A 3JB9k 4C4WA 4Z2XA 3ZZYA 1YJ9S 2LECA 4IOCQ 2NZ4A 5GAEU 1SJRA 4WFNQ 1KC8T 3VAJA 2DNPA 2CPIA 2CQDA 3NNHA 2KFYA 1FJ7A 3IRWP 3EX7B 4M5DB 2DHAA 2D9PA 2HGNA 4ZKAA 2MQOA 1Q86T 2M9KA 1NO8A 1WWHA 1JJ2R 3EGZA 2AYGA 2DGVA 3CMES 2KI2A 2VOPA 1R8HA 2AYMA 2F9JA 5CYJA 1A9NB 2ADBA 2Q79A 2M8HA 5MLCV 2LMIA 4WCEQ 1FJCA 2DNMA 2MKIA 2DGWA 3MUMP 1YITS 2JVOA 2MXYA 2DHXA 1WF0A 3MXHP 2LEAA 1WG5A 1DZ5A 1D9AA 4ED5A 2MGZA 2LA6A 2YTCA 2KU7A 1ZZNA 5D78A 2VONA 2X1FA 1FT8A 2XNQA 2L9WA 3Q2SC 3SDEA 1VQLS 2O3DA 2CJKA 3TP2A 1PGZA 3N9UC 1X5OA 2MKHA 1X4FA 2MY7A 3SMZA 3NS5A 5H1SV 1X0FA 4WKRA 4CQ1A 3H2UB 1VQ5S 1SJQA 3LPYA 2KM8B 5DM6Q 5JVGQ 1VQPS 5ITHA 1U1QA 3P5TL 3BO3A 4LIRA 3R1LA 3CC2S 3UCGA 1FXLA 3VF0B 4YOEA 3S8SA 1P1TA 3MURP 1RK8A 4J5OA 5D77A 2MKKA 2CPFA 4F25A 3CUNA 1H2UX 4UY8T 4Y0FA 3NMRA 4QU7A 4WIIA 3EGNA 2HGLA 2I38A 2CQIA 2MZQA 1UW4A 2OJ3A 2JX2A 3MI7X 1WEYA 2MYFA 1WELA 2PE8A 1N52B 3I56S 2CQGA 2HGMA 1X4EA 2HYIB 3G6ES 1JJ4A 2EK1A 1JMTA 2FC8A 4LJMA 4TU9A 5CXTA 1OWXA 2DNLA 4QQBA 3PIPQ 2AYBA 1IQTA 1X4BA 1VQ7S 2CPYA 2KXHA 2CQ3A 2MQPA 5DDRC 2ERRA 1W2BR 2JRSA 2LEBA 2CQ2A 3CCMS 5IM0B 2KRRA 2V94A 5GAGU 3NNAA 2CPDA 3CPWR 1H6KX 2AYEA 2MKJA 3MD3A 2CPXA 3CMAS 2M8DB 1SJ4P 1FNXH 4PKDB 3UCUP 1SXLA 2RT3A 2U1AA 4A8XA 1QVGR 2DNNA 1Q81T 3DLLQ 2MKSA 1F9FA 1VBXA 2KVIA 1X5TA 1YJWS 1VQ8S 3TYTA 3MD1A 3G4SS 2PEHA 2CQ4A 2OTJS 3HI9A 3BS9A 1A7GE 3U1MA 2LQ5A 2FHOB 3SXLA 4BS2A 4QU6A 3CCSS 1WHXA 2GHPA 3UD3P 2FPHX 2KN4A 3UWTA 2YH1A 4YB1P 1RKJA 1VBYA 2MPUA 1U1KA 2F9DA 2M4MA 1OPIA 4F26A 2DGTA 5LSOA 2DISA 3CCES 2LXIA 2LXUA 1SJ3P 2RUGA 5DDOC 4FXVA 3CCLS 2KXNB 3BEGB 2N7CA 1UAWA 2DIUA 4LMZA 3PIOQ 3RW6A 1KQSR 2MJNA 2DIVA 2CPHA 1X4AA 2X1AA 5LXYA 2CQ0A 2LCWA 1JJHA 2M88A 2WBRA 1VC5A 1NU4A 2YH0A 2RS8A 3US5A 2MJUA 2DH7A 2ZJQQ 2RNEA 2DNHA 2G0CA 3UE2A 2DGSA 4FXWA 3G96A 2CQBA 2BZ2A 1ZH5A 3MDFA 2KT5A 2MQLA 4PR6A 1HL6A 2OSQA 1KOOA 3P6YC 2J0QD 5JVHQ 2MKCA
chains in the Genus database with same CATH superfamily
2WK4A 4NRUA 2K7KA 3PW0A 1O8BA 2JWNA 1R89A 4CM0A 4NOHA 4TY8A 1RTDB 4JI5F 1TKZA 2BQRA 3V6DB 3R2DJ 2DITA 5GMEA 4NI2A 3S1TA 1WJ9A 1VISA 4B9MA 5JUMA 2A0FB 4HVZA 5A2QY 3EE3A 3I82A 1TL7B 4K4TA 3N6MA 5KFQA 1LWEA 3IAS9 2LEPA 2VFSA 1NK5A 2K1RB 2YWWA 3MAAA 1HNWJ 1RAIB 1NH7A 1QUPA 3D0IE 2WTFA 4XTTA 3GLJA 1P27B 1YJTA 2RQMA 3SBMA 4MKYA 4GVBA 4JV0A 4UT4A 3T3FA 1ACMB 2QMUB 3U1NA 2YY3A 2DGQA 2QYGA 4KHPF 3M9OB 4H4OA 4C8LA 2ZM6J 1IBLF 2LYVA 2AKWB 3HD1A 1VR6A 3NLCA 2IM3A 1YTYA 1RT6B 1WC5A 1HNZJ 2C28A 3BPDA 2AHOB 2JC0A 2YKNB 1MROB 2HHWA 1H7WA 4FPRA 4CZCA 3ZZRA 2KYXA 5LOQA 1RT2B 1YG0A 1XNRF 1Q8BA 4OJ1A 3AJDA 1K73T 3H40A 1U6BA 2M7SA 3S01A 4PXEA 2VBZA 3MEGB 1B4SA 4OI1A 3OSPA 3PJXA 4ZPAA 4OX8A 5E3QA 3OV7A 3H20A 3OR2B 1GMVA 4ILMA 3PACA 4M5GA 3OD2A 3WQPA 4M94A 1UP1A 4MMOA 5D0GA 2HVZA 3W65A 2ROGA 4UOHA 4MKVA 1JIHA 4DR6F 3OPKA 2WSFC 2J9EA 2CG4A 1U1NA 2FGOA 4DUTA 4KRWA 1UEUA 4ZS6A 3ITHA 4CO2A 4OZ0A 1SC4B 4MJKA 2ASYA 5FIIA 1M5KC 4P71A 4UY85 1DJ0A 1IKYB 3IG1B 4WE1A 2KG0A 2YX7A 3G71S 3SQOP 1G7CB 1YHQS 3P5BP 2PIIA 4KGVB 4TU7A 3V6HA 3FJ2A 2ZC4A 4C97A 1WTBA 1S48A 3BGFA 5KG5A 3BQ0A 2G0IA 1CQNA 1RBOB 1T03B 2CPIA 4PG5A 3V81B 1HQEB 4NLXA 1UCNA 4O3QA 1LFWA 3Q0AA 1TL1A 3FBCA 1H72C 3GJQB 5CYQA 1A9NB 2ROEA 1JXEA 2DBBA 4X4TA 3PHEA 1NPPA 1XEZA 3UDEA 4H4KC 2RMLA 3D0GE 1RAGB 2VG6B 1WUUA 5FD1A 3IR6B 4C8OA 1Y7PA 2H65B 4I68A 4RWXA 5B0AA 2AJQA 1NSPA 2HNDA 2OELA 4URQU 4ED2A 4DJBA 1B0TA 5BXIA 5JVGQ 3A4TA 4KGKA 3BKUA 1TAQA 4FF4A 3NCPA 1FXLA 4YOEA 2EI5A 5ETMA 2MLXA 2CRLA 3L7OA 4E2FB 1JKHB 3EYZA 1WKLA 1N52B 4IFYB 4RW8B 4M5MA 1JMTA 4IRKA 1N33F 5LMNJ 2AX1A 4ES3A 4RUHA 3I4HX 2CQ3A 1SI9A 1N34F 3PDNA 4XPCA 3CCTA 4EWTA 3NNAA 4IDKB 1PIEA 3JTOA 3L9ZA 2IM0A 3IGVA 2DNNA 5DZ6A 2ZBIA 1NK0A 5F0UA 2XI3A 1PYSB 2WB1D 2LP4A 2C3PA 3BR8A 4NLGA 2V2VA 1AUSL 2NYHA 1IN0A 5KFGA 3MMAA 4F26A 4ATNA 2LXIA 3OLAA 1XWLA 3PM9A 4N5SA 1AA1B 4FXVA 4PABA 1KP6A 5T14A 2AF6A 1VC5A 2UVVA 3DOKA 1NU4A 2R2RA 2HFNA 3M2RA 2DGSA 3MM6A 2JDJA 3TUZC 2J0QD 2IC3B 1GMWA 4R8UB 2VODA 1TKXB 1F1BB 1TVRA 3P8BB 4CWBA 2ZH2A 2VKRA 2XGPA 1J5OB 1URNA 4B3MJ 3F0NA 4K50A 5LM7E 1GQEA 4X2BA 2VPZB 4DPXA 3BB5A 3C16A 1VQOS 3OTDA 4K4WA 4EO8A 1ZM2A 2I6WA 1XR7A 1FRLA 2ZKTA 5DLFA 1HR0J 3CO0P 2ZH5A 2HZCA 3TA2A 3J81Y 4ECQA 4RU9A 5LMUJ 3RR8A 3CW2C 1JLAB 1U45A 2J8AA 1FNOA 1MU2A 4I6AA 4CH0S 2OTLS 2GCFA 4OV1A 2CQHA 4QJVA 3ILLA 3SFUA 4JB8B 4IH7A 2YNHB 4DV1F 1KQFB 1SIZA 3IBWA 2OEMA 1WG1A 4ZVTB 3MR6A 1U1PA 4Q2MA 3ZZZA 3CD6S 4KIAA 2MLYA 5DDQC 1N6QA 3VVUA 4CT9A 1KONA 5IM0A 2VJUA 1XMQJ 1TK8A 4KGXB 3GE9A 4CO5A 3C15A 1YLXA 2GJ2A 4O3SA 4RO0A 1WOPA 3WX4A 3OXFA 3T6BA 1APSA 1IM4A 1S9GB 1S6PA 3H59A 1OYDA 2Z2ZA 4JI3J 1HI0P 4PUOA 5DS7A 1P9YA 3IRXB 1IUJA 2BJEA 6FDRA 3H7HB 1E6YA 2M2BA 5J2QB 5M2UA 3DDKA 1XN9A 1GFWB 4ZITA 1SUQB 1YZ7A 1I1GA 2RQKA 1JNZB 4J9LA 1R27B 3ICLA 1U1LA 4Z7CA 1I51B 3C14B 5ETQA 3IN5A 4DV3F 4DG1A 2W2MP 2HVIA 3TAQA 4HR2A 3FZ2A 5AXKA 3TZXA 1RWNB 4DV0J 3O5TB 2ZZMA 5HP1B 3PX0A 2C2MB 3KHGA 1DLOA 1HI1A 4HTIA 1UJ5A 2UP1A 1RSCA 3K58A 4WK1A 1BLUA 3X1LB 2ZH7A 2FY1A 2CJYB 3DRPB 2DT9A 3VCDA 2EW9A 4DL0C 2IAJA 2CJBA 3LAKA 1HNXF 2DR9A 4ZK7M 4G1QA 4EBCA 5K5MA 2J0WA 1HNIA 2B4VA 2OPSA 3JAMU 1RWXB 2NUUG 2RF2A 3J80U 3EVMA 2HQIA 3OHBA 3BSAA 3TUPA 5J1EA 3IC1A 1HKAA 1PBUA 4NLVA 2DRAA 5HANA 3UN2A 1RABB 4EMDA 1WC6A 2W2NP 3GIRA 1VQYA 2C2EA 1D9AA 1J2VA 1RHQB 2DXFA 1T0TV 3Q2SC 2D3O1 3CD0A 2PC6A 4RJVA 3K8VA 4FYDA 4ZVRB 3HSGA 5ITHA 1Q79A 3PEJA 3W61A 4CRJA 4QIGA 1RK8A 1SKUB 2PI4A 2CPFA 4OV6A 1SCJB 2YPZA 2MZQA 2D3UA 1NHUA 5I3PA 1RHKB 1HBMB 1RTJA 2XY5A 4ZA1A 3LO3A 5KFYA 1QJHA 2AYBA 1RU1A 3JTPA 5KFSA 4ZN3A 5KFAA 2W4PA 2R7VA 2KRRA 1GXTA 2AYEA 2HW3A 2M8DB 1SJ4P 5HATA 2FUG9 4CYUB 2BJDA 1TKTA 3G4SS 4DUZF 5ETOA 1Y10A 3M7VA 4RUAA 3GG1A 4ZLNA 4PXCA 4KGZB 3DN9A 4AE5A 3OL9A 5DZ7A 4Z37A 5E3RA 2H4YB 1BE4A 4DL4A 2EFNA 4NA3A 5KFWA 4OI2A 3KLEA 3BEGB 4F3QA 1MN9A 5IC6B 1HPZA 2QMWA 3H5SA 4I64A 2BA9A 2GIRA 1FFGB 1IKWB 1QY7A 4LF1A 4RZRA 1HBUA 3MDFA 3W8PA 2KT5A 3P4UB 5CZXA 2E1MC 1S1WB 4DCOB 4F4ZA 5ADZA 5B08A 1B70B 4LVOP 3ILJA 2B9YA 2C2OB 3EGWB 3LAMA 3JSMA 4C7QA 4EBEA 1O0PA 2V4QA 1CVJA 4A47A 1TFWA 5LSLA 3RB4A 1YK9A 2VG5B 4RKUC 4DV6J 3WZ0A 3DGVA 1K1SA 2V67A 1FXRA 3X3UA 4A8QA 3LGNA 1I5OB 3M8SA 3CJ8A 4DU8A 4DPYA 3EJMA 1OSDA 5B0EA 1VGYA 1T05B 2W8LA 2IA6A 1SKSA 2W8KA 4JI5J 2K2PA 3MM8A 1X5PA 2ZVSA 1VQKS 4ILRA 1LW0B 2NSBA 3HHLA 1E6VA 4CLYA 3DRSB 5F9NA 5J2MA 1K0VA 4LF8F 1DQ8A 1V3SA 1ZYQA 4J9KA 5E7OB 3EPGA 4JI4J 1T7PA 2GC8A 1CJUB 2Y8YA 4MK9A 4QIFA 2MZSA 2PDAA 3DRRA 3M9NB 2B56A 2ZBQA 3J7ZT 2BKPA 3V2UC 4KFBB 3BBCA 2AGPA 2UXBF 2AGQA 4Q7AA 4NA2A 1U8WA 2B8QA 3KK1B 2RQ4A 4IUFA 2FJVA 5BJRA 2VFTA 5CD4H 4K4UA 2EFVA 3FEYB 3HJFA 3FSYA 2PD1A 1JLGB 4KHPJ 3I32A 4MIBA 3LH2S 4O23A 7FD1A 2XS5A 2X1GA 2DR7A 2ALZA 3J7A1 5F8LA 9ATCB 1DARA 4NX9A 3QSYB 2V9WA 2B7BB 4DR2F 3D66A 2KHCA 2KZZA 1SL2A 3HFKA 3NS6A 3LP1B 2MY8A 3W5YA 4P2XA 5FJ4A 4PYDA 4J9UE 2P6TA 3C8YA 3NY0A 5KG1A 1PYOB 4ETXA 2FJBB 2AEMA 1CJVB 4WPAA 4FF1A 1JLEA 2H51B 5F8NA 3PTWA 2YKQA 3ETOA 3JB9k 2VQEJ 4FS1A 4F4KA 1YJVA 3L7UA 1S5ZA 1SJRA 3VAJA 3NNHA 5D4LA 3I87A 3ET6B 5KFOA 1KVKA 1L3SA 5ETPA 3TANA 1D8YA 3MEEA 4ECRA 2MXYA 3FQLA 2WOMA 1WF0A 5HSPA 2HLTA 4K2XA 4LFAF 3TJAA 4DV4F 1DZ5A 3BV8A 2VG7B 4LSNB 4QR1A 2A10A 5F8HA 2VD3A 2P8IA 3D5MA 2R2TA 3IFEA 2ZHBA 1YJ7A 4I2QB 3GIJA 3TVZA 1UWBA 3GFXA 1VLOA 3BO3A 3BSOA 4NXNF 4ED3A 2GQQA 4ZPVR 3MURP 5D77A 4U7CA 2W25A 2PT0A 2GJFA 1K0TA 4WIIA 2OJ3A 1N5SA 3R7SB 2DVIA 1SC1B 3WBZA 3HO1A 4EBDA 2FHKA 3R9LA 5BYQA 3UPFA 4DHVA 3M6UA 4OX9F 2CZVC 1ICEB 3A3PB 2DNLA 3PIPQ 4B9LA 2CPYA 2AWZA 3BGLA 1DAXA 4C6AA 5I3QA 3MD3A 1LW2B 5J2PB 1WORA 3N5BA 3EDQB 4O4RA 2EFQA 3SXLA 4BS2A 5J1NA 2FPHX 3UWTA 1S0VA 4PXBA 2DGTA 2DISA 1CS4B 4DLEA 1N5VA 5BYRA 1Y00A 3IR7B 4NZ6A 2BRLA 5ETTA 1AB8A 2FHJA 4ZPWR 2G0CA 3QFHA 3VGVA 1N34J 3QJLA 4UUWA 4ALZA 2VFRA 4KKOA 3DGPB 3GSDA 2I5JB 2ZDPA 1HL6A 2QL5B 2H5EA 3PR5B 4C3LA 5RUBA 3IA0A 3BJYA 1VQ4S 2E7WA 4NLWA 3IGNA 2ZHAA 4IG0B 2VQFJ 5EGYA 3NGRA 4GC7A 3MOJB 3PRVA 1CJTA 1Q82T 4QBUA 2DPIA 1DFDA 1SH2A 3B4DA 1EP4B 3AOBA 3NS7B 1RHUB 3NBPA 1HMVA 5LJ3Y 3DMJA 4HACB 3OJSA 1R43A 1Y11A 4Y2KA 1IM6A 5E5NA 1M5OC 2WVCA 1RYSA 1Q95G 1RBAA 3ZXWA 4YP3A 2XSJB 2OMOA 3CCVS 2MEWA 3VAFA 1SKWA 1RWWB 4CTAA 4WFAQ 1HWLA 1S1UB 5LJ5Y 5FDLA 3BSNA 4P10A 2UVUA 3ZZPA 1AUDA 4ZP9A 3CMQA 3F73A 2DR5A 5CH7B 4K4XA 2YKMB 1RWKB 2LVWA 1Z4UA 4WFYA 1S7IA 2YNFB 2V8HA 3BR9A 4LR7A 3JSBA 2VH7A 2YX4A 3H5XA 5EWGA 3ZZOA 2ZE2B 3NGKA 5F0WA 4CT8A 1R31A 3TJ8A 3MTKA 4WP3A 3W3SA 2MZJA 3Q22A 1YJUA 2Z56B 1XQIA 4DV1J 4ZVEA 2IJRA 4AXIA 4O3OA 1X4CA 3MEDA 2JEFA 4B08A 4C0OC 1VRTA 3T1HF 2HBYB 4G3IA 3V4IB 2HSEB 1HFEL 1Y5NB 2BJ9A 2JEIA 5KFZA 3MECA 4DX8H 3Q2TC 2VB6A 4CO4A 1ZBTA 1FDNA 3POTB 4URGA 3M30B 5GAHI 3M1VB 4JBCA 2HBRB 4FNIA 2ZH9A 1RTDA 2H1YA 1HHTP 3GG0A 2R7QA 4LRBA 3HP6A 2OPQB 3V6DA 2DPJA 3T5JA 4HYKA 1VQMS 1FHTA 5KT4A 1KEKA 1GXLA 2GVDA 4FZVA 1YJ9S 4DWIA 4HKQA 5DLGA 3Q83A 1TL7A 3AJ1A 3GJSB 4DV3J 5EUHA 2KFZA 4AL6A 1OY9A 2WB4A 2NQPA 4OI3A 4TNOA 1EKRA 2WRMA 3HVRA 1RTZA 2K1RA 1D0EA 1R6YA 3ENQA 3UR0A 1JJCB 2RKIB 5KG6A 2WVFA 4DMZA 2LLZA 3HSZA 1PCAA 3QIPB 4FN5A 4B3SF 2VONA 5IOLA 3TZWA 2A2DA 1H7XA 4NLUA 5KG4A 1PGZA 3ILIA 2FZCB 3SMZA 5H1SV 2GNKA 4DL7A 4WKRA 2HHPA 1SC3B 1T8EA 3TRGA 1RT6A 1UEVA 3CNQP 2JFKA 3N79A 2YKNA 1MROA 3MFHA 3NAIA 3OSNA 3NXZA 2ZH4A 4X64F 3BGUA 4IQMA 2Z57B 4J9SA 1RT2A 1BXNA 3WIUA 1B3TA 1U02A 3AB4B 1O5JA 3I56S 3MEGA 1IKXB 2JH3A 3CJKB 4LF6F 4FKYA 3OR2A 1TV6B 5DDRC 1RHJB 3ZTOA 4ZPCA 2E9ZA 1IJFB 3D28A 2U1AA 1VS3A 4FYVB 2G13A 5AE2A 2Y1RI 3CIMA 2V6AA 1WOOA 3CCSS 2GHPA 4BC7A 3PYEA 4YB1P 2OPPB 2M4MA 1N32F 1CC8A 3PRDA 1XIQA 4ZVOB 2HNYA 1UVJA 1IKYA 3IG1A 5KT3A 2JC1A 1KVJA 2WVBA 5KFCA 4KV8A 4RW7B 3SZ2A 4M8LA 3D1OA 2DH7A 3P96A 3BBBA 4PG8A 2VF3A 4YS2A 1T03A 2JLFA 4H4MB 3A8JA 3V81A 2OSQA 1KOOA 2ZBRA 2DR6A 2ATLA 4ZJQA 2BJ3A 3PNIA 1NXIA 5KFNA 2DGXA 4RX6A 3CJSA 1M90T 1K8AT 2PN6A 2KRBA 3R5DA 3THTA 4DQSA 2C3UA 4ZVGA 2APOA 2VG6A 3V6JA 4K2JA 1KN6A 3SFGA 3LP0B 3NOCA 2YKAA 5GMKa 5L39A 2QA4S 3B54A 4ZPDA 2OIHA 4ED0A 3JTNA 3G8SA 3D0HE 2NR0A 1TUGB 1M1KT 3D4JA 2W7OA 1HARA 2PA3A 3UO0A 4JI6F 4CLTA 4PG6A 4OFZA 5A6WA 3DYAB 5D4OA 1EETB 3BGRB 3MUVP 2B9XA 2DNYA 4FVMA 3UVJB 3MF5A 1JKHA 1H38A 2KT3A 4IFYA 4RW8A 3CULA 1KHWA 4IQXA 3LGMA 1PAEX 4LR8A 1SPBP 3PYDA 2FQQB 1UFWA 3T1AA 2YBVA 4IDKA 1WEXA 4P2MA 1IWAA 1M5HA 3OTEA 2BOPA 4WWSA 3AAWB 3ISZA 3BH7B 5L1KA 3GWCA 4MK7A 3JS9A 1DBDA 1S99A 2RDJA 1HYSB 1OY8A 4KTQA 1YZ6A 2P5VA 3N6NA 4QWDA 1FESA 4OIXA 3SEOA 3M8QA 2QLXA 4Y34A 3VAIA 4ECSA 4PG7A 2LQ8A 3JXOA 3MM5B 4LF8J 1SJ1A 4CH1A 4QIVA 2IC3A 4R8UA 1YRXA 4OJHA 3I55S 1WF1A 1D09B 5HQMA 1J5OA 4NLSA 5I3UB 4FBUA 3QIDA 5LXRA 3AT1B 1RHRB 1FDBA 3VVTA 4DOZA 3I31A 2V50A 1T9WA 1LWCB 4DR4F 4WF9Q 1NKBA 4N47A 1MMDA 4J9QA 3A12A 1AZSB 2HAFA 5JJBA 2VJVA 2UVWA 4KH0B 4GKKF 2JOQA 4KPYA 4PCQA 3T9ZA 1JLAA 1T9VA 2PSZA 3IRWP 1M0SA 2HFOA 1IKVB 2P9GA 2AYGA 2VBWA 2DGVA 3TA0A 4USIA 2F9JA 1FRXA 5CYJA 4DR2J 2QC3A 2ADBA 2YNHA 1WC1A 2YWGA 1EARA 2IPOB 4M5IA 2JVOA 3T5KA 2BABA 2DHXA 2H5IB 1U2CA 3DXSX 3A3OB 3KLIB 2GZOA 4BWMA 1P9QC 2XBPA 3LF0A 3QO9B 4ZVQB 4EYHB 1K44A 2O3DA 1D9FA 4GKJJ 2MKHA 1X4FA 1S9GA 2YNGB 2W4DA 4OJ3A 1P1TA 4ZN1A 4J5OA 3IRXA 3NMRA 2FVPA 2IMWP 5KFHA 3KHHA 3OJUA 4A8FA 1JQGA 2MYFA 5J2QA 4X4OA 2CQGA 2BW2A 3UN3A 5ETLA 1NMEB 4DPWA 2QLWA 2F63A 4I56A 1SUQA 4LFAJ 1QTMA 2KXHA 4YMEA 1C1CB 3TEHB 2XHWA 2W4CA 4XDCA 1S57A 4DCJB 3C14A 3KDOA 2CPDA 3ZTRA 1SXLA 3RBDA 3SCKE 4ZCKA 3OFGA 2IJFA 3OFHA 2PEHA 3HI9A 2LQ5A 1XMOF 2AW0A 3RZAA 5HP1A 3DU6A 4QU6A 4KBIA 2CVIA 2UUAF 2MPUA 4HLBA 1W2IA 2EBGA 2KZMA 3DRPA 5THWA 5KT5A 4W4MA 4IRDA 2N7CA 5KT7A 4EU0A 3AD9C 2ZH3A 3KHLA 1FJGF 1Q4RA 1SL0A 4OX9J 4WJBA 1FCAA 1WKKA 1RWOB 3G96A 3M05A 4QYZJ 4PQUB 2BZ2A 4UOGA 3HDSA 1UJ4A 5JVHQ 2HHHJ 4OL8A 3Q8QB 2GMLA 2K7JA 3I9V9 5A8KB 5T7LA 1HQ2A 4R5PB 2XMJA 3M2VB 5B0FA 4O3NA 2J9DA 1LKZA 1XC9A 1FD2A 1RACB 1SKRA 3HULA 2DRBA 1WC3A 1EX8A 2HIQA 2N7YA 4F0MA 3R5CA 3DXBA 2Y0SD 3ISND 3BF4A 5BYSA 1GMWD 2CDRB 3C6UB 3DM2B 1D8ZA 2AJ0A 1FRMA 2B43A 4UOCA 1I6JA 3TA1A 4V19J 4TVAB 4ZPTR 2MSSA 4YDXA 4W90B 1RWPB 2GFFA 1RAHB 2OI2A 4KHRA 5D3GB 4ECVA 2ADCA 1RT7B 1NEEA 2D9OA 3S6EA 2CPZA 1HBMA 5GVQA 4PPDA 5ETNA 1NLKL 1S0MA 4DUYJ 1TFYA 3VZHA 5HVHA 2OLWA 4ED1A 1N88A 2QZ8A 3BM7A 5LL6d 3KUHA 2VDIA 3RTVA 3KG0A 4CYUA 3QRPA 3GB0A 2XO7A 4BCAA 1WI8A 1X4GA 3MEKA 3ZTPA 1PBAA 3K89A 2FVCA 1RI7A 2C2KB 5HVGA 2HLUA 3G8TA 4LF9F 1NSAA 2R8GA 4OYPA 2P9CA 3ISNC 1IVZA 2E5GA 3D54A 4OHYA 3OLBA 3DKDA 3RRGA 4RUCA 4IH5A 3OR1A 2B4PA 2XULA 3BDPA 4QZVB 3VALA 2OAUA 3TOQA 3TNVA 4FYWB 1WDDA 2HZVA 1S4FA 4PYAA 1IKWA 4ES1A 2KXFA 2W7AA 3L7PA 1EAYC 4J9NA 2KKHA 1UPMB 2WONB 4ELUA 1S1WA 2NUHA 2R8HA 2MB0B 4ZIVA 3G6XA 3VAGA 1ZPWX 2G4BA 1N54B 4C9DA 2ZFHA 3N4WA 2B9EA 2JLGA 4LREA 5D0RA 5EN1A 2XYHB 3OUYB 2PFFB 3KNGA 2L41A 3M6WA 1X60A 3MM9B 4YHHJ 2VG5A 3T1HJ 3T41A 3G87A 3GJRB 3UDCA 5SUHA 2W9BB 2DNPA 2JZ5A 3EX7B 2DHAA 4NYZA 4CLWA 3Q8UA 2F7VA 2G0JA 2WSCC 1T05A 4JV2A 3GJTB 4H4KA 4OYMA 4DR1F 5BR8F 4F8RA 4WCEQ 4E0DA 2DNMA 2GJIA 2QA1A 4I4BA 3CD5A 1PG5B 2CADA 1EQMA 1LW0A 3EVWA 2YX1A 2GQ2A 5HBMB 3DRSA 3R5JB 3TARA 4USKA 1RAEB 3MPWA 4N41A 2HHQA 1OY6A 3ZO7A 4NA1A 4WP8A 3A8EA 5C2CA 1UL3A 3D3BJ 1CJUA 3H2UB 3J81U 1LWXA 3MGJA 4DV7F 3K5NA 4OZ3A 2FJWA 4GRSA 1RA7A 3R1LA 2YPYA 3SSSA 2IYIA 2GGPB 2MKKA 3CUNA 2H5JB 5ETKA 3FCVA 3G6YA 4KFBA 2XMWA 3EZUA 1RP5A 3QMQA 3HVAA 2JX2A 2Z58B 4DR3F 3KK1A 2ATCB 3KLGB 1LV5A 2R7OA 3K59A 2Z2YB 5B09A 4DPOA 4TU9A 4Y65A 1YBAA 1OWXA 1SQEA 1VQSA 3W2VB 4B3SJ 3BN7A 4P74A 3NGSA 1VK3A 1JLGA 3KNAA 4NLQA 2IDEA 4OYXA 5ETVA 2AJ1A 3ZC4A 2KFNA 3PW4A 1RB0A 2OTJS 2LQJA 4RBVA 1DTQB 4JOUA 3UD3P 2YH1A 2Q1LA 1KKHA 1YJRA 3BYRA 4X64J 3LP1A 1JLFB 4TQRA 3OL6A 5LSOA 2HRYA 1ZA1B 2HRTA 3ZZTA 4EI2A 4C98A 2LXUA 3QNWB 2NXJA 1T94A 4LBHA 1UAWA 1CJVA 2MJNA 3KLHB 4J9PA 4JV5J 2X1AA 2M88A 5L1LA 4LF6J 1HLWA 3RB0A 4I2PB 4ICLB 5J1PA 4AUKA 3FCHA 2UU9F 4OI4A 8AT1B 3V5RA 2OMLA 2M5YA 3IS9A 3SCJE 1FRIA 2MMYA 1U6FA 2O1PA 4ZP6A 2ZUAA 2V69A 2LU2A 3GONA 3M8PB 2MZTA 2YWFA 2N82B 2IHR1 4ZCIA 5HMZA 2C3MA 1NK4A 1HBNA 2EK6A 4WU2A 1ZTTA 1FERA 1F60B 4FDFA 1Q8IA 1HD0A 3LQVA 5C7PA 5E2QA 4IKAA 2QGFB 2HFSA 3RU0A 2KYZA 3OQ2A 3VAHA 5A76A 5ETRA 4X66J 2VG7A 4LSNA 3R7BB 5IZHA 4P2SA 1NH8A 1QE1B 4I2QA 4PXDA 4NEZA 3D67A 4YQWA 1NB2A 3TWZA 2CQCA 3UD5A 4DV5F 4ZJLA 3BSCA 4MYTA 4F04B 3KK3A 3CWJA 2AZ1A 5KFUA 2ZZNA 3PYGA 4KAIA 3U27A 3H2VE 1LFPA 4J9MA 1RT4B 2E9TA 3PW2A 2E7XA 3KJFB 4K7QA 2N3LA 2Q3PA 4C0BA 2C3OA 2CZ4A 1UMJA 3QAUA 2K3KA 2JLEA 1LW2A 1DY3A 5J2PA 3LP2B 5HJYA 1FFWB 1A0OB 3NRBA 4DEZA 4A8YA 4OZ1A 3AFGA 1S6QB 2HNZB 3K17A 3JAMY 1NDLA 3K5PA 3NMAA 4GO5X 4OZ2A 2L9NA 4PWDA 1R6VA 4RBTA 4H54A 4FBTA 2G1DA 3NP5A 3M8ZA 2F3JA 2N3OA 1NPKA 2RRAA 1B7FA 4EO6A 3HJVA 2VFUA 1H2TZ 3FUYA 2E44A 1S12A 1NRKA 1RQ0A 2RE1A 3GV7B 4LFCF 3D9BA 3M4XA 5IQ6A 3KUEA 4ZVFA 2W24A 3OVAA 3EDRB 1X4HA 2XCPA 3C6TB 2DYAA 3DGPA 4K4ZA 2RH3A 5KFTA 2I5JA 1MMNA 2XMTA 1FK9B 4DDFA 5GADU 3H0PA 2DXEA 1S1XB 1WD6A 2RRBA 4P52A 4X4UA 4LSLB 4KGMA 3RG6A 1LWFB 1N5YB 4IG0A 2CNLB 3ENWA 2VASA 2X1BA 4DLGA 3R8YA 2ALYB 2XEXA 3J7YI 1EP4A 1WG4A 4ANEA 1N48A 2QEXS 2Z2MA 1XR6A 2HS4A 2XHCA 3R6LB 2V2ZA 1PYTA 2Z4PA 1TUWA 4PAAA 1VI7A 2J6UA 4CLLA 4C4WA 4N8NA 1S7HA 3BQ2A 1XK8A 4RW9B 4DSLA 4HEA9 4Y2MA 2F5GA 3BH6B 2XSJA 2D9PA 7AT1B 1QLNA 1RU2A 1U2RA 2B7CB 2MQOA 2M9KA 1GNKA 1PJ5A 3O1LA 4DX7A 2AYMA 2EG1A 2HZAA 2OUGA 4PEOA 1S1UA 3CT9A 2LQBA 2R7XA 2BRKA 2QA4G 1PJ6A 1C2PA 2HQDA 1WG5A 2YKMA 3FEZA 5C42A 5D78A 5C24B 2DHHA 3RR7A 4M5JA 5CHCB 2YNFA 1JLCB 3UNYA 2KTQA 2FVQA 3ZNUA 4GKKJ 1T9TA 4Q8EA 2O66A 1U1QA 2ZE2A 1N36F 1R7IA 3VF0B 4TN2A 1SC6A 1KHVA 4ZPBA 2KJWA 1Y3JA 3SQGB 3W60A 1UW4A 3OFEA 3FZBA 2E1PA 1WOSA 3GV8B 1BQNB 5DRKA 2HFVA 4MFBB 1MN7A 1ITPA 2FZKB 1CQMA 3PEHA 3V4IA 5HMXA 4IO1A 5GAGU 3D6HB 3CPWR 1H6KX 2OH2A 2R8JA 5D0EA 2IIHA 3NGUA 4WFXA 4PKDB 4DR7F 3POTA 3M30A 2E5LF 2KVIA 1DTTB 4U9RA 2W7PA 3DCAA 4XDDA 2NPFA 1AT1B 4J7CA 3GCWP 2QV6A 4QYZK 5E33A 1IBKF 2OPQA 2BACA 1CJKB 1S0NA 1RGVA 1T02A 3TUJC 2CVEA 2CQ0A 2ZHOA 1F3VA 3NG8A 2R2SA 4KQZA 3TAMA 4EEYA 4FXWA 4B9SA 2QT7A 2LXFA 3TW0A 4DI6A 3ZTSA 1Q5YA 4GO7X 1XMOJ 2F4VF 1P1LA 4EYIB 2Z0GA 4EZ6A 2RKIA 5HK4A 3ZTQA 3JSRA 4HL9A 2FHJD 5DGBA 3FRZA 3RAMA 3QIPA 1LXNA 3PX4A 4JI8J 2J76E 4W98A 2MQMA 4RW4B 1FEEA 3W64A 3T5LA 3TQ1A 2HKEA 1TL5A 3FEXB 2UXDF 2EC2A 3FMBA 2KH9A 1N6QB 1F9EB 3GYGA 3PVXA 2AMCB 4L3KA 4OZLA 3V6KA 1ZPVA 5CAAA 2FGCA 4CNZA 1NJWA 4OX6A 3FRYA 2HURA 2KHDA 1IKXA 3BO2A 3GZ7A 1G4CA 3O6QA 3E8OA 2KG1A 1H2VZ 2DO4A 4USJC 3R5BA 2DCUB 3QT8A 4K4VA 1N4LA 2UUBJ 4CO1A 4FKXA 2ZH6A 3G6VA 3B82A 5KFJA 3OBIA 1SQFA 3S7RA 1VC0A 3KTQA 5AXNA 3MHYA 2QO3A 4LQ3A 1U1MA 2DO0A 3Q23A 1NNDA 2Y3YA 2DGUA 1N8RT 3CEDA 4NLPA 2LQ9A 4J37A 1KBRA 4X65F 1WF2A 4LRCA 4DSFA 2DNKA 1WSVA 4TLQA 3ZFVA 1OSCA 3B6BA 3THPA 4UZCA 1M5VC 3K5MA 3AXKA 4ECUA 4KO0B 5U47A 1RT5B 2CUYA 4RW7A 2JHEA 3E51A 3PW5A 1Z2LA 2BVZA 4R25A 1KNZA 4H4MA 2ZM6F 1VIOA 4G1QB 4HI1A 2PMZD 3VQTA 3ZNJ1 4WXOA 4ZHRB 4WFBQ 1HNZF 3CDAA 2L9DA 2UXCJ 3ADAC 4DSEA 5D4PA 4F4XA 1VJWA 4LF9J 2Q66A 1KDNA 1YVFA 4YR2A 2V2KA 3LP0A 1KD1T 5IWAJ 2FLLA 3G2XA 4RNOA 3K5OA 5B0CA 4Y2AA 3VGUA 3GSIA 2HWIA 4P2FA 2X51A 3I6PA 3RRKA 2UV8G 1R0AB 1EETA 3BGRA 2JL9A 7FDRA 2BEFA 1PC5A 3QT7A 5F8IA 3UVJA 3H42A 4ANDA 2LMIA 3M32B 2FJEB 1X9MA 1XTZA 1G3OA 5KOXA 2ZITA 2QG9B 1NAQA 4QWCA 5C25B 2Z30B 4UW2A 4LVNP 2X1FA 1F3FA 3WC0A 3GU0A 3KHRA 2KB2A 2OHDA 3OTCA 3HVTB 3W2WB 3PKYA 2HS0A 3PJWA 5HVFA 1WNEA 1MW7A 3G82B 3GFZA 1JK9B 5D6GA 4LIRA 3CC2S 3UCGA 2YQ3A 2ZBPA 2AGOA 3S8SA 4IH6A 1NCLA 5HLFB 5K8NA 3LWMA 4UY8T 1HYSA 1FVSA 2CQIA 1CULB 1WSRA 4DR1J 5BR8J 3W66A 5KG7A 3O44A 1RCOB 3JQKA 3CB4A 1GX6A 3KJQB 4BC9A 3DI6A 5K9FA 2EK1A 4LJMA 2XMMA 1FTRA 5E3CA 4NXMJ 2V34A 2MQPA 1JLBB 1RYRA 2XWXA 4MAKA 1GK8A 1HPZB 3MM5A 3HFZB 3I0SB 4EUVA 4JI0J 1NUEA 1GH8A 1H3DA 3MMCB 2B6AB 5E3AA 4ZLLA 4DL6A 5KFIA 1F0XA 3D68A 4DL3A 1OJ4A 5I3UA 3SSQA 3KG4A 3KXDA 4TXSA 3FQKA 3BBFA 4DR3J 1R8CA 3BQ1A 4IR1A 5DDOC 4I6YA 3CCLS 5C5JA 5F9LA 2DIUA 1LWCA 3RW6A 2CNNB 3JSMB 1TZ0A 2LCWA 1AZSA 4NRTA 2BKNA 3AXMA 2PMWA 3W8GA 2DNHA 1J5EF 2ZKUA 2CQBA 3I5AA 3K2YA 4PR6A 2HMIB 3OL8A 3IXQA 2BJ8A 3IWNC 1F5BA 1X9SA 2J0SD 1VRUB 2LDIA 3QGPA 3GQCA 2CPJA 4OYIA 1YRUA 1VCTA 4U6PA 3KLIA 4NCGB 5A8WB 1AFJA 1U24A 1MNEA 1HQUA 1HA1A 2RILA 2MQQA 5EDWA 2RHQB 3QO9A 2W2PP 2ZC3A 3MMBB 3RBXA 5AE1A 1YBUA 1G2EA 4B9VA 3ETMA 1RWUA 5HJXA 1R8PA 2ASLA 3Q89A 2MQNA 2YNGA 4EZ9A 3ZZUA 2IJNA 2ASJA 2GAGC 4C8YA 2RHSB 4O44B 2CWKA 2YWKA 4N77A 1FFSB 4HHUA 2I1RA 2Z2LA 2QTWA 3FDSA 4CO0A 3PO4A 3CVKA 3D2WA 4B3MF 4NYPA 2NXCA 1XBWA 1QD1A 4PQAA 1W25A 4ECXA 2E7VA 4K59A 1T3NA 3BKFA 3N5FA 1C1CA 2ZEJA 2I0XA 1KQGB 1U48A 3DC2A 4NMXA 1BQMB 4O4GB 2BE2B 3CCRS 5DG9A 2B0GA 1WDTA 5L46A 1A6LA 1BY9A 2A3JA 3I0RB 4KC5A 1DRZA 4OHWA 2X7IA 3DLGB 2NPIA 3JSYA 2F1FA 4JI2J 2OSRA 2ZOFA 3NGTA 1VJQA 5DQGA 4IYQA 3C3LA 2OKQA 4F36A 2ZOMA 2FZGB 3HSJA 2ZWPA 4CNYA 4OJGA 3VAMA 4RL1A 1NDPA 4YFUA 4MK8A 2EVZA 4RU2A 1JB0C 5A8KA 2HWTA 3IWLA 1L3KA 3CJQA 2RAQA 3M2VA 1S97A 2EKYA 1C0UB 2Y9HA 4JI3F 4ZLJA 3MPVA 4MKAA 2HEKA 3D6TB 4NLRA 1GXUA 3SV4A 4LFCJ 3BN4A 2BANB 4C11B 3VR1A 3K5LA 5EWFA 2Y1LB 3C6UA 2AJ4A 3L95X 4OLOA 1XNQF 1FNMA 1RAFB 3DM2A 4YDDB 1RAJA 1YX2A 4RPFA 3E2EA 4I7FB 1HW9A 1UEKA 2HHTA 2XYGB 2WCXA 3OL7A 4QR0A 4K4SA 4USUA 4DV0F 4B3OB 5D3GA 1FJCA 1RT7A 3VZIA 2C1EB 3MXHP 3N01A 1AW0A 1T9UA 4NLOA 4DQPA 1S76D 1AYEA 4F0HA 2L9WA 2HHUA 4ZOSA 5KG0A 4OI6A 1C4AA 1SJQA 4AD6A 4HDHA 3IAM9 4CLSA 2KJVA 1RBLA 1P8GA 4OX7A 1H2UX 4P9SA 3CDWA 2AIRB 4B9NA 2EFGA 3NCRA 1WEYA 3U02A 5A0YB 4P73A 2FTRA 2FC8A 9RUBA 2ZUGA 1IQTA 1VQ7S 4C8ZA 3UDLA 2OD4A 3N0VA 3F44A 3QWPA 3AD7C 2PO4A 2QJ3A 2XCAA 3B8HA 4FVCA 2CPXA 4AFFA 1FNXH 3UCUP 3KK2B 5EX3A 1YJWS 4F7VA 5DG7A 1N36J 1Q53A 5KFXA 3UR3C 2AZ3A 3MPDA 1WHXA 1Y9OA 1HNVA 2J7KA 4F4WA 3CJ3A 2J7UA 3HD2A 2F8EX 2IM2A 2IRXA 1VFJA 2B4UA 3OUYA 4DCPB 2HFZA 3MM9A 3RYLA 5AE3A 2YH0A 1MG7A 2BV3A 4JYAF 4DPTA 3NWRA 1KLNA 1C4CA 2XMUA 2W9BA 4QWAA 2CJQA 2P2CB 3FVYA 3IWXA 2LFVA 4DR7J 1HMVB 2AQ4A 2E5LJ 4L76A 3RBEA 3BPSP 4ZCLA 2H48B 2Y0BB 4Q43A 4XAKA 2XG8A 3TVYA 4A8OA 2BJ7A 1P6TA 3M8YA 3WC2A 2UUWA 3VHQA 5GMDA 1VQ6S 5HBMA 2GS8A 3OTOF 4Q8FA 5DM7Q 4WKYA 3Q8PB 2XWYA 2R42A 4OHVA 2RQCA 1IBLJ 2KDOA 1GTHA 3FBEA 3Q8VA 5F3TA 2RVJA 4LRDA 1VOMA 3FSIA 2DH8A 2GGPA 4DQQA 1XNRJ 4ES2A 2G9OA 3KLFB 4P7TA 2F4VJ 2VC1A 3A8KA 3NCQA 2Q6CA 3KLGA 4YY3F 1YJNS 2KO1A 4JV1A 1MWQA 3VV2B 3W2VA 4LRFA 1FJEB 2VHGA 3Q86A 1LXJA 2V4JB 1FRKA 1IWGA 3QLHB 3QGHA 4LQ9A 3D3CJ 1U47A 4X4NA 2UXDJ 3BO4A 3O3LA 4DR6J 2CDQA 1Q7YT 4M1KA 2BOAA 3H4DA 3E3XA 1PJ7A 2W01A 1YKWA 2M70A 1DTQA 1H0HB 3OTBA 2QA2A 1O6XA 3OXGA 1JLFA 5DQHA 2OO4A 4QIWD 3PRBA 1FWPA 4DPUA 4LF7F 2FC9A 4ED4A 3CXCR 4L73A 4NLDA 3JQMA 3KLHA 4M63A 4I2PA 4ZLPA 4ICLA 4WYWA 4DN0A 5KFFA 1FKAF 2CNKB 4ECTA 2CA9A 2VV5A 1IR2A 2HPUA 3T9NA 4RNFA 1WEZA 2GVDB 4JI4F 4KJIA 4I0WA 2PGCA 3M8PA 3MUTP 4B3TF 4U67Q 4WU3A 1FKPB 4LFBF 4X65J 4DZ6A 2HK3A 4X62F 3ENVA 3JYTB 2ZJRQ 5E3PA 6FD1A 2M0GB 2CG8A 2VIHA 1S1VB 1U6ZA 1S9FA 2OFGX 4BDPA 3FFIB 1MWZA 1UVIA 4EGLA 1RAOA 1QE1A 3Q8RB 1ROFA 4AL7A 3EXCX 3KJVA 1HBOB 5H9EJ 4M5DB 4QCLA 2BUNA 3LTOA 2J5AA 2R3VA 4M95A 4ID5B 3EGZA 4KYZA 4RW6B 1JX4A 3D1HA 3MM7B 1BUXA 2VOPA 1X0PA 1R8HA 2W2QP 1IQZA 4WZQA 5D0HA 2JSXA 1N33J 1LOUA 1RT4A 4U8VA 3K7RA 1EB0A 1ZZNA 2JFDA 5MAOA 1VQLS 1RT1B 1PAUB 1O51A 5FLXU 3HSDA 4O0NA 2MY7A 3LP2A 4B17A 1Q0NA 1X0FA 1S6QA 2HNZA 2VQEF 5DM6Q 2KVQE 2XY6A 5L9XA 4NWBA 2B5JB 1X31C 2VU5A 1ZAXA 2B3TB 3C2PA 4U7UD 2AEFA 4QU7A 3R2CJ 2K06A 3DLJA 2E1AA 1WELA 2PE8A 2WVEA 1X4EA 2HYIB 3G6ES 3MCNA 2HFUA 2BJ1A 4CP5A 3DLKB 4X4RA 1OMSA 1BWEA 2HNYB 4USVA 2JRSA 3CCMS 3R3TA 4ZMMA 3C6TA 2YWHA 4KV8B 3QFWA 2RT3A 1FK9A 3TEGA 4G6VB 4PPZA 5B0GA 1S1XA 4BBYA 3DDIA 3TYTA 2CQ4A 3BS9A 1T3OA 4LSLA 1CEZA 1LWFA 1N5YA 2WW4A 4NLTA 1L3TA 4QW8A 2UUCF 3CCES 1KQKA 5CYMB 4M5NA 4DS4A 5JXSA 4LMZA 3GFHA 4Y3CA 5DJBA 4XO0A 3PW7A 2XY7A 2VC0A 1RHMB 2ZJQQ 2L48A 5G0RB 2HAIA 4RW9A 4L72B 3DLHA 4U95A 3AA8A 3FK4A 2NREA 4P6QA 1C0TB 1GAOA 2D1CA 3IP0A 4KR0B 3Q8YA 3CSKA 3HZEA 3RUBL 1RTIB 4WZMA 1UTAA 4I69A 4WYLA 5C24A 2CJXB 2W9CB 4N76A 1JLCA 2NYIA 4NEYA 1WACA 1D9DA 2V8PA 2DNGA 1VIXA 4CLFA 1J5EJ 2FJDB 1TL4A 4V19X 1WKJA 1NSQA 5IV4A 3GIMA 3SQGA 4C8MA 5C2GA 5HROB 3TO8A 1BQNA 2PI5A 5D15A 1VHIA 1I94F 2VQFF 4MFBA 3BKTA 3AOAA 1YGYA 1JXVA 3W9HA 2EBEA 5F8MA 3T5HA 4F4YA 1UFKA 4FNHA 1CG2A 3SDEB 1R0BG 3M8QB 4DN9A 2ILZA 3CC4S 3R5GA 2DR8A 5CZVA 3MR5A 2E5IA 1DTTA 2H4WB 1YSJA 2A2CA 3M9MB 3CC7S 1F5CA 4F2RA 2RRNA 2OP5A 3H8YA 3WDOA 2K3IA 1MMLA 3AOCA 3FCWA 1TMMA 2M52A 1CJKA 1S6OA 1NHKL 2W9AA 1HNXJ 1FF2A 1EQ0A 1QAYA 4DF8A 4LT6A 4B3RF 5A8RB 4AXJA 2OD6A 3T6JA 3QSIA 4QPTA 4ERDA 2F40A 1JXLA 3NNCA 5HQ8A 1QAIA 2DY1A 2GVZB 2EFPA 4USWA 1AFIA 1U1RA 3QAEA 4PZVA 4F02A 1UPPA 2N4CA 1S6UA 3WHIA 1TR0A 3N6LA 1FKOB 2V8DA 1RTHB 1BGXT 3P45B 5D4NA 4RW4A 4D3GA 4E98A 1LK7A 3M6VA 4P7VA 2LECA 2HHVA 1FI4A 3QBCA 1FD8A 1KC8T 4NCAA 2YKOA 2KFYA 3DNCA 3CDUA 3HCXA 1DQ9A 3CMES 5IT4A 1BQXA 3PFOA 4AQYF 2FYXA 2F8HA 5HQLA 1FXDA 4NLYA 3VGSA 2OEJA 2QFIA 2NXUA 4LSZB 4UUXA 1CC7A 4F0KA 4IG3B 1VBKA 3J7AN 2YTCA 1K47A 2P6SA 3VGTA 4LF4F 4HT5A 3SSRA 4CLKA 2ZOGA 1NDCA 1HQEA 4OI0A 3GPAA 5AJ3F 1VQ5S 2COLA 1XNQJ 5CABA 4DUZJ 2RIJA 2HIYA 4Y28C 4F4AA 1HHSA 4Y0FA 3T1YF 2AEJA 2PEBA 3UW1A 2FD2A 4JI7F 3HT0A 1W7WA 4KO0A 1RT5A 2ZD1B 3DHWC 4QQBA 4HT7A 4BHQA 2DTJA 3MPUB 2DEIA 2J6TA 2MKJA 2VPYB 4JI1F 5CD4A 2YQ0A 2BYCA 2EKNA 2R8IA 4ZHRA 4UZBA 1R3NA 3W5XA 2XZWA 3TZYA 3OVSA 2ROPA 8RUCA 1HW8A 2R9LA 2FJAB 1G1XA 3NL0A 3B78A 5T7LB 3H25A 2HHSA 3H5UA 4ENOA 4LR9A 3HFVA 1Q78A 1OQ3A 1FEHA 3PZPA 3EZ5A 3PIOQ 3QYYA 4K5SA 1X4AA 4B9TA 4OZJA 3AA9A 2A6OA 2WBRA 1TKDA 2WW8A 2UZAA 3UE2A 4DFMA 1URRA 2GQCA 3DLEB 4ZCMA 2XO6A 3GV5B 3FNNA 1RT3B 4MIWA 1CLFA 3HX9A 3P6YC 1R0AA 2A1BA 4DSKA 1RLDA 2DNRA 3GFYA 3K57A 1TK5A 2XS7A 5IT9U 4I6WA 3QT5A 2VUGA 2IBKA 2MZ1A 1MWYA 2B8PA 3CJ2A 1R8BA 3M32A 2RSQA 3RW7A 1SH3A 3J7Z5 2XMVA 2HS3A 2IVFB 5C25A 3TAPA 2XQCA 1VDHA 1SVDA 1S59A 2VL1A 3HVTA 4JYAJ 3W2WA 4KY3A 1TKXA 5K20B 4W92B 3G82A 3MR3A 3NEKA 1U4BA 3TVKA 4WFZA 5GAHU 5CQGA 3OVBA 3CCWA 1S10A 3LUYA 3CCZA 3HXMA 2E5HA 5HLFA 2Y8WA 2UXBJ 4X4SA 3EZOA 4ED8A 4C2MA 1CULA 2IVYA 3QPIA 1L3UA 1QVFR 1Y3KA 2AJ2A 2ACYA 5JMNA 4NZ0A 1XJWB 3PHTA 1TTHB 4TLRA 1MSWD 2QL7B 2IBOA 3CCUS 2CXEA 5IT0A 1VYAA 3OTOJ 4ETZA 2QRRA 2D3OR 1JLBA 3W5ZA 4USHA 3E01B 1X4DA 2V68A 2CIMA 4OYOA 3I0SA 3QT6A 3OR1B 1S1TB 3CDEA 3MR2A 3MMCA 1EIYB 1T9YA 2B6AA 4ZVSB 3Q24A 2H3EB 5EWEA 1RZMA 4Q0BB 1KLMB 1ULRA 3H90A 1HWKA 3PYFA 1U26A 4WTOB 5IXUA 1Z1ZA 4YY3J 4ZVHA 1CBKA 2EC0A 2GV1A 4TYAA 1NZ8A 2A18A 1CSJA 1WHVA 5A2QU 1Y5IB 3NWGA 2R7UA 1U2FA 2DKOB 2HMIA 2AV5A 1S79A 3DOLB 3LANA 5HO4A 4HI2A 4C8NA 2HQFA 2AU0A 1VRUA 3W1YC 2M3DA 4YN3B 5DGAA 4DV4J 5H9EK 4NCGA 5A8WA 2NXEA 2D41A 4LF7J 2D69A 1LK5A 3M8RA 2A6MA 3MMBA 3TQEA 2E9RX 3RJMB 1AXQA 1QM9A 3KLVA 3SCLE 4S0MA 1U0HB 1NM2A 5LSRA 4NXNJ 2CQDA 5HAOA 2D3ZA 2HGNA 4ZKAA 1Q86T 1T11A 1UVMA 4O44A 4WP9A 4D3HA 4B3TJ 2V4RA 4LFBJ 1SV5B 1C1BB 4PG4A 4X62J 3R97A 3F41A 2XZDB 2Y1IA 1N0UA 4QR2A 4ED5A 4DSIA 3MCMA 3RBZA 1TL3B 3DOMB 3NAHA 4USTA 4LF2A 1RXOB 1JLQB 1BQMA 4KSEB 4O4GA 2BE2A 4UTGA 4UF4A 1X5OA 1EZZB 2QL9B 4DR5F 3SCIE 3M2UB 1N5TA 1VQPS 1ZOTA 1S9EB 3I0RA 3L4BC 4DU7A 2ZNYA 3DLGA 4F25A 3QZ8A 4QPXA 2HGLA 5M2RA 1I3OB 2HBZB 4FYYB 1FRJA 4N56A 1HWUA 1W2BR 1N0VC 3BDEA 5AXMA 2FLOA 1ZS6A 3CMAS 2XGQA 1SBRA 4A8XA 3TR5A 4GKJF 4FF2A 4CDIA 3PO5A 4OYWA 5L38A 1R0CB 4M5KA 3MD1A 3KJNB 2V5HG 1FDDA 4A8WA 1A7GE 1D3WA 4CI0B 3UFCX 3IS9B 2Q6BA 3PCOB 1C0UA 2Z8QA 1S4EA 1YRTA 3R7NB 2F9DA 4CLPA 1UZHA 3LWLA 2E1RA 1GT8A 2H54B 2CYYA 1SJ3P 4CM2A 4IR9A 1HBNB 2KXNB 2AP6A 3GYNA 1F9HA 3PG9A 2BANA 4C11A 4A4JA 2FIUA 2R7TA 3G86A 1F2GA 4Q5VA 2GA7A 3AQPA 4I7FA 4NZ7A 2GO9A 2EG2A 3CCJS 3OT9A 4XPEA 5I42B 2BE9B 1U25A 1REGX 1OIAA 2AD9A 4B3OA 3AHPA 2RDDA 2B9WA 4DL5A 4M5HA 1ZM4A 3A8IA 2UUCJ 2ZNZA 1JNRB 3KK3B 2CZ9A 3FSXA 5M2PA 4Q45A 4LUBA 2IYGA 3P3DA 3L3CA 2DH9A 1B0PA 3MCSA 4B9UA 2R4FA 2IY5B 5AT1B 5KG2A 5J2NB 1FX4A 3AH6A 4I67A 3J81j 2DNQA 1YI2S 2UV8A 4WBFA 3CDBA 3D7SB 5L1IA 1VBZA 3ZZ0A 1KRPA 2HHHF 2FDNA 4ED6A 3TX8A 1T9XA 2RD5C 1U49A 4FP9A 2YXLA 3W63A 5KT2A 2R7RA 2V2QA 4C3KA 1UA1A 4PWDB 2W1BA 4IFVB 5A0YA 3FGVA 2OPRB 2YNIB 2IVMA 2MGZB 1VLYA 5SZTA 2QE5A 4LBIA 4TKTA 4OLPA 2MQ8A 1DQAA 1NPRA 4YB7A 2XSFA 2V8VA 3KK2A 3O8WA 2HQ3A 3VAKA 2MSTA 2RUSA 1REVB 2JEGA 2LA4A 4CO3A 5K14B 4KPCA 1ZETA 2UUTA 3ULHA 5KFEA 1N56A 2D74B 4NPOA 1HWJA 1I94J 4K0KF 3EUNA 3GMGA 4RR5A 1CPZA 3CTRA 2XC9A 4DUYF 2CQ1A 2BM1A 2HQGA 4Y6IA 4RLEA 3CJRA 2FJXA 2CFXA 4FXDA 3UDVA 4M5LA 4LIWA 1IXKA 1K1QA 4C3MA 2NS1B 3RB3A 1HD1A 1IR1A 5G4DA 2XMAA 3RAXA 2GHWA 1ZAWA 5KAKA 1HIYA 4Y00A 4ILLA 5EHHA 3FC9A 2MTLA 4CLZA 1ZZFA 3DHXA 3HHKA 4USMA 2GAHC 1QAJA 4J9RA 3VWSA 2XZTB 2LKZA 5GAEI 4NMLA 5DETA 4B3RJ 5C42B 4Z2XA 3ZZYA 1HI8A 1OYEA 1FJ7A 5KFVA 1NDKA 3A3NB 3MWBA 3HM9A 3KMQA 4XK8C 4TQSA 1NO8A 4NASA 1NZAA 2KI2A 2E66A 2M8HA 1UW9A 2F65A 3HHDA 4TY8B 3KLFA 3IBCB 4Q2LA 2MKIA 4F3MA 1YITS 2ACMA 2XLIA 1TKZB 3ILOA 3UQSA 1FX2A 2RDIA 2E1CA 3WIVA 2N4DA 4NI2B 2LA6A 5F8JA 1TK0A 1FT8A 2ASDA 2V4JA 2LDYA 3QLHA 3N9UC 3ET6A 1Q5VA 3NS5A 3WX8A 4YHHF 2RJZA 3QWUA 1BD6A 4O3RA 4QYRA 1S0OA 4J91A 1YBTA 3UI3A 1B0VA 3TI0A 1TELA 2VKZG 1LWEB 1KWMA 4L75A 1FE4A 2XI2A 1N32J 1KR4A 2QMXA 1Q7LB 3MAAB 4RNMA 4AQYJ 2VFVA 1V5IB 2C2DA 3QJJA 3QZ7A 1KFDA 2VBYA 1RJJA 4GVBB 4LF5F 1V9OA 5K8PA 2LEBA 4LF4J 4GC6A 5DO2A 4KE5A 4H4OB 5HMWA 4A46A 1UVNA 5AXLA 5AJ3J 2BQ3A 3TAMB 4DF4A 2C2NA 4OZ5A 4RNNA 2FHOB 4G1PA 1KSPA 5KOWA 1FKPA 4DSJA 4WXWA 2WSEC 3T1YJ 3JYTA 1OPIA 4A8SA 1SL1A 1UKUA 3DDNA 3QATA 4JI7J 1S1VA 3KWMA 5EX0A 4YB6A 1KS2A 2DIVA 4O0IA 4Y2CA 3FFIA 3L09A 4F3OA 2RNEA 4AL5A 4JI6J 2WAQD 5HMYA 5KFPA 2VBXA 2V0NA 1HBOA 1NJYA 3J80Y 4M5DA 1FWKA 2J9CA 3HHLD 4JI1J 2R7SA 2MKCA 3GIKA 4LRAA 1NJXA 4ID5A 4RW6A 4NCBA 4N7TA 3MM7A 4KB7A 1CS4A 1UZDA 1RUSA 3ITHB 1RADB 1YWXA 2XB2D 3I96A 1BC6A 2B51A 2J6SA 1U1OA 2DNOA 2ILYA 2GMHA 2BM0A 4WE1B 3P49B 1BHNA 1UVKA 3UCZP 2GMJA 1VHFA 1NKEA 4IOAQ 1RT1A 2MDAA 4JV5F 2I9SA 1VQNS 3THVA 1IBMF 2BMBA 5T41A 4OHXA 2CQPA 4OHZA 1L3VA 1GMUA 1F5AA 1SB6A 2NZCA 2B5JA 1TL1B 4BLGA 4CLUA 4DV2F 3KFWX 1TMJA 1FWLA 2ZJPQ 1K9MT 3GCXP 3HHEA 5CYQB 3ENAA 1WHYA 4AYBD 3RAQA 1B7YB 2L3MA 1J27A 2XYPB 3DLKA 4HACA 3W9IA 2HNDB 4DFKA 2DHGA 2MHNA 4X66F 3HHLC 3MAHA 2DNZA 1NK6A 1YIJS 1YDLA 1M5PC 5DQIA 3A1YG 1UWAA 1H74A 3N28A 2NLWA 2Y1JA 4TU8A 2HG4A 3H98A 1LQ9A 1RA6A 5HL7Q 4EFAC 5CYMA 1RKIA 2DB1A 2BXJA 4DR4J 3LPEA 4JP8A 3HKWA 3CJTA 4DQIA 2FHMA 2QSFA 3OHAA 5G0RA 4ER8A 4WIQA 3R27A 4YUDA 4RWWA 2DGOA 5I4MA 2JVRA 4YEAA 1Q16B 1U8SA 3M8WA 3TX0A 1QDUB 2VOOA 1C0TA 1F2HA 1RDRA 3VTIA 1NJZA 1QUVA 1Y0HA 3MMAB 3CF5Q 1RTIA 4DFJA 4P75A 1V3RA 2W9CA 2VPXB 1V3ZA 1FTCA 1BWVA 1KFSA 3LOUA 4L3NA 2DXDA 3DOKB 2MZRA 3F56A 2L08A 2OEKA 3M1VA 2YVSA 3M2RB 4IOCQ 5GAEU 1OS5A 1R8AA 3MM6B 2BW7A 2HVEA 1JJ2R 1TVRB 3MR7A 1W26A 2CAJA 4IOBA 4ZJOA 2XM3A 2HWHA 2HVDA 5A6PA 5HROA 1XMBA 3MUMP 2FB0A 2ABYA 2MHEA 2B4OA 1JWWA 2XTJP 3C16B 1S49A 4ZP7A 3DI6B 3EM1A 5CCMA 3SDEA 2HK2A 2GX8A 2J0XA 4N8OA 3TP2A 3SV3A 1L5UA 2GO8A 2EXUA 2DD8S 3MOZA 4CQ1A 2VZ9A 1V6HA 3I5BA 2DCLA 2EWHA 3NOGA 2HBQB 4CCHA 2F8MA 1MU2B 1M5SA 3VQSA 4ZIWA 2UUAJ 3KKFA 3MFIA 3NGDA 2I38A 1Y4ZB 1WC4A 5CCLA 2AJFE 1B99A 3I5CA 4NE9C 2AX0A 4MTPA 1FJGJ 1SH0A 3HVWA 1G6BA 5CXTA 1X4BA 3EVOA 4UOFA 5L9NA 1ZAVA 4FPIA 1KTVA 5A8RA 2ERRA 2IFXA 2JEJA 5IM0B 3M6XA 4FF3A 2X3GA 3CJ0A 3GR1A 4MKBA 2VDHA 2OGUA 2GVZA 1LEOA 3C15B 4DR5J 3SI8A 2PFDA 4MIAA 1Q81T 1F9FA 1X5TA 1S6PB 2QN6B 3PX6A 3U1MA 4F50A 4PUOB 2KN4A 1LNQA 4X4QA 3CJKA 1E6YB 1TV6A 1FKOA 2UVRA 3PY8A 1RTHA 3MTJA 2PMHA 2CWXA 1KQSR 4U7UK 3CD7A 2RS8A 3US5A 1XERA 4HDGA 1M1HA 3MZIA 4OYAA 1IR0A 1HQUB 5B7WA 1X8DA 3DRYA 2WHOA 2O5DA 4V1Ak 2E29A 4DG1B 6AT1B 3GYXB 2OPPA 4GMKA 5KFRA 1NHVA 1TUVA 4OYZA 3W62A 5H9FJ 3C46A 1S72S 1HNWF 4MYUA 4ECWA 2KT2A 4KT0C 3PKMA 1DLOB 3HPOA 4RUBA 5HN0A 3D1QA 3QRRA 5KFDA 4E8UA 1EHWA 1NJIT 2EEYA 2XS2A 3UD4P 4IG3A 5E0OA 4IRCA 2QYCA 2ZWOA 3I4PA 2IAJB 1VC6A 2C3YA 3K0JA 4OZNA 2O67A 2POKA 3U1LA 1Z2ZA 1HNIB 2OPSB 2YWEA 2K8GA 2RF2B 2G2OA 2D7SA 4L74A 1NK7A 1QSSA 2KM8C 1TAUA 1BMQB 1SJFA 3V4MA 2MLZA 1WTFA 1UJ6A 2XLKA 3RB6A 1NSKL 1ZTWA 5J1EB 2KL8A 2WZ1A 1HHQA 2CPEA 4I1TA 5KFMA 3AD8C 2ZD1A 2ZDOA 2AT1B 3J7YU 4IO9Q 2QLFB 1QSLA 4OMFG 1NK9A 1QSYA 4F2SA 4JI8F 1X9WA 1EJ7L 3DYAA 4NL5A 1FO1A 1QTNB 3G9CA 2P9EA 2I8EA 4MT1A 2QLBB 1OO0B 1IJEB 4Y2IA 2GHVC 3D6MB 1IBCB 2XNRA 1ZM9A 1NKCA 3CJ4A 4TYBA 3AQOA 2BDPA 4ANCA 5IFMA 2C42A 4PRFA 3GILA 1RTJB 2QIFA 1KOHA 5KT6A 2CNOB 2CJ9A 2UUBF 4Q44A 1TU0B 3G8QA 3DLEA 5KFLA 2DEJA 5FLXY 1RT3A 1U09A 3QQCD 4GVLA 2U2FA 3MPYA 4L6V3 2BE7D 2C2ZB 2J7WA 4R0JA 4DX5A 1NB7A 1TKTB 1VK8A 4U8YA 3I9ZA 3R6GB 1PC4A 4CIOA 4A8KA 3HHNB 4ZVPB 1DHMA 4ELVA 3MAQA 4DZDA 1SQGA 2WBMA 3OFFA 1Q8KA 3KLEB 4HHJA 2LU1A 2RS2A 4K0KJ 2DK2A 1RE1B 3SYZA 5CA5A 4HH0A 3LALA 2XLJA 1U7LA 2I2YA 1VQ9S 4DV7J 2NZ4A 2MKYA 3LGHA 1GTEA 4WK3A 2G2YA 2IDLA 3ELHA 1HBUB 3IM9A 2ZH1A 3PXGa 1WWHA 8ATCB 1RWVB 5K8OA 2Q79A 5MLCV 2XMKA 3W9JA 2DGWA 1FVQA 4DL2A 3DU5A 2GIQA 1EKSA 4DS5A 2UXCF 5LMNF 4R0EA 2DJWA 2DY9A 4URSA 2QLJB 2J8SA 2KU7A 4HHHA 2WVDA 4O3PA 4QW9A 2XNQA 4A48A 2BR0A 5F41A 3E01A 3FMWA 2CJKA 4YB5A 5IWAF 1FA0A 4QOTA 1S1TA 1IKVA 2EFOA 1RWMB 1DURA 4DXLA 4J9VA 1FE0A 2V63A 3P5TL 1AROP 5GADI 4OYBA 3BYPA 3W7BA 1ZM3A 4Q0BA 1KLMA 3EGNA 4X4PA 1T95A 3LA0A 2HQCA 1RLCL 2GW8A 2BX6A 5KFKA 2HGMA 3MM8B 1OPZA 1FDAA 2BBEA 1HNVB 4UQGA 1QAXA 3HHLB 1E6VB 4KHMA 2UU9J 4ZP8A 2CQ2A 3BZQA 5J2MB 4MH8A 3KG1A 1KVIA 3QRQA 3DRXA 5LT5A 3DOLA 5B0DA 1UA0A 1VBXA 3DRRB 5IC4B 2O01C 1ZA2B 3MMJA 2ZH8A 1RKJA 1VBYA 1Y5LB 4K4YA 2R8KA 3GP9A 4QWEA 2RUGA 1RAAB 2R2UA 2CPHA 1HR0F 5LXYA 3EWGA 3KYLA 2MJUA 4LF5J 4B02A 4ED7A 4NXMF 2VA3A 1H73A 5LMUF 1U0HA 4C8KA 1KTQA 1UETA 4XIUA 4YR3A 4DV5J 4QIEA 4CH7A 3IMQJ 3OW2R 4JI0F 1PO6A 3HLUA 2W2OP 2IM1A 2IRYA 3O2IA 1PILA 1SV5A 3FKBA 4UQTA 1UFLA 3IBFB 1C1BA 4NYOA 1VMBA 1FRHA 2QFJA 3HT3A 1TL3A 3DOMA 4PQUA 1XMQF 1JLQA 3CGIA 3KOAA 3IO1A 1JLEB 4C0HA 5B0BA 2G1HA 1M1GA 5GAGI 2F4FA 2DHSA 4R5PA 3M2UA 2V9KA 1SIWB 3CCQS 1S9EA 3Q8SB 3TUIC 3GTYX 3C66A 4HTJA 3IR5B 4ID8A 3R1HA 5IQQA 3EXYA 2G2ZA 4ECYA 4DQRA 3QGGA 4WTYA 2IA0A 2FLNA 4TY9A 3MEEB 4P72A 3PFEA 3KMSA 4ZDNA 3GIIA 4QWBA 1RISA 1XR5A 2WOMB 4J90A 2SXLA 3FBFA 2FVRA 3EPIA 4X84A 1WC0A 4U96A 2RU3A 5DG8A 3BGOP 1PKUA 3ONQA 1HWIA 1VRQC 3TZZA 1IBMJ 1UWBB 2BKOA 2RU9A 3NKYA 2FVSA 1Q1KA 3EMTA 3KUGA 4EK2A 1H98A 3IM8A 3EICA 4DV2J 5IV3A 3TJ9A 3HZGA 5ETSA 2NXNA 3A13A 3B4MA 2C22A 4ELTA 2J9DE 2EPIA 5L1JA 5E41A 2IMOA 3R5AA 5DDPC 5F8GA 1WI6A 1X5SA 1GX5A 2ZVIA 4PWUA 2NSCA 2QSWA 3HF5A 3OXLA 1WHWA 5I42A 4FYXB 3KJVB 3H2LA 4PWWA 2BQUA 1NBEB 3FBBA 1X7VA 2FLPA 5F3ZA 5IS2A 1YQHA 2NCKL 3BREA 4JI2F 4DFPA 2E5JA 2CKWA 3CO9A 3CJ5A 4Z7YA 4HH1A 4K5RA 3HK2A 2WONA 3HMJG 1V5VA 1Q8LA 4RBUA 4F67A 5J2NA 4X4VA 4WFNQ 2IRUA 4KKOB 3SIPB 4DX6A 2YQ1A 4OQJA 1TP7A 2HRUA 2ZZTA 3AY0A 3RRHA 2R7WA 2CJAA 3PV8A 1UVLA 3MCOA 4IFVA 1RCXB 1TQLA 2JNJA 4K8RA 4ECZA 2H9ZA 3AJ2A 2LEAA 2OPRA 2YNIA 1CJTB 3QGIA 5KTQA 3UNGC 2MGZA 3T19A 5D8HB 4JUZA 1PSDA 1N5QA 2GIFA 3NBPB 5KG3A 3DMJB 4G65A 1B64A 3HKZD 3AODA 1S77D 3K8WA 3LPYA 2KM8B 1REVA 2DRDA 2YKPA 4G1IA 4C48A 3AB2B 2C2RA 2FY8A 4J9OA 3KDNA 3LW5C 5K14A 2HVHA 4BWJA 1ELOA 2V8GA 1IBKJ 5IT9Y 3GR0A 4CTAB 3CE8A 5L8RC 3MI7X 3PR4A 5FDLB 3H4BA 4LBPA 3U7JA 1JJ4A 2ZBCA 3DLBA 3C19A 3PJ9A 4RNHA 3UN5A 5K8MA 4ZVUB 4DBQA 2QX0A 4A8MP 3EGVA 2V94A 2JJ4D 3CIZA 2RB7A 3DFEA 2VPWB 2HHXA 4AT1B 2OFHX 1QVGR 3QJPA 3DLLQ 1OQ6A 2MKSA 1VQ8S 1MLAA 4KH1B 2Q43A 1U1KA 4FS2A 3JQJA 3RGIA 5HI7A 2VICA 3D6FB 3MEDB 5H9FK 4YR0A 2X3DA 1D1UA 1JJHA 2VA2A 1VRTB 1NK8A 4ITSA 4DV6F 1F6TA 5KFBA 1GEHA 3MECB 1ZH5A 2PA8D 2MQLA 1U0SA 3H5YA
chains in the Genus database with same CATH topology
3IXQA 2WK4A 4NRUA 2K7KA 4NZ7A 3PW0A 1O8BA 2GO9A 2EG2A 2ATLA 3CCJS 3IWNC 1F5BA 4XPEA 1X9SA 2JWNA 2J0SD 3PNIA 5I42B 1R89A 5KFNA 1VRUB 2LDIA 1U25A 2DGXA 1OIAA 3QGPA 4NOHA 4RX6A 2AD9A 4B3OA 3GQCA 4TY8A 1M90T 1RTDB 2CPJA 1K8AT 3AHPA 2PN6A 4JI5F 2KRBA 1YRUA 3R5DA 2B9WA 4DL5A 1TKZA 3THTA 4DQSA 4U6PA 2BQRA 2C3UA 4ZVGA 2APOA 1ZM4A 3KLIA 4NCGB 5A8WB 1AFJA 1U24A 2VG6A 3V6JA 2ZNZA 1KN6A 1JNRB 3SFGA 3KK3B 3V6DB 1MNEA 2DITA 3S1TA 1HQUA 3LP0B 1HA1A 2YKAA 2RILA 3FSXA 5M2PA 5GMKa 4Q45A 5L39A 2QA4S 2MQQA 5EDWA 3QO9A 4LUBA 2ZC3A 3MMBB 4ZPDA 2OIHA 4B9MA 5AE1A 4ED0A 2IYGA 3P3DA 3JTNA 5JUMA 3L3CA 2DH9A 1B0PA 3MCSA 4B9UA 4HVZA 3G8SA 3D0HE 2R4FA 5A2QY 2NR0A 1G2EA 4B9VA 1M1KT 2W7OA 1RWUA 5KG2A 1HARA 2PA3A 5J2NB 3I82A 4JI6F 1R8PA 3AH6A 4I67A 2ASLA 4K4TA 2DNQA 1YI2S 4PG6A 4OFZA 2UV8A 5A6WA 2MQNA 2YNGA 3DYAB 3CDBA 4EZ9A 3ZZUA 2IJNA 5L1IA 1VBZA 2ASJA 5D4OA 3ZZ0A 1KRPA 3N6MA 4C8YA 1EETB 5KFQA 4O44B 2HHHF 2FDNA 1LWEA 3BGRB 4ED6A 3IAS9 3TX8A 2LEPA 2VFSA 1NK5A 2YWKA 4N77A 2K1RB 2RD5C 3MUVP 2B9XA 1U49A 2DNYA 2I1RA 2Z2LA 4FP9A 4FVMA 5KT2A 3MF5A 2R7RA 3FDSA 1JKHA 1H38A 4C3KA 1UA1A 4PWDB 1NH7A 1QUPA 4CO0A 2KT3A 3D0IE 3CVKA 4IFYA 4RW8A 2WTFA 3PO4A 4IFVB 3CULA 5A0YA 3D2WA 4B3MF 1KHWA 4NYPA 3FGVA 1P27B 1YJTA 4IQXA 1XBWA 2RQMA 3LGMA 4PQAA 2OPRB 1W25A 2YNIB 4MKYA 4ECXA 2IVMA 4K59A 4JV0A 1T3NA 3T3FA 3N5FA 2MGZB 1C1CA 1UFWA 3T1AA 1VLYA 3U1NA 5SZTA 2I0XA 1KQGB 2QE5A 2YY3A 1U48A 3DC2A 2DGQA 4KHPF 1BQMB 3M9OB 4H4OA 4IDKA 1WEXA 4O4GB 2BE2B 4C8LA 4TKTA 3CCRS 5DG9A 1M5HA 4OLPA 3OTEA 1DQAA 2B0GA 1IBLF 2LYVA 4YB7A 2XSFA 2V8VA 1A6LA 3KK2A 3O8WA 2BOPA 2HQ3A 3VAKA 1BY9A 2MSTA 3NLCA 3AAWB 2A3JA 2IM3A 1REVB 3I0RB 1YTYA 1RT6B 4KC5A 3ISZA 2C28A 2JC0A 1DRZA 4OHWA 5L1KA 2YKNB 2JEGA 1MROB 2HHWA 3DLGB 3GWCA 1H7WA 4MK7A 2NPIA 3JSYA 2F1FA 4FPRA 2LA4A 4CZCA 4CO3A 3ZZRA 5K14B 2KYXA 2OSRA 1ZETA 1DBDA 1S99A 2ZOFA 2RDJA 1HYSB 4KTQA 1RT2B 1YG0A 5DQGA 1XNRF 1Q8BA 2P5VA 2UUTA 3N6NA 4IYQA 3ULHA 5KFEA 4QWDA 4OJ1A 1FESA 4OIXA 1K73T 3H40A 3C3LA 1N56A 2M7SA 3S01A 4PXEA 1U6BA 2D74B 2OKQA 2VBZA 3MEGB 4OI1A 4NPOA 3SEOA 1HWJA 3M8QA 4K0KF 2ZOMA 3OSPA 3EUNA 3GMGA 3PJXA 4ZPAA 4OX8A 5E3QA 3OV7A 1CPZA 3H20A 2QLXA 4Y34A 3CTRA 3OR2B 4CNYA 2XC9A 4OJGA 4DUYF 2CQ1A 4ILMA 3VAIA 3PACA 3VAMA 4ECSA 4PG7A 2BM1A 4Y6IA 4RLEA 3MM5B 4YFUA 1SJ1A 4M94A 1UP1A 4MMOA 4MK8A 4CH1A 2EVZA 4RU2A 2HVZA 4QIVA 2ROGA 2FJXA 2CFXA 4FXDA 2IC3A 4R8UA 1YRXA 4OJHA 1JIHA 4DR6F 4LIWA 1JB0C 2WSFC 3OPKA 5A8KA 1IXKA 1K1QA 2J9EA 2CG4A 2HWTA 3IWLA 1U1NA 2FGOA 1L3KA 4KRWA 1UEUA 3M2VA 4ZS6A 3I55S 1S97A 4C3MA 2NS1B 1WF1A 3RB3A 3ITHA 1HD1A 1J5OA 2EKYA 4NLSA 4CO2A 4OZ0A 5I3UB 1C0UB 3QIDA 5G4DA 4MJKA 4FBUA 4JI3F 5LXRA 3MPVA 3RAXA 2ASYA 4MKAA 5FIIA 1FDBA 2GHWA 1ZAWA 1M5KC 5KAKA 4Y00A 4UY85 4ILLA 5EHHA 1DJ0A 1IKYB 4NLRA 4DOZA 1GXUA 3IG1B 4WE1A 2KG0A 2YX7A 3I31A 1ZZFA 3SV4A 3G71S 3DHXA 3HHKA 1G7CB 1YHQS 1LWCB 1QAJA 4TU7A 2PIIA 4DR4F 4J9RA 4WF9Q 3BN4A 3V6HA 2BANB 3VWSA 4C11B 1NKBA 3FJ2A 2ZC4A 4N47A 1MMDA 4C97A 1S48A 4J9QA 1WTBA 2LKZA 5JJBA 3BGFA 5GAEI 3VR1A 5KG5A 3K5LA 4NMLA 2UVWA 5DETA 3BQ0A 5EWFA 3C6UA 1CQNA 5C42B 4GKKF 4Z2XA 2AJ4A 2JOQA 3L95X 3ZZYA 4KPYA 1HI8A 4OLOA 1XNQF 4PCQA 1FNMA 3DM2A 3T9ZA 1JLAA 4YDDB 1RAJA 2PSZA 1T03B 2CPIA 4PG5A 1FJ7A 3IRWP 3V81B 5KFVA 1HQEB 3MWBA 4NLXA 3HM9A 3E2EA 4I7FB 1M0SA 3KMQA 4XK8C 4O3QA 4TQSA 1LFWA 2HFOA 3Q0AA 1NO8A 1TL1A 1IKVB 1HW9A 2P9GA 2AYGA 2VBWA 2HHTA 2DGVA 1NZAA 3TA0A 2WCXA 3OL7A 4QR0A 2KI2A 2E66A 4K4SA 4USIA 2F9JA 5CYQA 1FRXA 5CYJA 1A9NB 2ADBA 2ROEA 2YNHA 2M8HA 3HHDA 4DV0F 4B3OB 1JXEA 2DBBA 4TY8B 3KLFA 5D3GA 2YWGA 4Q2LA 1FJCA 4X4TA 1RT7A 3PHEA 3VZIA 2MKIA 4F3MA 1YITS 2XLIA 1XEZA 2JVOA 3T5KA 1TKZB 3UQSA 2BABA 2DHXA 2RDIA 3DXSX 4H4KC 2E1CA 3MXHP 2RMLA 2N4DA 3KLIB 3D0GE 3N01A 2VG6B 5FD1A 3IR6B 4C8OA 1Y7PA 4I68A 4RWXA 5B0AA 2AJQA 4BWMA 2HNDA 1AW0A 1P9QC 2LA6A 2XBPA 5F8JA 4NLOA 1TK0A 4DQPA 1S76D 1FT8A 3LF0A 2ASDA 2L9WA 2V4JA 3QO9B 4EYHB 2LDYA 2HHUA 3QLHA 4URQU 2O3DA 4ZOSA 1D9FA 3N9UC 2MKHA 5KG0A 1X4FA 4ED2A 4DJBA 3NS5A 1B0TA 4OI6A 4YHHF 2RJZA 1C4AA 3QWUA 1BD6A 1SJQA 4O3RA 4QYRA 5JVGQ 4HDHA 1S0OA 1S9GA 3UI3A 2YNGB 3IAM9 1B0VA 4KGKA 1TAQA 4FF4A 2KJVA 3NCPA 1FXLA 2W4DA 4OJ3A 1P8GA 4OX7A 1P1TA 4YOEA 4J5OA 2EI5A 3TI0A 2VKZG 1LWEB 1H2UX 2CRLA 1FE4A 3L7OA 3IRXA 3NMRA 2XI2A 2FVPA 1KR4A 3CDWA 2QMXA 5KFHA 3KHHA 2IMWP 1Q7LB 4RNMA 4B9NA 2EFGA 3NCRA 3OJUA 4A8FA 1JKHB 3EYZA 1WEYA 2MYFA 2VFVA 3U02A 5J2QA 2C2DA 1N52B 4IFYB 4X4OA 4RW8B 2CQGA 2BW2A 5A0YB 3QJJA 3QZ7A 2FTRA 1JMTA 1KFDA 2FC8A 4IRKA 1N33F 2QLWA 2VBYA 1RJJA 2AX1A 4I56A 1SUQA 2ZUGA 1QTMA 4ES3A 4RUHA 1IQTA 1VQ7S 3I4HX 4C8ZA 2KXHA 3UDLA 4LF5F 2CQ3A 2OD4A 1C1CB 1V9OA 4YMEA 3N0VA 3F44A 1SI9A 3QWPA 2XHWA 2W4CA 5K8PA 4XDCA 2LEBA 3PDNA 1N34F 4GC6A 5DO2A 3CCTA 4EWTA 4XPCA 3NNAA 4KE5A 2PO4A 2XCAA 4H4OB 2CPDA 4IDKB 3B8HA 4FVCA 2CPX