4H4MB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
428
structure length
428
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
total genus 102
structure length 428
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB03
4X2BA 3IGNA 4IG0B 4ZP6A 4MK7A 4K4ZA 1T05B 4DL7A 3DMJB 4IR1A 4IRKA 3BGRA 3I5AA 3KJVA 3DLEB 5KFHA 1C1CA 1TL1A 4RW8A 1D1UA 5KFRA 3H5SA 3MEEA 3Q8QB 3V6KA 3HHKA 5J2MA 3QGIA 3KHHA 4NRTA 1S1TB 1IKYB 4MKBA 2UVRA 4TY8B 3H5XA 5F8JA 3SI8A 2CKWA 2VA2A 3DM2B 3DRSB 4ZVHA 2FJXA 4TYAA 5KT5A 3KLGB 1S1XB 5EWFA 2D7SA 4WFXA 4ECUA 4K4UA 4KKOB 4F50A 4PWDB 3RBDA 3ITHB 5DG9A 3PR5B 3E01B 3BQ2A 3MEDA 3NBPB 2D3UA 3BR9A 4XO0A 3Q8SB 2XCPA 1K1SA 3KMQA 4NLPA 1N6QA 4G1QA 1RA6A 2AGOA 1BQNB 1HMVA 2W8KA 2R2UA 4KO0A 1RYSA 1S6PA 3KK2B 5HROA 4PUOB 1C0TA 3IN5A 1LWEA 5F8GA 2W9BB 3DLEA 5KFWA 2OPPA 3QIPB 4I2PB 2YKMB 5C25A 4ECWA 1NHUA 2ZKUA 3QYYA 1N48A 1S1UA 3T5KA 3MR6A 1JLBA 4IH7A 5KG7A 5KFKA 5HBMB 3BSOA 3I5CA 3V81B 5F9LA 3KLVA 5L1KA 2UVUA 5J2NA 4MIAA 1RTHA 4ID5A 3H40A 4NLGA 4DG1A 3DI6A 5F8HA 3OSPA 1SH2A 1LWCB 3CWJA 1S9EB 4URQU 1JLAB 4F4WA 2RDJA 2FLNA 2ZE2B 4ED0A 4K50A 3M8PB 4URSA 3OL6A 3E51A 4JV0A 3KK3A 1QUVA 3KLIB 1XR6A 3I5BA 4FS1A 2XI3A 3RB6A 4ZMMA 1IKWB 4ED2A 4LSLA 2WK4A 1TVRA 3KMSA 4EBEA 1HQEB 3IS9B 4RNMA 3H4DA 3DOKB 4ECYA 4O4RA 1RT3A 2ILZA 5CYQA 3LAKA 3QO9B 3KK2A 4Q44A 4IR9A 2E9TA 3CJ5A 3CJ2A 4NLRA 2GIRA 1JLGA 2QV6A 2VG7B 5EDWA 1U09A 5KFAA 1Z4UA 4NLOA 5KFTA 2C2DA 5DQIA 1HNIB 1C0UB 1TKZB 1S6QB 5J2NB 3KK1A 3V4IA 3E01A 1S48A 3V81A 2AX1A 1HQUA 2C2RA 3MEGA 4ED8A 5KG3A 5DGBA 3GIIA 3T5JA 3UPFA 1IKVB 2BR0A 4K4YA 2XWYA 3DLKB 5DGAA 3IG1B 4ZHRB 3MECB 5C42A 3HVWA 4NZ0A 4WZQA 1N5YB 1NNDA 1BQMB 2BQRA 5KFDA 2B6AB 1TP7A 4RNOA 3KJVB 5C24A 4FS2A 1S9GB 3M8PA 1KHVA 1UWBB 3RAQA 1S6QA 2J6TA 1GX5A 3RAXA 4EO8A 3BSNA 4DL2A 2YNHB 4MFBB 2WONB 1T03B 3EPGA 3PW0A 2AU0A 4Y2CA 1DTTA 3LANA 1HNVB 4MKAA 5KT4A 4IRCA 4I7FA 4ZP9A 1S1VB 2IC3B 2OPPB 3QIPA 4Q0BA 4O4GB 2FVRA 2AWZA 4ZPBA 4KE5A 5K14B 2ALZA 4NLVA 1S6PB 4PUOA 3H5UA 1RT5B 3JSMA 1JKHB 5CYMA 2XGQA 1MU2B 3MFHA 4QWAA 4JUZA 2B6AA 4R8UA 3GYNA 4RW9B 4ED3A 4YMEA 1N5YA 4GC7A 2AQ4A 3KLHA 4TXSA 5KG5A 1VRTB 2YNIB 4LSNA 2JC0A 3LP2B 3SFUA 2WONA 1I6JA 5J2PA 3QGGA 1JLQA 3OL8A 4EEYA 2R2TA 3FFIB 1TKTA 1S1UB 4WE1A 5DLFA 3CDUA 4O3SA 2F8EX 2XI2A 4NLWA 3DOLA 4LQ9A 3DYAA 4I2PA 1S1XA 5C25B 4RNFA 2AGPA 3HKWA 1RYRA 3C6TB 3LP0B 4IG3B 5EUHA 3SFGA 2WRMA 1DLOA 5F9NA 3H4BA 2C28A 5HROB 3M9MB 1KHWA 4Q0BB 4KHMA 3CDEA 1BQMA 2QE5A 1W25A 5DQHA 4KFBB 5L1LA 2HNZA 3LALA 1R0AA 3UQSA 4U6PA 3M8QB 2V9WA 1TKXA 4ED1A 2IMWP 1IKVA 3NL0A 1FKOA 2JC1A 3MEDB 2I1RA 4RNHA 1HQUB 1RT1B 4ZVGA 3GV5B 4RUAA 3RB4A 2YNIA 2IM2A 2XCAA 1XR5A 1LWCA 1TQLA 4NCGA 2R8HA 2E9RX 3DLGA 4F4ZA 2VG7A 3I0RB 1TKTB 1S9GA 5KG0A 1S0OA 1JLEA 2ZD1A 2HNYB 1JLBB 3CJ4A 4YR3A 1FK9A 2HNDB 3HVTB 1JIHA 4Y34A 1RTJA 4ECZA 3V6HA 3KHRA 4J9RA 3N6NA 4NLYA 5KT7A 4EYHB 2RKIA 4KB7A 3MR3A 1RT5A 4KFBA 3KOAA 4IDKB 2W9CA 4J9MA 4IH6A 3TVKA 1C0TB 2J6SA 2J6UA 4O3RA 4NLXA 1C1BB 5L9XA 1EETB 4M95A 1RTDA 3NGDA 4EBCA 1JLAA 1HMVB 4B3OB 1IM4A 4ECVA 4O3OA 4OL8A 5DQGA 3DI6B 3DLGB 4O44A 1S1WB 4Q43A 2OPRA 3QIDA 2D41A 5HBMA 1EETA 1OS5A 4QWEA 4WXWA 5KFSA 1C1BA 3FRZA 5DG8A 4QWDA 4XPEA 5EWGA 3G6VA 5J1EA 2R8GA 3MR2A 4K4TA 3I0SB 1J5OB 2B43A 4TN2A 4FBUA 3C6UA 5FDLB 4H54A 1QAJA 1VRUA 4RU9A 2DPJA 2W9AA 1ZTWA 3FDSA 1LWEB 2WHOA 4R8UB 1RT4B 4TY8A 5KFJA 4ZVEA 5HP1A 4J9PA 4K4SA 1SV5B 1K1QA 4DL3A 1T3NA 3MEEB 1S4FA 3I0RA 4TY9A 3PZPA 2AGQA 5D3GB 3RBEA 2UVWA 3BREA 1REVA 1C2PA 1RDRA 3KLEB 3MEGB 4J9OA 3FFIA 3IRXB 3NAHA 3V6DA 3OLBA 3T1AA 3LP2A 4ED6A 1WNEA 1XR7A 3QO9A 3QZ7A 3KLHB 3PW4A 2O5DA 3HVAA 1RTDB 2BQ3A 4ECTA 2ASJA 1HQEA 3IS9A 2GIQA 2R2SA 1SV5A 4KSEB 5KFBA 5C24B 2V4QA 4F4XA 2FJWA 2ATLA 3DDKA 4RW6A 4IG3A 5CYQB 5KFPA 3C6TA 3LP0A 2RKIB 4ZPAA 5KFYA 3PW5A 2BE2B 3G6XA 3KK3B 1T05A 1KLMA 2D3ZA 2IJFA 2C22A 5DLGA 2R8JA 3ISNC 2XGPA 3PJXA 3BSAA 5KFQA 4O3NA 4ECRA 3QLHA 3DLKA 4QWCA 1QAIA 4NLSA 3MFIA 3GIJA 2W7PA 4H4OB 3V6DB 5J2PB 2ZE2A 1HPZA 5KFGA 3H5YA 1REVB 1EP4A 3Q8PB 5L1IA 5D3GA 3V6JA 3MTKA 1LWFA 2E9ZA 2B5JA 4KAIA 4QPXA 4QWBA 4ICLB 3T19A 5KFOA 3KHGA 3GV7B 5K14A 3MR5A 5KFCA 1FKPB 4IDKA 2W9CB 3KLFB 3RB3A 2AX0A 2FLLA 4IQXA 3Q8RB 5KFLA 3BGRB 4RUCA 3M8QA 5DG7A 3BJYA 1R0AB 4ECSA 3OHAA 4F4YA 4G1QB 3DOKA 1ZETA 3FQKA 3DRRB 4KO0B 3MF5A 4JV2A 4J9SA 2CJQA 4J9NA 1JLEB 2ZD1B 3GILA 1JXLA 2RF2B 4MH8A 2DPIA 2JEFA 3TAMB 3KLIA 1JLFB 2BANB 3H98A 4IOBA 4NYZA 4IKAA 5JXSA 2R8IA 3DOLB 5KFVA 5KFUA 5KG1A 4KKOA 3NKYA 3UR0A 4DEZA 1S1WA 4O44B 4IFVB 4K4WA 3G6YA 4ECQA 3TAMA 2W8LA 1HARA 2ASDA 3JYTA 5HLFB 4KV8B 2FVCA 1RTIA 1RA7A 4NLUA 4RW4B 2FJVA 1C1CB 1TL1B 2OPQA 4RW8B 5KG6A 2UVVA 5F8MA 1S0MA 1MU2A 1SUQA 5KFMA 4U7CA 1VRUB 2V0NA 3C6UB 5FDLA 4RZRA 4KV8A 4NRUA 2EC0A 2HWHA 1D0EA 4WZMA 4YQWA 1N4LA 3PR4A 3DYAB 1BQNA 2I5JA 5I3UB 1DTTB 1S9EA 4DL4A 4NCGB 4HKQA 2WCXA 3LP1B 4H4MA 1HPZB 1QE1B 4XPCA 2R8KA 1LW0A 2YKNB 4O3QA 1S0NA 4Y2AA 3TQ1A 2VG6A 2VG5B 3OHBA 4IH5A 1RT6A 3BQ1A 3EPIA 2C2EA 4K4VA 3GQCA 4JV1A 4YR0A 4J9KA 1SUQB 2JLEA 1DTQA 4RW7A 3DRSA 4LSLB 1JKHA 5CYMB 3GIMA 2HNZB 1IKWA 3CIZA 2W9BA 2IA6A 4RW4A 5T14A 1RTJB 4WYWA 1RT6B 5I42B 2WB4A 2HAIA 4URGA 3PVXA 4ZHRA 4PQUB 4ZP7A 4ZPCA 3ISND 1HNVA 3LP1A 4H4MB 3FQLA 2WOMB 5KFIA 4ED7A 2IAJA 2WTFA 2R2RA 4H4OA 3NAIA 5J2QA 3PHEA 5C5JA 4Q45A 4MK9A 4MK8A 3RB0A 1JLQB 3V4IB 3QLHB 4PWDA 1RT7A 3M9NB 1HNIA 2HWIA 3BSCA 1TV6B 2W7OA 4J9QA 2YNFA 4HYKA 4Y3CA 2IBKA 1UWBA 2IM1A 3VQSA 4WYLA 5EWEA 2OPSB 4NLTA 4TQRA 1TKXB 4RW9A 2IM3A 3QGHA 2RDIA 4I2QA 1YVFA 5HP1B 5I42A 3UDLA 5J2MB 1TL3B 3KLFA 2YNGA 4M94A 3KNAA 1RT3B 4ICLA 4YR2A 3OL9A 4EYIB 5C42B 2IC3A 1DTQB 5F8IA 4I7FB 4YP3A 3CJ3A 3D5MA 5KG4A 4R5PB 5J1EB 4WXOA 3IRXA 3ITHA 4IFYA 3KLEA 5KFFA 3GV8B 2ILYA 3NMAA 5KT2A 2RF2A 4KBIA 1QE1A 3KHLA 1RTHB 4ID5B 4NLDA 2V4RA 3T5LA 4DL6A 4LQ3A 5KT3A 4DL5A 4G3IA 1S1TA 1RT2A 2BE2A 1TL3A 4O3PA 2HMIA 1HYSA 4J9LA 2BRKA 3JSMB 1IKXB 4NLQA 4RW6B 1FKPA 1RT4A 2VA3A 1SH0A 4RW7B 2FVQA 4ZPDA 3DMJA 4ZVFA 3N6LA 4O4GA 3PW2A 1S1VA 1TVRB 3CVKA 4WFYA 4FBTA 1J5OA 3IG1A 4TLRA 4Q8EA 5KT6A 1RT7B 1IKXA 4Q8FA 2HMIB 1EP4B 1HYSB 3H2LA 1ZTTA 4QW8A 1LW0B 2YKNA 2FLPA 1N6QB 2WOMA 5JUMA 1JLCA 4R5PA 2BQUA 4DG1B 3G86A 2FVSA 3BQ0A 4EBDA 4IFYB 1S9FA 1JLGB 4WFZA 1T94A 1S49A 3CJ0A 5F8LA 2YKMA 3CDWA 3KLGA 3DRRA 3H59A 3QZ8A 2OPQB 1IKYA 3OL7A 3MECA 4IRDA 2YNFB 1DLOB 2HNYA 4R0EA 3JYTB 5HLFA 3ICLA 2IJNA 3D28A 3OLAA 1GX6A 5J2QB 2B5JB 4RNNA 2UUWA 2I5JB 1C0UA 1TKZA 1TV6A 3KK1B 5I3UA 5KFXA 4TQSA 1LW2A 2XC9A 1JLCB 4PQUA 1JLFA 2BANA 3CO9A 5L1JA 1MMLA 2BRLA 2IAJB 2JEJA 4LSNB 4ZP8A 4KHRA 1S10A 3T5HA 3N6MA 4ECXA 3DM2A 1SH3A 3DRPB 1NHVA 4GC6A 2GC8A 1KLMB 1RTIB 5KG2A 2YNGB 1FK9B 2HNDA 3HVTA 3I0SA 4MIBA 2VG5A 3LAMA 4I2QB 1LWFB 3EZUA 3IGVA 1JX4A 2JEGA 2JEIA 3M9OB 3DRPA 2OH2A 1RT2B 4IFVA 2FVPA 3FSIA 5F8NA 3PJWA 5KFNA 2OPSA 2OPRB 4IG0A 4WE1B 4TYBA 1RAJA 2UUTA 5KFZA 4QW9A 2ASLA 2VG6B 3NBPA 2IM0A 1RT1A 2YNHA 4MFBA 1T03A 4B3OA 3GIKA 3PW7A 1S97A 1N56A 5KFEA 3OSNA 1CSJA 4EO6A 4K4XA 1LW2B 1VRTA 1FKOB
chains in the Genus database with same CATH superfamily
3IGNA 4IG0B 4DX6A 2K7KA 1Q5YA 4L3KA 2MYFA 1T05B 1UW9A 2VFTA 2HEKA 3BGRA 2JZ5A 1FXRA 1G4CA 3I5AA 1X4GA 3CNQP 1FXDA 1C1CA 3GCXP 5E3QA 4L6V3 3NMRA 4Y65A 3MEEA 4AQYJ 3CC2S 1RBAA 3FEXB 5J2MA 1E6VB 5H9FJ 3V6KA 2D3O1 3H5XA 2HS4A 1RWKB 2L9NA 5B0EA 3SQGB 2OKQA 2PT0A 4HT5A 4D3HA 4M5DB 4LFAF 3VGUA 3LGHA 4WFXA 3LOUA 4K4UA 3D0GE 5A8WA 4LF9F 1Y5NB 5DDRC 3KG4A 3N01A 2EC2A 4OX8A 2EI5A 5HMXA 3PYFA 3ZZOA 3KDOA 3IA0A 2DNPA 5ETOA 1HBNB 2DITA 4MT1A 2DHHA 3TVYA 4CLLA 3JAMU 4MKYA 3MMBB 2L3MA 5FIIA 2G2YA 4DZ6A 2CG4A 3NCPA 1URNA 1HMVA 4JI7F 1Y4ZB 4DR2J 3W61A 2W2PP 4KO0A 3R5DA 4DV5F 3KK2B 2F4VF 3IN5A 1HR0J 2Q43A 1LWEA 2W9BB 4Q7AA 5KFWA 3MAAB 4CI0B 5MLCV 1ZH5A 4LJMA 1HD0A 1VDHA 4C8MA 3BO3A 4C7QA 4FP9A 4I2PB 5C25A 5G4DA 5GAGI 3FRYA 1NK8A 2CAJA 4ILRA 4ILLA 3M2UB 1LEOA 2QA1A 3T5KA 1Y5LB 4JI2J 5LSOA 3BSOA 3Q8UA 2GVDA 1LOUA 5HBMB 2B3TB 2IVFB 3KLVA 2CXEA 2VUGA 2R7OA 4MIAA 4W4MA 2YKAA 2NR0A 3H40A 4QYZK 1TL5A 2CRLA 3J81Y 2R7VA 3OSPA 4LF9J 1UWAA 1SH2A 5F41A 5DLGA 5K8NA 2FLNA 1JLAB 3MPDA 3R7SB 4DLEA 2HFZA 3E51A 3N5BA 1QUVA 5ETRA 2BKPA 1Q4RA 2ZH9A 5B0AA 3I5BA 1DQ9A 3MEKA 2FHJD 3HHLD 3HSJA 3LUYA 1H3DA 1QAYA 3KMSA 3A1YG 5AE3A 4EBEA 3P5TL 1VC6A 4URQU 3DOKB 1FVSA 2Z30B 1UAWA 3JSYA 4OZ5A 3TEGA 1UJ4A 4ECYA 2ILZA 4PCQA 4TNOA 3KXDA 5D4OA 4Q44A 3T1HJ 2XY6A 3SSQA 3TARA 5EGYA 3RG6A 2CQBA 4ETXA 5GAEI 3NNAA 2E7WA 2L9DA 5CCMA 3AHPA 2VG7B 3NWRA 5E3RA 3OJSA 1RUSA 1UEVA 1Z4UA 4QPTA 5KFAA 5KFTA 4EU0A 3OVSA 3OW2R 1U0HA 1L3VA 1U47A 2HHUA 1AROP 3DKDA 3R6GB 1S6QB 2GNKA 2MKJA 1U1QA 1S48A 3V81A 1HQUA 2RIJA 4RR5A 3UVJB 3NG8A 1UPMB 5IV3A 3HM9A 1PCAA 1HBMA 2J9EA 4PPZA 5DGBA 4LSZB 2F1FA 4K4YA 1W26A 2XWYA 3A3OB 2V8GA 5DGAA 3IG1B 3SCLE 1FF2A 1HWJA 4ZVQB 3K58A 3MM8A 2FUG9 3DLHA 3W2WA 3X1LB 3HLUA 4AL5A 2Y1JA 4CLPA 2AJ0A 4ZLNA 4FS2A 4KJIA 5M2RA 1CS4B 1JK9B 2K06A 1U1RA 2HGMA 4GKJF 1UCNA 3CO0P 5AT1B 4X62J 1EQMA 1S6QA 3KFWX 3CCLS 3RAQA 1T11A 4OYBA 4JI5J 5F9LA 3UWTA 4CRJA 4DV0J 1U4BA 1T03B 1KVJA 2WONB 1L5UA 2BACA 1KNZA 3C46A 3CULA 4UOFA 3EPGA 4A8FA 2MJNA 3H25A 1RJJA 2XMJA 4NMXA 2AU0A 1FJEB 2E1PA 5KT4A 3BBBA 2A3JA 1KD1T 3CD0A 1NK0A 1X5SA 2IC3B 3CGIA 2OPPB 3FCVA 4Q0BA 4O4GB 3AOBA 3KDNA 3MI7X 4G1PA 4J90A 3A8KA 4ZPBA 2C2ZB 3D1HA 4KE5A 1ROFA 4HDGA 2ZH1A 3JSMA 2XHCA 3MM5A 4C3KA 3MHYA 3BKUA 2MTLA 3JTOA 2B6AA 2MKSA 4JUZA 1LXNA 3GYNA 4QWAA 2GAHC 1IBMJ 4N41A 3M6XA 3THVA 1CG2A 4TXSA 1VRTB 1Y5IB 4P7TA 4DQSA 2G9OA 1OMSA 5J2PA 3EE3A 4I6YA 5IC4B 1CVJA 2Q6BA 4M5MA 1VRQC 2HLTA 1XMOJ 2RUSA 2ZZMA 2PO4A 3BF4A 3VAMA 4O3SA 2VODA 2F8EX 2XI2A 1RHMB 1RABB 1N32J 1H74A 1S1XA 1B0TA 2A2CA 2QX0A 3MCMA 4C3MA 4DR7F 3LP0B 1CJVA 2DGSA 2VBZA 2JDJA 4JI8F 3GG0A 5F9NA 2GX8A 5HROB 3EMTA 3N5FA 4E2FB 1KHWA 4Q0BB 1NSAA 3CDEA 3ET6A 1WDDA 1W25A 2QE5A 3MM7A 4KHMA 1R6YA 3UQSA 2O01C 2NXEA 4LIRA 3IAS9 4M1KA 2N3OA 4OZNA 4NA1A 4CH0S 2KM8B 1YKWA 3MMBA 1VC5A 1SC6A 5L39A 1AXQA 2DRDA 3W5XA 2OIHA 2AYMA 1VLOA 2BZ2A 1GXUA 2CADA 5BYRA 5C2GA 2HHHF 4B9MA 3CCQS 4RNHA 3W2VA 3VAIA 2KTQA 5A2QY 3GV5B 1UFKA 3IC1A 2YNIA 2OUGA 3IR7B 3VGTA 2XCAA 2JLGA 1V3SA 1BWEA 4GRSA 5A0YB 4M8LA 2KXNB 1AUDA 2DGUA 2POKA 4DPXA 1TKTB 1HW8A 1M0SA 2HQIA 2MZ1A 1MWYA 1SCJB 1ZM2A 2QG9B 3AQOA 4Y2MA 4YB7A 3CJ4A 4DV1J 4YR3A 3UD3P 1FK9A 4ECZA 3PX6A 4B9SA 1A6LA 2G0JA 4TU8A 5D78A 1Y3KA 1TK5A 2J0WA 2W25A 1RHQB 3CJTA 4K2XA 4KB7A 1HHSA 3T1HF 1S72S 3IBWA 2OTLS 1DFDA 2V8PA 2NQPA 1TL4A 2OD6A 3Q22A 1C1BB 5L9XA 1AB8A 2JVOA 4DR4J 4I56A 8RUCA 1IBKJ 4EBCA 4CNZA 1K47A 2GAGC 4DV4F 3AXMA 2H48B 4DN0A 3DI6B 3DLGB 2JL9A 1WC3A 3RRHA 2KG0A 4O44A 2GHPA 4DR6F 1KFDA 4LRBA 2Y9HA 2V8DA 4XDDA 2DY9A 2JOQA 3VVTA 4LBHA 1OS5A 2C3PA 4WXWA 3ULHA 3FRZA 4QWDA 1NJZA 4XPEA 4PXDA 4K4TA 2XZTB 2XLKA 4NI2A 3R9LA 4TN2A 5FDLB 3X3UA 1ZTWA 3LWLA 4M5NA 4R8UB 1B7YB 5HVFA 5AXNA 5KFJA 4J9PA 1U1KA 1SKWA 4KPYA 1GEHA 4FF4A 1SV5B 4K4SA 1SXLA 3SDEA 3ZNJ1 4USKA 2F5GA 4USWA 1WEZA 2XWXA 1V3RA 1NDPA 2NSBA 1JJHA 2FPHX 2YQ0A 1RK8A 2Q3PA 3HJFA 4CH1A 1VC0A 5D3GB 2XSJB 4C9DA 2JH3A 3PFOA 1XBWA 3MEGB 4GVBA 3IRXB 3NAHA 2PE8A 4QR1A 2X1GA 2AV5A 2CZ4A 1PYTA 1YGYA 3M32A 3QO9A 3KLHB 4PYDA 3CC7S 2Z2LA 1RTDB 2NZCA 2K8GA 1HQEA 2GIQA 2HFUA 5IWAF 2ASJA 1N5VA 1LFPA 2J5AA 3EGNA 3I31A 3TA0A 2ZOMA 3VV2B 3C6TA 4FF3A 2GW8A 2C2MB 3C16B 3G6XA 2YWGA 4L72B 1KLMA 1TELA 1HKAA 5CH7B 4HTJA 3TWZA 3HFKA 3D6HB 2NLWA 5KFQA 1FRXA 1OPZA 3JXOA 2XNRA 1KTVA 2XYHB 3W1YC 1Q53A 3K59A 3K5LA 2XMTA 3E8OA 1P27B 1YITS 1IN0A 1RBOB 4RKUC 1RAFB 4ID8A 5GVQA 3H5YA 3MAHA 3PYEA 1AZSA 6AT1B 3ENQA 3Q8PB 1TMJA 2MKHA 2RB7A 3R5JB 3TJAA 1ZM4A 3MTKA 4WCEQ 1EZZB 4LRCA 3OXGA 2E9ZA 3GV7B 4DWIA 2QL7B 2IMOA 4E8UA 4IDKA 2QRRA 3FNNA 3HD2A 2LEAA 1H98A 1T9VA 3MZIA 2EFNA 3QWPA 3BGRB 3AJ1A 2HFOA 3UN3A 1QSSA 3M8QA 4OIXA 1LQ9A 2E5LF 1MW7A 4JI6J 3OHAA 1RAAB 4G1QB 3OFGA 3GSIA 1PSDA 3DRRB 2JWNA 4Q2MA 1JJ2R 3UFCX 3P8BB 4J9SA 2GIFA 2X7IA 4DUZJ 2VA2A 2RF2B 4NX9A 2E9TA 3EM1A 3TAMB 4LUBA 2FHMA 1YBAA 4WP9A 4ZIVA 3CMAS 4LFBF 3HHLB 2ZWPA 4O0IA 4KC5A 1VLYA 5HSPA 1Q78A 5KG1A 4OHYA 1X7VA 2ZC3A 3HZGA 1VJWA 4DEZA 3OTOF 2HS0A 1L3KA 3D67A 3HI9A 2FJEB 3TAMA 1FFSB 2GVZA 5D4PA 5LMUJ 3T1YJ 2ASDA 1B3TA 1AFIA 4KV8B 2FVCA 2JFDA 1FEHA 1FWKA 1RTIA 1RA7A 2G2OA 2N7CA 2KZMA 3TZZA 2P8IA 4RW4B 1M1GA 3RRGA 1W7WA 2HHXA 4L75A 3JB9k 4RW8B 2VPZB 3K5OA 4WPAA 3RU0A 1UVIA 2APOA 1MROB 2GJIA 2JNJA 2UZAA 3C6UB 2ZBIA 2H4YB 5LT5A 4AL7A 2RE1A 3OR2B 1FEEA 4NRUA 4DPUA 1XNRJ 4KHPF 2HWHA 3ZZUA 4DI6A 3U1NA 4YQWA 4OHZA 4A47A 1WHXA 1WHVA 3HCXA 1H7XA 2M3DA 3UE2A 2I5JA 1KVKA 1F2GA 4B3SF 1ZYQA 3EICA 4DL4A 2DVIA 4H4MA 1HPZB 4C97A 2ADCA 3PNIA 4UQTA 4DSIA 4A4JA 4Y2AA 4B3TJ 1OY6A 2VG6A 2J7WA 2VG5B 4CIOA 4IH5A 1PC5A 3BQ1A 5F0UA 2D69A 2WB1D 2C2EA 3K8VA 4OJHA 2XO6A 1S77D 4K4VA 1U7LA 4FN5A 2HVDA 4YR0A 3M4XA 1CS4A 2JLEA 2F4VJ 3AQPA 1QVGR 4RW7A 3SQGA 4OV1A 5CYMB 2DIVA 2DY1A 1FWPA 1NSKL 5LMNF 4X66F 1RT6B 4GKKF 2HIYA 2HAIA 3D54A 3PVXA 4QU7A 3ISND 2FLOA 4CO3A 1RHJB 3LP1A 1OPIA 1JB0C 4I0WA 2V34A 5SUHA 4H4OA 5C5JA 5J2QA 1RLCL 2QGFB 5CAAA 1KC8T 4MK8A 2N4DA 4FS1A 1BHNA 1EB0A 3M9NB 3P3DA 3KJNB 2MY7A 3ETMA 4LFBJ 3F73A 5GADU 1XMQJ 2QO3A 2VQEJ 3OT9A 1RWMB 2E1MC 2AJFE 2IM3A 5K9FA 1MWZA 1P1TA 3MR7A 2DR8A 2DGWA 2ROEA 3QGHA 5DDOC 4LF4F 4BS2A 2KO1A 2KYXA 1TL3B 3KNAA 2YNGA 5LM7E 4OI1A 2V9KA 3R5BA 4C6AA 2D9OA 1SL1A 1U02A 4CWBA 5IS2A 4DV2J 1EKRA 3D5MA 3EDRB 3SIPB 2FJBB 3MOJB 1CC7A 3ITHA 4KR0B 2F40A 3GV8B 2DNHA 1X4DA 3I87A 4X84A 5KT2A 3PM9A 1QE1A 2HGLA 5ETSA 3ETOA 5DDQC 2ASYA 4USUA 4DL6A 1NAQA 5H1SV 2OGUA 3K5NA 4G3IA 3MPWA 4NZ7A 4OLPA 3TEHB 2QMWA 5BR8J 5E0OA 4OJ1A 1Y11A 5F3ZA 3KTQA 1HNWF 2B4PA 4KGVB 4ZPDA 4X4VA 2YQ1A 1T95A 2WBMA 3GWCA 4WFYA 1J5OA 3IG1A 3AOCA 3IR6B 5KT6A 1RT7B 4Q8EA 3MD3A 4DS4A 1HYSB 1EP4B 2RU3A 2BEFA 1CJUA 2C42A 2XMVA 1NZAA 3RYLA 3F56A 2YY3A 1MWQA 2FLPA 3WIUA 1RU1A 1N6QB 2HVHA 3MCOA 2XLIA 1KRPA 4R5PA 1K73T 4FPRA 3BQ0A 4OJ3A 1HFEL 4IUFA 2FHJA 3KWMA 2N3LA 1KWMA 4OX6A 3C14A 4CO2A 2AJQA 4WF9Q 4OZ2A 1UA0A 3HDSA 3VALA 1S49A 1WG5A 1VIOA 2AMCB 2YKMA 1KFSA 1VQPS 4DX7A 1XNRF 1UVJA 3TRGA 2ATCB 3H59A 2IPOB 1WI8A 1KQSR 2YBVA 2VOPA 5D0GA 3PJ9A 3MECA 3VAHA 4D3GA 2MXYA 2YNFB 2IVYA 2IRUA 2HNYA 2DJWA 1QTMA 1PJ5A 2VOOA 1HWIA 5T7LA 1I5OB 2FB0A 5L9NA 5E41A 4DDFA 4MYTA 4EGLA 4RNNA 1VQMS 1PKUA 2LEBA 1YWXA 2MEWA 2UUWA 1RKIA 2B9YA 3KK1B 1OSDA 5KFXA 3BS9A 2XC9A 3TJ9A 1B99A 2YQ3A 4B08A 5T7LB 7FDRA 5J1PA 1R8CA 3CO9A 2DNZA 1MMLA 2QSWA 4FDFA 1WORA 4HDHA 5L1JA 2XY7A 1TUVA 3U7JA 3OXLA 1SC4B 1NSPA 1WC6A 4OYAA 4P74A 3T5HA 1S10A 1KLNA 3DM2A 1SH3A 2C3YA 3CUNA 3PX4A 4UY8T 4OI6A 1VS3A 1R0BG 1KLMB 1YSJA 4TU9A 3PIOQ 5LMNJ 2KJWA 1U1OA 2V4JA 1TFYA 1Q5VA 1FK9B 2RRBA 4KGKA 4USVA 2VG5A 3LAMA 2JEIA 1LWFB 2RNEA 3CE8A 1X4AA 3AODA 3EZUA 2DHGA 3IGVA 3CCMS 2FVPA 1RBLA 4DFMA 3PJWA 1Q95G 2OPSA 2IYIA 4DSLA 4LF8J 3HHLC 3M32B 1Q1KA 1FESA 4QW9A 3QMQA 2UUBJ 4LFCJ 2VG6B 2H1YA 1IR2A 2Z0GA 1T03A 2J6TA 2M2BA 3NGRA 3W66A 1WKKA 4K4XA 3ZTQA 2HYIB 4X2BA 3MMAA 4ZP6A 2XO7A 3QT7A 1W2BR 1FHTA 4WFBQ 5E3CA 4M5DA 3DMJB 1V5IB 4QR2A 5KFHA 4RW8A 1LNQA 2I9SA 3G8QA 4DSJA 3H5SA 3HPOA 5G0RA 3Q8QB 3IP0A 2WVEA 3HHKA 2J8AA 4IO9Q 3QBCA 2NXUA 4MKBA 4DR5J 2HWTA 4TY8B 1D09B 2CKWA 5AXKA 4ZVHA 2WVCA 3HHEA 3MMJA 4TYAA 2L41A 2CZVC 3JTPA 2DR9A 3OR1A 5GAHU 4ANCA 1U45A 5AXMA 1E6YB 1Q79A 2XULA 4F50A 4X4UA 3B6BA 3NRBA 3ITHB 3G87A 1IQZA 1P9YA 3FEZA 3ZTRA 3TZYA 2AIRB 4USHA 5F3TA 5DG9A 5H9EK 1X4BA 1ZM3A 3NBPB 2D3UA 2M4MA 4P73A 1EIYB 4XO0A 2HQFA 4HVZA 4ETZA 3P96A 2AGOA 3FZ2A 3PFEA 2GMJA 3H7HB 1UVNA 2BV3A 3MMCB 2W8KA 5LJ3Y 4L74A 2Y1IA 2CPEA 3CC4S 5BXIA 3MM6A 1S6PA 1IR1A 5E33A 2NSCA 5K5MA 4OJGA 1NJWA 3RR7A 5A8RB 2HHVA 3DLEA 2BJDA 1TK8A 4BLGA 2MQMA 2WAQD 2BJ9A 5A2QU 2FJDB 2YKMB 3HFVA 3GMGA 2KM8C 4OYXA 2FGOA 4ECWA 1NHUA 3QYYA 2DHXA 3B78A 1S1UA 1HHQA 1JLBA 2FC9A 4IH7A 3RBXA 3DC2A 3I5CA 2AYEA 2GMHA 4ID5A 5B0GA 4JI5F 3CJQA 1UVKA 4JV2A 3DI6A 5F8HA 3ZZ0A 3TX8A 1LWCB 1S9EB 1R8PA 1SI9A 2MLZA 2WVFA 2EFQA 2K2PA 3AB2B 1PAUB 3JTNA 3OTBA 2GVDB 2VF3A 1O5JA 5IXUA 5M2PA 1EKSA 1VQOS 2C3OA 1FI4A 3BZQA 1XR6A 4OLOA 3ZTOA 3RB6A 4JI0J 1NPPA 3OR2A 2I8EA 2L48A 3QATA 4LSLA 3QT8A 5GAGU 2WK4A 3J81j 1HQEB 4RNMA 2NUUG 3CCWA 2HURA 2CWXA 1RT3A 5RUBA 2DT9A 3QO9B 1AW0A 2BM0A 1XERA 4IR9A 4I69A 1IJEB 2EK6A 3PCOB 4KT0C 1GAOA 1QY7A 1VOMA 3CJ2A 1XC9A 1WC5A 4I6AA 1QVFR 1U09A 2EBEA 2VFUA 3SSSA 3KJFB 2BM1A 3P49B 3GU0A 2QMXA 2C2DA 1SIWB 3KK1A 2PGCA 4ES2A 5A8KB 3V4IA 4X4PA 3SV4A 2HHSA 3EZOA 3BGLA 3MEGA 4DLGA 4XDCA 4ED8A 2EXUA 2Y1RI 2ZH8A 2DRAA 3T5JA 3UPFA 2BR0A 2ZH6A 1I51B 2VDHA 4RBUA 4YB5A 1VQ6S 1M5VC 1MROA 3HVWA 3MECB 5C42A 5KFDA 4WZQA 4GVLA 3CCTA 1NNDA 1SQEA 1SC1B 1V6HA 2B6AB 1DQAA 3I6PA 4NOHA 3JSRA 2GCFA 3D66A 3DHWC 4ZDNA 2X1BA 2RT3A 3HO1A 3T9ZA 1JXVA 2UV8A 2AD9A 1S9GB 1ZAVA 1FRKA 3AB4B 3F41A 5E2QA 1Q8LA 5B08A 5M2UA 4CH7A 1UWBB 4FYXB 5A8KA 3T1YF 2B4UA 2PC6A 1TAUA 5K8OA 2FQQB 8AT1B 2HS3A 4DFPA 4EO8A 2V69A 2W4PA 3PW0A 2UUCF 4Z2XA 4Y2CA 4E98A 3LANA 2IRYA 2GO8A 4DOZA 4F0HA 5GADI 4I7FA 4ZP9A 2W2NP 1VJQA 4X66J 1T8EA 1CC8A 2RUGA 5HQMA 2ALZA 2H65B 4NLVA 4DCOB 4CO0A 1JKHB 1MU2B 4Y2KA 2CJ9A 4L76A 1T9XA 1HNXF 4B3MJ 4YN3B 4RW9B 1HQ2A 2MZRA 1N5YA 4ED3A 3C15B 5A0YA 2JLFA 5U47A 2XYPB 1VR6A 3VAGA 2YNIB 1SIZA 2B51A 3ILOA 2WSCC 3QGGA 3ZZRA 3OL8A 4I68A 1TKTA 3PIPQ 2CZ9A 2I0XA 2DNQA 2VV5A 1S1UB 2AHOB 3LPYA 2JFKA 4B9LA 2AGPA 4RNFA 1WC0A 3W63A 4DV6J 1RYRA 2VBXA 1RAOA 4M5IA 1X4EA 3HD1A 1DLOA 4YUDA 1EJ7L 4IQMA 3H4BA 2DGOA 3K17A 3M9MB 3FBFA 4DR5F 2C28A 3R2DJ 3DXSX 1BQMA 2L08A 5D6GA 4QR0A 4KFBB 2HNZA 2VPWB 4U6PA 4LR8A 1S0VA 2PI4A 2G1HA 3L7OA 1F0XA 1YDLA 1IKVA 3ENVA 2DISA 1U1LA 1DARA 2JC1A 3UCGA 2I1RA 2KFZA 1HQUB 2XSJA 3R5GA 4QIEA 1M5KC 1MG7A 3BDPA 4FF2A 2V2KA 3EXCX 2IM2A 1URRA 3OR1B 4IYQA 2K7JA 4NCGA 1HWUA 3TP2A 2R8HA 2IHR1 3DLGA 1X0PA 2VG7A 2EK1A 2ZBQA 2NYHA 3O6QA 1YJWS 3DGPB 1VGYA 1X9SA 4LREA 3GSDA 1JLEA 2ZD1A 1FD8A 4OHWA 4QJVA 4FPIA 2UV8G 1FJGJ 3V6HA 1FDBA 3M8ZA 5KAKA 3M05A 3G8TA 3ZZYA 2HHWA 4J9RA 1CJTA 4PG4A 3EVMA 5KT7A 1Y00A 3BM7A 2LA4A 3W64A 1PBAA 2W24A 3MR3A 4C8LA 3CD5A 5IT9Y 4KFBA 1AFJA 2W9CA 4JI1J 5D15A 4J9MA 1KBRA 3TVKA 4QYRA 2V2ZA 4FKYA 4NLXA 2WVBA 3L7PA 4O3RA 4YY3F 3EVOA 4M95A 1FTRA 1H7WA 2GGPB 4AUKA 3NGDA 1FKAF 1JLAA 2PFFB 2JX2A 3PHTA 4JI4J 3HZEA 5GAEU 4NCBA 2C3MA 2DBBA 3OXFA 4CP5A 4USMA 5DQGA 1H2UX 2PDAA 4Q43A 2UXCF 1RCOB 2OPRA 1PYSB 2CQGA 1D9DA 3QIDA 2D41A 3DN9A 3FBCA 1TMMA 4UOCA 2HHHJ 2R8GA 5DG8A 2BKOA 1RWNB 5EWGA 5I3QA 1FNMA 2V4JB 1J5OB 2VL1A 2B43A 3D68A 3QWUA 3CCJS 3ZZTA 2ZDOA 2V2VA 4H54A 4ZVPB 1QAJA 2R9LA 2EKYA 3M1VB 2FTRA 4LVNP 2WHOA 3O3LA 3LWMA 1I1GA 2ZH4A 1FA0A 4N47A 2UUAJ 1BD6A 2M88A 1F3FA 2IJRA 4DV6F 1K1QA 1EAYC 4DL3A 1S4FA 2UP1A 2ZH3A 1U2CA 4U7UK 1NSQA 3CMES 4Y00A 2DH8A 2KDOA 3ILIA 2YPZA 1X0FA 1Q86T 3PTWA 4O0NA 3VCDA 3PZPA 3FMBA 1DJ0A 1RDRA 3FBBA 1WHWA 2CWKA 3LH2S 3D7SB 4LT6A 4J9OA 3R1HA 1P8GA 2CQCA 4RUHA 4CLFA 3OLBA 3GR0A 4NA2A 4LF5F 3GR1A 4CLSA 3RW6A 1BLUA 4ED6A 3CJ8A 3DU6A 1FWLA 4DQIA 4HH0A 4AYBD 3HVAA 3NCQA 2ZNZA 3QNWB 3TNVA 2OMOA 3IS9A 2FJAB 3J7YI 2ZM6F 3SSRA 4ECTA 4F4XA 3WC2A 4QBUA 4FXWA 1WSRA 4IG3A 2LP4A 3UW1A 5KFPA 3LP0A 1CJVB 2RKIB 2PEHA 2C2RA 1NKCA 2BE2B 2FC8A 3KK3B 1XNQF 2X1FA 3IWNC 1KN6A 4DPTA 3PJXA 3RR8A 4NXMJ 3TQEA 2MSSA 3BSAA 1S12A 2IDLA 1GFWB 2ADBA 3QLHA 3DLKA 1LFWA 3ZZZA 2RH3A 3OTOJ 2VONA 4Q5VA 2DEJA 1N5QA 4BDPA 2XMKA 5KFGA 1N34F 1FRJA 3ZTPA 3W9HA 1X4FA 1B0PA 1VMBA 2C1EB 2XMWA 3RBZA 4AXIA 2ZBPA 3CCZA 1J5EF 2HBRB 3MM5B 1CULB 2B5JA 1HLWA 3D0HE 4DSKA 4ICLB 3T19A 2B8QA 2P5VA 3BKFA 4N8NA 3US5A 5KFOA 2G13A 3M2UA 5KFCA 4F3OA 2BW7A 5KTQA 4FVCA 4LF7F 3CJKA 4BWMA 3ZZPA 2DR7A 4B9UA 4IQXA 3PRVA 3F0NA 4RUCA 2HRTA 2ZWOA 1IBCB 4DR1J 4ECSA 1S5ZA 2F8HA 4ZN3A 4F4YA 2BJ7A 3M30B 2Y8WA 2K1RA 1ACMB 3MF5A 2YKOA 3DRXA 2CJQA 4J9NA 4JYAF 5KOWA 4ZS6A 5C2CA 1RWUA 2CYYA 3CMQA 3KLIA 2JEFA 1K0VA 1YJNS 2LU1A 4IOBA 4IKAA 3NLCA 3IO1A 5JXSA 4K5SA 3QFWA 4F67A 5KFVA 1IBLJ 3K57A 1S1WA 3HX9A 3Q86A 4K4WA 3TOQA 4V19J 3NNCA 4KPCA 4N77A 1NLKL 3MWBA 2W8LA 1N5SA 1FJ7A 3WIVA 1IUJA 2RQMA 3MCNA 4YY3J 4C8ZA 3B4DA 1FFWB 2UVVA 3CD6S 3OTCA 2CPJA 1MU2A 1NKBA 1XMBA 2BXJA 3BEGB 5FDLA 4WIIA 2KVQE 5SZTA 3FKBA 2HAFA 3KKFA 3MM6B 2NYIA 1NPRA 1TUGB 1R8BA 4I6WA 4MYUA 5DM7Q 2EC0A 4R25A 1MN9A 3DYAB 3ZTSA 1XMOF 1DTTB 4EZ9A 4NCGB 1RWXB 5B09A 1S76D 3LP1B 1FRMA 3SCJE 1LK7A 5DETA 4ZVTB 5A76A 2MJUA 5HQLA 5H9EJ 5GMEA 1AA1B 2R7WA 2J9CA 1HI0P 3TUIC 4ES3A 1RT6A 5GAHI 1GQEA 4LR9A 3AT1B 1D3WA 1RACB 4JV1A 1G2EA 5HANA 4J9KA 3OPKA 1DTQA 1VIXA 5L8RC 4LF4J 2HNZB 1LKZA 2UUAF 3CIZA 4F2SA 3E2EA 5T14A 2L9WA 1RTJB 1J5EJ 4WYWA 2E1RA 3THPA 4U95A 1KQFB 4CM2A 4ZPWR 4JI8J 4PQUB 4ZP7A 3NNHA 2CDRB 1HNVA 2LQ9A 3UCZP 3FMWA 1AZSB 3QQCD 3D6FB 5K8MA 4C11A 1XN9A 1D9FA 2Q66A 2WTFA 4A8KA 2R2RA 3QRPA 4HACA 4MK9A 4XIUA 1JLQB 3RB0A 2W7OA 1U6ZA 1RT7A 2UXDJ 3BSCA 2XGPA 2FY1A 1TV6B 2WW8A 3EJMA 3DNCA 4RBVA 4WYLA 3SCKE 2UXBF 1TKXB 4RW9A 3TW0A 1Z1ZA 2A18A 4RWWA 2DO4A 4ED4A 1PJ7A 1FD2A 4OX9J 1Y9OA 2LQBA 3P5BP 2PA3A 1J2VA 3D3CJ 3KLFA 1Y0HA 1WHYA 4RWXA 3LGNA 4WIQA 3UD5A 4C2MA 1YIJS 1RT3B 4ICLA 3M1VA 4WWSA 4MMOA 2LA6A 3L95X 3EGZA 5F8IA 4I7FB 1YJUA 2KB2A 1UL3A 1RAHB 3SV3A 2GS8A 3CJ3A 3LO3A 1VQKS 3OTDA 3FC9A 1FE0A 4IFYA 3KLEA 2P6SA 4WBFA 4A8XA 2IDEA 4UZCA 4C11B 4KBIA 2AYGA 1WD6A 2Y8YA 1JWWA 4OHVA 1YBTA 4ID5B 4WP3A 3W5YA 4YOEA 3T5LA 1PIEA 2IVMA 2VB6A 5HATA 5KT3A 4DL5A 2E29A 3RGIA 1PO6A 2YVSA 4N76A 2DXDA 2R3VA 5D8HB 2HMIA 5DJBA 2YWHA 2BRKA 3JSMB 2HLUA 4K59A 4NLQA 4UOGA 1FTCA 4J9LA 1FKPA 2EFPA 2FVQA 4BWJA 4ZVFA 4K0KJ 4ZLJA 3PW2A 1KTQA 4FBTA 1Q82T 2EG2A 4TLRA 4A48A 3HF5A 4DFKA 2M0GB 4HL9A 2XNQA 2B4VA 4DJBA 2VD3A 2XEXA 4FNHA 2PSZA 4OYWA 1VQLS 2C3UA 1LW0B 2YKNA 1U8SA 2OMLA 1C4AA 4QW8A 3MPVA 4OI3A 2CQ1A 4IOCQ 5HMZA 2OD4A 3WX8A 4EFAC 5FLXU 3FEYB 2MZSA 1Q7LB 2VPYB 3U1LA 4EBDA 4NL5A 1GMUA 2HFNA 3B4MA 3GLJA 4HHUA 3ILLA 1JLGB 1U26A 4PQAA 4WFZA 4CLUA 5LOQA 3CJ0A 1NDCA 4JI6F 2XZWA 5F8LA 3T3FA 2DGQA 4I67A 3MAAA 3QZ8A 5AJ3J 2NXNA 3MUMP 3FGVA 3OL7A 4E0DA 1QJHA 1U1MA 1IM6A 3KG0A 1DLOB 3PRDA 5CZVA 3CJKB 3FBEA 1XMQF 3ICLA 2IJNA 1NK5A 3HULA 1GX6A 2HK2A 4FYVB 1LV5A 2VQFJ 8ATCB 2M8HA 2ZDPA 5ETTA 2KJVA 1C0UA 1VQ9S 2QLXA 4K0KF 4TQSA 1LW2A 3L3CA 3NGTA 2VJUA 4DU8A 1UA1A 4PQUA 2I2YA 1X5TA 4LF6F 1CJKB 3R8YA 4CDIA 4ZOSA 1SL0A 2EPIA 2MLYA 2P9CA 2IAJB 4P71A 2VHGA 3TAQA 1G1XA 1EX8A 4WK1A 1ZPWX 4KHRA 2R7RA 2MZQA 1PILA 4GO5X 4MKVA 3VAKA 4A8SA 3DRPB 4JI1F 2XMMA 4GC6A 1BE4A 1WTFA 5A8RA 5KG2A 2VJVA 2BE9B 4DQPA 2HQGA 2YNGB 2A2DA 2RQ4A 3PO4A 1H73A 4I2QB 5HQ8A 1JX4A 4RUBA 3VZIA 4MTPA 4DPOA 2RQCA 2OH2A 1RT2B 4OX7A 3JQKA 3W62A 3FSIA 1FVQA 1U6BA 5CQGA 1NCLA 3GJRB 1FX4A 1R7IA 1FFGB 2EBGA 3A8IA 3DRYA 4TYBA 1RAJA 3CT9A 4ZPVR 1M1KT 4I64A 4B3TF 1NUEA 2MZJA 4B3OA 3PW7A 1U1NA 2F9JA 1WKJA 2YWFA 5EDWA 2DK2A 2YX4A 2A6OA 1VRTA 2BDPA 4ZK7M 3J80U 2QA2A 4K4ZA 3I9ZA 2HHQA 3GZ7A 4DL7A 4IRKA 3KJVA 1U1PA 3CW2C 1D1UA 1LK5A 4X4OA 1IWAA 1ZAXA 4CZCA 2V8HA 3GIRA 1QDUB 1U25A 3KHHA 3RTVA 3SEOA 2FY8A 4W92B 3M2RB 4ZCMA 3SI8A 2FJXA 3MTJA 1DURA 5KT5A 3KLGB 3KUEA 5EWFA 1UJ6A 1UTAA 3U02A 4WTYA 5EHHA 2W7AA 3G4SS 1R89A 3K5MA 2D74B 3MGJA 1YJRA 1TK0A 3GFZA 2KHDA 1BC6A 3SXLA 5JMNA 4ANDA 1VBZA 4M5HA 3BQ2A 3MEDA 4J9VA 3VF0B 4OYIA 4GKJJ 3BR9A 3M8WA 3IAM9 1NBEB 3Q8SB 2QLFB 2XCPA 1WG1A 2KRRA 1N6QA 1RA6A 1S7HA 4LFCF 3PYDA 1DHMA 1BQNB 2KXHA 2PI5A 2OSQA 1CJUB 4DR3J 3L09A 1RYSA 2CNKB 2QSFA 4PUOB 4YB6A 5HROA 1IJFB 3MM8B 1U2FA 5F8GA 3TUPA 3SQOP 1HNZF 1XIQA 3QIPB 2M7SA 2QL9B 2XLJA 1WEXA 1YRUA 5IT0A 2DIUA 4OYZA 5IT9U 3EXYA 2ZKUA 2XBPA 1N48A 2E5JA 4PYAA 3UVJA 4AXJA 4EO6A 2CQDA 4CLTA 5KG7A 5KFKA 2O1PA 3V81B 1WJ9A 2ZVIA 2MHEA 3PEHA 5J2NA 2MQ8A 2IYGA 3FCHA 2GQQA 3TR5A 4FYWB 3QPIA 3W9JA 4DG1A 1HBUB 2ZNYA 3KNGA 2B9EA 3Q23A 3CWJA 3RW7A 4F4WA 1RGVA 4LF1A 2RDJA 1MMNA 1O6XA 1YJ7A 4ED0A 3H2VE 4DPWA 1NK4A 3KK3A 2CQ2A 4Z37A 1P1LA 2W01A 1M5OC 2DNYA 3QRQA 4U96A 2XI3A 3N28A 4ZMMA 1IBKF 2HZVA 4DF4A 1TL7B 2BVZA 2D9PA 3OJUA 3R2CJ 3IS9B 5BR8F 1NM2A 2OJ3A 1ZPVA 3GJTB 4O4RA 4ES1A 2FYXA 1SC3B 2RHQB 3LAKA 1SJRA 2RILA 4ZVSB 4OYOA 5HMWA 3Q2TC 1N32F 3HHDA 1HIYA 1B4SA 2QV6A 3TUZC 1H38A 1WTBA 2QLJB 2CPHA 3H20A 4C48A 4WFAQ 2W4CA 4NLOA 1EQ0A 1UJ5A 4FXDA 1YRXA 4XAKA 5DQIA 2W9AA 1C0UB 4W90B 5J2NB 2DO0A 3DFEA 3E01A 3NEKA 2AX1A 4X65J 2PMWA 2DNMA 3FVYA 3IM9A 2GHWA 1NJXA 3D2WA 3QJLA 1S4EA 2F4FA 5KG3A 2PIIA 5DZ7A 2AJ1A 1IKVB 4XK8C 3LA0A 3PG9A 2RRAA 1VQNS 1WI6A 2CJBA 6FD1A 4NXNJ 3BGUA 4ZHRB 2BMBA 3M2VA 4OZ3A 2MQOA 4P9SA 1GXLA 1N36F 1N5YB 1VHIA 1BQMB 1UW4A 4J7CA 2CQ3A 3LGMA 3BPSP 2XQCA 4RNOA 1QLNA 4U67Q 4OZ0A 3VZHA 2M9KA 1I3OB 2NXCA 1CULA 3M8PA 3R97A 2CJAA 4KTQA 1KHVA 2LKZA 2VKZG 2Y0BB 3FJ2A 5CCLA 2M70A 4F3MA 4R0JA 3VAJA 1GX5A 2J76E 1GMWD 3BSNA 3F44A 4MFBB 2HGNA 3MUTP 2IBOA 4LRDA 2K1RB 4DX8H 3DOMB 4QCLA 1HNVB 4MKAA 1UEKA 2HBYB 2DR6A 3ZXWA 1S1VB 2A0FB 2DHAA 3IM8A 1FO1A 2F7VA 3BO2A 4YDDB 2QEXS 4RJVA 4ER8A 1S6PB 2CQHA 2G2ZA 3H0PA 2ZEJA 3QT5A 5D0RA 5LJ5Y 2XGQA 2CPFA 3MFHA 1G7CB 4R8UA 1N88A 2AQ4A 5LL6d 4DV5J 2LQ8A 3VHQA 4ALZA 1HW9A 2LXFA 3WX4A 1BUXA 5B0BA 1SPBP 5KG5A 4LMZA 1O8BA 3LP2B 1RISA 3AJDA 3HP6A 4DN9A 3CCRS 4X4RA 2R2TA 2Y1LB 3FFIB 1PAEX 4ANEA 1D8YA 4NE9C 4DCJB 3S7RA 5DLFA 2MKIA 4ZJQA 2MQQA 2J9DE 4WFNQ 4JI3J 3PEJA 3DOLA 4LQ9A 3DYAA 4I2PA 5C25B 1X5PA 1Q8IA 2ROPA 3NOCA 4ENOA 4G65A 4IG3B 3SFGA 3V4MA 4F36A 2WRMA 2ACMA 1PG5B 3G2XA 1BGXT 3LF0A 3LW5C 1X60A 2YTCA 5ETKA 2X51A 4YDXA 1MN7A 2KI2A 3LALA 1R0AA 4LVOP 5D0HA 2V50A 3M8QB 2A1BA 4ZITA 1TKXA 1SVDA 3CB4A 1BY9A 5L1KA 2IMWP 3NL0A 2CVIA 1HBOB 2LQJA 1BXNA 4WKRA 3MEDB 4B9VA 1Y3JA 4U8YA 1RWOB 3VGVA 1R27B 4U8VA 2UVUA 4NPOA 2M5YA 3FSYA 2MY8A 3J7Z5 3HXMA 4C8YA 5GMDA 1XR5A 1LWCA 2Z4PA 4ZCIA 3W5ZA 4A8WA 2E9RX 3W9IA 4RU2A 1I94J 1GH8A 1HA1A 5KG0A 2E5HA 2OELA 4V1Ak 5DRKA 2DXFA 5F0WA 1CLFA 1IBMF 5HAOA 1JLBB 3J81U 1RI7A 2HNDB 3W2WB 4CTAA 1JIHA 3S01A 1RTJA 3J7AN 4DMZA 2GMLA 2HHTA 1VHFA 3G71S 4UY85 3N6NA 4ZJOA 4NLYA 3WHIA 2Q6CA 4EYHB 1VK8A 1YJ9S 4ZJLA 3S6EA 1RT5A 2VBYA 1RB0A 4M5LA 4IH6A 5BYSA 1C0TB 2J6SA 2MMYA 3B8HA 1EETB 1IVZA 1RTDA 1VFJA 3OQ2A 1U2RA 5LSRA 3NWGA 4XTTA 1IM4A 4B3OB 5HJYA 4ECVA 4O3OA 1U0HB 5LMUF 3UCUP 1GTEA 3O5TB 4K5RA 4OI4A 1TFWA 1U0SA 5CA5A 3ADAC 1S99A 3NGKA 4QWEA 4X62F 3HHLA 5L1LA 1ITPA 2DNGA 5J1EA 3I0SB 2MQNA 2ZH7A 1IWGA 5DZ6A 1MSWD 3Q89A 4FBUA 3C8YA 3W3SA 4KH1B 2F8MA 3DDIA 4RU9A 2DPJA 5A6WA 4DCPB 4OMFG 1RP5A 3FDSA 4CT9A 1BMQB 4PXCA 4TVAB 4TY8A 3A13A 2W2QP 5EX3A 2QN6B 3CCUS 4KY3A 2HZAA 1T3NA 2R7UA 1N8RT 1V3ZA 4F02A 3I0RA 5D4LA 1M5PC 3R7BB 3UD4P 2O67A 4TY9A 4ZIWA 1NRKA 4QIVA 1CQNA 2X1AA 3BR8A 4X65F 2UVWA 3ZC4A 1L3UA 1C2PA 4CLWA 3KLEB 2Q79A 1NEEA 1EHWA 3V6DA 4A8YA 1WOPA 1N34J 4IO1A 3T1AA 1T7PA 3QSIA 5DO2A 2HIQA 1XR7A 3UDCA 2OI2A 3C15A 3PW4A 2O5DA 5FD1A 5ADZA 2DNLA 1RCXB 1V5VA 2QYCA 3HSGA 3BYPA 4GC7A 3I96A 2V4QA 2ATLA 4KSEB 1KVIA 5D4NA 4F8RA 4LRAA 3ZNUA 4F25A 4RW6A 4CYUB 1UETA 5CYQB 4CO4A 3QJPA 1NJYA 3PW5A 3JQMA 4ZPAA 2BA9A 5KFYA 4ZVRB 2R8JA 2D3ZA 2C22A 3EYZA 2W1BA 1FERA 1FRLA 3ISNC 3AA8A 1LXJA 1HBNA 1HWKA 4P75A 4DL0C 1VQSA 4BBYA 4C0HA 1F5BA 1REGX 2DTJA 3R5AA 2CQPA 4FZVA 3QFHA 2MHNA 4O3NA 2N82B 3BGOP 4QWCA 1C4CA 1H2VZ 4NLSA 3CXCR 1O0PA 3CCES 4C3LA 5JVHQ 3V6DB 1NKEA 1N52B 2ZE2A 1OY9A 1HPZA 2VZ9A 4OV6A 4RL1A 3UNYA 5DM6Q 4YHHJ 4UZBA 5L1IA 2UU9J 4EWTA 1S79A 5D3GA 1W2IA 4ELVA 3HK2A 4P2SA 4DV2F 1LWFA 1S7IA 1D8ZA 3TX0A 4KAIA 5DDPC 2PEBA 4QPXA 5IQ6A 2ZUAA 4C4WA 1YG0A 4LBIA 5K14A 4CT8A 5H9FK 1FKPB 2W9CB 2FLLA 2AF6A 2AX0A 2XS7A 4ED5A 3DLLQ 3Q8RB 4K8RA 4NYOA 3MUVP 1CJTB 2RMLA 4KYZA 1R0AB 1SJFA 3OFEA 5HVGA 4ELUA 2KL8A 3DOKA 2ZZTA 3CDBA 5HMYA 2MGZB 4JI7J 2LMIA 3BKTA 4HR2A 3ILJA 1JLEB 2ZD1B 1GK8A 4DU7A 4FYYB 2DKOB 1JLFB 2BANB 3H98A 1S59A 2OO4A 2MSTA 1Z2ZA 2R8IA 3DOLB 1E6YA 3AD7C 5KFUA 3DDNA 4KKOA 1RQ0A 2HK3A 3DHXA 3NKYA 3UR0A 2J0QD 4O44B 3SZ2A 4QYZJ 3TZWA 3TZXA 2CJXB 3G6YA 3CSKA 1KDNA 1ULRA 1ZOTA 4FYDA 4MIWA 3JYTA 2EW9A 4LFAJ 4NLUA 2V5HG 1F2HA 4BC9A 1TL1B 2OPQA 1ZBTA 3I82A 2AKWB 1VK3A 1WKLA 5EX0A 5DS7A 5KG6A 5F8MA 1F5CA 4AFFA 5KFMA 1IR0A 4U7CA 1VRUB 1SKUB 3M8YA 1MLAA 3TUJC 3DU5A 4J91A 4K2JA 3C14B 2NPFA 2ZJPQ 2OTJS 4HEA9 3A12A 5LXRA 3RJMB 1N4LA 1BQNA 2PFDA 3G82A 1QAXA 1S9EA 2BJEA 5K8PA 3GB0A 4HKQA 1T3OA 2WCXA 3A3NB 3P45B 1JQGA 4USTA 1QE1B 4XPCA 2R8KA 4O3QA 2M52A 5IM0B 1RAEB 3TQ1A 4ZCLA 1FDNA 2BJ3A 2RDDA 5C7PA 1NK6A 1U8WA 3CDAA 3IXQA 3KYLA 1RAGB 2E66A 2LEPA 2NUHA 1XEZA 2KXFA 3I55S 3DCAA 3EPIA 1SJ3P 4FF1A 2G4BA 1CEZA 3MOZA 2B8PA 1VCTA 3JAMY 2DYAA 2KN4A 3D1QA 5CD4H 2NPIA 3FUYA 4F04B 4LSLB 1JKHA 1RTZA 2BUNA 3GIMA 1IKWA 2VPXB 4OX9F 2IA6A 4RW4A 2W4DA 1FT8A 9ATCB 4OQJA 3IR5B 1HI1A 1H6KX 3IFEA 1J27A 2XSFA 5HK4A 2H9ZA 2ACYA 2FZCB 2FZKB 4OYPA 4HHHA 4ZHRA 3M2VB 4URGA 2UXDF 4LRFA 2K3KA 5ITHA 4YHHF 1WC1A 4N5SA 1OWXA 5KFIA 3TO8A 5E5NA 4ED7A 1VQ4S 3NAIA 3PHEA 5JVGQ 4I4BA 2ZZNA 3OUYA 1L3TA 3TA2A 2BABA 4RBTA 5AE2A 4EMDA 3J7A1 3QLHB 4PWDA 2HWIA 4QIGA 2LLZA 4J9QA 2YNFA 1UWBA 2BBEA 2M8DB 2IM1A 3VQSA 2RVJA 3GP9A 4OZ1A 3VWSA 3TAPA 2YWEA 4MAKA 2FD2A 1TTHB 1UMJA 2PMHA 1KOOA 4I2QA 1YVFA 1Q0NA 1AYEA 2RDIA 3HKZD 3R6LB 3NOGA 4HT7A 3U1MA 1N36J 2WSFC 4PABA 2CNLB 3WQPA 2AYBA 2MQLA 2H54B 2YWWA 2V63A 1KEKA 4PWUA 4DV7J 4EYIB 5C42B 1HR0F 3OL9A 2IC3A 2QA4G 1TL7A 2OHDA 4F3QA 3N9UC 2SXLA 4X4QA 7AT1B 4R5PB 5J1EB 3EWGA 3GPAA 4H4KC 3V5RA 3OUYB 3DXBA 2DNKA 2I38A 2ILYA 3NMAA 4HI2A 1PYOB 1L3SA 1VYAA 2Z2MA 4X64F 3K0JA 1RAIB 1WF1A 2EEYA 3M30A 5I3PA 4WTOB 1S1TA 1CBKA 1NU4A 2F9DA 2DNOA 1WF2A 2KU7A 3C16A 3DLJA 4O3PA 1HYSA 1SBRA 3QT6A 2AJ4A 3NY0A 4P10A 4O23A 4ATNA 4RW6B 3CJSA 4CYUA 1RT4A 2R7SA 1SH0A 1WWHA 4RW7B 1T02A 2AZ1A 3DMJA 2J0XA 1YBUA 2G1DA 2LDYA 2QFIA 3N6LA 3OVAA 3O2IA 3S8SA 3CCSS 3O8WA 1TVRB 3CVKA 3ENWA 4MJKA 4DR7J 4RX6A 2MQPA 3AD9C 3R27A 4KGMA 2D1CA 1VI7A 4GMKA 1RWWB 3H2LA 2MDAA 3AH6A 1XK8A 3AOAA 4B9TA 3BN7A 2ZHOA 3HJVA 4DPYA 2H5JB 2C2NA 4JI3F 2WOMA 1JLCA 3HHNB 4I1TA 4DV3F 4B3RF 4J37A 4F4AA 1JMTA 2BQUA 3TYTA 1U48A 1K44A 1RZMA 2ROGA 1ZM9A 3HMJG 3BPDA 4C8KA 2J7UA 3I4PA 1FCAA 2CDQA 2CNNB 1T94A 3TVZA 2IRXA 3CDWA 3W8GA 3KLGA 3DRRA 2LYVA 3GYGA 3A8JA 3EX7B 2ZOGA 3GG1A 2MKKA 2OPQB 2IFXA 1QSYA 2GHVC 4EI2A 3ET6B 3MM7B 2KFNA 1TU0B 4PXEA 3BV8A 3TANA 1F6TA 2K3IA 2EFOA 2ZFHA 3C19A 3JYTB 1GXTA 2LQ5A 3D28A 3OLAA 2P2CB 2OLWA 3THTA 4JV5J 5J2QB 1TZ0A 4DF8A 2P9EA 2CQ0A 2PMZD 5I3UA 1RLDA 1TKZA 2XZDB 1DQ8A 1FDDA 2E1CA 2X3DA 1JLCB 1JLFA 2BANA 4BHQA 1F3VA 2ABYA 4X4SA 1KR4A 4DV0F 1Q81T 2XB2D 2JEJA 1UPPA 4ZP8A 3QSYB 2C2OB 2E7VA 4PEOA 3I56S 1NDKA 2VKRA 4NCAA 3N6MA 4JI2F 4ECXA 2AJ2A 1R0CB 4ZLLA 2Y0SD 1NHVA 4YFUA 2NXJA 1VBKA 2GC8A 2YWKA 3IBCB 3PDNA 2GZOA 1X31C 4P52A 4QIWD 2LXIA 1SKRA 2XMUA 2DGVA 4DR1F 1WC4A 1S6OA 5KFFA 2HNDA 4CTAB 1O51A 1HWLA 1QM9A 2JEGA 2XTJP 1NH7A 3DRPA 4IFVA 4F0KA 1AUSL 4Z7CA 4N56A 4UT4A 2OPRB 4WE1B 1JNZB 5J1NA 2UUTA 2U1AA 5KFZA 2ASLA 1YLXA 4ERDA 4ZVOB 2IM0A 4USIA 4MFBA 3Q0AA 2RAQA 2PN6A 4DXLA 5IM0A 1N56A 1OY8A 5KFEA 2RHSB 5HN0A 3D6MB 1LW2B 2GA7A 1RWVB 2WBRA 3BGFA 4B3MF 4MK7A 2CG8A 4QQBA 4IR1A 1ZA1B 5B7WA 4DS5A 1SL2A 3DLEB 1TL1A 5KFRA 1F9HA 3M8SA 3MM9B 4DQRA 3MDFA 1G3OA 2CQIA 2ZBCA 3BH6B 4PG5A 3QGIA 2BOAA 4WK3A 4NRTA 1S1TB 2ZJRQ 1IKYB 3KG1A 2UVRA 5F8JA 1DBDA 4NEZA 3DM2B 3DRSB 2HVEA 3WC0A 5L46A 3ENAA 4X4NA 1S1XB 2KVIA 3RRKA 1M1HA 4DBQA 5HL7Q 2D7SA 3R5CA 4ECUA 3W65A 2B0GA 4KKOB 4USJC 3I4HX 3ZFVA 2EFGA 4PWDB 3RBDA 1F5AA 4M5JA 3C66A 3HT0A 3E01B 3PR5B 4Y6IA 1RADB 4HI1A 3OTEA 1FE4A 1PC4A 1VBYA 2HKEA 3VR1A 2HSEB 3JQJA 4JV5F 1K1SA 3KMQA 4NLPA 4G1QA 2VIHA 1ELOA 2R7XA 2ZUGA 4FNIA 2R2UA 1HNXJ 2DHSA 2F3JA 4KGXB 3RUBL 2CPIA 1C0TA 2ZOFA 3LPEA 4DV7F 3CIMA 2QZ8A 2AW0A 3NXZA 2OPPA 1JJCB 4BC7A 2ZHBA 5FJ4A 2YX1A 1UEUA 2VASA 2QC3A 2B7BB 3MMAB 2E1AA 3ZO7A 3KUGA 5HO4A 3MR6A 1RKJA 1NB7A 5T41A 2JHEA 3UDEA 5AE1A 1T9WA 4Z7YA 4F4KA 5HJXA 4DV3J 1RTHA 3CTRA 1TR0A 3GFHA 4YB1P 3CPWR 1GMVA 4NLGA 1WOOA 4AE5A 5D77A 3SBMA 3VVUA 1PJ6A 2QL5B 4K50A 2ZE2B 4DR6J 3M8PB 4URSA 3U27A 4JV0A 3OL6A 1NPKA 4JP8A 4PKDB 3KLIB 2RU9A 5IOLA 1V9OA 4FXVA 1IKWB 1R8AA 4CM0A 4ED2A 1TVRA 2F63A 1ZZNA 3H4DA 2PA8D 3CJRA 1ZZFA 5CYQA 3KK2A 2CPZA 4QU6A 1N0VC 2FGCA 2QYGA 4Q2LA 4C8NA 3CJ5A 1NXIA 4NLRA 2GIRA 1YHQS 1JLGA 1BQXA 3TJ8A 3UN2A 2P6TA 2CQ4A 4TLQA 2BKNA 2Z8QA 4PWWA 5LSLA 1JXEA 1M5HA 1K0TA 1HNIB 1TKZB 5B0CA 3D9BA 2RD5C 3MXHP 1WEYA 3N4WA 3PRBA 2XY5A 5CXTA 1UP1A 4UW2A 2VC1A 4PG6A 3GIIA 1R43A 3DGVA 2OSRA 4NA3A 3C2PA 3KUHA 4ZPTR 3DLKB 2MGZA 3ISZA 1PGZA 3P4UB 4NZ0A 3PX0A 2E5LJ 3VQTA 3QAEA 2BQRA 1SQGA 1IXKA 1TP7A 2VC0A 1SJ4P 2YKQA 3MMCA 1R6VA 5MAOA 3KJVB 5C24A 1WF0A 3WDOA 3HSZA 2YXLA 2W2MP 3CEDA 3FCWA 3GYXB 4UQGA 3BB5A 2QLBB 2ZHAA 5HVHA 2UU9F 3PY8A 9RUBA 1NJIT 4P2XA 2Z2ZA 2FHOB 3PV8A 1KKHA 3RAXA 1S6UA 4HTIA 2XYGB 2YNHB 4DL2A 1A9NB 3M6UA 2DCUB 2CUYA 2WZ1A 3J7ZT 4JI4F 2J8SA 2VH7A 2RSQA 1DTTA 1NDLA 2ZC4A 4HHJA 3IRWP 2RS2A 4IRCA 4DR4F 1QUPA 2QLWA 2E7XA 3QIPA 3GFYA 2FVRA 2BOPA 4U7UD 2AWZA 5G0RB 4ZCKA 5K14B 5AJ3F 3M8RA 2MKYA 3D3BJ 3K2YA 4PUOA 3H5UA 5AXLA 3Q24A 1RT5B 3H42A 5CYMA 3T41A 4F7VA 2DR5A 4NXNF 5I4MA 2KT2A 3NGUA 3R1LA 4YMEA 2QTWA 3VAFA 3KLHA 1KONA 4PR6A 2HFSA 4LSNA 2JC0A 3NGSA 3SFUA 2WONA 1I6JA 1I94F 1JLQA 4EEYA 4B9NA 2ERRA 4GVBB 2V94A 2WVDA 3B54A 5CZXA 1F60B 4ILMA 4WE1A 3CDUA 1B7FA 2BW2A 3VTIA 3E3XA 4NLWA 3EGWB 3HKWA 4L3NA 3C6TB 5EUHA 1DRZA 1HBOA 1YQHA 2HBZB 2ZVSA 3UR3C 2GJFA 3BO4A 4NXMF 1OO0B 4OFZA 3A3PB 3HT3A 1A0OB 4DUTA 5DQHA 2E5IA 4CLYA 3OFHA 2H5IB 2R7QA 1H2TZ 1Q16B 2GQCA 3Q83A 4J9UE 4JI0F 4H4KA 2XMAA 4ED1A 1FDAA 2ZM6J 2V9WA 1B70B 5ETVA 1WSVA 3GE9A 2KKHA 2G0IA 4FVMA 2J0SD 1HD1A 1FKOA 4DFJA 1U24A 2V68A 2YPYA 2DB1A 3MD1A 5B0DA 3H90A 4X64J 4UOHA 2IIHA 4NZ6A 2LDIA 1RT1B 2HRYA 4U9RA 4ZVGA 4RUAA 3RB4A 3BBFA 4QOTA 1TQLA 2MZTA 4F4ZA 5K20B 4ZN1A 3I0RB 2Z56B 4F0MA 1S9GA 1S0OA 1NB2A 1Q8KA 2J7KA 2ZKTA 4PAAA 2HNYB 1HL6A 2KT3A 2OEKA 3D4JA 2EFVA 3EVWA 3JS9A 3HVTB 2V6AA 3BN4A 1LWXA 4Y34A 1HNZJ 4DQQA 3MPYA 3QJJA 3KHRA 2RS8A 1TAQA 2KHCA 2RKIA 3OD2A 4KRWA 3L7UA 3K5PA 3KOAA 4IDKB 3QRRA 2NS1B 4NWBA 1N33J 2J6UA 5IC6B 2H5EA 2QMUB 4B02A 4BCAA 1HMVB 4LR7A 2UUCJ 2JVRA 4OL8A 1QTNB 3IWLA 5ETNA 3IMQJ 1S1WB 1X5OA 1UFWA 3NS6A 1CPZA 2IA0A 2QT7A 5HBMA 2HZCA 1EETA 3PACA 2YKPA 4AD6A 5KFSA 1C1BA 3G6VA 3W2VB 1MMDA 1A7GE 4NASA 3T6BA 3MR2A 1RSCA 4DV4J 4P2FA 4A8QA 5A8WB 2LECA 2PD1A 2E5GA 3C6UA 3PKMA 2B9XA 3NCRA 1VRUA 3T9NA 4JYAJ 5IT4A 3RAMA 1LWEB 1F9EB 2DGXA 2OAUA 1RT4B 4PXBA 4NYPA 4ZKAA 3LTOA 4ZVEA 5HP1A 2LVWA 3AY0A 5IWAJ 3MCSA 3MAQA 2NCKL 2DNRA 2JJ4D 3MEEB 3K8WA 1B64A 2R7TA 1KOHA 3WBZA 1FX2A 1WACA 2VBWA 1GMWA 7FD1A 1CQMA 3AD8C 1H72C 3AXKA 5CD4A 1OQ3A 2MB0B 2H3EB 3L9ZA 2NZ4A 1WOSA 2E44A 2AGQA 4NMLA 3UI3A 3RBEA 3BREA 1REVA 1AT1B 4W98A 4NEYA 3BYRA 2CPDA 3FFIA 4A8OA 1PBUA 2HW3A 1H0HB 2HRUA 2W2OP 4IOAQ 2MLXA 3GTYX 3LP2A 2C2KB 4UF4A 1WNEA 1S57A 1WG4A 2MPUA 2DRBA 5FLXY 3QZ7A 5IZHA 1X4CA 1VBXA 2AEJA 2F65A 3M2RA 3N0VA 3QGPA 4X4TA 3CD7A 2GGPA 3SMZA 2BQ3A 4TKTA 2XG8A 2AEFA 2R2SA 1SV5A 3UN5A 5KFBA 5C24B 4DUZF 2FJWA 3M6WA 4PG8A 1RHRB 3DDKA 4HLBA 1IBLF 1UFLA 3AJ2A 5IV4A 1B0VA 1YK9A 4KHPJ 1T05A 4DUYF 1DY3A 2IJFA 2CJKA 1KP6A 1JNRB 1P6TA 1N54B 2N4CA 3GJSB 2V8VA 3QAUA 1WUUA 3EUNA 5THWA 3HFZB 3NP5A 4TU7A 1F9FA 1QAIA 3PYGA 3MFIA 3GIJA 2HBQB 2W7PA 4H4OB 3RZAA 5J2PB 2ALYB 1YRTA 4M5KA 4P7VA 1REVB 1EP4A 2B9WA 2HVZA 2Z57B 4S0MA 3V6JA 2R4FA 3M7VA 3C3LA 4OI2A 1RXOB 3UNGC 1NMEB 2GFFA 1UZDA 3G6ES 2JSXA 4QWBA 3KHGA 4ZLPA 2VDIA 1YI2S 3GONA 3MR5A 4HH1A 3KLFB 4F26A 3RB3A 5IFMA 5A6PA 2OEMA 5KFLA 2O66A 4ZA1A 3I9V9 1M5SA 5DG7A 1ZAWA 3UDVA 3BJYA 2KYZA 2DD8S 4CLZA 1FJGF 3BH7B 2HPUA 2OEJA 1ZETA 3FQKA 1FRIA 4KO0B 2Q1LA 3KJQB 4PG7A 4AL6A 1JXLA 2HQ3A 3NS5A 4JBCA 3GILA 4MH8A 2VU5A 2EG1A 2VQEF 1XWLA 3POTB 2DPIA 2AT1B 2A6MA 2LCWA 4PPDA 2B4OA 4NYZA 4DHVA 3W60A 4FKXA 3J80Y 4UUWA 3MURP 5ETPA 1X9WA 3G82B 1KQGB 4DX5A 4IFVB 2OP5A 4LF6J 1RU2A 1NK9A 1MNEA 2KRBA 4ECQA 4A8MP 1VQ8S 3POTA 3FSXA 3G96A 1HARA 2YH1A 4QZVB 2UXCJ 5HLFB 4JOUA 2IY5B 2ZH2A 1OYDA 3PO5A 1SJ1A 1DZ5A 2VQFF 4LIWA 4GKKJ 2FJVA 1Q8BA 1C1CB 2DGTA 4LF2A 1OIAA 1S0MA 2NREA 3Q8VA 1SUQA 1R31A 1R8HA 2OFHX 1E6VA 2V0NA 1NK7A 1UVLA 4UUXA 2P9GA 1N0UA 4OI0A 2J9DA 4KV8A 4RZRA 4CLKA 2LU2A 3M6VA 4OZJA 4PZVA 2HFVA 1D0EA 4WZMA 1FNXH 5BJRA 2H51B 1RE1B 3R3TA 3PR4A 1FRHA 2DCLA 2HQCA 1SQFA 3DGPA 5I3UB 3IBFB 4Y28C 1FNOA 5IQQA 3K7RA 3SCIE 4AT1B 1U49A 1KQKA 2XHWA 2RQKA 2CJYB 3GJQB 2FZGB 4YS2A 1LW0A 2YKNB 3AFGA 3VGSA 1Y7PA 1YTYA 1S0NA 4UTGA 2UUBF 4LF8F 3G9CA 1T9TA 1TKDA 2VFSA 2CIMA 4GO7X 5E3PA 1GNKA 3OHBA 2KG1A 1SB6A 1KS2A 3G8SA 2O3DA 2LFVA 3GQCA 2N7YA 3B82A 2HG4A 6FDRA 1SUQB 4K7QA 2G0CA 1VQ7S 1OYEA 3DRSA 2WSEC 2X3GA 3EGVA 3IWXA 1WELA 2VICA 3J7YU 2W9BA 1QD1A 5I42B 3MM9A 3HSDA 2CA9A 2WB4A 3P6YC 4CO1A 4ZPCA 2DXEA 5GMKa 2CPYA 2Z58B 4KQZA 4H4MB 3DOMA 3V2UC 4C0BA 1UZHA 3FQLA 3D6TB 3SYZA 2WOMB 4DZDA 2Z2YB 3ONQA 2IAJA 2LXUA 1XJWB 1XQIA 5E7OB 3AAWB 1CJKA 5ETLA 4Q45A 3PKYA 3OV7A 4DSFA 4G1IA 1K8AT 1K9MT 2R42A 3V4IB 2RJZA 2FDNA 2VFVA 1HNIA 3D1OA 4HYKA 2BYCA 1ZA2B 1S97A 2IBKA 3EZ5A 4Y3CA 3W8PA 1XNQJ 2D3OR 4P72A 1NZ8A 2OPSB 4NLTA 4EK2A 5EWEA 4TQRA 5EN1A 2EVZA 1Z2LA 5LXYA 3MPUB 4P6QA 3CF5Q 3UDLA 5HP1B 5I42A 4RO0A 5J2MB 2KZZA 4M94A 4Y0FA 4Y2IA 4C8OA 1OJ4A 3EDQB 2HHPA 5ETQA 4YR2A 4DV1F 1YX2A 2GVZB 1IQTA 1DTQB 3LQVA 2YH0A 4KIAA 4YP3A 2FIUA 3TI0A 4LF7J 2CNOB 4LBPA 1RHUB 2AP6A 1P9QC 5KG4A 4WXOA 4OHXA 5HI7A 3IRXA 3WZ0A 2WW4A 4P2MA 3W7BA 2GJ2A 2GQ2A 4ZVUB 2ZBRA 4EZ6A 3GFXA 1M90T 3Q8YA 2B56A 3OBIA 2RF2A 2KT5A 1T9YA 1X8DA 3H2UB 3CCVS 4YEAA 3DLBA 1APSA 3KHLA 1RTHB 4NLDA 2V4RA 4LQ3A 3OVBA 3S1TA 1KSPA 4RPFA 1RT2A 3BBCA 1YZ7A 3SDEB 2BE2A 1TL3A 1RHKB 2JRSA 4WKYA 2EWHA 1IKXB 3O1LA 5BYQA 3FZBA 3D0IE 2VA3A 3AA9A 2B7CB 2RRNA 2CFXA 1BWVA 3NS7B 4DUYJ 2XM3A 1HNWJ 4O4GA 2BX6A 1WDTA 2QIFA 2GO9A 4C98A 1S1VA 5L38A 1ICEB 2AEMA 3K89A 4NI2B 4CCHA 2DH7A 2EKNA 4WJBA 1FJCA 1IKXA 2BE7D 4Q8FA 2HMIB 5CHCB 1ZTTA 1RWPB 1N5TA 3L4BC 1GT8A 5E3AA 1D9AA 4J5OA 5JUMA 3A4TA 2BJ1A 1G6BA 3A8EA 2H4WB 2BJ8A 4DG1B 1HBUA 2GV1A 1ZS6A 3H8YA 3G86A 2FVSA 2XS2A 1YJTA 1YZ6A 2OFGX 5D0EA 1SJQA 2I6WA 2HVIA 4IFYB 1S9FA 3BDEA 2DH9A 4OZLA 4WU3A 4ITSA 2ZJQQ 1U6FA 4A46A 4EUVA 2QA4S 2QJ3A 3FK4A 4M5GA 1QSLA 3ELHA 4OYMA 1IKYA 2U2FA 4DR2F 4N7TA 1HI8A 3GCWP 3T6JA 4F2RA 4IRDA 3JSBA 4ECRA 4DSEA 4R0EA 5HLFA 4CQ1A 2UXBJ 1HBMB 3R7NB 3HVRA 4B17A 4M63A 4N8OA 2B5JB 1NHKL 2DNNA 2ZITA 3OFFA 3Q2SC 5CABA 2YX7A 2DEIA 4B3RJ 5ETMA 3O44A 1FXLA 4PRFA 2I5JB 1TV6A 2VFRA 1Q7YT 1OQ6A 2A10A 4JB8B 2AZ3A 2HQDA 3N79A 2CPXA 1JJ4A 4WU2A 4HACB 1T0TV 2BRLA 2V2QA 4LSNB 1UKUA 4LF5J 1XTZA 2CVEA 4KGZB 1VQYA 1TUWA 1DAXA 1Y10A 1YJVA 1EARA 2MKCA 5B0FA 1OSCA 2KFYA 4AQYF 1HHTP 1NO8A 1NH8A 1F1BB 2V67A 2XS5A 1N33F 1VISA 1R3NA 5CYJA 1RTIB 4WP8A 5KOXA 2Y3YA 3TA1A 1UVMA 1X4HA 3HVTA 3I0SA 4MIBA 4L73A 3PXGa 3M9OB 2KH9A 2QFJA 4DR3F 4C0OC 5F8NA 4V19X 5KFNA 4IG0A 3I32A 1SKSA 1X9MA 4G6VB 5JJBA 1VQ5S 3NBPA 4ELTA 1RT1A 2YNHA 3GIKA 4QIFA 2COLA 2ZH5A 1GTHA 1T9UA 3OSNA 2FHKA 1CSJA 4CO5A 4RLEA 4B3SJ 4KH0B 3UO0A 4CNYA 1FKOB
chains in the Genus database with same CATH topology
3IGNA 4IG0B 2K7KA 2MYFA 1T05B 2VFTA 3BGRA 2JZ5A 1FXRA 3I5AA 3LPYA 1X4GA 5E3QA 1FXDA 1C1CA 3NMRA 4L6V3 4Y65A 3MEEA 3CC2S 3V6KA 3FEXB 5J2MA 1E6VB 5H9FJ 3H5XA 2HS4A 2L9NA 5B0EA 3SQGB 2OKQA 2PT0A 4HT5A 4D3HA 4M5DB 4LFAF 4WFXA 3LOUA 4K4UA 3D0GE 5A8WA 4LF9F 1Y5NB 5DDRC 3KG4A 3N01A 4OX8A 2EI5A 5HMXA 3ZZOA 3IA0A 2DNPA 1HBNB 2DITA 3TVYA 4MKYA 3MMBB 2L3MA 5FIIA 2CG4A 3NCPA 1URNA 1HMVA 4JI7F 1Y4ZB 4KO0A 3R5DA 4DV5F 3KK2B 2F4VF 3IN5A 2Q43A 1LWEA 2W9BB 4Q7AA 5KFWA 4CI0B 5MLCV 1ZH5A 4LJMA 1HD0A 3BO3A 4C8MA 1NK8A 4C7QA 4FP9A 4I2PB 5C25A 5G4DA 5GAGI 3FRYA 4ILLA 4ILRA 3M2UB 2QA1A 3T5KA 1Y5LB 5LSOA 3BSOA 1LOUA 5HBMB 2B3TB 2IVFB 3KLVA 2VUGA 2R7OA 4MIAA 2YKAA 2NR0A 3H40A 1TL5A 2CRLA 3J81Y 2R7VA 3OSPA 1SH2A 5F41A 5K8NA 2FLNA 1JLAB 4DLEA 2HFZA 3E51A 3N5BA 1QUVA 1Q4RA 2ZH9A 5B0AA 3I5BA 1DQ9A 3MEKA 2FHJD 3HHLD 3LUYA 1H3DA 1QAYA 3KMSA 3A1YG 5AE3A 4EBEA 3P5TL 1VC6A 3DOKB 1FVSA 4ECYA 1UAWA 3JSYA 4OZ5A 1UJ4A 2XY6A 2ILZA 4PCQA 4TNOA 5D4OA 4Q44A 3TARA 3SSQA 5EGYA 2CQBA 4ETXA 5GAEI 3NNAA 2E7WA 2L9DA 5CCMA 3AHPA 2VG7B 5E3RA 3OJSA 5KFAA 1UEVA 1Z4UA 4QPTA 5KFTA 4EU0A 3OVSA 3OW2R 1L3VA 2HHUA 1U47A 1AROP 1S6QB 2GNKA 2MKJA 1U1QA 1S48A 3V81A 1HQUA 2RIJA 3NG8A 3HM9A 1HBMA 2J9EA 4PPZA 5DGBA 2F1FA 4K4YA 2XWYA 2V8GA 5DGAA 3IG1B 3SCLE 1FF2A 1HWJA 3K58A 3MM8A 2FUG9 3DLHA 3W2WA 3X1LB 3HLUA 4AL5A 2Y1JA 2AJ0A 4FS2A 4KJIA 5M2RA 1JK9B 1U1RA 2HGMA 4GKJF 3CCLS 3KFWX 1S6QA 3RAQA 1U4BA 3UWTA 1T03B 1KVJA 2WONB 1L5UA 2BACA 1KNZA 3C46A 3CULA 3EPGA 4A8FA 2MJNA 3H25A 1RJJA 2XMJA 2AU0A 1FJEB 5KT4A 2A3JA 1KD1T 3CD0A 1NK0A 1X5SA 2IC3B 3CGIA 2OPPB 4Q0BA 4O4GB 4G1PA 3MI7X 4ZPBA 4KE5A 3D1HA 1ROFA 4HDGA 2ZH1A 3JSMA 3MM5A 4C3KA 3MHYA 4QWAA 3JTOA 2B6AA 2MKSA 4JUZA 1LXNA 3GYNA 4N41A 3M6XA 3THVA 1CG2A 4TXSA 1VRTB 1Y5IB 4P7TA 4DQSA 2G9OA 1CVJA 5J2PA 4I6YA 2Q6BA 2HLTA 2ZZMA 2PO4A 3BF4A 3VAMA 4O3SA 2VODA 2F8EX