4H4MB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
428
structure length
428
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 102
structure length 428
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB03
2CJQA 4TQRA 5KFMA 3IRXA 1S9EB 2IM0A 5KG4A 4X2BA 5DLGA 2VG6A 3GIJA 4O44B 2FLNA 5EWGA 4RNFA 2W9BB 4ZMMA 1EETA 3CJ3A 3ISND 1D0EA 3MFIA 3T5HA 4RW7B 4KB7A 3IS9B 3MECA 5KG7A 2JEGA 2BE2B 3IG1A 3TAMA 3CDUA 5KFKA 3MFHA 2E9RX 1S1UB 1TL1B 1EP4B 3LAKA 3C6UB 3CDEA 4DG1B 1DTTA 5J2QB 2WK4A 3G6XA 1RYRA 2DPIA 2FJWA 4NLSA 3KK1B 5F8HA 3KK3A 3PHEA 4IDKB 4G1QB 5DGBA 3DRSA 2YKMA 4ZPAA 2YNFA 4ECSA 1S0NA 2R8IA 2FLLA 4IR1A 1TVRA 2BQRA 1LWFA 3Q8QB 1RT7A 2ASLA 1S48A 5KFEA 4K4UA 1RTDB 5KFIA 5KFLA 1JLQA 4KSEB 4ED3A 4K4ZA 4Y3CA 3HVTA 5KFFA 4QWCA 3M9NB 3KLHA 4KHMA 3CO9A 2YNGA 4IG0A 4ED8A 4DL7A 2XGPA 1RT5B 5C24A 2B43A 1SH0A 4NZ0A 5DGAA 2WONA 2JEFA 3FFIA 5KG1A 3E01A 5HROA 3FQLA 3OL6A 3NMAA 4Q43A 3V81A 3C6TA 4F4ZA 1MMLA 3QO9B 3GV5B 1FK9A 3N6MA 3GIKA 4EBDA 4NLVA 1R0AA 2D7SA 3BQ0A 3PW5A 4TY8A 5J1EA 1RTIB 2R2UA 1D1UA 3HVWA 2WB4A 2C2EA 1RT3A 3QIPA 4GC7A 4RW6A 4B3OA 4K50A 5C42A 3M8PB 4Y2AA 3SFGA 3E51A 4MFBB 3D28A 4KE5A 4HYKA 2W9CB 4DL6A 4Q0BB 1S6PB 3T5KA 4O3PA 3MR5A 1HQEB 3PW0A 1C0TA 3RB3A 2R8JA 3PJWA 3SI8A 1TKZA 1JLFB 2FLPA 3DRPA 4ICLB 3JSMA 4NLYA 4ZHRB 2D3UA 3LP2B 1HPZA 3DMJA 1TV6B 4MKBA 5KG0A 3DLKA 2RKIB 3SFUA 3MEDA 3KJVB 3ICLA 2XI2A 3RB4A 2HNDB 4J9KA 2ASJA 4WXOA 1C1CA 3KHGA 4O3OA 4ECXA 3BR9A 2V4QA 4ECWA 4IG3B 5J2NA 1NHUA 4RUCA 1S9GB 3Q8SB 2YKNA 1HYSB 3DI6A 3NL0A 3JYTB 4O44A 3LP1A 3CWJA 4F4YA 2ATLA 2C2DA 4WYWA 3KLEA 4ECRA 3QLHB 4J9MA 1RT4A 3CJ4A 1LW0A 4RW8B 3N6LA 1JLBA 1JX4A 5L1IA 1S1UA 3DYAA 1TL1A 4TLRA 3DRRB 3C6UA 4PUOA 5KFPA 3LALA 4DG1A 5CYMB 1SUQB 5HLFA 2XWYA 2ZE2A 4KAIA 4RU9A 5KFGA 2VA2A 3V4IB 1LW2A 4O4RA 3G86A 2AGPA 1S10A 3BREA 4H4MA 4KO0B 2ASDA 5KFXA 1REVB 5K14A 1JXLA 2EC0A 3H5XA 4NLGA 4TY9A 4LSNB 2B6AA 5EDWA 2V4RA 4J9PA 4IH7A 1RTJA 3RBEA 2VG5B 4ID5A 4O3SA 5HBMB 2WCXA 4I7FB 4IFYA 3MR2A 5KG6A 3PR4A 4NLUA 4RNOA 2W8KA 4PWDA 4K4YA 1N56A 2HWHA 1SH2A 5EWFA 5KT7A 3KLGB 2RDIA 1VRUA 3KHHA 2R8HA 4ED0A 4URSA 1TL3B 3FSIA 4OL8A 4YR3A 2I5JB 1QE1A 5KFQA 4ZP7A 4RW9B 4ZVHA 3V6JA 2UVVA 4ZP9A 4IQXA 2R2TA 3PJXA 1T05B 1HNIA 4R5PA 2J6TA 2DPJA 3NGDA 4MH8A 2R8GA 5EUHA 1IKYA 4RNNA 2VA3A 4XPCA 3RAXA 1RT2B 1RTHA 3G6VA 2FJVA 3DOKA 3H5UA 2YNHA 3BSNA 4RW4A 1S49A 4WYLA 3T19A 3LAMA 4DL2A 2V9WA 3UPFA 5KFCA 1SH3A 1XR5A 4NLTA 1VRTB 2IC3B 2RF2B 3M8QB 4O4GB 4TYAA 2GC8A 4IFVB 4ED7A 3KLFA 1IKVA 1TKTB 3KLIB 2OPRA 3NAHA 2HNZB 1CSJA 3QZ7A 4MK7A 1S6QB 1TKXB 3MR3A 1N6QA 1W25A 2XGQA 3EZUA 3EPIA 5F8NA 2W9AA 1IKWA 4KFBB 2HNYB 4J9SA 3ITHA 2HNDA 5FDLA 1S1VA 3I0RB 2BRLA 1ZETA 5F8GA 3DOLA 4O3RA 3FRZA 1DLOA 3DDKA 1BQMB 1S9GA 4H4OA 4FS2A 3RBDA 2AWZA 1MU2B 5KFYA 4JV2A 1C1BB 3I0SA 3CJ0A 2ILZA 2HWIA 1NHVA 3IN5A 3KK2B 4K4WA 2BQUA 4DL3A 5J2PA 1KHVA 4FBUA 5KT2A 3FDSA 1S97A 5HP1A 5L1LA 5J2MB 1RT1A 3GILA 1FKOB 1S1WA 2BANA 1J5OB 2XI3A 4QWAA 4LSLB 1N48A 4KV8B 2BRKA 1U09A 1XR6A 1JKHA 3DLGB 1WNEA 3CVKA 4QPXA 3EPGA 2ZD1A 3NBPB 5KFWA 1ZTTA 3MEGB 5KG3A 2CKWA 2IJNA 2F8EX 5T14A 1KLMB 3D5MA 4EBEA 4ECYA 3V6DB 1HMVB 5KFHA 5KT3A 3G6YA 1LWEB 2JEJA 3KHLA 1JLGA 1JLEB 5DG7A 3OL9A 2OPQA 1FKPA 3V6KA 3DLEA 4EBCA 2YNIB 1DTQB 4NCGB 3I5AA 4PQUB 4I2QA 2FVRA 4I2PB 1HNVB 4MKAA 4TN2A 3H4BA 2ALZA 5I42B 1LWCB 2OPPB 4WE1A 5D3GA 5L9XA 4J9QA 1JIHA 4ZPDA 3BGRB 2GIRA 4EO6A 5C25A 2HMIB 1N5YA 3GV8B 3MEEA 2IAJA 2VG7B 1T03A 4Q45A 1S1XA 3QYYA 4NLOA 5KG2A 4J9NA 1JLAA 4XO0A 3M8QA 3PZPA 4ZVEA 3H2LA 4ZP8A 4EYIB 1BQNA 3JYTA 2ZKUA 4MK8A 2IM3A 1S9EA 3OLAA 4ZVFA 4M94A 4QW8A 3MR6A 2W9BA 5F8JA 1HQUB 2R2SA 1TQLA 2HAIA 2O5DA 1S9FA 2R8KA 4KFBA 3IRXB 4ZPBA 4RW7A 3QGHA 3IS9A 2VG6B 2BE2A 5L1KA 3GQCA 3I0RA 5CYQB 1SV5B 1EETB 1EP4A 4U7CA 3PR5B 4TXSA 3Q8RB 5J2QA 4NLPA 3I5CA 3KK1A 3MECB 1NNDA 4IDKA 4G1QA 3IG1B 3TAMB 5JUMA 1MU2A 2UVUA 5DQIA 1RT6B 3KMQA 1OS5A 2W7OA 3KK3B 2QV6A 1GX5A 5C5JA 4J9LA 3DRSB 2YKMB 1RA6A 2YNFB 2XCPA 5KG5A 4K4XA 4IRCA 1RTDA 3OHBA 4IH6A 1TVRB 1QAJA 3IGNA 3BSCA 1LWFB 3RAQA 1RT7B 1J5OA 2AU0A 4LSLA 4F4XA 4KKOB 5JXSA 1IKXB 4Q44A 2BQ3A 1JLQB 3BQ1A 1RT5A 4IOBA 3BQ2A 3PW2A 4RNHA 2IM2A 4WXWA 5KT6A 4TYBA 1TP7A 3VQSA 5I3UB 4IG0B 5DG8A 4K4VA 4LQ3A 3QO9A 5C24B 2FVCA 2XC9A 3H5YA 3GYNA 3FFIB 3ISNC 3E01B 5HROB 3OL8A 3KOAA 3T1AA 1RTIA 3RB6A 1IM4A 2IM1A 3C6TB 2IJFA 4QWEA 4U6PA 1FK9B 3M8PA 4J9OA 4WFZA 4MFBA 1R0AB 4TY8B 4O3QA 2W9CA 3QIPB 4Q0BA 4NLWA 1S6PA 4RW6B 4B3OB 5C42B 1DTQA 1HQEA 2ILYA 4MIAA 5KFRA 4IRKA 2JEIA 4DEZA 4PQUA 4NLRA 2AX0A 4FS1A 1HNVA 1JLFA 5KFTA 1N4LA 2FJXA 4ICLA 5KFDA 3BSOA 4IKAA 4ZHRA 5KT4A 1C0TB 3LP2A 3IGVA 5F8IA 2AX1A 1TV6A 3H98A 2RKIA 2HMIA 3DRPB 3KJVA 2D41A 3HKWA 3JSMB 3QIDA 2FVSA 4URGA 5DQHA 2C22A 1HPZB 3DM2B 3DMJB 4YP3A 3FQKA 4NYZA 4NLQA 4R0EA 5KFZA 5DLFA 3TQ1A 3DLKB 1T94A 3OHAA 2J6SA 4IG3A 4ECZA 1HYSA 1C1CB 3CDWA 1S1TB 3OLBA 3LANA 3H59A 3H40A 1HQUA 5J2NB 2AGOA 3QLHA 4F4WA 2YKNB 5KFNA 5KFOA 4RW8A 4YR0A 3DI6B 2WOMB 3M9MB 3LP1B 2FVQA 5CYQA 4RUAA 4Q8EA 1SV5A 3KLEB 1YVFA 3GIIA 4ECVA 3DRRA 4KHRA 3PVXA 2OPSB 1RT4B 5CYMA 1LW0B 1SUQA 1JLBB 4ECTA 3V4IA 3DYAB 4PUOB 3KHRA 1QUVA 1RT6A 1C0UB 4KO0A 5HLFB 2JC1A 1REVA 2ZE2B 4NRUA 4YMEA 3T5LA 3V6HA 3PW7A 5KFVA 3LP0B 4LSNA 1I6JA 1LW2B 4LQ9A 4TQSA 2WTFA 4H4MB 2VG5A 1S4FA 5HBMA 5K14B 2B5JB 4I7FA 4O3NA 4KBIA 2B6AB 2E9ZA 3GV7B 2C28A 4KKOA 3HHKA 1RTJB 3QZ8A 1IKXA 4ID5B 5DG9A 3OL7A 4IR9A 3KLGA 4IFYB 4NRTA 4ED2A 1TL3A 4QW9A 4HKQA 2OH2A 4PWDB 2I5JA 5I3UA 4WZQA 4RW9A 2UVWA 3H5SA 2IA6A 1VRUB 2UVRA 1T05A 2JC0A 1QAIA 4IH5A 3MTKA 2IMWP 4ZP6A 1QE1B 3CJ2A 3GIMA 4DL5A 1RT2A 4YQWA 1Z4UA 3BSAA 1HNIB 4R5PB 2WHOA 5F9NA 3OSNA 4ECUA 2V0NA 3CJ5A 1IKYB 3CIZA 1RTHB 1UWBB 1VRTA 2IC3A 2RF2A 4O4GA 3DOKB 1RA7A 2YNHB 4IFVA 4R8UB 4RW4B 2AGQA 4F50A 1TKTA 3KLIA 5KT5A 3UQSA 2HNZA 1JLCB 5F9LA 4EYHB 2E9TA 2IBKA 2XCAA 1S6QA 1TKXA 2BR0A 4IRDA 3KLFB 1IKVB 4K4TA 4JV0A 2OPRB 3KLVA 2HNYA 1C2PA 4ED6A 1S0MA 2C2RA 1KHWA 2QE5A 1N6QB 3QGIA 3PW4A 3DM2A 4NLDA 4EEYA 4G3IA 2RDJA 1IKWB 4K4SA 5F8MA 1BQMA 3ITHB 5FDLB 1S1VB 1XR7A 1S1TA 1C1BA 1T3NA 3DOLB 2J6UA 3MF5A 1RAJA 1DTTB 1DLOB 3KK2A 4FBTA 5KFAA 4H4OB 3NAIA 2WOMA 4RNMA 4YR2A 3I5BA 3I0SB 3M9OB 4JUZA 2W8LA 4H54A 2OPSA 5KFSA 5J2MA 2I1RA 1FKOA 5J2PB 4XPEA 4KV8A 4NLXA 4Y2CA 3KNAA 3DLGA 5L1JA 5HP1B 4J9RA 2AQ4A 1C0UA 1RT1B 3HVTB 4M95A 1S1WB 3NBPA 2BANB 2R2RA 5KFBA 3KLHB 3LP0A 3MEGA 3Q8PB 5KFUA 2YNGB 1K1SA 1RDRA 1JKHB 4WFYA 5DQGA 3BJYA 4JV1A 3HVAA 3H4DA 5KFJA 1KLMA 3KMSA 2ZD1B 2B5JA 2WONB 4ED1A 3UDLA 3RB0A 3V6DA 2D3ZA 3QGGA 1HMVA 3V81B 2UUTA 3N6NA 1LWEA 1S0OA 3TVKA 3UR0A 1JLEA 5J1EB 4QWBA 4URQU 1RT3B 4Y34A 4ECQA 2YNIA 1HARA 4NCGA 1JLGB 4I2PA 2OPQB 1ZTWA 4GC6A 1RYSA 1FKPB 4WFXA 4RZRA 3DLEB 2JLEA 5I42A 4DL4A 1LWCA 2OPPA 2WRMA 3BGRA 4ZPCA 4I2QB 3NKYA 1TKZB 2FVPA 4EO8A 3T5JA 2VG7A 4MK9A 4WE1B 1K1QA 5D3GB 2UUWA 1UWBA 5EWEA 5C25B 4R8UA 1N5YB 2GIQA 4QWDA 3MEDB 4Q8FA 3MEEB 2IAJB 1JLCA 1T03B 3OSPA 1S1XB 5F8LA 1JLAB 4WZMA 1GX6A 4MIBA 2W7PA 4ZVGA 1BQNB
chains in the Genus database with same CATH superfamily
4K59A 1R8HA 2XSFA 2F9JA 3QRRA 3IS9B 4O23A 4XAKA 2G9OA 3MPDA 1NK4A 3DRSA 2BA9A 1VOMA 3TZZA 3OTEA 4GKKF 4KHMA 1VC0A 2JEFA 4Q43A 2LA6A 3QO9B 3GV5B 1FK9A 1TAUA 4UOCA 2ZVSA 5J1EA 2BJDA 5BXIA 3N5BA 2IHR1 4PXDA 4B17A 4W92B 3UVJA 1HQEB 2WBMA 2ZH2A 2PEBA 3AY0A 2AYGA 3PYGA 4FF1A 2RRNA 3RZAA 2GQ2A 3G8SA 4WXOA 4MKYA 1QD1A 1X4GA 1YJUA 3DI6A 4WTYA 1R0CB 2EBEA 1CJKA 1N54B 2VODA 2LECA 1JX4A 2H51B 2ZDOA 2HFZA 1XNQF 2DGSA 3D6HB 5A6PA 1NPKA 3AXMA 3M30A 4ZIVA 2ASDA 4LFCF 2RNEA 1F0XA 3AHPA 4ID5A 1A6LA 3MR2A 1R89A 1Y5NB 1YBUA 1SH2A 2ZH4A 2QLXA 3B8HA 4C8LA 5E3RA 2JLGA 2RQKA 1IKYA 3FNNA 4LR8A 5HMYA 3IXQA 1F2GA 5M2UA 3BO4A 3W1YC 2ZNZA 3T19A 4ZS6A 4GO7X 1NAQA 3ULHA 3NAHA 5D0RA 4USHA 2ROGA 3I87A 3WHIA 1U1KA 1HLWA 2OFHX 2C3OA 3CJKB 3OV7A 1KHVA 2ZH1A 4OX6A 3GILA 2C3PA 3MEGB 4AL6A 4OHZA 1KFDA 5KFHA 1LWEB 4A8KA 5L8RC 3FBCA 2HVHA 2GA7A 4YEAA 4LREA 2Z8QA 4EFAC 4ZPDA 3VZIA 2FPHX 4OZLA 2I38A 4P2SA 2WVDA 2DCUB 3IC1A 3D3BJ 4NPOA 2APOA 1U1RA 2HFVA 4IDKA 4G1QA 2CVIA 1WWHA 2MKSA 5KG5A 2V8VA 1K47A 3LA0A 3CSKA 5G0RB 1PYTA 5IC4B 4LQ3A 2XB2D 4P2XA 3FFIB 3ISNC 4JV5F 4P71A 3M8PA 1T9WA 2DNYA 4J91A 1ZM9A 3C15B 4FS1A 1XTZA 2D74B 4Y6IA 1XMQJ 3UNGC 4X4OA 3VAJA 2ROPA 3KJQB 4S0MA 4R0EA 3OHAA 4IG3A 5HVHA 5C2GA 4F4WA 3DOMA 1UVIA 1QUVA 3T5LA 3LP0B 1MROB 2DT9A 4B9UA 4QW9A 4U7UD 2I5JA 3K5LA 2VC0A 1VRUB 1H2TZ 4UUXA 1QE1B 4HT5A 1MN9A 3RBXA 3DOKB 2J0WA 3C15A 2E9TA 4EZ6A 4LUBA 3UNYA 2PDAA 4XDDA 4FXDA 1CS4B 2R7WA 2HVDA 2M8HA 1SKRA 2GVDA 1NM2A 4PZVA 4C8YA 1IXKA 2RQCA 1DARA 4N76A 1N0VC 2R7UA 2RQMA 3AB2B 4HH1A 1X5TA 5I3PA 1KOHA 2Z2ZA 4KV8A 1PGZA 5AXMA 2CQBA 3LP0A 1DAXA 3EGNA 2BX6A 2L08A 3C66A 3TVYA 3C46A 5LSRA 1C4AA 3SYZA 4Y34A 1RP5A 1PYSB 3NXZA 5I42A 1RABB 1H72C 2Z57B 4DV3J 4DHVA 3QT6A 2DR5A 4OI3A 2Y3YA 1BC6A 2MYFA 3LUYA 3OSPA 2DXDA 2EBGA 1GX6A 4KH0B 3O1LA 1UFWA 4RW7B 3MMAA 2HHXA 3KK1B 3PHEA 2HURA 3I32A 2JNJA 1S48A 2HK2A 1RTDB 3HX9A 4RBVA 2POKA 2DRBA 2BKOA 4OHVA 5D8HB 2CZ9A 1NSPA 1OY6A 3FQLA 4C2MA 3D9BA 3GIKA 4P6QA 4F0KA 1VQMS 3GJTB 1T95A 4HYKA 2GW8A 1SPBP 1LQ9A 1FEHA 3PJWA 3LGNA 3UN2A 2AJ2A 3PACA 3GFYA 4EZ9A 3ENQA 4C3KA 2ATCB 1VBZA 1EKRA 2YVSA 2N3LA 3NLCA 2YKNA 3L95X 1J5EJ 3HSZA 1TR0A 3CJ4A 2E1RA 3K8VA 1EIYB 3G86A 3G82B 3VTIA 3O2IA 2DNHA 2DEIA 4IFYA 3PR4A 1I51B 2HWHA 1TU0B 3FZ2A 1NSQA 4FF4A 5KFQA 2CZVC 4LF6J 4QOTA 3OR1A 3NGDA 3HPOA 2DR8A 3H5UA 5HVGA 3BM7A 2V9WA 4NLTA 3EVWA 4TU7A 2E1MC 2DGTA 3MHYA 1W2IA 3VAHA 4USTA 4F0MA 4J9SA 2WBRA 3K5NA 1RAGB 6AT1B 2MQMA 4DXLA 1MU2B 2X51A 1WEXA 5AXLA 2BKNA 2HHHF 4F3MA 5E3QA 3NY0A 3BDPA 3GCXP 3EPGA 3NBPB 5KG3A 4DQRA 2HHVA 4ECYA 4YOEA 4USKA 1CJUA 3A8JA 2OPQA 2ZH8A 4P7TA 4EBCA 2DVIA 4HVZA 1XMQF 1FNXH 2B3TB 3ZTPA 4NYPA 1VQ4S 4FYYB 5KG2A 4PG8A 4LF1A 3PX4A 4EUVA 4JI3J 3W2VA 1HQUB 4WKYA 3CGIA 3I5CA 5JUMA 1MU2A 1VQLS 4KT0C 2E66A 2W7OA 3KK3B 2LQ9A 1VBYA 3EE3A 1M5HA 3ILOA 4OZ1A 2M8DB 5JVHQ 5KT6A 5DG8A 4TYBA 3OUYA 1P9QC 4C8KA 4DFKA 3OL8A 1GMVA 1B7YB 2VDIA 4MTPA 3L9ZA 3SEOA 3WX8A 2EK1A 3RB4A 1R6VA 3W65A 2F8MA 3TZYA 1Z2ZA 4AXJA 3H98A 3HKWA 4DUTA 4URGA 1EQ0A 1GMUA 3DM2B 4ECZA 1W2BR 1HQUA 3LP1B 4RUAA 1VJWA 5CYMA 2OMOA 1F9EB 3CJ8A 4PUOB 1Y9OA 3PFEA 2E1CA 4I7FA 2E5IA 4C6AA 1WDDA 3D67A 3QZ8A 4CWBA 3RYLA 2OH2A 2RHSB 1VCTA 2OEMA 4DV3F 1Z4UA 3SXLA 3CJ5A 1QSYA 1K8AT 2UU9J 1CC7A 2Y8YA 2Y1LB 2RU3A 3KYLA 2B4UA 2JRSA 1FTCA 4NZ7A 2HNYA 3D1QA 3A8EA 3R5CA 3DM2A 4LIWA 3HKZD 1IKWB 2DYAA 2XTJP 2N7CA 5FDLB 3KFWX 1FWPA 1NK7A 3M8SA 4YN3B 2JLFA 2ZH6A 4H4OB 4PRFA 1WEZA 2IYIA 2YPZA 3DHWC 2B56A 3BGUA 4DX5A 2B7BB 2L41A 1YG0A 1A7GE 2HHUA 1HMVA 3EDRB 3BBFA 1JLEA 4URQU 2YNIA 2BW2A 2YWHA 2EI5A 1JK9B 3CMAS 1RYSA 3M2RB 4LBPA 2I6WA 9ATCB 2EFVA 2QMUB 5LSOA 2M88A 2XG8A 1GQEA 2A2CA 4MIBA 1HD0A 4IRCA 2CJQA 1H98A 1J5EF 4FF2A 5AJ3J 1S7IA 3MECA 2BE2B 3IG1A 4QIWD 3FSXA 2UXCJ 5H9FJ 2FJWA 3FVYA 4WK1A 4DF8A 1SC4B 3HVRA 2L9NA 2KB2A 2LXIA 4K4UA 1ROFA 4ZKAA 1F5AA 4Y3CA 1PILA 4B9LA 4LF6F 3CO0P 4NLVA 4JI5J 3SFGA 3NGTA 4O3PA 2NR0A 4NXNJ 1X4BA 1TL7A 3D6FB 3OD2A 4LF4J 1CQNA 4OZ3A 1HIYA 3CC4S 4W4MA 3N01A 5EN1A 2BBEA 3AD8C 3CWJA 2WVBA 1HL6A 2O66A 5A8KB 3IO1A 4J9MA 3ILJA 1JLBA 4I69A 4ILLA 2VKZG 1YJTA 3NEKA 2XMTA 3DRXA 4OYZA 1REVB 1TL4A 5IV3A 4LSNB 1HNXJ 1JJ2R 2W1BA 4O0IA 3KUHA 2HGMA 1F3VA 5KT7A 2FHJA 1SQFA 4A4JA 1HBMB 2UVVA 2Y8WA 3CCUS 2DPJA 2HBZB 2VA3A 3RAXA 4LIRA 1JNZB 1KQFB 1M0SA 3QRPA 1KN6A 1XR5A 3FUYA 2IC3B 4TYAA 1IKVA 2HS3A 2HHTA 2XGQA 1T02A 5B7WA 4H4KA 1S1VA 2BRLA 2P9GA 1DLOA 4ZJQA 4BLGA 3DRYA 5T7LB 3K59A 5J2PA 3G87A 4QYZK 4LSLB 2OEKA 4JBCA 5IM0A 1OYEA 2IIHA 4I67A 3JTPA 4DR5J 2F7VA 5T14A 1P1TA 2CJBA 1VQKS 2GX8A 4QZVB 2IPOB 1RKIA 3OL9A 2MEWA 2KM8B 2NPIA 3ILLA 3TUIC 1UL3A 1KEKA 3H2UB 4NCBA 3DHXA 2KYXA 4ZPBA 4Z7CA 2VFUA 1EETB 4LF8J 1T3OA 3Q8YA 4F67A 1JJHA 3M6VA 5DQIA 3POTA 4M1KA 2YNFB 4IH6A 4I1TA 2XMWA 4QIFA 4LSLA 2MLZA 4Q44A 1ACMB 4IOBA 2Q66A 3THPA 2DGXA 4NA1A 1CPZA 5C24B 1UMJA 2PE8A 4HHHA 3BDEA 2V2VA 2XZWA 3K58A 2YWWA 4Q0BA 5KFRA 2JEIA 2FUG9 2AX0A 2KT3A 2X1AA 5FLXY 3G4SS 2H54B 2D41A 3JSMB 3BV8A 3D6MB 2MKJA 2FIUA 4NXMJ 1S1TB 3TARA 3OLBA 1YJNS 5KFOA 4L73A 4RW8A 3MD3A 2B8QA 3KLEB 2CPDA 2KVQE 2VV5A 4X62J 3C16A 2ZE2B 4LF5J 1LW2B 3FEYB 4O3NA 4JYAJ 3MI7X 2HQFA 3CDBA 4CLWA 2EK6A 1MWQA 4FZVA 3W9JA 4X66J 4CI0B 2WW4A 4YQWA 5GAGI 1NDLA 1RHUB 1OY8A 3FCVA 1X4EA 3D3CJ 1HFEL 4IFVA 4PWWA 1NMEB 1QTNB 2H1YA 3VWSA 2XCAA 1UA1A 2W4CA 1TKXA 5D4OA 1AT1B 5AJ3F 1GK8A 3ITHB 4P73A 1S1TA 1C1BA 3DOLB 2DNGA 1HBUA 1Z1ZA 1WSRA 2RS2A 1DY3A 2AQ4A 2ZBCA 3JXOA 3UW1A 1QSLA 1SC6A 1FRMA 2WB1D 2VJVA 2OFGX 2D1CA 2FGOA 1H7WA 5ETPA 1FXRA 1Q78A 4ECQA 2P9EA 1Y0HA 4X4UA 4CO3A 4NXNF 3TA0A 4LF4F 2VDHA 2PT0A 5EWEA 1Q16B 7FD1A 4XK8C 3MUMP 4WZMA 2W7PA 3IRXA 2JZ5A 2N82B 4ZPTR 3CJ3A 4CQ1A 4U67Q 3ISND 3T5HA 3DXBA 3P5TL 4DG1B 5F8HA 2AJFE 2Z2MA 4ZPAA 2QEXS 2FLLA 2HBRB 2COLA 1HNXF 2QA2A 1JLQA 4KSEB 1HR0J 5D78A 1X5SA 4I6YA 2B43A 1D9DA 1WEYA 2D9PA 4LBHA 4HEA9 2M70A 1B64A 3VVUA 4TY8A 1FWLA 3HVWA 3QIPA 5C42A 5A0YB 4JI1J 2LQJA 2DNQA 2AYEA 2R8JA 1JLFB 2K8GA 2AEFA 3DMJA 1CULA 1X9SA 4G65A 3LO3A 4WJBA 3T6BA 4ECXA 2VC1A 2CJXB 4NE9C 5K8NA 3KKFA 1YRUA 4UUWA 3AAWB 4P7VA 3ZZUA 1FERA 3SQOP 2IA0A 4DG1A 3IRWP 4OI4A 5KFGA 3VAKA 1NK0A 4O4RA 2CUYA 1HHSA 4DR5F 3OT9A 3BGFA 1KR4A 1MMNA 4NEYA 4AQYJ 4X65J 3UWTA 1XK8A 4RNOA 1VQ5S 1VIXA 3BEGB 3M8ZA 4ZK7M 3KHHA 1SQEA 3FSIA 4YR3A 2PA8D 4MIWA 3UDCA 3MWBA 1U02A 4N5SA 1DBDA 1RADB 1VRTB 4MJKA 1RKJA 3K5MA 2YH0A 5L38A 1UWAA 3MM8B 1TKTB 3MR3A 1W25A 3EZUA 2W9AA 4KFBB 1WD6A 4PG6A 1QTMA 4LF8F 1R3NA 2ABYA 3LTOA 2E1AA 1YIJS 2CPXA 4I68A 4X4VA 4JV2A 1S76D 1KS2A 1UEUA 4Q7AA 4DSIA 2AYBA 5CZVA 4CH1A 1HBNA 1YJVA 1U09A 1V5VA 1WUUA 2XZDB 2F8EX 3BBCA 4WCEQ 4E2FB 4K5RA 4EBEA 3GJSB 1RWVB 4QCLA 1H0HB 4CYUB 3I55S 1S6OA 1HNVB 3PFOA 3H4BA 2GVZB 2OPPB 1SJ1A 2JVRA 3BGRB 1LFPA 2LMIA 1YBAA 2IAJA 2CPFA 3H2LA 1HI0P 5L9NA 3MM8A 4NXMF 3OLAA 2VONA 5F8JA 4DV1F 4KFBA 5B0BA 3CCWA 2F40A 1S79A 5E2QA 1EAYC 3Q8RB 1X60A 1HI8A 4X62F 1F1BB 5KTQA 4DR4J 4LF5F 3UE2A 3VAFA 4PABA 1KNZA 2LCWA 3DC2A 2NXCA 4JYAF 5HQMA 2RRBA 1QAJA 2OGUA 4CLUA 3A12A 2MZRA 5JXSA 2MY7A 4C0OC 1M1KT 4J7CA 1TP7A 4X66F 1XNRJ 1WACA 4ANCA 5HROB 2H9ZA 3C6TB 4QWEA 1RWWB 4WFZA 1R0AB 2AJ0A 3R27A 2P9CA 3H90A 4DPUA 3M6XA 1HNVA 2QFJA 1N5QA 2GVZA 1FXLA 5KT4A 1FDDA 1TV6A 3DRPB 4HR2A 2RE1A 1KD1T 3QJLA 1B0PA 5BYSA 4YDDB 4TNOA 2J0SD 3BO3A 4N47A 2FVQA 2E44A 3I9ZA 1WG4A 3TAQA 4DX8H 2KG1A 1S4FA 4KBIA 4PKDB 5L46A 4N77A 3GV7B 4KRWA 4NRTA 3HZGA 4Y2KA 5D4NA 2UVRA 4J9UE 3QQCD 5I3QA 4FKYA 1CLFA 2UP1A 4A8XA 3A3OB 1N36J 2RF2A 4O4GA 2YBVA 3G8QA 1B70B 1WSVA 3UQSA 2KXNB 2BR0A 2AYMA 3ZNJ1 2UUAJ 2KKHA 2DY9A 4JV0A 3OVSA 2FY1A 4M5HA 4OJ1A 4I4BA 3ENWA 1PCAA 1U1NA 3QGIA 3TW0A 3GZ7A 4G3IA 1UCNA 2F63A 4OX8A 2DHHA 3FBBA 3MF5A 1FRXA 2CQHA 3VV2B 3MM9B 3MXHP 3TWZA 5J2MA 2M5YA 1HR0F 1S1WB 2R2RA 2UV8A 3KLHB 1YZ7A 4WFYA 1VHIA 4Z7YA 2KZMA 2J5AA 1K0TA 3KMSA 2ZD1B 2J0XA 2XLKA 3RR8A 2UUTA 1CJVB 2G1HA 5K8MA 4CLZA 4GKJF 3RGIA 2CNLB 1IBMJ 2MQPA 2FC8A 1LWCA 5B0AA 4IOCQ 3HSJA 1N5YB 3MEDB 2WZ1A 3IAS9 5IT9U 3PYDA 1RWKB 2W2PP 7FDRA 1VQYA 3N28A 2CQPA 1PG5B 1UP1A 2R7QA 4AFFA 5DGBA 3CE8A 2DNLA 2VFSA 1QSSA 1LWFA 3Q8QB 1RT7A 4AQYF 4DS4A 1M90T 3UD4P 3KLHA 3SCKE 1AUDA 1FX2A 3MM6B 2GZOA 5M2PA 3LW5C 2VOOA 4RW6A 3NRBA 2MXYA 1ZS6A 4KE5A 3M2VB 3W61A 3QPIA 4XTTA 3R97A 3FRYA 5KG0A 3DLKA 2RKIB 1UJ6A 3MEDA 2DNPA 2YWFA 4J9KA 2FLOA 4RUCA 2IRXA 3R2DJ 2ATLA 4OX7A 2Q79A 4NASA 4QR2A 4F7VA 3QWPA 1LW0A 3IWLA 2MHNA 1FO1A 1FA0A 4GVLA 3DRRB 5GADI 3GG1A 3EICA 2A10A 4CM0A 5HLFA 2EFGA 5AE2A 3WC2A 4KAIA 2G2YA 2A6OA 2AGPA 2W24A 2Q6CA 4OI0A 4QR1A 4IH7A 5EX3A 3WBZA 3H2VE 1B0TA 1VQ9S 3IP0A 4OLOA 4DV4J 3VR1A 3I4PA 4ZVHA 1Q8IA 2SXLA 3CW2C 4MKVA 3KG1A 3PYEA 1ZBTA 2CIMA 4ZCLA 1QLNA 4RW4A 1OMSA 4KGZB 1LK5A 1N33J 1Q53A 3NS6A 3MM5B 2DNZA 2Q43A 3ZZZA 1RLCL 3I0RB 1ZETA 2CQ3A 3TZWA 4DR4F 1NHVA 1VC5A 3KK2B 2M2BA 1H3DA 2H65B 1UVNA 4FBUA 1L3UA 1Q81T 4K0KJ 4USIA 5DDOC 4OYMA 1PJ5A 2HAFA 4LRFA 4ZLPA 1NU4A 1XNRF 4BWJA 4H4KC 2IJNA 4G1IA 1VK8A 1OQ6A 1ZA1B 4HTIA 1GXUA 2VPWB 3NGKA 3PTWA 3V6KA 4LF2A 2BE7D 2FVRA 1KQGB 2V6AA 4WE1A 4JB8B 3TEGA 4DUYJ 2GV1A 3SV3A 4PYDA 1T03A 2F3JA 1G3OA 1JLAA 1BQNA 3MM5A 3CCRS 3OR2A 1EB0A 2O5DA 1S9FA 2LQ8A 3FCHA 4QQBA 3I0RA 4U7CA 2VFTA 2RRAA 3P5BP 1HA1A 4MMOA 1RT6B 4L76A 1GX5A 1FCAA 3X1LB 1TVRB 3M2UA 4F4XA 2NUHA 2RILA 1U24A 1XBWA 3AJDA 4ZOSA 2IM2A 4IG0B 3GONA 1Q7YT 1RBLA 3HD1A 4OYIA 1N36F 3S01A 2PD1A 4NLWA 1S6PA 1ELOA 3BH7B 2UUAF 1NK5A 2OLWA 1RHKB 3HHLC 3KJVA 2FVSA 4F02A 1FRHA 3FQKA 4WP9A 5A6WA 3W3SA 1C1CB 2QYGA 2GGPB 1IBKJ 1MSWD 2HIYA 1B4SA 2A18A 4ECVA 2GHWA 1FJ7A 3N0VA 3CJQA 3DYAB 4DPXA 1RT6A 2JC1A 3PW7A 2HZAA 2WTFA 3ETMA 4Y2MA 2E9ZA 2KG0A 2VQFJ 4LFBJ 1TELA 4CTAB 4RW9A 1IBMF 1SKWA 1TAQA 5HN0A 1NRKA 2JC0A 1NK8A 1OWXA 3W7BA 4B3TF 1HNIB 3PHTA 4CLFA 4XDCA 2MQQA 4YB5A 3QJJA 2AP6A 2RDJA 1BQMA 1PC4A 4ELUA 4YHHJ 5K8OA 3G9CA 4JUZA 1BLUA 3AJ1A 4UOGA 1U8WA 3ZZPA 5K20B 1Y00A 2PSZA 3CC7S 4X4PA 2BXJA 5IT9Y 1FJEB 4U96A 3BJYA 4HL9A 5KFJA 3VGTA 3JSBA 2DXEA 1D3WA 3M6UA 4CTAA 1IM6A 1FD2A 4LR7A 2FYXA 4I2QB 3HHEA 1TKZB 3MCOA 2ZHBA 4BHQA 4F3OA 1K1QA 4LF7J 4QWDA 5IQ6A 2XYPB 5A8RA 3X3UA 2VG6A 5EWGA 5DDPC 1VLOA 3TYTA 5CCLA 2G2OA 5JJBA 2IFXA 1R8BA 1TL1B 3A8IA 1RYRA 1Z2LA 2ZBPA 3Q83A 2ASLA 1R31A 4CP5A 1WORA 1Q79A 4DV4F 3ILIA 2BKPA 3T1YJ 4QJVA 2FY8A 1OQ3A 4C48A 5C2CA 3OFGA 1PSDA 1U1QA 2KJVA 1RHQB 3BQ0A 6FD1A 1D1UA 3GMGA 1AROP 3D28A 2W2QP 1RHMB 2KFZA 1N33F 2ZC4A 1TKZA 4Y28C 1FESA 3LP2B 4MKBA 5ETSA 4DR3J 3EZ5A 2HFSA 4O3OA 3TX0A 2ZH5A 1S9GB 3PEJA 1NK9A 2LFVA 5ETRA 3MUVP 1TL1A 1AB8A 3BB5A 2QA1A 1DHMA 1UKUA 4QYZJ 3MEKA 4KO0B 2AZ1A 2HHWA 3H5XA 3F0NA 4TY9A 2IYGA 2FJDB 2HZVA 2VG5B 2HHQA 5KG6A 1P6TA 1NUEA 1BGXT 2KJWA 2ZKTA 4D3HA 5ETMA 2QG9B 4QBUA 2DNKA 4B3MF 3AA8A 1H38A 4DUYF 2H5IB 4DSLA 3EJMA 1P8GA 3KLFA 2ZITA 2MJNA 2OPRA 2YY3A 1RAIB 1FE0A 5LOQA 4L3KA 3MM7B 4DSKA 4GRSA 2RB7A 4PXCA 1S9GA 3HSDA 1OYDA 3KTQA 3IN5A 3UCUP 1S97A 5HP1A 1FKOB 2F4FA 3CVKA 3PYFA 4KYZA 5KFWA 2V2ZA 2DXFA 3H20A 2OELA 3NG8A 3SMZA 2PN6A 3SZ2A 3DLEA 3HT0A 4HACA 5BJRA 4UW2A 3B6BA 4J9QA 1JIHA 2HMIB 3PRVA 2BV3A 4NLOA 2LLZA 1S9EA 3SCLE 2GHVC 4ZVFA 3AT1B 2RD5C 3CJSA 2V69A 2W9BA 1IBKF 1H2UX 2KYZA 3MMCA 1XQIA 1QJHA 4M5DB 1AFJA 3WC0A 2KFNA 3D1HA 4L3NA 2V2KA 2DHGA 2V2QA 3CCQS 3OTOJ 5C5JA 2YKMB 3J7AN 4RJVA 4Z37A 2FTRA 2VQFF 4PR6A 2B9XA 1UVMA 4RNHA 1O51A 2HWTA 3G96A 2P5VA 2ZHOA 1NDCA 3W2WA 3UN5A 2C3YA 4MIAA 2VUGA 2H48B 3MCSA 3TA1A 4ICLA 3BSOA 1WOSA 4ZHRA 5F8IA 2HMIA 2CQ1A 5DQHA 2HGNA 5DDRC 1IUJA 5DLFA 3CUNA 3TQ1A 1WDTA 3CDWA 2VB6A 4YHHF 3H59A 4FDFA 3H40A 5J2NB 2FDNA 4WIQA 2V50A 3V4IA 5GAEU 4DI6A 1I6JA 4F36A 3D2WA 5HQ8A 2R7VA 1XMOJ 4A8SA 1KOOA 2PMHA 4DSJA 3WZ0A 4KGKA 1V6HA 1UJ5A 2CQ2A 1RAFB 4UZBA 3DDIA 2OEJA 3MMBB 3U1NA 2WAQD 2JJ4D 1E6YA 4ECUA 3K0JA 5AE1A 2PIIA 4LF7F 2E1PA 3E3XA 2XBPA 2BABA 3FMWA 3BGOP 2BZ2A 2RQ4A 4OMFG 3K57A 1UPMB 1N6QB 4LBIA 1NKEA 1AFIA 1F6TA 1S7HA 3VF0B 3UDVA 3GJQB 1RWOB 5KFAA 1GNKA 2A0FB 1IWGA 1PKUA 3IAM9 4H54A 5KFSA 2NZCA 4DR2J 2ADBA 4J9RA 1HNZJ 4ES2A 3Q8PB 2LYVA 3ZZ0A 1K1SA 3T1YF 1JKHB 5DQGA 1DQAA 3DU5A 2KRRA 3L7UA 3RB0A 3W63A 3ZZOA 2ZOMA 3NS7B 3T1HJ 2VFVA 2GMJA 1JLGB 2BM0A 1REGX 4GC6A 3MMBA 2C2MB 1JXEA 4UY85 1QDUB 5J1PA 4HDGA 2VG7A 4MT1A 4DR3F 3MEEB 4UY8T 2LEAA 2X3DA 3JYTB 5KFMA 1PC5A 2FLNA 2Y1IA 1JJCB 1D0EA 3G8TA 5KG7A 2A1BA 3HHDA 3HO1A 1GTEA 1RAEB 4K4ZA 2JFDA 4HLBA 1TFYA 2XGPA 5T41A 3OL6A 5B0FA 1ZZFA 4QYRA 4B9VA 3M32B 3PW5A 1U1LA 1RTIB 2IDEA 2MGZB 3UR3C 5DM6Q 1HQ2A 2MSTA 4DL6A 3AQPA 3RB3A 3C2PA 2XZTB 4CLPA 3PW0A 1C0TA 1RWUA 2C3UA 2BJ3A 2WVEA 3P6YC 4AYBD 1Q95G 1WC1A 4NLYA 5CAAA 3W60A 1Y11A 1QVGR 2HNDB 2V8DA 3S8SA 4UF4A 1HYSB 2C2ZB 2BUNA 3K5PA 3LQVA 2A3JA 2W2NP 4DU7A 2XO7A 3N4WA 3EDQB 4RU9A 4FYWB 2W01A 1T9YA 1V5IB 1JXLA 5EDWA 2K2PA 3G2XA 4ED4A 3MAAB 2AJQA 3KLGB 5A2QU 2KRBA 2HIQA 2K1RB 2R2TA 1T05B 1DZ5A 3TJAA 2ERRA 1I94J 1U6BA 2B7CB 1RT2B 2CPEA 4CLKA 1S49A 3HM9A 1M1HA 1HD1A 1SH3A 4L74A 3M8QB 3QT5A 2GC8A 1AZSA 2ZH3A 3KLIB 3THVA 1S6QB 5E7OB 1HHTP 3DGPB 1XMBA 1YJ7A 3UD5A 3C3LA 2HNDA 3DFEA 1WELA 5F8GA 5C7PA 2OO4A 2R42A 2QA4S 1LKZA 2OTLS 3OTOF 2B4PA 2XHWA 2BQUA 2AZ3A 2CQIA 3H7HB 4M63A 1XIQA 2O67A 2R7TA 1R43A 1RT1A 4C8NA 3BKUA 2JWNA 5DETA 2DHXA 1L3SA 1U0SA 4CH0S 1TFWA 2CAJA 2AKWB 3SQGB 1DTQB 3GR1A 1FKAF 4FNHA 2L9DA 5HL7Q 3QAUA 4JI2F 3M8QA 4TVAB 4ZP8A 3N5FA 4QW8A 2KVIA 1T7PA 3BR8A 2CG8A 3RG6A 4NLPA 1Y3KA 1TK5A 1U4BA 4C3LA 3DRSB 1RA6A 1LNQA 3KDOA 4K4XA 3ZFVA 1XMOF 2XMKA 1S6UA 1Y7PA 2EFPA 1RT5A 4OFZA 3Q8UA 2ACYA 2MKYA 1R7IA 5AXNA 3RB6A 2JSXA 1Y5IB 2BJ7A 4U6PA 1FK9B 2DK2A 2CDRB 1H6KX 1DTQA 2ILYA 1PJ6A 4NLRA 4BWMA 4C4WA 1DQ9A 3UVJB 3IGVA 2VASA 4WIIA 2V8PA 3GP9A 4NI2B 3OJSA 4DV5J 5HI7A 3HSGA 3W62A 3TX8A 3QLHA 3ZZYA 3DI6B 2WOMB 2V34A 3M9MB 1OJ4A 1YVFA 2NXEA 4KHRA 2XMAA 1CJKB 4N8OA 4ZCIA 4DR2F 1HNZF 1VGYA 5IXUA 2KL8A 4NRUA 3HT3A 3V6HA 5LJ5Y 5E5NA 3M30B 4Y0FA 4UOHA 5HBMA 3SSRA 2F4VJ 2MB0B 4ID5B 3T1HF 1NH8A 3IM8A 2FHJD 4B9TA 4ZVTB 1X8DA 2CJ9A 3CMQA 3PJ9A 3HULA 2IRUA 2WSCC 5B09A 1RAAB 1IKYB 3CIZA 3CJTA 5HJYA 5LXRA 1NDKA 3LF0A 4EYHB 2HNZA 1JLCB 4F8RA 4ZA1A 1Q7LB 4YB6A 3PW4A 4NI2A 2LDYA 5ADZA 2RU9A 4RWWA 2XY7A 2YKOA 1DTTB 3KG0A 4A8OA 2WOMA 2D9OA 4W98A 1U25A 3R6LB 2JHEA 4ENOA 4W90B 3NOCA 3BKTA 3Q86A 2C2NA 5IQQA 4RL1A 1RT3B 4DR7F 3S6EA 4WPAA 3TZXA 2UV8G 2NREA 2XYGB 4E0DA 4NCAA 4O0NA 3QATA 5CHCB 3L7PA 1EARA 2FJBB 2GIQA 3R7BB 1JLCA 4L72B 2CJYB 2PMWA 4KH1B 1J2VA 3KXDA 2H4YB 1FDNA 4ZMMA 3QGPA 4TU9A 1DTTA 2GQQA 3SSSA 4IDKB 4G1QB 2MY8A 1IQTA 2ZZMA 1M5SA 2XSJA 2EC2A 2OTJS 1Q8BA 3RRKA 3HHLD 1ZH5A 2B9EA 3AOCA 4X4QA 2BE9B 3UI3A 5HMZA 1FT8A 2J7WA 3E01A 5KG1A 7AT1B 3C8YA 2FZCB 1V3RA 1I94F 2K06A 1RT3A 3K7RA 3M8PB 3HXMA 4KTQA 4JI0F 1NDPA 3MR5A 3RAMA 2LKZA 1MNEA 1VQOS 4IUFA 2P2CB 2DO4A 2DRDA 1RBAA 2HQ3A 1HPZA 2LU1A 4WFAQ 3EGZA 2XLIA 5A2QY 3P3DA 2MPUA 4WF9Q 2V4QA 4ECWA 4IG3B 3JAMU 4N8NA 4ECRA 1RT4A 3DOMB 2NSBA 5CQGA 2MQNA 1S72S 3L09A 5U47A 4CO1A 3PKMA 1UETA 4NLGA 3CIMA 1GMWD 4LRCA 2V4JA 3MPYA 3AD9C 3FK4A 3FGVA 3OVAA 4R0JA 4NZ6A 5EWFA 1L3KA 1H74A 2I5JB 4X4SA 4KGVB 2FJVA 4ZITA 4YY3J 2DB1A 4DN0A 4KHPJ 5KFCA 1PO6A 1T9XA 2Z2LA 1UPPA 4TU8A 3QSYB 4OHWA 1S12A 5HANA 1E6VA 3HFVA 4JI6J 3DDKA 1VQ7S 2GVDB 1NHKL 2OUGA 4DL3A 4F3QA 2QN6B 2XI3A 5SUHA 4KV8B 4U8YA 1KWMA 1ZAWA 1RU1A 1HWJA 2EG1A 1X7VA 4YDXA 2HFNA 1R27B 3TNVA 4Q5VA 2CNKB 2HQGA 3JSRA 1FKPA 1RSCA 3F41A 1N5SA 3FC9A 2ALZA 5I42B 5D3GA 4DV7J 4UTGA 5C25A 1DJ0A 4DV5F 3QYYA 1Y4ZB 4LT6A 4EYIB 3CD6S 2DISA 2XWXA 2HAIA 3OPKA 3QGHA 4Q2MA 1ZYQA 1EP4A 2R7SA 4TXSA 5J2QA 2E29A 3I56S 4DLGA 4QU6A 3CD0A 3MMAB 4J5OA 2YXLA 2QV6A 2DHAA 4CT9A 2HPUA 2F4VF 1WF2A 1WOPA 3MDFA 3WQPA 4TKTA 3DU6A 3ADAC 5KFTA 1N4LA 3QT7A 1IQZA 1SC1B 2CQ4A 3HDSA 1ZM3A 1RWXB 4ZVQB 4YP3A 3M6WA 5HO4A 2DGOA 5HATA 5E3PA 5BYRA 1ZM2A 2CJKA 2ZM6J 3RRGA 2YKNB 3D54A 4YR0A 4Q8EA 3SCIE 2C3MA 1SUQA 3M8RA 2QLBB 2QO3A 2DIVA 4FXWA 1RBOB 1YTYA 1NCLA 4DOZA 1WKLA 2C28A 3K8WA 4IFYB 3J7Z5 1TL3A 4DF4A 2F5GA 2AJ1A 2G4BA 1MWYA 4IH5A 2HFOA 2YX7A 3J7ZT 3OR1B 1Q4RA 1YJ9S 4ERDA 4J37A 5ETKA 1UWBB 2CZ4A 4F50A 2ZDPA 2NYHA 2XO6A 3R5AA 3QAEA 1C2PA 2C2RA 1BMQB 4NLDA 3TUZC 5ETVA 4K4SA 1U0HA 4WU2A 2R3VA 1CVJA 3CTRA 3A1YG 5LT5A 1IVZA 2DY1A 2F9DA 4CLYA 2BVZA 4XPEA 2O01C 5L1JA 5KFBA 3M05A 1UTAA 5KFUA 3Q8VA 3KNGA 1KLMA 2WONB 4ED1A 3V6DA 4OZ5A 1WC4A 2N4DA 3R7NB 4J9VA 1CJUB 4NCGA 3B4MA 2OPQB 2XS5A 4RZRA 3NKYA 5ITHA 1BWVA 1UWBA 4DMZA 3HMJG 3W9HA 4A46A 4ZLJA 1D8ZA 4ZVGA 1T9TA 2G0IA 5KG4A 4O44B 3W2VB 3OFEA 4DSEA 4DL0C 1X4FA 3TAMA 3GIRA 3IR7B 3OVBA 4WU3A 1YZ6A 3CULA 2W25A 3EVOA 2R8IA 4I56A 3LPEA 2GO9A 1SIWB 3ZZRA 3K2YA 2J7UA 5KFEA 1ULRA 4CM2A 4K2JA 3M1VA 3TQEA 2E7VA 3TUPA 2WONA 1F5BA 3OUYB 1SL1A 3MAHA 4GC7A 4DCPB 4K50A 4B3OA 3Q22A 2Z0GA 4YY3F 3PO4A 1B0VA 1VK3A 4Y2AA 4KHPF 4PCQA 1RI7A 1NJXA 2G2ZA 2H4WB 3Q2TC 1X5OA 4JI6F 3D4JA 3LWMA 2VOPA 3BR9A 2CPIA 3OBIA 2EW9A 4ER8A 4O44A 4WYWA 3Q89A 5L1IA 2ZJPQ 5KFPA 2J8SA 5CYMB 2VA2A 1RK8A 1O0PA 3OFHA 2EC0A 5K14A 3UN3A 1VQ6S 3L3CA 2UUBJ 2Y0SD 3TVZA 4I7FB 4NLUA 4PWDA 4RLEA 1BHNA 1SJRA 3HJFA 4OL8A 2CA9A 1VS3A 4R5PA 3T9NA 4DV7F 1AUSL 1GFWB 3G6VA 1WKJA 2YNHA 4B08A 3ET6A 4ED7A 1LV5A 3QFHA 3SDEA 2GJFA 5DZ6A 4QR0A 2DNRA 2VU5A 1FE4A 2D3OR 2HNYB 1Q5YA 2ILZA 2DTJA 3EVMA 3D1OA 1T8EA 2HLUA 5ETNA 2BANA 4QIEA 5CXTA 3HZEA 3PG9A 4QPXA 1BXNA 2YQ0A 1LWXA 2VBXA 1BQXA 1NZ8A 5J1NA 4D3GA 4FXVA 4ZDNA 4C0BA 1HMVB 3KHLA 5G4DA 1JLEB 1IWAA 1JWWA 2YNIB 3I5AA 1FX4A 4FPRA 2J8AA 4RBTA 4EO6A 4FYVB 2M52A 4Q45A 1S1XA 4USVA 3H0PA 4M5KA 1RUSA 1WHWA 3J80U 2DGUA 4E98A 4HHJA 2ZM6F 2OAUA 1VR6A 4P74A 2R8KA 1WHYA 4IYQA 4C7QA 1N88A 1TKDA 1B7FA 3MECB 3IG1B 5K5MA 1RWMB 1UZHA 2X1GA 4UZCA 3VHQA 2XCPA 4F2RA 1VLYA 4EK2A 3BN7A 2BQ3A 3BQ1A 2QA4G 3ENAA 3H5YA 2XC9A 2ZBRA 4YS2A 4MFBA 1IBLJ 2ADCA 4KR0B 2W9CA 3BKFA 3TEHB 2DH7A 4OLPA 1HWIA 4UT4A 4C0HA 4ETZA 2OJ3A 1TL7B 1NJYA 4CNYA 4NYZA 2J6SA 2E5GA 4A48A 4X4RA 1Q1KA 5A76A 1YSJA 2CQCA 1JLBB 1H2VZ 4DZ6A 4PG4A 2GNKA 4NL5A 3TJ8A 1X5PA 4WBFA 4ATNA 3IBCB 2QSWA 3H5SA 3MTKA 2I8EA 3GIMA 5E33A 2AJ4A 2XS2A 1HNWJ 1IKVB 5K9FA 4YB7A 1APSA 2QLJB 4JI4J 1NKCA 2DNNA 4OJGA 1S1VB 4U7UK 1DLOB 1X9MA 2JVOA 4RNMA 1G4CA 2HG4A 4F25A 5J2PB 4NLXA 4Y2CA 3DLGA 2ZZTA 2KZZA 1U1OA 1UFLA 1P9YA 1UJ4A 2ZZNA 3HVAA 2ZWPA 5HK4A 5IM0B 2VZ9A 2A6MA 1TUVA 2CQDA 4B3RJ 1T11A 4I2PA 2QMWA 3OXLA 1T0TV 2I2YA 2NXJA 2VBZA 1RACB 1RE1B 5F3TA 2W7AA 2YWKA 3QT8A 1U1MA 2IM0A 4JI3F 3GIJA 2M9KA 4P75A 5KFKA 4TLQA 1V9OA 1WHXA 2WK4A 3G6XA 4BC7A 1CJTB 1ZOTA 1XERA 4IR1A 1MG7A 3B78A 4M5LA 2UUBF 3POTB 3ZTRA 2B51A 2MMYA 2ZBIA 2X7IA 1D9AA 3HHLB 3O8WA 3J81U 1SH0A 4PQAA 3NMAA 1NH7A 2XNRA 1MMLA 4JV5J 3N6MA 2C2EA 1URRA 3J81j 2Z58B 2HW3A 4Q0BB 2DR9A 5GADU 1NJIT 5IT4A 3C14B 4DPTA 3ICLA 2RT3A 2WSEC 3WIUA 4G1PA 1RTZA 4ES1A 3MTJA 4RW8B 3N6LA 1RISA 1R8CA 2G0CA 2ZOFA 2XWYA 2AV5A 2MQOA 1CJTA 2PA3A 4BC9A 3R6GB 4H4MA 3C16B 2B6AA 2V4RA 2KFYA 1RTJA 4JI8J 1WC3A 2DEJA 1NPRA 2W8KA 2AT1B 3HHLA 4K4YA 3AXKA 1TMJA 8AT1B 3V6JA 5THWA 3PJXA 4MH8A 1UVJA 5BYQA 2QGFB 1RTHA 4PPDA 3BSNA 4Y00A 2UU9F 1ITPA 3LAMA 4DL2A 4V19J 1ZA2B 2EPIA 4IFVB 1CSJA 1TKXB 2CJAA 2NCKL 3OFFA 3UO0A 3ZNUA 4HI2A 6FDRA 2QTWA 4ZJLA 1FJGJ 3C14A 1RCOB 5H9EK 1C1BB 3I0SA 1H7XA 2BMBA 1HBUB 2ZWOA 5KT2A 3EMTA 1HBOA 3J80Y 1GMWA 1GH8A 4EWTA 1NKBA 2CFXA 1IBLF 4HT7A 2CPHA 4OIXA 2BOAA 2GJ2A 3R5BA 4DS5A 3T41A 5AT1B 1UFKA 4USUA 4ZVEA 1WTFA 3TAPA 1OPIA 4LRBA 1L5UA 3IRXB 3IS9A 4NEZA 5L1KA 3DN9A 2UXCF 2X1BA 3JS9A 2HBYB 4K7QA 4J9LA 2KN4A 3J7YU 2AU0A 1N5TA 1JLQB 2C2KB 4M5IA 4PEOA 3PW2A 2YWGA 1EJ7L 1R6YA 1YRTA 3QO9A 2FVCA 1N32J 3RR7A 3CT9A 4Q2LA 1HWLA 4UQGA 4ZCKA 4TY8B 4JI5F 3QIPB 3H4DA 5C42B 1HQEA 2HHSA 1HNWF 1QVFR 2AX1A 2RH3A 3QIDA 4JI4F 1B3TA 3DMJB 4I6WA 4NLQA 5KFZA 1CULB 2CWKA 2XMUA 1WTBA 1FFGB 3MR7A 1F9FA 4ECTA 1SC3B 2CPJA 4GVBB 4OV1A 4ANEA 4YMEA 1OSCA 1CQMA 2B5JB 3G71S 3Q0AA 5CZXA 4B3RF 3PRDA 5DG9A 4C97A 4ED2A 1QAXA 5HAOA 2HFUA 3BYRA 2DGQA 3EUNA 4NYOA 2VD3A 4ZP6A 1QY7A 3CJ2A 2EVZA 2P8IA 2CXEA 1Y5LB 1RA7A 2AGQA 5BR8J 5KT5A 5IC6B 3GYGA 3AA9A 1BD6A 2HK3A 1GXTA 3GLJA 2VPZB 1KQKA 3B82A 5F8MA 1VHFA 1FFSB 1XR7A 4FP9A 4A8QA 1RAJA 3CJKA 2HHHJ 3N9UC 3BBBA 5L39A 3KNAA 4GVBA 3TI0A 1HBNB 3MEGA 1RDRA 3PM9A 4JV1A 2B5JA 1NPPA 1R8AA 2NXUA 1LWEA 4CZCA 3P96A 1Q8LA 2M0GB 2E5JA 2E5LJ 1JXVA 2E5HA 4DL4A 1FRLA 2HQIA 4EO8A 1YRXA 3GU0A 3LPYA 2QL9B 4B3SJ 4DPYA 1PYOB 4ZJOA 3J81Y 2IAJB 3MCNA 2MLXA 1S99A 1K0VA 2W4DA 3BF4A 1GTHA 1AW0A 1S1UB 5GAHU 1KBRA 1S0NA 3NOGA 1LFWA 4JI8F 1JMTA 1EQMA 3HLUA 5KFLA 4ED3A 3UCGA 4M5JA 5G0RA 5DGAA 3FFIA 1HWUA 2FZGB 5GAEI 1YDLA 3KJNB 1SVDA 2ZH7A 2KI2A 3R5JB 2L3MA 4X64J 3SI8A 1WC5A 3NCQA 1U7LA 3MOZA 2VKRA 5HQLA 1FJGF 1TV6B 5SZTA 1FVSA 4F26A 4K2XA 2ASJA 4OJHA 1D9FA 3IA0A 4DX7A 2FJAB 2W4PA 3I96A 1S1UA 2AW0A 4OZ0A 5CD4A 5IT0A 1S10A 1MROA 1SJ3P 2L48A 1U2FA 3GPAA 2Y1RI 3OTDA 1VRUA 3NNHA 1FRJA 2DGWA 1QE1A 2CNOB 2YX1A 5F0WA 2DKOB 3OTCA 2R8GA 4RR5A 3DOKA 1KC8T 3U7JA 5B0GA 1EKSA 2DH9A 1YX2A 2RF2B 4O4GB 3BN4A 1RWPB 4WK3A 5RUBA 1CS4A 2V9KA 4OHYA 2ACMA 4KJIA 2RS8A 2MQLA 5DM7Q 1VISA 1R8PA 3RBDA 5D0HA 1U1PA 5B0DA 2UZAA 1BUXA 2XNQA 5J2MB 5D4LA 2P6SA 3B54A 2HQDA 4FYDA 1VQSA 3PO5A 4ILRA 1N32F 2RVJA 3PY8A 3G6YA 1VQ8S 2R7XA 2XYHB 3D68A 1SB6A 4LRAA 3GTYX 3M4XA 4DV6J 3MOJB 2A2DA 1LWCB 2EEYA 5L9XA 2JX2A 1I3OB 2BJ9A 4FN5A 2F65A 2B4OA 4MK8A 1SCJB 3MR6A 1TL5A 2R2SA 3CCTA 4RW7A 3M7VA 4P2MA 3KK1A 1NNDA 2QMXA 2ZC3A 5CYJA 1NK6A 1RTDA 1OY9A 3OHBA 5GMKa 3HJVA 1LWFB 3RAQA 1RT7B 1FNOA 1VMBA 1CC8A 1B99A 2FD2A 4RU2A 4IO9Q 3QMQA 5EX0A 3NCPA 2X1FA 1FXDA 5IV4A 2NSCA 1XN9A 3CDAA 3L4BC 5EHHA 1YHQS 3T3FA 2HLTA 4JI1F 4RW6B 2XEXA 5BR8F 1U49A 2VPXB 1M5OC 4ALZA 4ANDA 4ELVA 2FHMA 3A8KA 3OW2R 2DNOA 3DLKB 3QFWA 3W5XA 3CD5A 4WP8A 3NMRA 1KDNA 5B0EA 1RAOA 1LW0B 4DU8A 3G82A 3PKYA 5HLFB 4E8UA 4FVMA 4LQ9A 1RCXB 1IR0A 2BW7A 4X65F 3TUJC 4LF9J 3NGRA 1MWZA 4HKQA 1WI6A 2E5LF 5IZHA 2OI2A 2V8GA 3ZC4A 2IMWP 1PAEX 1IR2A 3O3LA 2GJIA 4C98A 2V0NA 2DBBA 2V63A 4B3SF 3GFZA 5KOWA 2XM3A 4RW4B 2V67A 4MAKA 3AD7C 1S0MA 2CWXA 2AMCB 3DNCA 3GB0A 2ZVIA 4DQQA 1WC0A 3CC2S 1T3NA 3BH6B 3U27A 2Y1JA 3D0HE 1KVJA 3NS5A 3HFZB 4KY3A 4DR6J 2MZ1A 4WP3A 4EU0A 3NBPA 2CRLA 1KTVA 1F5CA 3KJFB 3TA2A 3H42A 4YFUA 3MUTP 5KAKA 1HKAA 2NPFA 4P2FA 2PI5A 1ZTWA 4X64F 4DLEA 4DX6A 4DUZJ 3T5JA 4MK9A 4WE1B 4ZLNA 3R9LA 1WHVA 3Q2SC 5KOXA 4BCAA 1T03B 1D09B 5F8LA 1JLAB 3Q23A 3F56A 3DCAA 1BQNB 4X2BA 3OR2B 3TJ9A 3HCXA 4V19X 4RNFA 1HW8A 4X4NA 2JEGA 1G1XA 3CDUA 4NMLA 3LAKA 3OTBA 3C6UB 2FC9A 4NLSA 1N34J 2BDPA 3KK3A 1KVIA 1BY9A 2NS1B 3DLHA 2QYCA 5FLXU 3AQOA 3FJ2A 3M2UB 4OZJA 3NCRA 1DQ8A 3US5A 1M5KC 1PBUA 4YUDA 2GO8A 3EGVA 1NSAA 2R2UA 2ZFHA 1T9VA 5CD4H 3CCSS 2MTLA 4L6V3 2YH1A 1SBRA 1S6PB 3PV8A 1SL2A 3S1TA 1NB7A 3IR6B 3U02A 3G6ES 3KJVB 2R4FA 3KHGA 4M8LA 1OPZA 3OQ2A 3MGJA 4AUKA 3Q8SB 4JP8A 3LP1A 4V1Ak 2E7XA 5M2RA 1WF0A 4PUOA 3C6UA 2G13A 2GMHA 1YITS 4FF3A 5I4MA 4RPFA 8ATCB 1Q8KA 4ZPWR 1HWKA 1ZZNA 2VIHA 3RU0A 2WCXA 3JB9k 3CCLS 1WKKA 2DH8A 2XS7A 4DV6F 4I6AA 4RW9B 1VC6A 4ZP9A 2HVEA 3SBMA 3WIVA 5EUHA 2VBYA 1M1GA 4WYLA 3BPDA 2EFNA 4CT8A 2J76E 2DRAA 5F8NA 4DV2J 1IKWA 4UQTA 2XMVA 5FDLA 3H8YA 1BQMB 4LRDA 4H4OA 3CJ0A 3VCDA 1YGYA 2UXDJ 1KONA 2AD9A 2ZJQQ 1XR6A 3LGHA 3RW7A 1XWLA 1URNA 2K7JA 3FKBA 2W2OP 5CABA 3DLLQ 4B9SA 2QIFA 2ZOGA 1TUGB 3QSIA 2OHDA 3R2CJ 4ZPVR 3M2RA 4ITSA 2OIHA 3M8YA 3GSIA 2GIRA 5LMNJ 2QLFB 1U26A 3E8OA 2ZKUA 1W26A 3W8GA 4M94A 4KIAA 3CMES 3QRQA 4DZDA 3VAMA 5A8RB 3U1LA 2VG6B 1HI1A 2BE2A 3O5TB 1UEVA 2ZUAA 3I31A 2UVUA 2QRRA 1S59A 4AL7A 3KMQA 3IR5B 2NQPA 2VBWA 2K3KA 4LF9F 4KKOB 3BQ2A 3BS9A 5I3UB 2M4MA 1S5ZA 3QWUA 1G7CB 1SXLA 2J9CA 5MAOA 4QU7A 3RUBL 3A13A 4DR1J 4USWA 1FTRA 2QL5B 1FI4A 2QLWA 4GMKA 2QZ8A 5ETQA 2MJUA 5A8KA 3D6TB 2ALYB 4L75A 4DR6F 2OPSB 3R5GA 3SV4A 2GMLA 2CQ0A 1REVA 4LSNA 4CNZA 4TQSA 2O1PA 3EXCX 3MCMA 4NWBA 4KKOA 4OV6A 5I3UA 4PXEA 2UVWA 1HBMA 2IA6A 3VVTA 1QAIA 2B9YA 2CG4A 4LVNP 3LWLA 4DUZF 4OYWA 2IC3A 5DS7A 5F9LA 1S57A 1M5PC 4U95A 3KLFB 2OPRB 3PX0A 1GT8A 2XULA 4HHUA 1N34F 5T7LA 1CBKA 2HS4A 3A3PB 2OPSA 1LOUA 4K0KF 1U8SA 2GFFA 1Q0NA 5HP1B 4M95A 4CDIA 1KSPA 1FWKA 3HFKA 2RUGA 2HHPA 1JJ4A 4NA3A 4C8OA 3IWXA 2PEHA 4C8ZA 1T9UA 3PDNA 1HARA 2HZCA 1G6BA 4WFXA 3DLEB 2JLEA 3CF5Q 1RWNB 4HACB 3EXYA 4KPYA 2EFQA 2KHDA 1V3ZA 4IOAQ 2DIUA 2KTQA 1N0UA 3F44A 2C1EB 1S9EB 4DV1J 4KPCA 5DLGA 3MPUB 2W9BB 1XC9A 1EETA 3MMCB 2E9RX 3TP2A 3CDEA 2VF3A 2DPIA 4CLLA 2YNFA 4ECSA 2NZ4A 2ZNYA 4LMZA 1KFSA 3OXFA 3KG4A 2DO0A 1VIOA 5D0GA 2MZTA 2PC6A 4ED8A 4A8MP 5C24A 2DNMA 3AOBA 2BEFA 2VL1A 1NJWA 4RUBA 2D7SA 2F8HA 3IMQJ 3HD2A 3W2WB 1MN7A 5HSPA 1MLAA 4WFNQ 3D0GE 4ICLB 3JSMA 4DV2F 4ZHRB 5DO2A 2XLJA 2ZUGA 4ILMA 4ZVRB 3GYXB 3SFUA 2VICA 2XI2A 2Z4PA 1UA0A 1PBAA 1X0FA 2VH7A 1Q5VA 1FDBA 3RRHA 5H9EJ 4F4YA 4LJMA 2UXDF 1U48A 3KLEA 2Q1LA 5E41A 5D6GA 2VHGA 3LALA 4Y65A 2ZE2A 3NNAA 3FEZA 3V4IB 3I82A 1LW2A 2H5JB 3RBZA 2MZQA 2BOPA 4LVOP 3IBWA 3RBEA 4RUHA 2R8HA 3ELHA 2MLYA 4LFBF 3HI9A 3D66A 2MDAA 4ZP7A 3O44A 1BWEA 4RNNA 1RLDA 3VGUA 5LMNF 3I6PA 1E6YB 5K8PA 2UUCJ 4MYTA 3R3TA 1LXNA 1U47A 1YJRA 1K73T 4DPOA 1C4CA 2Z30B 5H1SV 1GEHA 4KC5A 5IS2A 3ITHA 2O3DA 4OYPA 1H73A 3DOLA 2F1FA 4O3RA 1D8YA 2V94A 1FRIA 3JTOA 3Q24A 4FPIA 4Y2IA 2NUUG 4QWAA 2G0JA 1WNEA 3F73A 2LA4A 2CKWA 2NYIA 2I9SA 2YWEA 3FEXB 2PMZD 2JEJA 4DR1F 4GKJJ 3QJPA 2QL7B 4LSZB 4AE5A 2VG7B 2PFFB 4J9NA 2D3O1 2RDDA 2B9WA 2IMOA 3GQCA 5GMEA 3D7SB 5D4PA 1U45A 2HS0A 4PPZA 4DFMA 2HSEB 3EM1A 2Q3PA 1Y10A 1VFJA 3I4HX 3BSCA 1OIAA 2M3DA 3V4MA 1SL0A 2Y0BB 3VGVA 4Z2XA 2J9DE 4WXWA 4JI7J 4HH0A 1F2HA 3KOAA 3T1AA 1IM4A 3THTA 5A0YA 2IDLA 1UVKA 4FKXA 3L7OA 1EHWA 4P10A 4O3QA 2IVYA 2LP4A 4N41A 2DCLA 1JLFA 3OJUA 1NO8A 2H3EB 2FJXA 4IKAA 2RAQA 1C0TB 5A8WB 1CG2A 4USMA 1KQSR 2LEPA 2C22A 1FEEA 3DKDA 1T94A 1RHJB 2WW8A 2YKQA 8RUCA 3LANA 4DBQA 5FIIA 4NOHA 4AD6A 2EXUA 1UW4A 1UW9A 2WVFA 2J0QD 3GIIA 4G6VB 5IWAJ 2C2OB 5JMNA 3KHRA 2XMJA 1C0UB 1TUWA 2OSRA 4RBUA 1IJFB 3I9V9 2NLWA 2K7KA 1UZDA 1NB2A 2HVIA 3R1LA 4AT1B 3T6JA 2XY6A 3BSAA 2WHOA 3OSNA 3GWCA 1VRTA 2EKYA 1TKTA 3PRBA 2IBKA 4IRDA 5A8WA 1AZSB 4K4TA 4F4KA 4ED6A 1FD8A 2HRTA 3MPWA 4NX9A 1NXIA 1PIEA 3NAIA 2KXHA 4I64A 3IFEA 1C0UA 1RT1B 3ZXWA 1UAWA 2YNGB 1IR1A 5HVFA 3UDLA 1ZAVA 2IRYA 2V8HA 1U6FA 4CO5A 1KTQA 4QWBA 4CYUA 2AEJA 1SKUB 4KGXB 3S7RA 2HVZA 2HEKA 3GG0A 2OPPA 2Z2YB 3BGRA 4LFAJ 3DGVA 2UUWA 3CXCR 1WG1A 4Q8FA 2HBQB 3PXGa 2XQCA 4TQRA 1U6ZA 3D0IE 3M8WA 4KB7A 3K5OA 5LL6d 3NP5A 1N5VA 1U2RA 1F3FA 2ZHAA 2OMLA 4DCOB 3CB4A 4C9DA 2IVMA 5KFIA 1RZMA 4OI1A 2YNGA 3AFGA 5JVGQ 1RT5B 4NZ0A 5IOLA 5HROA 5CA5A 1VBXA 1WF1A 3C6TA 4F4ZA 2R7RA 3ZZTA 1R0AA 3LGMA 2X3GA 2YTCA 3W5ZA 2LXUA 2WB4A 2BJ1A 2UUCF 4ZIWA 3PEHA 4PAAA 3E51A 3TR5A 1Y3JA 4A8YA 4WFBQ 3PIPQ 2KHCA 3DRPA 2B8PA 2QJ3A 2DITA 3JTNA 1NHUA 5B0CA 3QLHB 4DFPA 4CRJA 4TLRA 3IWNC 3CCMS 3TO8A 5D0EA 1WG5A 2OD4A 1I1GA 4ED5A 5HBMB 1RU2A 2JH3A 1A9NB 1N56A 3J7A1 4ED0A 2B0GA 1X31C 5MLCV 3P45B 4JOUA 4CO4A 4B3TJ 1RGVA 1WC6A 2N7YA 1V3SA 2U1AA 4CO2A 3DLJA 3QZ7A 2HNZB 4I0WA 4MK7A 1F9HA 3PCOB 3JQJA 1O6XA 1F60B 3MM9A 4N7TA 1KVKA 2FQQB 2PO4A 4K4WA 2J9DA 3DXSX 4B02A 2WSFC 3BO2A 1S1WA 1N48A 2N3OA 1CEZA 2ZD1A 4JI7F 1ZPWX 3A4TA 1CJVA 3K17A 2DD8S 4A8FA 1GAOA 3CEDA 2HQCA 1JQGA 1S0VA 1XJWB 1UVLA 4OYXA 2DHSA 4TN2A 4B9MA 1N5YA 4OHXA 1BE4A 2FGCA 1TQLA 1KP6A 2YQ3A 5CYQB 5IWAF 3PR5B 2M7SA 1TTHB 2VQEJ 1X0PA 2YQ1A 3BYPA 3VALA 3VZHA 1OS5A 4P52A 3QNWB 4PXBA 2EKNA 2D69A 2XSJB 3EZOA 2C42A 5FD1A 4PG7A 4OYOA 3VQSA 3T9ZA 3MM6A 3RW6A 2LEBA 3E01B 1SI9A 3OXGA 3M2VA 1IN0A 2RUSA 5F3ZA 2RSQA 4NA2A 2AF6A 2KH9A 2RKIA 2CQGA 2CYYA 1HPZB 2FJEB 2EWHA 2NXNA 1TMMA 5LMUJ 3NWRA 2J7KA 5E3CA 5KFNA 2BACA 5CYQA 3DRRA 1SJQA 2GAGC 1RT4B 2QFIA 2XHCA 3KUGA 5KFVA 1X4AA 3TRGA 4M5MA 3KWMA 2IY5B 3OL7A 2V4JB 2AEMA 5DDQC 2RIJA 3GFHA 4B3MJ 4DL5A 4LFAF 2JL9A 4ZVSB 3BGLA 4R8UB 2Q6BA 2GS8A 4UOFA 3U1MA 3LH2S 2YX4A 2LQ5A 3KLVA 2WVCA 2R7OA 4J90A 1E6VB 2J6UA 3KK2A 2JDJA 3M9OB 2W8LA 2GQCA 4P9SA 2L9WA 1DFDA 1YQHA 4K8RA 2QX0A 3CNQP 4QPTA 3HHNB 3MZIA 3N6NA 4F0HA 3TVKA 5AXKA 4DDFA 3J7YI 2H5EA 4F2SA 2ROEA 1FKPB 1YI2S 2KU7A 5D3GB 2PFDA 5C25B 4R8UA 1FRKA 4PWUA 1LK7A 2FZKB 2K3IA 2DJWA 5HJXA 4DPWA 4K5SA 5E0OA 1SJ4P 3MURP 4OQJA 2VFRA 3MFHA 1EP4B 5J2QB 3TOQA 1RHRB 4M5NA 4OYBA 2KM8C 2VJUA 4ZVOB 4DV0J 1K44A 1TVRA 2BQRA 5LXYA 3E2EA 1PJ7A 3FZBA 2GHPA 3N79A 1NSKL 4QWCA 3CO9A 4IG0A 4DL7A 4C3MA 3UCZP 1YK9A 1KLNA 2BJEA 2EG2A 4EBDA 1N8RT 4YB1P 3NGUA 2Y9HA 3H25A 2QT7A 3T5KA 3V5RA 2FLPA 4EMDA 2D3UA 1MMDA 3FCWA 2MKIA 1C1CA 1WI8A 2GGPA 3GE9A 3HF5A 3P8BB 4HTJA 3R1HA 4RWXA 3DYAA 3WX4A 2U2FA 1K9MT 4AL5A 1SUQB 1OO0B 3V2UC 5KFXA 2I0XA 3W9IA 5LJ3Y 4BDPA 5DZ7A 2RDIA 1TL3B 3P4UB 1SKSA 2UXBJ 3ONQA 1HNIA 2V68A 4X84A 2J6TA 3MD1A 4CLTA 2LQBA 3QBCA 3UPFA 4PYAA 1EZZB 5F0UA 4HDHA 3BPSP 2LDIA 3NGSA 2MZJA 4NMXA 2VQEF 3FRZA 4FS2A 1U0HB 2AWZA 4OZNA 5KFYA 1DURA 2HWIA 1HHQA 5HMXA 2HKEA 5L1LA 1U2CA 4OI2A 3MMJA 1ZTTA 5GAHI 5GAGU 4A8WA 2GCFA 1KLMB 3V6DB 5KT3A 2KT2A 4DSFA 3NNCA 3W5YA 2DGVA 4NCGB 1SQGA 4I2QA 4MKAA 4DCJB 3GV8B 5D77A 3EGWB 4XO0A 2CDQA 4A47A 3PZPA 3AOAA 3UDEA 5LMUF 3TANA 3R7SB 1SV5B 5AE3A 2CPZA 3TAMB 4ES3A 2FHKA 5LM7E 3SIPB 2BYCA 4DQSA 1O5JA 3IGNA 2OSQA 2ASYA 1KKHA 2LU2A 2CNNB 4OI6A 3ZTSA 3VQTA 4BBYA 3M1VB 3W8PA 3IM9A 1ICEB 3JQKA 3GYNA 4PG5A 3CCJS 2IJFA 3PNIA 1VQPS 4B3OB 1TZ0A 2RHQB 2P6TA 5KFDA 3LP2A 4CO0A 2YKAA 3WDOA 1ZM4A 1YJWS 3R8YA 2JFKA 3MPVA 1SJFA 1J27A 1MW7A 2YKPA 1SV5A 1ZPVA 2LVWA 3ENVA 2BJ8A 3HP6A 3KUEA 4IQMA 4KO0A 1M5VC 3ZTOA 2PGCA 2VG5A 5K14B 4EI2A 1PAUB 3AH6A 3VAGA 2J9EA 3EX7B 3JAMY 3A3NB 4PWDB 5F41A 4OX9J 4WZQA 1FVQA 4R5PB 5F9NA 2LXFA 3ZO7A 2VPYB 4KGMA 1QM9A 1NJZA 2YNHB 3AJ2A 2HGLA 1RJJA 3ET6B 4U9RA 3SDEB 3MM7A 3FMBA 4XIUA 4OZ2A 3AB4B 4FBTA 4WWSA 4DV0F 4YR2A 2IJRA 2OP5A 2I1RA 1FKOA 1R0BG 1Q86T 3HVTB 2BANB 1HW9A 4CH7A 2KXFA 2D3ZA 3QGGA 3V81B 5DRKA 3CCVS 1S0OA 3UR0A 1Q82T 2HRUA 5FJ4A 3RTVA 2WRMA 2FVPA 4JI2J 4LR9A 3JSYA 5IFMA 2MHEA 1S1XB 4ETXA 1WOOA 4F04B 4M5DA 4C11B 1X9WA 2R9LA 4B9NA 4RX6A 3MFIA 3DDNA 4RO0A 1JB0C 1ZAXA 1AA1B 4N56A 2XMMA 4BS2A 2YKMA 1VRQC 1X4CA 1RQ0A 2CPYA 2KO1A 5GVQA 3CJRA 3HVTA 5KFFA 3M9NB 3PIOQ 3VAIA 1UEKA 1VBKA 3RJMB 3K89A 2UXBF 1FDAA 5B08A 3V81A 1YKWA 4DQPA 4MFBB 3JQMA 2W9CB 1P27B 4EGLA 2MKHA 4C8MA 2MSSA 3EWGA 3SSQA 3HK2A 2IBOA 2RMLA 5J2NA 3NL0A 2C2DA 4C11A 1FHTA 2IVFB 4AXIA 5H9FK 3AODA 1VYAA 4GO5X 3CD7A 2ZJRQ 4HI1A 3BREA 4DWIA 1FJCA 1P1LA 1IBCB 4J9PA 3GJRB 4O3SA 1RXOB 1S4EA 3IBFB 4GKKJ 5E3AA 4URSA 2KT5A 1VDHA 2HRYA 3SCJE 4IQXA 2B4VA 1DRZA 2QSFA 1S77D 4XPCA 2CADA 2MQ8A 1QUPA 3PX6A 4IO1A 2MZSA 5DJBA 1N6QA 3EPIA 3MAQA 4ID8A 1KRPA 1FNMA 3DLBA 4ZVPB 1LXJA 3UD3P 3FDSA 2QC3A 3VGSA 1TK0A 3ISZA 1J5OB 1XNQJ 2OKQA 3KDNA 2BRKA 1JKHA 3DLGB 4LFCJ 2AIRB 1QAYA 1N52B 3D5MA 1X4HA 2YPYA 5CCMA 4CLSA 1JLGA 1RB0A 5DG7A 5ETOA 4DR7J 5CH7B 4PQUB 4I2PB 4FVCA 1NEEA 1TK8A 1O8BA 3MEEA 4R25A 3JYTA 2IM3A 4FYXB 1EX8A 4ZCMA 1YBTA 1FF2A 2CVEA 3CCZA 3B4DA 1IJEB 1AYEA 2DR7A 4CCHA 1RAHB 5GMDA 4ZN1A 2OD6A 5D15A 1J5OA 2ZEJA 3BZQA 1IKXB 3FSYA 1NLKL 4OX9F 2ZH9A 4DN9A 4K4VA 4QIGA 2W2MP 3M32A 1RTIA 2MGZA 2IM1A 3P49B 4J9OA 4QIVA 3CCES 4JI0J 4IRKA 1L3TA 2BM1A 2XY5A 4USJC 4PQUA 4RKUC 4DEZA 3W64A 4U8VA 4WTOB 1LEOA 4X4TA 3C19A 3W66A 4MYUA 1AXQA 2DR6A 1HYSA 4FNIA 3ZTQA 2AGOA 4OYAA 3EYZA 1WJ9A 4ELTA 3PVXA 1G2EA 2GAHC 1GXLA 1YLXA 4WKRA 4P72A 4H4MB 3R5DA 2B6AB 4ZVUB 3GCWP 3MAAA 1W7WA 2FB0A 3HHKA 1RTJB 1IKXA 4IR9A 3KLGA 2G1DA 1VJQA 2K1RA 3O6QA 4F4AA 1T05A 5LSLA 2FHOB 2Z56B 1RT2A 1JNRB 2MKCA 3LOUA 1RTHB 4DJBA 1OSDA 4ZLLA 2JOQA 5HMWA 3KLIA 1XEZA 4ZN3A 1S6QA 1YWXA 5EGYA 2EFOA 2MKKA 3DGPA 1X4DA 1FFWB 3NWGA 1KHWA 2QE5A 2PI4A 4EEYA 3UFCX 4OJ3A 1NBEB 3GFXA 2ZBQA 2KDOA 1I5OB 3CPWR 3I5BA 3I0SB 4DFJA 2N4CA 2HYIB 9RUBA 2V5HG 4M5GA 1HBOB 5ETTA 2AHOB 1L3VA 1VQNS 2RJZA 1VI7A 2E7WA 1NZAA 3FBEA 1SIZA 5J1EB 3SQGA 3FBFA 4DQIA 3GSDA 2GIFA 3ETOA 4KQZA 4ZPCA 3GR0A 1A0OB 4CIOA 5ETLA
chains in the Genus database with same CATH topology
4K59A 3F44A 3IAS9 1R8HA 1S9EB 5KG4A 5DLGA 4O44B 2W9BB 3W2VB 1XC9A 1EETA 2XSFA 3OFEA 4DSEA 4DL0C 2F9JA 1X4FA 3MMCB 3IS9B 2E9RX 4O23A 3TAMA 3TP2A 7FDRA 3IR7B 1VQYA 4XAKA 2G9OA 2CQPA 3N28A 4WU3A 3OVBA 3CDEA 2DPIA 1UP1A 2R7QA 4AFFA 5DGBA 1NK4A 3CE8A 3CULA 2DNLA 2W25A 3DRSA 2BA9A 2YNFA 4ECSA 2R8IA 4I56A 2VFSA 2NZ4A 2ZNYA 1QSSA 1VOMA 2GO9A 4LMZA 1LWFA 3Q8QB 1RT7A 1SIWB 4AQYF 3OXFA 3ZZRA 1KFSA 3K2YA 3KG4A 2J7UA 5KFEA 1ULRA 2DO0A 1VIOA 4DS4A 1M90T 3OTEA 3UD4P 4GKKF 3M1VA 3KLHA 2MZTA 3SCKE 4KHMA 1VC0A 2PC6A 4ED8A 4A8MP 5C24A 1AUDA 2WONA 2JEFA 1F5BA 2DNMA 4Q43A 2VL1A 2LA6A 3MM6B 3OUYB 5M2PA 1NJWA 1SL1A 3QO9B 3GV5B 1FK9A 3MAHA 1TAUA 4UOCA 2D7SA 2F8HA 2ZVSA 5J1EA 2BJDA 3LW5C 3W2WB 4GC7A 4RW6A 4B3OA 3Q22A 2Z0GA 4YY3F 3PO4A 2VOOA 1B0VA 1VK3A 3N5BA 2IHR1 3NRBA 4Y2AA 2MXYA 4KHPF 4KE5A 4PCQA 3M2VB 4PXDA 4B17A 4W92B 1HQEB 3QPIA 2WBMA 2ZH2A 1RI7A 4WFNQ 3FRYA 3D0GE 1NJXA 4ICLB 3JSMA 4DV2F 4ZHRB 3AY0A 5DO2A 2AYGA 2XLJA 2ZUGA 4ILMA 5KG0A 4FF1A 3DLKA 2RKIB 2RRNA 3RZAA 1UJ6A 3GYXB 3MEDA 2DNPA 3SFUA 2XI2A 3Q2TC 2GQ2A 1X5OA 4JI6F 3G8SA 2YWFA 4J9KA 4WXOA 4MKYA 3LWMA 1X4GA 2VOPA 3BR9A 2Z4PA 1UA0A 2CPIA 2FLOA 3OBIA 1X0FA 4RUCA 2IRXA 2EW9A 1YJUA 2VH7A 1FDBA 3DI6A 3RRHA 5H9EJ 4O44A 4OX7A 2Q79A 4WTYA 4QR2A 4F4YA 2ATLA 4LJMA 4WYWA 1U48A 2UXDF 3KLEA 3QWPA 2Q1LA 5E41A 1LW0A 2EBEA 1N54B 3IWLA 2VODA 2MHNA 1FO1A 2LECA 1JX4A 5D6GA 5L1IA 2ZDOA 1FA0A 2ZJPQ 3DRRB 2HFZA 3GG1A 5KFPA 3LALA 2A10A 5CYMB 4Y65A 5HLFA 2EFGA 5AE2A 2ZE2A 1XNQF 2DGSA 3WC2A 4KAIA 3NNAA 5A6PA 2VA2A 3FEZA 3V4IB 3I82A 1LW2A 1RK8A 3M30A 2AGPA 2MZQA 1O0PA 2W24A 3OFHA 2ASDA 2BOPA 5K14A 4LFCF 2EC0A 4LVOP 1VQ6S 2Q6CA 4OI0A 3IBWA 3L3CA 2RNEA 4QR1A 2Y0SD 1F0XA 4IH7A 3TVZA 3RBEA 3AHPA 4ID5A 4I7FB 1A6LA 3MR2A 5EX3A 3WBZA 3H2VE 1R89A 1B0TA 1Y5NB 4RUHA 1VQ9S 4NLUA 4OLOA 4PWDA 4RLEA 1SH2A 2R8HA 4LFBF 1SJRA 3HI9A 2ZH4A 2QLXA