5C24B

Crystal structure of hiv-1 reverse transcriptase in complex with 7-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8-dimethylindolizine-2-carbonitrile (jlj605), a non-nucleoside inhibitor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
412
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
total genus 120
structure length 412
sequence length 412
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c24B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24B03
3PW7A 1JLGB 4IFYA 2OPQB 1MMLA 4TY9A 3BGRB 1TL1B 3V6HA 1IKWA 4TLRA 3FRZA 4J9NA 1RTHA 1DTTB 3QO9B 4PUOA 2E9RX 2OPPA 4URGA 4NCGA 4KB7A 3GV5B 4K4ZA 1RT2B 4G1QB 3FFIB 3I0SA 2UVUA 5FDLA 3NKYA 3KHHA 4U6PA 3EPIA 4ED3A 1DTQB 2B5JA 4X2BA 4RUCA 5HP1A 5HBMA 3I0SB 3PHEA 4WFXA 4ICLB 2GIRA 1RT7B 2IC3A 4ECXA 5CYQB 1S1XB 2ALZA 4I2PA 1RTHB 3DOLA 5DLFA 2JEIA 1HMVB 3SI8A 1K1QA 4QPXA 1IKVB 4ECYA 2C2DA 2ZE2A 4IG3B 2IJFA 4I7FB 3KLFA 4H4OA 1HQUB 4DL7A 3MEDB 4G3IA 5KG5A 5L1JA 5L1IA 4ICLA 1N5YA 3PJWA 4EEYA 5J2PA 2QE5A 3DYAB 3KMSA 1N56A 3H5UA 1RT6B 5KFIA 4ECTA 4KFBB 2ZD1A 4ED0A 1DLOB 3LAMA 2HNZB 2VG5A 4O3QA 5DQIA 4WFYA 1JX4A 5J2MB 2R8KA 2BRKA 4ECSA 4RW7B 3H40A 3I5AA 1JLEA 5KT7A 3MEGB 2I5JA 5DLGA 4IG3A 2V4RA 2B6AA 2D3UA 2XI3A 1S97A 3ISNC 4KKOA 3GIIA 3UR0A 3EPGA 3GIJA 2ASLA 2OPRA 2ZD1B 2B6AB 1TV6B 4FBTA 4XO0A 1FKPB 5KFLA 5L1LA 1RTDB 4ZP6A 4ZHRB 2IBKA 4RW8A 1RT3A 4O44A 3JYTB 3GV7B 4MIBA 5C24A 4ZP8A 4YQWA 3RB0A 2C28A 2HMIB 1T3NA 3N6LA 4NLRA 2HNYB 2FLPA 2OPRB 3BSAA 5C25A 2R8GA 1JLBB 1FK9B 2WONB 4NLSA 3OLAA 4NZ0A 1S6QB 2WK4A 4WYLA 2D7SA 4IDKA 2RKIA 3V6KA 3RB3A 3H4DA 2R2UA 3LP1B 1YVFA 4KO0A 4DL6A 4O44B 1EETA 2IAJA 1S9GB 3C6TA 1LWCB 4IH6A 4ED2A 3GILA 2HNDB 2XWYA 3DI6B 5JXSA 4RW9B 5KFYA 3V4IA 3KJVA 3T1AA 4RNMA 2AGOA 4EYHB 3DDKA 3DRRB 2D3ZA 2OPQA 4NRUA 1HNVB 1TKZB 3PR5B 2YNGA 3MR2A 2R8JA 1C1BA 3C6UB 4Q45A 5KFGA 1UWBB 5KG0A 1DTTA 3QO9A 4PUOB 4B3OA 1HYSB 4MFBB 2V0NA 3JSMB 1MU2B 1FKOB 4NLDA 5KT2A 3T5LA 2ASDA 2E9TA 1QE1B 4MIAA 4LQ3A 2I1RA 3KOAA 1JLFA 1LWCA 1HNVA 1TKZA 1RYSA 4NLWA 1XR5A 4RU9A 2AGQA 2VG6A 3KK2A 1CSJA 2VG7B 1RTIA 3KK1A 3GIMA 5JUMA 4ZPCA 1S10A 3IN5A 3ISND 2XC9A 3KLFB 3UPFA 1VRUA 1XR6A 2IM0A 4QW9A 2WCXA 2ILZA 1TL3B 1R0AA 1QE1A 1SH0A 5F8IA 3GQCA 3BJYA 4WE1B 3IG1A 1GX6A 4WYWA 5HROB 1HPZB 2W9BA 2ATLA 3I5BA 5DQGA 1S1UA 2HNZA 1TVRA 2VG5B 1SH3A 1J5OA 4TN2A 5EDWA 1S9EA 3IS9A 3MEEA 3KLEB 1OS5A 2JC1A 3T5KA 2BR0A 1RTIB 3KK1B 4TY8A 5KFZA 4ED6A 2UUTA 4H4MB 3EZUA 4KKOB 1EP4A 1ZTTA 3Q8RB 1BQMA 4K4TA 4IOBA 2UVVA 3TAMB 4IRCA 3DM2B 2FLNA 3E51A 1TVRB 4YMEA 4RUAA 3GIKA 3KHLA 2CJQA 4ED8A 2W8KA 2BANA 3V6JA 5KFKA 4WE1A 1S1TA 1DLOA 2RKIB 3IGVA 5KFBA 3PR4A 3FSIA 3KK3B 4I2QA 3KHRA 1JXLA 4NYZA 2YKNA 4DL4A 5I3UA 2C22A 3QZ8A 4Q8FA 4TYAA 5EWFA 3MF5A 3OL9A 3IRXA 3QLHA 4RW8B 4IR1A 3DI6A 1QUVA 5I3UB 3Q8QB 1IKYA 3V6DB 4QWEA 3SFGA 1RDRA 3BQ0A 4FS2A 1TV6A 1C2PA 3MFHA 5KFPA 4DG1B 3CO9A 1C0TB 2JC0A 3D28A 1T03B 4IR9A 4B3OB 1LW2B 5CYMB 4M94A 5KFVA 4DL2A 4RNOA 4I2QB 2JLEA 5K14B 1T03A 1KHVA 2J6UA 3NL0A 3PW2A 3NBPA 2OH2A 3MR6A 2W7OA 5F8NA 1JLBA 1FK9A 2WONA 4HKQA 2JEFA 4RW9A 4IH5A 2FJXA 1TP7A 2W9AA 4PWDB 2RDJA 5KG2A 4F50A 4J9SA 1S0OA 4YR2A 1D0EA 3BGRA 4DG1A 1NHUA 4PWDA 3ICLA 2R2TA 4K4SA 4R8UA 4QWCA 1S9GA 3CVKA 1JLAA 4NCGB 3IGNA 4J9PA 4Q8EA 1JKHA 1REVB 4MFBA 3IG1B 2ASJA 3E01B 3PZPA 3DRSA 3I0RB 1RT7A 2IC3B 1S1VB 1C1BB 3C6UA 4ID5B 2VG7A 4PQUB 2O5DA 5L1KA 3DRPB 3KMQA 4ECUA 4J9RA 3MECA 4Y34A 3PW5A 3M8PB 4J9QA 4TQRA 1RYRA 4NLGA 2HWIA 5KFAA 2OPPB 3LALA 1BQMB 2FJVA 5DQHA 1VRTB 3M8PA 3MR3A 1LW0A 5J2PB 1N5YB 5HROA 1DTQA 2B5JB 2W9BB 3KLIA 4MK9A 1RT4B 4RW4B 2IM2A 2HAIA 2W9CB 2IJNA 3IS9B 3OL7A 1J5OB 5KG7A 3KLIB 3ITHB 4QWDA 5D3GA 4F4WA 4Q0BB 2BE2B 1HMVA 1GX5A 1HYSA 4NLPA 2VA2A 2FVCA 1HQEA 3CJ0A 2B43A 4RW7A 2HNYA 1LWFA 4ZPAA 3HVTB 2WOMA 1LWEB 4MKAA 2C2EA 3DYAA 4K4XA 1LWFB 3UQSA 3V81A 5C42A 1RTDA 1RT6A 1S9EB 1FKPA 3G86A 1RT5A 4KAIA 4K4UA 3KK3A 1TL1A 5KG1A 3FQKA 3DMJB 2BQRA 3G6YA 5KFEA 3NMAA 4I7FA 3KLGA 3BR9A 3DMJA 4EYIB 5J2NA 4WXWA 3V4IB 2IM1A 2WRMA 4MK8A 5F8GA 1RT5B 1HARA 3I5CA 3BSCA 4ECWA 1N48A 1KLMB 4YP3A 1S6PA 2YKMB 1SUQA 1W25A 5C24B 2R8IA 2JEGA 1RT3B 3JYTA 4IKAA 3RBEA 2RF2A 3BREA 4NLYA 1HQUA 4ZPDA 4O3NA 4F4ZA 2BQ3A 4WZQA 1HNIB 4KV8B 3OHBA 1TQLA 1N4LA 3N6NA 4QW8A 3MR5A 4PQUA 2J6SA 4YR0A 2UUWA 4KHMA 3Q8SB 2OPSA 1S1XA 2YNGB 3FDSA 2WTFA 4TQSA 3KLHA 2W7PA 2XGPA 4O4RA 3CIZA 1S6PB 2YKMA 2WHOA 3PJXA 2XGQA 3QZ7A 3PW0A 2E9ZA 4KBIA 3FFIA 1IKYB 3V6DA 4NLQA 3DRPA 4ED7A 5DG7A 3CDEA 3H98A 4NRTA 2VA3A 4FBUA 5D3GB 4J9OA 3DLGB 4RNNA 3LP2A 3RAXA 3H5XA 4O3OA 3Q8PB 3E01A 1LW2A 5CYMA 3HHKA 3H5SA 2R2SA 4JV1A 2FVQA 5KT6A 3RAQA 2R8HA 4ECRA 5KFWA 1T05A 3TQ1A 3RBDA 3BQ1A 1RT2A 1RT4A 4G1QA 4RW4A 4ZVFA 4RZRA 3OL8A 2UVRA 5KFMA 3M9OB 3UDLA 5HP1B 4TYBA 3KJVB 4H54A 4NLXA 1VRTA 1HPZA 2IA6A 3DLEA 1ZETA 4IG0B 1T94A 5I42B 1K1SA 4NLOA 1HQEB 1IM4A 2YNIA 2D41A 5KT4A 1IKVA 3OHAA 3FQLA 1VRUB 4HYKA 4ZP7A 5F8LA 3M8QB 1JLEB 2IM3A 4H4OB 4U7CA 2FVSA 2W8LA 4IRKA 3V81B 1SH2A 2CKWA 4IFVA 2DPJA 1S1WA 3N6MA 3KK2B 4EO6A 2BANB 3HVTA 5I42A 4F4XA 3KHGA 4IQXA 3VQSA 4ECVA 4R5PB 3PVXA 2AGPA 5CYQA 2GC8A 2RDIA 4MK7A 2RF2B 4Y3CA 5J1EA 4KHRA 5KFCA 2J6TA 4F4YA 1IKWB 4H4MA 4KO0B 3BQ2A 2WOMB 3NAIA 4YR3A 3MEDA 4K50A 4EBCA 2DPIA 4ZPBA 5KFQA 1D1UA 4Y2AA 4O3RA 1SV5B 4GC7A 5KFFA 5J2NB 1NNDA 1C0TA 5J1EB 1N6QA 1RA6A 4JV2A 4NLVA 4KFBA 1UWBA 5KFJA 2BRLA 2FVPA 1QAJA 4R5PA 5KFRA 5KFTA 3LP1A 3OL6A 2EC0A 3IRXB 1KLMA 3QLHB 3CJ2A 1BQNB 2YNFB 3H5YA 4ECZA 1S1VA 3NAHA 2OPSB 4OL8A 4ZVEA 1RTJA 4J9LA 4DL5A 1TKTB 1S9FA 4URSA 5F9NA 4WFZA 1N6QB 1RA7A 3DLKB 3DOKA 1C0UB 1IKXB 4WZMA 1MU2A 1HNIA 1LW0B 4J9KA 4DL3A 4DEZA 5KT5A 2V4QA 4ZVHA 3T5HA 3T5JA 3RB4A 5FDLB 2FLLA 1BQNA 2AQ4A 3DLEB 4TXSA 5KG3A 2VG6B 4ED1A 2XI2A 5KFOA 2C2RA 4J9MA 3DOKB 3MEEB 4ZHRA 1JLGA 3KLEA 1S6QA 4O3PA 1QAIA 1WNEA 1S0NA 5F9LA 1JIHA 2ZE2B 3LAKA 3JSMA 4QWBA 3NGDA 3QIDA 4M95A 2FVRA 4LSLA 5EUHA 4K4WA 3MTKA 3DM2A 3KNAA 3LP2B 1RAJA 4LSNB 5J2QA 1JLCA 2ILYA 3SFUA 5KFHA 5KG6A 5HBMB 2YNIB 3GYNA 4NLUA 1TKXB 1JLCB 3G6XA 4MKBA 5DG8A 2JEJA 2FJWA 4IRDA 2XCAA 4XPEA 1C1CB 5HLFB 4R0EA 1TKXA 4URQU 4K4YA 3G6VA 3NBPB 4ECQA 4IFVB 1FKOA 2UVWA 3LP0B 3QIPB 1SV5A 1JLFB 2I5JB 5L9XA 3M8QA 3DLGA 3RB6A 4RNHA 1NHVA 3DRRA 4JV0A 5KG4A 3ITHA 3H2LA 1JLQB 2AU0A 3CDUA 4TY8B 4I2PB 2HWHA 3CJ5A 4JUZA 4R8UB 3HKWA 3MFIA 1S0MA 2BQUA 2AWZA 2QV6A 3LP0A 3QIPA 1EP4B 1RT1A 2F8EX 4EBDA 4EO8A 3D5MA 2XCPA 3QGIA 4FS1A 4O3SA 3I0RA 1U09A 3TVKA 1JLQA 5KT3A 1S1TB 1S1UB 4QWAA 5KFDA 2BE2A 4KSEB 3QGHA 3OLBA 4K4VA 3DLKA 3DOLB 3MEGA 3QGGA 1Z4UA 1S49A 1JLAB 1XR7A 5J2MA 4WXOA 4MH8A 2HMIA 5DGAA 1LWEA 2ZKUA 1RT1B 4RNFA 4NLTA 3H4BA 5F8JA 3TAMA 3HVAA 5C5JA 5T14A 3LANA 2V9WA 4KE5A 2YNHB 3CDWA 5KFSA 3H59A 5EWGA 5F8HA 3MECB 4Q0BA 3KLHB 1IKXA 2WB4A 5KFXA 4ZP9A 3GV8B 2YKNB 4EBEA 5K14A 3KLGB 1T05B 1ZTWA 1I6JA 4LQ9A 1TKTA 4Q44A 2IMWP 4O4GA 2AX1A 5KFNA 3OSPA 4IH7A 4KV8A 1RTJB 1C0UA 3M9MB 3BSNA 2YNHA 4O4GB 5C25B 4XPCA 3HVWA 2HNDA 4GC6A 1S4FA 2R2RA 4ZVGA 5C42B 3T19A 2GIQA 3OSNA 1KHWA 4IG0A 3M9NB 2W9CA 4RW6B 4Q43A 3CJ4A 4ZMMA 1SUQB 1C1CA 5HLFA 3PW4A 4RW6A 4IDKB 3QYYA 2AX0A 4Y2CA 5F8MA 2YNFA 5DG9A 1EETB 2IAJB 3C6TB 4LSLB 1REVA 3CJ3A 5EWEA 3KLVA 3BSOA 1JKHB 1S1WB 4LSNA 4IFYB 5J2QB 1S48A 5DGBA 1TL3A 1R0AB 4ID5A 3CWJA 3DRSB 5KFUA
chains in the Genus database with same CATH superfamily
1GFWB 1N34F 4IFYA 3B8HA 3ZZOA 4DX6A 4GVBA 2XY6A 3C3LA 1DTTB 2J7UA 1OYEA 3G6ES 4URGA 4WP8A 2KI2A 2MPUA 1FFSB 2G9OA 3H42A 3GV5B 3FFIB 1MWQA 1QTNB 3IO1A 2IDEA 1J5EF 2UVUA 1LEOA 3NKYA 4X2BA 2B5JA 2V69A 3IR6B 2MKSA 4RUCA 2C2NA 3HHEA 5AXLA 3PHEA 3I0SB 1M5OC 1XNQF 1HBUA 4XK8C 2AEJA 3N5FA 4ES1A 3TUZC 2FZKB 1S1XB 3KG1A 4I2PA 3FRYA 4X84A 4ZCLA 6FD1A 2VQFF 3PRBA 2ALZA 1HMVB 1T02A 1FJ7A 3D3CJ 1K1QA 2AJ0A 4CLKA 4ECYA 4WK3A 1H38A 1U0SA 4USKA 2GV1A 3BKTA 3JXOA 2GVZA 1JNRB 2IJFA 1F3VA 1URRA 1B7YB 1HQUB 5LT5A 5AXNA 2ZHOA 4WFNQ 5KG5A 2AP6A 3MOZA 4IOAQ 4OYXA 2DRDA 2MEWA 3OFHA 4DV4F 5D4PA 3MMCA 2R42A 4ZIVA 3KMSA 2ZH8A 1LXJA 1RT6B 3GWCA 1P8GA 4ID8A 5BYQA 2XB2D 3O1LA 1FTRA 1YGYA 2C3UA 3D1QA 3NY0A 5DDRC 1DLOB 1FDBA 3GMGA 1EZZB 4ED0A 4MYTA 1NEEA 3M2VA 1KD1T 4N7TA 4F0MA 3D6FB 3H40A 3FVYA 1JLEA 1NRKA 1X9SA 3MEGB 2I5JA 5IT9Y 2GVZB 2V4RA 2B6AA 3EGWB 2XI3A 3PM9A 4OHWA 4KKOA 1RAEB 2I0XA 2UV8G 3GIIA 5B09A 1S97A 1VC0A 4ILMA 1NXIA 2ASLA 2OPRA 2VOOA 1TV6B 4FBTA 1FKPB 2EBGA 3FGVA 2D69A 2DCLA 1RTDB 4ZP6A 1M5VC 2FPHX 2OFHX 1QSLA 2UUBF 1MWZA 3GV7B 3J7YI 3RB0A 3BYPA 3DNCA 3VF0B 2VZ9A 4GVLA 2Q79A 2YKQA 1TL7A 1ZH5A 2NXJA 1HLWA 4NLRA 4OZ0A 1HWKA 1HBOA 3W2WA 4A46A 1YX2A 2J8AA 4JOUA 2G2YA 4NZ7A 3OXFA 5H9FJ 3ENWA 2HWTA 1WC1A 1RACB 2VC0A 3NCRA 1NK8A 4DL0C 5JJBA 1ZM3A 2D7SA 1DURA 3CDAA 5DJBA 4IDKA 4Y00A 5ETNA 3V6KA 4K5RA 2R2UA 3BPDA 1FCAA 4IH6A 3C6TA 5IS2A 5L38A 3MR7A 3JQJA 1TL7B 2HNDB 2QIFA 3C8YA 1LWXA 1RAGB 3P5TL 5IT4A 4DUYF 3CD6S 1ITPA 4EWTA 1WKJA 3R7SB 4AUKA 5IM0B 3DDKA 3NEKA 1FRXA 1M5KC 3RU0A 1TKZB 5LOQA 5JMNA 3MR2A 4DR2F 2KYXA 1UWBB 2RMLA 5ETPA 4OYWA 3MCOA 3WIUA 4C8LA 3QO9A 2DISA 3FZ2A 3N01A 2DY1A 2XLIA 5A8KB 2CDQA 1FKOB 2FJDB 4NLDA 3T5LA 4LIRA 2JOQA 1HR0J 2BW7A 4MIAA 1GAOA 3KOAA 2I1RA 2DHSA 2VFRA 1TK8A 3CC4S 1LWCA 2KVQE 1TKZA 2ZOMA 1RYSA 4NLWA 1XR5A 2BMBA 2W2NP 3I4HX 4ZA1A 4YEAA 3WC0A 3O2IA 2W2QP 4C0OC 1SKSA 4JI7J 2HLTA 2CPZA 1RTIA 3AH6A 2LVWA 3S1TA 2CQ1A 2XC9A 3IN5A 1VRUA 1XR6A 2E7VA 3WBZA 2VPXB 3TARA 3PIOQ 2ABYA 3PX0A 3RR7A 2YTCA 1JJ2R 4QW9A 3AJDA 2KFYA 2P8IA 2JLFA 5K8PA 3DOMA 1TL3B 1R0AA 3GQCA 2R8GA 4KPCA 1X8DA 1RP5A 3HO1A 2EK1A 2PE8A 3AQPA 3W5ZA 1U48A 3LTOA 3LPEA 2V5HG 4TN2A 4CLTA 2JC1A 1OS5A 1RSCA 1L3VA 3KK1B 3PNIA 2J9EA 2IA0A 4A8YA 2E29A 2UUTA 1FFGB 2HQ3A 2QC3A 4ZPWR 3OR1A 2CJKA 4F2SA 3CJSA 3Q2SC 3Q8RB 4DR7F 1ZPWX 3NMRA 3TAMB 3OQ2A 2F3JA 1TVRB 1OPIA 1S7IA 3IXQA 1G4CA 3KG0A 3R97A 2MLXA 4U67Q 5IOLA 5KFKA 4DS4A 4X64J 1U6BA 1TFYA 2MY7A 3SCJE 1KFSA 2DGUA 1QLNA 2RKIB 2BUNA 1UEUA 3KK3B 3PR4A 3E3XA 2PFDA 2RHQB 1MWYA 4DV2J 1FXLA 5LXYA 4MMOA 4AT1B 4Q8FA 1S99A 3MF5A 3IRXA 4HH0A 3D1OA 3HD2A 4E8UA 2R9LA 2B3TB 3GCWP 2DH8A 3CCJS 1IKYA 1RU2A 1F5CA 2C3OA 1RDRA 3H2VE 4N41A 3J7Z5 1C2PA 4DU8A 4OLPA 4B3RF 3AJ2A 5KFPA 1F60B 2BM1A 2JVRA 2KYZA 1NO8A 5HMZA 5KFVA 3BN7A 5B0BA 4UOGA 4RNOA 1XWLA 5K14B 4I1TA 1T03A 3FBCA 3OTOJ 3NL0A 3OFFA 3NBPA 3MR6A 5F8NA 1ZM2A 3CGIA 1HNXJ 1WTBA 4X4SA 2JEFA 4ZIWA 4IH5A 4C7QA 4J9UE 1B0TA 3EXCX 1H7XA 2FJXA 2CQDA 3IM8A 4PWDB 4PXCA 5D4OA 2XQCA 2W9AA 2RDJA 4LF4F 3QJLA 4NA2A 2VICA 3BGRA 1NHUA 4PWDA 4R8UA 4QWCA 2WW4A 3TZZA 1S9GA 3CVKA 5KOWA 4NCGB 4J9PA 2KT5A 1SJ3P 1WI8A 4NYOA 2CFXA 5ETRA 4NEYA 5AT1B 4FVMA 4WCEQ 2N82B 4ZCMA 3QAEA 5B0EA 1RGVA 2GX8A 4LBHA 3I0RB 2O5DA 1RE1B 2N7CA 2WAQD 2JNJA 2ALYB 1TKDA 3EUNA 2X7IA 1SJQA 1Q8LA 1WKKA 1O5JA 3TEGA 4NLGA 3OW2R 3CO0P 2AJFE 4C4WA 4BLGA 1BQMB 2F4VF 2AMCB 1V3SA 1CJKB 4F3QA 4X66F 5A6PA 3W8GA 3KLIA 4RW4B 2IM2A 2HAIA 2HIQA 3VZIA 4PYAA 3HULA 5IWAF 2IJNA 3IS9B 2EK6A 1XBWA 2R7OA 4RBVA 4WWSA 3U02A 3KLIB 1PYOB 1QJHA 1A7GE 5KG7A 2C2KB 4WTYA 1C4AA 4C0BA 2OIHA 1FHTA 4OQJA 4DFMA 1GX5A 1HYSA 2GMJA 2CVEA 3R5JB 4NLPA 1GMUA 4P75A 4EZ9A 1WG4A 1DBDA 1HL6A 2B43A 2FUG9 4CH1A 3OVBA 2R7XA 5BXIA 3I87A 2ZZMA 2VPZB 2XSJB 2Z2YB 3GTYX 4MKAA 1VFJA 1X5SA 4Y2KA 3X3UA 3NWGA 4B3SJ 3NNCA 4L6V3 1UTAA 2XZWA 4JV5J 1RTDA 2LYVA 2E7XA 2A2CA 2IPOB 3TO8A 1Y5NB 5AE1A 2CUYA 1SPBP 4CQ1A 2Y1IA 4LF8F 2GHPA 2MDAA 2PO4A 2BX6A 3C16B 3KJNB 5KFEA 3KLGA 3G6YA 3HHNB 3BR9A 2ZH2A 4RL1A 3DMJA 2VJUA 5J2NA 5GAGU 3CD5A 2LQJA 3R5DA 5RUBA 1KQFB 4MK8A 2B9EA 2RQKA 4Y28C 5D77A 1O51A 4Q2LA 4J5OA 5B0FA 4ECWA 5HVHA 1S72S 2YKAA 3MAAA 2C3PA 2JFKA 4LR8A 3J7ZT 2LEBA 4YP3A 1S6PA 4MIWA 2RNEA 3AAWB 3O8WA 4UZBA 3NWRA 3BREA 3B6BA 2IHR1 4NX9A 1UZDA 5CCMA 3T3FA 2NSCA 2X3GA 4F4ZA 4WKYA 2BQ3A 1QM9A 4LR7A 1HNIB 3RW6A 1BWEA 1TQLA 2KJVA 5IFMA 4QW8A 2W2OP 2HQFA 2RIJA 3MR5A 2HHHF 3J81Y 2UUWA 2YWWA 3N9UC 1NDLA 3KWMA 4CRJA 3NRBA 2PSZA 1FI4A 3UD4P 3KLHA 3M2RA 4B02A 4DFKA 1UJ6A 2OP5A 3EGVA 4B9LA 4F02A 4H4KA 3RRKA 1H98A 2E9ZA 4ENOA 4YOEA 1FWKA 2XMVA 3FFIA 4DSKA 2XSFA 1IKYB 3JAMU 4NLQA 5DZ6A 1RKIA 3BYRA 4JI3F 5CXTA 2QLWA 1AXQA 2WVEA 4LF7F 4NRTA 1RQ0A 3ZZZA 5D3GB 1U0HA 7AT1B 4J9OA 3W64A 2DRBA 1TAUA 4DR3F 1DQAA 3NGKA 3HHKA 2QX0A 2YWHA 2OSRA 1AUSL 3DLBA 3RAQA 1RBAA 1IWGA 4ECRA 1LQ9A 3QWUA 5K8NA 2HFUA 4A8QA 1I94J 4IO9Q 1XMQJ 3KUGA 2UVRA 1NSAA 3VR1A 3ZXWA 5A76A 4DV1F 4BDPA 1JJHA 3PTWA 3ZZPA 2MLYA 4QIVA 1K8AT 1VRTA 2KHCA 1HPZA 1RAFB 1RHMB 2XMTA 4CLZA 4DF8A 5FLXY 1N5SA 1URNA 3R2CJ 4IG0B 5U47A 1PC4A 3CCZA 1FJEB 5H9EJ 4AE5A 1HQEB 1NPRA 1U45A 2F1FA 2A0FB 2P9CA 4QR2A 2Y9HA 3AD8C 2KT2A 2HPUA 2KB2A 4LF6J 5KTQA 1JLEB 1BGXT 4U7CA 2QLJB 1QSSA 4LBIA 2KG1A 4IRKA 2BEFA 1SH2A 3SBMA 4K0KF 1JK9B 1S1WA 1XMOJ 5DRKA 4EO6A 1U02A 2C42A 4O0IA 4DN9A 3H0PA 4ECVA 3PVXA 2EI5A 2GC8A 2DR6A 1D9FA 4OZJA 4L74A 1PIEA 2F40A 1IKWB 1B0PA 3GCXP 3I9ZA 4H4MA 4KO0B 1ZAWA 3BGOP 4Y6IA 5JVHQ 3GFXA 2HG4A 2MTLA 3DU5A 4KT0C 2DNYA 3UD3P 4K50A 1KQKA 1K0TA 3DXSX 2K1RA 4ZPBA 2RRAA 3D0GE 1PO6A 1XMQF 1WKLA 2MSSA 2B4VA 3VAIA 2LEPA 3GG1A 1WF2A 4N8NA 3V2UC 1C0TA 2IVYA 2P9GA 3OTBA 4M5DB 3EICA 4JV2A 5KFJA 2QN6B 2QSFA 3SCLE 4OJ1A 1QAJA 2FDNA 3FEXB 3J7YU 1SQEA 2KRRA 4RX6A 4FXDA 2PDAA 2KL8A 3IRXB 1NU4A 2M5YA 2QG9B 1SBRA 2GGPA 4G1IA 2DXDA 1BQNB 3CD7A 2YNFB 3OD2A 2E1CA 2MQOA 2NCKL 3UVJB 3TZYA 2OEJA 2UZAA 3R1HA 2OPSB 4JI4J 2ZH1A 2XMKA 4DU7A 2HZAA 1PJ6A 2Y0SD 1CBKA 1GXLA 3R5BA 2QA4G 2JLGA 1KONA 2VDIA 2RS8A 5E3PA 2HHTA 1TKTB 4DBQA 4U95A 2WVBA 1U26A 4ZCKA 1N6QB 1JWWA 4DR1J 2BJDA 3UNYA 2ZJPQ 4XIUA 4DV1J 2A6OA 1MU2A 1CJKA 4J9KA 3BH6B 1NBEB 3BDEA 4DEZA 4ZVHA 5KT5A 3PFEA 4LIWA 5IC6B 3T5HA 3T5JA 2CPYA 1DJ0A 3VAMA 1BQNA 1PC5A 1TUGB 1RBOB 3DLEB 4MYUA 2MB0B 4TXSA 1K73T 4ED1A 2VG6B 3RZAA 1HBMB 1GTHA 3M8WA 1AT1B 2O1PA 3A13A 3KLEA 1RHKB 1JLGA 1S6QA 1S5ZA 3M6XA 2PEHA 1RWUA 2RE1A 1RAIB 2XMMA 3VQTA 4QWBA 3LAKA 2UUAJ 2XMWA 3GB0A 4C97A 5HMYA 3R8YA 5GAEI 1DFDA 3DM2A 5D0EA 3LP2B 2Z58B 4LSNB 4DCJB 1JLCA 2D1CA 5KFHA 5HBMB 2YNIB 2RAQA 4FF2A 1TKXB 2M3DA 3ZFVA 5DG8A 3AJ1A 3H7HB 4A8MP 1LK7A 3TYTA 1FNXH 1TKXA 1XMBA 2WZ1A 4Y0FA 3MM5B 4JYAF 2B9XA 2UVWA 2HVZA 1QDUB 1QY7A 1H7WA 3GZ7A 3MPWA 4DX8H 3DLGA 3KKFA 4ES3A 2XYGB 4LRFA 4LF5J 3C14A 4CM2A 2QA4S 1FWLA 2IIHA 4C8OA 3BM7A 3IP0A 2JX2A 4WU2A 4TY8B 4I2PB 2CA9A 2RQCA 3IMQJ 4I64A 4DQSA 5G0RB 2GHWA 2JHEA 2ZNYA 1FJGJ 4PXBA 3PIPQ 4D3HA 1EP4B 1QUPA 1R8HA 2QJ3A 3GPAA 2MKYA 2V94A 2XCPA 4LF8J 3QGIA 2LXIA 4K59A 2XBPA 5CYJA 3K5MA 3KNGA 1DQ8A 2J7KA 3ZZYA 1TL5A 1PYTA 2CNOB 4PG4A 5KT3A 4TU7A 4CIOA 1KSPA 1UVJA 5KFDA 2CQGA 4KSEB 2C2OB 2OO4A 5ETKA 3RW7A 5I3QA 1VBYA 3DLKA 4JI0J 4OI2A 3V5RA 4NXMF 4F67A 2MHNA 3IWLA 3QT6A 2HMIA 1J27A 4ED4A 4X62J 3NLCA 2KM8B 3MCSA 4J7CA 4NOHA 2V2KA 2V9WA 2BJ7A 3FK4A 3UR3C 3H25A 4DCOB 4HHHA 5IWAJ 3VZHA 3MECB 2WB4A 2DY9A 3PDNA 4ZP9A 1TK0A 2CQ3A 5GVQA 2VPWB 1VQPS 4M5GA 2J9DA 2H3EB 1OYDA 4CLSA 2IMWP 1ZTWA 2V8VA 3FSXA 4O4GA 4ZS6A 2AX1A 1WOSA 1T8EA 2ZZNA 3QT5A 4IH7A 3ZTQA 4DZDA 4HDGA 3HVWA 5C25B 1IBMF 3QJJA 4PG7A 1S4FA 3TA0A 4C48A 5C42B 2VONA 1I3OB 1KHWA 1SXLA 4QU6A 3QNWB 2AGQA 3PY8A 2ZUGA 3CJ4A 1IBKF 4ZVSB 1R0BG 1ZM4A 1RZMA 2PD1A 2ATCB 2PI5A 1GXUA 1S0VA 2DNKA 3QT8A 4Y2CA 5F8MA 3VCDA 2C2ZB 3RR8A 2IAJB 1VCTA 3KLVA 1NUEA 2QGFB 4MKVA 1XC9A 1S1WB 4LSNA 2OSQA 2VD3A 1VISA 2VHGA 3K89A 3DHWC 3MOJB 2EKYA 5KFUA 3ISZA 3PW7A 4RUBA 2OPQB 4LF4J 3EM1A 3BGRB 1GT8A 4DSFA 3BGUA 4TVAB 1IKWA 4TLRA 3FRZA 4J9NA 4PUOA 5HANA 3CULA 2M88A 5LM7E 2KDOA 2MKCA 2E1RA 2YKPA 4OMFG 4DV3F 3I0SA 3OTOF 2X1AA 2XZDB 4U6PA 1JMTA 3PX4A 1DTQB 3DCAA 4YY3F 3FNNA 3SEOA 3J80U 5HP1A 1VMBA 4WFXA 3M8SA 1AW0A 4ICLB 1RT7B 1WSRA 2HVEA 3R7BB 4ECXA 2QL7B 4HDHA 3ILJA 3DOLA 1M90T 1FRKA 2J8SA 4QPXA 4G65A 2B4UA 2C2DA 1VQ9S 3EWGA 2R7SA 1X4GA 1L3KA 1EHWA 4IG3B 3G82B 2QFJA 2NQPA 3UVJA 5LJ5Y 4ICLA 1SJ4P 3CCWA 1RHJB 3PJWA 1M1GA 4WU3A 3UE2A 2QE5A 4KGXB 5E3AA 3KG4A 3ILLA 3VAKA 1O6XA 2ZUAA 3CC2S 2E5LJ 4M5NA 4I0WA 2NR0A 2HBRB 3JTOA 4X64F 2ZH4A 4RBUA 4ZK7M 3IR7B 3U27A 3LAMA 3P45B 1JX4A 4DR7J 2QLFB 2R8KA 3LF0A 5H9EK 2ZBQA 1T3OA 5KT7A 1NKBA 3D2WA 1J2VA 4IG3A 3G82A 2D3UA 2YX1A 1G7CB 4MKYA 4OZ3A 5D4LA 2DGWA 2IRUA 3QFHA 4LRBA 3I55S 3D6MB 1Y0HA 2KM8C 1U47A 5K5MA 5A8RA 3TJ8A 3EGZA 3F56A 4XO0A 2BDPA 3UN2A 2W7AA 4C8MA 1SKRA 2OD4A 3PHTA 4CH7A 2MQPA 1RT3A 4O44A 1ZA1B 3TEHB 4MIBA 2C28A 2YH1A 4ERDA 5GAHI 1T3NA 3CMQA 3N6LA 1KTVA 5C2CA 3O44A 4JI2J 2HNYB 5HQLA 4Z37A 2QL5B 1BC6A 3UDVA 4OIXA 2YWGA 5C25A 1FK9B 2WONB 5FIIA 3I9V9 4NLSA 3ZZUA 1W7WA 3THPA 2LXUA 3OLAA 4CYUB 4B08A 4DQRA 1HNWF 4X4NA 2AV5A 2LDYA 2LFVA 2WK4A 5HI7A 2LQBA 2VU5A 3RB3A 1T11A 3LP1B 3MM6B 3JSBA 4O44B 2IAJA 2OJ3A 1B64A 3H20A 3LWLA 4DFJA 2XWYA 3DI6B 5JXSA 3QRPA 4RW9B 2E5JA 3K8VA 5KFYA 3G71S 4QJVA 1HBMA 4RNMA 1YZ7A 4MAKA 4F2RA 4KPYA 3DRRB 1SC1B 4I68A 1LFPA 1Y7PA 2J0WA 4NMLA 5A8WA 2R8JA 3C6UB 2ZITA 3GSIA 1PJ5A 1WTFA 2YVSA 5KG0A 4DPUA 1VC5A 1DTTA 3FKBA 2ROGA 4B3OA 3MCNA 2DNMA 4LFAJ 4EU0A 4W90B 4IUFA 4PXDA 4I6YA 4Q7AA 3SXLA 4F3MA 3MUTP 2IY5B 1GMWD 4LQ3A 1LFWA 1X60A 2CQBA 5EN1A 3WC2A 2ZFHA 3ILOA 4ED5A 4RU9A 2GJFA 3KK2A 1VIXA 4BC9A 2XG8A 1UVIA 1UJ5A 2CPFA 2NZ4A 1IJFB 3GYXB 3GP9A 1FD2A 3CXCR 4L3KA 4RU2A 4USIA 5JUMA 2GO8A 4ZPCA 3MD3A 1RWPB 3ISND 1REGX 3KLFB 2B7BB 2Y1LB 2BJ8A 1Y11A 2AKWB 4AXJA 2RH3A 3RYLA 2JRSA 1KWMA 1NB2A 1X4DA 2CPIA 4O0NA 2WCXA 4YY3J 2ILZA 2MQLA 1SH0A 4P73A 3BJYA 2UUBJ 3IG1A 2DK2A 1FESA 1Y9OA 4DV3J 4NXNJ 2V6AA 2HNZA 1TVRA 2VG5B 1IR0A 2N3LA 1U1PA 1SJFA 5AJ3J 2F8HA 5CAAA 1RTIB 4O23A 4H4MB 3EZUA 7FDRA 1Q8BA 1U4BA 1SL2A 1ZS6A 2Z8QA 4IOBA 4K4TA 3WQPA 2MZ1A 1YBUA 2BJ9A 2O01C 3A8IA 4OYPA 4C11B 4C3LA 3E51A 4YMEA 2A10A 2ZC4A 4RUAA 3GIKA 2CJQA 3KHLA 4ED8A 2DNZA 4B3MJ 1ZAXA 1S1TA 1DLOA 2HBZB 3OT9A 3IGVA 1R8BA 5BJRA 3KHRA 3TQEA 1JXLA 1YBTA 2G2ZA 2NSBA 2QRRA 5A0YA 5A2QU 2YKNA 3C15B 4DV4J 1IBKJ 3I82A 4DL4A 3IAS9 2C22A 3K5OA 1TZ0A 2FHMA 4P72A 1Z2ZA 4TYAA 3AA8A 3QLHA 5B0AA 4RW8B 2DKOB 4IR1A 2DNGA 1Q86T 1IBMJ 3D68A 1KVKA 1B70B 2N3OA 4A47A 2NPIA 3WZ0A 3T6JA 2F7VA 4DG1B 1FERA 3W9HA 1Q95G 2JC0A 3IFEA 3L4BC 2H4WB 3FC9A 4K5SA 2VODA 2G1DA 1T03B 4QR0A 5CYMB 4M94A 2YH0A 2M8DB 1TK5A 4HI1A 4KQZA 4DL2A 2G0JA 1Y3KA 3RJMB 1BMQB 4NWBA 2HHQA 2CQIA 3C19A 5CCLA 1UA0A 1J5EJ 4OYZA 1OPZA 1VHFA 5K8OA 4HKQA 4DV6F 4B17A 4EFAC 5AE3A 1YLXA 4C8NA 3OUYA 2W2PP 2RU9A 3M8RA 1TP7A 2VQEJ 3PX6A 1FDNA 4I6AA 1UA1A 4AD6A 4AL5A 2HW3A 4DG1A 1WHXA 3FEYB 3K59A 1IR1A 1RISA 3F41A 5EX3A 4WKRA 3D3BJ 4JI0F 4NA1A 1JLAA 3M8YA 2V2VA 1CQMA 1SQGA 1FX2A 2DJWA 2LCWA 3GR0A 2DHXA 4MFBA 2Z4PA 4JI8J 2MJUA 3HDSA 2MQQA 2IC3B 2AF6A 4ID5B 1C1BB 1S6UA 4PQUB 4ECUA 2POKA 4J9RA 2K3KA 2V4JB 3MM7B 4P7VA 2KVIA 3QPIA 3LA0A 1NJIT 4J9QA 4TQRA 1RYRA 4OHXA 1ZBTA 3T1YJ 3FMWA 2OPPB 2AGOA 2YBVA 2JDJA 2FJVA 1SIWB 3MM9A 2ZEJA 3MR3A 2XLKA 1T7PA 2KZMA 4FVCA 1FDDA 4EUVA 4X4UA 1F1BB 4ZLNA 2W9BB 3C46A 1W2BR 2AJ2A 3NCQA 4MK9A 3UN5A 1HBNB 1GMVA 2B8QA 2KZZA 2W9CB 1KLNA 4JYAJ 1M0SA 3OV7A 3BO4A 4ITSA 1K47A 2F9JA 1IBLF 3ITHB 3EVWA 3C14B 4YB5A 4Q0BB 2BE2B 1HMVA 4DS5A 1XK8A 3EDRB 3MM9B 5CZXA 2VA2A 1FFWB 2HNYA 1BXNA 3I56S 4CDIA 3NNHA 2J0XA 2ZDOA 4ZVRB 3AQOA 3DYAA 1RWMB 3IA0A 4PPDA 4K4XA 2ROPA 3MMCB 3CCES 2AYEA 4NCAA 2E1AA 1YI2S 1RADB 4JP8A 1RT6A 1S9EB 3RG6A 5L9NA 4ER8A 3IWXA 1N0UA 2HRTA 3KK3A 1Q79A 2XYHB 1HW8A 3AB2B 2RRBA 3DDIA 4FPIA 1Q8IA 1PSDA 3DMJB 2OGUA 3C66A 5ETVA 2BQRA 1WORA 1VQNS 3A3NB 3NMAA 4I7FA 2CXEA 2AZ1A 4KIAA 1SC6A 3BGFA 2GJ2A 2VFVA 4EYIB 1NKCA 4CLUA 2R7UA 2MMYA 2GCFA 1U1KA 3V4IB 2IM1A 2WRMA 3P5BP 4E2FB 4ZVUB 1HARA 5M2PA 3FCVA 5F8GA 1UEKA 3AD9C 1ZA2B 3JB9k 1U1LA 4ZLLA 3MGJA 3NXZA 4YB7A 1ZZFA 4YS2A 1SUQA 5CABA 5C24B 1NDKA 2EWHA 3T41A 1ACMB 2L3MA 3TWZA 2R8IA 4PXEA 2ASYA 2AYGA 3CJ8A 3RAMA 3PYFA 5G0RA 1IQTA 4X4OA 4AYBD 1YQHA 2Z0GA 4WFAQ 2BXJA 2FTRA 3B4DA 3OR2A 4WZQA 3RTVA 1PCAA 2ZNZA 4JI4F 1FA0A 3GFZA 3EVOA 1M5PC 2BKNA 4YR0A 2J6SA 3AB4B 4KHMA 4W4MA 2RRNA 2OPSA 2NLWA 2YNGB 3CJKA 5KOXA 2W1BA 2KXHA 2WTFA 3H8YA 1HWLA 2JZ5A 3HSDA 2CPDA 3SCKE 3L9ZA 3KXDA 4O4RA 2JFDA 4ZVPB 4DPWA 4K7QA 1R6YA 1S6PB 3PJXA 1WOPA 1YKWA 2WHOA 2CZVC 3PW0A 2IDLA 1MMDA 1N0VC 3D54A 4P10A 2GQ2A 4RPFA 2RUSA 3Q8VA 1P27B 3CCSS 5DG7A 3H98A 2VA3A 1QAYA 1X5TA 2XO7A 4RNNA 3RAXA 2X3DA 3H5XA 3CT9A 5CYMA 2H1YA 5HQMA 1AFIA 2RQ4A 4JV1A 3MTJA 1Z2LA 2QA2A 8RUCA 5KT6A 2HHUA 1YITS 1RU1A 4OX7A 2OUGA 2NS1B 4LFCJ 3OJUA 3BQ1A 1RT4A 2AZ3A 3QATA 1WG5A 5KFMA 1IBLJ 3UDLA 3KJVB 4H54A 2WSEC 3MZIA 4K0KJ 1RB0A 4DOZA 3NS6A 1UW4A 4KH0B 1NSPA 3SIPB 3UCGA 3UWTA 1T94A 2DO4A 3M32A 4TNOA 2OMOA 4UOHA 3S7RA 4R0JA 1LV5A 4UY8T 2MZQA 1IM4A 2YNIA 2D41A 1KOHA 2MQ8A 1IKVA 3FSYA 3SDEA 4DMZA 5KT4A 4DSIA 1KNZA 4ZP7A 3CMAS 3BN4A 3U1MA 4ZCIA 2IM3A 2W8LA 1L3UA 3QBCA 1PAUB 2CKWA 5CD4H 1CULB 1VQ8S 2DXFA 4OYAA 2BANB 9ATCB 5I42A 4F4XA 4IQXA 5MLCV 1RK8A 2GA7A 2OLWA 5CYQA 3WHIA 1OY6A 5HO4A 4Q5VA 2RF2B 3HKZD 4CNZA 1ELOA 4DSLA 5E7OB 1F5BA 4NL5A 2XSJA 3OTCA 2MGZB 3BO2A 3M6WA 3R9LA 1L3TA 3LO3A 2IJRA 2RS2A 2DT9A 3QWPA 4EBCA 3AOBA 2KXNB 3MAHA 1D1UA 2DPIA 1WHYA 4Y2AA 2Y3YA 4I69A 4KY3A 3BH7B 4OHZA 4JI3J 1SV5B 3R7NB 4KH1B 3QRRA 4HHUA 1NSQA 3T1HJ 2XNRA 1RAAB 2VFTA 4Q2MA 4B9TA 4GKJJ 1X31C 2FVPA 2GS8A 5KFRA 1YRXA 1WF1A 5KFTA 3MMJA 1JJCB 3CC7S 3KTQA 3LP1A 3MM6A 3HFVA 3QLHB 1KLMA 1HW9A 1MROA 3G96A 3O5TB 2R7RA 3H5YA 2HHHJ 3AFGA 1VIOA 3I96A 3WIVA 3NAHA 3DGPB 2I38A 4HI2A 4DN0A 5B7WA 3VALA 3W66A 2ADBA 1X9WA 4B3TJ 2FLOA 4HR2A 3RRGA 4JI5J 3UN3A 3K5NA 2OHDA 2QYCA 3ET6A 1W2IA 4DL5A 1Y5LB 4X4PA 3MWBA 4A4JA 3W9IA 4P74A 2O3DA 2MHEA 1RA7A 4A8SA 3W62A 1C0UB 1IKXB 4WZMA 1HNIA 2K7KA 3LGHA 5K20B 2BKPA 4ZKAA 1A6LA 1L3SA 3CNQP 3MPVA 3CJQA 3EDQB 5FDLB 1YIJS 3GLJA 4USTA 1H72C 3IAM9 2MKKA 3DFEA 1HI8A 3L7OA 4J91A 3TUIC 2Y1JA 2G2OA 2HK2A 4OHYA 2BJ3A 3R5AA 4YB6A 4UT4A 4JI1F 3MEEB 1KVJA 1EARA 1N36F 1QAIA 4YHHJ 4U96A 1B0VA 2M8HA 1JIHA 3EGNA 5ETQA 3ENVA 3NGDA 2IVMA 4YDDB 2AEMA 5AJ3F 4C3MA 1VQOS 2HS3A 4B9MA 4K4WA 3FJ2A 4LVNP 2VBXA 1O8BA 2VBWA 5CHCB 3HF5A 1FD8A 2EC2A 2IVFB 3TJAA 2ZKTA 4OI4A 3MMBA 2HFNA 1NK5A 1V5IB 3PXGa 4MKBA 4OJGA 4XPEA 1C1CB 2HIYA 2HFZA 2E5HA 2VKZG 1VJQA 4N47A 4ECQA 4IFVB 4OX8A 2V67A 1TFWA 4X65F 3SV4A 1WEXA 1KQGB 3HJVA 2KJWA 1VLYA 3M8QA 1ZM9A 3CDBA 1ZOTA 4CNYA 3RB6A 4RNHA 2DGTA 2RB7A 1HHQA 3DRRA 5E3QA 5KG4A 3QSYB 3H2LA 1ZYQA 2CQ2A 4M5LA 4XTTA 3CSKA 9RUBA 3CDUA 5BYSA 3CJ5A 4PCQA 2RT3A 4JUZA 1S0MA 3HKWA 3G8SA 2J5AA 2FC9A 1OQ3A 1WD6A 2AWZA 2Z2ZA 2MGZA 2BQUA 2G4BA 2IRXA 3M2VB 3OR1B 2HBYB 3AY0A 3F44A 4ZN1A 2YWEA 3HHLD 1WC4A 2F8EX 5ETTA 4EBDA 3PG9A 2XY5A 4FNHA 5LJ3Y 1F5AA 1UCNA 4P2FA 3I0RA 1Z1ZA 1U09A 3PYEA 4QQBA 1NDPA 3W1YC 3R5CA 2CNNB 4KGVB 2DNLA 4D3GA 5LSRA 2CJYB 1WOOA 1P1LA 2CNLB 4K4VA 1FX4A 3MEGA 1FXRA 4ES2A 1Z4UA 1S49A 1XR7A 5IV3A 5J2MA 1E6YB 1WC5A 2HQGA 3TA2A 5HN0A 3J80Y 1KVIA 5DGAA 1LWEA 2ZKUA 3HSZA 5DM6Q 1F2HA 1SKUB 2HZVA 1QD1A 1YJWS 4ALZA 2AW0A 4UZCA 2VJVA 2Y8WA 3ETMA 4Z7YA 3CDWA 5KFSA 2ZDPA 1RHUB 4ELUA 3QFWA 2DHAA 5GMKa 1HNZF 1UW9A 3A12A 4JI2F 2A6MA 2UXBF 1CC7A 1RKJA 4OZ1A 2YKNB 3C15A 4EBEA 5K14A 2UU9J 3FCHA 5FJ4A 3IBWA 4OYMA 2U1AA 3K5PA 5KFNA 2CPJA 3K58A 2FB0A 4KV8A 1RTJB 1OSCA 1F9EB 3MM8B 1I51B 3CD0A 3M9MB 4XPCA 3BSNA 2W2MP 1WSVA 2HNDA 2COLA 4GC6A 3JAMY 2ACYA 2GIQA 3A3PB 3ONQA 3HXMA 3L3CA 3HSJA 2H65B 1JB0C 2YWKA 2ZM6J 4DV2F 1DZ5A 1FJCA 5HLFA 4KJIA 1WWHA 4RW6A 1FRIA 3N0VA 4LVOP 4QBUA 3QYYA 2AX0A 3G8TA 3FBBA 3GE9A 1C4CA 2YNFA 2OAUA 1EETB 3CJ3A 1REVA 5EWEA 2LXFA 2QO3A 3BSOA 5LXRA 1CULA 2DITA 1UVKA 3GSDA 1KP6A 3NS5A 1VYAA 3DRSB 2VIHA 2WVFA 4QYZJ 4I56A 2ZM6F 5LSOA 3V6HA 1TL1B 3M05A 3SDEB 2DXEA 2F8MA 2XEXA 1SL0A 2E9RX 1UWAA 4NCGA 3M2UA 4KB7A 4CO4A 4G1QB 4L76A 3EX7B 3FBFA 2J9CA 4WPAA 5FDLA 3KHHA 1RWOB 5T41A 1PG5B 2B7CB 3W65A 4DI6A 1E6VB 1D8ZA 1TU0B 2GIRA 5DDQC 3SSQA 1OMSA 1UFWA 2BE7D 1HNZJ 1RTHB 1Q82T 5DLFA 4I67A 2JEIA 1RHQB 2J76E 2RD5C 3SI8A 3M6VA 1IKVB 1H2UX 1WUUA 1SCJB 1SJRA 5IC4B 3MM5A 4R25A 3DOMB 2RHSB 1X4BA 4I7FB 4DXLA 3HPOA 4H4OA 4USMA 3MEDB 4OI1A 2DR9A 2LQ8A 4LT6A 5L1JA 1FO1A 1R31A 3CCTA 4KRWA 1UKUA 2V2ZA 5B08A 5L1IA 4ILLA 5J2PA 3HI9A 2KFZA 3AODA 3DYAB 1N56A 4LRDA 4RWWA 2V63A 1YJRA 2DD8S 2ZH3A 5KFIA 1F0XA 1NLKL 2B8PA 3L7UA 1NJZA 2CJAA 4LF9J 4KFBB 2FJEB 2JJ4D 2OEMA 1GTEA 1RAOA 3QGPA 4O3QA 2HNZB 2VG5A 2RILA 3N79A 3VGUA 4DPTA 4WFYA 4DPYA 4F26A 5DQIA 5J2MB 1E6YA 2BKOA 2BRKA 2GAHC 4DR2J 4ECSA 1YTYA 4F3OA 2KH9A 2JVOA 1NB7A 5DLGA 1O0PA 5A8RB 1WHVA 4DUYJ 2AJQA 1I94F 3EZOA 3UR0A 4ILRA 2EG2A 2E5GA 4OZLA 2ZD1B 2G0IA 5KFLA 5L1LA 4F0HA 2QL9B 4ZHRB 1XJWB 3D0IE 3GJSB 1T95A 3JYTB 5IXUA 1FWPA 4P2SA 5C24A 2EEYA 2HMIB 2C2MB 2IBOA 3M4XA 4GMKA 4L72B 4OZ5A 3ZTSA 1QVGR 4DR6J 2FLPA 2FHJA 2HYIB 1ROFA 3BSAA 1JLBB 3KJQB 1XERA 2HVIA 1RWWB 1AB8A 5T7LA 4FYVB 1S6QB 4X62F 2X51A 4DV7J 4GO5X 5D78A 1XEZA 2RKIA 5A8WB 1KR4A 4F8RA 1Q78A 5MAOA 3H4DA 2ZHAA 1YVFA 2H48B 4DL6A 1RJJA 4G6VB 1EETA 2AJ1A 4ED2A 1LKZA 3ZC4A 1VQKS 1N33J 2QZ8A 2YPZA 3EXYA 1V9OA 2HS0A 3V4IA 3KJVA 3T1AA 2CADA 3D0HE 3HK2A 2OPQA 1HNVB 5IQQA 4CO1A 4JI1J 2ZH5A 4Q45A 4CLYA 2YX7A 4PUOB 3L95X 1Q5YA 4PAAA 2O67A 3OVSA 1K0VA 5KT2A 4WF9Q 3R3TA 2YWFA 1YJNS 4DPOA 4CO3A 1WELA 1KOOA 4DQQA 2PA8D 2IYIA 1HNVA 2P6TA 4HT5A 1CSJA 2XHWA 4NYPA 5F3ZA 4FF1A 1AZSA 3NG8A 2VG7B 3W60A 4LUBA 2NZCA 3AHPA 1S10A 2KFNA 1MNEA 4A8XA 4JI5F 1AZSB 2V9KA 2W01A 3UPFA 4DLGA 3MM7A 2VH7A 4UUWA 2CG4A 2E5IA 2VL1A 3ZTOA 2HQDA 1XNQJ 2J0SD 4N56A 4HL9A 1BD6A 4P9SA 2K1RB 4CI0B 3QSIA 5GMEA 4QIWD 4F4WA 2WSCC 1MW7A 4P52A 3T9ZA 4WE1B 1GX6A 2OI2A 3W7BA 2W9BA 1HPZB 2BE9B 3W5YA 2CVIA 4RR5A 2DR5A 1S1UA 5EDWA 1SH3A 2XS7A 2KRBA 3MDFA 4BHQA 1G3OA 2ZH7A 3IS9A 3KLEB 1S7HA 2AEFA 2BR0A 5KFZA 3M2UB 2H4YB 3UW1A 4HACA 1N34J 2XS2A 2R4FA 1KS2A 1UFKA 3Q23A 5HVFA 4HVZA 1ZTTA 1VC6A 3Q83A 4C0HA 1BQMA 2PA3A 2QT7A 4GO7X 3W8PA 2UVVA 5LL6d 1N54B 1UMJA 4IRCA 1XQIA 1MSWD 3M7VA 2CQPA 2HVDA 1ICEB 2Z56B 2BANA 4OYIA 1YJUA 2CPEA 4NZ6A 5E3CA 4B9NA 1T9VA 1OSDA 2VDHA 1CQNA 2XYPB 2K06A 4I2QA 4PR6A 4E0DA 1FVQA 1V3RA 1VJWA 4FXWA 3W2WB 4CH0S 1MN7A 1EQMA 4CLFA 2FZGB 4BC7A 4TU8A 3CUNA 4DR1F 1HIYA 2CRLA 1BLUA 2E7WA 2GGPB 5EWFA 3DI6A 2DGXA 3DN9A 1R8AA 3Q8QB 4QWEA 3BQ0A 4FS2A 3TP2A 1TV6A 2CPHA 1R8PA 1N5VA 4WIQA 1C0TB 2YQ3A 2QLBB 4WIIA 2G1HA 2GNKA 3E2EA 4B3OB 1LW2B 2HK3A 2XMUA 1FNMA 2ZZTA 4S0MA 1Y4ZB 2JLEA 4BBYA 4F0KA 1KHVA 1RWNB 2ZBRA 2K3IA 5H1SV 5I4MA 4N5SA 5HATA 2W7OA 3PW2A 1FK9A 2WONA 1UFLA 3JTPA 2CNKB 2P2CB 4RW9A 4LFCF 3CEDA 3QJPA 4RJVA 4UF4A 1PBAA 1XNRJ 4KHPJ 4DFPA 4FYYB 1BUXA 4F50A 1WEYA 4DR5F 1S0OA 5HJYA 1D0EA 4DSEA 3VGTA 3GIRA 3VAHA 4DUTA 3ICLA 2R2TA 1VBKA 1NM2A 3K17A 1X5PA 3ZNUA 3P3DA 2WVDA 5A8KA 3IG1B 5D6GA 3E01B 2ASJA 4B3MF 1X9MA 3DRSA 2FGOA 2V8GA 3GFYA 4NA3A 1S1VB 4OI6A 4EMDA 5L1KA 2VG7A 4XDDA 2E1MC 2KO1A 2HS4A 1S57A 2LEAA 3DLHA 1KN6A 3MECA 1U2RA 2A1BA 1LK5A 3G87A 3MAQA 2E66A 3DGVA 4QYRA 2HWIA 3POTB 1YHQS 3PYGA 3TRGA 5DQHA 1VRTB 3M8PA 2B51A 1KEKA 1LW0A 2LA6A 1E6VA 4QIEA 1N5YB 5HROA 2B5JB 1OQ6A 3A3OB 3PCOB 3BBBA 2NXCA 2V34A 1JXEA 1YJVA 1HWIA 4EK2A 4B9SA 4B9VA 3R2DJ 4LMZA 4QWDA 5D3GA 4QIFA 3M6UA 4OFZA 4E98A 1TMMA 5LMNJ 2FVCA 1NHKL 2CJ9A 4WBFA 4F04B 2H51B 3R6LB 3CIMA 2GVDA 1VOMA 4RW7A 1T0TV 4PABA 1N32F 1WHWA 4CO0A 1LWFA 4ZPAA 3HVTB 2WOMA 3NS7B 4OYBA 5K8MA 4DR3J 4GKKF 1IM6A 1HWUA 1XIQA 4Z7CA 3Q22A 1U49A 1LWFB 2OKQA 3UQSA 4LF7J 1G2EA 1SL1A 4ZITA 2DNPA 5IV4A 4P2MA 2B4PA 1FKPA 1B4SA 2MJNA 4KAIA 3B78A 2VOPA 1YK9A 2UXDJ 2BOAA 1H2VZ 2EBEA 4OYOA 5DETA 8AT1B 5KG1A 2MY8A 4USWA 3UNGC 4I6WA 1TMJA 1WJ9A 4ZPTR 1NPKA 5LSLA 3HHLB 3K5LA 3GG0A 3BBFA 5F0UA 1P9YA 3UCZP 4WXWA 2DIVA 3D6HB 3G9CA 1RWXB 1RT5B 2L08A 4RWXA 3I5CA 2F65A 4FP9A 1P6TA 1HI1A 3B82A 3BSCA 5J1NA 4LBPA 1N48A 1CVJA 2QYGA 3TR5A 4F4KA 2YKMB 2XMJA 1CEZA 4USJC 1RT3B 5ADZA 2VFSA 3VV2B 5ITHA 2JEGA 1UVMA 2F9DA 1FE0A 1DAXA 3EJMA 4LREA 4U8YA 1HQUA 5CA5A 4O3NA 4K2XA 5B0DA 2V8PA 3IBCB 1N4LA 1YJ7A 4CCHA 1EJ7L 1OY8A 4PQUA 2HKEA 1Q16B 4UQTA 5IT0A 3Q8SB 1X0FA 1S1XA 4BWMA 4RUHA 2BJ1A 2MZJA 4TQSA 4MJKA 2ADCA 2XGPA 3D4JA 1SIZA 3CIZA 2XGQA 3QZ7A 4AQYJ 4JI8F 1RHRB 1HBOB 4KBIA 2CQCA 1F9FA 1N88A 5GMDA 3S8SA 4QCLA 3KYLA 3THVA 3DRPA 2XNQA 3HVRA 4DR4J 3M30A 3RRHA 2AJ4A 3ETOA 4PEOA 3ZNJ1 2D3O1 4O3OA 3UCUP 4JI7F 1LW2A 3VGVA 1LOUA 1R3NA 1WACA 3M30B 3H5SA 2R2SA 2ZBIA 2FVQA 2VQEF 5IZHA 2R8HA 4IOCQ 3VVTA 4DV6J 1MMNA 5ETSA 3TQ1A 3RBDA 4G1QA 4RW4A 1D9AA 1H6KX 4ZVFA 4C98A 4RZRA 3OL8A 3D66A 1UPMB 2DNQA 3M9OB 2HHWA 5HP1B 5CQGA 3THTA 2DR8A 1TTHB 2V2QA 5I42B 1OO0B 1ZZNA 3MMAA 4NLOA 2B4OA 2F4VJ 2I8EA 2DNNA 3FQLA 1VRUB 3OHAA 4HLBA 3TVZA 5F8LA 4CTAB 4HYKA 1U1RA 2GMLA 1ZAVA 2UXCF 4H4OB 1R8CA 1SQFA 2PGCA 3V81B 1GNKA 1HBNA 2XM3A 2DH7A 3RBXA 1V3ZA 2DPJA 4ZJOA 3LGNA 1HFEL 2W4DA 2LU1A 3KHGA 3VQSA 2CDRB 3BDPA 2BV3A 5DS7A 1FRLA 4Y3CA 4V19J 5J1EA 5KFCA 2APOA 2J6TA 4F4YA 4MT1A 1NH8A 1HD1A 1LNQA 1YBAA 3BQ2A 2DGQA 4DUZF 2R3VA 2BW2A 2GJIA 3NAIA 3NOCA 3MEDA 1CJUB 1N5QA 2C3YA 2EFVA 4YR3A 2F4FA 5KFQA 4DUZJ 3J7A1 4O3RA 4QZVB 4HT7A 3L7PA 4GC7A 1TELA 2MLZA 3N5BA 2EFQA 5SUHA 4BCAA 5J2NB 1Y00A 5IM0A 3SV3A 1PKUA 5J1EB 4P2XA 4GKJF 2L9WA 1HNXF 4NLVA 2R7VA 1UWBA 4CLLA 4YDXA 4NXNF 2NXUA 3C16A 1YZ6A 3FEZA 1IBCB 3BR8A 3PFOA 3QQCD 3OL6A 4C8KA 1YG0A 2JL9A 3CJ2A 2EC0A 2Y0BB 3OXGA 2KHDA 4FDFA 4G1PA 2UXCJ 3BZQA 2F63A 2GIFA 3DXBA 3I32A 3RUBL 6FDRA 3ZO7A 5EGYA 4ECZA 4OL8A 2DVIA 1RWKB 4DQPA 2PC6A 3N4WA 1S9FA 2PI4A 3Q2TC 1UVLA 4URSA 4A8FA 1D8YA 2FY1A 4ETXA 1H0HB 1JXVA 4ANCA 1H3DA 2MZRA 3CE8A 3DLKB 3DOKA 1SB6A 1T9XA 1Q4RA 1UZHA 2GHVC 1KBRA 3F0NA 1KQSR 2DB1A 1LW0B 3BEGB 3OR2B 2X1FA 2B56A 1S77D 1KRPA 4Y65A 4KGZB 2D9PA 3ADAC 3BF4A 2XLJA 2FLLA 1S12A 4LFAF 5EX0A 2WB1D 4ETZA 1CJVB 4M8LA 2AT1B 1RXOB 5KFOA 1L5UA 4ZN3A 4J9MA 3A8KA 3DOKB 5HMXA 3DLLQ 4O3PA 4ZHRA 3U7JA 3ZTRA 4DX7A 1WNEA 1R27B 1S6OA 5F9LA 5DDOC 1CJTB 1TUWA 2ZE2B 3JSMA 3JTNA 3NP5A 3QIDA 4AQYF 1U1OA 2FVRA 2U2FA 4ZLPA 3MTKA 3TZWA 5B0GA 4C11A 1B99A 3KNAA 2ILYA 5J2QA 1VBXA 1HWJA 5E5NA 3LQVA 2DO0A 3LOUA 4HTJA 5KG6A 3ULHA 1NKEA 1VQ6S 3GYNA 4NLUA 5LMUF 3VTIA 3I6PA 2AD9A 1HNWJ 2ZBCA 3G4SS 2WVCA 3A1YG 2FJWA 2JEJA 5C7PA 4DSJA 4IRDA 1B3TA 5L8RC 4R0EA 1VR6A 4URQU 5AE2A 3G6VA 2M2BA 3NBPB 2OMLA 1FKOA 1RWVB 3JQMA 2VB6A 3GJTB 2I5JB 2X1GA 3NGTA 5L9XA 4EZ6A 1EIYB 1UAWA 3HCXA 4OX9F 1FNOA 4M5DA 2HGLA 1VQ5S 1PILA 1R43A 4OI3A 1NHVA 1U2FA 1P9QC 4FXVA 3ITHA 4OJHA 4KR0B 2I9SA 2N4CA 4JV0A 3TVYA 4RO0A 1VQYA 2LQ9A 1Q0NA 4USHA 5GAHU 3CCVS 1VK8A 1YRTA 2HWHA 4R8UB 5JVGQ 3NNAA 4C6AA 1N8RT 3LP0A 3QIPA 3DDNA 4CT8A 1VQ7S 1VLOA 1RT1A 2VPYB 4PG6A 2FJBB 2QSWA 4JI6F 3ZZTA 4K2JA 4EO8A 2VKRA 1GMWA 1HKAA 2X1BA 3TA1A 4O3SA 2UXDF 1CC8A 1JLQA 4KGMA 3BO3A 1NSKL 1G6BA 1BWVA 3TX8A 2LQ5A 3DRYA 1D3WA 3HFKA 3IM9A 4CO5A 1T9UA 3OLBA 3QGGA 5HVGA 3TANA 2E5LF 3BBCA 1YSJA 3DHXA 4CLPA 5HQ8A 1JLAB 5H9FK 2FHOB 3BGLA 2Z2MA 4WXOA 2VF3A 4YN3B 3US5A 1XTZA 1K9MT 2DIUA 1EB0A 4HTIA 1VGYA 5LMNF 1RT1B 4RNFA 1T9TA 1BHNA 3H4BA 5F8JA 1DRZA 3TAMA 3HVAA 5FLXU 5T14A 1X4FA 2YPYA 4KE5A 1WG1A 4PRFA 3EVMA 4ATNA 3CCUS 5F8HA 3K2YA 3KLHB 5KFXA 3MUMP 2W24A 4AL6A 4LQ9A 1I6JA 2DTJA 4FNIA 1TKTA 4Q44A 4LFBF 1RLDA 2P5VA 3OSPA 1VQSA 3BKUA 4NPOA 4XAKA 2EW9A 2EFGA 2ZWOA 3E8OA 1C0UA 4YFUA 3TAPA 4UOCA 2YNHA 1PGZA 4A8WA 2QMXA 3R5GA 3OSNA 2MYFA 2W9CA 4FF3A 3T19A 1U0HB 3M9NB 4FKYA 3K57A 4RW6B 4Q43A 2EFPA 3TUJC 3A8JA 2DYAA 5EHHA 3AT1B 1SC3B 3IC1A 4DF4A 3PW4A 4PPZA 2VV5A 3GU0A 3CCLS 1IQZA 4DLEA 2PMWA 5K9FA 3G2XA 4P6QA 4ZJQA 2J0QD 4A48A 5J2QB 5DGBA 1TL3A 1R0AB 4TKTA 4ID5A 4DR5J 3CWJA 5D0RA 4ZVGA 3HM9A 3ENAA 4YUDA 4ZMMA 1U1NA 1JLGB 2QFIA 2RVJA 1MMLA 1XNRF 4KHPF 4TY9A 2FZCB 2V50A 1HHTP 5E2QA 4N77A 2GQQA 1Q7YT 1NDCA 1RTHA 2LDIA 1NK6A 3QO9B 2CG8A 2O66A 2OPPA 4K4ZA 4X4RA 2ROEA 1RT2B 4A8OA 4ED3A 1BY9A 3EPIA 2VQFJ 4C2MA 2XY7A 2L41A 2QMWA 3HHDA 5HBMA 1WC6A 5HMWA 2Q66A 2K8GA 2IC3A 4B9UA 5CYQB 2ERRA 3OJSA 2V4JA 1D9DA 2YQ1A 2ZE2A 3O3LA 3KLFA 4X4TA 4Y2MA 4DL7A 4G3IA 2MKHA 1VQLS 2PMHA 4NEZA 1N5YA 1SC4B 4EEYA 2HVHA 1KFDA 3JSYA 4NXMJ 1X4EA 2Z57B 3H5UA 3HZGA 4PKDB 3CCMS 4ECTA 2ACMA 4NI2B 2EG1A 4PWWA 3PO4A 1U2CA 2ZD1A 1KTQA 1U1QA 2DR7A 4LF2A 3UO0A 3NGSA 2VBYA 1IR2A 4M5IA 4UTGA 1VI7A 1R7IA 2LP4A 4RW7B 2ZVSA 4PG8A 5IT9U 3I5AA 3KDNA 3HLUA 3TI0A 2MQMA 2PN6A 3RBZA 1VHIA 1I5OB 1U25A 3VAFA 1CPZA 3ISNC 1FJGF 3EPGA 1TUVA 4NE9C 1Q7LB 5HL7Q 3HZEA 2NYIA 3GIJA 2B6AB 4PQAA 1UETA 4KGKA 1FEEA 4AFFA 3HX9A 1GK8A 2XTJP 4LF5F 5F41A 2IBKA 5SZTA 4RW8A 4YQWA 4ZP8A 1EX8A 4PWUA 4PYDA 2R7WA 2I2YA 3OTDA 2IMOA 2OPRB 4I4BA 1Y10A 5CZVA 1GH8A 1YDLA 3CB4A 5HK4A 3CMES 3CCRS 1NMEB 1FDAA 2HHSA 1RI7A 3TNVA 1D09B 4NZ0A 1PJ7A 3UFCX 4ELTA 3LGMA 3AXKA 4WYLA 2QLXA 3FMBA 2YQ0A 2ZH6A 1FVSA 2JWNA 4KO0A 1IN0A 1X5OA 2DBBA 3ZZ0A 1I1GA 2B0GA 1S9GB 1WC3A 1LWCB 4LR9A 3EZ5A 2EFNA 2H5IB 3GILA 3WX8A 4RLEA 4DJBA 2UUAF 4NCBA 4LRAA 3WDOA 3J7AN 2CYYA 3ENQA 2OTJS 1S59A 2Z2LA 5G4DA 2CZ9A 4EYHB 4NRUA 3PR5B 2D3ZA 2M7SA 4L3NA 4W92B 2A18A 2YNGA 2UV8A 3QMQA 1C1BA 4WP3A 1OJ4A 1AYEA 1WC0A 1S79A 2XULA 5KFGA 6AT1B 2HHXA 3TX0A 1A9NB 3KFWX 1HYSB 4MFBB 2V0NA 3JSMB 1N33F 1MU2B 3OXLA 1P1TA 4CT9A 2M52A 2ASDA 2E9TA 1UL3A 2FJAB 1QE1B 3D1HA 1M5HA 2BM0A 1BE4A 3MPDA 2M4MA 3N28A 1JLFA 1HBUB 2NXNA 2VC1A 4DPXA 4UQGA 1IXKA 2XO6A 3VWSA 2VG6A 4DV7F 4DQIA 3HJFA 3GJRB 2ZWPA 2GW8A 3MPYA 1Q1KA 3KK1A 2D74B 3GIMA 2H5EA 4KTQA 5BR8J 2UP1A 2VASA 2DEIA 3T9NA 4FF4A 3EMTA 4DR6F 2IM0A 2KXFA 3S01A 2A3JA 4ZOSA 3CJRA 2FIUA 5F8IA 1QE1A 1WDDA 2BBEA 2Q3PA 5HROB 4WYWA 5HSPA 4F7VA 2ATLA 2CWKA 2BOPA 4U7UD 3I5BA 3SMZA 5DQGA 1NJWA 5DM7Q 2MKJA 1UVNA 1J5OA 2V8HA 4N8OA 1S9EA 4HHJA 1FKAF 1HQ2A 3MAAB 3MEEA 3T5KA 2FHKA 2EKNA 1Q81T 3SQGB 5D15A 4TY8A 1K44A 2NPFA 2H54B 4ED6A 1U6FA 1NK0A 1UJ4A 2HGMA 3QT7A 2BA9A 2DNRA 4KKOB 1EP4A 2RDDA 3W61A 4DDFA 2HQIA 3S6EA 7FD1A 3LW5C 3PV8A 5GAEU 1Q5VA 1AROP 2M9KA 2MQNA 3KDOA 3I4PA 3JSRA 3DM2B 4USUA 3MUVP 2AYBA 3V6JA 2FLNA 1B7FA 1FRMA 2AHOB 2HQCA 1CS4B 3QAUA 2W8KA 4LF9F 1U6ZA 2XS5A 1F3FA 2C1EB 2YY3A 4WE1A 1T9WA 2DCUB 2IFXA 3A4TA 1N52B 3LPYA 3ILIA 3NCPA 3FSIA 4LF1A 5KFBA 1WEZA 4NYZA 2DGOA 5F3TA 3HT0A 3HT3A 1XMOF 2CIMA 5I3UA 3QZ8A 2DH9A 4BWJA 3W2VB 4DV5F 1Q53A 3OL9A 4V19X 3P6YC 1NK4A 3SZ2A 1QUVA 4LF6F 5I3UB 2M0GB 5HJXA 4DL3A 3V6DB 1N32J 1FXDA 3SFGA 4AL7A 4OV1A 3MFHA 4NASA 4QU7A 3CF5Q 2GMHA 1AA1B 3CO9A 4LFBJ 1NZ8A 1RLCL 3D28A 1CS4A 1KDNA 4IR9A 2EXUA 3UI3A 5T7LB 3TZXA 4I2QB 3R27A 2J6UA 1APSA 1R0CB 2ZVIA 4Y2IA 1JLBA 2PMZD 2Q1LA 4U8VA 1NJYA 2R7TA 1ULRA 2DHGA 1F9HA 5THWA 2FY8A 4LRCA 3W9JA 5KG2A 4F4AA 4LJMA 1CG2A 4J9SA 4YR2A 2HAFA 2ZOGA 4TU9A 2GO9A 3VVUA 4K4SA 2FD2A 5BYRA 3BV8A 3DLJA 3W63A 3IGNA 1U1MA 1S76D 4PG5A 1VDHA 2DRAA 4QOTA 4Q8EA 1JKHA 2E1PA 3KUHA 1REVB 4P71A 2H9ZA 3MCMA 4QPTA 5HAOA 1RABB 2OFGX 2A2DA 3R6GB 3PKYA 3PZPA 4JI6J 1RT7A 2L9NA 2OD6A 3C6UA 3KMQA 3DRPB 4MTPA 1HI0P 4Z2XA 4Y34A 3GFHA 3SYZA 3PW5A 3M8PB 3CW2C 3M32B 1PAEX 1WI6A 1X4AA 3WX4A 1DARA 4CLWA 3CPWR 2UUCJ 4DWIA 5KFAA 2CQHA 3ZTPA 3LALA 3HP6A 3EYZA 2C3MA 1NAQA 2UU9F 5J2PB 4J9VA 1JNZB 2FHJD 5GADI 3DU6A 1DTQA 2K7JA 3JS9A 3VAJA 1RT4B 2BACA 2R7QA 5IQ6A 2UXBJ 4ZVOB 1F6TA 3OL7A 4UY85 1J5OB 2CZ4A 1X7VA 3TUPA 1EKRA 1M5SA 2HRUA 1AUDA 3MXHP 3A8EA 3SCIE 4CO2A 1HQEA 3CJ0A 5LMUJ 2OH2A 4OLOA 1MN9A 2PIIA 1SI9A 2BZ2A 1W26A 2BABA 5AXMA 4FYDA 1LWEB 1VRQC 2CJBA 2C2EA 2N7YA 2FQQB 3BPSP 2ZHBA 4CZCA 3V81A 2FC8A 5C42A 1IWAA 2RQMA 4FYWB 4USVA 1SJ1A 1R6VA 1RT5A 1RAHB 3G86A 5L46A 1UEVA 2HSEB 3ELHA 3J81j 4K4UA 2AYMA 1TL1A 3RGIA 4ANEA 4JV5F 3FQKA 3HHLA 3HSGA 4B3RJ 2ZBPA 3ZZRA 4B3SF 2CJXB 2XWXA 4KC5A 2RSQA 4LSZB 1R89A 3DRXA 2YKOA 2EPIA 3PYDA 4AXIA 1T9YA 2MXYA 3DGPA 3CTRA 4ZVQB 1LXNA 3V4MA 4EGLA 4M5KA 1WDTA 1G1XA 1KLMB 1MROB 1W25A 4DV0J 3W5XA 4X65J 3JYTA 4IYQA 4IKAA 4DCPB 4YB1P 2RF2A 4M1KA 4ZPVR 3RBEA 2W4PA 3CJKB 1U8WA 2QA1A 4NLYA 4DV0F 4ZPDA 4X66J 2G0CA 3NGRA 3OHBA 4KV8B 2NXEA 2B9WA 4QYZK 1S4EA 3N6NA 3U1LA 1Y5IB 2NREA 2HFOA 2MZTA 2SXLA 2MZSA 3KUEA 1RUSA 3Q24A 2Z30B 5CH7B 3Q86A 3FDSA 4PZVA 1M1KT 8ATCB 5C2GA 3SSRA 3OFGA 2W7PA 1X4HA 3F73A 3W2VA 1HD0A 2YKMA 2GZOA 5E0OA 1NPPA 3TJ9A 4ANDA 2EVZA 2D9OA 1VK3A 4IQMA 4TLQA 4WFBQ 5A2QY 3CCQS 1DHMA 3V6DA 5DZ7A 5M2RA 4YHHF 1U8SA 4OZNA 1N36J 1SVDA 4JB8B 3SQOP 1HA1A 3CDEA 3Q0AA 4ED7A 1FRJA 4FBUA 4OI0A 3DLGB 1RCXB 3LP2A 1IJEB 3D6TB 2HFVA 3Q8PB 3E01A 5I3PA 3VAGA 4CP5A 3MPUB 3ET6B 2HFSA 2MKIA 1N5TA 1NK7A 3K0JA 2PFFB 5KFWA 1BQXA 1GXTA 2HGNA 1T05A 3GR1A 1NH7A 2KU7A 3AA9A 1RT2A 1U7LA 1YWXA 2FGCA 2WBRA 3AOCA 4M5HA 3OVAA 4P7TA 3P8BB 4WJBA 4U9RA 4CWBA 4IO1A 4CM0A 4TYBA 5J1PA 3L09A 4NLXA 3IRWP 2CWXA 5D0HA 3DKDA 4FYXB 2IA6A 2ZJRQ 4L73A 3DLEA 3AXMA 3O6QA 1ZETA 3GJQB 4NI2A 1NCLA 2LKZA 5GADU 1OWXA 2CPXA 4B3TF 1K1SA 3OFEA 2DGVA 3LH2S 2WSFC 2XMAA 1CLFA 2BJEA 3PJ9A 2UUCF 2RU3A 1EQ0A 4BS2A 3M8QB 3IR5B 2FVSA 4UOFA 1QSYA 4IFVA 2XZTB 3N6MA 2KG0A 3KK2B 1QTMA 1WF0A 2LLZA 3HVTA 1DQ9A 4XDCA 2ZH9A 3T1HF 3TAQA 4EI2A 4R5PB 3M1VB 2VFUA 2AGPA 5ETOA 3AD7C 2CAJA 2DNHA 2RDIA 3GONA 4MK7A 3MMBB 1YJ9S 4KHRA 2BYCA 3K8WA 4GVBB 1FE4A 1U24A 3HFZB 2J7WA 2ZOFA 4ZDNA 4HACB 2WOMB 4QIGA 4F25A 2HZCA 3K7RA 4DX5A 2OTLS 4DR4F 4X4VA 3Q8UA 2WW8A 3PO5A 3B4MA 1FF2A 4H4KC 4OJ3A 1EAYC 3BB5A 4M5JA 1V5VA 1IVZA 3KJFB 5KFFA 5A6WA 1NNDA 3TW0A 1Q8KA 3MEKA 2HURA 1N6QA 1RA6A 3I31A 4KFBA 3FCWA 4FPRA 2BRLA 5F0WA 4R5PA 3M1VA 1A0OB 2I6WA 1H73A 1UP1A 3P4UB 3P96A 4M63A 2NYHA 3PRDA 2G13A 3X1LB 3NGUA 4OV6A 4M5MA 3LUYA 3HMJG 2YX4A 2ZC3A 1F2GA 1QVFR 1NK9A 2XHCA 4GRSA 4UUXA 1RTJA 3MM8A 2KKHA 2M70A 4ZVEA 4CYUA 4F36A 4A8KA 3BS9A 1RTZA 1FT8A 4J9LA 3H90A 3HHLC 2LA4A 5GAGI 2HHPA 3FUYA 4WK1A 5F9NA 1TL4A 1OIAA 5DDPC 4WFZA 4DV5J 3PRVA 4DHVA 2QEXS 3MD1A 3TOQA 1VQ4S 2L48A 2NUHA 1IUJA 2VBZA 3D67A 2V4QA 2N4DA 2IRYA 2JH3A 3UD5A 3RB4A 1MG7A 2DGSA 5M2UA 1HR0F 4C3KA 2AQ4A 1XN9A 2BVZA 3Q8YA 2MSTA 2XI2A 5KG3A 2HLUA 3C2PA 2B9YA 1RBLA 2C2RA 3UDCA 3FBEA 4J90A 2CQ4A 2DEJA 1OY9A 1S0NA 4CTAA 2GAGC 2P6SA 3IBFB 1ZPVA 2H5JB 3Q89A 2AIRB 2OELA 2V68A 5ETLA 4M95A 4HH1A 1Y3JA 3HD1A 4LSLA 2PEBA 5EUHA 3T6BA 4ZLJA 1NJXA 3OBIA 1RAJA 2Q43A 4GKKJ 3MURP 3SFUA 2J9DE 1PBUA 3CJTA 1CJVA 3MMAB 1JLCB 2LECA 3G6XA 2D3OR 4FZVA 1MLAA 4RKUC 3FZBA 1VQMS 2XCAA 1JJ4A 5HLFB 2Y1RI 2LMIA 5BR8F 4K4YA 3H2UB 2VUGA 3BKFA 4C8ZA 1CJTA 4ZVTB 4OX9J 3LP0B 3QIPB 1SV5A 1JLFB 1TR0A 1YJTA 5D4NA 3OPKA 2WBMA 5E3RA 3OUYB 3W3SA 1GEHA 2Q6BA 1KKHA 4U7UK 1RCOB 1TAQA 2LU2A 3G8QA 1UPPA 1JLQB 4OHVA 2E44A 2PT0A 2AU0A 2W25A 3M8ZA 3QRQA 5B0CA 3MFIA 3AOAA 5E41A 2QV6A 3D9BA 4C9DA 4RBTA 2KTQA 2P9EA 4L75A 4OZ2A 2V8DA 1QAXA 3EE3A 4V1Ak 3LWMA 1JQGA 3D5MA 5E33A 1FTCA 2KT3A 1X4CA 3PEHA 4FS1A 3IWNC 3TVKA 4ZJLA 4C8YA 1S1TB 1DY3A 1S1UB 3SSSA 3PEJA 4QWAA 4N76A 2BE2A 3B54A 3M2RB 3QGHA 2DHHA 1AFJA 2W4CA 1VBZA 3DOLB 2GQCA 2QMUB 1M1HA 2F5GA 1HHSA 3OTEA 2OEKA 3PACA 4JBCA 4W98A 3U1NA 5L39A 1YRUA 2Y8YA 3UDEA 5KAKA 4MH8A 1KC8T 4K8RA 1V6HA 4NLTA 2L9DA 2QTWA 5C5JA 3LANA 2ZJQQ 2YNHB 5AXKA 2Q6CA 3H59A 4KYZA 2RJZA 4WTOB 5EWGA 4Q0BA 1IKXA 3NOGA 3MI7X 1VS3A 3GV8B 2EFOA 1H74A 3SQGA 5A0YB 3KLGB 1T05B 2GVDB 2HEKA 1CJUA 1PYSB 2YXLA 4DZ6A 1EKSA 3T1YF 2HHVA 2GFFA 1H2TZ 2HBQB 4FKXA 2RUGA 4O4GB 1SKWA 2R2RA 2FYXA 5D0GA 4IG0A 1NZAA 1X0PA 3D7SB 5ETMA 3VHQA 2KN4A 1SUQB 2DNOA 5D8HB 3JQKA 2CQ0A 1C1CA 1FEHA 1FRHA 2HRYA 4IDKB 3DC2A 2JSXA 4FN5A 4J37A 4UW2A 5FD1A 3VGSA 3POTA 3R1LA 3GYGA 2NUUG 5DG9A 1GQEA 3C6TB 4LSLB 2K2PA 3MHYA 1JKHB 2IYGA 4NMXA 4OX6A 3PKMA 5CD4A 1S48A 4IFYB 4HEA9 4X4QA 4WP9A 3P49B 5DO2A 4ELVA 1S1VA 3J81U 4QR1A
chains in the Genus database with same CATH topology
1N34F 4IFYA 3B8HA 3ZZOA 2XY6A 3C3LA 1DTTB 2J7UA 3G6ES 3SZ2A 4URGA 3GV5B 2KI2A 2MPUA 4DFKA 2G9OA 1J5EF 3FFIB 3IO1A 2UVUA 3NKYA 4X2BA 2B5JA 3IR6B 2MKSA 4RUCA 3HHEA 5AXLA 3PHEA 3I0SB 1M5OC 1XNQF 1HBUA 4XK8C 3N5FA 4ES1A 3TUZC 4X84A 1S1XB 3KG1A 4I2PA 3FRYA 4ZCLA 6FD1A 2VQFF 2ALZA 3PRBA 1PO6A 1HMVB 1T02A 1FJ7A 1K1QA 2AJ0A 4ECYA 4WK3A 1H38A 2GV1A 2IJFA 1JNRB 5AXNA 1URRA 3VAMA 1HQUB 5LT5A 2ZHOA 4WFNQ 5KG5A 2AP6A 3MOZA 4IOAQ 3OFHA 4DV4F 5D4PA 3MMCA 3KMSA 2ZH8A 1LXJA 1RT6B 3GWCA 1P8GA 4ID8A 5BYQA 3O1LA 1FTRA 1YGYA 2C3UA 3D1QA 5DDRC 4ED0A 1DLOB 1FDBA 3GMGA 4B3MF 4MYTA 1NEEA 3M2VA 1KD1T 3H40A 3FVYA 1JLEA 1NRKA 1X9SA 3MEGB 2I5JA 5IT9Y 2V4RA 2B6AA 3EGWB 2XI3A 3PM9A 4OHWA 4KKOA 2I0XA 3GIIA 2UV8G 1S97A 5B09A 1VC0A 4ILMA 2ASLA 2OPRA 2VOOA 1TV6B 4FBTA 1FKPB 2EBGA 3FGVA 2DCLA 1M5VC 1RTDB 4ZP6A 2FPHX 2OFHX 1QSLA 2UUBF 1MWZA 3GV7B 3J7YI 3RB0A 3DNCA 3VF0B 2VZ9A 2Q79A 2YKQA 1ZH5A 4NLRA 3W2WA 4OZ0A 1HWKA 1HBOA 4A46A 2J8AA 4JOUA 4NZ7A 3OXFA 5H9FJ 3ENWA 2HWTA 2VC0A 3NCRA 4DL0C 5JJBA 1ZM3A 2D7SA 1DURA 3CDAA 5DJBA 4IDKA 4Y00A 3V6KA 4K5RA 2R2UA 1FCAA 4IH6A 3C6TA 5IS2A 5L38A 2HNDB 2QIFA 3C8YA 4DUYF 3P5TL 5IT4A 3CD6S 4EWTA 4AUKA 5IM0B 3DDKA 1M5KC 1FRXA 3RU0A 1TKZB 3MR2A 4DR2F 2KYXA 1UWBB 2RMLA 3OVBA 4C8LA 3QO9A 2DISA 3FZ2A 3N01A 2XLIA 5A8KB 2CDQA 1FKOB 2FJDB 4NLDA 3T5LA 4LIRA 2JOQA 4MIAA 1GAOA 3KOAA 2I1RA 2DHSA 2VFRA 1TK8A 3CC4S 1LWCA 1TKZA 2ZOMA 1RYSA 4NLWA 1XR5A 4ZA1A 2AGQA 3I4HX 4YEAA 3WC0A 3O2IA 4C0OC 1SKSA 2HLTA 2CPZA 1RTIA 3AH6A 2LVWA 3S1TA 2CQ1A 2XC9A 3IN5A 1VRUA 1XR6A 3WBZA 3TARA 2VPXB 3PIOQ 2ABYA 3PX0A 3RR7A 2YTCA 1JJ2R 4QW9A 2KFYA 2JLFA 5K8PA 3DOMA 1TL3B 1R0AA 3GQCA 2R8GA 1X8DA 1RP5A 3HO1A 2EK1A 2PE8A 3AQPA 1U48A 2V5HG 4TN2A 2JC1A 1OS5A 1L3VA 3KK1B 3PNIA 2J9EA 2IA0A 4A8YA 2E29A 2UUTA 2HQ3A 4ZPWR 3OR1A 2CJKA 4F2SA 4DR7F 3Q2SC 3Q8RB 3NMRA 1ZPWX 3TAMB 3OQ2A 2F3JA