4H4MB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
428
structure length
428
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 102
structure length 428
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mB03
5C25A 1N5YB 4R5PB 4ZPDA 5KFJA 3LP1B 4IH6A 3OL6A 1IKVB 4TQSA 3QGHA 1NNDA 5I3UA 1JLEB 2WOMB 1REVB 3MEEA 5HBMA 2YNFB 4MK8A 1LWFA 2IM1A 4ECTA 1S0NA 5F8LA 4K4YA 3EPGA 4QWDA 4LQ9A 4RNOA 4FS2A 1RT4A 5FDLB 2IAJA 3Q8PB 3BGRA 2OPPA 5K14B 3PW0A 2HNDB 4XPEA 2EC0A 2O5DA 3ITHB 1KHWA 3IG1A 5CYQA 5HLFA 4RNMA 4QWEA 3PW5A 3PVXA 1DLOB 3M8QA 1JLGA 4JUZA 1S1XA 1TKTB 3DLGA 2VG7A 2B5JB 4ECSA 4ZVEA 2R8KA 4O3QA 2YNHB 4RW7B 5KFCA 4J9NA 3DOKB 1U09A 5KFTA 2R2TA 2AGOA 1GX5A 3H98A 1C1CB 5C25B 3KJVB 3N6MA 1BQMA 1IM4A 2XCAA 5KT6A 5EWGA 3M9NB 3BQ1A 4EBEA 2FJWA 3T5LA 3SI8A 4ID5A 3LANA 3KHLA 1TL1B 3PR5B 1LWFB 2RF2A 4URGA 5KFWA 2JEFA 3DRPA 3PW4A 2JEJA 1RT4B 4NZ0A 2IAJB 5KFGA 5CYMA 3BGRB 3CDEA 3JSMA 2D7SA 3QIPB 4ZVFA 5KFAA 2OPPB 2V4RA 4IFYB 5L1LA 2OH2A 3IG1B 5HLFB 2UUTA 4O3PA 1BQNA 4MKBA 4ECUA 2WCXA 2OPSA 3M8QB 2ATLA 1JLGB 1S1XB 3DLGB 3T19A 2VG7B 2VG5A 3DRRA 4QPXA 3FSIA 4YP3A 5F9LA 4ED8A 1S10A 2J6TA 1IKWB 2FJXA 4RNNA 3KMQA 4B3OA 3OSPA 1HMVA 2RKIA 3OLAA 1BQMB 4F4YA 2W7OA 2ZE2A 1N56A 1S9EA 4Y34A 4WZQA 4ID5B 1RT5A 5HROB 3NAIA 3DMJA 3DLEA 2RF2B 2J6UA 2AU0A 1TKZA 2OPQA 2R2SA 1JXLA 4KV8A 1IKYA 2YNGA 2HMIA 5DQGA 4J9LA 1D0EA 5CYMB 3JSMB 3FDSA 2WB4A 4Q45A 1RAJA 5DG7A 4JV1A 1JLBB 4IDKA 1IKXA 3NKYA 4J9QA 1BQNB 1RT2A 4ECYA 2OPSB 2IBKA 2FLNA 4IRCA 1RTIA 3IS9A 2XI2A 2WONA 4NYZA 4PQUA 2VG5B 3DRRB 3KLIA 1HYSA 2ILYA 1WNEA 4K4TA 3QGGA 4WXWA 4B3OB 4DEZA 1HMVB 3M8PA 3MECA 5DG8A 4RW8A 4I2QA 3PW7A 2ZE2B 3ICLA 1S9EB 5J1EA 2VG6B 3RAXA 2FJVA 4YQWA 4MFBB 1HNVA 1RT5B 3I0RA 3DMJB 3DLEB 2JLEA 5L1KA 4ZHRA 1TKZB 2OPQB 3HHKA 4MIBA 1IKYB 2YNGB 2HMIB 5DG9A 4J9KA 3RB6A 1HARA 5KG0A 1ZTTA 5KFHA 1T03A 1HPZA 3MTKA 3GIJA 4NLVA 1IKXB 3TAMA 5HP1A 3HVWA 2ASJA 2J6SA 2W9AA 2I5JA 1RT2B 3EZUA 2UVUA 1SH2A 4GC6A 4KO0A 1RTIB 4RW9A 2WONB 4PQUB 2R8GA 1J5OA 1HYSB 1LW2A 4DL7A 1RYRA 1TP7A 1OS5A 2BQ3A 2IM0A 3M8PB 3MECB 3CDWA 3MFHA 1N4LA 3MR6A 1RTHA 4I2QB 2E9TA 3BSAA 4XPCA 4ECVA 2HNZA 5J1EB 5KG3A 4I7FA 3KMSA 2RDJA 3OHAA 4TYBA 3G6YA 5KFRA 2IMWP 1SV5A 3DOLB 2XI3A 4LQ3A 4LSNA 1GX6A 2WHOA 4URSA 5KT2A 4KKOB 4IRDA 4NLGA 4U6PA 1S0OA 3CJ5A 3GIKA 4EYIB 4K4ZA 2UVVA 1T03B 2C28A 5D3GA 4IG0A 3TAMB 3FRZA 3KK3A 4IH5A 4O3OA 5KFDA 3QLHA 2I5JB 2C2RA 4KO0B 4IOBA 4Q44A 4NLQA 1RYSA 1J5OB 3SFGA 4EO8A 1XR6A 4K4XA 1JLAA 1LW2B 3KHHA 5KG6A 1SH0A 2RDIA 2UVRA 2WTFA 4ECZA 3KHGA 2BRLA 1RTHB 2FVCA 1D1UA 2HNZB 3BJYA 1NHUA 4LSLA 1R0AB 4O44A 5F8HA 3KLHA 3I0SA 3MF5A 2W8KA 4Q8FA 4DL2A 3KK2A 1SV5B 5KFEA 4ZVGA 3KLVA 2ALZA 3BSOA 1RT3B 4LSNB 2BANB 2GIRA 4DL3A 1VRUA 1QE1A 5J2NA 5KG1A 4Y2CA 3BSNA 1CSJA 2W9CA 2YKMB 2V0NA 2IA6A 2FVPA 2B43A 1JLQA 4WFYA 5D3GB 4IG0B 3CJ4A 1JLFB 1HQEA 3KK3B 4F4XA 1EP4A 2DPIA 3OL9A 3GV7B 4HKQA 2FLPA 3JYTA 1I6JA 3GILA 4ECXA 3BREA 2ILZA 3M9MB 4JV2A 4J9RA 3DDKA 3DRSA 2DPJA 3M9OB 4NLPA 3BR9A 5I3UB 5HBMB 3MEEB 4R0EA 3V6DA 1FKPA 4LSLB 4ED0A 3I5CA 4O44B 1LW0A 2CKWA 3KLHB 3I0SB 1S1UA 3KK2B 5KFYA 4NCGA 4TQRA 1JX4A 1VRUB 4KSEB 1S97A 1QE1B 4ZPBA 4ZMMA 1VRTA 5CYQB 2W9CB 4J9SA 4TYAA 4O4GA 2BE2A 2W9BA 2BQRA 3BQ2A 1FKOA 2AQ4A 2QE5A 5KFPA 4RZRA 1JLQB 2HWHA 3T5KA 5I42A 2W8LA 1XR7A 4H54A 1EP4B 4NLXA 1SH3A 1LWCA 2ZKUA 2C2EA 3SFUA 2XGPA 4QWBA 3D28A 3VQSA 4EO6A 1EETA 3DRSB 4K4UA 1W25A 4Y2AA 2QV6A 1T3NA 3V6DB 4F4ZA 2IJFA 3DRPB 1LW0B 3QO9A 3LAKA 5L1IA 2D3ZA 1S1UB 4DG1A 4NCGB 2IJNA 2E9ZA 5DGBA 1C1BA 3V6HA 1VRTB 4J9MA 4O4GB 1TVRA 4MIAA 2W9BB 3V6KA 1FKOB 4PUOA 3PJWA 1S1WA 3NL0A 1DTQA 1KLMA 5F8GA 5DLGA 5JUMA 1S1VA 4HYKA 2C22A 1S0MA 5KT7A 3H5YA 1LWCB 3IGNA 2RKIB 2XGQA 4FBUA 4RW6A 3N6NA 1Z4UA 2XCPA 4RNFA 4FS1A 4G3IA 1EETB 3H2LA 3GQCA 4EYHB 4ZP7A 3QZ8A 4NRTA 3UPFA 3KHRA 3KJVA 3FQLA 2OPRA 3T5JA 2JC0A 5KFZA 1K1QA 5KT4A 3QO9B 4KV8B 4WE1A 4ECQA 3MR5A 3HKWA 1TQLA 4MKAA 5KFSA 3FQKA 1C1BB 3PR4A 4IDKB 1QAIA 3MEGA 5KFLA 5DQHA 4H4OA 5DLFA 4WYLA 1TVRB 3NBPA 4NLRA 4PUOB 3IS9B 4PWDA 1KLMB 3KLIB 3H59A 3H5SA 1S1VB 4QW9A 4NLTA 3LP2A 2IM3A 2YKNA 2CJQA 3GV5B 1RT6A 4RW6B 4RW8B 5EWFA 4FBTA 1C0UA 4K4SA 3PJXA 1TL3A 3CDUA 5KFBA 3RBDA 4KE5A 5J2QA 1HNVB 3I0RB 4DL5A 2R8HA 2OPRB 4NLYA 3OSNA 4RUAA 3KOAA 2FVSA 3OLBA 4WFXA 4ICLA 3QIDA 4ZHRB 4O3SA 2AX1A 4YR2A 4ED3A 2FVRA 3IRXA 2WRMA 4NLDA 4WE1B 4TY8A 1LWEA 1S48A 4NLSA 3PW2A 3H5XA 3UQSA 4NRUA 1HPZB 4R5PA 1N6QA 5KG5A 3LP0A 1YVFA 5HP1B 3C6TA 1TKXA 4H4OB 2D41A 3DI6A 3NBPB 4IKAA 4RW9B 4Q0BA 2UUWA 4KFBA 4PWDB 1JLEA 4RW4A 3NAHA 5KG7A 3ISND 3GYNA 1XR5A 3LP2B 4ZP8A 1S9GA 3MEDA 1ZETA 4KB7A 2XC9A 2ASLA 1RT6B 3RB4A 3G86A 3MR2A 3G6XA 1C0UB 1TL3B 1RTDA 3CIZA 5F8IA 4GC7A 2HNYA 4RU9A 4I7FB 5J2QB 3CJ0A 5C24A 4TN2A 5J2MA 3PZPA 2UVWA 4KBIA 4MK7A 4IFVA 4RNHA 4IQXA 4ICLB 3BSCA 4RUCA 3OL7A 4ZP6A 4IR1A 2R2UA 3CWJA 4TY9A 4TY8B 1LWEB 2YNHA 3V4IA 5L9XA 4WFZA 4URQU 4ZPAA 1N6QB 3Q8SB 3LP0B 2AX0A 3C6TB 4KAIA 1TKXB 1NHVA 3QLHB 3H4BA 4XO0A 3DI6B 1RDRA 4Q0BB 4KFBB 4RW4B 1TL1A 1JLAB 1KHVA 4EEYA 4MH8A 3T5HA 4M94A 4TXSA 3UR0A 1HNIA 1S9GB 3MEDB 4K4VA 1HQUA 4YR0A 4IH7A 2C2DA 4K50A 3H4DA 2AGPA 2ASDA 3RAQA 4X2BA 1RTDB 3QIPA 4M95A 2R8JA 3DM2A 4IFYA 2HNYB 1JKHA 4TLRA 5C24B 2D3UA 5J2MB 3IN5A 4NLWA 4IFVB 5L1JA 4ECRA 3V81A 5J2NB 5KFXA 4R8UA 3V4IB 1IKWA 1T94A 5DGAA 1DTTA 2FVQA 1UWBA 2IC3A 4DL4A 3MR3A 2E9RX 4WYWA 4H4MA 4OL8A 1HQEB 3E51A 1JLCA 4MK9A 4QWCA 3NGDA 3JYTB 5HROA 1S49A 4F4WA 4J9OA 1C2PA 1HNIB 3OL8A 1HQUB 4ED1A 4J9PA 4WXOA 1FKPB 3QGIA 4NLUA 3DM2B 3MFIA 1JLBA 1S6QA 1JKHB 3ISNC 3CVKA 2JEIA 5T14A 4ED2A 4EBCA 5KFUA 4K4WA 3V81B 5KG4A 5KFOA 4ZVHA 3KLEA 2HAIA 4R8UB 1SUQA 2V4QA 1DTTB 2BE2B 1RT7A 1UWBB 2IC3B 4NLOA 3GIMA 2IM2A 4H4MB 4KHRA 5I42B 3PHEA 3KLGA 3HVTA 1T05A 1JLCB 2VG6A 4I2PA 4MFBA 3DYAA 3CO9A 2GIQA 2ZD1A 4YMEA 1S9FA 1QAJA 1S6PA 5F8NA 4YR3A 3BQ0A 4DL6A 3CJ3A 5F9NA 3EPIA 3LALA 2VA3A 3G6VA 4WZMA 3KLFA 4ED6A 5KFKA 2YNIA 4ED7A 1S6QB 1N48A 1RA7A 4EBDA 2JC1A 4ECWA 5F8JA 3LAMA 4DG1B 3C6UA 5JXSA 4QW8A 2R8IA 4IG3A 5J2PA 4ZP9A 2W7PA 3KLEB 1K1SA 5EUHA 2R2RA 3H40A 1SUQB 1S1TA 3CJ2A 1RTJA 1RT7B 2B6AA 3KK1A 1JIHA 4Y3CA 3NMAA 1S1WB 5KFNA 3H5UA 2I1RA 1DTQB 4JV0A 3HVAA 4O3NA 3KLGB 3HVTB 1T05B 4O3RA 4QWAA 5EWEA 3DLKA 1MU2A 4I2PB 2BQUA 3DYAB 2ZD1B 3E01A 4G1QA 3I5AA 1TV6A 1S6PB 3DOLA 4F50A 3UDLA 1RT1A 3T1AA 3GIIA 1MMLA 4KKOA 5KFVA 2WK4A 1FK9A 5KT5A 3KLFB 5KFIA 5C5JA 3OHBA 3FFIA 2AGQA 2YNIB 5C42A 2VA2A 3RBEA 1C0TA 5KG2A 4U7CA 3C6UB 2HWIA 4IRKA 4ZPCA 3RB3A 3N6LA 1S4FA 4IG3B 5J2PB 3Q8RB 1N5YA 5KFMA 3TVKA 3V6JA 2FLLA 3LP1A 3Q8QB 5KFFA 3MEGB 1QUVA 5KT3A 1IKVA 1S1TB 4IR9A 1RTJB 2B6AB 3KK1B 2AWZA 1RA6A 5EDWA 4Q8EA 2WOMA 3I5BA 1REVA 3QZ7A 2YNFA 2BRKA 1ZTWA 2F8EX 3DLKB 3IGVA 2YKNB 1MU2B 1R0AA 3QYYA 3E01B 4G1QB 5FDLA 1TV6B 2JEGA 3KNAA 1RT3A 1RT1B 5DQIA 2BANA 5F8MA 5K14A 2GC8A 2HNDA 1FK9B 3D5MA 3ITHA 3GV8B 3RB0A 4O4RA 4Q43A 3FFIB 2YKMA 5C42B 1DLOA 1C0TB 1TKTA 3IRXB 2B5JA 2BR0A 1JLFA 2V9WA 4RW7A 5KFQA 3TQ1A 3DOKA 2XWYA 4KHMA 1C1CA
chains in the Genus database with same CATH superfamily
1A6LA 2PIIA 1FDNA 2G2OA 3PYGA 2DH7A 4BBYA 1NNDA 1S0NA 1KNZA 4RX6A 1LK5A 3GWCA 3UR3C 1NU4A 2MDAA 3CCSS 2V68A 4DF4A 1R0BG 1WC1A 5L38A 3AQOA 2MKIA 2HZAA 2JRSA 5F0UA 4DFPA 1BQMA 3A12A 5CD4H 1Y0HA 3Q0AA 4DU7A 2ZOGA 1H0HB 4DQPA 5F3ZA 4MIWA 3JSMA 4L74A 4LF2A 4FZVA 2SXLA 2GJFA 2BJ7A 5GVQA 1ZH5A 4DX7A 4B9MA 2AU0A 3UD5A 4KV8A 1Q0NA 2BJDA 2HMIA 5DQGA 2NXUA 4GKJJ 3NKYA 1UAWA 4ANDA 2VG5B 1J5EF 3GYXB 1P27B 3MUTP 4P71A 3RAXA 1U1MA 1RT5B 1XTZA 3TJ9A 1VFJA 3RB6A 2GS8A 1IR1A 1IWAA 2YWGA 1VQOS 4F3QA 3V4MA 3QRQA 4XPCA 2JNJA 1REGX 3B4DA 2WHOA 4OI3A 5HN0A 3HF5A 4PR6A 1Y3KA 2C28A 1U1PA 3ZZ0A 1FNOA 4WPAA 3IBFB 5E33A 3CD0A 2ACMA 1D1UA 1VBXA 3BJYA 1FVQA 3ZC4A 3MF5A 3NGRA 1N32J 4ZLPA 5A8RB 2YKMB 1GMUA 1G7CB 1KS2A 3DHXA 1VC6A 2FLPA 1U02A 4EMDA 3MEEB 4R0EA 5HVFA 1TTHB 3I5CA 3HVRA 4C11A 1N33F 1ZOTA 3SCJE 4ID8A 1FKOA 4OX8A 1M90T 5I42A 3ZZRA 4JYAJ 1TK0A 1W25A 4L75A 4Y2AA 3V6DB 2CA9A 2IJFA 2ZUGA 1KQFB 1FXDA 1C1BA 3D0IE 1VRTB 3GP9A 3KXDA 3VGTA 4DU8A 5KT7A 2CWXA 2MGZA 1HA1A 5KFZA 2LEBA 2B4VA 2FGOA 1CQNA 4M5LA 1NJYA 1TQLA 2JDJA 2HLUA 1TVRB 3H59A 3ZZUA 3D0GE 2AF6A 2ZDOA 3AD9C 4ZLLA 3H7HB 1X7VA 3KDNA 2OPRB 2C2NA 2ZWOA 4F0HA 1S48A 4A4JA 1RHJB 4RPFA 2RILA 1N52B 4PWDB 1ACMB 5GAGU 1IBLF 1Q5YA 3AFGA 1NJIT 4HH1A 5AT1B 1UFKA 1T8EA 2V8DA 2OD4A 1TKXB 1SC6A 4KFBB 2AYEA 1HWIA 5CHCB 2CVIA 3TWZA 5C2CA 2ROEA 5BYSA 4TLRA 1S7IA 5E5NA 4DCJB 2V4JB 1RQ0A 1AROP 2FVQA 2M5YA 4KGZB 2NREA 4MK9A 2IVFB 4EI2A 1NKCA 5HROA 2CQDA 2HVEA 2PMZD 2IVMA 3CCUS 4ENOA 2FLOA 3CVKA 1AFIA 5CYJA 3QRRA 4DOZA 1TL7A 4B9UA 3BBFA 1DTTB 2RE1A 3GFXA 4H4MB 2C2KB 4F26A 3A1YG 5HL7Q 3EPIA 2XS7A 3LALA 2QTWA 2A2CA 4DUZJ 3TO8A 3LAMA 1OPZA 1WSRA 3I32A 2W7PA 4N47A 1KKHA 3ZZYA 3HVAA 2MZSA 2DIUA 1WOOA 2F8HA 2V8HA 3U02A 1BMQB 4HR2A 1NUEA 4F2SA 2CQ1A 1GK8A 2HZCA 3QSIA 3ISZA 2ZNYA 3Q8RB 5CCLA 2N4DA 2XSJB 1HNWJ 2CJAA 2UUAJ 4Q8EA 2AJ2A 4CQ1A 3CC4S 2YKNB 2KG0A 4RWWA 2BKNA 5K14A 1S6OA 2CZ9A 2CQIA 4O4RA 2Y3YA 3FFIB 1DLOA 3MMCB 1BWEA 2B5JA 2J7UA 3MAAB 1PBUA 3KJVA 2DGUA 4TQSA 4JI1F 1JLEB 2ZM6J 2DGVA 3EPGA 4YDDB 1DQ8A 3BGRA 3FEZA 2I8EA 1NJWA 3M8QA 1ZM2A 1CEZA 3H98A 3SYZA 3M9NB 5KT6A 3R6LB 2FJWA 2XYPB 3NGUA 4UZCA 3R97A 4YY3J 2F1FA 3BF4A 3CJSA 2BUNA 1D9DA 2QFIA 1BQNA 5MLCV 1MLAA 1S10A 3ULHA 4JI0J 1M5KC 1BQMB 3QAEA 1NZAA 4OJGA 1N56A 2Q6BA 2DCLA 3JSMB 1RHUB 1RAJA 4LF6F 3M8SA 4OHYA 4DSEA 3TUPA 2PDAA 2WONA 1UVNA 2GJIA 1HNZF 3PW7A 2RRNA 2VKZG 4YQWA 4MFBB 1HNVA 1QAXA 1M5OC 4OZLA 3HHKA 1RGVA 2M7SA 2HMIB 5DG9A 1HPZA 4DPOA 2ASJA 4X64J 1PYOB 4GC6A 1AW0A 1OS5A 1RACB 5D0RA 1GX6A 2LEPA 1B7YB 4KKOB 1R89A 2HHWA 2AEJA 3GIKA 3GYGA 5D0EA 4O3OA 1S6UA 2W4DA 1RYSA 1RAIB 1JLAA 1N88A 3J7YI 2A1BA 2VFUA 2ZH2A 1Q95G 4C8LA 5E0OA 3EZ5A 4USMA 3BSNA 1U6BA 4A46A 1SCJB 4ES3A 3NS5A 1GH8A 4WTYA 5JVHQ 3ZXWA 2MPUA 4A8OA 5IWAJ 1NXIA 1RCOB 4DV7J 3DDKA 3DRSA 2KT3A 3J81j 1ZZFA 3ZTPA 3HD2A 3GR1A 3PG9A 3VAFA 2H5EA 1F60B 4ZMMA 4O4GA 1KONA 2C3UA 2M3DA 5D6GA 2CZVC 4HI2A 1LWCA 2ZKUA 5IV4A 4EO6A 4LFCF 1U0HB 2QV6A 3QFWA 3EVWA 1FRJA 2KRBA 2H65B 3G71S 4C11B 2E9ZA 4OI0A 3V6HA 1Q1KA 1FKOB 1RHQB 4HYKA 1VLYA 3H5YA 4NXMF 2KYZA 3N6NA 3JAMY 3DC2A 1P1LA 1RAOA 5I4MA 3T9ZA 4ITSA 5KFSA 3CC2S 4DX6A 1C1BB 1QAIA 1HR0F 2GVDA 1X4DA 4K2XA 5A0YA 1FJEB 1T9TA 3BH6B 4NLTA 1XNQF 2UXCF 2N7YA 3DCAA 1TL3A 1SBRA 1T11A 4KE5A 4CI0B 2MGZB 1JJ2R 3HULA 4WWSA 4EZ9A 3OLBA 3TOQA 1K44A 4ZHRB 4YR2A 1Y5NB 3OUYA 3H5XA 3DXSX 5ETMA 3FSYA 2RQMA 3CJKA 2EG2A 1UFLA 4Q0BA 1CS4A 4HACA 3W64A 4ZP8A 4QCLA 3UD4P 2V5HG 1RTDA 3MR7A 1FJ7A 4YHHJ 5J2MA 3PZPA 1DARA 1I51B 4PXEA 2DB1A 4IQXA 2UXDJ 4DQRA 2VDIA 5AXNA 2BX6A 3MOJB 4ZS6A 2XZDB 3UR0A 2E5LF 2ZH1A 3D6MB 3DM2A 4KHPJ 5D4OA 2V2QA 4OYPA 2EFPA 2MZTA 3D54A 1SC4B 2CJXB 1MMNA 1FCAA 1SKRA 3UI3A 3K89A 4F04B 4LF1A 2LDYA 1TAQA 4WXOA 2Z30B 2OP5A 2ZH8A 3SSQA 4EBCA 5KFUA 1Y7PA 1FX2A 5BR8J 4I2PA 4F4KA 4ED6A 2R42A 2O1PA 3C6UA 5JXSA 2EVZA 2HVIA 1R8CA 1TL7B 2MTLA 3VALA 1JIHA 4ZLNA 2JH3A 4JV0A 3A3NB 4P9SA 1SJQA 1TV6A 3PKMA 1TUVA 1U25A 2DR9A 3K5LA 3CJRA 3R7NB 3LUYA 5C5JA 1LFPA 4J9VA 4OQJA 1JXVA 3OFFA 2EFNA 3RBXA 1N5YA 4NPOA 2IY5B 5KT3A 3LWMA 3GONA 4JI2J 4TU7A 1O51A 1R0AA 3JTOA 1HI1A 5HVHA 1U1NA 3DGPB 4DV5F 3JXOA 1WACA 1JLFA 3D1OA 3JS9A 5E3CA 5KOXA 3QGHA 2DNMA 4MK8A 1XBWA 4LQ9A 4ELUA 2P6SA 5K14B 2P9CA 4RNMA 3K58A 4GKKJ 1DLOB 1DY3A 1YJRA 4CYUB 2NUHA 2B5JB 4W90B 1DQAA 2AGOA 3KJVB 3UDEA 1IM4A 1H7WA 2B8PA 3SI8A 2RHSB 1TR0A 2AKWB 3FGVA 1B0PA 3GJTB 4S0MA 3BGRB 4DF8A 3NGKA 1X4AA 2HHSA 3DXBA 3K0JA 3M8QB 2ATLA 4UOHA 1WSVA 2FJXA 2ZJQQ 2JWNA 3SXLA 2HHXA 4Y34A 4BCAA 2W1BA 3DLEA 3JSBA 2GJ2A 4J9LA 2FJEB 3GJQB 1IN0A 1BQNB 4KJIA 2G0JA 4M5IA 3W66A 4PQUA 1R6YA 2IA0A 5DS7A 4JI8F 2DD8S 4I2QA 2N4CA 1WUUA 2ZBIA 4QOTA 3C16A 2HURA 2RD5C 3MHYA 2XEXA 5K20B 4MKVA 4USJC 3OFGA 2MZQA 1HIYA 3G8SA 2WONB 2IM0A 1RTHA 3BBCA 2W2MP 2QL7B 4TYBA 4L3KA 4URSA 2B9EA 4ERDA 3D6TB 4HHUA 1MN7A 1TMJA 1VJQA 3HHDA 3JAMU 4Q44A 3OFEA 2CPXA 3M30A 4ECZA 2BRLA 2MQLA 3KNGA 2RRAA 5IM0A 3VGVA 3VAGA 1PSDA 1VQ7S 1OQ6A 2M88A 3CJ4A 3PRVA 3TW0A 4Q5VA 4M5MA 4Y0FA 2QL5B 3GG1A 3F0NA 4YOEA 3LOUA 3MM8B 4KH0B 1S77D 1S97A 3BQ2A 2AQ4A 3R9LA 2CQ4A 2RH3A 1HW8A 4P72A 3DRSB 1FFSB 3SV4A 4K0KF 3LAKA 2O01C 4DXLA 1BLUA 2AYMA 4ANEA 1XMBA 4O4GB 2C22A 1HKAA 4OX9F 3JB9k 1WC0A 3WQPA 4AFFA 1LWCB 4LR9A 4MT1A 3HMJG 2MKYA 4OYBA 4O0NA 1Q53A 2GO9A 2ZH6A 1PC5A 3A8JA 3N5BA 2LU1A 3MAQA 4FPRA 4CO2A 1IR0A 2H51B 2Q66A 2IMOA 1Y11A 2CJQA 5GADU 1A0OB 3PJXA 1VBKA 3OTCA 4A48A 1FDAA 2QA1A 4DV1F 1IBLJ 1LWEA 3C6TA 1Q7YT 3CC7S 2GVDB 3O5TB 5A0YB 3GYNA 4QIWD 4CH1A 3VCDA 1UEVA 1TL3B 3CIZA 1HBUA 1ULRA 4IFVA 1EKSA 1FE4A 4OJHA 3CWJA 5CCMA 2YNHA 3OUYB 2WW8A 2N3LA 5LMUF 3CJKB 4HH0A 3CMAS 4Q0BB 1OSDA 1NMEB 1CS4B 4KH1B 2XG8A 1YKWA 1S0VA 4M94A 4TXSA 3ILIA 3H4DA 4KTQA 3RAQA 1RTDB 5J2MB 4M5JA 2HFOA 1T94A 3NOGA 5AE2A 3Q8VA 3NGDA 3L7PA 1HW9A 3IM9A 2RNEA 3S8SA 2NQPA 1X5OA 3OL8A 3MM5A 3DM2B 4OJ3A 1FFGB 3R5AA 2V4QA 4AQYJ 3SEOA 2NSCA 1SJ3P 3DRYA 4BC7A 4LBIA 1WKLA 2DK2A 2UV8A 3CO0P 3K5PA 4TNOA 4ZOSA 4HHHA 4ED7A 1PG5B 1FHTA 2YWFA 2I1RA 4I2PB 2R3VA 2Z8QA 2GZOA 2XMAA 1WELA 4UUWA 4F4AA 5EN1A 3FZ2A 3X1LB 1S5ZA 3TANA 3C6UB 4IRKA 3JQJA 3MEGB 1RADB 2ZH3A 1NJZA 3PRDA 3AOBA 1SC3B 3IGVA 3FCHA 1TV6B 5F8MA 2IRYA 4TKTA 4DN9A 9RUBA 3BH7B 3PEJA 1NM2A 1SI9A 1N5YB 1NKBA 4GRSA 1FE0A 2I0XA 1LWFA 4QU7A 4OHXA 2KZZA 3BR8A 1RT4A 1GAOA 4FNIA 1FTCA 1E6VA 3LGNA 3K5MA 3OW2R 1I3OB 1BQXA 4J9NA 2AMCB 3N6MA 2DR6A 2HS3A 2MQMA 2ZH4A 1SQEA 4QYRA 4B3MJ 2YH0A 4LFAF 4NZ0A 4U9RA 2K7JA 2ZC3A 1EJ7L 3CDEA 2OH2A 5L1LA 4O3PA 4C7QA 2A18A 5IQ6A 3CXCR 3KMQA 4RNNA 4LF6J 3OSPA 3LGMA 1BUXA 3CIMA 3WX8A 1HNZJ 1FJGJ 1CQMA 5IC4B 4NYZA 1WNEA 3PO4A 3VVUA 2CPIA 3ICLA 5LXRA 2VHGA 3DLEB 2V9KA 2VPZB 4LF5F 1ZTTA 4OZ0A 3EZUA 3M05A 1DQ9A 2CQBA 4PQUB 1NEEA 1X8DA 2ROPA 1KTVA 1RYRA 4PG6A 4DPTA 3MPWA 3FMWA 4I2QB 1NH8A 4I7FA 3KJFB 1YJUA 1UCNA 3C16B 4CTAA 8AT1B 1HWKA 2IYGA 1YITS 2KXHA 1DAXA 4YB6A 3EGZA 2ZFHA 2Q6CA 1YI2S 1RTHB 4R25A 4ZN3A 3P45B 4OYAA 4QQBA 1RT3B 3SIPB 3Q22A 2XB2D 1R8BA 1VJWA 4WFYA 5GMKa 3JYTA 3M30B 3NG8A 3LWLA 3VAIA 4ED0A 3AJ1A 1S1UA 5IM0B 3CMES 1SB6A 1TL5A 1J27A 2VFTA 2QE5A 1NBEB 5ETLA 5B0DA 2M0GB 1YRXA 2YXLA 1M5HA 5ETPA 4ETZA 4QWBA 2JJ4D 2J9CA 4L73A 3MMBA 3TYTA 2DR8A 1FNXH 1TL4A 4JV5F 2Z56B 3J7YU 2YX1A 2OI2A 1RU2A 2RKIB 2MQQA 4FBUA 1YJNS 2A3JA 2VC1A 5KAKA 3FQLA 2NPIA 3SCIE 3ZNUA 1XNQJ 3DLBA 5D77A 4MAKA 3IS9B 2MLZA 4A8MP 1FRIA 1HBOA 2MB0B 1WTBA 4B3SJ 5KFBA 1DBDA 1WHYA 4K59A 2DGXA 4X4TA 1WC3A 4DSJA 3LP0A 1YVFA 3KG4A 5HP1B 4RW9B 3OR1A 1SJRA 2ASLA 2LVWA 3G6XA 2PE8A 3F56A 3VGSA 3TUZC 3HX9A 4M1KA 4GVBA 2E5LJ 4PWWA 1LWEB 5L9XA 2MHNA 1Q16B 3C6TB 2JX2A 1RDRA 1UVLA 2L9WA 3CTRA 4FYWB 1T3OA 3RUBL 1S99A 3LGHA 2AJQA 4IFYA 2Q43A 3M32A 1HBUB 3H2VE 1UW4A 4IFVB 5L1JA 2Y8WA 2KM8B 4LMZA 4HI1A 1IKWA 4FDFA 4M5NA 4QBUA 2KM8C 3CF5Q 3KDOA 3ZZPA 3O8WA 2CQHA 1NDPA 2V2ZA 2DNYA 1NB2A 1FKPB 2B51A 3MWBA 1V3RA 3M6WA 5KFOA 2HAIA 3TRGA 3RW7A 3DYAA 2M2BA 3MM5B 3Q8YA 2VA3A 4WZMA 3KLFA 3SCLE 2DNRA 4EBDA 4FF3A 1B70B 3IAM9 2R8IA 3T1YF 2VOPA 3UCZP 4ZJLA 1OYDA 2ZZTA 4E2FB 4U67Q 1NSAA 2J0QD 4O3RA 4QWAA 2ACYA 5IC6B 1RHMB 1N0VC 3GIIA 1SKUB 4JB8B 4PYDA 2CJ9A 1U6FA 1QSSA 1FD2A 2J8AA 4IR9A 4DJBA 3I87A 1ZTWA 4OHZA 1FFWB 4DV0F 1WI6A 4AL7A 3T1HF 1XWLA 2W7AA 4AYBD 3IR7B 3DOKA 4KHMA 1BHNA 4DCOB 2ZBCA 5I3UA 1OYEA 4ECTA 3OT9A 2FZKB 3Q8PB 4I67A 2AHOB 3FBFA 1X4CA 1ZPVA 3R5BA 1QVGR 3IA0A 1S1XA 1YLXA 1D3WA 4ZVEA 1M5SA 3TJAA 3LANA 4LF8J 3PX0A 1LWFB 2RF2A 2DKOB 1XMOF 1RT4B 2Y0SD 4RLEA 1UFWA 1YX2A 1E6VB 4MKBA 4JI6F 1N54B 3T19A 3GJSB 1N0UA 3FSIA 1EX8A 2ZE2A 2CG4A 3HFZB 3A4TA 2DGSA 3SDEA 2J6UA 1QDUB 3D68A 1TKZA 1B0TA 3CCTA 2F4VJ 4HDHA 3G6ES 3HDSA 2JZ5A 1RTIA 4CH7A 3OTBA 2YWHA 1H2TZ 1VOMA 4AL5A 3O3LA 2F65A 3H25A 2HRTA 4F0MA 1HARA 1IWGA 3J7Z5 1HBMA 1LOUA 2W9AA 3TUIC 2MSSA 4FN5A 1RXOB 1EAYC 1DRZA 1LWXA 4P52A 3S7RA 2RDJA 4K5RA 4DWIA 5E41A 1X9SA 3M8ZA 4C3MA 4M5GA 2QLJB 2QMWA 4EUVA 4LSLA 3KG1A 3KLHA 1AA1B 1YK9A 4DL2A 1H3DA 4CTAB 3HK2A 2BANB 5J2NA 3BEGB 2F5GA 1EP4A 4LRAA 2DPIA 2BACA 3TX8A 3CCLS 1SKSA 1VK8A 3MUVP 4V19X 4KY3A 4F36A 2VDHA 2QGFB 4USIA 3D67A 5SZTA 5CYQB 4J9SA 2BE2A 3HHLC 1RLCL 1YJ9S 2DHAA 1EETA 1T3NA 2DISA 2MSTA 3DRPB 2ZEJA 1S1UB 3UE2A 1VMBA 3HD1A 3PJ9A 4J9MA 5C7PA 1XERA 3S6EA 2QO3A 3NL0A 5F8GA 1S1VA 5M2UA 4OV6A 4RW6A 4A47A 3QZ8A 2XS5A 3T5JA 1U26A 4WTOB 3KHRA 2LXFA 3MMBB 4FF1A 2RQ4A 2ASYA 2MEWA 2KI2A 4H4OA 5CXTA 3EGNA 2XLJA 4CLLA 3H5SA 3J80Y 4CNZA 3E3XA 1IVZA 3IWXA 2DGOA 2Q79A 4NZ6A 3OSNA 1Q4RA 4ED3A 4LBPA 3IRXA 4DQSA 3D6FB 4RU2A 2VV5A 3I96A 2LA6A 3PKYA 5KG7A 3ISND 1WDDA 3MEDA 2ZHBA 2W2NP 1EQ0A 3B8HA 4DX8H 2G0CA 3V4IA 2CJKA 3LP0B 4OZJA 5GAHI 2VL1A 1TL1A 3QATA 3OR1B 1ZM4A 4Y28C 2PN6A 1WHWA 2JVOA 1YSJA 2LMIA 2BKOA 4GVBB 3KUEA 1RBOB 1KBRA 3ZFVA 2QC3A 1KRPA 5CZVA 1TELA 5HQMA 4TU9A 1S49A 4OZNA 5LOQA 1PCAA 3CMQA 3M32B 4USVA 2ZH5A 5IV3A 4NLOA 3BKFA 1U1RA 3C19A 1M5PC 4ZPWR 1WG4A 4I68A 5DDQC 3BDPA 3CDAA 3QT5A 3PV8A 5CQGA 5DDPC 3BPDA 5JJBA 2VOOA 2ZKTA 3CJ2A 3W9HA 3B6BA 5CA5A 1MU2A 2X3GA 3DYAB 4KGKA 4GKJF 1KQSR 1MMLA 3L09A 3KLFB 2H4WB 3TEHB 2FC8A 4LUBA 3Q8QB 1M5VC 4DSIA 3SQGB 3FBCA 3QYYA 2E7XA 1S4EA 1T9XA 2HFNA 4Q43A 4LBHA 2HVZA 1C1CA 2CVEA 5KFJA 1FNMA 2OAUA 3HPOA 3MM9A 2IM1A 4CO0A 1NJXA 5CD4A 2MLYA 4ZVRB 1KQGB 2JFKA 2VQFJ 4UY85 1JLGA 1PC4A 2VG7A 2HFSA 2RAQA 3DOKB 2KT5A 4LVNP 4PYAA 1U4BA 3AXKA 2XWXA 3RU0A 1N32F 1TK5A 3W5ZA 1GT8A 3MGJA 3QIPB 3QRPA 1FDBA 3I4HX 1S1XB 1L3SA 4OYXA 2CQGA 2W7OA 3F41A 3NS6A 2RF2B 2YWWA 3TP2A 5HI7A 5C2GA 4M5HA 4JV1A 4JYAF 4A8YA 2AYBA 2XI2A 4LF5J 4B3TJ 2UU9J 2YQ0A 4RW8A 2ZE2B 3M7VA 1X4EA 3SDEB 1RCXB 4ANCA 1TKZB 1UZDA 2OFGX 2AV5A 3GIJA 2WBRA 4RJVA 1RTIB 1RJJA 2Y1JA 3GFHA 3KMSA 1X60A 1TU0B 4LQ3A 3WIUA 2FZGB 1HBMB 3KK3A 4IH5A 5KFDA 4KPYA 2BOAA 1L3VA 4NI2A 2MQ8A 2UVRA 4JI7F 4ZPVR 2AYGA 3KLVA 1VIOA 1QE1A 3I9V9 3R7BB 2W9CA 3J80U 1RK8A 2IA6A 2ZHOA 4DV6J 5DETA 1OIAA 1V5IB 1D9FA 3GILA 1GQEA 2ILZA 5I3QA 5CH7B 4LSLB 3KLHB 3S01A 1G6BA 2XYGB 2BQRA 1CBKA 3MM6A 3UN5A 3T5KA 1ROFA 1EP4B 1HQ2A 1RWPB 3CW2C 3RTVA 1MWQA 3B78A 1QUPA 4QPTA 4J9UE 3CNQP 2VJUA 4QR1A 2XS2A 5G0RA 3POTA 1MN9A 1U45A 5DM7Q 3VAJA 1F0XA 2O67A 4NASA 1EETB 3GQCA 1T9YA 2CPZA 3UPFA 4DPXA 4NL5A 4ECQA 4MKAA 1KQKA 5A8KB 4IDKB 5KFLA 3GU0A 1RWOB 3KLIB 1S1VB 1KVIA 1T9WA 3GV5B 4RW6B 4DL5A 3I4PA 2HHHJ 1VYAA 2HBQB 2WSCC 2R7TA 4H4OB 1SQFA 1Q81T 2W2OP 4RKUC 2XO7A 1PIEA 3DU5A 3G86A 4GC7A 3NGTA 2H3EB 3AY0A 3TAPA 1ZM9A 4URQU 4B9SA 1U2FA 5G4DA 1VRQC 4DR6F 3W7BA 1HNIA 3MEDB 1UA0A 2Q3PA 2MY7A 1NCLA 5J1PA 3PTWA 1UMJA 5K8OA 1W7WA 3V4IB 3CB4A 2ZM6F 2E9RX 5D8HB 1YHQS 3AH6A 3MZIA 1S6QA 4WKRA 4ED2A 4ED5A 2GAHC 2YPYA 4YY3F 2NXEA 1WKJA 3GIMA 4HTIA 3HVTA 1HLWA 2DXFA 5LMNJ 4NE9C 2XY6A 4PPZA 3O6QA 5LXYA 4ECWA 4DG1B 1UPMB 4IG3A 4ZP9A 3MUMP 2YKOA 2MQPA 2RQCA 1S1TA 2AJ1A 4Y3CA 2WW4A 1UW9A 4N5SA 2A6MA 3OHBA 4Y00A 2VA2A 2MHEA 1C0TA 4DV0J 5ITHA 3RB3A 1S4FA 4F25A 2P6TA 4ZN1A 4EZ6A 2D74B 2F8EX 5E3RA 1OQ3A 1MU2B 5FDLA 1WEXA 1RWNB 2NZCA 4OYZA 2YKMA 2BE7D 1F3FA 2ZHAA 2C42A 2GGPB 4IH6A 3OL6A 3MEEA 1CULB 4UW2A 2CWKA 4QYZJ 2B9YA 1XIQA 3IG1A 3PW5A 4FYVB 4B9VA 1XMOJ 2J0XA 3DLGA 2GO8A 2QYCA 2R8KA 3T41A 5BXIA 1C1CB 2XCAA 5EWGA 2DO4A 1RHRB 3MM9B 4BC9A 2M9KA 2ZOFA 4DR7J 4NWBA 5KFGA 4PG5A 4BLGA 1NK7A 3PX4A 3FCVA 4X66J 1JLGB 2VG7B 3DRRA 1HBNB 1ZBTA 2BZ2A 2Z57B 1IBKJ 5D4LA 3DMJA 3PFOA 1GFWB 1D0EA 4ZIWA 3W1YC 5IT9Y 3FDSA 4U7UK 3ILJA 4IRCA 2MXYA 3A8KA 3M8PA 4B9TA 3AOCA 2ZNZA 2FJDB 1IM6A 4C8YA 3IC1A 2DNGA 1WJ9A 3LPEA 4CCHA 1EQMA 4UQTA 4DPWA 4J9KA 3WC0A 3DNCA 2PC6A 3TAMA 3HVWA 3MMAA 2WVEA 2UVUA 5ETRA 2QLWA 3QAUA 3GR0A 5KG3A 3W5XA 3JQKA 2V2VA 4ZDNA 4CLFA 4X4PA 4KIAA 4EO8A 4WFBQ 1X4HA 1X0FA 3I0SA 2RHQB 1XN9A 2V4JA 4DL3A 4Y2CA 1PBAA 1KWMA 3KK3B 1U7LA 2CXEA 4AL6A 2EK1A 4WK3A 4UY8T 4NI2B 3BREA 4JV2A 3VAMA 3BR9A 1NRKA 3OTDA 2CNNB 1QE1B 1ZM3A 4F67A 2W9CB 1RWXB 2B0GA 4USTA 2FUG9 2HWHA 3C14B 2W8LA 4KHPF 2DNZA 4K4UA 5D4NA 2VIHA 2AEFA 4A8WA 4LF4F 4YS2A 5L1IA 2D3ZA 4DR5J 2FTRA 2MZ1A 3L4BC 2BABA 4ZA1A 5SUHA 3ZZZA 3PJWA 4DUYJ 2HPUA 2HSEB 3H42A 2HGNA 4NRTA 1W26A 4NEZA 5D78A 2X3DA 4P73A 5LJ3Y 3H90A 5G0RB 2KVIA 3LPYA 3POTB 3HJFA 3UDCA 2YKNA 5HATA 2O3DA 3A8EA 2ZC4A 1OMSA 2XLKA 1VQPS 2KH9A 4CRJA 4LR8A 2HBYB 3VQTA 3MPDA 2FVRA 1T0TV 4JBCA 2DNPA 4RBUA 1JLEA 2IBOA 3PNIA 2FPHX 1XR5A 1JJ4A 1JNZB 4LJMA 2B7CB 2DTJA 4KBIA 3ETMA 4ZJOA 2R2UA 4JI2F 1WD6A 3H4BA 2VBYA 1LXJA 4MH8A 1F2GA 2C2DA 3FMBA 1U2RA 1OY8A 3CCWA 2NUUG 1VQNS 3CE8A 3W5YA 5AE3A 2LXUA 4NX9A 2IRUA 2QFJA 1HNIB 4GKKF 3BM7A 2JEIA 1MNEA 2RU3A 3FCWA 4LFBJ 5K5MA 1T95A 2LP4A 4MFBA 4MTPA 3TZWA 1S9FA 2GW8A 4HT7A 3HP6A 1S6QB 3HSGA 2L9DA 3Q24A 5GAHU 3ET6A 3ADAC 4UOFA 1HD0A 2E7WA 4PEOA 4O3NA 3HVTB 1GMWD 2G2YA 4G1QA 2HEKA 2XQCA 3HZGA 1GXUA 5KFVA 4KKOA 2QT7A 5AJ3J 2CDRB 2ZZNA 2B56A 2Z4PA 4IG3B 5KFMA 2AZ3A 1S1TB 2QL9B 2AWZA 2KYXA 4FVCA 1AB8A 3Q86A 1N34J 2XHCA 2Z2MA 2ZWPA 2HWTA 3C66A 1C0TB 1JWWA 2R7WA 3TQ1A 1P1TA 4ZPDA 4Y2IA 3KUGA 3O2IA 1LEOA 4FP9A 3P49B 2GHWA 5FDLB 2IAJA 3PW0A 4DPYA 3KFWX 1XNRJ 4ECSA 1AZSA 1FT8A 2R2TA 2EXUA 2E7VA 2KO1A 2F7VA 2IJRA 1U0HA 3QT6A 3CJ8A 4NZ7A 2UP1A 5GADI 1Q8BA 3AD7C 2GNKA 2GA7A 2D1CA 4QYZK 3IG1B 3CCMS 3DLGB 4HHJA 2GX8A 1B3TA 2RUSA 2ADBA 1JXLA 1IBMJ 4ZKAA 4Q45A 2VQEF 4QIVA 2XNQA 3O1LA 1NSKL 1P9QC 2G4BA 3TNVA 2KU7A 3EYZA 3DRRB 1FJCA 4K4TA 4WXWA 3CT9A 5J1EA 1Z2LA 1VBYA 2KHDA 4YDXA 3WDOA 3DMJB 2YQ3A 3EE3A 4ZHRA 1H98A 2Y1LB 2V67A 3J7AN 1B0VA 4TLQA 1RE1B 3M6XA 4KYZA 2PO4A 1LW2A 1PILA 3M8PB 4OV1A 1BXNA 4ECVA 2HNZA 2DXDA 3DOLB 2OFHX 4JI7J 3THTA 1YGYA 1MWYA 5JVGQ 4NLGA 2X1BA 3CJ5A 2XMWA 3BDEA 4EYIB 2A10A 2Y8YA 2LEAA 3TAMB 6AT1B 3MMAB 1XR6A 5KG6A 5A2QU 2QRRA 1WORA 1D8ZA 1NHUA 3NS7B 5F8HA 1NHKL 1VRUA 2J76E 3RR7A 4F4XA 3N4WA 2FZCB 2VD3A 2VODA 5B0AA 2XNRA 3OXLA 5LT5A 4NLPA 1UETA 5I3PA 1IXKA 1KD1T 1Q8KA 3I0SB 2XMKA 4RBTA 2UUBF 3NEKA 1G3OA 4YB5A 5D4PA 4DQQA 4CDIA 1ICEB 1H74A 4CLTA 3D28A 3DOMA 4PXBA 2HQFA 4AE5A 2JHEA 3HKZD 3U27A 2IJNA 2V8VA 3V6KA 2VKRA 4UTGA 3W65A 4EYHB 2D3OR 3EXCX 3ZO7A 4LRCA 1WHXA 2HQCA 2VPYB 4AQYF 2K8GA 1Q82T 3KWMA 4F0KA 2W24A 3L3CA 1TAUA 2U1AA 1RT6A 2NXCA 2Z2YB 2NS1B 3HHLD 3DGPA 3I0RB 1NZ8A 4RUAA 3BGUA 2IIHA 2AX1A 4P7TA 1YJVA 3K7RA 3D2WA 2BOPA 3EWGA 2UXBJ 2ZDPA 4KB7A 4FYDA 4ILMA 2F8MA 2HW3A 4DR6J 1RUSA 1FESA 4CYUA 3OL7A 2EFVA 2XMUA 4WFZA 4ZPAA 1D9AA 3Q8SB 3RRKA 4C97A 1OJ4A 4DSFA 3CPWR 3VAKA 5ETOA 3OFHA 4QU6A 2R8JA 4M95A 3QMQA 1JKHA 2MKKA 3EMTA 3V81A 3OXGA 1KEKA 1TUGB 4R8UA 1HQEB 4UOGA 2J9DE 4J9PA 4W4MA 2OHDA 2VFVA 3ZZTA 3GB0A 4Z2XA 2RRBA 2VF3A 4ZVHA 2BKPA 4B3MF 4ZCIA 2A6OA 1LFWA 4DMZA 3BQ0A 4DL6A 2ZJRQ 2MY8A 2DIVA 2OO4A 3AJDA 3P5BP 3H40A 3UCUP 2B6AA 1WF1A 1FJGF 1DTQB 2KN4A 3E01A 2OSQA 2VBXA 4WIIA 1T9VA 2R7QA 1SXLA 3ET6B 1TZ0A 3X3UA 2WAQD 4XIUA 4N41A 1WTFA 4ZCLA 2E1AA 4G1QB 2AJFE 3NOCA 5DQIA 2YX7A 4A8FA 3RB0A 2BR0A 5KFQA 1RAFB 1PAEX 2HVDA 4R5PB 4U8VA 2X51A 4I1TA 3R5CA 3MM8A 3BKTA 2DO0A 4CM2A 5HLFA 3PVXA 2C3YA 3GZ7A 3A8IA 2XMVA 2QEXS 1S76D 4P2XA 2X1AA 4HT5A 2YQ1A 3OBIA 3ZTSA 2PMHA 2K3KA 2IAJB 2HFVA 4CT9A 2FHJD 3TVZA 3HHNB 2LDIA 5F8JA 2DY9A 1VQSA 1AZSB 4D3GA 4WF9Q 4B3OA 3AAWB 3GTYX 2ADCA 5AXMA 3NAIA 1F6TA 1VQ8S 2E5GA 4K5SA 3A3OB 1YIJS 2HLTA 2LQ5A 2FY1A 2W01A 3CD7A 4OYOA 2GCFA 2P9GA 3DLHA 4BHQA 2JLEA 3DLJA 2GQCA 2DNHA 3DFEA 4KO0A 3N79A 5CZXA 2R8GA 1QM9A 1TP7A 5H9FJ 2E9TA 5J1EB 2BYCA 3P5TL 1GXLA 5KFRA 2XI3A 4LSNA 5DJBA 1RAHB 4IRDA 2VFSA 2UVVA 4P74A 2BM1A 2LA4A 4FKYA 3DU6A 2P5VA 4B3SF 3CD6S 1LW2B 5F41A 2GVZA 2BDPA 2GQ2A 2PFDA 3QJJA 4DR4J 2HNZB 5BYRA 1RBLA 4O44A 4RL1A 2ZUAA 3BSOA 1CJUA 2EW9A 1ITPA 2CPDA 5IS2A 2DHHA 2FY8A 5FLXY 1G1XA 4LVOP 4GO7X 5HBMB 3NGSA 1VRUB 1RAAB 1K47A 4LF4J 2AW0A 5BYQA 3BYRA 2AZ1A 7FD1A 1SH3A 1W2IA 2ZBRA 2WZ1A 3TZZA 3WC2A 5DGBA 3IBCB 2POKA 2EWHA 1GEHA 2IDLA 2VFRA 2NPFA 4JI5J 3UNGC 5B0GA 1S12A 2H1YA 3DOMB 3M8RA 2YH1A 1FI4A 2HK3A 3R8YA 2JC0A 1K1QA 4ZCKA 5ETTA 3US5A 3HKWA 5ETSA 3MEGA 1CPZA 4WYLA 5B0CA 1NDLA 4M5KA 4QW9A 1HWUA 3AB2B 2B3TB 4QR0A 4K4SA 1S59A 4WFXA 1U24A 4RWXA 1FD8A 1HL6A 2QLXA 5T7LB 3UQSA 4ER8A 1RISA 1FWKA 2R4FA 4ZLJA 2HKEA 1T02A 3NAHA 2MJUA 4CLYA 3K59A 4AT1B 1RT6B 3RB4A 3H0PA 4TN2A 3RJMB 1SJ1A 4ZP6A 1H2VZ 4NYPA 2HHPA 2E1RA 4I56A 1S57A 3QLHB 1VIXA 5L39A 1HFEL 3FK4A 4W98A 1WF2A 3QGPA 1HQUA 2D3UA 2XMMA 3ENWA 1LXNA 2W4PA 3BB5A 2VH7A 4DL4A 2BJ1A 4LF9F 1X5PA 3OXFA 2LQ8A 2HIYA 3GIRA 4ED1A 1R31A 1TFYA 1JKHB 1U1LA 3K2YA 1PYSB 1RBAA 3QT8A 2MKHA 3V81B 4R8UB 4LF8F 2IM2A 1T05A 1R8AA 3KJNB 2GIQA 2ZD1A 4KGMA 2M4MA 5CABA 4CLKA 2YNIA 3SV3A 5L9NA 2JC1A 4TVAB 2HBRB 4CT8A 1K1SA 5IT4A 2QYGA 2LYVA 2E1MC 4DR2J 2F4VF 4PPDA 3T1AA 3CJQA 1FK9A 1JB0C 3N0VA 2IHR1 3I56S 2E5IA 2V94A 2HGMA 3B4MA 2QLFB 5KFFA 1QUVA 3QNWB 5IXUA 2B6AB 4CWBA 3W63A 3E01B 5LL6d 1RT3A 2YWKA 5HO4A 2G1HA 2MMYA 2V9WA 2DGTA 3HHEA 3LO3A 1SIZA 4PKDB 4QIEA 4RNOA 3AJ2A 4OHWA 2WVFA 1W2BR 2CADA 2V2KA 4QWEA 2ZBQA 2XZWA 4JUZA 2CUYA 5KFCA 2U2FA 1VQ4S 4ID5A 2HQIA 3VHQA 4P75A 2JEJA 3NP5A 4IOAQ 4ZVUB 4ZVFA 4ZVQB 2HRUA 5HLFB 4ECUA 2CNOB 2DNOA 2WVBA 2RKIA 2CRLA 3MCOA 2VQEJ 2QX0A 3C46A 1S9EA 4WZQA 3Q83A 2HHTA 1RHKB 2MYFA 2I6WA 2X1FA 3MPUB 5FLXU 5DG7A 1LQ9A 4JP8A 2E5JA 1RT2A 3IS9A 2F63A 5HMZA 2B4UA 4L72B 3Q8UA 2EG1A 4B3OB 2K1RA 2FJAB 3IR6B 3PIPQ 5B08A 3G8QA 2QA4S 4FXDA 2NXJA 6FDRA 2PD1A 3PXGa 2B4PA 1TFWA 3PACA 2MQOA 1U6ZA 1ZAXA 2LFVA 3CD5A 1AXQA 5HP1A 5A76A 1URNA 1GTEA 1WEYA 4RW9A 2Y0BB 2R7RA 4PZVA 3AA9A 2XMTA 3MFHA 4DLEA 3BSAA 5DM6Q 5GAEI 8RUCA 5KT2A 1JMTA 4B02A 2RUGA 3DKDA 3VF0B 4KO0B 3SFGA 3TAQA 3AOAA 3OR2A 4C0HA 1I5OB 5H9FK 2IFXA 2FHMA 3KK2A 1UL3A 1VGYA 5KFEA 4LSNB 4X4RA 2E1CA 2B43A 4ATNA 1N5VA 3R1LA 4DLGA 2J9EA 1DJ0A 3PY8A 3BO2A 1FRHA 1I94J 2UUBJ 2RS8A 2GVZB 2BE9B 3TA0A 1FKPA 2XY7A 4O44B 3FC9A 4TQRA 3SCKE 4X4QA 1CJUB 3QJPA 2RS2A 1DHMA 3D0HE 1QJHA 4NLXA 2C2EA 4KQZA 3JSRA 4PG8A 5D0HA 4PG4A 2H5IB 4JI4J 3PM9A 2KFYA 3VR1A 2RQKA 3NLCA 3W60A 4WK1A 2AEMA 5E7OB 5K8NA 6FD1A 2VJVA 1KLMA 3GCWP 1Z4UA 1OY9A 4CLSA 4RNFA 2XCPA 3FBEA 2E29A 2DRDA 4ES2A 2RDDA 1X4GA 3MR5A 3ELHA 2F40A 5ETQA 2X7IA 2FJBB 4FPIA 5HQLA 3GJRB 4A8SA 2N82B 1VQLS 1NSPA 4E0DA 2K06A 2WVCA 3PW2A 4DR3J 1B7FA 2D41A 2XC9A 5F8IA 2VONA 4RNHA 2LLZA 1FDDA 3DDIA 2J9DA 1VDHA 3T5HA 2V69A 5BJRA 2NSBA 5DZ6A 2H4YB 1IQZA 4NLWA 3MM7A 2WSEC 2EFGA 1UWBA 1K8AT 2AJ0A 1O5JA 3E51A 1JLCA 2RVJA 4BWMA 1PJ5A 1NSQA 2VQFF 2VPWB 1HQUB 2OTLS 1CJTA 1SUQA 4E8UA 1L3KA 4KHRA 2HAFA 4USHA 2OD6A 3EX7B 3IRWP 3O44A 3G6VA 3Q2SC 1RTZA 2FQQB 1UZHA 3W2VA 1WC4A 3BN7A 5K9FA 3NMAA 1S1WB 3M2UB 1T05B 2OGUA 1KR4A 5EWEA 3VAHA 2ZD1B 1RWVB 3V5RA 3UDLA 2ZH7A 4B3TF 2YNIB 2UU9F 1SC1B 3Q23A 1V3ZA 4NEYA 2BVZA 2GMJA 3W8GA 3H8YA 3P6YC 2GFFA 3V6JA 1RA6A 2B9WA 2DRAA 1F2HA 5K8MA 2R7UA 2BANA 4UUXA 3HSJA 1FK9B 4G6VB 3ITHA 2DCUB 4OI6A 4EFAC 8ATCB 2XWYA 2MZRA 3NWGA 2XYHB 3D3BJ 1BGXT 5KOWA 5B0BA 3IAS9 3G8TA 5CYQA 1OWXA 1X5TA 4O3QA 4CO1A 4Y65A 3WIVA 1UVIA 1VHIA 1UTAA 3T5LA 2UUCF 3EDQB 3THPA 1L3UA 3HZEA 2JLGA 2JEFA 3DRPA 1R6VA 2IPOB 2KT2A 3G96A 4ILLA 3TR5A 4DV6F 2D7SA 3BPSP 4G1IA 4LIRA 3GFZA 2XBPA 4NMXA 4OLPA 2ZBPA 2Z0GA 4LT6A 2J6TA 3M1VB 2CZ4A 5CAAA 3OLAA 4ID5B 3AD8C 3M8WA 2G9OA 1FRMA 2NYHA 3CUNA 3TA2A 2YBVA 2DHXA 2YNGA 4I69A 4OYIA 1JLBB 3RAMA 1YG0A 3QGGA 1VI7A 3MECA 2CG8A 1S9EB 2VG6B 2FJVA 2CJBA 1J2VA 3HJVA 4DHVA 1NPPA 4F3OA 1T03A 3K5OA 3ILLA 2I5JA 1RT2B 3GPAA 5A8WA 1VLOA 4HEA9 2OELA 1UPPA 2K1RB 3CDWA 2FHOB 4F3MA 3H20A 2IMWP 1FERA 2RU9A 4C48A 4PRFA 4DS4A 4NYOA 2OMOA 3BN4A 3OVBA 2KG1A 5E3PA 5DDRC 1IR2A 3E2EA 2EC2A 1H2UX 2HHHF 2OLWA 2FVCA 2GIRA 3FSXA 1Y5IB 2DHSA 4J7CA 1JLQA 4ED4A 2Z2ZA 3ZTRA 1UP1A 1KVJA 3KYLA 4DV3F 1RB0A 4WFAQ 5HANA 3OR2B 5T41A 4CLUA 1NPKA 1YJWS 4WP8A 3KK2B 3ZTQA 4KSEB 2MZJA 4C8NA 4TYAA 4OMFG 2W9BA 4LRDA 4Q2MA 5D0GA 2J0WA 3FUYA 3R1HA 4XDCA 3QO9A 3RR8A 1Y3JA 4ZIVA 4ZPTR 2KHCA 4MIAA 3CCES 3P4UB 4DV2F 2O66A 5JUMA 4UOCA 3IGNA 1YDLA 1V6HA 1WDTA 4KV8B 3NNCA 5LSOA 2BMBA 3HFVA 5LMNF 3R3TA 5DLFA 3MD1A 3MCSA 9ATCB 1VCTA 2KL8A 1KLMB 3SQGA 1AFJA 1D09B 5A6WA 2E66A 5EWFA 4FBTA 3CDUA 1FO1A 1R3NA 1ZAVA 3GCXP 4NLYA 3IWLA 4ICLA 2CNLB 2WRMA 3EGWB 1YTYA 2Y1RI 2CQ2A 1QVFR 2DEIA 2UUWA 3FZBA 1XEZA 1ZETA 2P2CB 1P9YA 1IBCB 2HNYA 3CEDA 1FA0A 2XTJP 3KKFA 3VV2B 2QSFA 1DZ5A 3U1MA 4KAIA 4B3RF 1ZPWX 4DV4J 1KHVA 2YKPA 4LF9J 3TVYA 3OJUA 3QIPA 3TARA 1K0VA 5KFXA 3PHTA 2HFZA 5KTQA 2IC3A 1YRTA 4F4WA 3PDNA 5H1SV 3PX6A 4KGXB 4U95A 3ISNC 2AJ4A 4KPCA 3MM7B 4NCBA 4XK8C 1CVJA 2XSFA 2OIHA 2VU5A 3OVAA 1UWBB 4DR7F 5I42B 3KLGA 1JLCB 1QAJA 3IXQA 4X62J 4YR3A 3PFEA 2DR5A 4X66F 2UZAA 4DDFA 3SSRA 1CJTB 1IBKF 1N36J 1SUQB 3AT1B 5H9EJ 2GQQA 3DLKA 4X4VA 3LF0A 2KKHA 1NK6A 2V8PA 3W2VB 2CPEA 2PMWA 3PYFA 2BJEA 4QIFA 4CH0S 2FLLA 2MKJA 5EDWA 3I5BA 3EUNA 3I9ZA 2H5JB 2DVIA 3KNAA 4CO4A 2MLXA 1Y5LB 1UEKA 3GV8B 1KLNA 1V9OA 4FF4A 2KVQE 4RW7A 3R2DJ 3DN9A 3J81Y 1X31C 1UJ5A 3AODA 4K4YA 3SSSA 3FEXB 3UCGA 4IOCQ 3PRBA 3QFHA 2O5DA 3ITHB 1H7XA 1JQGA 4RBVA 4WP3A 2CPHA 4YEAA 1EZZB 4USWA 3JTNA 3PW4A 2GV1A 4CP5A 4PXDA 1FKAF 2CFXA 4OHVA 2UUTA 2CQCA 3FRYA 3PO5A 3WHIA 5HROB 3HCXA 3MTJA 4DR1J 4CIOA 1X4BA 3RGIA 1N5QA 2JOQA 1TUWA 1YWXA 3MI7X 5A8KA 2KTQA 4IDKA 4B08A 2NXNA 4MMOA 2FLNA 3VZIA 3KLIA 1HYSA 3BO4A 4DR5F 1F9EB 3LQVA 2YNGB 4DUYF 3EM1A 1KFSA 5KG0A 1RKIA 2G0IA 1J5OA 1CG2A 3K8WA 1NK5A 3MECB 3N28A 2W4CA 1JJCB 3M2VA 4J37A 1T03B 2ATCB 2E5HA 5D3GA 4K2JA 2I5JB 3LW5C 2OEJA 4NLQA 1ZZNA 4K4XA 3KHHA 3DHWC 1PJ7A 5A8WB 4FF2A 1OPIA 4UF4A 2W8KA 2AD9A 2ALZA 4ES1A 1FTRA 4RR5A 4Z7YA 7AT1B 3WX4A 4DS5A 4XDDA 1UVKA 4NOHA 4YN3B 2APOA 2OTJS 1VQYA 2L08A 1UWAA 5KFYA 4NCGA 1JNRB 4DL0C 4KRWA 3G82A 2JLFA 3TEGA 1JLQB 4E98A 4H54A 4I6AA 2WVDA 2ROGA 2ZZMA 3VZHA 1C4AA 1RWKB 3D3CJ 3U7JA 5GAEU 3RG6A 1J5EJ 3TQEA 4C3LA 3S1TA 4OI1A 3IP0A 4DG1A 1K73T 4P2FA 2NR0A 1PAUB 4WU2A 2W9BB 2LKZA 3W61A 4GO5X 1P8GA 4KT0C 3UW1A 3H2LA 4LFBF 4M63A 4K7QA 2AT1B 5KT4A 3QO9B 4UQGA 4IUFA 4WE1A 1YQHA 3I82A 2F9JA 3CGIA 3FQKA 2PSZA 1FF2A 5DQHA 3MURP 1B64A 4P10A 3NBPA 1H73A 2DHGA 1G4CA 1X9MA 4EU0A 1HNVB 2P8IA 3KUHA 2R8HA 3CCRS 3KOAA 1U8WA 4TU8A 2H9ZA 2OEMA 2PEHA 3W8PA 5M2PA 4NLDA 2J7KA 1FEHA 1HPZB 2GGPA 4IKAA 3RZAA 1NKEA 1CULA 2L9NA 2IYIA 3OVSA 5AJ3F 1S9GA 5B7WA 3UDVA 4X4NA 5C24A 2CQPA 1CJVA 1C4CA 4ICLB 3BSCA 4P2MA 2AX0A 1N34F 1NHVA 1N33J 4XO0A 4OLOA 2CIMA 1JLAB 3R2CJ 3WBZA 3Q89A 2C2OB 1RKJA 2HNYB 1LV5A 1O6XA 3IN5A 1PKUA 4J90A 4OI2A 1HBNA 4LF7F 4WYWA 1SKWA 4UZBA 3BO3A 4DSKA 4XAKA 3HLUA 1X5SA 4RUBA 1O0PA 3ENVA 4J9OA 1XNRF 1C2PA 2FIUA 4U7UD 3TJ8A 1KDNA 3ENAA 3DGVA 3J81U 2RSQA 3BYPA 3KLEA 4FXWA 2IC3B 3BKUA 4KGVB 1ZA1B 2CPYA 2V50A 2B8QA 2IRXA 3RW6A 3CULA 1FXRA 3IWNC 2OUGA 5F9NA 4M8LA 1RA7A 4LR7A 5FD1A 4C3KA 2V63A 2Q1LA 1CLFA 1EIYB 1WEZA 4M5DA 4AXJA 3MCMA 3W2WA 2N7CA 2C3MA 1PYTA 3H5UA 2COLA 3GLJA 3KLGB 2WB1D 2QA2A 1R8PA 4DSLA 1IBMF 3PYEA 1HHTP 4IQMA 2VBZA 5KFIA 2AGQA 2HYIB 3RBEA 2P9EA 3R7SB 2CYYA 3CCJS 2DBBA 3UN3A 3LP1A 5FJ4A 4I4BA 3TI0A 2X1GA 2WOMA 2K7KA 1WG5A 5H9EK 4I6WA 2J5AA 3DLKB 1NK9A 1GMWA 3CDBA 3D5MA 2N3OA 4C4WA 2BV3A 1U2CA 5HMYA 4CLZA 3BS9A 3N9UC 1VQ5S 1KTQA 4O0IA 4HACB 3HFKA 1A9NB 1Q78A 2UUCJ 1SPBP 2OPPA 2EC0A 1U1KA 2NLWA 1KC8T 1WOSA 3EZOA 3C14A 1YJ7A 4RW7B 2DEJA 1GX5A 2XMJA 1VQ6S 4EBEA 2CQ3A 2H54B 2ZOMA 4URGA 3EDRB 3IFEA 2XO6A 3HI9A 4YP3A 1T9UA 4HDGA 2HRYA 1SVDA 2LQ9A 2C3OA 4F4YA 3PYDA 2KB2A 4FKXA 1Y4ZB 2LECA 1VK3A 2BJ8A 2JL9A 1AUSL 2WB4A 2BBEA 1QSYA 3L9ZA 4J9QA 4ZVPB 3NXZA 4QIGA 1QY7A 4DEZA 5DDOC 4W92B 2F4FA 1FX4A 2Z2LA 4PQAA 5B09A 4MIBA 5IOLA 2A0FB 5L8RC 5KFHA 3MTKA 4KR0B 4NLVA 3U1NA 2J6SA 1SH2A 1YBTA 2EBEA 3MXHP 1HYSB 1MG7A 3J7ZT 4V19J 1GMVA 4C9DA 3MR6A 2YY3A 4X4OA 3P96A 4CLPA 4JI1J 3I6PA 1S0OA 2KDOA 4R0JA 3VGUA 2Z58B 4V1Ak 2C2RA 4DCPB 1UVMA 1J5OB 2ZVSA 3BGOP 1SH0A 3GSDA 3WZ0A 2EKNA 3KHGA 3H2UB 3M8YA 3MD3A 1R0AB 4DV3J 3M2VB 5GMEA 2GHVC 5U47A 3VVTA 2FVPA 5D3GB 2UXBF 1JLFB 2HQDA 1U48A 1ZAWA 4N77A 1HHQA 1SJ4P 2RMLA 2CKWA 1APSA 4DZDA 5IFMA 3QSYB 5IQQA 4ZPBA 2J8SA 1QSLA 5HQ8A 5HK4A 1SIWB 7FDRA 2V8GA 4JOUA 4RZRA 2KJVA 4DN0A 2R7SA 4AD6A 4BS2A 3IR5B 4DV2J 1IUJA 4NCGB 1FEEA 3AHPA 4Y6IA 3G82B 3JSYA 1YJTA 2XGQA 3LTOA 3K57A 4ZP7A 4F2RA 2I2YA 1BE4A 3D1HA 2RIJA 1H72C 4A8XA 1YZ7A 2CPJA 1NH7A 3N01A 3LP2A 3C2PA 1VR6A 3W3SA 3ZTOA 1AUDA 1C0UA 1R7IA 5J2QA 5DRKA 4YB1P 3DRXA 4WE1B 4TY8A 2H48B 2DJWA 3T9NA 4NRUA 2HS0A 1HNXF 5KG5A 3NBPB 1UJ4A 2CPFA 4XTTA 2HIQA 3P8BB 1Z1ZA 3IO1A 4B3RJ 1L5UA 2B4OA 1XK8A 3HHLA 5ETNA 4DUTA 4C0OC 4OIXA 3NWRA 4ILRA 1F9HA 2YVSA 1Y10A 2DH9A 4DZ6A 1S9GB 4K50A 2ZH9A 5C24B 2KRRA 4LFCJ 4USKA 3HSDA 1CJVB 1KVKA 5DGAA 4PXCA 2OMLA 1URRA 5LSRA 1U1QA 4A8QA 2MQNA 5IZHA 4NLUA 4NXMJ 2GHPA 4PABA 4ETXA 4WP9A 1GNKA 2EBGA 2FHKA 4X65F 3CO9A 1HR0J 2QIFA 1NLKL 3CJ3A 4Q7AA 2QA4G 3W62A 3CSKA 2EEYA 2UXCJ 2NYIA 4QW8A 1WOPA 5J2PA 4ELVA 3KLEB 5EUHA 3KK1A 4JI3F 3K5NA 4FNHA 3DOLA 1Z2ZA 4ZVOB 2F3JA 2OEKA 3E8OA 3L7UA 3RBZA 4C2MA 3N6LA 4M5DB 4P7VA 1IKVA 3W2WB 2QLBB 2YNFA 2GAGC 3C3LA 3HO1A 2HNDA 4B17A 3G9CA 4OI4A 2RT3A 1TKTA 4OZ1A 3LP1B 3EVOA 2YKAA 5HAOA 1NDCA 2BEFA 2WOMB 4LRFA 4QWDA 1KN6A 4NA3A 1KHWA 3P3DA 2DRBA 1N5TA 3OTEA 2YNHB 2LQBA 5KFTA 3D9BA 4DR4F 3BQ1A 2MJNA 3BV8A 1ELOA 1VQKS 2DXEA 5KFWA 2XM3A 5CYMA 2OPPB 1BD6A 5EX3A 5LM7E 4X4SA 2OPSA 3D7SB 3A3PB 4ED8A 2PFFB 2GMHA 3MOZA 1PJ6A 1F5CA 2QG9B 3OTOF 1YRUA 3HM9A 2R2SA 2OPQA 1IKYA 1VQMS 2FHJA 1IKXA 3ETOA 2IBKA 5FIIA 3NCPA 1RAGB 2HQ3A 3NMRA 2PA8D 1RZMA 3W9IA 3I0RA 2BW7A 1NAQA 4OFZA 5L1KA 3JQMA 1OY6A 4ZJQA 4JI5F 1FWPA 4DV5J 4P6QA 2CDQA 1S79A 2R7VA 2MKCA 2BQ3A 1LNQA 1WG1A 1CC7A 4IYQA 5B0FA 2C1EB 2HBZB 4IG0A 3FRZA 4IOBA 4DFKA 3ZNJ1 4PG7A 2RDIA 2WTFA 4DX5A 1MMDA 4Q8FA 1EKRA 1BC6A 3OD2A 5KG1A 2KFZA 1CJKA 3V2UC 4OX6A 4DPUA 1HQEA 5J1NA 1HI0P 5A6PA 4DQIA 4WFNQ 4J9RA 3M9OB 1U47A 1MROA 1LW0A 3U1LA 1WI8A 5L46A 2QMUB 2I38A 4CM0A 5HJXA 5DO2A 1F5BA 2YX4A 5KFPA 1RP5A 1XR7A 2D9PA 3SFUA 5ETVA 2DH8A 3EVMA 4JI8J 2DNKA 2C2ZB 3SQOP 1FRXA 2JFDA 2VB6A 4PUOA 1DTQA 4IO1A 1N8RT 4FS1A 4OZ5A 1M1HA 4WJBA 2VICA 4Z37A 3PR4A 3MPVA 4J5OA 3N5FA 1SL0A 4AXIA 2PI4A 5JMNA 3RBDA 4NXNF 4OYMA 3THVA 1TKDA 4I6YA 1KSPA 3LH2S 4O3SA 1H6KX 2HGLA 4C8OA 4DR2F 4R5PA 3DI6A 4WU3A 4RW4A 5IT9U 3LP2B 3ZZOA 5AXKA 1KFDA 3UO0A 1C0UB 1NK0A 2YTCA 4I7FB 5J2QB 3CJ0A 2EKYA 4X4UA 2ZJPQ 4IR1A 5THWA 4TY8B 3GFYA 1YZ6A 1WF0A 2UV8G 4LF7J 3OQ2A 1LKZA 2BM0A 4X2BA 2VC0A 3QQCD 3HHLB 2CJYB 4QR2A 1WC5A 1WKKA 4K0KJ 3OJSA 4L76A 1Q5VA 1M1GA 3JYTB 1SL1A 3NCQA 3R5DA 2QSWA 4OX9J 3QGIA 4WCEQ 4K4WA 5KG4A 3BBBA 2DNLA 3PHEA 2HS4A 1KP6A 3D1QA 1S6PA 1HHSA 5F8NA 4AUKA 2CQ0A 2B7BB 5KFKA 1PGZA 5E3QA 1IQTA 4CO5A 1BWVA 1RTJA 4DV1J 4YFUA 5K8PA 5KFNA 2M8DB 2WK4A 3T6BA 4U7CA 4C0BA 2HWIA 5J2PB 3TVKA 1AT1B 3A13A 2DT9A 4ALZA 1XMQF 3NNAA 3KK1B 3QZ7A 1REVA 1NB7A 2ZITA 1RU1A 2EFQA 5LMUJ 1HBOB 4C6AA 5EX0A 1QTNB 2BJ9A 4P2SA 1VC0A 3R5GA 2FC9A 3EJMA 4FYYB 4N76A 2XULA 3BGLA 1OO0B 3AA8A 5C25A 3M6UA 1IKVB 2PA3A 1VC5A 5HBMA 2YNFB 4BDPA 4MYUA 4ELTA 1V5VA 4F8RA 5HMXA 2HNDB 4XPEA 2RJZA 3M6VA 4HL9A 1TKTB 3KTQA 1P6TA 3MDFA 2A2DA 2FDNA 2AP6A 3PR5B 2ERRA 3ONQA 4A8KA 1E6YA 4FYXB 3MPYA 1X0PA 2V4RA 4IFYB 1ZS6A 2BA9A 2QMXA 2C3PA 2WCXA 4KC5A 1M1KT 1I94F 4QPXA 5F9LA 2WSFC 1IKWB 4RO0A 3L7OA 1HMVA 3B82A 2W25A 4N8OA 2E1PA 3M2RA 5HJYA 4C98A 1NO8A 4Y2KA 3QWPA 2BW2A 1RAEB 1KOHA 5CYMB 2B9XA 4N7TA 2VBWA 1RWUA 3CCVS 2OPSB 3FKBA 4RUHA 3ENQA 2ILYA 2M70A 3KJQB 3SMZA 3IMQJ 4YB7A 4JI4F 5DG8A 2G1DA 1RWWB 1WWHA 4WIQA 1MW7A 5HVGA 1WC6A 2OPQB 3C15A 4G1PA 1IKYB 2D3O1 1SQGA 5T7LA 3HT0A 1IKXB 3BGFA 2QJ3A 3QPIA 4DL7A 4PAAA 4NMLA 5ADZA 3OHAA 2PT0A 2R9LA 1SV5A 2G2ZA 5LSLA 5F3TA 3GSIA 2DNNA 3D66A 1GTHA 2K2PA 2KXNB 3FEYB 3QLHA 4B9NA 5M2RA 1FWLA 5GMDA 4C8KA 1SL2A 4DR3F 2ZVIA 1TMMA 2L3MA 1VQ9S 5EHHA 2V0NA 4LFAJ 4IG0B 3OL9A 3GV7B 4HKQA 5ETKA 2M8HA 3M9MB 4HVZA 5I3UB 3IBWA 3UN2A 3D4JA 3G2XA 1B99A 1JX4A 1NK8A 3QJLA 1CJKB 1Y9OA 1UVJA 4GMKA 3MEKA 3VQSA 3G4SS 3AB4B 4ZCMA 1MROB 3TA1A 5GAGI 4CNYA 1LW0B 4BWJA 1YBUA 5MAOA 3PCOB 4OYWA 1RLDA 2FD2A 4IO9Q 3MAHA 3AXMA 4MJKA 4OZ3A 4QZVB 3RRHA 2NZ4A 1JJHA 1IJEB 3NRBA 3J7A1 4PWUA 3I55S 2EPIA 4I0WA 4PUOB 4GVLA 1X9WA 5RUBA 3HT3A 2IM3A 3NCRA 1HNXJ 1NPRA 3VTIA 5LJ5Y 5HMWA 4H4KA 3QIDA 1I1GA 4LSZB 4DFJA 3BZQA 2D9OA 1N6QA 1UJ6A 2AIRB 1U1OA 3MR2A 4RU9A 1RSCA 2MKSA 2UVWA 4RUCA 4ZVTB 3UVJA 4U96A 2GMLA 3TX0A 5IT0A 4OZ2A 2PEBA 3DI6B 2FYXA 3GG0A 4RW4B 2KZMA 4EEYA 4YR0A 2AGPA 2ASDA 2ALYB 1RI7A 2LCWA 4MYTA 2OJ3A 1YBAA 1VISA 5J2NB 1U0SA 2PI5A 4N8NA 1XJWB 1M0SA 4CLWA 4OL8A 4L6V3 3IM8A 4QWCA 1SJFA 2XLIA 4JV5J 1Y00A 4X65J 2OKQA 1UKUA 3K17A 1K9MT 2GIFA 3CCZA 2BE2B 3ILOA 1RT7A 2E44A 3KG0A 3C8YA 4YMEA 2DYAA 4JI3J 1N48A 2HG4A 2HK2A 2HQGA 2C2MB 2VZ9A 4DUZF 3CCQS 2BQUA 3EICA 1S6PB 4F50A 1RT1A 1XC9A 1Q86T 4EK2A 5KT5A 1Q7LB 5C42A 3AQPA 1OSCA 4NA1A 1FVSA 3FBBA 4LREA 2DGQA 1HWLA 1RTJB 4QJVA 2BRKA 2XZTB 1Q8LA 2LU2A 2LXIA 1U49A 1HNWF 2VUGA 3IRXB 3EGVA 2UUAF 3RRGA 2FGCA 1ZA2B 1IJFB 5F0WA 3SBMA 1REVB 5F8LA 4C8MA 4CZCA 4FS2A 2HHVA 3M4XA 3HSZA 1O8BA 4X84A 2DR7A 2L41A 1U09A 4FVMA 5C25B 4ZITA 1AYEA 2V6AA 4USUA 3KHLA 1TL1B 2RB7A 4LRBA 2HVHA 1HI8A 2R7OA 3B54A 3OTOJ 5KFAA 2Y9HA 4OX7A 2VG5A 3LA0A 2HHUA 2CNKB 1Q79A 1L3TA 3T1YJ 1RT5A 1E6YB 2JSXA 3F44A 1X4FA 4JI0F 4HTJA 4MKYA 4ECYA 3L95X 1JXEA 3TZYA 3DLLQ 2KXFA 2KFNA 3CJTA 1HMVB 3FJ2A 2VPXB 2QN6B 3M2RB 2YKQA 4LIWA 1TK8A 1VBZA 3MMJA 1NK4A 2W2PP 4C8ZA 1QLNA 5AXLA 3UD3P 2EK6A 5E3AA 2HZVA 3T1HJ 1JK9B 4DI6A 4DFMA 1N4LA 3GMGA 4NCAA 3R5JB 3D6HB 2WBMA 2DITA 3G6YA 3F73A 2J7WA 4X64F 3C15B 3DDNA 4U6PA 5A8RA 1F3VA 4K4ZA 1CC8A 1RWMB 2D69A 4OJ1A 4PCQA 4EWTA 5DZ7A 1QD1A 5EGYA 1KOOA 2DGWA 1ZYQA 1RABB 1SV5B 4ZVGA 3FVYA 1EB0A 1CSJA 2I9SA 3T6JA 1VS3A 1I6JA 4ECXA 4DBQA 4JI6J 2DPJA 1F9FA 3V6DA 3VWSA 3UNYA 1N5SA 3SZ2A 1MSWD 4Z7CA 4DV4F 4FXVA 1VRTA 5IWAF 3QBCA 4DV7F 2HFUA 1EHWA 1EARA 1DURA 2XGPA 2YWEA 4F4ZA 1BY9A 4YUDA 4CO3A 4I64A 1TVRA 1S1WA 3M2UA 2NCKL 2VASA 3R27A 5DLGA 1S0MA 2YPZA 5AE1A 4WBFA 3NNHA 4G3IA 2OPRA 4NXNJ 2IDEA 4U8YA 2XHWA 3RYLA 1B4SA 2LQJA 4NLRA 3UWTA 4X62F 4B9LA 4PWDA 4D3HA 2F9DA 2BJ3A 1K0TA 3I31A 1LK7A 4RW8B 2PGCA 1FXLA 1A7GE 3HXMA 1N36F 2XY5A 2FVSA 1FRLA 3PEHA 5B0EA 4NLSA 3MCNA 4Q2LA 1TKXA 2Y1IA 3OPKA 4KFBA 1T7PA 2J0SD 1S72S 3TUJC 1FRKA 3FNNA 5HSPA 3QWUA 4Y2MA 1MWZA 4EGLA 2KJWA 2W2QP 4MK7A 4TY9A 2CAJA 1UEUA 4H4KC 1F1BB 1N6QB 4WKYA 1S7HA 2K3IA 1VHFA 1HD1A 4K8RA 4YHHF 1H38A 4K4VA 4IH7A 2UXDF 4F02A 2DNQA 4G65A 4ECRA 3UVJB 1UA1A 3M1VA 1DTTA 2JVRA 3MR3A 4H4MA 4J91A 1R43A 3G87A 3T3FA 1QTMA 4ZK7M 1D8YA 3MFIA 3Q2TC 1JLBA 2OSRA 3EXYA 5T14A 2BXJA 2R7XA 1NDKA 3MM6B 4N56A 2QZ8A 2FB0A 4NA2A 1U8SA 2VG6A 2ABYA 1F5AA 4ZVSB 2EI5A 4O23A 4HLBA 3TZXA 3K8VA 5A2QY 3PIOQ 1V3SA 2V34A 5D15A 5BR8F 2XSJA 1DFDA 2R2RA 4DR1F 1R8HA 3R6GB 1RT7B 2DY1A 1QAYA 1WHVA 3I5AA 1XMQJ 4F7VA 2G13A 3OV7A 3FFIA 3MMCA 5KG2A 1XQIA 4UT4A 1PO6A 3MAAA 4ZPCA 1HWJA 1Q8IA 1GXTA 3JTPA 2M52A 3QT7A 2JEGA 1R0CB 2EFOA 1RT1B 3GE9A 2GC8A 1G2EA 3W9JA 4L3NA 5C42B 3NY0A 3UFCX 2L48A 2IVYA 5E2QA 1R27B 2HHQA
chains in the Genus database with same CATH topology
5HMYA 4R5PB 1A6LA 2PIIA 1FDNA 3BS9A 2DH7A 2ZBCA 2X51A 4BBYA 1NNDA 5I3UA 3N9UC 4ECTA 1VQ5S 1KTQA 1S0NA 4I1TA 4O0IA 1KNZA 3HFKA 1A9NB 4RX6A 1LK5A 1Q78A 3R5CA 3GWCA 3UR3C 3MM8A 3Q8PB 4I67A 2OPPA 2DO0A 1NU4A 2MDAA 2EC0A 1U1KA 3CCSS 5HLFA 1X4CA 1ZPVA 3R5BA 1QVGR 3IA0A 2NLWA 3PVXA 1KC8T 2C3YA 1S1XA 4DF4A 3GZ7A 1D3WA 4ZVEA 1M5SA 2XMVA 3AQOA 5L38A 4RW7B 2MKIA 2QEXS 1GX5A 2JRSA 5F0UA 1S76D 2XMJA 1BQMA 2X1AA 4DFPA 4EBEA 1VQ6S 2CQ3A 4HT5A 5CD4H 1Y0HA 2ZOMA 3OBIA 3LANA 3Q0AA 3PX0A 2PMHA 1LWFB 2ZOGA 1H0HB 4DQPA 2RF2A 4URGA 5F3ZA 1XMOF 1RT4B 2K3KA 2IAJB 2Y0SD 3IFEA 4MIWA 4CT9A 4RLEA 2FHJD 3JSMA 3TVZA 1UFWA 3HHNB 1E6VB 3HI9A 2LDIA 4MKBA 4JI6F 1N54B 4FZVA 3T19A 2SXLA 4YP3A 5F8JA 1N0UA 3FSIA 4HDGA 1VQSA 4D3GA 4WF9Q 4B3OA 2HRYA 3AAWB 2LQ9A 2C3OA 4F4YA 2ZE2A 5GVQA 2CG4A 1ZH5A 2ADCA 2KB2A 5AXMA 3NAIA 4B9MA 2DGSA 3SDEA 2J6UA 1Y4ZB 2AU0A 1TKZA 1B0TA 2LECA 1VQ8S 4KV8A 2BJDA 3CCTA 2HMIA 5DQGA 1VK3A 2JL9A 2E5GA 2WB4A 4K5SA 4HDHA 2NXUA 2BBEA 3G6ES 3HDSA 1YIJS 1QSYA 2HLTA 3NKYA 2LQ5A 4J9QA 2FY1A 1UAWA 2JZ5A 1RTIA 3CD7A 4CH7A 2VG5B 1J5EF 3OTBA 2GCFA 2P9GA 2YWHA 1H2TZ 1VOMA 3GYXB 4QIGA 1QY7A 1P27B 4DEZA 3MUTP 4AL5A 5DDOC 3DLHA 4W92B 3RAXA 3O3LA 1RT5B 1XTZA 4BHQA 1U1MA 1VFJA 2Z2LA 2JLEA 3DLJA 4PQAA 5B09A 2GQCA 4MIBA 3H25A 3RB6A 2DNHA 3DFEA 1HARA 5L8RC 5KFHA 3J7Z5 3MTKA 1HBMA 4KR0B 4NLVA 1LOUA 3U1NA 2J6SA 2W9AA 3TUIC 2MSSA 1SH2A 4KO0A 2EBEA 4FN5A 3MXHP 3N79A 2YWGA 5CZXA 2R8GA 1VQOS 1HYSB 1QM9A 4V19J 1TP7A 3J7ZT 4F3QA 1DRZA 3V4MA 4C9DA 5H9FJ 3MR6A 2E9TA 4XPCA 2YY3A 5J1EB 3S7RA 2BYCA 3P5TL 4X4OA 2RDJA 3P96A 1GXLA 5KFRA 3B4DA 2XI3A 4LSNA 2WHOA 4K5RA 5DJBA 4IRDA 3I6PA 4OI3A 5HN0A 1S0OA 4DWIA 2VFSA 2KDOA 3HF5A 4R0JA 5E41A 1X9SA 2UVVA 4PR6A 1Y3KA 2C28A 4C3MA 2BM1A 3ZZ0A 1U1PA 2LA4A 3DU6A 1FNOA 2C2RA 2P5VA 4B3SF 1UVMA 3CD6S 1J5OB 2ZVSA 1LW2B 3GSDA 1SH0A 5E33A 3WZ0A 5F41A 2QMWA <