4H4MB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
428
structure length
428
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 102
structure length 428
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB03
1S1XA 2YKMB 3BQ2A 1SV5A 4URGA 1C1BA 3OL9A 4J9PA 5FDLB 4PUOA 4KSEB 4NLRA 5KFHA 3PJXA 3DRSA 4ID5A 3PW7A 1GX5A 2FVQA 5DLGA 1RT4B 3MEDB 3HVWA 5I3UA 1LWFB 1VRTB 1ZETA 3DLEA 2FJWA 5KFNA 3RB6A 3CDWA 4PQUB 3PJWA 4KE5A 2E9ZA 1JIHA 5KG7A 1MMLA 2QE5A 3PW4A 2UVRA 2W9AA 1RT1B 5KFRA 2JC0A 1CSJA 1S10A 2HNDB 4QWBA 1N5YA 2IJFA 4WFYA 2W9CB 2D41A 2VG6B 3JYTB 5J1EB 1RTIA 5D3GB 2OPQA 4WYWA 2BR0A 2E9TA 1JKHA 5KG3A 3DMJB 4IR1A 3HVTA 4YP3A 1HNVB 3FQKA 2WOMB 5F8NA 1RTHA 2YKNA 4O4GA 5J2MA 2BRLA 1S1VA 4RNNA 4ECRA 3CWJA 4F50A 3RB4A 2OPSA 4QWEA 4EYIB 4O3OA 5L1JA 4KB7A 4NLWA 3QO9B 4K4VA 1EP4A 2BANB 3H4DA 4LQ3A 4YR0A 1FKOA 1QE1B 3KHHA 5HP1B 3FQLA 4WFXA 3DRRA 4B3OA 3OHBA 4JV0A 2F8EX 2XGPA 4NLSA 1LW2A 2RKIB 3DOLB 4ZVGA 2D7SA 1RT2B 4FS2A 3M8PB 5C5JA 1EETA 3T5HA 3CDUA 2IM2A 3QIPB 4PWDA 5DG9A 3BQ0A 4NLQA 2AWZA 2FVCA 4ECXA 4IFVB 4NRUA 2JEGA 3SFUA 4MIAA 4ZHRB 5KG0A 5L1IA 2JEJA 4K50A 1RT5A 1TKZA 5KFVA 4O3NA 4IR9A 4J9MA 4KFBB 1ZTTA 2RF2A 3DI6B 1RT7A 4HKQA 3TAMB 1HYSB 1U09A 3M9NB 4JV1A 2B5JA 5J2PB 1HQEB 3KHRA 4NZ0A 4IFYB 3KLVA 3JSMA 5KFQA 3H2LA 1SUQA 3DRPA 2AX1A 1T3NA 5KFLA 5C24A 4RZRA 2CJQA 4WZMA 2UUTA 4K4ZA 4RUAA 1C1CB 1S9EA 3KK1A 5L1KA 1JX4A 4GC7A 3TVKA 5I42A 4ECYA 2BQRA 3BQ1A 4URQU 2XCAA 4KHRA 3HKWA 1MU2A 2IC3A 4EO8A 1OS5A 3NKYA 5KFJA 3IS9A 2B43A 3DM2A 3OSPA 1KHVA 5L9XA 3MFIA 1KHWA 5T14A 2C28A 3Q8SB 1NNDA 1S97A 4O3PA 3LP1B 1S1TB 3GQCA 3QLHB 2RDIA 3RAXA 3IGNA 4H4OB 1HNIB 4Q0BB 5KFGA 3MR2A 3MR6A 3C6UA 4Y2AA 2HNZA 4QWDA 3CJ3A 5KFEA 3MFHA 4RW4A 2UUWA 4I2QA 1XR7A 1RT6A 3KHGA 1S9FA 1S9GA 2ZD1B 3NAIA 4K4TA 4NLPA 3M8QB 1IKYB 5F8LA 5K14A 3OL8A 3MEEB 3T1AA 3V81B 4J9SA 1TL3A 4TQRA 5KT2A 3MF5A 4QWAA 5KFTA 1DTTA 1KLMA 1N4LA 1FK9B 4DEZA 1JLBA 3KLFA 5KG6A 3UDLA 1RA6A 4TYBA 2UVVA 4RW8B 4ZP8A 4IH6A 2HMIA 2C2EA 1LWEA 1S1WA 5HBMA 1TKXB 1IKWA 4KV8B 3KK2A 1S6PB 3KHLA 4ED6A 3T5LA 3DYAB 3DLKB 5CYQA 1RTDB 3E01B 3GIIA 4DG1A 1LW0A 4TLRA 3UQSA 3DOKB 3LP2B 4U6PA 3MEGA 3CDEA 1JLEA 3UR0A 3OL7A 1N6QB 1JLAA 1DLOA 2JC1A 1J5OB 5KG5A 4HYKA 1C0UA 4G1QB 1ZTWA 1Z4UA 3ITHB 5KG2A 3KLGB 5KFZA 4LSNA 3GIJA 4ED3A 2J6TA 4YR2A 4RW6A 1C0TB 3MR5A 4MK9A 3GILA 1RYRA 3NMAA 3KOAA 4F4XA 3CJ0A 3KLIA 3H4BA 4NYZA 3QZ8A 2DPIA 3V4IA 4KKOA 2ASDA 4I2PB 4ECSA 4TY9A 4M95A 4MFBB 4LSLB 3OL6A 3DLGB 2I5JA 1RA7A 3BGRB 4TXSA 5EWEA 3GIKA 3IG1B 4O44A 1K1SA 2R8JA 4TY8A 2VG5A 2AGOA 2IMWP 1XR5A 2OPPB 4NLDA 1LWCB 1TV6A 1VRUB 4I7FA 4Q44A 5KFKA 3PR4A 4MH8A 2YNIA 2HWIA 3M9MB 4WE1B 3PW2A 3PW5A 2FLLA 1S6QB 4IDKB 4R8UB 1S48A 2R8IA 4H4MB 3H5XA 3V6DA 4MKAA 3C6TA 2IM1A 1RT3A 4J9NA 2OPRB 4IG3A 1FKPA 4QWCA 5C25B 3MR3A 5C42A 4RW9B 4LQ9A 1S1XB 2BQ3A 1TKTA 1SV5B 4EBCA 1C1BB 4Y3CA 4XPEA 3MTKA 2IJNA 5F9LA 4PUOB 2YNFA 4WZQA 2R8KA 1HMVA 4ZPDA 3DRSB 4ID5B 3M8PA 1BQMA 2HNYB 5I3UB 2IA6A 3DLEB 3PW0A 3FDSA 4KBIA 4ICLA 4ZHRA 4RW7A 4K4WA 3I5CA 1HARA 3H59A 4O3QA 1UWBA 2WONA 2D3ZA 2D3UA 4NLUA 4RNFA 1JLFB 4YQWA 3GYNA 1RTJA 2W9BA 1HQUA 2QV6A 4Q8FA 1BQNA 2C2RA 3KMQA 4WYLA 5CYMA 1IKVA 1RTIB 1IM4A 2OPQB 4IG0A 2WCXA 5F8IA 1JKHB 3N6NA 4DL5A 1S0MA 4J9KA 3HVTB 4YR3A 4EEYA 4NLYA 1RTHB 2YKNB 4O4GB 5J2MB 3PHEA 1S1VB 2AGPA 1TVRA 4ZVFA 3UPFA 2OPSB 1S1UA 2VG7A 3KK3B 5F8GA 1T03A 1EP4B 4WXOA 2ILZA 5EWFA 4OL8A 1FKOB 5HLFA 1D1UA 3DRRB 5KFPA 4RNMA 2C22A 2OH2A 4B3OB 3QGGA 3Q8RB 4URSA 5DLFA 1LW2B 3CJ5A 4J9LA 3PZPA 4JV2A 3BSAA 2IBKA 3GV7B 3MECA 4R0EA 2WB4A 3NBPA 4PWDB 4IOBA 3HVAA 4MK8A 4ZVEA 5J2QB 2ASJA 4GC6A 1HPZA 2HWHA 1RT5B 1TKZB 4M94A 4EO6A 4RUCA 2ALZA 2WTFA 2RF2B 1RT7B 2YNGA 4ZVHA 4R5PA 4WXWA 2FVRA 1DTQA 2WRMA 4NLTA 3G6YA 2B5JB 3OSNA 3KJVA 3JSMB 1SUQB 3DRPB 4DL2A 4ZMMA 5DG8A 1JLQA 5C24B 1D0EA 3QIDA 2YNHA 2FJVA 3EZUA 3LP0A 3T19A 4ECQA 2XI2A 3D28A 1S9EB 3KK1B 1IKXA 5KFIA 1TQLA 3I0SA 5I42B 4Q8EA 2GIRA 1MU2B 4F4YA 2IC3B 1SH2A 4ED1A 4KO0A 3CO9A 2XC9A 3IS9B 5EUHA 4NCGA 2B6AA 3DM2B 4U7CA 1JLCA 4X2BA 2R2TA 3KLHA 3ISNC 4QW8A 3QGHA 3QZ7A 3KLEA 1S0NA 1RYSA 5J2NA 1YVFA 4O4RA 3SFGA 3RBEA 1REVA 5KFUA 3FFIA 3H5SA 1T05A 3BSOA 1TL1A 1R0AA 3C6UB 3V6KA 3IRXA 4O3RA 4IH7A 2AX0A 4O3SA 2IAJA 4FS1A 4RW4B 2ZE2A 3KNAA 4I2QB 4RNHA 1RT6B 5HROA 4ECUA 4ECTA 3G6VA 1JLGB 4Q45A 3ISND 5K14B 3V6HA 5KFOA 2AQ4A 2YKMA 2XGQA 1TL3B 3GIMA 2IM3A 4ZPCA 4XO0A 5FDLA 1DTTB 1KLMB 2R2SA 3NGDA 3RB3A 3OHAA 4ED2A 3RBDA 1JLBB 3KLFB 3BREA 2IM0A 5EWGA 2W7OA 4DL3A 4RNOA 1S4FA 2BQUA 4FBUA 1WNEA 4NLGA 2HMIB 1LWEB 1RT4A 3MEDA 1NHVA 3N6LA 1LWFA 1VRTA 5KFYA 3VQSA 5KFBA 4ED0A 5HBMB 1IKWB 2W8LA 5CYQB 4PQUA 4Q43A 4DG1B 1LW0B 4TN2A 3MEGB 1S6QA 4TYAA 1JLEB 3E51A 5KFWA 1RT1A 3I0RB 5KT5A 3H5UA 1JLAB 1DLOB 2UVUA 4K4SA 2HNDA 2W9CA 2FLPA 3M9OB 1C0UB 2ASLA 4J9RA 2VG6A 3JYTA 5J1EA 5D3GA 1S49A 4H54A 4ECZA 2FVPA 2ILYA 3I5BA 3DMJA 1W25A 4IKAA 4J9OA 1HNVA 4LSNB 3LANA 4TQSA 2BE2B 2WOMA 2VA2A 2ATLA 5KFAA 4K4YA 4RW6B 2XWYA 3QGIA 2I1RA 4IQXA 3QO9A 3TQ1A 2BANA 1RDRA 3KLIB 3T5JA 1QE1A 3V4IB 5HP1A 4KKOB 3IGVA 2HNYA 2J6SA 2W8KA 4ZP6A 2RKIA 3DOLA 4IRCA 3D5MA 2I5JB 1S0OA 1RT2A 1SH0A 3T5KA 3OLBA 3QIPA 4O44B 5DGAA 4IFVA 1JLFA 4TY8B 2VG5B 3LAMA 5KFFA 4XPCA 2V0NA 1T94A 3H40A 1TV6B 4I7FB 2VA3A 4KFBA 2YNIB 2ZKUA 5KT4A 2XCPA 3DI6A 3NAHA 4K4UA 3BJYA 1QUVA 3TAMA 1HYSA 3V6DB 2R2UA 3C6TB 4ECVA 5J2PA 1N5YB 1RT3B 1HQEA 4IFYA 4MK7A 4IG3B 1FKPB 4IH5A 4ED7A 3KK3A 5C42B 4ZPAA 4EBDA 2O5DA 3G6XA 4Y2CA 4EYHB 1TKTB 1QAIA 4RU9A 2RDJA 1C1CA 2YNFB 4JUZA 1HMVB 3EPGA 5F8JA 4Y34A 1RAJA 5KFDA 1N48A 1BQMB 5KFMA 1K1QA 3N6MA 4DL7A 2BRKA 3GV8B 5J2QA 4ICLB 4IRDA 3FSIA 5KG4A 4RW7B 5JUMA 3SI8A 2AGQA 2EC0A 3NL0A 1EETB 1UWBB 4EBEA 2C2DA 2WONB 3LP1A 1S1TA 5F8MA 3QLHA 2R2RA 2W9BB 1RTJB 1HQUB 4H4OA 1HNIA 4Q0BA 3PVXA 3DDKA 4KAIA 1BQNB 4FBTA 5CYMB 1IKVB 4IG0B 4YMEA 1QAJA 4ZP7A 4ED8A 5KT3A 4NLXA 1TVRB 2ZD1A 2XI3A 1S1UB 3M8QA 2R8GA 1IKYA 1N56A 2VG7B 3CJ4A 3MEEA 3V81A 1T03B 4DL6A 2E9RX 3LAKA 5HLFB 2AU0A 2V9WA 5KFSA 1FK9A 3QYYA 5L1LA 2WHOA 4MIBA 5DQIA 5KT7A 3RAQA 4RW8A 4J9QA 5DG7A 3MECB 4IRKA 3NBPB 5F9NA 1TKXA 4KV8A 3BSNA 1S6PA 3EPIA 2CKWA 4QPXA 3DYAA 3DLKA 5DGBA 3BSCA 4DL4A 3CJ2A 3H5YA 1RTDA 1HPZB 3E01A 2W7PA 2GIQA 5KFXA 3DOKA 3LP2A 5KFCA 3Q8PB 2UVWA 2YNGB 4R5PB 3RB0A 2JLEA 1DTQB 1N6QA 3CVKA 4ZPBA 1J5OA 3ICLA 4G1QA 3OLAA 3KJVB 3H98A 3ITHA 2HNZB 3KLGA 1JLGA 4NRTA 4MKBA 3PR5B 5KT6A 1JLQB 2YNHB 1C0TA 1S9GB 3LP0B 3FRZA 1IKXB 4F4ZA 2R8HA 3I0SB 2V4RA 4I2PA 1NHUA 4KO0B 4MFBA 3I5AA 1SH3A 4NCGB 2B6AB 4LSLA 3DLGA 1JLCB 2J6UA 3BGRA 2DPJA 4G3IA 3KLHB 3BR9A 4QW9A 4WFZA 3IG1A 3KLEB 3V6JA 5J2NB 4KHMA 5JXSA 1S1WB 3KMSA 4F4WA 5DQHA 3KK2B 3I0RA 2JEFA 1REVB 2OPPA 2GC8A 1LWCA 1VRUA 2FJXA 3FFIB 3G86A 2JEIA 1T05B 1TL1B 1R0AB 5F8HA 4WE1A 2FLNA 3IRXB 2V4QA 5KG1A 4IDKA 4R8UA 3Q8QB 4H4MA 2WK4A 5DQGA 3LALA 2FVSA 2IAJB 4NLOA 3CIZA 3IN5A 2BE2A 4K4XA 2HAIA 4ZP9A 3GV5B 2ZE2B 3HHKA 4NLVA 4ECWA 1I6JA 2OPRA 5HROB 5C25A 5EDWA 1JXLA 1GX6A 1TP7A 4RW9A 1C2PA 1XR6A
chains in the Genus database with same CATH superfamily
4KSEB 3NS6A 4UTGA 3CJSA 1Q79A 4IQMA 4P7TA 4B08A 1R6YA 1WHWA 3CDWA 5GAEU 3HM9A 4I68A 3K8VA 2QL9B 2DD8S 4U9RA 1S12A 2HNDB 2QFIA 2E9TA 4LR7A 4CTAA 2FZGB 1V9OA 1QD1A 5J2MA 1VJQA 1ZBTA 5M2RA 2NSCA 5B09A 1FJCA 5DG9A 3Q8VA 4NLQA 4X4OA 3QQCD 1VI7A 2I0XA 2M0GB 4PQAA 1FXDA 3TVKA 3W1YC 1MU2A 3HJVA 1GXUA 1KHWA 4P7VA 1LFWA 2FHKA 3HZEA 5J1PA 2O3DA 2ZH6A 2KFZA 4C8YA 1TFYA 2ZFHA 1VQPS 3LW5C 3N9UC 5KT2A 4A46A 2VBWA 2CWXA 1BY9A 4ZP8A 2ACMA 3CD7A 3OFFA 1MROA 8RUCA 2ZH9A 1HBNB 4ZVQB 1JLEA 3EXYA 2RQCA 1N6QB 2G4BA 2CQ3A 5KFZA 3N5FA 4U7UK 2LU1A 1NH7A 2KM8C 1FDBA 1RU2A 3C15B 3NWGA 2KL8A 4Q44A 4NZ6A 4ID8A 1VK3A 2H3EB 1TKTA 3NOCA 1KFSA 9ATCB 1CJTA 1HMVA 2WSEC 4MKVA 1D8YA 4ANEA 3QT5A 3FDSA 2WONA 5CQGA 2IDEA 4PG4A 2GVDB 1FEEA 1HQUA 4Z2XA 3HD1A 1X8DA 5CYMA 1Y9OA 2RVJA 3W66A 5A76A 2VG7A 3KK3B 2NUUG 3ETMA 1WWHA 2KDOA 4P73A 3D1QA 1CJKB 3MECA 2G2ZA 4A8XA 2Y0BB 4OYOA 2YNGA 3NCQA 2V8VA 4ZPTR 4ZMMA 5LJ3Y 3TZXA 3ENWA 3KK1B 4G65A 2CQ1A 1WACA 4ED1A 1WF2A 4NCGA 3M7VA 3ISNC 3N01A 5J2NA 1VS3A 3FEXB 1T0TV 1T05A 3C6UB 2ZE2A 4ECTA 5ITHA 4OYAA 4PEOA 5B7WA 4JI0F 3OTDA 4USTA 3OUYA 3BF4A 3VQSA 3PKMA 3BB5A 1X5TA 3IRWP 3W5YA 4DLGA 5D3GA 3DMJA 3C14A 1VIXA 2XWYA 5IV3A 4WIQA 4WKYA 3U1NA 4FYDA 2YKOA 5DDRC 4CO3A 2I5JB 1MN9A 3F56A 2YNIB 2FZCB 4F36A 3DI6A 2EWHA 5IWAJ 2QMWA 3UVJB 2KG0A 2E5IA 4A8SA 2P5VA 3VGVA 4OZLA 1IBLF 1IBMF 4BC9A 3TAQA 1NZ8A 2U1AA 4MT1A 3FSIA 1URNA 2W9BB 3CTRA 4JI3F 1H6KX 4X4QA 4QQBA 3PRDA 3OFGA 3J80Y 1Q5VA 1VHFA 4ELUA 4KY3A 3D6TB 4DS4A 2V9WA 4OJGA 3PTWA 1P1LA 1W2BR 2FIUA 3FMWA 3G82A 3CVKA 3ICLA 2E1CA 3MR7A 2P9CA 4FNHA 4UOHA 4DN9A 2CPEA 4KO0B 5CZVA 2ZH3A 2VJUA 2LA4A 3W2VB 1RUSA 3BO3A 1FJGF 5F8HA 2FLNA 4H4MA 2VBZA 1RACB 2RMLA 1GX6A 2MQMA 2X51A 1C2PA 3WDOA 2V8DA 3FBBA 2DXFA 4HH0A 1NK0A 4DR2J 3FBEA 3JQJA 3PJWA 4XK8C 1MMLA 5KFRA 3PFOA 2LDYA 4OI4A 4QWBA 4WFYA 2ZBRA 2BW2A 3MPUB 1YJ9S 2CVEA 2YBVA 2OPSA 3C16A 2UUBJ 1UETA 3CMQA 3DRRA 4ZLJA 3R2DJ 1N52B 2XGPA 4FYXB 1RT2B 1EETA 1NPRA 4NRUA 5KFVA 5LT5A 2XMAA 1ZTTA 1MG7A 1RADB 1HYSB 4NA3A 4U96A 1X31C 4LVOP 3RGIA 3DRXA 1J5EF 1QAYA 3I31A 1Y3JA 3HFKA 5LMNF 2AYMA 2FHOB 2MKIA 4E0DA 3IGNA 5KFGA 3K17A 3L09A 1RAEB 2V2KA 1HBOB 1S9GA 1J2VA 1VC0A 4K4TA 2Z56B 3M8QB 4NLPA 4FVCA 1YI2S 2MKJA 4OHXA 4DEZA 4X65J 2HMIA 2C2EA 2YPZA 2BVZA 4TLRA 1GFWB 1R8PA 3BGOP 4NEYA 1ZTWA 3ITHB 2V8GA 3CMAS 5IM0A 3MR5A 3IXQA 3HVRA 4KKOA 5D8HB 2D1CA 4LF5F 4M5IA 4OJ1A 2IMOA 4RBTA 3E2EA 1LWCB 1NLKL 1PYSB 4I6WA 4I1TA 2DNGA 4QWCA 2HEKA 3Q2SC 3MD3A 3QJJA 4OMFG 1M5OC 2VZ9A 2UXDJ 3KJFB 5GMDA 4O3QA 3BPDA 4RNFA 2VFRA 3I56S 1CEZA 1T3OA 2QTWA 4YR3A 1HW9A 1UJ6A 2AGPA 1VYAA 2KYXA 4NZ7A 1T03A 2ILZA 2CPYA 4LMZA 1Z2ZA 3BGUA 3HFZB 2M2BA 4ZVEA 5E3CA 2CJAA 3H90A 4NLTA 2KM8B 4KTQA 3BH7B 4ATNA 3S6EA 3ZO7A 3OV7A 4WTYA 3PEHA 3PX6A 4LR8A 2CYYA 4FF3A 1P9YA 2JX2A 1JLCA 2GV1A 1RYSA 5C7PA 2VASA 1R0AA 1YGYA 4IH7A 4YB6A 4RW4B 1H72C 2NLWA 3D67A 5KFOA 4LF8F 4WFBQ 2MEWA 1M1HA 3TA2A 2CZ9A 4WP8A 5HQ8A 2DRBA 5C2CA 1S57A 1HNZJ 1WUUA 1WOPA 1PG5B 4TN2A 1PJ7A 4KH1B 5KT5A 1KRPA 4NYOA 3M9OB 5ADZA 1HNVA 3WX8A 4PXCA 1SJFA 3JB9k 3QGIA 2XWXA 3ZTQA 3PCOB 2W8KA 3D5MA 4KHPF 2LQJA 3BKTA 5E7OB 2VFSA 4IFVA 1NJIT 2XCPA 3ENAA 3CJKB 4AE5A 1KFDA 4CCHA 4UOGA 2D9PA 3BDEA 3AD7C 3MM9B 2OSRA 2K1RB 1X4BA 4NCBA 4AL5A 3G8QA 3IR5B 3TZYA 3DGVA 3J7YI 5E5NA 2PFDA 4B3TJ 2RHSB 4DL6A 4AFFA 2HS3A 4Y28C 5G0RB 2DNLA 1T8EA 5DQIA 3FBCA 4CM0A 4DV5J 3QWUA 3E01A 5KFCA 2DISA 2KVIA 1BUXA 3WZ0A 4LRAA 1M5VC 2PIIA 5LMUF 2AV5A 4KT0C 2CQIA 3OVAA 1NHUA 1SH3A 4NEZA 4LSLA 1H74A 3SDEB 3V6JA 1FD2A 2MSTA 1LWXA 3ZZUA 4DV4J 2I8EA 3S7RA 3G2XA 2XQCA 1RCXB 4ZP9A 2P9GA 2OPRA 3PHTA 4B3SJ 2DHSA 3ENVA 1C1BA 4USJC 4UY85 4DUZJ 5I3UA 1XMOF 3HT0A 5IFMA 3MOJB 5EX0A 1RT1B 2IJFA 1PYTA 5D4NA 1XMBA 4O4GA 1S1VA 4QWEA 2ZJQQ 4LQ3A 3KHHA 1IBKJ 5HP1B 4WFXA 1F0XA 4CLUA 4LUBA 2ACYA 1LKZA 1HQ2A 4OHWA 4C8LA 2UXCF 2CQ4A 3M30A 3M9NB 1IWGA 5J2PB 4LIWA 1HQEB 1G2EA 3RZAA 4M5KA 4RUAA 4FNIA 3NGTA 3HSJA 2RQMA 1FTCA 4URQU 1OSCA 4KGVB 1NK5A 4G1PA 3KJQB 2B43A 3FEZA 3D6HB 2B9EA 1NNDA 4KGZB 4QIVA 2RDIA 3EVMA 4NWBA 4Q0BB 1Q81T 4YEAA 2HBQB 2JL9A 2W2NP 4WTOB 3OL8A 4J9SA 4DJBA 4RUHA 4JI1F 3MF5A 3QT7A 1NZAA 5AXMA 3O5TB 3KWMA 2E66A 3JQMA 1IKWA 2QN6B 2NXEA 4PZVA 1ZAXA 2QEXS 3CDEA 3UR0A 2PI5A 5KG5A 2V5HG 2IRUA 4ED3A 4CO1A 2ZH5A 3TVZA 4PXDA 2ASDA 1SJ1A 1XNRJ 4MFBB 7AT1B 1NSQA 2W4DA 4C3KA 2VG5A 4YS2A 1WKJA 1TV6A 5KOXA 2AGOA 1K9MT 2HQIA 1QSSA 3GJSB 5K20B 3MMAB 1WC5A 4FXWA 2ZEJA 5K5MA 3HHLA 1WSRA 2CQHA 3W9HA 4KBIA 4DV7J 1HWIA 2OSQA 2CQGA 2OLWA 2JFKA 4X4TA 1Y0HA 2OPQB 3NNCA 4LFBJ 2GQQA 3N6NA 1RAAB 3HX9A 2KTQA 4Y2KA 4N47A 4OL8A 3TZWA 3QGGA 5HMXA 4URSA 1LW2B 4P9SA 5H1SV 4E2FB 4DZDA 3SSQA 3BKFA 1U1LA 1RT5B 3CW2C 5JJBA 4F2SA 1X4HA 2GFFA 3RRHA 5DG8A 4XDDA 5U47A 2W2OP 3LP0A 4ECQA 1OSDA 1R31A 2DH9A 2HPUA 1LNQA 1S0NA 4DPOA 3FFIA 1YJVA 3IRXA 2GMHA 3DGPA 1RT6B 3ET6A 1H3DA 5K14B 2M9KA 2NXUA 4CLZA 2XGQA 2LLZA 2I9SA 3PYDA 2R2SA 1HNWJ 3BREA 3H0PA 3I4HX 1RLCL 2JH3A 2RSQA 3E51A 2E5GA 4HH1A 3EUNA 5F41A 1S6UA 5AXKA 1SQEA 4ELTA 1T95A 3AFGA 3NNHA 4YY3J 1UFLA 3TQ1A 2R4FA 4DXLA 4HTIA 3VZIA 2LXIA 4QYZJ 2ZC4A 3TP2A 3L9ZA 2GGPA 4B3RJ 1AB8A 3T1YJ 5AJ3F 2XSJA 4I7FB 1L5UA 2ZKUA 5KT4A 4ZN1A 2OIHA 2VV5A 1N5YB 2KXFA 2V68A 4U8VA 2M88A 4EYHB 3F41A 2N3OA 4F3QA 3TUJC 2IVYA 4N76A 1XNQJ 2DGUA 1RWMB 4H4OA 1HNIA 2RU9A 1JJ2R 2ROGA 1UVIA 5L1LA 2WVEA 3RAQA 2HLUA 1S6PA 5DGBA 3BSCA 1F3FA 1HR0F 1BQXA 3NGUA 2KKHA 1N0UA 1JXEA 3RB0A 1DTQB 2VU5A 3MM8A 3DOMB 2AKWB 3H98A 4NRTA 5D78A 3JAMY 3ZZTA 2CPJA 3LGMA 3I0SB 2RNEA 4AQYF 4M5DB 1QAXA 3OR1A 2W1BA 2MSSA 3IG1A 1EKRA 3SQGB 1KQFB 4F3OA 5L46A 3SYZA 2XZTB 4MTPA 3IN5A 3BS9A 3HHKA 4NLVA 4NCAA 1S1XA 4FKYA 2LEPA 4NLRA 7FDRA 3DRSA 2H65B 3S8SA 5DLGA 2ZBQA 3HVWA 3A8EA 3RB6A 1HBUB 2HSEB 2JC0A 4PG6A 3EYZA 3GJQB 5LOQA 1IQTA 3FQLA 1KOHA 1GEHA 1FDNA 4LF9J 2I6WA 4F0HA 3W7BA 4FS2A 4GKJJ 3BQ0A 5DDOC 4RR5A 1RQ0A 3WC2A 2CUYA 1X4EA 1SIZA 1U09A 4JV1A 4OJ3A 4EUVA 1L3KA 1FWLA 4DCPB 1N5TA 1WOOA 1N36J 2ZZTA 2CDQA 1JX4A 1CS4B 3OD2A 1WC0A 1WORA 1OYEA 4QYRA 5DJBA 2BQRA 3VF0B 4KHRA 1QSLA 1OS5A 3TJ8A 1EAYC 2PEHA 5F3TA 2B4UA 1Q95G 2MQLA 1FNXH 3RAXA 1WTBA 1R0CB 2HNZA 4EI2A 3CDAA 4B3MJ 2EFOA 3JQKA 3HDSA 4DX5A 3B4DA 5ETVA 2XY7A 2BJ8A 5KFTA 1Q7YT 2VD3A 4F25A 1TR0A 1SC4B 1HIYA 1RTDB 1J5OB 2AIRB 3GIJA 4C0BA 4YR2A 2WAQD 3UCUP 4CLFA 1C0TB 3ONQA 2F1FA 3A3PB 1RA7A 4TXSA 3GIKA 4KRWA 4Z7YA 4B9VA 2HQCA 2GJ2A 4DX6A 2CIMA 3N0VA 5KFKA 2WZ1A 3MM6B 2V69A 1S6QB 4R8UB 3TJ9A 2MZQA 4K8RA 3QWPA 1KS2A 2C3PA 1JNRB 3VALA 1MWYA 5F0WA 3QJLA 4X4PA 2B9WA 2XYPB 4CQ1A 1ZM9A 3P96A 1X4GA 3OW2R 1GMUA 2C2RA 3KMQA 5F8IA 5B0GA 1H0HB 4CTAB 2FQQB 5J2MB 1R8HA 4ZVFA 4RWXA 3EJMA 2C2MB 1D1UA 4RNMA 4FP9A 5FJ4A 4J9LA 1PBUA 3MHYA 1H98A 4GC6A 1OQ3A 3M6XA 3DC2A 3X3UA 1R3NA 1S77D 1GXLA 1KKHA 1X5PA 4DL2A 3MAAA 3T19A 5KFIA 2LECA 1MU2B 4PG7A 1TKDA 3VVUA 2NXNA 4OV1A 5IT9Y 1N5VA 5KFUA 1TL1A 2GZOA 4QOTA 1DQAA 4WFAQ 3R5CA 3KNAA 1HI0P 3G6VA 1N8RT 2HHSA 4U8YA 1NEEA 3P8BB 3NGDA 3CE8A 2K3KA 3K5PA 4N8NA 3ZZOA 3RBDA 2W4PA 1CJVA 3CGIA 5HANA 4DQPA 4PG5A 1MROB 1MMNA 2WVCA 4DQQA 2KG1A 3BBCA 1YJUA 2A6OA 1JLEB 3Q86A 2A0FB 2W9CA 1NJXA 5J1EA 4H54A 3CCRS 5L9NA 2WOMA 3R27A 4OZ3A 1V5IB 1F2HA 2QA2A 3FCVA 4ZLNA 3CD5A 1NPKA 2UU9F 1FHTA 3DOLA 4KC5A 4IRCA 3O44A 1VJWA 1TL5A 4F7VA 3K89A 3H40A 4MIWA 4QZVB 3TO8A 3KK3A 1UVJA 4EBDA 3THPA 1TKTB 1C1CA 1CJTB 4CNZA 1HMVB 5RUBA 1RAJA 4DSJA 4FYYB 3GV8B 3U1LA 4EBEA 2C2DA 3HT3A 2WONB 2A1BA 2RQKA 4B17A 1NSKL 3QLHA 3G71S 1HQUB 2UP1A 5CYMB 1RWNB 2VG7B 3CJ4A 4L3KA 1RXOB 4JI7F 4B9TA 2RE1A 2A10A 2Q43A 3MECB 4ES2A 3R2CJ 4QU6A 4HEA9 2XM3A 3DOKA 2YNGB 2YWHA 4JI0J 3F73A 1NSAA 3CF5Q 2PE8A 5T7LA 4QIWD 3WIUA 5KT6A 2GX8A 2HFVA 4WP3A 3RR7A 1YBUA 1FJ7A 1RWXB 4CYUA 2H4YB 3HHLD 4DQRA 4X64F 2IRXA 2KJWA 4NCGB 1IXKA 3OJUA 3M8WA 5J2NB 6FDRA 5HVFA 1T05B 4A8FA 3LALA 3R7NB 3UN2A 2ZE2B 4Q7AA 1YJ7A 2HVEA 1EZZB 3AJ2A 2KRBA 1F5AA 3FGVA 3OUYB 3OXFA 5KFNA 3FUYA 1IBMJ 4K0KF 2M7SA 2QLWA 4Q5VA 2E9ZA 4HACA 2HZAA 1D09B 1X9MA 4WF9Q 5D3GB 1JJCB 2BR0A 2PMWA 5KG3A 3DMJB 1Q8KA 4L75A 2DEJA 5ETQA 3O3LA 4I64A 1FKOA 4JI3J 4B3OA 4YDXA 4LSZB 2DO4A 2JEGA 4K50A 2JEJA 5FLXU 1FE0A 2FGCA 3DI6B 3HD2A 3KHRA 3JSMA 4RZRA 3MAQA 2R7OA 3JSYA 4K2XA 4ILRA 3KJNB 1M5HA 2VIHA 3IBWA 1RWPB 2EBEA 2FPHX 2Y3YA 2RH3A 3KHGA 1S9FA 3NAIA 2YTCA 1U1PA 1FJGJ 3TEGA 1RHJB 3UDVA 3UDLA 2HQGA 4IYQA 5GAGI 1E6YA 2E1MC 1QSYA 3KHLA 1EIYB 3I87A 3GIIA 1B0TA 4ETZA 3UFCX 3MEGA 3G82B 1XBWA 1OYDA 3J7YU 2KYZA 5HMZA 2J6TA 1ZM2A 4RW6A 4J5OA 3MEKA 2ZVSA 3T9NA 4NYZA 4C8KA 1QJHA 2E1PA 3K5LA 1XTZA 1O5JA 3NMRA 1IVZA 4ZS6A 3HCXA 4L76A 2HYIB 1HA1A 4DF8A 4H4MB 3V6DA 3C6TA 3TW0A 3R1HA 3ILIA 4LQ9A 4M5GA 4ZPDA 4DV3F 2OO4A 3MPDA 2HVZA 3UE2A 2BW7A 5HO4A 1J5EJ 3MMBB 1Y00A 1P1TA 3L3CA 2D3UA 4NLUA 1LQ9A 2PMHA 3P4UB 3N79A 3W5XA 2CPHA 2OPSB 2VC1A 3C16B 2XTJP 1WDTA 3QAEA 4R0JA 3DRRB 3LOUA 2Y9HA 2OH2A 2RRBA 5M2UA 4CZCA 2QMUB 2QT7A 4HT7A 2CJYB 1HPZA 3I9V9 1GH8A 3GR1A 2FZKB 5HAOA 2WB1D 3NY0A 3SSRA 2XS5A 3GZ7A 3KLHA 3KLEA 2LFVA 1W26A 2LVWA 1FJEB 2CPXA 1O6XA 4LF5J 5AE2A 5HROA 5ETRA 4EFAC 4IUFA 3OTEA 4IRDA 1APSA 2IM0A 1L3VA 2HMIB 4P74A 2DCUB 1VQKS 1VCTA 4DPYA 4GKKF 1S79A 4B9MA 2FVPA 3I5BA 2CNLB 2O66A 4J9OA 5DM6Q 3LANA 3TA0A 2ATLA 5IM0B 1JQGA 4KKOB 3CJQA 4P75A 2FHJD 3A4TA 3T5KA 1A9NB 4KFBA 1EARA 1AUDA 1RP5A 1FFGB 1OMSA 3SV3A 1U6BA 5H9FJ 2IVFB 4OYMA 1FERA 4OI1A 1NK6A 3CCLS 1N48A 4B9UA 3N6MA 4DL7A 1YHQS 1FRMA 2ZDOA 4OLPA 5E3RA 3D0GE 3NS5A 2NR0A 3QT8A 1B0VA 4NL5A 1YJWS 4ZP7A 2ZD1A 1U47A 2H51B 4H4KA 1T03B 3Q2TC 1NKBA 5KFSA 1FK9A 7FD1A 5DG7A 1NKEA 4CT8A 4KV8A 2CKWA 3DYAA 1WTFA 2R42A 4LF8J 2BJDA 4ZPBA 1OY9A 3CMES 4A8OA 3FRZA 5D0HA 2DT9A 1JLCB 1H2TZ 5DQHA 3KK2B 3KFWX 4WIIA 1ZAVA 1HI8A 1ICEB 3IA0A 1R0AB 4CH1A 4PXEA 4HHHA 4BBYA 4KHPJ 1R7IA 5EDWA 3A13A 2LQBA 1TK0A 3CCMS 2MZJA 3DLEA 5HN0A 1S5ZA 4J9UE 3D1HA 2HG4A 3TARA 1RTIA 4IR1A 1HNVB 3AB2B 1UEUA 4CRJA 1CULA 5A2QU 1H2VZ 1KC8T 4GVBA 2E1AA 1F5BA 2QX0A 4X4SA 1IN0A 3IWLA 2LEAA 4R25A 4IFVB 3ZNUA 2DJWA 3CCWA 4IR9A 2JOQA 2ZOFA 2VB6A 3BBBA 1SUQA 1UFKA 3AXKA 4DZ6A 3FZBA 1OY8A 3I32A 3QSYB 4ECYA 2VOPA 2XCAA 1SKRA 4LBHA 2CPZA 5LMUJ 1FE4A 1WOSA 3DN9A 1Y7PA 5IOLA 2BJ1A 2DNQA 2MHEA 3H25A 5BYSA 3NGRA 3GJRB 1WC6A 4DR5F 4M5LA 4ED6A 3E01B 3AD8C 1JNZB 1LW0A 4RBUA 1JLAA 1AYEA 3M6WA 4Y00A 4ZN3A 2DIVA 5SZTA 1XMOJ 4N7TA 2POKA 3WC0A 1NK4A 3OJSA 2BACA 4LBIA 3FK4A 4BS2A 2VPXB 4LSLB 2HHQA 4B9NA 3IWNC 4CT9A 1EQ0A 2HWIA 3VGTA 4UQGA 1M5KC 2V63A 2GMLA 2OPRB 5B0EA 1SC3B 2UXCJ 3FVYA 2KHDA 1C1BB 4WWSA 4OYZA 2HNYB 5I3UB 4MYTA 1CVJA 2E44A 3J7AN 3I5CA 3MMJA 1RHKB 1UWBA 3FCHA 1VQOS 2KN4A 1K8AT 2DHAA 3ILJA 1AW0A 2NXJA 2WCXA 1S0MA 4DFKA 1NJYA 4O4GB 3PHEA 1S1VB 2MLXA 1TUGB 4WU3A 2GMJA 3QPIA 3ULHA 2C22A 2V94A 2LYVA 1S59A 2WB4A 4IOBA 3HF5A 2VQFF 2N3LA 3AY0A 4JI1J 2YKAA 3D66A 3M30B 2FVRA 5IS2A 2B8PA 4PWWA 2XSFA 1DJ0A 4ZCKA 3M2VA 5BJRA 3TRGA 2QLJB 2E1RA 3PYFA 2Z2MA 4QW8A 2DTJA 1JK9B 3H5SA 1UW9A 4ZPWR 3MMCA 4TLQA 3VCDA 3MM5A 4UY8T 4FS1A 3IAS9 4QJVA 2YKMA 4OI3A 2MZRA 3GSDA 3GU0A 1ZAWA 2L48A 3FRYA 2QG9B 3JSBA 1IKWB 4ZDNA 3CJRA 5DDQC 2UVUA 4K4SA 2OGUA 4M63A 2ILYA 1WG1A 4DMZA 4OZ5A 1RK8A 4F2RA 2XLKA 2K06A 2IIHA 4OZJA 3D9BA 2OAUA 1ZZNA 2AW0A 2XS7A 1HFEL 2VG5B 2H5IB 3V5RA 1W7WA 1TV6B 3FJ2A 3PEJA 4LFAF 4FPRA 4ECVA 1SC6A 2O5DA 4NXMF 4F02A 1QAIA 2B0GA 3HHLB 3D54A 1SBRA 2HS0A 2PEBA 2MHNA 4Z37A 4E8UA 4C8ZA 4ZVSB 4CLYA 2VOOA 3DU5A 2DNYA 4OX7A 3ZZYA 2XNRA 2ADCA 4LJMA 2V9KA 3QSIA 3BSNA 3EPIA 5GAHI 3D3CJ 2QA4S 5BXIA 4LF1A 2ZOMA 2OEMA 2GQ2A 5GMEA 3PR5B 1EB0A 3LP0B 3PY8A 1UEKA 2FHMA 3PYGA 4P2XA 4I2PA 2E5LF 4KR0B 1SJQA 3EVOA 3HHEA 2WVDA 1U8WA 3FFIB 4EMDA 4WE1A 3IRXB 2V4QA 4IDKA 1VQ8S 1JWWA 2D3OR 3DGPB 2DKOB 3MPYA 2E5JA 3PACA 2COLA 3ET6B 2VONA 2HFZA 5AJ3J 3OL9A 1SL1A 4PABA 2QA4G 1S4EA 2MDAA 1Q53A 3LA0A 1FD8A 2MY7A 3BYRA 2GVZA 2YWKA 4DUTA 1N5YA 2KU7A 3AAWB 1RTHA 4ECRA 2BRLA 3FZ2A 2NCKL 4PKDB 3PX0A 1JJHA 2MZTA 2D7SA 2KHCA 2GGPB 1SB6A 5HMYA 2XSJB 2GHPA 3KTQA 2MZSA 2G0JA 4J9MA 2EW9A 2UXBF 4DFJA 1VQ6S 5H9FK 4DI6A 2CXEA 5BR8F 2CDRB 1BWVA 4Y65A 1TMJA 4NZ0A 2HURA 3GLJA 2AX1A 1HNXF 1HR0J 2HBRB 2L9NA 2MLYA 2IC3A 1X7VA 1VBXA 3Q8SB 2CG4A 4OX8A 2X1AA 4H4OB 1HNIB 1UEVA 4AQYJ 1Q0NA 1BD6A 2AYEA 1T9YA 4DHVA 3NWRA 4F4AA 1XK8A 3GCXP 4EK2A 4TQRA 3CEDA 3PIPQ 1NAQA 2P6TA 3M32A 4YN3B 2BUNA 1U2CA 4IH6A 3RBZA 1S6PB 4X4UA 2DGTA 4PYDA 3PG9A 3TYTA 2YY3A 4JI8J 3J81U 3MM8B 2C2OB 3M8SA 3MAHA 1VQ9S 3OT9A 2VH7A 2ZNZA 1M1GA 4ECSA 3OR1B 3EDQB 3IG1B 1HBUA 4P52A 3OTOF 1KN6A 1SL0A 1BE4A 4NMXA 5DZ6A 2PMZD 1RT3A 2F65A 1RWVB 1FKPA 2UZAA 1U8SA 2A6MA 1S1XB 2HWTA 3T6JA 2XO6A 3MTKA 2IJNA 3DRSB 4V19X 1X60A 3IR7B 1PILA 3UNGC 4YQWA 3AB4B 2G2YA 1IKVA 3EVWA 4V19J 4Q2MA 4WXOA 3QRQA 5HL7Q 5J1NA 1RZMA 1R43A 3RTVA 3PZPA 4XTTA 2L3MA 2MKSA 1VBZA 4M94A 4ZOSA 4EO6A 4RUCA 4R5PA 1SPBP 3OSNA 1PJ6A 3TANA 5AXLA 4J7CA 3US5A 3EDRB 3W8GA 2IJRA 1VHIA 2QA1A 1U0HA 2B7CB 4S0MA 3M1VA 1YJNS 2Q1LA 2KRRA 4DOZA 1JJ4A 3HO1A 1OJ4A 3BN7A 1TELA 2F3JA 5B0AA 4DLEA 1NSPA 4FF1A 1F3VA 2WW4A 1JLGB 4Q45A 1WG5A 3ISND 1K0TA 4QR2A 5AT1B 2IVMA 2M70A 1X5OA 1WI8A 3HI9A 5AE1A 3RRKA 3PM9A 4YB5A 3B82A 4BWMA 1S6QA 2VQEF 2NS1B 5CXTA 2ASLA 1FCAA 3DU6A 1T7PA 3C46A 2CPIA 3MXHP 3L95X 2O01C 4USIA 1A7GE 1KLNA 1O51A 5A0YA 1PGZA 1V3SA 5GAGU 1NXIA 2YXLA 2ZHOA 1WKLA 3P5TL 1RKIA 1A6LA 2JVOA 4IOAQ 2QO3A 4ZKAA 2ZHBA 1LV5A 1LOUA 1KVIA 1HLWA 3EGNA 2FJDB 1X5SA 2Y0SD 4I4BA 2ZBCA 2EG2A 4HR2A 3A3NB 4KIAA 2AGQA 1QDUB 2R7RA 2C3OA 1UW4A 5EN1A 1CBKA 4M5MA 4LFCF 4BWJA 5B0CA 3UW1A 2BABA 2GHWA 1YX2A 4UOFA 2XI3A 2QIFA 1IKYA 2YX4A 4AUKA 2Y8WA 1E6VA 2MQ8A 4M8LA 3X1LB 2M8HA 5IC4B 1NCLA 4DF4A 1T9VA 4YB7A 3RR8A 2XNQA 4L6V3 2MQNA 3AOAA 3A8KA 4G1QA 2OEJA 3K59A 1ZPWX 3MAAB 5THWA 4F4ZA 2R8HA 4NPOA 3R1LA 3MGJA 2V4RA 4DR6F 2KT2A 2ZBIA 4ILMA 1NRKA 3B54A 5KTQA 4KHMA 2GW8A 1Q8IA 2PT0A 2CFXA 1TL1B 2UU9J 5DQGA 3AA9A 3IWXA 1I6JA 1HKAA 1AFIA 2QGFB 5C25A 4RW9A 4GVLA 2AYGA 1SV5A 2M5YA 5ETNA 2C2ZB 2F63A 3AJ1A 1CJVB 2AJ1A 3PW7A 2FVQA 4H4KC 4AXIA 4ANDA 2CJBA 3QT6A 1NPPA 3NCPA 2W9AA 2ZVIA 4ENOA 2W9CB 1NK7A 5C2GA 5J1EB 5F3ZA 4DR1F 2WOMB 4CO5A 2F9JA 2Z2ZA 3T6BA 2AJ2A 3H2VE 3DOLB 3T5HA 4PWDA 1UP1A 2BBEA 2G13A 3NS7B 4DDFA 1XMQF 1ZPVA 4JI7J 3MCOA 2PA8D 3J7Z5 4X4VA 4QPTA 3H2LA 4P2SA 1KD1T 5ETOA 3FKBA 5DZ7A 1C1CB 3OSPA 3SV4A 2C28A 3QLHB 2EI5A 3AOCA 1R0BG 4ZLLA 1U1OA 4X64J 4HDHA 1LK5A 3CXCR 1TL3A 3VAHA 5L39A 4OZ2A 1DTTA 1N4LA 2BKPA 1N33F 5A6PA 3R7BB 4F67A 1ITPA 2HGMA 4DG1A 3DOKB 1FDDA 3MZIA 1FWKA 5T7LB 1VISA 4K0KJ 2CAJA 1YZ6A 4JBCA 4CYUB 3KOAA 3KLIA 1N88A 4TKTA 1CQMA 2PFFB 2PSZA 1M90T 3BR8A 2G0IA 3UD5A 2DEIA 4J9NA 3L7PA 1NDKA 4EBCA 4WZQA 2YNFA 1ELOA 2X7IA 2HW3A 2D74B 3W64A 4EZ6A 3GFXA 1YG0A 1OPZA 3H59A 3IBFB 4J90A 4DUYF 3MURP 1JLFB 4HACB 5KOWA 2ZJPQ 4A48A 5JVHQ 1RU1A 2YQ1A 3IM8A 3VWSA 2EVZA 1FKOB 1K0VA 3R5DA 4B3OB 2ZC3A 3CJ5A 3TUIC 1RJJA 3R5JB 3NBPA 4C2MA 1Q4RA 2Q66A 1FNMA 3JSMB 3BDPA 3GMGA 1YLXA 2GO9A 2GIRA 1VQSA 2B6AA 2LKZA 4U7CA 1HD1A 1V3ZA 4NI2A 3NCRA 4A8KA 4O3SA 2DGXA 3AODA 3BH6B 4RNHA 2VKZG 1BC6A 3GPAA 3KUHA 2IM3A 2VBXA 3DKDA 4P2FA 1UTAA 2DBBA 1RT4A 1E6YB 2W01A 2W8LA 2K7JA 3MD1A 1VMBA 3RU0A 5MLCV 3MEGB 1ULRA 2J7KA 2GIFA 4OLOA 2FLPA 4K4YA 4RW6B 1B7FA 3QO9A 3IMQJ 3T5JA 2BM1A 4F0MA 3GR0A 5ETMA 4ZJQA 1SH0A 2G9OA 3MMBA 3GP9A 3G8SA 2CVIA 1I94F 3V6DB 3C6TB 4QCLA 4ZVUB 3MDFA 3MI7X 1TU0B 2BMBA 4ED7A 2Z57B 2L41A 3H8YA 4OZ1A 2Q6CA 3D6MB 1UWAA 4ZCMA 1FO1A 2XMUA 3LP1A 2A18A 3ETOA 2CADA 2APOA 4MJKA 3PVXA 2J76E 5SUHA 2KXNB 2Y1RI 1FDAA 1VLYA 3MEEA 3V81A 4DV1F 2VHGA 2E5HA 3M2RA 1ROFA 3WQPA 6FD1A 2BJEA 4MIBA 3B78A 4JB8B 3A1YG 2MLZA 1KWMA 1HPZB 2JSXA 2W7PA 2E7WA 3BBFA 1MWQA 1SI9A 4GKKJ 1NM2A 3SMZA 4WK3A 1SXLA 1N32F 1F60B 1ZZFA 2FJEB 5E3QA 4J91A 3KLHB 3D68A 3KLEB 1G6BA 1H2UX 3IM9A 5LL6d 3FSXA 3OPKA 3Q8QB 2OELA 5LSOA 2HAIA 4ZK7M 3GV5B 3WBZA 5HROB 2B3TB 1XR6A 5IT0A 2CPFA 1RB0A 2Z8QA 1MW7A 1DRZA 4LF2A 1RHMB 1JIHA 1CSJA 3DXSX 2DNNA 2DH8A 4WYWA 1JKHA 3G9CA 2YKNA 4O0NA 5D0EA 1PO6A 3HSDA 4OHYA 2XLJA 4DV2F 4CLTA 2HHHF 1FRHA 2DO0A 2ROPA 1R8CA 2WBMA 5GADI 1Y10A 4V1Ak 2HFUA 4MIAA 3SSSA 1YZ7A 5IC6B 3GWCA 4CIOA 3TQEA 4KFBB 4HKQA 1UPPA 5EHHA 1SKWA 3KLVA 3I4PA 5IZHA 2L08A 4FYVB 5L1KA 1S9EA 3I96A 2W2PP 3DHWC 3RRGA 3PNIA 2NYIA 1TFWA 4RPFA 1UJ5A 1X4CA 1XQIA 2CZ4A 3R5BA 2R7SA 1RAGB 2W25A 2ZD1B 1GXTA 1AZSB 5AE3A 1FK9B 2WVFA 3KLFA 1YKWA 3HPOA 3LO3A 2UV8A 4JI6F 4KV8B 3KK2A 2ZUGA 3T5LA 3DYAB 2HLTA 1XWLA 4AD6A 1IR1A 1T9WA 3ZFVA 4RU2A 1L3SA 2JC1A 2RUGA 4WCEQ 4HHUA 1T02A 2V67A 2DPIA 3LGHA 2X3DA 2M3DA 2MGZA 1DZ5A 2RILA 2J0QD 4OX6A 4JI5F 3PXGa 1GNKA 5K9FA 5GAHU 4NLDA 3AH6A 2Q6BA 2HRTA 2NZ4A 2IM1A 1XNRF 2AF6A 1YSJA 3OQ2A 2DNKA 3LUYA 2DY1A 4X66F 3DLEB 3PW0A 1L3UA 4OX9F 2BX6A 1FEHA 2BA9A 3GYNA 4C3LA 2JWNA 3GYGA 1RTIB 4OYBA 4P2MA 5LJ5Y 2XMWA 4MAKA 3UPFA 5CD4H 1CULB 1U48A 3R6GB 5EWFA 2LQ8A 4RBVA 4GVBB 1X9SA 3Q8RB 2QFJA 2XY6A 3EX7B 1F9EB 4R0EA 2R7QA 3OFHA 2RS8A 4FF4A 5J2QB 3M2UA 2H4WB 4O0IA 1KNZA 5FLXY 4I6YA 2FLOA 4DCOB 4DR5J 1AFJA 4UT4A 1N0VC 1SUQB 2CJKA 3QIDA 2WSFC 2FJVA 2XBPA 2VDHA 2G0CA 5DO2A 3QZ7A 1Y5NB 2L9DA 4NYPA 1O8BA 4A8MP 4ECUA 3V6HA 2M52A 4DU8A 1FI4A 1UCNA 4CLSA 1WKKA 4ED2A 1WNEA 2GAGC 1NHVA 4C6AA 3R5AA 2H48B 1UVMA 1LW0B 1MSWD 2HVHA 4NA1A 4TYAA 3ISZA 3JTNA 1JLAB 2ZH7A 1U1KA 3OR2B 4FYWB 4TQSA 1F5CA 2J8SA 1IM6A 2B7BB 1RDRA 2ZHAA 1Y5IB 2HNYA 3N28A 3MTJA 1YK9A 3I82A 4DFPA 3NGSA 2GJFA 2AJQA 2J9CA 1PAUB 5B08A 4Y2MA 4FDFA 2R2UA 1MN7A 2QC3A 4LF6F 3BO2A 2VQFJ 3AQPA 4YB1P 5GMKa 2OMOA 4PG8A 4LRCA 1K1QA 3HJFA 1HD0A 2J8AA 1UWBB 3GFYA 1Q82T 3IAM9 3DDKA 4KAIA 1IJEB 4ED8A 4OZ0A 2HGLA 3W2WB 4NLXA 2SXLA 2E9RX 2MQQA 2HBZB 5KT7A 4L74A 3ZZ0A 1TKXA 4F4KA 2JRSA 2GIQA 2XHCA 1WEXA 3HHDA 3OLAA 5D4PA 2YWGA 3GYXB 3CPWR 2OI2A 3HSGA 4MKBA 3M2VB 3UO0A 1RWUA 3UDEA 2Y1JA 1LEOA 4DL0C 2KFYA 4RWWA 2QSFA 5JXSA 3G86A 3MMCB 2FVSA 3MM5B 4RJVA 2ZM6F 2DY9A 1UKUA 3GFHA 2PD1A 2YKMB 2WVBA 3K57A 2V8HA 4LFAJ 3Q83A 5KFHA 3LPEA 4C11A 3MM7A 1U6FA 1RABB 4RKUC 3DHXA 1YRUA 4NXMJ 2QE5A 2DK2A 1SL2A 1PC4A 2JJ4D 4CI0B 4RNNA 3CWJA 4C48A 3UD4P 3VR1A 5ETPA 4D3GA 3CO0P 2IM2A 4USKA 4YHHF 3FSYA 1N5SA 1RT7A 5D6GA 2XY5A 4K5RA 3ILOA 2KO1A 5KFQA 3DRPA 5C24A 5K8PA 2UUTA 2Y8YA 4GC7A 4W90B 4ER8A 3HKWA 3NKYA 1KQGB 5KFJA 2CA9A 1IR0A 1AUSL 5JMNA 3MR6A 4DV6F 2XLIA 4M5HA 2MZ1A 1XIQA 2LCWA 4LR9A 1JLBA 5KG6A 2UVVA 1C4CA 1LWEA 1XJWB 1U1RA 3W62A 2NQPA 2H5EA 2R7TA 8AT1B 3UCGA 4U6PA 4BLGA 1NDLA 1M5PC 4MK9A 3EZ5A 4F4XA 3CJ0A 2HK2A 4I2PB 3RJMB 1P6TA 3W63A 3DLLQ 4LREA 4TY8A 2IYIA 4NMLA 2KI2A 5F8NA 3O2IA 3SBMA 4WE1B 3PW2A 4IDKB 2VICA 1OY6A 3HLUA 4IG3A 3CB4A 3MR3A 4AL6A 5E41A 4Y3CA 2R8KA 2UXBJ 4CNYA 5BR8J 5IQ6A 5CD4A 4C3MA 2IA6A 1HNXJ 4DSIA 4ICLA 2YH1A 2GVZB 2HK3A 4Q8FA 4ZPVR 4MYUA 4IG0A 4DL5A 1RTHB 1D9AA 1S1UA 1SKUB 2IBOA 4OZNA 2CG8A 3B6BA 4OI2A 5A2QY 1DARA 5A8RA 4P6QA 3GV7B 1VGYA 1TL7A 4L72B 2ALZA 2YWEA 3P6YC 2FC9A 1RTZA 3T3FA 1NUEA 2IDLA 1IKXA 2IC3B 4HT5A 3CO9A 3AOBA 3K0JA 3R5GA 3SFGA 4ES3A 3RBEA 1REVA 1UPMB 4O3RA 4M5NA 3W8PA 4ZIWA 3SCIE 1NB7A 2WBRA 3OTOJ 3VAKA 1D9DA 3M32B 3OHAA 2DR5A 1L3TA 1R89A 4FBUA 1WEZA 3MEDA 3N6LA 1LWFA 4ZLPA 1U26A 2DHHA 2AEFA 4PQUA 3V2UC 2PO4A 2RU3A 2FD2A 2K7KA 3JYTA 2DVIA 3W65A 4ECZA 2BE2B 1FVQA 4FZVA 5LSLA 2DR8A 1G1XA 1QE1A 2PC6A 4KPCA 2RKIA 1DURA 3OLBA 1S99A 2VPWB 1QUVA 2QLXA 1RT3B 2XZWA 4TNOA 1FKPB 2OFHX 1ZM3A 1GTHA 3NXZA 4TU8A 2RDDA 4Y34A 1RLDA 3M4XA 2W24A 1YJTA 5DDPC 2GAHC 3AQOA 4MMOA 1IBCB 2ATCB 3UCZP 4FBTA 1IKVB 2QJ3A 4DQSA 3FEYB 1Y5LB 3LAKA 2GQCA 2CQPA 4XIUA 2EFQA 3VGSA 1RISA 4ZJLA 4QPXA 2CWKA 3LP2A 2EPIA 3LGNA 4R5PB 2NPFA 3U1MA 4CO0A 1U24A 1JLGA 2XEXA 3BPSP 1PJ5A 2HIYA 2V2ZA 4ED5A 1EHWA 4X4RA 3NNAA 1JXVA 4OYXA 1KVKA 1U0HB 2VQEJ 1YJRA 3M1VB 4PCQA 4G3IA 3DLGA 4U67Q 1VC5A 3Q23A 4C8NA 1WC1A 2GC8A 5ETKA 4LF7F 2WK4A 4W92B 3VHQA 1UVNA 2KZMA 4C0OC 2FYXA 4WK1A 2N7YA 3BO4A 3CCUS 2GO8A 1F2GA 2MKYA 1HWKA 4Y2IA 4G6VB 4DSEA 5HQMA 3IR6B 3VAGA 3PFEA 1D3WA 2GS8A 3HVTA 4LIRA 2W7AA 2MJUA 3PX4A 3RB4A 3C2PA 4IO1A 4EYIB 4K4VA 4LFCJ 4CH0S 4YUDA 1FXRA 5A0YB 3M8PB 1FRLA 1VR6A 2QYGA 5L1IA 2RF2A 2BJ7A 2HFOA 2G1HA 3TI0A 1T9UA 1ZOTA 4DPUA 1H38A 4PPDA 3H7HB 1UL3A 4CLKA 2AD9A 1WEYA 5I42A 1H7WA 3IS9A 2ZH4A 3TUPA 1S97A 4NOHA 3AJDA 4DR6J 2ZJRQ 4DR3F 3R3TA 3KDOA 3RAMA 1XR7A 4EWTA 4I56A 1IKYB 4LRDA 3WX4A 3CC2S 1E6VB 2LP4A 4K2JA 1C4AA 3PV8A 5HBMA 2JVRA 1ZS6A 1F1BB 1DLOA 2MJNA 3GB0A 1C0UA 4G1QB 3IO1A 3KKFA 5CA5A 2X3GA 2Z4PA 1U1MA 2RQ4A 3VAIA 2E7VA 3H4BA 4CLWA 2DGQA 2E7XA 4DR1J 2ZNYA 3HFVA 5EWEA 3NGKA 4O44A 2ZH8A 4CH7A 4UQTA 1MLAA 5HVGA 1S48A 3H5XA 1OPIA 2R7UA 5C25B 1FFWB 1VLOA 4RW9B 3R8YA 1XMQJ 1SV5B 2NXCA 4XPEA 3T41A 1IWAA 3FMBA 3R6LB 4HL9A 2EBGA 3ADAC 5K8MA 2VKRA 1WI6A 2DNOA 4USWA 3QMQA 3BYPA 1U2RA 4AXJA 2H5JB 1BQNA 3IBCB 4WYLA 1WF0A 1TVRA 2LQ5A 4BDPA 5KFPA 1IR2A 5DLFA 3NOGA 2AYBA 5E2QA 2IBKA 2DNZA 4PWDB 4MK8A 3Q8YA 2PA3A 4EZ9A 2HWHA 2W4CA 4WXWA 1N33J 3G6YA 3KJVA 2OTLS 2HHXA 2N4DA 4CLLA 4J9VA 4HVZA 3CCES 1DFDA 2VBYA 5GADU 3CJ8A 2OUGA 2AQ4A 1TL3B 2RUSA 4XO0A 2AZ1A 1DTTB 2UUAF 4K7QA 3RB3A 1KQSR 1VRTA 1KOOA 1LFPA 3NP5A 3CCQS 4DG1B 4USHA 4C0HA 2C42A 3J81Y 2VG6A 2J6SA 2BE7D 4QIGA 3MUVP 4DUYJ 4IQXA 2BANA 3KLIB 3BEGB 1U7LA 1IBLJ 2MY8A 3J7ZT 2HGNA 5JVGQ 1JLFA 3CSKA 3OVBA 3TAMA 3D6FB 1P8GA 4P71A 4F3MA 3P5BP 1Q7LB 2O67A 2LQ9A 1VQMS 2F8MA 4C98A 2YNFB 3LF0A 4N8OA 4UOCA 4KYZA 2XHWA 2AJFE 3SI8A 2EC0A 2OJ3A 2J9EA 1JB0C 1QAJA 1NU4A 2FB0A 4NASA 2OMLA 3KDNA 3PJ9A 3QAUA 3W5ZA 4RW8A 2CZVC 3NBPB 5F9NA 3DLKA 3TJAA 2DR7A 2J9DA 5KFXA 4X4NA 5CABA 4X62F 2V2QA 3A8JA 3KLGA 2OFGX 2FY8A 1EQMA 1R8BA 3FBFA 1GT8A 1WJ9A 3VV2B 5D15A 2U2FA 2B6AB 3BGRA 3BR9A 1ACMB 1FRIA 2OPPA 1B3TA 2JEIA 2CPDA 1LXJA 4NI2B 5KG1A 4NLOA 4K4XA 1CLFA 4A8YA 2YWFA 1JXLA 2NUHA 3UI3A 4J9PA 4PUOA 4JI2F 1I94J 2RRNA 4NXNF 4ID5A 4KGMA 3LTOA 1Z1ZA 1RT4B 5HQLA 2FJWA 2MYFA 2ZDPA 4DSKA 2OD4A 3VAJA 1HHQA 2LMIA 4PRFA 2BJ3A 4KH0B 1B64A 5K8OA 4L3NA 4F50A 4LRFA 1WHXA 2J0XA 4O3OA 5L1JA 3RBXA 3QO9B 1IJFB 4ZIVA 1XEZA 2F8EX 3A3OB 3IFEA 3CDUA 2UUCF 2PGCA 4UZCA 2HFSA 1QLNA 4ZHRB 4DV1J 1TKZA 5E3PA 2ZZMA 5LMNJ 2CNNB 2B5JA 1D9FA 1NH8A 5KFLA 2HHVA 2CJQA 3D0HE 4K4ZA 3BKUA 3Q89A 2HZVA 3WHIA 1KONA 3DM2A 5L9XA 5HMWA 4PPZA 3LP1B 2D69A 3ELHA 4JYAF 4DX7A 3MR2A 1N32J 1VRQC 5KFEA 4I2QA 4ZCIA 1QTNB 3K7RA 3MEEB 3V81B 3QNWB 1KLMA 2RIJA 3M2RB 5E3AA 3JTOA 2IY5B 1QY7A 1KEKA 1U4BA 4B9SA 4DR7F 2M8DB 3CCZA 2J0SD 2V8PA 3UQSA 4Z7CA 4AL7A 1J27A 1K73T 3SXLA 4LSNA 4ERDA 3JS9A 5D0GA 4TU7A 2RHQB 4WBFA 1K1SA 2MQPA 1EKSA 3PW5A 2B4PA 4DV2J 1X0FA 1OIAA 4HI1A 2HHHJ 3K58A 1KR4A 2IFXA 2F4VF 2OHDA 2LXFA 3KUGA 4USMA 3E3XA 1KVJA 1ZM4A 1RTJA 4DN0A 2R3VA 1RHUB 3OTBA 1JKHB 1N34F 4EEYA 2LEBA 4NLYA 1FESA 2YKNB 3B8HA 1CC7A 4N56A 2FC8A 5F8GA 2MMYA 1HWJA 3ILLA 2QLBB 4JV2A 2BXJA 3BSAA 2HVDA 1N5QA 3HVAA 1OQ6A 1YTYA 1OO0B 5HK4A 3SIPB 2JHEA 3GIRA 4CP5A 4JI6J 1AZSA 2BKOA 2YNHA 1G3OA 1S9EB 2BDPA 4F4YA 2QL7B 2AJ4A 4JI4F 3CNQP 1PYOB 3R97A 4X2BA 3CCJS 3QGHA 4ETXA 1VFJA 3MPVA 3BSOA 3V6KA 1RBOB 3UD3P 2AX0A 3Q8UA 2IAJA 5ETTA 3GG0A 3P45B 4JI5J 5DETA 1YIJS 4O23A 4ZPCA 3AA8A 5FDLA 5D4OA 3KLFB 4RNOA 2H9ZA 4JV5F 5KFYA 2J7UA 4F26A 2H1YA 1W2IA 2LU2A 5DM7Q 1NB2A 1RHRB 1S49A 4X66J 5I4MA 3BN4A 1AROP 4OX9J 2VA2A 5KFAA 1NJZA 4PXBA 1VQ5S 3DXBA 5ETSA 2MGZB 2CRLA 1S0OA 1SIWB 3QIPA 2V0NA 1RCOB 4NE9C 3RW7A 3NAHA 3BJYA 5A8KA 1D8ZA 1FX2A 2I2YA 3MUMP 4IFYA 1BHNA 4IH5A 4ZPAA 3RG6A 4WPAA 5CCMA 4RUBA 2HS4A 1VC6A 3EPGA 5KFDA 4OI6A 5KFMA 1T11A 2BRKA 5J2QA 1U1QA 4TU9A 4ZVOB 4OYIA 1S1TA 3MPWA 1M1KT 1CC8A 1WHYA 2OP5A 3VTIA 2ADBA 3THVA 4UF4A 3T1HF 1UA1A 2CJ9A 2AU0A 5A8WA 1NK8A 3OXLA 3QYYA 2ZUAA 3DDIA 2ZWOA 1UA0A 4J9QA 2X1GA 1MWZA 1SCJB 2K2PA 2AT1B 2YQ3A 3DCAA 3M2UB 2R7VA 4DL4A 1HBMA 3CJ2A 3H5YA 1V3RA 4GMKA 2VC0A 1SJ4P 2NZCA 1U02A 3E8OA 2JLEA 4DWIA 3QBCA 4FN5A 3DRYA 1KDNA 4B9LA 3Q24A 1XERA 3OTCA 2J9DE 3EWGA 1RAIB 4DR4F 1K44A 1YRXA 4Y0FA 2PI4A 4EGLA 1S1WB 1FRKA 4M1KA 4F4WA 1S72S 2JEFA 1VRUA 3OR2A 3TZZA 4K5SA 3CCVS 2EKYA 2WHOA 1FRXA 3BQ2A 2D3O1 1R27B 1RAOA 3HXMA 4LF6J 1UZHA 4HHJA 5IXUA 2DH7A 1U2FA 2QL5B 4KE5A 1RHQB 4ZITA 1UZDA 2BM0A 3C19A 3K2YA 2QZ8A 4KB7A 1EP4A 2V4JA 3H4DA 4JV0A 3UN5A 2JZ5A 3P3DA 2AWZA 4ECXA 1AT1B 1AXQA 1YDLA 5B0BA 3V4MA 3N4WA 1R6VA 3W2WA 2ZBPA 1QTMA 1HWLA 2FUG9 5B0DA 4HI2A 2F9DA 3I9ZA 1V5VA 3HZGA 5HJXA 1U0SA 1KHVA 5T14A 4ES1A 1S76D 3GQCA 4Y2AA 2BEFA 3EICA 1CJUB 1Y3KA 5F8LA 2FJBB 4LT6A 4WJBA 2A2CA 4OV6A 3GJTB 4A8WA 2OD6A 2ZM6J 1TKXB 5CYQA 2A2DA 1ZH5A 3OL7A 3AXMA 2DHXA 3BV8A 2V50A 3QGPA 2P6SA 2C3MA 2DRDA 4M5JA 3POTA 2GJIA 3GILA 2DIUA 4XAKA 2KXHA 1EJ7L 3V4IA 3QZ8A 1VK8A 3QFHA 4JI8F 3H20A 3CCTA 1FRJA 2B56A 4YDDB 4N41A 2R8JA 5AXNA 2IMWP 2HQDA 1IQZA 5DRKA 4MH8A 1KSPA 2C1EB 1VQYA 3N5BA 1B70B 2Z2LA 5C42A 4YHHJ 3W9IA 2DNMA 5F9LA 3EGWB 4HTJA 2RJZA 2QYCA 4C11B 3MM7B 1BQMA 4DQIA 4RW7A 1U1NA 1GQEA 2D3ZA 2QV6A 3A8IA 4OQJA 3J80U 2CQCA 4J9KA 4USUA 1Z2LA 1X4DA 1UFWA 3M8ZA 3HSZA 5HLFA 4DV0F 3CUNA 4DV6J 3AHPA 3C3LA 5EGYA 2FHJA 3KG1A 3O6QA 2PDAA 2ASJA 3T9ZA 2WTFA 1RT7B 2Y1IA 1VQ4S 2DR9A 1Y4ZB 3DRPB 1X4FA 2IRYA 1JLQA 5C24B 3UWTA 4LF4F 9RUBA 2RRAA 4IO9Q 2ASYA 5L38A 2BE9B 1G7CB 1REGX 1I51B 3VAFA 1VQNS 3G8TA 1VDHA 2JFDA 4I67A 2DB1A 2RAQA 1GTEA 1PC5A 5F0UA 1JLBB 4DL3A 1S4FA 3SCKE 1LWEB 4ED0A 1QUPA 1SJ3P 3CCSS 4L73A 3I0RB 3H5UA 2L9WA 2HNDA 4J9RA 4IKAA 2Z0GA 4DFMA 2I1RA 2HQ3A 3PO5A 3IGVA 1FX4A 2XMVA 1HHSA 4ZP6A 1Q78A 2IA0A 4BCAA 4TY8B 4XPCA 3M8YA 5B0FA 4K4UA 1BMQB 4MK7A 4ED4A 4IG3B 3F0NA 4CO4A 3QRRA 1SVDA 2PN6A 2Z58B 3M8RA 3NLCA 1AA1B 4ICLB 4U7UD 3KXDA 5MAOA 4C9DA 2QSWA 4CO2A 4ZVRB 1DBDA 1MMDA 2V2VA 3ZC4A 4IG0B 4YMEA 2RT3A 4ZJOA 5KT3A 4PWUA 1QVGR 2R7WA 1S1UB 5E33A 4WP9A 3QATA 2AHOB 5A8RB 3RYLA 4C8OA 4IRKA 1TL7B 4X84A 4C7QA 1HBNA 2YX1A 4QIEA 1VOMA 5EX3A 1N6QA 1TAUA 4NX9A 1FNOA 4I69A 2KT3A 4KGKA 1IKXB 2AEMA 2J0WA 2RD5C 1V6HA 2J6UA 2DPJA 3SCLE 4QW9A 3C15A 1REVB 1I3OB 1CQNA 3CIZA 2BE2A 4ECWA 2FDNA 2BQ3A 1JMTA 3D2WA 1TP7A 2DGOA 4XDCA 4ZCLA 3W3SA 4ELVA 2F7VA 3PJXA 3KUEA 4MKYA 1GX5A 3MEDB 1LWFB 2HQFA 3DLHA 3AT1B 4PQUB 3ZXWA 4QR0A 2UVRA 3DNCA 3PW4A 2NPIA 2GVDA 4D3HA 1WC3A 1NDCA 2D41A 3JYTB 4JP8A 4W98A 4EU0A 2N82B 1Q8LA 4NLWA 2IHR1 3ZTOA 4YR0A 1QE1B 1IUJA 4W4MA 4G1IA 2RKIB 2P8IA 1CJKA 1X0PA 3JXOA 5C5JA 1HL6A 3JSRA 4QBUA 2XYHB 3Q22A 2EK6A 4LVNP 3W60A 3OBIA 4WZMA 1I5OB 5H9EJ 3CC7S 3KK1A 2CJXB 3M6VA 4TVAB 3BQ1A 2HAFA 2AP6A 3MFIA 3TX8A 4C97A 4ALZA 1GAOA 2JNJA 3C6UA 2MXYA 2EK1A 2HHTA 4QWDA 2N4CA 3MFHA 4LBPA 3G96A 4OHZA 2BJ9A 4LF7J 1SKSA 4TYBA 3GFZA 1HHTP 2LDIA 1YRTA 2XMMA 3LP2B 1WC4A 3MCSA 3ENQA 3DLJA 1HW8A 1NHKL 5KG2A 4P10A 2F5GA 3IP0A 2Q79A 1WDDA 1TK8A 3NMAA 3PRVA 4TY9A 2XMJA 3EGZA 2P9EA 2BKNA 3DLGB 2I5JA 2DITA 2H54B 1XR5A 1TTHB 2AJ0A 4I6AA 2CQBA 2YNIA 1FFSB 2YX7A 3UVJA 2DXEA 3ZTSA 2VPZB 2DCLA 2FGOA 4UUWA 3CDBA 4FPIA 3C14B 4PYAA 1N54B 4F0KA 2DR6A 1TAQA 2EXUA 1FF2A 4QYZK 3LPYA 3M8PA 4IOCQ 5CYJA 3FCWA 3C8YA 1WSVA 2W9BA 2R9LA 3TUZC 3GTYX 2EFNA 2ZKTA 1IM4A 2MKKA 3OVSA 3HVTB 4UZBA 3EMTA 3ZTPA 2DGWA 4OJHA 2VFVA 2QRRA 4DR3J 5IWAF 4OI0A 2XMKA 1PIEA 4E98A 4KQZA 1TL4A 3B4MA 2RF2B 2WRMA 1YWXA 5HVHA 3O1LA 4PR6A 5CZXA 3HMJG 1Q8BA 3EZUA 1TQLA 2NREA 5I42B 2B8QA 2VL1A 2P2CB 4KO0A 4LRBA 3IS9B 3S01A 4U95A 5GAEI 4F04B 1WHVA 1X9WA 3W2VA 2HIQA 3QRPA 1F6TA 3O8WA 2Q3PA 5EWGA 2W7OA 2BQUA 3VAMA 1M0SA 2OKQA 5KFBA 5HBMB 2Z30B 1M5SA 3NEKA 3H2UB 4DSFA 2MB0B 2GCFA 1DLOB 1C0UB 2BV3A 1W25A 3IC1A 3TR5A 4C8MA 1Q5YA 2KVQE 3U7JA 5L8RC 1RT2A 4QR1A 4O44B 1F9FA 5DGAA 1KTVA 5KFFA 1T94A 1HYSA 2EC2A 1BXNA 5IV4A 1GMWA 1NJWA 5HI7A 4DR2F 1K47A 5LXRA 2RDJA 3FC9A 1S7HA 5KG4A 3NL0A 3I55S 3WIVA 1EETB 1FXLA 5E0OA 5HSPA 2DXDA 2UUBF 2A3JA 5T41A 5D77A 3LWMA 1BQNB 3H42A 4GO7X 3PIOQ 2ALYB 2FTRA 2DNRA 1HBOA 1TVRB 2RB7A 3M8QA 4DBQA 3HKZD 6AT1B 3P49B 2ZH2A 1RGVA 3BZQA 3NRBA 2Y1LB 1WG4A 2YVSA 1XN9A 3HHLC 2UVWA 2UUAJ 2KZZA 1T9TA 3KJVB 2XO7A 3ITHA 3ZZRA 5IQQA 1H7XA 2EEYA 1S9GB 1F9HA 3CULA 3VZHA 1VBKA 3GE9A 3A12A 2K8GA 3I5AA 4WFZA 2X1BA 4FXDA 3KMSA 2F40A 2NSBA 1LWCA 1O0PA 2VDIA 2BOAA 4GO5X 2HZCA 4X65F 1N56A 4A47A 1DQ9A 2FJAB 4RO0A 4JOUA 4CLPA 4OFZA 1VRTB 2DNHA 1GK8A 2MPUA 1VQ7S 5KG7A 2DRAA 1S10A 2VG6B 3FQKA 3EM1A 4QU7A 2BANB 1S0VA 1WF1A 4ZVGA 2W2MP 2QMXA 3SFUA 2JLFA 2YQ0A 4FXVA 3TAMB 4OYPA 2G2OA 5FIIA 2UXDF 3ZZZA 1NK9A 2DGVA 2JDJA 2ZZNA 1CPZA 1RWKB 3RUBL 1B99A 2BYCA 4EO8A 4X62J 1HWUA 3D1OA 1U25A 2VPYB 4O3PA 4OIXA 1SQGA 1DQ8A 3CJ3A 2B51A 4RW4A 1Y11A 2UUWA 1DHMA 3OFEA 3T1AA 5D0RA 3D7SB 4QWAA 2HRYA 1RA6A 3UDCA 4RW8B 3D0IE 3K5NA 3TAPA 2OTJS 1CG2A 1NMEB 2XG8A 3DLKB 2GNKA 1ZA2B 3R7SB 2DGSA 2ZWPA 4JI2J 2F8HA 3U27A 2KH9A 4NXNJ 3S1TA 4HYKA 1R8AA 1Z4UA 3KLGB 3TWZA 5BYRA 4DX8H 4M95A 2C2NA 3OL6A 3BGRB 1U49A 3DFEA 1MNEA 2OPPB 4DV3J 2FLLA 2R8IA 4HLBA 4MKAA 2VFTA 1UAWA 3CJKA 1NO8A 2ERRA 2UUCJ 1RI7A 1HNZF 4DCJB 4PUOB 3PDNA 1ZYQA 4ID5B 3MM9A 2K1RA 1T9XA 3TOQA 3VQTA 4ZHRA 4K4WA 2MTLA 4YFUA 2HHWA 5LXYA 1SJRA 2WW8A 3J7A1 3CIMA 4Q2LA 2R7XA 3KG4A 4JYAJ 3CT9A 5G0RA 2EG1A 2VF3A 2B4VA 3D4JA 1QVFR 1UJ4A 1Q1KA 5A6WA 1TKZB 2YPYA 4ZVHA 2BOPA 2B5JB 4Y6IA 5H9EK 4DR7J 3JAMU 2YKQA 2ABYA 1B7YB 2NYHA 3W61A 1KTQA 2J5AA 2HHUA 2XC9A 1A0OB 3DM2B 4B3TF 4ITSA 3SDEA 5KAKA 2HFNA 1YVFA 4O4RA 2HKEA 2B4OA 4RLEA 3BGLA 4A4JA 2XS2A 4I0WA 1XC9A 1TUWA 4I2QB 1S6OA 1TZ0A 4WFNQ 4DV5F 3GIMA 1KQKA 3U02A 1KLMB 4PAAA 2B9XA 2Z2YB 2F4VJ 4ILLA 3EZOA 4Q43A 4RX6A 2YWWA 1UMJA 1RT1A 3VVTA 3L4BC 2K3IA 2J7WA 4LSNB 2BZ2A 4DU7A 4DS5A 2HHPA 2W2QP 3LH2S 2LXUA 4DV4F 4UW2A 5HP1A 3UR3C 2XMTA 3KG0A 1FTRA 1VBYA 1N34J 2VUGA 5M2PA 3KNGA 3LAMA 4B3SF 3D3BJ 4DUZF 5J2PA 1HQEA 2EFGA 2M4MA 3F44A 3M6UA 4Y2CA 4RU9A 3AD9C 3MCMA 5G4DA 4JUZA 3J81j 2KFNA 5F8JA 1I1GA 1FWPA 2MKCA 2C3YA 2DNPA 1FA0A 3BM7A 3KYLA 2V34A 5CH7B 5F8MA 2R2RA 1RTJB 1YBTA 1IBKF 4Q0BA 4JI4J 2HRUA 2RS2A 2R8GA 1GMVA 1PSDA 3MCNA 4FKXA 3PRBA 8ATCB 4RL1A 2ZOGA 1TK5A 2X1FA 4JV5J 3HHNB 1P9QC 2MKHA 3TNVA 3PKYA 2I38A 3JTPA 2YNHB 1Q16B 1H73A 3M05A 4MFBA 2CNOB 3SEOA 2CQ2A 3G87A 2IYGA 2O1PA 2IAJB 1G4CA 3MWBA 1SQFA 2OEKA 3MMAA 4URGA 2VODA 5FDLB 3FNNA 2C2KB 3SQOP 1KBRA 3G6ES 3CD0A 3TX0A 1ZETA 4CM2A 3OXGA 4GRSA 3GSIA 1PAEX 5LM7E 2OPQA 1FVSA 4YP3A 4AT1B 3TA1A 2YKPA 5IT4A 2JLGA 3OHBA 4NLSA 1LW2A 2AZ3A 3L7OA 2VJVA 3ZNJ1 4P72A 3QIPB 4CDIA 2FVCA 3T1HJ 5KG0A 2KB2A 5HATA 1RT5A 4O3NA 5A8KB 3I6PA 1UVLA 3HK2A 4IFYB 2N7CA 4UUXA 4KPYA 1FT8A 4DV7F 5K8NA 4CWBA 2EFVA 2QLFB 1BGXT 4LFBF 1RE1B 2ROEA 5IT9U 1S1TB 1OWXA 4DR4J 1B0PA 3R9LA 4YOEA 1RSCA 1U6ZA 1RT6A 5K14A 2EKNA 5I3PA 5A8WB 1SC1B 3CJTA 1S7IA 1YITS 2B9YA 1S1WA 4HDGA 4KJIA 1HBMB 2IPOB 2CQ0A 2CNKB 1DAXA 2VFUA 1RBLA 1GMWD 2F4FA 5CHCB 1RBAA 2XULA 1KP6A 1RYRA 1YBAA 3RW6A 5DS7A 4FVMA 4AYBD 1BLUA 1U45A 1VRUB 4I7FA 3PR4A 3M9MB 1TUVA 1HNWF 4DPWA 5FD1A 3K5OA 4USVA 5GVQA 3BGFA 2EFPA 4BHQA 3CC4S 1RWOB 3PYEA 2MQOA 2LA6A 1HI1A 1HARA 4F8RA 2ZITA 2AEJA 4YY3F 4N5SA 2FY1A 4ANCA 3LQVA 4B02A 2YH0A 2GHVC 5BYQA 4C4WA 2WSCC 4B3RF 1EP4B 3T1YF 2V4JB 4K59A 3SCJE 2DHGA 1RWWB 3SZ2A 3HP6A 1TMMA 1VQLS 1YQHA 1DTQA 3DOMA 1CJUA 3ZTRA 4NA2A 1RAHB 1D0EA 1XNQF 2KJVA 3LWLA 2XI2A 3D28A 1B4SA 1QM9A 3I0SA 4Q8EA 1PKUA 4M5DA 1SH2A 3EE3A 5EUHA 2R2TA 1RKJA 1RAFB 3SQGA 1URRA 1VIOA 5I3QA 3UN3A 4OYWA 3UNYA 2ZH1A 4ZA1A 3NG8A 4WU2A 1T3NA 4A8QA 4NLGA 2UV8G 3K5MA 4OHVA 5CYQB 3TVYA 2AMCB 5KFWA 3GG1A 2CQDA 3C66A 2XB2D 5ETLA 3POTB 5CCLA 3TEHB 4DPXA 3V4IB 3DLBA 3VGUA 1Q86T 1UVKA 3DDNA 5LSRA 5HJYA 2VA3A 4DV0J 3QJPA 1NDPA 3W9JA 2G1DA 5C42B 1P27B 5D4LA 3G6XA 2HBYB 1CS4A 2GA7A 4ZVTB 3MOZA 1BQMB 2HVIA 3L7UA 1FKAF 4RW7B 2DYAA 5JUMA 3G4SS 1EX8A 4J37A 3PO4A 4LF4J 1X4AA 1LK7A 4LF9F 2KT5A 3Q0AA 3HULA 3GONA 3ZZPA 4GKJF 3QFWA 1WELA 1WD6A 3K8WA 4N77A 5HLFB 4DPTA 4WKRA 4KGXB 1ZA1B 2E29A 1RTDA 1N36F 2E5LJ 3Q8PB 1LXNA 2C3UA 1J5OA 2XZDB 2HNZB 3CD6S 4QIFA 1JLQB 1C0TA 1DY3A 4BC7A 2XYGB 3EGVA 3EXCX 1NKCA 4ZVPB 1PBAA 4B3MF 4FF2A 3I0RA 2FJXA 3MM6A 3THTA 1NBEB 3MUTP 4R8UA 4DSLA 3GCWP 2V6AA 2D9OA 1BWEA 1PCAA 5CAAA
chains in the Genus database with same CATH topology
1FRXA 3BQ2A 4KSEB 3NS6A 2Z8QA 3AJ2A 1R27B 2KRBA 1F5AA 1Q79A 3HXMA 3FGVA 3OUYB 3OXFA 1MW7A 4IQMA 4P7TA 1DRZA 4B08A 4HHJA 1R6YA 5KFNA 1WHWA 5IXUA 2DH7A 1U2FA 3CDWA 4K0KF 2M7SA 2QLWA 5GAEU 3HM9A 4I68A 4Q5VA 4KE5A 3K8VA 2E9ZA 1JIHA 2DD8S 4U9RA 1CSJA 1X9MA 2BM0A 2HNDB 4WF9Q 3DXSX 2DNNA 5D3GB 2DH8A 4WYWA 2E9TA 2BR0A 1JKHA 3K2YA 3DMJB 5KG3A 4CTAA 3G9CA 1V9OA 2YKNA 5J2MA 1PO6A 2QZ8A 4KB7A 3O3LA 1EP4A 4I64A 1ZBTA 2V4JA 3H4DA 5M2RA 4OHYA 1FKOA 2XLJA 4B3OA 4DV2F 4JV0A 4YDXA 2JZ5A 2NSCA 2DO4A 5B09A 1FJCA 3P3DA 2HHHF 1FRHA 2DO0A 2ROPA 5DG9A 4NLQA 1R8CA 2AWZA 2WBMA 4ECXA 1AXQA 5GADI 2JEGA 4K50A 4MIAA 3SSSA 2JEJA 4CIOA 3GWCA 4X4OA 4KFBB 1FE0A 2FGCA 3DI6B 5B0BA 4HKQA 3V4MA 3N4WA 5EHHA 1SKWA 3W2WA 1VI7A 3KHRA 3KLVA 3JSMA 3I4PA 5IZHA 2I0XA 2M0GB 1QTMA 1HWLA 4RZRA 2L08A 2FUG9 4PQAA 5L1KA 1S9EA 3I96A 5B0DA 1FXDA 4HI2A 2F9DA 3MAQA 3I9ZA 3TVKA 2R7OA 3HZGA 3JSYA 3DHWC 4K2XA 1MU2A 4ILRA 1M5HA 3RRGA 1KHVA 1GXUA 3IBWA 1KHWA 4P7VA 5T14A 1LFWA 2FHKA 3HZEA 3PNIA 2NYIA 4ES1A 5J1PA 1TFWA 1S76D 3GQCA 2O3DA 2ZH6A 2KFZA 4Y2AA 1UJ5A 1X4CA 2EBEA 4C8YA 2FPHX 2CZ4A 1TFYA 3R5BA 2RH3A 2R7SA 2ZFHA 1Y3KA 3KHGA 1S9FA 2W25A 2ZD1B 1VQPS 3NAIA 1GXTA 2YTCA 5F8LA 1U1PA 2FJBB 3LW5C 4LT6A 3N9UC 4WJBA 5KT2A 2A2CA 5AE3A 1FK9B 4A46A 2VBWA 3KLFA 3UDLA 4A8WA 1BY9A 2OD6A 4IYQA 5GAGI 3HPOA 4ZP8A 3LO3A 1E6YA 3CD7A 2E1MC 1MROA 2UV8A 3OFFA 4JI6F 1QSYA 1TKXB 4KV8B 3KHLA 3KK2A 2ZUGA 2ZH9A 3T5LA 3DYAB 2HLTA 5CYQA 1HBNB 1XWLA 2A2DA 3I87A 3GIIA 1ZH5A 1B0TA 4ETZA 3UFCX 3ZFVA 3MEGA 4RU2A 1JLEA 3EXYA 3OL7A 1XBWA 2RQCA 1N6QB 1L3SA 2JC1A 2G4BA 2DHXA 2RUGA 4WCEQ 3J7YU 2KYZA 1T02A 2CQ3A 5HMZA 5KFZA 3QGPA 2J6TA 2P6SA 2C3MA 3N5FA 4U7UK 1ZM2A 4RW6A 2LU1A 3POTA 2GJIA 4J5OA 3MEKA 3GILA 1NH7A 2ZVSA 2KM8C 2DIUA 1FDBA 3T9NA 4XAKA 2DPIA 4NYZA 2KXHA 3QZ8A 3V4IA 1VK8A 4JI8F 2M3DA 4C8KA 3H20A 3CCTA 2MGZA 1DZ5A 1FRJA 1QJHA