5C24B

Crystal structure of hiv-1 reverse transcriptase in complex with 7-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8-dimethylindolizine-2-carbonitrile (jlj605), a non-nucleoside inhibitor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
412
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
total genus 120
structure length 412
sequence length 412
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c24B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B03
4Y2CA 2IC3A 2FJVA 4MKBA 4YR0A 5KG7A 4J9QA 4TYBA 3MEEB 2R2RA 2B6AA 2YNFB 3M8PA 2BRKA 1C0TB 4QW8A 4URGA 2XC9A 5KFNA 2XGPA 1SH3A 4ED2A 2ZD1B 3H5UA 4KHMA 4O3NA 4WZMA 1VRTB 5C24B 1RT3A 4WXOA 4XPEA 4ICLA 1N5YB 4NLVA 4RUCA 3DRRB 5DLGA 1XR5A 3MECA 3HVTA 5I42A 5I3UA 4MK9A 4ZP9A 1HYSA 2HWIA 4ZVGA 1NNDA 1HARA 2I5JA 2WONB 3QZ7A 1JLBA 2CKWA 1S1XA 4IOBA 1HNIA 1EETA 1ZTWA 3PW5A 3QGHA 3OL7A 2E9TA 5KT2A 1TKZA 3ICLA 4R8UA 4MFBB 1RTHB 1S1TB 4RW9A 5HBMA 5KFHA 1S1VA 1S48A 3D5MA 1HPZB 2RF2B 5FDLB 2HAIA 2XGQA 2JEJA 1S6PB 2BR0A 2V4RA 2D3UA 3KLHB 4WFZA 3SFGA 3FFIA 2UUTA 3GIKA 2AGQA 5KG6A 3SFUA 4TY8A 4RW8B 4J9MA 2BQUA 1S6QA 5CYQA 2D7SA 3QO9A 5J2NB 4K4TA 4TN2A 4ED3A 3H40A 2OPSB 1U09A 4ECZA 2HWHA 3EPGA 3PJXA 2WOMB 3NMAA 2UUWA 1RT1B 1EP4A 1S4FA 3V81B 1HMVA 1TQLA 4RW6A 3DLKB 4JV1A 4WFXA 1HQEA 3V6DA 4IR1A 3KLFA 4ECQA 1LW2A 2C2DA 3IRXB 1JIHA 3TVKA 5KFVA 3BSOA 3LALA 4ED7A 4J9SA 3PZPA 4WFYA 4MH8A 3Q8PB 3QYYA 4ECYA 1VRUA 4KV8B 4TXSA 4F4ZA 3DMJB 4WYLA 5HLFB 2C22A 2JEGA 3G86A 4RW4A 1LWCB 3LP0B 5J2MB 3EZUA 3C6UB 2W9CB 3H4DA 4J9KA 3RAXA 1TL3B 2IMWP 4LSNB 5KG5A 5F8LA 2YKMB 3N6MA 4Q45A 4QWCA 3I0RA 3OLAA 2VG5B 1QUVA 4KE5A 5KG4A 2JEFA 4TLRA 1JLAB 3H4BA 1IKYB 5DQGA 4ED8A 3MEEA 2YNFA 4EBEA 3OLBA 3KHRA 2XI2A 4K4XA 1GX6A 4IQXA 2BQ3A 1VRTA 1JKHB 3I0SB 4R0EA 5KFGA 3H5XA 4DL6A 4J9RA 4IH5A 4XO0A 2JC1A 1D1UA 3DRRA 1C1CB 2AX0A 4IG3B 1S49A 5J2PA 2BQRA 4M94A 4PQUB 4ED0A 3DLGB 1RT3B 1DLOB 3I5BA 3ISND 3D28A 4RZRA 1HNVB 3HVTB 2F8EX 5I3UB 4ZPDA 3BQ1A 3RBEA 1NHVA 3NKYA 1S1TA 3DI6B 4B3OA 3FQKA 4TYAA 3KLIB 1HPZA 1JX4A 2RF2A 5FDLA 3GIJA 1HNIB 1S6PA 1QAIA 5L9XA 3CJ2A 3KLHA 4YP3A 2WRMA 3OL9A 3UQSA 3LAKA 3MFIA 4RW8A 2IA6A 4QWBA 4ZP6A 3BR9A 2ILZA 5J2NA 1RYRA 5EWGA 3FFIB 5F8JA 4NCGB 5C5JA 3QGIA 3M9NB 4TY8B 3ISNC 4EBDA 2WOMA 3HVWA 1SUQB 1RT1A 4ID5B 3Q8SB 1S6QB 3IG1A 3V81A 3GIIA 3DLKA 3E01B 3UPFA 5EWFA 3IRXA 3BREA 3GQCA 3PW4A 2YNHA 2UVUA 1JLEB 2WK4A 4H4OB 1HMVB 2YKNB 2RDIA 4QWEA 2I1RA 2W7OA 5J2QB 4KV8A 1D0EA 3CDEA 3IN5A 3KHLA 3KLFB 4HKQA 1ZETA 3KOAA 1LW2B 5HLFA 4PWDB 5J2MA 1LWCA 3LP0A 4IFYB 3T1AA 3NAIA 1TL3A 3T19A 4LSNA 5DQIA 5KT5A 4F4WA 2YKMA 1VRUB 4NLYA 1IKWB 2VG5A 3H2LA 2FVQA 1IKYA 1LW0B 4ZPCA 3CDUA 4ECUA 2IBKA 5D3GA 5L1JA 4DG1B 3CIZA 1JLCA 1S1WA 3BJYA 3V6JA 2EC0A 3QZ8A 4EEYA 1C1CA 3LP2A 1RT7B 4IG3A 5CYMB 3KK3A 4PQUA 1DTTB 4IDKB 3FSIA 5F9NA 2HNYA 3DLGA 3JYTB 4JV2A 1TL1A 5KFKA 5DLFA 1DLOA 4RW7B 1S9FA 3DRPB 5F8HA 4K4SA 4QWDA 4K4ZA 1HNVA 5J2PB 5K14B 5KT7A 2J6SA 1RTJB 4Y2AA 3DI6A 3MEDB 5JXSA 3MFHA 3KLIA 4IRDA 3ITHA 3PHEA 4M95A 1NHUA 3UDLA 1LWFB 1JXLA 1SH0A 2UVVA 3KNAA 4FS2A 1HQUB 4F4XA 3MTKA 1RAJA 4B3OB 4ECVA 4RNFA 5C42B 3M9OB 5DG8A 4I2PB 4DL7A 4NCGA 4MIBA 2OPPB 2WHOA 4ZMMA 3JSMB 2V0NA 1SUQA 4ID5A 5KFQA 2C2RA 4PUOA 2IM3A 2WCXA 4K4WA 3E01A 2JEIA 2ZE2A 1K1QA 3DOLB 1S9GA 2QV6A 5KFIA 1Z4UA 4FS1A 3LP1B 1JLEA 4KFBB 3IG1B 4H4OA 2YKNA 4HYKA 5J2QA 5F9LA 4OL8A 3RBDA 2CJQA 4PWDA 2YNIB 4NRUA 3PJWA 2YNHB 4IFYA 5KFSA 4K50A 3KK2B 2FLNA 1ZTTA 2XCPA 3E51A 1IKWA 2D3ZA 2FLPA 1LW0A 3KJVB 1RA6A 3I5AA 1KHVA 3T5HA 1JLQB 3HVAA 4ZHRB 3G6XA 2BE2A 4QWAA 4NLUA 4NLWA 4DG1A 3EPIA 3LANA 2GIRA 1RTDB 2HMIB 1JLFB 4MK7A 5T14A 5KFEA 4Y34A 2HNZA 2IM2A 3N6LA 2XI3A 1REVB 1RT7A 2VG7A 5CYMA 3DOKB 1DTTA 4IDKA 2DPIA 2FVPA 1DTQA 1RT4B 5D3GB 3JYTA 1T94A 3CJ5A 2ASDA 3CO9A 2W7PA 1JLCB 1S1WB 4RW7A 2R8KA 3T5JA 1FKPB 5KFRA 3KHGA 4FBTA 3DRPA 4Q44A 3LP2B 1KLMA 3KK3B 5K14A 2O5DA 3C6TB 3GILA 4ZPBA 1RTJA 4NZ0A 3MEDA 2HNYB 2HNDA 2AWZA 1TL1B 3NGDA 1TKXB 1LWFA 5HROA 4U7CA 3GIMA 1WNEA 1IKXA 2B5JB 5KT6A 3PR5B 1S1UA 3KMSA 4ECWA 1HQUA 4KKOB 4IFVA 4LQ3A 3HKWA 3ITHB 2VA2A 5C42A 1IKVA 4FBUA 4H4MB 1S0NA 3DDKA 1IM4A 4I2PA 4O3QA 3H59A 1CSJA 4U6PA 1UWBA 5C25B 4MIAA 4TY9A 3V6HA 4DL5A 3DM2A 2OPPA 4WE1B 3PW2A 3MR6A 1T3NA 3JSMA 4IG0B 4YMEA 4QPXA 2OPQB 2GC8A 4RNOA 1K1SA 5KG3A 5DG7A 3MR2A 1RYSA 5KFXA 3CDWA 2E9ZA 3DOLA 2RDJA 3KLGB 2R8IA 3H5YA 3RAQA 3LP1A 2DPJA 3RB4A 4KFBA 4PUOB 3CVKA 3PW7A 4LSLB 5KFBA 2ZE2B 1S9GB 1YVFA 2FVCA 2YNIA 3IGVA 4RU9A 2BANB 1RA7A 3Q8QB 3KK2A 3QGGA 4JUZA 1BQMB 1RT2A 4KO0B 4R5PB 4TQSA 3BQ0A 4YR3A 4EBCA 1S10A 4ZVEA 5KFAA 3NAHA 3T5KA 3KHHA 3KJVA 1QAJA 3UR0A 4DEZA 4G1QB 1JLQA 3MR3A 5EDWA 4ZHRA 4NYZA 4F4YA 2FVSA 2IJNA 3RB3A 1JLGB 2IAJA 1JLFA 1RTDA 2HMIA 5DGBA 5DGAA 2FLLA 5KFYA 4ECTA 1QE1B 1REVA 5KG1A 2R2UA 3FQLA 1FK9B 3DOKA 3BSAA 4O3RA 2BE2B 1RT4A 2OPRB 3BQ2A 2JLEA 1FKPA 3OSNA 1MU2A 3PVXA 3GV7B 2HNZB 4NLQA 2VG7B 3DLEB 3C6TA 1DTQB 3LAMA 4X2BA 1RTIB 1R0AB 4URQU 1TKXA 4ZVHA 2D41A 4RNNA 3IS9A 2B5JA 1KLMB 4KSEB 1T03A 4NLXA 4KKOA 1W25A 4Q8EA 2RKIA 1RDRA 5L1KA 2HNDB 2IM1A 4IH7A 4WZQA 5KG2A 3M8QB 4ZPAA 4H4MA 5HROB 4Q8FA 3QLHA 1IKXB 5KFTA 5C25A 1S1UB 5KFUA 4WE1A 4O3OA 4IFVB 4IRCA 3M9MB 4DL2A 4IG0A 5L1LA 2OPQA 3QIPB 1IKVB 4O44B 1I6JA 5L1IA 3CWJA 2W9BB 3NBPA 1UWBB 1TP7A 4KBIA 4YQWA 4Q0BB 3DM2B 3GV8B 3KLGA 2FJXA 4YR2A 3OSPA 3PR4A 1S9EB 2W8LA 4J9OA 1SV5A 4LSLA 4TQRA 4IH6A 5KFCA 5KT3A 4O3SA 2R2SA 1TV6B 5KFJA 2BANA 1BQMA 4KO0A 4R5PA 2R8JA 3BSCA 4JV0A 3MEGB 5KFPA 4K4VA 4DL3A 5DG9A 4NLOA 4QW9A 3MR5A 3BSNA 3VQSA 5J1EB 1RT2B 2YNGA 4G1QA 1LWEB 4KHRA 4LQ9A 3CJ0A 3CJ3A 3OL8A 4F50A 5DQHA 1OS5A 4ED6A 1TVRA 4I7FB 1JLGA 1T05A 1GX5A 3TQ1A 4O3PA 5KFLA 1XR7A 4KB7A 4K4YA 1SH2A 1S0MA 1QE1A 3TAMB 5KFMA 4K4UA 1FK9A 2B43A 1RT6B 2OPRA 3RB0A 1C1BA 3CJ4A 4ECSA 2IAJB 3BGRB 2WB4A 5KFZA 4EO8A 4ECXA 1RT5A 4KAIA 5F8IA 1FKOA 1C2PA 1TKTB 3DLEA 2QE5A 4J9PA 4O4GA 3FDSA 3PW0A 5F8NA 5KT4A 2W8KA 4NRTA 5EWEA 2XWYA 1RTIA 1MU2B 5HP1A 1R0AA 1J5OB 2J6UA 1BQNA 4EO6A 4URSA 3KK1A 1N6QB 3DRSA 1N48A 1C0UA 3RB6A 2UVRA 4WYWA 3I5CA 3M8QA 4NLPA 3KLEA 2WTFA 2AX1A 3OL6A 3IS9B 5F8GA 2VA3A 2VG6A 1T03B 5KG0A 4RNMA 3NL0A 4XPCA 2RKIB 2R8HA 3DYAB 4NLRA 2UVWA 4I2QB 3QIPA 1C0TA 4O44A 4DL4A 2W9BA 3QLHB 2ZD1A 3V4IB 3G6VA 2R2TA 4EYHB 4Q0BA 5C24A 5KFWA 2IC3B 4EYIB 1XR6A 1N5YA 2AGPA 2C2EA 2ASLA 2B6AB 3M8PB 4IKAA 4O4RA 1S9EA 3FRZA 3NBPB 1S97A 5KFFA 2V9WA 3GV5B 3V6KA 2WONA 3Q8RB 4IR9A 1TV6A 4ICLB 2ASJA 2OH2A 4ZVFA 3H5SA 3MECB 5I42B 3H98A 1SV5B 4MFBA 1HYSB 1RTHA 3MEGA 4ZP7A 2GIQA 2I5JB 1JLBB 1N56A 1S1XB 1EETB 3T5LA 5J1EA 2IM0A 1LWEA 4NLSA 1TKZB 3GYNA 4MKAA 4R8UB 4J9NA 2AU0A 4RW9B 5KFDA 5HBMB 1S1VB 4NLDA 4I7FA 3G6YA 2BRLA 2W9AA 3OHBA 2AGOA 2YNGB 3TAMA 2E9RX 2OPSA 2ATLA 4IRKA 2JC0A 4H54A 4Y3CA 3KMQA 1RT6A 2IJFA 1TVRB 1T05B 3BGRA 2ALZA 2V4QA 5CYQB 2C28A 3QO9B 3MF5A 4WXWA 1TKTA 3N6NA 2FVRA 4ECRA 3SI8A 3QIDA 3IGNA 1C1BB 4G3IA 1EP4B 4ED1A 1J5OA 4ZP8A 1RT5B 4RW6B 2FJWA 4MK8A 1FKOB 1HQEB 3V6DB 2ILYA 1KHWA 4RNHA 2AQ4A 4O4GB 2R8GA 3DMJA 3KLVA 1N6QA 2XCAA 4NLTA 2W9CA 4RUAA 3C6UA 2ZKUA 5HP1B 4NLGA 3OHAA 1BQNB 1N4LA 1MMLA 4J9LA 1S0OA 4Q43A 5JUMA 3KK1B 1JLAA 3DYAA 3DRSB 4RW4B 5EUHA 4GC6A 3HHKA 1C0UB 2J6TA 4I2QA 3KLEB 5F8MA 5KFOA 4GC7A 3I0RB 3V4IA 2VG6B 3I0SA 1JKHA
chains in the Genus database with same CATH superfamily
4Y2CA 5M2UA 5D78A 3EGWB 1X9SA 1VRTB 4ICLA 3B54A 3GJSB 2I8EA 2W4CA 1WC5A 1IBLJ 4ZP9A 4A47A 3PTWA 3QZ7A 4ZVTB 4EUVA 3HXMA 2LMIA 3EXYA 2EFPA 4HI1A 5KTQA 1RTHB 5KFHA 3D5MA 2RF2B 1Q7YT 4F4KA 4HHHA 2DR5A 5B08A 5EN1A 3TJ8A 3GIKA 4TY8A 2GJIA 2VOOA 2AYGA 1N5TA 4PPZA 3D0HE 2R7XA 4UF4A 4B08A 3V81B 5E5NA 3FJ2A 1DQ9A 2YH1A 3V6DA 2AT1B 4FKYA 1DQAA 3MM5A 4TXSA 1ZPWX 4WIIA 2QL5B 3G86A 2ADCA 4KHPJ 4L3KA 4F25A 2YNFA 2POKA 2XI2A 4JOUA 1GX6A 2MKIA 2YPYA 3SZ2A 2FY1A 2HS3A 4DPUA 1O8BA 4NMXA 4CLYA 2AEFA 1ELOA 4HDGA 3CC2S 1UW9A 2RT3A 5IXUA 1NHVA 2QFJA 4TYAA 3DI6B 2EFGA 5FDLA 4U67Q 3MXHP 1B7YB 1F9FA 4OYXA 1HNXF 4M5JA 1KSPA 3QGIA 2X3DA 3HVWA 2D74B 2Z57B 4BS2A 3DLKA 3E01B 3IWLA 3BREA 2D3OR 4DPTA 2IIHA 5J2QB 4KV8A 2LKZA 2BE7D 1Z2LA 5J2MA 2VG5A 5F41A 1YJ9S 4F2SA 5ETNA 3KUGA 2Y1JA 2A1BA 2PGCA 4ILRA 4ETXA 4PQUA 3FSXA 2PFDA 1N36F 2X1FA 2DIUA 1T9WA 3M2UA 2DGXA 3KNAA 2LP4A 2H9ZA 1KONA 4F0KA 4MYUA 3D54A 5LMNJ 3M8YA 4WBFA 4LFCJ 3ET6A 4KH1B 2J7WA 4AL5A 2V2VA 2H5EA 2WHOA 1XNRF 2Y3YA 2DGVA 4RPFA 5DZ6A 4PUOA 5ETOA 4MKYA 4DX8H 1QAYA 1FJGJ 2HZVA 2ZHOA 5ETMA 1U1KA 2P5VA 2VJVA 1CPZA 5A76A 1GK8A 4ZHRB 2BE2A 4NLUA 2XZDB 2HLUA 3H20A 1NSAA 2VPWB 4K8RA 3R1LA 2I2YA 2DNRA 2PMWA 1NSPA 3ZTOA 1X0FA 1HQUA 2B9XA 3G6ES 4O3QA 4L72B 1TL5A 3GB0A 1HHSA 3JSMA 4YMEA 2FUG9 2BW2A 4DU7A 4I6AA 1LKZA 4LSLB 1AFIA 1YVFA 3Q8QB 1S10A 3UD4P 3KG0A 2IAJA 2V8PA 4OJGA 1HL6A 4B3MF 4ECTA 1QE1B 3CGIA 2MKCA 1AW0A 4GKJJ 1SL0A 3ENAA 2BVZA 2Y0BB 4I69A 4M5DA 3UD3P 1R27B 2FZKB 4NLXA 4Q8EA 1BHNA 1OY6A 5C25A 3R6LB 2VKZG 2I0XA 3IM9A 3MOJB 4HH0A 5G0RA 1SV5A 3OXLA 1NK5A 5KFJA 4HACB 4FYXB 2CQGA 3EXCX 3M2RA 1PKUA 3AODA 3OFEA 4GRSA 2B43A 1YWXA 4ECSA 3PX0A 4DSFA 3P3DA 1CC7A 3E2EA 2IVMA 2DHXA 5LMUJ 1R0AA 4BHQA 3R5CA 1WJ9A 2DY9A 2WTFA 5CA5A 4A8QA 1E6VB 3MWBA 3TAPA 3DYAB 4JV5J 3FZBA 4ZK7M 4U96A 3UCGA 2W9BA 3AJDA 3HD1A 4EYHB 4Q0BA 4YB6A 5AJ3J 4KGXB 3BKTA 2YWFA 3MOZA 4OYWA 4CO3A 3MEGA 2H5JB 4RU2A 3N4WA 5DDPC 3B78A 1LWEA 1T0TV 4IUFA 1I94F 2XYHB 3SCLE 1N54B 4DZ6A 2GHPA 4LSZB 2YNGB 2JC0A 4N56A 2H3EB 5CYQB 1RE1B 4F36A 4YFUA 2KZZA 3CD6S 3OBIA 1J5OA 3DNCA 1RI7A 2AQ4A 1U2RA 4KPYA 5B09A 4ANEA 4USIA 4M8LA 5K8PA 3PYFA 3HT3A 1H2UX 4V19J 2B6AA 1F2GA 1IBKJ 2HWTA 4ALZA 3CCUS 4NE9C 3HHLA 3WBZA 5HAOA 1XR5A 2GCFA 4P75A 4JYAJ 3ZZOA 3U7JA 3HHNB 4CYUA 2BJDA 1NJXA 3AOAA 3EGZA 3MUVP 1SIWB 2NXNA 4WFZA 4P6QA 2AYEA 2NUUG 2G2OA 1ZAVA 3W8PA 2HWHA 3S6EA 1WEYA 2ACMA 3WIVA 4IR1A 1BUXA 1VISA 2COLA 1U4BA 2RS8A 2PDAA 2VB6A 4ECYA 1KS2A 3NXZA 1VRUA 4KTQA 2L41A 2JEGA 5LXYA 3LA0A 1I51B 1WHWA 1RWKB 2B51A 2VONA 1JKHB 3BB5A 1PYOB 2FLOA 1YITS 5FLXY 3VF0B 4DV1J 1UJ4A 5J1NA 3I5BA 4AYBD 3FBBA 3HVTB 2GO8A 2N3OA 1XNQF 3CJRA 4Y00A 1HNIB 3DU6A 4DV2F 1EARA 1KOHA 1U26A 3OL9A 3TNVA 3LAKA 2NLWA 1S6UA 4ZP6A 3W5XA 2EBEA 3CCVS 3BS9A 3J7A1 4NCGB 3G82A 3PACA 3IRXA 4KGMA 5J1PA 1JLEB 3PV8A 4H4OB 3B4DA 3GWCA 4EI2A 4D3HA 3CMES 4M1KA 5DQIA 2KG0A 1JJCB 1SL2A 4OZ1A 1PAUB 4WK3A 1RAIB 4DG1B 2Z8QA 2FJBB 5JVHQ 4Y0FA 1VFJA 2UUBJ 4RW7B 5DETA 2RILA 4OQJA 1EQ0A 4K0KF 3R6GB 4IO1A 2QA1A 3O3LA 5RUBA 2LFVA 3LPYA 1QVGR 2ALYB 2OPPB 5K8NA 3TO8A 1Q8BA 3Q86A 5U47A 3MMCB 1UVNA 4ILMA 4B9SA 1RADB 1SJFA 5KFSA 1ZTTA 4ZCIA 5D4PA 3BKUA 3T3FA 3LANA 4OZ3A 1CJUB 2FIUA 5CYMA 1DTQA 3KHGA 1IUJA 3GILA 4KIAA 2HEKA 1UMJA 5FD1A 2HHQA 1MN7A 5LOQA 1KVIA 2GC8A 4RJVA 1K1SA 4FYYB 5IC4B 4DN0A 2E9ZA 2MHEA 4DV4F 3LH2S 3AD9C 4P74A 4X4VA 1B99A 4EBCA 4L76A 2DR7A 2BJ3A 4QZVB 3T5KA 3FK4A 1ITPA 4M5HA 2HMIA 1RZMA 3KYLA 3GR1A 3FQLA 1VC6A 4QIEA 1U24A 2QYCA 3W9HA 2CJYB 1SKRA 3R2CJ 1U8WA 4NZ6A 4FVCA 2J9EA 2GHWA 3M8QB 4LF2A 4PYDA 4O3OA 5HI7A 2W1BA 1IKVB 3SCIE 4LMZA 2HHSA 2P6TA 3OSPA 1S9EB 3OR1A 3THVA 5KT3A 4O3SA 3Q89A 4R0JA 1IBMJ 5D6GA 4UW2A 4LF7J 2QLFB 3IAM9 1EQMA 3OR2A 3GMGA 4ID8A 4F50A 3M2VB 1NPPA 1TFWA 2EFNA 1RP5A 2K1RA 4CP5A 2W4PA 1D9DA 3HHDA 3PO4A 1CQNA 2R7TA 3NMRA 5KT4A 2W8KA 2HW3A 3NOGA 2OMLA 3KK1A 4K2JA 1SC1B 2HIQA 2B9EA 3HSZA 3HZEA 3PFEA 1M5VC 1JJ4A 3V4MA 1T11A 2W7AA 2AGPA 2OD4A 3M8PB 4OX9F 1S97A 3AA8A 2WONA 3FEXB 2VBZA 4A4JA 2CAJA 2J9CA 2B3TB 4NXMJ 4A48A 4NLSA 5B7WA 3QT7A 1WTBA 4JI1F 4DZDA 2HHHF 4WF9Q 1TVRB 2DHSA 1U8SA 2XWXA 4RKUC 1FKOB 1H7XA 3KG4A 4J9LA 2O1PA 4C97A 4DSIA 2RDDA 1TELA 1JLAA 3WZ0A 5EUHA 1YJNS 3KNGA 3TUZC 5F8MA 1KTQA 1LOUA 3QPIA 1RSCA 5E3RA 2FJVA 3TJ9A 4DS5A 1XK8A 1N5VA 4DR4F 4D3GA 1K8AT 1CEZA 3AJ1A 4L6V3 2DIVA 4LR8A 4LUBA 1KDNA 2Q6CA 1HKAA 1FRHA 2XY5A 7FD1A 1UW4A 2PE8A 1S6QA 2H4WB 3ILOA 3CB4A 4NPOA 2O66A 2XYPB 2UV8A 4MH8A 1FE0A 1LWCB 3LP0B 5ETRA 5K5MA 2QSWA 3N6MA 2P9CA 3M32A 3H4BA 1RCOB 1IKYB 4ED8A 5HJYA 4EBEA 2E1RA 3H5XA 4N77A 2HAFA 2CADA 3AQPA 2CFXA 2KHCA 4ZVSB 3K57A 1N88A 3RBEA 3HO1A 3FQKA 2LQ8A 4CWBA 2VPXB 2VFTA 1N0VC 2EK1A 1R8PA 1EZZB 4DX7A 3W5YA 1KTVA 4O0NA 2ZBPA 4NI2A 1Y3KA 4RBUA 1NMEB 2HG4A 5L8RC 3J7YI 1LW2B 3B82A 3NAIA 4PPDA 3U1LA 4NYOA 4K2XA 2FVQA 1TAQA 2GA7A 4UZBA 4KJIA 2KO1A 4V1Ak 1C1CA 2NREA 2QLWA 3TAQA 1PO6A 4K4ZA 2WAQD 1N34F 4M95A 3QT5A 3BYRA 1PIEA 2LA6A 1VC0A 3MTKA 4ENOA 3DXBA 5DG8A 4AXJA 3D1QA 4DX6A 1M5SA 4ID5A 2WCXA 1K1QA 3OVBA 3LP1B 4ELUA 3D6FB 2ZM6J 1U6FA 1UETA 2NUHA 2DRAA 2YKQA 1G1XA 2CVEA 2HBQB 1UJ6A 1U2FA 3BV8A 4DCPB 1Y7PA 3W2WA 4LFAF 3MPWA 4NLWA 4DR6J 5T14A 1VHFA 1FKAF 4GMKA 1R8BA 2DR8A 1RT4B 3JYTA 2C3YA 4FPIA 1KLMA 2FGCA 3CC7S 4OYPA 1UA0A 3PR5B 2YWEA 4X62F 4KKOB 4CLFA 3HKWA 4A8OA 4XDDA 2J0WA 1UWBA 2V8GA 2QLXA 1UZDA 2LDYA 1RYSA 1RAHB 3M30B 1PC4A 1W2BR 1S9GB 2EC2A 5HVFA 1DQ8A 4CTAA 3H8YA 3DHXA 3QGGA 2FDNA 4YY3F 5EHHA 3POTA 3OW2R 3VR1A 3IBWA 1BC6A 3CUNA 2JH3A 4CRJA 9ATCB 1KOOA 1UAWA 3O5TB 4I64A 1NU4A 3AQOA 3VGSA 3K7RA 5EGYA 2KM8C 3MM6A 3VZIA 3HULA 3GFXA 2ZNYA 2XZWA 2DCLA 1TP7A 2HQGA 1MG7A 3MM9B 1QSYA 1X8DA 1BQMA 2X7IA 2R8JA 4NLOA 3C66A 1F60B 2UXBJ 2K2PA 2AP6A 4A8YA 3X3UA 2BMBA 3O6QA 1QSLA 2GMJA 1C2PA 1TKTB 4TU8A 5HP1A 2PI5A 1BQNA 3NGTA 3U1MA 1N6QB 3AXMA 4NLPA 3BGLA 2F4VJ 3EMTA 5LSRA 2CNNB 2YWHA 1OMSA 3NBPB 1CJKB 2CNKB 5KAKA 4IR9A 1VGYA 1VRQC 3HFZB 1EETB 5J1EA 1TUGB 4NLDA 2DXDA 1M1KT 1ZM9A 2DO0A 3EE3A 1FT8A 2MQMA 4LREA 3N6NA 3OTEA 3PNIA 4DLEA 4ZS6A 1ZS6A 4BWMA 1YK9A 2R8GA 3ENQA 1WG1A 3MMAB 1U1RA 2QLBB 2UP1A 1KC8T 1SC4B 3R5DA 5KFOA 2IJRA 1PC5A 2PFFB 4OX6A 4ELTA 3SIPB 3K89A 4OZ0A 2ZD1B 2PEBA 5LSLA 4O3NA 5C24B 4Q2MA 5I42A 2G2YA 1HARA 2I5JA 2E7XA 3HPOA 1S1VA 4P2MA 2F8HA 2LECA 3VGTA 3VAIA 2QN6B 4DUZF 3D9BA 3NCPA 4HL9A 4TN2A 4FP9A 3AHPA 4JI7F 4GKKJ 4NCAA 4OMFG 2IVYA 1LFWA 3TVKA 4DN9A 5GADI 2VICA 3ETOA 4Q45A 1X4BA 5E41A 1NB7A 2Y8YA 2MTLA 1SQEA 2OO4A 3C19A 4DL6A 3TI0A 2AX0A 1DLOB 4UUXA 1T95A 4PEOA 3BKFA 3D28A 3NKYA 1S1TA 4B3OA 4W90B 3R2DJ 1QAIA 4DV7F 1VS3A 4ZKAA 4QPTA 3MAAA 3G8QA 3M9NB 1FRMA 2DR6A 1RT1A 4WU2A 4CI0B 1SXLA 4YDDB 5E33A 3Q22A 3CF5Q 3A1YG 3U1NA 2NPIA 2B4OA 3HFVA 2CQIA 5L9NA 4ECUA 4F0HA 1S1WA 1IM6A 3QZ8A 2L9WA 3QJLA 1NCLA 2F5GA 1UVIA 4AQYF 3J7ZT 2ERRA 5F8HA 2HS0A 1RTJB 4IRDA 3PHEA 2XS2A 1P9YA 1MROB 5F3TA 1D8YA 4HEA9 2R7SA 2VIHA 2L48A 1XIQA 2AJ4A 4ZJLA 2C2ZB 1WF0A 2ASYA 4RLEA 2ZBIA 2VOPA 1NH8A 1JNRB 4KHPF 4OYBA 3AXKA 4GVLA 2CG8A 3WX8A 2NXEA 2YX7A 2BM0A 3T5HA 2E5LF 3MAHA 3THTA 2ZVSA 3M6VA 1HBNA 2VZ9A 2IM2A 2E1CA 1NK8A 2VG7A 2XLKA 1RLDA 5D3GB 1RKJA 4NA2A 1JLCB 3T5JA 4MTPA 2KFZA 2HZAA 2Z30B 1SC3B 4YB1P 2ZJQQ 3NCQA 2AIRB 3G8TA 2J8SA 1EJ7L 5CH7B 4WE1B 4BCAA 4JI6F 5HVGA 5DDQC 4DPXA 4CH0S 2E5GA 1NSKL 3IP0A 1KNZA 2DPJA 2OI2A 4R5PB 5A8WA 4YR3A 4YEAA 3VGVA 2GVZA 3IR5B 3NAHA 3FGVA 1VQLS 1CS4B 4F3OA 2IJNA 2LEPA 1QVFR 2E29A 3OXFA 3TQEA 1S7IA 1REVA 2R2UA 3LO3A 1FKPA 3C6TA 3LAMA 1B7FA 2NSBA 1RTIB 4I56A 1AZSB 3F73A 3FMWA 4IH7A 3QLHA 2OAUA 5BXIA 2H4YB 5L1LA 4DF4A 2OPQA 4E2FB 2OGUA 3KLGA 1A7GE 1B64A 3PR4A 4OZ5A 2LXUA 2L3MA 1NK9A 5KFPA 3V2UC 1FERA 3HK2A 4I7FB 4B3TF 1G2EA 1WELA 3GE9A 1SH2A 1FK9A 5B0CA 4JI3J 2WB4A 3BGRB 2KN4A 4ZVPB 2AHOB 2KU7A 2M8HA 2W2QP 4JI4F 1U0SA 2XWYA 2B4PA 1MU2B 3GSDA 3RJMB 1C0UA 3UE2A 4AD6A 4U7UD 2EW9A 2V6AA 1NAQA 4O44A 2BJEA 4DL4A 1PBUA 4NOHA 1IQTA 1NH7A 2V9WA 3V6KA 2ASJA 3Q83A 1X4AA 2ZH2A 2JVOA 3H90A 3M1VA 2AU0A 1DAXA 4C0HA 3M7VA 1HIYA 4Y3CA 2CRLA 4X4TA 3AOCA 4LBPA 4L73A 4C8YA 4ITSA 1HR0F 3GR0A 3CE8A 2XCAA 2W9CA 2VL1A 5A0YA 5IOLA 2QFIA 3W8GA 5LSOA 3J80U 3ZTPA 4UQGA 2G1HA 4C6AA 1C0TB 1GFWB 2XHWA 4XPEA 3NGKA 3DRRB 2XY7A 1HYSA 1S59A 3FC9A 3PYEA 2AJQA 2P9EA 3W63A 2OLWA 3KTQA 1RWWB 4XAKA 2OSRA 3NG8A 1R3NA 1XBWA 3CJKA 3HZGA 5LMUF 3I6PA 3DLBA 4X4SA 4ZLJA 1UPPA 2GW8A 3VAKA 2QL9B 1HQEA 2GQ2A 3BSOA 4JV5F 1M5HA 1VBXA 1RAOA 4JI0F 5HLFB 4LSNB 1XQIA 3AOBA 4EZ6A 2LU1A 2V9KA 4PXEA 4ES2A 3TZXA 2X1BA 5DQGA 2H48B 3I82A 4IH5A 5J2PA 2YX4A 2ZVIA 3CCQS 1HQ2A 3JSBA 2XM3A 4MJKA 3BQ1A 2F65A 2HBYB 2ZH9A 3SYZA 3UQSA 1YDLA 4QWBA 3BR9A 1VQYA 1NK7A 4TY8B 3VAHA 1UPMB 2AEJA 4I67A 4YB5A 1BQXA 2CQHA 3PW4A 2QA4G 1WOOA 4X66J 3T19A 3MM5B 3SQGB 4C98A 4DBQA 4DR1J 2Y9HA 4UTGA 1F6TA 3GCXP 3WIUA 4OI0A 4M5MA 2AYMA 2HKEA 1L3SA 2HNYA 4M5IA 3LUYA 4QWDA 3KDNA 2XY6A 3FCHA 1D09B 2A2DA 3O2IA 2HGLA 2BKOA 1FTRA 2PMHA 4DQPA 4MIBA 5KFQA 3BBCA 2IM3A 3P4UB 1CQMA 4KFBB 2YKNA 4OYMA 5CAAA 1XTZA 5LJ5Y 1HW8A 1VMBA 3SCKE 1LW0A 1RA6A 3J7AN 1HNZJ 1R43A 1QSSA 4DL0C 4DV5J 2K3IA 4AE5A 5IFMA 2CJXB 4CO2A 3GIMA 1LWFA 1X4DA 5IS2A 1IXKA 1H72C 4H4MB 2HQIA 1VJWA 2OEKA 2W24A 4I2PA 5CD4H 4M5GA 2C2NA 3ET6B 1URRA 4HLBA 4QQBA 1EAYC 1CBKA 1GT8A 3VVTA 1N33J 4PUOB 2MJUA 2Z56B 5KFBA 4JI2J 2YNIA 1E6YA 1RXOB 3N9UC 1NBEB 3KHHA 2KXHA 1JLQA 4MKVA 2FVSA 5IV3A 1X5TA 2DNNA 2BE2B 2UZAA 3HKZD 5A8KA 3JS9A 3VHQA 3OSNA 3GV7B 1WC6A 2UUCJ 1QDUB 2BZ2A 2P9GA 2G0IA 4DPOA 3SV4A 3HJFA 3KDOA 1NJWA 1YLXA 2VBYA 4JI8F 2W25A 2NXJA 4U95A 4PWUA 3BH7B 3CWJA 1XMOJ 4YQWA 5B0FA 2GQCA 5GAEI 3H25A 4YR2A 5AXNA 2J7KA 2DNPA 4PG5A 3CJ0A 3ZNJ1 5AXMA 3J7Z5 1OS5A 1RK8A 2IAJB 2E5HA 2VC1A 1FRLA 4J9PA 1M5OC 2KI2A 3QNWB 1NJZA 1FNMA 1WC0A 3FSYA 1WG5A 3GJTB 4RWXA 2WVCA 1SJ3P 3V4IB 2KFNA 4EYIB 1JXVA 1TK8A 2V8VA 4BBYA 3FRZA 2M2BA 1TV6A 3SXLA 2YVSA 2ZH5A 1LXNA 3H98A 1B3TA 1SV5B 5DJBA 3NCRA 3Q24A 1UVLA 1RHKB 5KFDA 5HBMB 3G6YA 1U0HA 2AD9A 3QSYB 3M2RB 3BGUA 2GS8A 3N79A 4DR7F 1JJ2R 4ECRA 3CNQP 3IGNA 4LF1A 1H38A 4G3IA 4QR1A 5B0BA 1M0SA 2R3VA 3DMJA 5EX3A 1S0OA 4A8MP 2IDLA 1RGVA 2QMUB 1UEKA 3I0RB 2DGWA 3S01A 2JFKA 2YPZA 4DR2J 4HT7A 1HW9A 4ZITA 1IBMF 2KB2A 2WSFC 1U1MA 3I96A 4RUCA 3AAWB 4LF7F 3GJQB 4ZVGA 3ZZYA 1KBRA 1JLBA 4OZ2A 1ZTWA 2ZC4A 1K0VA 1R8HA 2QGFB 2MSSA 1TKZA 3NEKA 1S48A 3A3PB 1CULA 3CD7A 3SFUA 5GAHU 2BQUA 3L9ZA 2R7UA 4ED3A 1C4AA 5KOWA 3TUIC 3A8JA 2MY7A 2GO9A 4JI5J 4Y65A 5BR8J 2OFGX 3TP2A 4JV1A 4OYOA 2UXDF 1KEKA 4OI3A 4CLWA 3LGMA 3EZUA 4JV2A 3RR8A 3HSGA 5D77A 4I68A 4LFBF 2KDOA 1VRTA 5LL6d 4DV3F 1S49A 4ED0A 4WP8A 3ISND 3HHLB 4MT1A 2MLYA 4KR0B 2RF2A 2JDJA 4CLSA 4CYUB 2N4CA 3RGIA 3KKFA 4KGKA 1NLKL 2G1DA 5ETTA 1O5JA 3K5PA 3ISNC 4CH1A 3Q8SB 3V81A 2C3MA 2BX6A 2JLGA 2DD8S 4QWEA 1RAFB 4IFYB 1VRUB 2X3GA 3CJTA 2VD3A 3CIZA 1KFSA 3ZZZA 2XNQA 5F9NA 2CJBA 4EK2A 4PQAA 3DRPB 1OYEA 3DGPA 1BMQB 3DI6A 3FZ2A 3IXQA 2UVVA 1X60A 4RNFA 2VQFJ 3AA9A 2J0SD 1FFGB 1R89A 2DNKA 1FVSA 4OYAA 2CQPA 3E01A 2ZE2A 5LXRA 3MAQA 3RU0A 4HYKA 5J2QA 5F9LA 4NRUA 5HK4A 4CNYA 3CCMS 1UWAA 1IJEB 2CVIA 1OPIA 1YGYA 2XMKA 2XS7A 1RHQB 2F63A 4I0WA 1JLFB 3PIPQ 4Y34A 4YHHF 2OELA 2R8KA 2CNOB 5IT9U 1N52B 3MTJA 3KMSA 1RKIA 2EVZA 1RAAB 3QRRA 4U6PA 3RRGA 3DM2A 1WUUA 5H9FK 3RW7A 5KFXA 2E7WA 3RB4A 1X5PA 2HGNA 4DQQA 1Y5LB 4WFBQ 1RT2A 4KO0B 3A3OB 2RIJA 3UWTA 2K3KA 1RBAA 3NLCA 4G1QB 2Y1RI 1T02A 4ZHRA 3CSKA 5IWAJ 1JLGB 2PA3A 3EVWA 2FLLA 5KFYA 1X0PA 3RUBL 2JLEA 2B56A 3D2WA 1DTQB 4CLUA 3JTPA 1WEZA 3P49B 2MLZA 2LYVA 1ZM2A 3IS9A 1T03A 3PXGa 2IPOB 4ZA1A 1FCAA 4ZPAA 4Q8FA 2PN6A 2BKPA 3MZIA 1HBUA 5CABA 1KFDA 1X9MA 4DFJA 4WCEQ 2CPXA 4ZPWR 3GV8B 2FJXA 4G1PA 4LSLA 4IH6A 1W2IA 2ROPA 4LF6F 1NB2A 2ZH8A 5L46A 1RUSA 1MWQA 3HSDA 3OXGA 2FPHX 1I1GA 1QE1A 2HURA 1MN9A 3CJ4A 1DRZA 2MB0B 2DNHA 2VFRA 4K5SA 4Z7YA 2FYXA 4ELVA 4DV6J 1VC5A 4N47A 3RB6A 4WYWA 4ZVRB 4ILLA 2VG6A 3NL0A 1X4EA 1WSVA 3T1YJ 2HQ3A 3UN2A 4OI2A 2FZGB 4O4RA 4DCJB 4HACA 3ILLA 3OR1B 2ZH3A 2LQ9A 4B3SJ 4DCOB 4X65J 4R8UB 2HFOA 4DMZA 1V5VA 1ZA2B 4FYWB 2OPSA 1UVKA 1WORA 2IJFA 4ZCKA 3W3SA 2VF3A 3QO9B 2K1RB 1KVJA 1T9VA 4ZP8A 4TU7A 3GPAA 2FJWA 4RL1A 4B3RF 3C6UA 1I3OB 4P7TA 3OHAA 1E6VA 3KK1B 3DYAA 2K7KA 3W60A 1L3UA 3K2YA 3BN4A 2HVIA 3KUHA 2CQ3A 1XMQF 4N41A 2WONB 2Q43A 3FBCA 3KUEA 3EWGA 5B0AA 4AL7A 4FDFA 1X4CA 1LQ9A 5KG6A 3GG0A 2CYYA 5CYQA 2D7SA 3CMQA 3D0IE 4DR3F 3WX4A 2HHXA 2APOA 4X64F 2WSEC 3MPYA 4DSJA 1IVZA 2X1GA 4F4ZA 1RWPB 2MEWA 4IQMA 5E3AA 5CD4A 5F8LA 4PWWA 1JLAB 2YQ0A 3HP6A 3QJJA 4F3QA 2B9WA 5KFGA 4USTA 4MYTA 1F1BB 3VGUA 2EFVA 1CG2A 1HNVB 3KJQB 1B0PA 4PCQA 1HBOB 4G65A 2IA6A 3LQVA 3AFGA 5T7LB 1S6QB 1BWEA 1WI6A 1HNXJ 3IBCB 1WHVA 1RHJB 2RDIA 3OJUA 3NNCA 5KT5A 1OJ4A 1Y5NB 1FA0A 2F4FA 4KPCA 1VJQA 5HANA 3ZZPA 3M32B 4HR2A 2RD5C 1U1QA 1QAXA 1TL1A 5DLFA 4WPAA 3TEHB 2DISA 5JXSA 4NA3A 3PDNA 2EBGA 1Q1KA 1N36J 3L95X 3BH6B 1RAJA 4ECVA 3L7OA 1Q81T 5BJRA 2PT0A 4NCGA 4GKKF 3KJNB 4K4WA 2H1YA 2HZCA 1S57A 4DSLA 3DOLB 3JXOA 1JLEA 4NI2B 4H4OA 1XNRJ 3BEGB 2CJQA 2V2KA 3KWMA 4YOEA 2V50A 3A8EA 5L39A 3HVAA 2OIHA 4DG1A 2KHDA 2LA4A 5CZVA 3DOKB 4N76A 1T94A 5DRKA 2ASDA 4RW7A 1FD2A 3JQKA 5IQQA 3LF0A 1TKXB 2C3UA 1ZM3A 2D1CA 4DQRA 3T9ZA 4C3LA 2X1AA 4FNHA 4DWIA 4ERDA 3PRBA 2OPPA 1FFSB 4YDXA 4DI6A 5KG3A 5DG7A 3L7UA 3MMCA 4QOTA 2RDJA 3GONA 3RAQA 4IOCQ 3VVUA 4RU9A 2CDRB 5SZTA 2BANB 2XYGB 1WC3A 2FGOA 4ZVEA 4EMDA 2UXCF 2WVFA 4J37A 3LWMA 4ETZA 1CJUA 3D6MB 1WEXA 4YB7A 3AY0A 3UCUP 2OPRB 4OJHA 2EXUA 3R5AA 3PVXA 3D3BJ 4B3MJ 3MURP 1WC4A 1O51A 1G7CB 1KLMB 1UJ5A 5IT0A 3SV3A 4NXNF 2KTQA 7FDRA 1VQOS 3M9MB 4H4KC 3R7BB 1UWBB 4LF8F 3W1YC 6FD1A 2IYGA 3VTIA 5GMEA 4K4VA 4CTAB 1N5QA 4HVZA 3RYLA 3MR5A 4OZNA 1P6TA 2YQ3A 3POTB 2Y8WA 5KFLA 4KB7A 3NP5A 4LVOP 5ETQA 2BM1A 1R31A 2GMLA 4FYVB 4KAIA 5T41A 1GXLA 2DGSA 2Y1LB 3QWPA 2MQPA 1NUEA 3DRSA 4DDFA 2UVRA 5GVQA 3M8QA 3E8OA 2CPDA 4QYZJ 1Q95G 1OY9A 4HT5A 5F0WA 5IM0B 2V63A 3MM6B 1WKJA 2RQ4A 2HHUA 3G6VA 1N32J 3UVJB 2QRRA 2KVIA 4IKAA 4P2SA 3S1TA 1S9EA 2N82B 3QGPA 2ZHBA 2OH2A 3H5SA 3MECB 2BDPA 1RAEB 1L3KA 2AMCB 2C2OB 2XLIA 3M2VA 4RW9B 1FDBA 2RH3A 3D1OA 3THPA 2B4VA 3QJPA 3Q2SC 2C28A 4CIOA 2M4MA 1I94J 3FRYA 1EP4B 2RS2A 4RW6B 4P2FA 3QT6A 1R8CA 5HP1B 1BQNB 4Q43A 3PJ9A 4GC6A 3TA2A 4KYZA 3I0SA 2JHEA 4YR0A 1DZ5A 1RWXB 3M8PA 3BGFA 4W92B 2DHGA 4IOBA 3QMQA 3ZTSA 5C2CA 1V6HA 3GLJA 3NGUA 1JK9B 2PD1A 2FQQB 1UKUA 2OFHX 7AT1B 3EPGA 3PJXA 1EKSA 3S8SA 4WFXA 1KRPA 1S77D 1YX2A 2CPYA 3H4DA 2H65B 2MSTA 2BABA 2K8GA 4KE5A 4YUDA 1KP6A 1MWYA 5CQGA 2M52A 2ZFHA 1UCNA 4XO0A 4IG3B 3W65A 4H4KA 2Q3PA 1GMWD 3ZO7A 4C0BA 2CDQA 4U7UK 2UUAF 4OV1A 1HWJA 1UTAA 2FY8A 1WD6A 3K17A 3QQCD 2ZUAA 4PZVA 1XNQJ 4M63A 4DV2J 3IG1A 3M8WA 1KD1T 3GFYA 2ZHAA 2UVUA 5HSPA 2HVZA 3KHLA 2VASA 4HKQA 4RUHA 3TANA 2CG4A 1LWCA 3LP0A 4WJBA 3VAMA 4B9MA 1VBKA 1IWGA 2F40A 2AV5A 2BOPA 2FJDB 1HI0P 1IKYA 3TW0A 5DM7Q 2EKYA 1K0TA 1MMDA 3UNGC 1S76D 3LP2A 3SCJE 4XDCA 3CW2C 1RTZA 5KT7A 3FBFA 1VQPS 4B3OB 1D3WA 3OTBA 4I6YA 3B4MA 5HMYA 2Z0GA 3I56S 3UN3A 2XCPA 3BPSP 1FFWB 2L08A 5IV4A 1KHVA 3BPDA 5KFEA 3OD2A 2HNZA 2OTJS 2CPIA 1S1WB 2CZ4A 5KFRA 1YI2S 5DZ7A 5B0GA 1F0XA 3UI3A 1WOPA 2ZBCA 3I9V9 2MGZA 4IFVA 1NSQA 2VA2A 1Y4ZB 4MIAA 4IG0B 4HHJA 3CDWA 3LP1A 3PW7A 3IGVA 4J9VA 1SJ1A 4DV4J 3MUMP 4DS4A 4ER8A 2Y0SD 2KL8A 4NYZA 3RB3A 3LWLA 3R5JB 5DGAA 1NK0A 5KG1A 3FCWA 1RT4A 2RHSB 3NNHA 1HBNB 1FRXA 2VG7B 1APSA 3DLEB 5BYRA 2V2ZA 4KKOA 4NASA 1WHXA 3AD7C 1DURA 2D69A 2BBEA 2VDHA 3W2VB 2NZ4A 5KFCA 1U48A 3MM7B 1J2VA 2DGUA 3VQSA 2AZ3A 3ZZRA 5A8WB 4DV5F 1GX5A 1SIZA 3CD5A 4X4RA 3TAMB 2G0JA 3CCTA 4ED5A 5IT4A 2KRRA 1D8ZA 1VQSA 5D15A 1WI8A 3N01A 1YJRA 2W2MP 2WBMA 3OL6A 5F8GA 2VA3A 3DLLQ 3IFEA 4LF4F 3QLHB 2CPHA 2DNGA 2MZTA 2IC3B 3NNAA 3PEHA 2O3DA 4ZLNA 3FEYB 2QZ8A 1BLUA 1J5EF 4QIFA 4OX9J 2ZEJA 2GHVC 1R6VA 2LXIA 3KMQA 2UUCF 3A13A 1U47A 2FC8A 2IVFB 1FNOA 1TKTA 4JI1J 2HHHJ 2PIIA 4ZJQA 4RNHA 4ZPVR 1N6QA 3DRYA 4ATNA 4NLGA 5B0DA 1YQHA 1LV5A 3HHKA 1C0UB 4FN5A 4KGVB 1VQ4S 4UOCA 3MEEB 2R2RA 1J27A 2IRYA 2M8DB 2HHTA 1CJKA 3PRVA 1H98A 3O44A 4FXDA 5I3UA 4X4UA 1TU0B 5D4OA 1UEUA 2ROEA 1EETA 4C48A 2QEXS 2YY3A 4OX7A 5LJ3Y 4WP3A 2XGQA 3EDRB 4M5NA 4E8UA 5M2RA 1M5PC 3K5OA 2M7SA 1U09A 2QA2A 3K59A 5FIIA 2A6MA 2WOMB 2HFNA 1U6ZA 2XULA 4OYIA 4Z2XA 3C46A 3KLFA 1N8RT 1NHKL 2XNRA 2B8PA 1KR4A 1S6OA 1FE4A 3T6JA 3MMAA 3Q8PB 1OPZA 2QO3A 4WYLA 2W9CB 1ULRA 4TNOA 1Z1ZA 2YKMB 3KJFB 4LBIA 1HWLA 4GVBB 2ZKTA 2KXNB 4K4XA 1YJWS 1LNQA 1GH8A 4O0IA 4M5LA 2BV3A 4DHVA 1HWIA 4ZOSA 2MDAA 2YX1A 3IC1A 4J90A 2DH9A 4PXDA 1AA1B 3TJAA 2AKWB 1WACA 4A8SA 2VPYB 2YTCA 3CJKB 5EWFA 2OUGA 5A8RA 2I1RA 4AXIA 3RBZA 3KOAA 2F7VA 1ZETA 2GMHA 2YWKA 3WDOA 2MZJA 3PKMA 1IKWB 3E3XA 5GAHI 2HHPA 2HBZB 3CDUA 3EZ5A 1A9NB 4HTIA 3W66A 5A2QU 1DTTB 4IDKB 3QAUA 1RQ0A 1DLOA 3MI7X 2MKKA 5J2PB 3UR3C 2ZITA 5LT5A 3D7SB 3UDLA 4OI1A 3J7YU 2LEBA 3UO0A 4WTYA 2ZH4A 3ZNUA 1N34J 5CCLA 3PHTA 4ZMMA 4R25A 4PG4A 3UD5A 4PYAA 4IO9Q 4J91A 3ETMA 3ZTRA 1TL7B 5F3ZA 4ZLPA 4P73A 3ISZA 3HHEA 1S5ZA 1SJRA 3KJVB 5I3QA 2FTRA 2N7CA 4LRFA 5CYJA 3L4BC 2FVPA 2GVDB 4USWA 2VJUA 3MCNA 4OHVA 4ZIVA 4Q44A 3C15B 3DFEA 1RTJA 2HNYB 2AWZA 1H2TZ 2XEXA 1BXNA 2VQEJ 4CLZA 5HROA 1WNEA 1IKXA 2B5JB 1MROA 1S1UA 4ECWA 5HQ8A 4LQ3A 4QU7A 4F3MA 3DDKA 3SDEA 4X4OA 3P45B 2B9YA 4QPXA 4X62J 4RNOA 1F5BA 1YSJA 2CQ4A 3EGNA 2DNYA 2HYIB 1GMVA 2DRDA 3L3CA 1ZZFA 1MNEA 4LVNP 3EJMA 3AH6A 4DU8A 2H54B 2KYXA 2MZSA 4DR5F 4DSEA 4YY3J 1ICEB 4ZN1A 4BWJA 2HVEA 4PXCA 2CUYA 1RISA 1B70B 1OWXA 4RNNA 2CPZA 3BR8A 5IC6B 5BYQA 1FXLA 4WE1A 3G8SA 2FHJD 1CJVB 1IQZA 4ZLLA 1Y0HA 2W8LA 5IZHA 1NO8A 1O0PA 1BY9A 1Q5VA 3L09A 4R5PA 3R5GA 2DVIA 3MUTP 1CS4A 3J81Y 1E6YB 2VODA 1Q5YA 4O3PA 3UW1A 3TVYA 5KFZA 5A8KB 4NRTA 2BW7A 3PM9A 1VQKS 1RTIA 1P9QC 1L5UA 1AZSA 2P2CB 3MM8B 3PIOQ 4OHWA 4QYZK 3I5CA 2V5HG 2AX1A 1CJTB 2VFVA 3HSJA 4CDIA 4OJ1A 5MAOA 5KFWA 1N5YA 4CT9A 4LF5F 3Q8RB 5MLCV 1PYTA 1YG0A 2FZCB 1N56A 5IWAF 3T5LA 4MKAA 4I7FA 2BRLA 2E1AA 3C16B 5AE1A 3DLJA 1ACMB 3BGRA 3K8WA 4F0MA 2FD2A 1TFYA 2RU9A 4P2XA 3TR5A 4ZVQB 1T9TA 3JAMU 3ENWA 4OLOA 4RW4B 2YKOA 3OVAA 3RBXA 4NZ7A 4B9NA 2LVWA 2XGPA 4UOFA 5CZXA 4WZMA 4C7QA 3VQTA 2R42A 2Q66A 2JJ4D 3RZAA 2CKWA 5HMZA 4DFMA 3OL7A 5K8MA 2G2ZA 4FVMA 1HPZB 1VQ6S 1PILA 4HTJA 4RW8B 3K0JA 2ACYA 5J2NB 3PFOA 1VK8A 2KZMA 4RUBA 1ZYQA 1S4FA 1HMVA 3C3LA 1SKUB 2ZWPA 1FXRA 4DUZJ 2C2DA 2HVHA 5JMNA 2HQFA 4J9SA 3PZPA 1QY7A 4USKA 4DPYA 3DMJB 2XG8A 2XB2D 3RAXA 2KJWA 1TL3B 2XO6A 2A3JA 2JEFA 4FF1A 3R1HA 3HFKA 2BQ3A 2FJEB 4PKDB 3DRRA 4LRDA 3CO0P 3ONQA 4X65F 1IJFB 4LF9F 3P5BP 5JJBA 2VC0A 4F4AA 1Q53A 5GADU 2GNKA 2UU9F 4YP3A 1QUPA 1KQFB 5JVGQ 1LFPA 1X9WA 1EHWA 2A2CA 2MPUA 5EWGA 3CDAA 1SUQB 3DKDA 1VLOA 3FCVA 3UPFA 3UDEA 2OJ3A 2V4JB 2YNHA 4OI6A 4LR9A 3TZWA 2VH7A 4QBUA 1T7PA 1Q8IA 2BJ7A 2B8QA 3R7SB 2W01A 5HLFA 3QT8A 4J7CA 3PCOB 4X4QA 4LSNA 2JZ5A 3I4HX 1RWNB 1LK5A 2ZOFA 8RUCA 2EC0A 3MD3A 1DY3A 1RT7B 2CA9A 3I31A 3R7NB 1TAUA 2DTJA 1PJ5A 1URNA 5DS7A 4FF4A 1NHUA 4AQYJ 2IHR1 5C42B 3M9OB 2E5JA 3CJQA 2HLTA 4USVA 2QG9B 2V0NA 3F56A 4BDPA 3MPDA 3DOMA 3D6HB 3W64A 1Q4RA 2CQDA 3KK2B 2U1AA 2L9NA 3SQGA 2BE9B 2XS5A 1VCTA 5ADZA 2OP5A 2HGMA 3BN7A 2F9DA 1DJ0A 4Y2KA 4F2RA 2E5LJ 4CO4A 2HNDA 2MQ8A 3PRDA 3TYTA 5E0OA 3US5A 2KT5A 2R4FA 3DGPB 5KT6A 1H2VZ 3PW2A 3M6XA 1NXIA 4KFBA 2BJ1A 2ZE2B 4KRWA 4JI6J 2E5IA 3QRPA 1FI4A 1P1LA 3EGVA 4TQSA 1M1HA 3H42A 5KFAA 2OHDA 2HK3A 1SQGA 2HPUA 1K73T 3BSAA 1YJTA 1SVDA 4MIWA 2EFQA 3GYGA 4CO1A 6FDRA 2NR0A 5C2GA 4KQZA 4X2BA 3DDIA 4DUYJ 4ZVHA 8AT1B 1TKDA 2RKIA 2R7WA 1SQFA 3ILIA 4H4MA 3LW5C 4IRCA 3MPUB 3QBCA 4DV0J 4GO7X 3DM2B 2E66A 2DNMA 3HM9A 2R2SA 2V8DA 2EWHA 1L3VA 1Y3JA 1RT2B 2E7VA 3OL8A 1T05A 4K4YA 4K4UA 3SEOA 2NXUA 1RT6B 2C1EB 1OSCA 2D9PA 3OTOF 3EX7B 4O4GA 5F8NA 4B3TJ 5EWEA 2ZBRA 3HHLD 2XSJB 1SI9A 2IFXA 3MCSA 2MQOA 3T41A 2M0GB 2E1MC 4KC5A 1XJWB 2P8IA 4JI4J 3IS9B 3OUYB 1T03B 4XPCA 4I2QB 3ELHA 3HHLC 2EG2A 1HBUB 2C2EA 2G9OA 1OYDA 2P6SA 2MZRA 1Y5IB 2MMYA 3SQOP 3GV5B 2CPEA 4MFBA 1K9MT 1S1XB 2IM0A 4O23A 2QX0A 4AT1B 2R7VA 1HBMA 2MLXA 2GAGC 1MWZA 2QL7B 2HFVA 2Z58B 2ALZA 5E3QA 3P5TL 1UFLA 3SI8A 2FB0A 2ILYA 3KLVA 3J81j 4RUAA 1HR0J 3EICA 2KVQE 3RG6A 3V4IA 2VG6B 1IBLF 4EU0A 1RJJA 4QW8A 1W7WA 2M70A 3M6WA 1YBAA 1SH3A 4ED2A 2YQ1A 1RT3A 1QLNA 4QCLA 4MK9A 2HWIA 4EFAC 1QTMA 1Q79A 5HBMA 2DT9A 2W4DA 8ATCB 5KOXA 2JEJA 3MDFA 1S6PB 3FEZA 2V4RA 3KLHB 2UUTA 1WTFA 2AGQA 2DEIA 2OPSB 4QU6A 2FHMA 1LK7A 4WFYA 1Q78A 3QYYA 1CVJA 2RRAA 4PR6A 2IMWP 3C6UB 1N32F 5KG5A 3I0RA 1NZ8A 4LIRA 4JI0J 4E98A 4USMA 2H51B 3R3TA 2CZVC 4IQXA 1X4FA 1BD6A 2QIFA 1BWVA 3DCAA 2VDIA 3IAS9 3DLGB 2R7QA 3GP9A 4RZRA 2IBKA 1U49A 4LT6A 3KLIB 4C9DA 5L9XA 1G3OA 5H9FJ 4LIWA 3BO3A 2HFSA 1S72S 5D4NA 2DNOA 2WVBA 3MMBA 2F3JA 3CDEA 2A10A 1GTEA 2LQ5A 4PWDB 2AJFE 2OEMA 4FYDA 2MKSA 4ZPCA 2F9JA 4EEYA 4YN3B 4HH1A 4CT8A 5KFKA 3CD0A 2CQBA 4UOHA 5K14B 5LMNF 3MEDB 4LFCF 2FHOB 3Q2TC 2RHQB 3CTRA 1SH0A 2R7OA 2JX2A 4U8YA 3NGRA 5G4DA 4C0OC 3D1HA 1AUDA 1MMNA 1UFWA 2MKHA 1FJGF 1Z4UA 2CJKA 2NZCA 4PG8A 2IYIA 1R0BG 1AROP 2BEFA 4OIXA 4IFYA 4CH7A 4ES3A 2V2QA 2BYCA 1NDPA 5H9EK 5D0EA 3UDCA 1XWLA 1REGX 1RTDB 3N6LA 3TZZA 2HS4A 1VR6A 2AEMA 1WOSA 3CO9A 3DRPA 1TL1B 4TKTA 2ZOGA 4M5KA 2AJ0A 1GMUA 3H59A 4BC7A 2LLZA 1WKKA 2CJ9A 1B0TA 2J76E 3GFHA 3O8WA 3TUJC 2ZZNA 4I6WA 3QSIA 2DGQA 2DXFA 4C8OA 4DJBA 4F4YA 3SSSA 4C11A 3K8VA 4GKJF 1JLFA 1NEEA 3TEGA 3EYZA 2MQQA 2MQNA 2DH8A 2Z2MA 3C2PA 2D41A 1PJ7A 5L1KA 2KG1A 3R9LA 2RMLA 4K59A 2OKQA 1K47A 4WTOB 2QC3A 2AYBA 3QIPB 4ZCMA 1GTHA 5ETLA 2DNLA 2DBBA 4JI8J 2HK2A 2GGPB 2O01C 2RB7A 1Z2ZA 3R27A 4KO0A 1NKBA 4DL3A 3D6TB 4QW9A 4ZCLA 3BSNA 4KHRA 4G1QA 3CJ3A 4OI4A 4Y2IA 4A8FA 1FRIA 4C2MA 1JLGA 3GTYX 1UEVA 4N8OA 3Q8VA 1C1BA 4U9RA 3C14A 5GAEU 4LRBA 4EO6A 3MCMA 2YBVA 3KLEA 3CCWA 5AJ3F 2W2OP 4USUA 2R8HA 1ZA1B 1XR6A 3W5ZA 3NGSA 5KFFA 4ICLB 1M5KC 3PYGA 3A8IA 5HQLA 4ZP7A 2GIQA 1ZPVA 1HNWJ 2DGOA 3ZC4A 1OQ6A 1HHTP 5C7PA 2VBWA 5SUHA 4QIGA 2MZQA 1RHRB 2E9RX 4Y6IA 1IR0A 3W61A 4MK8A 3V6DB 4ZN3A 3VAFA 4DR7J 2CJAA 1FJEB 1S99A 2LEAA 2ZKUA 3IR7B 5K20B 1VK3A 1N4LA 5A2QY 3DRSB 1IBKF 1VIOA 1CC8A 4GC7A 4CNZA 4JYAF 3AB2B 5KG7A 2YNFB 2BRKA 4KHMA 5I4MA 3TUPA 2ZZMA 4WXOA 4NLVA 1XN9A 1NNDA 4PABA 3IM8A 1SB6A 3WHIA 1U1OA 2Q6BA 2NYIA 4R8UA 4OHYA 1JJHA 5FDLB 1YJ7A 2ZJPQ 2AW0A 2D3UA 3FFIA 3KG1A 3R8YA 3ZZ0A 3QO9A 1FRKA 2ZWOA 3DLKB 2KH9A 1NDCA 1T9YA 3K5LA 3M4XA 3BBFA 5KFVA 3SSQA 3AJ2A 2ZJRQ 4KV8B 4CCHA 2C22A 5BYSA 5J2MB 3GU0A 4J9KA 3JSYA 2UXDJ 4QJVA 2VG5B 1QUVA 4DV1F 1DHMA 1YBTA 1EIYB 1YRUA 1NJIT 3I0SB 4J9RA 4CQ1A 4I1TA 3P6YC 1K44A 4PQUB 3ULHA 4LFBJ 3PKYA 4IOAQ 5CHCB 3M2UB 4DV3J 2DCUB 2HRTA 2GQQA 2DJWA 1L3TA 2ILZA 3QRQA 5C5JA 4EBDA 4C8LA 4F7VA 5GMKa 3H7HB 1KN6A 3W7BA 1VBYA 3GQCA 4ES1A 1ZBTA 1NKEA 3DDNA 2XBPA 4F4WA 1Q8KA 1V3ZA 4PXBA 2UUBF 3ZXWA 4JBCA 1RWVB 1F3VA 3KK3A 1MW7A 2N3LA 3EVOA 1HNVA 4Y2AA 3ITHA 2K7JA 1HQUB 2M3DA 1HBOA 2PO4A 5HATA 4QR2A 2KT2A 1B4SA 3JSMB 5T7LA 2XZTB 2ATCB 3OPKA 3CJSA 4ANDA 1JXEA 4X84A 3IG1B 4B02A 4OL8A 1NJYA 3CCRS 2QMWA 2FLNA 1HHQA 4K7QA 2DH7A 1PGZA 2XMJA 2HHWA 2KKHA 2LDIA 4QWAA 5LM7E 4BLGA 1T9UA 1YZ6A 2XI3A 4B9LA 3X1LB 1UVJA 3LP2B 2M5YA 3I9ZA 3EVMA 4YHHJ 1UL3A 2CQCA 4M5DB 3GSIA 2DEJA 3BM7A 3WC0A 1BGXT 1S0NA 1FWLA 4X4PA 5C25B 4DL5A 3IWXA 1T3OA 2VKRA 1UVMA 3DOLA 1F5CA 3H5YA 5G0RB 3SBMA 4ZDNA 2EK6A 1AYEA 1ZM4A 2BJ8A 3B6BA 2FVCA 4JUZA 2BOAA 1VIXA 4DF8A 2WVEA 2DYAA 1LXJA 4DEZA 1WDTA 3JAMY 3DOKA 1WDDA 2HNZB 3OQ2A 5FJ4A 5H1SV 1W26A 2V68A 3I32A 5CXTA 2YWWA 1R0AB 1TKXA 1RBLA 5ETSA 1HWKA 1TZ0A 2MGZB 5KFUA 4IFVB 5M2PA 1TL4A 1I6JA 5L1IA 5D8HB 2W9BB 1UA1A 4CO5A 4DXLA 4S0MA 4KBIA 4Q0BB 2CPJA 3Q8UA 1T8EA 4B17A 1PBAA 1PAEX 4TVAB 1RU1A 4CLKA 1R8AA 2BANA 1FEHA 2HFUA 2C2KB 4JV0A 1HWUA 2RSQA 3MEGB 2K06A 2HSEB 3N28A 1LWEB 5DQHA 4LF6J 2HRYA 3G2XA 4TLQA 2XMWA 5KFMA 2OPRA 2IBOA 4A8XA 2NPFA 4ECXA 4YS2A 1RT5A 2VQEF 3G96A 3PW0A 1J5OB 4AL6A 2YKPA 2U2FA 1G6BA 1CLFA 2C3OA 4Q2LA 1FESA 1U02A 1JWWA 1GEHA 2E44A 4A46A 3T1HJ 1SL1A 1VOMA 4FPRA 4FXWA 2CWKA 1S12A 2ZDOA 4ZIWA 2B6AB 2SXLA 3W9IA 4NXMF 5IQ6A 4N8NA 1EKRA 2ZH6A 4ZVFA 4NL5A 3TA1A 1RTHA 3Q8YA 2D9OA 5THWA 2W9AA 2Y1IA 4IRKA 4H54A 2HVDA 5A6WA 3FUYA 4NWBA 2LCWA 2FVRA 2O67A 4DSKA 4ED1A 4C8ZA 3TA0A 3CCLS 5HMWA 4L3NA 5JUMA 5IM0A 4HHUA 4FXVA 4DFKA 4B3RJ 4XTTA 2DY1A 1FNXH 3UVJA 4CZCA 4P71A 4URGA 3HLUA 5KFNA 4WP9A 4P10A 2J0XA 5DLGA 4OYZA 3MECA 1Q0NA 3U02A 4RW9A 1XMQJ 2HAIA 4OZLA 2BR0A 3JTOA 1GXTA 3SFGA 3G4SS 3LOUA 4ECZA 1NK4A 3OV7A 3G82B 2IDEA 1EP4A 4RW6A 3IA0A 4ECQA 5HL7Q 3IRXB 1R6YA 4ED7A 1PJ6A 3OFFA 4DR3J 4TU9A 1FTCA 4X64J 1ZOTA 4RWWA 3AT1B 4KY3A 4Z7CA 3D4JA 3MMJA 1FWKA 2QLJB 2CIMA 2JC1A 4NEZA 1MSWD 2BJ9A 2GIFA 2F8EX 5I3UB 4F04B 5AE2A 4G6VB 2PMZD 2J0QD 3TX8A 3CJ2A 2WRMA 1VQNS 1VQ5S 4C3KA 1XC9A 3M6UA 5F8JA 1ZAXA 4Z37A 2XTJP 5DDOC 1RCXB 5GAGU 2EG1A 2F1FA 2JSXA 2WK4A 2W7OA 2V34A 5ETVA 2WZ1A 3KLFB 1EX8A 3GJRB 3CC4S 1H7WA 2DNZA 4ZPTR 4KGZB 5DO2A 3AD8C 2V94A 3CCES 3CCSS 4IG3A 5CYMB 4F67A 1UP1A 3ILJA 4B9UA 2JLFA 3IRWP 3MFHA 2DB1A 2MKYA 4UQTA 3LGNA 5GMDA 2D3O1 2ZM6F 4FKXA 4MAKA 3CJ8A 2QV6A 5KFIA 5HVHA 2Z2LA 2IRUA 1RB0A 1Q82T 3PJWA 5A8RB 4DR6F 1RABB 3PY8A 4ZJOA 3FNNA 2V69A 3CIMA 2GIRA 2HMIB 3EZOA 1YRXA 3D68A 3RR7A 1ZZNA 2LQBA 1TR0A 3QFWA 3OT9A 1ZAWA 3DN9A 4U7CA 1RACB 1ROFA 3QWUA 1IM4A 4HDHA 1T3NA 3EDQB 1UZHA 2W2PP 3D0GE 4PG7A 3CVKA 1NPRA 1AB8A 1FHTA 2HIYA 1RA7A 3BQ0A 1NZAA 1HI8A 2H5IB 3OR2B 2NXCA 3MR3A 2CWXA 2UXCJ 4CLPA 2DK2A 2IRXA 3F44A 3Q0AA 3MGJA 4GO5X 2VPZB 2QSFA 3F0NA 3RRKA 2GFFA 1U6BA 1W25A 2KJVA 5AT1B 5KG2A 5HROB 1IKXB 1JQGA 1S1UB 4E0DA 4L74A 2EEYA 4IG0A 1N0UA 1PYSB 3SDEB 2F8MA 3F41A 4NXNJ 2VU5A 2UXBF 4JP8A 3CDBA 1OSDA 2I9SA 4LF8J 3HJVA 2YNGA 2V8HA 4LQ9A 1DFDA 2CQ0A 1VQMS 1G4CA 4C8NA 3DLEA 2OMOA 1VQ9S 2F4VF 1RAGB 3N0VA 1AFJA 3K5MA 3D3CJ 2VFUA 3JQMA 1HA1A 1RHUB 4JB8B 4QYRA 2J8AA 3W2VA 2NQPA 4FNIA 4KT0C 3MM7A 5E3PA 3FKBA 3KXDA 2X51A 3OTCA 2CNLB 1A6LA 3OFGA 3W62A 2BA9A 3TAMA 2ATLA 3HT0A 1YKWA 1Y11A 3A4TA 2V4QA 4DUYF 3HF5A 3JTNA 1SJ4P 1U2CA 3IBFB 3CCZA 4P52A 2N4DA 3AB4B 1FXDA 4DV0F 3CMAS 2ABYA 2QA4S 1X31C 1JKHA 4RBVA 2IC3A 2ZNZA 1NDKA 4J9QA 1WKLA 3TOQA 2XC9A 1SBRA 3H5UA 3PX6A 3MEKA 4J5OA 1N5YB 3HD2A 3HVTA 3UNYA 2RUSA 1D9AA 2EFOA 1V9OA 1HNIA 1KQGB 3PW5A 3FMBA 3TX0A 2OD6A 3NS7B 2ZOMA 2B4UA 3GCWP 1TQLA 5CCMA 3N5BA 1Y00A 4DPWA 5E2QA 4AFFA 3VAJA 2MKJA 1Y9OA 1FO1A 4UY8T 2GZOA 2ZZTA 4TLRA 1F9EB 3MEEA 4OFZA 4N7TA 3OLBA 1HLWA 1TUVA 4R0EA 1N5SA 2JNJA 1C1CB 2ZH1A 4M94A 3TARA 4RX6A 4C3MA 2C2MB 2BXJA 2QTWA 1C4CA 1V3SA 4WWSA 4NX9A 2UUAJ 2XQCA 1RYRA 3HI9A 5L38A 3NRBA 2WOMA 4ID5B 3JQJA 4NYPA 1I5OB 1HMVB 1D0EA 1Q7LB 1R0CB 1T9XA 3T1AA 2YKMA 4NLYA 4ZVOB 3W2WB 4GVBA 2AZ1A 3QFHA 5L1JA 2Q1LA 3BJYA 1F9HA 2BUNA 2MJNA 3J80Y 3DRXA 3JYTB 1P27B 1S9FA 1VBZA 1UFKA 1A0OB 1S4EA 1VQ8S 3U27A 4F4XA 4DL7A 1H3DA 1WHYA 4J9UE 2C2RA 1YIJS 1WC1A 4G1IA 4FS1A 3JSRA 4ANCA 5HN0A 3A8KA 4C8MA 1F5AA 2YNHB 1D9FA 4X4NA 1IKWA 4QR0A 3P8BB 3I5AA 3NOCA 4F8RA 3LTOA 3HX9A 2GJFA 1RU2A 4MK7A 4PRFA 3DXSX 3BDPA 4CM0A 1DTTA 4IDKA 4C8KA 2W7PA 1X5OA 2MHNA 3UN5A 2O5DA 4ZPBA 4NZ0A 1X7VA 3GFZA 1DARA 1YJVA 5I3PA 1IKVA 2XMMA 1CSJA 4TY9A 1U1NA 3MR6A 2PEHA 3VV2B 2ROGA 4DX5A 2XMTA 3M8RA 3DOMB 1X4HA 3HMJG 1BQMB 2BKNA 1M90T 1TL7A 2KRBA 3UDVA 3VZHA 2WSCC 3KJVA 3MCOA 3UR0A 5EDWA 4DOZA 5DGBA 1YHQS 4B9TA 4O3RA 2GVDA 3IWNC 1VYAA 2AF6A 3VAGA 2HQDA 2L9DA 1AUSL 3C15A 1IN0A 5K9FA 4AUKA 2B5JA 5AXLA 4UT4A 2ADBA 4WU3A 2FC9A 2HNDB 2IM1A 1FDAA 1WF1A 4KH0B 1H0HB 3IO1A 2UV8G 4J9OA 1TMMA 3CT9A 1FRJA 4JI3F 1FDNA 5J1EB 4W4MA 5AE3A 4ED6A 1TVRA 1Q86T 3PX4A 3S7RA 3L7PA 1FKOA 3CPWR 4RBTA 2MYFA 2RE1A 2Z4PA 3JB9k 2YH0A 3OTDA 3G71S 1RBOB 2RKIB 1CJVA 2UVWA 2CQ2A 4WK1A 2ZDPA 3T9NA 4NA1A 2JWNA 4LF4J 4EZ9A 3B8HA 1GQEA 5I42B 2I5JB 4WFNQ 4DUTA 2FHKA 1FX4A 1S1VB 1J5EJ 2A6OA 2GX8A 2MXYA 1QJHA 1T05B 2J7UA 3TVZA 1U1LA 5K8OA 4F26A 3W9JA 1WG4A 3MM8A 1KHWA 2J9DA 1WSRA 4O4GB 1U25A 1EB0A 4PG6A 3D66A 1CJTA 4N5SA 1MMLA 3VALA 2C3PA 3DU5A 2AGOA 3HVRA 4P7VA 2ZH7A 2DHAA 4TYBA 2RU3A 2KM8B 4NEYA 1IBCB 1XERA 4CLLA 3TZYA 1HD0A 1Q8LA 1VDHA 1WF2A 2LQJA 1RWOB 2QJ3A 3G9CA 1VHIA 3QGHA 2E9TA 3ICLA 4MFBB 1S1TB 3PYDA 4XK8C 3C16A 1S7HA 4K0KJ 4DLGA 2MZ1A 1YJUA 4I4BA 1HBMB 1OQ3A 3MAAB 4WKRA 2UUWA 1RT1B 1OIAA 1WWHA 5B0EA 1LW2A 1FEEA 1JIHA 3LALA 1FX2A 3ADAC 3IMQJ 2YKAA 4U8VA 4RW4A 1VQ7S 4LR7A 4QWCA 1KLNA 1LEOA 3CEDA 4CM2A 1U7LA 3KHRA 2GJ2A 2QYGA 3KFWX 3QAEA 2A0FB 1D1UA 2BQRA 4QIVA 1HNWF 4WKYA 1B0VA 2NCKL 2R7RA 1RT3B 2WW8A 2XMAA 3H2VE 2HQCA 3RTVA 3NY0A 4ZPDA 1HPZA 3GIJA 5F0UA 2GV1A 3MFIA 3BYPA 4RW8A 2N7YA 4C4WA 5J2NA 1SJQA 2DXEA 3K5NA 1FJCA 3GIIA 4B9VA 4X66F 2KFYA 4Y2MA 3IN5A 4DR1F 4DQIA 3BZQA 1TL3A 3SMZA 5D0RA 1H73A 3V6JA 3M05A 2HHVA 3VWSA 4NMLA 1KVKA 2AJ2A 1JXLA 3BBBA 2KYZA 1X4GA 1SUQA 3M30A 5A6PA 1S9GA 2V4JA 1GMWA 1P8GA 3I87A 3GZ7A 3MMBB 4EGLA 3RAMA 1HNZF 1DBDA 1R7IA 2GVZB 2A18A 3E51A 2G13A 2FLPA 1FD8A 1SPBP 1FVQA 1REVB 1RT7A 3O1LA 1TTHB 3CJ5A 3CULA 1AXQA 1FKPB 3P96A 4FBTA 4K5RA 2RAQA 3C6TB 3DLHA 3NGDA 3BGOP 4WFAQ 1O6XA 5FLXU 1BE4A 1U45A 5C42A 4FBUA 2VBXA 3V6HA 1N33F 4OX8A 2DRBA 3MM9A 4WIQA 1VI7A 2OPQB 4JI2F 2RVJA 1PSDA 2M9KA 4IYQA 2KXFA 4UY85 3KLGB 2R8IA 3KK2A 2OSQA 4ED4A 1PG5B 3BO2A 2VFSA 2HRUA 5HQMA 5HJXA 1FK9B 1KKHA 3RW6A 4DR5J 2RJZA 1XEZA 2DKOB 3A12A 4URQU 2XO7A 1OO0B 2DITA 3FBEA 1XMOF 4Q5VA 3Q23A 2Z2YB 4DL2A 4O44B 3NBPA 3UFCX 2JFDA 2RQCA 5HO4A 3BF4A 5ETPA 4TQRA 3K58A 4DR4J 4F02A 1SC6A 3NWGA 3TWZA 5DG9A 1NK6A 3M1VB 5DDRC 4RR5A 5EX0A 2BACA 3OJSA 1XR7A 1S0MA 3PG9A 4C11B 4UZCA 2DO4A 5F8IA 1TUWA 3FDSA 1Q16B 2HFZA 2J6UA 3G87A 2I38A 5A0YB 1ZH5A 3MHYA 5IT9Y 2ZC3A 4NLRA 2CZ9A 2ZD1A 5C24A 2RQKA 2ASLA 4CLTA 2JOQA 1HYSB 4LF5J 3HCXA 2OTLS 3D67A 1TK5A 2XHCA 3OHBA 1RT6A 1AT1B 3PEJA 4FF2A 2LXFA 1C1BB 4OV6A 4UUWA 2RNEA 2EPIA 2XSJA 1HQEB 1M1GA 2DGTA 3C14B 2I6WA 2PA8D 3EM1A 1KWMA 4DR2F 3OUYA 3ZZUA 2R9LA 2J6TA 4I2QA 2OEJA 3KLEB 3EPIA 1IR1A 4MKBA 1QD1A 2B0GA 5ITHA 1S0VA 1FJ7A 2NS1B 1YBUA 3CCJS 1XMBA 3ENVA 3BDEA 2LU2A 4LBHA 4OJ3A 3OFHA 1S1XA 4P72A 3ZTQA 5KT2A 1PCAA 1OY8A 4JI5F 1S79A 5BR8F 1VLYA 4J9MA 4V19X 1V3RA 4K4TA 3H40A 3NMAA 2RRNA 1RWMB 3LGHA 2C42A 1NKCA 1KQSR 2MY8A 2PC6A 4PAAA 3T1HF 3RRHA 1HD1A 3OLAA 5H9EJ 5KG4A 3N5FA 2IA0A 1JNZB 2PI4A 3NS6A 4LFAJ 1QM9A 5AXKA 2CXEA 1KQKA 3OVSA 1NDLA 4BC9A 1JX4A 3FVYA 1S6PA 1JB0C 4XIUA 3KLHA 1YTYA 3TRGA 4LF9J 1RLCL 2J5AA 3FFIB 2UU9J 3M8SA 2FJAB 1GAOA 2EI5A 2YKNB 2G0CA 3T6BA 1FDDA 3CXCR 3H2LA 2GAHC 3MR7A 4UOGA 1LW0B 2B7BB 3R5BA 4NCBA 5D3GA 1JLCA 3MD1A 2VHGA 3FSIA 3DLGA 2WB1D 4DFPA 4K4SA 2J6SA 2VQFF 3KLIA 1LWFB 3H2UB 2YXLA 2DHHA 4W98A 4FS2A 2WBRA 3GYXB 4I2PB 1NM2A 4RO0A 3EUNA 4OHZA 2JEIA 2XMUA 2DR9A 3J81U 3SSRA 4Q7AA 4CO0A 2XMVA 3RBDA 4PWDA 2YNIB 4K50A 1JMTA 3LPEA 2D3ZA 4L75A 5D4LA 1JLQB 3G6XA 2DNQA 3DGVA 2RQMA 5ETKA 2DPIA 5HMXA 3M8ZA 3I4PA 4LJMA 5GAGI 3KK3B 5K14A 3MEDA 2WW4A 2ZUGA 4A8WA 4MMOA 3IR6B 4QIWD 3HDSA 1TK0A 2JVRA 1NRKA 1QTNB 3ITHB 4HI2A 3UCZP 3BO4A 1LWXA 2WVDA 1RWUA 3MR2A 1HFEL 1SKWA 1GNKA 3MPVA 1H6KX 2W2NP 3WQPA 1X5SA 2Q79A 2JRSA 2E1PA 1YRTA 1QAJA 2EKNA 3DC2A 2XLJA 4ZVUB 1RTDA 2PSZA 1F2HA 3BQ2A 1MU2A 2V67A 4NLQA 4OLPA 1NPKA 2ZBQA 2QMXA 4EWTA 6AT1B 4P9SA 2QT7A 1TMJA 4KSEB 3ZZTA 1RDRA 2RRBA 4WZQA 1Y10A 5KFTA 3PO5A 4Y28C 2CPFA 2B7CB 1FWPA 3ZFVA 3GG1A 1HI1A 3V5RA 5D0GA 5E7OB 2J9DE 2MQLA 1IWAA 4LRAA 1TV6B 1U1PA 4OHXA 3BSCA 2RUGA 2XSFA 2NSCA 2HBRB 1U0HB 3TQ1A 3WC2A 1RHMB 3C8YA 3GIRA 4DV6F 4LRCA 9RUBA 3RB0A 4DQSA 3A3NB 4EO8A 2G4BA 2QE5A 4USJC 4USHA 1P1TA 4JI7J 4URSA 3OTOJ 3I55S 1N48A 3T1YF 4OZJA 5D0HA 2NYHA 5KG0A 4RNMA 2M88A 1GXUA 3QIPA 1C0TA 2VUGA 1SCJB 2R2TA 3R97A 4FZVA 2GGPA 4B3SF 2AJ1A 3NS5A 2VV5A 4FF3A 1JLBB 1FF2A 3H0PA 1TKZB 3GYNA 4J9NA 2FHJA 2IY5B 3VCDA 1CULB 2JL9A 4DV7J 5DM6Q 2YWGA 3MF5A 4WXWA 2CQ1A 1H74A 1MLAA 3QIDA 1F3FA 2KT3A 1RT5B 1V5IB 2IMOA 4NLTA 2Z2ZA 3QATA 3DHWC 1SKSA 1IR2A 5E3CA 1YZ7A 4A8KA 3NWRA
chains in the Genus database with same CATH topology
4Y2CA 1FNXH 1VQ4S 5M2UA 4UOCA 3MEEB 2R2RA 5D78A 2IRYA 3EGWB 4CZCA 1C0TB 2M8DB 4URGA 2HHTA 3HLUA 5KFNA 1X9SA 1VRTB 2XHWA 4XPEA 4ICLA 1H98A 3O44A 2I8EA 2W4CA 3NGKA 3DRRB 2J0XA 5DLGA 4FXDA 3MECA 4ZP9A 5I3UA 2XY7A 4A47A 4X4UA 1HYSA 5D4OA 1UEUA 3QZ7A 2ROEA 1EETA 4EUVA 3HXMA 2LMIA 3EXYA 2EFPA 2QEXS 2YY3A 4HI1A 1RTHB 4RW9A 4OX7A 3U02A 5KTQA 3D5MA 5KFHA 2AJQA 2P9EA 2RF2B 2HAIA 5LJ3Y 2XGQA 4OZLA 1Q7YT 4E8UA 2BR0A 4F4KA 3JTOA 1GXTA 2OLWA 5M2RA 5B08A 2DR5A 1M5PC 5EN1A 3SFGA 3KTQA 3GIKA 3G4SS 4TY8A 2GJIA 2VOOA 4XAKA 3K5OA 2AYGA 2OSRA 2M7SA 1N5TA 3NG8A 4PPZA 1R3NA 1XBWA 3LOUA 3CJKA 3HZGA 5LMUF 3D0HE 2R7XA 1U09A 2QA2A 4ECZA 3K59A 4B08A 5FIIA 1NK4A 3OV7A 2WOMB 2HFNA 3I6PA 1U6ZA 1EP4A 3DLBA 4X4SA 2XULA 3V81B 5E5NA 2GW8A 4RW6A 1DQ9A 3FJ2A 3IA0A 3VAKA 2YH1A 1HQEA 3V6DA 2GQ2A 4Z2XA 3C46A 3KLFA 4ECQA 5HL7Q 1N8RT 3IRXB 1R6YA 2XNRA 1KR4A 3BSOA 1S6OA 4ED7A 1FE4A 3T6JA 3MMAA 3Q8PB 4JV5F 3OFFA 1M5HA 1DQAA 3MM5A 1VBXA 4JI0F 4TXSA 1ZPWX 4TU9A 4WIIA 1FTCA 1OPZA 2QO3A 5HLFB 4WYLA 3G86A 2W9CB 1ULRA 4TNOA 2ADCA 1ZOTA 4LSNB 4RWWA 1Z1ZA 2YKMB 4EZ6A 2LU1A 2V9KA 4PXEA 4ES2A 2X1BA 1HWLA 2ZKTA 2KXNB 5DQGA 4F25A 2YNFA 2POKA 3MMJA 2XI2A 4K4XA 4JOUA 1GX6A 1YJWS 2MKIA 3SZ2A 2FY1A 2CIMA 2HS3A 3I82A 4IH5A 2JC1A 1GH8A 1O8BA 5J2PA 4O0IA 2YX4A 2BV3A 4DHVA 1MSWD 1HWIA 3CCQS 4ZOSA 3JSBA 2MDAA 4MJKA 2YX1A 2F8EX 1ELOA 3IC1A 5I3UB 4HDGA 2RT3A 5IXUA 1NHVA 3BQ1A 4TYAA 3DI6B 3CC2S 2QFJA 5AE2A 2EFGA 5FDLA 2ZH9A 4G6VB 2PMZD 2DH9A 4PXDA 3TX8A 4U67Q 3SYZA 2J0QD 3MXHP 3CJ2A 1WACA 2WRMA 1VQNS 3UQSA 1VQ5S 1F9FA 4C3KA 4QWBA 1HNXF 3BR9A 1XC9A 4A8SA 3M6UA 1VQYA 5F8JA 1NK7A 1KSPA 3QGIA 1ZAXA 4TY8B 2VPYB 4Z37A 3HVWA 3VAHA 2D74B 2YTCA 4I67A 4YB5A 3CJKB 4BS2A 1BQXA 5DDOC 3DLKA 3E01B 5EWFA 3IWLA 5GAGU 2EG1A 2CQHA 3BREA 3PW4A 2D3OR 2F1FA 2JSXA 5A8RA 2WK4A 2W7OA 2I1RA 4AXIA 5J2QB 4KV8A 2LKZA 2QA4G 3KLFB 2F7VA