1YWXA

Solution structure of methanococcus maripaludis protein mmp0443: the northeast structural genomics consortium target mrr16
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
MDISIISDRNNPLLQRREIKFTVSFDAATPSIKDVKMKLVAVLNANKQVLVVDTLDQIFGKLEAEGYAKIYNDEKAMATIETKSVLEKNKIEEEAEAEVAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords 30S ribosomal protein S24e
publication title Solution Structure of Methanococcus maripaludis Protein MMP0443: The Northeast Structural Genomics Consortium Target MrR16
rcsb
source organism Methanococcus maripaludis
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ywxA01
2WBRA 1WG4A 3BO2A 5DETA 1Q82T 3B4DA 1VQ6S 4C4WA 5LXYA 2G0CA 4QQBA 2AYMA 3UD3P 3LPYA 3G6ES 5IFMA 2CQGA 4Y0FA 2OTLS 1WF0A 2MYFA 3UWTA 1SXLA 4WIIA 1W2BR 1HD1A 1OWXA 1XN9A 3DXBA 2KVIA 2K3KA 3L3CA 1K8AT 1G2EA 2AYEA 2HGLA 3CCJS 3H2VE 2CPDA 2E5IA 3P6YC 2M8HA 2N3LA 2VOPA 2QA4S 1H2TZ 3CCMS 2MKSA 2MJNA 2AD9A 2XS2A 3CCVS 1X4AA 3MUTP 2AYGA 3G4SS 2KG1A 3SXLA 2DNGA 2CPFA 5DM6Q 1OO0B 2OIHA 1Q86T 3Q2SC 3K0JA 4UQTA 2MQMA 4WKRA 2ZJRQ 1WTBA 1UFWA 4LIRA 3UD4P 2JX2A 4CQ1A 2XNQA 4TU7A 3MURP 2KI2A 1Q81T 2UP1A 2QFJA 3CC7S 2DNNA 2E5GA 2LXIA 2MZQA 2ADBA 3EGNA 2DH9A 2O3DA 5LJ5Y 4WFBQ 4WFNQ 2DK2A 2E5HA 2J0SD 1A9NB 2KU7A 4OZ0A 2L9WA 2LECA 5IQQA 2CQ3A 4QU6A 4ERDA 1VQ7S 3MD1A 1UP1A 4IOCQ 1D8ZA 2QEXS 4Y00A 2XB2D 4PR6A 3CPWR 1ZZNA 2YH0A 2YKAA 3FEYB 1VQ5S 5GAGU 4QU7A 2MKCA 3CF5Q 1P1TA 1VQNS 3BS9A 1JJ2R 3VAIA 2MHNA 2KM8B 1KD1T 2DGVA 3CCQS 2MQQA 2CPIA 1SJRA 1VQMS 2MSTA 4LMZA 2CQPA 2MGZB 3J7YU 2L41A 3VAKA 2DGQA 2DITA 2NLWA 1WF2A 1WI6A 2MB0B 2MJUA 1FJEB 5DDRC 1PO6A 2OSQA 3TYTA 2N82B 1VQKS 1P27B 1FJ7A 3CMAS 1H6KX 2I2YA 2M4MA 3S8SA 1FT8A 2DHAA 5D77A 1F9FA 3J7ZT 2DNLA 2KN4A 3N9UC 3MXHP 1U6FA 1WHVA 1SJ3P 2X1FA 5DDOC 2HZCA 1QVFR 5DDQC 2XS7A 1JJHA 2DH7A 5DDPC 2M0GB 1M90T 2DNQA 1N52B 3CCLS 2N3OA 1R8HA 3HI9A 2BZ2A 3V4MA 1NU4A 1WG5A 2DISA 2JVOA 2KXFA 2V94A 1X4HA 3VAFA 4ZKAA 1FXLA 1PGZA 1HA1A 2LA6A 2MY7A 3MI7X 1A7GE 2KRRA 2DO4A 2X1GA 2CPJA 2ERRA 4P6QA 5BJRA 2DH8A 1VC0A 2DNPA 2DGSA 1WWHA 1SJQA 3PIOQ 2F9JA 2DGUA 1VQ8S 1WHWA 1HD0A 3NNHA 4TU8A 2AYBA 2E44A 1AUDA 1U1MA 3PIPQ 2YWKA 4IUFA 2CQ4A 1YITS 4CH0S 2VOOA 3CUNA 3P5TL 2D9OA 1WELA 1URNA 3P49B 2RQCA 2KT5A 1H2UX 3CCRS 4UY8T 3THPA 2YH1A 1VQOS 3THTA 2M8DB 5D78A 3I56S 4U67Q 4CH1A 2L08A 2J8AA 3H2UB 5LSOA 2KXNB 2CPZA 3G71S 1VQ9S 4YB1P 1KOHA 1M5VC 1H2VZ 2DGXA 2E5JA 3RW6A 2G1DA 2ZJPQ 1X5SA 1YJWS 2LYVA 1X4FA 4PRFA 2HGNA 4IO9Q 3VALA 2FC8A 2RQ4A 2CQHA 3TO8A 4WCEQ 1VC6A 3B4MA 3IWNC 2HGMA 1VQLS 4WF9Q 2CQ0A 2EVZA 2EK6A 1KQSR 5GAEU 2DIUA 2N7CA 3VAJA 3OW2R 3UCUP 2RRAA 2RS8A 2X1AA 2CQBA 2ADCA 1NJIT 5IM0A 2CQ1A 3G96A 1U1RA 2D9PA 1WG1A 2RNEA 3HHNB 2DHGA 2MPUA 2MZ1A 2FY1A 3CMES 2MQPA 4QPTA 2RS2A 3R27A 3U1MA 1WI8A 3VAMA 5DM7Q 2F3JA 3S7RA 2MQLA 2OJ3A 1VQ4S 5GVQA 2DGTA 5LJ3Y 5GADU 2DIVA 2LEBA 2RUGA 5JVGQ 2RRBA 3US5A 1U1KA 2DNYA 3G9CA 1VBXA 1UW4A 1N8RT 2LA4A 1YTYA 1K73T 1X5OA 3CULA 4OZ1A 2KM8C 2LKZA 5ITHA 1VBZA 1N88A 2GHPA 3FEXB 1OPIA 2J0QD 1Q7YT 2JRSA 3CTRA 4C7QA 4W90B 3SDEA 4A8XA 1U1NA 5CA5A 1FJCA 1JMTA 2DGOA 2KG0A 2DNRA 1U1PA 1HL6A 2DNHA 2DGWA 2PE8A 3CCUS 5CXTA 2J76E 4BS2A 2CQIA 3NNCA 3S01A 2A3JA 2RT3A 3UE2A 2RU3A 5HL7Q 3SMZA 2HYIB 3MUVP 1BY9A 1U6BA 4W92B 2MKIA 2M70A 2HVZA 2FHOB 2M7SA 4FXWA 2OTJS 1DZ5A 5H1SV 1YHQS 2LMIA 3MUMP 2M52A 1DRZA 4F26A 2XNRA 2RVJA 3MDFA 1WEZA 5MLCV 1KC8T 5GAHU 3BO4A 3U1LA 1YJ9S 3D2WA 2KFYA 1SJ4P 3NNAA 1OIAA 3LQVA 1B7FA 2CQ2A 3G8TA 2SXLA 2ZJQQ 1M5PC 1K9MT 2CPYA 3P3DA 3IRWP 2VONA 2VODA 3SDEB 2CQDA 2Q79A 1S79A 1YWXA 3S6EA 4EGLA 1QM9A 3CD6S 3EGZA 1D9AA 2EK1A 3G8SA 3ZZYA 4ED5A 5JVHQ 4YOEA 1X5PA 2CJKA 4TLQA 4F02A 2LCWA 1X0FA 3NMRA 2DB1A 2BOPA 2I38A 2DNKA 3BO3A 1U1QA 3I55S 1M1KT 3MOJB 1YIJS 2DNZA 3BEGB 2FC9A 3CCSS 2MGZA 2X1BA 3CC2S 1X5TA 2K8GA 3DLLQ 4J5OA 1U2FA 2DNMA 2MKJA 1ZH5A 2MKHA 5LXRA 2U1AA 3UCGA 1CVJA 1S72S 1WEYA 5LSLA 2CPEA 2U2FA 2MXYA 1QVGR 2MZSA 1X4EA 5CYJA 4TU9A 1IQTA 2LEAA 1WF1A 2DHXA 3EX7B 3ZZZA 2KH9A 3CXCR 1WEXA 2YTCA 2XSFA 1WHYA 3R1LA 2MZRA 1L3KA 5GMKa 2M88A 4F25A 3TP2A 4PKDB 2MY8A 2MZTA 5FJ4A 2DHSA 1FHTA 1YJNS 1SJFA 2LQ5A 2D3OR 2G4BA 2M2BA 2NZ4A 3CCES 3JB9k 1U1OA 2DNOA 4C0OC 2MZJA 1M5OC 4YUDA 1DHMA 1FO1A 2KXHA 2XS5A 2KRBA 2MSSA 2JVRA 1X4BA 1KOOA 3MD3A 2CPHA 1X4DA 1ZZFA 1WHXA 1NO8A 4FXVA 2DO0A 3NS5A 2KYXA 3RW7A 1U1LA 4CIOA 4M5DB 3UCZP 3VAHA 1RKJA 1DBDA 1FNXH 2MMYA 3CC4S 2JWNA 5IM0B 3ULHA 3NS6A 2KHCA 1RK8A 1YI2S 2MQNA 2MQOA 1R8PA 4WFAQ 2CQCA 2GO9A 1M5KC 4IOAQ 2B0GA 1X4GA 2F9DA 3VAGA 3R1HA 1O0PA 2M9KA 2PEHA 2CPXA 2MKKA 5EN1A 4LJMA 3VF0B 1VBYA 4RU2A 1N54B 5HO4A 3Q2TC 1X4CA 2LXUA 4Z2XA 1VQPS 1VC5A 1JJ4A 1UAWA 4V19X 2OSRA 2FPHX
chains in the Genus database with same CATH superfamily
1NKEA 2HMIB 2ZVSA 2HKEA 2DBBA 3DLKB 3KTQA 3UD3P 1PBAA 4EO8A 2CQGA 1O51A 2XMWA 3P96A 4GKJJ 3DXBA 2ZC3A 5IT9Y 4Y34A 2M8HA 2BJ8A 1SV5A 3SQOP 2MKSA 3DGVA 1CJVA 1HBMB 4P2SA 3QT6A 2VICA 1Q86T 3H4DA 4GKJF 4WKRA 4B3MJ 2QLXA 4M5LA 1RWPB 5AXMA 3HVTA 4LVOP 2MZQA 3R6LB 5KFZA 3KLEA 4NLPA 4ZITA 2W9BB 3JSYA 3DDNA 4NYOA 2KT2A 5IQQA 2I1RA 4K7QA 3BB5A 1H74A 1PIEA 3LGHA 2CJBA 4B3MF 1VQNS 3FGVA 4RNFA 4OHWA 4CH7A 2FVRA 2HS0A 1RAIB 2XG8A 2QX0A 1U8WA 4YB5A 4DV5J 3PHTA 4DF8A 4USKA 2BACA 5J2NA 1QVFR 1KLMB 2DH7A 3A1YG 2R8IA 3I32A 2LU1A 3MCMA 1AZSB 2DISA 3CB4A 3GP9A 4LVNP 1CULB 3OFHA 3EZUA 2GC8A 2R7RA 4LRDA 4DV5F 2ZBPA 3KG4A 2UVRA 4UOCA 3I5CA 4H4KA 1FJGF 2Z8QA 2FHJA 3R5DA 3QJPA 3H5XA 1DY3A 4MYUA 3AFGA 2WW8A 3PX4A 4MK9A 2E44A 3BM7A 5DGBA 2HZAA 2BXJA 1OMSA 4ZCKA 1CJUA 2D9OA 2DD8S 2ZH9A 1NH7A 1Y9OA 4L6V3 4U67Q 4CH1A 3WX8A 4K0KJ 5EX0A 5B09A 4MIAA 1R0AB 1RXOB 3I0RB 3P5BP 4YQWA 3BBCA 3PG9A 4C8OA 1S0VA 2RS8A 5HAOA 5HBMA 2NREA 3O3LA 2CYYA 5KG3A 3VTIA 4F36A 1S1XB 2VKZG 1LEOA 3JS9A 1S76D 2OPSA 3ZZRA 2HFZA 1S9FA 2OJ3A 3IRXA 2B6AB 1OYDA 1U02A 5CD4A 5AXNA 5LJ3Y 3Q22A 2BABA 1XR7A 3NXZA 3MFHA 1HARA 3BR8A 3BBFA 1DTTA 1N8RT 3RB6A 4NLVA 5D8HB 1N88A 1Z2ZA 2GAHC 1GMWD 3GJSB 2IM2A 4NLOA 4QW9A 4KO0B 1PAEX 1HNXJ 3POTA 2B7BB 1UA1A 1EZZB 2GO8A 2RU3A 3TEGA 1E6VB 1QLNA 3MOZA 3MECB 1UEVA 4LR7A 4IOBA 4F26A 1HI8A 1RAGB 3VQSA 5IQ6A 3U1LA 1GMVA 2FJEB 2W7AA 1FTCA 4KB7A 3MM8B 1UVKA 1HW8A 2OLWA 4EGLA 4TXSA 2R7TA 3SI8A 3EWGA 4OX7A 2PMHA 3RJMB 3GJQB 3QFWA 1X0FA 4G1QB 2DB1A 2G9OA 5LOQA 3K5MA 3GIIA 2ZH3A 5GADI 4OMFG 1GT8A 1EAYC 1HHQA 4HT7A 4NCAA 4ZP6A 4WU2A 1CQNA 2FVQA 4HKQA 2MZSA 1FKPB 3SCLE 2ZKTA 1UZHA 3SEOA 4U8VA 1WEXA 2R8GA 1MLAA 2RILA 1S1TB 1WORA 4A8MP 5DRKA 4LSLB 1LKZA 2HHPA 1H38A 4RUCA 1I3OB 3BSCA 2IYGA 4OYPA 3K5OA 1DHMA 2MSSA 3R5CA 2W24A 3MD3A 4PXBA 2KB2A 3KNGA 4PXEA 3KUGA 3DLBA 4P75A 2PDAA 4DR5F 3MR5A 2JWNA 2YKOA 2IBOA 4DQIA 2FD2A 2NYIA 4ZLPA 1GXTA 8AT1B 3FMBA 4ZLLA 2LU2A 1Q8BA 5EN1A 2J9CA 3IFEA 2V69A 2AEFA 1VQPS 2EG2A 3PW5A 2OELA 3MCNA 1H3DA 1WG4A 3QMQA 2R2TA 4DCPB 4QQBA 3HHLB 1F3VA 4A47A 2EFGA 4OYIA 2YWEA 4RW6A 5ETPA 3MEEA 1KKHA 3PACA 4Y3CA 2UUBJ 3GONA 1REVA 4EO6A 3MR2A 4DV1J 2CNLB 4RW9A 4ILRA 3MUTP 2KG1A 3RYLA 1LV5A 1Q4RA 2MQMA 1RHJB 4QZVB 2ZHBA 1NKCA 2J9DE 1T0TV 2QLBB 2XC9A 2UUBF 1XNRF 4QOTA 2YX4A 4DV1F 4DUTA 2AJ4A 2HVHA 4JOUA 1E6YB 3CJ5A 5CQGA 1JNZB 3ICLA 3UI3A 1PJ6A 3EGWB 3VAIA 4PG8A 1EQMA 2YNFA 4EI2A 3CD7A 1RDRA 4R25A 2JLFA 2J5AA 2ZEJA 4KSEB 1TL1B 2R9LA 2P2CB 5A2QY 3M1VB 3TA0A 4KHPF 3N5FA 1TL7B 2LQ8A 5HATA 5RUBA 1TMJA 4PQAA 3TAMA 3ENQA 1RCOB 2YKMA 1PGZA 3NOGA 2UUTA 3HSZA 3MI7X 1F6TA 1A7GE 4JI6F 3BSAA 3GE9A 1VC0A 1WOPA 4AXIA 4O23A 3UDLA 4KV8A 2ZZTA 3HHKA 2WAQD 4JUZA 3GCWP 4UOFA 1HNWJ 4ZVTB 4DG1B 1CG2A 4LFAJ 3TVZA 4LFCF 1FKAF 3EE3A 2KVQE 5EUHA 1LWFB 4JP8A 2ILZA 1HNWF 2CQHA 3B4MA 4F0KA 4KKOB 1TFYA 2RRAA 3QT8A 1JLCA 3GIRA 1JLBB 3B82A 4LFAF 1U1RA 1RADB 5A8KB 3HHDA 2BW2A 3H90A 5J1PA 1SC3B 4EU0A 2V2ZA 4FS1A 1KVKA 5A6WA 3VCDA 2AHOB 3N0VA 1HWKA 1YRTA 1O8BA 1G6BA 3RUBL 4U96A 2A6OA 2JEIA 2XMVA 3TAQA 1ROFA 5JJBA 2CDRB 4WK1A 3C15B 1AXQA 2DNHA 2DGWA 3X1LB 4PPZA 3R9LA 4IO1A 4KFBB 3GIKA 3KJQB 1KBRA 4RKUC 3D3BJ 1N4LA 3RB3A 3T41A 2XM3A 4X4OA 3L4BC 1YRUA 2GVZB 3D2WA 2V8HA 2XGQA 3BGUA 2XZWA 3UVJB 5L38A 3E01A 1TKZA 1FF2A 1YWXA 3RAMA 3S6EA 5FLXY 4MKVA 1RHKB 1D9AA 5AJ3J 3FUYA 2FY8A 4OZ5A 5KFHA 4Y2IA 5JMNA 4TQRA 2UXDJ 3QAEA 3JYTB 3MEDB 4A8YA 1N34F 4DZ6A 2K8GA 4DPUA 1R43A 4R8UA 4F4YA 4QW8A 3RB4A 4IFVA 3DNCA 4OI6A 4FYVB 1T3OA 2MZRA 1S6QA 3KLIB 4DSFA 4PQUB 4OI2A 1YK9A 3OTOF 2D3OR 1DLOB 3MEGB 1Y5NB 2XS5A 4LF5J 4NLRA 2E7VA 3ILOA 1WUUA 3FSYA 4JB8B 4B3RJ 1U0HB 3W8PA 3U7JA 2XLJA 4FBTA 3R1HA 2A2DA 2XO7A 3R6GB 4ICLA 4WK3A 5E33A 4OYZA 3DOLB 4LF5F 2YNGB 4CLSA 3Q86A 1VQ6S 3F44A 1Q95G 4CLYA 3T3FA 4B3RF 5A8WA 5HVHA 1CJKB 1OSCA 1R7IA 1T11A 1HD1A 5ETOA 4DUYF 4CNZA 3KJFB 4RNMA 2VFUA 2LVWA 1LXJA 3N4WA 3RAXA 1QAYA 2CDQA 3K17A 1HYSA 1NK4A 2N4CA 2P6TA 2XTJP 3QJJA 3OLBA 2VB6A 2FJBB 1M1HA 1TKTA 3TA1A 3QLHB 4PZVA 2LXIA 1Y11A 2C2NA 4PXDA 1B7YB 5I4MA 1C4CA 3GIMA 2BJ7A 4DV3J 2UVVA 4Y28C 5DQIA 4DR1J 1XBWA 3CGIA 3BS9A 4RUAA 3DGPB 4ZPAA 1DARA 4P2FA 4RL1A 1VQKS 3TYTA 2N82B 1RWOB 2YQ0A 2DNLA 3HP6A 3DRSB 4DR1F 1RJJA 4CO2A 4GVLA 2YY3A 4OHZA 5G0RB 3SBMA 2CJYB 3E51A 3HXMA 5DZ6A 5L9XA 2F8EX 4LRBA 1NDPA 1FXLA 5E3AA 1KFSA 1KR4A 1RT6B 1RWNB 2H5JB 4YFUA 5HVGA 3D68A 1XWLA 2I0XA 1WOSA 2OD4A 1Y0HA 3BPDA 2JLGA 2DXDA 2HIQA 4X65F 3Q0AA 1DFDA 1U1MA 2YXLA 4QIWD 2RQCA 1VRQC 4ZVHA 3AQOA 4O0NA 3PW0A 2DRDA 4YHHJ 4A8OA 2H48B 1KOHA 4DQPA 1RBAA 2VFRA 3GJRB 2D3O1 3SCJE 4ZPCA 2GZOA 1RT2A 3ZNJ1 3V6HA 2B7CB 3H7HB 5B08A 3BKTA 1SV5B 2ADCA 5IM0A 3HSDA 1CJVB 4JI3J 4I2QB 4Q8EA 2QZ8A 2XO6A 4F3OA 3J81U 3ETOA 2MPUA 4RU9A 2HHHJ 1XTZA 2W4DA 3R27A 3U1MA 1YZ6A 1S6OA 2F3JA 3VHQA 3BQ2A 1J2VA 1UVLA 3HVTB 3DOKA 2RRBA 4B9MA 2OO4A 2CNKB 3KLEB 1Q5YA 3HFVA 4UUXA 5LM7E 4EBCA 4DXLA 5CA5A 3MM9A 2EI5A 5T7LA 2HHHF 3MF5A 3WIVA 3D6FB 8ATCB 4JV2A 1U09A 1SB6A 1UVNA 2MKYA 3KUEA 3S1TA 4FXWA 2EKNA 2PSZA 3IXQA 3MUMP 1EIYB 1KC8T 2FVPA 1RA7A 1M5SA 5J2NB 3WDOA 4M5IA 4NXMJ 4DOZA 3HT3A 1H7WA 4EYIB 3PO5A 1S1UA 2QMXA 1EP4A 3UW1A 2ZZMA 1BWVA 1FRIA 3VWSA 6FD1A 2FLNA 2OMOA 4DS5A 4C3LA 4URQU 5KTQA 4NXMF 5DQGA 1YG0A 1A6LA 3UN2A 2NS1B 2MKJA 3WC2A 3GJTB 5EWEA 3RRKA 4PWDA 1CJUB 1T7PA 2DHXA 2YNHA 4N56A 4RNHA 2MTLA 2R7VA 3R1LA 3OFEA 2CJAA 3VGTA 4DL0C 3SSSA 1KOOA 3D0IE 8RUCA 5LMNJ 2RHQB 1FEEA 2FZCB 1HWJA 4G1IA 3QWPA 1HBOB 2ILYA 2DPJA 5C25A 3H59A 5HBMB 4CRJA 1FRMA 5DGAA 2PA8D 4D3GA 2M9KA 3GSIA 3HPOA 2OPSB 4K59A 5HO4A 5IT9U 3HHLD 4AD6A 3IRXB 5LMNF 2BVZA 4NLQA 5F9NA 3TW0A 4YDDB 2F4VJ 1DTTB 2E29A 4NLUA 3LPYA 1NNDA 4JI7F 1PILA 2P9CA 4X66J 1B3TA 4LBHA 3POTB 1ZAXA 2CPDA 2E5IA 3JQMA 4CO0A 4N47A 4JI1J 1TK8A 2Z2LA 2AD9A 5THWA 2E7XA 2YWGA 4ZHRA 4DQQA 1T02A 1NHVA 2I5JA 5HI7A 4NA1A 3T1AA 4CQ1A 2BJEA 4C8YA 3SSRA 1RWVB 4ZP7A 2KFZA 5H9FK 3SYZA 2R8HA 2K06A 3OBIA 1SKUB 3IBWA 1HIYA 3M9OB 5AXKA 4MFBA 1U25A 4IFYA 2Y1LB 4QIVA 3PW7A 4ANCA 4K4SA 2YKAA 2YPZA 1SC4B 3FEYB 3M2RA 2AEJA 1F2HA 4HVZA 2KM8B 3CCQS 2HQDA 2BRLA 2P9EA 4IYQA 1VQMS 1FI4A 1U2CA 1PYSB 2CQPA 1JLEA 2G13A 2HZVA 2V2QA 4UTGA 4LF9F 2OSQA 4RW8A 1SJ3P 4HHHA 1KFDA 5DDOC 3TRGA 3OLAA 1XR5A 2B9WA 2KKHA 1N52B 4AXJA 1S49A 4UZCA 2N3OA 4WYWA 2BZ2A 2V4JA 1U48A 2DRBA 1UPMB 4RNOA 2EXUA 5KFRA 2BMBA 2BKPA 1RABB 1RTHA 2COLA 4FXDA 3J7Z5 2CPJA 2VV5A 3A8JA 5ETTA 3KG0A 4AL7A 1F3FA 3AA8A 4HTJA 5KFVA 3QQCD 2YWWA 1XMOJ 3CJKA 3OL9A 2BE2A 4USVA 3OL7A 2CKWA 3NMAA 2HBYB 1NK9A 3HVAA 4I69A 3BREA 5ETRA 4MK8A 4DUZJ 3G6XA 1LK5A 2KXNB 2UUCJ 3PR5B 2ZJPQ 2AP6A 4WFXA 1XMOF 2FC8A 5E3RA 1FNMA 4RW6B 3BYPA 3QO9A 1KSPA 4CP5A 3MEEB 2HG4A 5DLFA 5KFSA 4DUZF 4NLTA 1REVB 2XYPB 3B6BA 2DIUA 3C16A 2EBEA 3V6DA 1DQ8A 2UUCF 5KOXA 3IMQJ 4RW9B 4IQMA 3EXCX 2RNEA 2HLTA 1OY6A 1S9GA 4YS2A 3PW4A 4ZJQA 4ZPBA 4ETXA 4OZ3A 3NS7B 2Q66A 3US5A 1YTYA 4WFYA 3IG1A 2LQ9A 4A8XA 4M8LA 3HKZD 1OQ6A 5C42A 4I6WA 3M8WA 1U47A 4ZVQB 4DX6A 3DI6A 2HQIA 2OEKA 4RZRA 4XAKA 3TI0A 2YNFB 4F4AA 4DL5A 1KQFB 1VK8A 2BW7A 1N5VA 3PYDA 4PG4A 4ILLA 4NZ0A 1JLAA 3D9BA 2CPYA 5J2QA 2Q79A 1S79A 4TVAB 3C66A 2W7OA 3GB0A 1K47A 3TAMB 2FHMA 2YKMB 5T41A 1F60B 5LMUJ 1KS2A 4ECYA 2BOPA 4KT0C 4B9SA 3CIMA 2XSJA 3AD8C 1WC1A 1RAFB 4QJVA 4NCBA 1Y00A 2ABYA 2DNMA 2U1AA 1CVJA 1PJ7A 3MCOA 4CLLA 2R2UA 2DCLA 3OV7A 4ZVPB 1FKOA 1RTDA 3TX0A 3ZC4A 1U49A 3TNVA 3OHBA 5F41A 4QIGA 3CNQP 4HL9A 2FTRA 4JI4F 1UVJA 1BMQB 4HDGA 1SJFA 1ZPWX 2K7JA 2IVYA 3FMWA 2H5EA 2VG7A 4NZ6A 4YN3B 1RB0A 1VJQA 3AAWB 3RW7A 3UCZP 2Y1IA 2WOMA 1DBDA 3M8QA 1J27A 3ZTRA 1JLCB 2W4PA 1MWZA 2VBZA 4N8OA 4RBTA 1Q0NA 1R8PA 4WFAQ 3PJXA 4YDXA 2CPXA 4LJMA 5C24B 2UU9J 1VC5A 5KOWA 4WP3A 2IC3A 4USMA 2WBRA 1FCAA 2L48A 3OR2A 1NK6A 5IXUA 2CUYA 1FX4A 1UPPA 4RR5A 3OUYA 3AOBA 4LREA 4WIIA 2E5LJ 2KVIA 3SCIE 1G2EA 2WB1D 2UU9F 3H2VE 4WE1A 2QV6A 3OSNA 3MPYA 2Z2MA 5C7PA 3ZTOA 5DM6Q 3K57A 1N0UA 2E5LF 1RHUB 4NYPA 2GHWA 5KFYA 5HQ8A 1KEKA 3E01B 3J7AN 5ETLA 1N0VC 3QRPA 3LGMA 4Y65A 4Q5VA 2DK2A 3M6VA 3Q24A 3ZTPA 3FBBA 3M6UA 3IBCB 3RAQA 2HBZB 3LALA 1UFKA 5A2QU 1RHRB 1ZZNA 4EWTA 3ZZUA 1MMLA 2H9ZA 1TUVA 4AFFA 5KFDA 5KG5A 4AT1B 1U7LA 2J7KA 1I94J 3SCKE 3K5PA 4WP9A 5B0GA 3L9ZA 2L41A 3OR1A 4KE5A 4R8UB 3I31A 4FS2A 4OL8A 5A0YA 5D77A 2WVDA 5IS2A 3M9MB 4WYLA 2YPYA 5D4PA 3RG6A 2QTWA 2VHGA 1I94F 5KT5A 2QO3A 5G4DA 1NAQA 1S6QB 1RTIA 2W1BA 2DR5A 2JVOA 2KXFA 3VAFA 5E0OA 3MM5B 3KK2A 3MPUB 2X51A 2KRRA 2DO4A 2ERRA 2ROGA 5BR8J 2DH8A 3HF5A 5HANA 1AROP 2D7SA 2UV8A 1R8AA 3NGSA 2BEFA 2F9JA 1IKYA 2DGUA 3KMQA 3LO3A 4TU8A 3DM2A 2GCFA 2Y0BB 3OXGA 4DR2J 2XY5A 1NK0A 4GC6A 2FZKB 5D3GA 2VOOA 1URNA 1WDTA 3CIZA 4ICLB 1SIWB 5A8RA 2V4QA 5GAGI 2LEPA 5BR8F 4H4MA 2M8DB 2AU0A 3H2UB 2C3MA 3KDOA 1CLFA 2YX1A 4CM0A 3QJLA 5CABA 2QL7B 1NHUA 1RAAB 2F4FA 1VC6A 3LF0A 2YNIA 2GA7A 4OJHA 4LR8A 1SH0A 4I4BA 3HJFA 1HYSB 5B0FA 1WG1A 2BKOA 3HHNB 2RS2A 4FVMA 1TKTB 2D74B 2JZ5A 4O4GA 2ZH7A 3C46A 3CULA 3PR4A 1AA1B 2J0QD 3BKUA 2CZVC 3BV8A 3VR1A 3LWLA 1WD6A 2Q1LA 2XMTA 3TAPA 4G3IA 3CD0A 2BYCA 5BXIA 3V81A 2BQUA 2MLZA 1NK8A 4E98A 3D7SB 3MMBA 4N5SA 3LANA 3TZWA 5JUMA 3TJ8A 4IG0A 5ETQA 4MIBA 3NGDA 1B7FA 2DXFA 2YWFA 1M5PC 3NWGA 3CT9A 3PNIA 4ES1A 5GAEI 2VONA 3PXGa 5IC4B 2B3TB 5KG1A 1Q16B 1WSRA 3EGZA 5KFEA 4ED5A 4U7UD 4EMDA 4YOEA 1EX8A 2DNKA 2HPUA 4XK8C 1IVZA 3FNNA 5LT5A 1FE4A 4J5OA 4J9SA 2C2KB 1ZOTA 3UCGA 5LSLA 4LQ9A 2HBRB 4HT5A 1RACB 1U8SA 1CQMA 3PX6A 4DWIA 1L3KA 1OQ3A 2PFDA 4JV5F 2ALZA 3G87A 1VDHA 1MWYA 2AIRB 1U1OA 1Y3KA 4DFMA 4A46A 3M2UA 3GMGA 2JVRA 1RT2B 3H5YA 4HI2A 1CJTA 4HI1A 3IR6B 4DV2J 1MSWD 4ED3A 5IM0B 3ULHA 5KFCA 2CQCA 3GFHA 5M2PA 2QMWA 3K8WA 3VF0B 4ECXA 3DLGA 1ZYQA 1V9OA 1JJ4A 3HJVA 2PA3A 2IYIA 2OSRA 3F73A 2XY6A 2DRAA 4B9UA 2FGOA 3DOKB 3AH6A 2I8EA 2HQCA 4OV1A 4DV2F 3G6ES 3HMJG 2HHSA 4ECVA 3SV3A 4OYOA 4K4XA 3H20A 1XN9A 2YVSA 3MM9B 5T7LB 2FLLA 3LAMA 1M1GA 4H54A 5KFFA 3IR5B 2WBMA 1IXKA 1V3SA 1IR1A 4C8MA 3T6BA 4J9MA 1HHSA 3EDRB 1BUXA 1NKBA 4RUBA 4G1PA 1NSAA 1JLGA 4PCQA 3M8YA 2FJVA 1AFIA 4OZ0A 1Q8LA 2W9CA 4E0DA 4QU6A 3BKFA 4ERDA 4C8NA 3MD1A 2LP4A 4NLYA 1S1UB 1EP4B 2VG6A 1VQ5S 2DGVA 4JI0J 3HZEA 4B9LA 3QRRA 3FVYA 2HS4A 4LMZA 3KFWX 4MH8A 4O3RA 2GJIA 3AJ1A 2MB0B 1PO6A 3ADAC 1X9WA 4ELVA 4PWDB 3N9UC 3MXHP 1JJHA 2KT3A 1H72C 2M0GB 2WVFA 2YNHB 2DNQA 3MWBA 3KNAA 4JI0F 3UNYA 3V4MA 1DAXA 4C98A 4ZA1A 2JFDA 4NRTA 4RW4A 1P8GA 4JV0A 3WQPA 4R5PA 1NH8A 3BR9A 3W2WA 2ZH2A 2RDDA 4DPOA 3C14A 5AE2A 3TANA 3LAKA 1TVRA 4DZDA 4DV4J 4HEA9 1SQFA 5C25B 3C6TA 2C3PA 4P73A 2C3OA 3GPAA 4OV6A 4IKAA 1YITS 3R2CJ 1XMQJ 1Y5IB 3HHLC 2V9WA 2XEXA 2KT5A 3DRXA 1H2UX 3JTPA 2HNYB 4NE9C 2FJXA 2HSEB 3W65A 2CWXA 5B0CA 4DV4F 4EEYA 2V2KA 2DGXA 5KT3A 4S0MA 4DR7J 1J5OA 1Y10A 3VGSA 4K50A 4MYTA 3MR6A 1XMQF 2RQ4A 2E9RX 4QYZJ 4DPYA 1BQXA 4NL5A 4DSJA 4M5DA 1RT5A 4P10A 4Q44A 4CT8A 1GMWA 1Q79A 4ZHRB 2I5JB 4DX5A 4UZBA 3MM6A 3VAMA 2OPPA 4LF8F 5GVQA 3OPKA 3FSXA 2DKOB 1RE1B 1HHTP 4CCHA 3DMJA 2ZH5A 2NXUA 3W61A 2GHPA 2M5YA 3W63A 4W90B 2F63A 1G7CB 1GK8A 4MFBB 4PYDA 3R5JB 4IFYB 5CXTA 1NM2A 5HN0A 3G6YA 3M2RB 3H98A 1UETA 1R27B 2ASDA 2J8SA 1S7IA 4MTPA 3JAMY 5DO2A 3PEJA 4KGVB 3IWLA 2XULA 2WW4A 3I9V9 1JLEB 1DZ5A 5H1SV 1M0SA 1HW9A 3BO4A 4CT9A 5B0EA 4RW8B 1GEHA 2RAQA 4DV7J 4X62J 1VHFA 1T9VA 1B0VA 4WBFA 3IRWP 4KPYA 1XNQF 1IJEB 3H25A 4KY3A 1HR0J 3JSRA 3CW2C 2KTQA 1RTHB 1Q78A 2FVSA 5CH7B 2OUGA 4ENOA 2WCXA 1B0PA 2C42A 2RJZA 1S99A 2F7VA 4LBPA 3FBEA 4IG3A 1V5IB 3ENWA 3DN9A 1WEYA 1B0TA 3CJKB 2BE2B 1JNRB 1ZM4A 2HK3A 2D3ZA 5GMKa 4IRDA 2IBKA 1R89A 3TA2A 1D9FA 2ZZNA 4HH0A 4QWEA 2WTFA 2DNOA 4C0OC 4X2BA 5CYQB 4HYKA 4ETZA 2VDHA 2O1PA 3QO9B 3UFCX 2O5DA 2VKRA 3WHIA 3SFUA 3C16B 3DOMA 2WONA 3NS6A 3LUYA 3QBCA 3V6DB 4IOAQ 2UUWA 3M30A 4ZDNA 1WC4A 3AHPA 4L72B 1N54B 1RT3A 4DR4J 3BN7A 1S9GB 4ECZA 4M5GA 1HWLA 1FFGB 1WC6A 1GNKA 4OJ3A 1KP6A 3UO0A 4X4NA 3QFHA 2VPYB 3EM1A 3K5NA 4K2XA 4OHYA 1ZM9A 1WF0A 2ASLA 4FKYA 4XIUA 5J2MA 1VIXA 3VVUA 1OWXA 3D0GE 2G0JA 2GVDA 3PFOA 3L3CA 5C42B 4DR4F 5F8MA 3DI6B 2XMMA 2IVFB 1RZMA 3MM7A 2XS2A 3KHHA 2AJFE 1TKDA 2MHEA 1P1LA 5KFBA 1Y3JA 2G2YA 1SL0A 1S7HA 4XTTA 3K7RA 3IAM9 5IV4A 1LW0A 4YB7A 3NBPA 1JLAB 3H5UA 2O3DA 4ZIVA 3HVRA 4DI6A 3Q8UA 5KG6A 5J2QB 2DR9A 2ZNZA 1UP1A 2IJRA 2OMLA 3CD5A 3G6VA 3FDSA 3W3SA 3KDNA 3UDEA 3M8RA 4FNIA 5C2GA 3O2IA 4O3QA 3KKFA 2P8IA 2HNZA 5KG4A 3ILJA 1WF2A 4ZVGA 1TUWA 4DFJA 1P27B 3CMAS 4JYAF 4CLFA 2RE1A 4QR0A 2CWKA 3SIPB 4ANEA 1RTDB 5DDPC 2V6AA 2QG9B 2UZAA 1NU4A 4YY3J 4I64A 4CO1A 1R0BG 4DHVA 4YEAA 2AT1B 1RGVA 2Y3YA 1SBRA 4NLXA 3MPWA 2VG7B 3ISZA 4P6QA 1HQ2A 4K4TA 2YKQA 3MTJA 1REGX 5KT4A 2DTJA 2WOMB 3M8QB 2Q3PA 2HIYA 3LPEA 1AUDA 2PIIA 1LWCA 1CC8A 4CH0S 3CUNA 4UY8T 4KYZA 4M5KA 3THTA 2QLJB 3L7UA 4RNNA 5J1EA 2IC3B 1YBUA 2W7PA 3OR2B 3W66A 1VQ9S 3W2VA 2K7KA 2ACMA 5HMZA 1DTQA 3EXYA 1DQAA 3ISND 4EBEA 2G1DA 3DLJA 4HDHA 3OUYB 5DLGA 4PRFA 2PC6A 4IO9Q 4DS4A 5DG8A 1FFWB 3TO8A 1KQGB 3Q8RB 4TLRA 2CQ0A 1MU2B 2EKYA 2W8KA 4WE1B 1N48A 1QE1A 3M2VB 4FYYB 3VAJA 1AUSL 1LOUA 1NJWA 4AL5A 5F8HA 2W2OP 3ZNUA 3CMES 2XYHB 4ZVFA 5HJXA 1JQGA 2W25A 3FC9A 4ECSA 2DIVA 3A3NB 2DNYA 3G9CA 3TARA 2FZGB 5JXSA 1S77D 1HFEL 2Z4PA 1SC1B 2VPXB 2JDJA 4ZP9A 2KO1A 5KT6A 2OEJA 1TL3A 3OXLA 2AGQA 1FJCA 4FKXA 2DGOA 4KGXB 2ZWOA 4CTAA 1Q5VA 2RHSB 1FDBA 2PE8A 1LFWA 2J76E 2ZNYA 5GMEA 1SCJB 2EC0A 1H7XA 3UE2A 5HL7Q 2B4VA 2XLIA 1ZTTA 2M7SA 3OFFA 3OR1B 4K4UA 2CADA 2NPFA 1T9WA 2HVEA 1IBKF 4OYMA 5DG7A 3GZ7A 5A0YB 2KFYA 1T9TA 3G8TA 2ZH1A 3M7VA 2AQ4A 4DF4A 2VD3A 4V19J 3UPFA 2D1CA 1RTIB 1LNQA 3A8IA 1UVMA 3R7SB 3PO4A 1JXLA 3MEKA 2ZITA 3KK2B 2RB7A 2JEJA 5IT0A 1FE0A 1V6HA 1U1QA 2AGOA 4QBUA 1D09B 1IKYB 3V2UC 4F4WA 2E7WA 1X5TA 3DM2B 4LBIA 3R5AA 5ETMA 2JC0A 3VGUA 1SH3A 5CCMA 3EX7B 5A8RB 4DV0F 4H4MB 2H51B 1UTAA 4X4PA 4Q7AA 2M88A 2NXNA 3CCES 3L7OA 4WTYA 2IMWP 1HNVA 2F8HA 2KRBA 2B43A 1HI1A 1HPZA 1X4BA 1D0EA 3QYYA 2YNIB 3IBFB 4FXVA 3NS5A 4OI1A 2R2RA 5BYQA 1FTRA 4M95A 3RU0A 5D0HA 4P2MA 1FJGJ 4DL7A 1RLDA 2YBVA 4LF4J 3BQ1A 3Q2TC 2LXUA 2HWIA 1ZM3A 2W9AA 3M32A 4RBVA 3DC2A 2RQMA 5U47A 5DETA 3OXFA 3NLCA 2G0CA 5L39A 4O4GB 1KTVA 1BGXT 2OTLS 3AA9A 2MYFA 1Y7PA 2ZUAA 4LF4F 2UVWA 2KL8A 2LQBA 3IS9A 4U7UK 5KG2A 2XZDB 3NP5A 2RUSA 3V81B 2Y1RI 2KJVA 2VOPA 5H9EK 1FK9A 2QSWA 3G4SS 3MMBB 4NXNF 1UJ5A 2LLZA 1RT1A 4IG0B 4EZ6A 4TU7A 4GKKF 2KI2A 2I6WA 1Q81T 2XMAA 3CC7S 1RP5A 2Y8YA 2HK2A 4CZCA 3EGNA 2NQPA 2R7QA 1YVFA 4H4KC 3EDQB 3D6HB 4RJVA 1X7VA 2OGUA 4PR6A 4QU7A 4YB6A 1FRHA 2AJ2A 3QGGA 1FXRA 2CG8A 3JSMA 1V3ZA 4URSA 2IJFA 4L73A 1OYEA 1S57A 1RHQB 3J7YU 2NCKL 3ZTQA 2VC0A 5E41A 2AZ1A 2A18A 5BYSA 2R7XA 3QZ7A 2VDIA 4F2SA 2KN4A 1U6FA 2ROEA 3KLFA 2DXEA 4C2MA 1SIZA 4A8KA 3TX8A 3N28A 1KWMA 4BCAA 1X0PA 4KR0B 3OL6A 2B9EA 4AL6A 2FJAB 2L9NA 4TYAA 3QIDA 3M2UB 1HBNA 1S97A 1SL1A 2IVMA 2DNPA 5B7WA 1TV6A 1C1CA 1FD2A 1WKLA 1GXUA 1SPBP 2ZBIA 2BQRA 1CJTB 7FD1A 2EBGA 4DSLA 4J9PA 1SKSA 4IUFA 2KZZA 2YWHA 4Q2MA 3TJAA 4WZMA 2HFVA 3DLGB 4WU3A 3MR7A 1WACA 4QWAA 2YH1A 1NSQA 2L08A 3NRBA 1V3RA 2GW8A 2E5JA 2GQQA 2LYVA 2P6SA 3PYEA 4KJIA 3NKYA 5L46A 2EFPA 4I2PA 4R0EA 1EB0A 2IRUA 4Q8FA 1PSDA 1S1VA 3IO1A 2X1AA 5I42A 2OKQA 4BDPA 1IKWB 3OJUA 2K2PA 2BE9B 3KMSA 3RBDA 2W2NP 2ZM6J 2IJNA 1QUPA 3OVBA 2HWTA 4DR5J 3PFEA 2MQLA 4I67A 1VQ4S 4LFBF 1VS3A 1JLGB 4I1TA 2XLKA 2ZH6A 4X4SA 1PYOB 4Q0BA 2W9CB 2KM8C 1IKVA 3FEXB 1U0SA 2CNNB 4O3OA 1U1NA 2DR6A 2VG6B 2ZM6F 2A0FB 4F8RA 1RWKB 3CCUS 4BHQA 3AXKA 2IRXA 2Y8WA 3R8YA 3PKYA 1WNEA 3MUVP 4N8NA 4OLOA 2KFNA 1I5OB 2FLOA 1BY9A 4W92B 3GFXA 2M70A 3A8KA 3MDFA 1N36J 4IH5A 1T03B 2R8KA 1ZETA 3LQVA 2ZUGA 2ACYA 1F5AA 4AQYJ 3SDEB 1H98A 2JL9A 2Q6CA 3AY0A 1S1TA 3G8SA 4RW4B 1IUJA 1XNRJ 1N36F 4R5PB 3NEKA 1VLOA 3W2WB 3M4XA 3KLGA 3C14B 4LSZB 1FEHA 1TVRB 4QIEA 2FC9A 4AQYF 4JI2J 1U2FA 5LXRA 1QSSA 4ZPTR 1S72S 1L3TA 2IRYA 2X3GA 2U2FA 2WVBA 1EARA 2IHR1 4DX8H 4I7FA 2YTCA 5E7OB 3EMTA 2Z58B 4JI2F 2RMLA 2DHSA 4KHPJ 3SFGA 4K4VA 2F1FA 1J5OB 4YR3A 3PYFA 4OYAA 2XWXA 1U26A 2C22A 1D1UA 5KT2A 4JI5J 2XHCA 4B3OA 2X3DA 1ZZFA 2M3DA 3BYRA 1Z2LA 3T9NA 4OX8A 4M5DB 1RT5B 3PRDA 3KK1A 3VAHA 5KFNA 4X84A 2J9DA 5ETKA 3I4PA 4JI6J 2UXCJ 3CJSA 5FDLB 3TZXA 2OPRA 2EG1A 1N6QA 3KLHA 4IR1A 4JI5F 3MM6B 1RT7A 1SUQA 3ZFVA 1QAXA 2IPOB 5D6GA 1YJ7A 3DMJB 4QPXA 2QIFA 3GWCA 2VASA 2UXCF 2IM0A 3GQCA 2QT7A 3ELHA 4OZNA 4I68A 2UUAF 4A8WA 4LFCJ 2ZFHA 1Y5LB 3ILLA 2HHTA 4DR3F 2QA4G 4MKBA 4MAKA 5K8OA 3CCVS 2YX7A 3JXOA 4IH6A 3SXLA 1PBUA 1GMUA 4DQRA 4Y2CA 2J9EA 1SQGA 3F41A 4CYUA 2HLUA 1S9EB 2QFJA 3HZGA 1CPZA 2IMOA 3M8PA 2ADBA 1B70B 4C3KA 2XCAA 4PG7A 5DZ7A 2XCPA 2LXFA 2DYAA 2LECA 1HNIA 1IN0A 2C2MB 1RTZA 1D8ZA 4RW7B 1IQZA 3G86A 5F3TA 3AOCA 4U7CA 4AUKA 3DLEA 4ITSA 3T6JA 1S6PA 2FQQB 2QGFB 2HQFA 1VOMA 3LH2S 2VG5A 2ZDOA 1RI7A 4XPEA 4ED0A 3EVMA 1T8EA 2DGQA 1HKAA 4IG3B 2AMCB 1B99A 3BH6B 3RZAA 3AJ2A 3K5LA 2X1FA 2HZCA 5DDQC 5D4LA 2PI5A 1M90T 2DEJA 4JBCA 1KHWA 1BQMB 3H4BA 3HK2A 1WSVA 2HHUA 3MZIA 1YDLA 2KJWA 3K58A 3O1LA 1NDCA 3K2YA 4YR0A 5F8IA 3PIOQ 1HI0P 2JHEA 1N32F 3DOMB 2WONB 1V5VA 5D4NA 1YGYA 4BWMA 1M5HA 3M30B 1N34J 2QMUB 3P5TL 1RT3B 2BJ1A 1TL4A 1VQOS 1AB8A 1MROA 4F7VA 4K4ZA 1XEZA 3WIUA 5CZVA 1YX2A 2WB4A 4LT6A 5J2MB 1VCTA 2NXEA 2LFVA 3J7A1 5IWAJ 3MAQA 4AE5A 3RRGA 2GVDB 4C8LA 3OTOJ 5F0WA 3UCUP 1K1SA 4CI0B 2R4FA 3MM7B 2ZHAA 2ZDPA 3ZO7A 2DHGA 2PO4A 3DYAA 2XMKA 5KFPA 4A8QA 1I51B 4NZ7A 4XO0A 1WI8A 5IWAF 2QYCA 1LW0B 3NBPB 5L1JA 3JAMU 5KFAA 1YQHA 2UV8G 4CLZA 1CBKA 2R8JA 3EPIA 4OZ1A 4X64F 3D54A 5KFXA 2HFNA 3NWRA 2DVIA 3AD9C 4DPTA 1U1PA 1TMMA 4CLPA 4TKTA 4BS2A 2AJ0A 3NNCA 3FRYA 4YR2A 2E1CA 2RT3A 3TQEA 3SMZA 1P9YA 4RO0A 4TN2A 1U6BA 1NSPA 2HNZB 4DUYJ 1EKRA 2P9GA 3IC1A 1DRZA 1GTEA 1MWQA 4OZLA 1S6UA 4WPAA 1YJ9S 3GFYA 4ECRA 3GG0A 4M1KA 1U45A 3QGHA 2CQDA 3ONQA 4MKYA 1H73A 3CD6S 3TZZA 2EK1A 1RCXB 5JVHQ 5A76A 4OHVA 1WJ9A 3UN3A 3D28A 4ZVEA 1S0NA 3I55S 3C6UA 1FWKA 1VK3A 3K89A 1NDKA 5KFMA 2EWHA 2RU9A 2KDOA 1LWCB 3V5RA 1U0HA 3V4IA 1QVGR 3Q23A 3MMAA 4P74A 3C2PA 1WHYA 3D1HA 5J1EB 2CZ4A 4ED8A 5IC6B 3BJYA 3I6PA 1PYTA 3ISNC 1JJCB 3W2VB 2QA1A 5FJ4A 1DTQB 2AX1A 2NZ4A 2L9DA 3JB9k 3H2LA 2LDYA 2ROPA 3NOCA 1SL2A 3KHGA 1UFLA 3C19A 3DRYA 2BM1A 4J9VA 1FESA 1HQEA 2DO0A 2KYXA 4G65A 2DCUB 1FNXH 3GV7B 2KHCA 3P45B 3HDSA 2PEHA 2WRMA 2EW9A 2ZOMA 5HP1A 4X65J 2ZVIA 3Q8SB 2E9TA 4ZN1A 2HURA 2R7UA 2AYMA 3ZXWA 4LRCA 4ECWA 1LWEA 1TL3B 4C97A 4CTAB 1S12A 3CDBA 4PYAA 3U1NA 3UN5A 3AXMA 3X3UA 3CCMS 4F04B 1S48A 1EETA 2HQ3A 3DGPA 4B3TJ 1YRXA 1IKXA 3LA0A 4F67A 4WXOA 1WTBA 1KN6A 2XNQA 4ELTA 2HS3A 2DNNA 4WFBQ 1VFJA 1R8CA 3Q8YA 5H9FJ 1S4EA 3EYZA 2L9WA 4B3TF 1XC9A 4P2XA 4IOCQ 2XGPA 2QEXS 3QT5A 3MTKA 4Q2LA 1IBMF 4J9LA 5J1NA 3T1HJ 2MKCA 4X4UA 4OI3A 1T95A 4LQ3A 5K14A 4DN9A 1RWMB 5HVFA 3A8EA 2MJUA 5DDRC 1NJZA 1FJ7A 3S8SA 1FT8A 5HROA 2POKA 4MJKA 5KFIA 3UQSA 2C1EB 5SZTA 3T1HF 2H3EB 4LUBA 2QJ3A 4Z37A 2VF3A 4FYDA 2BJ3A 5E2QA 4OIXA 2X7IA 2EEYA 1OY9A 3PX0A 3K8VA 3H0PA 4PWWA 1HA1A 1HNVB 4ED1A 4F0HA 3ZZPA 1HPZB 3EGVA 4GC7A 1SJQA 1P6TA 3QIPA 1HD0A 1Q1KA 2JJ4D 2IAJA 2AYBA 2OD6A 3PKMA 4EFAC 1YSJA 2CQ4A 4I2QA 1PG5B 4ZS6A 3M32B 4ZJOA 2EFVA 2XQCA 3THVA 2DT9A 4C9DA 3E2EA 2AJQA 4ED7A 3NCQA 5A6PA 5DJBA 1K0VA 4N76A 1YJWS 4L3NA 3DCAA 5D4OA 3W9HA 3QAUA 2PD1A 3IS9B 5HLFA 5EDWA 2Z30B 2ZC4A 4C8ZA 4LIWA 1NJIT 2HWHA 1FK9B 2AWZA 3PJ9A 3RTVA 2IA0A 1WC0A 1RT1B 2B4OA 2EFNA 3CDWA 4WWSA 4C3MA 2DGTA 4I56A 2JOQA 2LEBA 4BC7A 2MEWA 1U1KA 4Z7YA 3MFIA 1R6YA 5CYMA 1B4SA 5K5MA 2V67A 2XBPA 4FNHA 2DNRA 1HL6A 3CVKA 2W4CA 1VR6A 2W8LA 4JI7J 3JSMB 1ZPVA 2ZH4A 3PTWA 4RWXA 2MKIA 2XYGB 2OTJS 3T5HA 4FPIA 4WXWA 2XNRA 2RVJA 4J37A 3CJ3A 5GAHU 3Q8QB 5EGYA 1OIAA 3KLFB 2Y9HA 4Y2KA 1KVIA 1PC5A 4PAAA 2VBWA 4L3KA 4ZCMA 2HFSA 5HMYA 3QNWB 1VRTA 1HBUA 3HX9A 2CJKA 2LCWA 4A4JA 1VISA 1HBNB 4P7TA 1TV6B 1C1CB 3HD1A 3IWXA 2W2MP 1NPRA 2JNJA 2XMJA 5E5NA 1YKWA 4KBIA 3ITHA 4PUOA 1HBOA 4DL3A 1F0XA 4K0KF 3QGPA 3OVSA 4N41A 4LF9J 1QUVA 2XSFA 1VIOA 1UA0A 3HHEA 5AE1A 1TKXA 2V63A 4DSIA 3QRQA 2CA9A 2BUNA 4I2PB 4TY8A 3A13A 4WZQA 1KVJA 4QCLA 2E1RA 7FDRA 1PKUA 3N01A 2OAUA 5KAKA 1S1VB 4O3NA 2GS8A 2RKIA 4OI0A 5I42B 1M5KC 2GO9A 4RLEA 3ZZOA 1AW0A 4F50A 4USWA 2D69A 4C0HA 4J9QA 3FJ2A 1G4CA 2C2ZB 5L8RC 2WVEA 5M2UA 1HNXF 1ZAWA 3KJNB 4Q0BB 4USIA 1SXLA 1IKVB 2MLYA 3PJWA 1WKJA 3CCJS 1FDAA 3PYGA 3P6YC 3BSNA 3B8HA 1EHWA 3HLUA 5L1LA 1X4AA 1WC3A 2BR0A 2DNGA 4P71A 2CPFA 2OIHA 4HHUA 5KFTA 1YBAA 1UFWA 3FK4A 4HH1A 3DDIA 3UR3C 1S1WA 2UP1A 1QY7A 1FNOA 2E5GA 5J2PA 2DR7A 3T5LA 1PC4A 4WFNQ 1GX6A 1A9NB 3KK3A 2KU7A 3E3XA 2APOA 3RR8A 1L3UA 2NUHA 2OPQA 2Z2YB 4OX9J 2YH0A 2C2OB 3DFEA 2MHNA 3KLGB 1OPZA 3RBZA 3W8GA 4V1Ak 1VGYA 2MSTA 3NG8A 2A6MA 3VAKA 4NWBA 1FXDA 2DITA 2CNOB 3IAS9 1JWWA 1MG7A 3J7ZT 4OX9F 2DPIA 4ATNA 4O0IA 4M5MA 3R3TA 1T05A 4I7FB 3DRPA 4J90A 3D67A 2AGPA 1LW2A 4DL6A 4E2FB 2HRTA 2RIJA 2BX6A 4ZKAA 4OJGA 4KGZB 4PXCA 4EYHB 2LA6A 1GH8A 4P72A 4URGA 3N6NA 4B3OB 4C8KA 1LXNA 4IR9A 2HNDA 3KK1B 4KGMA 3M9NB 2BQ3A 3Q8VA 2OPRB 1SKWA 1N6QB 3KLHB 3P49B 1ZS6A 1ZM2A 5D0RA 3KG1A 4TNOA 1RT7B 1SUQB 2EPIA 3I56S 1F9EB 3CDAA 2NSCA 3OJSA 3U02A 4X4RA 4CLKA 4DQSA 1U2RA 4FBUA 3IM9A 3IWNC 1IR2A 4JI4J 4KV8B 2HW3A 3ENVA 4NI2A 1OJ4A 5CHCB 3V6JA 3DKDA 2D9PA 1R8BA 4ID5A 2MZ1A 5KFOA 1ULRA 4CYUB 4NA3A 4USJC 3M8PB 1NZAA 1JLQA 1UW4A 3DHWC 5KFGA 4FN5A 1HNIB 4XDCA 2DR8A 4O3PA 2JRSA 4CWBA 4WJBA 4FP9A 3FZBA 2CQIA 3DLEB 1S6PB 1QTMA 1G1XA 1ZTWA 2EC2A 1RT4A 2VG5B 3TJ9A 1GTHA 1CS4A 3RB0A 5MLCV 3W62A 4L74A 2H1YA 3N6LA 3W1YC 4USUA 4IQXA 4NASA 1F5CA 2E1PA 1TR0A 2JSXA 5M2RA 2QLWA 3E8OA 3M6XA 1LQ9A 1C0TA 2J7WA 3NGKA 4TLQA 1TU0B 1N5TA 4DL4A 4U8YA 2BE7D 2ALYB 3CCSS 3KXDA 4U9RA 1O6XA 2X1BA 3CC2S 3DLLQ 2AX0A 3I9ZA 1S4FA 2MXYA 3HSGA 3SZ2A 4CNYA 1X4EA 5CYJA 1TKZB 4R0JA 1IQTA 3ZZTA 2ASYA 2ZWPA 1GQEA 5C24A 1U6ZA 4FYWB 9RUBA 4IDKA 4RPFA 5CD4H 2MZTA 1MROB 4FF4A 1YJNS 4K4YA 2MZJA 4M5NA 3F56A 1UCNA 2CG4A 1MNEA 4CO3A 1WHXA 3CSKA 4DEZA 1IR0A 4CIOA 3D4JA 3GTYX 1RK8A 1TZ0A 2HHQA 4IFVB 2RDJA 4DU7A 3DYAB 1KONA 1X4CA 4Z2XA 1TAQA 3ET6A 4V19X 4M94A 1Q82T 3B4DA 5KG0A 5F3ZA 4C4WA 4DFPA 5IFMA 3KHRA 3PDNA 3LP0A 4DLGA 4ED2A 4X4QA 1ZA1B 1W2BR 3BH7B 4OI4A 4OFZA 2HGLA 3I87A 4LSNA 4Y2MA 4DSEA 3GLJA 2AV5A 4NEZA 2IM1A 1RHMB 1EQ0A 4A8FA 4OYWA 3FBCA 2I9SA 1QTNB 3GYXB 3CJ8A 3EVOA 5A8WB 5AJ3F 1UWBA 1X8DA 1BC6A 4FF3A 2YKPA 4RWWA 3HM9A 4QIFA 3J81j 1LK7A 4Q45A 1VQ7S 2UXDF 3OT9A 4NA2A 1MN7A 2F65A 2V8PA 2QN6B 1NPPA 3MM5A 2PMWA 2MQQA 1SJRA 3C6UB 1SVDA 2RH3A 2OFGX 4B9NA 5SUHA 2O01C 5C5JA 1DURA 3MPDA 1FJEB 3V4IB 4K5SA 3LGNA 3EPGA 1IWAA 3MMAB 4FYXB 3PHEA 2E9ZA 2HHVA 1EJ7L 1CC7A 1SI9A 5GMDA 3NCPA 2V94A 3I4HX 1X4HA 5HSPA 4DU8A 1F2GA 5KFJA 2V50A 4L76A 2X1GA 4KAIA 3QZ8A 5BJRA 3JQKA 4ZP8A 4CDIA 4F0MA 1HQEB 3CDEA 1RQ0A 3L09A 3EZ5A 1T9YA 2Z2ZA 1LFPA 3BN4A 3N6MA 2VC1A 1WELA 2GV1A 5HP1B 3CCRS 2V4RA 3AOAA 4IRKA 4IH7A 2RRNA 4OYXA 2V0NA 3MR3A 3KJVA 2FHJD 4W4MA 3MMJA 4KC5A 2HGNA 1LWEB 1NB7A 2NSBA 2A1BA 4J91A 2NPIA 4WCEQ 4JV5J 1SJ1A 2HVDA 2CVEA 3QSIA 3CE8A 3NCRA 4OX6A 1EETB 2RF2A 1DJ0A 2VJVA 5IZHA 2NZCA 1NPKA 1IKXB 2MQ8A 2FY1A 4QPTA 2GJ2A 3Q8PB 4P7VA 1GX5A 2C28A 3HD2A 5HMXA 1HWUA 3GR1A 5GADU 4DPXA 4HTIA 3A3PB 1AYEA 4DV3F 2BA9A 2C3UA 4DL2A 4UF4A 3HFZB 3FFIA 2LKZA 3CTRA 4LF7J 3TVYA 2QA2A 4J9UE 3WX4A 1ZAVA 2D3UA 1TELA 2A3JA 2GIFA 2HYIB 3A12A 1Z1ZA 5K14B 2HVZA 3DXSX 1FWPA 2V34A 2VFTA 2HVIA 1Y4ZB 3A4TA 1S0OA 4LF7F 4OYBA 5EWFA 4ZLNA 3EVWA 4J9OA 5HROB 1HQUA 3OHAA 2CQ2A 4DCJB 1TUGB 3TUPA 1RYSA 4HACA 3BDEA 1HWIA 1N5YA 2DEIA 3V6KA 1F1BB 4MT1A 3NMRA 1CEZA 4H4OA 4UOGA 3R7NB 2I38A 2AF6A 4QR1A 3FEZA 1S5ZA 3P8BB 3MOJB 1YIJS 2DNZA 4NLDA 2FHKA 3QIPB 2MGZA 1LWXA 2ZBRA 5D15A 1UJ4A 2IAJB 1B64A 2MKHA 3DDKA 1RISA 4YHHF 2IFXA 1NSKL 3H42A 4MKAA 2BDPA 1C4AA 3ZZZA 1D9DA 2KH9A 2J6UA 3TP2A 4PKDB 1S10A 5C2CA 1FHTA 2LQ5A 1W2IA 1RBLA 5F0UA 3CCWA 4ECTA 4JI3F 3MMCA 2WHOA 2HFUA 5HLFB 4I0WA 1N5SA 1RKJA 2YKNA 3C8YA 2HQGA 5KG7A 1RA6A 3UR0A 2ZD1A 2F9DA 4X4VA 1T3NA 3DRRA 2EFOA 2HRUA 3BZQA 1VBYA 2N7YA 3HVWA 1NUEA 4FPRA 1SKRA 2H65B 4GVBA 2FLPA 2Z57B 2FPHX 1NJYA 3WC0A 5E3QA 2J0XA 5CYMB 1T9XA 3OTCA 2F40A 4C48A 2GQ2A 1ELOA 1KTQA 3W60A 2J7UA 3UNGC 2C2RA 5T14A 3G82A 2GMJA 4KPCA 1VJWA 5K9FA 3DLHA 4YMEA 3KLVA 3MAAA 1NHKL 2CAJA 3GU0A 2ZJRQ 1FWLA 1TL5A 4ZPWR 3K59A 1FX2A 4A8SA 1Q8KA 3MAHA 2J0SD 3GSDA 2YQ1A 4LF8J 1VRTB 4NOHA 1HBUB 2R3VA 3RBXA 5D0EA 4RBUA 1JKHA 1IWGA 2BOAA 3CF5Q 3BQ0A 3NGUA 2NR0A 2B51A 4NMXA 3N79A 3PVXA 2BBEA 4D3HA 3AB2B 3ITHB 4PUOB 1H6KX 2M4MA 1XMBA 4UQGA 4KQZA 2UVUA 1WHVA 4K2JA 2OFHX 1MN9A 2BKNA 2R7WA 2RQKA 2HNYA 1VLYA 4UT4A 3WZ0A 1TKXB 3O8WA 3T9ZA 1X60A 1NB2A 2NUUG 1XNQJ 4TY8B 1NK5A 4KH0B 2DGSA 4CM2A 4GO5X 1BXNA 2GNKA 2RKIB 3QT7A 2GIRA 1RAHB 5EWGA 2F4VF 2Q6BA 5KT7A 2V4JB 1RBOB 1SC6A 5D78A 2ZKUA 4X66F 4NLGA 5LSOA 3M05A 4ZVRB 3TVKA 1M5VC 5I3PA 3J7YI 1Q7LB 3CJ2A 1HMVA 4JI1F 1SH2A 3GYNA 2V8DA 2JFKA 3VALA 1R6VA 4Q43A 1RU2A 5BYRA 1J5EJ 3H5SA 3MHYA 4PPDA 1FRJA 3A3OB 3AT1B 2OI2A 2CFXA 3ETMA 4USHA 3R7BB 3G96A 4J9NA 5K8NA 2VA3A 4OZJA 5L9NA 3B78A 1NCLA 4G6VB 5DM7Q 2GHVC 2QLFB 3RR7A 1Q53A 1S1WB 1J5EF 2HHXA 3RBEA 3HFKA 4O3SA 2RUGA 5J2PB 3IN5A 4BC9A 1S0MA 5I3QA 4DSKA 5D0GA 3BGLA 1X5OA 3KK3B 1VBZA 1Q7YT 2ZHOA 2KHDA 3I82A 1P9QC 2O66A 2OPQB 3OFGA 3LP1A 1QAJA 4DN0A 3FKBA 1YZ7A 3D66A 5HQLA 3H40A 1UVIA 2AJ1A 4C6AA 3TUZC 2FHOB 2K1RA 2GGPA 1YHQS 9ATCB 1ZA2B 2H54B 3TQ1A 3NNAA 3J80Y 2CJXB 3B54A 3IG1B 1GAOA 4ZCIA 1T05B 3R5GA 2FYXA 5I3UA 5DQHA 1VHIA 3CJ0A 2WVCA 3HKWA 2VODA 3DRPB 1LW2B 1BQNA 1L3VA 1RU1A 1QM9A 4HLBA 3OSPA 4FF2A 4DCOB 1TP7A 3OD2A 4X4TA 1C1BA 4NCGA 5CYQA 2Q43A 1M1KT 1JK9B 3D0HE 3BEGB 2B9XA 2JEFA 2LQJA 2HNDB 1JLFA 1ZBTA 2ZE2A 2BM0A 3UDVA 3VZHA 3ZZ0A 2CPEA 2A2CA 5HJYA 1NEEA 2FUG9 1PCAA 4BWJA 2LEAA 5DG9A 5B0BA 2XZTB 4KGKA 1C0UA 4JYAJ 1SQEA 4DLEA 2MY8A 1OSDA 1OS5A 4QWCA 2G4BA 2XSJB 4YUDA 2IDEA 2KXHA 3M8SA 1KNZA 3BDPA 2CPHA 1X4DA 3TWZA 4ED4A 4NI2B 3OL8A 5EHHA 2MQOA 2W01A 4N77A 5LL6d 1FKOB 5ADZA 3VAGA 2MKKA 2AZ3A 4ER8A 4ID5B 2WZ1A 5B0DA 2VJUA 1UAWA 3L7PA 4ID8A 3IM8A 3KHLA 3BO2A 1JLQB 3NL0A 5LXYA 2NYHA 4ANDA 3LWMA 4HR2A 3IR7B 3CWJA 3HULA 4KRWA 4EUVA 3IP0A 3I0SA 3LP2A 4RUHA 2QRRA 2OHDA 2N3LA 2R7OA 5H9EJ 1KDNA 1JXVA 1RT4B 2C3YA 1IBLJ 3HO1A 2AYGA 3ZTSA 5AE3A 4C11A 1CS4B 1FVQA 4UQTA 1YJUA 2B5JA 4DFKA 4LIRA 2JX2A 3MURP 2ZOGA 1BWEA 4BBYA 5LJ5Y 4CLUA 5LMUF 2E5HA 2RSQA 3SQGA 1IBLF 4O44A 3AB4B 1NZ8A 3FBFA 5AXLA 3FQKA 5E3PA 1C0TB 3KYLA 2XB2D 3CPWR 1UL3A 2R7SA 1JJ2R 2HHWA 3OQ2A 3FSIA 1RYRA 1RUSA 4J9KA 4PG6A 1WI6A 3U27A 2QC3A 1F9FA 2GJFA 1JIHA 4LRFA 1RSCA 3TZYA 3CCLS 1APSA 1IBKJ 1R8HA 3TR5A 4K8RA 3PY8A 2AW0A 3VZIA 2G0IA 4IDKB 3BGRA 3W9JA 2MY7A 4NMLA 1RTJA 1X9MA 2VA2A 2JLEA 2R42A 2DY1A 4WKYA 2D41A 1VRUA 1WHWA 4TY9A 1MU2A 3M2VA 4NPOA 4UOHA 1BD6A 4B08A 1Q8IA 2VZ9A 2ZBQA 2BANA 5F8LA 1U24A 3ET6B 4WTOB 5EX3A 1BLUA 2CPZA 4FZVA 3G71S 2WSCC 2VFSA 2C2DA 2PEBA 4YB1P 4PABA 3LP0B 4DV0J 1X4FA 2O67A 2DY9A 2Y1JA 2HAFA 1VQLS 4LF6J 4DR6J 4LSNB 4F4KA 3GV5B 2IA6A 5D3GB 1FD8A 3PW2A 2J6TA 3HT0A 2B8QA 1FFSB 1UW9A 3QWUA 3M6WA 4U95A 1VQSA 3OTDA 1YJTA 2FJWA 3S7RA 2G2ZA 1HNZJ 2HMIA 4DX7A 4LF6F 4DR6F 1UWBB 4F4ZA 3DLKA 1VBXA 1RWXB 2PFFB 2EFQA 3GILA 2B9YA 1NBEB 1TK5A 4Z7CA 1FRKA 5ITHA 1OPIA 4TQSA 2V8GA 3FCWA 4C0BA 1FRLA 1NDLA 1QSYA 1HNZF 3S01A 4YP3A 1TTHB 6AT1B 3MPVA 1QD1A 1HBMA 3FCVA 3D6TB 3GG1A 3D1QA 2JC1A 2WSFC 1R3NA 2SXLA 4NXNJ 4GRSA 2W9BA 3MCSA 1Z4UA 2L3MA 4GKKJ 4ZJLA 4B17A 1MMDA 3ZZYA 2E1MC 4NRUA 1X5PA 1UEKA 4F02A 1IJFB 3BPSP 4DR2F 4OHXA 3T5JA 1O5JA 4JV1A 3CCTA 4GO7X 3D3CJ 3KOAA 1RLCL 1MMNA 2VQEJ 5K8PA 4DV6J 5ETNA 4TU9A 3FCHA 1KLMA 1WF1A 1XR6A 3AODA 2ATCB 3C3LA 1AZSA 3KJVB 2A10A 4KH1B 3RRHA 1K44A 4ECQA 1CULA 2V5HG 2GFFA 3I5BA 3NAIA 2VQEF 1FO1A 4DV6F 4ZLJA 1T94A 4ZVSB 3PRBA 4ALZA 2WSEC 1KHVA 2PI4A 1NO8A 1U1LA 4EBDA 2H4YB 4QYRA 3ENAA 3CC4S 3T19A 1YI2S 2HFOA 5L1KA 2RF2B 1X4GA 1O0PA 2PN6A 5FLXU 1N56A 4UUWA 1WDDA 1FERA 5HK4A 3JTNA 3CJQA 3TUJC 1T9UA 3O44A 4I6AA 3QGIA 1URRA 4WIQA 4Y0FA 2F5GA 3BBBA 1R0AA 3FFIB 3UWTA 4MIWA 1NMEB 1FDNA 3I0RA 2LDIA 2K3KA 5K8MA 1XIQA 5IOLA 3IGNA 3CJRA 3CEDA 2QA4S 3UDCA 1C2PA 1S1XA 4KIAA 4M5JA 3R2DJ 1OO0B 1UWAA 2B4PA 3Q2SC 4LF2A 3UD4P 2VBXA 2CZ9A 2B6AA 5KFQA 4M63A 1HQUB 4ELUA 3FZ2A 3AQPA 2DH9A 2VBYA 4FF1A 4DBQA 3P4UB 3WBZA 1FRXA 4CLWA 3W64A 4HACB 4ES3A 4RX6A 4LFBJ 3CJ4A 4AYBD 1N5YB 3VVTA 4Y00A 4KO0A 1RKIA 2QFIA 1P1TA 4H4OB 4J9RA 4LF1A 1KD1T 1E6VA 2ZBCA 1VMBA 3MECA 4NX9A 2MGZB 3QPIA 2NLWA 2V68A 4M5HA 1IBCB 3KWMA 3HCXA 5KFKA 2Z56B 5F9LA 3BGFA 5F8JA 3MM8A 3F0NA 1QJHA 4WFZA 3EUNA 1WG5A 2JH3A 2H4WB 1RAEB 4I6YA 2RDIA 4EZ9A 4G1QA 1ACMB 4F2RA 3MGJA 3MMCB 1F5BA 1WWHA 3NGRA 2YKNB 3NNHA 4B9TA 4K4WA 2ZD1B 3W5XA 2YWKA 3DRRB 1IKWA 1FKPA 3D5MA 3LTOA 1RAOA 4GVBB 1PAUB 2ASJA 4ZIWA 3JTOA 4KHMA 2J8AA 1JX4A 3NAHA 4LSLA 2QE5A 1YJVA 2VIHA 1UMJA 3NY0A 2B8PA 1JB0C 2FB0A 1TAUA 4MMOA 1KLNA 3G82B 3VQTA 4WF9Q 1K0TA 2EK6A 3C6TB 1KQSR 4K5RA 2N7CA 2XI3A 2CQBA 2CQ1A 3IGVA 4ZVUB 1D3WA 2GMHA 3H8YA 5ETSA 1WTFA 2DHHA 2OEMA 3MAAB 2BV3A 2FIUA 5KFUA 3CMQA 2WK4A 2FJDB 3Q83A 2GQCA 1TK0A 1UJ6A 1W25A 1XERA 1T03A 3HHLA 2KYZA 3G2XA 3W5YA 2OH2A 2K3IA 5IV3A 4C7QA 3SDEA 2R2SA 2AKWB 2KG0A 2PT0A 2HRYA 2V9KA 1JKHB 4XDDA 3AD7C 3CCZA 3W9IA 4CLTA 1NLKL 2UUAJ 5L1IA 2LMIA 2M52A 2OPPB 2XI2A 4DR3J 2VH7A 4MK7A 2VL1A 1BE4A 4ZK7M 3ILIA 2CJQA 2XHWA 4LR9A 1E6YA 3OTEA 1TFWA 2J6SA 2H5IB 5LSRA 3PCOB 3NGTA 2B4UA 2XY7A 4F3QA 4WP8A 1FA0A 3BO3A 4USTA 4F4XA 3QSYB 1VI7A 5CCLA 3UD5A 3PZPA 3W5ZA 1ICEB 4OQJA 1ZH5A 4J7CA 1TL1A 4L75A 4CO4A 1NXIA 4A48A 5FDLA 3M1VA 1WKKA 2GIQA 4DR7F 1R31A 1TL7A 1N33J 1QAIA 3N5BA 4W98A 4ZOSA 1WOOA 1L3SA 5FIIA 1HMVB 1XQIA 5GAHI 2VQFJ 3PEHA 3DU5A 5FD1A 1N33F 1KQKA 4ED6A 4CO5A 2MQNA 4ZCLA 2B0GA 1IM6A 3SV4A 4BLGA 5HMWA 4RU2A 2E1AA 1HLWA 4O4RA 4Y2AA 1I1GA 1N32J 3IA0A 4NEYA 5K20B 2VQFF 4DG1A 3OVAA 2XWYA 1AFJA 4ZVOB 1S9EA 3JSBA 1U4BA 1GXLA 1LWFA 1ITPA 1K8AT 4KKOA 2AYEA 3LP1B 5AT1B 3GR0A 1EKSA 2RD5C 3W7BA 4RW7A 1CSJA 4P52A 1JLBA 1H2TZ 2MJNA 3OTBA 1BHNA 5A8KA 4DV7F 4X62F 2K1RB 2GGPB 2V8VA 1DQ9A 3K0JA 4Y6IA 5MAOA 2B56A 3I96A 3TUIC 4NYZA 5IT4A 5E3CA 3CJTA 5CAAA 1HR0F 4FDFA 1WC5A 4EK2A 5I3UB 4UW2A 2CQ3A 1BQNB 2P5VA 3C15A 4N7TA 2FDNA 4B3SJ 2YQ3A 3LOUA 1I6JA 2NXJA 3I5AA 2F8MA 2IIHA 4F3MA 5GAGU 4KFBA 5KFWA 1BQMA 1D8YA 3CO9A 1VQYA 4X64J 3D6MB 2IY5B 1FDDA 2V2VA 1C1BB 4NCGB 2CPIA 5F8GA 2Y0SD 2OP5A 5KFLA 1RAJA 2ZH8A 1JLFB 2E66A 2ZE2B 3QATA 4B3SF 4FVCA 1JXEA 2I2YA 2GVZA 2DHAA 2CJ9A 3UVJA 1F9HA 1RWUA 1QDUB 2XS7A 3O6QA 1NJXA 4ZPVR 1C0UB 1W7WA 3GCXP 3HI9A 2VU5A 3FRZA 3VGVA 4ZMMA 1GFWB 4XPCA 3TEHB 2UXBJ 3JYTA 3MEDA 4PG5A 3BF4A 3T1YJ 1VQ8S 4LRAA 2MDAA 2PGCA 4IRCA 4DMZA 3PIPQ 4QR2A 2Z0GA 4QWDA 4DDFA 3SSQA 3THPA 2IM3A 2UXBF 3R97A 3KLIA 4PQUA 2MLXA 3T1YF 1YLXA 3BSOA 2HAIA 4NLSA 1H2VZ 1IM4A 2AEMA 3RW6A 1DLOA 4B02A 3MEGA 1X5SA 4P9SA 2VFVA 2ZOFA 4QYZK 4KHRA 2HGMA 2CXEA 2EVZA 3I0SB 1K1QA 3BGOP 3LP2B 2QL9B 1VBKA 4UY85 5GAEU 3OW2R 2BRKA 1PJ5A 2HEKA 2G1HA 2W2PP 2W2QP 4KTQA 5HQMA 4C11B 2FVCA 2MQPA 2B5JB 1MW7A 3EICA 4ZPDA 2VPWB 2VUGA 1OY8A 3GYGA 3DOLA 3GV8B 2YNGA 5JVGQ 3EZOA 2LA4A 1K73T 4DPWA 3SQGB 1CJKA 4OJ1A 4O44B 1R0CB 5B0AA 3O5TB 1JMTA 3J80U 3Q89A 1QE1B 2XMUA 3J81Y 7AT1B 3G8QA 3PV8A 1RWWB 2GMLA 2CIMA 2IDLA 4E8UA 1FVSA 3AJDA 1N5QA 4ECUA 4ZN3A 3EJMA 3T5KA 2ATLA 4B9VA 4ES2A 1AT1B 1UKUA 4DJBA 3PRVA 3CDUA 1G3OA 3D1OA 1WEZA 2NXCA 3HSJA 1UEUA 4PWUA 5DS7A 1SJ4P 2CRLA 4YY3F 1YJRA 3QLHA 2ZJQQ 2CVIA 1K9MT 3P3DA 6FDRA 4OLPA 2GX8A 2QSFA 3LW5C 1A0OB 1XK8A 3BGRB 3PM9A 3VV2B 4PEOA 2VPZB 2KZMA 3CO0P 1RTJB 2FGCA 3JQJA 1L5UA 2G2OA 1IBMJ 1VRUB 2J0WA 4OZ2A 2N4DA 2GAGC 3DRSA 2BANB 1XJWB 2HBQB 2QL5B 3TOQA 5CZXA 3M8ZA 5F8NA 5G0RA 3CXCR 3FQLA 4TYBA 1X31C 1NK7A 2DJWA 2PMZD 4HHJA 3R5BA 4F25A 1VYAA 4NLWA 1NRKA 2M2BA 1M5OC 1RT6A 3GFZA 4GMKA 1KRPA 4JI8J 3DU6A 2JEGA 2BJDA 1TQLA 3L95X 2BJ9A 4QWBA 1W26A 2MMYA 2C2EA 2QYGA 3RGIA 4U6PA 3GIJA 3DHXA 5ETVA 1UZDA 1X9SA 4JI8F 1YBTA 3KUHA 1QSLA 1S59A 1H0HB 4ILMA
chains in the Genus database with same CATH topology
1NKEA 2IC3A 2HMIB 1NJYA 2WBRA 2ZVSA 3WC0A 1FCAA 2DBBA 3DLKB 2J0XA 2L48A 3OR2A 5E3QA 5D6GA 3KTQA 3UD3P 3DMJB 5CYMB 4QPXA 2QIFA 3GWCA 3OTCA 4EO8A 2CQGA 2F40A 2VASA 5IXUA 1NK6A 1O51A 2GQ2A 2UXCF 1ELOA 1KTQA 2XMWA 3P96A 3OUYA 2IM0A 3GQCA 2QT7A 4WIIA 2J7UA 3UNGC 2C2RA 4OZNA 3DXBA 5T14A 2KVIA 4I68A 3SCIE 1G2EA 2UUAF 2GMJA 2WB1D 2UU9F 2ZC3A 3H2VE 5IT9Y 4A8WA 4WE1A 2QV6A 2ZFHA 1Y5LB 2M8HA 4Y34A 3OSNA 3MPYA 2HHTA 2Z2MA 1VJWA 1SV5A 4DR3F 5K9FA 2MKSA 2QA4G 4MKBA 1HBMB 4MAKA 5K8OA 4P2SA 3CCVS 3DLHA 2YX7A 4YMEA 4IH6A 3KLVA 3SXLA 4DQRA 5DM6Q 4Y2CA 3K57A 1N0UA 2J9EA 1Q86T 3F41A 3H4DA 4GKJF 4WKRA 2ZJRQ 2E5LF 2QLXA 2HLUA 4NYPA 1S9EB 2GHWA 1TL5A 5AXMA 5KFYA 4ZPWR 2QFJA 3HVTA 3HZGA 3K59A 1CPZA 2IMOA 5HQ8A 4LVOP 1KEKA 2MZQA 3M8PA 3E01B 2ADBA 4A8SA 1N0VC 4C3KA 2XCAA 5KFZA 3KLEA 3LGMA 4Y65A 4Q5VA 4PG7A 2DK2A 4NLPA 3MAHA 2J0SD 3GSDA 2W9BB 3M6VA 3JSYA 2XCPA 3DDNA 2LXFA 4NYOA 2LECA 1HNIA 2KT2A 5IQQA 2I1RA 1IN0A 3Q24A 3BB5A 3M6UA 3RAQA 1D8ZA 3LALA 1VRTB 4NOHA 1HBUB 4RW7B 2CJBA 4RBUA 1IQZA 1JKHA 3G86A 4B3MF 5F3TA 1ZZNA 4EWTA 3ZZUA 4U7CA 4AUKA 3CF5Q 3BQ0A 1VQNS 1MMLA 2H9ZA 3DLEA 4ITSA 1TUVA 3T6JA 4AFFA 5KFDA 5KG5A 1S6PA 1U7LA 2J7KA 3FGVA 3SCKE 3K5PA 1VOMA 2NR0A 3LH2S 2VG5A 4RNFA 4OHWA 5B0GA 2ZDOA 4CH7A 2B51A 2FVRA 1RI7A 2HS0A 4XPEA 4ED0A 2XG8A 3N79A 3PVXA 1T8EA 2BBEA 2L41A 3OR1A 4D3HA 2DGQA 4IG3B 4KE5A 4R8UB 3AB2B 3ITHB 3I31A 4YB5A 4FS2A 4PUOB 4OL8A 1H6KX 5A0YA 2M4MA 1XMBA 4DF8A 5D77A 5IS2A 4UQGA 4KQZA 2UVUA 3M9MB 2BACA 1WHVA 3AJ2A 4WYLA 3RZAA 3K5LA 5J2NA 2X1FA 5D4PA 2HZCA 1QVFR 5DDQC 1KLMB 5D4LA 2DH7A 2PI5A 2OFHX 3A1YG 1M90T 1I94F 2R8IA 3I32A 5KT5A 2QO3A 2R7WA 2LU1A 5G4DA 1NAQA 2RQKA 1S6QB 2HNYA 1VLYA 1RTIA 3WZ0A 2DISA 3CB4A 4JBCA 2DR5A 4LVNP 1KHWA 1TKXB 2JVOA 3O8WA 2KXFA 3VAFA 3OFHA 3EZUA 3T9ZA 1BQMB 2GC8A 3H4BA 3HK2A 2R7RA 5E0OA 3MM5B 4DV5F 3KG4A 2HHUA 3MZIA 3KK2A 2X51A 2KRRA 2DO4A 2ERRA 2KJWA 2NUUG 3K58A 2UVRA 2ROGA 4TY8B 4UOCA 2DH8A 3HF5A 3I5CA 4H4KA 2Z8QA 1NK5A 1FJGF 1AROP 2D7SA 2UV8A 2FHJA 3O1LA 3R5DA 2DGSA 1R8AA 3K2YA 3QJPA 4YR0A 3H5XA 5F8IA 3PIOQ 4GO5X 2F9JA 1IKYA 1HI0P 2DGUA 2JHEA 3KMQA 1N32F 2GNKA 2RKIB 4MYUA 3LO3A 2GIRA 4TU8A 3DM2A 2WW8A 2WONB 3PX4A 4MK9A 2GCFA 5D4NA 1YGYA 2E44A 4BWMA 3OXGA 3BM7A 5EWGA 2XY5A 5DGBA 1NK0A 1M5HA 3M30B 4GC6A 2BXJA 4ZCKA 5D3GA 2F4VF 2VOOA 3P5TL 2D9OA 1URNA 2DD8S 3CIZA 1RT3B 2Q6BA 4C4WA 2ZH9A 4ICLB 1SIWB 5A8RA 1NH7A 2V4QA 5KT7A 2V4JB 2LEPA 5GAGI 1TL4A 1Y9OA 4L6V3 5BR8F 4H4MA 1VQOS 1SC6A 2M8DB 5D78A 4U67Q 4CH1A 2ZKUA 4X66F 2AU0A 4NLGA 3H2UB 5LSOA 2C3MA 3M05A 1CLFA 2YX1A 1MROA 3TVKA 4K4ZA 1M5VC 5I3PA 1XEZA 3J7YI 3QJLA 5EX0A 5B09A 4MIAA 1Q7LB 3CJ2A 1HMVA 4LT6A 2WB4A 5CZVA 5J2MB 1SH2A 1R0AB 3GYNA 2V8DA 4JI1F 2JFKA 1NHUA 3J7A1 3VALA 3MAQA 4AE5A 3I0RB 4YQWA 3RRGA 4Q43A 1VC6A 3LF0A 5BYRA 4C8OA 3H5SA 3MHYA 2YNIA 4PPDA 1FRJA 4C8LA 2GA7A 4OJHA 1S0VA 5F0WA 3UCUP 1K1SA 2RS8A 2CFXA 4USHA 1SH0A 3G96A 5HBMA 4CI0B 4I4BA 2R4FA 3MM7B 2ZHAA 2NREA 3O3LA 2CYYA 4J9NA 5KG3A 3VTIA 3HJFA 1HYSB 5B0FA 2ZDPA 5K8NA 2VA3A 1WG1A 1S1XB 2VKZG 4OZJA 3HHNB 2DHGA 2PO4A 5L9NA 1S76D 3DYAA 2XMKA 2OPSA 5KFPA 4A8QA 2RS2A 4NZ7A 4XO0A 1WI8A 3B78A 3ZZRA 2QYCA 4G6VB 5IWAF 5DM7Q 2GHVC 3RR7A 2HFZA 1S9FA 2OJ3A 3IRXA 1Q53A 1S1WB 2B6AB 4FVMA 1J5EF 1TKTB 3RBEA 3HFKA 4O3SA 3Q22A 5AXNA 5LJ3Y 2HHXA 2BABA 1LW0B 2RUGA 3NBPB 5J2PB 1XR7A 5L1JA 5KFAA 3MFHA 2D74B 1HARA 3BR8A 1DTTA 1YQHA 4BC9A 3IN5A 1N8RT 2UV8G 2JZ5A 3RB6A 5I3QA 1S0MA 4DSKA 4O4GA 4NLVA 2R8JA 3EPIA 3BGLA 2ZH7A 1X5OA 3KK3B 3C46A 3CULA 4OZ1A 3PR4A 5D8HB 4X64F 1VBZA 1N88A 2J0QD 1Z2ZA 2CZVC 1Q7YT 3D54A 5KFXA 2HFNA 2ZHOA 2KHDA 3VR1A 3I82A 1P9QC 3LWLA 2O66A 2DVIA 1WD6A 2OPQB 2Q1LA 1U1PA 2XMTA 2IM2A 3OFGA 4NLOA 4QW9A 3TAPA 4G3IA 3LP1A 4KO0B 4TKTA 3CD0A 3POTA 2BYCA 4BS2A 2AJ0A 3V81A 2B7BB 3FRYA 2BQUA 1QAJA 4YR2A 4DN0A 1UA1A 3NNCA 2E1CA 2RT3A 2GO8A 2RU3A 3SMZA 1NK8A 4E98A 1E6VB 3H40A 1UVIA 1QLNA 3MOZA 2AJ1A 3MECB 4TN2A 1U6BA 2HNZB 3TUZC 1UEVA 3MMBA 2FHOB 4N5SA 3LANA 2K1RA 2P9GA 2GGPA 3IC1A 1YHQS 1DRZA 4IOBA 1GTEA 1HI8A 4F26A 5JUMA 4IG0A 3VQSA 4OZLA 5IQ6A 1S6UA 3U1LA 1YJ9S 4MIBA 2FJEB 2W7AA 3TQ1A 1FTCA 3GFYA 4KB7A 3NGDA 3J80Y 3NNAA 4ECRA 1B7FA 3IG1B 2YWFA 1GAOA 4ZCIA 1T05B 1M5PC 3NWGA 3MM8B 1UVKA 3GG0A 5I3UA 5DQHA 3CT9A 3PNIA 4ES1A 3CJ0A 4M1KA 5GAEI 3HKWA 1U45A 2VONA 2VODA 3DRPB 3QGHA 2CQDA 3PXGa 2B3TB 3ONQA 1LW2B 1BQNA 1L3VA 4MKYA 1HW8A 2OLWA 4EGLA 1QM9A 4TXSA 1Q16B 5KG1A 3EGZA 3CD6S 2EK1A 2R7TA 4HLBA 5KFEA 3SI8A 3OSPA 4ED5A 4OX7A 5JVHQ 4FF2A 4YOEA 2PMHA 4OHVA 1X0FA 4G1QB 1TP7A 2DB1A 2G9OA 3D28A 4ZVEA 2DNKA 3K5MA 2HPUA 1S0NA 4X4TA 3GIIA 5GADI 1C1BA 4NCGA 4XK8C 5CYQA 2Q43A 3I55S 2ZH3A 1M1KT 3C6UA 1JK9B 3D0HE 3BEGB 2B9XA 4OMFG 1VK3A 3FNNA 2JEFA 1GT8A 2LQJA 2HNDB 1JLFA 1ZBTA