The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
102
|
structure length |
102
|
Chain Sequence |
MDISIISDRNNPLLQRREIKFTVSFDAATPSIKDVKMKLVAVLNANKQVLVVDTLDQIFGKLEAEGYAKIYNDEKAMATIETKSVLEKNKIEEEAEAEVAEE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution Structure of Methanococcus maripaludis Protein MMP0443: The Northeast Structural Genomics Consortium Target MrR16
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Methanococcus maripaludis
|
| molecule keywords |
30S ribosomal protein S24e
|
| total genus |
17
|
| structure length |
102
|
| sequence length |
102
|
| ec nomenclature | |
| pdb deposition date | 2005-02-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01282 | Ribosomal_S24e | Ribosomal protein S24e |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |
