5C24B

Crystal structure of hiv-1 reverse transcriptase in complex with 7-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8-dimethylindolizine-2-carbonitrile (jlj605), a non-nucleoside inhibitor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
412
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
total genus 120
structure length 412
sequence length 412
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c24B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B03
3KK1B 4WFYA 3V6DA 2OPSB 3NAIA 4MK9A 4IRKA 3M9NB 2FJWA 4ZP6A 1DTQB 4NLXA 4ZPBA 4K4XA 1LW0A 4U7CA 3E51A 3TVKA 2XGPA 4RU9A 4G3IA 2I5JA 2OPRA 4DL4A 4ZMMA 3KLIB 2ASLA 5HBMA 1UWBB 2JC0A 4R8UB 3I5CA 1S1VB 5F8IA 1SH2A 4F4WA 4EBDA 4O3RA 4NCGB 4TYBA 3MECA 5HROB 4IH6A 2FVRA 5KFDA 4U6PA 4PUOA 1J5OB 1S6PB 5EUHA 4KKOB 2E9ZA 2HNZA 1FKOA 4I2PA 5J2PB 3HVTB 2BR0A 3DI6A 4HYKA 4Y2CA 2ZD1A 1SH3A 3MR2A 2W9BB 4ECUA 4I2QB 5KFRA 3NMAA 2OPPB 1IKVB 4R5PA 1ZETA 1JLAA 3FSIA 4DL6A 1JLBB 4YP3A 5J2QB 1LWCA 4ICLB 2C2EA 2IAJA 4O44B 5JUMA 3GQCA 4YR3A 3IG1A 2FJXA 3KHHA 3NKYA 4K4UA 3T1AA 4R0EA 3M8PB 4H4MA 5L9XA 3IS9A 4RW4B 5KFEA 1EP4B 3G6YA 1NNDA 3PW0A 3FFIA 1U09A 3CJ2A 4NLYA 1IM4A 1DTTB 3MFIA 2IM1A 4WFXA 2IBKA 2UVUA 1S1WA 1TKXB 2V9WA 2YNIB 3T5LA 3DOKB 2B6AB 1SV5A 3DLKB 4RUCA 3BQ2A 2AQ4A 3SI8A 3KLFB 1IKWB 1S9EA 3IGNA 1ZTWA 2YKMB 3V6KA 5KT3A 2J6SA 1WNEA 4NLVA 1S1TB 4LSLA 3ITHA 3KJVA 4KAIA 5F8JA 4EO8A 1VRTA 3DLEA 1TV6A 1EETA 1XR7A 3BJYA 3RB4A 2YKNB 5KFOA 2R8JA 5F8NA 3Q8SB 2YNHA 1HNIA 4ZP7A 3KHGA 5DQHA 3QO9B 3D28A 3C6TA 4ECTA 3FQKA 1DTQA 5KG4A 4TYAA 1C2PA 3CVKA 1LWFB 3MEDB 2WRMA 3H2LA 4RW7B 4ID5A 3HKWA 4NLPA 4IR1A 4ZVHA 3I5AA 3H5SA 2D7SA 2R8GA 3V6DB 2J6TA 4IRCA 4WXWA 3GYNA 4ECZA 1LW0B 3I0RA 2FLPA 4JUZA 5DLGA 3OL7A 1DLOA 2C28A 2I5JB 2OPRB 4TLRA 3G6XA 3NAHA 5HBMB 4IDKA 4QWAA 2XCPA 1S97A 1S0OA 2GIRA 4XPEA 1RTHA 2VG6A 2BE2A 1RT5A 1K1QA 3EPIA 2FVPA 3MECB 3HVWA 4DL2A 2DPJA 1JLBA 4PUOB 3CDWA 4K4VA 2HNZB 1N6QA 1FKOB 1HPZA 4I2PB 1NHVA 4TY8A 3DI6B 4F4YA 2OH2A 2ZD1B 2IJNA 3KNAA 4EO6A 1S10A 4X2BA 4K4SA 4R5PB 1JLAB 5I3UA 5KFCA 3V4IA 4QW8A 4WE1A 5C42A 3UQSA 4EEYA 3RB0A 1LWCB 2E9TA 5KFPA 2IAJB 1JLGA 1C0TA 4ED7A 2JEFA 3IG1B 2ILYA 1K1SA 4WYWA 4H4MB 2R2SA 3MR5A 4FS1A 2E9RX 1W25A 3FFIB 3KK3A 1I6JA 2W9CA 2IJFA 3T5KA 1N56A 2WOMA 1S1XA 3MTKA 2VG5A 3DYAA 1S1WB 1QE1A 2ALZA 4OL8A 2R2RA 4F4XA 1SV5B 3DRSA 1HQUA 3BSCA 5KFJA 3DRPA 3GIMA 1S9EB 4MIAA 4IOBA 5F8LA 4O3OA 4J9MA 4NZ0A 5K14A 3H98A 5KT5A 5DG9A 4O4RA 4NLGA 1LWEA 4LSLB 4XPCA 1HQEA 2HWIA 1HNVA 3ITHB 3KJVB 4O3SA 5KG1A 1VRTB 3DLEB 2YNGA 4NLDA 1TV6B 1EETB 3QYYA 4NRUA 3KK2A 4Q44A 2RDJA 3DM2A 2YNHB 4WZQA 1HNIB 2BANA 3MEEA 2HAIA 3LP2A 3C6TB 3V6HA 4XO0A 3CJ3A 5JXSA 3OHAA 4LQ9A 2XGQA 4ID5B 2HMIA 5I42A 3QIDA 2W8LA 4J9OA 3QIPA 3M9MB 1RTDA 5L1JA 2VA2A 2XCAA 4JV1A 4RNOA 1S9GA 3I0RB 3HVAA 1DLOB 4F4ZA 3H5YA 1JKHA 2JEGA 3N6NA 5KG5A 4GC7A 1QAJA 1TL1A 4IDKB 2ZKUA 1S9FA 3PW5A 3DMJA 1RYRA 1RTHB 2VG6B 3D5MA 2BE2B 4ECXA 1RT5B 3Q8PB 5DLFA 3TQ1A 5KT4A 4MKBA 4MFBA 5FDLA 5KT7A 1SUQA 3CO9A 5F8GA 1N6QB 4GC6A 1HPZB 4RNFA 4TY8B 3C6UA 3ISND 1YVFA 2C2RA 2AGPA 3VQSA 5L1LA 4RNHA 1N5YA 3BSAA 2IMWP 3GIKA 4DL3A 2JEIA 4RW6A 1S4FA 5I3UB 2D3ZA 3V4IB 2IC3A 4WE1B 5C42B 3CDEA 1S0NA 1RT7A 3E01A 3QZ8A 1JLGB 1C0TB 3MEGA 2WTFA 4EBCA 4FBTA 1S1UA 4ZP8A 2VA3A 4IR9A 4WZMA 2AGQA 4I7FA 2D41A 5KG7A 3MFHA 3BQ0A 1RT4A 3TAMA 3DOLA 2BQUA 3KK3B 1HYSA 2W9CB 2WOMB 1S1XB 2FVSA 2ATLA 2VG5B 3DYAB 4KV8A 1QE1B 3NBPA 1KHVA 1S6QA 5J1EA 2RDIA 3T5JA 3DRSB 1JLFA 3FDSA 1HQUB 3KLVA 3DRPB 1JLCA 2VG7A 4J9KA 5DGBA 4ECWA 3H40A 5K14B 1C1BA 5KG2A 4QPXA 1RYSA 1LWEB 1HQEB 4ZPAA 1HNVB 4KHRA 3OL6A 2HWHA 2YNGB 3IGVA 2W8KA 1RT1A 3KK2B 1HMVA 1MU2A 2ILZA 4J9LA 3DM2B 2D3UA 4H4OA 5KFHA 1REVA 2BANB 2UVRA 3MEEB 1BQNA 2GC8A 3LP2B 3H5UA 4ZP9A 5KFMA 2FVCA 4MK7A 3N6MA 1TKZA 3QLHA 5C24A 4QWBA 4O3NA 1NHUA 4FS2A 1QAIA 3I0SA 4LSNA 2UUWA 1TL3A 2AX0A 3CJ0A 2HMIB 3FRZA 1C1CA 1RT3A 3CJ5A 4ECYA 2HNDA 5I42B 2R8KA 2R8HA 3QIPB 1RTDB 4IH7A 1S0MA 2RKIA 1S9GB 1S49A 2BRKA 3M9OB 1FK9A 4M95A 1JKHB 3PHEA 2OPQA 4IH5A 1TL1B 1T94A 4NLRA 5J2MA 3DMJB 3UDLA 5EWFA 4YMEA 3V81A 5KFTA 3Q8QB 4MFBB 5FDLB 1T05A 4RZRA 1SUQB 4URQU 4K4WA 1IKYA 3C6UB 3PJWA 1T03A 4KSEB 1RT2A 5L1KA 3ISNC 1N5YB 1OS5A 2QE5A 4TN2A 4J9RA 1TVRA 3JYTA 5CYQA 4RW6B 3I5BA 3LALA 2IC3B 1GX6A 3FQLA 4WYLA 3GV8B 2CKWA 3PZPA 1RT7B 3E01B 4B3OA 4PQUA 3MEGB 2GIQA 3QGGA 1S1UB 2XWYA 5KFAA 3PVXA 2RF2A 3T19A 1IKXA 3GIIA 3OSNA 4I7FB 4O3PA 3UPFA 3HHKA 4Q45A 1RT4B 4NLTA 4JV0A 3TAMB 3KLEA 3DOLB 1HYSB 3N6LA 1TP7A 3CJ4A 3OHBA 4KV8B 5KFFA 3NBPB 4KE5A 2W9AA 1S6QB 3LP1A 5J1EB 4JV2A 1JLFB 2FLNA 2IA6A 4ED8A 5HLFA 3PW2A 1JLCB 2VG7B 1D0EA 3EZUA 5F8HA 3IRXA 5KFUA 5KFIA 4KO0A 4RW9A 4KBIA 1VRUA 4IKAA 3BQ1A 4J9PA 1JXLA 4LQ3A 4QWCA 1C1BB 4Q0BA 1RTJA 3RB3A 4URGA 4ECSA 3QGIA 1RT1B 1HMVB 1MU2B 1TQLA 3SFGA 1R0AA 2HNYA 4H4OB 4MH8A 1REVB 2BQ3A 2FLLA 1BQNB 2I1RA 4NLWA 4MKAA 5J2NA 5L1IA 1TKZB 3QLHB 5C24B 4YQWA 4O4GA 4KB7A 4TXSA 4J9SA 3I0SB 4LSNB 1TL3B 3CWJA 2W7PA 3MR6A 1C1CB 1FKPA 3DLGA 4H54A 1RT3B 2R2TA 2HNDB 4G1QA 2B5JA 3DDKA 4WFZA 5EWEA 4EBEA 3OSPA 4ZVGA 2RKIB 4Y34A 2YNFA 1FK9B 3KHRA 5C5JA 1GX5A 1XR5A 2OPQB 4ECVA 4RNMA 4QW9A 3PW4A 2V4RA 5J2MB 4Q43A 4DL5A 1BQMA 2ZE2A 2UVWA 1LW2A 4ZHRA 1D1UA 5F9LA 3QZ7A 3V81B 4K4TA 5F8MA 2IM3A 1T05B 5DG8A 2XC9A 3KMSA 1T3NA 3KOAA 3KLHA 1IKYB 4DG1A 3NGDA 4RUAA 1T03B 3OL9A 4ED2A 1RT2B 1RA6A 1CSJA 5KT6A 2V4QA 3JSMA 4K4ZA 1TVRB 3JYTB 2WONA 5CYQB 3BREA 4K50A 4IG3A 5HP1A 1MMLA 2UVVA 4EYIB 4ED3A 3G6VA 3DRRA 4PQUB 4B3OB 4ZPCA 5KG6A 1C0UA 2F8EX 3G86A 1JLQA 4Y2AA 4IFVA 4MK8A 5DQGA 1TKTA 3M8QA 2RF2B 2IM0A 1JLEA 1RT6A 1IKXB 1RDRA 2WK4A 3GV7B 4F50A 2AU0A 1N48A 4FBUA 2UUTA 3LP0A 3UR0A 5DQIA 3KLEB 5KFNA 4ZVFA 1KHWA 4RW8A 4KHMA 3MR3A 4ED6A 5DG7A 2C2DA 2BQRA 1RA7A 1ZTTA 1SH0A 4NRTA 4KFBA 3KHLA 2EC0A 2WB4A 3KLGA 3LP1B 1JX4A 4J9QA 4PWDA 3PR4A 5HLFB 1XR6A 3IRXB 3EPGA 4IG0A 4KO0B 4RW9B 1VRUB 5CYMA 4MIBA 4ED0A 5KFBA 3RAQA 5EWGA 3PR5B 4Q0BB 1RTJB 4NYZA 4IFYA 5C25A 1RTIA 2WCXA 1JIHA 4Y3CA 5KG0A 4RNNA 2R2UA 3OLBA 5D3GA 1KLMA 3CDUA 3BGRA 4ZPDA 3KK1A 3H4DA 5F9NA 1R0AB 2HNYB 3PW7A 3RBEA 2OPSA 3ICLA 3V6JA 2C22A 5T14A 2FJVA 4URSA 1HARA 2XI3A 5J2NB 5EDWA 2IM2A 4QWDA 4O4GB 2BRLA 4QWEA 3KLIA 4NLSA 1FKPB 3DLGB 4HKQA 2R8IA 1UWBA 4NLOA 4O3QA 4R8UA 4G1QB 1QUVA 3LANA 2B5JB 3T5HA 1S1VA 4K4YA 2J6UA 4NCGA 3BSOA 2YNFB 5HROA 4YR2A 3OLAA 2JC1A 1J5OA 1S6PA 4YR0A 4KKOA 5KT2A 1BQMB 5J2PA 2ZE2B 3HVTA 3SFUA 4ECRA 1LW2B 4ZHRB 2W9BA 3RBDA 4NLUA 1RAJA 3H59A 2ASJA 4I2QA 2FVQA 2XI2A 5KFSA 2OPPA 1IKVA 1Z4UA 5KFKA 3Q8RB 5DGAA 3IN5A 2JEJA 3BSNA 5J2QA 4TQRA 4IRDA 3KLHB 4ICLA 4DG1B 4O44A 3LAMA 3RB6A 4DEZA 3M8PA 2QV6A 3GIJA 3JSMB 4RW4A 3PJXA 4IQXA 4Q8FA 2WONB 1EP4A 1S48A 2AGOA 5KFLA 5KFQA 2DPIA 4IG3B 5HP1B 3CIZA 3QGHA 2WHOA 3DRRB 1DTTA 3RAXA 2JLEA 1C0UB 4TQSA 1JLQB 2W7OA 4IFVB 1TKXA 1TKTB 3M8QB 2AX1A 5KFXA 1JLEB 1RT6B 2YNIA 3DOKA 4EYHB 1N4LA 3IS9B 4ZVEA 4M94A 2B6AA 3DLKA 3GV5B 5KFYA 3LP0B 3H5XA 3KLFA 4Q8EA 4RW8B 1IKWA 2ASDA 2O5DA 4J9NA 2YKMA 4TY9A 4KFBB 5KFZA 3KLGB 1S1TA 4PWDB 2B43A 4ECQA 3MF5A 3LAKA 4IG0B 2AWZA 5KFWA 5CYMB 3GILA 5KFGA 2YKNA 2V0NA 3BR9A 4ED1A 3H4BA 4DL7A 3QO9A 4IFYB 5C25B 1RTIB 2CJQA 4WXOA 3KMQA 3NL0A 5KG3A 3OL8A 5KFVA 5D3GB 1LWFA 3MEDA 4NLQA 1KLMB 4RW7A 3BGRB
chains in the Genus database with same CATH superfamily
4IYQA 2EG1A 2H5IB 3ZTSA 1H2TZ 4DR6F 1VMBA 4G3IA 1F60B 1RHQB 5AXMA 1FF2A 2JLFA 3NY0A 2F40A 1SH2A 5F8IA 3PX0A 5KFDA 5HROB 3POTA 1NJIT 5IT9Y 3OR1A 1KTQA 5A6PA 2ZWPA 1IQZA 2DTJA 2O67A 4K4UA 2FJXA 3H8YA 3M8PB 1RWWB 2DRDA 2DH7A 2I38A 2MMYA 2K7JA 2IM1A 2HHWA 1PKUA 4USKA 2EBEA 2I9SA 4AFFA 2HFVA 3LGNA 3DXSX 1JJCB 3CMAS 3CXCR 3TZZA 1U1OA 2XMKA 1YZ7A 5K5MA 3FQKA 2NYIA 2ZBRA 3HKWA 2WVCA 4N8NA 1GK8A 2M8HA 3CCLS 1GXUA 1N32F 3THVA 4B3TJ 3I4HX 1LW0B 5DLGA 3HHDA 1S59A 1G6BA 4KY3A 4DL2A 2KVIA 3L7UA 3VGTA 3PYEA 2VL1A 3BS9A 5KFCA 3UQSA 2GZOA 3BKFA 5T7LB 2UXBF 4OJ3A 1N56A 4CO2A 4ES2A 4J91A 3AOBA 2BYCA 2DO0A 2MQQA 2G9OA 2R2RA 1KFDA 1FWPA 5KFJA 2FPHX 3T1YF 4YB1P 3NWGA 4DV0J 1S72S 3DRXA 2RDJA 3KKFA 4JI3J 2HHHF 4K59A 1YTYA 2C3MA 2KDOA 4JI1J 1S9GA 2JEGA 1TL1A 2B3TB 1XIQA 1I94F 5E7OB 1SB6A 4KGVB 4QOTA 1LXJA 1VQKS 1M1GA 4RNFA 2LA6A 2X3DA 3TA1A 1UFKA 1WC1A 1R89A 2XY5A 1U0HA 2V8PA 2E1AA 3NBPA 4DBQA 2DR9A 5KAKA 2G13A 5BXIA 3GSDA 4RBUA 4HACA 1LKZA 4ZCMA 3OL6A 2HWHA 2FY1A 2ILZA 5B0GA 5LJ5Y 2BANB 3I9V9 3ZTPA 5C2CA 2XEXA 1TKZA 4TU8A 5AT1B 3IBWA 3BBFA 2F4VJ 4W4MA 1RWKB 4MIWA 3QIPB 1EAYC 2BRKA 1FK9A 5CA5A 4JI6J 2YH0A 4OZNA 4DV5J 4LFCF 1KR4A 3Q8QB 4MFBB 3PFEA 1VK3A 3TI0A 4DF4A 4GRSA 3ISNC 1XN9A 3DHXA 2HQFA 3QRRA 1Q1KA 1Q16B 3GIIA 2V34A 2Z8QA 4DX8H 4TU7A 2QLBB 1RADB 1MN7A 3IRXA 2XMTA 4IKAA 3O6QA 2HFOA 3DGVA 2DY9A 1WHYA 2OEMA 4DSKA 2WSEC 2VIHA 3O2IA 4C8KA 3BEGB 2DNRA 4EBEA 5IM0B 2KRRA 2BJ9A 3D66A 3D6TB 5D4LA 3A3PB 5F8MA 1B0TA 4WFNQ 2XMMA 3O5TB 1MWQA 3TUZC 2KFZA 3O3LA 3Q22A 5L8RC 4B3OB 3VAKA 5KG6A 3QFHA 4M5DB 3G86A 1LNQA 3LF0A 3M2VA 1L3SA 2H4YB 3F0NA 5L39A 4PWDA 4DR5J 4IG0A 4ZIVA 2HFNA 2RSQA 4NYZA 2IPOB 3WZ0A 5D3GA 4HDHA 3BGRA 3RBEA 2VPZB 1YJ9S 2KJWA 4L74A 3A8JA 1L3KA 1UA0A 2ZBIA 1N33F 3EXYA 1V3ZA 1N8RT 2JC1A 5CXTA 3J80U 2W2NP 3NNAA 4WK1A 5CZXA 2XS7A 2FVQA 5GVQA 4NA2A 3MPYA 4IRDA 1TL4A 3KUEA 3CIZA 5JJBA 2JLEA 4RX6A 2W7OA 2CNLB 1HHQA 1JLEB 1RT6B 3IS9B 4UOCA 1YBAA 2GQ2A 3NOGA 4KFBB 1S4EA 3L09A 3CCZA 2DNMA 3NL0A 3OL8A 3G96A 1XMQF 3K59A 5LM7E 4M1KA 1WF1A 3M9NB 3IC1A 4K7QA 4M5IA 2C2NA 2OPRA 2MEWA 1DQAA 2EFPA 4OHVA 5B08A 1NK9A 2HPUA 4Q5VA 4KKOB 1RZMA 2QRRA 4HYKA 3FKBA 3NMAA 2OPPB 1JLAA 2RNEA 5GAEI 4HDGA 4H4MA 4RW4B 4FYVB 4ZITA 3J81j 2IVMA 4N8OA 1S1WA 3RU0A 3I9ZA 4DS4A 2RU3A 2D74B 2A2DA 4DR2J 2M8DB 3QRQA 1VRQC 2EKNA 5DQHA 1KWMA 2F7VA 4QU6A 1HD1A 2PMZD 4NEYA 4ID5A 2H5JB 4B3RJ 4ID8A 1TAQA 2CVIA 3M6VA 2I5JB 3EX7B 4TLRA 2KM8B 4AQYJ 4ERDA 1PYSB 4N56A 2NR0A 4PUOB 2YKAA 2HNZB 3C19A 4EO6A 1QSYA 1VQYA 3IG1B 1NB7A 2B9EA 1B4SA 2R2SA 1E6VA 1F0XA 2BM1A 4BWJA 2WOMA 3TVZA 1Q0NA 2DRBA 1FE4A 4GKKF 1SV5B 2L9WA 3B4MA 3RAMA 2J9DA 4P71A 4NLGA 5A2QU 3OVAA 1C4CA 3V6HA 2OMLA 2R7UA 5JXSA 1XEZA 4MYUA 1SJFA 2HMIA 4L6V3 3MOJB 4RNOA 3H5YA 1JKHA 1DQ8A 2KHCA 1OPIA 2P9EA 3MPWA 3M8SA 2XY7A 2Y9HA 1SUQA 3CO9A 4TY8B 3C6UA 4K2XA 1NZ8A 1JLGB 5CABA 1S1UA 2F63A 2AGQA 4LF8F 3TAMA 4OJHA 3LQVA 3ENQA 2BJDA 3KTQA 3W66A 2BACA 1BXNA 2QJ3A 1KD1T 1RHKB 2P6SA 1LWEB 1Y5LB 3IGVA 2PSZA 3CJQA 2CWKA 2ZNYA 3H5UA 1VOMA 2NZ4A 1QAIA 4Q2LA 3PIOQ 5E2QA 2XTJP 4YMEA 5ETRA 1XJWB 1TK5A 5LXYA 2GMJA 3NWRA 3FBCA 2RD5C 5T41A 3GYGA 5CYQA 2GMLA 4WYLA 3W2WA 5LMNJ 3BBCA 1H73A 2P6TA 3H42A 2HIQA 2IVFB 4AYBD 5DDQC 1EQMA 3CCJS 5ETNA 1PYTA 3M2UB 1KVJA 1FTCA 2HBZB 3IMQJ 3A4TA 2K1RA 2MLZA 1REVB 1SKWA 4ILLA 1IBCB 2RT3A 2ZZTA 5K9FA 1TL3B 3CWJA 1XTZA 4L76A 1RWXB 4WU2A 1C1CB 1FKPA 1FXDA 2CRLA 3MUVP 2PO4A 2Y8WA 3FBFA 5C5JA 1WKJA 5HQLA 1LW2A 1YQHA 1T05B 3KOAA 1RT2B 3DGPA 4BC9A 4OMFG 1IJEB 3NGSA 4PQUB 2DNOA 2FJBB 4MK8A 2IM0A 1X4BA 1IKXB 4FBUA 4QR1A 4DR3F 3KLEB 5E33A 4PKDB 4DN0A 1K9MT 4D3HA 5KFBA 3IRWP 2R2UA 3ILOA 3KXDA 3EDRB 3ICLA 1H74A 4AL6A 2HGLA 3MHYA 2NXCA 4LVOP 1HW9A 4ZVTB 2BM0A 4DV2F 4FYXB 3DLBA 1MLAA 1N34F 3A12A 4YOEA 2CIMA 1HBMB 4O44A 4DR1J 2VV5A 1H0HB 4N47A 2WHOA 2N7YA 1JJHA 3GTYX 1NKEA 4RW8B 2O5DA 1I1GA 1D8YA 4EZ6A 3GFZA 1LWXA 1RI7A 3C8YA 4ECQA 1AROP 1ACMB 2AYEA 2CJBA 5KG3A 2KZZA 5A8KA 2IY5B 4NZ7A 2DNHA 4G1IA 3VGSA 3V6DA 2AZ3A 2YPYA 1VBYA 1VBZA 4ZPBA 3GE9A 2ASLA 2RIJA 2M88A 1RB0A 4EBDA 3MCMA 1T9UA 5AE3A 2FVRA 4X66J 1C4AA 2XLJA 4I2PA 3QRPA 3N01A 5RUBA 3PIPQ 2BE7D 4X62F 3R6GB 4I4BA 2AIRB 5K20B 3UWTA 1F2HA 3UW1A 2N3OA 3MFIA 2B7BB 2CDQA 2V9WA 1OYDA 4PPZA 2D3O1 3BQ2A 2FY8A 1SI9A 1OSDA 4CWBA 4MKVA 1NK6A 3R6LB 1TV6A 2XYPB 2HURA 4RW7B 1M5OC 1H6KX 2XO6A 2J8AA 5HBMB 1S0OA 2DISA 4B3TF 4F3OA 3QSIA 4QYZK 2BE2A 3UO0A 1LOUA 4RUHA 1N6QA 4F2SA 1HPZA 3DI6B 3AOCA 1HNXF 4R5PB 2V94A 3RB0A 1C0TA 4B9UA 1K1SA 1SIWB 1SL0A 1RAIB 5AXLA 2AF6A 3ETMA 2E44A 2JVOA 2W4CA 2VICA 4DPWA 3MEEA 3RZAA 3CEDA 5AJ3J 4LQ9A 2R7QA 5LMUJ 4JI3F 5FJ4A 4DMZA 4OYZA 3K89A 2VDIA 4ECXA 1RT5B 5FDLA 2M7SA 2R7XA 1D9FA 2IRUA 4RNHA 3GIKA 4B9SA 4RW6A 2ZC4A 3B78A 4OI1A 3GLJA 4OI6A 4FXVA 1HYSA 1VQMS 1KQFB 4PZVA 3TUPA 1M5KC 2OEKA 1NH7A 3EICA 1C1BA 1FERA 4G6VB 4H4OA 3G4SS 3HHNB 1M1HA 3CJ0A 1TL5A 2ZBCA 3M4XA 3OTEA 2IDLA 4EWTA 3NGUA 4M95A 3PHEA 1T94A 1HR0J 2MZSA 4DSFA 3G82A 2E1PA 2NSBA 4WF9Q 1NB2A 2VPYB 3MCNA 1XQIA 1N5YB 2DCLA 1OS5A 4I6YA 1UW9A 2QT7A 3QJPA 2J0WA 2QMXA 3PY8A 2C2ZB 3OR2B 4NEZA 3EXCX 4PG5A 3MDFA 4Y6IA 5ETQA 4KPYA 4HTJA 4ED8A 3HSDA 2BKPA 4Q0BA 4CNZA 1R0AA 1UVLA 1BQNB 1P8GA 3QFWA 3TWZA 2DITA 3QLHB 5C24B 4ZJLA 2Z56B 3MR6A 1NJWA 4LIWA 4QW9A 1IBKJ 1VBKA 3FCHA 2IM3A 2DB1A 3AJDA 2XC9A 3KMSA 4AT1B 1IKYB 2GCFA 3HHEA 2VPWB 2V4QA 3GP9A 4U96A 3ZZUA 4NASA 3S01A 1SJ4P 3VHQA 3QT7A 1TKTA 3M8QA 1RDRA 2CJKA 2ZHOA 4M5JA 3W65A 2CWXA 2FHJD 1SH0A 4NRTA 3MM6B 2LU2A 2VUGA 1YRUA 3P8BB 2UUCF 1ULRA 2UXCJ 1RUSA 5HJYA 3HP6A 3RW6A 3MPVA 2CG4A 3MM8B 1S12A 2LQ5A 4RU2A 4URSA 2HLTA 2IM2A 2N4CA 3DLGB 3GYXB 2R8IA 1RTZA 2DRAA 4YR2A 1RWVB 3DXBA 3WIVA 5D4PA 2W9BA 3H59A 2ASYA 3IN5A 4M8LA 3RB6A 1V9OA 2L9DA 4Y2KA 3PDNA 2DGSA 2LMIA 5D0HA 2AX1A 1RCOB 3JB9k 2GVZB 2DJWA 1R8CA 4DUYF 2CPXA 1F5BA 1S1TA 2O3DA 1AA1B 5K8OA 4KGMA 2DNPA 1R8PA 4OHXA 1E6YB 3M30B 4A47A 5KFGA 3HSZA 1LWFA 3I5BA 4MK9A 1HWLA 4U7CA 3TVKA 1PIEA 4ZMMA 1AB8A 2ZH3A 4IO9Q 3HSJA 3MECA 2V8DA 4KJIA 3MTJA 1IKVB 5J2QB 4UQGA 4ICLB 3KHHA 3T1AA 4R0EA 2MY8A 3L7OA 3FFIA 1HI0P 1EJ7L 4Q7AA 3CJRA 4NXNJ 1TKXB 3VALA 3MCOA 2UXDF 4RUCA 3DKDA 2HEKA 1HBOA 3TAPA 2VFSA 1EETA 4DR2F 5D6GA 1F3VA 1C2PA 4DEZA 2WRMA 1P9QC 1PC4A 1ZH5A 3H5SA 4CP5A 3G6ES 4PXCA 3R7NB 2FLPA 3CDAA 4B3RF 4QR2A 4XPEA 1X5PA 2IRYA 3ENAA 2QZ8A 2ZZMA 1FRHA 1UAWA 2E9TA 3G8TA 3LO3A 3IAM9 3NCPA 3AHPA 2VQFF 2OP5A 2APOA 1RAHB 4P75A 4MIAA 1VBXA 3SQGA 1VHFA 4OJ1A 4KGXB 3AQPA 1VRTB 3DLEB 1X4DA 4WZQA 4F4KA 2XWXA 2KKHA 3GSIA 1MN9A 4LF1A 1RQ0A 2H54B 2HS4A 4KQZA 5ETPA 1RTHB 3TQ1A 2CVEA 4MKBA 1P27B 1PBUA 2OI2A 4J9UE 1KSPA 3EGNA 2DT9A 2JEIA 2B51A 4ANCA 4J90A 1GEHA 4WZMA 3NS5A 1FX2A 4P52A 1HQUB 2FZKB 3DRPB 3ZZRA 1JLCA 3WC2A 4ECWA 4O23A 3VGUA 2C1EB 2PI5A 3TO8A 3DU6A 5LSLA 4ZLPA 1L3TA 2EFNA 4OZ0A 2HNDA 1U1RA 4B3MF 2DGOA 5ETSA 3KYLA 4B02A 1BWVA 2YWFA 4M63A 5D4OA 3SSQA 1T03A 3RG6A 1N36J 3MAAB 1FX4A 2Y1JA 2HQGA 2HQ3A 5HATA 3TVYA 5IT9U 1UZHA 4CLSA 2ZH5A 2FLNA 3TA0A 4KYZA 2QTWA 4DR7F 1RBLA 4OFZA 1OO0B 1BY9A 4MKAA 5B0BA 4CO0A 1P9YA 4BWMA 2B5JA 5EWEA 2DVIA 2RKIB 3TP2A 4KC5A 4DUTA 4WTOB 3SCLE 5J2MB 2IJRA 3THPA 3MXHP 2FB0A 2MZTA 1MG7A 5HVHA 1QAXA 2GQQA 1V6HA 4OX8A 1RA6A 2BA9A 1VJQA 2N4DA 3G6VA 4ZPCA 3UR3C 2AV5A 1P6TA 4QPTA 3CJSA 1R31A 4ES3A 1S7HA 2A2CA 1XR6A 2DXDA 3ZZPA 3O44A 4KO0B 2VB6A 1VRUB 1R8BA 3JSYA 2W7AA 3CNQP 2ZH1A 4IFYA 4Y3CA 3OLBA 3I96A 3KK1A 5IZHA 5J2NB 1FA0A 3MMCA 3KLIA 4W98A 2WVFA 2ZOMA 3DDIA 2HHXA 2AYBA 2L3MA 4ZHRB 1K0VA 2XI2A 5KFKA 5DGAA 3UN5A 4DSJA 4IQXA 1FRMA 2PGCA 3IA0A 2UU9J 1NEEA 5MAOA 1C0UB 1EB0A 1EHWA 3J7YI 3J7AN 2DEJA 3N9UC 3LTOA 1BHNA 1Y5NB 3A8KA 4P72A 1KEKA 5M2UA 1T11A 1B70B 3ZC4A 4TVAB 1X9SA 3W9JA 3Q0AA 4Z7YA 2CQDA 4EZ9A 2OPSB 1ZM9A 4C98A 2NS1B 4OYMA 1PYOB 4CLUA 1GXTA 4OI0A 5JVGQ 1O51A 2COLA 2QC3A 3VR1A 3OXGA 4YY3J 1X4FA 3X3UA 2QL7B 4ECUA 4ITSA 4F0HA 2YQ0A 3ZZYA 2JL9A 5A76A 4NYOA 1KVIA 3IS9A 1QTMA 1GMWA 3PW0A 1U2FA 3CJ2A 2K3IA 2HZCA 3D0GE 1T0TV 2AEMA 1G3OA 3W1YC 2C3UA 4OI2A 3RTVA 3T5LA 4F2RA 2J9DE 2L08A 1Q78A 3T6JA 1IKWB 1VHIA 2HHPA 5F8JA 4WCEQ 2FIUA 1HNZJ 1SC6A 1RKIA 5F8NA 2EEYA 4LUBA 5L9NA 3H2LA 1WSVA 1UETA 4DCJB 2J6TA 3GG0A 1S97A 2ERRA 4QWAA 2UUBF 1JJ4A 2Q6CA 1MMDA 2JZ5A 3JAMY 2DNNA 3VAHA 1CJUA 2XSJB 5BYQA 4K4VA 1Q5VA 1PJ5A 3BGOP 2HVZA 1FTRA 5I3UA 4EEYA 2IAJB 5DZ7A 1AUSL 2Q6BA 3TR5A 1CG2A 4WYWA 1NJZA 4F3MA 3J81U 1GT8A 2C3OA 2W9CA 5DETA 5HQ8A 2P2CB 1G4CA 4OYWA 3GB0A 4C4WA 3TOQA 5KT5A 5DG9A 2VBYA 1F5AA 1D3WA 2CPJA 4YUDA 3QYYA 4NRUA 2FD2A 1NAQA 1SQGA 1L3VA 2ZDOA 5I42A 1PCAA 5AJ3F 4J9OA 2VA2A 5L1JA 5LMUF 1X7VA 1QAJA 2A18A 3GR1A 3PW5A 4UY8T 4OLPA 2HWTA 4E98A 2RJZA 1FEEA 4I1TA 3TUIC 1ZZFA 3MMAA 4FYDA 2D3ZA 4YB6A 4OZ5A 4C3MA 2RRNA 3Q8VA 1NUEA 2BQUA 3CCRS 4KV8A 1QE1B 1HIYA 2A10A 2E5LF 3GFYA 1AZSB 5G0RA 2F9DA 4KHRA 1J2VA 1WWHA 3BYPA 4OYPA 1CBKA 1HMVA 2DY1A 3DM2B 5KFHA 3BV8A 4USJC 3Q24A 3N6MA 1NHUA 2AX0A 1F5CA 4ECYA 4C2MA 2HZVA 3H20A 3OUYB 1S0MA 3P96A 2PD1A 5CHCB 2RHQB 3T9ZA 3H25A 1QSLA 3FSXA 1WC5A 3CJ8A 3RGIA 1TVRA 3G9CA 2N7CA 4FPIA 2IC3B 3PX6A 4KRWA 2OD6A 3RUBL 3PVXA 4U7UK 3HHKA 2B8QA 5A8WB 4D3GA 4K0KJ 2XLIA 1IVZA 2CA9A 3LP1A 2VKZG 2YH1A 2VG7B 4YHHJ 2QEXS 3BQ1A 1VDHA 4CYUA 4OYAA 2HVIA 1UJ5A 2Y1IA 2HW3A 2YWHA 4ZKAA 1FVQA 1CVJA 2KZMA 2CQCA 4DR6J 1RBAA 2W7PA 4PRFA 4G1QA 1YJNS 3FNNA 3IO1A 2A1BA 2XMVA 1GX5A 3OVBA 1ZOTA 2LA4A 2YTCA 2QLFB 1BQMA 5F9LA 4DSEA 3THTA 2U1AA 3K57A 1T3NA 4FNIA 2MQ8A 3KLHA 4AXJA 3NGDA 4CM2A 2OD4A 1Q8BA 4K4ZA 1MMLA 5IC6B 5THWA 4IFVA 4F50A 2ZM6F 3BM7A 1YWXA 5DQIA 5KFNA 2JSXA 1ZTTA 4MYTA 3KHLA 4QIFA 2V5HG 3SV3A 1RTIA 2R3VA 2JWNA 1PAEX 1RISA 1XNQJ 1WDTA 4ZLNA 4X4RA 3ETOA 1A6LA 5EDWA 1V5VA 1UWBA 2E1MC 8ATCB 2GVDA 1WHXA 4J37A 1L3UA 4C0BA 4ATNA 1TFYA 2DHAA 4PG6A 3CD0A 4DG1B 5LSOA 3HD1A 2E7WA 3K8VA 4OYOA 5JMNA 2UXBJ 3QGHA 3C15B 3ILLA 1DTTA 2YX1A 3DLKA 3KLFA 3K58A 2FLOA 1FRLA 3IXQA 3P3DA 4BC7A 2H48B 3M2RA 1HNWJ 2XULA 3DDNA 3R2CJ 3KMQA 2HHHJ 3SDEA 1CC8A 4NI2B 3A3NB 2M9KA 1RBOB 2JFKA 3FEXB 4C8OA 1QTNB 3FVYA 4RU9A 1KNZA 2WB1D 2WVEA 2VDHA 1S1VB 2HBQB 1NPRA 2VBWA 2AYGA 1SH3A 4K2JA 4LREA 5EX3A 1LWCA 4EUVA 2VQEF 2KO1A 3VGVA 5DM7Q 4HEA9 1ZTWA 2MDAA 2QA1A 4NXNF 2MQMA 4USWA 5I3PA 1H38A 4ZJQA 1Q8LA 3OTBA 2YKNB 3QPIA 4NL5A 2YNHA 4ECTA 2VFRA 4RJVA 2P9GA 4IRCA 2VC1A 1K8AT 3KUHA 4F3QA 7FDRA 2HK3A 4WIIA 1QVFR 4C3LA 1TUGB 1WUUA 2GW8A 1A9NB 1D8ZA 5F3TA 3BGLA 4ED7A 1K0TA 2ZOFA 3CJKA 2CPIA 4UTGA 2E9RX 2HS0A 4FS1A 2VJVA 4X4SA 4Y0FA 3ISZA 1OQ3A 4EFAC 2PDAA 4B3SF 1YJUA 4IOBA 1X4GA 4M5NA 2CJYB 1IJFB 1HQEA 1HNVA 4O0IA 4O3SA 3MOZA 3MD1A 5B0FA 4F02A 3MI7X 3R2DJ 2HAIA 1PJ7A 5FLXY 2XNQA 3OHAA 1GTEA 3SEOA 5BJRA 2MSTA 4LVNP 4JI7F 5KG5A 3HHLC 4PEOA 2VG6B 1RWPB 3D5MA 2DNQA 2PA3A 5F8GA 4DV1J 2RILA 4X64J 4FKYA 4OZ3A 2ALYB 1YZ6A 2IDEA 1ELOA 3MM7A 3S6EA 1VQOS 4A48A 2VA3A 2H65B 3GJSB 3FBEA 2MJUA 3DOLA 4P74A 1S1XB 2JFDA 1NSPA 2FZGB 4DZ6A 3I87A 2RDIA 3CD7A 1JLFA 1YITS 1DURA 2VPXB 2BOAA 3S7RA 4C7QA 5K14B 2DKOB 1NDKA 3BB5A 3HPOA 2R7OA 3SCIE 4C11A 4ELUA 1DBDA 3CGIA 4KT0C 2W8KA 1RABB 2K06A 1A0OB 1QLNA 1YRTA 4FS2A 4LSNA 3UVJB 4IOCQ 4EU0A 1N33J 4DPTA 5LJ3Y 4ELVA 2XS2A 5LL6d 1XMBA 3L4BC 4ZCIA 3OBIA 1RKJA 4U95A 4RBTA 3KDOA 3E01B 2Q43A 3MEGB 3ZZZA 1N36F 5KFAA 3T19A 4I7FB 4FF3A 2QLWA 4RR5A 4CLYA 1T9YA 4RW9A 3MPDA 2DD8S 1XMQJ 1TQLA 5A0YB 4OYBA 3W60A 4V1Ak 3OXLA 4C8LA 3M8WA 5H1SV 4J9SA 4LF5F 2B9XA 1X4AA 1U4BA 1U49A 4ZVGA 4GKJF 4PXDA 2XS5A 1Y4ZB 3D68A 2DGQA 3EGVA 2EFOA 1FJEB 2V9KA 3HDSA 1JWWA 4K4TA 2XMUA 3C16B 4PXEA 1CEZA 3DOMB 2XLKA 1F6TA 2NSCA 4C3KA 1U1KA 3HK2A 3MR3A 1AFIA 2CQ4A 4OQJA 4H4KC 2M52A 3D67A 3VF0B 5CYMA 4JB8B 5EWGA 3HI9A 5K8NA 1PAUB 5C25A 4OJGA 1FHTA 3W8GA 1F9HA 5T14A 4UOGA 3W9HA 3W2VB 3MWBA 2J0QD 2HHSA 1WG4A 4OZ2A 3T5HA 4K4YA 2YNFB 3OLAA 1S6PA 1Q82T 3HLUA 5HAOA 2ZE2B 3HVTA 3U1NA 1RAJA 1N88A 5KFSA 4KTQA 1Z4UA 4PXBA 4LF6J 1YIJS 3UD3P 1EP4A 4IG3B 1UMJA 3DRRB 1UVNA 1SJQA 1JLQB 2JHEA 1T95A 1NPKA 1N4LA 4ZVEA 4GKKJ 1M0SA 2JVRA 4Q8EA 1CJTB 2UU9F 2YKMA 2DR6A 2B43A 1ICEB 1U26A 4ZPTR 1RU1A 1VLYA 2G0IA 4NLQA 1LXNA 1VK8A 2ZZNA 4EGLA 4B9NA 4R25A 3MUTP 4K4XA 2MKKA 5IT4A 2UZAA 2EPIA 3CCTA 2E1RA 5GMDA 4NCGB 2MKYA 3C14B 3QWUA 4IH6A 3JQMA 4FP9A 1J5OB 5EUHA 4YY3F 2CQHA 3FMWA 3VVTA 1ZETA 4P7TA 3UDEA 3AOAA 1FJCA 3M32B 3NKYA 4UUWA 4LF8J 4MMOA 3GFHA 2JRSA 1TL7B 4DQQA 3BYRA 9RUBA 3DOKB 1M5VC 1U8SA 5GAHU 2RH3A 2H51B 5KTQA 2DNYA 3FMBA 1WEYA 4KAIA 3PCOB 2QL9B 2E5IA 2XY6A 2CZ4A 4TYAA 1HNZF 2MB0B 3I5AA 4JI5F 4MTPA 2D1CA 2C28A 2Y1RI 4Y2IA 4PABA 1VISA 3POTB 2IBOA 4F4YA 3OR1B 3KNAA 2Y0SD 2HK2A 5SUHA 1IWAA 2EFGA 1KQKA 2W01A 1UL3A 4RO0A 1UVIA 4JOUA 2AZ1A 1YGYA 4F4XA 5GAGU 2EXUA 1HKAA 4PG8A 3PKMA 2IRXA 3QSYB 1O8BA 1NMEB 1CJKA 2OLWA 3LH2S 1T8EA 3G8QA 1RTDA 1NK5A 1IUJA 3N6NA 3QNWB 3E3XA 1MMNA 4MT1A 1ZS6A 4CTAA 3G8SA 4TKTA 3RYLA 3H90A 4DXLA 4CLKA 3MD3A 2Y3YA 3A1YG 2CQBA 5B0CA 2D9PA 4M5GA 1OIAA 4ZP8A 4FZVA 2FDNA 4DR3J 5CZVA 4UOHA 5J1EA 4JP8A 2XYGB 3ELHA 5B09A 5D77A 3HSGA 1TR0A 5AXKA 2FJAB 4OX6A 2RVJA 2XBPA 3L3CA 3PV8A 3M1VA 2DHXA 4ENOA 2V2ZA 3MM9A 1OMSA 1MNEA 5LXRA 1FRXA 4MK7A 4BBYA 2B4PA 3GJRB 1S9GB 2W24A 3IFEA 4DV2J 2OPQA 1TL1B 5GADU 3N5FA 3TX8A 1N34J 1WORA 4UUXA 2I2YA 2AQ4A 3PZPA 2FHOB 3OFEA 4U8VA 2GIQA 2FQQB 2NZCA 2RF2A 1U0HB 4NLTA 4HT7A 3NBPB 1EX8A 5HSPA 3Q83A 4PCQA 2UV8G 5KFUA 4LQ3A 4WK3A 4HACB 4YHHF 4URGA 2VFVA 3AB2B 3J80Y 4FKXA 2I1RA 1TKZB 4O4GA 4TXSA 3V2UC 2R2TA 3QT8A 3WC0A 3DDKA 4ZS6A 3B82A 1FK9B 2ZVIA 2VFUA 2OELA 4Q43A 4A8WA 1WELA 4X62J 4HI2A 3GIRA 4V19J 4I68A 2DNKA 3HX9A 2X1FA 2KM8C 3K5OA 2W4PA 2O01C 2WK4A 1J27A 1KHWA 2MXYA 2BQRA 2C2DA 3BZQA 1RA7A 5L38A 3IRXB 2Z2LA 4UOFA 1X31C 2M3DA 4Y65A 1VQ8S 3H4DA 3PW7A 4FN5A 2HSEB 2PN6A 1VQ7S 5E3RA 4CI0B 1XNQF 3WDOA 5HANA 3EGWB 2PC6A 3RBDA 2DR8A 4I2QA 3ENWA 3KG1A 1HNXJ 1RCXB 4DPXA 1VC0A 2BVZA 3OVSA 1U1LA 1YJRA 3LWLA 5KFLA 3H0PA 3KDNA 1SC3B 2YKPA 3I6PA 2KN4A 4TQSA 4XIUA 3M2VB 2EVZA 4M94A 3ONQA 4C9DA 3P4UB 3GFXA 2ASDA 4DUZF 2UP1A 3EJMA 4PWDB 1IBLF 3I82A 2Z2ZA 4KHPF 4IG0B 1RAOA 2BEFA 4USHA 2CJQA 1ZAVA 1CS4A 1N54B 1HNWF 1T9TA 4A8QA 5D3GB 3BGRB 5H9FJ 2B4UA 1HD0A 2K2PA 4HI1A 2MGZA 3I5CA 2E9ZA 2RUGA 1RP5A 5KFRA 1PBAA 1WJ9A 3DLJA 5GMKa 2C2EA 3ADAC 5JUMA 5L9XA 3U02A 2MZQA 3G6YA 3EMTA 2RQ4A 1I3OB 2FJEB 3ZO7A 4U9RA 4DFPA 3L9ZA 3ITHA 2CPEA 3IM8A 1MSWD 3QJLA 3C6TA 4QCLA 2BDPA 2FTRA 2FUG9 1B0PA 2QMUB 2DGXA 2OPRB 3G6XA 1S7IA 3E2EA 3TJ8A 4DI6A 4CLWA 4UZCA 1QSSA 2I0XA 2C2KB 2FVPA 2DPJA 3CDWA 1GFWB 3W61A 1Q86T 2WBMA 2KJVA 2DIUA 1NK4A 2V2KA 1JLAB 3V4IA 3OV7A 2PA8D 5KFPA 3PM9A 3MZIA 3O1LA 2XO7A 4ILMA 4H4MB 4QIEA 1W25A 4BCAA 1I6JA 2YKOA 2IJFA 4HHUA 3T3FA 3CW2C 1S1WB 1NK7A 3DRSA 4ZLJA 5H9EJ 3BGFA 2MQPA 2QLXA 3CB4A 4J9VA 2AJ0A 2YNGA 3D1QA 3KK2A 4Q44A 3PRDA 2Z0GA 4F4AA 2E5HA 4ID5B 8RUCA 4NCBA 2DO4A 3EDQB 3OJUA 3DU5A 3UDCA 2HBYB 5B0EA 2CPFA 6FD1A 3ZZTA 4GC7A 1G7CB 3Q8PB 2CAJA 3PRBA 2R4FA 3LOUA 3VQSA 3N5BA 2BJ8A 4DV1F 3CDEA 1RT7A 4X64F 4FBTA 3EUNA 2DXEA 3JSRA 1U1NA 4ZK7M 1E6VB 1FO1A 1FNMA 2WOMB 4DN9A 4C6AA 1OPZA 2HZAA 2C3PA 3KLVA 4YN3B 4J9KA 5DGBA 3K5MA 2DHGA 4BHQA 2UUCJ 2W2MP 3MM5A 3ZNUA 3PEJA 4AL5A 4A8FA 1F9EB 1T02A 2ZDPA 2UVRA 1YJVA 5CCMA 3I0SA 2HMIB 5AXNA 2F9JA 1VQ6S 1JKHB 2GGPA 4IH5A 1NDCA 1UTAA 3R5CA 3H7HB 3UDLA 4OZ1A 1FD8A 3PO5A 4DJBA 4PQAA 4FYWB 4RZRA 1SUQB 3B54A 3HO1A 3C6UB 1YKWA 3U1LA 3ZZOA 4DV6J 2WW8A 1UPMB 1S1UB 4NYPA 3RR7A 4ES1A 1FXRA 1F1BB 3J7ZT 3TAMB 2Q66A 4DUYJ 3M8YA 3ULHA 2KI2A 1D0EA 1FDNA 4IOAQ 4JV5J 1OY6A 2MJNA 4DFKA 2MTLA 1NSAA 3SFGA 1FCAA 1RAFB 1WOSA 4JYAJ 4C0OC 4X84A 1RE1B 1UKUA 2NPIA 3WX8A 1VS3A 1V5IB 1YJ7A 3OT9A 4XAKA 1XR5A 4C8YA 1UVJA 2D9OA 5FD1A 2LQBA 1N5SA 8AT1B 1YK9A 5F3ZA 4P7VA 3OL9A 4ED2A 1WC4A 1CSJA 3JAMU 3JSMA 5CYQB 3BREA 1CQNA 1U2CA 4CLPA 3W2WB 5HP1A 4NCAA 5F0WA 3GV7B 2J76E 4P10A 2UXDJ 4ZVFA 2EC0A 3KUGA 1T3OA 4LFBF 3EPGA 4MIBA 3SBMA 3M6WA 2ABYA 5HO4A 1RJJA 2CJXB 3TUJC 2DGWA 1O0PA 2K1RB 3GPAA 3PTWA 1HHTP 3DN9A 3SSRA 4IO1A 1CULA 4QWEA 5HVFA 1FKPB 1M5HA 3IWLA 4XTTA 5A8RA 3AB4B 2M5YA 5J2PA 1LW2B 2WSCC 4YDXA 2QFJA 1U1MA 2BE9B 1TTHB 5EN1A 2YX4A 3BSNA 2XM3A 3DGPB 1FRJA 3PO4A 2KRBA 4NX9A 4LF6F 3CMQA 5KFXA 2YNIA 2VQFJ 3EVWA 2B6AA 2CQ0A 2C2OB 5HVGA 2DBBA 2G4BA 2IHR1 2AWZA 5KFWA 3UCUP 2V0NA 2E7XA 3AH6A 5KFVA 3Q2TC 2O66A 4WFYA 5CYJA 4C0HA 1LV5A 2XGPA 4GO5X 2NPFA 1VQ9S 2JC0A 2FYXA 3CDBA 4O3RA 2VBZA 2GX8A 1HQ2A 1HI1A 1TUVA 1WKKA 2OJ3A 3SSSA 2ZD1A 4CLTA 4QQBA 3CC7S 3A13A 2LU1A 1JLBB 1RXOB 4O44B 4YR3A 3VQTA 1U09A 1VGYA 2IBKA 2ZH6A 2HGMA 1O6XA 4DV4J 4NXMF 4NMXA 5IV4A 2J6SA 1WEXA 4LSLA 3KJVA 1GNKA 3BJYA 2QGFB 2M70A 3F41A 1W7WA 1HBUA 3IR7B 5A8KB 3M6UA 4IR1A 1WDDA 1HL6A 4XK8C 3T9NA 3V6DB 4B3MJ 2Y8YA 1FKAF 2BJ3A 3OL7A 1DLOA 1S57A 2SXLA 3ET6A 3BDEA 4EI2A 1VC5A 2QYGA 4I2PB 2GAGC 5I3QA 3AXMA 1H2UX 3OTCA 1EKRA 2LXIA 2JEFA 1U48A 5DDRC 2VG5A 3DYAA 1NHKL 2ALZA 4DDFA 4C48A 1XMOF 2HFUA 1SJ1A 3CMES 4O3OA 3H98A 4WTYA 2GO8A 1WSRA 5D0GA 4WP9A 4ZCKA 3CD5A 1TV6B 5C2GA 4RL1A 4DR7J 2HHQA 2R7WA 3LP2A 2LP4A 5HK4A 1VQPS 5D0RA 2CQGA 2VZ9A 2ADCA 2RMLA 1L5UA 4W90B 1YJWS 2QL5B 2ZKUA 1NKBA 5EHHA 2BE2B 1TAUA 4L73A 1N6QB 1HPZB 2KB2A 2C2RA 1UCNA 4TU9A 1C0TB 2WTFA 1Q95G 2HAFA 1Z1ZA 3R97A 3MFHA 2W2OP 1U6FA 1N5QA 2ATLA 3CO0P 5ETMA 4GVBA 1N5TA 1P1LA 1PSDA 1ZPVA 2HHUA 2PMWA 4P2XA 1AYEA 4ETZA 2J0SD 1K73T 4OHZA 1RT1A 1MU2A 3MEEB 5KFMA 3TQEA 2FVCA 1MW7A 1F3FA 4W92B 4ALZA 3D2WA 2VJUA 1DZ5A 1RT3A 1PJ6A 3PX4A 3RBXA 2MQNA 5DDPC 2OIHA 1XBWA 5FDLB 2R42A 7AT1B 5M2PA 4Q2MA 4ZN1A 4KSEB 4TN2A 3JYTA 4RW6B 4HHJA 5GAEU 3QGGA 1SKSA 4DL0C 1HYSB 1MROA 5HLFA 2DNLA 2HQDA 4QWCA 1C1BB 1GMWD 1RTJA 1T9VA 3PEHA 2ROPA 1MWYA 1NSKL 2VOPA 3KWMA 2BQ3A 5B7WA 4H4OB 2CQ1A 4NOHA 4RKUC 1U0SA 2NXEA 2RAQA 2CQPA 3ZTQA 4Y34A 1SC4B 3KHRA 1VIOA 4GO7X 1TK0A 4DL5A 1M90T 2ZJPQ 1CJVA 3G82B 2V2QA 2BJ7A 1EQ0A 3W5XA 4X4VA 3QT6A 3N28A 3T1HJ 3TZXA 3SV4A 4J9QA 2AMCB 5D15A 3FRYA 1PILA 3VVUA 3GWCA 4RBVA 4Q0BB 2WCXA 4P2FA 2GA7A 1KLMA 2HVEA 1R0AB 2C22A 2GJIA 2ZC3A 4QWDA 2BRLA 1SIZA 1WC6A 4R8UA 2UUBJ 1T9XA 5FLXU 3SCKE 3BSOA 3NMRA 4LFAF 1Q7LB 3OSPA 1IR1A 2KU7A 3VWSA 2V8GA 2RQKA 1H7WA 1S5ZA 1Q53A 2AJQA 2XNRA 1LFWA 1QAYA 1TKTB 3M8QB 1NM2A 3W63A 2Y1LB 4J9NA 1NDPA 3UE2A 1H3DA 1EIYB 3QO9A 4QIGA 4A8XA 1FE0A 3BF4A 2VU5A 3FEYB 4WPAA 2NLWA 3MEDA 1OJ4A 3OD2A 2R7RA 1DTQB 5IQ6A 3MMBA 3PYDA 1BMQB 3O8WA 2YX7A 1GMUA 2NXUA 4HHHA 4MAKA 1FKOA 3NP5A 2W9BB 4AUKA 3AXKA 2NXNA 5DZ6A 1NSQA 4NLYA 1IM4A 2UVUA 4MJKA 4QR0A 2CPZA 1S9EA 2E5LJ 4UZBA 3PKYA 4A8MP 1S1TB 1D09B 2WBRA 3HULA 4R0JA 1GMVA 2R8JA 1FDAA 3Q8SB 1HNIA 3CCVS 2GNKA 5HMXA 4GMKA 3CIMA 1LWFB 4LSZB 2OEJA 4A8KA 1RWOB 2GO9A 4M5KA 3I0RA 2ZJRQ 3LA0A 4IDKA 2WSFC 3MECB 3W5YA 4QIVA 4KGKA 2V4JA 1NK0A 3R9LA 1OY9A 4WE1A 5C42A 3AD9C 4PPDA 3RW7A 2Y0BB 3FFIB 1WOOA 1J5EJ 5BYRA 4F7VA 3KK3A 2HGNA 3G2XA 3R7SB 3FZ2A 3I4PA 4TLQA 4NZ0A 5IFMA 1FDDA 1XNRF 1HBOB 4XPCA 1D9DA 1EETB 4CZCA 1RACB 4ZPWR 1JQGA 3CJ3A 3MMJA 3AY0A 2W8LA 3M9MB 1VJWA 2XCAA 1FXLA 2RUSA 3DMJA 5DLFA 1PGZA 1I5OB 2E5GA 1IWGA 5MLCV 5KT7A 4F04B 4NE9C 3PJ9A 1X0PA 5BR8F 3ISND 2YQ1A 1N5VA 1X5SA 1S0VA 2A0FB 2HLUA 4A8YA 1B7YB 1SCJB 2I8EA 1RT4A 2ZM6J 2FVSA 5H9FK 3HT3A 1S6QA 2M2BA 1AUDA 2W2QP 3SQGB 4Z2XA 2LQJA 1RLCL 2GC8A 2LLZA 2CDRB 2VASA 3P45B 2QYCA 3BR8A 2C42A 1S49A 1O5JA 1NKCA 3V81A 2NXJA 2Z57B 4ZOSA 3UI3A 1VQNS 4X4PA 3PJWA 2JOQA 3OW2R 1FT8A 5L1KA 4OX9J 5IQQA 5GMEA 1FDBA 2UVWA 5HMWA 4HH1A 4CO1A 1TFWA 4O3PA 1XC9A 4DV6F 3BN7A 1IN0A 2IFXA 3GMGA 1UJ6A 1UP1A 3EWGA 1JLCB 1N0VC 3PXGa 2YVSA 5E3AA 3HHLA 3DLLQ 1NDLA 4DZDA 1QUPA 3TNVA 4JV5F 1WF0A 2HNYA 1BC6A 3PRVA 5L1IA 3M05A 2BZ2A 2JNJA 2WVDA 4JYAF 4JI4J 2HNDB 1Y3JA 1VIXA 3R5JB 3LW5C 5BYSA 2OUGA 4BDPA 1FWKA 2VHGA 1KBRA 5H9EK 2LEBA 1T03B 2WONA 2VQEJ 1RWNB 4Y2AA 5I4MA 2AU0A 3K2YA 3LP0A 2W4DA 4ETXA 2E5JA 1DAXA 3KLGA 3NG8A 1YBTA 1W2BR 3M7VA 4WKRA 5DM6Q 3PR5B 4BS2A 3HFVA 3K0JA 2CPYA 2BOPA 1TMJA 1YDLA 1BWEA 4UW2A 3FK4A 2QA4S 4NLSA 4DV7J 3AT1B 7FD1A 2B5JB 3UNYA 5HROA 3OQ2A 1NCLA 5KT2A 4X65J 4ECRA 2BX6A 2ZBPA 1FESA 4DFJA 4QIWD 5E3CA 4CDIA 3M8PA 4Q8FA 1NJYA 2Q79A 5KFQA 1FVSA 4CLLA 2CFXA 3AFGA 4ANDA 4B3SJ 2J7UA 1BLUA 4F36A 3HF5A 4AD6A 1WF2A 4IFYB 4B9LA 3R5BA 1UJ4A 3KK1B 2XQCA 3VV2B 4KR0B 1LW0A 3MMCB 3HZEA 1ZM2A 2EC2A 3KLIB 1HHSA 4JI7J 4LMZA 4F4WA 1WTFA 2BW2A 2DGVA 3J81Y 4U6PA 5IV3A 3R27A 2Q1LA 2Z30B 2XG8A 2J7KA 4H4KA 2KFYA 4JI0J 1ZM3A 1VYAA 5T7LA 2X3GA 2KXNB 3CF5Q 1ZBTA 5E3PA 3H2UB 1QVGR 2LEPA 1A7GE 3IGNA 4YB7A 2J5AA 3V6KA 3RRKA 4DV4F 3BPDA 2V69A 3PACA 1WG5A 4CLZA 3VZHA 2BABA 4EO8A 4RWXA 5KFOA 1IR2A 2KT3A 5G4DA 1NK8A 2VBXA 3GYNA 3R1HA 3KJNB 2XYHB 2G2ZA 2JLGA 4LF4J 4DCOB 5ITHA 1VCTA 2V8HA 2IMOA 2OH2A 3W7BA 1UWAA 3QMQA 2Q3PA 1X60A 3BH7B 3TJAA 4FPRA 3MTKA 3OFHA 4KPCA 4J9MA 2F65A 3PHTA 3B8HA 4WBFA 5HN0A 2POKA 2BANA 2KTQA 2XGQA 4I6WA 4LF5J 2H5EA 1NXIA 3QIPA 1CPZA 4WJBA 4F4ZA 3IP0A 3I56S 4GKJJ 1S9FA 4RUBA 2ZITA 2VOOA 1KKHA 4MFBA 1CJUB 4FXDA 2CPHA 3IWNC 3HXMA 2AGPA 2MQLA 2CXEA 2MHEA 3BSAA 4DL3A 5I3UB 3RJMB 1SC1B 3KFWX 1Z2LA 2YPZA 1HBNB 4IR9A 3BQ0A 2W9CB 2KHDA 1YJTA 1TK8A 2FC9A 4QPXA 1RYSA 1AW0A 4DR4J 1T9WA 2OFGX 2KXHA 2D3UA 4I56A 1RSCA 5I42B 3D6MB 3UDVA 2RU9A 3F56A 5IM0A 3D0IE 3GJQB 2J0XA 3UFCX 1RLDA 2DNZA 1UEVA 3NLCA 2LQ9A 4DQRA 4A46A 2QE5A 3MMAB 1UFLA 3PFOA 4WFBQ 4B3OA 2J9EA 4M5DA 2BW7A 4BLGA 4Q45A 4CLFA 3M8RA 3AD8C 3OHBA 4KV8B 2MKSA 2YY3A 1H2VZ 5DDOC 5KFIA 4KBIA 3AQOA 4B17A 5G0RB 4ZN3A 2OAUA 3QGIA 2R7VA 4PYDA 1HMVB 4NLWA 2NREA 4YQWA 4DS5A 4H54A 1R8HA 2W25A 2F8HA 2H3EB 3D6FB 4DOZA 1FJGJ 4RNMA 5HL7Q 2E29A 3VAIA 1D1UA 3QBCA 3L7PA 5SZTA 4NWBA 1TVRB 2RB7A 5AE2A 1JLEA 1RT6A 2UUAJ 2DHSA 2HQIA 3UR0A 2HS3A 4KFBA 1OYEA 3LP1B 3T1HF 1JX4A 3TX0A 9ATCB 4P73A 4YFUA 2MZJA 4CYUB 2DIVA 2QO3A 5M2RA 3AA8A 1KN6A 5KG0A 2V50A 2AD9A 1OSCA 1BQXA 4JI5J 2A6MA 4J7CA 2IA6A 4G1QB 2XMAA 5HMYA 2XMJA 1RWUA 1DJ0A 3KG4A 4KKOA 1R7IA 1BQMB 2OPPA 5DS7A 3Q8RB 1R0BG 5DJBA 1APSA 3KLHB 4N5SA 4RW4A 1DHMA 2AGOA 2DPIA 2AKWB 4LR9A 4IFVB 3EM1A 4PR6A 3H5XA 2RS8A 4M5HA 3MF5A 4OI4A 3LAKA 1ROFA 3HMJG 1RTIB 1JXEA 2WZ1A 1DY3A 2Z58B 4ZP6A 2BJ1A 2I5JA 4DL4A 1D9AA 1UWBB 3CC4S 2GVDB 3TJ9A 1KQSR 4TYBA 2HRTA 4B9VA 4PUOA 2HNZA 4A8SA 1SKRA 3GQCA 3IG1A 3T41A 2PMHA 1S77D 3PNIA 1DTTB 4WFXA 1RK8A 1KDNA 1KONA 1OY8A 1SV5A 3DLKB 2F8MA 3KLFB 3D3BJ 4WP8A 1R6YA 2YQ3A 1SJRA 3TYTA 1WNEA 3M2RB 4FVCA 3KHGA 2V67A 3SDEB 3CVKA 2G2YA 4LR8A 5EGYA 5IWAF 1RHJB 2UV8A 2X1AA 1M5PC 4U67Q 6AT1B 2XCPA 1PO6A 2PEBA 1K1QA 3D0HE 1WTBA 1JLBA 4PYAA 3OJSA 3MAHA 4TY8A 2CPDA 4QW8A 5HQMA 1LWCB 1JLGA 2ILYA 2ZOGA 1REGX 5LOQA 1BE4A 1U7LA 5E3QA 1J5EF 3QAUA 3GIMA 4DV3J 2QLJB 1LWEA 3GU0A 2PI4A 4I0WA 3W3SA 2YNHB 4XO0A 3N79A 2U2FA 4WWSA 4JV1A 2EK1A 3CCWA 2GHVC 2FGCA 4F0MA 4E2FB 3QT5A 2YKQA 2HRYA 2KYZA 1YVFA 3W5ZA 3WIUA 3JXOA 4RLEA 5CD4A 1FI4A 3HM9A 2RHSB 2CQ3A 2N82B 3CJKB 5KG7A 3J7YU 3MEKA 3VAMA 3K17A 3M2UA 3FSYA 4P2MA 5D4NA 4LRAA 1HQEB 1HNVB 3WHIA 2ZNZA 2DHHA 4J9LA 3MR7A 1REVA 4KH0B 1TL3A 3FRZA 1C1CA 2IIHA 4ANEA 4IH7A 2QG9B 1RAAB 2OSQA 4DPUA 4NLRA 1B3TA 5IC4B 3JTPA 5EWFA 4OZLA 1X5OA 4F26A 1RAEB 1T05A 4URQU 3KJFB 4DSLA 1WG1A 1RT2A 3NCRA 3CCSS 6FDRA 3Q2SC 1GX6A 3GV8B 5JVHQ 1KTVA 3MM7B 4PQUA 3V5RA 4OX9F 4GVLA 1IKXA 2E66A 2HYIB 1YRXA 4KIAA 3KLEA 2I6WA 3DOLB 3N6LA 3CJ4A 2Z2YB 2LYVA 3BH6B 4JV2A 4DUZJ 1HWKA 3G71S 1JLFB 2GQCA 1WHWA 3PW2A 1IBLJ 3EZUA 4KHPJ 3RRGA 2ACYA 2B9WA 4C11B 4DV0F 1VI7A 3Q89A 4KGZB 2IVYA 2DCUB 2KG0A 2H1YA 1CQMA 3PG9A 3SIPB 1FNOA 1HA1A 1XK8A 4KB7A 4LSNB 2WW4A 4JI1F 1Y9OA 5HI7A 2G2OA 4JI4F 4DFMA 2B8PA 2CNKB 3QZ7A 2EKYA 2MPUA 1HBMA 3P5BP 3BKTA 5KT6A 3US5A 2YWEA 5DQGA 1Q79A 5DG7A 4RW8A 1N0UA 3PR4A 4RW9B 2RE1A 4LRCA 4ED0A 4EK2A 1F2GA 3TEGA 1JIHA 3AD7C 4B08A 2FJVA 1BUXA 3D1HA 2F4VF 2E7VA 2LEAA 2CYYA 1QJHA 4ZVPB 2L9NA 3DHWC 1AT1B 4PG4A 2ZKTA 4JI6F 4DV7F 4DV5F 1U8WA 3UD5A 3TZWA 3SFUA 2AYMA 2MKHA 4X65F 1RAGB 1XERA 2ROEA 3PJXA 1S48A 3NS6A 4CRJA 1NLKL 1S6UA 5ETKA 2MKCA 1SQFA 4EYHB 2QFIA 5KFYA 1KOHA 2AJ1A 2V2VA 3UN3A 5DO2A 3V4MA 3JTNA 1AXQA 1R6VA 2OTLS 2J8SA 5CYMB 3BR9A 4CO3A 2RDDA 3ENVA 5C25B 4RW7A 3EVOA 3NAIA 3TEHB 4IRKA 2AW0A 4E8UA 1BGXT 2Z4PA 1B99A 2QA2A 5HBMA 3GR0A 2HVHA 4M5MA 1S6PB 3HVTB 2BR0A 3DI6A 4L3KA 4R5PA 4OLOA 3IR5B 5U47A 4HTIA 5KFEA 1EP4B 4JI0F 1Z2ZA 3K5PA 3K7RA 1M5SA 4TNOA 3U7JA 3SI8A 4DCPB 4DU8A 2YKMB 4LBHA 4CO5A 5KT3A 3MGJA 1X4HA 1H98A 5D8HB 4DR5F 2XMWA 2GHWA 2VH7A 2EFVA 3RB4A 2ADBA 3FCVA 3IR6B 3RR8A 1DTQA 2GMHA 1VQ4S 2D7SA 1ITPA 3HCXA 4ZVSB 2HG4A 3HKZD 2GIRA 4NZ6A 1RT5A 3NEKA 2KH9A 2KXFA 1WHVA 2BKNA 3QQCD 1RHUB 4LF4F 1WC3A 3D9BA 2P9CA 1KS2A 2XHCA 2CJAA 5J1PA 1WEZA 1GTHA 4LBPA 4OL8A 2QSWA 3LUYA 4Z7CA 1JK9B 3CCUS 4FNHA 5KG1A 3WQPA 2G1HA 4A8OA 4ZLLA 1URNA 4LBIA 2LKZA 1PG5B 2FC8A 1Y11A 2D3OR 3EZOA 1IQTA 4DLGA 1VFJA 3NS7B 1RYRA 2B0GA 1SKUB 2BBEA 4GC6A 2AJFE 2PIIA 2W2PP 5CH7B 1N5YA 3BO3A 1TELA 3CCES 3CCMS 3W8PA 1MWZA 1ZZNA 1GXLA 1TKDA 3OR2A 3GONA 4A4JA 2OSRA 4JI8J 5E5NA 5IT0A 1Q81T 3FDSA 4ZDNA 1T7PA 1W26A 2NQPA 4LFBJ 1NU4A 1Q5YA 1V3RA 1RGVA 4WFAQ 1BQNA 3ZZ0A 4ZP9A 3BDPA 1X4CA 4DR4F 1JXVA 1CJKB 3QLHA 5C24A 3BBBA 3W9IA 1KLNA 3NOCA 5ETVA 4DPOA 2R8KA 1RTDB 1H72C 3M9OB 1Y10A 4AQYF 2IA0A 2XZWA 2EFQA 3K5LA 5KFTA 4CTAB 4I64A 3T6BA 1IKYA 4J9RA 2X1BA 3FEZA 2CQIA 3QWPA 3CSKA 2ROGA 4ILRA 5F41A 4I69A 3OFGA 3MM6A 4HVZA 5J1EB 2KG1A 3CC2S 5B0AA 5F8HA 3RRHA 1JXLA 4J9PA 1VQSA 3M1VB 4ECSA 2YWKA 3MM9B 2FLLA 3MM8A 4FDFA 2AEJA 4Z37A 1U45A 2DNGA 4LRFA 3DLGA 1BD6A 4C97A 2NUUG 4WFZA 1Y0HA 2MHNA 4UY85 2OPQB 1N52B 4FF2A 3PW4A 3HT0A 4JBCA 3BGUA 2EW9A 1HWUA 2JX2A 4Y2MA 1FJGF 2L41A 4CH1A 1KRPA 4KH1B 2ZH7A 1Y3KA 1JNRB 2RF2B 1N48A 2CQ2A 4U7UD 4I6AA 4NXMJ 2UUTA 2M0GB 2GVZA 3NRBA 5KOWA 3OFFA 2UUAF 2VONA 4Y00A 1S76D 3IAS9 1R0CB 2FGOA 2B7CB 1E6YA 3M30A 4HH0A 4HLBA 4B9MA 3DLHA 3CDUA 1FRKA 4QU7A 3V6JA 1HARA 3CE8A 4O4GB 3K8WA 4NLOA 4O3QA 1U02A 2ZH2A 3QGPA 4LR7A 1HWJA 5E0OA 4LF7J 1IKVA 2JEJA 2BKOA 5J2QA 4ICLA 2QV6A 3R5AA 2ZBQA 4DX5A 5LMNF 3OXFA 3RAXA 1TKXA 3JTOA 3GV5B 5ETLA 1XMOJ 3RBZA 3VAJA 4CO4A 2GHPA 3ZNJ1 3IWXA 2QSFA 1YHQS 1ZAXA 2OFHX 1QD1A 4YEAA 2HKEA 4NPOA 3LPEA 2XZDB 3BO2A 1X4EA 4K5SA 4I67A 2ZH9A 3B6BA 3OTOJ 3FZBA 1U2RA 2E1CA 2R7TA 3MR2A 4I2QB 3TARA 3NNHA 2DR7A 2JH3A 1IR0A 4LRDA 2ZFHA 3FGVA 2ZEJA 2ZUGA 3JQJA 2OHDA 3X1LB 3SYZA 1JMTA 5CCLA 2YWWA 5IXUA 1VRTA 3DLEA 3DNCA 2HHTA 4ZP7A 1CS4B 2B9YA 4NLPA 1EZZB 4USTA 2ATCB 4DX7A 2MGZB 3SZ2A 1RTHA 4G65A 3HVWA 2W1BA 1ZA2B 1NHVA 2BUNA 2IJNA 4AXIA 1S10A 4K4SA 1GH8A 4ZJOA 2GAHC 3EE3A 4DR1F 3UCZP 1NO8A 1Q8KA 5ADZA 3T5KA 4XDCA 5A6WA 2ZHBA 1HQUA 3DRPA 2F4FA 5F8LA 1SL2A 1K47A 4O4RA 4PAAA 2HWIA 3ITHB 4DV3F 5CQGA 1R43A 4ZPVR 4USUA 4HL9A 3C6TB 2M4MA 2LXFA 1KC8T 2K3KA 1JNZB 3QIDA 1B0VA 3TW0A 1GAOA 3LGMA 5E41A 1U25A 4ELTA 2YWGA 3I32A 5C7PA 4X66F 3BO4A 1FD2A 4OV6A 1YG0A 3MAAA 3R3TA 3V4IB 3QZ8A 3QJJA 5F0UA 1SBRA 2D69A 1ZYQA 3GCWP 4USMA 2EWHA 3AJ1A 4YB5A 3T5JA 3DRSB 2VFTA 4N41A 3H40A 4FXWA 4DPYA 2YNGB 2LCWA 3KK2B 2NYHA 2G1DA 4QWBA 1YX2A 2UUWA 3TANA 3CJ5A 2B56A 2R8HA 2RKIA 4WKYA 4LFAJ 4NA3A 5J2MA 1W2IA 4L72B 3Q23A 1UEUA 1UPPA 1TU0B 1HBNA 1ZM4A 3KNGA 4OZJA 3LALA 1RT7B 2XWYA 3CD6S 3R5GA 2A3JA 1TP7A 3TRGA 3VTIA 4JI2J 2NUHA 2DYAA 2GV1A 4KO0A 4LF2A 1VRUA 3MCSA 1HLWA 2XSFA 3MM5B 2DGUA 5J2NA 2DGTA 3I0SB 1F9FA 2AJ2A 2JDJA 2MLXA 2A6OA 1FEHA 1SVDA 2C2MB 1IBMJ 2QIFA 2GGPB 4X4NA 1FFWB 4ZHRA 2EK6A 3NCQA 3C2PA 3HZGA 5DG8A 3GG1A 3WX4A 4RUAA 4K50A 3D3CJ 4OYXA 3UN2A 1C0UA 2F8EX 3CJTA 4UF4A 1UZDA 5A2QY 2GJ2A 5HMZA 1LQ9A 2GJFA 1KOOA 1Q8IA 3P49B 3IBFB 1X9MA 1CLFA 3ILIA 2AEFA 3A8IA 4RNNA 2CZ9A 1S6OA 3M6XA 4ZPDA 2OPSA 2HBRB 4G1PA 3DRYA 3A3OB 4HKQA 1QUVA 3LANA 3D4JA 2J6UA 3ZXWA 4F25A 2EG2A 3FJ2A 1JB0C 1HR0F 2ASJA 1SXLA 1U6BA 4AL7A 3JQKA 3W64A 4Y28C 3D54A 3JSMB 3C46A 2LDIA 5HP1B 3H2VE 2VC0A 2QMWA 2HIYA 4CH7A 2EBGA 3EGZA 2N3LA 1IKWA 3BPSP 3BN4A 4LF9J 2VF3A 4WP3A 4OHWA 1DARA 2G0JA 1XNRJ 2RS2A 1NRKA 1X8DA 3GILA 3W62A 1VQ5S 4WXOA 2DH9A 2HHVA 1S79A 1TMMA 2V6AA 4DQPA 4IQMA 3E51A 1CULB 1FRIA 1Q4RA 4P6QA 3C3LA 2KT5A 4LJMA 5A8RB 4NA1A 1JJ2R 2XSJA 5BR8J 4K8RA 5J2PB 2PT0A 1IBKF 4Y2CA 3MUMP 1Q7YT 2IAJA 1Y00A 2BJEA 1NNDA 4FYYB 1IXKA 2CG8A 3I55S 2YNIB 4N7TA 2B6AB 3CT9A 4ZCLA 2KYXA 1ZAWA 2DH8A 4NLVA 1H7XA 4USVA 1XR7A 1KQGB 1N32J 2UXCF 3PYGA 4ZVHA 5LSRA 2R8GA 4WXWA 1QY7A 1X5TA 4ECZA 4JUZA 2FHKA 3HHLD 4N76A 3VAFA 1RU2A 3EPIA 2AT1B 2ZJQQ 3LGHA 4C8NA 2HRUA 1OWXA 2EI5A 3SCJE 2ZD1B 4X2BA 2FHJA 5CAAA 2KFNA 3LPYA 3MR5A 1DRZA 3DCAA 4HR2A 3T1YJ 1QDUB 1QE1A 3B4DA 3KG0A 4CM0A 1GQEA 1AZSA 2AP6A 2OO4A 4LSLB 3KJVB 4F8RA 2RRAA 2P5VA 3DM2A 1URRA 2DEIA 1HBUB 2JJ4D 3I31A 4DX6A 2LECA 3DFEA 4L3NA 3OUYA 1I94J 4CT8A 1LEOA 3HVAA 3EYZA 1DLOB 2NCKL 2HFZA 3ET6B 3IM9A 5KT4A 4CCHA 4N77A 3R8YA 2IMWP 3K5NA 2G0CA 1S4FA 3CCQS 2IC3A 4V19X 4LIRA 1S0NA 5DRKA 4EBCA 2BMBA 4WU3A 5FIIA 5A8WA 1VC6A 4B9TA 5EX0A 2VG5B 3DYAB 4ED4A 2AJ4A 2VG7A 2F3JA 4JI8F 5KG2A 1DQ9A 4ZPAA 3GJTB 1QM9A 1YI2S 4DU7A 2CUYA 3N0VA 2BXJA 3LP2B 4LT6A 4LFCJ 3FBBA 3HVRA 4ZVRB 2QA4G 1FJ7A 4MKYA 4ZVOB 1ZA1B 4EMDA 4LRBA 4ED5A 2LXUA 3AODA 2F5GA 3M8ZA 2RQCA 4CIOA 1UFWA 3AAWB 1U1QA 3DC2A 1G2EA 1KVKA 3JS9A 4DQSA 2CKWA 2MKIA 4J5OA 1UVMA 3OSNA 3UPFA 2BV3A 1UEKA 4UT4A 4JV0A 1NZAA 3NGRA 4QYRA 5GAHI 4OYIA 4GVBB 2Z2MA 4U8YA 1RT1B 1HI8A 1MU2B 2IYGA 1WC0A 1FWLA 3VAGA 1RT3B 4RWWA 5B0DA 4YS2A 2MQOA 4P9SA 4ECVA 2XB2D 2MY7A 2V63A 3F44A 2MSSA 3D6HB 4O0NA 4ZVQB 1I51B 3WBZA 4DG1A 4DLEA 1FFSB 2VD3A 2RRBA 3JYTB 1U1PA 2UVVA 3C15A 4EYIB 4ED3A 2ZH4A 2HVDA 2LQ8A 1LFPA 4ED6A 4KHMA 4P2SA 5CD4H 5GAGI 1WOPA 2WB4A 1MROB 5HLFB 2DR5A 3S1TA 2L48A 1RTJB 3Q8UA 4NI2A 4RPFA 3SMZA 3JSBA 5F9NA 3FC9A 4ZA1A 2XI3A 2QN6B 4X4UA 3E8OA 3U27A 1S1VA 3AJ2A 1XWLA 4FF4A 4FF1A 2AHOB 2HQCA 4NLUA 1WD6A 3VCDA 1V3SA 3ZTOA 2R7SA 1CJVB 2PFFB 1EKSA 4TQRA 4S0MA 3GIJA 4LF7F 2H9ZA 4OX7A 5K8MA 2H4WB 4CH0S 3D1OA 1M1KT 1U6ZA 1S99A 2PE8A 3MURP 1Y5IB 3QAEA 3P5TL 2YKNA 2XZTB 4ED1A 2LDYA 4UQTA 1KLMB 3N4WA 1SPBP 2DK2A 2FJDB 4QBUA 4M5LA 2FJWA 4NLXA 1KFSA 2IYIA 1HFEL 3R7BB 4X4QA 2J9CA 4DQIA 4HT5A 4R8UB 5GADI 3NGTA 2V68A 2ZHAA 1G1XA 2WVBA 1UW4A 2K8GA 5AE1A 3OTOF 5ETOA 3FSIA 4DL6A 2B4OA 4YP3A 3FUYA 1YBUA 1R3NA 4OV1A 1SQEA 3CTRA 3NGKA 1PC5A 1R27B 1CC7A 2GS8A 3GCXP 3A8EA 1U24A 2PFDA 4DF8A 2MLYA 2X1GA 1EARA 1NJXA 3QO9B 3D28A 5KG4A 3TA2A 3MEDB 1NPPA 3MPUB 2VODA 3OPKA 3ZTRA 2PEHA 1AFJA 4OI3A 3MMBB 1R8AA 3NAHA 1VQLS 2R9LA 1FNXH 1YLXA 3HFKA 2VG6A 3CULA 2MZ1A 1FKOB 1VLOA 1LK7A 2K7KA 4F67A 2FZCB 3S8SA 3LWMA 3C66A 2FHMA 5HJXA 1S1XA 1WACA 3BSCA 1OQ6A 4ZIWA 1S9EB 3Q8YA 3NNCA 5K14A 2HFSA 2QX0A 3KJQB 4NLDA 3J7A1 1HNIB 4NMLA 2VKRA 3QATA 3UVJA 4FVMA 2MKJA 4CNYA 1X0FA 4F0KA 3R5DA 4ZVUB 3I0RB 3GZ7A 2YBVA 4IDKB 1WI8A 2KT2A 3HFZB 5D0EA 2LFVA 1X9WA 3FCWA 1P1TA 2V4JB 4IUFA 3ZFVA 5L1LA 4WE1B 5C42B 3E01A 1WI6A 3MEGA 1TZ0A 3EZ5A 4I7FA 5L46A 2D41A 3CUNA 3SQOP 4C8MA 3KK3B 4E0DA 1KHVA 3CPWR 1NH8A 1WKLA 2ACMA 4YDDB 5IS2A 1ZPWX 1RWMB 3HJVA 5A0YA 3VZIA 2OTJS 1RHMB 4O3NA 3AA9A 3D7SB 3NXZA 1B64A 2GIFA 3L95X 3TZYA 3DMJB 5LT5A 1SJ3P 2X51A 2GFFA 2CZVC 4OIXA 2OMOA 4K4WA 3C16A 2ZWOA 1TUWA 1YSJA 3FQLA 5IOLA 4AE5A 3DOMA 1HW8A 2OKQA 2F1FA 2V8VA 2WAQD 3UD4P 1RT4B 1KP6A 3MAQA 1SL1A 5KFFA 2C3YA 4KE5A 2W9AA 1S6QB 2KVQE 2CNOB 4PWUA 1IM6A 3P6YC 4USIA 5ETTA 4JI2F 4DWIA 1RHRB 3RB3A 4X4OA 3UNGC 2ZH8A 4MH8A 2O1PA 3W2VA 5KOXA 4XDDA 4CQ1A 1VR6A 3R1LA 2YXLA 1B7FA 2YNFA 1U47A 3BKUA 2V4RA 3F73A 2ZE2A 1IBMF 2B4VA 2X7IA 3IBCB 3V81B 1NBEB 4DHVA 2P8IA 3U1MA 3Q86A 4IG3A 3DRRA 1JLQA 4L75A 3RAQA 4QYZJ 3OTDA 1DFDA 1CJTA 3PYFA 1UA1A 1FFGB 1UVKA 4X4TA 3HHLB 4C8ZA 5J1NA 3EVMA 1Y7PA 2XHWA 2HNYB 4OHYA 5IWAJ 4ER8A 4PG7A 3SXLA 2LVWA 4CT9A 2ZUAA 2J7WA 4NCGA 3C14A 2CNNB 4QZVB 1J5OA 4YR0A 3ILJA 4QJVA 2KL8A 3M32A 4DSIA 3LAMA 5K8PA 3UCGA 2WONB 4K5RA 1TL7A 1K44A 3J7Z5 3DOKA 3HJFA 2MZRA 3LP0B 2OGUA 5D78A 4K0KF 1LK5A 4TY9A 5KFZA 3KLGB 4WIQA 2MYFA 4LF9F 4PWWA 3TAQA 2ZVSA 2CJ9A 3G87A 2DXFA 3H4BA 4DL7A 2RQMA 1HWIA 3HD2A 2CADA
chains in the Genus database with same CATH topology
2CQDA 2O66A 4EZ9A 4WFYA 3NAIA 2OPSB 2EG1A 4IYQA 5CYJA 4IRKA 4C0HA 1H2TZ 1ZM9A 2AW0A 4C98A 4E8UA 2NS1B 1LV5A 2XGPA 4DR6F 4GO5X 1BGXT 1VMBA 4G3IA 1F60B 2Z4PA 5AXMA 1FF2A 2NPFA 1GXTA 1VQ9S 2QA2A 5HBMA 5JVGQ 4OI0A 1O51A 2COLA 2JC0A 3VR1A 3GR0A 2HVHA 2JLFA 3OXGA 2F40A 1SH2A 3CDBA 5F8IA 4O3RA 3PX0A 5KFDA 5HROB 2VBZA 2GX8A 1S6PB 1HI1A 1TUVA 1X4FA 2OJ3A 3X3UA 3POTA 3HVTB 3SSSA 3DI6A 2BR0A 1NJIT 5IT9Y 2ZD1A 3OR1A 4QQBA 4ECUA 1KTQA 5A6PA 4ITSA 3CC7S 4R5PA 3ZZYA 4OLOA 1IQZA 2LU1A 1JLBB 2DTJA 2O67A 4O44B 4K4UA 4YR3A 2JL9A 2FJXA 3H8YA 4NYOA 3IR5B 5U47A 3M8PB 4HTIA 1KVIA 3IS9A 1QTMA 3VQTA 5KFEA 1EP4B 3PW0A 1U2FA 1U09A 1VGYA 2DH7A 2K3IA 1Z2ZA 2HZCA 3CJ2A 2I38A 2MMYA 3D0GE 2K7JA 1M5SA 3K7RA 2IM1A 3K5PA 2IBKA 2HHWA 2ZH6A 2HGMA 1G3OA 3RTVA 2C3UA 4OI2A 3T5LA 4F2RA 2EBEA 4NXMF 4TNOA 3U7JA 2J9DE 2L08A 1Q78A 3SI8A 3T6JA 2I9SA 1IKWB 4AFFA 3LGNA 2YKMB 4CO5A 5KT3A 3DXSX 2J6SA 3CMAS 1WEXA 4LSLA 3MGJA 1X4HA 2HHPA 1H98A 3CXCR 5D8HB 4DR5F 3KJVA 2XMWA 2GHWA 1GNKA 2FIUA 4WCEQ 1U1OA 5F8JA 1SC6A 2VH7A 1RKIA 2EFVA 3BJYA 3RB4A 5F8NA 2XMKA 2M70A 2ADBA 3F41A 3IR6B 1HBUA 4LUBA 5K5MA 3FQKA 1DTQA 2NYIA 5L9NA 3RR8A 3IR7B 2GMHA 3H2LA 5A8KB 3HKWA 3M6UA 4N8NA 4IR1A 2M8HA 3CCLS 1VQ4S 1HL6A 1UETA 2D7SA 4XK8C 3V6DB 1GXUA 3T9NA 2J6TA 3GG0A 1N32F 3THVA 3I4HX 2HG4A 1FKAF 1LW0B 5DLGA 3OL7A 1DLOA 3HHDA 1S97A 2ERRA 4QWAA 3HKZD 1JJ4A 2UUBF 2SXLA 2Q6CA 1G6BA 2GIRA 4NZ6A 1MMDA 2JZ5A 3JAMY 1RT5A 2DNNA 3VAHA 3BDEA 2KH9A 2KXFA 4DL2A 2XSJB 5BYQA 1VC5A 4K4VA 4I2PB 1WHVA 2KVIA 2HVZA 5I3QA 4LF4F 1FTRA 2VL1A 3BS9A 1H2UX 5I3UA 3OTCA 5KFCA 3UQSA 2LXIA 4EEYA 2IAJB 2P9CA 3TR5A 2Q6BA 5T7LB 2JEFA 1KS2A 1U48A 1CG2A 5DDRC 2CJAA 4WYWA 1NJZA 2UXBF 4F3MA 1GT8A 2C3OA 4OJ3A 1WEZA 1GTHA 5J1PA 2W9CA 1N56A 4CO2A 4ES2A 5DETA 2VG5A 3DYAA 5HQ8A 2BYCA 2ALZA 4OL8A 4DDFA 2DO0A 2MQQA 2G9OA 2R2RA 2QSWA 1XMOF 1KFDA 5KFJA 2FPHX