2CQPA

Solution structure of the rna binding domain of rna-binding protein 12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
GSSGSSGASSGKPGPTIIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords RNA-binding protein 12
publication title Solution structure of the RNA binding domain of RNA-binding protein 12
rcsb
source organism Mus musculus
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqpA00
2UP1A 1VQPS 1Q7YT 3CCLS 3Q2TC 2EVZA 1VC5A 3VAKA 4A8XA 2DNGA 2AYMA 1KQSR 2PEHA 2HGLA 3MD1A 2AD9A 2D9PA 2N7CA 2L41A 1YWXA 3L3CA 1U1RA 3MOJB 2E5IA 2XS7A 2RNEA 2ZJRQ 1M90T 3DLLQ 4QQBA 3UD4P 4ZKAA 2CQ2A 2KG1A 3TO8A 3US5A 1VQ7S 2DNYA 2XNQA 3BO3A 2M7SA 2M4MA 1K9MT 2DNOA 3BO2A 1YJ9S 2E5HA 2YTCA 1PO6A 2DNRA 4W90B 4F26A 3BEGB 1H2TZ 5LSLA 3MDFA 2CJKA 1Q81T 2K3KA 3MUVP 1M5PC 1Q82T 2KM8C 3CCES 5GMKa 2K8GA 2KFYA 4V19X 4C0OC 2CQGA 2LEBA 2MQMA 2MGZB 2DGWA 2CQBA 2HVZA 4LIRA 2YH0A 1WHYA 1KC8T 2XB2D 2ZJPQ 3S01A 3CCJS 2NZ4A 3I56S 3G8SA 4OZ1A 3CCRS 3R27A 3CCQS 1KOHA 1RK8A 3IWNC 1A9NB 1X5TA 1WEXA 2KN4A 2ERRA 4PKDB 2YKAA 1QVFR 2EK6A 2JVOA 1KD1T 1U1KA 2CPYA 2M8DB 3SDEB 2DHGA 2DGTA 1WEZA 1WF2A 1X4HA 1X5PA 2KXHA 2JVRA 5H1SV 2HYIB 1VQMS 2KXFA 2CQCA 1DHMA 3NS6A 4J5OA 2DGQA 1VBYA 2CPXA 2L9WA 5LJ5Y 1FO1A 4FXWA 5GAGU 5JVGQ 4WIIA 1FNXH 1JJ4A 1BY9A 1WHXA 2DHXA 2M70A 2MJNA 2JRSA 2VONA 2MKIA 2MGZA 2OTLS 1M5VC 2QEXS 1X4AA 2MZTA 2X1AA 1DRZA 4IOAQ 2SXLA 3P6YC 1YI2S 1VBZA 1D8ZA 1OIAA 1P27B 2DH8A 4M5DB 1SJRA 5DDRC 2DGVA 4TU7A 1S72S 1S79A 2QA4S 1UW4A 1L3KA 1X4CA 1M5KC 3UD3P 4QU7A 2JX2A 3MXHP 3G96A 3SDEA 2MY8A 2M52A 3MURP 3G4SS 1FHTA 3CD6S 2DK2A 1ZZNA 1FJCA 2LMIA 3CMAS 1WG1A 4WFBQ 3VAMA 2VOPA 1VQ4S 2CQDA 1HD1A 5D78A 2CQ4A 3V4MA 2FC8A 2FC9A 2LXIA 1VC0A 2GO9A 1WTBA 3OW2R 4EGLA 2RVJA 1SJ4P 1FT8A 1DBDA 1VQKS 1X5SA 2J8AA 3UWTA 4WF9Q 1OO0B 2BZ2A 2M2BA 3N9UC 2O3DA 3RW7A 3LQVA 4F02A 2LQ5A 3CCMS 3THPA 3CUNA 2MJUA 3DXBA 1OWXA 1VBXA 2KG0A 1X4EA 4CH1A 2OTJS 2DNPA 1H6KX 1X0FA 3LPYA 2XS2A 3CXCR 1YJWS 2MKCA 2N3LA 5DDPC 3EX7B 2X1FA 1K73T 2DO4A 3P49B 3IRWP 2ADCA 5LXRA 2F9DA 5DM7Q 2LEAA 4U67Q 4C7QA 1VQLS 1WF0A 2CQIA 1PGZA 4LMZA 1U2FA 3G8TA 3CMES 5LJ3Y 2V94A 4C4WA 2RU3A 3CPWR 1U1QA 1SJQA 2D9OA 2CPIA 2FY1A 2KT5A 3K0JA 1HD0A 4Y00A 4WFAQ 3EGZA 3VAHA 2YWKA 2MKJA 3FEXB 3SXLA 1O0PA 2VODA 1IQTA 2QFJA 2MPUA 1M1KT 4UQTA 3PIOQ 3MUMP 3TYTA 2LA4A 4IOCQ 1OPIA 1UAWA 4F25A 3BS9A 1QM9A 1NU4A 4P6QA 2E5GA 2J76E 1VQ6S 5CA5A 1U6BA 2E44A 2PE8A 1ZZFA 2B0GA 2LXUA 3VAFA 2FHOB 3VAGA 3CCVS 2DHAA 1VQOS 3ZZZA 5DDQC 2U1AA 2MQQA 1N8RT 3G9CA 2DNZA 2RS2A 1B7FA 2AYGA 2EK1A 3J7ZT 3ZZYA 1SJ3P 1URNA 1JJ2R 4FXVA 5GVQA 2N82B 3R1HA 3VAIA 4OZ0A 1R8HA 1RKJA 1A7GE 4ED5A 2X1GA 1WG4A 4UY8T 1U1OA 2CQ0A 2F9JA 3ULHA 2DNQA 2Q79A 3THTA 2FPHX 1U1NA 1NJIT 2KH9A 3G71S 5MLCV 2XS5A 5GAHU 2J0SD 3NMRA 2E5JA 1KOOA 4CQ1A 2AYEA 1X4DA 1X4GA 1YHQS 1SJFA 2HZCA 1D9AA 3UCZP 1FXLA 2MKKA 3B4MA 2XNRA 1VC6A 4CIOA 4TU8A 2XSFA 3MD3A 1F9FA 3VF0B 2MYFA 1X4BA 2DO0A 1M5OC 2LA6A 5IFMA 1HL6A 5ITHA 3J7YU 2LYVA 2ZJQQ 1FJ7A 3MI7X 5HO4A 1K8AT 1WF1A 3UCUP 4YB1P 2NLWA 2CPDA 1ZH5A 4QU6A 2KHCA 3TP2A 2DITA 4TLQA 2CPJA 2RS8A 1UFWA 1WHWA 1XN9A 4YOEA 2MHNA 2MZSA 4WFNQ 4Y0FA 2DNNA 2G1DA 2D3OR 2MQLA 5CXTA 3CCSS 5LSOA 5BJRA 1W2BR 5DDOC 2CQPA 5CYJA 2OIHA 1DZ5A 2OSQA 1WELA 2KRBA 1U6FA 4QPTA 4PR6A 2M8HA 4Z2XA 1VQ5S 3VAJA 2MZJA 5JVHQ 1NO8A 3NNHA 4WKRA 5EN1A 2RQCA 2BOPA 2N3OA 2LCWA 1QVGR 3CULA 2CQ1A 2RQ4A 2RUGA 4RU2A 3S8SA 3JB9k 1U1PA 4W92B 5LXYA 2VOOA 2J0QD 1UP1A 3NS5A 1X4FA 2MZQA 3H2VE 2I38A 4IUFA 2KU7A 2KRRA 2G0CA 2A3JA 2RRBA 2ADBA 2DIUA 5HL7Q 2YH1A 4PRFA 2MXYA 2MQNA 2CPEA 1N88A 1HA1A 2AYBA 3H2UB 2HGMA 1H2UX 2MSTA 3CF5Q 5D77A 2M9KA 3RW6A 1WHVA 3P5TL 1U1MA 3P3DA 3CCUS 3EGNA 3BO4A 2CQ3A 2DHSA 2MMYA 2MSSA 5GADU 1WEYA 2X1BA 3U1LA 4TU9A 4LJMA 2KVIA 1N54B 2HGNA 1WI6A 2MZRA 2DGUA 2DNKA 2M0GB 3UE2A 1YITS 2DGSA 5DM6Q 3Q2SC 1Q86T 1WWHA 5FJ4A 1SXLA 2WBRA 1R8PA 1YJNS 3I55S 3HI9A 1P1TA 1X5OA 2DNHA 3CC4S 4BS2A 2MZ1A 1JMTA 2DIVA 1U1LA 1YIJS 5IM0B 1H2VZ 2DNMA 1AUDA 1N52B 1VQNS 5IQQA 2JWNA 2DH7A 4CH0S 2M88A 1FJEB 2MQOA 2LECA 2DGOA 2DISA 3PIPQ 2MY7A 3NNAA 2OJ3A 3CC2S 3U1MA 2G4BA 2KXNB 1G2EA 2CQHA 2RT3A 1JJHA 3CC7S 3S6EA 3R1LA 2CPZA 3UCGA 2KYXA 2GHPA 2DB1A 2DNLA 2MQPA 1WG5A 5DETA 2KM8B 3B4DA 3MUTP 4IO9Q 3FEYB 3G6ES 5GAEU 2RRAA 1WI8A 2MKHA 2DH9A 5IM0A 3NNCA 4ERDA 3SMZA 1CVJA 2U2FA 4WCEQ 2I2YA 2DGXA 2L08A 1VQ8S 4YUDA 3HHNB 3D2WA 3VALA 2MB0B 2LKZA 1YTYA 2MKSA 1VQ9S 3S7RA 2CPHA 2CPFA 2F3JA 2KI2A 2OSRA 3CTRA
chains in the Genus database with same CATH superfamily
1KR4A 2WSEC 5KG0A 4IYQA 4DV6F 1VYAA 1KRPA 3UD4P 3G8QA 2BKPA 1Q95G 2QLJB 4N56A 4YS2A 2BJ8A 1S57A 2YTCA 1HYSB 1VRUA 3FVYA 3MDFA 3H42A 1RT7A 3D5MA 2HVDA 4KHMA 4K2JA 2B4PA 4KHPJ 2B4VA 4IRCA 2YH0A 3TZWA 1Q53A 3M2VB 1Z2LA 3GWCA 4ETZA 1RK8A 4I2PB 2YX1A 5ETLA 2KN4A 2M8DB 3SDEB 2FVCA 2ZC3A 1X4HA 3BR9A 4HI2A 5I3UA 2CPXA 1JLCB 2FVSA 4FXWA 1HNXJ 4WIIA 1JLGB 4HVZA 2MGZA 1WSRA 4OYAA 1GXUA 4DN0A 3ZO7A 2R8KA 2D69A 1S1UA 1P6TA 5CCLA 4Y2CA 1S0VA 1NLKL 4WYLA 1XR6A 2BOAA 4CI0B 3C15A 3MAAB 3MXHP 1IR0A 3DFEA 1ZZNA 3NG8A 2KYZA 3NKYA 4C8KA 1Z1ZA 3OD2A 3U27A 2LXFA 4ZHRA 5IWAF 4P2SA 4YP3A 1FVQA 3CCMS 2Z57B 1JLEA 3IM8A 4FKYA 1KFDA 1A6LA 1ZAVA 4YN3B 2EG1A 2ZOMA 4ZLNA 2XO7A 3LUYA 2Y3YA 1ZM9A 2UUWA 4Q5VA 1HI0P 4LR9A 5DM7Q 1FX4A 1ITPA 4CT9A 2PO4A 1VQLS 2AQ4A 4C3MA 5KFWA 1OY8A 3W63A 1YZ6A 2J5AA 3MEDB 4H4MA 4Y28C 1VLOA 3NS7B 1ZM2A 3AA9A 1TKZA 4EO8A 3CJQA 3BF4A 1TUWA 5J1EA 3J81Y 3X1LB 2F63A 5CA5A 4DR3F 2VFRA 3VAFA 1U8WA 1W7WA 4O4RA 3UDCA 2ZE2B 4RW8B 3BJYA 2Z2LA 1SJ3P 3HFKA 3H5XA 3O8WA 4N76A 2CQ0A 3BGLA 3FCVA 3HO1A 3MM5A 5I3PA 1O51A 2WOMA 1NK6A 1QUPA 3U7JA 3OUYB 3V4IA 1KS2A 1UCNA 3UCZP 2MKKA 2XNRA 4M5NA 3GIRA 5KFLA 4L3KA 4HH0A 2OLWA 2ASDA 1JXVA 4ZCKA 3V81A 3MI7X 3C8YA 3OHBA 1ZS6A 3VQSA 4I67A 4ECWA 2CVEA 1S76D 2VBXA 2D3OR 2MQLA 1PIEA 3OFHA 2Q43A 4IR1A 5E3PA 5DDOC 2LLZA 2B4OA 2C2KB 2VL1A 5EN1A 1VQSA 3EDRB 1TUVA 5L46A 4C11A 4LF1A 2GQQA 3H2VE 2KU7A 3R7BB 2KRRA 2G0CA 5LM7E 1D1UA 3OVAA 3KLHA 1PILA 2WVEA 4ICLA 5AXLA 4CP5A 3RB4A 1H2UX 5C2GA 3M2RA 3PJWA 2HGNA 2MQ8A 3SSQA 5EWEA 2VBYA 5DS7A 3E8OA 1M0SA 2F4FA 3WBZA 1N5YB 3LP1B 4DR2J 2XC9A 1AUDA 1N52B 4HHUA 1VQNS 5SZTA 1KLMB 4KHPF 1UL3A 2BM1A 2HQFA 1ZOTA 5LMNJ 2CNOB 2EW9A 4M5MA 5K8OA 1MWYA 3FBBA 2ZOGA 3SZ2A 3SBMA 2I5JA 5M2RA 4R0JA 2CNLB 3OVBA 2IJFA 3UN3A 4UZBA 2R7WA 3G6ES 4JOUA 4MIAA 3QT6A 5FDLA 3LAMA 5I42A 4QYRA 1IBKJ 1YTYA 2AJ4A 5E41A 1VIXA 3IBFB 3BKUA 2CPHA 3OTCA 2CPFA 2FVRA 1Q7YT 3Q2TC 3DOMB 3KDOA 2IFXA 1KQSR 4ID5A 2HNYB 2RHQB 2KG1A 2E9TA 4P7VA 2NPIA 5J2QA 4ZVQB 5LSRA 2GIQA 5KFOA 1QAJA 1T9YA 2EBGA 4L73A 2D1CA 4Q43A 3ILJA 3W3SA 3LOUA 1FRMA 2ZM6F 1PC4A 2A1BA 3HVWA 1X7VA 4Y65A 3IG1A 4C0HA 3NY0A 3CSKA 1N32F 1U1KA 5L9NA 1GMWA 2P9CA 2YKPA 1Y4ZB 1CS4A 4W98A 1RE1B 1DLOB 1WC6A 3W2WB 3A8EA 2YY3A 4TY9A 4JI7J 2ZH9A 2JRSA 2ZWPA 1CEZA 4F0HA 3C14A 5DLFA 1RAIB 3FSXA 4ZCLA 4DFKA 1HNZF 2V5HG 5HAOA 5CYQB 2DGVA 1M5KC 2GAHC 2IYGA 2GIFA 4QU7A 3MFIA 3EJMA 4G65A 5AJ3J 3MF5A 5KFQA 4ZDNA 4WFBQ 4C98A 1HPZB 2LXIA 2HQDA 1FJGJ 3J7A1 1K47A 1FX2A 1X5SA 4WF9Q 3CJKA 4XPCA 4CNZA 1T03A 4ECTA 2MJUA 3DXBA 5L1LA 1VBXA 2VB6A 2P2CB 1JLQB 3Q0AA 3ZNUA 3PM9A 5F8LA 3NGRA 1NXIA 2X3DA 1K73T 4X4OA 2P6TA 3KHHA 2L9NA 3IR7B 1VRTB 3PVXA 3G8TA 5HQLA 3D1HA 3K58A 4UQGA 1IJFB 2R8GA 2HS0A 3FEXB 2OUGA 5D4NA 2QA4G 2CUYA 3HHLA 2QT7A 2J8SA 5GADI 4OZNA 1XK8A 1R0AB 3VV2B 1VQ6S 2LXUA 4RW6A 1HBMB 2RD5C 1EQ0A 2A2CA 4JI4F 2C3MA 2L3MA 3V6KA 2B9EA 2NZCA 3R1HA 4OX6A 4X65J 3L95X 4ED5A 4AD6A 3LAKA 2UXDF 4AL7A 4JI2J 2DNQA 1H38A 5MLCV 4JP8A 4F2SA 1YHQS 2C3PA 2J9DE 1ZAWA 1YRUA 1RCOB 4HDHA 3E01B 4LRAA 5KFMA 3SV4A 2YWFA 1SC6A 1FKPB 3Q8VA 2CPJA 2CJAA 2Z0GA 4NMLA 3QJLA 4OJHA 5BYSA 2OIHA 1WELA 4QPTA 4DV1J 4CCHA 3RAMA 1S6PB 2RUGA 3K2YA 4RNOA 4I7FB 4WZMA 4RL1A 3VVUA 3PNIA 1WUUA 1B3TA 2A3JA 3IS9B 2AJ1A 2HFSA 1GFWB 3QAUA 1U0HA 5D0RA 4U7UK 3GIIA 1UETA 2B7BB 4OI0A 1X31C 1MN9A 1R8BA 3ILOA 4F3QA 1RU1A 4NLXA 2KVIA 1N54B 2MZRA 1AXQA 2FY8A 4A48A 3A13A 2CIMA 4N8NA 1YJNS 2C2DA 2I1RA 1VRQC 1N6QB 3CC4S 1DY3A 5CZXA 1RHKB 3AOCA 5IQQA 1JNZB 3HULA 3H40A 2IRYA 1HYSA 1UWBA 2FJDB 1KBRA 3U1MA 4HEA9 2DRBA 4PEOA 5HI7A 2J9CA 1I94J 5B0EA 2QLXA 3QJPA 2CDQA 3TX8A 2IA6A 4K5RA 4E0DA 3W8PA 1TL5A 4FKXA 3M2VA 3QATA 3PTWA 3HD1A 3FEYB 2YX4A 2MKHA 5IM0A 1JLAA 2B8PA 3JTNA 5KFPA 1BXNA 1WC1A 3N5FA 1XWLA 3BPDA 4IDKA 2Y1IA 3D7SB 1JLCA 4CLUA 2N4DA 2F3JA 3KG4A 1QTMA 3D0GE 1MROA 2Q6CA 1JLGA 2QRRA 4G1PA 4RPFA 1C4CA 4UF4A 5AJ3F 2GCFA 2EXUA 2X3GA 2H51B 1WORA 2EC2A 2P9EA 3C6UB 2K3IA 2ZJRQ 3DLLQ 5EGYA 1TU0B 3GCWP 3Q8QB 3AAWB 2M4MA 3MAAA 1Z2ZA 4AT1B 3DMJA 4CLKA 3NCRA 1S5ZA 2EBEA 3RUBL 2Y8YA 2G0JA 1NZAA 3TANA 2XB2D 3S01A 4O0IA 3UN5A 5T41A 4WFZA 2BQUA 4DDFA 1S49A 2WSFC 1UVMA 2YBVA 5H1SV 1QSLA 1VQMS 2KJVA 3KUGA 2GVZB 3M1VB 2L9WA 4YR3A 1X60A 2B9WA 4HHJA 2XY7A 4QWBA 2DHXA 2M70A 3OR1B 4NRTA 5FLXU 4DR7J 4FP9A 3OL7A 5SUHA 5D0EA 1PJ7A 3P6YC 1HQ2A 4M5DB 1C0TA 2QA4S 2UXCF 3DNCA 3G6VA 4X65F 3HVAA 1Y3KA 3G6YA 5B0FA 1MG7A 4JI2F 1Y9OA 1UFKA 1BWVA 3D68A 2UUTA 2Y8WA 2ZE2A 2ILYA 2GO8A 4RW8A 4PG6A 1QAXA 4P2MA 4ZP8A 4DQSA 3AJ1A 3QGGA 4F02A 2F8EX 4M5LA 1NMEB 2W9CB 5HP1B 3MMBA 1X0FA 3OUYA 3RG6A 5E3AA 1ZM3A 4PWDB 4OX8A 1OY9A 3IRWP 3TX0A 1B70B 4MK7A 3MR7A 1FFGB 3E2EA 3K57A 2RE1A 2BRLA 2ACMA 2YWWA 4IG0B 2D9OA 3CIMA 3K0JA 1IQZA 4OYMA 4X62J 2WB4A 2QL9B 3T5KA 3AD7C 4X4TA 1M1KT 2LQ8A 1PYOB 3IN5A 4MKYA 3U02A 3GQCA 4P6QA 4B9NA 2BMBA 3BDPA 4O0NA 2WBMA 2PA3A 2DHAA 1S1XA 1U09A 1KLNA 3AXMA 2N82B 3VAIA 4NL5A 5D0GA 3PHTA 1S9EA 1GAOA 3D4JA 3GMGA 3KXDA 5A8RB 2E5LF 2ZH8A 1C1BA 3F73A 1KOOA 2DYAA 1R89A 1OY6A 3QGHA 2CJ9A 4RBTA 3MD3A 4DR1J 1M5OC 3HKZD 2HURA 1N5YA 3TA0A 3NGSA 3DYAB 3KWMA 4IFYA 5HO4A 2W2OP 1K8AT 2E7VA 3DDIA 1KLMA 4TLQA 4CLFA 5A8WA 2CJXB 4Z7CA 1GTHA 5EUHA 5IS2A 1RP5A 2CWXA 4WKRA 5HQMA 3CULA 2XHCA 2AX0A 1N5TA 2C2MB 2RQ4A 3JB9k 4DJBA 4J9QA 2WHOA 1X4FA 2ADBA 4PRFA 2QV6A 3HHEA 5KT5A 1HA1A 2AYBA 3BGOP 1RWKB 5A8KA 1S4EA 1WI6A 2DGUA 1BQNB 3GR1A 5D6GA 3TAPA 4I6YA 1P1TA 2V2VA 5M2PA 2F65A 2HNYA 2RMLA 4BCAA 3IC1A 4LF5J 3Q86A 1YIJS 1H2VZ 4UOHA 1RHRB 3TOQA 4KT0C 4NEZA 2DGOA 4NA3A 1VIOA 3GIJA 1T9VA 2E1CA 4ILLA 2EC0A 2HAFA 3PKMA 5H9EK 3KUEA 3GSIA 3GFHA 1JJHA 2ZH4A 2CPZA 1FRIA 4LF6F 3UCGA 4Z37A 3HLUA 4I69A 5H9FK 2XCAA 4C8ZA 4H4OA 3C46A 2V8GA 2RRAA 1LW2A 4IH6A 1NDPA 1L3TA 3HF5A 4K7QA 4U96A 2MB0B 2H1YA 1ZETA 2GQCA 4TKTA 3HM9A 3W2WA 1TZ0A 1N5QA 3POTA 1U0SA 3MTKA 2CZ4A 2V8DA 2K06A 2AD9A 3M30A 3NWRA 1IXKA 2ZNZA 3H5UA 1S1VA 4ZVPB 4B9SA 5CYQA 1CJVA 4IOBA 2IM0A 2XCPA 2O67A 3H2LA 3PY8A 1TQLA 3DOLB 4ZJLA 4W90B 2RRNA 2QE5A 4K4TA 3H90A 2W4PA 1Q82T 3QSIA 1FEHA 2H4YB 3EGVA 3N4WA 4MFBB 3GV8B 5LL6d 2CXEA 1CC7A 1AZSB 2W01A 2OAUA 1KOHA 1MLAA 4A8SA 4NLQA 5K9FA 2DEIA 2ZZTA 2EFGA 4U8YA 1JLQA 3MPYA 1WEZA 1X5PA 2EKYA 3Q89A 2R8IA 3HFZB 2QIFA 3I4PA 2VONA 1CC8A 2OELA 2ZOFA 1TKDA 3CJ2A 4EYIB 1OIAA 3CJ8A 2QMXA 3SQGB 4UOFA 1L3KA 3GFXA 3D3CJ 4J9MA 1R0AA 5KFAA 2W7PA 3R9LA 3LWMA 3PFOA 4EGLA 1EP4B 5DG8A 2AHOB 3DCAA 1RDRA 3M6WA 4H4KC 5F3ZA 2HHPA 1UKUA 1FFSB 3B6BA 2E1AA 3JQJA 2R7SA 3GTYX 4DL4A 4L76A 1S99A 4DEZA 4K8RA 3JSMB 1PBUA 5E3QA 3RBDA 3CXCR 4OV6A 2MKCA 4P71A 3M8YA 4DXLA 2V6AA 1YQHA 2ADCA 3CD7A 3RRGA 1SL2A 1IWAA 4PWWA 1GX5A 1CJKB 1NHKL 1G3OA 2DT9A 1EKSA 1WC5A 3BH7B 1DTTB 2QA1A 2BANA 4U8VA 3V6HA 1N0VC 1RT4A 2LA4A 2OMLA 3DKDA 2ATCB 4QWCA 1HFEL 2NXJA 2GGPA 4FYWB 2HVIA 1S6OA 1ZTTA 5IQ6A 3ZZYA 5ETMA 3DRRA 3FDSA 5GVQA 4USTA 5C7PA 4O44A 3PX6A 2E9ZA 2J0XA 3G71S 5GMEA 3WC0A 4LF9F 1D9AA 2I8EA 2AW0A 3DLKB 2KZMA 2XSFA 4Y2AA 2HNDB 1TK0A 1GMVA 2ROEA 4RUAA 4LR7A 4DQPA 4B9VA 5IV4A 3RZAA 2C2RA 4TXSA 2KHCA 4ALZA 1RXOB 2XY6A 1LW0B 3KFWX 1PJ6A 3NGTA 1Q1KA 3VQTA 2Y0BB 1MMLA 4KE5A 4BC7A 1VS3A 2BKNA 3ENVA 1LXJA 1TV6B 3NS5A 1IKWA 4QW8A 4LF4J 5IT4A 3PX4A 2ZHBA 4OQJA 1NKEA 4U95A 1S9GA 1XJWB 2HQ3A 3L7UA 3RW6A 1P8GA 1LK7A 1WEYA 2CZ9A 3SCJE 3TUJC 2DGSA 1SXLA 2WBRA 4C6AA 2IM3A 4GVBB 3GLJA 4BS2A 1E6VB 5H9EJ 1RBOB 2BJEA 4BC9A 4LVNP 2FHMA 3ITHB 5KFTA 3JSBA 5B0BA 2D74B 4KGMA 2OO4A 2LFVA 3K5MA 3M7VA 1N48A 5H9FJ 4DS5A 1REGX 4DQQA 1FJEB 1UJ4A 3KK1B 2KHDA 4PG5A 1QD1A 2VFUA 2BJDA 2XHWA 3PX0A 8AT1B 1G4CA 3TUZC 4ZMMA 1NNDA 5A76A 2RIJA 3TRGA 3DOKB 3MTJA 4G1QB 2L9DA 4M5HA 2PD1A 2BQ3A 4BDPA 1V3RA 3VHQA 2F4VF 1LWXA 4MT1A 3BN7A 2F40A 3KLEA 3M1VA 3OFFA 4KV8A 4HKQA 5HROA 2UP1A 2NUHA 3A1YG 3OR1A 3ZZPA 2HGLA 2CNKB 5DJBA 3SV3A 3O2IA 2L41A 2HHSA 2FHJA 3EXYA 3CIZA 1R6YA 2MHEA 4ZKAA 2OPRB 3BSNA 3MMJA 1RT3A 4WK3A 2XYGB 3GCXP 2VJUA 3N5BA 1RAOA 3J7Z5 1YJ9S 2XWYA 3NL0A 2NSBA 5BYQA 5LSLA 2FB0A 2IM1A 1X9SA 3M9OB 2KFYA 2G13A 4CLPA 4JI5F 3W2VB 3W60A 1V3ZA 2R7UA 1S6QB 3OR2B 2B5JB 2YKAA 2W9CA 2EK6A 2GJIA 1SQFA 1T9XA 4PWDA 4MKVA 4F67A 1FO1A 4WBFA 5CZVA 4CH7A 3I5BA 2DRDA 4IKAA 2V0NA 2HBYB 4RBUA 3IGVA 2EFQA 5EX0A 4A47A 4D3GA 4MMOA 4IOAQ 4DSLA 5JMNA 4NYPA 5C25A 1SVDA 4ED6A 4CLWA 1Q5VA 1UPPA 2WW4A 3SSSA 3TZXA 3G4SS 4K50A 5RUBA 2RF2B 4DV7J 2MTLA 3DLJA 2BJ3A 1VQ4S 3KKFA 1WTBA 2RVJA 2VQEJ 4DHVA 1OO0B 1N5VA 2OPSA 3BGUA 2B56A 2WVCA 2V69A 1J5OB 2CWKA 4G1IA 5A8RA 2KL8A 1LK5A 1FEEA 4B3MJ 4ED8A 3VCDA 4URGA 2IPOB 3T1AA 1Y5LB 1UEUA 4Q0BB 1O8BA 1TKXB 3WX8A 4C7QA 1DTQB 4IRDA 2BJ7A 1MN7A 4CO1A 2IMWP 5F8HA 3I4HX 3LALA 2OEMA 4ZN3A 2DTJA 2K1RB 3L4BC 2ZUGA 3NAHA 2Q3PA 3TYTA 3RU0A 2W8KA 4KBIA 4WFXA 3QLHB 4IRKA 1N33J 1NK5A 4U7CA 4ZPBA 1HBOB 1NK0A 4J90A 1F9HA 1N8RT 3G9CA 2OEJA 1U48A 3VTIA 4X64F 2HRTA 2YPYA 3IR6B 3W5ZA 4CO4A 1U1OA 3CEDA 1SUQB 5IV3A 4ANCA 1RT2A 1NJIT 3JTPA 3M6VA 4RW9B 3A4TA 2W2PP 3CJ3A 3CW2C 4DX7A 5JJBA 3RB0A 2PFFB 2HNZA 5J1PA 4USUA 1Y7PA 3M8RA 1WNEA 4LR8A 1PAEX 1NK4A 2IVFB 4ES2A 3SSRA 4ELVA 4QU6A 2VG6B 3TP2A 2VQFF 2RS8A 2Y1JA 3X3UA 4ZLLA 4CLTA 3B8HA 2HWIA 1UEVA 4X84A 5JVHQ 2I9SA 2KB2A 3IGNA 2VD3A 1U8SA 4DZDA 2R8JA 1UVLA 2YKMA 3I0SB 1LWEB 3O3LA 3QIPB 1GX6A 2CPEA 3A8JA 3K8WA 3QIDA 1NBEB 3P3DA 3SCIE 2QLBB 1U47A 1HNVA 5F9LA 4ZPVR 1CULB 3W5XA 3I55S 5B0DA 1CG2A 1WC0A 4B3SJ 2IA0A 2KJWA 1F3VA 1S1WB 1RB0A 1XC9A 3H25A 4URSA 2MQOA 4NCGB 4ED2A 4B3OB 4PG7A 4K0KF 2JJ4D 4IH7A 3PIPQ 3HX9A 3AT1B 2KKHA 4PCQA 4F4WA 4RUBA 2Z58B 4KKOA 3Q8RB 2CNNB 4K2XA 3OL6A 4IO9Q 4K59A 2HK3A 3K8VA 5GAEU 3DLEA 2BACA 3RAXA 2I2YA 5F41A 2D3UA 2VZ9A 4WJBA 1VRUB 1FCAA 4DOZA 4F8RA 4GVLA 2JEGA 2R9LA 4O3QA 1DQ9A 1VHIA 1YKWA 3QZ8A 5BR8J 9ATCB 1HW9A 3IXQA 3PR4A 5J2PB 4QQBA 2CQ2A 3Q24A 3SQGA 2VQEF 4DV5F 1RHUB 5I3UB 3H7HB 1K9MT 1YBUA 2YX7A 1S48A 2H54B 3MOZA 2BDPA 1H3DA 2KM8C 3BGFA 4V19X 2LEBA 4J9UE 2MQMA 2MGZB 5D15A 1IR2A 1S1UB 2DBBA 3T1YJ 4DCOB 3G8SA 1NB7A 4OZ1A 1KQKA 2W2QP 1A9NB 3C15B 3HXMA 5DQGA 5ETSA 2XMTA 1N56A 2DGTA 1JWWA 3EZOA 5KT2A 3NS6A 4XAKA 3FZBA 3PDNA 2DGQA 4M63A 3D54A 2C3UA 1YSJA 1XQIA 5JVGQ 1GTEA 1YGYA 1VLYA 4ZHRB 1CJKA 1KVJA 1KDNA 2VA3A 5HMYA 4XTTA 3IBWA 1O5JA 2QJ3A 1DTTA 1TK5A 1V3SA 4LF7J 1LWCB 3UD3P 4X66J 4QR1A 1SI9A 3UDVA 3MURP 5F0WA 1I51B 4IO1A 1TMMA 1WKJA 3CD6S 1WG1A 1HR0F 1ZPWX 3N79A 2FIUA 2HBZB 5CQGA 4JBCA 1Y5NB 3SYZA 2GO9A 1KSPA 1JK9B 2JHEA 4USWA 2C2ZB 3UWTA 3UI3A 1NK9A 1TFYA 3N9UC 4WXWA 2JEJA 4PXEA 2JLEA 4YDXA 2JEIA 3HT0A 3EZUA 2IBKA 5HBMA 2XI3A 3PEJA 3I0RB 4ITSA 2FVQA 4ECUA 5FD1A 1KKHA 2AGPA 2XZDB 2F9DA 2WCXA 4U67Q 1RHQB 2CQIA 2DXEA 6FD1A 3RJMB 3K5OA 4KGXB 1SJQA 5L9XA 3RGIA 3MM5B 1SC3B 2VODA 3V4IB 4CNYA 3F44A 1CQMA 5AXNA 1OPIA 1NDCA 4OYBA 4WP3A 2E7WA 2E5GA 1UJ5A 5E0OA 4DLEA 2F5GA 3K5LA 3PYDA 3VAGA 1KQFB 3JSYA 4FXVA 1A7GE 2AGOA 3DXSX 1F0XA 3ET6A 2AYEA 4ZP7A 4FF1A 4FXDA 1EQMA 3CJ4A 2BYCA 2GMJA 4JI8J 4LF8F 3GE9A 5M2UA 4DV3J 1F5CA 4PYDA 1TL3A 1JIHA 1UWAA 5ITHA 3ITHA 2OHDA 1IBMF 4X4PA 3KLHB 4ICLB 3UCUP 4YB1P 4OLOA 3J7YI 3M2RB 1NH7A 4Y2KA 3KK1A 1R7IA 4XO0A 3IP0A 4P52A 4YB6A 1RWXB 2R2UA 8RUCA 5KT7A 2RQCA 1NB2A 2GC8A 2A2DA 1J5EJ 1WDDA 4W92B 3DOKA 3MR3A 1UEKA 4ECQA 2I38A 2HFOA 4ZPWR 4CRJA 2QSWA 2LDYA 3CF5Q 4I1TA 4BLGA 3AJ2A 5D77A 4NCAA 4ANDA 4NXNJ 1SC4B 3O5TB 3PRBA 3U1LA 1LFPA 5IT9U 1VJWA 2UUAF 2ZHOA 3AODA 2I5JB 2GVDA 4OJGA 1YITS 5E5NA 3DC2A 1QLNA 2QYCA 2ZH6A 5CD4H 1U4BA 5L1IA 2IBOA 4FN5A 5IT0A 1RWVB 2OPRA 3ENWA 3MAHA 4MAKA 3MFHA 2NSCA 4CO0A 1HI1A 3WQPA 4LFCJ 3BYPA 4CH0S 5EWFA 2EFOA 4M94A 1IJEB 1T95A 2B7CB 3FUYA 5KFNA 4ZPDA 1BLUA 5J2MB 1RWNB 3P5BP 2JNJA 2ASYA 3MEKA 3R97A 2R7QA 4ID5B 5KFBA 4K4SA 1HI8A 3KUHA 4PAAA 4KFBA 1U24A 4H54A 4R0EA 2E1RA 3OR2A 3TR5A 4QIWD 4DV4J 3M8SA 3KOAA 3C16B 1SPBP 2DR7A 2Z8QA 5J2QB 4DUYF 2ASLA 4RUHA 1VQ8S 4M5IA 2UUCJ 1B7YB 1VQ9S 4CT8A 2RAQA 5LT5A 1HQEA 2FZGB 1IVZA 1IKXB 2BKOA 3DGVA 4OHYA 2CJBA 4M8LA 2XZWA 3OXLA 2GMHA 3IG1B 2YWEA 2RDJA 4OZJA 3US5A 3KLGB 4LVOP 4ZVTB 3BO2A 4JI3F 3V5RA 2H5EA 1CS4B 2OFGX 3RRHA 4NI2B 2CJKA 3PRVA 3QBCA 2C2EA 3CDBA 2C42A 1EKRA 1XNQF 3M8WA 3C14B 2QG9B 2RQMA 1J5OA 2W9BA 4CTAB 2Y1RI 3D0HE 1Q78A 1PC5A 3CCQS 1RTIA 1X5TA 3VR1A 1N0UA 3TQEA 2OD6A 3BQ1A 1QVFR 2JVOA 2MDAA 3EGWB 4JI0J 4DV2F 5CYMB 4C97A 4Q0BA 1TKXA 3QT7A 4DPWA 4Y6IA 1DTQA 3KNGA 3CJKB 3JAMY 2OTLS 3MPDA 4ZCMA 2QEXS 4C2MA 4TQRA 1T03B 4ES3A 5DG9A 3MM7A 2K1RA 3AB2B 5B09A 5DG7A 4NEYA 1S72S 2GZOA 1X4CA 4M5KA 3T41A 1FDBA 4PQUA 3RBZA 4F7VA 1RTDA 4GKJJ 5I3QA 3W8GA 3QLHA 2LMIA 4I2QB 2HPUA 3HJFA 3OT9A 2RHSB 2WW8A 3OW2R 4DR4J 1DAXA 5K14A 2GS8A 1KN6A 4JI8F 1NDKA 3RW7A 1NSKL 5HLFA 4NLYA 5KT6A 1SUQA 3CT9A 3G82A 1OWXA 2UV8A 4TLRA 2YKQA 2V2KA 4DN9A 1F6TA 2JLFA 4EUVA 4RW6B 2DR5A 1RA7A 1BD6A 4B02A 2G2YA 1HWJA 4F50A 1U2FA 3AD8C 4L74A 4OV1A 5F8JA 2FLLA 1XBWA 1Y0HA 3MM6A 3IAM9 2JH3A 1HWUA 1IQTA 2BE2A 1NK7A 2PI4A 2QFJA 3CCWA 4U7UD 4FNHA 3BS9A 1B0VA 2JLGA 1AYEA 3MR5A 4MK9A 2UXBJ 5B0AA 4FYDA 2E44A 2B0GA 3NAIA 2U1AA 2PMZD 3QRRA 3I0SA 3NXZA 1LWEA 1VJQA 1P9QC 2PSZA 3EYZA 5A0YA 1FDNA 4ZP9A 4KO0A 1X0PA 3JSRA 2KH9A 1KTVA 1KHWA 3GJSB 2HZCA 1CULA 4CIOA 3JTOA 1ZPVA 1WC3A 2DO0A 3QWPA 4L72B 5C42A 2RUSA 5A6WA 1HL6A 3EVOA 1YDLA 2ZJQQ 4CZCA 1S1WA 1YVFA 1U0HB 5GAEI 4QJVA 3HVTA 1TKTB 4OHXA 4B3OA 2GHVC 4XK8C 4ED1A 1FE4A 4RZRA 1YBAA 2FUG9 3TARA 4PXBA 3UO0A 1NO8A 1SH2A 2BOPA 1QVGR 4AL5A 2BA9A 4CWBA 5HL7Q 3KTQA 1RT6B 4QR2A 4RNMA 2MXYA 1TR0A 1TTHB 3NRBA 2XMKA 2KT2A 1UWBB 2YKOA 3A3OB 2D41A 5U47A 1EHWA 4R8UB 4B3TF 3I5CA 1PAUB 4JI6F 2IVYA 4MIBA 3V6DB 1TK8A 5J2PA 4BBYA 1SL1A 4DL5A 3HZGA 4X4NA 1TL1B 1XR7A 5IM0B 1JLAB 1LOUA 5AE3A 2GAGC 1BWEA 4IDKB 1F5AA 4QOTA 2B6AB 1RT5A 2DISA 5KFGA 4ZPAA 3BYRA 4USVA 3CC2S 2BJ9A 2CQHA 1MROB 4JYAF 1AUSL 3ENQA 3GIMA 2ZHAA 3TJAA 1WDTA 2KYXA 2FQQB 2RDIA 1FXRA 4A8KA 4KPCA 2RKIB 3C6TA 2HHWA 4ZLJA 2J6SA 4ECRA 2ZITA 4FZVA 3H5SA 1FWLA 4GKKJ 3ZFVA 4RWXA 1REVA 2FJBB 2UUBF 3M32B 2MLXA 2IDLA 3DMJB 4IQMA 5JUMA 4J9OA 2JL9A 2OKQA 1ELOA 4C8LA 3CCLS 2DNGA 2LEPA 3ETOA 3MD1A 4GKJF 4DV0J 4Y2MA 5LOQA 1RWOB 2J9DA 4KJIA 1VK3A 3TNVA 3PV8A 1FTRA 3M8QA 4AQYF 5KFXA 2DPIA 3BO3A 1LWCA 3RBEA 2DNRA 3RAQA 1EARA 2HQCA 4DI6A 1RBLA 2CQGA 2Y1LB 2DY1A 1R0CB 1T94A 3LA0A 1U7LA 3PZPA 3VVTA 1WHYA 2M5YA 5DLGA 3PRDA 2V4QA 5L1KA 3EICA 1NHUA 2HW3A 2MKYA 1C0TB 3N6MA 3Q8UA 1CJUA 2CPYA 4NLWA 2DHGA 2G0IA 3I0RA 2CQCA 4J5OA 3BGRB 4DX5A 4CYUA 5LJ5Y 2B8QA 1FNXH 1BC6A 3LP0A 3VZIA 2ZVSA 7FDRA 4USHA 4V1Ak 1HARA 3H4DA 4LT6A 1NZ8A 4YR2A 2ZZMA 2SXLA 2XI2A 2HVHA 1SJRA 1PKUA 3MMBB 4DR6J 4F4KA 3GP9A 2HBQB 2FJWA 4F04B 4GO5X 2HHVA 2R7OA 4PXCA 3QT5A 4O4GA 1HD1A 4EBCA 4NXMJ 4YY3J 1IR1A 2FYXA 2JFKA 4DR5F 1DBDA 3NGUA 1C1CB 1GT8A 4LSZB 2O3DA 1G6BA 2YQ3A 3AA8A 4EO6A 3RTVA 4KPYA 3J80U 2YQ1A 4OYWA 3QRPA 3O1LA 1X4EA 4OX9J 2CRLA 4CH1A 3CDWA 2DNPA 3FMBA 3KNAA 5L8RC 1NPPA 1FDAA 1MNEA 4UTGA 2X1FA 2DO4A 2CFXA 3P49B 1S1XB 2GHWA 2LEAA 4N7TA 2RDDA 5KFDA 1UMJA 1SV5B 3CMES 1S9EB 3DLBA 1VFJA 4WFAQ 1C1BB 1RYSA 2MPUA 3GFZA 2IAJA 3MAQA 2CG8A 4ED7A 2V8VA 2NREA 2Y9HA 2C3YA 2KFZA 1HNIA 2ZUAA 1U6BA 3CCVS 1GK8A 2WVDA 3ZZZA 1LEOA 1C0UA 4IFYB 2AYGA 1B4SA 2JC0A 3C19A 2X1GA 5A8WB 4EEYA 2YWGA 4ILMA 2Z56B 5KFCA 2ZBRA 1X4GA 5AXKA 4LQ3A 2O66A 1FK9A 2W7AA 3UNGC 5KFRA 3F56A 4E2FB 1LNQA 1HNXF 3HDSA 1UFLA 4DUTA 5IOLA 1SQGA 3KLIA 1RZMA 4YR0A 3FMWA 2PEBA 5A8KB 3BSOA 2ZC4A 3DI6B 4Y0FA 5CXTA 1XTZA 2D7SA 2BQRA 3BDEA 1ZAXA 5J2MA 3PW4A 4AFFA 2MZJA 1RBAA 1LXNA 1QTNB 3FCHA 4DS4A 1N34J 2V9WA 3OTOJ 1U02A 4OHWA 4S0MA 2I0XA 2EG2A 3C16A 3I9V9 2MSTA 1X9WA 2M9KA 1WHVA 3P5TL 5HVHA 3TQ1A 1NPKA 3BO4A 4DSEA 3RR7A 3ZZ0A 1RAGB 1IKXA 2VPZB 3HP6A 2NYHA 4FVMA 2BJ1A 4H4OB 3GIKA 2ZBIA 3PO4A 1LW2B 5KG5A 4QYZK 3KLGA 3M6XA 1UA0A 2HS3A 2LECA 4TY8B 3EUNA 1BQMB 4NI2A 3BSAA 2VICA 3POTB 1IKVA 2JOQA 2PA8D 2GHPA 4IFVB 2MQPA 3M30B 5CCMA 4NLPA 3P96A 4OI2A 4CTAA 1S1VB 5DZ6A 5IXUA 4Q45A 2GNKA 2VBZA 1CJVB 1FRJA 2PMHA 2U2FA 4DQRA 4QWEA 4IQXA 2HSEB 2NCKL 1URRA 4WE1A 1IKYA 3CE8A 4P72A 2HIQA 2YNGA 5CYMA 4U9RA 5KG7A 2PN6A 1KFSA 1CQNA 1P9YA 3TJ8A 4YDDB 1RQ0A 1HHTP 1M1GA 2D9PA 4WZQA 1HLWA 3BV8A 1VCTA 4YY3F 4B3RJ 4NLGA 3TO8A 2IYIA 2FLOA 4EBEA 2DNOA 1HW8A 2APOA 1VQYA 1H2TZ 4I2QA 5GMKa 1E6YA 4LQ9A 5JXSA 1S0MA 3CCJS 5D4OA 3IFEA 4CM2A 2VBWA 1Y11A 1WEXA 2ERRA 1AT1B 1FESA 1KP6A 2Q6BA 3UW1A 3HSGA 4N77A 1BMQB 2JVRA 3I82A 2W2NP 3CD0A 1L3SA 4DPOA 1JLBA 3B54A 1K0VA 2W2MP 2QN6B 1V9OA 1IM4A 2ZKTA 1M5VC 2XULA 4LIWA 1HHQA 3CJ5A 4Q7AA 1NUEA 2XLIA 3IWXA 1P27B 2DH8A 4YHHJ 4DR2F 2RJZA 3KJVA 1H72C 1MWZA 2A6OA 4AYBD 2AJ0A 3PW5A 2WONB 4ZVHA 1UZDA 1QUVA 1WJ9A 2LQJA 4HTIA 2ZH1A 5LMNF 2FC8A 4OJ1A 3JQKA 3SFGA 5T7LA 2X7IA 3OTBA 4B9UA 4CLSA 3TAQA 1HBNA 4WU3A 3GZ7A 5ETVA 2BANB 2NXCA 4ED4A 2FTRA 2VUGA 2AIRB 1RT4B 1FE0A 2QC3A 4NLUA 1IBKF 2H9ZA 1UZHA 2LQBA 2GV1A 4QIVA 2GGPB 2QMWA 3KK3A 2AMCB 1SBRA 2F8HA 1HNWJ 3DRRB 3GSDA 3PYFA 4FS2A 2IHR1 3PFEA 2J6TA 1TL4A 4O44B 1HD0A 3GR0A 1TKTA 1TAQA 1N34F 4CO3A 2HWTA 2MKJA 4IR9A 3DGPA 2F7VA 3TUIC 3MUMP 2C2NA 2C1EB 1UAWA 4F25A 2B4UA 1NU4A 1FRHA 5EX3A 5HJXA 5B08A 1GQEA 4HH1A 1TP7A 1ZZFA 1HBUB 3FEZA 2MQQA 4LFBJ 3J7ZT 3PEHA 4DPYA 1RT6A 3R5BA 4AXIA 3ULHA 1RTJB 4N8OA 2Z2YB 5HJYA 4ZCIA 1UVKA 1GMUA 4EYHB 4R8UA 3DLGA 2VFTA 4DV6J 4F3OA 3V6DA 1X4BA 1S1TB 1IKWB 4DL7A 3T6BA 4C8OA 1TL1A 1UVNA 4JI7F 1O6XA 4ZVUB 1S9GB 4C9DA 3NMAA 3BBFA 3KYLA 2B6AA 1XN9A 5DGAA 5EHHA 4WFNQ 3EVWA 4DFJA 1FTCA 2M8HA 4OI4A 1YJRA 4R25A 3DU5A 1QAYA 3LH2S 4ZVSB 2RKIA 2OFHX 3M8ZA 1TL7A 2RRBA 3HZEA 4TN2A 1FJGF 3BREA 2HQGA 2NXUA 3LGHA 4OI6A 3S1TA 1Y10A 4NYZA 3H2UB 1R6VA 1JJCB 2IJRA 3M32A 1HWLA 4LJMA 4QYZJ 1RI7A 4NLDA 4P74A 2UVUA 4IG3B 4LBHA 2RSQA 2DNHA 4PWUA 3EPGA 3GYGA 1JMTA 2VA2A 4C8NA 1DJ0A 3R5GA 5G4DA 1D09B 5KFZA 2AJFE 3MCSA 3HHLC 1MMDA 3IRXA 2R7XA 3O6QA 1KHVA 4DSFA 1Q16B 3KLEB 4QR0A 4KV8B 4FF2A 2V2QA 3SCKE 3IR5B 5HROB 1R43A 1EAYC 4CLYA 1SQEA 2RT3A 1GH8A 3MPWA 3S6EA 4LBPA 5IWAJ 2WVFA 3V2UC 4ANEA 2XG8A 3OL9A 3QO9A 4PG8A 3B78A 1HMVB 1S0OA 1RT3B 2VU5A 4ERDA 3QFWA 3SMZA 1T7PA 2MLZA 4OJ3A 1NK8A 2DRAA 2J9EA 1YBTA 2LKZA 3OXGA 3BGRA 3UN2A 4ENOA 2OSRA 4YHHF 3BKTA 7FD1A 4PUOA 4J9NA 2EVZA 1BGXT 3VAKA 3LANA 4GC7A 1YWXA 1GMWD 1NCLA 4JV1A 4OYOA 2E5HA 1PO6A 4DLGA 4DR3J 2PIIA 4F26A 4A8WA 2VFSA 4DPUA 2ZKUA 1Y00A 2PI5A 4C0OC 2FGCA 1BQXA 1NSQA 1K44A 5KT3A 4DV1F 4LIRA 1C1CA 3PKYA 4OIXA 3MEGA 1VHFA 4ZPTR 5C25B 2VG5A 3IWNC 5IT9Y 3FRYA 4MIWA 4NLOA 2W1BA 3OV7A 1PYSB 3GONA 1RT1A 2H3EB 1AFJA 2YNIA 2LU1A 2G1HA 1NJZA 3LP2A 1WHXA 2OPSB 1SV5A 1MSWD 1U25A 4NZ0A 4KC5A 3B82A 1UVJA 5E33A 3TVZA 4M95A 2JX2A 3PW0A 3NCPA 4DL3A 3T9NA 3UVJB 1OYDA 2CQDA 4GMKA 3F41A 3GYXB 1VC0A 2E29A 1I94F 1WKKA 3PW7A 3D6MB 3ETMA 2POKA 2HFZA 3FC9A 3CUNA 3THPA 1XMOJ 3TZZA 4Q8FA 3HHLD 1R27B 2KG0A 4DU7A 3ILLA 2YKNB 4WFYA 4HT5A 5DDPC 4EFAC 5ETKA 2E1MC 1M1HA 1EZZB 2KTQA 3FGVA 3KHGA 4G3IA 4R5PB 5LJ3Y 2Z4PA 3QPIA 2QMUB 2CPIA 3CJRA 4Y00A 1RT2B 4MTPA 2AEJA 3CNQP 4ED0A 4F4XA 3DI6A 2AKWB 2HNZB 3DRSA 1I6JA 1Y5IB 4HYKA 2FLNA 4NZ7A 4KGKA 2EI5A 4PZVA 3JAMU 3WIVA 1PCAA 1KWMA 2BVZA 1U1NA 2FPHX 2FD2A 1KNZA 2J0SD 4MKBA 1SJFA 1DURA 3GG0A 4HL9A 3TAMB 1S0NA 1VBKA 2FZKB 1IUJA 5F9NA 4J9RA 4L75A 2YKMB 4E98A 2ZEJA 3AFGA 5A2QY 2V8PA 2IVMA 1WF1A 4DR7F 2XSJB 1NDLA 3GB0A 2MHNA 4TY8A 3MMCB 1BQMA 1HNVB 1K1SA 4HLBA 2FDNA 5CYJA 3VAJA 1RAEB 2CQ1A 4IFVA 5I4MA 4UUXA 4A8MP 2ZM6J 4OHZA 4LSNA 2DCUB 1UP1A 3MM9B 1CBKA 3KLVA 4IUFA 5L1JA 1N32J 1N36J 2IRUA 2MQNA 3GV5B 2CJQA 4TQSA 4A46A 2JFDA 1HKAA 1NKBA 2DHHA 4DG1B 1EIYB 4KKOB 3PHEA 4PPDA 5DM6Q 1Q86T 3D66A 2JC1A 4P75A 3EMTA 1HNZJ 2VDIA 2BE9B 2ALZA 2NR0A 3N0VA 2B9XA 2XMAA 3DLEB 3UNYA 4YEAA 2DH7A 5K20B 4MYTA 2AU0A 3MWBA 2QA2A 3R5AA 4QZVB 4X62F 3G6XA 5ADZA 3E51A 1I1GA 1TAUA 5E2QA 4B17A 1D8YA 4YFUA 3UD5A 4WTOB 3W1YC 2B43A 4RW7B 1UJ6A 2OEKA 3B4DA 2IIHA 3I9ZA 1QDUB 1ACMB 1RSCA 3CO9A 4O3PA 1WI8A 1D9FA 2IRXA 3FK4A 1RWWB 2VIHA 3CVKA 4ZOSA 2E9RX 5HATA 3IM9A 1FKAF 1Q8LA 3Q8YA 4FDFA 4B08A 4DR1F 2N7CA 4QWDA 3H0PA 2ZH7A 3JYTA 1FD8A 2XLJA 2GIRA 2WONA 4FF4A 1XMOF 4JI4J 3MUVP 3WZ0A 3R3TA 2V4JB 2HVZA 2UXDJ 2BUNA 2QL7B 1JXLA 4DU8A 1YJUA 4X4RA 3OTEA 2H4WB 2COLA 4PKDB 4FYXB 4ECZA 3A3PB 1EJ7L 2KXFA 2DD8S 1VBYA 3HFVA 5J2NB 4ES1A 1PYTA 5ETOA 3EVMA 1LFWA 3BQ2A 2R3VA 2OH2A 2QLWA 5KFSA 1D0EA 2ROGA 2EEYA 4WPAA 2MZTA 5K8NA 1TMJA 3VGVA 1MU2A 4LF5F 3TW0A 5HBMB 1Q5YA 3Q8PB 4WTYA 3FSYA 4OI3A 5F3TA 4PXDA 1FVSA 2M52A 4OZ2A 1FHTA 4F3MA 1S12A 4NPOA 1FJCA 3H98A 2O01C 1HBUA 4AUKA 3V4MA 1CPZA 4LRBA 4G6VB 2J8AA 4EZ6A 1Q0NA 3DRXA 2UVVA 1RTJA 4DPTA 3LPYA 2CDRB 1WOPA 1IM6A 3EX7B 1S1TA 1XR5A 2JDJA 4KYZA 3DDKA 2XMWA 1U1QA 1JKHA 5KFIA 3LWLA 2ZD1B 3J81j 2X51A 4CO2A 3WHIA 3OJUA 2XLKA 4X4UA 1UTAA 3ET6B 1SIZA 4NLSA 1N36F 1T0TV 2MLYA 4U6PA 1YRTA 4O23A 5D8HB 2HBRB 1TL3B 1YJVA 1AFIA 3P8BB 1URNA 2WSCC 3EE3A 2LU2A 4LF2A 4ZIWA 4N41A 4F2RA 2R7RA 3HCXA 1RWUA 4OMFG 5HMXA 4KH1B 4IG3A 1W2IA 3CD5A 4USIA 4M5JA 2LA6A 1K0TA 4DWIA 1KVIA 3ILIA 2XBPA 5G0RA 3J7YU 1FJ7A 2NLWA 2CPDA 1D3WA 2DPJA 5DQIA 1TFWA 1M5HA 2V68A 2JSXA 2RILA 4KTQA 1QY7A 2DNNA 2GVDB 5LSOA 5BJRA 4WU2A 1DZ5A 3BZQA 2WB1D 2LCWA 4X2BA 2AJ2A 3SFUA 1KTQA 2KFNA 4QCLA 2VOOA 2J0QD 1KONA 3J80Y 2QZ8A 1HMVA 4KY3A 4ECYA 3T6JA 5EWGA 5DRKA 3ZXWA 4FPRA 3OSPA 3SEOA 2ALYB 4KFBB 1RAFB 2XWXA 2OI2A 4L6V3 3GPAA 2UXCJ 1LWFA 3A3NB 4RJVA 4HACB 2B9YA 4PPZA 4CLLA 3FFIA 2XEXA 1HQEB 3CC7S 1M5SA 2BXJA 3R1LA 4FVCA 3SQOP 4J7CA 5HANA 1NJYA 3H8YA 4K5SA 2P5VA 2EFNA 2DY9A 2FVPA 3MMAA 4P7TA 1YZ7A 1SKUB 5HK4A 4RW4A 3QFHA 2L08A 2EPIA 3D2WA 3RBXA 2V67A 2MKSA 3E3XA 5HMWA 1EETA 2Z2MA 1VC5A 4A8XA 2C2OB 4NCBA 2CZVC 4PG4A 2W4CA 2W9BB 2IC3B 1U1RA 3K7RA 2VC1A 3MOJB 1RTIB 1M90T 4EZ9A 2K7KA 2HMIA 2DNYA 4QIGA 3DM2B 4WKYA 2M7SA 4PABA 2DR8A 4DUZJ 4V19J 1ULRA 2WRMA 1IWGA 1U2RA 3UVJA 4UY85 1VISA 1RAJA 3PO5A 4B9MA 1FI4A 2KO1A 3MM7B 2NZ4A 2E5LJ 2OPQB 3CCRS 2VKRA 3OL8A 1U26A 3GJQB 1U45A 4LF4F 4PQUB 2YKNA 1RTDB 3R5CA 1FRKA 4PYAA 2E1PA 1RISA 4WP8A 2Q1LA 5K14B 4R5PA 4Q44A 5HLFB 2ZH5A 2ZVIA 2X1AA 2V4RA 2KT3A 3G82B 4RX6A 3M05A 3ELHA 3R6GB 4I2PA 4P2FA 5KFJA 1RACB 3G96A 3SDEA 2GA7A 5THWA 2BABA 5KFKA 2FGOA 2XTJP 3HSZA 2CQ4A 4NLTA 2NPFA 3W66A 2FJAB 4HDGA 3AD9C 2F8MA 1JX4A 3MM6B 3LQVA 2ABYA 2N4CA 2BE2B 3AOBA 3GJTB 4WWSA 1RJJA 2ILZA 1C2PA 3ZZRA 3TWZA 5KFEA 1AROP 2NS1B 4Q8EA 3TAMA 3T5HA 2G2OA 4YMEA 3F0NA 5LXRA 3VWSA 1BUXA 2ZDOA 1PGZA 2B51A 4C4WA 2V94A 4F0KA 2RU3A 5A0YB 4KO0B 2XSJA 3R5JB 2HFNA 3SXLA 3P45B 3MMCA 3M8PB 4DX8H 3OSNA 2W8LA 4DSKA 2GFFA 3FCWA 4LF6J 2OD4A 3W65A 3D9BA 2NYIA 4A8YA 2J76E 3W64A 5C42B 5DDQC 4DPXA 3MM9A 2RS2A 4F4ZA 1RKJA 3HVTB 2HFVA 5J1NA 3MEDA 3THTA 2W25A 4DG1A 5CD4A 1KEKA 1FF2A 4UUWA 4TU8A 2HRUA 5KG6A 2BRKA 1DARA 3UDLA 1RA6A 4QW9A 2Y0SD 3A12A 2LYVA 3R7SB 2XMUA 1V5IB 1ZH5A 5C2CA 1NAQA 2QSFA 3ZZOA 1UFWA 3HK2A 3VGUA 4FF3A 3HMJG 4QWAA 2MZSA 2G1DA 1UA1A 1LKZA 1R3NA 2FJXA 1W2BR 5KG2A 3HHDA 2UV8G 4KIAA 2OSQA 3BSCA 5HVGA 3NNHA 2ZDPA 3MR2A 1B64A 4LUBA 3CWJA 4RU2A 4DV7F 3C66A 2YNHB 2ROPA 5HQ8A 5LXYA 4RW7A 1WKLA 4A8QA 1ZM4A 4AE5A 3TEHB 2AX1A 4GRSA 2Q66A 1WOSA 1N88A 4WIQA 3TVYA 1RT5B 3TI0A 2N7YA 4TU9A 5D3GB 4B3MF 4DL6A 3N6NA 3Q2SC 2GW8A 2UVRA 1SKWA 3C6TB 3T5LA 5KFFA 4DUZF 1F2HA 3THVA 2YPZA 3BR8A 1U1LA 2P9GA 1REVB 4EMDA 2JWNA 2VG7B 2G2ZA 2M88A 2A10A 4CLZA 1FXDA 3PJXA 3QWUA 3C2PA 3MZIA 4C8MA 3M9NB 2MEWA 4NMXA 3OLBA 1NJXA 1KVKA 3KMQA 2V4JA 2FHJD 4RLEA 1N33F 4N47A 2KM8B 4J37A 1FERA 4NZ6A 4FBUA 1NPRA 3M8QB 2XQCA 3LP1A 2XZTB 3JS9A 1CVJA 4NLVA 4WP9A 4H4KA 1TUGB 4YUDA 2KZZA 3ISNC 3GILA 5L38A 5F8GA 1T05B 3AH6A 3KJFB 5J2NA 4TYAA 4KGVB 3TUPA 4RKUC 4O3RA 3AY0A 2AYMA 5IC4B 2HKEA 1RKIA 2K2PA 2FZCB 3BBBA 1SB6A 2Z30B 1WACA 1CJUB 3RB6A 4ETXA 1VQ7S 4HR2A 1S77D 2XNQA 2R7VA 1AA1B 2FJEB 5KFHA 3I5AA 2XGQA 3MCNA 4CYUB 3H5YA 3BEGB 4DFMA 2Z2ZA 1Q81T 2K3KA 2UU9J 1KQGB 1UPMB 2K8GA 3LP0B 5ETQA 3W5YA 4RU9A 3HSDA 2DGWA 3DOMA 3AJDA 5E7OB 3M9MB 3IA0A 3UDEA 4LF9J 2VFVA 2HYIB 1DHMA 3MGJA 4O4GB 1VK8A 1N5SA 2ZZNA 2JEFA 1X9MA 5GAGU 1JLFB 3BB5A 4I56A 2V63A 5K8PA 1BY9A 2CVIA 2XMMA 3DRPB 2W24A 2ZD1A 2FLPA 3LTOA 2PGCA 4ECSA 3NP5A 4B3SF 1XEZA 3R8YA 2E66A 3EPIA 1UW4A 5AE1A 1XNRJ 2WZ1A 3PJ9A 3VAMA 1DLOA 2AT1B 2VPWB 3LPEA 4KAIA 2VPXB 5DZ7A 2BZ2A 2M2BA 1T3NA 5KG4A 5E3CA 5D4PA 3AHPA 2VDHA 2IAJB 2OTJS 4KQZA 3QZ7A 1RTHB 3TEGA 4OZ5A 4I6WA 1YJWS 2H5IB 1HNIB 3KHLA 4KB7A 4KR0B 2KDOA 3EDQB 3HT3A 1C0UB 1HPZA 2BW2A 3EZ5A 2R4FA 3K5NA 4LMZA 1I3OB 3ADAC 5BR8F 4TYBA 3V6JA 3QRQA 3CMQA 3ZTSA 3WX4A 4K4VA 4FBTA 2GMLA 3VAHA 5C24B 4HI1A 2DR9A 4GO7X 5F8NA 4ZA1A 4ZJQA 2QGFB 4ZJOA 2HHHJ 3ISND 1FK9B 4UOCA 4OFZA 4BWJA 4X4QA 1HQUB 1SH0A 2BX6A 3ZTOA 3CCZA 3KLIB 2AEMA 1B7FA 4LREA 3RYLA 4J9KA 2LP4A 3QGPA 1VRTA 2F4VJ 4QIEA 3T1YF 2Q79A 1Q7LB 5DO2A 2XS5A 5GAHU 3NMRA 2FHKA 3G2XA 1CJTB 4ZLPA 2QFIA 1VC6A 2HZAA 3NGKA 2AZ3A 4ILRA 1T02A 3H4BA 1HBMA 5KFYA 3RR8A 1T8EA 1FNOA 1H7XA 4TNOA 2DITA 4EWTA 4HACA 1WHWA 4YOEA 1FKOB 1OYEA 4M1KA 4DSIA 4JI5J 1ZTWA 4LF7F 4A4JA 1NSPA 4X66F 4KSEB 1OQ6A 2N3OA 3IO1A 2E7XA 3OBIA 1ZA2B 3BKFA 3E01A 3VGSA 5HVFA 2DIUA 2H5JB 1FKPA 2HS4A 1U1MA 3GJRB 1RLCL 3CCUS 1GXTA 2MSSA 4DZ6A 4X4VA 4JB8B 1IKVB 5HSPA 1LV5A 2DNKA 2M0GB 1CSJA 3FRZA 1XIQA 4KGZB 1FRXA 1Q8KA 3GU0A 2R2TA 3R6LB 1S6PA 3G86A 2IC3A 3NGDA 3M2UB 4I7FA 3GV7B 2DIVA 2UU9F 1F9EB 3K17A 3KG0A 3IS9A 2UVWA 3DM2A 4CO5A 4WE1B 1IKYB 3N28A 3BQ0A 3NOCA 2YNGB 2R7TA 4J9LA 3UPFA 1NEEA 5CH7B 3WIUA 3FSIA 2J7KA 3BBCA 1L5UA 3R5DA 1F3FA 2DB1A 4L3NA 1RWPB 1WOOA 9RUBA 1N6QA 2OPQA 2PMWA 5A2QU 5ETPA 4QBUA 1F2GA 2XMJA 3VALA 2ATLA 1Q4RA 2QO3A 2ASJA 2CYYA 1FWKA 1E6YB 2KI2A 2ZH3A 3ENAA 3OTDA 4J9VA 2PC6A 3HD2A 1XNRF 1GXLA 4ELUA 4DV3F 2XS7A 3HPOA 1FNMA 2XM3A 4P2XA 1HHSA 3NCQA 2QLFB 3KLFB 5F8IA 3KHRA 2LVWA 4URQU 1JLBB 2EKNA 2HHTA 3LW5C 4X64J 2IM2A 3J81U 5EDWA 4RR5A 1J5EF 3WC2A 3I56S 1QE1B 4ID8A 5DGBA 3C6UA 3KJVB 1YLXA 3D6FB 2PT0A 3QT8A 2W4DA 4RNNA 1FA0A 3FKBA 1S10A 4EU0A 3MECB 4NWBA 3I96A 4NXNF 3OQ2A 3GFYA 4XDDA 5T7LB 4JUZA 1JJ4A 3CJTA 2HHHF 3ZC4A 1RAAB 2VQFJ 1X4AA 3TJ9A 1HBNB 1DRZA 3OFGA 3OJSA 3MEEB 4Z7YA 1VBZA 2AP6A 3M8PA 1S79A 3RB3A 1SL0A 4LFCF 1T9UA 2DK2A 5IC6B 3KK3B 2VOPA 3C3LA 2GVZA 3PYGA 2YNFB 4YQWA 3M6UA 4W4MA 4MKAA 3D67A 4NOHA 4A8OA 3AB4B 3DGPB 4DV4F 3N6LA 4M5DA 1UW9A 2R8HA 4OI1A 3TVKA 2DCLA 3MCMA 4GC6A 5T14A 2N3LA 2XY5A 3SI8A 3MM8B 2UUCF 2BR0A 3KDNA 4NA1A 2VH7A 1VI7A 2G9OA 1RGVA 3D6HB 4HT7A 3QAEA 5AE2A 3W9IA 1V6HA 4ER8A 2FY1A 2KT5A 5IZHA 3QGIA 4K0KJ 3ICLA 1QSSA 2HQIA 3NBPB 1WD6A 1CLFA 2I6WA 4C3LA 1T3OA 5HP1A 3DLGB 4JV2A 3T3FA 3CDUA 1K1QA 3VZHA 2PE8A 1WC4A 2PDAA 2YNHA 2FHOB 4DMZA 2VV5A 1SC1B 2ZFHA 1S7IA 2EK1A 1JJ2R 1OPZA 4WYWA 4MK8A 1RHMB 4IG0A 2F9JA 5CAAA 5A6PA 3HKWA 2HLTA 4CQ1A 5D3GA 1IBCB 5AXMA 2HHQA 4K4WA 2CJYB 2AGQA 1Y3JA 1Q8BA 1BHNA 1H98A 2MYFA 1B0PA 4JI0F 1TL7B 3PR5B 4K4XA 4OZLA 4DV5J 3H59A 3Q8SB 2VKZG 2VHGA 2VG7A 4LBIA 4LFAJ 4PQAA 3WDOA 4XIUA 1YG0A 4BWMA 3R7NB 1HWIA 5F8MA 4ED3A 2IY5B 3CCSS 4ZIVA 2A0FB 1R0BG 1YRXA 1EX8A 4UT4A 1ZBTA 4FNIA 4OYIA 1YK9A 1U1PA 4DX6A 1SJ1A 4NA2A 4DR4F 2YH1A 3DYAA 5ETTA 4ZVRB 3GG1A 3IRXB 4KRWA 2GJ2A 2YVSA 4K4ZA 3CDAA 1S4FA 1WSVA 2DHSA 4LSLB 3K59A 2PFDA 3O44A 3ZTRA 1SH3A 3L09A 1T9WA 1T05A 1JB0C 2AZ1A 3PCOB 3UE2A 4P9SA 1F60B 2W7OA 1R31A 4E8UA 3TA1A 3UR3C 1X5OA 2MZ1A 1GEHA 3QO9B 4DBQA 3PG9A 3Q83A 1TVRB 4O3OA 4RNFA 2O5DA 3IWLA 1SIWB 2ZH2A 3DRYA 1T9TA 1JNRB 5K8MA 1HR0J 3LO3A 3ZZUA 1OJ4A 4QIFA 1ICEB 4RBVA 4PUOB 4NASA 2BV3A 3HHKA 2XO6A 5GAGI 1BQNA 2DNLA 2IMOA 1A0OB 2UXBF 1AW0A 1WG5A 5DETA 1HIYA 1XMBA 3HSJA 3IAS9 3D0IE 5CABA 1JXEA 2DH9A 3JXOA 2WAQD 2C3OA 2HZVA 4WCEQ 4NX9A 4OYXA 3KK2B 1R8CA 4USMA 1TELA 2RQKA 3DDNA 1RWMB 3PYEA 3PACA 4MYUA 3U1NA 3MPUB 4ZS6A 2QYGA 1JLFA 2HIYA 3FJ2A 2H48B 4N5SA 3A8IA 2PEHA 4MH8A 1F1BB 4RNHA 3MEGB 3DRPA 1PSDA 2RNEA 2VG5B 3I6PA 2OGUA 2OPPB 6FDRA 3L7PA 1VDHA 1AB8A 2HG4A 7AT1B 4EI2A 3KMSA 3NWGA 4D3HA 4OLPA 5CHCB 5D0HA 1RT1B 2XGPA 1IBLJ 2YNIB 4J9PA 3LP2B 3CCES 5MAOA 1KC8T 4QPXA 3OLAA 4ELTA 1P1LA 3MR6A 1FWPA 1L3UA 4LRCA 1RTHA 4LF8J 1WF2A 4JI1J 2GQ2A 1RHJB 3DOLA 1NM2A 5B7WA 2HHXA 2EWHA 3D28A 3LF0A 1IBMJ 4F0MA 3T9ZA 3D1QA 2MJNA 4NYOA 2MKIA 2OP5A 4MFBA 1UVIA 5KTQA 3W7BA 4OHVA 1AZSA 2HHUA 3N01A 5C24A 3AQPA 1D8ZA 4TU7A 2LQ9A 3BH6B 2XMVA 3VGTA 4NRUA 5GAHI 1I5OB 4C0BA 2YXLA 6AT1B 1MMNA 1HQUA 5D78A 1RT7B 4A8FA 4WK1A 4I4BA 1H0HB 1RCXB 1VQKS 1GNKA 2DKOB 4B9TA 4B9LA 2K7JA 5K5MA 2EFVA 3LGMA 1S6UA 2UUAJ 2D3ZA 5ETRA 4NLRA 3DRSB 4GKKF 1CJTA 1H74A 2J7WA 3A8KA 2XS2A 3OVSA 1WTFA 4MJKA 5KFUA 3DHXA 4LFAF 1DQAA 2DXDA 2HAIA 2J7UA 3ISZA 2VC0A 1FDDA 1WF0A 2VF3A 3I32A 3T1HJ 1PG5B 4DCJB 5DQHA 1EP4A 4DSJA 3CO0P 3CPWR 3UFCX 3HVRA 2R2SA 4DV0F 3PXGa 1OMSA 5GMDA 2YWKA 1NH8A 1FKOA 2QTWA 4F4AA 2BM0A 4UQTA 1APSA 1PBAA 4EK2A 3JSMA 3KJNB 3PW2A 3CGIA 3BM7A 3FBEA 5KG1A 2DR6A 1B99A 2R2RA 1L3VA 3L7OA 2DNZA 4I0WA 2AWZA 1HWKA 1R8HA 2NXNA 3RRKA 4DUYJ 2W9AA 3CDEA 4FYYB 4ZP6A 2CAJA 1JLEB 4CM0A 3MPVA 1W26A 2E5JA 4K4YA 4RWWA 1X4DA 1FXLA 3P4UB 1Q79A 5D4LA 1VR6A 3B4MA 3TA2A 1N4LA 4ECVA 1NRKA 3OPKA 4JV5J 4LSNB 1Q8IA 4DCPB 3M2UA 5IFMA 4KHRA 3I87A 1FRLA 3EXCX 4JI3J 4H4MB 5KG3A 5HMZA 4DF4A 2L48A 3MCOA 2YQ0A 4ZN1A 4F36A 1TKZB 5LMUJ 1BE4A 1QSYA 2CG4A 2HFUA 3IMQJ 1XNQJ 3DN9A 4Z2XA 2KRBA 3ZZTA 5J1EB 4DR6F 4PR6A 1VQ5S 5KAKA 4XPEA 3W9JA 3DLKA 4O3SA 1MW7A 2HNDA 4Y34A 1PJ5A 1U2CA 3LGNA 4NXMF 2MZQA 2A18A 1XMQJ 4F4YA 1NHVA 2CKWA 5B0CA 4NE9C 3T5JA 3T19A 2VPYB 5C5JA 2HGMA 2NXEA 4OX7A 1RADB 2WOMB 4DV2J 2CQ3A 4ECXA 2MMYA 4JV0A 3FBFA 1LW0A 4OX9F 4TVAB 1OSDA 1WWHA 2YWHA 2A6MA 5FJ4A 1R8PA 4OYPA 3HI9A 2HVEA 5FIIA 3QSYB 2VJVA 1H7WA 1VMBA 2CA9A 1IBLF 1TV6A 1QJHA 2GX8A 3V81B 1D9DA 1OS5A 3I31A 3KLFA 3KJQB 4ZVEA 3J7AN 1QAIA 2MY7A 3NNAA 2OJ3A 1W25A 5ETNA 2G4BA 3BN4A 1OQ3A 1VGYA 2CADA 2AF6A 2WK4A 4DL2A 5FLXY 4JI1F 2J0WA 4C11B 4ZITA 4GVBA 1E6VA 3CJSA 3MUTP 3Q22A 5BXIA 1QE1A 1RTZA 3JYTB 2QL5B 3QMQA 2AV5A 3DHWC 2DGXA 2AEFA 3TZYA 2V9KA 1IN0A 4ZVOB 3MECA 3FNNA 4K4UA 1NSAA 3UQSA 1VQPS 5F0UA 2DJWA 4USKA 2F1FA 2IJNA 3L3CA 1RUSA 2E5IA 3CB4A 4RUCA 2OMOA 5HN0A 1NJWA 3MEEA 4G1QA 3ONQA 3JQMA 4UZCA 3OFEA 4OZ3A 4UW2A 1YX2A 5BYRA 3W62A 4I6AA 1ROFA 1M5PC 2YNFA 3W61A 2J6UA 1RAHB 3G87A 4RO0A 4KH0B 2AJQA 2CQBA 2ZBPA 2UZAA 2ZJPQ 4XDCA 1S9FA 4BHQA 1X8DA 1OSCA 3R27A 1MU2B 3NOGA 2P6SA 5FDLB 3OTOF 1VOMA 5I42B 3T1HF 1KD1T 1U6ZA 3QQCD 2O1PA 2KXHA 2M3DA 5B0GA 3SCLE 4O3NA 4DF8A 1DQ8A 3MM8A 3SIPB 5L39A 2P8IA 2NQPA 2R42A 4ATNA 3OHAA 1LQ9A 3FQLA 2C22A 3W2VA 2QX0A 4AXJA 1S6QA 4HTJA 4DQIA 3BPSP 1YI2S 5DDRC 2B5JA 3AXKA 3NBPA 2RH3A 1EB0A 3FBCA 2MY8A 1JQGA 3CMAS 4YB7A 1S7HA 2FC9A 4ZPCA 2V8HA 1SJ4P 4EBDA 3Q23A 1FT8A 2GJFA 1JKHB 3NEKA 3R2DJ 2ACYA 1FD2A 1V5VA 2KVQE 1H73A 1B0TA 2LQ5A 1XERA 4JV5F 3EM1A 4B3TJ 4J91A 4USJC 4DFPA 4HHHA 1H6KX 4LRDA 2XYHB 1RU2A 4JI6J 4FPIA 8ATCB 2RF2A 1T11A 4FYVB 1MWQA 2JZ5A 4C48A 1YJTA 4WXOA 5LMUF 2RB7A 2B3TB 1RLDA 3EGZA 3K5PA 2RU9A 4UOGA 3W9HA 4ZVGA 1O0PA 4JYAJ 4B3RF 1XMQF 3PIOQ 2HK2A 4IOCQ 4OYZA 1Z4UA 1QM9A 2VASA 3R2CJ 3D1OA 2IDEA 1VQOS 2FJVA 5G0RB 4I64A 3OXFA 3IBCB 4OZ0A 1C4AA 4OL8A 2UUBJ 1WG4A 2D3O1 4UY8T 4ZVFA 2ZWOA 4C3KA 3QJJA 4C8YA 4LSLA 1SKRA 4AL6A 2BW7A 5KOXA 2HLUA 1F9FA 3FQKA 3VF0B 4DL0C 1HBOA 5KOWA 4AQYJ 3NLCA 4IH5A 5KFVA 1TVRA 3L9ZA 2ZNYA 4Y2IA 2LDIA 3AQOA 3GYNA 3CJ0A 3UR0A 4RW9A 3HHLB 2CQPA 1J27A 3K89A 3MHYA 1U6FA 1S59A 2DEJA 2WTFA 2BEFA 4Q2LA 3S8SA 3AOAA 4LRFA 4I68A 1LWFB 1R8AA 4CDIA 3M4XA 4M5GA 4FS1A 3D6TB 3DU6A 3FFIB 3KK2A 2VG6A 1NKCA 3HJVA 3EGNA 4X4SA 5GADU 2X1BA 3D3BJ 2V34A 2V50A 3FZ2A 5E3RA 1S97A 2HEKA 3ZNJ1 2H65B 2V2ZA 2NUUG 2WVBA 1G1XA 3DLHA 3MMAB 2OPPA 3ZTQA 2DNMA 1HNWF 4RW4B 3QIPA 2HRYA 2BBEA 3QNWB 4P10A 2DXFA 5KT4A 2ZBCA 1SKSA 3EWGA 3QYYA 2EFPA 2KXNB 1G2EA 1EETB 1DFDA 4DR5J 4P73A 1ZA1B 2XYPB 1RYRA 3KG1A 1RABB 1G7CB 4Q2MA 1YJ7A 2DVIA 1FFWB 4YB5A 3ZTPA 1J2VA 2HWHA 4J9SA 3H20A 2HMIB 1F5BA 4LFBF 3NNCA 3CCTA 4ZK7M 1U49A 4Y3CA 3HHNB 4NCGA 5AT1B 2C28A 2BE7D 3S7RA 1ZYQA 1SCJB 2ZBQA 3CTRA
chains in the Genus database with same CATH topology
2UP1A 4RKUC 1KFSA 2NUHA 3A1YG 4O3RA 1CQNA 3AY0A 3OR1A 4YDDB 2AYMA 1KR4A 2WSEC 3ZZPA 2HGLA 5KG0A 1RKIA 1RQ0A 1HHTP 4IYQA 5DJBA 4DV6F 3SV3A 3O2IA 2K2PA 2D9PA 2L41A 2HHSA 1KRPA 4WZQA 2FHJA 3EXYA 3CIZA 1R6YA 1SB6A 2MHEA 4ZKAA 1WACA 2OPRB 4YY3F 3UD4P 4NLGA 3RB6A 3TO8A 3BSNA 4ETXA 1VQ7S 3G8QA 1RT3A 3MMJA 4WK3A 1S77D 2IYIA 2XNQA 2R7VA 2FJEB 5KFHA 3I5AA 2FLOA 4N56A 3N5BA 2DNOA 4EBEA 3J7Z5 1YJ9S 2XGQA 1HW8A 2YTCA 1HYSB 3H5YA 1VRUA 3BEGB 2APOA 2XWYA 3NL0A 1VQYA 1H2TZ 2NSBA 4I2QA 5BYQA 2FB0A 3FVYA 3MDFA 5LSLA 4DFMA 1Q81T 2K3KA 1KQGB 2IM1A 1X9SA 1RT7A 3M9OB 3D5MA 5GMKa 2K8GA 2KFYA 2G13A 1E6YA 3LP0B 4KHMA 4JI5F 4RU9A 2B4PA 2DGWA 4LQ9A 5JXSA 2B4VA 4IRCA 5HROA 3W2VB 2YH0A 3DOMA 1S0MA 3CCJS 1V3ZA 5D4OA 1Q53A 2R7UA 3M2VB 1S6QB 3IFEA 1Z2LA 3GWCA 5E7OB 3OR2B 2B5JB 4ETZA 3M9MB 1RK8A 2VBWA 4I2PB 3IA0A 2YX1A 1WEXA 2KN4A 2ERRA 2YKAA 2W9CA 2EK6A 2GJIA 1FESA 2M8DB 3SDEB 2FVCA 2VFVA 2Q6BA 3UW1A 2ZC3A 4N77A 1X4HA 3BR9A 2JVRA 2HYIB 4HI2A 5I3UA 1DHMA 4PWDA 3MGJA 4O4GB 1VK8A 1N5SA 2CPXA 3I82A 2ZZNA 1JLCB 3CD0A 2FVSA 2JEFA 4F67A 1X9MA 1FO1A 4FXWA 5CZVA 5GAGU 1JLFB 4CH7A 3BB5A 1L3SA 4DPOA 3I5BA 1JLBA 4WIIA 4I56A 1K0VA 5K8PA 1BY9A 2CVIA 1JLGB 4IKAA 4HVZA 2V0NA 1V9OA 4RBUA 1IM4A 2MGZA 3IGVA 2XMMA 2ZKTA 1M5VC 2EFQA 1GXUA 4DN0A 2R8KA 3DRPB 5EX0A 2XULA 4LIWA 1S1UA 2W24A 2ZD1A 1P6TA 3CJ5A 4Q7AA 2FLPA 4A47A 2PGCA 2XLIA 4D3GA 4MMOA 5CCLA 4ECSA 4Y2CA 3IWXA 4DSLA 1S0VA 3NP5A 4B3SF 4IOAQ 1XEZA 4NYPA 1P27B 5C25A 2DH8A 4ED6A 4DR2F 2E66A 2RJZA 3EPIA 1UW4A 4WYLA 3KJVA 1XR6A 4CI0B 1MWZA 3MXHP 4AYBD 5AE1A 3SSSA 3G4SS 4K50A 2AJ0A 3PW5A 2WONB 1IR0A 3DFEA 2RF2B 1ZZNA 4ZVHA 3NG8A 2LQJA 1QUVA 3DLJA 4HTIA 3VAMA 1VQ4S 2ZH1A 1DLOA 5LMNF 2FC8A 2KYZA 3NKYA 4OJ1A 4C8KA 3KKFA 1Z1ZA 2VPWB 4KAIA 1WTBA 3SFGA 5T7LA 2RVJA 2VPXB 3U27A 2LXFA 4ZHRA 4DHVA 3OTBA 5IWAF 1OO0B 1N5VA 2BZ2A 2M2BA 2B56A 2OPSA 3BGUA 4P2SA 1T3NA 4B9UA 1J5OB 5KG4A 5E3CA 4YP3A 4G1IA 5D4PA 1HBNA 3TAQA 4WU3A 1FVQA 3AHPA 5A8RA 3CCMS 3GZ7A 1LK5A 1FEEA 1JLEA 2BANB 1J5OA 2FTRA 2IAJB 2VUGA 2OTJS 1KFDA 1A6LA 1RT4B 1FE0A 4KQZA 3QZ7A 4ED8A 1RTHB 4NLUA 1ZAVA 1IBKF 2EG1A 4OZ5A 3VCDA 4I6WA 1YJWS 2H9ZA 2LQBA 2ZOMA 2XO7A 3LUYA 4URGA 1HNIB 3KHLA 2GV1A 1ZM9A 4QIVA 2GGPB 4KB7A 3T1AA 4KR0B 2KDOA 2QMWA 1Y5LB 1UEUA 2UUWA 4Q5VA 1HI0P 3HT3A 3KK3A 5DM7Q 4Q0BB 1C0UB 1SBRA 1HPZA 1O8BA 1TKXB 2BW2A 4CT9A 4C7QA 3EZ5A 2PO4A 1VQLS 2AQ4A 2F8HA 4C3MA 1DTQB 4IRDA 3DRRB 2R4FA 3K5NA 5KFWA 4LMZA 3GSDA 4FS2A 5BR8F 2IHR1 4TYBA 4CO1A 3V6JA 3PFEA 2IMWP 2J6TA 1TL4A 4O44B 2J5AA 5F8HA 3MEDB 1HD0A 3I4HX 4H4MA 3WX4A 4K4VA 3LALA 4Y28C 2DTJA 2K1RB 1TKTA 1TAQA 3GR0A 4FBTA 2GMLA 3VAHA 1N34F 1ZM2A 5C24B 2ZUGA 3AA9A 4CO3A 2HWTA 2MKJA 3NAHA 4HI1A 4IR9A 3DGPA 2Q3PA 4GO7X 2DR9A 1TKZA 4EO8A 2F7VA 5F8NA 4ZA1A 3TUIC 3MUMP 3TYTA 3RU0A 2W8KA 3ISND 4KBIA 3BF4A 1FK9B 4UOCA 1UAWA 4F25A 2B4UA 5J1EA 4WFXA 4OFZA 1NU4A 4BWJA 3J81Y 1FRHA 5EX3A 5B08A 1GQEA 4X4QA 3X1LB 4HH1A 3QLHB 4IRKA 5CA5A 1NK5A 1TP7A 1ZZFA 1HQUB 4DR3F 1HBUB 2VFRA 3FEZA 1SH0A 4U7CA 3VAFA 4ZPBA 1HBOB 4O4RA 1NK0A 3UDCA 2ZE2B 2MQQA 4RW8B 3CCZA 1N8RT 3G9CA 3KLIB 3BJYA 1B7FA 3J7ZT 2Z2LA 3PEHA 1SJ3P 3HFKA 3RYLA 1U48A 3VTIA 4X64F 3QGPA 4J9KA 1VRTA 1RT6A 3R5BA 3H5XA 3IR6B 3O8WA 4AXIA 4CO4A 1U1OA 2CQ0A 3BGLA 4N76A 3ULHA 3CEDA 1SUQB 3HO1A 4QIEA 3MM5A 3T1YF 2Q79A 1Q7LB 1RT2A 1RTJB 4N8OA 3JTPA 3M6VA 5DO2A 1O51A 5I3PA 1NJIT 2WOMA 4RW9B 2XS5A 5GAHU 1NK6A 3NMRA 4ZCIA 1UVKA 2FHKA 3CJ3A 4EYHB 1QUPA 3U7JA 3OUYB 3V4IA 1KS2A 4R8UA 5JJBA 3RB0A 2PFFB 2HNZA 3UCZP 4ZLPA 2MKKA 3DLGA 2XNRA 1VC6A 2VFTA 3NGKA 5J1PA 1Y7PA 3M8RA 4F3OA 1WNEA 3V6DA 4ILRA 5KFLA 1T02A 1X4BA 1S1TB 4HH0A 2OLWA 1IKWB 3H4BA 1HBMA 4DL7A 5KFYA 3RR8A 1NK4A 2IVFB 4ES2A 2ASDA 3T6BA 4C8OA 1T8EA 1TL1A 4ZCKA 3SSRA 1UVNA 3V81A 4ELVA 3MI7X 4JI7F 1FNOA 1S9GB 4C9DA 1H7XA 3C8YA 3OHBA 4QU6A 3NMAA 4TNOA 2VG6B 3TP2A 2VQFF 2DITA 4EWTA 3VQSA 4I67A 3KYLA 2RS8A 2B6AA 2Y1JA 1WHWA 1XN9A 5DGAA 4YOEA 1FKOB 3X3UA 4ECWA 2CVEA 5EHHA 1S76D 2VBXA 4WFNQ 2D3OR 2MQLA 3OFHA 4M1KA 3B8HA 4DSIA 2Q43A 4IR1A 5E3PA 5DDOC 1ZTWA 2HWIA 2LLZA 4DFJA 4LF7F 2B4OA 1UEVA 4A4JA 1FTCA 2M8HA 2VL1A 4X84A 4X66F 5JVHQ 5EN1A 4OI4A 1VQSA 4KSEB 1OQ6A 1TUVA 2N3OA 2I9SA 2KB2A 1YJRA 3IGNA 2E7XA 1QAYA 2VD3A 3DU5A 3IO1A 4R25A 4C11A 3LH2S 1U8SA 3OBIA 2RKIA 2OFHX 3E01A 2R8JA 1UVLA 2GQQA 2YKMA 3H2VE 3I0SB 2KU7A 2KRRA 2G0CA 1LWEB 2RRBA 3O3LA 3HZEA 2DIUA 4TN2A 1D1UA 3BREA 1FJGF 3OVAA 3QIPB 1GX6A 2NXUA 3KLHA 1PILA 2CPEA 4OI6A 3S1TA 3K8WA 3QIDA 3H2UB 4ICLA 4NYZA 5AXLA 3RB4A 1FKPA 1H2UX 2HS4A 3M2RA 1U1MA 3P3DA 3M32A 3CCUS 1GXTA 2MSSA 1HWLA 4X4VA 3SCIE 4LJMA 3PJWA 1U47A 4QYZJ 1HNVA 2HGNA 5F9LA 1IKVB 1LV5A 3SSQA 1RI7A 2DNKA 4ZPVR 2M0GB 1CSJA 3FRZA 4NLDA 1FRXA 5EWEA 2VBYA 2UVUA 4IG3B 5DS7A 3E8OA 2RSQA 2R2TA 3I55S 1S6PA 5B0DA 1M0SA 2DNHA 4PWUA 3G86A 2IC3A 1CG2A 3NGDA 3M2UB 3EPGA 1JMTA