5C24B

Crystal structure of hiv-1 reverse transcriptase in complex with 7-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8-dimethylindolizine-2-carbonitrile (jlj605), a non-nucleoside inhibitor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
412
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/inhibitor
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
total genus 120
structure length 412
sequence length 412
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c24B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B03
3PJWA 4I2PA 3H98A 5CYQA 2HMIA 1RT1B 1C0TB 4ZP8A 4FBUA 3TQ1A 5J1EB 1N6QA 4ED2A 3MTKA 3CJ3A 3LP1B 2RDIA 2OPRB 4PUOB 3DLEA 2ASLA 4I7FB 4ZHRA 1JLGB 5L9XA 3CVKA 3KK3B 1SUQB 1RT6A 3GV8B 1KLMA 2YNIA 3LP2A 3MR3A 3MEDB 1S1WA 4Y34A 1TVRB 3UR0A 3VQSA 4J9OA 4JV0A 4R5PB 5KG5A 3ISNC 4Q45A 4F50A 2IJFA 1S0OA 5C42B 5FDLB 3CDEA 4ZP6A 5L1KA 2XI2A 3PW7A 3PHEA 5KG3A 4DL4A 3MEEB 1C1CA 3DOKA 4RW4B 4O3SA 4ZVGA 3OLAA 2CKWA 2UUWA 2W7PA 1R0AB 1EETA 4IDKB 4NLRA 5CYQB 2HMIB 3C6TA 2W9AA 1MU2A 3HKWA 5KFMA 2VA3A 2E9ZA 2UVVA 3KJVB 4TQRA 1D1UA 4Q44A 4ECXA 4K50A 1S49A 2V4RA 4FBTA 4ZVHA 3KMQA 4X2BA 3DLEB 4KO0A 4ZHRB 4URGA 4QWDA 2R2TA 1S1XA 4KFBA 2VG6A 2FVPA 1KLMB 3LP2B 3KLFB 5KFOA 2RF2A 3QYYA 3BSOA 4Q43A 3TAMB 1S1WB 2AGQA 4Q0BA 2JEIA 3MEGA 3QLHB 3OL7A 2I1RA 4FS2A 2IA6A 4KE5A 1RTJA 3OSPA 3RB0A 1K1QA 3KHRA 2R8JA 4U7CA 3DOKB 3DRSA 1REVB 3DYAA 2W8KA 3GIIA 1S1UA 1IKVA 3BQ1A 3BQ0A 1JLFA 5HP1A 4F4ZA 4IG0B 3PZPA 5F8JA 3HHKA 3CDUA 2FJXA 4PWDA 1TKZB 1C2PA 1S9FA 1JX4A 2WB4A 3MR5A 4RNNA 4ED8A 5D3GA 2WONB 3PJXA 4KO0B 3KLHA 2HNYA 4ED0A 1HNIA 4EBEA 1TL1A 1S1XB 4KFBB 4RW9B 2VG6B 4LSLA 2WTFA 3G6VA 4EEYA 2RF2B 1GX5A 1BQNA 3I5BA 1NHUA 4O4RA 1RTDA 2ALZA 4WFXA 4J9KA 3NAHA 3MECA 4ID5A 4MKAA 3MEGB 5F8GA 1HQUA 2IAJA 1RTJB 3D28A 2XGPA 1RA6A 4MH8A 3FRZA 4IFVA 5KFKA 2AGOA 4WE1B 2JC1A 4O3RA 2R8IA 4H4OA 4MIBA 5EWGA 4RW6A 4YP3A 2R2UA 4QWAA 2YNHA 3KNAA 1JLFB 3DDKA 1IKWA 4ZP7A 4TLRA 4QWEA 1BQMB 4JV2A 1HQEA 4XPEA 4PWDB 1CSJA 3G6YA 1HNVB 4ZP9A 3NBPB 2FVCA 4NLGA 2GIRA 2W8LA 1DTQA 4Y2AA 4NLDA 1HNIB 5F8IA 4KV8A 1FKOA 4LSLB 1S97A 1RTDB 1RYSA 5J1EA 4RNHA 2RDJA 5KT4A 3MECB 4ID5B 3IN5A 1OS5A 5DG7A 2B6AA 4MFBB 2IM1A 2IAJB 2R2RA 3NAIA 4WXOA 3Q8RB 4PUOA 3T5KA 4MIAA 4I7FA 1S6QA 5J2QB 4ZPBA 2WOMB 2IMWP 4H4OB 3NKYA 3DMJA 3LAMA 4RW6B 4JUZA 5DG8A 2YNHB 4ECZA 4O3PA 4YR3A 4TY8A 4IR1A 1LW2A 1IKWB 4ED6A 4PQUB 1TVRA 2UVRA 2JLEA 3QGHA 2C2RA 5KFSA 2JC0A 3RB6A 1J5OA 3E01A 4KHRA 2W9BB 4RU9A 3OL9A 1S9GA 3QIDA 2VA2A 4IRCA 3H59A 4RW4A 2ZE2B 3SFUA 1SV5B 1KHWA 2XGQA 3RB3A 4KV8B 4IDKA 1R0AA 1FKOB 3IGVA 4R8UA 4ECVA 4ECWA 2ZD1A 3DLGA 4EYIB 3JYTB 2R8GA 1XR7A 3KJVA 1C0UA 4Y2CA 4ZVEA 2B6AB 3DRRB 2BR0A 1NNDA 2FVSA 4ECYA 3BR9A 3V6HA 3CJ2A 4K4TA 1S6QB 5HBMB 4LQ9A 2FVRA 3DMJB 5F8LA 5KT3A 1TV6A 3KLFA 4TY8B 5KFBA 1LW2B 2QE5A 4RUAA 3NGDA 4DL7A 1HPZB 3TAMA 3E51A 1IM4A 5KFFA 2BQUA 4F4WA 5F8NA 1TL3B 3H5UA 3QLHA 1J5OB 3E01B 4NCGB 1S9GB 1T03B 3IGNA 4ED1A 4O4GB 5DQGA 4J9SA 5J2NA 1REVA 3QGIA 4NLSA 4WZQA 2IM2A 4IFYA 1RA7A 3OHBA 2FVQA 4R8UB 5F8HA 2GIQA 3LP0B 4IG0A 5KFCA 2ZD1B 3DLGB 4TXSA 4IOBA 5KT2A 3PR5B 4K4VA 1JLQB 1QE1A 1C0UB 3CJ5A 1TKZA 2ZKUA 3PW4A 2AX1A 2CJQA 5EWEA 2J6SA 3NL0A 3KK1B 2WONA 2BRLA 1K1SA 3CJ4A 1QUVA 3EPGA 5KFDA 2OPPB 2YNGB 1ZTWA 4H54A 1RYRA 4YR2A 4RW9A 2ATLA 4I2QB 1S1VB 1TV6B 5HLFA 3RAQA 2FLNA 1TKTA 2I5JA 2BE2A 3I5CA 4KKOB 1RT2A 3H5XA 1JKHA 3HVAA 2J6UA 5F8MA 4WE1A 3PW0A 1DLOB 1S6PA 5J2NB 4QW8A 3LAKA 2OPQA 4K4YA 4IFYB 3CDWA 4RZRA 4MK9A 4ECUA 4RNFA 1NHVA 5JUMA 3JSMB 1BQMA 1QE1B 1RT3B 1LW0B 3C6UA 3D5MA 1HNVA 4M94A 4KHMA 1TQLA 4QWBA 1KHVA 3NBPA 2B43A 4EBCA 1FK9B 5DG9A 4B3OA 3GYNA 3KK2A 5KFJA 1N5YA 3UQSA 3UPFA 3IS9B 2EC0A 3DM2B 3TVKA 3M9MB 1RT4B 3FFIB 2B5JA 4M95A 1TKXA 5HLFB 5KG2A 2I5JB 1TKTB 2BE2B 1W25A 5L1IA 1RT2B 4ED3A 4GC7A 3DOLB 4MFBA 2IJNA 1JLEB 1JKHB 4RNMA 4MK7A 3OL8A 1JLCA 4J9MA 3RB4A 3OL6A 2BQ3A 2W9CB 4K4SA 5J2QA 4NYZA 4WFYA 2WOMA 1RT5B 4MK8A 3RBEA 1S6PB 2AWZA 2OPQB 2HWIA 5DLGA 2WRMA 3KLEB 4J9QA 2JEFA 3H2LA 2J6TA 4JV1A 4PQUA 4EO8A 1RT7A 3GV7B 1GX6A 3C6UB 2DPIA 4IQXA 2HAIA 2FJVA 3N6NA 4Y3CA 5KG7A 2W9BA 2F8EX 2XCAA 3KLVA 4NLXA 4R0EA 4B3OB 2ZE2A 4FS1A 3KK2B 1SV5A 5DGAA 4WZMA 1N5YB 5F9LA 3DRPA 1FKPA 2B5JB 5KFGA 3M9NB 1TKXB 3IG1A 3JYTA 1QAIA 4ICLB 4NLPA 3M9OB 1LWCA 1RTHA 4XO0A 3KHGA 4LQ3A 4DG1A 3DRRA 4QWCA 5KFPA 1JLCB 3G86A 1JIHA 3T1AA 3KLGA 2C22A 5HBMA 3MFHA 4NLTA 3MR2A 5KFXA 4K4WA 2AQ4A 3KLIA 1U09A 3PR4A 5J2MB 1HPZA 1S48A 1S10A 3KHHA 5KFWA 1S0NA 3QO9B 4NLQA 1TL3A 4EYHB 1RT7B 1T05A 3EZUA 1T3NA 3BGRA 4NCGA 5JXSA 1T03A 5C5JA 3RAXA 4F4YA 4O4GA 2YKNA 2JEJA 3DRPB 3ISND 1FKPB 2ILZA 1DTTB 3LP0A 3T5JA 3IG1B 5KFEA 2R8HA 4EO6A 1JLQA 2R8KA 4YR0A 1LWCB 1RTHB 3QZ7A 3GV5B 5HROB 4DG1B 1IKXB 4RW8A 3CO9A 3I0RB 4Q8EA 4NLUA 3KK1A 3CIZA 3Q8QB 3N6LA 1EP4B 3KLGB 2YNFB 2D41A 2OPPA 3QGGA 4IH5A 1S9EA 3H5YA 5J2PA 3M8QB 4J9NA 2YNGA 4ECSA 2XI3A 4KB7A 2JEGA 4I2QA 1S1VA 3KLIB 5KFTA 3LANA 4NLWA 4KBIA 1XR5A 2AGPA 2UUTA 4KKOA 1T05B 5C25B 2R2SA 1LWFB 3QZ8A 5I42B 4GC6A 3BGRB 1ZTTA 2C2DA 5DQHA 1TP7A 4F4XA 1WNEA 4J9PA 4QPXA 3FSIA 4TY9A 1N48A 2UVUA 2YKNB 1DLOA 2HNZA 2OPSB 3I0SB 2WCXA 4URSA 3Q8PB 4O44B 3OLBA 5DLFA 1SH2A 1RAJA 4KAIA 3T19A 4H4MA 4ECTA 4NLVA 5KFYA 2V4QA 4J9RA 5CYMB 3JSMA 1XR6A 4DL6A 1RT3A 1LW0A 3M8PB 4O3OA 2YKMB 3DI6B 1N4LA 2WK4A 3FDSA 4RW8B 4NRTA 1N56A 1FK9A 4KSEB 4TN2A 1LWEB 4G1QA 5KG0A 3KOAA 4QW9A 1JLBA 1S9EB 3V6JA 5J2PB 4O3NA 4DEZA 3IS9A 2E9TA 3DM2A 4ZVFA 3KMSA 1RT4A 3EPIA 2ASDA 3FFIA 2E9RX 1UWBA 2VG5B 5K14B 4G3IA 3T5LA 3N6MA 4HKQA 3BJYA 4URQU 3DOLA 2ILYA 1JLEA 1ZETA 3DLKB 3PVXA 4ZPAA 5KFIA 4I2PB 5L1JA 2WHOA 4TYAA 2FJWA 5EWFA 2W9CA 5KT5A 4HYKA 3OSNA 3PW5A 2D7SA 2O5DA 4DL5A 3RBDA 1RT5A 1HMVA 1SH0A 4ZPCA 2HNZB 1N6QB 4WFZA 5KFHA 2C2EA 3H40A 3BQ2A 3MR6A 3KLEA 3V4IA 3LALA 1I6JA 3T5HA 1S1TA 4RUCA 3CJ0A 2VG7A 3MF5A 4H4MB 2GC8A 3V6DA 4RW7A 1VRTA 2ASJA 2UVWA 3Q8SB 3BSAA 5KFUA 3CWJA 1HYSA 5L1LA 1RT6B 4NLOA 2YNIB 3HVWA 4MKBA 4YMEA 4DL2A 1RDRA 3BREA 4G1QB 4NRUA 3FQKA 5KFNA 5DGBA 1JLBB 2RKIA 2W7OA 2XC9A 5KT7A 2IM0A 4IKAA 1UWBB 3H4DA 3MFIA 2QV6A 1C1CB 4ICLA 5KFZA 2V0NA 5KG1A 3SFGA 3ICLA 3SI8A 1QAJA 1RTIA 1EETB 1T94A 1JLAA 3C6TB 1IKYA 1MU2B 4NZ0A 2D3ZA 4IH6A 4WYLA 5KFVA 2BANA 1HMVB 3V6KA 4DL3A 2BRKA 3V4IB 2BQRA 1S1TB 3GIMA 3GILA 2VG7B 5J2MA 3H5SA 2IC3A 3V6DB 3QO9A 4RW7B 1VRTB 2XWYA 3FQLA 1C1BA 3GQCA 4K4XA 1HYSB 4YQWA 1HARA 4IG3A 5I3UA 2RKIB 4Q0BB 1YVFA 5KG4A 3GIJA 5KFRA 1DTTA 4ZMMA 4TQSA 4ECRA 5EUHA 3DRSB 4RNOA 3DYAB 5C24A 4WXWA 3ITHA 5HROA 1IKXA 3I5AA 5KT6A 1S1UB 1IKVB 3I0RA 3H4BA 1RTIB 4IRDA 5HP1B 4LSNA 1JLAB 1IKYB 1EP4A 2YNFA 2AX0A 4TYBA 4ECQA 4IR9A 3IRXA 3HVTA 2BANB 3M8QA 1S4FA 5T14A 4EBDA 2HNDA 1VRUA 3BSNA 4Q8FA 3QIPA 5KFLA 3V81A 5D3GB 2V9WA 2IC3B 1S0MA 5F9NA 3KLHB 1Z4UA 2C28A 2HNYB 1D0EA 5KFAA 1TL1B 5C25A 1C1BB 5KFQA 1LWFA 5I42A 3NMAA 1JXLA 2HWHA 1RT1A 5KG6A 1C0TA 1BQNB 4XPCA 4IG3B 5I3UB 4IH7A 3I0SA 2OPSA 5EDWA 3LP1A 4O44A 2OPRA 4O3QA 1HQUB 1SH3A 2FLLA 4IFVB 3OHAA 5CYMA 1JLGA 4ZPDA 4IRKA 4WYWA 3PW2A 2XCPA 4U6PA 3M8PA 5C24B 2YKMA 3DI6A 3ITHB 1SUQA 3KK3A 2OH2A 4K4ZA 3G6XA 4LSNB 1LWEA 2IM3A 3MEDA 3UDLA 3KHLA 2FLPA 3IRXB 3HVTB 4R5PA 2D3UA 1HQEB 2HNDB 3BSCA 2AU0A 1VRUB 5C42A 3QIPB 5FDLA 5DQIA 4NLYA 2VG5A 2IBKA 5K14A 4OL8A 3MEEA 3V81B 2DPJA 1DTQB 4ED7A 1MMLA 4K4UA 3GIKA 4J9LA 3DLKA
chains in the Genus database with same CATH superfamily
3OVBA 3LF0A 3TANA 1XNQJ 1VIOA 2XY6A 3TVYA 3BKUA 4LRBA 4JI6F 2C3YA 3G4SS 5CZVA 3CEDA 4RJVA 2MQNA 2H3EB 3I32A 3FEYB 1WDDA 4H4KA 2I2YA 1R8CA 4OJ1A 3C6TA 1UEKA 4ECXA 1VQ8S 2E1AA 3CMQA 3DLEB 1L3KA 3EYZA 2J76E 3W9IA 4EZ9A 3GFXA 3KJFB 2CDRB 5HL7Q 3DRSA 4OI1A 1SKRA 2KYZA 3DDNA 1E6VA 4QIVA 5JVGQ 1LNQA 3W2VA 1KTQA 4FVCA 2FLOA 4AL6A 1NHUA 4OQJA 2ZHAA 1PSDA 3TO8A 3J7A1 1URRA 4KPCA 1V6HA 1IBLJ 3KNAA 5LXRA 2C42A 2B4OA 4HVZA 3NS7B 4P2MA 1BMQB 4F0HA 4ZP9A 2C2KB 4HACA 3N5FA 1VDHA 4ZN3A 1RYSA 4OHYA 4WXOA 2MZ1A 1FT8A 3NKYA 3DMJA 1VK3A 5D15A 2NZ4A 3AA8A 4HHJA 4IRCA 4I0WA 4OYZA 2GHVC 5I3PA 3MMCB 1R0AA 4EYIB 3LPEA 4OX8A 3Q23A 4RUAA 3E51A 3P4UB 3C14B 2B4VA 4ELUA 2DNNA 3IGNA 2U2FA 1RB0A 2DGUA 2I0XA 1NH7A 4R8UB 3LP0B 4IG0A 1M5SA 2CVEA 1EX8A 4IOBA 2ZKUA 3SCJE 3F73A 7FD1A 2HLUA 2YKPA 2HHHJ 2AV5A 3KKFA 4DV6J 1TUGB 3SQGA 2CPDA 5E5NA 2J9EA 1TV6B 3ZC4A 4DV7J 3MM7B 3EZ5A 1E6YB 3L9ZA 2DT9A 2BA9A 2AYGA 4MK9A 1VS3A 3JSMB 1OJ4A 4EGLA 1LK7A 4JI2J 4KHMA 1X31C 3DC2A 2NXNA 3TVKA 1RT4B 1MLAA 1U45A 3A3NB 1X4CA 2DXEA 3UD5A 4J9QA 1GX6A 3TVZA 2WW8A 1B4SA 2HW3A 3A8JA 1FCAA 1FKAF 3MFHA 1R6VA 3SYZA 4DFJA 4F02A 2E1RA 4C97A 4NCGA 2NPFA 1T03A 2F8MA 4P7VA 3MTJA 1U48A 1P9YA 1F1BB 5HROB 1ZM9A 1EP4B 3KLGB 4F3OA 1RAIB 2A0FB 4TU8A 2XI3A 2QMWA 5B7WA 1S1VA 3IMQJ 2X3GA 3AQPA 1LWFB 1N48A 3FSIA 2H5IB 1DLOA 4MKVA 1WHXA 4USUA 3A1YG 2D9PA 1FK9A 1XQIA 1LWEB 3HM9A 4U8YA 2HSEB 2E5LJ 1LXJA 1X4GA 3IS9A 2WVBA 5T7LA 4LF6F 1LKZA 3DLJA 3N6MA 1HQ2A 4EFAC 1XWLA 2DITA 2L08A 3R27A 1CJUA 3KDOA 2YWKA 2UU9F 2MKJA 3LALA 1NDLA 5HMZA 4XTTA 1GMWA 1UJ6A 1S6OA 4B08A 5CD4A 1TUVA 5B08A 1HR0J 5CD4H 4DV5F 1UWBB 3H4DA 5K8NA 2KJVA 1T8EA 1RWOB 1VBYA 1QAJA 3QT8A 4OYBA 1X0FA 5ETRA 2XG8A 3IBWA 4LBHA 2ZBCA 1B7FA 4RW7B 4MMOA 4E8UA 5AXKA 3KTQA 1YQHA 1RLCL 4JI1J 3LUYA 4DV1J 4XK8C 3TA0A 1WEZA 2ZOFA 4CYUB 4WKYA 2R7VA 1VRUA 1ZZFA 1NSQA 2FJAB 5M2RA 3K0JA 1LFWA 4O3QA 2FLLA 4CT8A 1RCOB 4FYVB 5HVGA 2EBGA 3QGPA 2PMHA 1U4BA 4L6V3 3WX4A 2JL9A 1P1LA 2DPJA 5FJ4A 1KSPA 3R6GB 4PG6A 3NS6A 3CJ3A 2AF6A 2BBEA 1NHKL 4UQGA 5D4NA 2HGNA 2KL8A 2ASLA 2J7WA 2GX8A 3QRRA 3KK3B 5ETKA 4FYYB 4KIAA 4LBIA 3TZXA 3BN7A 3CDEA 4PCQA 4L3NA 5SUHA 3CTRA 1WHVA 1N8RT 2I8EA 1MU2A 2E9ZA 1D1UA 1PJ6A 4I56A 3CCUS 4KFBA 4ZJLA 1KLMB 2CZVC 3U1MA 1RTJA 3QFHA 2JLGA 1RWNB 1TFYA 3DOKB 1VC6A 2LYVA 4DJBA 3CCJS 2ZZNA 2WB4A 1FEHA 4NMXA 2HNYA 4QR2A 3TNVA 2D74B 1RA6A 3MCOA 1SJ1A 1G6BA 4QWAA 2G2ZA 2BJDA 3PEJA 1JLFB 4C0OC 1IWAA 1VBKA 1SC4B 3PX4A 3MUTP 2GHWA 4Q5VA 3CO0P 2CJBA 2K1RB 3K8VA 1T7PA 1JXVA 3M2UA 1XMQJ 3T5KA 4MIAA 4PXDA 3LAMA 1FJEB 5LMNJ 2JLEA 4PXBA 3ADAC 2XNQA 3RB3A 2FC9A 1XR7A 3Q8UA 1ZAXA 4ZVSB 3S01A 4PPDA 4B3SF 2FVRA 2QYGA 2UUBF 3FC9A 5F8LA 5KT3A 1Z1ZA 3C46A 4KC5A 3ISZA 1S9GB 2WW4A 2P9EA 4F26A 1ZBTA 2VV5A 2XS7A 4YB1P 5F0WA 3T1YJ 2FHJD 5ETSA 2BJ1A 5KFCA 1SKUB 3HLUA 3H20A 1H2VZ 3UNYA 1V9OA 2BRLA 2EI5A 4QPTA 2FY8A 5E33A 2HBRB 3TW0A 3I4HX 1QSLA 1JKHA 2ERRA 4AD6A 5BR8F 5F8MA 2C3PA 2RDDA 4L72B 4LF5J 2B43A 2A3JA 2KN4A 4FNHA 2HS4A 1R27B 1S57A 3GG1A 3BB5A 4GC7A 4MK7A 2CIMA 4BC9A 3GFYA 4NYZA 4WFYA 3AAWB 1S6PB 2ZNYA 3UCGA 5D8HB 2QLXA 2N3OA 4DFKA 4LFCF 1W2IA 2FJVA 4ES1A 1RISA 3AQOA 1UVMA 2V94A 1CQNA 4A8MP 1S48A 3A3PB 3KHHA 3N4WA 4PR6A 2OEKA 2OLWA 1Q81T 4JI7J 1CPZA 2ZOMA 3W61A 4C2MA 4QIGA 2LXFA 3I0RB 2PD1A 3Q8QB 1QLNA 5J2PA 3J7AN 5HANA 4CO4A 2BM1A 3ILLA 1JNZB 4NZ6A 3KWMA 2KT2A 5C25B 1H7XA 5DLFA 3AOCA 1LK5A 1YG0A 4J9RA 3K5OA 4BS2A 1RP5A 2W1BA 5BYRA 1IQZA 3M8PB 3DI6B 4YFUA 4A8QA 5GMEA 1Q53A 1JLBA 4P72A 3EPIA 3NCRA 1RHKB 3FZBA 3UFCX 3DLKB 2W9CA 5K20B 2YY3A 1VGYA 1RWVB 3BQ2A 3R5JB 2D9OA 2ASJA 1KN6A 1WI8A 5L1LA 4LF4J 1Q82T 2CQ3A 2FQQB 3G8SA 2MY7A 3AJ2A 4OX9F 2UXCJ 3GONA 4QOTA 3AB4B 4WYLA 3P96A 2VUGA 2IBOA 1R3NA 3GILA 1HW9A 2PSZA 2XULA 3W65A 3RGIA 3Q83A 1H74A 2RKIB 1HW8A 4OZ5A 1T9XA 1FWLA 4LSZB 1F60B 1IKXA 3O5TB 3R6LB 3J81Y 4I68A 4B3TF 1Z4UA 4CLWA 6AT1B 1C1BB 2YQ1A 2Y9HA 3AJ1A 2DIUA 5ETMA 5AE1A 3OHAA 3SZ2A 3PY8A 5L46A 3B6BA 1SL2A 2D3UA 2NS1B 2XZTB 2PI5A 3JSYA 3THPA 2UXBJ 2B9XA 1H6KX 4RO0A 3Q8YA 1N6QA 2O3DA 3FK4A 4ZHRA 3LW5C 4YHHJ 1KWMA 1S1WA 2JZ5A 4YS2A 2EFPA 2F9JA 1NO8A 1UA1A 1JJ2R 2XMTA 2CKWA 2CYYA 2QL5B 5H9FK 2O01C 1KQFB 4KYZA 5D4OA 4G1IA 3UWTA 4EMDA 1NZAA 4JYAJ 3EGNA 2GFFA 4NL5A 1FNOA 3RB0A 1K1QA 1N36F 4D3HA 4OHWA 1AUSL 1IBMF 1SVDA 4B9MA 5IZHA 2NXCA 3PTWA 1XMOF 4DCOB 5H9EK 4KO0B 3L09A 1U8WA 2WTFA 1GX5A 4X65J 1VBZA 4MYUA 3KJQB 1HQUA 3QFWA 3ZZTA 2Q3PA 4AE5A 1FJCA 5IT4A 4DV3F 1CS4B 1CSJA 5EGYA 5A2QY 2FVCA 3MM9A 3B78A 4C3MA 3MAAB 1PYOB 4LSLB 2FHOB 2Q6BA 3QRPA 5JVHQ 1JB0C 2LVWA 2CQIA 5KT4A 4RUBA 4OZNA 3N0VA 1EQ0A 2IAJB 1S6QA 3DLLQ 4DMZA 3CD5A 4JUZA 1LW2A 3D0HE 1IKWB 2Q79A 2UUAJ 2UVRA 5IC4B 3E01A 4KHRA 4WJBA 2KXFA 3KG4A 2RUGA 3H59A 2ZE2B 2HYIB 2XGQA 3HI9A 3G87A 3CMES 4NXNF 3DLGA 2DGTA 1EJ7L 2CJAA 4DR4F 3DRRB 1AA1B 4BBYA 4RPFA 3P5BP 3B4MA 4AYBD 4TY8B 2XLIA 4K7QA 4ED1A 2C3OA 3IAM9 1JLQB 4C0HA 5ETQA 4E0DA 1N5TA 3S8SA 2OPPB 1HI1A 2FZKB 1X4BA 2NXJA 3QNWB 5HLFA 2FLNA 3P6YC 4KKOB 4C0BA 3W5YA 1H73A 3TUPA 2GVDB 2HHSA 3VQTA 5KAKA 3WX8A 1DURA 5JUMA 3C2PA 4GKJJ 2BZ2A 5KFJA 1X4DA 3QPIA 2AYBA 1P27B 2B5JA 4M95A 3D1QA 3EDQB 3NGUA 1MN7A 2XEXA 1SJRA 2RAQA 3RBEA 2R3VA 2GJIA 3EWGA 3FBFA 5DZ6A 3C6UB 2XTJP 4F2RA 5KG7A 2H4YB 5KOWA 2IIHA 3ETOA 3KLVA 4NLXA 1SKSA 1EHWA 2FTRA 5D4LA 1R6YA 1VLOA 1JMTA 4OJ3A 4RR5A 3G82B 3M6WA 4QWCA 4X66J 2EVZA 3EGVA 3IWNC 4UZBA 3I56S 2BYCA 3EZOA 5E3CA 2MEWA 4UY8T 3HCXA 6FD1A 3MMAA 3KK1A 1TL7B 2ZDPA 2YNGA 4QR0A 3OPKA 4KBIA 5I42B 4P2XA 1TP7A 3OFHA 5IT0A 2OPSB 3F44A 2HHUA 1UWAA 1SIZA 2G2OA 2VPWB 4ELTA 1KNZA 2YKMB 2BJ8A 2B56A 4K59A 3T5LA 3WC0A 1FTCA 4OLPA 2M70A 1NK0A 2GS8A 1I6JA 2ZFHA 2UVWA 4HL9A 1X5PA 3BSAA 2FHMA 4F3MA 5CXTA 3Q89A 4DV0F 2J0QD 2OMLA 4I69A 3I87A 4Y28C 1JLAA 3I6PA 4NZ0A 3T9ZA 2HLTA 5B0BA 2BANA 1NK6A 3O1LA 4OI0A 1MMNA 3V6DB 3OTOJ 2MQLA 2HQGA 2OFHX 3HJVA 2ZH9A 1TL5A 4X4OA 4C7QA 5AJ3F 1RTIB 1IKYB 1RADB 5D3GB 3W5XA 3VHQA 1C0TA 4IG3B 5I3UB 1HBMB 3I0SA 3LP1A 3BYPA 2OPRA 1IM6A 4WYWA 2J9DA 4K4ZA 1R8BA 5F0UA 3T1HF 1OYEA 2VG5A 1CJKB 2DO4A 4LRFA 3AXMA 2GW8A 3QATA 1U25A 5CYQA 2C3MA 2B7CB 1UVLA 1VQLS 1YJTA 1HBOB 1AFJA 1RT6A 3S6EA 1OIAA 3W9HA 4R5PB 2CADA 4F50A 4KGVB 4W92B 5FDLB 2OTJS 1OQ6A 4DX8H 4DBQA 5K8PA 3SSSA 4DUYF 1VI7A 2UVVA 4K50A 1CQMA 2RF2A 1RBAA 3G6ES 2BV3A 2LDIA 2HHTA 1YGYA 4U7CA 4DU8A 4CRJA 1BC6A 1UZDA 2UV8G 5EN1A 4I64A 5LJ5Y 5DO2A 4RW9B 3WBZA 4ZPVR 2GJ2A 5I3QA 2L3MA 2V8PA 2JC1A 2N82B 4H4OA 2XYPB 2R2UA 3D9BA 1V5VA 1HNVB 5CYJA 4NLGA 3GFZA 4DR3J 2NSCA 1Y5NB 3O6QA 1F3FA 1SBRA 1YZ6A 3C16A 4ECZA 2DB1A 3A8IA 3QJJA 2VPYB 4ED6A 4PQUB 2C2RA 4CO2A 3H25A 4DN9A 4U9RA 3SFUA 4HACB 3IGVA 3Q86A 1P8GA 4DR7J 3G9CA 1MNEA 2QTWA 2KYXA 5DETA 3AD8C 4AQYJ 3DMJB 3CNQP 2UUCF 1KC8T 4OJHA 1KQGB 3SXLA 2POKA 1HA1A 1RA7A 4CQ1A 4I1TA 4Y2IA 1TKZA 1P1TA 2XSJB 1U1RA 2Y1JA 3A8KA 4YR2A 3TOQA 3VAIA 2QG9B 4I4BA 2VQFJ 3GJRB 1J5EF 4O0IA 3LQVA 3R5CA 3GYNA 4FYDA 3NWRA 4O0NA 1N5YA 1YJRA 3Q0AA 1QVFR 2P8IA 3CT9A 4ED3A 2BQ3A 1JLCA 4LRDA 3W2WA 2Z30B 4I6WA 1UP1A 4WTOB 3BBFA 2LQ9A 4F4KA 4C8YA 1YJNS 3NGRA 2F8EX 2MQOA 4FS1A 1F9HA 4YUDA 1PAEX 2W7AA 3BDPA 1T9YA 1X4AA 3GR1A 2HHPA 1NDCA 3OQ2A 1KKHA 2P5VA 1WACA 3UD4P 5D6GA 1SB6A 3BGRA 2RMLA 1N32F 1I5OB 2YKNA 2R7TA 2SXLA 2ILZA 3D1HA 1RAHB 2R8HA 3HFKA 4IO1A 2YNFB 1S9EA 2RSQA 3RRGA 1T9UA 3C3LA 3WQPA 2VKRA 4DQPA 1U2CA 4TY9A 2K3KA 4A46A 2DNYA 4H4MA 2H4WB 4KSEB 1O5JA 4G1QA 2VQEJ 4O3NA 3DU6A 1S6UA 2NCKL 3HSZA 3MPWA 3DOLA 3VZIA 1GH8A 3GIRA 1M0SA 3RBDA 2DCLA 2AD9A 1S5ZA 3RTVA 1UJ5A 2FY1A 3CJSA 3BPDA 4WFZA 3T5HA 1S1TA 2XLJA 2MZSA 3D6TB 3FSYA 1X0PA 2D69A 4NRUA 5DGBA 1MN9A 3JQJA 2YQ0A 2R7RA 3E3XA 2OP5A 3HHLD 1C1CB 2CNLB 4CZCA 4FF1A 2O67A 3FCHA 5KFVA 1CJUB 2D3O1 3FQLA 1U1LA 1UMJA 4FXWA 2YX7A 1U0HB 1OY6A 3TA2A 3D67A 4TQSA 2B3TB 3DYAB 1IKVB 2B9WA 2GMJA 1VC0A 3VZHA 3M8QA 2UXDJ 3V81A 4LF2A 3D66A 2V2ZA 1BWEA 3TEGA 3D4JA 3IWXA 2QGFB 4ZPDA 2MHNA 2XCPA 1CJTB 2OH2A 2EW9A 3MEDA 2G4BA 1VRUB 3MM8A 5DQIA 1S12A 4B3MF 1DTQB 3CCLS 1KR4A 2HMIA 2DR5A 1S76D 1ICEB 3R7SB 2I9SA 1N5SA 2ALYB 5IQ6A 2Y0SD 4WCEQ 3GLJA 3ISNC 4P2SA 1AROP 9RUBA 2UUWA 4J9VA 1LEOA 4XDCA 4Q44A 4KGZB 1HWIA 1RZMA 4URGA 3PX6A 2BVZA 4PG7A 2VG6A 3AD9C 3BSOA 3AFGA 1ZA2B 4Q0BA 1HNXF 1RHQB 2R8JA 4EI2A 2W8KA 3M6VA 3QJPA 4GMKA 3ET6A 1RCXB 4KFBB 3DFEA 2HWTA 1FEEA 3MECA 2N4DA 1RTJB 1KS2A 2C2NA 2GJFA 4WE1B 5GAEU 2QYCA 3QJLA 1WTBA 3UCUP 2NLWA 3F56A 1HQEA 3J81U 4U95A 4LFBJ 3A12A 4ZCIA 1QJHA 4KV8A 4WFNQ 1QDUB 2XZWA 3I31A 2EFQA 1H0HB 3L7PA 3IN5A 2KXHA 2CJYB 2ABYA 4ZS6A 3D68A 4DI6A 1FRIA 3V4MA 5RUBA 2LQ8A 3TR5A 3JYTB 2JNJA 1U2FA 1WG1A 1NSPA 1G1XA 1OWXA 2XMAA 2CG4A 5KFBA 4LREA 2RT3A 3H5UA 2BOAA 1XNRJ 3MMBA 1D9AA 3TUZC 2XYGB 2CDQA 5BXIA 4ZCKA 1REVA 5KT2A 1GXTA 2U1AA 3BM7A 3CJ5A 3VVTA 2AX1A 5EWEA 4ANCA 1QUVA 2XY7A 2QLBB 3JB9k 4N41A 3RAQA 2BE2A 3TJ9A 1UEUA 2J0XA 3FCWA 1RTZA 4DLEA 2VL1A 4QW8A 2OPQA 1HD1A 4KR0B 3MOJB 2RJZA 2YPZA 2K7JA 1YRXA 3HXMA 2H9ZA 2DJWA 4MFBA 1JKHB 2ADCA 2VFVA 2DR9A 2M5YA 2DRAA 2OELA 1SJFA 4JV1A 4U7UK 4JI3J 1N33F 4DFMA 5GADU 2DR7A 4DPOA 3M6UA 5A2QU 4R0EA 4WZMA 3HFZB 4DV2J 2EEYA 1QAIA 4DOZA 2LQ5A 4NLTA 1VFJA 3MR2A 4K4WA 1WJ9A 4GKKF 2IYGA 2KVQE 2BW7A 5JXSA 2XY5A 6FDRA 3T41A 2F9DA 1FRXA 1QM9A 5KFEA 3FMBA 5HMXA 4Q8EA 5A8KA 2Y8YA 4J9NA 3HHNB 1Y7PA 3CCMS 5M2UA 1KBRA 4F4XA 5DRKA 2O66A 3D6HB 1Q16B 4O44B 3SV4A 5G4DA 2X7IA 1N4LA 2JWNA 2OIHA 5J2PB 4WK1A 3KMSA 3FFIA 5K14B 1YI2S 3SV3A 2CQ2A 4NA1A 2KG0A 3AY0A 3PVXA 4HYKA 3H5XA 2G2YA 2BJ9A 4TNOA 2VG7A 1DFDA 2ZH6A 1HYSA 1Y0HA 4YMEA 4X4QA 1JLBB 5SZTA 5CHCB 3VGTA 4JI5F 2N3LA 2V0NA 4CM0A 3SI8A 1FDBA 2C2MB 1HI8A 1NPKA 1VQNS 2BQRA 1R8AA 2D1CA 1KFDA 3EJMA 1KFSA 5EUHA 2XMJA 4RNOA 3ITHA 2NXUA 3G96A 4IRDA 5IV3A 3R8YA 3CC7S 1S4FA 3C19A 2IMOA 4B02A 1CJVA 1KLNA 2E7VA 2EK1A 3NMAA 1RQ0A 2QO3A 2ZDOA 5FIIA 1J27A 1N54B 2MY8A 3D6FB 1WG4A 1RWXB 4F4AA 1JLGA 5M2PA 3PX0A 4LVNP 4XAKA 4ILRA 1BQXA 3G71S 2M9KA 2V63A 4TVAB 4J9LA 4I2PA 1AB8A 2X1GA 3HMJG 3MTKA 3MCNA 1KVIA 4M5MA 1B7YB 5L9XA 2CRLA 3MR3A 1R0CB 4Y34A 4FNIA 1U6BA 3HO1A 4JV5F 1HNZJ 2DR6A 2MKYA 2H48B 1W7WA 5KG3A 4OI2A 3IR7B 3KUGA 4UT4A 3ULHA 4TQRA 2LEBA 1FRKA 4OZJA 1Y9OA 4ZHRB 2R2TA 5B0FA 3FUYA 2PC6A 1S1WB 1BUXA 5MLCV 1N0UA 2FGCA 1S1UA 5HP1A 2ZH2A 4QYZJ 3PZPA 3SCKE 1PC5A 2FJXA 2Z0GA 4I6YA 4DR6F 5D0GA 1HNIA 3IAS9 4Z7YA 2ALZA 2ZM6J 2DYAA 3FRZA 4KHPF 7FDRA 5KFKA 4P52A 5LMUF 4X64J 2B4UA 5GAHU 4C8LA 4LF9F 2NYHA 3NBPB 1QTMA 1HBUA 4Y2AA 3HP6A 3IM8A 1U1QA 2M8HA 8RUCA 1GAOA 2J6UA 1UTAA 3IA0A 4LF8F 1X9SA 1G4CA 1UVNA 2VFSA 1WF1A 3PFEA 2VONA 5DG8A 4A8OA 4X62F 1DBDA 2HS3A 1IR2A 4JI0J 1TVRA 4FN5A 2OD6A 3OL9A 3QIDA 1JJCB 4YB5A 5BYQA 4NXMF 3K59A 5C2GA 3MUVP 4ECWA 1C0UA 4PXEA 1S6QB 1LW2B 2QE5A 1XNQF 4U7UD 3E01B 4L76A 3SQOP 2JVRA 1L3UA 2NZCA 2HFUA 3DLGB 1N0VC 1O0PA 5I4MA 2EG2A 3EPGA 3ZTRA 2RS8A 2H5JB 2ZEJA 1HLWA 4NA3A 2I5JA 1RT2A 4DSEA 2CQ4A 4NI2A 2L41A 2RRNA 3GG0A 2IDEA 4GO7X 4RZRA 2HAFA 4ALZA 3PFOA 3ZXWA 4EBCA 1EAYC 3OUYA 2HPUA 3DM2B 2X3DA 2QLWA 5HLFB 1VQPS 2KTQA 4N8NA 4AXIA 2R9LA 4JI8J 2DGWA 3KLEB 2NYIA 2W4DA 2PDAA 4CLSA 3UN5A 2W9BA 1SV5A 3JSRA 1FFSB 1IBLF 3QWPA 2B5JB 5AE3A 2MKIA 4JI4J 4LQ3A 1Q0NA 3BO2A 3D0GE 3ZTSA 3AHPA 2ZBPA 3OXFA 2WSEC 4NLQA 4N5SA 1SQEA 1FJGJ 1VISA 1S7HA 3HKZD 4O4GA 1X9MA 3N79A 3ZTOA 3M1VB 3EVWA 4YR0A 4NLUA 3N6LA 2PMZD 1SJ4P 3CDAA 4NLWA 4MKYA 1P9QC 4DWIA 1R8HA 3GMGA 1SJQA 1XR6A 2JFKA 4B17A 2WK4A 4KRWA 3MMAB 1N56A 3CUNA 3CCVS 2MZJA 3UN3A 1WSVA 2E1PA 3BEGB 2M88A 3OXGA 3MPYA 2HHHF 2O5DA 4DV6F 1T95A 3M2RA 4DV7F 1RAFB 2GNKA 4C9DA 5KFNA 1NKBA 4JI2F 1U6FA 4MTPA 4GVBA 3OR1A 1FWPA 2ZITA 4QIWD 3QO9A 4DSJA 2A10A 1NPPA 3TA1A 4YQWA 4LUBA 1PCAA 2XNRA 4DPWA 2LXUA 5C24A 5KT6A 3I5AA 1WORA 1JLAB 3H0PA 3OTCA 2J9DE 4IR9A 1YJ9S 2BANB 4B3RJ 2EFOA 4R0JA 3BGUA 3N28A 1D0EA 3US5A 2FGOA 1Y5LB 1MWZA 2A6OA 2DKOB 2A2DA 2OHDA 2JX2A 1PGZA 5CYMA 2CZ9A 3PW2A 1TTHB 1SUQA 4DF4A 1M1GA 2FLPA 2MQPA 4W98A 3Q24A 3BSCA 1D9DA 3MEEA 4YEAA 4V19X 5IM0A 5IT9Y 1RLDA 2V4JB 1C0TB 1OMSA 3LP1B 2OPRB 1IN0A 1WUUA 3GV8B 3LP2A 4YB6A 3PNIA 3CXCR 3QSIA 4LIRA 4JV0A 4AL5A 4PZVA 2R7UA 3OLAA 1H2UX 2CPEA 1EETA 2HQCA 1Q1KA 4NLRA 5CYQB 3KJVB 2E5LF 4ZVHA 3KMQA 5B0DA 4WU2A 2YWEA 3OJUA 2V8HA 4USIA 3QLHB 2M0GB 2C1EB 2KI2A 1FO1A 2KT5A 2XMWA 3GIIA 4QIFA 3NGKA 3FSXA 5F8JA 4PWDA 1HR0F 1JX4A 2VC1A 2R7WA 2ZH5A 1N88A 1TL1A 3R1LA 2IVFB 1DQ9A 2AKWB 2RF2B 1RTDA 4MKAA 1X8DA 3JS9A 2N4CA 2AW0A 1NEEA 4FKYA 1KONA 4MIBA 4RW6A 2PN6A 5BJRA 4OZ0A 1IVZA 4ZP7A 3VR1A 3I4PA 4JV2A 3CCQS 4JI1F 4F36A 3C15B 4DX5A 4DV1F 5IWAJ 3RW7A 3TUIC 3DRXA 4F04B 1D09B 4DX7A 2B6AA 2IM1A 5ETVA 1QD1A 3Q8RB 4AFFA 4H4OB 5E3PA 1IJFB 4NXNJ 2CPZA 1Q95G 2JC0A 3RB6A 2ZH1A 2E29A 2QIFA 5A8RA 1WF2A 3LA0A 2MXYA 4BWMA 3PO5A 3KUEA 3C16B 4ANDA 4DL7A 4DF8A 5F8NA 4X4PA 1FRLA 3K5LA 4X4NA 4X4RA 4DL0C 1JNRB 4WZQA 3VAKA 9ATCB 2B0GA 2GVZA 3MR7A 1K73T 2RQKA 2MZQA 5GAEI 3VAFA 2CQ1A 2ZWPA 4QZVB 4HHUA 3PW0A 5HMWA 1WKJA 1YJ7A 4X4VA 2CAJA 3D5MA 4J37A 2G1HA 1FVSA 4USMA 3UQSA 4Y2KA 2MGZA 4ANEA 2AJ2A 2FD2A 2DVIA 2Z56B 1RKIA 2AIRB 4QJVA 2IJNA 3CB4A 1RHMB 1B0PA 5D78A 1RT5B 1GQEA 3AB2B 2JEFA 1U24A 2H65B 1N5YB 2I38A 3GR0A 3IG1A 4NLPA 4ZVQB 1IR0A 3OJSA 1JLCB 3BO4A 1U2RA 3PR4A 1S10A 4HLBA 3C14A 3SDEB 4EYHB 1T05A 1XMQF 2VICA 1SI9A 1Q5VA 4WIIA 2VF3A 2F8HA 3LP0A 5LMNF 2WBRA 1VHFA 4FPRA 4V1Ak 3RYLA 1Y10A 4DR2J 1D8YA 3EE3A 4M5JA 1T0TV 2E7WA 3BGRB 1ZTTA 2YKNB 1QAYA 3OLBA 1ROFA 3F0NA 1QUPA 3Q2SC 3JSMA 3HSJA 1HIYA 1HL6A 3FDSA 2IFXA 4QW9A 2QX0A 1S9EB 1REGX 1RT4A 2HBZB 3T1YF 3BJYA 1F2GA 2ZH4A 1RI7A 2ILYA 2IRXA 2ZUGA 4ZPAA 3CSKA 4TYAA 5KT5A 5GADI 4DL5A 3CJ0A 4H4MB 2X1BA 5L8RC 2YNIB 1VMBA 4G1QB 3FQKA 3KG1A 3W66A 3IR5B 1WF0A 2QV6A 2HZAA 3FCVA 4ZVPB 2O1PA 4LF5F 3EX7B 2D3ZA 4W4MA 3R9LA 4ES3A 3FNNA 3NY0A 1S1TB 3GIMA 2IC3A 1M90T 1TUWA 1ZPVA 1DJ0A 3VCDA 1F5CA 4C8NA 1PC4A 1T11A 4UTGA 5IOLA 4DQIA 5HROA 2HFOA 2PEHA 1EP4A 1Y3KA 1X7VA 2CQ0A 1YK9A 2KT3A 2C28A 3KLHB 4Z7CA 2A18A 5KFAA 5LSOA 1LWFA 5KFQA 4DLGA 1RT1A 1O6XA 4PYAA 3SIPB 4OI6A 1BGXT 4U96A 3NG8A 2CPFA 1RHRB 4HT5A 1TZ0A 1LWEA 4JI7F 4FYWB 3V81B 1AFIA 4LR8A 2AP6A 2WSFC 1UVKA 5J1EB 2VFUA 2RDIA 1KQSR 4PUOB 4UF4A 2BMBA 2GO8A 3MEDB 3UR0A 2RH3A 4Q45A 3MM8B 1VBXA 1NK5A 3PW7A 3PHEA 2J5AA 2KJWA 2KG1A 4ZLPA 4IDKB 2HMIB 2W9AA 2EFVA 3MAHA 2VHGA 4CTAA 3AT1B 1S1XA 3KLFB 3T6JA 3TAMB 1A6LA 3QQCD 1N34J 1Q4RA 4KE5A 4LT6A 1KVKA 3CF5Q 3ILIA 1ZM3A 3DN9A 2J7UA 2KFZA 1GMVA 3BBCA 3FBEA 4LF4F 3K57A 3HHKA 3ZTQA 4CYUA 4RX6A 4WP9A 2VODA 1CG2A 2UXCF 5K5MA 2PMWA 2VG6B 1UL3A 4WFXA 3NAHA 4ID5A 3ELHA 2L9NA 4HR2A 2M4MA 2YNHA 3PRDA 2DGSA 2VZ9A 2IA0A 3DHWC 1T9VA 3R7BB 3GWCA 3D2WA 1VQKS 2HURA 3MECB 2J8AA 4ZPBA 2KM8C 3OR2A 2QEXS 1I3OB 4RU2A 2ZZMA 4M8LA 4QCLA 1N52B 1HWUA 2GIFA 5LOQA 4RU9A 4WU3A 1RUSA 2CZ4A 4KV8B 4CO5A 2MTLA 2BKNA 4LQ9A 4F0MA 3HD1A 2UXBF 1IM4A 4K5SA 3U1NA 3J80U 2CPHA 3PXGa 4NLSA 2P9CA 3LOUA 4YHHF 4HHHA 2P9GA 1FD2A 4K4VA 3PW4A 4QYRA 2J6SA 1WI6A 2KU7A 2ZJRQ 1U7LA 4FYXB 1RWPB 1TMJA 3VV2B 3QT6A 2IVYA 2IYIA 2HHVA 5A8WA 5GAHI 5DDOC 5B09A 2RQMA 4RNFA 1O8BA 1CEZA 3VF0B 5DM7Q 4JYAF 1LW0B 4M94A 3FKBA 5DG9A 4CDIA 2DNHA 2NUHA 2BE2B 1W25A 4ZCLA 1HD0A 4RNMA 3W1YC 3OL8A 2QSWA 2DHXA 2OPQB 4ZOSA 1PJ5A 4A4JA 2OAUA 4X65F 2YVSA 3R1HA 2GQQA 3RJMB 3RU0A 3GJQB 2W24A 5E7OB 2XS2A 4DG1A 2J9CA 3KLIA 2Y0BB 5J2MB 4DXLA 3TEHB 1G7CB 1T3NA 1TFWA 2KZZA 4WFAQ 3TAPA 3NNAA 3MXHP 1KQKA 2UUAF 3QZ7A 4LFAJ 2D41A 3JQKA 3H5YA 2LQJA 4B9TA 4KB7A 1RAEB 2R7OA 2J8SA 1SIWB 3LANA 1FI4A 1RWWB 3D6MB 1W26A 5CABA 2R2SA 4UUXA 3HHDA 2XYHB 1FVQA 3PRBA 1JJHA 5KOXA 4ECTA 4M5LA 3J7ZT 2ZVSA 4Q2LA 1F5AA 2BKPA 1NZ8A 3GP9A 2JH3A 2XB2D 3PW5A 1NLKL 3M30B 3EVMA 3KFWX 1CC8A 4RUCA 2GC8A 5LM7E 3JSBA 5CH7B 1MROA 3A13A 3ETMA 3GE9A 1NSAA 5F41A 2LDYA 3MFIA 4OI3A 1MMDA 2W2OP 3M2VA 2Z2ZA 2DGXA 4GKJF 2DRDA 2VG7B 1U47A 4NASA 5H9FJ 2G0JA 4U8VA 3GQCA 2M2BA 2MB0B 1HYSB 3HZGA 4KGKA 3CJTA 3MGJA 4FKXA 1RU1A 2DNRA 4YDDB 4ECRA 4P6QA 2HVDA 3I0RA 4LSNA 5AXNA 4ECQA 2AX0A 3G8TA 1FA0A 4HEA9 3BSNA 2B9YA 2DXFA 4N47A 5T41A 4UOFA 5C25A 4A8XA 4X66F 3BKTA 3THVA 2DTJA 1YKWA 5ETTA 3M8WA 4B3MJ 1UEVA 2VBXA 3M8PA 3DI6A 3ITHB 3CCTA 3WC2A 3W8GA 4H4KC 1B0TA 3TZZA 5HN0A 1DRZA 1CJVB 1SC1B 4UUWA 3DLKA 1TK5A 4ZP8A 5ETPA 7AT1B 1JLGB 3CVKA 4JP8A 5KG5A 1Q7LB 5B0EA 2IJFA 4RW4B 4O3SA 3K8WA 2JFDA 4DR1J 3E2EA 3C8YA 2AEJA 2PFDA 4X2BA 3NWGA 1FNMA 2B8PA 5A0YB 4OYMA 2ZNZA 4BLGA 2RVJA 4MJKA 2EBEA 4DPYA 2VD3A 3OSPA 1WKLA 4L73A 3BH6B 2BM0A 2GGPB 2B9EA 4ED8A 1FX4A 1ITPA 3DHXA 1PBAA 3I5BA 4Z2XA 2HHXA 3MD1A 3HPOA 1F3VA 4O3RA 2AEFA 2R8IA 4YP3A 3OTOF 4Q7AA 2RE1A 4TLRA 4XPEA 1RACB 3G6YA 5HATA 1L3SA 4WKRA 3QSYB 4PXCA 1HNIB 2EK6A 4UOCA 3I55S 1UFWA 3O44A 3UN2A 2ASYA 3DNCA 2IMWP 2WOMB 2QFJA 2QSFA 3D54A 3PYDA 2ROGA 3L7UA 1W2BR 1X5OA 1RSCA 4HH1A 4CCHA 1YSJA 2E66A 5FD1A 1YDLA 2V34A 1KHWA 4HT7A 2HG4A 5IT9U 4ZVEA 3FBBA 3O8WA 1TK0A 5HBMB 2FB0A 4YDXA 1HPZB 4C11A 1TL3B 2N7YA 3LGMA 2DNQA 3OFEA 4IFYA 4PG8A 2FZGB 4CM2A 1U0SA 1QE1A 1C0UB 2YKQA 3LO3A 2CJQA 5JJBA 4WFBQ 5KFDA 2AYEA 3TX0A 1RYRA 2W2MP 3IRWP 4I2QB 2ZBRA 2KZMA 2QRRA 4WBFA 1LFPA 1DQ8A 2BUNA 4ECUA 1CS4A 3DXBA 1RT3B 1RKJA 3MAAA 4B3OA 5HI7A 2HQDA 1TU0B 2I5JB 4RBUA 1G2EA 1RT2B 4NI2B 3OL6A 4MK8A 1AUDA 1WEYA 4A8WA 4DHVA 1RAOA 4IQXA 2RRAA 3M05A 3OUYB 2ZE2A 1FDDA 5KFGA 2DNGA 1Q79A 5ETNA 4ZVTB 3DRRA 2FHJA 2B51A 3VVUA 4DR3F 5E2QA 4CNZA 1U09A 5KFWA 3EZUA 3FGVA 3UDVA 1R7IA 2V2KA 3BF4A 4DDFA 1L3VA 1FJ7A 4ZVRB 1GTHA 2LXIA 4EO6A 1JLQA 2R8KA 4IH5A 2OPPA 1VQ6S 8ATCB 2M8DB 1C4AA 5KFTA 1RK8A 4KKOA 2CNNB 3W9JA 4DR7F 2QMUB 3CJ8A 2GVDA 2I6WA 4AQYF 4URSA 3GJSB 4PYDA 3RBZA 2K7KA 3H42A 4TN2A 3OVAA 4DEZA 4F2SA 4OIXA 2LU2A 4ZCMA 3GCWP 4URQU 4AXJA 1ZETA 4CH7A 2FJWA 4M5NA 2JOQA 3I9V9 2YQ3A 1EQMA 1UA0A 1VRTA 2VQFF 2W2QP 2K06A 4NLOA 1MG7A 1I94J 1IBCB 3FBCA 5KT7A 2IM0A 3IBCB 4LJMA 3G82A 2OD4A 1TKDA 3I82A 2RQ4A 3LH2S 2RUSA 2GAGC 1SJ3P 1ELOA 3T9NA 3O2IA 3H5SA 1PG5B 3M2RB 4DFPA 2CXEA 2RD5C 1QSYA 3CJQA 4ITSA 3ZFVA 4DN0A 3GYGA 4ZIWA 2HNDA 3QIPA 2MKHA 1S0MA 1IWGA 3K17A 4HH0A 5I42A 1BQNB 3EGZA 4L75A 2OPSA 1WOSA 4KJIA 5CA5A 4IFVB 1RJJA 2MSTA 5C24B 2YKMA 3JAMU 5G0RB 1RHUB 2DHAA 5C42A 4B9NA 1ZYQA 2NREA 2YWGA 1HKAA 4CP5A 4FBUA 4JV5J 1R31A 3OTEA 4I7FB 1B0VA 1SUQB 3P5TL 4N56A 2W25A 3ZZOA 3H90A 2ZBIA 1LV5A 3MEEB 2CQBA 2G0IA 4YB7A 3HVRA 5IM0B 2W7PA 2JSXA 1IJEB 2VQEF 2V4RA 4FBTA 3UVJB 1XIQA 4QWDA 1YWXA 3LP2B 1M5PC 3CGIA 4Q43A 2KM8B 1T9WA 3OL7A 4FS2A 4OFZA 4NZ7A 4N77A 1VQ7S 4F4ZA 2RU9A 4X4SA 3WIVA 4ZLNA 5D3GA 2WONB 4KGXB 2MYFA 1HBMA 4TKTA 2NQPA 5HQMA 3D28A 1TR0A 5U47A 2HQIA 3HHEA 3U02A 5LSLA 5CZXA 4B9SA 2AMCB 1BQMB 4PWDB 1FERA 4OZ1A 2RHQB 2HZVA 2W8LA 2CWKA 1RTDB 2CQDA 1DAXA 2UXDF 3AOAA 3WDOA 3R5BA 4DPUA 2PGCA 4P71A 1JK9B 5J2QB 5HMYA 5HVFA 1X4HA 4RW6B 5A6WA 5GVQA 2YWFA 3QGHA 3R5DA 1NB7A 4UW2A 4YY3J 3T3FA 4ECVA 1OPIA 1U49A 3S1TA 3JTOA 2BACA 1T3OA 1T02A 2B6AB 2FVSA 1YX2A 2HGMA 4PWUA 3UCZP 3BPSP 4FF3A 4ER8A 4RWXA 3W60A 3NGDA 4IQMA 4DS5A 1OSDA 1B64A 1MSWD 1VIXA 5DQGA 5J2NA 5A8RB 5JMNA 2CJ9A 3CPWR 1YBTA 4KT0C 2LP4A 3CJ4A 2VJVA 3OD2A 1ZTWA 4RW9A 1WOOA 3BGOP 5AXMA 1OY9A 5K8MA 1K0VA 1JQGA 1FFWB 2YKOA 1KOOA 4U67Q 3KNGA 4K4YA 1RWMB 3ENVA 1NHVA 2QLJB 3ZZ0A 1HNVA 2GVZB 4OYAA 3UPFA 3PO4A 4S0MA 4YOEA 1A9NB 4NA2A 1JLEB 1VR6A 3NEKA 4TLQA 3KXDA 4PQUA 4EO8A 1FFGB 3ENAA 1VQOS 4XDDA 2GHPA 3N6NA 4CT9A 3RUBL 2BDPA 2MGZB 1FKPA 1ZS6A 3CJKA 3ENQA 4ICLB 3KHGA 1WHYA 4LFBF 3T1AA 4KPYA 1RXOB 2QN6B 1GMWD 1IR1A 4UOHA 2IPOB 3RZAA 3BO3A 3H8YA 4TU9A 4PPZA 2FIUA 2LCWA 5C5JA 3RAMA 1DTTB 3IG1B 1UVIA 2XSJA 2ZZTA 3BN4A 1RHJB 4V19J 3MOZA 2JJ4D 4OJGA 4OZ2A 4F8RA 1T05B 4GC6A 2N7CA 2QL7B 3LWLA 2HNZA 2KB2A 2Q1LA 3J81j 5DZ7A 4LF7J 4O3OA 1KD1T 1XNRF 5E3AA 3V6JA 1BXNA 4IUFA 4N76A 1LOUA 3VALA 3NMRA 2AQ4A 2YWWA 3X1LB 1YIJS 1HMVA 1S0VA 2DNOA 4DU7A 1HFEL 3RBXA 4K0KJ 3CWJA 1ZAVA 2WAQD 2Q6CA 3PCOB 2GMLA 1X4FA 3MMJA 1UFLA 3ICLA 3C6TB 2DGVA 5LL6d 2VDHA 4K4XA 2YPYA 4WIQA 1FRMA 1HARA 3OVSA 2FJEB 3DRSB 2OKQA 4JI3F 3M8YA 3H4BA 4PABA 1JXEA 4G1PA 2YNFA 3IRXA 4EBDA 1FXLA 1E6VB 4A48A 4DV2F 2IC3B 3W2VB 3A8EA 4DQRA 4RBVA 2GQ2A 1NCLA 2LEAA 2FJDB 1FRHA 1R89A 4NX9A 3WZ0A 2AZ1A 1XERA 3UDLA 1Q8IA 2V67A 3P3DA 1H38A 3EVOA 2DBBA 4NLYA 2HIQA 2PA3A 4F25A 4OL8A 2ROEA 3GTYX 4K4UA 1RT1B 2VKZG 3TQ1A 3MM6A 4P7TA 4ZJOA 1VLYA 3W5ZA 3QRQA 4J9OA 2JHEA 1UAWA 2XHWA 1S0OA 5HJYA 4DV4J 4DL4A 1PYSB 1C1CA 4DR5J 1R0AB 2LLZA 2XBPA 3CULA 4EUVA 1NDPA 3BDEA 2BE9B 2DIVA 1GNKA 1WC3A 1ACMB 4RKUC 4C8OA 1BHNA 1R0BG 4IOCQ 1U0HA 4ZVUB 4USVA 2WZ1A 1HNWJ 3DYAA 1IKVA 3U1LA 4IG0B 5DS7A 4PG5A 3MR5A 1DQAA 3GCXP 2AJ4A 3SQGB 4CTAB 1IBKJ 1S1XB 3G8QA 3G6VA 1V3RA 2KHDA 2V69A 4J9KA 3DOMA 2RNEA 2XGPA 4CO1A 2AGOA 3IXQA 1CJTA 1FE0A 4CIOA 1IUJA 3POTA 1RU2A 3NGTA 1RAGB 2PE8A 1DTQA 3BBBA 3IP0A 3NS5A 4LMZA 4RNHA 4ID5B 5CAAA 2XZDB 3PIOQ 2J0SD 2YNHB 3FJ2A 2RS2A 3HZEA 2F4VJ 1NUEA 2ACMA 3V5RA 1F9EB 2KDOA 4M5HA 2R8GA 1DHMA 4ECYA 2FDNA 1K9MT 3OR2B 4CLZA 2E44A 5DM6Q 3L4BC 2ZKTA 4NCGB 1T03B 1VK8A 2A1BA 2C2OB 3QGIA 4J9SA 4ATNA 2GIQA 4OZ3A 3MR6A 3PR5B 2C2ZB 4F0KA 1HNZF 2P6SA 4DUZJ 5D0RA 1S1VB 4WF9Q 1TKTA 2WSCC 5L9NA 2MSSA 4WE1A 5LJ3Y 2XMMA 1DLOB 4NYOA 1BY9A 3ILOA 2MKKA 3DU5A 2QA1A 1NK4A 1FK9B 3KK2A 3IS9B 1NBEB 4UQTA 5T7LB 4B9VA 3ZZUA 5A8WB 4IO9Q 4FPIA 2HWIA 1KEKA 2CA9A 2JVOA 3R5AA 2ZM6F 1RT7A 2EXUA 2DH8A 4X64F 3DRPA 3K5PA 2VFTA 3SSQA 3JYTA 2KRRA 1RTHA 1WC6A 1D8ZA 5IFMA 3FMWA 1AZSA 3IO1A 4M5GA 2ATCB 3D1OA 4PG4A 3M7VA 2OSRA 3LPYA 1WDTA 1FWKA 2JEJA 1CULA 4JI0F 1NJZA 3MM5A 4DG1B 3CO9A 3VAJA 4P73A 3QGGA 3G2XA 3KLIB 1MW7A 4JI6J 3SMZA 4ZLLA 1RAJA 4PQAA 3V2UC 4DZDA 2VU5A 3KOAA 3N5BA 2HKEA 3TZWA 2IA6A 1AYEA 2BOPA 5KFHA 1WC4A 2KO1A 3Q8SB 1HHTP 5B0AA 3BREA 2VDIA 1KOHA 4UZCA 1V3SA 4USTA 3CW2C 2W2NP 1MU2B 5E3RA 2F65A 1NJWA 2CPJA 1MROB 3BH7B 4HDGA 4ZA1A 3AOBA 4JI8F 4OHVA 2PIIA 3NLCA 1FNXH 1X5TA 4UY85 3M2VB 1EIYB 4FXVA 3I96A 1ZAWA 2HNYB 2M7SA 1PBUA 4L74A 4JI4F 1PAUB 2NR0A 3HSDA 3AA9A 2YWHA 4O44A 2YH1A 3H2VE 1FJGF 2LMIA 3TARA 4LSNB 2IDLA 3PJ9A 4WWSA 2E1CA 4RBTA 4B9LA 5K14A 4F3QA 2XMUA 5K8OA 4CLFA 2YXLA 3H98A 3HHLA 4DQSA 4ED2A 5L39A 2Y8WA 3M2UB 5HQ8A 3VQSA 2AEMA 2HQ3A 3MPUB 4ZVGA 4QIEA 4RWWA 4KH1B 2BKOA 4NCBA 2OSQA 4OLOA 5IS2A 1VQ9S 2WBMA 1NKEA 2FVPA 1NMEB 2YTCA 5KFOA 2CQPA 3QYYA 3IFEA 3LWMA 2R4FA 2KXNB 1R8PA 2JEIA 3MEGA 2VFRA 3KHRA 2HFSA 2R7QA 3BQ1A 3BQ0A 4NPOA 3CDUA 2A2CA 3B8HA 3PJXA 3EM1A 2MKSA 4G3IA 2RHSB 3MURP 1S99A 4O4RA 3JQMA 2FJBB 3IR6B 1F5BA 1S7IA 3L7OA 5E0OA 3DDKA 1WSRA 1SC3B 2QC3A 4ILMA 4OI4A 2E7XA 3UDCA 2VC0A 1VCTA 4DSFA 1S97A 2JLFA 2R2RA 2Y1LB 2GV1A 2KKHA 4B3RF 1NH8A 5ETLA 2Y1RI 4KGMA 1ZM2A 3MZIA 1J5OA 4IOAQ 2NPIA 3OTDA 2ZD1A 2XS5A 3NOCA 3UDEA 2QL9B 4PAAA 3K7RA 4BC7A 2V2VA 1FD8A 3MPVA 3P49B 4NWBA 1H2TZ 4LF6J 1BE4A 3D3CJ 4M63A 4TXSA 4NEYA 3PM9A 4ZVOB 5AT1B 2UU9J 4H54A 4ZLJA 4UOGA 4C11B 4KQZA 3PG9A 4DV5J 1K0TA 1UKUA 2EG1A 4IFYB 4OYXA 2K2PA 1QE1B 4JBCA 4QWBA 5KFYA 2V4QA 3NBPA 1EKSA 4P9SA 2EC0A 5HSPA 3GB0A 2LFVA 1TKXA 1M5OC 3UW1A 2W9CB 4K4SA 4FXDA 2XO6A 1FESA 3PDNA 1ZA1B 1FDNA 3QT5A 2HHQA 1G3OA 2WRMA 3TWZA 4EWTA 3HK2A 2KH9A 4B3OB 2L48A 4OYPA 1HBNA 4BWJA 3THTA 5F9LA 1V3ZA 5AE2A 3M9OB 1LWCA 3UD3P 2HBYB 4W90B 2DNPA 2Z4PA 2BJEA 2W2PP 5KFXA 3AH6A 3I9ZA 3GSDA 2CNOB 5IWAF 4LR7A 2PO4A 1ZH5A 3IBFB 3TUJC 3ISND 1A0OB 4J90A 4DCJB 2G9OA 1IKXB 3CIZA 1BLUA 2UUTA 4A8SA 1WC0A 3R2DJ 1CLFA 1WNEA 3VTIA 2C2DA 1Q7YT 1TELA 1CBKA 1NSKL 3Q8PB 2MZRA 3NRBA 4KAIA 4NLVA 3VGSA 1YHQS 2C3UA 2E9TA 2F5GA 3LTOA 3DM2A 3J80Y 3H2UB 2ASDA 3EUNA 3DGVA 2WHOA 3TAQA 3OSNA 2L9DA 1SH0A 1N6QB 4P2FA 1QVGR 3KLEA 2V68A 1PO6A 2BJ7A 2UV8A 4ERDA 4ZKAA 5IV4A 1YRUA 2X1AA 1IXKA 3CE8A 4CNYA 2ZHBA 4K2XA 1VHIA 1WTFA 2MMYA 2CQGA 2HK3A 3JTNA 1VRTB 3ILJA 3KUHA 3M32A 4ILLA 3M1VA 1UCNA 4WXWA 2MQ8A 3LGHA 3S7RA 4CLLA 1RAAB 2LECA 3HVTA 3GSIA 2DNKA 3N9UC 3HULA 2R7XA 4OMFG 2OTLS 2APOA 1ZZNA 4USJC 3OBIA 3NXZA 1KDNA 1HQUB 1UFKA 2XMKA 1NK9A 4ZPWR 4LBPA 3R3TA 2HNDB 2AU0A 3O3LA 2BX6A 3QIPB 3D3BJ 3MM9B 4B3SJ 2UUBJ 1K8AT 3OV7A 3CC2S 1A7GE 1FHTA 1VJWA 3LGNA 2P2CB 4DR2F 3RRHA 5LSRA 4QBUA 1OSCA 4Y0FA 2W4PA 5C42B 4E98A 3FRYA 4CH0S 2AT1B 2IRUA 1J2VA 2Q43A 5BR8J 2ZC3A 2FPHX 2VIHA 1EKRA 3AJDA 3AXKA 1NKCA 4OYOA 2WB1D 4CWBA 2J0WA 2A6MA 2QZ8A 3ZZPA 3PV8A 3K58A 2LKZA 2DGQA 2L9WA 2GAHC 1S9FA 1NPRA 4OV6A 4RNNA 2Z58B 4EBEA 3MWBA 5IC6B 4YN3B 2EC2A 4LFCJ 1Y3JA 2DR8A 3WHIA 1HI0P 4MH8A 2E5GA 1NDKA 1XJWB 3TRGA 2HK2A 4QWEA 1VQSA 3K2YA 3HHLC 3QBCA 2RIJA 1FKOA 2V4JA 1WEXA 3D7SB 2HZCA 3DCAA 4IR1A 4YR3A 3OFGA 1LQ9A 4DZ6A 3RR7A 3B82A 2LEPA 3PACA 4ED5A 3KJVA 4WK3A 2H51B 2DRBA 1F0XA 2E5IA 3CJ2A 4QU6A 2V9KA 4GO5X 4DPTA 1WKKA 3U7JA 2G13A 5D0HA 2MJNA 3EMTA 3QLHA 1Q8BA 3CJRA 3DLBA 4DQQA 2GZOA 2FVQA 5F8HA 3DXSX 1Q8LA 2PFFB 3KK1B 2H54B 1M1KT 2YNGB 2ATLA 5THWA 1QAXA 4AUKA 2Y3YA 2EWHA 5ITHA 5CQGA 5J2NB 3TJAA 3NCPA 1H72C 1X4EA 3CDWA 3NP5A 2VJUA 2BEFA 4OX9J 3EICA 2F40A 1N34F 1TQLA 2DEJA 3C15A 1U8SA 1C4CA 2HVHA 3GU0A 4J9MA 2MHEA 3M8RA 2AWZA 2DHSA 3GJTB 5DLGA 3ZZZA 1L5UA 2GO9A 2J6TA 2BABA 1NK7A 3RRKA 2CFXA 3HDSA 2E5HA 3TJ8A 3GV7B 3Q22A 2DPIA 1Q86T 2HAIA 1TAUA 3B54A 4BDPA 4CO3A 4FF2A 4B3TJ 1NB2A 1YJUA 2C22A 3BGLA 3OXLA 2W4CA 2HS0A 2OMOA 1T9TA 2HFNA 5GMKa 3DRYA 5C7PA 1FKPB 3CJKB 3GYXB 1PIEA 3J7YU 4RW8A 2QT7A 4ECSA 4MAKA 1APSA 4DS4A 4X4UA 2Z2YB 2AGPA 1DY3A 2EFNA 2XSFA 1GT8A 3QZ8A 5DQHA 5KTQA 2UVUA 3I0SB 1U02A 4NYPA 1Y00A 1SH2A 2G1DA 3DDIA 2MLYA 4DL6A 3EXYA 5H1SV 2VBZA 2VG5B 4L3KA 1TL4A 4CH1A 4M5DA 2ZH8A 4I67A 4EK2A 1RT5A 1V5IB 2HNZB 3BV8A 3H40A 3V4IA 2IJRA 4LIWA 1N36J 1IBMJ 1RT6B 1RDRA 3DGPA 3F41A 2W7OA 1FRJA 2B8QA 1XMOJ 3CDBA 2WVFA 3Q2TC 3AODA 2VBWA 4IH6A 1HMVB 2DK2A 4QQBA 3SDEA 2QA4S 3P45B 1CC7A 4DV3J 1NM2A 1YVFA 5KG4A 1RWUA 1VQ4S 1S4EA 2R42A 3MPDA 1M5VC 3JTPA 2VASA 1DARA 2V8DA 1Z2LA 1I51B 2V9WA 4RLEA 3BKFA 5LT5A 4NEZA 2HWHA 1S77D 4I6AA 3PYFA 1WC5A 1UETA 1GEHA 5E41A 5C2CA 3NOGA 2CWXA 4OZLA 2MZTA 1GXLA 2E5JA 2HVIA 3IRXB 4DR4J 2J7KA 5A76A 2DHGA 2IBKA 3DLHA 3R7NB 4C6AA 2QLFB 4X84A 3GIKA 4LFAF 3IC1A 2AJ0A 1U26A 4OHXA 3DLEA 2ZHOA 5F3TA 1GXUA 3QAUA 4DSIA 2YNIA 1AXQA 2M3DA 1SCJB 3ZZYA 1Q5YA 2UP1A 5L1KA 5EX0A 4NE9C 2VH7A 3NNCA 3HKWA 5KFMA 2VA3A 4ZPTR 1S49A 3MM6B 2AGQA 2F63A 1OO0B 2CNKB 2RB7A 2H1YA 1EZZB 2HGLA 2IVMA 2XLKA 3FEZA 3W3SA 1TKZB 1MWQA 2IY5B 1BD6A 2D3OR 1X5SA 3KLHA 3EGWB 1SL1A 3R5GA 4TU7A 4WTYA 3BS9A 4LVOP 2V2QA 4MT1A 5B0GA 4NLDA 4LRAA 3MMCA 3IWLA 3R97A 5J1EA 5K9FA 3DOMB 1B3TA 4PUOA 2M52A 4A47A 3W2WB 1SL0A 4PEOA 2AHOB 3POTB 5B0CA 5FLXY 1NJIT 2DH7A 4IDKA 4R8UA 2F7VA 3JAMY 2VOPA 3B4DA 3MHYA 4Y2CA 1OYDA 2BR0A 3BR9A 1OPZA 2HVZA 3V6HA 3CD7A 1YLXA 1TV6A 3KLFA 3MUMP 3TAMA 4F4WA 2PEBA 3KYLA 3MM7A 1RBLA 3L3CA 1FTRA 1E6YA 4ES2A 5EX3A 2RILA 2Z2LA 4LRCA 2GCFA 2DY9A 2LA6A 3L95X 1K1SA 4KTQA 4DR1F 1QTNB 2QFIA 1NK8A 4KY3A 4HTJA 2ZC4A 3ZNUA 4ELVA 4DV0J 1OY8A 3LAKA 4OV1A 2C2EA 3JXOA 2ROPA 1M5KC 3M9MB 2K8GA 5KG2A 4MIWA 1TKTB 3DOLB 3NGSA 3EDRB 2PA8D 4OHZA 3RB4A 2BXJA 4ID8A 3UO0A 5AJ3J 2Z57B 1B99A 1VQYA 2F3JA 3UE2A 5ADZA 3KK2B 2LU1A 1NRKA 2Z2MA 3UNGC 1ULRA 1HHQA 5DDQC 3G86A 3KLGA 4M5KA 4CLUA 2ACYA 2HRUA 2ZJQQ 5IQQA 1RT7B 3AD7C 5HK4A 2WVDA 3PKMA 3T1HJ 1F9FA 1SKWA 3DRPB 3A4TA 2FHKA 1Y11A 3GV5B 1JJ4A 1RTHB 5HAOA 4Q2MA 1GTEA 3M8QB 4LR9A 3ONQA 1AZSB 1XR5A 1GK8A 5GAGU 3FZ2A 3CCES 3HJFA 4CLKA 2XHCA 4ZJQA 4J9PA 1U1NA 1CULB 4MYTA 3MM5B 1LW0A 4DUYJ 1AT1B 3E8OA 4ZVFA 3U27A 2E9RX 1UWBA 4GRSA 2LA4A 4DSLA 4GVLA 2CUYA 2VPXB 5L1JA 4M5IA 4ZPCA 1S72S 1H3DA 3MF5A 3FVYA 4RW7A 4OYWA 1NU4A 2BE7D 4MKBA 1Q8KA 1N5VA 4Y00A 1NJYA 4N8OA 5ETOA 1KP6A 1PJ7A 1T94A 1XEZA 5HJXA 2YBVA 3QT7A 5J2MA 2QJ3A 2OJ3A 1YBAA 4ED4A 1HWLA 4Q0BB 1KVJA 2DD8S 2ZH7A 3TP2A 2HFVA 4ZMMA 5D77A 4M1KA 1URNA 2P6TA 3OFFA 4Y6IA 3WIUA 4J91A 2XQCA 2MLZA 3ET6B 4HI2A 3OW2R 3TZYA 3CCWA 4N7TA 1SH3A 4EZ6A 1LXNA 1Y5IB 4U6PA 1YBUA 3KK3A 3VAHA 3KHLA 1HQEB 2DY1A 4ED7A 4CO0A 3PJWA 2UUCJ 2DXDA 3M30A 2XMVA 1SQFA 1SPBP 1WG5A 4HI1A 1KLMA 1X9WA 2MDAA 4RUHA 2NSBA 4NOHA 3DOKA 2AYMA 1SXLA 8AT1B 3HHLB 5IXUA 1J5EJ 3HT3A 2EFGA 1XN9A 2VBYA 1Q78A 4FDFA 1WOPA 4C4WA 2I1RA 3MMBB 2BW2A 1B70B 4A8KA 1WWHA 1REVB 3PIPQ 4QU7A 5F3ZA 1JLFA 2CPIA 2HVEA 1I94F 1C2PA 2ZWOA 2V6AA 3HSGA 4C3KA 4ED0A 4EEYA 1S79A 2K1RA 1U1PA 3MEGB 5F8GA 1XTZA 4WP3A 4ZIVA 4HDHA 2JRSA 5GMDA 4LF1A 2X51A 2QMXA 2GIRA 4IYQA 2OGUA 3NNHA 4PWWA 1OS5A 5DG7A 4MFBB 3H7HB 1XK8A 1O51A 1N32J 2HIYA 4C48A 1FF2A 4Y65A 2QA2A 4O3PA 4QR1A 2MLXA 5KFSA 1UW4A 3C66A 1S9GA 2VA2A 4RW4A 1KTVA 1RWKB 4J5OA 3PKYA 2VOOA 1YRTA 2MQMA 1UW9A 2R7SA 3GFHA 4K4TA 4CI0B 5J1PA 5A0YA 4USHA 5KFFA 1J5OB 3DKDA 3OHBA 3TI0A 3CCZA 2ZD1B 2GGPA 5EHHA 2V5HG 3NL0A 5A8KB 4FVMA 4P10A 2DH9A 2CPYA 3I5CA 4RL1A 3HVAA 3BYRA 5DDRC 1S6PA 1ZM4A 4ZITA 4KH0B 1UZHA 1XMBA 1KHVA 1M1HA 2AJFE 3MD3A 1FX2A 3VAGA 2IRYA 3FFIB 1N5QA 4CLTA 2FC8A 3A3OB 3MDFA 2HRYA 2VPZB 2WOMA 3ZNJ1 3QWUA 2DEIA 3PYGA 5A6PA 1ZPWX 3M9NB 1TKXB 5DJBA 4XO0A 4BCAA 4ENOA 5KFPA 3M8SA 2RU3A 5HBMA 3EXCX 2JDJA 2K3IA 2H5EA 1HPZA 4J9UE 2CJKA 1TL3A 5H9EJ 4F4YA 3RG6A 1HBNB 3BGFA 1YITS 2GA7A 3PHTA 4XIUA 1U1KA 3T6BA 1LWCB 3UI3A 3BZQA 5HQLA 4B9UA 4G65A 4YY3F 4G6VB 2KFYA 2F4FA 2JEGA 4I2QA 4FP9A 1VOMA 3OT9A 2KRBA 2LQBA 2F1FA 3FEXB 3OTBA 4O23A 3KDNA 1PYTA 3T19A 3RW6A 1WC1A 1RT3A 3N01A 4DPXA 4NRTA 5DDPC 3K89A 1UJ4A 2AJQA 2YX4A 1PKUA 4HTIA 4I2PB 2HHWA 3SBMA 2D7SA 3W7BA 1HNXJ 4A8YA 2DCUB 3MAQA 5KFUA 2FUG9 4ETXA 2RKIA 4K8RA 4C8MA 3M6XA 4ZDNA 5KFZA 5KG1A 3SFGA 1M5HA 1IQTA 2BRKA 1UVJA 2V50A 4PRFA 1C1BA 3M4XA 3TYTA 2BJ3A 3J7YI 3GIJA 3PYEA 3MI7X 5CCLA 1R43A 1S1UB 5HP1B 4FF4A 4TYBA 2OO4A 1HWJA 4Q8FA 2WVCA 3CCRS 2ZJPQ 5F9NA 1GFWB 1RABB 4WP8A 1H98A 4F67A 4Y2MA 4C8KA 1VQMS 5KG6A 3VGVA 2DGOA 1K47A 3M32B 5D4PA 1VC5A 4P74A 3W8PA 2OFGX 1FXDA 3CD0A 3CD6S 5L38A 1QY7A 2DNZA 3G6XA 2IM3A 3HVTB 1MWYA 4D3GA 1GMUA 2OEJA 1HBUB 1MMLA 5BYSA 2YH0A 3HX9A 3MCMA 2GQCA 5E3QA 3NCQA 2G0CA 2IHR1 1QSSA 1TVRB 2DNLA 2XM3A 4ZP6A 2XI2A 3MEKA 3ENWA 1HWKA 1I1GA 2RRBA 3SCIE 3ZZRA 1LWXA 2RQCA 4LF7F 2MQQA 3MCSA 5J1NA 2CQCA 1YTYA 3PEHA 3R2CJ 3TX8A 3HFVA 2Q66A 4KO0A 4OX7A 2MPUA 2CVIA 2COLA 1WELA 3HF5A 4JB8B 2YX1A 2XO7A 2DISA 2OUGA 3K5MA 4AL7A 4K0KF 3TQEA 3ZO7A 3PRVA 1YZ7A 1AW0A 4PKDB 4LSLA 1BQNA 1N33J 3GZ7A 4C8ZA 2WVEA 1PILA 2IAJA 2B4PA 2FZCB 4IFVA 2MKCA 2HRTA 5EWGA 1NXIA 5G0RA 3W64A 1IKWA 2CPXA 1FE4A 2V8GA 1NAQA 1FXRA 2ZVIA 1WD6A 5F8IA 3CMAS 4GKKJ 1WHWA 2RDJA 3RR8A 4DX6A 4Z37A 3NAIA 3VWSA 4K5RA 1Y4ZB 2DHHA 4I7FA 1U1OA 2EPIA 3IM9A 2EKYA 1RE1B 4TY8A 5HVHA 2VB6A 5D0EA 1D3WA 2W9BB 4OX6A 4OYIA 4A8FA 3VGUA 1RBOB 2UZAA 1YJWS 1SV5B 1YJVA 1FKOB 2CQHA 3UVJA 1NNDA 2PI4A 4WPAA 1HHSA 4P75A 2BQUA 4CLYA 3UR3C 4F7VA 3W63A 1TMMA 4O4GB 4QYZK 2IM2A 2HBQB 1UPPA 2PT0A 2MJUA 2AZ3A 2WONA 4DUTA 4DV4F 1CVJA 4DR5F 4C98A 4EU0A 2HQFA 2HFZA 1KRPA 4USKA 1TAQA 3CIMA 4JOUA 2FYXA 1Z2ZA 4JI5J 1BQMA 2CJXB 3C6UA 1TK8A 4ZN1A 1XC9A 2KFNA 4CLPA 3SCLE 3P8BB 1HNWF 3M8ZA 5L1IA 1XBWA 1D9FA 5J2QA 2KHCA 4R25A 3HD2A 1IBKF 3SEOA 3QMQA 1VRQC 3H2LA 1H7WA 4J7CA 1RGVA 3CCSS 4Y3CA 2XCAA 5DGAA 2OEMA 1VYAA 5AXLA 2CG8A 1EARA 1JIHA 1TL7A 1SQGA 4GVBB 4BHQA 4NCAA 2QA4G 5LXYA 3OR1B 1EB0A 4E2FB 1S0NA 3QO9B 1L3TA 3RAXA 5FLXU 1U1MA 2X1FA 4DCPB 4ETZA 2KVIA 3T5JA 1UPMB 3X3UA 1F2HA 2ZH3A 2F4VF 1SC6A 4FZVA 2NUUG 2B7BB 2DNMA 1P6TA 4AT1B 4QPXA 2WCXA 4C3LA 3KJNB 5CYMB 2ZOGA 4RW8B 3SSRA 2V8VA 5KG0A 1DZ5A 4HKQA 3BR8A 2OI2A 3Q8VA 5MAOA 1JLEA 5KFIA 3KG0A 5EWFA 4DUZF 3V6DA 4ZK7M 3HT0A 4K2JA 3HVWA 4DL2A 5CCMA 2DO0A 2W01A 2XC9A 4DR6J 4IKAA 4X4TA 4ICLA 1FDAA 4M5DB 2AJ1A 1RTIA 1EETB 1JWWA 4DSKA 1IKYA 3V6KA 2E1MC 4DL3A 1F6TA 3K5NA 3V4IB 4KHPJ 2HEKA 5LMUJ 1BWVA 2Z8QA 3GPAA 2XWYA 1NJXA 3DGPB 4IG3A 5I3UA 4LF9J 5KFRA 1DTTA 1X60A 2Y1IA 1OQ3A 1S59A 2YKAA 1ZOTA 2XWXA 2ADBA 5GAGI 2ZBQA 5T14A 4LF8J 1CJKA 5KFLA 3ZTPA 1VJQA 1TL1B 2ZUAA 4X62J 1JXLA 3D0IE 3W62A 4XPCA 2EKNA 4IH7A 5HO4A 5EDWA 2GMHA 4NMLA 4USWA 3VAMA 4IRKA 1HBOA 4NXMJ 1VQ5S 3J7Z5 2NXEA 4R5PA 1U6ZA 5FDLA 3QAEA 3CC4S 1K44A
chains in the Genus database with same CATH topology
3OVBA 1A7GE 2HMIA 3LF0A 1TK5A 2DR5A 4ZP8A 3TANA 1FHTA 1VIOA 1VJWA 2XY6A 1S76D 3TVYA 2I9SA 3LGNA 4DR2F 1N5SA 5IQ6A 3RRHA 1JLGB 4JI6F 2Y0SD 5LSRA 3CVKA 4QBUA 1OSCA 4Y0FA 2C3YA 2W4PA 3G4SS 4WCEQ 5KG5A 3ISNC 5CZVA 1Q7LB 3CEDA 2IJFA 4P2SA 5C42B 5B0EA 2MQNA 1AROP 3I32A 3FEYB 4H4KA 4E98A 4RW4B 2I2YA 3K8WA 2JFDA 4O3SA 2UUWA 3FRYA 4CH0S 1R8CA 4OJ1A 3E2EA 3C6TA 2IRUA 3C8YA 1J2VA 4XDCA 2Q43A 4Q44A 4ECXA 1VQ8S 2E1AA 2ZC3A 1HWIA 2FPHX 4X2BA 3DLEB 1NKCA 4URGA 3NWGA 1FNMA 3PX6A 2WB1D 1L3KA 2BVZA 4PG7A 5A0YB 2VG6A 3EYZA 2J0WA 2J76E 2ZNZA 3BSOA 2RVJA 4Q0BA 4MJKA 2EBEA 1HNXF 4EZ9A 2VD3A 3OSPA 2QZ8A 3GFXA 3ZZPA 2R8JA 5HL7Q 3PV8A 3DRSA 3K58A 2LKZA 2BM0A 2DGQA 2W8KA 4OI1A 2L9WA 3M6VA 2GGPB 1SKRA 2KYZA 3DDNA 1S9FA 1E6VA 4QIVA 5JVGQ 3QJPA 4GMKA 4RNNA 4ED8A 3W2VA 1KTQA 4FVCA 4EBEA 3DHXA 3MWBA 2FLOA 4KFBB 3DFEA 2HWTA 4AL6A 3I5BA 1NHUA 1FEEA 4OQJA 3MECA 2N4DA 4Z2XA 1Y3JA 2HHXA 2ZHAA 1RTJB 1PSDA 2DR8A 3MD1A 3TO8A 1HI0P 3HPOA 4MH8A 1KS2A 3J7A1 1URRA 4WE1B 4O3RA 1V6HA 5GAEU 2R8IA 2QYCA 2E5GA 4YP3A 3OTOF 3QJLA 3KNAA 5LXRA 4Q7AA 3UCUP 1WTBA 2NLWA 2RE1A 2C42A 2B4OA 4HVZA 3TRGA 4TLRA 4QWEA 1VQSA 3F56A 1HQEA 4XPEA 3G6YA 3K2YA 4ZP9A 1L3SA 3HHLC 4WKRA 2RIJA 4PXCA 4ZCIA 1QJHA 1HNIB 4KV8A 2EK6A 4WFNQ 1FKOA 4UOCA 2V4JA 1UFWA 3O44A 3I55S 2XZWA 3N5FA 3I31A 2ASYA 1H0HB 2EFQA 1RYSA 3DNCA 3L7PA 3IN5A 1WEXA 4OHYA 2HZCA 4WXOA 2KXHA 2MZ1A 1FT8A 2IMWP 2WOMB 2QFJA 2QSFA 3D54A 3NKYA 3DMJA 2ROGA 3DCAA 4IR1A 1W2BR 1X5OA 2ABYA 4YR3A 1VK3A 4ZS6A 4HH1A 3OFGA 2NZ4A 3AA8A 4CCHA 4HHJA 1LQ9A 3RR7A 3B82A 1YSJA 1FRIA 2E66A 3V4MA 5FD1A 4IRCA 2LEPA 4I0WA 1KHWA 2GHVC 3PACA 4HT7A 5I3PA 3MMCB 2HHSA 2HG4A 1R0AA 4ED5A 4EYIB 3TR5A 3JYTB 3KJVA 4OX8A 4ZVEA 3Q23A 4WK3A 1U2FA 2DRBA 1F0XA 2E5IA 3CJ2A 4QU6A 3O8WA 1TK0A 5HBMB 1WG1A 2FB0A 2V9KA 1G1XA 4GO5X 4YDXA 1OWXA 2CG4A 3U7JA 4RUAA 5KFBA 1HPZB 2G13A 3E51A 4C11A