4H4MB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
428
structure length
428
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
total genus 102
structure length 428
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB03
1RT5B 1RDRA 1RAJA 1ZETA 1DTTA 4Q8EA 4NCGA 3JYTB 4MIBA 3DI6B 1RA6A 4MFBB 3MFIA 3RB0A 3I5BA 2ZD1B 1IKXB 4LQ9A 1RT6B 2IAJA 5KFDA 2AQ4A 4ECYA 3DRPB 4Q8FA 1FK9B 3NAIA 2IA6A 4HYKA 2ZE2B 3ISND 1J5OB 1C1BB 3M8PA 1EETB 5C25B 3QIPA 2D3UA 1IKYB 1RA7A 3DRRA 3QYYA 3DRSA 1FK9A 3BSAA 2C2EA 4Q44A 4K4ZA 5KFBA 2OPQB 5C24A 2ILZA 5KFKA 2R8HA 2C22A 5J2QB 1DTTB 4ED7A 3GIKA 2B6AA 1RT1B 3GIIA 1S0MA 4ZHRA 2V9WA 5F8MA 4ID5A 3RBDA 3E01B 3LAMA 2V4RA 4I7FB 5KFQA 1BQMB 3C6TA 1TKXA 3D5MA 2E9TA 2AGOA 4PQUA 3ITHB 5F9NA 3HKWA 2YNGB 3KLVA 4F4XA 2RDIA 5KFGA 2E9ZA 4K4UA 3DMJB 2YKMA 1C0TB 4K4TA 5FDLA 3KLGA 1LW0A 3UDLA 3PW5A 5KT7A 3QIDA 3M8QA 2WHOA 4NLOA 4TN2A 1JX4A 2QE5A 1TKZB 4WE1B 1T03B 3PZPA 5DGAA 1HQEB 1QAJA 3CDEA 3MEEA 1S6QB 1SH2A 1XR6A 4F4ZA 2C2DA 2XCAA 5JXSA 3G6YA 5J1EB 2VG7B 4IDKB 1TVRA 2JEIA 3FDSA 1SUQA 1JLBA 5FDLB 3PHEA 3BSNA 4ZPCA 2I5JA 2OPPA 4XO0A 5KFLA 4NLDA 2AGQA 4R5PB 3DYAA 5KFTA 4RW4B 4XPCA 4QWBA 3DOLB 4I2PB 4RNNA 4DG1B 3UQSA 4QPXA 2FJWA 4IFYB 4WFXA 3KLIB 4RUAA 2XI3A 3C6UA 4IOBA 5F8NA 3PR4A 2B6AB 2AWZA 3MEGA 3H98A 5KFWA 4IDKA 2WB4A 3T5HA 2BRKA 4QW9A 1HPZA 1LWFA 3KK1B 3DLGA 1T05A 5C25A 4J9PA 4URSA 4H4OB 4RNFA 5L1JA 1K1SA 2RF2A 3H2LA 3MEEB 1R0AB 4MK7A 2IJNA 4ED6A 3KK1A 3NGDA 3TAMB 4M94A 5D3GA 3QZ8A 4QWCA 3PJXA 1NNDA 1HQUA 1S1XA 3DDKA 1LW2B 2I1RA 5KFVA 1DTQB 3OSNA 1RYSA 4YR0A 1N5YB 1S10A 4WYLA 1JKHA 1S1VA 3PVXA 1JXLA 2OPSB 3EPIA 4PQUB 5KFAA 2YNGA 5DG9A 3MR5A 3Q8PB 3DMJA 4ECUA 3RB3A 2JEFA 4M95A 4QW8A 2FLNA 1RTDB 2J6TA 3V6JA 2HNYB 4TY8A 4HKQA 1RT7B 5DG7A 2BQ3A 4Q45A 1MMLA 4GC7A 2R8GA 1SH3A 4FS2A 3OHAA 3KLEA 1S1XB 3PW7A 4ECWA 2WRMA 3MTKA 2WTFA 5J2MA 2XCPA 4MH8A 1LWCA 3H4BA 5KFZA 3FFIB 4YR3A 1JLQA 2RF2B 1JLCB 4KE5A 5KT3A 2RKIB 3MR6A 3MECB 2UVUA 5HROA 4G1QB 1S48A 2HNZA 3DI6A 4DL5A 3KNAA 1N6QB 3CO9A 1IKXA 4J9MA 4ED3A 1T3NA 4JUZA 2AX0A 2CKWA 5KT6A 3HHKA 4DG1A 2HAIA 2IM2A 4IFVB 2W9CB 4IFYA 4YP3A 2BANB 4K4VA 1RTHA 3RAXA 4O3SA 4EYIB 4GC6A 5KG5A 5I3UA 3LANA 5KFSA 5F8LA 1TKXB 4ZVFA 4FS1A 1S1UB 5L1IA 5KFFA 1RTHB 1KHWA 4R5PA 2ZKUA 5KFXA 4K4XA 4NLRA 4Y2AA 2JEJA 5C24B 2XWYA 4O3QA 3GV7B 4IRKA 3BSCA 2UUTA 3OL9A 3CWJA 1LWEB 3RB4A 4NLQA 4RW7B 2BE2A 3BQ0A 4NLGA 1SV5B 1TVRB 3I0SA 2UVWA 4IQXA 3H4DA 3IS9A 5D3GB 3LALA 5L1KA 1IKYA 1HQEA 3OL7A 3FFIA 1KHVA 3BJYA 5C42B 3NKYA 5KG2A 3I0SB 2WCXA 1HPZB 2V4QA 4J9LA 3PJWA 4NRTA 2AGPA 1JLEA 4KB7A 5JUMA 3CVKA 4DL3A 1HNVA 4FBUA 4YQWA 3BSOA 4J9QA 5HP1A 1IKWB 5KG4A 5CYMB 3C6UB 2BR0A 1JLGA 2JC1A 2EC0A 2JLEA 1HYSB 3CJ4A 3D28A 2WONB 4B3OB 3DLKB 3QGIA 1RT4A 4URQU 4RNOA 4IG0B 3EPGA 4IR9A 2HNYA 4ZP9A 3KK3B 1ZTWA 4RW8A 5I3UB 4ZMMA 1RT1A 2WONA 4B3OA 5DGBA 4U6PA 4IG0A 4RUCA 1N6QA 1SUQB 5KFUA 3KMQA 2IM3A 5KFEA 2FVRA 2FVCA 4NLYA 5F9LA 1HNVB 4EO6A 2W8LA 4F50A 4EBCA 4ED1A 5HP1B 4MK9A 4RNHA 3M9MB 4ECXA 2R2UA 1N48A 2RKIA 3DOKA 3MECA 3HVTA 4LSNA 1ZTTA 1NHUA 4WYWA 4H4OA 3N6MA 3DRPA 1S9FA 1RT2B 3LP2A 4ICLA 4NLSA 2ASLA 1TQLA 4QWAA 1R0AA 5KG6A 1BQNB 2E9RX 1C0UA 1TKZA 4WE1A 5HLFB 4I2QA 5F8HA 4NCGB 1LWEA 3MEGB 1W25A 3QGGA 3LAKA 3JYTA 2AX1A 2D3ZA 1JIHA 1TP7A 2W7PA 3KLGB 4ECSA 3DOLA 3N6LA 1S1UA 2GIRA 3H5SA 4TXSA 4NLWA 1TL1A 4KFBA 4ZPAA 3KJVA 2C2RA 1RYRA 4URGA 2OPRB 2YNIA 3IG1B 3T19A 4NLVA 5CYMA 3MR2A 5KG0A 3T5LA 2VG6A 4O3RA 5J2NB 3HVAA 3V81A 4X2BA 5J1EA 2UVRA 2IM0A 4LSLA 4DEZA 5KG7A 1QAIA 4NLXA 3HVTB 4LSNB 3KLFB 4ZP6A 1XR7A 2ASDA 4NLTA 4ICLB 2YNFA 5CYQB 1JLCA 2FJVA 1REVB 2IM1A 2BQRA 1TV6A 3DLGB 1T05B 3GIMA 1TKTB 3DLEA 4G3IA 3NBPB 4MKBA 3Q8RB 5EWFA 1D1UA 2VA3A 3QO9B 5KFRA 1EP4A 4F4YA 4KBIA 3ITHA 4YR2A 4RU9A 3G6VA 3RAQA 1RTJB 3DYAB 4DL4A 2F8EX 1JKHB 1GX6A 4Q0BA 1HYSA 1S6PB 2XI2A 5KFIA 3V6KA 4PWDA 1RT4B 2V0NA 2R8KA 3Q8SB 3VQSA 4K4YA 1OS5A 1S9EA 4PUOB 5C5JA 4DL6A 2BQUA 3DLEB 4F4WA 1N56A 3ICLA 5KT5A 2OH2A 1BQNA 3FQKA 1KLMA 1WNEA 3N6NA 3OL8A 2IC3B 3GQCA 3V4IA 3QZ7A 2IJFA 4ECTA 4ED8A 3GIJA 3DOKB 3LP1A 1UWBB 3MF5A 5L1LA 4OL8A 3V81B 2QV6A 3BGRA 1VRTB 5EUHA 4TY9A 5F8GA 1RT7A 3KJVB 3I0RB 1C0TA 2GIQA 1S49A 5KFJA 2RDJA 2JEGA 2IBKA 2O5DA 4EEYA 4J9NA 4IH6A 2XGQA 3H5YA 4RW6B 4ECZA 3OL6A 4KV8B 4R8UB 3M9OB 4DL7A 2FLLA 5T14A 4FBTA 3G6XA 4IFVA 2I5JB 1IKWA 2FVQA 1FKOA 5KFOA 2YNHB 3OHBA 1N5YA 3SI8A 3UR0A 3T1AA 1Z4UA 3IRXB 4NLPA 1XR5A 4NRUA 3OLBA 4H4MB 1FKPB 5HROB 2YNFB 1TL3B 2VG7A 5CYQA 5C42A 1TV6B 3PW4A 1S9GB 4H54A 3BQ1A 2R8IA 1T03A 3KHHA 4Q43A 1LWCB 2CJQA 3I5AA 1RT2A 4H4MA 4EYHB 2BE2B 4TYBA 4RW9A 2W9BB 4IR1A 1LWFB 1RT3A 1RT6A 3RBEA 1LW0B 3QLHB 2XC9A 2WOMA 4IG3A 2FJXA 4NYZA 3M8QB 1YVFA 2UUWA 1JLAB 5EDWA 4J9SA 3FSIA 4O44B 1S0NA 2YNHA 3Q8QB 1BQMA 3BREA 2WK4A 1S6PA 3V6HA 3GV8B 2DPJA 2HNDB 2ALZA 4ZP8A 2BANA 4ECVA 2VG5B 4WFYA 1TL1B 4KFBB 4KV8A 4R8UA 3GV5B 3KLHA 5J2QA 3FQLA 2OPSA 1EP4B 2ASJA 2W9AA 2HNZB 5KFMA 1QE1B 2B5JA 4RZRA 3NL0A 1RT3B 1RTIA 3TAMA 3OLAA 5KG3A 3QIPB 1JLEB 3QLHA 4WXOA 4K4SA 4KO0B 3DRSB 3JSMA 1HNIB 3NAHA 3KOAA 4JV0A 1S6QA 4ZVGA 1HMVB 5HBMB 4O4RA 3LP1B 5DQIA 4QWEA 2D41A 4JV2A 2VA2A 5J2PA 2J6SA 4KO0A 3JSMB 2BRLA 2ZE2A 4WXWA 4ZVHA 4IH5A 1HMVA 3KK2B 4R0EA 4NLUA 1IM4A 4K4WA 2IMWP 4KHMA 4ZPDA 4PWDB 5F8IA 2FVSA 1QE1A 1VRUA 3SFGA 5DLFA 1K1QA 2YKNA 5K14A 4I2PA 4ECRA 2R2TA 5EWEA 5I42A 2B43A 5KT4A 3MFHA 4ZHRB 3KK3A 2ATLA 1QUVA 4Y34A 3M9NB 3E01A 4XPEA 3I0RA 4J9OA 3T5KA 4YMEA 3DM2A 3G86A 1GX5A 3V6DB 2D7SA 1N4LA 1C2PA 4ZP7A 1LW2A 3NBPA 4U7CA 4Y3CA 3PW0A 1DLOB 2JC0A 1C0UB 5HLFA 3ISNC 3LP0A 4O3NA 5KG1A 1C1CA 4EBDA 4IRCA 2C28A 2W7OA 1REVA 1C1BA 4J9RA 4Y2CA 3I5CA 1EETA 1KLMB 4WZMA 5J2MB 2IC3A 3PR5B 5KFPA 5KFYA 2GC8A 4RW7A 1TL3A 3FRZA 3OSPA 1S4FA 4K50A 4MFBA 1SV5A 4MK8A 3MEDB 5DQHA 3GYNA 1S9EB 4PUOA 2HWHA 4QWDA 3V6DA 4TQRA 5KFHA 4LQ3A 2YNIB 3IG1A 4EBEA 4WFZA 3KLIA 3H5UA 1FKOB 3IGNA 2VG6B 3IN5A 4I7FA 3KLHB 4O4GB 4Q0BB 2ILYA 1RTDA 3BR9A 2W9CA 2OPPB 3QGHA 4RW6A 2UVVA 3QO9A 4KKOA 1S1VB 4WZQA 4G1QA 3BGRB 1S1WA 2R2RA 4KAIA 4MIAA 1JLFB 1S1TA 1VRTA 3MEDA 3SFUA 5KFCA 2R8JA 4ZPBA 1IKVB 1TKTA 5J2PB 3DRRB 3V4IB 3LP2B 1JLQB 1S9GA 4O3PA 2IAJB 3IS9B 2FVPA 1IKVA 3KLFA 1S0OA 5DLGA 1HNIA 4MKAA 3KLEB 4KSEB 3EZUA 5J2NA 1DLOA 1RT5A 4KKOB 4RNMA 3E51A 3BQ2A 1S1WB 1S97A 4ED2A 4TY8B 1NHVA 4ECQA 4RW4A 3RB6A 4O4GA 4TYAA 2OPRA 3TVKA 1MU2A 2HMIB 3MR3A 2R2SA 4ED0A 3DLKA 2HNDA 1I6JA 3CJ2A 4TQSA 1U09A 2VG5A 1RTJA 1VRUB 4ID5B 3KHRA 1JLBB 2YKNB 4JV1A 3PW2A 4J9KA 4IG3B 2WOMB 1HARA 1HQUB 3KMSA 1JLAA 1D0EA 1DTQA 3KK2A 5KFNA 3UPFA 2J6UA 1UWBA 2DPIA 4I2QB 3CIZA 4NZ0A 4KHRA 4DL2A 1J5OA 4RW9B 2W9BA 3KHGA 5HBMA 3M8PB 2W8KA 3T5JA 5F8JA 5EWGA 4O3OA 3LP0B 4IH7A 5DQGA 3IRXA 3NMAA 3HVWA 1C1CB 3CJ0A 1FKPA 3IGVA 5KT2A 1T94A 2HWIA 1JLFA 1S1TB 4LSLB 2B5JB 2ZD1A 2XGPA 3H40A 4ZVEA 2YKMB 1RTIB 3H5XA 3DM2B 3CDWA 3CJ3A 3TQ1A 4IKAA 2FLPA 2AU0A 5DG8A 3CDUA 4EO8A 1SH0A 3KHLA 5L9XA 4RW8B 3CJ5A 5K14B 3C6TB 1CSJA 3GILA 1MU2B 2HMIA 4IRDA 5I42B 3H59A 4O44A 4TLRA 2OPQA 1JLGB
chains in the Genus database with same CATH superfamily
3BBCA 1RAJA 3L4BC 2R7VA 1VHFA 4Z7CA 1O5JA 4NCGA 2DGXA 3DRYA 3IR5B 3JYTB 1UPPA 3A8JA 3G8SA 1T8EA 2DISA 1DFDA 1HD0A 4LQ9A 1N34J 2IAJA 5HMYA 2M3DA 4CLPA 1S6UA 2BW2A 4ZN3A 3N0VA 1Q78A 2XMAA 2VICA 4D3GA 2ZE2B 1J5OB 2F3JA 4LIRA 1C1BB 3D6TB 2D3UA 1GNKA 5HQLA 2ZH9A 3BSAA 3HHLA 4Y00A 2RAQA 5KFBA 1R8BA 3OD2A 2ZBPA 2JZ5A 5C24A 1NH7A 5J2QB 2VQFJ 3B82A 3D0IE 3IWLA 4ANCA 2BXJA 3J81Y 2V9WA 3PKYA 1PBUA 2EFVA 5KFQA 1BQMB 3C6TA 4ELUA 5IT9U 4FXDA 1M5VC 4HACA 3PO5A 2R7TA 1RWKB 3HKWA 2YNGB 3UN5A 3KLVA 1P9YA 2RDIA 3DMJB 3FRYA 3QWUA 2ZJRQ 3VQTA 2N7CA 4K4TA 1DAXA 1VQSA 1P9QC 2DO4A 4WP9A 1Q4RA 3Q8YA 3M8QA 1V9OA 2WHOA 4NLOA 1M5PC 2HS4A 4PG6A 2QE5A 1IBLF 5DGAA 1T9VA 4NYPA 3AA8A 5IWAJ 3CDEA 2MSSA 3W64A 3NGKA 1AA1B 1FFGB 1OY9A 1P1TA 1AYEA 1KONA 2VPWB 2DEJA 1WDTA 2Q6BA 4YY3F 5DETA 3SBMA 2VG7B 1X4AA 2BW7A 2EEYA 2QA2A 4M1KA 1JLBA 5FDLB 2LDYA 2VJUA 1RHJB 1U0SA 3A8IA 4IOCQ 1PC5A 2RRNA 4ZPCA 2PIIA 2I5JA 1SKWA 2AGQA 4OYMA 3DYAA 1PCAA 4X65F 4DPTA 3GJRB 4RW4B 4X64F 1NEEA 1V3RA 4KR0B 2L41A 2DITA 2IBOA 3CIMA 3ELHA 1KKHA 2FJWA 1VCTA 4OHWA 4WFXA 5HK4A 2XO7A 1C4AA 1IWGA 1D9AA 3TYTA 4PXDA 1Y3KA 2DHSA 3NS6A 2IYIA 2OELA 3PR4A 2AWZA 2G2OA 3D0HE 3H98A 3MM5A 2YKQA 3RW7A 4IDKA 4ATNA 2LXFA 1R0BG 3JB9k 1FNXH 1HPZA 1QSYA 1T05A 2JFDA 3AOAA 4URSA 4CO2A 5IQQA 2KO1A 2RQ4A 5L1JA 1XERA 2BEFA 4XIUA 1PC4A 4DR5J 3KNGA 3NGDA 2KI2A 2P6TA 3TEGA 3OXLA 3NXZA 2ZHBA 3DDKA 2GJFA 2W4CA 2I1RA 3V4MA 1RI7A 1X5TA 1RAGB 1UAWA 4ZVSB 1JKHA 3NCPA 2HZCA 5IQ6A 2MKIA 2F8MA 2HLUA 4PQUB 3D66A 2PMZD 2VFRA 4M5GA 5DG9A 5H9EK 4ZLLA 1DZ5A 3HK2A 2KT5A 4ECUA 3TUPA 2BV3A 3MD3A 2QMWA 4A47A 3NGRA 1PJ7A 2XWXA 2VBYA 4QW8A 3V6JA 2CPEA 1RZMA 2FLNA 3MCOA 1RAFB 2J6TA 1KDNA 4C7QA 3PX6A 4OI2A 2J9DA 1TFYA 2A3JA 3EGWB 4U8YA 5DG7A 5DS7A 2QLFB 4Q45A 2R8GA 3OHAA 3KLEA 5JJBA 4FXWA 4WF9Q 2HRUA 2WRMA 2LFVA 7AT1B 3GSIA 2XCPA 4MH8A 2A2CA 2HFSA 2X1BA 1WEZA 2QN6B 3D0GE 3FFIB 1Y5LB 3R9LA 5HO4A 1KNZA 1K73T 2WVCA 3C66A 4R25A 3W60A 2QSFA 4MMOA 4RO0A 5I3PA 3MR6A 1WHXA 2GIFA 2M70A 3MDFA 4A8OA 5A6PA 2UVUA 5HROA 3GTYX 3SCJE 2HNZA 3DI6A 2FUG9 2V67A 1SJRA 5B7WA 2V5HG 1IKXA 2MHEA 3CO9A 2MZJA 4O23A 4WPAA 4UT4A 2AX0A 1CJVB 2ATCB 3M7VA 1F5AA 4A48A 5KT6A 3MMCA 4DG1A 2CPFA 3Q8UA 1N36F 3GMGA 3EWGA 5THWA 3VGVA 1E6VA 1Q16B 2HGLA 3UFCX 4EYIB 5KG5A 4OV1A 4GC6A 3BGOP 3ISZA 4ZVFA 3UO0A 4FS1A 1S1UB 4DDFA 3I82A 3KDOA 4LVNP 4CM0A 4UOCA 1RTHB 4G6VB 2QYGA 4WJBA 2B51A 5ETTA 2MLZA 4K4XA 4Y2AA 4I6YA 4F2RA 2XWYA 4WTOB 3H0PA 3GV7B 1L5UA 2N3OA 2GAHC 3PV8A 1RKJA 1FE4A 4TVAB 1NB2A 4KY3A 3JSRA 5B0GA 3I0SA 2RMLA 4DV0F 2UVWA 1S77D 3SV3A 3K8WA 2AYEA 5LXYA 2FJDB 4NCAA 3Q83A 3MPVA 1VBZA 4OFZA 3FFIA 1SJFA 1KHVA 4LBHA 5GAHI 5F3TA 4NCBA 1J2VA 3G2XA 1X5OA 4J7CA 2V4QA 4DQSA 3OW2R 4NRTA 4ETXA 2AGPA 4KB7A 5JUMA 4QR2A 4C48A 1DARA 2MMYA 3GG1A 2MXYA 4QPTA 5HP1A 1IKWB 4JI5F 1XTZA 3VALA 5LSLA 1SBRA 5K8PA 4NI2A 3GJSB 4IUFA 4C8ZA 1HYSB 4LRFA 4IR9A 1AROP 4ES2A 4I69A 3EPGA 3HJFA 1X4FA 2KFZA 1E6VB 3AH6A 1TK5A 4OHYA 4LF2A 3JAMY 3CSKA 2Q3PA 1TUGB 3IWXA 3QRQA 1RT1A 2WONA 4B3OA 2LLZA 4OIXA 5CXTA 1NJIT 4LBPA 3NNAA 1UWAA 2EC2A 4TU9A 2IM3A 3OSPA 3FSXA 5KFEA 4EO6A 2AF6A 2N4CA 3CMES 2R2UA 1AZSB 4LSNA 1VC0A 2DGWA 4CLYA 3J80Y 2HQIA 2IRYA 4Q5VA 2HHUA 3LP2A 2H54B 1M5KC 2ASLA 2W2OP 4QWAA 1FA0A 1H6KX 3FBCA 4LRCA 4HH1A 5ETRA 3EJMA 2E9RX 1URRA 3M2UA 1C0UA 3KHHA 4FVCA 4P7TA 3Q24A 1WUUA 1QVGR 2OFGX 1LWEA 2RDJA 1W25A 2CXEA 2Z2LA 3PDNA 2VHGA 3TRGA 1W26A 3PFOA 1YIJS 4QU7A 2DXFA 2D3ZA 5GAGU 5GAHU 2J0WA 1ZZNA 2AIRB 3FJ2A 1B7FA 4ECSA 3FMBA 2Q1LA 3MAAA 4TXSA 1N54B 2NXEA 3GFZA 4A8MP 4NLWA 2BKOA 3I9V9 5F0UA 2ZZNA 2C2RA 3DN9A 4USWA 4JI4J 4HH0A 4MIWA 3EE3A 1RWMB 3CCUS 3HF5A 3T5LA 2VG6A 1CC8A 1SQGA 4BC7A 2DNGA 3HVAA 3ZXWA 1IUJA 5C7PA 2FHMA 1X4HA 2H3EB 5G0RA 2QA4G 5J1EA 4X4VA 1BUXA 3J7A1 4X2BA 1FI4A 2GHWA 3I55S 3UD4P 1FJCA 3CTRA 4YDDB 2QLWA 1RHMB 4LSNB 3D6MB 2OKQA 4CLSA 3EYZA 1VQ6S 4NLTA 3R1LA 1REVB 3C19A 3MAQA 4UOGA 4IO1A 2N82B 1RLDA 3O2IA 3MUTP 2DCUB 1TUWA 3EZOA 2ZBRA 5ETSA 3CDBA 5GVQA 3ZTOA 4X4TA 4USMA 4CWBA 5EWFA 3Q8RB 1FD8A 3QO9B 2Y1RI 3HSDA 5KFRA 1EP4A 2V50A 2ZDOA 3L9ZA 4HACB 4YR2A 2YX1A 1KQSR 1TZ0A 4JV5J 2HVDA 2ZBQA 3K89A 3DGVA 2H51B 2XI2A 2KM8C 3MHYA 5BXIA 4A8KA 4FYXB 1OS5A 1XNRF 3MM8A 2XZDB 4ZPTR 4KIAA 5C5JA 3THPA 3NS5A 1N56A 3ICLA 1UFLA 4P2XA 4EK2A 3RRGA 1RABB 4LF7J 2CPYA 1HW9A 2OH2A 1PO6A 3FQKA 2J7UA 3OL8A 1Q82T 2UXDF 2AT1B 1VFJA 1S12A 5HMWA 3V4IA 2JJ4D 3GQCA 5T7LB 1U0HA 4NA3A 5J1NA 3GIJA 3HX9A 3DOKB 1N32J 3S8SA 2HKEA 1JK9B 2PA3A 4OL8A 1ZAVA 2X7IA 4DUYJ 1SVDA 3BGRA 4E0DA 1S99A 2MDAA 2QL9B 2CDRB 2CJ9A 1HBUA 5EUHA 6AT1B 5F8GA 3R97A 2JEGA 1IJFB 3I31A 4LFAJ 2UUCJ 2QEXS 1EKRA 4M5NA 2VH7A 2DNKA 4IH6A 4K4ZA 3H5YA 4RW6B 2LXIA 4KV8B 4R8UB 4DL7A 3VAGA 2FLLA 2MZTA 1UJ4A 3LWMA 4JI8J 5BYRA 4G65A 3GPAA 1FDDA 1G7CB 2XMKA 2YWHA 1CS4A 5SUHA 2FVQA 3J81U 4FBTA 4DSLA 2MGZA 2AYBA 2FD2A 2NXCA 4ZVPB 1N5YA 1ZM9A 2BJ8A 5ITHA 4F02A 2XB2D 5BYQA 1NXIA 4NLPA 2WVDA 1I94F 2YNFB 5CYQA 1IBKF 3OUYB 4EZ9A 1TV6B 1SQFA 3IXQA 2LMIA 3H25A 5JVGQ 1Y11A 1GXLA 4H54A 2R8IA 3DHXA 5K20B 1WELA 4DN0A 5A2QY 4CIOA 1TR0A 3W2WA 4NMLA 2G9OA 1LWFB 2AJ1A 1RT3A 2CQ1A 2HLTA 4YUDA 2Y3YA 3IM8A 1RB0A 3MTJA 2QYCA 3ZTPA 2XLJA 4IG3A 3B54A 2AEMA 2GO9A 1G2EA 1KVIA 3FSIA 2LKZA 1S0NA 1VQ5S 1BQXA 2P9EA 2F4VJ 1BQMA 3BREA 2DGTA 5B0AA 2DPJA 2JX2A 2OEJA 4Y65A 5DDRC 3AJDA 2BANA 3R5DA 4QIGA 1MMDA 2CRLA 3VTIA 1EQMA 2DNPA 4KV8A 4R8UA 1CJTB 1CQNA 3QAEA 4C0BA 4WKYA 1F0XA 1NCLA 2X1GA 1VLOA 1R8AA 1T0TV 2HGNA 2BOPA 1UVLA 3SXLA 4EGLA 2L9NA 4RZRA 1RTIA 4DV2F 4N41A 5A2QU 5L39A 5LJ3Y 3KOAA 2VDIA 5M2PA 4DV4J 3ZZOA 1UFWA 1HNXF 5DQIA 1CJKB 1F3VA 1FDAA 2D41A 5IOLA 2VA2A 5J2PA 4KO0A 4OZLA 4OYAA 2AZ3A 1HBOA 3VCDA 4P2SA 2XMMA 2JLFA 1QSSA 2FHJA 4DSJA 4NX9A 1M5HA 4J91A 3MMJA 3R2CJ 4XDCA 4K4WA 4M5MA 4ZPDA 1U24A 4PWDB 2J5AA 2XEXA 4IYQA 2M52A 1RP5A 4DR7J 3SFGA 3HZEA 4DR4F 5EX0A 4FP9A 3VAFA 4ECRA 2R2TA 4LF5F 4GMKA 1Q8IA 2ATLA 1IQTA 3MMAB 3E01A 3I0RA 1VMBA 4F7VA 1N5TA 3EXYA 3OTOJ 3HDSA 1C2PA 1FEHA 1RE1B 2MZ1A 4HTIA 2AJQA 5LJ5Y 1CBKA 4RLEA 1GMWA 2AKWB 5AT1B 3LP0A 1G6BA 5KG1A 4USJC 1RBLA 1VR6A 2YX4A 1REVA 1YG0A 2C28A 4J9RA 3EDQB 2R4FA 2UP1A 5J2MB 1LQ9A 3PR5B 3D67A 1SQEA 1APSA 4L73A 4GVBA 1TL3A 2C2KB 2LP4A 1L3VA 4NL5A 5DQHA 4MK8A 1YBUA 2KKHA 3AB2B 3KTQA 2NUUG 4QWDA 4OLPA 3V6DA 5HJXA 1RHUB 1VBYA 2VF3A 4LQ3A 2YNIB 1I1GA 4OYIA 2OP5A 1XIQA 4WP3A 2VKRA 4X62J 3P96A 3ILIA 2MTLA 2K1RB 1T9UA 3LWLA 2GCFA 1YDLA 2W2PP 4ZK7M 2OI2A 3OBIA 3D1QA 4RW6A 2UVVA 4F4KA 5GMKa 3D68A 2KVQE 1S1VB 4USHA 3VAIA 4M5DB 1HNWF 1BWEA 2H48B 4WZQA 3BH6B 4MIAA 4JI0F 3KWMA 2GGPA 1YITS 3MEDA 2RU3A 2A0FB 1EB0A 1S7HA 3J7YI 4ZPBA 2BOAA 4B3RJ 3SEOA 4OYWA 1NK5A 3V4IB 3LP2B 1Z1ZA 1T11A 1KQKA 3E3XA 4AT1B 4TKTA 2RQCA 3PCOB 2JOQA 5HVGA 1OO0B 1RCXB 3AHPA 1RTZA 2I2YA 3KLFA 5CHCB 1VBKA 2HGMA 1HBNA 5DLGA 1S0OA 1HNIA 4JYAF 2WW4A 1HHQA 2GVDB 3ZZTA 3PX0A 4DSIA 2JFKA 5J2NA 1CQMA 4C3LA 2UXCJ 1XMQF 1Q8KA 2KJWA 3N28A 1S0VA 2YKAA 3QFHA 3E51A 2VQEF 1TL5A 4DCJB 3W8GA 1Z2ZA 1FHTA 4W92B 4ECQA 2GJIA 2G0IA 3U1LA 5GAEU 3HM9A 4DV6F 4U7UK 1NSPA 2K1RA 2QLJB 3OT9A 2HMIB 4TYAA 1JNRB 3TVKA 4WFAQ 3DLKA 3MR3A 2HBRB 4KPYA 2K2PA 4B3TF 1U09A 1QUPA 1RTJA 3WC0A 4JV1A 4N5SA 1IQZA 3WZ0A 3TJAA 3GP9A 4KTQA 5GAGI 1B70B 1S5ZA 4ED5A 4KGVB 2NPFA 2VJVA 2C1EB 4BBYA 2G4BA 2BZ2A 5HANA 4NZ0A 4NA2A 3CO0P 2R7OA 4I67A 2GVZA 2KXFA 4EUVA 2NYHA 3KHGA 4ERDA 3T5JA 1U1RA 4DX5A 5F8JA 3CD0A 3EVWA 3OR2A 1Y9OA 1RCOB 5B09A 2G1HA 1FKPA 2O1PA 1QSLA 3TWZA 2RILA 1JLFA 3DGPB 5D77A 2ZD1A 4ZVEA 2BJEA 3MCMA 4HHHA 4P2MA 2UUBF 1TUVA 3ETMA 5HL7Q 1ZA1B 5FLXY 3TQ1A 2FLPA 1YHQS 3JS9A 1EKSA 2GV1A 5D4OA 2BJ9A 4X4OA 1YJWS 3MOZA 4TLQA 1XMBA 3R5CA 1YZ7A 2HMIA 4OQJA 4X4UA 9RUBA 5DJBA 2CQHA 3EGVA 4DZDA 4TLRA 5D0RA 3GB0A 4X84A 4CO3A 4C4WA 1RT5B 1RDRA 1ZETA 1HHTP 1DTTA 4Q8EA 2BJ7A 3HCXA 4PCQA 3DLJA 4LVOP 4RPFA 2HVIA 4MIBA 1FJ7A 1XNQF 2GFFA 3I5BA 4USUA 4YDXA 2MQPA 1N32F 2AW0A 4PG5A 3EM1A 2CVEA 4K4YA 1U6ZA 4UUWA 4YS2A 4YN3B 2L3MA 3QWPA 5CAAA 2QTWA 3J7Z5 1GMUA 4RWWA 2A6OA 5FLXU 2HFNA 3EGNA 4ZJOA 1ROFA 1UVNA 3DRRA 5G4DA 1OYEA 5EX3A 1FK9A 3SDEA 3DXSX 3HP6A 1QTNB 2R7RA 3IRWP 1NK9A 1GMWD 2RS2A 3MOJB 2OPQB 2DGVA 2WSEC 3WHIA 1RT1B 3NGSA 1FRIA 3TR5A 4DR2J 3QT6A 2WSFC 2JSXA 1SXLA 2Q43A 2ZNYA 4ID5A 3IA0A 3E01B 3LAMA 1NPPA 2V4RA 4JOUA 4OHZA 2KFYA 3T1YF 2E9TA 2CG4A 2KXHA 5E2QA 2AHOB 2LEAA 2LQ8A 3GE9A 2KT2A 4P72A 4ZCKA 2DCLA 1RBOB 2E9ZA 3GYGA 2YKMA 1C0TB 3KLGA 1LW0A 3UDLA 3M1VB 2YH1A 2OO4A 1MN7A 4FVMA 5T41A 4ZITA 2XMTA 3CJ8A 3CE8A 4TN2A 2YKOA 3W9JA 3UNGC 3FUYA 3TNVA 4P10A 3UDVA 2XS5A 3I96A 3PZPA 1H74A 3Q2SC 1HQEB 5K8NA 3DU5A 2CQDA 4HVZA 1JJ4A 2HHQA 2JWNA 1PJ6A 2MQNA 3FCHA 2CZ4A 3KDNA 4F4ZA 2C2DA 2MZRA 3R1HA 3G6YA 1J5EF 3HSGA 3AXMA 2QO3A 3CCSS 4ILMA 2RNEA 1U1MA 1UTAA 1KC8T 1N36J 1GXUA 3FDSA 1SUQA 4CLUA 3V2UC 1DBDA 1L3SA 3PHEA 2IFXA 3S7RA 4C6AA 2GMHA 2H5EA 4JI8F 4XO0A 2OAUA 3CJKA 1CJTA 4QWBA 4XPCA 4BC9A 4WU2A 4LF4F 1HQ2A 4RNNA 2BX6A 3UQSA 4QPXA 3H20A 4YB1P 2EFQA 4M5IA 3KLIB 2D9PA 2MJNA 3C6UA 3BKTA 1RJJA 3BZQA 5IT4A 1Q7YT 3SMZA 4JI1F 2B6AB 1X0FA 1K8AT 3MEGA 3L09A 4L3NA 5KFWA 1FRJA 2BRKA 1RACB 2EBGA 2MQQA 1OY8A 3HKZD 1TAUA 1HKAA 2OTJS 2PN6A 4H4OB 4RNFA 3D54A 2Z30B 1K9MT 3O6QA 1H7WA 4DR4J 4M94A 3QZ8A 3G8TA 2ZZTA 4QWCA 2B7CB 1SPBP 2BYCA 1NNDA 1F60B 1S1XA 2DH9A 1LW2B 3PJXA 2KZZA 5KFVA 1RYSA 5EGYA 2XSJA 3C14B 1TMJA 2V63A 1S10A 4WYLA 1O0PA 1V5IB 2IDLA 3GCWP 5LM7E 2XY6A 1U1KA 1JXLA 3QAUA 1RWXB 5KFAA 3EDRB 3MD1A 1WG5A 3CCMS 2YNGA 1Q8BA 4DS4A 2J8SA 3R6LB 3DMJA 1S7IA 3A4TA 5F41A 1BMQB 3ILLA 5EN1A 1VQKS 1KSPA 4PPDA 4I0WA 1HD1A 4FPIA 4O0IA 4C9DA 3NLCA 4HKQA 1WC5A 3UI3A 5A0YA 5AE3A 2C2OB 1H2UX 3IR7B 4S0MA 4F0KA 3PIOQ 3FZ2A 1X0PA 3VZHA 1SC6A 3BYPA 1Y5IB 3CGIA 2KU7A 3M2UB 4D3HA 2QFIA 2DIVA 5J2MA 1VIXA 5F0WA 4KYZA 1UCNA 5KFZA 3GFHA 1BE4A 1JLCB 4FZVA 4KT0C 5B0FA 4CI0B 2LU1A 3DDNA 5KT3A 4X65J 3MECB 1FNMA 5F3ZA 5HQMA 2WZ1A 1WTFA 1EHWA 4B9UA 1TK8A 4B3MJ 4G1QB 2A2DA 2DBBA 2YX7A 3CMAS 1N6QB 4DL5A 3T1HF 1IBMF 1Q95G 2U2FA 4LR9A 3FEYB 2BKPA 4AL5A 2V8HA 3OJSA 1YJ7A 2IM2A 1RHRB 4YP3A 2BANB 3KG1A 1RTHA 4O3SA 1WC3A 1O51A 4Z2XA 4CNZA 2MQOA 1AUDA 5KFSA 1C4CA 4CYUA 1IBKJ 5IWAF 5L1IA 3US5A 1F2GA 3D4JA 2GQQA 2Y1JA 1VQLS 1AUSL 1WF1A 3OPKA 4ELTA 4R5PA 2ZKUA 2KRBA 4NLRA 3SYZA 4O3QA 4IRKA 3BSCA 1WD6A 1VQ4S 3OVBA 4DX7A 4BLGA 3MM9A 4RW7B 2B4VA 1YRTA 4QBUA 1SV5B 1P8GA 4GO5X 1WOSA 4KC5A 4RUBA 4WTYA 3RUBL 3H4DA 1FO1A 1FRMA 5L1KA 2B9YA 2DTJA 2KL8A 1HQEA 3BV8A 3IBCB 5CCLA 4QIEA 4U8VA 2RIJA 3SSSA 1R89A 1FX2A 4LFAF 3R2DJ 4DU8A 4B9SA 3FCVA 3PJWA 4OI3A 3MMBB 1JLEA 1OPZA 1RUSA 4CT9A 5AXMA 1AB8A 4YQWA 2DNLA 4J9QA 4K2JA 1KQFB 1H98A 1JLGA 1EJ7L 2CQ2A 4P73A 2PI5A 1NJXA 3L7UA 2WONB 4B3OB 3DLKB 1HA1A 1WKKA 3N5BA 3U27A 2H5IB 4DPYA 4RNOA 2MZQA 4PYAA 4ZP9A 4RW8A 4ZS6A 3T1HJ 4B08A 3UCUP 4ZMMA 1NK7A 1YQHA 1HR0F 3SCKE 4CRJA 1MSWD 2FGCA 2QRRA 1F3FA 2CNLB 2V6AA 4RUCA 1NSQA 2VIHA 2G0CA 2Y9HA 1WI8A 3KMQA 4NLYA 1S57A 1HNVB 2W8LA 1U1LA 4HDGA 3CC2S 2HAFA 3DOKA 2K8GA 2OHDA 5E3AA 2DNMA 3THVA 4LF8J 1NHUA 2W7AA 2F40A 3ZFVA 4H4OA 3N6MA 4JI2F 3DRPA 3ZZZA 1OIAA 4B3MF 3OV7A 4ICLA 4NLSA 3G96A 1TQLA 1TAQA 2GX8A 4RU2A 2NYIA 4Q2MA 5HLFB 1TKZA 4WE1A 3R7BB 5F8HA 2HBYB 1LK7A 4DN9A 2AEJA 3EVMA 3QATA 3QGGA 3OVAA 1RWWB 3GJTB 3TO8A 4P9SA 1TP7A 2CPIA 4JI7F 1Q5YA 2RT3A 3N6LA 1S1UA 2GIRA 1SL1A 3MM6B 4YB5A 1Y3JA 5D0EA 2CQPA 4HTJA 2E7XA 1RYRA 1RKIA 2R7UA 2Z4PA 2F8HA 3TA0A 3C15B 3H90A 2LEPA 2IVMA 3BGLA 1YX2A 3T19A 2L48A 3ZZ0A 5IXUA 4C8LA 5CYMA 4PG4A 5KG0A 1YSJA 2I9SA 1IR1A 3M8WA 1OY6A 1U2CA 2R7WA 2KN4A 3ENVA 1UVMA 2PC6A 1VQYA 2QMXA 2UVRA 4JI4F 2KJVA 4ZPWR 3T6JA 1QAIA 3P5BP 1T02A 4EFAC 3KLFB 4C8MA 1X8DA 2HIQA 4ICLB 2IM1A 1K0TA 1JLCA 2M7SA 3WIVA 3GONA 2BQRA 1UVIA 2EK6A 4FN5A 5DZ7A 2XBPA 2ZH2A 3DLEA 2RH3A 1NK4A 4FYDA 2AV5A 2H65B 1LWXA 4MKBA 5L38A 2MQLA 4B9LA 2ALYB 2BE7D 1D1UA 1REGX 2VA3A 2QL7B 1Q0NA 2RVJA 1MG7A 3CJTA 1UPMB 4KBIA 3QJPA 4LRBA 2MB0B 1XN9A 5D4NA 1RTJB 4DL4A 3HO1A 4FNIA 3C16B 4DSKA 5J1PA 4UOHA 5HAOA 3W1YC 3AJ1A 1FJGJ 2V0NA 1U6FA 4KPCA 2ZM6J 3RRHA 5IS2A 2R8KA 4LF4J 4TU8A 3Q8SB 4X4PA 1MN9A 1WC0A 3Q23A 3NEKA 4PUOB 2PEHA 4FYWB 4R0JA 3RJMB 3N9UC 4WFNQ 1NMEB 4F2SA 4DL6A 3SQOP 1SL2A 3DU6A 1FF2A 4F4WA 5CABA 1U0HB 4ZVRB 1WACA 2IVYA 4B9VA 2VONA 3HI9A 2HHHJ 3J7ZT 2IJFA 3AOCA 3FSYA 3DLLQ 2XQCA 1ZAXA 3AJ2A 5D4PA 1UWBB 1F9EB 5D4LA 4DMZA 2CQ0A 1B0VA 1U25A 3V81B 1X5PA 3W9IA 2D1CA 2FDNA 5C2CA 2GA7A 5KFJA 3I0RB 2IBKA 1NRKA 3CJRA 2DKOB 4CLWA 1XMQJ 1DRZA 2ROEA 4NASA 3CW2C 4I64A 1CJUB 5BR8F 3TANA 2EWHA 2DHHA 2MKHA 3DLHA 1FKOA 2K7JA 1BLUA 3SI8A 2KHCA 3UR0A 3UDEA 3KG4A 1Z4UA 3PM9A 4Z37A 1FKPB 5HROB 3F56A 1TL3B 2VG7A 2WSCC 3W2WB 2CZVC 2HS3A 1HHSA 5FJ4A 3ZZRA 5DDOC 3PX4A 1H73A 3OFHA 4Q43A 3RBZA 3EGZA 2BVZA 2OEMA 1IM6A 4H4MA 1VJWA 1L3KA 3D3BJ 4USKA 5M2UA 3QJLA 1CLFA 2W9BB 1HBMA 4OI0A 2E29A 2HQ3A 1T3OA 1TL7A 1RT6A 3RBEA 3H2UB 2U1AA 3M8QB 5EDWA 1U8WA 1JLAB 4OI4A 2H4WB 2M8HA 2YNHA 1ITPA 1RXOB 5L8RC 3Q8QB 3SCIE 1WEYA 2EI5A 3UCZP 2M4MA 3FMWA 3FBFA 3VAHA 1PSDA 4DUZF 3MM6A 4ZP8A 4JI1J 2CNNB 1OJ4A 1FT8A 2EKYA 4WFYA 4A8XA 4X4RA 4LR7A 4OLOA 4ZLJA 4ECVA 1I94J 4MTPA 3KLHA 2BUNA 2XMVA 4JI6J 4DV7J 2OPSA 2D69A 2XLKA 4PG8A 3IMQJ 2W9AA 1EZZB 2HHSA 5KFMA 3BDEA 1QE1B 2B5JA 2QFJA 3ETOA 2ADCA 1U45A 1Q86T 3OLAA 4J5OA 1GTEA 5KG3A 3UR3C 3QLHA 2G13A 3BB5A 4KO0B 2HURA 3M05A 5T7LA 1HNIB 3NAHA 1H38A 2NXUA 2PFFB 1JJHA 1ZZFA 4NZ7A 4ZVGA 5HBMB 5LMUJ 4ZLPA 2J0XA 4AYBD 3CULA 2MQ8A 3JSMB 3AD8C 3AFGA 4XDDA 2BRLA 1PG5B 1RADB 1WHWA 1NK8A 3S6EA 4LIWA 2VC1A 2V69A 1NLKL 1U48A 4KGZB 5A8WA 2CDQA 5F8IA 3SV4A 3WQPA 2FHJD 4ZA1A 2ADBA 2WVFA 1RWNB 3LPYA 1PAEX 2P8IA 5K14A 2YKPA 4DR7F 2CPXA 3CCJS 1KOOA 2E44A 3W63A 1NBEB 2B43A 4LR8A 4NYOA 4ZHRB 4BHQA 5KT4A 3T5KA 4CLTA 3M9NB 2PE8A 2M2BA 3T41A 4Q7AA 3G86A 3FEXB 3PRVA 3M30A 3TZYA 1TTHB 2ZH8A 3NBPA 4DFMA 1VGYA 2CADA 4OZ2A 3W2VA 3T1YJ 2FZGB 1DLOB 4L74A 1C0UB 1DHMA 1UKUA 4DOZA 3K57A 1F9HA 3HHNB 3PTWA 2IA0A 4YHHF 1RAHB 2EFNA 2BJDA 3A13A 2LYVA 1LFWA 1X60A 3PEHA 6FDRA 2C3PA 4YHHJ 2HYIB 4K50A 4LFCF 3CCWA 4GKKJ 4MFBA 2PMWA 2DHXA 4FYYB 2J9EA 4GRSA 5M2RA 3GYNA 3H7HB 1S9EB 1KTQA 1X4BA 3RZAA 4Y0FA 1L3UA 2BDPA 2Z2MA 1RHQB 2HHXA 2F5GA 2HVHA 2UV8A 4EBEA 1T7PA 3KLIA 5ETVA 3H5UA 1T9WA 2VG6B 3IN5A 4OHVA 5IC6B 1UJ5A 3QGHA 4DCPB 1PILA 4OJ3A 2B8PA 2HPUA 3CPWR 1TFWA 3OFEA 4K5RA 2VUGA 2K7KA 2VZ9A 2ZHOA 3CCES 4KAIA 5E33A 5LT5A 2NLWA 1VRTA 3O5TB 1P6TA 2Z56B 2XY5A 2R8JA 5J2PB 3DRRB 1IN0A 1HBNB 1HBOB 4QQBA 3UN3A 3CCZA 4I6AA 4I68A 2FVPA 3IS9B 1U47A 2OGUA 3GR1A 4UQTA 3M8RA 5AJ3J 1RSCA 1JQGA 3FZBA 3KJNB 4MKAA 4UF4A 1YJNS 3K2YA 3QRPA 2MYFA 1VQMS 1P1LA 2F9DA 4G1PA 3IBWA 1S72S 2ZH4A 2HHTA 4KKOB 2ZOGA 3SSRA 1R6VA 2BJ1A 1S1WB 3QFWA 4LF5J 1WKJA 4JI6F 3MMAA 2O67A 1X4EA 3HD1A 1CVJA 3GIRA 2LVWA 1MU2A 2FQQB 2N4DA 1NKEA 4CTAA 1R27B 4UW2A 1VRUB 2FJEB 3LGNA 3H8YA 5ETKA 1QVFR 2DJWA 2YKNB 1W7WA 3I87A 3R8YA 2CWXA 4C0OC 1N8RT 2WOMB 3KMSA 1HARA 2DT9A 4LT6A 1D0EA 2E5GA 1GMVA 2W2MP 8RUCA 2L08A 3OR2B 1QDUB 4DXLA 1X4GA 1R6YA 1B0PA 3NWGA 4CH0S 3NMRA 2HS0A 2P2CB 2KTQA 3B78A 2DH7A 4DF4A 4DSFA 2W9BA 2QGFB 2WVBA 2YXLA 5HBMA 3M8PB 3MM7A 1WWHA 4L72B 1HI8A 4ANEA 5DQGA 5K8OA 3NMAA 4M8LA 2OD4A 1VQ7S 1T94A 1OWXA 1S1TB 2ZWPA 4LSLB 3D6HB 4HI2A 2DHGA 2PA8D 5MLCV 2BA9A 2CJAA 5HJYA 3A12A 2ZEJA 2UV8G 4U67Q 1M1GA 1VC5A 3MR7A 2GHVC 1U4BA 4AXIA 5GADU 3CCTA 3EICA 5DG8A 3CJKB 1SH0A 4NE9C 4C2MA 1YI2S 2H9ZA 1LXNA 3C16A 4QZVB 3SQGA 4RW8B 3ULHA 2FYXA 2OMOA 2B9XA 5K14B 1CSJA 1RWOB 1MU2B 3CJ5A 1ZM4A 3K17A 3MPUB 1UP1A 3B4DA 3R27A 4M63A 4CTAB 1G3OA 3PIPQ 3LOUA 3OVSA 3LTOA 4O44A 4CO5A 1RQ0A 4OX9J 2RE1A 1F5BA 3OFGA 2H4YB 1X9SA 5E7OB 3NG8A 3PXGa 3DI6B 1RA6A 3RB0A 1Q81T 2H5JB 1IKXB 3BM7A 4K2XA 4Y2IA 2IYGA 4F3MA 3SSQA 3DRPB 4ECYA 1FK9B 3R3TA 1NKCA 2HFVA 2LQ9A 3K5PA 3HT0A 3ISND 1KVJA 2VFUA 3M8PA 3MM7B 3DRXA 5C25B 2H1YA 1RISA 3QYYA 1RA7A 2LXUA 4NOHA 4KHPJ 3M8YA 3DRSA 2X1AA 1T9YA 3PY8A 3AQPA 4DR6F 3N5FA 4V1Ak 1NJWA 2E5IA 2R8HA 1X9MA 3LA0A 4ED7A 4M5DA 3K5OA 3ILOA 5AJ3F 3GIIA 1BC6A 1QTMA 3IWNC 4ZHRA 5F8MA 3RBDA 2Y0BB 3HZGA 3NWRA 1IBCB 1DQAA 4OZJA 1FNOA 3SQGB 4DF8A 2DNNA 1YJ9S 4Y28C 5F9NA 3ITHB 1M90T 1KVKA 1EAYC 2I38A 4F4XA 3DCAA 5KFGA 1VI7A 2EBEA 4FYVB 3R5GA 4DX6A 1NJZA 3PW5A 5FDLA 2DXEA 1R0CB 2W2QP 2NXJA 2OLWA 3HHLB 3RR7A 4GVLA 3JXOA 4EU0A 1JX4A 4HR2A 1GT8A 1TKZB 4WE1B 4QU6A 2APOA 3PYGA 3MEEA 5IC4B 4OX8A 3SCLE 2B7BB 1SH2A 1XBWA 1ZPWX 3Q89A 2O01C 3LPEA 4IQMA 1GFWB 1Y7PA 2XCAA 3TX0A 4P71A 3TZXA 5HMXA 1FE0A 3MM5B 2HK2A 2IJRA 3W65A 4ES1A 4IDKB 2UXDJ 4X66J 1TVRA 5E3CA 4F67A 5GADI 2JEIA 1X4DA 3MM8B 2XLIA 1M1HA 3I9ZA 3BSNA 5KFLA 1FERA 5BJRA 4NLDA 4R5PB 1U8SA 2ACMA 5KFTA 4DV3F 4CCHA 3C46A 1W2IA 3F44A 3LH2S 2MHNA 5HI7A 1JB0C 4AUKA 3R6GB 1XMOJ 4I2PB 4JBCA 8ATCB 4CLZA 2GMJA 4IFYB 1WG1A 3BH7B 5HN0A 4JI7J 4RUAA 2N7YA 2XI3A 4DV1J 1VJQA 3BEGB 2IHR1 2DR6A 4JV5F 3LO3A 4IOBA 4PEOA 3UCGA 4FKXA 2KXNB 3E8OA 4C8YA 4BCAA 3KKFA 3QPIA 2HIYA 5IV3A 1GTHA 2WB4A 3DGPA 1QY7A 4G1IA 4OZ1A 3TP2A 1LWFA 4C0HA 4DL0C 4QW9A 4C3KA 3D7SB 2DNZA 1IWAA 2RF2A 3N01A 4UOFA 3MEEB 1SIWB 5CZVA 2IJNA 4ED6A 1U26A 3KK1A 3TAMB 5D3GA 3A1YG 1D9FA 1GK8A 4V19J 1E6YB 1HQUA 3B6BA 2MGZB 1DTQB 2HFOA 4YR0A 1KLNA 1N5YB 1S1VA 5CH7B 4P52A 5CA5A 3PVXA 5B0BA 3EPIA 1K0VA 2KHDA 2PT0A 4A46A 2Q6CA 2RQKA 3MR5A 1WHYA 4NZ6A 4IO9Q 3DNCA 4AXJA 1VQ9S 2JEFA 4F36A 4M95A 2AYMA 1VK3A 4LF6F 1GQEA 4QOTA 5A8RA 1R31A 4K0KF 2HNYB 2PSZA 2BM1A 4J90A 4OX6A 1ACMB 1RT7B 2HBZB 4RR5A 4WK1A 2IRXA 3TAQA 1CJVA 2BQ3A 1MMLA 1ZM2A 4PWUA 4A4JA 1WC6A 4GC7A 3PO4A 4LF9J 3SDEB 3JQMA 3K5LA 3B4MA 2IPOB 4WU3A 2UUCF 2KH9A 1RAEB 4A8QA 3R7SB 1FD2A 4DBQA 2VKZG 2WTFA 3H5XA 2CPHA 3VVTA 4CH7A 1SJ1A 1F1BB 3H4BA 2ZDPA 3B8HA 4YR3A 3D2WA 2RF2B 2CJXB 4OJHA 3VV2B 4DUYF 3L95X 2J7KA 2VFTA 2RKIB 2V68A 4P75A 3L7PA 2R9LA 3E2EA 1FKAF 3Q2TC 1TMMA 3W8PA 4USTA 2VFSA 2E5LF 4BS2A 4W90B 4LSZB 2CQIA 4MKYA 3M1VA 3HHKA 4CYUB 1FJEB 1WI6A 3C15A 3Q86A 4JI3J 2V2QA 3WX8A 4PYDA 2V2VA 3WDOA 3OXFA 1V6HA 3QT7A 2OSQA 3PNIA 5I3UA 2D3OR 5F8LA 5LOQA 2AP6A 4NWBA 2EK1A 3FC9A 5KFFA 1N52B 4PQAA 3QNWB 2NR0A 5KFXA 4B17A 3QRRA 5C24B 4CT8A 3Q0AA 3K59A 3CWJA 1LWEB 2CG8A 4I56A 4GVBB 4DPXA 4NLGA 1BGXT 2NUHA 1B64A 4IQXA 3R5BA 4DV5J 3IS9A 3HULA 3OL7A 2V2KA 4TNOA 3K5MA 3NKYA 2B56A 2X51A 3N79A 1R3NA 4NPOA 5KG2A 4J9LA 1DQ8A 3FK4A 2DR9A 2CFXA 5IT0A 2QX0A 3CVKA 4DR2F 1NKBA 4FBUA 5E0OA 1LEOA 2FIUA 3BSOA 5KG4A 3QJJA 2PEBA 1UW9A 2GO8A 4DWIA 3A8KA 4C8OA 3C6UB 3AAWB 2ZC3A 4DV3J 1WC4A 2V2ZA 1BWVA 3D1HA 2JLEA 4F0MA 4U96A 2VASA 3D28A 2EC0A 4URQU 3PHTA 4HL9A 4K5SA 5HSPA 3EX7B 4F8RA 3P6YC 3NNCA 1RU2A 2YWEA 2XS7A 3BYRA 3PRBA 1KFDA 5I3UB 5IM0A 4N8OA 4IG0A 2W24A 2DB1A 1LFPA 3DHWC 4RBVA 1T9TA 1NM2A 3QSIA 4CLLA 3T3FA 2J8AA 5F9LA 1VDHA 4EBCA 4ED1A 1XWLA 2QIFA 4L6V3 4A8SA 5HP1B 3M9MB 1T3NA 1O8BA 3CCVS 2POKA 3M4XA 3MECA 3HVTA 1Y00A 2ZZMA 1SI9A 2HQCA 2CIMA 3GSDA 4WWSA 2NSBA 1RT2B 2Z8QA 3KG0A 3R5JB 4ZIVA 1NJYA 2OSRA 4LF9F 4FF1A 1RWVB 3DOMB 1BQNB 2GJ2A 5DO2A 3BO3A 4I2QA 1NDCA 4OZNA 4NCGB 1LKZA 3RGIA 9ATCB 3JYTA 1UMJA 1FXLA 1UEVA 2AX1A 2QG9B 1VC6A 1JIHA 2ACYA 4DQRA 2Z2YB 3NOCA 3KLGB 3GJQB 3L7OA 6FD1A 2EKNA 4OYBA 3H5SA 1VQ8S 1RGVA 2E7VA 3MGJA 3NP5A 4PAAA 4ZPAA 3PFEA 3KJVA 1WHVA 4QJVA 2OPRB 4BDPA 1YGYA 5JMNA 1ZM3A 3IG1B 3ADAC 4YEAA 5ADZA 5HQ8A 2F9JA 4ZJQA 4NLVA 1RLCL 3GR0A 5AXNA 3JSBA 3CEDA 4ID8A 3MR2A 2AYGA 5J2NB 3ENQA 4ZVQB 2RSQA 2EXUA 2KVIA 1J5EJ 2IM0A 1B4SA 1FESA 1HBMB 1N5SA 2XULA 4KQZA 3UD5A 4DEZA 5KG7A 1MW7A 1N0VC 4NLXA 3HVTB 4QIVA 2X3GA 4JI5J 1DQ9A 4ZP6A 1NSKL 2ASDA 4N7TA 3ZTQA 1U2RA 3P5TL 2DNYA 1NSAA 4CLKA 3KFWX 1ZA2B 4LJMA 4RKUC 4CQ1A 3ILJA 3DLGB 4DV6J 1XQIA 5FD1A 4DR5F 3VVUA 1TKTB 1HWKA 1FFWB 2E1RA 2NS1B 1FRXA 4G3IA 1CS4B 2G1DA 3RTVA 1XMOF 1FRKA 2FZKB 1RK8A 1N0UA 2ZOMA 4QYRA 3MURP 4X64J 2VV5A 2B8QA 3IM9A 1S76D 1F5CA 2CPZA 1N33F 4F4YA 3NOGA 3ITHA 4PG7A 4RU9A 4HT5A 2V8DA 2ZVSA 3G6VA 4QYZJ 4X66F 1GX6A 1ZH5A 4Q0BA 1S6PB 4PXEA 1RT4B 4Q8FA 1NAQA 1BD6A 2DXDA 3G8QA 4H4KA 3M2VB 1UEKA 4OZ3A 1NK6A 1S79A 2E5JA 3GYXB 4OX7A 2HHWA 4PR6A 2C3YA 2A1BA 3BGFA 1UFKA 5K9FA 4HDHA 2BQUA 1HR0J 3W5XA 3VWSA 1FXDA 3D6FB 2E5HA 4CLFA 3G4SS 3JQJA 1WTBA 5C2GA 2AJ4A 2E5LJ 3N6NA 1UA0A 1J27A 3QZ7A 4C11A 1SKUB 2IIHA 3CNQP 1M0SA 4AFFA 4ECTA 3O44A 3LP1A 1V3ZA 3PYEA 2JVOA 1B3TA 2FY1A 1NZ8A 2EG1A 4ETZA 2DD8S 2EG2A 5L1LA 2CQ3A 5ETQA 2QV6A 3BF4A 5D6GA 1F2HA 2HSEB 5FIIA 4TY9A 3RR8A 5A0YB 1C0TA 1JXEA 2DNRA 2GIQA 2MKJA 2OFHX 1VOMA 2PO4A 3FCWA 4ZJLA 2O5DA 3T9ZA 3CCQS 4LF7F 1FDNA 4J9NA 4ILRA 2AEFA 4N56A 3I32A 2XGQA 1ULRA 2VQFF 3CCLS 3OL6A 5CQGA 2O66A 2COLA 5T14A 1U1QA 3F41A 3G6XA 3EZ5A 4IFVA 4LF6J 2I5JB 1IKWA 4KHPF 3TA2A 3MPWA 3OHBA 2XMWA 1XR5A 2PGCA 2I6WA 1LNQA 4H4MB 4B3SF 4C8KA 1B0TA 4KGKA 3OTOF 2E1PA 2JH3A 3PW4A 1UETA 3HJVA 1S9GB 2BBEA 2A6MA 2E1CA 2JNJA 3NGTA 1T03A 1R43A 2Z2ZA 4MJKA 1LWCB 2CJQA 3I5AA 3QBCA 1RT2A 4RJVA 1KEKA 1UZDA 2KG0A 3ZZYA 4EYHB 2BE2B 2JRSA 4RW9A 4TYBA 4C98A 2DGUA 2CQ4A 2JL9A 3HXMA 2PI4A 3CD6S 4PZVA 2LU2A 2ZITA 2XZWA 5HATA 1LW0B 4AE5A 3HVRA 2XYPB 3CUNA 3W5ZA 4LF1A 3U1NA 4CP5A 1NPRA 4W4MA 4DPUA 1WNEA 2KFNA 3OTBA 4O44B 1G1XA 4QYZK 1VIOA 1IJEB 1GXTA 1I51B 2WK4A 2WAQD 2KRRA 3H2VE 5D0GA 5LL6d 2HNDB 3FBEA 3CXCR 2MJUA 3VAKA 4AL7A 3F0NA 4OI1A 2XHWA 4DJBA 2KM8B 3MUMP 5J2QA 3FQLA 2QJ3A 3RAMA 2DYAA 4E98A 2ZH5A 2ASJA 2HNZB 3TX8A 4HT7A 4WKRA 2Y1LB 4F26A 1HBUB 2LA4A 2HEKA 1RT3B 2QSWA 1UEUA 2IVFB 3NL0A 1JLEB 1JWWA 1T95A 3JSMA 3DRSB 1SC4B 5L9NA 3LGHA 3MZIA 4JV0A 1KBRA 5LMNF 4ER8A 1QLNA 4UY8T 2CJYB 2PDAA 1YJVA 1VQOS 4B3RF 1TELA 1HMVA 3KK2B 1IR0A 2HQDA 4IH5A 4OYXA 4R0EA 4Y6IA 2F4VF 4ENOA 1IM4A 1KRPA 4B9MA 4KHMA 2RHQB 4JP8A 3W5YA 2QA1A 1IBLJ 3G71S 3FEZA 1VRUA 4P6QA 3WBZA 1K1QA 2YKNA 3NY0A 4WFBQ 4DR1F 2MKYA 1ZYQA 1UVJA 4I2PA 2C42A 2GMLA 2HVZA 3BBBA 5I42A 1U1NA 2CJKA 3KK3A 5B0CA 3FKBA 4XPEA 3MPYA 4X62F 4J9OA 3DM2A 3CJSA 1GX5A 3V6DB 4Z7YA 3VGUA 2HRTA 2B0GA 4FKYA 4DR3F 1LW2A 2A10A 1I3OB 1NU4A 2VBWA 1IR2A 2GVDA 2XSJB 3QQCD 3PW0A 2HBQB 2XYGB 3JSYA 5HLFA 2HHVA 3ISNC 1X4CA 3K58A 1KN6A 1L3TA 1U2FA 3KUHA 2XO6A 4IRCA 2MLXA 4OYZA 5AXKA 2W7OA 2HQGA 1Q79A 4Y2CA 1EETA 1MROA 3AY0A 2FHKA 3CF5Q 1PIEA 5U47A 3OTCA 2YWWA 5KFPA 5KFYA 1YKWA 2M8DB 2GC8A 3FRZA 2GQ2A 3MEDB 3JTNA 4MAKA 2HWHA 4ANDA 1WJ9A 2CJBA 2YY3A 4TQRA 4TU7A 1W2BR 4M5HA 3M6VA 4WFZA 4ILLA 4LFBF 1FKOB 1HWLA 3IGNA 1SCJB 4MT1A 2OEKA 3I4PA 3C8YA 4H4KC 4I7FA 2EFPA 3KLHB 4O4GB 1KWMA 4Q0BB 2CA9A 2ILYA 2DNHA 2F63A 2ZC4A 3POTA 1SC1B 3CB4A 4E8UA 2LA6A 3BR9A 3SIPB 2OPPB 2W9CA 3IAM9 4USVA 2CNKB 4HI1A 4B3TJ 5E3QA 4N76A 1JXVA 3TAPA 1HI1A 1BXNA 1P27B 2QLBB 1FTRA 3TZWA 1UVKA 4G1QA 3BGRB 3PYFA 2O3DA 3TW0A 1JLFB 3K5NA 2MZSA 3AQOA 1HNZF 2OMLA 3W61A 1CG2A 2VODA 3TOQA 4JYAJ 5CD4H 3M6UA 3T9NA 1SL0A 3TVYA 1S9GA 3ET6B 2IAJB 2MKSA 5BR8J 1IKVA 4WCEQ 2RRAA 3KLEB 2AJ0A 4FNHA 1N33J 3IP0A 4WBFA 2ROPA 1RT5A 1SKSA 4LRAA 4RNMA 2NREA 5IT9Y 4HLBA 2LQJA 1ZBTA 1D8YA 1RAOA 1S97A 5AE1A 2WB1D 1NHVA 3G87A 2V9KA 3VZIA 2R3VA 4O4GA 2OPRA 2R2SA 2V34A 2HNDA 3G82B 2E1AA 1HLWA 5CYJA 2RDDA 1OQ6A 1YZ6A 2VPXB 1JLBB 5SZTA 5ETLA 3U02A 4LFBJ 1CULB 3AB4B 2DGSA 3VHQA 3ZTRA 1ZS6A 3MMCB 1XNQJ 5D8HB 3JTOA 4IG3B 3RU0A 5I3QA 3P45B 1WEXA 1Q1KA 1BY9A 5HVHA 1KOHA 2W1BA 5KFNA 5LMUF 3HFKA 3UPFA 1UWBA 1MWQA 1YLXA 3CIZA 1KTVA 2VB6A 2GZOA 2DPIA 4Q2LA 4KHRA 4FF3A 2FY8A 3EXCX 2P9CA 4CO4A 4RW9B 3W62A 4DL2A 1NB7A 3OTDA 2QT7A 1ZPVA 2N3LA 3AD9C 4ED4A 4IH7A 3IRXA 5A6WA 1C1CB 3CJ0A 3O3LA 1SC3B 4FF4A 2RU9A 2DO0A 3MCSA 3QT8A 3H40A 2UUAF 2Q66A 2YKMB 3PEJA 1RTIB 2FZCB 2E7WA 2MY7A 7FD1A 2DR8A 1CJUA 2EVZA 2AU0A 3CDUA 4EO8A 2HHPA 2VPYB 4ZVTB 4A8WA 3KHLA 4A8FA 4O0NA 4WK3A 5L9XA 2M9KA 3VGTA 1XK8A 2RHSB 4I6WA 3GILA 1TK0A 4IRDA 1CC7A 4CNYA 2VPZB 1RAIB 2A18A 3G82A 4DHVA 5I42B 3MCNA 3OFFA 2XY7A 2MEWA 1KS2A 1U1PA 1U49A 2HRYA 4DR1J 2OPQA 2LEBA 4FF2A 3M8ZA 2R7XA 1ELOA 4ZCIA 4DUZJ 2V8GA 3PRDA 3MFIA 4MFBB 2M0GB 2ZD1B 4KH1B 3C2PA 2DGQA 1RT6B 3OQ2A 2JDJA 5KFDA 3ENAA 1WF0A 2AQ4A 3NAIA 2IA6A 1IXKA 2ZKTA 3UNYA 1TL4A 4F25A 4HYKA 1VQPS 2JHEA 2HW3A 1EIYB 1GAOA 1EETB 1MROB 2YWGA 5H9FK 1NPKA 3QIPA 2SXLA 1IKYB 4YB7A 1CPZA 1PAUB 2VD3A 5HMZA 4DV4F 4DFPA 2C2EA 4ALZA 3AXKA 4Q44A 4OJGA 1HWUA 2KT3A 5K8MA 2D3O1 1PYTA 5KFKA 2ILZA 4KH0B 1WG4A 1Y5NB 1H2VZ 2RB7A 1DTTB 2C22A 3GIKA 1M5OC 2B6AA 4OHXA 4X4NA 4FXVA 1B99A 1S0MA 5JVHQ 3CDAA 5DZ6A 4I7FB 2UU9F 3D5MA 4W98A 1TKXA 3CMQA 3POTB 2C3MA 1YJRA 4OI6A 4P74A 4PQUA 3TUJC 3AD7C 3IBFB 2AGOA 3J7AN 2R7SA 2YTCA 2K06A 1HNZJ 4K4UA 3W7BA 2NCKL 4P2FA 5I4MA 1KD1T 2NPIA 5LXRA 5KT7A 2P9GA 2FB0A 3QIDA 3ZNJ1 1HNWJ 1NZAA 4NXNJ 1WSRA 2YQ3A 3BR8A 2FJBB 3PACA 4ZPVR 1T03B 1SB6A 3DDIA 2KDOA 1SJ3P 4UTGA 3EVOA 5E3PA 1NDPA 1QAJA 1JMTA 2NSCA 3DXBA 1S6QB 3BN4A 3V5RA 2J7WA 2RS8A 4F4AA 1XR6A 2XMUA 5A8KA 3GCXP 2CQBA 5JXSA 4GO7X 2MKKA 4CH1A 4JI3F 2MPUA 5J1EB 3A3OB 2CUYA 4CM2A 4B3SJ 2LDIA 2HHHF 3X3UA 1LOUA 2XGPA 3M8SA 3VAMA 2Y1IA 1HIYA 2CVIA 1R8HA 2QC3A 2XYHB 4C8NA 2OPPA 4ZVOB 1AW0A 2LQBA 1URNA 2DHAA 1PJ5A 3DOLB 2I0XA 2ZH1A 4DG1B 4QCLA 1CEZA 2MQMA 5D15A 1WC1A 4OV6A 4DFJA 4OYOA 4LRDA 5F8NA 2J9DE 2BM0A 3I6PA 1Z2LA 1JJCB 3BO4A 1TKDA 4DPWA 1AFJA 2MLYA 1FVQA 2RD5C 2WVEA 2Y8WA 2V8VA 3KK1B 3DLGA 4J9PA 5C25A 3THTA 5B0DA 2DK2A 1K1SA 4K59A 4C11B 4F3QA 3G6ES 2VBZA 3H2LA 4EI2A 4MK7A 1R0AB 1FTCA 3RYLA 4QIFA 2KYZA 3T6BA 1FWLA 2DRDA 5ETMA 4ZN1A 4CDIA 2ZHAA 3OSNA 3MPDA 2VC0A 3W3SA 3KYLA 3JAMU 1H0HB 4Y2KA 2OPSB 4YFUA 3QMQA 4UUXA 4DZ6A 5A8RB 2EFOA 4FDFA 3Q8PB 2LQ5A 2W01A 3TUZC 3RB3A 1U1OA 3WX4A 1HNXJ 2PFDA 8AT1B 3UVJB 1DJ0A 2UXBF 3GU0A 1RTDB 3TEHB 1RBAA 2V8PA 3OTEA 4TY8A 3LUYA 2DR7A 1QAXA 2P6SA 1MWZA 2IRUA 2J76E 3JTPA 3TJ9A 4DSEA 1MWYA 4HHJA 3Q22A 1SH3A 4OZ5A 4FS2A 1FDBA 1S1XB 3BBFA 4AQYJ 3PW7A 4ECWA 4RBUA 4IOAQ 3DOMA 3D3CJ 3MTKA 3MI7X 1V5VA 4ES3A 2B9WA 1XC9A 1LWCA 2FPHX 3FGVA 4YOEA 2NZ4A 1JLQA 2IMOA 3M32B 1R7IA 4KE5A 1AZSA 4DV5F 2OJ3A 1NUEA 3KXDA 2VOPA 3NS7B 1GH8A 1FRLA 2BJ3A 3CD5A 3OJUA 5G0RB 2J9CA 5RUBA 1UA1A 2XNRA 1S48A 1PYSB 2ABYA 1B7YB 2GGPB 4ED3A 2ERRA 4JUZA 1N88A 2CKWA 4ELVA 3K0JA 2HAIA 1HL6A 4IFVB 1LK5A 4IFYA 2ZFHA 4YY3J 4M5LA 3R7NB 2W9CB 4DLEA 3RAXA 4K4VA 4WIQA 2R7QA 2QL5B 2B4OA 2FLOA 3LANA 3TVZA 1TKXB 2ZM6F 3HSJA 3Q8VA 5ETPA 4OMFG 2ZUGA 1KHWA 2IDEA 3P4UB 2JEJA 3C14A 1QM9A 2B4PA 2UUTA 3OL9A 2M5YA 3MEKA 3RB4A 4NLQA 2NZCA 3U1MA 2BE2A 3BQ0A 1TVRB 2MSTA 5DDPC 1SJQA 2F65A 4U9RA 2VOOA 2FJAB 5D3GB 3LALA 3M2RA 1IKYA 1X31C 2XMJA 3TA1A 2HZVA 4DX8H 2GS8A 1QAYA 2Z0GA 1I5OB 3C3LA 3BJYA 4F0HA 5C42B 1HI0P 3I0SB 4ZCLA 2WCXA 1HPZB 3VAJA 4A8YA 3IO1A 4DL3A 2ASYA 4WIIA 1HNVA 3HFVA 2MKCA 3NCQA 1SJ4P 5CYMB 2YH0A 1SIZA 2BR0A 2EW9A 2JC1A 2IY5B 3BGUA 4K0KJ 2DIUA 3CJ4A 2Q79A 1IVZA 3QGIA 1RT4A 2C3OA 2KB2A 4IG0B 2PMHA 3CJQA 2HNYA 4C3MA 3KK3B 1FWKA 1R8CA 3HHEA 1ZTWA 5DM6Q 1IBMJ 1D9DA 4QR0A 5H9EJ 1NDKA 5DGBA 4U6PA 1VLYA 2QZ8A 2ZBCA 4F04B 1N6QA 1H2TZ 1WORA 1SUQB 3ONQA 5DRKA 3HMJG 5KFUA 5IV4A 2W2NP 3MMBA 4L75A 1OPIA 2FVRA 1O6XA 2FVCA 4B02A 4F50A 4MK9A 4RNHA 4ECXA 1N48A 3RW6A 2RKIA 1MLAA 3AODA 3LW5C 1NH8A 4N77A 5ETOA 2X1FA 1ZTTA 4WYWA 4RUHA 3M2RB 3D9BA 2VBXA 1VK8A 1HWJA 1YBAA 5CZXA 4AQYF 2YWKA 1S9FA 1K47A 1R0AA 2CAJA 2VL1A 5B0EA 5KG6A 3QSYB 1Q53A 4EWTA 4LREA 2ZNZA 4ZOSA 2ZUAA 2KG1A 2HG4A 3MEGB 1S4EA 4DQPA 3LAKA 2XTJP 3HD2A 4KGMA 5CD4A 4JI2J 1NDLA 1UW4A 3I4HX 2GHPA 5E41A 4B9NA 2XSFA 2W7PA 1RU1A 5E3RA 2F1FA 5IZHA 2MY8A 3DOLA 1HW8A 2XS2A 4J9VA 2JLGA 5KOWA 3WIUA 1TL1A 4KFBA 1OMSA 3M6WA 2C2ZB 3OR1A 4URGA 2AJFE 1JJ2R 1KP6A 1WF2A 4HEA9 2YNIA 2Z58B 3UN2A 2J0QD 3AOBA 2R42A 2G2ZA 2VFVA 4O3RA 1OSCA 2VU5A 1U7LA 5LSOA 2HZAA 4F3OA 4X4SA 2Y8YA 3V81A 2AMCB 2BMBA 1N5VA 2D9OA 2Z57B 4AD6A 4ZVUB 4LSLA 1HFEL 3O8WA 3OXGA 3ET6A 2W4DA 1A0OB 1XR7A 4LUBA 4J37A 3MWBA 2YNFA 5CYQB 2FJVA 2DGOA 3BKUA 3M32A 4MYUA 1TV6A 2WW8A 1OQ3A 1NO8A 1SKRA 4AL6A 5DDQC 1T05B 2ZWOA 4M5KA 5D78A 3P49B 3GIMA 1VRQC 3PG9A 3GFXA 3HLUA 3M30B 2CYYA 4BWJA 3NBPB 4KJIA 1EARA 2L9DA 4DU7A 1PKUA 4K7QA 2CZ9A 2DNQA 5EHHA 5IM0B 3KNAA 2CPDA 2GAGC 1DURA 1FWPA 1PYOB 2FGOA 3RAQA 2WBMA 3DYAB 1VISA 1YRUA 2F8EX 1UJ6A 1JKHB 2L9WA 3TJ8A 1HYSA 2P5VA 5KFIA 4CO1A 1FXRA 4PWDA 2B9EA 3V6KA 3D1OA 1K44A 1WDDA 3DFEA 2DR5A 3VQSA 1KQGB 4DR6J 1S9EA 2RRBA 3K7RA 1AT1B 4U95A 4PXBA 1X9WA 3DLEB 3N4WA 1UZHA 3IAS9 1EQ0A 5KT5A 3G9CA 1LXJA 1BQNA 1H7XA 2RUSA 1H3DA 5D0HA 1KLMA 2QLXA 1X7VA 3QGPA 2JVRA 1BHNA 3BPDA 2IC3B 3BO2A 4DCOB 4NXNF 3NNHA 3LF0A 3VR1A 2V94A 4ED8A 3ZC4A 3A3PB 1N34F 4XTTA 2DEIA 2OUGA 3MF5A 4USIA 4XK8C 3SZ2A 3MXHP 1FEEA 3IC1A 3MM9B 1JNZB 3PJ9A 1VRTB 1RAAB 1FFSB 4PRFA 1RT7A 3KJVB 4DV1F 1Q5VA 1S49A 1CULA 2NQPA 4EEYA 4U7UD 3P8BB 3LGMA 3CD7A 2VQEJ 3M6XA 4ECZA 1Y4ZB 3UWTA 2DRBA 4OJ1A 2QMUB 4ZIWA 3TQEA 1OYDA 4DV0J 3CCRS 4V19X 3GLJA 4EZ6A 3MAAB 5LSRA 2UXBJ 2E1MC 3H42A 5KFOA 1Y0HA 2YNHB 2ZVIA 1XJWB 3GG0A 3IFEA 3T1AA 5CCMA 3IRXB 2W25A 4NRUA 2RJZA 2D74B 3ZNUA 3U7JA 4UZBA 3OLBA 3TI0A 5C42A 2HWTA 4NMXA 4LMZA 2F4FA 5KOXA 2ZBIA 3BQ1A 3LQVA 1VQNS 3KJQB 4PWWA 7FDRA 2YQ0A 1AXQA 3I56S 5GMEA 3OUYA 4IR1A 3ZO7A 1YWXA 1AFIA 1R8PA 1S6OA 4QIWD 4CO0A 3QLHB 3R5AA 4N47A 2XC9A 2WOMA 2FJXA 1S59A 3DKDA 4NYZA 1YVFA 2UUWA 4J9SA 4LF8F 2ZOFA 2B4UA 3HHDA 3JQKA 3W2VB 4UQGA 4RBTA 4GKJJ 1RWUA 2K3KA 3ZTSA 4X4QA 1WOOA 1S6PA 3BPSP 3UVJA 5B08A 3GV8B 4DS5A 3V6HA 3UE2A 4DFKA 1ZAWA 1TU0B 2ALZA 2VG5B 1NK0A 1TL1B 4KFBB 2DRAA 2VDHA 5MAOA 4NI2B 3GV5B 2DVIA 2CNOB 4C97A 1F6TA 1EP4B 3A8EA 1HWIA 4ZKAA 3UD3P 5K5MA 1GEHA 3WC2A 1YJTA 5AE2A 3K8VA 5E5NA 1TL7B 3TAMA 2CWKA 5AXLA 3QIPB 4RX6A 4WXOA 1LV5A 4K4SA 2C2MB 1A9NB 1E6YA 1ICEB 2DNOA 4DV7F 1PGZA 1S6QA 2CQGA 1HMVB 2C3UA 4O4RA 3LP1B 4QWEA 4JV2A 2UUAJ 4YB6A 4N8NA 3HT3A 4MYTA 1YBTA 2ZH3A 2J6SA 2YBVA 3AT1B 4NXMJ 2GNKA 2ZE2A 2HFZA 2DY1A 4WXWA 4ZVHA 4ZLNA 1CJKA 5HVFA 2QA4S 3CC7S 4B9TA 4PABA 2HK3A 4NLUA 3AA9A 4DPOA 1KFSA 3BDPA 2WBRA 3KUEA 2IMWP 3J80U 1D3WA 2FVSA 1QE1A 2OD6A 1QD1A 3MAHA 4OX9F 4NEZA 5DLFA 4DQIA 5BYSA 3OR1B 2Y0SD 3GFYA 1VBXA 5EWEA 2W4PA 4OZ0A 3VGSA 3MFHA 1Q8LA 1D8ZA 5A76A 4CZCA 3X1LB 1QUVA 4Y34A 3GWCA 5L46A 2XG8A 4NEYA 2LCWA 2DY9A 4YMEA 2DH8A 1U02A 2XNQA 2D7SA 1N4LA 4XAKA 4ZP7A 2BE9B 1A7GE 2C2NA 3NCRA 4U7CA 2XM3A 4LBIA 1T9XA 1DY3A 1FCAA 2XZTB 4Y3CA 4J9MA 2UU9J 2JC0A 5A8KB 4O3NA 1QJHA 3IR6B 3HHLC 3W9HA 3L3CA 1C1CA 4EBDA 3P3DA 2FC9A 5H9FJ 2BKNA 5GMDA 1C1BA 2ZH6A 3DC2A 3I5CA 3PKMA 1KLMB 4RWXA 4WZMA 3RRKA 2ZH7A 4P7VA 2IC3A 4KRWA 4RW7A 2G0JA 2GVZB 3NRBA 1S4FA 1M5SA 2CPJA 1SV5A 4M5JA 1G4CA 3J7YU 4PUOA 2YPYA 4DQQA 2ROGA 4KGXB 4HHUA 2GW8A 2YWFA 5KFHA 3IG1A 4ZDNA 1ZOTA 2HQFA 3KUGA 2AJ2A 4PPZA 3S01A 3UW1A 2BACA 2V4JB 1VS3A 1RTDA 5KAKA 2F7VA 3BKFA 3FNNA 2K3IA 3VF0B 1UL3A 3HPOA 2HFUA 3QO9A 2YQ1A 3CC4S 1WKLA 1U6BA 4KKOA 1FX4A 2I8EA 1RHKB 2BABA 4I1TA 5A8WB 1FVSA 3ENWA 2R2RA 1S1WA 1YRXA 2FC8A 4FPRA 1S1TA 1YK9A 3RBXA 3SFUA 2UZAA 3RG6A 1VYAA 1WSVA 5KFCA 1FRHA 3A3NB 1IKVB 3DLBA 1TKTA 3GZ7A 5KTQA 1FJGF 2CQCA 4RL1A 4NXMF 1YJUA 1JLQB 2RQMA 3HFZB 1KR4A 1N5QA 4J9UE 4UZCA 2UUBJ 4JB8B 1MNEA 4O3PA 4JI0J 2E66A 2EFGA 3BS9A 3CT9A 2NXNA 4UY85 2J0SD 4DR3J 1Y10A 3NGUA 3FBBA 2YPZA 4L3KA 1VHIA 5H1SV 4KSEB 4DUTA 3EZUA 2KYXA 1DLOA 4L76A 4BWMA 3EMTA 1MMNA 1X5SA 1H72C 5GAEI 3BQ2A 3FVYA 4TY8B 3M2VA 3ZZPA 4E2FB 4ED2A 5DM7Q 2AZ1A 4RW4A 4ITSA 3T5HA 2EPIA 3RB6A 2V4JA 2GQCA 3BN7A 4ED0A 3F73A 3TARA 2OTLS 2LECA 3UDCA 1I6JA 3CJ2A 1V3SA 4TQSA 4I4BA 2VG5A 3KHRA 4ID5B 4GKJF 2AD9A 1RWPB 3QT5A 3W66A 4PXCA 3PW2A 2FTRA 4J9KA 3TUIC 1HQUB 2PD1A 2YVSA 3HHLD 5IFMA 1JLAA 4EMDA 1DTQA 4ZCMA 3KK2A 4DLGA 2B3TB 4WP8A 2J6UA 3TZZA 4I2QB 4LFCJ 3PYDA 4GKKF 1XEZA 1A6LA 1OSDA 3S1TA 2XHCA 1J5OA 1PBAA 4Y2MA 2UXCF 4QR1A 2W8KA 4DV2J 1XNRJ 2HVEA 2ZJPQ 4OYPA 5EWGA 4O3OA 3LP0B 2G2YA 1F9FA 3HVWA 4MKVA 5KT2A 3IGVA 2RUGA 3ZZUA 2HWIA 3HSZA 3KJFB 2B5JB 2KZMA 4PKDB 5LMNJ 1WOPA 3DM2B 3CDWA 3CJ3A 3EUNA 4IKAA 2ZJQQ 1EX8A 4NA1A 2OIHA 2X3DA 2FHOB 1Q7LB 1D09B 2M88A 3O1LA 4K8RA 4DI6A 3C6TB 5ETNA 3H59A 3J81j 1M1KT 1NHKL 3M9OB 3MUVP 1YTYA 1JLGB
chains in the Genus database with same CATH topology
1RAJA 2R7VA 1VHFA 1O5JA 4NCGA 2DGXA 3DRYA 3IR5B 3JYTB 3G8SA 1T8EA 2DISA 1DFDA 1HD0A 4LQ9A 2IAJA 5HMYA 2M3DA 1S6UA 2BW2A 3N0VA 1Q78A 4D3GA 2ZE2B 1J5OB 2F3JA 4LIRA 1C1BB 2D3UA 1GNKA 2ZH9A 3BSAA 3HHLA 4Y00A 5KFBA 1R8BA 2JZ5A 5C24A 1NH7A 5J2QB 3B82A 3D0IE 3IWLA 2V9WA 2BXJA 3J81Y 3PKYA 2EFVA 5KFQA 1BQMB 3C6TA 4ELUA 4FXDA 1M5VC 3PO5A 2R7TA 3HKWA 2YNGB 3KLVA 2RDIA 3DMJB 3FRYA 3QWUA 2ZJRQ 3VQTA 2N7CA 4K4TA 1DAXA 1VQSA 1P9QC 2DO4A 1Q4RA 3M8QA 1V9OA 2WHOA 4NLOA 1M5PC 2HS4A 4PG6A 2QE5A 1IBLF 5DGAA 4NYPA 3AA8A 3CDEA 2MSSA 3NGKA 1P1TA 1KONA 2VPWB 2Q6BA 4YY3F 5DETA 2VG7B 1X4AA 2QA2A 4M1KA 1JLBA 5FDLB 2LDYA 4IOCQ 1PC5A 2RRNA 4ZPCA 2PIIA 2I5JA 1SKWA 2AGQA 3DYAA 4X65F 1D9FA 2L41A 4RW4B 4X64F 1NEEA 1V3RA 4KR0B 2DITA 2IBOA 3CIMA 2FJWA 4OHWA 4WFXA 2XO7A 1C4AA 1D9AA 3TYTA 4PXDA 1Y3KA 2DHSA 3NS6A 2IYIA 3PR4A 2AWZA 3D0HE 3H98A 3MM5A 4ATNA 2YKQA 3RW7A 4IDKA 3JB9k 2LXFA 1FNXH 1HPZA 1QSYA 1T05A 2JFDA 4URSA 4CO2A 5IQQA 2KO1A 2RQ4A 5L1JA 1XERA 4XIUA 1PC4A 3KNGA 3NGDA 2KI2A 2P6TA 3OXLA 2ZHBA 3DDKA 2W4CA 2I1RA 3V4MA 1RI7A 1X5TA 1UAWA 2MKIA 1JKHA 3NCPA 2HZCA 5IQ6A 2F8MA 2HLUA 4PQUB 2PMZD 2VFRA 5DG9A 1DZ5A 3HK2A 2KT5A 4ECUA 2BV3A 3MD3A 2QMWA 4A47A 4QW8A 2FLNA 2XWXA 2VBYA 2J6TA 3V6JA 2CPEA 4FF2A 4C7QA 3PX6A 4OI2A 2J9DA 1TFYA 2A3JA 3EGWB 5DG7A 5DS7A 4Q45A 2R8GA 3OHAA 3KLEA 5JJBA 4FXWA 2HRUA 2WRMA 2XCPA 4MH8A 2A2CA 2X1BA 3D0GE 1WEZA 5HO4A 3CD6S 3FFIB 1Y5LB 1KNZA 1K73T 3C66A 4R25A 2QSFA 4MMOA 5I3PA 3MR6A 1WHXA 2M70A 3MDFA 4A8OA 5A6PA 2UVUA 5HROA 3SCJE 2HNZA 3DI6A 2FUG9 1SJRA 5B7WA 2V5HG 1IKXA 2MHEA 3CO9A 2MZJA 4O23A 4CIOA 4J9MA 2AX0A 5SZTA 5KT6A 4F2SA 1F5AA 4A48A 1N36F 3MMCA 4DG1A 2CPFA 3GMGA 5THWA 1E6VA 1Q16B 2HGLA 3UFCX 4EYIB 5KG5A 4OV1A 4GC6A 3ISZA 4ZVFA 4FS1A 1S1UB 4DDFA 3I82A 4LVNP 4UOCA 1RTHB 4G6VB 4WJBA 2B51A 4K4XA 4F2RA 4Y2AA 4I6YA 2XWYA 3GV7B 1L5UA 2N3OA 3PV8A 1RKJA