1YWXA

Solution structure of methanococcus maripaludis protein mmp0443: the northeast structural genomics consortium target mrr16
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
MDISIISDRNNPLLQRREIKFTVSFDAATPSIKDVKMKLVAVLNANKQVLVVDTLDQIFGKLEAEGYAKIYNDEKAMATIETKSVLEKNKIEEEAEAEVAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Methanococcus maripaludis Protein MMP0443: The Northeast Structural Genomics Consortium Target MrR16
rcsb
source organism Methanococcus maripaludis
molecule tags Structural genomics, unknown function
molecule keywords 30S ribosomal protein S24e
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ywxA01
2E5HA 4CIOA 1ZZNA 2J0QD 1JJHA 2FC9A 4F02A 1HD1A 5DDOC 2CPXA 1U6BA 3VAKA 1HA1A 3VF0B 3L3CA 1UP1A 1X4DA 2EVZA 4WFBQ 3IRWP 4TU7A 1X4FA 4F26A 4PR6A 3UCUP 2DK2A 2XS5A 2CQHA 3NMRA 3CCMS 2ZJPQ 1DRZA 5LSOA 1X4EA 1WF2A 1JJ4A 3SXLA 1YIJS 1OIAA 4W90B 1VQOS 2PE8A 3P49B 1OPIA 3UD3P 1YITS 1KOOA 3PIOQ 1WI8A 2MGZA 2LKZA 2KT5A 5LXRA 2E5GA 3G4SS 4UQTA 4Y0FA 3VAHA 2DIUA 1N8RT 1X5SA 1U1LA 3S01A 1HD0A 2DNMA 2K8GA 2KM8C 3CC4S 2RVJA 1SXLA 3US5A 1KQSR 2M70A 3TO8A 3DLLQ 3CMAS 3CCES 1X5TA 1M5KC 2DITA 1M1KT 2X1BA 1QM9A 1X4HA 2YH1A 2I2YA 2CQ1A 3UWTA 2DGTA 2MJNA 5GAEU 1WG1A 2RRBA 3MD3A 3SMZA 5MLCV 1G2EA 3VAGA 2RT3A 3VAFA 3LPYA 1SJQA 2M4MA 3NS5A 2RS2A 1H2TZ 4W92B 2I38A 2J8AA 4FXVA 3CCUS 3CCVS 3J7YU 2ADCA 1K8AT 3IWNC 2LXUA 2DGUA 1L3KA 4CQ1A 1N54B 2KRBA 3UCZP 1VQ8S 2OTLS 3P3DA 2DGWA 1U1RA 3Q2TC 2KN4A 2NLWA 3J7ZT 3JB9k 1ZH5A 4Z2XA 2LEAA 1QVFR 2L08A 3CC2S 1ZZFA 2CPJA 3UD4P 3PIPQ 1D9AA 2QEXS 2MZTA 1VQ4S 2DGOA 1DBDA 1N52B 2CPHA 2CPEA 2QFJA 3BO3A 2LMIA 1X5PA 2DB1A 2MKSA 2OSRA 1A7GE 2DNOA 2MPUA 1Q86T 2DNPA 1H2VZ 1WTBA 4QU6A 5D77A 4OZ1A 1BY9A 3NS6A 1UAWA 2MB0B 2CQGA 3TP2A 1YJNS 4WIIA 2G4BA 2JVOA 2MQMA 2CPIA 1NU4A 2LEBA 3MXHP 1K9MT 1VQ7S 2D9PA 3THTA 2N82B 2VODA 3B4MA 1QVGR 1YJWS 1P27B 5HO4A 2XSFA 4LIRA 2DGQA 5CYJA 1SJ4P 2VOPA 4YUDA 2MJUA 3BO4A 2DHXA 2MY7A 2MMYA 2DNZA 3LQVA 1KOHA 2DNKA 5JVGQ 1FHTA 4PKDB 3CCRS 1X4CA 3TYTA 4P6QA 2XS7A 3SDEB 1VBYA 2YTCA 1P1TA 1VQ5S 2XS2A 2MQPA 2XNRA 3ULHA 1VC5A 2MZ1A 1WI6A 3U1MA 4IOAQ 2MSTA 5HL7Q 2PEHA 2FY1A 2RQ4A 2DNQA 3CCLS 3CXCR 3MURP 1UW4A 2M2BA 2HZCA 2LYVA 5D78A 1N88A 2FPHX 5DDRC 1CVJA 3CULA 4BS2A 1M90T 1JMTA 1O0PA 4C7QA 5LJ5Y 3BO2A 4IUFA 1U1QA 4OZ0A 2E5IA 4ZKAA 3MI7X 1WWHA 3MUTP 2RUGA 2U2FA 3ZZYA 2MQOA 1Q82T 4LMZA 2F9DA 2DH7A 2MXYA 2LA6A 3R27A 2HVZA 1F9FA 1FXLA 2AYMA 3FEXB 3I56S 1YI2S 4CH1A 2YKAA 3BS9A 4TLQA 5DM7Q 3RW7A 2DISA 1AUDA 1B7FA 1JJ2R 1WEZA 3DXBA 2AYGA 1VQKS 2RQCA 3P6YC 5BJRA 1FJCA 1VQNS 1WHYA 3MOJB 3R1LA 2D3OR 2E44A 2SXLA 5DM6Q 2MYFA 3UCGA 1S79A 2B0GA 2MZRA 3VAMA 1FJEB 2WBRA 2E5JA 1FNXH 2AYEA 5GMKa 2MKKA 1H2UX 3VAIA 2OTJS 5H1SV 3EGZA 2AYBA 5EN1A 1VQ9S 2RRAA 5CXTA 1WEYA 1YJ9S 1X0FA 2DNGA 3NNCA 3HI9A 1VQLS 4C4WA 2MHNA 2ZJQQ 2UP1A 1UFWA 3R1HA 1YHQS 3CTRA 1W2BR 5LSLA 3EX7B 1YWXA 2MGZB 1FO1A 2GO9A 2DNNA 3S8SA 2L9WA 3CMES 2ADBA 1YTYA 3K0JA 2KXNB 1VC6A 3N9UC 4V19X 4A8XA 2DHAA 1X5OA 2DO4A 1X4AA 3CF5Q 4J5OA 2KHCA 2CQCA 2F9JA 1WHVA 1R8PA 2MKCA 3CUNA 2DH9A 2HGNA 5GAHU 2NZ4A 2KYXA 3CCJS 4QU7A 1WG5A 3Q2SC 4U67Q 2CQBA 3VAJA 2JX2A 2N7CA 3D2WA 4WF9Q 2CPYA 2MZSA 3CPWR 3G8TA 2CPDA 2HGLA 4WFNQ 2HGMA 2HYIB 5DDPC 2CPFA 2MKJA 3MD1A 2M8HA 2MQNA 2KG0A 2KXHA 2MQQA 1D8ZA 2MY8A 2V94A 2XNQA 2F3JA 2LQ5A 2LECA 4IO9Q 1U6FA 2KRRA 3B4DA 1U2FA 2D9OA 3I55S 5GAGU 3HHNB 2U1AA 4PRFA 2KFYA 4F25A 2CQ4A 4LJMA 2JRSA 2DGSA 3CCSS 2OIHA 1R8HA 5CA5A 1M5VC 2M0GB 2J0SD 3MUVP 3BEGB 2RU3A 2ZJRQ 2KVIA 4YB1P 2CQ0A 4M5DB 3CCQS 3H2UB 3MUMP 1OWXA 2N3LA 2G1DA 1U1OA 2CJKA 2CQ3A 3MDFA 3RW6A 2J76E 1U1NA 3VALA 2KG1A 2FC8A 1Q7YT 3EGNA 2O3DA 3S6EA 1SJ3P 1HL6A 2M9KA 4C0OC 5ITHA 2KXFA 5DDQC 1Q81T 1SJFA 4WFAQ 2AD9A 3G9CA 3G96A 1U1KA 5GADU 2A3JA 2X1GA 2RS8A 2M7SA 2MKHA 2G0CA 2YH0A 1U1PA 4ERDA 2EK1A 2OSQA 1X4GA 4TU9A 2MKIA 2M8DB 2DGXA 3NNHA 2N3OA 5FJ4A 2X1FA 2LA4A 2EK6A 2FHOB 4ED5A 1FJ7A 1WELA 1OO0B 1VC0A 2VONA 5LXYA 2DIVA 5IFMA 2VOOA 1A9NB 3P5TL 1H6KX 5IQQA 3U1LA 1KC8T 1FT8A 2K3KA 4CH0S 2OJ3A 2DO0A 1XN9A 1U1MA 2CQPA 1VBXA 1PO6A 3CD6S 1WF0A 1VBZA 1RKJA 4IOCQ 5GVQA 2DH8A 3V4MA 4YOEA 3SDEA 4RU2A 3CC7S 2L41A 1M5PC 5LJ3Y 2YWKA 1K73T 3NNAA 2MZJA 3H2VE 1WHWA 2MQLA 1M5OC 2CQDA 1WHXA 2MZQA 1KD1T 2DHGA 4QQBA 3ZZZA 2DNRA 1SJRA 4UY8T 1URNA 2KU7A 5IM0A 2KM8B 3G71S 5IM0B 3G6ES 1S72S 2M52A 2X1AA 2BZ2A 4WKRA 1DZ5A 2GHPA 2DNHA 1VQ6S 2QA4S 2CQIA 3G8SA 3THPA 2JWNA 2DNLA 2DGVA 2CQ2A 2RNEA 2MSSA 2XB2D 1PGZA 2CPZA 4WCEQ 2JVRA 1VQMS 4FXWA 4EGLA 3S7RA 1NJIT 1RK8A 1IQTA 2LXIA 1WEXA 1X4BA 5DETA 2BOPA 1VQPS 1WF1A 2KH9A 5JVHQ 1NO8A 4QPTA 2DNYA 2ERRA 2KI2A 3UE2A 2LCWA 2M88A 3FEYB 4Y00A 2DHSA 2Q79A 4TU8A 1WG4A 1DHMA 3OW2R
chains in the Genus database with same CATH superfamily
1RA7A 5L39A 2BQRA 4PXEA 1ACMB 1SL0A 4BWJA 3CD0A 3VF0B 1HR0F 1HW9A 1KTVA 1X4DA 3JAMY 1VK8A 3MCSA 3DNCA 4NX9A 4B9LA 3M2UA 4WFBQ 1I6JA 4DSJA 1K44A 4S0MA 3FBCA 1KR4A 3BQ2A 4QCLA 3BYPA 3DDIA 2DXDA 1X4FA 1FD8A 3KG1A 5AJ3F 5EGYA 1KWMA 5F8JA 2XS5A 2WK4A 1PCAA 4HHUA 5U47A 3J80Y 4HEA9 4KKOA 4YDXA 3O3LA 4BHQA 3MM8B 4C98A 5KFJA 4KFBA 2BUNA 1WF2A 5CABA 3CC4S 3FDSA 2AIRB 3R6LB 4ZVTB 1L3TA 1YIJS 2YNGB 4KYZA 1VQOS 4ZVUB 3L9ZA 1U4BA 4V19J 1OYEA 5D8HB 2RJZA 1OPIA 1U8WA 3UD3P 1KOOA 1NDKA 3M8ZA 2OLWA 3PYFA 3QLHB 4I4BA 2AF6A 3PIOQ 3EZ5A 1RYSA 1HYSB 3W66A 1HYSA 5I4MA 4CO0A 4HDHA 3W61A 3G4SS 3BSCA 4J91A 1X9WA 2EWHA 3ZXWA 1IKXA 1N33F 2KHDA 4IFVB 1N0VC 4KAIA 5D0HA 4Y0FA 2AJ4A 4DU8A 4LF7J 3RB4A 2Z2MA 2P9EA 1MSWD 2N7YA 4ECYA 1R7IA 2DIUA 2VC1A 1SI9A 1T0TV 2L9NA 3S01A 4FP9A 4X66J 1HD0A 4CTAB 4IRCA 3T5HA 2PI5A 2WRMA 3CNQP 9ATCB 1XK8A 3JTPA 3DKDA 2KM8C 3US5A 4X62F 2W2NP 4USKA 1KQSR 3OL7A 1RAOA 2H48B 3A1YG 1SBRA 3AJ1A 4XDDA 2M70A 5AXLA 1CJUB 5B0AA 3QT8A 5J1EB 4OX9J 1C2PA 5A0YA 2QGFB 3TO8A 3UNGC 3HKZD 3NGTA 3CMAS 3G86A 4TY8B 1LV5A 4N41A 1UZHA 2DITA 4TY8A 4YB7A 1F5CA 3HT0A 5HMWA 1Q79A 4JBCA 3BKTA 2PMWA 2UXDF 1M1KT 3UDEA 3LUYA 2QRRA 2F63A 2RHSB 2IY5B 3W8PA 5GMDA 2CQ1A 4UZCA 2G2OA 2DGTA 3R2CJ 1C0TB 1FVSA 2HLUA 4L72B 4DQSA 3VV2B 2PD1A 1G2EA 1N32J 1S1TB 4LRBA 2RT3A 3BJYA 2AT1B 3NMAA 3GZ7A 3FKBA 5DG7A 3AHPA 2ZHAA 2E1RA 3SCKE 4DS4A 2NCKL 1Q95G 3HZGA 2E29A 2M4MA 1XJWB 3NS5A 4CDIA 4HYKA 1OQ3A 2I38A 1F5AA 3A8IA 5KFEA 3CCUS 2ILZA 3MGJA 4J9OA 2VBZA 1N4LA 1DURA 2CJYB 2LXUA 3OR1A 4ANDA 3MM5B 4OZNA 2H9ZA 3K5PA 1TK5A 2E9ZA 2KJVA 4CQ1A 2IFXA 1S7HA 2Y1JA 3DLGA 5E3CA 2ZOGA 3G87A 4GO7X 2D1CA 4ZLPA 4DL2A 1VQ8S 1XNQJ 3LWMA 2OTLS 1HNWF 2KN4A 3G2XA 3GG1A 2R7WA 3K7RA 4CLWA 4DV1J 2W1BA 2HNYB 5B09A 1QVFR 3W2VA 2R7TA 3VQSA 4PWDB 3CIMA 4QWCA 2YKPA 1T9WA 2FJDB 1MROA 3QQCD 1DY3A 2CPJA 4PWDA 3Q8YA 1WACA 2OPPA 1R0BG 1MMNA 7FDRA 2XLIA 5KT5A 3ZTRA 3PZPA 4K50A 1ZM4A 4ETZA 2B3TB 2GX8A 3OXFA 3IGNA 1VQ4S 1R0AB 3RU0A 1PC5A 1TUWA 1WC0A 2CPEA 2J8SA 4KO0A 4UOCA 4DFKA 3DU5A 5HATA 4A8SA 4IR9A 2KFNA 1N6QA 2OPRB 4WYLA 1W7WA 1X5PA 5JJBA 4B3OA 3AQOA 1BQMA 3V4IA 4B3OB 1AT1B 3V4IB 1Q8LA 2DB1A 2RDJA 1HQEA 2GJFA 3AXKA 3UFCX 2P6SA 2ABYA 3HSZA 3MPVA 2I8EA 3LTOA 1RUSA 2MKYA 4RKUC 1TL1A 3CDUA 4J9MA 3IBWA 4WYWA 2R8GA 1TV6B 3NL0A 4CM2A 1AA1B 1LWEB 1RTJB 4YR2A 1EZZB 3BSNA 4EZ9A 4M5GA 3HSGA 4G65A 5F8MA 4LF9J 3QFHA 1KQKA 1W25A 2E1MC 1MG7A 3MXHP 2E66A 3LALA 3FRZA 1KLMA 5LMUJ 4GC7A 1K9MT 3THTA 2EW9A 2VQFF 2AQ4A 2KYZA 1QVGR 4PQUA 2FB0A 5L1LA 1P27B 5E0OA 4F3QA 3T1YF 2Y3YA 3M6UA 1HBUB 4Q8FA 1JK9B 3OFGA 5ADZA 5CYJA 3IBCB 4MK9A 1SJ4P 3RR7A 1XMQJ 4UY85 2LEPA 1ZAWA 2MQ8A 4EEYA 2A2DA 4CWBA 5DO2A 3TUJC 3Q22A 1JLGA 1H98A 1H3DA 1R8BA 2VG7B 2YWHA 3DLJA 3HFVA 3E01B 3ZTPA 1KOHA 8RUCA 4K4XA 2FJBB 4RW8A 3T1HJ 2NS1B 4PKDB 4DX5A 3CCRS 2HPUA 3D6HB 4U7UK 2R7QA 5I42A 2YTCA 2YX1A 4DS5A 5F8LA 1P1TA 2UUCJ 1VQ5S 2GAHC 4OI6A 3R97A 1FFWB 1ULRA 3ULHA 4CZCA 1HNXF 3LANA 1RTDA 3KNGA 1WI6A 2BE2B 1TMMA 3JS9A 4FXDA 2K7KA 2MSTA 2JFKA 5HL7Q 2W7OA 2D69A 4NEYA 4PUOB 3TAQA 1IBMF 2H51B 4O3QA 4OJ3A 4Q0BB 1BWEA 4LQ9A 3I96A 4Y28C 4F0HA 3GILA 2NR0A 2RE1A 1R8AA 1BD6A 1HMVA 2W2OP 3EZUA 3KDOA 4OHZA 5DS7A 2GC8A 3HCXA 4DV1F 3MURP 3VGSA 1W2BR 4CO5A 2M2BA 4IKAA 3TX0A 1H7WA 5D78A 4WIQA 3MM7A 4DV5F 1CC7A 3W9HA 3OHAA 5DDRC 2QE5A 1OY9A 4DV2F 1KSPA 1CVJA 3CULA 3QRRA 5J2QA 1M90T 1APSA 2YKNA 3TZZA 2PN6A 5J2QB 1JMTA 5A6PA 4H4OA 2HHWA 4IUFA 1HBNB 5KT7A 1U1QA 1UVNA 1AB8A 2HQCA 2LLZA 3JTOA 3MI7X 2GGPA 4M5MA 2Z2ZA 4LVOP 4MKBA 4IO1A 3MF5A 5IQ6A 3MCNA 4MYUA 3HSDA 4WKYA 2WSFC 2VQEF 3OTEA 2UV8G 3V81B 4NXMF 3LP2A 4LMZA 1VRTB 4CLUA 4X4OA 3HXMA 1FFGB 1VRTA 1RHKB 3R27A 3GV8B 4ZVEA 4C8LA 3C3LA 1F9FA 1VQYA 4AD6A 3SSRA 1EJ7L 1RACB 2AYMA 2CG4A 2UUTA 2UXCF 4JUZA 2HHHF 2YKAA 3BS9A 4LT6A 4BC7A 4QIVA 4D3GA 1GMUA 1HBMA 2B9YA 5DM7Q 4FYDA 4J7CA 3C66A 2ZEJA 2EPIA 2OD6A 2RIJA 1B7FA 2BMBA 1NDLA 1GX5A 4ID5B 1AXQA 4ID5A 2HW3A 5BR8J 3BGLA 5C24A 3I9V9 4D3HA 3EUNA 2PGCA 4NLRA 3RRHA 2YWEA 1SKWA 3R7BB 3NS7B 3JSBA 2OD4A 4UUWA 4ED8A 2HEKA 3D6FB 3IC1A 5D4LA 4C97A 4WP8A 3Q23A 3I5BA 2LQ8A 2IC3A 2D3OR 3QT5A 2IC3B 2C3PA 4LF7F 4IFYA 1O6XA 4RBTA 2R7UA 1GFWB 2XMKA 4YY3F 5GMKa 2OTJS 2LQ9A 2IDEA 2NXNA 1C0UA 3ISND 3MMAA 4HTIA 2AYBA 5D4OA 2DT9A 2HNZA 3L7PA 4CNYA 4A8OA 1YJ9S 4X64J 4Q44A 1AFJA 1IVZA 3K5MA 4JI6J 4EU0A 3HI9A 1DTTB 4LSZB 2MHNA 3EVWA 3EICA 1X8DA 2W7AA 4QPXA 3HDSA 2V4RA 2GQCA 5HP1A 3MAAB 1CJVA 1UFWA 1SVDA 1VK3A 2V67A 3DYAB 4OZ5A 5E3PA 2WB4A 5LSLA 3EX7B 4J9PA 1YWXA 2MGZB 4QYZJ 1WSRA 3MPUB 3VVUA 1R27B 4F36A 1Z1ZA 1J5OB 4C8ZA 3K59A 2DNNA 2QYGA 2FHJD 4OHWA 2KXNB 2UZAA 3N9UC 2Z2YB 2OMLA 4B3SF 3HHLA 4V19X 2DHAA 3CJ3A 4DV3J 1X4AA 2J5AA 4GC6A 4LQ3A 4J5OA 1KBRA 3IM8A 5F9NA 1S77D 1FX2A 4YR3A 4LREA 1VHFA 3K0JA 2AV5A 2IVYA 1R8PA 2MKCA 4LSNA 2IVFB 3CUNA 2VBWA 3BR8A 2NZ4A 2KYXA 4C11A 1PYOB 3M9OB 4U67Q 1T94A 1CLFA 2NZCA 2JX2A 3D2WA 5HQMA 1V5IB 1CS4B 2VDHA 1XNRF 3HD1A 3VWSA 2Y1LB 2CPYA 2WONA 4DR1F 3GFZA 4F2RA 3G8TA 3A8KA 4MKAA 2VC0A 2IRUA 2FJEB 3PTWA 3BN4A 1MWQA 3IS9B 4ZVSB 3T5JA 4L76A 2HGMA 1N34J 1YDLA 2W2PP 3KUEA 4C0HA 3K58A 3ZTQA 3PKMA 5DDPC 2HMIB 4G6VB 4MKYA 5I3QA 1S5ZA 2MQQA 4JYAF 4JB8B 3DU6A 5AXNA 4F0KA 2IJFA 3EVOA 3QWUA 1HIYA 2LQ5A 3CIZA 4B3MJ 1DLOA 3UI3A 4X62J 1U6FA 3B4DA 1IBLF 2BANA 2RDDA 3GYXB 3L95X 1U2FA 2D9OA 2BVZA 1FXRA 3HHNB 1VMBA 3F0NA 2MLYA 4J9QA 2YBVA 3MECA 1Y4ZB 1LKZA 2HRUA 5SUHA 5JXSA 4F25A 4DSLA 4N47A 1IM4A 2EFOA 4IOBA 2VPZB 2N4CA 1TKXB 3TNVA 1H7XA 3MFIA 4WU3A 3BEGB 3MUVP 3GIRA 4K5RA 4B9NA 3K5OA 3MHYA 1Q5VA 4FZVA 1RP5A 3CSKA 4ID8A 5CH7B 3DCAA 1S0VA 3H2UB 2UV8A 1UW9A 5CYQA 2N3LA 3MUMP 2UUAF 4ZN1A 1VLOA 4KPCA 5CYQB 1JNZB 2CJKA 3RBXA 1NK8A 5CCLA 4ZCMA 3HVWA 2G1HA 3MDFA 4RW6B 3RW6A 2ZITA 1UCNA 1U1NA 3KHRA 1YVFA 3J7Z5 2R8HA 2FGCA 1YBAA 4NMXA 3JYTA 2JSXA 1RT3B 2AW0A 4ED3A 1FKOB 4WK3A 3EGNA 1FWKA 2QA1A 2RHQB 4CLKA 1IJEB 3LP1B 4J9VA 4DV4F 2OFGX 3C8YA 3DM2B 2QA4G 1WJ9A 3HX9A 2KXFA 1N5QA 1XMOJ 1GT8A 4WFAQ 4B9TA 2O67A 1U1KA 2YX7A 3NY0A 2V8VA 4NLQA 5KG5A 5GAHI 1MU2A 3GJRB 3T19A 4HH1A 2BQ3A 2RS8A 2E7VA 3MM9B 3QGPA 2GFFA 4GO5X 2UVUA 1FEHA 2DR6A 3GMGA 4CLTA 2OPSA 2R2TA 2EK1A 2MKIA 1RCOB 1X4GA 5E5NA 3D54A 4Q8EA 2C3MA 4QR2A 4IQXA 4FPIA 2DGXA 1D8YA 5FJ4A 1P9QC 3ZTSA 2XEXA 1ZYQA 4HL9A 2ZC3A 3JQKA 2HQFA 3MEGB 4P71A 1OO0B 4C48A 2R8JA 2B56A 2VONA 1Q8KA 4OYOA 5LXYA 5IFMA 3GQCA 1F5BA 4AQYF 2AP6A 2HZVA 3ONQA 3K5NA 1RT7A 3P5TL 1M5SA 4OHXA 4ZPVR 3U1LA 3W5XA 4F3MA 2M3DA 4DU7A 3QGIA 1UA0A 3HD2A 1KC8T 3AA9A 3KHGA 2IBKA 2DO0A 2Y0BB 1PO6A 1WF0A 4DV0J 4RW8B 3TUZC 1FKPB 2VFSA 3MEDA 2L48A 3AY0A 3N01A 4NYZA 4UUXA 3V4MA 3V2UC 4CT9A 5KT2A 2DCLA 2W01A 2EEYA 2J9DE 1ZTWA 1TQLA 2H54B 4DSIA 3D1QA 3BREA 3PW0A 3LAKA 4AXJA 5KFCA 2YWKA 2HK2A 3GWCA 4L73A 3R7SB 4URGA 4ED1A 3H2VE 1P8GA 1T3NA 3UVJB 2AGQA 1HWUA 4FS2A 2XGQA 1UEUA 1IKVB 1TL4A 4QQBA 2HURA 2C1EB 3QRPA 3EGVA 1U25A 3R9LA 3KLEA 1NM2A 3PFEA 3Q8UA 5DG8A 2UUBF 3NXZA 3POTA 4OYAA 2VBYA 2QT7A 2HSEB 3SCJE 4EI2A 1FNMA 1HFEL 3PV8A 3G6ES 4KBIA 4RBVA 2M52A 2RMLA 4Y2MA 2FJXA 2AJFE 5BYRA 1R8CA 1S6QB 3H20A 1R6VA 3H59A 3MPDA 3W2VB 2ZH1A 1YK9A 2RQKA 3T1HF 4IRDA 4IRKA 4WKRA 3ZZTA 3TJ8A 4Y34A 4M63A 1NNDA 3BGRA 2GHPA 3CGIA 5B0DA 1VOMA 4QZVB 1DZ5A 1G4CA 1HBNA 3CD5A 1YSJA 3SCIE 2ZM6J 3SYZA 4HTJA 3ILLA 2EBGA 2QX0A 2QA4S 3BZQA 4NRUA 4OZ3A 2CQIA 3S1TA 3WZ0A 2XCAA 3FUYA 2VZ9A 3O6QA 3ENVA 3GCXP 4KQZA 1JLAA 1IWAA 5L9NA 2ACYA 4FN5A 4C8YA 1E6YB 1NDCA 2HK3A 2RNEA 4MH8A 4ES3A 3MR7A 5IOLA 3N6MA 4ES2A 2RQMA 2WB1D 3MEKA 4YHHF 4FXWA 4HHJA 1NJIT 2C3OA 1U09A 1IQTA 4OLPA 3TVKA 2WHOA 4ED0A 3QAUA 4B9SA 2GMLA 1AZSB 2F8EX 3HULA 2H65B 2K7JA 1XTZA 3AD8C 1KTQA 4L75A 4XIUA 2IPOB 4B02A 2KH9A 3PW5A 3V6JA 1NO8A 4QPTA 2ERRA 3A3PB 3KLIB 4M5IA 4QJVA 3JXOA 3UE2A 3KLIA 3E51A 2HFUA 2BJ3A 4ZLLA 3OVSA 2RH3A 4ZMMA 1F0XA 5DQGA 2DHSA 3R7NB 1G3OA 4ZIWA 3VHQA 5L38A 1X7VA 4TU8A 1DHMA 5DLGA 3BBBA 1HNVA 1HNZF 2GVDB 4CIOA 4HR2A 1XMBA 1REVA 4NYOA 4TKTA 5B7WA 1RLCL 3D7SB 4LR9A 4ZPWR 5EWGA 1LOUA 1VCTA 2FC9A 2ZE2A 4G1QB 3CJKB 5DDOC 2FVQA 4F02A 3VAKA 5KFAA 1HD1A 1UP1A 3NCRA 3G82A 4WTYA 3IAS9 2V63A 4O0IA 3ELHA 3OFEA 4PPDA 5FLXU 2VFVA 4OI1A 2VB6A 4PR6A 2AX0A 1RE1B 1JLGB 4JI0F 4ECTA 3UCUP 4ELUA 1BMQB 5HJXA 2OPPB 3BV8A 3M6VA 4RO0A 4BBYA 3QZ8A 4F7VA 3OL8A 4RLEA 1RAGB 5IV3A 2Y1RI 4CYUB 1QTMA 1W2IA 1LEOA 1FRIA 1T9VA 2DBBA 2PT0A 2XMUA 1K0VA 1LWFA 2FJAB 3MAAA 1Y5LB 4I68A 2AGOA 4RBUA 3SXLA 4X4VA 2Y9HA 2JL9A 1N33J 2JEIA 4I6AA 3HJVA 2BE2A 1EX8A 4HT7A 4CLSA 3P49B 2YKQA 1YITS 1GAOA 3D6TB 3DLEB 2HWHA 2FVPA 2BKPA 2ZZNA 2LKZA 1U8SA 4I2PA 3NWGA 2H5JB 4MAKA 2E5GA 1Q8BA 2GAGC 4J9UE 1KS2A 1RTZA 1LK7A 5HVHA 4NASA 5KFNA 1NKEA 4ZN3A 2YKOA 4CCHA 1B99A 3I9ZA 5L8RC 4P7VA 4JI8J 4LF9F 1N8RT 2Q3PA 3I4HX 4DN9A 4DWIA 1U1LA 4TNOA 4F8RA 1FRMA 1N36J 2CDQA 2Z57B 3WC2A 4QYZK 2GIFA 1QD1A 1PJ6A 2V2VA 1T11A 2RVJA 3R5AA 1S7IA 4M1KA 3OV7A 3FEZA 1CQMA 5F8HA 4ECXA 5D3GA 3KK1A 3FCWA 5KG3A 1MWZA 2D7SA 1Q0NA 3KYLA 2O66A 1SH3A 3TAPA 4KC5A 1YGYA 5K8NA 4K2XA 1BUXA 2B8QA 1FERA 3CCES 2M5YA 4WWSA 1RT1B 1M5KC 1FFSB 1PIEA 3KKFA 1T03A 2CFXA 3R6GB 2HVDA 3OJUA 4OZJA 2BJ1A 3RAXA 1HBOB 4ZVGA 2X1BA 1HBOA 2QLWA 4Q2LA 2EG1A 3C16A 3KLFB 2YNHB 4USVA 3U7JA 5GAEU 3BYRA 3I6PA 3UNYA 2AZ1A 3N6LA 2QC3A 2RRBA 3LH2S 3WDOA 3WIVA 3ENWA 4KTQA 2XWXA 4EBDA 1BQXA 4DR4J 1M1HA 2ACMA 2FUG9 1SJQA 4C8MA 4DG1B 1TR0A 5HN0A 3OXLA 4W92B 2KTQA 3UDLA 4KY3A 2FGOA 3EGWB 5CYMB 3J7YU 2WAQD 4DL4A 5CYMA 2ADCA 2ZH5A 1K8AT 1JX4A 2KFZA 3CO9A 3CMQA 4WE1A 5LSRA 2DGUA 1YBTA 3OR1B 4GKJF 1IUJA 2CNOB 2G9OA 4EK2A 2VFRA 3ZZPA 1VR6A 4ZP8A 3FSYA 1N54B 1N5YA 2VPXB 1AW0A 1TKXA 3P5BP 4A47A 1MW7A 5LL6d 5C2CA 3P3DA 5KFHA 1Q7LB 4RNMA 4X4UA 2VICA 3KUGA 1KONA 2EG2A 4ED6A 4OJGA 2HQDA 2LEAA 4LFAJ 1Q4RA 2K1RA 2L08A 4WFYA 2K1RB 3CC2S 4DCJB 2XG8A 1ZA1B 2NUUG 1YJRA 2HBZB 2I1RA 1WNEA 4I7FA 3DOLB 3H5YA 5KFWA 5EWEA 1D9AA 3ILOA 4W98A 5ETVA 3BB5A 1BWVA 2E1AA 2MZTA 3NG8A 4PCQA 4P9SA 4IH7A 4ZVPB 1YG0A 2XTJP 2DGOA 1DBDA 1ZPWX 1JLEB 1N52B 2CG8A 1JJCB 2ZFHA 2ZWOA 3DOMB 1YBUA 3HHDA 4A8KA 1VISA 5HP1B 1XNQF 4K0KF 2R7VA 3BO3A 5F9LA 4ZK7M 4C3MA 1ZTTA 1LNQA 1SKUB 1R89A 3M1VB 3HKWA 3OJSA 2MKSA 2W9BA 4LFAF 2BQUA 2JJ4D 1U48A 1DJ0A 3H2LA 1LFWA 1A7GE 2MPUA 4X4SA 4F04B 1WTBA 1S1WA 5K9FA 2CVEA 3TJAA 5HVGA 4OZ1A 3RB3A 1N36F 2HWIA 2OPSB 1IR0A 4JI5J 3NS6A 4FKXA 2MB0B 4JI3F 3DGVA 5D15A 1FTRA 1UWAA 1LWEA 1RTJA 1S48A 5T14A 2B6AA 2CPIA 1C4CA 2B6AB 3ICLA 1EETB 2HIQA 2LEBA 2BACA 1N34F 2VA2A 1LW2A 1UTAA 2XZWA 4R25A 4IDKB 2N82B 4RX6A 1H38A 1YJWS 4OLOA 4OYZA 2PFDA 2ZH6A 5HO4A 2BRKA 1GTHA 4F50A 4BLGA 4JI5F 2FHMA 2HFVA 2ZBIA 4LIRA 4YN3B 1SC6A 2BXJA 1RHMB 4NEZA 4RW9A 4USWA 4YUDA 1MN7A 4LR8A 3RBEA 3IWXA 2DHXA 2ROPA 2GIQA 1TU0B 2X51A 1MMDA 3BKUA 5KT6A 2DRDA 3M4XA 1BQNA 3FFIB 4YS2A 4I0WA 2DNKA 2WZ1A 5AT1B 1NZAA 1X4CA 2CIMA 2NYIA 4DV6J 3SFUA 5KT3A 3K57A 3MM6A 2UXBJ 4F3OA 1ZBTA 3FCHA 3OTDA 3GR0A 2MZ1A 2WVBA 4IOAQ 1B70B 1QSLA 2KDOA 1B7YB 4QW9A 2F40A 4LF5F 1DFDA 2BM1A 4OI3A 1I1GA 4C0OC 1KVIA 1YKWA 1JWWA 1S1UA 3CCLS 1OSDA 3KHLA 2HZCA 4QWAA 3RBDA 3IRXB 4DZDA 3O1LA 2LU2A 1RHJB 1FJGF 1N88A 3QO9A 4M5LA 4OMFG 3W2WA 5LT5A 3QO9B 4AL5A 5C25B 1LQ9A 3DRSB 5T7LB 2OHDA 1RAIB 3DRSA 2EXUA 2VDIA 4Y2IA 5T7LA 3TZYA 2XULA 1O0PA 2I5JB 5LJ5Y 1JIHA 3Q24A 2FY8A 4NLUA 4ZKAA 2QL7B 2NXEA 1SKSA 2DXFA 4DPUA 3MUTP 3MMCA 4NLVA 3MFHA 3P4UB 2U2FA 5LMNF 2ZH8A 3J80U 3OL9A 2YXLA 3AQPA 2F9DA 4JI7J 2LA6A 3LP1A 1S6PB 3QIPB 3LAMA 1S6PA 4NLXA 1JKHB 3B82A 3NAHA 1S49A 1P9YA 2GJ2A 4Y2CA 1Y3KA 1XIQA 3I56S 4IQMA 3JAMU 4RZRA 4CH1A 3QWPA 1S0MA 2HMIA 4A8MP 2FQQB 3MM9A 3RW7A 1ZA2B 2V69A 2GZOA 3FBBA 1NPRA 3I82A 2C2MB 4N77A 3W65A 1WEZA 4DLGA 3KXDA 3LP0B 4IH6A 4A8YA 5KFXA 1T02A 1JJ2R 4NLPA 2V34A 4NA2A 4TQSA 2B9XA 2HNDB 3DLBA 4B9UA 2YPYA 3LA0A 2RDIA 2UVWA 2PIIA 1GH8A 2KT3A 1FDBA 3PRBA 3MEGA 3OTCA 3EJMA 1REVB 2AHOB 3PFOA 4FVMA 2NPFA 4WTOB 5BJRA 4LR7A 4FYVB 4OV6A 1S0NA 2HQ3A 2OUGA 3N28A 1RWOB 2AEFA 3KDNA 3PR5B 1F9HA 2I9SA 3MCOA 3R1LA 2E44A 2VUGA 3F41A 2MYFA 1FRLA 4Q7AA 1S79A 4H4KC 1CULA 3UCGA 3BPDA 5HJYA 2QTWA 4Q5VA 2WBRA 3VAMA 1FJEB 1S1VB 2AYEA 1QUPA 3M8QB 1RAHB 1S1VA 4H54A 1F3FA 3DRRB 3TA1A 1QSYA 1VQ9S 1FKPA 2PEBA 1WEYA 2F4VJ 1X0FA 3MM8A 1UWBA 1Q78A 4FYYB 4IYQA 2HBYB 2HVEA 3D67A 4OI4A 3T9NA 1VQLS 4DL7A 3NNCA 3IAM9 2QV6A 3KG0A 3T5LA 2KL8A 4L3KA 4YB6A 2BR0A 4LUBA 1FKAF 3J7A1 4I2QB 3I0SA 1AROP 1PC4A 3I0SB 1YRXA 3R1HA 2QSWA 3C6UA 2RUSA 3CCWA 4I69A 1YHQS 3UVJA 4CP5A 2RF2B 4N56A 3PRVA 1PYSB 3CEDA 1HHSA 4ECWA 2GO9A 2V4JB 3D68A 4UW2A 1KEKA 3B8HA 1KNZA 2DCUB 1VC6A 3Q8SB 3TA0A 3FSXA 3ZFVA 1RWKB 4FYXB 5L1IA 1NSPA 2ZVSA 3OR2A 2KJWA 3KG4A 4QWBA 3UD5A 3R5DA 1JLCB 3OD2A 1JQGA 1LXNA 3R5JB 2CQCA 3BH7B 2IYIA 4HVZA 5KFUA 4JI2J 2Y8WA 4RUHA 1RT2B 3GE9A 1RT2A 2DH9A 1U2RA 1Y10A 2RKIB 2XMWA 4KV8B 4DQQA 3Q2SC 3ZNUA 2CQBA 1IBCB 1HARA 5A8WA 1CEZA 5CD4H 1U47A 2RU9A 3OT9A 1RHQB 4AUKA 1GMWD 1VGYA 1F9EB 2W8KA 4LF8F 1RBLA 5H9EJ 4NLDA 5KFLA 3PHTA 4X4NA 3CPWR 3R8YA 2P5VA 3H40A 2HGLA 4WFNQ 1VRUA 1KFSA 1VRUB 2QL5B 2XGPA 4ZITA 2ZD1B 3U27A 1TUGB 3UR3C 3AA8A 4NMLA 3F73A 5CZXA 4DQRA 2XI2A 2KG0A 3MR2A 2BEFA 4WXOA 3ZO7A 5IZHA 1FRXA 3RUBL 2MY8A 1UVIA 3J81U 1WC4A 2D74B 1X31C 2F3JA 3SZ2A 2EKYA 4OX7A 2MHEA 2LECA 4IO9Q 1CJKB 3H0PA 3O8WA 1DLOB 1UKUA 2BJ8A 2W24A 2E7WA 3GSDA 4ZVRB 3MR3A 2QMUB 3HVTA 1O5JA 4NLWA 2U1AA 3RZAA 1I3OB 3FMBA 3FZ2A 2DEJA 3MOZA 1N5YB 1TMJA 2DGSA 2ZDPA 3GJQB 4NA3A 2FHJA 5ETQA 5IC4B 5IS2A 1F6TA 2VKZG 3POTB 1UVJA 2VKRA 4KGVB 2J0SD 3HFKA 3OLAA 3W62A 2ZJRQ 4YB1P 4P2MA 2UU9J 3FQLA 4L6V3 2XMAA 2ZKUA 2FHKA 3R2DJ 1MN9A 3CCQS 3GJSB 3I32A 3OVAA 2ROEA 1OWXA 3EZOA 2HS4A 3T1YJ 2J7UA 2IRYA 1RHRB 2QLXA 5DGAA 1U1OA 1SV5A 2IA0A 2VL1A 4Y65A 1NEEA 3ZNJ1 1EKRA 4ZP6A 1JLBA 4YDDB 3HHKA 2W7PA 5C7PA 3OQ2A 1Q7YT 3TJ9A 1RAJA 3D1HA 4ECQA 3DLKA 5E3AA 5KFSA 1WOSA 2FJVA 3DLKB 2DR9A 4X66F 3QLHA 5KFVA 2ZHOA 1NKBA 1FRHA 1Q81T 1FF2A 2ZBQA 1QAJA 2UU9F 1K47A 1SJFA 4U95A 4DBQA 2AD9A 3FSIA 4RR5A 1XR7A 3Q8RB 3I4PA 4EO6A 5GADU 3CJQA 1UJ6A 1S1WB 3A8EA 2V2KA 3K2YA 1KLNA 3RBZA 4DL6A 4JI4F 4X2BA 4DPYA 1REGX 4MK7A 2M7SA 4TQRA 3C15A 3M2RA 2MKHA 1TKTA 2YH0A 5HVFA 4DV6F 5DLFA 1U1PA 4DPOA 2OSQA 4TU9A 4ERDA 2M8DB 4I67A 2J0WA 4KHPF 1S1XB 5E3RA 3NNHA 1ZAVA 2X1FA 2HG4A 2LA4A 4GVBA 1FDNA 2VIHA 2FHOB 3FBFA 4DR2J 1HR0J 3CWJA 3J81Y 4DL0C 1IKYA 2XQCA 2JNJA 1VC0A 4RPFA 3QNWB 4ZA1A 2QMWA 1RWNB 3F44A 5J1NA 2AZ3A 4JI0J 3N5BA 4MTPA 2FLPA 1HI8A 3M30B 3NOCA 4PWUA 3PJXA 2K3KA 3C16B 4DX6A 3KLFA 1VBXA 2OJ3A 4J9RA 2CQPA 3CD6S 1PJ7A 2VG7A 7FD1A 3IA0A 3KK3B 4XO0A 2O1PA 3FQKA 4ECUA 4KHPJ 3Q89A 3FBEA 1I94F 3AJDA 5L46A 2HWTA 1HQ2A 4IOCQ 4NXNJ 5A2QY 4RJVA 5I42B 1MLAA 4WFZA 1M5PC 3CJ8A 4J9NA 2ZBRA 4LFBJ 4KFBB 4OI2A 4U7UD 1SC3B 4IG3B 3OHBA 4MFBB 4FF1A 3C46A 2YNGA 4WP9A 5HQ8A 2KVQE 3LW5C 3SQGA 1M5OC 1PAEX 4DOZA 2LVWA 1EP4A 2Z58B 4G3IA 2R2UA 2MZQA 2DHGA 1T9UA 2Y0SD 4O3PA 2ZH3A 3D3CJ 4PQAA 4JI8F 4EYIB 4Y2AA 3ZZUA 1SJRA 2AMCB 1Q16B 2R7OA 3TQ1A 1JXEA 5J2NA 2KU7A 5J2PA 4ICLB 4K4YA 5KOXA 4NI2B 2QIFA 4LFBF 3MM7B 2HNYA 1P1LA 1RI7A 1RA6A 5GMEA 3EE3A 4DPWA 1RWWB 3ETOA 3HM9A 3PVXA 1NH8A 4HT5A 2GHVC 1JLQA 4CO2A 4H4OB 3WHIA 2DNHA 4GMKA 2XI3A 2EKNA 3KWMA 2BJ7A 3TOQA 2J9DA 2V6AA 1J2VA 3BF4A 2PSZA 4I1TA 4DUZJ 2ZWPA 5D4PA 2FJWA 4UOHA 2Q43A 2ZH9A 3KLHB 4GKKF 1RABB 2OPRA 1OS5A 4DUTA 1PGZA 2ZOMA 1BQMB 1RT4B 2IBOA 2JVRA 2RILA 3D4JA 3M8RA 1RT4A 2CRLA 5JMNA 5C5JA 3NCQA 3PX6A 4EGLA 3DLHA 1HQEB 5HBMB 1TAQA 3MMBA 4DZ6A 1SL1A 4FNHA 2UXDJ 4NCGA 5M2RA 1S1TA 1X4BA 5DETA 2F4VF 2K2PA 1UA1A 1UEVA 1VQPS 1IBMJ 2HAIA 1TFYA 5HMYA 4HLBA 2R8KA 3DGPA 5EX0A 2FLNA 1HKAA 5A8RB 3TI0A 3DGPB 4CLPA 4ES1A 2G2YA 3RR8A 3H90A 3DI6B 1H74A 3AODA 2YY3A 3MMJA 5C42B 1EETA 5KFBA 1WG4A 2GNKA 2Z30B 5C42A 3SV3A 4K4ZA 1RKIA 4LRDA 4NZ0A 5HK4A 1S9EB 1T9YA 3NLCA 2GIRA 1ZZNA 1XC9A 4HKQA 3M9NB 2OMOA 1JJHA 2AJ0A 1M0SA 3M6XA 2CPXA 2Z2LA 1HA1A 1ITPA 3W8GA 1HBUA 1CULB 3EXYA 4ENOA 3PHEA 4LBPA 5D0RA 1TZ0A 2CJAA 3DRXA 4I56A 1QY7A 5J2MB 1RDRA 2AJ2A 3DDNA 4TU7A 4F26A 1HW8A 2XLJA 5IT0A 1D9FA 2NPIA 2VH7A 1D9DA 3MCMA 1C1BA 1WC5A 2CQHA 5B08A 1N48A 4DR7F 4PYDA 3CCMS 3TARA 3NMRA 1DRZA 5IXUA 5E3QA 1X4EA 1HNZJ 1RTHA 3SIPB 1G6BA 4A48A 3SCLE 2UVVA 1NHKL 1HNIB 3I0RB 4B3RF 4E8UA 1AUSL 3A12A 1S4FA 1JLEA 1XR5A 3LPEA 4NLTA 5F3TA 5HMXA 5IWAJ 4ZLNA 4W90B 3IMQJ 3GR1A 3H25A 1F2GA 1RAAB 3RYLA 1HI1A 2GA7A 1HWIA 1WOPA 5KG6A 4PUOA 4JYAJ 3ITHB 4ZPTR 1L3UA 3ITHA 2XHWA 1SQEA 1FNOA 3PACA 1SJ1A 2VFTA 3PCOB 4JOUA 5IT9U 4CLZA 1VRQC 3HP6A 1L3SA 3D1OA 2PA8D 1NSQA 1NXIA 3SSSA 2HHHJ 1TL1B 1X5SA 3D0HE 3N0VA 2MEWA 1ZS6A 2X7IA 4MJKA 3CJ2A 2K8GA 2RB7A 3NKYA 4DFMA 2YQ0A 2R7XA 1R43A 2IM2A 3UO0A 2QSFA 3OPKA 3PYEA 4Y6IA 4F2SA 4OX6A 4LVNP 2XO7A 4PG4A 4KB7A 8ATCB 4DR5F 1IBKF 2EFGA 4IDKA 1UETA 2EFPA 4LF2A 4CT8A 1DAXA 1FCAA 3DLLQ 3BGUA 4ZCLA 1D09B 1RAFB 4K7QA 2XM3A 4K4WA 5ETTA 4A8FA 5FIIA 4P7TA 3OTBA 2BKOA 2R2SA 4EBCA 3IGVA 2IAJA 3DOKB 2VBXA 3QIPA 4ZP9A 3IR5B 2CXEA 2EFVA 4DPXA 3PX0A 1QM9A 4FF4A 1X4HA 1GXUA 5ETKA 4LF6F 2V8PA 4OL8A 2YNHA 4OYWA 2MJNA 2G13A 1WG1A 4RWWA 2XHCA 4F4WA 2ASJA 3VAGA 1QDUB 4LRAA 4RNOA 1NSKL 3GFXA 4MT1A 5AE3A 3VAFA 3W63A 4DV4J 3LPYA 3M8PB 4PWWA 2XYPB 1RWMB 1RT6A 1K0TA 3BDEA 3M2VA 3RRKA 2NYHA 2V8DA 3OTOF 3KK2B 1CPZA 1VDHA 1R0CB 1N5VA 2QLBB 2PDAA 3N6NA 2E9TA 3NBPB 1HPZB 2NSCA 4EZ6A 1GXLA 5EX3A 3GYGA 3AT1B 2YNIB 4WE1B 5I3UB 2NXCA 3N4WA 1L3KA 2DR5A 1B4SA 1VJQA 3RTVA 4LF8J 3W64A 2KRBA 4OYXA 5DRKA 5L1JA 4DV5J 5H9FK 2DGWA 1U1RA 3Q2TC 4F4XA 4F0MA 4IFYB 1Q1KA 4Z2XA 2GV1A 2GW8A 1TTHB 2F5GA 4QWDA 1DQAA 2DJWA 3MTJA 2YWFA 4DLEA 1C0UB 5C25A 1ZZFA 2HFNA 2C28A 4X4QA 1ICEB 4P2SA 3IN5A 1SV5B 3MPWA 2R42A 3FJ2A 5EHHA 5KFQA 4RW6A 2E1PA 3LO3A 1WC1A 5IWAF 1LWXA 1RTIB 1JLBB 2ROGA 1VQSA 2L3MA 2A1BA 1DTQB 4I2QA 2EFNA 1RT3A 2QO3A 3PX4A 4AFFA 3DMJA 2QFJA 6AT1B 2LMIA 4EO8A 2HFOA 2CYYA 4K4VA 3FVYA 1IM6A 1F3VA 1NK4A 2BKNA 2CWXA 4DL5A 1Q53A 1U49A 1FK9B 1Z4UA 4QIEA 4B3TF 4DX7A 2HHQA 1LWCB 3SQOP 2DNOA 3Q83A 1MU2B 4NWBA 4IFVA 3WX8A 1DQ9A 2QLJB 2CZVC 2HHSA 4QU6A 4TYAA 3M32A 3RRGA 2CADA 1EARA 5H9EK 1TKTB 1JLCA 2DYAA 2GMJA 1RAEB 1DARA 2CQGA 3BSOA 3W60A 2MQMA 3A8JA 4P10A 1QE1B 2VG6B 2GQ2A 2RKIA 2XSJA 2ZDOA 4KRWA 2VG6A 5K14A 1J27A 1OYDA 2WVCA 4MK8A 2BM0A 2XZDB 4C11B 2QJ3A 5J1EA 4X65F 2RRNA 4P72A 1OSCA 1V6HA 3BR9A 3UN3A 4B17A 3G6XA 1IBKJ 1D3WA 4ANCA 1RZMA 2MTLA 2DR7A 1PYTA 2Q1LA 2R7RA 1FX4A 2CJQA 1RYRA 4HACB 2VFUA 2XSFA 3C2PA 4O4RA 3H42A 5BXIA 4F4YA 3PO4A 5HLFB 3VCDA 1UPPA 2HS3A 4RW9B 3KJVB 3BO4A 4XK8C 1NH7A 1YRUA 2MY7A 2WBMA 2MMYA 4QW8A 2MXYA 2XCPA 1RGVA 2LXFA 1FWPA 4DL3A 3LQVA 4Q45A 2HS0A 5JVGQ 1FHTA 2C22A 4ZPCA 3TYTA 1RU1A 2ATCB 2XS7A 3SDEB 1VBYA 1RCXB 1TL3A 4L3NA 4RW7A 4OZLA 4M95A 3FK4A 3CD7A 3QSYB 3T3FA 4KSEB 2XNRA 4J9SA 3I87A 5HMZA 1CJVB 2VPWB 3FZBA 4ZCKA 3RJMB 1CJKA 2H5EA 3LF0A 1CG2A 2JC0A 4I64A 3U1MA 2BANB 2QG9B 4DFJA 4F4KA 4R0EA 1EP4B 4DSEA 2L9DA 3KOAA 1HQUB 2XY7A 3BGFA 3HK2A 2PEHA 3UPFA 3IFEA 3KLEB 2XC9A 2RQ4A 3W7BA 5K8OA 5HROB 1RWVB 3HFZB 4PG7A 2B4UA 2DNQA 3SEOA 1GNKA 1UW4A 1Y7PA 1V3RA 2QA2A 3W5ZA 2B8PA 2E5LF 1Y5IB 3IRXA 2IJNA 4O4GA 2VJVA 4DQPA 1M1GA 3GG0A 1S59A 3AB2B 4I6WA 1KKHA 4CTAA 1ZOTA 2VQEJ 3HHLC 3D66A 2D41A 2ZKTA 5M2UA 2HLTA 1ZM2A 4QIWD 4C7QA 3L7OA 1S57A 3U1NA 1CJUA 1FWLA 2AKWB 2GVZB 2E5IA 2KT2A 4OZ0A 4B9MA 1WWHA 3DHWC 3G8QA 4ZIVA 1SIWB 2RUGA 4KO0B 3V6KA 1RWUA 3ZZYA 4ZPDA 3KLHA 3SFGA 2K06A 1FKOA 2JDJA 5DG9A 4XPCA 2Z4PA 2DH7A 3CCZA 2YQ1A 1RT5A 2HVZA 3ILJA 2V8HA 1WTFA 1RT5B 1RJJA 3OFHA 1SH2A 4HDGA 5ETLA 4E98A 5A8KA 5FLXY 2V50A 2IDLA 3E3XA 3MMBB 3C14A 4U8VA 3THVA 1FXLA 3C14B 2C3UA 4FS1A 1AZSA 3GCWP 2Z56B 1E6VB 4TLQA 1XQIA 1F1BB 4JI3J 2J9CA 3CB4A 2W9CB 2DISA 2IRXA 2IIHA 4J9LA 1X0PA 2LQBA 2FVSA 1WDDA 3NGUA 2Q6CA 1S1XA 2VHGA 1KHVA 2EC2A 2BA9A 4W4MA 1NZ8A 4QIFA 2AYGA 1VQKS 4LF4F 3MM5A 3P6YC 3CDWA 4ECVA 4ED7A 1Y5NB 2ZE2B 3CJKA 1VQNS 1S6OA 1WHYA 3MOJB 2IVMA 3HHEA 3HZEA 3QT7A 5RUBA 3EPGA 2JEJA 1GX6A 5IV4A 3LGMA 3UR0A 3RB0A 2MZRA 2B0GA 4TXSA 5K5MA 2A18A 3FGVA 4ZJQA 5J2MA 4DR6J 3M2UB 1Y3JA 2MKKA 3BPSP 1H2UX 3VAIA 5H1SV 1GEHA 4OJHA 2AGPA 1Q5YA 3EGZA 5ETOA 5EN1A 4TN2A 4RNNA 3DFEA 3CJTA 1JXVA 5CXTA 2VA3A 2Y1IA 4DSKA 4YMEA 5J1PA 4ALZA 2DNGA 2ALZA 1HNIA 2D3ZA 4GRSA 2ZJQQ 1T8EA 1R0AA 1QSSA 5F3ZA 1TL5A 2NXUA 3N79A 3TZXA 2UP1A 3WX4A 2YQ3A 4KGXB 3H8YA 1C1CA 1OJ4A 1QAXA 1RBAA 3C6UB 3CTRA 1C1CB 3SQGB 2WOMA 2H4YB 4RUBA 2J6TA 4LF5J 2YNFA 1SQGA 3BSAA 3W9IA 4WZQA 1SH0A 3P8BB 2PA3A 1PBUA 2HKEA 1FDAA 1FO1A 2DHHA 2WVFA 2XMTA 1GMVA 2JZ5A 1SUQB 2L9WA 3LOUA 5THWA 3S8SA 1YTYA 2ADBA 1HMVB 2ZOFA 2EC0A 1HLWA 3Q8PB 3DRYA 4R0JA 1IN0A 4A8XA 1X5OA 2DO4A 3OR2B 4KH0B 2KHCA 4KJIA 4U7CA 1NHUA 2KO1A 4H4MA 1R6YA 3IBFB 2COLA 5GAGI 1XNRJ 3FMWA 1JLQB 5K8PA 2HGNA 1XR6A 4USJC 4EFAC 3QRQA 1IXKA 4QU7A 1WG5A 3BKFA 4NRTA 1KLMB 2ZVIA 3TW0A 4AYBD 1NK7A 1NK9A 1UVLA 3HO1A 2OEJA 2UUBJ 4FYWB 5D0GA 5I3PA 4DCOB 3VAJA 5KTQA 4C8OA 4WF9Q 4P52A 3TVYA 4DV0F 2CPDA 4AE5A 1RADB 2G2ZA 4JV1A 5L9XA 5F0WA 2FLLA 4U9RA 1UMJA 1EQMA 5ITHA 3OSNA 4USUA 2HYIB 2W8LA 2VASA 5KFZA 2MKJA 2OI2A 2ZD1A 3MD1A 3BQ0A 4N7TA 2HQIA 2W4CA 2QFIA 2YX4A 2KXHA 1BXNA 3M8WA 1Z2LA 3LGNA 1NKCA 1D8ZA 3M8YA 1HWKA 3QFWA 4OV1A 1EIYB 2FD2A 2VF3A 3RG6A 4LF4J 4MFBA 2CWKA 4FF3A 2R7SA 1X9MA 2DPIA 4YHHJ 1WDTA 3OUYA 3I55S 1KDNA 1XERA 3OUYB 3M9MB 1H73A 3T1AA 4DCPB 2XY5A 3NOGA 2E1CA 4TY9A 4DR7J 4ILMA 2ZH2A 1WKLA 2JRSA 5KFKA 5DJBA 2ASYA 3CCSS 2OIHA 4LRFA 3K8WA 1TK8A 4N76A 3PW2A 4NYPA 4N8OA 5J2PB 1M5VC 1IKWB 1RLDA 3EMTA 1RHUB 2RU3A 3DHXA 2P8IA 1T9TA 1PILA 2CQ0A 4PG8A 4CLLA 2O5DA 2W9AA 2QN6B 1C1BB 3JQMA 5D0EA 2QYCA 1UL3A 4NOHA 3J81j 3DOLA 5KFOA 4QWEA 2G1DA 4J90A 3VGTA 2DKOB 3W5YA 4EBEA 1B3TA 2KZZA 4KGZB 1NAQA 4HI1A 5CAAA 3VALA 3P45B 3TAMA 3DMJB 3ZZRA 2KG1A 3IG1A 3IR7B 2O3DA 1E6YA 2ALYB 4G1IA 2KKHA 1QAYA 4P2FA 3S6EA 1U2CA 4EUVA 3GIMA 1Z2ZA 3VQTA 3EWGA 3TRGA 1FK9A 4M5KA 3BH6B 3UN2A 1LW0A 5DDQC 1RWPB 3ISZA 3M7VA 5EDWA 1LW0B 1PG5B 2ZH7A 3A13A 3OVBA 5HAOA 4ECZA 2HVHA 4NCGB 1G7CB 1HWJA 3IO1A 4DDFA 1JXLA 5F41A 1WORA 3CDBA 2E7XA 2G0CA 3Q0AA 3C15B 3M2RB 3AH6A 3OFFA 2LFVA 1Y0HA 4CLYA 1PBAA 5ETMA 1S9GB 1TKZA 5ETRA 4M5JA 1TKZB 2R8IA 3KMQA 3RAMA 4LSNB 2ZNZA 3AD7C 5C24B 3ILIA 1T05B 2IYGA 2V2ZA 1N0UA 3GIJA 3PW4A 1FJ7A 1WELA 1PKUA 4OI0A 2WVEA 1S9EA 5KFTA 2JEFA 4K4TA 2W2MP 2P2CB 3CVKA 2VOOA 4V1Ak 3TANA 3TEGA 3T6BA 2HAFA 4YEAA 1I94J 3TR5A 5IQQA 4DPTA 2ZHBA 2XWYA 2RAQA 2KB2A 2BOAA 1FT8A 1VIXA 3HLUA 4L74A 2FVCA 3NGDA 2Z8QA 1BLUA 3U02A 3KK3A 1FA0A 1TK0A 3MMAB 1D0EA 1S76D 4NZ6A 1NK5A 3GLJA 1RKJA 2AWZA 4JI1F 2HVIA 1UFLA 1AYEA 4IH5A 3QT6A 4YOEA 2ZUAA 4DN0A 2DEIA 4RU2A 4ILRA 3ET6B 1TL3B 2OELA 4KGKA 4RW7B 3GU0A 2VV5A 4CYUA 3CC7S 3H4DA 4ZVOB 2FVRA 1S10A 1EAYC 3GFHA 3MAQA 4CRJA 2JHEA 4QYRA 2MZJA 4TVAB 2E9RX 4G1PA 1WHWA 2CVIA 4RW4B 1HPZA 1YRTA 2J7KA 1WHXA 4RW4A 4O3RA 2JLGA 1RWXB 1NMEB 2WSCC 1KD1T 3ZZZA 2XLKA 4PG6A 5F8IA 2NREA 4FBTA 2BBEA 2C2KB 2CNLB 5A76A 4UTGA 1LK5A 5GAEI 4NZ7A 5G0RB 1IR1A 1V3SA 3G71S 1U0HA 1S72S 1U0HB 4OIXA 4CO4A 2X1AA 1MMLA 3EDRB 3IP0A 3QYYA 2BZ2A 4NPOA 3VR1A 4LSLA 4IG0A 4Z37A 2XO6A 4K59A 3AD9C 4IG0B 4A8WA 4XPEA 1CQNA 4XAKA 4O23A 3R5CA 5D3GB 2GVZA 2MDAA 1SKRA 4B3SJ 1U6ZA 3G8SA 3FC9A 2LU1A 1V5VA 3L4BC 5KG1A 2DNLA 4PXCA 3THPA 2B43A 5MAOA 1X60A 2DGVA 3V81A 1BC6A 3O2IA 4KR0B 4ER8A 4U8YA 3AOCA 3QGGA 4OYIA 4ITSA 1T7PA 2DY1A 3M1VA 4WCEQ 3CJ5A 4RNHA 3KLGA 3V5RA 4CM0A 1HHTP 3S7RA 3KLGB 1RK8A 1GTEA 3BN7A 3J7YI 5HBMA 4UT4A 1WEXA 1OMSA 1E6VA 4ZJLA 3KHHA 1T9XA 5HI7A 3A3OB 3AAWB 3GTYX 1WF1A 5JVHQ 2DNYA 4DG1A 2KI2A 4DUZF 2LCWA 1T95A 2FZCB 1FRKA 1R31A 2M88A 3JSYA 5F0UA 4ZHRB 3FEYB 1ELOA 1TL7B 2W4DA 4FKYA 4DR2F 1QE1A 1SC1B 1KHWA 2FDNA 1V9OA 2Q79A 2XSJB 5ETPA 3UDVA 2ZZMA 3OW2R 3PNIA 2YNIA 2H5IB 5I3UA 2E5HA 3PO5A 4RL1A 2XMJA 3DRPA 4ZP7A 2WTFA 2J0QD 5B0FA 2V8GA 2YKMA 4FBUA 1UVMA 1U6BA 3PW7A 2B7CB 3L3CA 4HI2A 1WOOA 3ETMA 2EVZA 5IT4A 1B64A 2YWWA 4B3MF 3EXCX 3NGSA 3GV7B 3MPYA 2BRLA 4M8LA 3IRWP 1HNWJ 4CNZA 4X4PA 3HJFA 1NLKL 3JSRA 3MTKA 1H72C 4JV5F 4K8RA 2DK2A 1RB0A 2JLFA 5KFRA 2ASLA 5KFDA 3O5TB 3FFIA 2ZJPQ 1S99A 1O51A 4Q2MA 5B0GA 3TEHB 5LSOA 2H1YA 3I31A 1KVJA 1SC4B 4NCAA 1NHVA 3W3SA 4K0KJ 1RTIA 4ED2A 4USHA 2C2RA 3M6WA 4XTTA 2UXCJ 3MM6B 1JJ4A 1NDPA 3NP5A 4HHHA 3RB6A 3JYTB 3NGRA 4UOGA 2VD3A 1OIAA 3D6MB 2CNKB 4ZPBA 5LOQA 2DRBA 2PE8A 2X3DA 4BCAA 2CZ4A 2W4PA 3FRYA 2R2RA 1TKDA 1FEEA 3J7AN 1NK0A 1U45A 4CH7A 1WC6A 3DM2A 5ETSA 1WI8A 2MGZA 4CO1A 4CO3A 2G0IA 4X4RA 2GS8A 2KT5A 2V4JA 3EM1A 5A6WA 5LXRA 4AXIA 4DMZA 2YVSA 2R9LA 4JV5J 1LWCA 4UQTA 4M94A 1F2HA 3TWZA 1FXDA 1J5EF 3SI8A 3E2EA 2YWGA 2R3VA 3QAEA 3BGOP 3M32B 2QMXA 3W1YC 4F4AA 1NCLA 4C3LA 5EWFA 3VAHA 3BDPA 4H4MB 4O4GB 1IQZA 3H7HB 4WZMA 5LM7E 2YPZA 3R5GA 5KT4A 3ADAC 3OBIA 1UEKA 1VIOA 1ZAXA 2B5JB 2DNMA 4K2JA 4OYMA 5KG2A 3EDQB 1N56A 1SXLA 4BWMA 5FD1A 1PJ5A 3IXQA 4PXBA 1S12A 4ATNA 4YY3J 4DF8A 2HHVA 1S9FA 3DN9A 3TQEA 2H3EB 3ZZ0A 1X5TA 2DXEA 3VTIA 3L09A 4ECRA 2GMHA 1YX2A 2C42A 1FRJA 2R4FA 4HACA 4FVCA 2A6MA 1RT7B 2JLEA 1FE4A 2OGUA 4QR0A 4HH0A 2WVDA 2RD5C 1TFWA 1JKHA 2OP5A 3E8OA 2YH1A 2I2YA 1C0TA 2OKQA 2XYGB 4LIWA 3UWTA 4KE5A 5KG7A 2IM0A 4NLYA 2C2NA 4RNFA 3MD3A 3SMZA 4R8UB 1BQNB 3OTOJ 5MLCV 3HVAA 4ILLA 1ZPVA 3WIUA 6FDRA 2BW2A 3HT3A 2BX6A 1KQFB 2V4QA 2V0NA 1K1QA 2RS2A 1H2TZ 3RAQA 2J0XA 5KFIA 2J8AA 3M2VB 1LXJA 4FXVA 4K5SA 3KK2A 3ENQA 5C2GA 3CCVS 4DV7F 4UOFA 4DR6F 3OL6A 3IWNC 1FVQA 2J9EA 3CDAA 3IWLA 3NBPA 4DEZA 3PEHA 1N5SA 1IKVA 5M2PA 2AU0A 2HRYA 2BDPA 2UUAJ 3D9BA 5JUMA 3MECB 1X9SA 2UXBF 1KN6A 5AE1A 4PEOA 1FDDA 4UZBA 2AEMA 5HROA 3UCZP 1FJGJ 2EBEA 3CJSA 1OY6A 4DXLA 3J7ZT 2NLWA 4X84A 3JB9k 4WPAA 5FDLA 3OLBA 1ZH5A 5DQHA 3M8QA 3M05A 1QUVA 3P96A 4USTA 4O3NA 1YJ7A 3UD4P 2IMWP 4ANEA 3PIPQ 4JV0A 3ZC4A 2LDIA 5LMNJ 1NPPA 2ZUGA 5CZVA 2I5JA 1RISA 2FIUA 4J9KA 1HI0P 2QEXS 2F65A 1UJ5A 3HMJG 4EMDA 3KNAA 2HFSA 4XDCA 3H4BA 3KTQA 3TAMB 1KQGB 2V5HG 2CPHA 3MMCB 3ZTOA 3KLVA 4B3TJ 3Q86A 5G4DA 3ZZOA 4O44B 3UQSA 4O44A 3GJTB 4DSFA 1LFPA 2CAJA 4NXNF 1SPBP 2RF2A 1EQ0A 2WOMB 4LBHA 2YNFB 1TVRB 2HQGA 5CQGA 3NWRA 1WKKA 3DC2A 2Z0GA 4I2PB 1YZ6A 1J5EJ 2OSRA 4WXWA 1Q86T 2DNPA 3B6BA 1S97A 1H2VZ 3HSJA 4Y3CA 1OPZA 3GSIA 5D77A 1NUEA 3G6YA 3IM9A 3SV4A 1BY9A 2LP4A 3HPOA 4YP3A 1UAWA 2G4BA 5KFYA 3TP2A 4WIIA 2IMOA 4ZDNA 2CNNB 1YJNS 2JVOA 2PI4A 2WW4A 4ZPAA 2C2OB 3F56A 4USIA 1NU4A 3BQ1A 4OJ1A 2FTRA 2CJ9A 1Y11A 1UJ4A 5K14B 3GV5B 1HNVB 4CLFA 1VQ7S 2B4VA 2D9PA 4QR1A 2J6UA 4Z7YA 1Y00A 3NRBA 5A0YB 2VODA 1WC3A 2A0FB 3B4MA 2CZ9A 5KOWA 1QTNB 1RT1A 3KMSA 2VOPA 2JEGA 3WQPA 2GCFA 1VHIA 2C3YA 5EUHA 2H4WB 3BBCA 3G82B 1RXOB 3V6DB 1D1UA 2DGQA 4OZ2A 1SL2A 3V6DA 3MZIA 1XEZA 2MJUA 3KJVA 5D4NA 3VZHA 2DNZA 3GYNA 1V3ZA 2J7WA 4QOTA 1OQ6A 3A4TA 3C6TA 4DUYJ 4ZVQB 4GVLA 3ET6A 3MEDB 1FE0A 2A6OA 3K8VA 2WSEC 3ENAA 2CA9A 4P6QA 2J6SA 1K1SA 1G1XA 1R3NA 3JQJA 4DFPA 4MKVA 5KFFA 4C9DA 1LWFB 1UZDA 2MQPA 3KJQB 4AL7A 2XS2A 2B4OA 3PJ9A 4O3OA 3T9ZA 1C4AA 2AJ1A 5H9FJ 3SBMA 1VC5A 3NAIA 1QJHA 3QZ7A 1NB7A 4DR3F 1P6TA 1URRA 3DLEA 1ZM9A 4MIBA 1UFKA 2RSQA 4MMOA 3A3NB 3TZWA 2POKA 2FY1A 2NQPA 1SUQA 3DLGB 4DR5J 3KUHA 2HFZA 3CCTA 4YFUA 4YQWA 5J2NB 3QBCA 4NXMJ 2HHXA 3QPIA 4ICLA 4TLRA 1W26A 3GIKA 4NI2A 3CXCR 5IT9Y 4PZVA 2PFFB 2LYVA 1WKJA 3HHLD 8AT1B 2CJXB 3H5UA 4P74A 3T41A 2CJBA 2BE9B 2FPHX 3AFGA 4P75A 4A4JA 4A8QA 2GHWA 4AQYJ 4FNIA 2YKNB 1MROB 4BS2A 1ZETA 5B0EA 4RU9A 4P73A 1MNEA 4I7FB 3BGRB 4KV8A 2FZKB 3BO2A 4USMA 4ZVFA 3RGIA 3KK1B 2V9KA 3QSIA 4C2MA 5A8WB 3CDEA 4OFZA 2AX1A 1DQ8A 5DZ6A 1NB2A 4YB5A 3MEEB 3N5FA 2MQOA 2WW8A 1Q82T 1T03B 2UVRA 1JLAB 1YLXA 5KFGA 2UUCF 2OAUA 2ZNYA 3C19A 3FNNA 3JTNA 4WU2A 1TUVA 2DTJA 5HANA 3Q8VA 3K89A 4ZJOA 4KGMA 2VU5A 1KP6A 5A8KB 4B08A 4URQU 5KFMA 1GXTA 3FEXB 4OX9F 2AEJA 4U96A 3NCPA 3CT9A 1XMOF 2DPJA 1YI2S 4WK1A 2NSBA 4JI7F 3L7UA 1UVKA 4PABA 3K17A 5E41A 1VI7A 1AUDA 2XZTB 3I5CA 3CO0P 4NLOA 5A8RA 1QAIA 4IR1A 1TV6A 4LFCJ 3WC0A 1S9GA 3FCVA 2ZBCA 2BYCA 2ZC4A 3B78A 1HWLA 4J37A 2GJIA 2AJQA 4RUAA 4GVBB 3DXBA 1YZ7A 2RQCA 1NJZA 3GP9A 1SB6A 1XWLA 3PJWA 3PYDA 9RUBA 4KH1B 2PMZD 3QGHA 3PR4A 3D0IE 2V9WA 1FJCA 4DR4F 4PQUB 4NE9C 2MLXA 4WP3A 4G1QA 4MYTA 1U26A 2SXLA 5DM6Q 5GADI 3M30A 2JOQA 2QLFB 1FNXH 2A2CA 2E5JA 4R5PA 1N6QB 4R5PB 4KHMA 1CSJA 5CCMA 3CE8A 2W25A 4URSA 3E01A 3QJJA 4Y2KA 5E2QA 2RRAA 2OEKA 1BGXT 3PXGa 3TUIC 7AT1B 4AL6A 1NPKA 1NJWA 1RTHB 5F8GA 3QJPA 3TUPA 2IM3A 4KKOB 4DV3F 4C4WA 2OFHX 2XMMA 3ISNC 2GO8A 5AXMA 1U0SA 1WD6A 1YQHA 4M5NA 4P2XA 1TP7A 2V68A 4O0NA 1VBKA 5KG4A 3GPAA 3UW1A 3DYAA 3IG1B 4M5HA 5CD4A 4KPYA 2XBPA 3VZIA 1S0OA 5E7OB 2OH2A 4X4TA 2W9BB 1J5OA 1GQEA 1FI4A 2N4DA 3AOAA 4Q0BA 4LBIA 3OXGA 2O01C 3CMES 4LRCA 2F8MA 1IJFB 2JH3A 3PDNA 4WJBA 1IKXB 5HQLA 1YJVA 2HBRB 3CF5Q 3VVTA 2UUWA 1S6UA 2F9JA 2LDYA 2IJRA 1WHVA 4GKJJ 3NGKA 4EWTA 4LSLB 4PPZA 1NJXA 1VLYA 2EFQA 3JSMB 3JSMA 1IR2A 5GAHU 3B54A 3D5MA 4WFXA 3CCJS 1LW2B 1T05A 2HZAA 3GFYA 3D3BJ 3QATA 1RQ0A 1IKYB 3WBZA 2N7CA 2G0JA 4JI2F 5HSPA 4Z7CA 5B0CA 3TVZA 3W9JA 2ZH4A 3QMQA 5A2QU 2XY6A 3LP2B 2MZSA 1YJTA 1BHNA 4K4SA 1H0HB 1WSVA 3SSQA 3IS9A 1RSCA 3KFWX 2C2EA 1OY8A 3EYZA 1YJUA 2CPFA 4DI6A 3BBFA 2M8HA 2MQNA 3UN5A 1JNRB 2VJUA 4LFCF 2HHTA 2JC1A 2V94A 2XNQA 4JV2A 4IG3A 2E5LJ 1RTDB 2HHPA 1XMQF 4E2FB 4ZS6A 2Q66A 1FTCA 3DI6A 3PM9A 2IHR1 1B0VA 2KRRA 2HHUA 5GAGU 4H4KA 4C3KA 4OYBA 1GMWA 1ROFA 4NA1A 2KFYA 2K3IA 2ATLA 4PRFA 2CQ4A 4EYHB 1WUUA 3AB4B 4LJMA 2ASDA 4K4UA 5AE2A 3PY8A 5L1KA 1R8HA 1IBLJ 1FESA 5CA5A 3VGVA 3G6VA 2BV3A 4ELTA 2M0GB 4B3RJ 1IKWA 4KIAA 4OX8A 2DY9A 4PAAA 5CHCB 5BYSA 4C8KA 2KVIA 3Q8QB 3NEKA 1ZM3A 2V2QA 3TA2A 3T6JA 4C8NA 2B9WA 2HIYA 4NLSA 2PMHA 1A0OB 1VFJA 5AXKA 3W2WB 4M5DB 4U6PA 4DJBA 2KZMA 4OQJA 1U7LA 3MWBA 4M5DA 1N32F 4BDPA 3QIDA 1L5UA 4PXDA 1UWBB 1VYAA 2CQ3A 2B4PA 4ZLJA 2CDRB 2I6WA 1DTTA 2APOA 3CJRA 4TYBA 3MR6A 5LMUF 1KRPA 2J76E 2ZM6F 2DVIA 1L3VA 3PYGA 4DV7J 2JFDA 2FZGB 5DQIA 4O3SA 4C0BA 2FC8A 1RU2A 3DOMA 2MLZA 1GK8A 4JP8A 4UF4A 4ZVHA 2VPYB 4JI6F 3T5KA 4DV2J 2Y8YA 1I51B 1SJ3P 1HL6A 2WCXA 2PC6A 3EVMA 2M9KA 2BJEA 4PG5A 1AFIA 4B9VA 1MWYA 2BW7A 3CJ0A 4F67A 5BYQA 1U24A 3G9CA 4DF4A 2B9EA 3LGHA 3G96A 1BE4A 1UPMB 1SCJB 2B51A 3HHLB 2A3JA 2X1GA 4LF1A 4QBUA 3H5XA 1A6LA 3PG9A 5E33A 3K5LA 1NRKA 4DQIA 1JLFB 3LP0A 2VG5B 1JLFA 2B5JA 3IR6B 5KAKA 2VG5A 2N3OA 2HNDA 4AT1B 4NCBA 1N5TA 2XMVA 4BC9A 3H98A 3PKYA 4LF6J 2EK6A 3CW2C 4ED5A 2DR8A 4C6AA 4X65J 3DRPB 2P9GA 3CJ4A 2YKMB 2BE7D 1CS4A 4ZOSA 1JB0C 4FF2A 2DIVA 3M8SA 4FDFA 4ELVA 4FPRA 1A9NB 1H6KX 2I0XA 5K8MA 2IAJB 1B0TA 3DOKA 3KJFB 3KJNB 1NK6A 1VJWA 5IC6B 1CBKA 3TX8A 1HHQA 2OPQA 5DZ7A 4CH0S 1CJTA 1U1MA 1XN9A 2OPQB 1CJTB 1TELA 2IA6A 1VBZA 3D28A 1XBWA 3C6TB 3DRRA 3BM7A 2HNZB 4DX8H 5SZTA 5GVQA 2DH8A 2D3UA 3H5SA 3X1LB 4OYPA 2F4FA 3SDEA 2NXJA 4GKKJ 5KG0A 1IWGA 4I6YA 4ED4A 2L41A 2OO4A 4ETXA 3I0RA 4KHRA 4ZCIA 5T41A 2W2QP 4NLGA 5LJ3Y 2P9CA 1K73T 3NNAA 1VS3A 2FYXA 2GQQA 1O8BA 2CUYA 3GONA 1EB0A 1KVKA 2MQLA 3X3UA 2CQDA 5DGBA 1HQUA 3R3TA 2C2DA 3O44A 2OEMA 1F60B 3HVTB 4A46A 2VQFJ 4X64F 5F8NA 2Q6BA 2QL9B 4CI0B 1FD2A 2DNRA 1B0PA 3AJ2A 4JI1J 2PO4A 2HBQB 2P6TA 2LQJA 4UY8T 4DHVA 1URNA 4ECSA 1S1UB 3AXMA 4N8NA 5G0RA 5IM0A 2KM8B 1I5OB 2NUHA 5IM0B 5FDLB 2F7VA 3R5BA 2D3O1 4Q43A 3LWLA 3EPIA 1EKSA 1S6QA 2BJ9A 4KT0C 2XYHB 3GB0A 4QIGA 4WBFA 5HLFA 3PEJA 4RUCA 3V6HA 3MR5A 5B0BA 3HVRA 3MAHA 2HRTA 5BR8F 2C2ZB 3D0GE 1KFDA 1NSAA 1RBOB 1VQ6S 5K20B 2FLOA 4MIWA 1HNXJ 3DDKA 1S4EA 2JWNA 2GGPB 3QJLA 2EI5A 1DTQA 3MEEA 1Y9OA 1Q8IA 3OSPA 4RWXA 2WONB 2CQ2A 2ZBPA 2MSSA 4DR3J 4F4ZA 2XB2D 1U02A 2IM1A 4OHVA 2BABA 2CPZA 1NJYA 1TVRA 1VQMS 1TAUA 4OHYA 3PRDA 2BJDA 3UDCA 2B7BB 1CC8A 2A10A 4N5SA 2CKWA 4R8UA 3I5AA 3VGUA 2LXIA 4YR0A 4DUYF 5D6GA 1PSDA 4MIAA 3GIIA 2W9CA 2DD8S 5KFPA 1EHWA 2BOPA 3AOBA 1HBMB 4DR1J 1M5HA 3M8PA 2F1FA 4PYAA 2DRAA 1RT6B 5AJ3J 5ETNA 2QZ8A 4UQGA 4JI4J 1SQFA 2X3GA 4E0DA 4Y00A 4ZHRA 1TL7A 1NBEB 2ILYA 1SIZA 1T3OA 1QLNA 2ZZTA 2F8HA 6FD1A 3DXSX 2GVDA 4NL5A 1PAUB 3HF5A
chains in the Genus database with same CATH topology
1RA7A 5L39A 2BQRA 4PXEA 1SL0A 4BWJA 3CD0A 3VF0B 1HR0F 1HW9A 1KTVA 1X4DA 3JAMY 1VK8A 3MCSA 3DNCA 4NX9A 4B9LA 3M2UA 4WFBQ 1I6JA 4DSJA 4QCLA 1KR4A 3BQ2A 3KG1A 5AJ3F 1X4FA 1FD8A 5EGYA 5F8JA 2XS5A 2WK4A 5U47A 3J80Y 4HEA9 4KKOA 4YDXA 3O3LA 4BHQA 3MM8B 4C98A 5KFJA 4KFBA 2BUNA 1WF2A 3FDSA 1L3TA 1YIJS 2YNGB 1VQOS 1U4BA 4V19J 5D8HB 2RJZA 1OPIA 3UD3P 1KOOA 1RYSA 2OLWA 3QLHB 4I4BA 3PIOQ 2AF6A 3EZ5A 1HYSB 1HYSA 5I4MA 4CO0A 4HDHA 3G4SS 3BSCA 1X9WA 1N33F 2EWHA 1IKXA 2KHDA 4IFVB 1N0VC 4KAIA 4Y0FA 2AJ4A 3RB4A 2Z2MA 2P9EA 1MSWD 2N7YA 4ECYA 1R7IA 2DIUA 2VC1A 1SI9A 2L9NA 3S01A 4FP9A 1HD0A 4CTAB 4IRCA 3T5HA 2PI5A 2WRMA 2KM8C 1XK8A 3JTPA 3CC4S 3US5A 4X62F 1KQSR 3OL7A 3AJ1A 5AXLA 3A1YG 1SBRA 4XDDA 5J1EB 2M70A 5B0AA 1C2PA 5A0YA 3TO8A 3UNGC 3HKZD 3CMAS 3G86A 4TY8B 1LV5A 4N41A 2DITA 4TY8A 4YB7A 1F5CA 5HMWA 1Q79A 4JBCA 1M1KT 3LUYA 2QRRA 2CQ1A 2DGTA 1C0TB 1FVSA 2HLUA 4L72B 4DQSA 2PD1A 1G2EA 1S1TB 3BJYA 2RT3A 3NMAA 3GZ7A 5DG7A 3AHPA 2ZHAA 2E1RA 3SCKE 4DS4A 3HZGA 2E29A 2M4MA 3NS5A 4HYKA 1OQ3A 2I38A 1F5AA 5KFEA 3CCUS 2ILZA 3MGJA 4J9OA 2VBZA 1N4LA 1DURA 2LXUA 3OR1A 3MM5B 4OZNA 2H9ZA 3K5PA 1TK5A 2E9ZA 2KJVA 4CQ1A 2IFXA 1S7HA 2Y1JA 3DLGA 5E3CA 2ZOGA 4GO7X 2D1CA 4ZLPA 4DL2A 1VQ8S 3LWMA 2OTLS 1HNWF 2KN4A 3GG1A 2R7WA 3K7RA 2HNYB 5B09A 1QVFR 3W2VA 2R7TA 3VQSA 4PWDB 3CIMA 4QWCA 2YKPA 2FJDB 1MROA 4PWDA 2CPJA 1WACA 2OPPA 7FDRA 1MMNA 2XLIA 5KT5A 4K50A 3PZPA 1ZM4A 4ETZA 2B3TB 2GX8A 3OXFA 3IGNA 1VQ4S 1R0AB 3RU0A 1PC5A 4KO0A 4UOCA 2CPEA 4DFKA 3DU5A 4IR9A 4A8SA 2KFNA 1N6QA 2OPRB 4WYLA 1X5PA 5JJBA 4B3OA 3AQOA 1BQMA 3V4IA 4B3OB 3V4IB 1Q8LA 2DB1A 2RDJA 1HQEA 3UFCX 2P6SA 2ABYA 3MPVA 2I8EA 4RKUC 4J9MA 2R8GA 1TL1A 3CDUA 3NL0A 3IBWA 4WYWA 1TV6B 1LWEB 1RTJB 4YR2A 4EZ9A 3BSNA 5F8MA 1KQKA 1W25A 2E1MC 3MXHP 2E66A 3LALA 3FRZA 1KLMA 4GC7A 1K9MT 3THTA 2EW9A 2VQFF 2AQ4A 2KYZA 1QVGR 4PQUA 2FB0A 5L1LA 1P27B 5E0OA 4F3QA 3T1YF 3M6UA 1HBUB 4Q8FA 1JK9B 3OFGA 5ADZA 5CYJA 1SJ4P 4MK9A 3RR7A 4UY85 2LEPA 1ZAWA 4EEYA 2A2DA 5DO2A 3TUJC 3Q22A 1JLGA 1H98A 1H3DA 1R8BA 2VG7B 2YWHA 3DLJA 3E01B 1KOHA 4K4XA 2FJBB 4RW8A 2NS1B 4PKDB 3CCRS 2HPUA 4U7UK 2R7QA 5I42A 2YTCA 2YX1A 4DS5A 5F8LA 1P1TA 1VQ5S 4OI6A 1HNXF 1ULRA 3ULHA 4CZCA 1RTDA 3LANA 3KNGA 1WI6A 2BE2B 4FXDA 2K7KA 2MSTA 2JFKA 5HL7Q 2W7OA 4PUOB 3TAQA 1IBMF 4O3QA 4OJ3A 4Q0BB 4LQ9A 3I96A 4Y28C 3GILA 2NR0A 2RE1A 1R8AA 1BD6A 1HMVA 3EZUA 4OHZA 3HP6A 4DV1F 5DS7A 2GC8A 3MURP 4CO5A 2M2BA 4IKAA 1H7WA 5D78A 3MM7A 4DV5F 1CC7A 3OHAA 5DDRC 2QE5A 4DV2F 1KSPA 1CVJA 3CULA 5J2QA 1M90T 1APSA 2YKNA 2PN6A 5J2QB 1JMTA 5A6PA 4H4OA 2HHWA 4IUFA 1HBNB 5KT7A 1U1QA 1UVNA 3JTOA 2LLZA 3MI7X 2GGPA 4LVOP 4MKBA 4IO1A 3MF5A 5IQ6A 4MYUA 4WKYA 3V81B 2WSFC 2VQEF 3OTEA 2UV8G 4NXMF 4LMZA 3LP2A 1VRTB 4X4OA 3HXMA 1VRTA 3R27A 3C3LA 3GV8B 4ZVEA 4C8LA 1F9FA 1VQYA 3SSRA 2AYMA 2CG4A 2UUTA 2UXCF 4JUZA 2YKAA 3BS9A 4LT6A 4BC7A 4QIVA 4D3GA 5DM7Q 1HBMA 2B9YA 4FYDA 3C66A 2EPIA 2OD6A 2RIJA 1B7FA 1GX5A 4ID5B 1AXQA 4ID5A 2HW3A 3BGLA 5C24A 3I9V9 4D3HA 3EUNA 2PGCA 4NLRA 3RRHA 2YWEA 1SKWA 3JSBA 2OD4A 4UUWA 4ED8A 3IC1A 5D4LA 4C97A 3Q23A 3I5BA 2IC3A 2D3OR 2IC3B 2C3PA 4LF7F 4IFYA 4RBTA 2R7UA 2XMKA 4YY3F 5GMKa 2OTJS 2LQ9A 3ISND 3MMAA 1C0UA 2AYBA 4HTIA 5D4OA 2DT9A 2HNZA 3L7PA 4CNYA 4A8OA 1YJ9S 4Q44A 1AFJA 3K5MA 4EU0A 3HI9A 1DTTB 2MHNA 1X8DA 2W7AA 4QPXA 3HDSA 2V4RA 2GQCA 5HP1A 1UFWA 1VK3A 3DYAB 4OZ5A 5E3PA 2WB4A 5LSLA 3EX7B 4J9PA 1YWXA 2MGZB 4QYZJ 1R27B 1Z1ZA 1J5OB 4C8ZA 3K59A 2DNNA 2FHJD 4OHWA 2KXNB 2UZAA 3N9UC 2OMLA 4B3SF 3HHLA 4V19X 2DHAA 3CJ3A 1X4AA 2J5AA 4GC6A 4LQ3A 4J5OA 5F9NA 1S77D 4YR3A 1VHFA 2AV5A 2IVYA 1R8PA 2MKCA 4LSNA 2IVFB 3CUNA 3BR8A 2VBWA 2NZ4A 2KYXA 4C11A 3M9OB 4U67Q 1T94A 1CLFA 2JX2A 3D2WA 1XNRF 3VWSA 2CPYA 2WONA 4DR1F 3GFZA 4F2RA 3G8TA 4MKAA 2VC0A 2IRUA 2FJEB 3BN4A 3IS9B 3T5JA 2HGMA 4C0HA 3K58A 3PKMA 5DDPC 2HMIB 4G6VB 4MKYA 5I3QA 4JYAF 2MQQA 3DU6A 5AXNA 2IJFA 3QWUA 3CIZA 2LQ5A 1DLOA 3UI3A 1U6FA 3B4DA 1IBLF 2BANA 3GYXB 3L95X 1U2FA 2D9OA 2BVZA 1FXRA 3HHNB 1VMBA 4J9QA 3MECA 1Y4ZB 1LKZA 2HRUA 5SUHA 5JXSA 4F25A 4DSLA 4N47A 1IM4A 2EFOA 4IOBA 2VPZB 2N4CA 1TKXB 3TNVA 1H7XA 3MFIA 4WU3A 3BEGB 3MUVP 4K5RA 4B9NA 3K5OA 3MHYA 4FZVA 1RP5A 3CSKA 4ID8A 5CH7B 3DCAA 1S0VA 3H2UB 2UV8A 3MUMP 5CYQA 2N3LA 2UUAF 5CYQB 2CJKA 1JNZB 1NK8A 5CCLA 4ZCMA 3HVWA 3MDFA 4RW6B 3RW6A 2ZITA 1U1NA 3KHRA 1YVFA 3J7Z5 2R8HA 2FGCA 1YBAA 3JYTA 1BWEA 2JSXA 1RT3B 2AW0A 4ED3A 1FKOB 4WK3A 3EGNA 2QA1A 1IJEB 3LP1B 4DV4F 2OFGX 3C8YA 3DM2B 2QA4G 3HX9A 2KXFA 1N5QA 1GT8A 4WFAQ 4B9TA 2O67A 1U1KA 2YX7A 2V8VA 4NLQA 5KG5A 5GAHI 1MU2A 3T19A 4HH1A 2BQ3A 2RS8A 3MM9B 3QGPA 2GFFA 4GO5X 2UVUA 1FEHA 3GMGA 2OPSA 2R2TA 2EK1A 2MKIA 1X4GA 5E5NA 4Q8EA 3D54A 2C3MA 4QR2A 4IQXA 2DGXA 1D8YA 5FJ4A 1P9QC 2XEXA 1ZYQA 4HL9A 2ZC3A 3MEGB<