1YWXA

Solution structure of methanococcus maripaludis protein mmp0443: the northeast structural genomics consortium target mrr16
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
b'MDISIISDRNNPLLQRREIKFTVSFDAATPSIKDVKMKLVAVLNANKQVLVVDTLDQIFGKLEAEGYAKIYNDEKAMATIETKSVLEKNKIEEEAEAEVAEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S24e
publication title Solution Structure of Methanococcus maripaludis Protein MMP0443: The Northeast Structural Genomics Consortium Target MrR16
rcsb
source organism Methanococcus maripaludis
molecule tags Structural genomics, unknown function
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ywxA01
1K8AT 3UCGA 3VAKA 1VQMS 2BZ2A 3NS6A 1WF2A 2MKKA 1D9AA 3FEYB 4TU9A 1ZZNA 2KFYA 3G71S 2RS8A 2RU3A 4F25A 3V4MA 3ZZZA 1S79A 2MPUA 1VBYA 4UY8T 1QVFR 1N8RT 2DNYA 2CQHA 1RK8A 1OWXA 3H2UB 2J8AA 2PE8A 1JJHA 1CVJA 1X5SA 1X5PA 5CA5A 2E5JA 1WWHA 2KG1A 3CULA 1FO1A 1FJ7A 2ADCA 2DHAA 1KOHA 2LMIA 3S7RA 1WG1A 2MY8A 1OPIA 1YHQS 1H2UX 2MZ1A 2JRSA 2L08A 2DHGA 2KXNB 2LQ5A 2YH1A 2DH8A 2RS2A 1WG5A 3S6EA 1SXLA 5LXYA 1X4CA 1FHTA 2U1AA 4BS2A 5DDRC 2MJNA 2AYBA 1U6BA 3RW6A 4J5OA 5HO4A 1M5OC 5DETA 2MZRA 2CQ4A 1S72S 1UAWA 4CQ1A 4W90B 3DXBA 5GVQA 2HVZA 1VC6A 1KD1T 3MURP 1U1OA 2KXFA 2SXLA 1U1PA 1VQKS 3R1LA 2E44A 2N3LA 3TO8A 3THTA 2MKIA 1R8PA 2CQDA 3CMAS 3MI7X 2G0CA 4ZKAA 1Q82T 2U2FA 3G8SA 3G4SS 1O0PA 1HL6A 3MD1A 4EGLA 1WHVA 2YWKA 2HGLA 4WIIA 1P1TA 2RQCA 1U6FA 2XNQA 2O3DA 3CD6S 1U1KA 4YUDA 4LJMA 3L3CA 1K9MT 4W92B 1D8ZA 2ZJPQ 1M90T 3CCJS 2CJKA 2D3OR 3LQVA 3ULHA 2HZCA 4UQTA 3RW7A 3NNHA 5LXRA 1X4AA 2KN4A 1DZ5A 2MQPA 1FJCA 1SJQA 3UWTA 2HGMA 2MQMA 4CH1A 1U1RA 2M8HA 2M70A 3IWNC 1B7FA 1A7GE 3VAGA 4QPTA 3MOJB 3SXLA 3B4MA 2DNZA 2DITA 1SJRA 1UW4A 2AYEA 1VQOS 3CCSS 4QQBA 2MXYA 2LXUA 1SJ4P 2CQ2A 4WFAQ 2KH9A 2YKAA 2NZ4A 2KVIA 2J0QD 1YJ9S 2XNRA 2VOOA 1OIAA 3H2VE 2QFJA 2MKSA 3G6ES 2OSQA 1X5TA 5DM6Q 1WI8A 2DNPA 4YOEA 1NJIT 2G4BA 2DB1A 4WKRA 1U2FA 2MQLA 1HA1A 2JWNA 2MKCA 2OTJS 5GADU 5JVHQ 1BY9A 1VQ9S 1A9NB 3EX7B 2M0GB 1Q7YT 2LEAA 5FJ4A 4FXWA 2LEBA 2CPZA 2CPJA 3S01A 1QVGR 5GAEU 3I56S 2JVOA 1WHYA 2CPDA 1DRZA 1PGZA 2MSSA 2CPFA 2DHXA 2VODA 4WCEQ 2OSRA 5DM7Q 2LECA 2LCWA 4OZ0A 5H1SV 2CQ3A 2PEHA 3P49B 2UP1A 4C0OC 1VQ6S 2MQOA 3IRWP 3U1MA 4F02A 3OW2R 4PR6A 3UE2A 3U1LA 2J0SD 2LA6A 1N54B 2EK6A 1X4BA 3CC4S 5CYJA 3THPA 1JJ4A 1WTBA 3CCUS 5D78A 5IM0B 4TU7A 5IFMA 3UD4P 3US5A 2ERRA 1K73T 1YJNS 1VBZA 2NLWA 4CH0S 2HGNA 2ZJQQ 1KQSR 3P3DA 3CPWR 2B0GA 2RUGA 3SMZA 3MUMP 3CCMS 2BOPA 2MZQA 2D9OA 2CQPA 3NNCA 2RRBA 4IOAQ 2X1GA 1H2VZ 4TU8A 3Q2SC 2DGOA 4CIOA 1ZZFA 1WI6A 2CPEA 2FY1A 2MZJA 2CQ0A 2MYFA 3UD3P 1SJFA 3G8TA 5LJ3Y 2MB0B 3CCQS 2MKJA 2MJUA 3VALA 1VQ4S 1X5OA 5CXTA 3NNAA 2KG0A 1QM9A 2DIVA 2GO9A 3DLLQ 3CC7S 2MY7A 2DISA 3CXCR 2MZTA 2DIUA 2K3KA 3EGNA 4ED5A 1YWXA 3VAFA 1X4DA 3MUVP 1YIJS 4LIRA 2CQBA 4ERDA 1M5KC 2J76E 1UP1A 1VQ7S 1M5VC 2M2BA 1U1QA 4RU2A 2KU7A 2K8GA 2X1AA 2FPHX 3FEXB 1YI2S 3VAMA 1L3KA 3MDFA 1JMTA 2N82B 2CPHA 1M1KT 2DHSA 2AD9A 5LSOA 3UCZP 1M5PC 3MUTP 1VQPS 2DO0A 2DGQA 1WHWA 1Q86T 2MGZB 2LYVA 1SJ3P 2ZJRQ 3R1HA 4QU6A 2KHCA 2DGVA 3G96A 4YB1P 2ADBA 3VAJA 2M9KA 3R27A 3CF5Q 1VQ5S 1F9FA 3VAIA 1X4HA 3NS5A 5JVGQ 2KYXA 5DDOC 2X1FA 2KRBA 3SDEB 2VOPA 1YJWS 2DNGA 3BO4A 5MLCV 2G1DA 4WF9Q 5DDQC 4M5DB 2MZSA 3CTRA 4U67Q 4IO9Q 1U1NA 1OO0B 5LSLA 4C7QA 5EN1A 2DNLA 2KT5A 1G2EA 4QU7A 4TLQA 3CC2S 2OTLS 3JB9k 1RKJA 1N52B 1N88A 3P5TL 2DGXA 3LPYA 3PIPQ 1U1MA 1WELA 4P6QA 5GMKa 2XS5A 3HHNB 2AYMA 2GHPA 5GAGU 5IM0A 4IUFA 1Q81T 2RT3A 3EGZA 2KRRA 2AYGA 2DNOA 3G9CA 1P27B 2XB2D 5HL7Q 2DGUA 1YTYA 2EVZA 2DK2A 5DDPC 3BO2A 5ITHA 1H6KX 2E5IA 1IQTA 2RVJA 1FNXH 4Z2XA 4LMZA 5D77A 1FT8A 5BJRA 2X1BA 2N7CA 2QEXS 2CQ1A 2D9PA 2MQNA 2I38A 2FC9A 2LA4A 2A3JA 1H2TZ 2E5GA 2XS7A 1HD1A 2DNHA 2DNQA 5GAHU 1WF0A 3VAHA 2MKHA 1DBDA 2QA4S 2CQGA 3BO3A 4C4WA 2OJ3A 2KM8B 2MSTA 1U1LA 2E5HA 2M52A 3HI9A 1HD0A 2YH0A 2YTCA 3CUNA 2KXHA 1VQ8S 2L9WA 2HYIB 2MMYA 2M88A 1X4EA 2CPXA 1W2BR 1X4FA 3S8SA 5IQQA 2RRAA 2N3OA 2DNNA 2DGTA 3CCLS 3CMES 2DGWA 3D2WA 1KC8T 3MXHP 2CQIA 3J7ZT 1FXLA 2F3JA 2DNRA 3BEGB 2MQQA 1VQNS 4Y00A 4A8XA 1WG4A 1WEXA 4IOCQ 4V19X 2JVRA 2JX2A 2M8DB 3MD3A 1URNA 2WBRA 3UCUP 3Q2TC 1PO6A 3NMRA 3J7YU 2LKZA 3CCES 1DHMA 4WFNQ 1KOOA 1WHXA 3ZZYA 1VC5A 1FJEB 2V94A 1VQLS 1VBXA 2MGZA 2Q79A 4WFBQ 1X4GA 2DO4A 3I55S 3VF0B 4PRFA 2OIHA 2CPYA 4Y0FA 1YITS 1VC0A 2EK1A 1WEZA 2MHNA 2DNMA 2KM8C 1WEYA 2VONA 1AUDA 2F9JA 3K0JA 3B4DA 1NO8A 2KI2A 2FC8A 2RQ4A 2L41A 5LJ5Y 2LXIA 3SDEA 2M4MA 1WF1A 1X0FA 2DH9A 3TYTA 2CPIA 2DGSA 2FHOB 2XS2A 4FXVA 1ZH5A 3BS9A 2F9DA 3P6YC 1UFWA 2M7SA 3TP2A 2DNKA 3CCRS 1XN9A 3PIOQ 4OZ1A 3CCVS 1NU4A 4PKDB 2XSFA 4F26A 2CQCA 1JJ2R 3N9UC 1R8HA 2I2YA 2RNEA 2DH7A
chains in the Genus database with same CATH superfamily
4URQU 1BGXT 1K8AT 3VAKA 5KFTA 2ZD1A 2K7KA 1CJVB 1HHTP 3VQSA 1ZZNA 2L48A 1JKHA 1T7PA 1N8RT 3ETOA 5B0AA 1OS5A 2J8AA 5ETPA 5FDLB 1FA0A 2BYCA 2L9NA 1PC5A 3QGHA 2FVRA 1KOHA 1YZ6A 4R25A 1YHQS 3B8HA 2UVWA 4NMXA 1U6ZA 4DR1F 1KNZA 4CLPA 2MQ8A 5LXYA 5T7LA 3Q89A 5A8RA 1HBOB 3VGUA 1RSCA 3Q8YA 1NJXA 4W90B 3MEKA 1RT1A 2WW4A 4B3OA 4LSNB 1F2HA 2G0CA 3MCOA 3MPUB 3T1AA 4JI0F 3CGIA 1RT6A 3LAKA 4DQPA 1U6FA 2O3DA 4Z37A 2R8HA 3GR0A 3GTYX 2OD4A 4RKUC 2RMLA 4ZMMA 3KJVB 1J5OA 3PFEA 3U02A 4ZHRB 3HHLB 5F0UA 3I87A 2NXCA 2AV5A 1LWFA 1S6UA 2JHEA 1UMJA 4EZ6A 3RB4A 1X4AA 2BDPA 3FUYA 1HR0J 2UVUA 2DNZA 1PBAA 1UW4A 1VQOS 2HBZB 4QQBA 1SJ4P 4ED6A 3ILIA 1KSPA 2ZHBA 2KVIA 1SPBP 2XNRA 3KLFA 3PO4A 2QO3A 1VHIA 3G6ES 1MWYA 5IC6B 1LWEA 3SCIE 2WOMB 1FJGJ 2MQLA 3IBWA 3C6UB 3PW4A 4FNHA 5M2UA 3OL9A 3QRRA 2M5YA 1GEHA 3BGRA 3V4IB 2V34A 4R0JA 1PAUB 3TW0A 1S6PB 2LECA 3JYTB 4K4TA 1IBMJ 3OL7A 3NAIA 2LQBA 3UN3A 2VQEF 4FYVB 2FHJA 3TZYA 4F8RA 1S59A 1RACB 1RWMB 3D1QA 2COLA 2LP4A 3US5A 4OV6A 3GU0A 2UXCF 2ZJQQ 3BKUA 2HMIA 2VDHA 3GFZA 2BOPA 5IWAJ 3N5BA 1AT1B 2HVIA 4O44B 3SI8A 4ED1A 2E9RX 4P71A 2XY5A 2MJUA 2LXFA 4LVNP 3OUYA 5DJBA 3RB6A 3PDNA 3CC7S 4OHZA 3T5HA 3OR1B 3KJNB 3ZO7A 4ED5A 4NLSA 1FX2A 1ZA2B 4EZ9A 2M2BA 3KLGA 1I94J 1S0VA 4J90A 1HNVB 3UCZP 2LYVA 3IC1A 1WC1A 4IG3B 1VQYA 2VDIA 1UWBB 4CRJA 1JNZB 4YB1P 3VAJA 1CULA 4USKA 2ZE2A 3W63A 1F9FA 1S9GB 2X1FA 2KRBA 4XPCA 1QSYA 3KG4A 4LIWA 1QAJA 4I68A 4DHVA 2ALYB 2QLJB 3EICA 1RYSA 3F0NA 3DHXA 2KT5A 4MAKA 4IKAA 3BJYA 5KFMA 2VA3A 3C66A 3JS9A 2XO7A 2HNDA 4ZVPB 3NRBA 1C1BB 5EWEA 2JNJA 1EKRA 2R4FA 1Y3KA 1HD1A 2DNQA 1NLKL 3VAHA 3TQ1A 4J7CA 4P74A 2QC3A 1TQLA 4MT1A 4MTPA 2V5HG 2QG9B 3AOCA 2MSTA 1U1LA 3GYXB 1HNWJ 2FVPA 1R89A 4EK2A 1Q8BA 2N3OA 4KV8B 2JFKA 2F3JA 4K2JA 3A13A 1VQNS 4Y00A 5HAOA 3DRPA 3BDEA 5ETQA 2LDIA 2AZ1A 1R0BG 2IC3A 1FKAF 3CJ5A 3CCES 4LF2A 4O3SA 2UUWA 1KVIA 4NX9A 4IR1A 3W2VA 3DLHA 3J81Y 4NE9C 5I3PA 2E1PA 3MMAA 2RQ4A 1RHMB 4B3TJ 4NASA 2V4RA 4V1Ak 2FY8A 1Y7PA 3GILA 1N36J 5KFHA 4QIVA 4EO8A 3DRRA 7FD1A 2YKOA 2F4VJ 1V5VA 1G6BA 1BQNB 2V4JB 3AT1B 3FEYB 1YSJA 2RU3A 3WX4A 4IFYB 3OVAA 1CC8A 1CVJA 1KP6A 2AX1A 3F56A 2XM3A 2QLWA 2P5VA 1WG1A 2MY8A 3KLHA 1RYRA 3JTPA 1OSDA 4U7UK 2GFFA 3EYZA 4J9QA 1H38A 4H4KA 2AEFA 5J2PA 2YH1A 2AT1B 3GWCA 1Y0HA 5A0YA 4Q8FA 2DVIA 1Q53A 2AYBA 1U6BA 2BJ8A 4NMLA 4OX7A 2P6SA 3TNVA 3MPYA 2DR8A 3HP6A 3M8PA 4KGKA 3MI7X 2FGCA 2UVVA 5D3GA 5D4PA 3FZBA 4OYWA 3HZGA 1YK9A 2J8SA 2XMAA 2I0XA 5CYQA 5EHHA 1AZSB 3OHBA 1MLAA 4RW8A 4IYQA 4HI1A 4KE5A 1HWIA 3PG9A 2W1BA 3HHKA 4OJ1A 2CNLB 2CNNB 1R6YA 3I0RB 2AP6A 4KO0B 4B9SA 2QJ3A 5I3UA 3OJUA 4H54A 1Z4UA 4QWEA 2J7KA 2ACYA 2C2MB 5KFGA 3QZ7A 1NKCA 2YQ3A 1TVRA 3L4BC 4OZ3A 4LR7A 4LR8A 5HP1A 4Z7CA 5J1PA 2G0JA 3M30A 4LRCA 5D4NA 3M9NB 2ZOMA 3FGVA 1VQ9S 4K50A 2CJ9A 4K4ZA 3VGTA 3DXSX 2HQIA 3I56S 3GE9A 1YRTA 2QMUB 5KFVA 1TL5A 1JLEB 1RDRA 1IKXB 4O3OA 3UFCX 3C15B 3HF5A 1BHNA 1GFWB 3QRQA 4RUAA 5IM0B 3K7RA 1K73T 4DR6J 1DFDA 4ZP7A 2RKIA 2B0GA 1XMOF 1F5CA 4NI2A 1HNZJ 5AE2A 1WI6A 4Q0BA 2P8IA 1M1HA 1RT7B 3TX0A 3PHTA 3D5MA 3ZC4A 2QYCA 1RISA 3A12A 1VQ4S 5GAHI 4RR5A 3NNAA 2AX0A 4ED7A 2BV3A 1S77D 2OEKA 2CG4A 3HSJA 1R8BA 2CQBA 3W8GA 1RWVB 3GIKA 1RTIB 4DV6F 3BKFA 4IQMA 3VCDA 5AJ3J 4P2SA 3LO3A 4ZCIA 1WHWA 3BSOA 2FJXA 3G96A 4DL4A 2OPSA 2HFVA 3R27A 5GMEA 5AXKA 3CF5Q 1ZS6A 3MGJA 4HDGA 5DDOC 3HVWA 2DNGA 1F6TA 3W66A 4RW4A 4DV3J 4MK8A 4TLQA 1UVNA 1RT4B 3ZXWA 4IUFA 5B0GA 3QT7A 3EGZA 4O3QA 4FKXA 2AYGA 1UZDA 2C28A 3JAMU 1R8AA 5ITHA 5C24A 3UNYA 2C2EA 4HACA 4I4BA 2HW3A 5BJRA 2N7CA 3CDWA 2IBKA 1QY7A 4YP3A 5LMUJ 5DLGA 1OMSA 2DT9A 2B4PA 1EETB 4DN0A 5H9FJ 2W8LA 1J5EF 2YTCA 5DGAA 4I69A 1TL7A 4FVCA 4UTGA 5A6WA 3DM2B 4R0EA 3ITHB 2EXUA 1QAYA 2DNRA 1JXEA 3LGHA 4EYIB 2OD6A 4UOCA 4X64F 1DTTB 1FTRA 4FNIA 2LKZA 3D68A 1L3SA 4C6AA 2CZ9A 4OI1A 2DO4A 5KT7A 4DPUA 4PRFA 2EK1A 4USIA 4P75A 1BE4A 1RAEB 1T9VA 2M4MA 3TJ8A 4WIQA 3G2XA 2BJEA 2DNKA 2GV1A 4F3OA 3GJRB 1T94A 4ZVHA 5F8JA 4OZJA 2MKKA 4JI6J 3R7SB 3AQPA 1S4FA 4M5HA 2CVEA 2XSJA 1VK3A 3H2UB 2B6AA 4YY3J 2Y1JA 3OBIA 2AJ4A 3ILOA 5CA5A 3T5LA 1YZ7A 2C22A 3WZ0A 3DI6A 2ADCA 1IKWA 3QO9A 1H2UX 2DKOB 1CEZA 1FESA 2DPIA 3J81j 5KFBA 5CCMA 2W9AA 4L76A 1JLAA 1X4CA 4DV4J 3AB4B 4K4UA 5AE3A 2NXEA 3W5ZA 1S72S 2LQ8A 1UAWA 1U8SA 4HHJA 4HL9A 3BQ2A 4OQJA 3K2YA 2AU0A 1NB2A 2EG2A 4ZVGA 3D66A 2UUTA 3EZOA 1PAEX 2HBRB 4ZJQA 3MEGB 2HNZB 2UVRA 4CO4A 5L1JA 2BKNA 5THWA 5IT0A 1N4LA 5F8NA 3NNHA 1DURA 4OYPA 1MW7A 5AXNA 3HVTB 1H7WA 1LW0A 3LP2A 8AT1B 3CCSS 3OQ2A 1NUEA 2AKWB 2NYHA 4JI2J 1Q4RA 2QMWA 1FD8A 3VVTA 2V68A 2ZFHA 3DGVA 3POTA 4J37A 2DNPA 4C9DA 5D0RA 2BKPA 1KVJA 4JV0A 4Y28C 1T9XA 5KFPA 6FD1A 1TKTA 3DGPA 1Q7YT 4DL0C 1PKUA 4EO6A 2ATCB 4K0KF 1PGZA 3KDOA 1IM6A 3LF0A 2OSRA 1RA6A 5CZVA 3A3PB 4RL1A 3U1MA 3MHYA 3FNNA 4ZPTR 3T1YF 4ID5A 3KK3B 3QT8A 3CDAA 5H9EJ 1JJ4A 3GJQB 3J7AN 2B3TB 4NA3A 4NZ7A 4ES1A 1KN6A 1VLYA 1FD2A 1TL1A 1S57A 2HVDA 2HURA 4OJHA 2XO6A 2LLZA 3ENWA 5C25A 1UTAA 2MZQA 4DR7J 2KYZA 1TKXA 2AIRB 3IS9B 1A6LA 3E2EA 1U0HA 2MHEA 3UPFA 1YJTA 1JLGA 2EFVA 5ETRA 3GONA 4CLWA 1MROA 1EP4A 4QR1A 3HFKA 5CQGA 1UWAA 4C8MA 4D3HA 1MMLA 1YIJS 4ERDA 4LFAJ 2JEIA 3I96A 3JQMA 2VV5A 2CPHA 2AJQA 3FSIA 3MUTP 2ZBCA 4QW8A 1VQPS 5HBMB 4DZDA 4QU6A 2FHKA 5IQ6A 3VGSA 4ICLA 2G1DA 2I6WA 4F2RA 1C2PA 5DDQC 5AT1B 4IO9Q 2H48B 4K5RA 2XEXA 2PMHA 1U1MA 4P6QA 2YWFA 4A8MP 1RA7A 2HVEA 1RAIB 2XY6A 3A8JA 5A8KB 4Y2CA 1RT3A 3H25A 1S6QA 4K4YA 4DF8A 5KG2A 1JLQB 3DRSA 1S1VA 1NDCA 4OZNA 2HS4A 3M2RA 2W2NP 5IT4A 4YB6A 5K8NA 2VG5A 2RUSA 3PJXA 1BQXA 3BZQA 3JSYA 5K8PA 2E5HA 4PXEA 3KK1A 1AA1B 2RILA 1S99A 2CPXA 1Z2LA 1XEZA 2ILYA 2DGTA 3LP0A 3NY0A 2KL8A 2CA9A 3MPVA 2EWHA 5L8RC 4NLGA 3KYLA 4KBIA 1LKZA 2ZH7A 3OL6A 1CJTA 3UN2A 3OTBA 3NMAA 3TRGA 1DHMA 4N41A 1HIYA 4WFBQ 1UPMB 1YITS 1Q1KA 3PYGA 1AUDA 1YRUA 5FIIA 3DLEA 1OSCA 1NK0A 5L38A 2DH9A 4M5IA 1K1QA 4WYWA 2M7SA 4OYMA 3CCRS 1GQEA 3PW0A 2HHHF 3N9UC 3HKWA 2OPPA 4GKJF 3UCGA 3EUNA 2RS8A 2UU9J 2MPUA 4OYXA 3FVYA 3WIUA 5LL6d 2A18A 3G6YA 2KKHA 2KG1A 4RUHA 2BABA 4Q8EA 3WBZA 4ZS6A 2MZ1A 2JRSA 5DGBA 4MK7A 1C1CB 4L72B 3S6EA 2CJQA 5CZXA 4WU3A 3CVKA 2XMWA 3N6MA 3KLEA 2KZZA 2YKMB 4NLQA 2YKPA 2MZRA 4DU7A 3GB0A 4J9KA 4FPRA 1SH2A 1EX8A 1VYAA 1FVSA 4DSKA 2AEMA 1TKZB 4N7TA 4DSLA 3CCZA 2R42A 3CO9A 4WYLA 2R9LA 2IJNA 4KRWA 3V6HA 3TZWA 1GNKA 2WZ1A 3H20A 3V6JA 1HNZF 2RHQB 2D3OR 5L9NA 5U47A 2DPJA 1WDTA 3OTDA 2E1MC 4AQYJ 1N5SA 4UZBA 2Z2YB 2VFVA 1KBRA 1UW9A 3T9NA 2XC9A 3JSBA 4TQSA 4HR2A 4L75A 4C48A 1VRTA 4AXIA 3BH7B 1V3SA 1X0PA 3MMAB 3VVUA 5L1KA 1FCAA 2D74B 2IRXA 3MR6A 2GAHC 2V8PA 3QJJA 2EC0A 4DV3F 3UE2A 1KONA 4G3IA 2GX8A 3MFIA 1FTCA 3W9IA 5E0OA 2KVQE 4ZP6A 1VBZA 3C14B 1IBLF 2GAGC 3HJFA 2H1YA 4C3LA 3E51A 4L73A 1ULRA 3TZZA 3QBCA 4TU8A 1BWEA 2VPZB 3PR4A 2CPEA 1R8CA 2FLOA 3L9ZA 1EJ7L 2GMLA 1KS2A 5FD1A 2ZBPA 3H5YA 2MKJA 1UA0A 3AODA 2VQFF 1D09B 2JJ4D 2CNOB 3EM1A 4DV5F 3M8PB 2NREA 1KFSA 5A8WB 4CM0A 1RI7A 2K8GA 3SQGA 3MM7A 4ZJOA 4ECVA 1QDUB 3UVJB 2G9OA 4OHYA 2DO0A 3QFWA 2FDNA 2QRRA 3GFXA 2MGZB 4DI6A 4ZVFA 3DOKA 3FRZA 4I6WA 3JQKA 2WRMA 2QL5B 3IA0A 1U1NA 2HQ3A 3HSDA 1OO0B 2E5LJ 4QU7A 1PJ6A 1TV6A 4OJ3A 2XS5A 3RRKA 4GVBB 4NWBA 4PUOB 5IOLA 2WONB 2AJ2A 3SSRA 4I67A 2IDLA 4XIUA 2QEXS 2YNHA 1T05B 1RHKB 1KHWA 3BO3A 3AOAA 4DPTA 4DV1F 1LFWA 3MOZA 5IT9Y 1Q16B 2D7SA 3V6KA 1HBMA 5B09A 3MXHP 4GVLA 5A2QY 3R2DJ 1DLOA 1VQSA 4NRTA 4V19J 1T11A 3G8QA 3IP0A 4V19X 4ELTA 2J0XA 5T41A 1JLFB 2M3DA 3J7YU 3MEDA 4EU0A 3CIZA 1EZZB 1N33J 1L5UA 1Y11A 3I55S 2KHDA 2RQKA 5EUHA 1DJ0A 2DNMA 2L41A 1FKPA 3C6TA 2YX1A 2XI2A 4I7FA 5DS7A 2IM3A 4MIBA 1TKDA 3ETMA 2JDJA 3PIOQ 2DBBA 1MU2B 3RJMB 4FBTA 2QT7A 1RTZA 4WK1A 2LU1A 1GAOA 3TARA 1YJVA 4ECUA 1QVFR 3TUJC 2J9DE 3FCWA 5B08A 2GHVC 1D9DA 3E8OA 2DJWA 1SQFA 3MR7A 2OPSB 3L7OA 4TKTA 2E5JA 5ETOA 1X9SA 2DXDA 1YJ7A 4TY8A 3MMBA 2J7WA 3OHAA 5K14A 2IJFA 3T9ZA 2DHGA 4N5SA 1FKOA 3Q8PB 3OD2A 3DOLB 3C16A 1ZA1B 5C7PA 2H51B 2GJIA 3H5SA 4ATNA 1RCOB 5F0WA 3N0VA 5EX0A 3ZTPA 1IBCB 3LP1B 2GQ2A 3MURP 2FJDB 2KXFA 3RGIA 1U1PA 4ZPCA 4RBUA 4AD6A 1CS4B 2CXEA 4XAKA 1NJYA 2RDJA 3OFFA 4JV2A 3J80Y 3E3XA 5KFOA 1U24A 1J2VA 1C0UA 3L3CA 1X31C 3B6BA 3Q8RB 3LQVA 4F3MA 2PIIA 3RW7A 2OFGX 3UWTA 2M70A 4G1PA 3PW5A 4AL5A 2GIFA 3CD5A 2DITA 2FZGB 4UY85 1CJVA 2D41A 1UVIA 2Y8YA 1Q5VA 1SKRA 2VD3A 3MCNA 2PA3A 1X8DA 4DEZA 3WC0A 1ACMB 2YWGA 4EBCA 1YBTA 3NEKA 5F8IA 4YOEA 3CCWA 2Q3PA 2DB1A 2R2RA 4WKRA 3GMGA 5FDLA 4LRAA 1U2FA 3CJKB 3L7UA 1AB8A 3GQCA 4ECRA 3EX7B 2M0GB 5FJ4A 3BGOP 3M4XA 1B0TA 2NSCA 3DLGB 3DFEA 2AJFE 4FF4A 1WHYA 3GYGA 4WU2A 3PYDA 1IWAA 3K57A 1HBOA 3SSSA 1NPKA 1OQ6A 1SH0A 1O8BA 3D3BJ 5KFYA 3SFGA 1WC5A 4KJIA 2DEIA 1FFGB 4LSNA 5BYQA 3MWBA 4DR2J 3IBCB 3UN5A 1VHFA 2B6AB 3P45B 3DN9A 5GAGI 2PFFB 5B0CA 1IKWB 2X51A 3KJVA 3V5RA 4ZHRA 2DGOA 3HHLA 1IVZA 3CW2C 3KLVA 4X4NA 4C0HA 1D0EA 4DV2F 4ED3A 2ZZTA 4BBYA 4KB7A 4BCAA 1RTJB 5F8MA 1QM9A 2K3KA 4X62J 3D9BA 2XCAA 1YWXA 3FKBA 2Y9HA 3W61A 2EPIA 1UVKA 2HHPA 2NYIA 4JI8F 1UP1A 5KG5A 1BQMB 1VFJA 3MDFA 2WOMA 2DEJA 3RRGA 1S97A 4ZIWA 3C6UA 2BQRA 3D1HA 3BPSP 4B3RJ 2OUGA 2YNIA 1YLXA 1F3FA 3W1YC 5JVGQ 4DUTA 1R27B 3CCTA 2UXDJ 3V4IA 1LXNA 2FJBB 1HI1A 1S6PA 5F41A 3JYTA 1V3ZA 1HHQA 2R2SA 4IFVA 4URSA 2J0WA 4K59A 4DUZJ 4OI4A 2C3UA 3QJPA 1N56A 3M2UB 2GJFA 3JXOA 4ZOSA 4MKVA 5HL7Q 2ZH5A 3OFGA 1XNRF 5CD4A 4LMZA 4WZMA 1LK5A 2CQ1A 1FRMA 2LA4A 3AXKA 5GAHU 2XLIA 2UUAF 4GKKJ 2HZAA 3HK2A 2IDEA 2WB1D 2C2OB 1YBAA 2C3PA 3CD7A 2HYIB 2PO4A 4ID5B 3D4JA 3OR1A 4DX5A 3QRPA 5ETLA 1SKUB 2YVSA 1RBLA 2A2CA 2D3UA 4X4PA 1Y5IB 5DG7A 4O3PA 4ECWA 3QAEA 4I6AA 2BE2B 1TL3B 5C25B 2BQ3A 1GMWD 1HNVA 3WX8A 4FYXB 1W26A 1JXVA 2V94A 1RLCL 4RUBA 4IG3A 3WDOA 3VF0B 1UWBA 2RB7A 4EBDA 5I42B 5E3PA 1HNIB 1S9GA 2UXBJ 3U27A 4DFPA 2ASYA 2RJZA 1LEOA 2XS2A 4NXNJ 5I4MA 3BSAA 4DG1A 3IGVA 2B7BB 4KGXB 5HANA 1C4AA 2BZ2A 3NS6A 4LREA 1U8WA 2WCXA 3K5PA 1UVMA 3ZZZA 1RTHB 2BXJA 1C1BA 2BRLA 1Q95G 4ZCKA 4JI5J 3KMSA 2PMZD 2PE8A 1RU2A 3OVBA 1KVKA 2E1RA 1WWHA 4DR1J 3P8BB 3GV5B 1VR6A 3J7Z5 4L6V3 2H5JB 1IWGA 4DL5A 5L39A 5A6PA 4KV8A 1NZAA 2CJYB 2ZC3A 5HO4A 3LWMA 1SJ1A 4DZ6A 4RNHA 3TUIC 1VC6A 4JI0J 1F3VA 3HMJG 4KT0C 3FJ2A 1R6VA 3CMAS 2FB0A 4M5NA 2D3O1 3M2RB 4OYAA 4EI2A 3P4UB 3PJ9A 3EWGA 3T19A 1NK9A 3KK1B 4ED2A 1M90T 2BJ1A 2XY7A 1FJCA 4O23A 3IWNC 1BQNA 4A46A 2IMOA 2V4JA 2KH9A 1CJTB 1NHUA 1OIAA 4Y2AA 4IFYA 2Q66A 2IVFB 1O5JA 1S9FA 1Z1ZA 4MKBA 4DWIA 4LVOP 1NSKL 5GADU 3FBBA 3DLEB 3QAUA 2R7TA 4FP9A 1XR6A 5E3QA 2VQEJ 2CPDA 3NXZA 2MSSA 4OYOA 3SSQA 4DDFA 1U0SA 2R8IA 2UUBJ 2I5JB 2OPPB 4G6VB 4O0NA 3R7NB 2E5LF 2LA6A 3IWXA 2UXCJ 1NSAA 1K0TA 1HBUA 1NMEB 3KFWX 3UD4P 4B3MF 4UZCA 2CJAA 2QA2A 2OI2A 3SCJE 1RWOB 4YR0A 4CH0S 1E6VB 4J91A 1V3RA 2VFTA 4NCBA 3LOUA 2ZUAA 4AE5A 3D6FB 1AZSA 4IR9A 3RBDA 3PRVA 5KG1A 3CJ3A 1N32F 2YQ0A 2IA6A 4EWTA 2XCPA 2F4FA 1X9MA 3I0RA 2GO9A 4NLDA 1I3OB 3D6TB 4O0IA 3P5BP 4KO0A 3GSDA 3ZFVA 4EMDA 2A10A 4W98A 3DDNA 4RZRA 2HHVA 2WSEC 2QYGA 3Q23A 4U7CA 3KG0A 3MM8A 3WHIA 4AXJA 1OPZA 1WOPA 2OELA 1WC6A 2BJ7A 2ZUGA 3VQTA 1V9OA 2ACMA 2Q1LA 5KT3A 1U25A 3R1HA 3HLUA 1OY9A 3EZUA 3KHGA 2PSZA 2ZVSA 1VK8A 4FYWB 4HDHA 1YJWS 1JLEA 4YEAA 2RDIA 1IKXA 1S12A 4FXDA 5KT5A 5DQHA 1WC4A 3C15A 3HZEA 3MEEB 3I4HX 2QSFA 1CSJA 1WELA 3QZ8A 2E29A 5IM0A 4S0MA 2V8HA 3SCLE 5HVFA 1N0VC 2FJWA 2DNOA 4MFBB 2XYHB 4LF9F 3ILJA 1WKJA 3D28A 2FHMA 2GMJA 2RVJA 1IQTA 2HHWA 3BGLA 2HQGA 4P7TA 1EIYB 5CCLA 1H7XA 1NK6A 4Y65A 2A3JA 3D6MB 3DU6A 4FF1A 1RT7A 1NK4A 3X1LB 3ZZ0A 5EX3A 2UV8A 2KM8B 1XWLA 2HS0A 1RWXB 1FDNA 1LFPA 3QPIA 1GX5A 3S8SA 2XULA 2Z2MA 1B64A 2BOAA 2RDDA 4UT4A 4F67A 3T1HF 2GW8A 4DX8H 1KFDA 3DU5A 5J1NA 4FF3A 4QYZJ 5KFRA 3FBEA 1SV5B 1VBXA 1NDKA 1O6XA 3FBCA 3PTWA 3D0GE 1R0CB 2CPYA 4B3SF 4QWAA 4QIFA 3OFHA 1XNQJ 2F9JA 2XYGB 4CDIA 1IR0A 3DLBA 1VLOA 2DGSA 4TN2A 4FXVA 4P7VA 1CQMA 3P6YC 1REGX 2ZC4A 2CQCA 2Z2LA 1XJWB 1RT4A 4YFUA 2FJEB 3ZZRA 3SQGB 1IKYB 3TOQA 1NHKL 2RF2B 2D1CA 5HLFB 2GCFA 1HHSA 5HJXA 1OWXA 2Y0BB 2EKNA 5E5NA 3QQCD 5KFDA 1X5PA 2LVWA 3M8QA 3DOKB 3K58A 3BBCA 1EETA 3PM9A 1HPZB 1OPIA 5HROB 1KQFB 1T03A 2KXNB 2AJ0A 2VASA 2L9DA 3R6LB 3DM2A 3ITHA 4USHA 4USTA 3RUBL 2PA8D 4CQ1A 3DXBA 4AFFA 1DTTA 3QGGA 1VQKS 1FEEA 4DR2F 1FNOA 2CAJA 3I4PA 5DQGA 2K2PA 3N6LA 1HL6A 1PG5B 5K20B 2JEGA 4JI4J 1KEKA 3CD6S 1R43A 3EVOA 2J5AA 4F4YA 4W92B 3PEJA 2ASDA 4B9UA 1HBMB 3PX4A 1S1XB 1B7FA 1DLOB 1GXLA 3MM9B 2LXUA 3M9MB 2CQ2A 1UJ6A 4B9LA 1E6YB 2ZOFA 3AD9C 2XMVA 1SI9A 3BBFA 3BM7A 4WZQA 2HHUA 4WFYA 1FE4A 2XGPA 5JVHQ 1H3DA 3GFHA 4B9NA 2UXDF 2RQMA 2YKQA 2DHXA 4ZP9A 2XGQA 1LOUA 4C2MA 2YX7A 3B78A 1B0PA 3LUYA 4N76A 5ETTA 1VQ6S 2UZAA 3I5CA 3DHWC 3O1LA 4DPYA 3V6DB 4DR4F 1NHVA 1HARA 2W2OP 5KG4A 2V9WA 1U45A 3GSIA 3THPA 2BE7D 1XMOJ 2W7OA 2DY1A 1JK9B 1YJNS 2C3OA 2NLWA 4L3KA 2ILZA 3MEGA 2HNZA 2I8EA 4X65J 5AXMA 4XO0A 4JI7F 4L3NA 1Q8KA 1ZTWA 4GKKF 3RR8A 1K1SA 5E3RA 4LBIA 1JNRB 6FDRA 3M9OB 2IPOB 2JLGA 3O6QA 4DV6J 2DIUA 1TAUA 5KOXA 5KFSA 1NSQA 2Y8WA 3KOAA 2J6UA 3O2IA 2FZCB 1LV5A 2G1HA 1P6TA 4H4KC 1DTQB 3TEGA 1FXDA 3C8YA 5DZ7A 3VZIA 3VAIA 5KFEA 2HWIA 3GJSB 3SDEB 1ZM2A 5MLCV 2FLNA 2ZBRA 2NPFA 4U67Q 2V69A 1IBKF 4I64A 3QATA 3KK3A 1NKBA 2E7VA 1G2EA 3CB4A 4YDXA 5E2QA 2AGQA 4NRUA 2H4WB 3MMJA 1D9FA 3PW2A 5DDPC 4JI5F 2G2ZA 4OYIA 5ADZA 4ANCA 3PEHA 5D77A 2ZWPA 2X1BA 4A4JA 3NBPB 1DAXA 3IS9A 1J5EJ 1FI4A 4U8VA 2DTJA 2DNHA 4NLTA 1I6JA 1WF0A 4I6YA 4QR0A 1WSRA 1RBAA 2VA2A 4C4WA 2OH2A 1H0HB 4NYPA 4DLEA 4ECYA 5HJYA 1AFJA 4X64J 1TK0A 1OYDA 2J6SA 3PCOB 1CQNA 1URNA 4MIWA 3KXDA 4Y2KA 1HW9A 4ZPAA 1RADB 2ZWOA 5HBMA 1F9HA 4Q7AA 1VC0A 5CYMB 4N77A 2FYXA 2VONA 3J81U 3B4DA 2FC8A 3PKYA 1FFSB 5T14A 2FHOB 4LRFA 2EFOA 3MCMA 3BS9A 1RQ0A 3GG1A 4RW7B 4IOBA 2YY3A 2RNEA 5F3TA 2OEMA 3PJWA 2KFYA 4F25A 5A8KA 1WD6A 2VL1A 1RAFB 4CI0B 1M5HA 1GT8A 2C2ZB 1JLQA 2CG8A 2AQ4A 2YNIB 3GR1A 2IRYA 3HHLD 2DHAA 3HCXA 4KFBB 4IFVB 4ILRA 2GA7A 2Y1RI 4LF8J 2UUBF 2CRLA 2W4PA 4QW9A 4HT7A 1DARA 1YBUA 2SXLA 4ZPBA 2XZTB 2FVQA 4KH1B 2YWKA 4E0DA 3NCRA 3SQOP 4MKYA 1AFIA 2NPIA 1JWWA 1RHUB 3CCJS 2HHXA 2VKRA 3DRYA 2HZCA 2HGMA 4DXLA 4XDDA 4PQAA 3NS7B 1SJRA 4CWBA 3QWPA 5CHCB 3UDEA 4IH6A 2X3DA 2PI5A 4LQ3A 2H9ZA 4FS1A 3JTOA 3KTQA 3R5AA 2K1RB 5M2PA 1ZETA 4USWA 3QIDA 2QX0A 4K0KJ 2W25A 2YBVA 4UUWA 1UETA 2CPZA 4USUA 5D0HA 3RZAA 1C1CA 3T1YJ 3FC9A 2CPFA 1HYSB 4DG1B 2VODA 1C0TB 1TU0B 5DM7Q 2PEHA 2YKMA 3VR1A 4ZVQB 4F02A 3L09A 4DN9A 4UOFA 3V81A 1FWLA 2Q6CA 2LQJA 1TKZA 5KG0A 2XWXA 4JV5F 1KHVA 1Y4ZB 2IHR1 4DS4A 1A0OB 2DYAA 3CPWR 2VICA 2DHHA 4C98A 4LRDA 3R5GA 3SCKE 1HNXJ 3GG0A 1S7IA 5ETVA 1QTNB 3G82B 1JIHA 2XMTA 5B0FA 2ALZA 2FD2A 1SQGA 4OX9J 1G3OA 1LQ9A 3R6GB 1M5VC 5A76A 3EMTA 4DX7A 5KT2A 1JMTA 1K47A 3PACA 2ADBA 1KQGB 1XNQF 2M9KA 3BQ0A 4PAAA 5C42B 2Q43A 3IRXB 2BBEA 4QIEA 4K8RA 3M1VB 1JLCB 4NLXA 2YWWA 2HPUA 3CC2S 3N28A 3P5TL 4I2QB 5GAGU 3OL8A 1ELOA 2DGUA 3C14A 2HNYA 4CLZA 3BO2A 5EGYA 1WSVA 5L1LA 2QMXA 5L46A 4WBFA 2GIRA 1X9WA 4LF4J 3NWRA 4WFXA 4FBUA 2QV6A 1JXLA 3R8YA 2IIHA 1HD0A 1OJ4A 2QSWA 2R7QA 2W9CB 2QN6B 2RRAA 4LQ9A 3DOMA 2IM1A 1HBUB 2VPYB 4P9SA 5A8WA 4WK3A 4IRDA 1T9YA 1BWVA 1WJ9A 3Q2TC 3UVJA 4CO3A 2MGZA 1ZAWA 2IVMA 4JI4F 1X4GA 3CJ8A 2W01A 4QR2A 2DD8S 1F5BA 1P8GA 3EGVA 4KHPF 4GC7A 1CPZA 2V2QA 3TAMB 2HHHJ 2Y3YA 3IGNA 1WF1A 1QTMA 4GKJJ 2E7WA 3ZZPA 3CCVS 1NU4A 3KMQA 1JJ2R 2WB4A 2ZH2A 3FSXA 4OZ5A 2DH7A 3MM8B 1VCTA 4GVBA 4PUOA 4DR5F 2WONA 3GJTB 3I9ZA 2VH7A 1RE1B 2P2CB 3BGFA 1Y00A 1JJHA 1X5SA 4OI3A 5E3AA 1NPPA 1T05A 4ID8A 4W4MA 2YNFB 3AH6A 1U2CA 4IH7A 5HVGA 3FEZA 1VI7A 1RZMA 3LAMA 2KFNA 1MN9A 3QLHB 3VHQA 5JUMA 2CQ4A 1UJ5A 3KHRA 2JEFA 2OFHX 2ROPA 4GO7X 1JLFA 2B56A 3THTA 4A8QA 2CQDA 3CEDA 1VGYA 3HPOA 4KPYA 1TFYA 2U2FA 3G4SS 4KH0B 1KTVA 3MFHA 4X65F 1P9QC 1ZPWX 5LSRA 2GVZB 2AZ3A 3CIMA 2ZJPQ 4IDKB 3UNGC 3ULHA 1SJQA 1NK5A 3H2LA 3MR5A 1MU2A 3M8RA 3NCQA 1M1GA 1PJ7A 4WFAQ 4OL8A 2EI5A 1X5TA 2EFGA 3K8WA 4EFAC 4OV1A 2JWNA 4A8OA 3NKYA 4DJBA 1BY9A 3QSYB 2LEBA 4F0MA 1QVGR 1IM4A 3DOLA 4JI1F 4H4MB 4RW6B 5CH7B 4OZ0A 2CQ3A 3RRHA 3RBZA 1P9YA 1FNMA 3LP1A 1REVB 3O8WA 4HH0A 5HK4A 1IBLJ 4TYAA 4F4KA 4WPAA 1CS4A 1LNQA 1RHQB 5KFKA 2B9XA 3M8QB 1S49A 1QAXA 8RUCA 3NNCA 1T03B 4IOAQ 3FFIB 4CIOA 3CJ4A 1U49A 2VQFJ 2PN6A 1K0VA 3FRYA 5KFIA 1HQUB 1SL1A 4Q45A 5CABA 1FE0A 4DV5J 5HMYA 1NM2A 2FJVA 2KG0A 3IR5B 4M5JA 4MYUA 4X4OA 4YHHJ 1Q5YA 4PQUB 1DQ9A 3NGDA 3W62A 1VQ7S 4UF4A 1WC3A 3FEXB 4FVMA 5IZHA 3IG1B 3CJKA 2HRYA 1SKWA 3DLGA 2OPQA 4C8ZA 2ZBIA 3OR2B 3NS5A 1CJKB 4G1IA 2KYXA 2VF3A 1OYEA 4ED4A 1VDHA 5EN1A 2EKYA 2DNLA 4PYDA 4GMKA 2GHPA 4G1QB 2IBOA 5DO2A 3QIPB 3CDUA 2ZVIA 5LOQA 1S1UB 5F8LA 1URRA 4QYZK 3NOCA 1T9UA 1H6KX 2I9SA 2F7VA 4OI2A 3HXMA 3CJ2A 4AUKA 2C2NA 3SV4A 3RB0A 4KGMA 2QTWA 2ZOGA 4HLBA 5CAAA 2CWXA 3U7JA 4DV1J 3LGNA 4NA2A 3QSIA 3NCPA 4X84A 2Z58B 5BR8J 1M5SA 1Q8LA 4JYAF 1RTJA 4CT8A 3NL0A 2M88A 1WOOA 2XHWA 4KHMA 4LF8F 4JP8A 2DGWA 1FXRA 3D2WA 3FK4A 4ZPWR 4A8XA 3Q0AA 1GXTA 2R3VA 1U4BA 2YKNB 3MD3A 3TEHB 3BN4A 2I1RA 1BQMA 3O5TB 4UOGA 1KTQA 3EXYA 5F8HA 1S0MA 1RAAB 1FJEB 1B99A 5J2QB 1IKVB 1HMVB 4PWDB 2KM8C 4LFCJ 1G4CA 3DLKB 2F5GA 4FF2A 3OVSA 3W2WB 2CPIA 4BLGA 4ZVOB 1S48A 1QLNA 5J1EB 2F9DA 2AJ1A 4BC7A 2G2OA 2I2YA 4K4VA 3KHHA 1QSSA 2ZEJA 1VJQA 2WAQD 1BC6A 4TU9A 2ABYA 3M2UA 3GLJA 4F2SA 2VB6A 1VBYA 2XWYA 3C19A 1RB0A 4DR3J 1PYSB 1NB7A 3OLAA 2MLXA 3CMQA 1HQEB 1N5QA 2RSQA 2ZKUA 1HWLA 3W64A 2DXEA 3NAHA 1CLFA 1FRJA 2EBGA 4J9VA 4QIWD 1FF2A 1RHJB 2IM0A 4B9TA 2CADA 1VISA 4J5OA 4OFZA 1VJWA 1U26A 4J9OA 4HVZA 2BE2A 1TL3A 2IAJB 3R1LA 3I5BA 4QBUA 3TO8A 1F2GA 3MMCB 1ZM4A 3PO5A 3R7BB 3F44A 5I42A 4QOTA 2HRUA 3F41A 1W25A 2ZM6F 4WE1B 1HNIA 1HNXF 4ZITA 2W9BA 2ZH3A 1DZ5A 1RAHB 4CH1A 4Y3CA 2UUCJ 3LTOA 1ZAVA 1IJEB 3E01B 4RPFA 4OX9F 4CO1A 3FMBA 1RTHA 3HJVA 4WP8A 2ZH1A 4WTYA 2DR7A 4FYYB 4NYZA 3IXQA 1XMBA 5E41A 3BH6B 4LFBF 1WUUA 2JSXA 3VWSA 2KFZA 4N56A 4CYUB 3ZTRA 1RXOB 4ANEA 2J6TA 2O5DA 4M5KA 1YRXA 2BW2A 2LCWA 4PCQA 5KG7A 2ZZNA 2HLUA 2J0SD 2OPRB 3DMJB 3NGUA 1N54B 1WTBA 3CCUS 2WSFC 4FKYA 2O66A 2GO8A 1CC7A 3ENAA 4DSEA 1Q0NA 1ROFA 3HSZA 4R8UB 3JSMB 5HMXA 5B0BA 2RRBA 4DV2J 3OSPA 2X1GA 1H2VZ 1TMMA 4LF4F 3PHEA 2WBMA 1I5OB 2D69A 1S4EA 1CG2A 5J2MB 5L1IA 1PIEA 5BXIA 3MPWA 4DMZA 4JI8J 1VIXA 3CWJA 2B5JB 2B8QA 2MZTA 3EGNA 4ZJLA 2B8PA 2V67A 3LWLA 1TK5A 2KU7A 3UR3C 1FVQA 1XMQF 2IJRA 4UW2A 5HN0A 3MR2A 5LSOA 1TZ0A 5J2NB 4NLVA 2F40A 4PPDA 2ZJRQ 3KNGA 2DGVA 3NWGA 4RNMA 1HW8A 2G0IA 2H5EA 2V0NA 3Q8QB 2QE5A 4ER8A 2QA1A 1KLMB 2GC8A 4QWCA 2I5JA 4B08A 2FHJD 2CZ4A 5B0DA 2V4QA 1NBEB 2DGXA 3PIPQ 2XQCA 3GV7B 2OP5A 3PX6A 1XNRJ 2AWZA 1SVDA 1EAYC 3TUPA 3K5MA 2F8MA 1E6VA 2UUAJ 1FNXH 1AXQA 1HI8A 4LF7F 4NLOA 1UVJA 3AA9A 3H59A 2MQNA 2Z57B 2BEFA 2JOQA 3KK2B 2C2KB 3MM6B 4C8OA 1AW0A 2A6OA 2QA4S 1RAGB 3AJ2A 2L9WA 4NYOA 1W2BR 1PYOB 2VG6B 4ILLA 5HQLA 3V81B 3Q22A 2X3GA 2XI3A 3CMES 3OJSA 5IT9U 4OMFG 3VZHA 1JB0C 3OTOF 3BN7A 5A2QU 2GQQA 4PYAA 2R2TA 3U1NA 3TA2A 3DKDA 1VOMA 2WBRA 3IAS9 1JLBB 4Y34A 1VC5A 1VQLS 1PBUA 1UVLA 4HH1A 4BHQA 3SV3A 2MHNA 4ZLJA 5LJ5Y 4CLSA 2R8KA 3N4WA 1X0FA 3J7YI 3H4DA 3I9V9 4NA1A 1RABB 3MEEA 1SH3A 3D0IE 4K5SA 2G2YA 4UQGA 4ECXA 4JI3F 2XBPA 3CJQA 4ZVRB 3EDRB 2JFDA 4MFBA 1ZM9A 4U8YA 3HHLC 1XIQA 4KPCA 3T41A 1GK8A 2R7SA 3A8IA 4ECTA 1APSA 4I56A 3NP5A 2HWTA 4NLYA 1H73A 2DXFA 3CULA 1FO1A 1HLWA 2R7XA 1T0TV 4ETZA 2L08A 3BDPA 3FCHA 1KLNA 1WKKA 3IR7B 1UEKA 4AYBD 4HYKA 3HHEA 2F1FA 5GAEI 2H4YB 2POKA 4JV1A 3D1OA 2FVCA 3H7HB 5L9XA 4J9NA 2HNYB 3DRXA 3OXGA 4P72A 2CNKB 1SV5A 4CO5A 3G8SA 1O0PA 4DQSA 2VC1A 4C97A 2HGLA 4KGVB 3GIJA 1P1TA 2FUG9 3W8PA 4O4RA 3J80U 1DQAA 4LJMA 5K8MA 2IA0A 1N5YB 2FLLA 1VRUB 5LXRA 3OXLA 1H72C 4B9MA 3A3NB 3T3FA 1IR2A 3DOMB 5LMNF 3KDNA 2F63A 1YX2A 3B4MA 1YGYA 2PT0A 2HLTA 1IKYA 4RX6A 4YHHF 2RF2A 4G65A 2R7VA 5HLFA 2MEWA 5DM6Q 2V8VA 4M1KA 2XTJP 5F9LA 3ZZTA 2XZDB 2LFVA 1S6OA 3QFHA 2R2UA 3HO1A 4DL7A 2LEAA 1HPZA 4FXWA 3NGRA 5HROA 2W2PP 5D15A 1SUQA 3W7BA 1BLUA 5KFXA 2FTRA 2HEKA 1KR4A 3RAQA 3ZTSA 2GQCA 4OZLA 1ZM3A 1N34F 4J9UE 2V8DA 4RJVA 4B3MJ 4EUVA 4DUYF 3EJMA 4WKYA 4KAIA 2PD1A 1AUSL 4RW9B 2NXUA 3PKMA 2EK6A 4UOHA 2W4DA 3OSNA 1NDPA 3IN5A 5IFMA 2XMUA 2V2KA 7FDRA 3BQ1A 3IMQJ 1EARA 1QE1A 4CZCA 2D9OA 4KR0B 1N32J 2X7IA 5G0RA 4ZVSB 2MYFA 1GMVA 5BR8F 2HAIA 4FN5A 1S1XA 3TANA 1WACA 3RAMA 3MM9A 3DLLQ 4NLRA 3BREA 1FERA 3CXCR 1NDLA 3C3LA 2GGPB 1E6YA 2DRBA 3ZTQA 2Z4PA 5HI7A 2HK3A 1T8EA 3FQLA 2X1AA 1VRQC 4YR2A 4YMEA 4F3QA 4OLPA 3HM9A 2C1EB 4DSJA 2YPZA 1IJFB 3HDSA 4JOUA 4N47A 5AXLA 2BW7A 3M2VB 1MMNA 4OX8A 1B7YB 1NK7A 5E3CA 4LFCF 1MSWD 1IUJA 2B7CB 1U2RA 5KFZA 4M5DB 2MZSA 3V6DA 4ENOA 3D7SB 4J9RA 2OTLS 3IM8A 2W24A 4LF9J 1T9TA 1EB0A 3ENVA 3I32A 2EW9A 4H4OA 2PGCA 2DK2A 3FMWA 4YN3B 3PV8A 1U09A 1S1WB 4DR3F 3KWMA 1RGVA 1Q8IA 4WFZA 2FC9A 2ZH4A 3BSCA 3X3UA 4YR3A 2OAUA 4TY9A 2JL9A 1DBDA 2W2MP 2CQGA 2CYYA 4D3GA 3K5NA 4Y2IA 2BX6A 3CJRA 2MMYA 2NUUG 1X4EA 4HKQA 1X4FA 2RH3A 1SQEA 2YX4A 2OKQA 3T1HJ 2QL9B 4PXCA 2HQFA 1W2IA 4B3SJ 4WFNQ 1L3VA 3M05A 4CLUA 1DTQA 2A2DA 3AQOA 4NXMF 4C11B 4I2PB 4ZN3A 1RT5B 3SDEA 4DV0F 4U95A 3ZZOA 3H90A 3FDSA 3UDLA 2OLWA 2V63A 2UUCF 1R0AB 2DR9A 1JX4A 4Q2LA 5KTQA 2V50A 3M7VA 4WTOB 2YNGB 1EKSA 2VJUA 1WF2A 1D9AA 4X66J 3KLIB 1UL3A 3V4MA 1YKWA 4ECQA 2GVDA 2IFXA 3NBPA 4M8LA 3HD1A 4ES3A 2A6MA 2OPQB 2HBYB 2VG7A 4IH5A 3GCXP 1RWWB 1CBKA 4DQRA 1RT2B 3T5JA 3G6VA 5D0EA 4PPZA 4O4GB 1CJUB 4AL6A 3UD5A 2RS2A 1SXLA 1XQIA 1D8YA 4BS2A 3MECB 2EG1A 4LSLB 1R3NA 4CLYA 3MTJA 5DG8A 3DCAA 2PEBA 1FK9B 2V8GA 5GVQA 3LA0A 2ZH6A 3K5OA 1FRHA 5KAKA 1U1OA 4TVAB 1N6QB 2IYGA 2BE9B 1RTDB 1SC4B 4ZKAA 4ZIVA 2XHCA 2CWKA 4NCAA 2P9EA 1HWKA 2VZ9A 5CYMA 3PVXA 3ENQA 3TQEA 1LWCB 3KJQB 4EYHB 4PWWA 4RUCA 3AXMA 1WOSA 3DYAB 1D8ZA 2Q6BA 3N01A 2CJKA 2KN4A 5ETKA 4RW7A 3MF5A 3RBEA 3SYZA 1G1XA 1HR0F 4DCOB 4PABA 1YJ9S 5KG3A 3H2VE 1Q79A 2R7WA 1LW2B 3PRDA 1GX6A 4DQQA 4HEA9 4WP3A 1NEEA 1Q78A 2MKCA 5H9FK 1F1BB 2HIQA 1TUWA 4P10A 4CO2A 4KFBA 3P96A 1FJGF 3TR5A 3NG8A 4DR4J 2BANB 4WCEQ 5H1SV 4ALZA 5GADI 1TTHB 1Y5NB 3U1LA 2VBZA 2AGPA 3MAAB 1IBMF 4MH8A 4ED0A 4NEZA 1Y9OA 2IM2A 4TU7A 8ATCB 3GFYA 2ERRA 4TLRA 1NRKA 5EDWA 4JI7J 3K17A 2HGNA 3HT3A 3P3DA 3IM9A 4L74A 3FQKA 4BWJA 4DF4A 1LXJA 2DR5A 3HHDA 3CJ0A 3THVA 1L3UA 4ZVUB 4F0KA 5IWAF 4CNZA 4LT6A 4C3MA 3UDCA 4A8SA 4MIAA 4A8YA 2MY7A 2DISA 3K89A 3PRBA 4XPEA 4X4QA 4TXSA 1X4DA 3MCSA 1S0NA 1ICEB 1UZHA 3KUEA 4PG7A 4LBPA 4OLOA 3W9JA 3IR6B 2G13A 2K1RA 1S1TA 2DHSA 1MNEA 1NKEA 4MMOA 4IG0B 2QLFB 4DFKA 2W9BB 2OMLA 1I94F 1GMWA 2CUYA 5JMNA 1IBKJ 1S9EB 1HYSA 1C0TA 1UFLA 3AJ1A 4WF9Q 4FDFA 3M32B 4CTAB 2RHSB 2KTQA 3IAM9 4QIGA 1F60B 2AMCB 2PDAA 2KJVA 2ZD1B 1Q81T 1L3TA 2KRRA 3JAMY 4DV7J 1BUXA 1P27B 2W8KA 1NJWA 1YTYA 4KGZB 4WWSA 1JKHB 2WHOA 2XG8A 2ZH9A 1FT8A 4CM2A 3ISND 4LSZB 2VBWA 2BVZA 1WDDA 2JC1A 3G82A 1SC6A 1YVFA 3PNIA 3RAXA 4URGA 5HVHA 4OHXA 3HT0A 1BMQB 2MTLA 2M52A 3HI9A 1ZYQA 1VQ8S 3BR9A 2K3IA 1PILA 2W7PA 5KFNA 4USJC 2IYIA 1VS3A 5T7LB 5A8RB 2B51A 4BC9A 2HVHA 2HFOA 5C5JA 3HVAA 1HNWF 4IOCQ 3R2CJ 2ZITA 2JX2A 4I1TA 1RT1B 2PMWA 4PXBA 2QA4G 4ZCLA 3C46A 1TR0A 1RKIA 3L95X 4B3OB 3GPAA 3BYPA 1PO6A 4C0BA 2HFZA 2HG4A 1RT6B 3IO1A 3I31A 3TA1A 4J9PA 4F4XA 1H74A 2ROGA 1WEZA 4RO0A 2NQPA 2XMJA 5C42A 5LT5A 4RLEA 1J5OB 2O01C 1RUSA 4P2XA 3IRXA 1LWFB 2HK2A 1ZH5A 3M1VA 1JLCA 4B3TF 5H9EK 4TNOA 2ATLA 1IQZA 4I2QA 4CLFA 2NSBA 2P9GA 4NCGA 5HATA 3M6UA 1N36F 2N4DA 2BUNA 3W9HA 3ONQA 2F4VF 3DLJA 3KLFB 3QGPA 4UY8T 3BR8A 4O3NA 1RK8A 1LWEB 5B7WA 1SCJB 3PX0A 2YXLA 4PXDA 3H4BA 2WVFA 3W5YA 1FRIA 5G4DA 2LQ5A 2XYPB 2W9CA 2DH8A 2QLBB 1KWMA 3OLBA 3ELHA 3AD7C 3F73A 3BGRB 3HX9A 2U1AA 1QSLA 3OTEA 4WJBA 3ZNUA 5D4OA 4ITSA 2VHGA 3LANA 1MN7A 1KD1T 4ZN1A 1KDNA 4ECZA 1B70B 5KFLA 1R8PA 4Z7YA 4EGLA 2XMMA 4WIIA 4P73A 3BV8A 1JQGA 2HMIB 2B9WA 3TAMA 2B4VA 3ISZA 1O51A 3RBXA 2MQMA 3PXGa 3TVZA 1FDBA 4QPTA 3OUYB 3MOJB 2AYEA 2JH3A 1D3WA 4YS2A 2MXYA 3OFEA 2NZ4A 4NZ0A 4EEYA 1WKLA 1IR1A 2E66A 1RWPB 1N5VA 2MKSA 2QFJA 4CLTA 2CJBA 3KLGB 1NJIT 4KKOA 2E9ZA 4N8OA 2E1CA 2KDOA 4CNYA 1HA1A 2JLFA 1FWKA 3UO0A 4AL7A 1U02A 2Z30B 1UPPA 2Y1LB 2GJ2A 4ZK7M 2CPJA 2YNFA 1FDDA 3LGMA 4ANDA 3HD2A 1CULB 2ZE2B 3EXCX 4F4AA 2JVOA 4HHUA 3QLHA 2D3ZA 2Z2ZA 4C0OC 3VV2B 4YB7A 2KB2A 3EZ5A 4DS5A 2RU9A 4JV5J 4DQIA 4DBQA 3CT9A 5B0EA 3CC4S 5CYJA 1FDAA 3HSGA 1R7IA 2HNDB 4C8YA 4CO0A 4R5PA 3FBFA 1MWQA 1FWPA 4ZLLA 1TUVA 4EBEA 1QUVA 1NPRA 1UA1A 5HMZA 2GVZA 5JJBA 4DR6F 3CSKA 3GV8B 4IDKA 1Y5LB 4F0HA 4OX6A 2MZJA 4X4TA 2C2RA 3AHPA 2F65A 2UV8G 3UD3P 1SJFA 5LJ3Y 4TYBA 2C42A 3NGTA 3VALA 4B17A 1OQ3A 3K5LA 3OTCA 3R5JB 4KTQA 1YG0A 1Y3JA 2DRDA 3VAFA 4LIRA 1M5KC 2CDRB 3DRPB 2HHQA 2HAFA 5D6GA 2J7UA 2OMOA 3I0SA 4QYRA 2W2QP 2IC3B 1B4SA 2MDAA 1M5PC 3C2PA 3Q8VA 3W2VB 4F4WA 4MK9A 3H8YA 5AJ3F 2AW0A 3LH2S 4OHVA 5KFUA 1VQ5S 4H4MA 3W3SA 4RW6A 1SC3B 4ELVA 2LQ9A 4AT1B 2VIHA 2VFSA 4NOHA 4PWUA 1HWJA 3DRRB 1REVA 3M6VA 1RKJA 1N88A 1NH7A 5GMKa 9RUBA 2AYMA 4X4UA 4XTTA 2MLYA 4P2MA 3CDEA 4X66F 2NXJA 2PFDA 2XB2D 4CH7A 4NZ6A 2FJAB 4NLWA 4Z2XA 3TJAA 4E8UA 1SIWB 3QYYA 3K59A 3FFIA 1SUQB 4ZDNA 4FZVA 3A8EA 3Q24A 5KT6A 3M8YA 1HQUA 3KLHB 4Q2MA 3OXFA 5LMUF 5J2PB 5A0YB 4CLLA 2CQIA 5F9NA 3J7ZT 3BEGB 4PQUA 2RIJA 2MQQA 4K2XA 1WG4A 4I0WA 4QZVB 4U6PA 5KG6A 2HQDA 2GMHA 4YB5A 3IG1A 3UCUP 3NMRA 2WVEA 1QE1B 4IO1A 4UUXA 4RWWA 3GCWP 1WHXA 2CDQA 3IFEA 4KHPJ 3FCVA 5EWFA 5D3GB 1PSDA 4ED8A 5G0RB 2HFNA 3OR2A 1CJKA 3W60A 5CYQB 4JB8B 2A0FB 4KSEB 4QWBA 3TYTA 4RW8B 4DX6A 4C8NA 2H65B 5IV4A 2QLXA 4X4RA 4DR5J 3RTVA 4OZ1A 5ETSA 4PKDB 1GXUA 1X7VA 4U9RA 4G1QA 1VQMS 3QIPA 2B9EA 4QJVA 4RNOA 1S1UA 3BBBA 2FGOA 4F7VA 3PW7A 5I3UB 1ZTTA 2DNYA 3DNCA 1TVRB 4JI6F 2A1BA 5HP1B 4Q44A 1AROP 4PG8A 3M30B 4YQWA 1ZPVA 1K44A 2VBYA 3NOGA 3JQJA 4YY3F 4P2FA 2OO4A 2FVSA 2RD5C 1BXNA 3M8WA 5JXSA 3K8VA 2VFUA 3W5XA 5D8HB 1WG5A 4PEOA 4RBTA 4KIAA 1FHTA 3KJFB 4GO5X 3RW6A 1M5OC 4BDPA 3D3CJ 4H4OB 4DLGA 2YKNA 4DV4F 3S1TA 1RWKB 5C2CA 1TAQA 1F9EB 3MD1A 2EEYA 4OJGA 1WHVA 3Q86A 4NL5A 2RQCA 2XNQA 2H5IB 5J2QA 2RKIB 1U1KA 1IKVA 2KT3A 1HMVA 4PWDA 1RAOA 1EQMA 2R8JA 3DLKA 2YWHA 3DC2A 1GMUA 3AFGA 4NI2B 3W2WA 4Q0BB 1FX4A 5J1EA 1S7HA 2Y1IA 2FLPA 2PI4A 3PZPA 4FYDA 2M8HA 2YQ1A 2K06A 4X4VA 3M8SA 3VAGA 1MWZA 5I3QA 3SXLA 3MM5A 2GIQA 1HBNA 2J0QD 4O3RA 5K9FA 2VUGA 1QUPA 3OV7A 3ET6A 4JI2F 2BQUA 4M5GA 3KHLA 2EFQA 4JI1J 1HQEA 3EPIA 3S01A 3AJDA 5GAEU 5HMWA 3NLCA 2V2ZA 3TJ9A 3SZ2A 1IN0A 4J9LA 4LF6J 2ASJA 2UP1A 2MQOA 3IRWP 4RW4B 4KYZA 5KFFA 1MMDA 4M63A 2IAJA 3UQSA 2ASLA 2GVDB 3MMCA 5D78A 2EC2A 4DV7F 4WXOA 3N79A 3ADAC 4LUBA 5D0GA 1LK7A 2VG7B 4WE1A 5C24B 3MUMP 4HACB 4OZ2A 2CQPA 3Q2SC 2HHSA 4DPXA 3JSRA 2BKOA 4Y6IA 4ECSA 1QD1A 2CQ0A 5EWGA 4DR7F 3G8TA 3H0PA 2JLEA 5KFQA 3RR7A 3QJLA 5IC4B 1X5OA 2BRKA 4HHHA 5CXTA 4DPWA 2DIVA 2MKYA 1RAJA 1TL7B 3A4TA 3E01A 2O67A 2DY9A 3H40A 2FIUA 3KG1A 1DY3A 1YDLA 5E7OB 2P9CA 4RU9A 1SIZA 2FPHX 1M1KT 2N4CA 4MKAA 4ZLNA 1N0UA 4DFJA 4LFAF 5KFJA 4M94A 1Q86T 3WC2A 2KHCA 5CD4H 2Z0GA 3QGIA 4CYUA 2WVCA 3KUGA 3G86A 4N8NA 1WORA 4OHWA 1SC1B 1KKHA 1U7LA 5LSLA 4C7QA 3BGUA 1T95A 2OPRA 3DMJA 2AF6A 1N52B 4HTIA 3LPYA 1NJZA 2VJVA 1AYEA 2RT3A 2K7JA 2ZHOA 1DQ8A 3GYNA 4R8UA 2J9DA 2E5IA 2VU5A 3JSMA 2XSJB 1SKSA 3QMQA 1HI0P 3T5KA 2VBXA 3TVKA 2I38A 2E5GA 4JYAJ 2GZOA 2XS7A 2IVYA 5LM7E 2MKHA 3R97A 4F36A 3DI6B 2DCLA 3QO9B 5J2MA 2YPYA 2OJ3A 4C8LA 4M95A 3RG6A 2KXHA 3TAPA 3QT6A 3R5BA 2DNNA 2B5JA 1RLDA 3KUHA 1KC8T 5DQIA 1JLAB 1KRPA 5IXUA 1FXLA 5E33A 4ZVEA 3AOBA 4P52A 3W65A 1YQHA 7AT1B 2F8HA 2NXNA 1TL4A 4QWDA 1RCXB 3R3TA 2HBQB 1QJHA 3BKTA 3I82A 3ZZYA 3H98A 4LBHA 2HWHA 3UI3A 5J2NA 1XERA 2Y0SD 2ZNYA 1Y10A 2OIHA 1WEYA 3K0JA 3LPEA 2KI2A 2ZDOA 3GIMA 2ZBQA 1KLMA 4LF5J 3CE8A 2EFPA 4X4SA 2F8EX 3TP2A 3B82A 9ATCB 5RUBA 2XSFA 4F26A 1LW0B 3LP2B 2V9KA 2J9CA 3RYLA 4K4SA 5SUHA 5KFCA 5K8OA 4ELUA 3R5CA 3D6HB 3EPGA 1S1TB 1S79A 4CT9A 1GH8A 4USVA 4F4ZA 3L7PA 3M6XA 3D67A 4NLUA 2CQHA 3O44A 2BR0A 5HQ8A 3POTB 4B9VA 3ZNJ1 2UU9F 2RRNA 2NS1B 3M6WA 3KK2A 4DSIA 1FJ7A 1UFKA 3MM6A 4HI2A 2LMIA 1TKTB 4E2FB 3DGPB 4F50A 1UKUA 1BD6A 4KC5A 1ZOTA 4XK8C 4DL6A 2R8GA 4GC6A 1JJCB 4PG4A 4O44A 2VG6A 3EE3A 3UDVA 2VPWB 1NH8A 1UJ4A 2CJXB 1UEVA 2MJNA 3R5DA 4USMA 5DETA 4HTJA 4ZPDA 3HULA 4KQZA 1IXKA 1FRKA 1JLBA 3ZZUA 2MKIA 1PCAA 2WW8A 5FLXU 2ZM6J 3LW5C 1R31A 1Q82T 3TA0A 5KFWA 1TL1B 2R7RA 2XMKA 1C4CA 1SB6A 2B4UA 4LRBA 1MG7A 4RNFA 1TKXB 2O1PA 3OT9A 2ZH8A 3HKZD 4LF1A 4UQTA 1U0HB 2JEJA 2KO1A 1U1RA 1VIOA 2CFXA 1JLGB 1A7GE 4CCHA 3MTKA 1MROB 3PYEA 2BM0A 1EP4B 2L3MA 2YKAA 5HQMA 4AQYF 3I5AA 2VOOA 3KKFA 2OSQA 4K4WA 4LFBJ 1WI8A 3WIVA 4F04B 4JBCA 5DZ6A 3BSNA 4OI0A 2OTJS 1UEUA 4NLPA 2AEJA 4M5MA 2EBEA 4A8WA 1DRZA 5BYRA 2HQCA 3TAQA 3PYFA 2HHTA 2XZWA 2C3YA 4ICLB 3P49B 4NCGB 1F0XA 1F5AA 5F8GA 4PR6A 3MR3A 1WC0A 5ETNA 3IBFB 5F3ZA 4RNNA 4ZPVR 2CKWA 4OYBA 2H54B 2KJWA 1KQSR 1RT3B 3LALA 1XR5A 1S6QB 4J9SA 3SIPB 1XR7A 3RU0A 3TWZA 4OYZA 3BB5A 1XBWA 1T02A 1ZBTA 3UW1A 3DRSB 1S1VB 2RAQA 2Z56B 1N5YA 3OPKA 2QGFB 1ZZFA 2FY1A 1VRUA 2VG5B 4ZVTB 2VC0A 4DSFA 1FRLA 1HQ2A 1RJJA 3JTNA 2BACA 3CDBA 3BYRA 4PG6A 4DCJB 3LP0B 2HZVA 2C2DA 1XMQJ 1NAQA 3MUVP 2BA9A 3GIIA 4ZA1A 1U1QA 4X2BA 3VTIA 1I51B 3AD8C 3B54A 3N5FA 2W7AA 1L3KA 1N5TA 2N82B 1VMBA 2DR6A 1NZ8A 2AD9A 2Z8QA 4MYTA 1SL2A 3A1YG 1SJ3P 1OY8A 3DDKA 1RP5A 1S76D 3PY8A 2CIMA 2VOPA 2IMWP 2JC0A 4IQXA 2XLKA 1WNEA 3TUZC 2H3EB 1LWXA 2VPXB 2YWEA 1Z2ZA 3JB9k 4RW9A 4OI6A 5M2RA 3HHNB 4A8KA 2B43A 3ISNC 2ZNZA 4KKOB 1HWUA 4LF7J 1SL0A 2VFRA 3G9CA 1RU1A 1RHRB 1WTFA 2GNKA 2W4CA 3N6NA 1W7WA 2CVIA 1T3NA 4OIXA 2V2VA 3H5UA 2OHDA 2VKZG 1N48A 1FRXA 1RBOB 2QZ8A 1XC9A 4WP9A 3PR5B 2C3MA 3QWUA 1ZAXA 4BWMA 4J9MA 3CUNA 5KFAA 3OTOJ 2FZKB 3TVYA 3A3OB 4KHRA 5AE1A 5IQQA 3CCLS 5FLXY 5DRKA 2GGPA 3KLEB 3H42A 2BJDA 1NNDA 2B4OA 3EGWB 4K7QA 2WVDA 2OEJA 2BJ9A 1WEXA 3D0HE 4R5PB 1HFEL 2ZDPA 2GHWA 3WQPA 2NR0A 2EFNA 1SBRA 4TQRA 2Q79A 2HIYA 3M2VA 4C8KA 4Y0FA 5GMDA 1TFWA 1NO8A 2LXIA 1N33F 1TUGB 2QL7B 4M5DA 4JI3J 5MAOA 4IRCA 4GRSA 1XN9A 2DRAA 3O3LA 3FZ2A 1R8HA 2BJ3A 2WTFA 3EVMA 4KY3A 4NPOA 3Q8SB 4DL2A 3I0SB 3G71S 1V6HA 2E1AA 1M0SA 1U48A 4RBVA 2IY5B 4DOZA 3NGSA 5KT4A 1S1WA 2R7UA 4ZCMA 1VRTB 3AA8A 1TP7A 3AAWB 3DDIA 3VGVA 3CNQP 2OGUA 1NSPA 3S7RA 3CD0A 2LEPA 5IV3A 3T6JA 1T3OA 2KT2A 4LF6F 2BM1A 2NUHA 5DDRC 3IWLA 2R7OA 2QIFA 2JZ5A 2HVZA 1P1LA 2E44A 2IRUA 2N3LA 1XK8A 3NGKA 2AHOB 3GIRA 1EHWA 1RTIA 3MPDA 1OY6A 3Q8UA 1NK8A 4C11A 4I2PA 2GS8A 4YUDA 1K9MT 1RT5A 4A47A 2MLZA 5LMNJ 4A8FA 6AT1B 2ROEA 2MQPA 1ITPA 5DG9A 1R0AA 2B9YA 4DFMA 1VBKA 1HKAA 2YNGA 5IS2A 3ZTOA 3BF4A 2BMBA 1J27A 3KLIA 2HRTA 3H5XA 1TELA 3HVRA 5HSPA 3SBMA 3EVWA 4QCLA 2G4BA 3MM7B 3A8KA 1T9WA 4U7UD 2P6TA 2WK4A 2ZHAA 1A9NB 2FQQB 1RT2A 1PC4A 1Q7LB 4FS2A 3QNWB 4Y2MA 4M5LA 2LU2A 3FSYA 4O4GA 1CJUA 3TX8A 2QFIA 1N34J 2N7YA 4DUYJ 3MECA 1GTHA 1RWNB 1EQ0A 4LSLA 3SFUA 4ETXA 4Q43A 3OW2R 2HKEA 1FK9A 2J9EA 3BPDA 3EDQB 5BYSA 3CJTA 3TZXA 1NCLA 1TV6B 1X4BA 3ICLA 1B0VA 3UR0A 1N6QA 2PC6A 1RTDA 1S10A 2WVBA 3CO0P 4JUZA 1V5IB 2RUGA 3SMZA 3CCMS 1LWCA 2YNHB 3RB3A 3DYAA 5C2GA 4RWXA 2MB0B 4B02A 3CCQS 4MJKA 1S0OA 1S5ZA 1X60A 2APOA 2WSCC 2HFUA 2ZKTA 4HT5A 4DPOA 2V6AA 2XLJA 3QT5A 5SZTA 3CJSA 3KNAA 5ETMA 4DCPB 1LW2A 2J76E 4RU2A 3D54A 1UCNA 1KQKA 4X62F 1YI2S 3VAMA 3MEDB 3M8ZA 2DGQA 1QAIA 3AY0A 4WXWA 2E7XA 3ILLA 3HFZB 2AGOA 1H98A 1YJUA 1X4HA 2BANA 4LF5F 1FKPB 3PFOA 3C6TB 3BO4A 3MM5B 4DU8A 2CZVC 4CP5A 4YDDB 4B3RF 4CLKA 1YJRA 3CTRA 4I7FB 1HBNB 5DLFA 4XDCA 4IRKA 3MAAA 1I1GA 1D1UA 3ET6B 4FPIA 4LR9A 3TI0A 5D4LA 3G6XA 2EVZA 1PJ5A 4DUZF 2HS3A 4PG5A 4ZP8A 3G87A 4C3KA 2D9PA 4ZLPA 1GTEA 1H2TZ 4QPXA 1RWUA 3MZIA 4TY8B 3MMBB 1B3TA 2NZCA 5K14B 2HSEB 2YH0A 1FKOB 3GP9A 2NCKL 2KZMA 3J7A1 1NXIA 3C16B 4K4XA 3GZ7A 3V2UC 2DCUB 2RE1A 3HVTA 1TK8A 1G7CB 2JVRA 2M8DB 3HFVA 3T6BA 5K5MA 3SEOA 1KOOA 4NXMJ 2HFSA 4IG0A 3MAQA 4DV0J 3I6PA 4A48A 4Q5VA 1FFWB 4E98A 5KOWA 1C0UB 3Q83A 3R9LA 1S9EA 1TMJA 1XTZA 3AB2B 4NEYA 4ES2A 3MAHA 4U96A 3M32A 4DL3A 4CTAA 1PYTA 1U47A 1UFWA 2E9TA 2UXBF 2LDYA 4ILMA 4PZVA 2ZZMA 1FEHA 4NXNF
chains in the Genus database with same CATH topology
4URQU 1BGXT 2QT7A 3M6UA 5KFTA 3VAKA 2N4DA 2K7KA 2ZD1A 2BUNA 3MM8B 1N36F 4WK1A 1HHTP 3ONQA 3VQSA 4PUOA 4DR5F 1ZZNA 2F4VF 2WONA 2LU1A 3DLJA 2L48A 1GAOA 3I9ZA 3KLFB 2VH7A 3TARA 1YJVA 4ECUA 3QGPA 1JKHA 1T7PA 4UY8T 1QVFR 3BR8A 3TUJC 1N8RT 4O3NA 2J9DE 5B08A 3ETOA 1RK8A 2GHVC 5B0AA 1LWEB 1OS5A 3BGFA 1Y00A 2J8AA 1JJHA 3E8OA 2DJWA 1D9DA 1X5SA 4OI3A 5FDLB 1FA0A 2OPSB 5B7WA 3L7OA 4TKTA 5E3AA 2E5JA 1X9SA 2BYCA 2L9NA 3PX0A 4TY8A 3MMBA 1PC5A 3QGHA 2J7WA 1T05A 4ID8A 2FVRA 1KOHA 3OHAA 4PXDA 4R25A 5K14A 1YHQS 3B8HA 2UVWA 3H4BA 2IJFA 3T9ZA 2YNFB 3AH6A 2DHGA 1FRIA 1FKOA 1U6ZA 4N5SA 5G4DA 3Q8PB 4IH7A 2LQ5A 3DOLB 2W9CA 4DR1F 2DH8A 3OLBA 3F73A 3FEZA 1KNZA 1VI7A 3BGRB 2GJIA 3HX9A 3LAMA 3H5SA 5LXYA 2KFNA 5T7LA 2U1AA 5A8RA 4ATNA 1HBOB 3QLHB 1QSLA 3OTEA 4WJBA 5F0WA 5JUMA 3N0VA 5EX0A 5D4OA 4ITSA 2CQ4A 1UJ5A 1NJXA 3LANA 4W90B 3KHRA 3LP1B 2GQ2A 1KD1T 2JEFA 3MURP 3MEKA 1RT1A 2FJDB 2OFHX 2ROPA 2KXFA 4GO7X 4ECZA 1U1PA 4B3OA 1JLFA 2B56A 4ZPCA 5KFLA 3THTA 4A8QA 4RBUA 4LSNB 1R8PA 2CQDA 3CEDA 1VGYA 3HPOA 2G0CA 4KPYA 1TFYA 2U2FA 3G4SS 4XAKA 4JI0F 1KTVA 3T1AA 4EGLA 3MFHA 2XMMA 1NJYA 3CGIA 1RT6A 2RDJA 3LAKA 3OFFA 4JV2A 4DQPA 4WIIA 1U6FA 3J80Y 2O3DA 3E3XA 4Z37A 5KFOA 2R8HA 3GR0A 4X65F 2HMIB 1P9QC 1U24A 1J2VA 1C0UA 2OD4A 4RKUC 1ZPWX 2RMLA 4ZMMA 3KJVB 5LSRA 1J5OA 2B9WA 3L3CA 3TAMA 2B4VA 3PFEA 3U02A 3CIMA 3HHLB 5F0UA 4ZHRB 3Q8RB 2ZJPQ 3I87A 4IDKB 3ISZA 2AV5A 1LWFA 3LQVA 1S6UA 2JHEA 2PIIA 3UNGC 1UMJA 3ULHA 4F3MA 4EZ6A 3RW7A 1O51A 3RB4A 1X4AA 2BDPA 1SJQA 2OFGX 3UWTA 2MQMA 1NK5A 3PXGa 2M70A 3TVZA 3H2LA 4G1PA 3MR5A 3PW5A 1FDBA 4AL5A 3CD5A 1MU2A 3M8RA 2UVUA 4QPTA 3OUYB 3MOJB 2DNZA 2DITA 3NCQA 1UW4A 2AYEA 2JH3A 1VQOS 1D3WA 4UY85 4QQBA 2MXYA 1SJ4P 4WFAQ 3OFEA 4ED6A 2D41A 1UVIA 2NZ4A 4NZ0A 1KSPA 1SKRA 2VD3A 2ZHBA 2KVIA 4EEYA 4OL8A 2XNRA 3KLFA 3PO4A 2QO3A 2PA3A 2EI5A 1X8DA 4DEZA 2E66A 3WC0A 1N5VA 2MKSA 3G6ES 2QFJA 1MWYA 1X5TA 2EFGA 2YWGA 2CJBA 4EBCA 3KLGB 3K8WA 5F8IA 1LWEA 3CCWA 4EFAC 2Q3PA 1NJIT 4YOEA 4KKOA 2DB1A 2R2RA 2E9ZA 4N8OA 4OV1A 3GMGA 2E1CA 3SCIE 5FDLA 4WKRA 2KDOA 1U2FA 3CJKB 4CNYA 2WOMB 2MQLA 1HA1A 2JWNA 4A8OA 3IBWA 2JLFA 3NKYA 4DJBA 1BY9A 3GQCA 4AL7A 3C6UB 3EX7B 4ECRA 2M0GB 5FJ4A 3PW4A 2LEBA 3M4XA 2GJ2A 4ZK7M 2CPJA 4FNHA 2YNFA 1FDDA 1B0TA 2NSCA 3LGMA 3DLGB 5M2UA 1QVGR 3DFEA 1IM4A 2AJFE 2ZE2B 3DOLA 3EXCX 3OL9A 2M5YA 2JVOA 4JI1F 4FF4A 4H4MB 1WHYA 4RW6B 5CH7B 3BGRA 4WU2A 3V4IB 4R0JA 3TW0A 1S6PB 2LECA 4OZ0A 3K57A 1HBOA 2CQ3A 3QLHA 2D3ZA 3SSSA 4C0OC 3JYTB 3RRHA 4K4TA 3OL7A 3NAIA 4YB7A 1OQ6A 2KB2A 2LQBA 3EZ5A 1FNMA 1SH0A 2RU9A 4DS5A 2VQEF 1O8BA 5KFYA 4DQIA 3LP1A 1REVB 2FHJA 3SFGA 4DBQA 3CT9A 5B0EA 4F8RA 3O8WA 3CC4S 4HH0A 4KJIA 5CYJA 4TYAA 4F4KA 1FDAA 3D1QA 4LSNA 5BYQA 3MWBA 2COLA 1VHFA 2B6AB 3US5A 1R7IA 2HNDB 4C8YA 5KFKA 2B9XA 3DN9A 4CO0A 4R5PA 2UXCF 3M8QB 2ZJQQ 5GAGI 2PFFB 5B0CA 1S49A 4EBEA 1TUVA 1QAXA 1IKWB 2X51A 2HMIA 3GFZA 2BOPA 3KJVA 1QUVA 1UA1A 5HMZA 3NNCA 5JJBA 1T03B 3V5RA 4DR6F 3N5BA 3CSKA 4IOAQ 1K8AT 4ZHRA 3FFIB 2DGOA 3HHLA 4CIOA 3GV8B 3CJ4A 4IDKA 1U49A 1Y5LB 2HVIA 4O44B 4OX6A 2MZJA 2PN6A 3SI8A 4X4TA 1K0VA 2C2RA 3AHPA 3KLVA 4X4NA 2UV8G 3FRYA 5KFIA 4C0HA 3UD3P 1HQUB 4ED1A 1SJFA 1SL1A 2E9RX 5LJ3Y 1D0EA 4TYBA 2C42A 4DV2F 4ED3A 2XY5A 4Q45A 2MJUA 1FE0A 5HMYA 4BBYA 2LXFA 4LVNP 3OUYA 4KB7A 4BCAA 3VALA 5DJBA 2FJVA 1RTJB 2KG0A 3RB6A 5F8MA 4B17A 1QM9A 1OQ3A 3IR5B 3PDNA 3K5LA 3CC7S 3OTCA 4OHZA 3T5HA 3OR1B 4MYUA 4X4OA 2K3KA 2XCAA 4KTQA 1YG0A 1Y3JA 4ED5A 1YWXA 3VAFA 4NLSA 4PQUB 1DQ9A 3NGDA 4LIRA 2EPIA 1UVKA 4EZ9A 1M5KC 2HHPA 2NYIA 3DRPB 1UP1A 4JI8F 1VQ7S 2HHQA 2M2BA 5D6GA 3KLGA 2J7UA 2OMOA 3I0SA 5KG5A 3FEXB 1BQMB 1VFJA 4FVMA 3MDFA 1S0VA 4QYRA 5IZHA 2IC3B 3IG1B 3CJKA 2WOMA 2MDAA 1HNVB 3RRGA 3UCZP 1M5PC 1S97A 2HRYA 3C6UA 2LYVA 3IC1A 3D1HA 2BQRA 1SKWA 3C2PA 4IG3B 3W2VB 1VQYA 4F4WA 1UWBB 3H8YA 1JNZB 4MK9A 4YB1P 5AJ3F 2AW0A 2YNIA 3DLGA 3VAJA 2OPQA 3LH2S 2ZE2A 4C8ZA 4OHVA 2ZBIA 5KFUA 3OR2B 4H4MA 1F9FA 1VQ5S 3W3SA 3NS5A 4RW6A 4G1IA 5JVGQ 1R27B 1S9GB 3CCTA 2KYXA 3V4IA 2X1FA 2KRBA 1LXNA 2FJBB 4XPCA 1HI1A 1QSYA 4ELVA 1S6PA 3KG4A 2LQ9A 4LIWA 5F41A 1QAJA 4I68A 4DHVA 3JYTA 1V3ZA 2R2SA 2VFSA 4IFVA 4URSA 4NOHA 4PWUA 2EKYA 5EN1A 1HWJA 1RYSA 3DHXA 3DRRB 2DNLA 2KT5A 1REVA 4MAKA 3M6VA 1RKJA 1N88A 4GMKA 2J0WA 4K59A 1NH7A 4IKAA 5GMKa 3BJYA 5KFMA 2AYMA 2GHPA 4X4UA 4G1QB 2VA3A 2IBOA 4OI4A 5DO2A 3C66A 2C3UA 3QIPB 3CDUA 2XO7A 3CDEA 4X66F 3QJPA 2HNDA 1S1UB 1N56A 3M2UB 5F8LA 4ZOSA 2XB2D 1URRA 5HL7Q 3NRBA 2ZH5A 3OFGA 4CH7A 4NZ6A 1C1BB 1XNRF 1H6KX 2FJAB 4NLWA 2I9SA 4Z2XA 5EWEA 2F7VA 4E8UA 4OI2A 3HXMA 4LMZA 4WZMA 1SIWB 1LK5A 2R4FA 3CJ2A 1Y3KA 2CQ1A 3QYYA 4AUKA 1FRMA 3K59A 3SV4A 3FFIA 1SUQB 3RB0A 2LA4A 4KGMA 4ZDNA 4FZVA 2ZOGA 4HLBA 1HD1A 3A8EA 3U7JA 5GAHU 2DNQA