3HJVA

1.7 angstrom resolution crystal structure of an acyl carrier protein s-malonyltransferase from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
307
structure length
306
Chain Sequence
b'MSKFAIVFPGQGSQAVGMLADLAEQYAVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRTQPALLAASVAIWRVWQQLGLEQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQLMQQAVPAGTGAMYAIIGLEDEAIAKACADAAQGEVVSPVNFNSPGQVVIAGQKDAVERAGVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNAPQIPVINNVDVVAETDPVKIKDALIRQLYSPVRWTECVEQMSAQGVEKLIEGPGKVLTGLTKRIVKTLEGVAVNDVASLDAVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malonyl Coa-acyl carrier protein transacylase
publication title 1.7 Angstrom resolution crystal structure of an acyl carrier protein S-malonyltransferase from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 103
structure length 306
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3hjvA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3hjvA01
3HJVA 4QBUA 3TZZA 5CZDA 2PFFB 2CUYA 3TQEA 2VKZG 5DZ6A 3K89A 3TZWA 2C2NA 4RL1A 2QO3A 3SBMA 3IM8A 3PTWA 2VZ8A 3TZXA 1MLAA 3R97A 2JFDA 3TZYA 2G2YA 2UV8G 2QJ3A 3HHDA 2VZ9A 2G1HA 2H1YA 3H0PA 3R8YA 3BV8A 4RR5A 3IM9A 3QATA 5CZCA 2G2ZA 3RGIA 3CJ8A 1NM2A 3G87A 3EZOA 5DZ7A 2G2OA 3HMJG 2JFKA 2QC3A 2HG4A
chains in the Genus database with same CATH superfamily
2HAFA 5GMDA 2V2ZA 1P6TA 3BKTA 2GW8A 1SCJB 4CWBA 2VICA 3CMQA 4ZP9A 4NCAA 3NGTA 2C3PA 3MM5B 3G8TA 1TKXB 3DI6B 3C16A 4KGZB 4IR9A 2ZHAA 4FF1A 4Z7CA 2V34A 4WIQA 4YY3F 1IBLF 2HWIA 3CD0A 3B54A 2IMWP 2F40A 2MHEA 4CIOA 4PG6A 1MG7A 3MDFA 4RUAA 5HROA 5KFOA 2ZD1A 2CYYA 1WD6A 4PUOA 1FO1A 1SPBP 4DQPA 2OD6A 3OT9A 3QRRA 3BSCA 5F9LA 5CZVA 3MCMA 3TVKA 2E9ZA 2IAJB 1P1TA 3DOLA 2MY7A 5KFEA 2FJAB 2CPFA 3GIJA 2M88A 4ECQA 1CQMA 1JLQA 2XEXA 5DM7Q 2MXYA 3VZHA 5A2QY 4O4RA 2OTLS 3PXGa 3T1AA 4GC7A 1BGXT 1NJXA 2AHOB 3GV5B 4XDDA 1VI7A 2IBOA 1LW0B 4ZN3A 3MPWA 2QMWA 3OXLA 3I4HX 2O3DA 4HI2A 4DLEA 1UVIA 1F2HA 3NBPA 3BO2A 3H59A 2XLJA 5ETTA 1Z2ZA 1EKRA 3NGRA 2KT3A 1UP1A 2PFDA 2JEGA 1HI8A 2X3GA 4DCJB 3U02A 4GKKJ 4U7CA 4UOCA 2A6OA 2CPEA 4K8RA 4OZLA 3WHIA 3QGIA 3LWMA 2HFZA 1E6VB 3MM7A 2Z2ZA 1B0VA 3NMRA 3JTNA 4ZVOB 4ER8A 4Y2AA 2CQ0A 3E2EA 2WBRA 4G1IA 3DFEA 2N3LA 5HVHA 4U95A 1J5OA 4E98A 1TKTA 1SKUB 1ROFA 4ENOA 2Z57B 2BE7D 5F3ZA 4HHJA 1H3DA 2BA9A 2W2MP 5J2QB 1UKUA 1UWBA 3T1HJ 3M2VA 3G86A 4ITSA 3IM8A 4C0HA 1SJ1A 2VG7B 4WJBA 4A8YA 2UUAJ 4RW7A 2C1EB 4NLVA 1XMOF 5B0BA 2VFRA 3G2XA 2BYCA 4ZA1A 4FKYA 3TRGA 3H40A 1XBWA 2A3JA 4Q2MA 3EVWA 2CXEA 2Q43A 5A8RB 3UR3C 4NYPA 4WFNQ 1YBAA 3NEKA 1V6HA 1UA1A 3FMBA 5GAGI 1JMTA 5LSRA 3RYLA 2H9ZA 2P9CA 2CWKA 2XMTA 3CJ3A 3QJLA 5GAHU 1H6KX 4JI4J 2B43A 4LIRA 3CJ8A 3AD7C 4I67A 3NP5A 4UOFA 2HKEA 4BHQA 4M5DB 4C3MA 1S49A 5DG7A 1APSA 1WHYA 1HIYA 4GVLA 3I6PA 3RW7A 4USIA 5JXSA 2Y0SD 3UQSA 2PA8D 5H9EK 3H0PA 3W7BA 4R0JA 1TR0A 1RU1A 4DPYA 1AUDA 1S1TA 2AX1A 2HHSA 4AFFA 3HD2A 1ICEB 3OFGA 3O2IA 2KG0A 4FYYB 4ED8A 1NO8A 4R8UB 4Y3CA 1W26A 4NLDA 3KJVA 1WC4A 2D41A 2BE2B 5EX3A 4DR4F 2RAQA 1Q86T 1GMUA 4ZVRB 1K9MT 3P3DA 2R7VA 1HHQA 1F2GA 2FHKA 3KJQB 2JSXA 3PRDA 2OJ3A 4CM2A 5I3UB 3MAQA 1YX2A 4DL6A 1YLXA 1YRUA 5F0UA 5KFBA 5KFIA 2DR5A 1CS4B 3EMTA 1XERA 5D0EA 2UZAA 2JX2A 1H7WA 2GHPA 1RWMB 5CA5A 2ROGA 1FDBA 4I6WA 1PBUA 2CG4A 1FRIA 1EETA 4WFBQ 1EP4B 2R2TA 1QAJA 2E1RA 1LWEB 4ECYA 3I5BA 1RI7A 3D0IE 4PXCA 1NBEB 5DDRC 3PG9A 3SI8A 4BC9A 1KRPA 2J8AA 3ZZ0A 4C4WA 4NXMF 3FQLA 2MQMA 1DARA 3QYYA 4CO4A 5D4NA 4KFBA 4DV0J 4C8YA 1JLCA 2GX8A 2CQGA 2K3IA 2DBBA 3VVTA 4B3TF 3EVMA 1RJJA 2VV5A 1VK8A 1FX2A 3VGTA 1U0HA 2YX1A 1HHTP 2ZE2A 5GAHI 2YWKA 1BQMA 2NPFA 1U4BA 2HNZB 2PIIA 2PMHA 3CDEA 2QA2A 4IQMA 3QFHA 5AE2A 3D54A 2J5AA 5LMUJ 1H2UX 1IUJA 2L9NA 1XNRF 2OTJS 5AXMA 2HW3A 3L7UA 2CPIA 4C97A 3ITHA 3KYLA 2HNYB 1NH8A 1S4FA 5LMNF 4ILLA 1Q8LA 1S12A 2K3KA 4DV6J 4LSLB 2MQNA 3LGHA 2H65B 3OL6A 5HANA 3JTOA 2R7SA 1SC1B 2QL7B 2IC3B 3G87A 2W24A 4X65F 1BHNA 3BGFA 1K73T 2HAIA 2AJFE 3WDOA 4YS2A 1SUQA 4RBUA 1JLEA 3LP2A 2C42A 1DHMA 4FPIA 1KLMA 1FKOA 1LFWA 5DG8A 3QIDA 2C2ZB 4PPZA 3PEJA 3OD2A 1VS3A 4ZVEA 1AROP 1NSPA 2FLNA 3GIRA 2YH0A 3KLHA 2GJ2A 1QSSA 4DSFA 1VDHA 4JI6J 3UR0A 2ZH1A 5DJBA 2CPHA 2B56A 4B9LA 4DV7F 2QIFA 1T03A 4F02A 2CVIA 4ILRA 3SFUA 4RU9A 2IPOB 3QFWA 1R7IA 4M5GA 2XGPA 1S6QB 1T94A 5C7PA 2UUAF 3BYRA 2YX4A 3BQ0A 3FVYA 2N7CA 4FZVA 1PYSB 2J0WA 2Z2YB 2HBQB 1NDCA 2JEIA 2VUGA 1U47A 2ZH4A 3IR6B 1TUGB 3KLFA 3OXGA 4CTAB 3HCXA 4CLTA 2XYPB 2XY7A 4KSEB 3MEKA 1JLFA 3P5BP 2MTLA 2R2SA 3UDCA 1N5VA 2GZOA 1OQ6A 4FVMA 3JSMA 2DRBA 3HSJA 2I6WA 4FN5A 3SSRA 4PRFA 4LMZA 4K4UA 5CZCA 3PW7A 2ZBQA 3Q83A 2W25A 1K0TA 2OD4A 5DETA 1WHWA 4I68A 1VIOA 3W3SA 3PJ9A 2RJZA 3DDIA 1FFWB 2Z8QA 3MHYA 3KKFA 3HHKA 4CLSA 1FJCA 3CMAS 2CAJA 5AE3A 3J81Y 4ZPDA 1SH0A 2H54B 3AH6A 4L73A 3D68A 4ATNA 3TVYA 3VGSA 5I42A 1VQSA 1NU4A 3NS7B 3IM9A 1HKAA 3NMAA 4A4JA 4N7TA 3DGVA 3IRXA 1VHFA 4F3QA 2XYHB 2V50A 4DV1J 1IR0A 1N6QB 4NCBA 4Y34A 2GJFA 1JJ4A 3GR0A 2IYGA 4MKBA 2JDJA 3E01B 3KK1B 1MU2B 4QIFA 2VODA 1U09A 1Q1KA 2UUBF 4UY8T 2FHJD 2KI2A 2AJ2A 3ZZOA 1REGX 4EEYA 2V4JA 8AT1B 3KDNA 5B08A 5KG5A 1D3WA 1IKVB 2Z58B 1N88A 2VG5B 1EZZB 2QE5A 1NB7A 1B7FA 3QGPA 5KG4A 4H54A 3UCUP 2V4QA 2HIYA 1HQEA 3DRSB 1CPZA 3N6MA 4NZ0A 4K4VA 1C0TA 3AXMA 2EFOA 4ED7A 2BV3A 3GFXA 2JC0A 3G71S 1J5EF 2M4MA 2NR0A 1PAUB 1WORA 1KN6A 3CMES 2W7PA 4O4GA 1TUWA 3CD6S 4RR5A 2BABA 4M5JA 1RQ0A 3N4WA 2C3MA 4NL5A 3TANA 3JXOA 2ZC4A 3W65A 1KHWA 2ATCB 4KR0B 7FDRA 3MM9B 5AXLA 3GJSB 4KO0A 1B0PA 5E41A 5CAAA 2BBEA 3CC7S 2JLFA 2PE8A 4JYAF 5KFSA 1NHVA 2DRAA 1OY9A 2BQ3A 3HP6A 1RT3B 7AT1B 1CULA 5C25B 2C22A 4DSJA 3OR1A 5KFGA 3DOKA 1RB0A 4M5HA 4TY8A 2FC8A 4BS2A 3K0JA 4NRTA 3MECB 1L3TA 2ZH5A 2BJ3A 1PCAA 5F8IA 3VALA 1FA0A 5BXIA 2FIUA 3VGUA 1HA1A 3ZNJ1 4C8MA 5DQGA 1RAFB 4TQRA 5KFRA 4OX9F 1K8AT 4RW8A 3GFHA 2YWWA 3ETMA 2DGSA 2DGUA 2ZBCA 4DI6A 4DFMA 2W1BA 1P9YA 1T3NA 2YWFA 1UVJA 4DCPB 1HR0J 2ADBA 3JSRA 3SCLE 4YDXA 3MMCA 4QW9A 1SH2A 3N0VA 3RBEA 1VQ7S 4LF1A 4FF3A 2F8HA 4MK7A 1NEEA 1F5CA 3CJQA 4OV6A 3KTQA 4CH0S 3AOAA 1HQUB 3SV3A 4I56A 1H38A 4IR1A 4FYWB 1T05A 5BYRA 4ED5A 4I6AA 4HH1A 1JKHB 3M2UA 3CCSS 3LAMA 1SKSA 4ANCA 3CCES 1AUSL 1LK5A 3AQOA 3ISZA 2RILA 1XJWB 1RK8A 2A2DA 4LFCF 2BKPA 3VAHA 1U24A 1YBTA 3UN5A 5FLXY 3Q2SC 3NNAA 1ZTWA 4IOCQ 2EC2A 4EGLA 1HNZF 4KJIA 4C11A 2DNQA 2MKIA 5L9XA 3PEHA 3LP1B 3LP0B 4O44B 3SQGA 2YQ0A 2R8KA 4OZ3A 5C42A 1RBAA 4USTA 1VJWA 1TVRB 2PI4A 4UUWA 5J2PA 3MFIA 4KHMA 2WTFA 3KHRA 3UFCX 3DOMA 2IIHA 2ZVIA 4ZPWR 4L6V3 1TKDA 3V4MA 4MIWA 4J7CA 3BGLA 1LV5A 5G0RB 3MM6A 1V3ZA 4JV1A 1FCAA 3C6TA 3NGKA 3NWGA 1I1GA 4UUXA 3EPIA 4B3SJ 4DMZA 1RABB 3MCSA 5D0GA 2CDRB 3U1LA 2LXIA 5IQQA 5LSLA 3NXZA 1SJ3P 1HWLA 5KFQA 3K59A 4HH0A 2IRXA 2BOPA 4UTGA 5BR8J 5KFCA 1U6BA 2V2VA 1TKZB 3R2CJ 3VTIA 5AJ3F 2R2UA 5KTQA 1SQFA 1FRKA 4GVBA 3FZBA 1S9GA 2HHHF 1Q5VA 1Y4ZB 1HWIA 2CQPA 4KGMA 3CCJS 3PR4A 3CD7A 1TMMA 2MHNA 4DX7A 1GH8A 5DLFA 2KZMA 2B4UA 2E1AA 1SIWB 1QD1A 4E0DA 3JS9A 2CPXA 5IXUA 3NS5A 4YR3A 4AQYJ 4DUYF 5KFUA 1WC0A 1GXUA 1JJCB 2J9DA 4DL2A 2D3ZA 2GO9A 4XK8C 3IC1A 4OYOA 2ZNYA 4OMFG 2KL8A 3HT0A 4LF4J 2YKNA 3W2VB 1N0VC 2PDAA 5C2GA 2VKZG 4U7UK 4OYXA 1N5SA 4RLEA 4DPUA 2OEMA 1OIAA 1WNEA 3C6UB 2HFNA 3L09A 4B9NA 2DPIA 3G6VA 2WAQD 1L3KA 4Q0BB 2VBXA 1VFJA 2JWNA 1NHUA 2BEFA 3KK3B 3GYNA 2HSEB 4YR0A 3IO1A 1KKHA 3V4IB 1O0PA 4USUA 4DOZA 3MXHP 3J7Z5 4U67Q 4H4MB 2RRNA 4ZPTR 4FS2A 1PJ7A 4QZVB 1KD1T 1MROB 3D3CJ 2VHGA 4ED1A 2VDIA 4A46A 2VQEJ 4Y00A 3GE9A 2VJUA 5IV3A 2QYGA 2ZJPQ 5IFMA 2DHGA 2ZKTA 2QLFB 4JI0F 3QWPA 2K1RA 3T6JA 3UWTA 2J9DE 1VR6A 1B4SA 2DEJA 2YX7A 4ID8A 3H98A 3H42A 2JRSA 3QRPA 3EGZA 1RT6A 4Y2KA 4DHVA 4JI3J 4O3RA 1J2VA 2W2NP 2G4BA 1ZS6A 2GJIA 1M5SA 1FK9A 1G2EA 3S7RA 4Q8EA 1LXJA 2G9OA 1MMLA 4EUVA 3W61A 1ZOTA 3IBWA 4X66J 4QU7A 1JXVA 4X4TA 4W4MA 4CLYA 5HP1A 2VPWB 3MM8A 3ZZRA 3KLIA 3ZTQA 1HNXJ 1DQ8A 3NCQA 4HLBA 1UWAA 3D67A 2RQ4A 1YBUA 1I51B 4AUKA 3M9NB 4JUZA 3PKMA 1VQMS 1WEZA 1AZSB 3E3XA 3HHLB 5ETMA 4IFVB 1WC3A 1GAOA 3S01A 3MMBB 1WC5A 4C2MA 3LQVA 3ZFVA 2J9CA 4A8SA 4LF2A 3TX0A 1S1XB 2XC9A 1EX8A 3AB2B 1WKKA 2KYXA 4TVAB 4RO0A 1RLCL 2ZDPA 3PRBA 3WZ0A 4V1Ak 2ZH9A 3MPDA 5HBMA 3WIUA 3TNVA 3EVOA 3BSOA 1ZAWA 4WFAQ 4IUFA 1IKWA 2X51A 1AA1B 3FSIA 1F3FA 3NLCA 1KQGB 3UPFA 4IG3A 1FKPA 2JEFA 2GQQA 1X4GA 4DUZF 2J0XA 1HI1A 2M70A 1QAXA 1RTHB 2C2OB 4EO6A 1S1WB 2RVJA 2NXNA 3IMQJ 1IKYB 4AMMA 4OX8A 2WSFC 1X9SA 1WI6A 4PCQA 2E9TA 5B0GA 1TK5A 5DLGA 4H4KC 4Y2CA 1H72C 4OFZA 4EO8A 3ZO7A 1X4BA 5KFMA 3PW2A 1HARA 4TU9A 2W8LA 5KG7A 3CCRS 1IR1A 3F0NA 4OHVA 2VFSA 2C2EA 2HPUA 2KVIA 2RQCA 1T11A 4DSIA 3LANA 1FRJA 3RUBL 3CD5A 1CS4A 2MLYA 4LBPA 4M63A 2FJDB 4Q45A 2QT7A 3P96A 3MGJA 2QFIA 1TL3A 2FZGB 1S48A 1Q79A 2IM1A 1VCTA 5F41A 4DQQA 3QLHA 3TQEA 1VBXA 4WE1B 1SJFA 5H1SV 4P2MA 4CQ1A 1WHVA 4MIAA 4M5MA 1C4CA 2PO4A 4RNOA 4DV3F 3OJUA 4NI2A 1UFLA 1RT4B 4I2PB 2W7AA 4X64J 3ZTPA 3PYGA 4DG1A 2EKYA 5J1EA 4KGVB 1ZA2B 2CG8A 4NLRA 3ILLA 1VMBA 1MN9A 2VZ8A 2E1MC 4XDCA 1R6VA 5D4PA 4BWMA 3DGPB 1FVQA 3DMJB 1PC5A 4UT4A 1OY6A 4AT1B 4K2XA 4LIWA 2ILZA 3CDAA 3HO1A 5JUMA 4RW9A 3PM9A 3KDOA 3BV8A 2M3DA 4B3MJ 1SV5A 5L1JA 4LFAF 1S1VB 1FJGJ 4FS1A 1NSAA 1AW0A 4AMOA 1VRTA 3RG6A 2HHWA 4I7FA 5IQ6A 3M8PA 4PPDA 3ILIA 1RAHB 2VONA 3QAEA 4UQTA 1U1LA 5M2PA 2C2NA 4ECWA 3HHNB 4KAIA 3H4DA 3L7PA 2ZOFA 1GXLA 3Q22A 4L75A 3OVAA 3BH7B 2HZCA 2FB0A 4KB7A 4P2SA 3H2UB 1RTDB 3H4BA 3DXSX 2HFUA 3DU5A 2YNFB 3OR2B 5DQHA 2W9CB 1S99A 3BGRA 3RRKA 3EDQB 4M94A 1PBAA 2HHTA 2FUG9 3M30B 4DR2F 3CIMA 4NE9C 1JWWA 1M5OC 1SIZA 1RT2B 3R5CA 1XNQJ 3M6VA 1IM6A 2F65A 3PZPA 2BVZA 4HL9A 4TU8A 4EFAC 1IWGA 3R8YA 1NK0A 3PR5B 4QWBA 3K5LA 4LFBJ 1RT7B 4NASA 1RU2A 1IJFB 5L1LA 4RNHA 4CTAA 2IJNA 3D28A 1RHQB 1NPKA 4B9UA 3AFGA 2XY5A 4TU7A 3GJRB 3N79A 1HBUB 2AT1B 4RW4A 5AXKA 1TL7B 1NH7A 4LBIA 3RZAA 5IV4A 2N3OA 3L9ZA 3PYDA 1TL1B 4ZIWA 3BM7A 3OSPA 3A8JA 3MR6A 1Y5LB 3JSBA 2PEHA 2GQ2A 4PYAA 2FHOB 1RA6A 2I8EA 3ONQA 2E9RX 3U1NA 2Q6CA 1X4DA 4D3HA 1WOPA 2LFVA 1VQ6S 4NA3A 3UN3A 1WUUA 1PO6A 1XTZA 3FSYA 3QAUA 2WBMA 5HK4A 3GIKA 2BRKA 3EWGA 2X1BA 2DTJA 4Y2IA 1FDAA 4LF7J 3W66A 1R31A 2CVEA 3K5PA 3MAAB 3W8PA 2HRTA 1TELA 1HBMB 3SMZA 5EN1A 4YHHF 3SCIE 4ZVTB 2XS7A 3DLBA 2DY1A 5F8MA 2ZITA 2V2KA 5D8HB 1BXNA 5LT5A 2KXFA 3EE3A 3TAMB 3NAIA 1N5TA 3MUVP 3MPVA 2CJ9A 2DEIA 4LJMA 2CIMA 3THTA 1UL3A 4PG8A 5CYMB 1QY7A 1YJTA 2BDPA 2MMYA 2V9KA 5EWGA 3D0GE 2RKIB 4KGKA 2E5LF 5DGBA 3M2RA 4WWSA 4OHZA 2WB4A 4B3OB 3BSAA 4IRDA 4DL5A 1FRMA 4NMLA 1FWKA 4WK3A 4IRKA 4V19X 1QM9A 2RF2B 3K5NA 1FI4A 3DM2B 1X31C 2I38A 2RRBA 3TUZC 4P2XA 4C8ZA 1HNVA 1I94J 5KFLA 2P6TA 1DZ5A 3JAMU 2HMIA 4FKXA 1C2PA 3N01A 3HJVA 3M8WA 1MNEA 1X7VA 2OPSB 2CPYA 1NDLA 3PY8A 2U1AA 3D9BA 2I0XA 2VH7A 4WXWA 3BB5A 2C2MB 1EAYC 5K20B 4OJGA 1WHXA 2WSEC 1E6YA 3NGDA 3POTA 3PACA 4ICLA 2MKJA 4TY9A 3F73A 3BO4A 1OO0B 4KGXB 1FX4A 4A8XA 4CRJA 2HVEA 3FJ2A 2CPJA 3L4BC 1W7WA 1SH3A 4J9UE 2CQIA 5F3TA 2UUCF 3R3TA 2JFKA 4KQZA 2FJVA 4U7UD 4P72A 2B8QA 4UY85 2F4VF 1RAAB 4OQJA 5DO2A 4KIAA 4ZVSB 1FEHA 2VQFF 4L3NA 4QIEA 2EWHA 2DXFA 9RUBA 3HSZA 4FDFA 1FWLA 2XYGB 4CO3A 4X4QA 2V67A 3S1TA 3AD9C 5SUHA 3FEYB 4LF5F 2LMIA 2J0SD 4A8KA 2WVDA 1QE1B 3BGUA 3P5TL 1JLGA 1LOUA 2UXCJ 1WEXA 4TLRA 3Q24A 4N8NA 3ET6B 1R0CB 3CE8A 3CJRA 4LR7A 3PDNA 2WRMA 3HZEA 5E33A 4X2BA 1HWUA 4HHHA 2GVZB 2Z2LA 4N41A 4JI7J 4LT6A 4IFYB 1N34J 1IBKJ 5KOXA 1S77D 2LQ5A 4OYIA 4OI4A 1JKHA 5K8OA 4DSEA 1NJIT 3GJTB 3NG8A 5HQMA 1DTTB 1LWXA 4NXNJ 4DX8H 5D3GB 2Y8WA 3VWSA 4KHRA 2VG6A 2DGXA 2NPIA 2NUUG 4BCAA 4ETZA 4BBYA 3EDRB 1NXIA 1ZM9A 2ROEA 4JI5J 2MZRA 4AMPA 3SSQA 2B8PA 3EGWB 2LEPA 2AGPA 4QBUA 4ECZA 4F8RA 4MFBB 1WEYA 4Z37A 2FQQB 3AXKA 1QLNA 3BN4A 2LDYA 4RU2A 1G1XA 5G0RA 2B5JB 3T1YF 3C14B 1QUPA 3CGIA 1CJVB 4QR0A 3HD1A 2I9SA 2EFVA 1UPPA 2KT5A 4AL5A 5HLFB 4ES2A 2L3MA 1WJ9A 4PWDA 3W5ZA 3W2WB 3R9LA 3PVXA 2DGTA 1N8RT 2KRBA 2V63A 4X62F 1QSYA 2BXJA 2DNYA 4USHA 1FFSB 3VHQA 2JVOA 2OI2A 2FTRA 2H5JB 2D7SA 4I2QB 4PXBA 2DVIA 4ECVA 1CC8A 4NOHA 2O67A 1SVDA 1R8AA 1JB0C 4KKOB 2BMBA 3KOAA 4NA1A 1HNWJ 1JNRB 2HBZB 1SJ4P 1MWYA 2CQ2A 4K0KJ 2DNLA 1EIYB 2MLXA 5MAOA 3TUPA 2HVDA 1TZ0A 1D9DA 1I6JA 5H9FK 3CTRA 4ECXA 3IWNC 2YQ3A 4Y2MA 1X0PA 2QRRA 2PSZA 2OPRA 3R5AA 2XY6A 3FFIA 3DRRB 1FEEA 3QT7A 5IWAF 3ENAA 4DZDA 3CXCR 1RGVA 3CT9A 2RS2A 1YJ9S 4DR1F 5F0WA 3G4SS 1ACMB 1HWKA 3BZQA 5J1PA 3TA0A 1Q81T 2OSRA 1LWCA 1YJRA 5E3AA 2R2RA 1UJ4A 3D66A 3N6NA 1OS5A 3U1MA 3LALA 5KG3A 3T19A 3V6DB 1KHVA 2ILYA 1NDPA 1HLWA 3M8QA 2UV8A 1Y3KA 1U1KA 2QJ3A 5L9NA 1WELA 4I4BA 2ZH3A 1EARA 3BS9A 3FRYA 1A7GE 3Q8PB 4AXIA 4EZ9A 2VL1A 2WSCC 1KVKA 4EBEA 3PHEA 3KLEA 4H4OA 5F8LA 3U27A 1LW2A 2KRRA 3KFWX 2XZTB 1CJTA 4H4MA 3WX4A 1U1QA 1RSCA 1M5HA 3A12A 2V9WA 2IMOA 4NLSA 2ZVSA 1S9EB 4YDDB 1QVFR 1KWMA 2D74B 4RL1A 1FDDA 1MMNA 4NMXA 4MKVA 5A8WB 4RZRA 1GTHA 4JP8A 1JXLA 4DR6J 5IC6B 4OZNA 5E3QA 2GIRA 4OLPA 5KFFA 2C3YA 2DGQA 4MJKA 3OTOJ 4G6VB 2LXUA 3CDBA 4XPCA 5IZHA 4GO5X 3CJ0A 3H90A 5D0RA 3T5HA 4CYUB 4GKJJ 1T9VA 4MK8A 2Z56B 2HBYB 1G6BA 2R8IA 2H51B 4USVA 4RNNA 3OTBA 1WKLA 1HQ2A 5EWEA 4YR2A 3KG1A 1YWXA 3MEDB 2RU3A 2EBEA 4EYHB 3DHWC 4WF9Q 4FNIA 1NJWA 2W9BB 2VU5A 1FD8A 3OFEA 4UOHA 1WSRA 5HSPA 3JYTB 4ALZA 1N33J 3HKWA 3CCLS 2LEAA 4ZOSA 1KR4A 5KG6A 1RTIA 2R7XA 3TP2A 1LQ9A 3BSNA 1U6ZA 2RQMA 3IXQA 2RUGA 3D1HA 1YJWS 2ZH6A 2JVRA 3M32A 3A3PB 1UVLA 2Y1IA 1NZ8A 5AE1A 3I56S 3I0SA 2NS1B 2DNOA 2HK3A 1A6LA 3AT1B 4KY3A 4WYWA 1N5YB 4ZPCA 4DSKA 3QNWB 2CADA 4DR7F 4BC7A 4LVNP 5GADU 4I1TA 3DRPB 4KPYA 2V8PA 3M8RA 3RB3A 2FJXA 5I3QA 2QLBB 3OL7A 3FUYA 3MFHA 5A8KB 1IQZA 4LRDA 4GRSA 1C0UB 2DGVA 3MEEA 5IT9U 3J7AN 2XBPA 5GAEI 1U2FA 2F8EX 2MDAA 1CJUA 2BR0A 2F3JA 3SBMA 2OPPA 1GX6A 2R7OA 1MW7A 1FFGB 1RTHA 3D4JA 1S1WA 2XMMA 2H5EA 2P5VA 4DPTA 3EYZA 4HACA 1IKYA 2DNKA 4F04B 2GGPB 1D1UA 3PX0A 1F1BB 1R8HA 2V8VA 2LA4A 4P10A 3DHXA 1RAOA 1U1OA 4ECTA 2DGWA 5LXRA 2KFYA 3GV7B 4KT0C 4OI2A 1JXEA 1JX4A 2UVVA 3RRHA 3TEGA 2G0CA 2BANB 4YB5A 2XLIA 1S1UA 1Y10A 1RTJA 5A0YB 4PXDA 3FBFA 2BQRA 3NY0A 4HT7A 2XCPA 3ZZPA 4HDGA 6FD1A 2WVBA 5D0HA 1RT5B 1LNQA 4X4UA 3CB4A 4G1QA 1T9TA 2AJ1A 4Z7YA 3FEZA 3CO0P 3KLVA 2J7UA 3CPWR 1X5PA 2N7YA 1S0VA 1P8GA 4BWJA 3I0RB 3FCWA 2ZOGA 1Y0HA 4WFXA 3R97A 4ZHRB 1RWKB 3SDEB 2V8DA 3WQPA 1AB8A 5L1KA 1XN9A 3FCHA 4ZP6A 5J1NA 3QIPA 2BQUA 3GV8B 1EHWA 4IG0B 5J2MB 2O1PA 1V3SA 2GIQA 3K89A 2AKWB 2K8GA 2VF3A 4JI8J 4OHYA 2HQIA 2Q3PA 1NJYA 1S6PB 1N52B 7FD1A 2FHJA 4X4OA 1S79A 4QW8A 3KJNB 1UA0A 2XNQA 2E29A 2YNHA 2ALZA 2D69A 4OYWA 1OSDA 2KXHA 3CCZA 1HFEL 1F3VA 4KBIA 3X1LB 4PQUB 4ZVPB 4LQ9A 3OUYA 1XMQJ 2SXLA 4ZCKA 1DBDA 4J9LA 4W98A 3AOBA 3FRZA 2EK6A 4MK9A 4QIVA 1F9FA 5CH7B 1T02A 2YNGB 2VC0A 2BOAA 1SQEA 1N0UA 3DDNA 2CA9A 5CYQA 5DS7A 3KK2B 3CC2S 3LA0A 1JNZB 4G65A 3NL0A 2Y1LB 1FHTA 3JQJA 3UDEA 4J9MA 2NZ4A 2ZM6F 3K17A 5DRKA 3G6XA 2LVWA 4NCGB 4DL7A 3QQCD 2J6UA 1WF1A 4O0NA 3PNIA 2QLWA 1K1QA 1MLAA 3PRVA 4DPXA 2YKQA 4C8NA 2HLUA 5HMXA 4ERDA 2C3OA 1NNDA 3OL8A 2RUSA 4ZJOA 3Q23A 3TR5A 4P71A 4Q7AA 1IJEB 1KFSA 3DDKA 2ZUGA 3C46A 2UVRA 2XMUA 2XMVA 4B3RJ 4L72B 3Q8RB 3KG0A 2BJ1A 4JV5J 3D0HE 4ZCMA 4O3PA 5F8NA 2HK2A 2DCLA 2WONA 3JB9k 3OXFA 3FBCA 4OYAA 4DV5F 1NZAA 1WDDA 5HROB 3LTOA 3Q2TC 2ZD1B 5ADZA 3IS9A 1S4EA 4DV2J 4PUOB 1JK9B 3CJTA 2DYAA 1VGYA 1TL7A 4HTJA 4FXDA 1WOOA 5T41A 3HX9A 4URSA 2UVUA 3JTPA 4URGA 4TYAA 3R27A 1SL1A 1UMJA 2E5HA 3DOLB 5GAGU 4DWIA 3M8ZA 3H8YA 1X5SA 2RDIA 1JLQB 2QZ8A 3CIZA 3IWXA 3SCKE 1FNMA 1HBOA 4PXEA 2PT0A 3KHLA 3H20A 1WF2A 3C15A 3LF0A 1VQLS 1GNKA 5L1IA 3DXBA 3CO9A 3NBPB 1RLDA 1U2CA 2OPQA 1T0TV 1R8BA 4ETXA 4NWBA 3NKYA 1VQKS 2XB2D 2EG2A 5B0EA 2N4DA 2F9JA 4NYZA 1PSDA 1VC6A 2CJXB 4ZCLA 2BKNA 4Q43A 3IR5B 2WOMA 5I3PA 3MM7B 2IDEA 5IOLA 2DNRA 4CNZA 1SB6A 1HBMA 5IC4B 3FZ2A 4O3SA 1M1GA 3JQMA 2HFSA 1CC7A 1N36J 1SQGA 4HEA9 1C1BB 4RW6A 3M7VA 5LOQA 1J5OB 4J91A 4C0OC 1TFYA 5H9EJ 2XCAA 2VASA 5EUHA 3MR3A 1NDKA 1UWBB 1N54B 3M2VB 4B9SA 2ZWPA 2DNGA 3FBEA 4PR6A 3FCVA 2AQ4A 1S0OA 2ACYA 1H98A 4KE5A 4C9DA 3KMSA 2RKIA 4LF8F 2LU1A 4QJVA 3GB0A 3R6GB 1FJ7A 3Q8SB 3C8YA 2UXDJ 2CZ4A 3VQSA 4DJBA 3TJAA 4LF9F 2KJWA 1RUSA 2QSFA 1IBMF 1T95A 2F4FA 2MSTA 4DFKA 4CLPA 2PC6A 2J6SA 3JAMY 3DLJA 2XZDB 4D3GA 3FKBA 5D78A 1YGYA 2HHUA 3UNGC 2MGZA 2DIVA 1R8CA 2HRYA 3CWJA 2YNIA 3UVJA 4ELTA 3EZOA 2WVEA 4LBHA 2QMUB 4CO0A 4LF6J 1U6FA 3AQPA 2M9KA 3RBXA 3RB0A 4IH7A 4R0EA 4R5PA 2MEWA 3DLKA 3ISND 3N5FA 3EGVA 5ETPA 4JI1F 3HFKA 1S1TB 3HHDA 4J5OA 3CJ4A 1S9FA 3FBBA 1T7PA 2G2ZA 2DO0A 3EICA 1W25A 2IA6A 3W8GA 2NYIA 3KJVB 5K14A 1N32F 1RAGB 3QO9A 4FF2A 4QOTA 3MURP 2GNKA 3O44A 4DR5J 1EKSA 3R7NB 4W90B 2LEBA 2LLZA 2ATLA 4OZ0A 3N6LA 1PYOB 1HL6A 2MQ8A 2C3UA 3QZ7A 3MF5A 2MZSA 3MD1A 2O66A 1IQTA 3NRBA 2RU9A 4PQAA 1Q95G 2ZFHA 3ZTRA 3JSYA 4B9MA 4P73A 4F2RA 4ZVGA 3EUNA 4UZCA 3G9CA 2B4PA 4QWAA 2OMLA 2B0GA 5B0CA 1KEKA 5CD4H 4RNMA 3B78A 2DB1A 4P7VA 2QEXS 4KFBB 2EFQA 3CJKA 3ENQA 1BWEA 3MOZA 2RB7A 4NLGA 2V8GA 5ETRA 1FDNA 1JLCB 2HQFA 3WIVA 3BYPA 3IP0A 3SSSA 3UDVA 1DTQA 4HTIA 3CJ2A 1AYEA 3P6YC 1NUEA 2V4RA 3D3BJ 2I5JA 2ZZTA 1REVA 2UP1A 1U0HB 2IBKA 2DIUA 1BQMB 1RT1A 2CQCA 4DR3J 5K5MA 1QJHA 3OLAA 2RT3A 1YJ7A 4DUTA 2DHSA 2AEFA 2ADCA 4WP9A 4N5SA 2DISA 3ITHB 1FWPA 2B4VA 1F9HA 4OYMA 2JOQA 4RBVA 4P2FA 1PJ6A 1U7LA 4YOEA 1VOMA 1ZM3A 2V68A 1CJVA 5DGAA 4NPOA 3ZZUA 2PEBA 3M6WA 2W8KA 3Q8QB 3KLGB 3W2WA 4CLWA 2NSBA 4GKKF 3MMAA 2LA6A 5FDLA 1SUQB 2NXUA 1JLEB 3LP2B 1KLMB 1X0FA 1FKOB 1QSLA 1LK7A 3DU6A 2BRLA 2FLPA 4K4ZA 3MCNA 5FJ4A 4ID5A 4PWUA 2YXLA 3HHLD 4F7VA 3RW6A 5L38A 1R6YA 5CABA 4OYPA 4F4AA 3KLHB 3QJJA 1KVIA 3H2LA 3PFEA 5KFVA 4EK2A 2NSCA 2MQQA 1TAQA 2ZJQQ 1T03B 3T3FA 3PIOQ 3OTEA 1HNIA 3T1HF 4NLUA 3GFZA 2EPIA 5E3CA 1SKRA 1SC4B 4KTQA 2C2KB 3KLFB 1Q78A 3N9UC 4MKAA 2B6AB 4PG5A 1JLFB 4K4YA 4ECUA 4A47A 4DXLA 2DKOB 2JNJA 3JSMB 4USWA 2AGOA 1FE0A 2CFXA 2QX0A 3NS6A 2HURA 2M8HA 4UW2A 2VA2A 4JI4F 1PKUA 2CQBA 2GMJA 2XMKA 3C66A 5DZ7A 2VDHA 3GILA 1S72S 5BJRA 1YITS 1CEZA 3OTCA 2KYZA 4OI1A 4DV4J 1LWFA 5DDPC 3K58A 3SYZA 2RS8A 2YWHA 1S9EA 3TARA 2HS0A 3RR8A 4JI2J 5B0DA 4FXVA 4FNHA 2WVCA 5AXNA 4DF4A 2CJAA 3H7HB 2HVHA 2ZH8A 1NPPA 3W60A 4CT9A 1RYSA 2C2RA 2QLXA 5ETSA 2CQHA 4OJ1A 3ILOA 2G2YA 3BPSP 4PYDA 1RCOB 2NXEA 4USJC 3H5YA 3RGIA 2QFJA 3W64A 1RWUA 2KG1A 3BJYA 5CZDA 3HK2A 4F50A 1KVJA 2HS4A 2V4JB 4OYZA 3GU0A 4DF8A 2LQBA 2R9LA 2D3UA 3AA8A 1UEVA 3BPDA 1SBRA 2YWEA 2FPHX 3G96A 1ZBTA 1BQNA 3DLGB 4EI2A 1HQEB 3I31A 5KFKA 4DFJA 4F26A 1C0TB 1YKWA 1R0AB 2AF6A 2YKMA 3GIMA 2VA3A 4IDKA 3H5UA 4A8FA 4YY3J 5DQIA 1IBLJ 2A0FB 4O4GB 3VZIA 3ZXWA 5T7LA 4UOGA 4FBTA 4XPEA 4DV0F 3QZ8A 3MUTP 1Q8KA 4PEOA 1FF2A 3B4MA 1X4AA 4NLPA 3AJ2A 1MSWD 4KO0B 3IR7B 3R5JB 1VQ9S 2OKQA 3HLUA 3S8SA 3BBCA 2JL9A 4LRAA 4DN0A 3THVA 5JMNA 1S7HA 3BR8A 3MEGB 5LMUF 4ES3A 4MTPA 5KT3A 4Q8FA 1RBOB 2WW4A 3D6MB 2D9OA 3Q0AA 5IT9Y 1CULB 1UTAA 3U7JA 4F4YA 3QPIA 3B6BA 3OR1B 5ITHA 2EXUA 3IBFB 1O51A 4O3NA 1HD1A 4TY8B 1ZETA 4O3QA 1U25A 4DV6F 2VKRA 1FERA 2WB1D 1O6XA 4RBTA 2KM8C 2ZOMA 2CNOB 1R8PA 1HPZA 4LREA 2QTWA 4C0BA 3ZZTA 2XSFA 2HYIB 1A9NB 3J7YI 2YQ1A 3G6ES 4RW8B 3HSGA 2RNEA 1TTHB 1C4AA 1UFKA 2AZ3A 1Y5IB 1T9YA 2MQLA 4UF4A 3HVTA 2QYCA 2QGFB 3DYAA 3MMCB 1T9UA 3QATA 3ZZZA 1UEKA 4N77A 5EX0A 4JI6F 2HNDA 1RT5A 3TO8A 2AU0A 1BD6A 1IKXA 2QMXA 5LL6d 4J9SA 2G13A 4QYZK 4U6PA 1FXDA 4EBCA 2ZWOA 1T05B 3NGUA 2MQPA 1W2IA 2R7UA 2COLA 3M2UB 2OSQA 1DLOA 5KG1A 3I0RA 4Z2XA 1YJUA 1XMOJ 2DNPA 4DU8A 3KUHA 3T5KA 2E7WA 3F44A 3QSIA 3IRWP 2DCUB 2ZJRQ 4CDIA 1UVKA 3E51A 4IG0A 2DK2A 3VGVA 1CQNA 4J9VA 2WVFA 1VQ5S 3PW5A 4C11B 2EVZA 1S6PA 4F3MA 5JJBA 4Y0FA 3A1YG 1T9WA 2L9WA 2HIQA 3SQGB 1B70B 1NJZA 1VLOA 2G1HA 2D1CA 5C42B 3DLEA 2KZZA 4F4XA 1D9AA 1YJVA 3VV2B 1TU0B 3E8OA 5J2PB 2VJVA 1CSJA 1KOHA 2XHCA 2B7CB 4TLQA 1JLAA 3GZ7A 3BDEA 3DOMB 1ZZNA 1BLUA 1RAIB 5C24A 5KFPA 5IM0A 2J7KA 2A18A 1V9OA 1K47A 2XSJA 1UW4A 3C6TB 3GSIA 1CJKA 2FVSA 2CZVC 5JVHQ 1OSCA 2HBRB 1GMWD 2EW9A 1KQSR 1P9QC 3VR1A 3VCDA 1HYSB 4JV2A 4YEAA 1VRUA 1WG1A 3GP9A 2J6TA 4DR4J 1RISA 3J7A1 1ZTTA 4HHUA 4KHPJ 4YB6A 3THPA 4DV1F 1WC6A 2BKOA 2KU7A 5KAKA 3QJPA 1RKJA 1OY8A 4GVBB 1S9GB 3GCXP 1RACB 1RYRA 3ETOA 2HGNA 3VAIA 1KTVA 3TAPA 2V5HG 3PO4A 2LYVA 1S7IA 1KSPA 2CUYA 4F0MA 2OUGA 4IOBA 4EBDA 3NWRA 3PKYA 4X4SA 2RMLA 2ASLA 1GMVA 2MZ1A 2HWTA 4QR2A 3MM5A 4MAKA 2CJYB 2FGCA 4WFYA 1N4LA 1Q4RA 2VBZA 1TKXA 1OQ3A 4CLUA 3DI6A 3FC9A 1BWVA 3TYTA 3TZZA 3RBZA 4NXMJ 1YRXA 2YKNB 2GO8A 1XR6A 1VYAA 3GSDA 2NLWA 4G1PA 2Y1RI 4B3TJ 3BH6B 5RUBA 3QT6A 3M8SA 1QTNB 2OAUA 3DNCA 1WSVA 3WC0A 2QA4G 2Y0BB 5E3PA 5CD4A 3FSXA 3HMJG 2X3DA 2NREA 4TXSA 3QBCA 2FC9A 1SC6A 2IAJA 4CO1A 3PW4A 4I6YA 2QV6A 4N8OA 1DAXA 1XNRJ 3W63A 2CNKB 5HVGA 3OPKA 3CVKA 5LMNJ 3NOCA 4OYBA 2HLTA 4QIGA 4MH8A 1LW0A 2UV8G 4HI1A 1L5UA 4A8WA 4P74A 4DQSA 3I9ZA 2W4CA 5HMZA 4U96A 3TUJC 2QLJB 2K1RB 5KFNA 4X65J 3TJ9A 1S97A 4I64A 1NKCA 1X5TA 1NK6A 1RT6B 4ZLJA 3MCOA 2UVWA 1R3NA 1E6VA 4AL6A 3HM9A 1C1BA 4A48A 3QGHA 5KFJA 1FK9B 2BJ9A 2RDJA 1VC5A 3X3UA 5HQLA 1HR0F 1RXOB 4OX6A 2P8IA 4FP9A 3AA9A 1GK8A 3HVRA 1Y00A 2RIJA 2G1DA 1Q16B 5DZ6A 1X60A 2CNNB 5HP1B 4DV7J 1VQOS 2XZWA 1KNZA 2Q79A 2WCXA 3MM8B 3KLIB 4KH1B 4ZJQA 1SL0A 1ULRA 5J2QA 3UO0A 3PX4A 3FDSA 1FD2A 2VG7A 2Y8YA 1GX5A 3CW2C 3OLBA 1LEOA 2Z2MA 4PAAA 2GMLA 2CJKA 3EZUA 1NB2A 2BM0A 3ICLA 3BO3A 5KFXA 4IYQA 1S57A 1ZH5A 5A8RA 1NSQA 2EI5A 2VB6A 1WF0A 1EJ7L 2HZVA 1Z1ZA 1ZPWX 2W01A 1PIEA 5HBMB 1VC0A 5D15A 4UZBA 5E3RA 1I3OB 2Q1LA 2VFVA 3A8IA 1IKWB 4KC5A 5M2UA 2FVPA 2DD8S 4RNFA 4M5DA 2YTCA 4IG3B 1Y3JA 3M6UA 1FKPB 3A3NB 4YQWA 2FLLA 3QMQA 2K06A 4FBUA 3NNHA 2AZ1A 4B3SF 3R5DA 4DCOB 2JJ4D 2A1BA 5CCLA 4R8UA 4KHPF 2J76E 4ZDNA 4YP3A 3RB4A 3LO3A 4DZ6A 1R89A 2BE2A 4KV8B 2IRYA 4C3LA 4A8QA 1W2BR 1PAEX 1GQEA 5BR8F 2B9YA 1QAYA 3HPOA 3G8SA 3K8WA 1PJ5A 5I3UA 2KHCA 5C2CA 2UUBJ 4M5NA 1UVMA 1TL3B 4W92B 3M9MB 3QLHB 2QN6B 2X1AA 3PO5A 1EP4A 5DDQC 2EK1A 3BF4A 3LAKA 1B64A 2PD1A 3VQTA 3DLHA 4AQYF 1LWEA 4F2SA 3R7SB 2VPXB 3CCVS 5HAOA 4HKQA 1J5EJ 4NI2B 1OMSA 4LF4F 4A8MP 4QCLA 1NAQA 4DG1B 2FY8A 1WG4A 2EBGA 3T41A 5J1EB 4OI6A 4B9TA 5ETQA 3IG1B 5AT1B 3BBBA 3DLLQ 1P1LA 4I69A 5GMKa 1AT1B 4OJ3A 4OZ5A 4J9KA 2GC8A 1EQ0A 4LSZB 2F9DA 3G6YA 2FJEB 4JYAJ 4K4TA 2HNZA 5LXYA 2QL9B 4J9QA 4DPOA 3I5CA 4B17A 3MZIA 4WZQA 3FEXB 3UE2A 4WXOA 1K0VA 4RW9B 1C1CB 2NXJA 3SEOA 1MMDA 4USMA 2CRLA 3F41A 2IM2A 1K1SA 2XMJA 2EFNA 3UDLA 2FYXA 3AY0A 2HNYA 1SV5B 1VQ8S 4FYDA 5D77A 2VQEF 3GCWP 2BW2A 1VRTB 2JLEA 3I9V9 3R1LA 3J81j 4YUDA 4LSLA 4F0HA 3KLGA 1Q5YA 1HBNB 1JIHA 4I7FB 1V5IB 3RTVA 3M8PB 1IWAA 1F5BA 2J8SA 2IC3A 4WKYA 3PIPQ 2E5IA 4OX9J 3KHHA 1X4CA 5K8PA 5SZTA 3FK4A 5BYSA 1NPRA 2DH7A 4EYIB 3EXYA 1NK8A 3D2WA 4JI3F 3GLJA 2K7KA 3PJXA 4IQXA 3NGSA 2RRAA 2PI5A 1F5AA 3BGRB 3TI0A 5ETVA 6AT1B 3PFOA 1NRKA 1NKBA 1FT8A 2XI2A 2HHPA 3TZXA 4X66F 5IS2A 4NRUA 4NZ6A 1DY3A 3EXCX 2LECA 4P9SA 1HNXF 2F8MA 1S6QA 5A6WA 3EM1A 5A6PA 1O8BA 1FESA 3JQKA 3K5MA 2QL5B 3DN9A 2B6AA 1RWOB 4MT1A 4DFPA 4RW4B 5F8GA 5D4OA 5DG9A 1FRXA 3R6LB 2JEJA 4LFCJ 3OHAA 1S0NA 4QWCA 1VQYA 2VOOA 4ED0A 2FVQA 2XMWA 2F5GA 1HNZJ 4M95A 1X5OA 2W2OP 1TFWA 1JLBB 3I55S 4QWDA 3M8YA 3KNAA 2OP5A 3EJMA 2P9EA 4QPXA 2AYMA 3AAWB 2HRUA 4ZLNA 4OHWA 1RHRB 4YFUA 2DXEA 4DPWA 4OZ1A 5GMEA 1OJ4A 4DQRA 3P4UB 2RE1A 4RKUC 1NKEA 2DPJA 3TOQA 1M5PC 2ALYB 3KJFB 1AFIA 5I4MA 2GHVC 4K5SA 1CG2A 3R2DJ 4NLOA 5KT4A 3CJSA 1NSKL 4C6AA 1SC3B 1EQMA 1JJHA 3KHGA 3TEHB 3W62A 4J9NA 1RHMB 5HJYA 3AD8C 2OO4A 5HL7Q 1EB0A 3P49B 4WCEQ 2BX6A 1N6QA 3PV8A 4NEYA 1X4FA 4F67A 5AJ3J 3OBIA 2E1PA 2AYBA 9ATCB 3B8HA 2OHDA 1VISA 1RP5A 4CO5A 2GAHC 2D9PA 4CO2A 2HHHJ 3E01A 3VF0B 4ZIVA 3KK1A 3LGNA 2G0IA 4OZJA 1MU2A 1V5VA 2IJRA 1Q53A 1SJRA 2QSWA 2DNHA 4K2JA 2CQ4A 4ANEA 3AB4B 2IY5B 2A10A 1XEZA 2LXFA 3LPEA 3DLGA 1N48A 3TVZA 3M2RB 2ZHOA 1IKVA 2VG5A 4DUYJ 2FZKB 1R0AA 1LKZA 1M0SA 3TAQA 2FHMA 3DRSA 2CQDA 2OLWA 3J80U 4KRWA 1RZMA 3BKFA 3LUYA 4Y65A 2E5JA 4ZVQB 2IDLA 1ZAXA 1HNVB 1PG5B 3T9ZA 2X1GA 3DCAA 1M90T 4RJVA 2HMIB 3V6KA 4X64F 1YG0A 1P27B 3AHPA 4R25A 3A3OB 2ZDOA 4L76A 1Q7YT 1UEUA 1TV6B 2GS8A 5G4DA 3SIPB 2W4PA 1M1KT 2E7XA 1E6YB 3MM9A 2AW0A 3POTB 5MLCV 3MEGA 4M5IA 4ICLB 1H2TZ 2E1CA 1U02A 3ULHA 4DX6A 3OVBA 4WTOB 1KLNA 1HWJA 4OI0A 1RT3A 4CT8A 4O0IA 5C25A 4P6QA 3H5SA 2WHOA 4B3MF 2D3O1 1FJGF 2RHSB 4ED3A 3L7OA 4JI0J 4RWXA 1L3VA 2H4WB 3MECA 2DO4A 3OJSA 2R8GA 1S0MA 1DQAA 4IOAQ 1GEHA 4N47A 1HD0A 5A76A 3LPYA 2NYHA 1JLGB 4FVCA 1TMJA 5HN0A 1D8YA 5ETNA 2AYGA 5FIIA 4P75A 4AMNA 5LM7E 5GVQA 4K4XA 4CLLA 3GG0A 4F25A 3TA1A 1Y11A 5M2RA 3UI3A 4ED4A 4NYOA 2CQ3A 4LR8A 3HHEA 2RDDA 4RPFA 2ASDA 1TK0A 4WBFA 1XNQF 1TP7A 1B7YB 1QAIA 1NK9A 2MYFA 4PKDB 2EFPA 3QRQA 5IT4A 4LFBF 1HQUA 4WP3A 2VG6B 2PMWA 2MKCA 4J90A 3MPYA 6FDRA 4J37A 3O5TB 3EX7B 1NMEB 5H9FJ 1J27A 3LP1A 3LP0A 4O44A 2ZH2A 1KFDA 2KDOA 2IJFA 3GONA 2L48A 1VBKA 1TVRA 1ZYQA 3C2PA 5ETOA 1HMVB 1XC9A 5B09A 3MWBA 3UW1A 4L74A 3RU0A 2AJQA 2NCKL 4DUZJ 4PWDB 3L95X 2OEJA 3I82A 3HDSA 4OX7A 3Q8UA 4QU6A 4LF7F 1HYSA 1KS2A 4G3IA 2N82B 3ENWA 1BC6A 4IO9Q 2KFZA 5LJ3Y 3EGNA 1WKJA 1RWXB 4KYZA 3OVSA 4NX9A 3CCMS 3W9IA 4ES1A 4C8OA 2J9EA 2XGQA 1PYTA 1TKZA 3HKZD 1Z4UA 1RAJA 5ETLA 2KH9A 1RCXB 1U1MA 2CPZA 1AFJA 3PX6A 1R43A 2GCFA 3FMWA 3PW0A 3QWUA 4NLTA 4DBQA 2OPRB 1G7CB 3FFIB 2GA7A 3NNCA 2IYIA 3T5JA 4QQBA 4C8KA 1U48A 4H4KA 3TUIC 2BW7A 5E0OA 4FF4A 5KT7A 2YY3A 2LQ9A 3MOJB 3GQCA 5HMYA 2UXBJ 4DV3J 1LWCB 2HQCA 1RDRA 4JB8B 2ZBRA 5L39A 1SL2A 1I94F 3W2VA 3M8QB 4LR9A 1BMQB 2JHEA 3MR2A 1F9EB 1UVNA 3SCJE 4E8UA 2PFFB 4ILMA 1H73A 4ZPBA 4XAKA 3C6UA 4PWWA 4B08A 4J9RA 4YN3B 4IKAA 1Q8IA 1PC4A 3KLEB 4H4OB 2DJWA 4Q0BA 1LW2B 1CJTB 3SZ2A 1UPMB 5THWA 1GFWB 3KK3A 3IA0A 4ZCIA 3V4IA 2PGCA 3M4XA 4K4SA 4M1KA 2AEMA 3TJ8A 1K44A 5GAEU 3KUGA 1MROA 3CULA 4WU2A 4X4NA 3H25A 2EKNA 2P9GA 4LFAJ 3P45B 2XHWA 2HGLA 2DR7A 1RWNB 2IM0A 2B51A 2MJNA 4X4PA 3GR1A 3A13A 2HHQA 1L3UA 4X84A 3H2VE 3D6HB 2AX0A 4B9VA 3R5GA 2DNZA 1IVZA 3ADAC 1UW9A 3P8BB 2B3TB 3K5OA 2R7QA 1U2RA 3PCOB 4Q44A 4PABA 3OW2R 5ETKA 1AXQA 3MTKA 2A6MA 1OPZA 5L8RC 1YTYA 4KPCA 1VQ4S 2H48B 5LSOA 2MY8A 5L46A 4RUBA 3GFYA 2UXCF 2EG1A 4ZPAA 2VIHA 3DRXA 1U1RA 4MKYA 2MSSA 1KDNA 2XS5A 2L41A 3O1LA 1ELOA 1XIQA 1X9WA 3NCPA 1Q8BA 4DR2J 4TYBA 1RTIB 4WFZA 4JI7F 3H5XA 2ASYA 4AD6A 2R7TA 1OPIA 4MIBA 2CKWA 3BR9A 3M32B 4BDPA 3D1QA 1N34F 3NOGA 1YIJS 3K2YA 4O23A 3RB6A 1IBKF 3ZTOA 3I0SB 4IH6A 2FJWA 2KN4A 4OV1A 2K7JA 3HT3A 5KT6A 2GVDB 1AZSA 3C19A 3HHLA 3O6QA 2QA4S 1ZZFA 1WG5A 5D6GA 4NXNF 1KP6A 3R5BA 4LSNB 3DRYA 1KQKA 3W1YC 4IFVA 3IAS9 3MMBA 4TN2A 2IA0A 2KTQA 1S1XA 4JI5F 2Y1JA 3LW5C 4OI3A 2V6AA 1UAWA 1DJ0A 4TQSA 2LP4A 1MWQA 1SXLA 2CPDA 3MEEB 3KUEA 3EZ5A 4P7TA 5CYJA 3MUMP 1CJUB 2BJ7A 4C3KA 4F4KA 2OPPB 1R27B 1FE4A 2W2QP 3ISNC 3M9OB 3AJ1A 1FRHA 2FGOA 2RH3A 3PHTA 1FXRA 4HACB 1SI9A 3A8EA 5CXTA 1PGZA 2KJVA 3ENVA 4HR2A 3CDWA 3VAMA 3ZTSA 1YRTA 4EZ6A 3VAFA 3C3LA 3I87A 2B7BB 2BACA 3IN5A 5KG2A 4ZLPA 2ZH7A 4AYBD 4EMDA 3WBZA 4KV8A 3OHBA 2VC1A 2J0QD 4C7QA 4YHHJ 1S1UB 2W2PP 3VAKA 3BN7A 4ZP8A 4X4VA 1HNWF 1RTJB 4ELVA 4K0KF 4M5LA 1UZHA 4J9PA 2DY9A 1TK8A 2DNNA 2B9XA 4OZ2A 3BDPA 3M1VB 2YPYA 3M6XA 1NK7A 1QDUB 2ABYA 4G1QB 5HJXA 3S6EA 3TZWA 3ZNUA 4CZCA 2E5LJ 8RUCA 3HXMA 3TW0A 5KFDA 1H0HB 4CI0B 1RAEB 4C98A 4WU3A 4WE1A 2UXBF 3RRGA 1KBRA 4OL8A 3QT8A 1Y5NB 3QIPB 2VPZB 1NLKL 4WTYA 5KOWA 1UFWA 4URQU 4ZITA 2ZNZA 2F1FA 3IG1A 3UD4P 3ELHA 1RT4A 1JQGA 4I2PA 2HHXA 2YNHB 3UCZP 5J2NB 2E5GA 3OV7A 3GPAA 1G3OA 5B7WA 1TL5A 1S6OA 3F56A 2BJ8A 1U8SA 3OUYB 3OQ2A 4GC6A 3RAQA 3DGPA 2HWHA 3DMJA 1C1CA 3SFGA 1KONA 3G82B 3EPGA 2YKAA 3RJMB 1LFPA 4RX6A 3V81B 3SV4A 2UUCJ 2XTJP 1U45A 2F4VJ 1MN7A 1I5OB 1D9FA 4IRCA 5CYQB 4UQGA 2X7IA 4DR6F 1M5KC 1HBNA 2BJEA 2VQFJ 1S1VA 2DITA 3UD5A 5HO4A 4CCHA 3OTOF 4Q5VA 1H2VZ 2NQPA 1M1HA 3B82A 3RAMA 2LQJA 4GKJF 2MKSA 1N5QA 4LF5J 1N56A 1FTRA 1NK4A 1Q82T 3I4PA 3HHLC 2F7VA 2LCWA 3UCGA 2W9AA 2OIHA 1B99A 1U49A 4K59A 1F60B 5KFZA 3T9NA 1BQXA 4X4RA 1RTDA 2ZC3A 2YNFA 1WWHA 4ZP7A 3OR2A 3AJDA 2W9CA 1PILA 3NCRA 1N33F 1LXNA 2Y3YA 1WI8A 2FZCB 4GO7X 3M30A 3C16B 1Y7PA 1RT2A 4NA2A 2WONB 3BKUA 5F9NA 1QTMA 2VBWA 5KFHA 2ZUAA 4FYVB 3ZC4A 2X1FA 5EDWA 5HMWA 2CQ1A 3IS9B 5F8HA 1RT7A 2IVFB 5B0AA 3G8QA 2LDIA 4CH1A 1TQLA 2R7RA 2KKHA 3UN2A 1KOOA 4JV0A 1HW8A 1HBUA 4EU0A 4N76A 1RHKB 1WACA 1JLBA 1XK8A 3BREA 4C8LA 4B02A 2MZTA 1TL1A 3FQKA 4LVOP 3NAHA 1HBOB 1D09B 4EWTA 4HT5A 4LRFA 4ED2A 2M5YA 3C15B 3KWMA 5A2QU 1D8ZA 2JLGA 4K50A 1FNXH 2HQ3A 2OPQB 5BYQA 1O5JA 4ZVHA 1YI2S 3T1YJ 2MQOA 1URNA 4BLGA 2O5DA 4DDFA 4CLKA 1ZM4A 2WOMB 2E66A 2HS3A 1VK3A 2JH3A 2MB0B 4CLZA 4X62J 3V6JA 2HGMA 3HF5A 3BEGB 5CCMA 4PG7A 1BE4A 1YDLA 2AGQA 3DC2A 2AV5A 2ZBPA 3BBFA 3W9JA 1R0BG 3MAAA 4RW6B 5F8JA 1Q7LB 1HHSA 1TL4A 1WDTA 3I32A 2XNRA 1U1PA 4DS5A 2AP6A 2YBVA 1S76D 4CLFA 3T6BA 2L08A 1TKTB 3TAMA 2KVQE 1FXLA 4ZN1A 3CSKA 2HZAA 2NZCA 1GMWA 4WP8A 3PYEA 4WPAA 4A8OA 2VFUA 3GYGA 2MZJA 3GWCA 5CYMA 1H74A 1KTQA 2QG9B 3KG4A 4U8YA 1FJEB 4DX5A 3UD3P 3OL9A 5FD1A 2YKPA 4NEZA 3J80Y 2LU2A 4RW7B 5IWAJ 4F3OA 3K8VA 1XR5A 3BQ2A 4B3OA 2WZ1A 1RADB 2BM1A 3GTYX 3HVWA 4FYXB 3WX8A 4YMEA 5CQGA 4DR1J 4OIXA 1YVFA 1B0TA 3GJQB 3V6HA 3HFVA 2I1RA 2R8HA 2RF2A 1WTBA 2VPYB 3DM2A 1Q0NA 2ERRA 3QT5A 4JI8F 2M52A 2BJDA 3Q8YA 3D1OA 2Z30B 1T9XA 1WTFA 2DR6A 2R42A 2MGZB 2GMHA 2YPZA 1TV6A 1UJ5A 2AEJA 1FRLA 3D7SB 3Q89A 2OPSA 1RA7A 2YNIB 2WW8A 3UVJB 5B0FA 4OJHA 4NLQA 2VZ9A 1VIXA 2V69A 4XO0A 1XMQF 2XO6A 4WKRA 5U47A 4R5PB 3DLKB 2XG8A 4ZJLA 4RWWA 1OYEA 3HVAA 3L3CA 2QO3A 3OFFA 1OYDA 1YK9A 1YJNS 3TA2A 3US5A 3MAHA 2XLKA 5K14B 1RE1B 3QO9B 1GXTA 3W5XA 2AYEA 4ZVFA 2V0NA 4IH5A 2R3VA 3SQOP 2M8DB 2XI3A 1F0XA 3GG1A 2RHQB 2BZ2A 4O3OA 1ITPA 2AJ0A 1GTEA 5KFWA 4WYLA 2G2OA 2LQ8A 1YHQS 1QE1A 3CEDA 1IR2A 3IBCB 4WIIA 1U1NA 4NLXA 3CCQS 1OWXA 3ET6A 1UCNA 2GFFA 1EETB 2VFTA 1A0OB 1MWZA 2UU9J 4DN9A 1S59A 2GVZA 4B3RF 2PA3A 2OH2A 4DS4A 3ILJA 4JV5F 4IFYA 3CJKB 3VVUA 1IBCB 1T3OA 3R7BB 1YZ7A 5K8NA 3CJ5A 3LH2S 3CNQP 2HQGA 2ZEJA 1DTQB 1WC1A 2XO7A 4ECSA 4DV2F 3N5BA 2DR9A 1S6UA 2I5JB 1REVB 4USKA 1DTTA 2Q66A 4DR7J 1RT1B 5D3GA 4J9OA 4WZMA 2OMOA 1S5ZA 2ZZMA 1NHKL 3OSNA 1X8DA 2ZE2B 4QYRA 4DL0C 3DKDA 1QVGR 1UETA 2R8JA 2CJQA 5IT0A 3Q8VA 4I0WA 1WOSA 1TUVA 5KT5A 2CDQA 2ZKUA 1IN0A 4MFBA 1XR7A 2ZBIA 2YVSA 2DH8A 1HMVA 4KH0B 3AOCA 4HYKA 2Q6BA 2DHHA 2HEKA 3MI7X 2IM3A 2B4OA 2HVIA 4MYUA 2B5JA 3C14A 5EHHA 3MMAB 3W5YA 2DNMA 2FVCA 1RKIA 4QIWD 1DFDA 5FDLB 2V8HA 5HI7A 5HLFA 5JVGQ 3T5LA 3CC4S 1RWPB 2DRDA 4DEZA 4MMOA 3CCWA 2K2PA 4ID5B 2MZQA 4F4ZA 4ZLLA 1RBLA 2B9EA 4ELUA 1ZPVA 3KNGA 4I2QA 4CM0A 1N36F 5E5NA 3MR7A 2UUWA 3BQ1A 4ZK7M 3RR7A 4KKOA 4Y6IA 5KG0A 2EC0A 2FY1A 1VBYA 2WK4A 4Y28C 4OHXA 1VRQC 2R7WA 3CCUS 2KM8B 2Z4PA 2LKZA 2J7WA 1HNIB 3TWZA 2L9DA 2ZZNA 2MPUA 5EWFA 4ECRA 3ZZYA 2V2QA 3FGVA 4F0KA 4ANDA 2KFNA 4GMKA 2UXDF 4V19J 2OFGX 3DRRA 2CWXA 1U26A 3M05A 4IO1A 3O8WA 1XMBA 3IFEA 2A2CA 4RUHA 3A4TA 3HZGA 2FD2A 2CNLB 2FLOA 2GAGC 2ASJA 4C48A 1DRZA 3OFHA 3V6DA 3LGMA 5KFYA 1Y9OA 3LWLA 4S0MA 3PYFA 4AXJA 4ZKAA 1RHJB 3V5RA 3HULA 2XQCA 2IVMA 3KMQA 2EEYA 1XQIA 1LWFB 1RTZA 4U8VA 4LF6F 1YZ6A 5K9FA 3MPUB 3SXLA 5CHCB 3TZYA 1NCLA 2XWYA 3J81U 5HATA 3VAGA 2AIRB 5I42B 1SJQA 1URRA 2BUNA 5T14A 1RHUB 2QC3A 1KQFB 4LUBA 3IWLA 2AJ4A 2DGOA 2AD9A 5A8WA 4LQ3A 2C28A 3IRXB 4DR5F 3Q86A 5DM6Q 4WK1A 3MR5A 2ZM6J 1VBZA 3J7YU 4CP5A 4DQIA 5E2QA 5E7OB 3MTJA 2QA1A 4JBCA 4CYUA 3OTDA 2IVYA 1H7XA 2ACMA 4N56A 1JJ2R 3R1HA 2HFOA 1FTCA 4AL7A 5C5JA 2H3EB 3MEDA 2HHVA 4DL3A 3UNYA 1UZDA 1T8EA 2W9BA 2BE9B 2VBYA 1BQNB 1VLYA 4E2FB 2UU9F 2RSQA 2GV1A 3CCTA 5LJ5Y 1X4EA 3IGVA 2XMAA 2P2CB 3AODA 1M5VC 2YKMB 3JYTA 4IDKB 1YSJA 2DXDA 3WC2A 3D6FB 2AMCB 3V2UC 3O3LA 4DL4A 5T7LB 4XTTA 1ZM2A 4CH7A 1X9MA 2V94A 2G0JA 5HQ8A 2OELA 4DV5J 2GVDA 1YQHA 2F63A 4L3KA 3RBDA 2VOPA 1FNOA 4LSNA 2DHAA 3KXDA 1ZA1B 3D6TB 1N5YA 2EFGA 4ZMMA 4K5RA 2W7OA 2D3OR 3QGGA 2MKKA 2M0GB 3DRPA 3IAM9 3D5MA 4DR3F 1VQNS 2W4DA 3LOUA 1GT8A 1BY9A 2AWZA 1U0SA 5KT2A 2NUHA 4QYZJ 5A8KA 2FJBB 3A8KA 3BGOP 2XM3A 4DLGA 1C0UA 2Y9HA 4F4WA 2KO1A 1CLFA 1FKAF 2PMZD 3FNNA 1HW9A 1DURA 3DOKB 1HPZB 2R4FA 2MJUA 2MKYA 3B4DA 2YWGA 2H4YB 2GHWA 1DQ9A 2CJBA 2MLZA 2IHR1 4LRBA 1XWLA 2GGPA 2GQCA 1NK5A 4MYTA 4P52A 2DH9A 5HVFA 3VAJA 1SKWA 3TX8A 2M7SA 4PZVA 4Q2LA 3HVTB 1RWVB 4OLOA 3IGNA 4FXWA 3DYAB 4M5KA 2BANA 4TKTA 2HNDB 2P6SA 3HSDA 3PTWA 1CBKA 3M1VA 3HFZB 5A0YA 1X4HA 2OGUA 4U9RA 1IKXB 4QR1A 4ZPVR 5EGYA 2H1YA 1BUXA 2XWXA 4XIUA 3GYXB 2DT9A 2N4CA 3RAXA 4NZ7A 4JOUA 1D0EA 2HQDA 4LF8J 2OFHX 1RWWB 4QPTA 1DLOB 4DSLA 1V3RA 2YH1A 1ZAVA 3CF5Q 2XS2A 2FDNA 5CZXA 1VJQA 2HVZA 4AE5A 1CVJA 2IFXA 1TAUA 4NLWA 2KB2A 2Z0GA 4LF9J 1IBMJ 1G4CA 2DR8A 4DU7A 3GMGA 4ZHRA 3SDEA 3MD3A 5DDOC 2UUTA 4HVZA 5GADI 2FVRA 4ZVUB 2E7VA 2YKOA 2U2FA 8ATCB 5J2MA 1Z2LA 4M8LA 5FLXU 4CNYA 3W9HA 3DLEB 2HG4A 2ROPA 4QWEA 5J2NA 1VQPS 4YB7A 2APOA 1U8WA 2JFDA 2PN6A 3HI9A 1JLAB 4LRCA 3CDUA 2MKHA 5C24B 5IM0B 1HI0P 1FVSA 4YB1P 2XULA 4PG4A 5KFTA 3N28A 1L3SA 2NXCA 2VD3A 2XSJB 3GIIA 3MMJA 4PQUA 1IM4A 2ZHBA 4DV4F 1CJKB 3G82A 3PJWA 2I2YA 4JI1J 4JI2F 3V81A 3MM6B 5D4LA 2O01C 1B3TA 1QUVA 4HDHA 2DHXA 3I96A 2CZ9A 2RQKA 4F36A 2H5IB 2YNGA 2M2BA 3QSYB 4ED6A 4K7QA 2HFVA 1VRUB 2C2DA 2POKA 1F6TA 4ZS6A 1N32J 2JC1A 1UJ6A 1S10A 2KT2A 3KK2A 2JZ5A 3K7RA 1NM2A 3TQ1A 4RUCA 3I5AA 2OEKA 2GIFA 1VHIA 2KXNB 4K4WA 2RD5C 5KFAA 3HJFA 1KC8T 2E44A 3J7ZT 3CUNA 2IRUA 4NCGA 4FPRA 2B9WA 3K57A 1IXKA 4NLYA 4TNOA 5K8MA 2KHDA
chains in the Genus database with same CATH topology
3HJVA 4QBUA 3TZZA 5CZDA 2PFFB 2CUYA 3TQEA 2VKZG 5DZ6A 3K89A 3TZWA 2C2NA 4RL1A 2QO3A 3SBMA 3IM8A 3PTWA 2VZ8A 3TZXA 1MLAA 3R97A 2JFDA 3TZYA 2G2YA 2UV8G 2QJ3A 3HHDA 2VZ9A 2G1HA 2H1YA 3H0PA 3R8YA 3BV8A 4RR5A 3IM9A 3QATA 5CZCA 2G2ZA 3RGIA 3CJ8A 1NM2A 3G87A 3EZOA 5DZ7A 2G2OA 3HMJG 2JFKA 2QC3A 2HG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJV A;  4QBU A;  3TZZ A;  5CZD A;  2PFF B;  2CUY A;  3TQE A;  2VKZ G;  5DZ6 A;  3K89 A;  3TZW A;  2C2N A;  4RL1 A;  2QO3 A;  3SBM A;  3IM8 A;  3PTW A;  2VZ8 A;  3TZX A;  1MLA A;  3R97 A;  2JFD A;  3TZY A;  2G2Y A;  2UV8 G;  2QJ3 A;  3HHD A;  2VZ9 A;  2G1H A;  2H1Y A;  3H0P A;  3R8Y A;  3BV8 A;  4RR5 A;  3IM9 A;  3QAT A;  5CZC A;  2G2Z A;  3RGI A;  3CJ8 A;  1NM2 A;  3G87 A;  3EZO A;  5DZ7 A;  2G2O A;  3HMJ G;  2JFK A;  2QC3 A;  2HG4 A; 
#chains in the Genus database with same CATH topology
 2HAF A;  5GMD A;  2V2Z A;  1P6T A;  3BKT A;  2GW8 A;  1SCJ B;  4CWB A;  2VIC A;  3CMQ A;  4ZP9 A;  4NCA A;  3NGT A;  2C3P A;  3MM5 B;  3G8T A;  1TKX B;  3DI6 B;  3C16 A;  4KGZ B;  4IR9 A;  2ZHA A;  4FF1 A;  4Z7C A;  2V34 A;  4WIQ A;  4YY3 F;  1IBL F;  2HWI A;  3CD0 A;  3B54 A;  2IMW P;  2F40 A;  2MHE A;  4CIO A;  4PG6 A;  1MG7 A;  3MDF A;  4RUA A;  5HRO A;  5KFO A;  2ZD1 A;  2CYY A;  1WD6 A;  4PUO A;  1FO1 A;  1SPB P;  4DQP A;  2OD6 A;  3OT9 A;  3QRR A;  3BSC A;  5F9L A;  5CZV A;  3MCM A;  3TVK A;  2E9Z A;  2IAJ B;  1P1T A;  3DOL A;  2MY7 A;  5KFE A;  2FJA B;  2CPF A;  3GIJ A;  2M88 A;  4ECQ A;  1CQM A;  1JLQ A;  2XEX A;  5DM7 Q;  2MXY A;  3VZH A;  5A2Q Y;  4O4R A;  2OTL S;  3PXG a;  3T1A A;  4GC7 A;  1BGX T;  1NJX A;  2AHO B;  3GV5 B;  4XDD A;  1VI7 A;  2IBO A;  1LW0 B;  4ZN3 A;  3MPW A;  2QMW A;  3OXL A;  3I4H X;  2O3D A;  4HI2 A;  4DLE A;  1UVI A;  1F2H A;  3NBP A;  3BO2 A;  3H59 A;  2XLJ A;  5ETT A;  1Z2Z A;  1EKR A;  3NGR A;  2KT3 A;  1UP1 A;  2PFD A;  2JEG A;  1HI8 A;  2X3G A;  4DCJ B;  3U02 A;  4GKK J;  4U7C A;  4UOC A;  2A6O A;  2CPE A;  4K8R A;  4OZL A;  3WHI A;  3QGI A;  3LWM A;  2HFZ A;  1E6V B;  3MM7 A;  2Z2Z A;  1B0V A;  3NMR A;  3JTN A;  4ZVO B;  4ER8 A;  4Y2A A;  2CQ0 A;  3E2E A;  2WBR A;  4G1I A;  3DFE A;  2N3L A;  5HVH A;  4U95 A;  1J5O A;  4E98 A;  1TKT A;  1SKU B;  1ROF A;  4ENO A;  2Z57 B;  2BE7 D;  5F3Z A;  4HHJ A;  1H3D A;  2BA9 A;  2W2M P;  5J2Q B;  1UKU A;  1UWB A;  3T1H J;  3M2V A;  3G86 A;  4ITS A;  3IM8 A;  4C0H A;  1SJ1 A;  2VG7 B;  4WJB A;  4A8Y A;  2UUA J;  4RW7 A;  2C1E B;  4NLV A;  1XMO F;  5B0B A;  2VFR A;  3G2X A;  2BYC A;  4ZA1 A;  4FKY A;  3TRG A;  3H40 A;  1XBW A;  2A3J A;  4Q2M A;  3EVW A;  2CXE A;  2Q43 A;  5A8R B;  3UR3 C;  4NYP A;  4WFN Q;  1YBA A;  3NEK A;  1V6H A;  1UA1 A;  3FMB A;  5GAG I;  1JMT A;  5LSR A;  3RYL A;  2H9Z A;  2P9C A;  2CWK A;  2XMT A;  3CJ3 A;  3QJL A;  5GAH U;  1H6K X;  4JI4 J;  2B43 A;  4LIR A;  3CJ8 A;  3AD7 C;  4I67 A;  3NP5 A;  4UOF A;  2HKE A;  4BHQ A;  4M5D B;  4C3M A;  1S49 A;  5DG7 A;  1APS A;  1WHY A;  1HIY A;  4GVL A;  3I6P A;  3RW7 A;  4USI A;  5JXS A;  2Y0S D;  3UQS A;  2PA8 D;  5H9E K;  3H0P A;  3W7B A;  4R0J A;  1TR0 A;  1RU1 A;  4DPY A;  1AUD A;  1S1T A;  2AX1 A;  2HHS A;  4AFF A;  3HD2 A;  1ICE B;  3OFG A;  3O2I A;  2KG0 A;  4FYY B;  4ED8 A;  1NO8 A;  4R8U B;  4Y3C A;  1W26 A;  4NLD A;  3KJV A;  1WC4 A;  2D41 A;  2BE2 B;  5EX3 A;  4DR4 F;  2RAQ A;  1Q86 T;  1GMU A;  4ZVR B;  1K9M T;  3P3D A;  2R7V A;  1HHQ A;  1F2G A;  2FHK A;  3KJQ B;  2JSX A;  3PRD A;  2OJ3 A;  4CM2 A;  5I3U B;  3MAQ A;  1YX2 A;  4DL6 A;  1YLX A;  1YRU A;  5F0U A;  5KFB A;  5KFI A;  2DR5 A;  1CS4 B;  3EMT A;  1XER A;  5D0E A;  2UZA A;  2JX2 A;  1H7W A;  2GHP A;  1RWM B;  5CA5 A;  2ROG A;  1FDB A;  4I6W A;  1PBU A;  2CG4 A;  1FRI A;  1EET A;  4WFB Q;  1EP4 B;  2R2T A;  1QAJ A;  2E1R A;  1LWE B;  4ECY A;  3I5B A;  1RI7 A;  3D0I E;  4PXC A;  1NBE B;  5DDR C;  3PG9 A;  3SI8 A;  4BC9 A;  1KRP A;  2J8A A;  3ZZ0 A;  4C4W A;  4NXM F;  3FQL A;  2MQM A;  1DAR A;  3QYY A;  4CO4 A;  5D4N A;  4KFB A;  4DV0 J;  4C8Y A;  1JLC A;  2GX8 A;  2CQG A;  2K3I A;  2DBB A;  3VVT A;  4B3T F;  3EVM A;  1RJJ A;  2VV5 A;  1VK8 A;  1FX2 A;  3VGT A;  1U0H A;  2YX1 A;  1HHT P;  2ZE2 A;  5GAH I;  2YWK A;  1BQM A;  2NPF A;  1U4B A;  2HNZ B;  2PII A;  2PMH A;  3CDE A;  2QA2 A;  4IQM A;  3QFH A;  5AE2 A;  3D54 A;  2J5A A;  5LMU J;  1H2U X;  1IUJ A;  2L9N A;  1XNR F;  2OTJ S;  5AXM A;  2HW3 A;  3L7U A;  2CPI A;  4C97 A;  3ITH A;  3KYL A;  2HNY B;  1NH8 A;  1S4F A;  5LMN F;  4ILL A;  1Q8L A;  1S12 A;  2K3K A;  4DV6 J;  4LSL B;  2MQN A;  3LGH A;  2H65 B;  3OL6 A;  5HAN A;  3JTO A;  2R7S A;  1SC1 B;  2QL7 B;  2IC3 B;  3G87 A;  2W24 A;  4X65 F;  1BHN A;  3BGF A;  1K73 T;  2HAI A;  2AJF E;  3WDO A;  4YS2 A;  1SUQ A;  4RBU A;  1JLE A;  3LP2 A;  2C42 A;  1DHM A;  4FPI A;  1KLM A;  1FKO A;  1LFW A;  5DG8 A;  3QID A;  2C2Z B;  4PPZ A;  3PEJ A;  3OD2 A;  1VS3 A;  4ZVE A;  1ARO P;  1NSP A;  2FLN A;  3GIR A;  2YH0 A;  3KLH A;  2GJ2 A;  1QSS A;  4DSF A;  1VDH A;  4JI6 J;  3UR0 A;  2ZH1 A;  5DJB A;  2CPH A;  2B56 A;  4B9L A;  4DV7 F;  2QIF A;  1T03 A;  4F02 A;  2CVI A;  4ILR A;  3SFU A;  4RU9 A;  2IPO B;  3QFW A;  1R7I A;  4M5G A;  2XGP A;  1S6Q B;  1T94 A;  5C7P A;  2UUA F;  3BYR A;  2YX4 A;  3BQ0 A;  3FVY A;  2N7C A;  4FZV A;  1PYS B;  2J0W A;  2Z2Y B;  2HBQ B;  1NDC A;  2JEI A;  2VUG A;  1U47 A;  2ZH4 A;  3IR6 B;  1TUG B;  3KLF A;  3OXG A;  4CTA B;  3HCX A;  4CLT A;  2XYP B;  2XY7 A;  4KSE B;  3MEK A;  1JLF A;  3P5B P;  2MTL A;  2R2S A;  3UDC A;  1N5V A;  2GZO A;  1OQ6 A;  4FVM A;  3JSM A;  2DRB A;  3HSJ A;  2I6W A;  4FN5 A;  3SSR A;  4PRF A;  4LMZ A;  4K4U A;  5CZC A;  3PW7 A;  2ZBQ A;  3Q83 A;  2W25 A;  1K0T A;  2OD4 A;  5DET A;  1WHW A;  4I68 A;  1VIO A;  3W3S A;  3PJ9 A;  2RJZ A;  3DDI A;  1FFW B;  2Z8Q A;  3MHY A;  3KKF A;  3HHK A;  4CLS A;  1FJC A;  3CMA S;  2CAJ A;  5AE3 A;  3J81 Y;  4ZPD A;  1SH0 A;  2H54 B;  3AH6 A;  4L73 A;  3D68 A;  4ATN A;  3TVY A;  3VGS A;  5I42 A;  1VQS A;  1NU4 A;  3NS7 B;  3IM9 A;  1HKA A;  3NMA A;  4A4J A;  4N7T A;  3DGV A;  3IRX A;  1VHF A;  4F3Q A;  2XYH B;  2V50 A;  4DV1 J;  1IR0 A;  1N6Q B;  4NCB A;  4Y34 A;  2GJF A;  1JJ4 A;  3GR0 A;  2IYG A;  4MKB A;  2JDJ A;  3E01 B;  3KK1 B;  1MU2 B;  4QIF A;  2VOD A;  1U09 A;  1Q1K A;  2UUB F;  4UY8 T;  2FHJ D;  2KI2 A;  2AJ2 A;  3ZZO A;  1REG X;  4EEY A;  2V4J A;  8AT1 B;  3KDN A;  5B08 A;  5KG5 A;  1D3W A;  1IKV B;  2Z58 B;  1N88 A;  2VG5 B;  1EZZ B;  2QE5 A;  1NB7 A;  1B7F A;  3QGP A;  5KG4 A;  4H54 A;  3UCU P;  2V4Q A;  2HIY A;  1HQE A;  3DRS B;  1CPZ A;  3N6M A;  4NZ0 A;  4K4V A;  1C0T A;  3AXM A;  2EFO A;  4ED7 A;  2BV3 A;  3GFX A;  2JC0 A;  3G71 S;  1J5E F;  2M4M A;  2NR0 A;  1PAU B;  1WOR A;  1KN6 A;  3CME S;  2W7P A;  4O4G A;  1TUW A;  3CD6 S;  4RR5 A;  2BAB A;  4M5J A;  1RQ0 A;  3N4W A;  2C3M A;  4NL5 A;  3TAN A;  3JXO A;  2ZC4 A;  3W65 A;  1KHW A;  2ATC B;  4KR0 B;  7FDR A;  3MM9 B;  5AXL A;  3GJS B;  4KO0 A;  1B0P A;  5E41 A;  5CAA A;  2BBE A;  3CC7 S;  2JLF A;  2PE8 A;  4JYA F;  5KFS A;  1NHV A;  2DRA A;  1OY9 A;  2BQ3 A;  3HP6 A;  1RT3 B;  7AT1 B;  1CUL A;  5C25 B;  2C22 A;  4DSJ A;  3OR1 A;  5KFG A;  3DOK A;  1RB0 A;  4M5H A;  4TY8 A;  2FC8 A;  4BS2 A;  3K0J A;  4NRT A;  3MEC B;  1L3T A;  2ZH5 A;  2BJ3 A;  1PCA A;  5F8I A;  3VAL A;  1FA0 A;  5BXI A;  2FIU A;  3VGU A;  1HA1 A;  3ZNJ 1;  4C8M A;  5DQG A;  1RAF B;  4TQR A;  5KFR A;  4OX9 F;  1K8A T;  4RW8 A;  3GFH A;  2YWW A;  3ETM A;  2DGS A;  2DGU A;  2ZBC A;  4DI6 A;  4DFM A;  2W1B A;  1P9Y A;  1T3N A;  2YWF A;  1UVJ A;  4DCP B;  1HR0 J;  2ADB A;  3JSR A;  3SCL E;  4YDX A;  3MMC A;  4QW9 A;  1SH2 A;  3N0V A;  3RBE A;  1VQ7 S;  4LF1 A;  4FF3 A;  2F8H A;  4MK7 A;  1NEE A;  1F5C A;  3CJQ A;  4OV6 A;  3KTQ A;  4CH0 S;  3AOA A;  1HQU B;  3SV3 A;  4I56 A;  1H38 A;  4IR1 A;  4FYW B;  1T05 A;  5BYR A;  4ED5 A;  4I6A A;  4HH1 A;  1JKH B;  3M2U A;  3CCS S;  3LAM A;  1SKS A;  4ANC A;  3CCE S;  1AUS L;  1LK5 A;  3AQO A;  3ISZ A;  2RIL A;  1XJW B;  1RK8 A;  2A2D A;  4LFC F;  2BKP A;  3VAH A;  1U24 A;  1YBT A;  3UN5 A;  5FLX Y;  3Q2S C;  3NNA A;  1ZTW A;  4IOC Q;  2EC2 A;  4EGL A;  1HNZ F;  4KJI A;  4C11 A;  2DNQ A;  2MKI A;  5L9X A;  3PEH A;  3LP1 B;  3LP0 B;  4O44 B;  3SQG A;  2YQ0 A;  2R8K A;  4OZ3 A;  5C42 A;  1RBA A;  4UST A;  1VJW A;  1TVR B;  2PI4 A;  4UUW A;  5J2P A;  3MFI A;  4KHM A;  2WTF A;  3KHR A;  3UFC X;  3DOM A;  2IIH A;  2ZVI A;  4ZPW R;  4L6V 3;  1TKD A;  3V4M A;  4MIW A;  4J7C A;  3BGL A;  1LV5 A;  5G0R B;  3MM6 A;  1V3Z A;  4JV1 A;  1FCA A;  3C6T A;  3NGK A;  3NWG A;  1I1G A;  4UUX A;  3EPI A;  4B3S J;  4DMZ A;  1RAB B;  3MCS A;  5D0G A;  2CDR B;  3U1L A;  2LXI A;  5IQQ A;  5LSL A;  3NXZ A;  1SJ3 P;  1HWL A;  5KFQ A;  3K59 A;  4HH0 A;  2IRX A;  2BOP A;  4UTG A;  5BR8 J;  5KFC A;  1U6B A;  2V2V A;  1TKZ B;  3R2C J;  3VTI A;  5AJ3 F;  2R2U A;  5KTQ A;  1SQF A;  1FRK A;  4GVB A;  3FZB A;  1S9G A;  2HHH F;  1Q5V A;  1Y4Z B;  1HWI A;  2CQP A;  4KGM A;  3CCJ S;  3PR4 A;  3CD7 A;  1TMM A;  2MHN A;  4DX7 A;  1GH8 A;  5DLF A;  2KZM A;  2B4U A;  2E1A A;  1SIW B;  1QD1 A;  4E0D A;  3JS9 A;  2CPX A;  5IXU A;  3NS5 A;  4YR3 A;  4AQY J;  4DUY F;  5KFU A;  1WC0 A;  1GXU A;  1JJC B;  2J9D A;  4DL2 A;  2D3Z A;  2GO9 A;  4XK8 C;  3IC1 A;  4OYO A;  2ZNY A;  4OMF G;  2KL8 A;  3HT0 A;  4LF4 J;  2YKN A;  3W2V B;  1N0V C;  2PDA A;  5C2G A;  2VKZ G;  4U7U K;  4OYX A;  1N5S A;  4RLE A;  4DPU A;  2OEM A;  1OIA A;  1WNE A;  3C6U B;  2HFN A;  3L09 A;  4B9N A;  2DPI A;  3G6V A;  2WAQ D;  1L3K A;  4Q0B B;  2VBX A;  1VFJ A;  2JWN A;  1NHU A;  2BEF A;  3KK3 B;  3GYN A;  2HSE B;  4YR0 A;  3IO1 A;  1KKH A;  3V4I B;  1O0P A;  4USU A;  4DOZ A;  3MXH P;  3J7Z 5;  4U67 Q;  4H4M B;  2RRN A;  4ZPT R;  4FS2 A;  1PJ7 A;  4QZV B;  1KD1 T;  1MRO B;  3D3C J;  2VHG A;  4ED1 A;  2VDI A;  4A46 A;  2VQE J;  4Y00 A;  3GE9 A;  2VJU A;  5IV3 A;  2QYG A;  2ZJP Q;  5IFM A;  2DHG A;  2ZKT A;  2QLF B;  4JI0 F;  3QWP A;  2K1R A;  3T6J A;  3UWT A;  2J9D E;  1VR6 A;  1B4S A;  2DEJ A;  2YX7 A;  4ID8 A;  3H98 A;  3H42 A;  2JRS A;  3QRP A;  3EGZ A;  1RT6 A;  4Y2K A;  4DHV A;  4JI3 J;  4O3R A;  1J2V A;  2W2N P;  2G4B A;  1ZS6 A;  2GJI A;  1M5S A;  1FK9 A;  1G2E A;  3S7R A;  4Q8E A;  1LXJ A;  2G9O A;  1MML A;  4EUV A;  3W61 A;  1ZOT A;  3IBW A;  4X66 J;  4QU7 A;  1JXV A;  4X4T A;  4W4M A;  4CLY A;  5HP1 A;  2VPW B;  3MM8 A;  3ZZR A;  3KLI A;  3ZTQ A;  1HNX J;  1DQ8 A;  3NCQ A;  4HLB A;  1UWA A;  3D67 A;  2RQ4 A;  1YBU A;  1I51 B;  4AUK A;  3M9N B;  4JUZ A;  3PKM A;  1VQM S;  1WEZ A;  1AZS B;  3E3X A;  3HHL B;  5ETM A;  4IFV B;  1WC3 A;  1GAO A;  3S01 A;  3MMB B;  1WC5 A;  4C2M A;  3LQV A;  3ZFV A;  2J9C A;  4A8S A;  4LF2 A;  3TX0 A;  1S1X B;  2XC9 A;  1EX8 A;  3AB2 B;  1WKK A;  2KYX A;  4TVA B;  4RO0 A;  1RLC L;  2ZDP A;  3PRB A;  3WZ0 A;  4V1A k;  2ZH9 A;  3MPD A;  5HBM A;  3WIU A;  3TNV A;  3EVO A;  3BSO A;  1ZAW A;  4WFA Q;  4IUF A;  1IKW A;  2X51 A;  1AA1 B;  3FSI A;  1F3F A;  3NLC A;  1KQG B;  3UPF A;  4IG3 A;  1FKP A;  2JEF A;  2GQQ A;  1X4G A;  4DUZ F;  2J0X A;  1HI1 A;  2M70 A;  1QAX A;  1RTH B;  2C2O B;  4EO6 A;  1S1W B;  2RVJ A;  2NXN A;  3IMQ J;  1IKY B;  4AMM A;  4OX8 A;  2WSF C;  1X9S A;  1WI6 A;  4PCQ A;  2E9T A;  5B0G A;  1TK5 A;  5DLG A;  4H4K C;  4Y2C A;  1H72 C;  4OFZ A;  4EO8 A;  3ZO7 A;  1X4B A;  5KFM A;  3PW2 A;  1HAR A;  4TU9 A;  2W8L A;  5KG7 A;  3CCR S;  1IR1 A;  3F0N A;  4OHV A;  2VFS A;  2C2E A;  2HPU A;  2KVI A;  2RQC A;  1T11 A;  4DSI A;  3LAN A;  1FRJ A;  3RUB L;  3CD5 A;  1CS4 A;  2MLY A;  4LBP A;  4M63 A;  2FJD B;  4Q45 A;  2QT7 A;  3P96 A;  3MGJ A;  2QFI A;  1TL3 A;  2FZG B;  1S48 A;  1Q79 A;  2IM1 A;  1VCT A;  5F41 A;  4DQQ A;  3QLH A;  3TQE A;  1VBX A;  4WE1 B;  1SJF A;  5H1S V;  4P2M A;  4CQ1 A;  1WHV A;  4MIA A;  4M5M A;  1C4C A;  2PO4 A;  4RNO A;  4DV3 F;  3OJU A;  4NI2 A;  1UFL A;  1RT4 B;  4I2P B;  2W7A A;  4X64 J;  3ZTP A;  3PYG A;  4DG1 A;  2EKY A;  5J1E A;  4KGV B;  1ZA2 B;  2CG8 A;  4NLR A;  3ILL A;  1VMB A;  1MN9 A;  2VZ8 A;  2E1M C;  4XDC A;  1R6V A;  5D4P A;  4BWM A;  3DGP B;  1FVQ A;  3DMJ B;  1PC5 A;  4UT4 A;  1OY6 A;  4AT1 B;  4K2X A;  4LIW A;  2ILZ A;  3CDA A;  3HO1 A;  5JUM A;  4RW9 A;  3PM9 A;  3KDO A;  3BV8 A;  2M3D A;  4B3M J;  1SV5 A;  5L1J A;  4LFA F;  1S1V B;  1FJG J;  4FS1 A;  1NSA A;  1AW0 A;  4AMO A;  1VRT A;  3RG6 A;  2HHW A;  4I7F A;  5IQ6 A;  3M8P A;  4PPD A;  3ILI A;  1RAH B;  2VON A;  3QAE A;  4UQT A;  1U1L A;  5M2P A;  2C2N A;  4ECW A;  3HHN B;  4KAI A;  3H4D A;  3L7P A;  2ZOF A;  1GXL A;  3Q22 A;  4L75 A;  3OVA A;  3BH7 B;  2HZC A;  2FB0 A;  4KB7 A;  4P2S A;  3H2U B;  1RTD B;  3H4B A;  3DXS X;  2HFU A;  3DU5 A;  2YNF B;  3OR2 B;  5DQH A;  2W9C B;  1S99 A;  3BGR A;  3RRK A;  3EDQ B;  4M94 A;  1PBA A;  2HHT A;  2FUG 9;  3M30 B;  4DR2 F;  3CIM A;  4NE9 C;  1JWW A;  1M5O C;  1SIZ A;  1RT2 B;  3R5C A;  1XNQ J;  3M6V A;  1IM6 A;  2F65 A;  3PZP A;  2BVZ A;  4HL9 A;  4TU8 A;  4EFA C;  1IWG A;  3R8Y A;  1NK0 A;  3PR5 B;  4QWB A;  3K5L A;  4LFB J;  1RT7 B;  4NAS A;  1RU2 A;  1IJF B;  5L1L A;  4RNH A;  4CTA A;  2IJN A;  3D28 A;  1RHQ B;  1NPK A;  4B9U A;  3AFG A;  2XY5 A;  4TU7 A;  3GJR B;  3N79 A;  1HBU B;  2AT1 B;  4RW4 A;  5AXK A;  1TL7 B;  1NH7 A;  4LBI A;  3RZA A;  5IV4 A;  2N3O A;  3L9Z A;  3PYD A;  1TL1 B;  4ZIW A;  3BM7 A;  3OSP A;  3A8J A;  3MR6 A;  1Y5L B;  3JSB A;  2PEH A;  2GQ2 A;  4PYA A;  2FHO B;  1RA6 A;  2I8E A;  3ONQ A;  2E9R X;  3U1N A;  2Q6C A;  1X4D A;  4D3H A;  1WOP A;  2LFV A;  1VQ6 S;  4NA3 A;  3UN3 A;  1WUU A;  1PO6 A;  1XTZ A;  3FSY A;  3QAU A;  2WBM A;  5HK4 A;  3GIK A;  2BRK A;  3EWG A;  2X1B A;  2DTJ A;  4Y2I A;  1FDA A;  4LF7 J;  3W66 A;  1R31 A;  2CVE A;  3K5P A;  3MAA B;  3W8P A;  2HRT A;  1TEL A;  1HBM B;  3SMZ A;  5EN1 A;  4YHH F;  3SCI E;  4ZVT B;  2XS7 A;  3DLB A;  2DY1 A;  5F8M A;  2ZIT A;  2V2K A;  5D8H B;  1BXN A;  5LT5 A;  2KXF A;  3EE3 A;  3TAM B;  3NAI A;  1N5T A;  3MUV P;  3MPV A;  2CJ9 A;  2DEI A;  4LJM A;  2CIM A;  3THT A;  1UL3 A;  4PG8 A;  5CYM B;  1QY7 A;  1YJT A;  2BDP A;  2MMY A;  2V9K A;  5EWG A;  3D0G E;  2RKI B;  4KGK A;  2E5L F;  5DGB A;  3M2R A;  4WWS A;  4OHZ A;  2WB4 A;  4B3O B;  3BSA A;  4IRD A;  4DL5 A;  1FRM A;  4NML A;  1FWK A;  4WK3 A;  4IRK A;  4V19 X;  1QM9 A;  2RF2 B;  3K5N A;  1FI4 A;  3DM2 B;  1X31 C;  2I38 A;  2RRB A;  3TUZ C;  4P2X A;  4C8Z A;  1HNV A;  1I94 J;  5KFL A;  2P6T A;  1DZ5 A;  3JAM U;  2HMI A;  4FKX A;  1C2P A;  3N01 A;  3HJV A;  3M8W A;  1MNE A;  1X7V A;  2OPS B;  2CPY A;  1NDL A;  3PY8 A;  2U1A A;  3D9B A;  2I0X A;  2VH7 A;  4WXW A;  3BB5 A;  2C2M B;  1EAY C;  5K20 B;  4OJG A;  1WHX A;  2WSE C;  1E6Y A;  3NGD A;  3POT A;  3PAC A;  4ICL A;  2MKJ A;  4TY9 A;  3F73 A;  3BO4 A;  1OO0 B;  4KGX B;  1FX4 A;  4A8X A;  4CRJ A;  2HVE A;  3FJ2 A;  2CPJ A;  3L4B C;  1W7W A;  1SH3 A;  4J9U E;  2CQI A;  5F3T A;  2UUC F;  3R3T A;  2JFK A;  4KQZ A;  2FJV A;  4U7U D;  4P72 A;  2B8Q A;  4UY8 5;  2F4V F;  1RAA B;  4OQJ A;  5DO2 A;  4KIA A;  4ZVS B;  1FEH A;  2VQF F;  4L3N A;  4QIE A;  2EWH A;  2DXF A;  9RUB A;  3HSZ A;  4FDF A;  1FWL A;  2XYG B;  4CO3 A;  4X4Q A;  2V67 A;  3S1T A;  3AD9 C;  5SUH A;  3FEY B;  4LF5 F;  2LMI A;  2J0S D;  4A8K A;  2WVD A;  1QE1 B;  3BGU A;  3P5T L;  1JLG A;  1LOU A;  2UXC J;  1WEX A;  4TLR A;  3Q24 A;  4N8N A;  3ET6 B;  1R0C B;  3CE8 A;  3CJR A;  4LR7 A;  3PDN A;  2WRM A;  3HZE A;  5E33 A;  4X2B A;  1HWU A;  4HHH A;  2GVZ B;  2Z2L A;  4N41 A;  4JI7 J;  4LT6 A;  4IFY B;  1N34 J;  1IBK J;  5KOX A;  1S77 D;  2LQ5 A;  4OYI A;  4OI4 A;  1JKH A;  5K8O A;  4DSE A;  1NJI T;  3GJT B;  3NG8 A;  5HQM A;  1DTT B;  1LWX A;  4NXN J;  4DX8 H;  5D3G B;  2Y8W A;  3VWS A;  4KHR A;  2VG6 A;  2DGX A;  2NPI A;  2NUU G;  4BCA A;  4ETZ A;  4BBY A;  3EDR B;  1NXI A;  1ZM9 A;  2ROE A;  4JI5 J;  2MZR A;  4AMP A;  3SSQ A;  2B8P A;  3EGW B;  2LEP A;  2AGP A;  4QBU A;  4ECZ A;  4F8R A;  4MFB B;  1WEY A;  4Z37 A;  2FQQ B;  3AXK A;  1QLN A;  3BN4 A;  2LDY A;  4RU2 A;  1G1X A;  5G0R A;  2B5J B;  3T1Y F;  3C14 B;  1QUP A;  3CGI A;  1CJV B;  4QR0 A;  3HD1 A;  2I9S A;  2EFV A;  1UPP A;  2KT5 A;  4AL5 A;  5HLF B;  4ES2 A;  2L3M A;  1WJ9 A;  4PWD A;  3W5Z A;  3W2W B;  3R9L A;  3PVX A;  2DGT A;  1N8R T;  2KRB A;  2V63 A;  4X62 F;  1QSY A;  2BXJ A;  2DNY A;  4USH A;  1FFS B;  3VHQ A;  2JVO A;  2OI2 A;  2FTR A;  2H5J B;  2D7S A;  4I2Q B;  4PXB A;  2DVI A;  4ECV A;  1CC8 A;  4NOH A;  2O67 A;  1SVD A;  1R8A A;  1JB0 C;  4KKO B;  2BMB A;  3KOA A;  4NA1 A;  1HNW J;  1JNR B;  2HBZ B;  1SJ4 P;  1MWY A;  2CQ2 A;  4K0K J;  2DNL A;  1EIY B;  2MLX A;  5MAO A;  3TUP A;  2HVD A;  1TZ0 A;  1D9D A;  1I6J A;  5H9F K;  3CTR A;  4ECX A;  3IWN C;  2YQ3 A;  4Y2M A;  1X0P A;  2QRR A;  2PSZ A;  2OPR A;  3R5A A;  2XY6 A;  3FFI A;  3DRR B;  1FEE A;  3QT7 A;  5IWA F;  3ENA A;  4DZD A;  3CXC R;  1RGV A;  3CT9 A;  2RS2 A;  1YJ9 S;  4DR1 F;  5F0W A;  3G4S S;  1ACM B;  1HWK A;  3BZQ A;  5J1P A;  3TA0 A;  1Q81 T;  2OSR A;  1LWC A;  1YJR A;  5E3A A;  2R2R A;  1UJ4 A;  3D66 A;  3N6N A;  1OS5 A;  3U1M A;  3LAL A;  5KG3 A;  3T19 A;  3V6D B;  1KHV A;  2ILY A;  1NDP A;  1HLW A;  3M8Q A;  2UV8 A;  1Y3K A;  1U1K A;  2QJ3 A;  5L9N A;  1WEL A;  4I4B A;  2ZH3 A;  1EAR A;  3BS9 A;  3FRY A;  1A7G E;  3Q8P B;  4AXI A;  4EZ9 A;  2VL1 A;  2WSC C;  1KVK A;  4EBE A;  3PHE A;  3KLE A;  4H4O A;  5F8L A;  3U27 A;  1LW2 A;  2KRR A;  3KFW X;  2XZT B;  1CJT A;  4H4M A;  3WX4 A;  1U1Q A;  1RSC A;  1M5H A;  3A12 A;  2V9W A;  2IMO A;  4NLS A;  2ZVS A;  1S9E B;  4YDD B;  1QVF R;  1KWM A;  2D74 B;  4RL1 A;  1FDD A;  1MMN A;  4NMX A;  4MKV A;  5A8W B;  4RZR A;  1GTH A;  4JP8 A;  1JXL A;  4DR6 J;  5IC6 B;  4OZN A;  5E3Q A;  2GIR A;  4OLP A;  5KFF A;  2C3Y A;  2DGQ A;  4MJK A;  3OTO J;  4G6V B;  2LXU A;  3CDB A;  4XPC A;  5IZH A;  4GO5 X;  3CJ0 A;  3H90 A;  5D0R A;  3T5H A;  4CYU B;  4GKJ J;  1T9V A;  4MK8 A;  2Z56 B;  2HBY B;  1G6B A;  2R8I A;  2H51 B;  4USV A;  4RNN A;  3OTB A;  1WKL A;  1HQ2 A;  5EWE A;  4YR2 A;  3KG1 A;  1YWX A;  3MED B;  2RU3 A;  2EBE A;  4EYH B;  3DHW C;  4WF9 Q;  4FNI A;  1NJW A;  2W9B B;  2VU5 A;  1FD8 A;  3OFE A;  4UOH A;  1WSR A;  5HSP A;  3JYT B;  4ALZ A;  1N33 J;  3HKW A;  3CCL S;  2LEA A;  4ZOS A;  1KR4 A;  5KG6 A;  1RTI A;  2R7X A;  3TP2 A;  1LQ9 A;  3BSN A;  1U6Z A;  2RQM A;  3IXQ A;  2RUG A;  3D1H A;  1YJW S;  2ZH6 A;  2JVR A;  3M32 A;  3A3P B;  1UVL A;  2Y1I A;  1NZ8 A;  5AE1 A;  3I56 S;  3I0S A;  2NS1 B;  2DNO A;  2HK3 A;  1A6L A;  3AT1 B;  4KY3 A;  4WYW A;  1N5Y B;  4ZPC A;  4DSK A;  3QNW B;  2CAD A;  4DR7 F;  4BC7 A;  4LVN P;  5GAD U;  4I1T A;  3DRP B;  4KPY A;  2V8P A;  3M8R A;  3RB3 A;  2FJX A;  5I3Q A;  2QLB B;  3OL7 A;  3FUY A;  3MFH A;  5A8K B;  1IQZ A;  4LRD A;  4GRS A;  1C0U B;  2DGV A;  3MEE A;  5IT9 U;  3J7A N;  2XBP A;  5GAE I;  1U2F A;  2F8E X;  2MDA A;  1CJU A;  2BR0 A;  2F3J A;  3SBM A;  2OPP A;  1GX6 A;  2R7O A;  1MW7 A;  1FFG B;  1RTH A;  3D4J A;  1S1W A;  2XMM A;  2H5E A;  2P5V A;  4DPT A;  3EYZ A;  4HAC A;  1IKY A;  2DNK A;  4F04 B;  2GGP B;  1D1U A;  3PX0 A;  1F1B B;  1R8H A;  2V8V A;  2LA4 A;  4P10 A;  3DHX A;  1RAO A;  1U1O A;  4ECT A;  2DGW A;  5LXR A;  2KFY A;  3GV7 B;  4KT0 C;  4OI2 A;  1JXE A;  1JX4 A;  2UVV A;  3RRH A;  3TEG A;  2G0C A;  2BAN B;  4YB5 A;  2XLI A;  1S1U A;  1Y10 A;  1RTJ A;  5A0Y B;  4PXD A;  3FBF A;  2BQR A;  3NY0 A;  4HT7 A;  2XCP A;  3ZZP A;  4HDG A;  6FD1 A;  2WVB A;  5D0H A;  1RT5 B;  1LNQ A;  4X4U A;  3CB4 A;  4G1Q A;  1T9T A;  2AJ1 A;  4Z7Y A;  3FEZ A;  3CO0 P;  3KLV A;  2J7U A;  3CPW R;  1X5P A;  2N7Y A;  1S0V A;  1P8G A;  4BWJ A;  3I0R B;  3FCW A;  2ZOG A;  1Y0H A;  4WFX A;  3R97 A;  4ZHR B;  1RWK B;  3SDE B;  2V8D A;  3WQP A;  1AB8 A;  5L1K A;  1XN9 A;  3FCH A;  4ZP6 A;  5J1N A;  3QIP A;  2BQU A;  3GV8 B;  1EHW A;  4IG0 B;  5J2M B;  2O1P A;  1V3S A;  2GIQ A;  3K89 A;  2AKW B;  2K8G A;  2VF3 A;  4JI8 J;  4OHY A;  2HQI A;  2Q3P A;  1NJY A;  1S6P B;  1N52 B;  7FD1 A;  2FHJ A;  4X4O A;  1S79 A;  4QW8 A;  3KJN B;  1UA0 A;  2XNQ A;  2E29 A;  2YNH A;  2ALZ A;  2D69 A;  4OYW A;  1OSD A;  2KXH A;  3CCZ A;  1HFE L;  1F3V A;  4KBI A;  3X1L B;  4PQU B;  4ZVP B;  4LQ9 A;  3OUY A;  1XMQ J;  2SXL A;  4ZCK A;  1DBD A;  4J9L A;  4W98 A;  3AOB A;  3FRZ A;  2EK6 A;  4MK9 A;  4QIV A;  1F9F A;  5CH7 B;  1T02 A;  2YNG B;  2VC0 A;  2BOA A;  1SQE A;  1N0U A;  3DDN A;  2CA9 A;  5CYQ A;  5DS7 A;  3KK2 B;  3CC2 S;  3LA0 A;  1JNZ B;  4G65 A;  3NL0 A;  2Y1L B;  1FHT A;  3JQJ A;  3UDE A;  4J9M A;  2NZ4 A;  2ZM6 F;  3K17 A;  5DRK A;  3G6X A;  2LVW A;  4NCG B;  4DL7 A;  3QQC D;  2J6U A;  1WF1 A;  4O0N A;  3PNI A;  2QLW A;  1K1Q A;  1MLA A;  3PRV A;  4DPX A;  2YKQ A;  4C8N A;  2HLU A;  5HMX A;  4ERD A;  2C3O A;  1NND A;  3OL8 A;  2RUS A;  4ZJO A;  3Q23 A;  3TR5 A;  4P71 A;  4Q7A A;  1IJE B;  1KFS A;  3DDK A;  2ZUG A;  3C46 A;  2UVR A;  2XMU A;  2XMV A;  4B3R J;  4L72 B;  3Q8R B;  3KG0 A;  2BJ1 A;  4JV5 J;  3D0H E;  4ZCM A;  4O3P A;  5F8N A;  2HK2 A;  2DCL A;  2WON A;  3JB9 k;  3OXF A;  3FBC A;  4OYA A;  4DV5 F;  1NZA A;  1WDD A;  5HRO B;  3LTO A;  3Q2T C;  2ZD1 B;  5ADZ A;  3IS9 A;  1S4E A;  4DV2 J;  4PUO B;  1JK9 B;  3CJT A;  2DYA A;  1VGY A;  1TL7 A;  4HTJ A;  4FXD A;  1WOO A;  5T41 A;  3HX9 A;  4URS A;  2UVU A;  3JTP A;  4URG A;  4TYA A;  3R27 A;  1SL1 A;  1UMJ A;  2E5H A;  3DOL B;  5GAG U;  4DWI A;  3M8Z A;  3H8Y A;  1X5S A;  2RDI A;  1JLQ B;  2QZ8 A;  3CIZ A;  3IWX A;  3SCK E;  1FNM A;  1HBO A;  4PXE A;  2PT0 A;  3KHL A;  3H20 A;  1WF2 A;  3C15 A;  3LF0 A;  1VQL S;  1GNK A;  5L1I A;  3DXB A;  3CO9 A;  3NBP B;  1RLD A;  1U2C A;  2OPQ A;  1T0T V;  1R8B A;  4ETX A;  4NWB A;  3NKY A;  1VQK S;  2XB2 D;  2EG2 A;  5B0E A;  2N4D A;  2F9J A;  4NYZ A;  1PSD A;  1VC6 A;  2CJX B;  4ZCL A;  2BKN A;  4Q43 A;  3IR5 B;  2WOM A;  5I3P A;  3MM7 B;  2IDE A;  5IOL A;  2DNR A;  4CNZ A;  1SB6 A;  1HBM A;  5IC4 B;  3FZ2 A;  4O3S A;  1M1G A;  3JQM A;  2HFS A;  1CC7 A;  1N36 J;  1SQG A;  4HEA 9;  1C1B B;  4RW6 A;  3M7V A;  5LOQ A;  1J5O B;  4J91 A;  4C0O C;  1TFY A;  5H9E J;  2XCA A;  2VAS A;  5EUH A;  3MR3 A;  1NDK A;  1UWB B;  1N54 B;  3M2V B;  4B9S A;  2ZWP A;  2DNG A;  3FBE A;  4PR6 A;  3FCV A;  2AQ4 A;  1S0O A;  2ACY A;  1H98 A;  4KE5 A;  4C9D A;  3KMS A;  2RKI A;  4LF8 F;  2LU1 A;  4QJV A;  3GB0 A;  3R6G B;  1FJ7 A;  3Q8S B;  3C8Y A;  2UXD J;  2CZ4 A;  3VQS A;  4DJB A;  3TJA A;  4LF9 F;  2KJW A;  1RUS A;  2QSF A;  1IBM F;  1T95 A;  2F4F A;  2MST A;  4DFK A;  4CLP A;  2PC6 A;  2J6S A;  3JAM Y;  3DLJ A;  2XZD B;  4D3G A;  3FKB A;  5D78 A;  1YGY A;  2HHU A;  3UNG C;  2MGZ A;  2DIV A;  1R8C A;  2HRY A;  3CWJ A;  2YNI A;  3UVJ A;  4ELT A;  3EZO A;  2WVE A;  4LBH A;  2QMU B;  4CO0 A;  4LF6 J;  1U6F A;  3AQP A;  2M9K A;  3RBX A;  3RB0 A;  4IH7 A;  4R0E A;  4R5P A;  2MEW A;  3DLK A;  3ISN D;  3N5F A;  3EGV A;  5ETP A;  4JI1 F;  3HFK A;  1S1T B;  3HHD A;  4J5O A;  3CJ4 A;  1S9F A;  3FBB A;  1T7P A;  2G2Z A;  2DO0 A;  3EIC A;  1W25 A;  2IA6 A;  3W8G A;  2NYI A;  3KJV B;  5K14 A;  1N32 F;  1RAG B;  3QO9 A;  4FF2 A;  4QOT A;  3MUR P;  2GNK A;  3O44 A;  4DR5 J;  1EKS A;  3R7N B;  4W90 B;  2LEB A;  2LLZ A;  2ATL A;  4OZ0 A;  3N6L A;  1PYO B;  1HL6 A;  2MQ8 A;  2C3U A;  3QZ7 A;  3MF5 A;  2MZS A;  3MD1 A;  2O66 A;  1IQT A;  3NRB A;  2RU9 A;  4PQA A;  1Q95 G;  2ZFH A;  3ZTR A;  3JSY A;  4B9M A;  4P73 A;  4F2R A;  4ZVG A;  3EUN A;  4UZC A;  3G9C A;  2B4P A;  4QWA A;  2OML A;  2B0G A;  5B0C A;  1KEK A;  5CD4 H;  4RNM A;  3B78 A;  2DB1 A;  4P7V A;  2QEX S;  4KFB B;  2EFQ A;  3CJK A;  3ENQ A;  1BWE A;  3MOZ A;  2RB7 A;  4NLG A;  2V8G A;  5ETR A;  1FDN A;  1JLC B;  2HQF A;  3WIV A;  3BYP A;  3IP0 A;  3SSS A;  3UDV A;  1DTQ A;  4HTI A;  3CJ2 A;  1AYE A;  3P6Y C;  1NUE A;  2V4R A;  3D3B J;  2I5J A;  2ZZT A;  1REV A;  2UP1 A;  1U0H B;  2IBK A;  2DIU A;  1BQM B;  1RT1 A;  2CQC A;  4DR3 J;  5K5M A;  1QJH A;  3OLA A;  2RT3 A;  1YJ7 A;  4DUT A;  2DHS A;  2AEF A;  2ADC A;  4WP9 A;  4N5S A;  2DIS A;  3ITH B;  1FWP A;  2B4V A;  1F9H A;  4OYM A;  2JOQ A;  4RBV A;  4P2F A;  1PJ6 A;  1U7L A;  4YOE A;  1VOM A;  1ZM3 A;  2V68 A;  1CJV A;  5DGA A;  4NPO A;  3ZZU A;  2PEB A;  3M6W A;  2W8K A;  3Q8Q B;  3KLG B;  3W2W A;  4CLW A;  2NSB A;  4GKK F;  3MMA A;  2LA6 A;  5FDL A;  1SUQ B;  2NXU A;  1JLE B;  3LP2 B;  1KLM B;  1X0F A;  1FKO B;  1QSL A;  1LK7 A;  3DU6 A;  2BRL A;  2FLP A;  4K4Z A;  3MCN A;  5FJ4 A;  4ID5 A;  4PWU A;  2YXL A;  3HHL D;  4F7V A;  3RW6 A;  5L38 A;  1R6Y A;  5CAB A;  4OYP A;  4F4A A;  3KLH B;  3QJJ A;  1KVI A;  3H2L A;  3PFE A;  5KFV A;  4EK2 A;  2NSC A;  2MQQ A;  1TAQ A;  2ZJQ Q;  1T03 B;  3T3F A;  3PIO Q;  3OTE A;  1HNI A;  3T1H F;  4NLU A;  3GFZ A;  2EPI A;  5E3C A;  1SKR A;  1SC4 B;  4KTQ A;  2C2K B;  3KLF B;  1Q78 A;  3N9U C;  4MKA A;  2B6A B;  4PG5 A;  1JLF B;  4K4Y A;  4ECU A;  4A47 A;  4DXL A;  2DKO B;  2JNJ A;  3JSM B;  4USW A;  2AGO A;  1FE0 A;  2CFX A;  2QX0 A;  3NS6 A;  2HUR A;  2M8H A;  4UW2 A;  2VA2 A;  4JI4 F;  1PKU A;  2CQB A;  2GMJ A;  2XMK A;  3C66 A;  5DZ7 A;  2VDH A;  3GIL A;  1S72 S;  5BJR A;  1YIT S;  1CEZ A;  3OTC A;  2KYZ A;  4OI1 A;  4DV4 J;  1LWF A;  5DDP C;  3K58 A;  3SYZ A;  2RS8 A;  2YWH A;  1S9E A;  3TAR A;  2HS0 A;  3RR8 A;  4JI2 J;  5B0D A;  4FXV A;  4FNH A;  2WVC A;  5AXN A;  4DF4 A;  2CJA A;  3H7H B;  2HVH A;  2ZH8 A;  1NPP A;  3W60 A;  4CT9 A;  1RYS A;  2C2R A;  2QLX A;  5ETS A;  2CQH A;  4OJ1 A;  3ILO A;  2G2Y A;  3BPS P;  4PYD A;  1RCO B;  2NXE A;  4USJ C;  3H5Y A;  3RGI A;  2QFJ A;  3W64 A;  1RWU A;  2KG1 A;  3BJY A;  5CZD A;  3HK2 A;  4F50 A;  1KVJ A;  2HS4 A;  2V4J B;  4OYZ A;  3GU0 A;  4DF8 A;  2LQB A;  2R9L A;  2D3U A;  3AA8 A;  1UEV A;  3BPD A;  1SBR A;  2YWE A;  2FPH X;  3G96 A;  1ZBT A;  1BQN A;  3DLG B;  4EI2 A;  1HQE B;  3I31 A;  5KFK A;  4DFJ A;  4F26 A;  1C0T B;  1YKW A;  1R0A B;  2AF6 A;  2YKM A;  3GIM A;  2VA3 A;  4IDK A;  3H5U A;  4A8F A;  4YY3 J;  5DQI A;  1IBL J;  2A0F B;  4O4G B;  3VZI A;  3ZXW A;  5T7L A;  4UOG A;  4FBT A;  4XPE A;  4DV0 F;  3QZ8 A;  3MUT P;  1Q8K A;  4PEO A;  1FF2 A;  3B4M A;  1X4A A;  4NLP A;  3AJ2 A;  1MSW D;  4KO0 B;  3IR7 B;  3R5J B;  1VQ9 S;  2OKQ A;  3HLU A;  3S8S A;  3BBC A;  2JL9 A;  4LRA A;  4DN0 A;  3THV A;  5JMN A;  1S7H A;  3BR8 A;  3MEG B;  5LMU F;  4ES3 A;  4MTP A;  5KT3 A;  4Q8F A;  1RBO B;  2WW4 A;  3D6M B;  2D9O A;  3Q0A A;  5IT9 Y;  1CUL B;  1UTA A;  3U7J A;  4F4Y A;  3QPI A;  3B6B A;  3OR1 B;  5ITH A;  2EXU A;  3IBF B;  1O51 A;  4O3N A;  1HD1 A;  4TY8 B;  1ZET A;  4O3Q A;  1U25 A;  4DV6 F;  2VKR A;  1FER A;  2WB1 D;  1O6X A;  4RBT A;  2KM8 C;  2ZOM A;  2CNO B;  1R8P A;  1HPZ A;  4LRE A;  2QTW A;  4C0B A;  3ZZT A;  2XSF A;  2HYI B;  1A9N B;  3J7Y I;  2YQ1 A;  3G6E S;  4RW8 B;  3HSG A;  2RNE A;  1TTH B;  1C4A A;  1UFK A;  2AZ3 A;  1Y5I B;  1T9Y A;  2MQL A;  4UF4 A;  3HVT A;  2QYC A;  2QGF B;  3DYA A;  3MMC B;  1T9U A;  3QAT A;  3ZZZ A;  1UEK A;  4N77 A;  5EX0 A;  4JI6 F;  2HND A;  1RT5 A;  3TO8 A;  2AU0 A;  1BD6 A;  1IKX A;  2QMX A;  5LL6 d;  4J9S A;  2G13 A;  4QYZ K;  4U6P A;  1FXD A;  4EBC A;  2ZWO A;  1T05 B;  3NGU A;  2MQP A;  1W2I A;  2R7U A;  2COL A;  3M2U B;  2OSQ A;  1DLO A;  5KG1 A;  3I0R A;  4Z2X A;  1YJU A;  1XMO J;  2DNP A;  4DU8 A;  3KUH A;  3T5K A;  2E7W A;  3F44 A;  3QSI A;  3IRW P;  2DCU B;  2ZJR Q;  4CDI A;  1UVK A;  3E51 A;  4IG0 A;  2DK2 A;  3VGV A;  1CQN A;  4J9V A;  2WVF A;  1VQ5 S;  3PW5 A;  4C11 B;  2EVZ A;  1S6P A;  4F3M A;  5JJB A;  4Y0F A;  3A1Y G;  1T9W A;  2L9W A;  2HIQ A;  3SQG B;  1B70 B;  1NJZ A;  1VLO A;  2G1H A;  2D1C A;  5C42 B;  3DLE A;  2KZZ A;  4F4X A;  1D9A A;  1YJV A;  3VV2 B;  1TU0 B;  3E8O A;  5J2P B;  2VJV A;  1CSJ A;  1KOH A;  2XHC A;  2B7C B;  4TLQ A;  1JLA A;  3GZ7 A;  3BDE A;  3DOM B;  1ZZN A;  1BLU A;  1RAI B;  5C24 A;  5KFP A;  5IM0 A;  2J7K A;  2A18 A;  1V9O A;  1K47 A;  2XSJ A;  1UW4 A;  3C6T B;  3GSI A;  1CJK A;  2FVS A;  2CZV C;  5JVH Q;  1OSC A;  2HBR B;  1GMW D;  2EW9 A;  1KQS R;  1P9Q C;  3VR1 A;  3VCD A;  1HYS B;  4JV2 A;  4YEA A;  1VRU A;  1WG1 A;  3GP9 A;  2J6T A;  4DR4 J;  1RIS A;  3J7A 1;  1ZTT A;  4HHU A;  4KHP J;  4YB6 A;  3THP A;  4DV1 F;  1WC6 A;  2BKO A;  2KU7 A;  5KAK A;  3QJP A;  1RKJ A;  1OY8 A;  4GVB B;  1S9G B;  3GCX P;  1RAC B;  1RYR A;  3ETO A;  2HGN A;  3VAI A;  1KTV A;  3TAP A;  2V5H G;  3PO4 A;  2LYV A;  1S7I A;  1KSP A;  2CUY A;  4F0M A;  2OUG A;  4IOB A;  4EBD A;  3NWR A;  3PKY A;  4X4S A;  2RML A;  2ASL A;  1GMV A;  2MZ1 A;  2HWT A;  4QR2 A;  3MM5 A;  4MAK A;  2CJY B;  2FGC A;  4WFY A;  1N4L A;  1Q4R A;  2VBZ A;  1TKX A;  1OQ3 A;  4CLU A;  3DI6 A;  3FC9 A;  1BWV A;  3TYT A;  3TZZ A;  3RBZ A;  4NXM J;  1YRX A;  2YKN B;  2GO8 A;  1XR6 A;  1VYA A;  3GSD A;  2NLW A;  4G1P A;  2Y1R I;  4B3T J;  3BH6 B;  5RUB A;  3QT6 A;  3M8S A;  1QTN B;  2OAU A;  3DNC A;  1WSV A;  3WC0 A;  2QA4 G;  2Y0B B;  5E3P A;  5CD4 A;  3FSX A;  3HMJ G;  2X3D A;  2NRE A;  4TXS A;  3QBC A;  2FC9 A;  1SC6 A;  2IAJ A;  4CO1 A;  3PW4 A;  4I6Y A;  2QV6 A;  4N8O A;  1DAX A;  1XNR J;  3W63 A;  2CNK B;  5HVG A;  3OPK A;  3CVK A;  5LMN J;  3NOC A;  4OYB A;  2HLT A;  4QIG A;  4MH8 A;  1LW0 A;  2UV8 G;  4HI1 A;  1L5U A;  4A8W A;  4P74 A;  4DQS A;  3I9Z A;  2W4C A;  5HMZ A;  4U96 A;  3TUJ C;  2QLJ B;  2K1R B;  5KFN A;  4X65 J;  3TJ9 A;  1S97 A;  4I64 A;  1NKC A;  1X5T A;  1NK6 A;  1RT6 B;  4ZLJ A;  3MCO A;  2UVW A;  1R3N A;  1E6V A;  4AL6 A;  3HM9 A;  1C1B A;  4A48 A;  3QGH A;  5KFJ A;  1FK9 B;  2BJ9 A;  2RDJ A;  1VC5 A;  3X3U A;  5HQL A;  1HR0 F;  1RXO B;  4OX6 A;  2P8I A;  4FP9 A;  3AA9 A;  1GK8 A;  3HVR A;  1Y00 A;  2RIJ A;  2G1D A;  1Q16 B;  5DZ6 A;  1X60 A;  2CNN B;  5HP1 B;  4DV7 J;  1VQO S;  2XZW A;  1KNZ A;  2Q79 A;  2WCX A;  3MM8 B;  3KLI B;  4KH1 B;  4ZJQ A;  1SL0 A;  1ULR A;  5J2Q A;  3UO0 A;  3PX4 A;  3FDS A;  1FD2 A;  2VG7 A;  2Y8Y A;  1GX5 A;  3CW2 C;  3OLB A;  1LEO A;  2Z2M A;  4PAA A;  2GML A;  2CJK A;  3EZU A;  1NB2 A;  2BM0 A;  3ICL A;  3BO3 A;  5KFX A;  4IYQ A;  1S57 A;  1ZH5 A;  5A8R A;  1NSQ A;  2EI5 A;  2VB6 A;  1WF0 A;  1EJ7 L;  2HZV A;  1Z1Z A;  1ZPW X;  2W01 A;  1PIE A;  5HBM B;  1VC0 A;  5D15 A;  4UZB A;  5E3R A;  1I3O B;  2Q1L A;  2VFV A;  3A8I A;  1IKW B;  4KC5 A;  5M2U A;  2FVP A;  2DD8 S;  4RNF A;  4M5D A;  2YTC A;  4IG3 B;  1Y3J A;  3M6U A;  1FKP B;  3A3N B;  4YQW A;  2FLL A;  3QMQ A;  2K06 A;  4FBU A;  3NNH A;  2AZ1 A;  4B3S F;  3R5D A;  4DCO B;  2JJ4 D;  2A1B A;  5CCL A;  4R8U A;  4KHP F;  2J76 E;  4ZDN A;  4YP3 A;  3RB4 A;  3LO3 A;  4DZ6 A;  1R89 A;  2BE2 A;  4KV8 B;  2IRY A;  4C3L A;  4A8Q A;  1W2B R;  1PAE X;  1GQE A;  5BR8 F;  2B9Y A;  1QAY A;  3HPO A;  3G8S A;  3K8W A;  1PJ5 A;  5I3U A;  2KHC A;  5C2C A;  2UUB J;  4M5N A;  1UVM A;  1TL3 B;  4W92 B;  3M9M B;  3QLH B;  2QN6 B;  2X1A A;  3PO5 A;  1EP4 A;  5DDQ C;  2EK1 A;  3BF4 A;  3LAK A;  1B64 A;  2PD1 A;  3VQT A;  3DLH A;  4AQY F;  1LWE A;  4F2S A;  3R7S B;  2VPX B;  3CCV S;  5HAO A;  4HKQ A;  1J5E J;  4NI2 B;  1OMS A;  4LF4 F;  4A8M P;  4QCL A;  1NAQ A;  4DG1 B;  2FY8 A;  1WG4 A;  2EBG A;  3T41 A;  5J1E B;  4OI6 A;  4B9T A;  5ETQ A;  3IG1 B;  5AT1 B;  3BBB A;  3DLL Q;  1P1L A;  4I69 A;  5GMK a;  1AT1 B;  4OJ3 A;  4OZ5 A;  4J9K A;  2GC8 A;  1EQ0 A;  4LSZ B;  2F9D A;  3G6Y A;  2FJE B;  4JYA J;  4K4T A;  2HNZ A;  5LXY A;  2QL9 B;  4J9Q A;  4DPO A;  3I5C A;  4B17 A;  3MZI A;  4WZQ A;  3FEX B;  3UE2 A;  4WXO A;  1K0V A;  4RW9 B;  1C1C B;  2NXJ A;  3SEO A;  1MMD A;  4USM A;  2CRL A;  3F41 A;  2IM2 A;  1K1S A;  2XMJ A;  2EFN A;  3UDL A;  2FYX A;  3AY0 A;  2HNY A;  1SV5 B;  1VQ8 S;  4FYD A;  5D77 A;  2VQE F;  3GCW P;  2BW2 A;  1VRT B;  2JLE A;  3I9V 9;  3R1L A;  3J81 j;  4YUD A;  4LSL A;  4F0H A;  3KLG A;  1Q5Y A;  1HBN B;  1JIH A;  4I7F B;  1V5I B;  3RTV A;  3M8P B;  1IWA A;  1F5B A;  2J8S A;  2IC3 A;  4WKY A;  3PIP Q;  2E5I A;  4OX9 J;  3KHH A;  1X4C A;  5K8P A;  5SZT A;  3FK4 A;  5BYS A;  1NPR A;  2DH7 A;  4EYI B;  3EXY A;  1NK8 A;  3D2W A;  4JI3 F;  3GLJ A;  2K7K A;  3PJX A;  4IQX A;  3NGS A;  2RRA A;  2PI5 A;  1F5A A;  3BGR B;  3TI0 A;  5ETV A;  6AT1 B;  3PFO A;  1NRK A;  1NKB A;  1FT8 A;  2XI2 A;  2HHP A;  3TZX A;  4X66 F;  5IS2 A;  4NRU A;  4NZ6 A;  1DY3 A;  3EXC X;  2LEC A;  4P9S A;  1HNX F;  2F8M A;  1S6Q A;  5A6W A;  3EM1 A;  5A6P A;  1O8B A;  1FES A;  3JQK A;  3K5M A;  2QL5 B;  3DN9 A;  2B6A A;  1RWO B;  4MT1 A;  4DFP A;  4RW4 B;  5F8G A;  5D4O A;  5DG9 A;  1FRX A;  3R6L B;  2JEJ A;  4LFC J;  3OHA A;  1S0N A;  4QWC A;  1VQY A;  2VOO A;  4ED0 A;  2FVQ A;  2XMW A;  2F5G A;  1HNZ J;  4M95 A;  1X5O A;  2W2O P;  1TFW A;  1JLB B;  3I55 S;  4QWD A;  3M8Y A;  3KNA A;  2OP5 A;  3EJM A;  2P9E A;  4QPX A;  2AYM A;  3AAW B;  2HRU A;  4ZLN A;  4OHW A;  1RHR B;  4YFU A;  2DXE A;  4DPW A;  4OZ1 A;  5GME A;  1OJ4 A;  4DQR A;  3P4U B;  2RE1 A;  4RKU C;  1NKE A;  2DPJ A;  3TOQ A;  1M5P C;  2ALY B;  3KJF B;  1AFI A;  5I4M A;  2GHV C;  4K5S A;  1CG2 A;  3R2D J;  4NLO A;  5KT4 A;  3CJS A;  1NSK L;  4C6A A;  1SC3 B;  1EQM A;  1JJH A;  3KHG A;  3TEH B;  3W62 A;  4J9N A;  1RHM B;  5HJY A;  3AD8 C;  2OO4 A;  5HL7 Q;  1EB0 A;  3P49 B;  4WCE Q;  2BX6 A;  1N6Q A;  3PV8 A;  4NEY A;  1X4F A;  4F67 A;  5AJ3 J;  3OBI A;  2E1P A;  2AYB A;  9ATC B;  3B8H A;  2OHD A;  1VIS A;  1RP5 A;  4CO5 A;  2GAH C;  2D9P A;  4CO2 A;  2HHH J;  3E01 A;  3VF0 B;  4ZIV A;  3KK1 A;  3LGN A;  2G0I A;  4OZJ A;  1MU2 A;  1V5V A;  2IJR A;  1Q53 A;  1SJR A;  2QSW A;  2DNH A;  4K2J A;  2CQ4 A;  4ANE A;  3AB4 B;  2IY5 B;  2A10 A;  1XEZ A;  2LXF A;  3LPE A;  3DLG A;  1N48 A;  3TVZ A;  3M2R B;  2ZHO A;  1IKV A;  2VG5 A;  4DUY J;  2FZK B;  1R0A A;  1LKZ A;  1M0S A;  3TAQ A;  2FHM A;  3DRS A;  2CQD A;  2OLW A;  3J80 U;  4KRW A;  1RZM A;  3BKF A;  3LUY A;  4Y65 A;  2E5J A;  4ZVQ B;  2IDL A;  1ZAX A;  1HNV B;  1PG5 B;  3T9Z A;  2X1G A;  3DCA A;  1M90 T;  4RJV A;  2HMI B;  3V6K A;  4X64 F;  1YG0 A;  1P27 B;  3AHP A;  4R25 A;  3A3O B;  2ZDO A;  4L76 A;  1Q7Y T;  1UEU A;  1TV6 B;  2GS8 A;  5G4D A;  3SIP B;  2W4P A;  1M1K T;  2E7X A;  1E6Y B;  3MM9 A;  2AW0 A;  3POT B;  5MLC V;  3MEG A;  4M5I A;  4ICL B;  1H2T Z;  2E1C A;  1U02 A;  3ULH A;  4DX6 A;  3OVB A;  4WTO B;  1KLN A;  1HWJ A;  4OI0 A;  1RT3 A;  4CT8 A;  4O0I A;  5C25 A;  4P6Q A;  3H5S A;  2WHO A;  4B3M F;  2D3O 1;  1FJG F;  2RHS B;  4ED3 A;  3L7O A;  4JI0 J;  4RWX A;  1L3V A;  2H4W B;  3MEC A;  2DO4 A;  3OJS A;  2R8G A;  1S0M A;  1DQA A;  4IOA Q;  1GEH A;  4N47 A;  1HD0 A;  5A76 A;  3LPY A;  2NYH A;  1JLG B;  4FVC A;  1TMJ A;  5HN0 A;  1D8Y A;  5ETN A;  2AYG A;  5FII A;  4P75 A;  4AMN A;  5LM7 E;  5GVQ A;  4K4X A;  4CLL A;  3GG0 A;  4F25 A;  3TA1 A;  1Y11 A;  5M2R A;  3UI3 A;  4ED4 A;  4NYO A;  2CQ3 A;  4LR8 A;  3HHE A;  2RDD A;  4RPF A;  2ASD A;  1TK0 A;  4WBF A;  1XNQ F;  1TP7 A;  1B7Y B;  1QAI A;  1NK9 A;  2MYF A;  4PKD B;  2EFP A;  3QRQ A;  5IT4 A;  4LFB F;  1HQU A;  4WP3 A;  2VG6 B;  2PMW A;  2MKC A;  4J90 A;  3MPY A;  6FDR A;  4J37 A;  3O5T B;  3EX7 B;  1NME B;  5H9F J;  1J27 A;  3LP1 A;  3LP0 A;  4O44 A;  2ZH2 A;  1KFD A;  2KDO A;  2IJF A;  3GON A;  2L48 A;  1VBK A;  1TVR A;  1ZYQ A;  3C2P A;  5ETO A;  1HMV B;  1XC9 A;  5B09 A;  3MWB A;  3UW1 A;  4L74 A;  3RU0 A;  2AJQ A;  2NCK L;  4DUZ J;  4PWD B;  3L95 X;  2OEJ A;  3I82 A;  3HDS A;  4OX7 A;  3Q8U A;  4QU6 A;  4LF7 F;  1HYS A;  1KS2 A;  4G3I A;  2N82 B;  3ENW A;  1BC6 A;  4IO9 Q;  2KFZ A;  5LJ3 Y;  3EGN A;  1WKJ A;  1RWX B;  4KYZ A;  3OVS A;  4NX9 A;  3CCM S;  3W9I A;  4ES1 A;  4C8O A;  2J9E A;  2XGQ A;  1PYT A;  1TKZ A;  3HKZ D;  1Z4U A;  1RAJ A;  5ETL A;  2KH9 A;  1RCX B;  1U1M A;  2CPZ A;  1AFJ A;  3PX6 A;  1R43 A;  2GCF A;  3FMW A;  3PW0 A;  3QWU A;  4NLT A;  4DBQ A;  2OPR B;  1G7C B;  3FFI B;  2GA7 A;  3NNC A;  2IYI A;  3T5J A;  4QQB A;  4C8K A;  1U48 A;  4H4K A;  3TUI C;  2BW7 A;  5E0O A;  4FF4 A;  5KT7 A;  2YY3 A;  2LQ9 A;  3MOJ B;  3GQC A;  5HMY A;  2UXB J;  4DV3 J;  1LWC B;  2HQC A;  1RDR A;  4JB8 B;  2ZBR A;  5L39 A;  1SL2 A;  1I94 F;  3W2V A;  3M8Q B;  4LR9 A;  1BMQ B;  2JHE A;  3MR2 A;  1F9E B;  1UVN A;  3SCJ E;  4E8U A;  2PFF B;  4ILM A;  1H73 A;  4ZPB A;  4XAK A;  3C6U A;  4PWW A;  4B08 A;  4J9R A;  4YN3 B;  4IKA A;  1Q8I A;  1PC4 A;  3KLE B;  4H4O B;  2DJW A;  4Q0B A;  1LW2 B;  1CJT B;  3SZ2 A;  1UPM B;  5THW A;  1GFW B;  3KK3 A;  3IA0 A;  4ZCI A;  3V4I A;  2PGC A;  3M4X A;  4K4S A;  4M1K A;  2AEM A;  3TJ8 A;  1K44 A;  5GAE U;  3KUG A;  1MRO A;  3CUL A;  4WU2 A;  4X4N A;  3H25 A;  2EKN A;  2P9G A;  4LFA J;  3P45 B;  2XHW A;  2HGL A;  2DR7 A;  1RWN B;  2IM0 A;  2B51 A;  2MJN A;  4X4P A;  3GR1 A;  3A13 A;  2HHQ A;  1L3U A;  4X84 A;  3H2V E;  3D6H B;  2AX0 A;  4B9V A;  3R5G A;  2DNZ A;  1IVZ A;  3ADA C;  1UW9 A;  3P8B B;  2B3T B;  3K5O A;  2R7Q A;  1U2R A;  3PCO B;  4Q44 A;  4PAB A;  3OW2 R;  5ETK A;  1AXQ A;  3MTK A;  2A6M A;  1OPZ A;  5L8R C;  1YTY A;  4KPC A;  1VQ4 S;  2H48 B;  5LSO A;  2MY8 A;  5L46 A;  4RUB A;  3GFY A;  2UXC F;  2EG1 A;  4ZPA A;  2VIH A;  3DRX A;  1U1R A;  4MKY A;  2MSS A;  1KDN A;  2XS5 A;  2L41 A;  3O1L A;  1ELO A;  1XIQ A;  1X9W A;  3NCP A;  1Q8B A;  4DR2 J;  4TYB A;  1RTI B;  4WFZ A;  4JI7 F;  3H5X A;  2ASY A;  4AD6 A;  2R7T A;  1OPI A;  4MIB A;  2CKW A;  3BR9 A;  3M32 B;  4BDP A;  3D1Q A;  1N34 F;  3NOG A;  1YIJ S;  3K2Y A;  4O23 A;  3RB6 A;  1IBK F;  3ZTO A;  3I0S B;  4IH6 A;  2FJW A;  2KN4 A;  4OV1 A;  2K7J A;  3HT3 A;  5KT6 A;  2GVD B;  1AZS A;  3C19 A;  3HHL A;  3O6Q A;  2QA4 S;  1ZZF A;  1WG5 A;  5D6G A;  4NXN F;  1KP6 A;  3R5B A;  4LSN B;  3DRY A;  1KQK A;  3W1Y C;  4IFV A;  3IAS 9;  3MMB A;  4TN2 A;  2IA0 A;  2KTQ A;  1S1X A;  4JI5 F;  2Y1J A;  3LW5 C;  4OI3 A;  2V6A A;  1UAW A;  1DJ0 A;  4TQS A;  2LP4 A;  1MWQ A;  1SXL A;  2CPD A;  3MEE B;  3KUE A;  3EZ5 A;  4P7T A;  5CYJ A;  3MUM P;  1CJU B;  2BJ7 A;  4C3K A;  4F4K A;  2OPP B;  1R27 B;  1FE4 A;  2W2Q P;  3ISN C;  3M9O B;  3AJ1 A;  1FRH A;  2FGO A;  2RH3 A;  3PHT A;  1FXR A;  4HAC B;  1SI9 A;  3A8E A;  5CXT A;  1PGZ A;  2KJV A;  3ENV A;  4HR2 A;  3CDW A;  3VAM A;  3ZTS A;  1YRT A;  4EZ6 A;  3VAF A;  3C3L A;  3I87 A;  2B7B B;  2BAC A;  3IN5 A;  5KG2 A;  4ZLP A;  2ZH7 A;  4AYB D;  4EMD A;  3WBZ A;  4KV8 A;  3OHB A;  2VC1 A;  2J0Q D;  4C7Q A;  4YHH J;  1S1U B;  2W2P P;  3VAK A;  3BN7 A;  4ZP8 A;  4X4V A;  1HNW F;  1RTJ B;  4ELV A;  4K0K F;  4M5L A;  1UZH A;  4J9P A;  2DY9 A;  1TK8 A;  2DNN A;  2B9X A;  4OZ2 A;  3BDP A;  3M1V B;  2YPY A;  3M6X A;  1NK7 A;  1QDU B;  2ABY A;  4G1Q B;  5HJX A;  3S6E A;  3TZW A;  3ZNU A;  4CZC A;  2E5L J;  8RUC A;  3HXM A;  3TW0 A;  5KFD A;  1H0H B;  4CI0 B;  1RAE B;  4C98 A;  4WU3 A;  4WE1 A;  2UXB F;  3RRG A;  1KBR A;  4OL8 A;  3QT8 A;  1Y5N B;  3QIP B;  2VPZ B;  1NLK L;  4WTY A;  5KOW A;  1UFW A;  4URQ U;  4ZIT A;  2ZNZ A;  2F1F A;  3IG1 A;  3UD4 P;  3ELH A;  1RT4 A;  1JQG A;  4I2P A;  2HHX A;  2YNH B;  3UCZ P;  5J2N B;  2E5G A;  3OV7 A;  3GPA A;  1G3O A;  5B7W A;  1TL5 A;  1S6O A;  3F56 A;  2BJ8 A;  1U8S A;  3OUY B;  3OQ2 A;  4GC6 A;  3RAQ A;  3DGP A;  2HWH A;  3DMJ A;  1C1C A;  3SFG A;  1KON A;  3G82 B;  3EPG A;  2YKA A;  3RJM B;  1LFP A;  4RX6 A;  3V81 B;  3SV4 A;  2UUC J;  2XTJ P;  1U45 A;  2F4V J;  1MN7 A;  1I5O B;  1D9F A;  4IRC A;  5CYQ B;  4UQG A;  2X7I A;  4DR6 F;  1M5K C;  1HBN A;  2BJE A;  2VQF J;  1S1V A;  2DIT A;  3UD5 A;  5HO4 A;  4CCH A;  3OTO F;  4Q5V A;  1H2V Z;  2NQP A;  1M1H A;  3B82 A;  3RAM A;  2LQJ A;  4GKJ F;  2MKS A;  1N5Q A;  4LF5 J;  1N56 A;  1FTR A;  1NK4 A;  1Q82 T;  3I4P A;  3HHL C;  2F7V A;  2LCW A;  3UCG A;  2W9A A;  2OIH A;  1B99 A;  1U49 A;  4K59 A;  1F60 B;  5KFZ A;  3T9N A;  1BQX A;  4X4R A;  1RTD A;  2ZC3 A;  2YNF A;  1WWH A;  4ZP7 A;  3OR2 A;  3AJD A;  2W9C A;  1PIL A;  3NCR A;  1N33 F;  1LXN A;  2Y3Y A;  1WI8 A;  2FZC B;  4GO7 X;  3M30 A;  3C16 B;  1Y7P A;  1RT2 A;  4NA2 A;  2WON B;  3BKU A;  5F9N A;  1QTM A;  2VBW A;  5KFH A;  2ZUA A;  4FYV B;  3ZC4 A;  2X1F A;  5EDW A;  5HMW A;  2CQ1 A;  3IS9 B;  5F8H A;  1RT7 A;  2IVF B;  5B0A A;  3G8Q A;  2LDI A;  4CH1 A;  1TQL A;  2R7R A;  2KKH A;  3UN2 A;  1KOO A;  4JV0 A;  1HW8 A;  1HBU A;  4EU0 A;  4N76 A;  1RHK B;  1WAC A;  1JLB A;  1XK8 A;  3BRE A;  4C8L A;  4B02 A;  2MZT A;  1TL1 A;  3FQK A;  4LVO P;  3NAH A;  1HBO B;  1D09 B;  4EWT A;  4HT5 A;  4LRF A;  4ED2 A;  2M5Y A;  3C15 B;  3KWM A;  5A2Q U;  1D8Z A;  2JLG A;  4K50 A;  1FNX H;  2HQ3 A;  2OPQ B;  5BYQ A;  1O5J A;  4ZVH A;  1YI2 S;  3T1Y J;  2MQO A;  1URN A;  4BLG A;  2O5D A;  4DDF A;  4CLK A;  1ZM4 A;  2WOM B;  2E66 A;  2HS3 A;  1VK3 A;  2JH3 A;  2MB0 B;  4CLZ A;  4X62 J;  3V6J A;  2HGM A;  3HF5 A;  3BEG B;  5CCM A;  4PG7 A;  1BE4 A;  1YDL A;  2AGQ A;  3DC2 A;  2AV5 A;  2ZBP A;  3BBF A;  3W9J A;  1R0B G;  3MAA A;  4RW6 B;  5F8J A;  1Q7L B;  1HHS A;  1TL4 A;  1WDT A;  3I32 A;  2XNR A;  1U1P A;  4DS5 A;  2AP6 A;  2YBV A;  1S76 D;  4CLF A;  3T6B A;  2L08 A;  1TKT B;  3TAM A;  2KVQ E;  1FXL A;  4ZN1 A;  3CSK A;  2HZA A;  2NZC A;  1GMW A;  4WP8 A;  3PYE A;  4WPA A;  4A8O A;  2VFU A;  3GYG A;  2MZJ A;  3GWC A;  5CYM A;  1H74 A;  1KTQ A;  2QG9 B;  3KG4 A;  4U8Y A;  1FJE B;  4DX5 A;  3UD3 P;  3OL9 A;  5FD1 A;  2YKP A;  4NEZ A;  3J80 Y;  2LU2 A;  4RW7 B;  5IWA J;  4F3O A;  3K8V A;  1XR5 A;  3BQ2 A;  4B3O A;  2WZ1 A;  1RAD B;  2BM1 A;  3GTY X;  3HVW A;  4FYX B;  3WX8 A;  4YME A;  5CQG A;  4DR1 J;  4OIX A;  1YVF A;  1B0T A;  3GJQ B;  3V6H A;  3HFV A;  2I1R A;  2R8H A;  2RF2 A;  1WTB A;  2VPY B;  3DM2 A;  1Q0N A;  2ERR A;  3QT5 A;  4JI8 F;  2M52 A;  2BJD A;  3Q8Y A;  3D1O A;  2Z30 B;  1T9X A;  1WTF A;  2DR6 A;  2R42 A;  2MGZ B;  2GMH A;  2YPZ A;  1TV6 A;  1UJ5 A;  2AEJ A;  1FRL A;  3D7S B;  3Q89 A;  2OPS A;  1RA7 A;  2YNI B;  2WW8 A;  3UVJ B;  5B0F A;  4OJH A;  4NLQ A;  2VZ9 A;  1VIX A;  2V69 A;  4XO0 A;  1XMQ F;  2XO6 A;  4WKR A;  5U47 A;  4R5P B;  3DLK B;  2XG8 A;  4ZJL A;  4RWW A;  1OYE A;  3HVA A;  3L3C A;  2QO3 A;  3OFF A;  1OYD A;  1YK9 A;  1YJN S;  3TA2 A;  3US5 A;  3MAH A;  2XLK A;  5K14 B;  1RE1 B;  3QO9 B;  1GXT A;  3W5X A;  2AYE A;  4ZVF A;  2V0N A;  4IH5 A;  2R3V A;  3SQO P;  2M8D B;  2XI3 A;  1F0X A;  3GG1 A;  2RHQ B;  2BZ2 A;  4O3O A;  1ITP A;  2AJ0 A;  1GTE A;  5KFW A;  4WYL A;  2G2O A;  2LQ8 A;  1YHQ S;  1QE1 A;  3CED A;  1IR2 A;  3IBC B;  4WII A;  1U1N A;  4NLX A;  3CCQ S;  1OWX A;  3ET6 A;  1UCN A;  2GFF A;  1EET B;  2VFT A;  1A0O B;  1MWZ A;  2UU9 J;  4DN9 A;  1S59 A;  2GVZ A;  4B3R F;  2PA3 A;  2OH2 A;  4DS4 A;  3ILJ A;  4JV5 F;  4IFY A;  3CJK B;  3VVU A;  1IBC B;  1T3O A;  3R7B B;  1YZ7 A;  5K8N A;  3CJ5 A;  3LH2 S;  3CNQ P;  2HQG A;  2ZEJ A;  1DTQ B;  1WC1 A;  2XO7 A;  4ECS A;  4DV2 F;  3N5B A;  2DR9 A;  1S6U A;  2I5J B;  1REV B;  4USK A;  1DTT A;  2Q66 A;  4DR7 J;  1RT1 B;  5D3G A;  4J9O A;  4WZM A;  2OMO A;  1S5Z A;  2ZZM A;  1NHK L;  3OSN A;  1X8D A;  2ZE2 B;  4QYR A;  4DL0 C;  3DKD A;  1QVG R;  1UET A;  2R8J A;  2CJQ A;  5IT0 A;  3Q8V A;  4I0W A;  1WOS A;  1TUV A;  5KT5 A;  2CDQ A;  2ZKU A;  1IN0 A;  4MFB A;  1XR7 A;  2ZBI A;  2YVS A;  2DH8 A;  1HMV A;  4KH0 B;  3AOC A;  4HYK A;  2Q6B A;  2DHH A;  2HEK A;  3MI7 X;  2IM3 A;  2B4O A;  2HVI A;  4MYU A;  2B5J A;  3C14 A;  5EHH A;  3MMA B;  3W5Y A;  2DNM A;  2FVC A;  1RKI A;  4QIW D;  1DFD A;  5FDL B;  2V8H A;  5HI7 A;  5HLF A;  5JVG Q;  3T5L A;  3CC4 S;  1RWP B;  2DRD A;  4DEZ A;  4MMO A;  3CCW A;  2K2P A;  4ID5 B;  2MZQ A;  4F4Z A;  4ZLL A;  1RBL A;  2B9E A;  4ELU A;  1ZPV A;  3KNG A;  4I2Q A;  4CM0 A;  1N36 F;  5E5N A;  3MR7 A;  2UUW A;  3BQ1 A;  4ZK7 M;  3RR7 A;  4KKO A;  4Y6I A;  5KG0 A;  2EC0 A;  2FY1 A;  1VBY A;  2WK4 A;  4Y28 C;  4OHX A;  1VRQ C;  2R7W A;  3CCU S;  2KM8 B;  2Z4P A;  2LKZ A;  2J7W A;  1HNI B;  3TWZ A;  2L9D A;  2ZZN A;  2MPU A;  5EWF A;  4ECR A;  3ZZY A;  2V2Q A;  3FGV A;  4F0K A;  4AND A;  2KFN A;  4GMK A;  2UXD F;  4V19 J;  2OFG X;  3DRR A;  2CWX A;  1U26 A;  3M05 A;  4IO1 A;  3O8W A;  1XMB A;  3IFE A;  2A2C A;  4RUH A;  3A4T A;  3HZG A;  2FD2 A;  2CNL B;  2FLO A;  2GAG C;  2ASJ A;  4C48 A;  1DRZ A;  3OFH A;  3V6D A;  3LGM A;  5KFY A;  1Y9O A;  3LWL A;  4S0M A;  3PYF A;  4AXJ A;  4ZKA A;  1RHJ B;  3V5R A;  3HUL A;  2XQC A;  2IVM A;  3KMQ A;  2EEY A;  1XQI A;  1LWF B;  1RTZ A;  4U8V A;  4LF6 F;  1YZ6 A;  5K9F A;  3MPU B;  3SXL A;  5CHC B;  3TZY A;  1NCL A;  2XWY A;  3J81 U;  5HAT A;  3VAG A;  2AIR B;  5I42 B;  1SJQ A;  1URR A;  2BUN A;  5T14 A;  1RHU B;  2QC3 A;  1KQF B;  4LUB A;  3IWL A;  2AJ4 A;  2DGO A;  2AD9 A;  5A8W A;  4LQ3 A;  2C28 A;  3IRX B;  4DR5 F;  3Q86 A;  5DM6 Q;  4WK1 A;  3MR5 A;  2ZM6 J;  1VBZ A;  3J7Y U;  4CP5 A;  4DQI A;  5E2Q A;  5E7O B;  3MTJ A;  2QA1 A;  4JBC A;  4CYU A;  3OTD A;  2IVY A;  1H7X A;  2ACM A;  4N56 A;  1JJ2 R;  3R1H A;  2HFO A;  1FTC A;  4AL7 A;  5C5J A;  2H3E B;  3MED A;  2HHV A;  4DL3 A;  3UNY A;  1UZD A;  1T8E A;  2W9B A;  2BE9 B;  2VBY A;  1BQN B;  1VLY A;  4E2F B;  2UU9 F;  2RSQ A;  2GV1 A;  3CCT A;  5LJ5 Y;  1X4E A;  3IGV A;  2XMA A;  2P2C B;  3AOD A;  1M5V C;  2YKM B;  3JYT A;  4IDK B;  1YSJ A;  2DXD A;  3WC2 A;  3D6F B;  2AMC B;  3V2U C;  3O3L A;  4DL4 A;  5T7L B;  4XTT A;  1ZM2 A;  4CH7 A;  1X9M A;  2V94 A;  2G0J A;  5HQ8 A;  2OEL A;  4DV5 J;  2GVD A;  1YQH A;  2F63 A;  4L3K A;  3RBD A;  2VOP A;  1FNO A;  4LSN A;  2DHA A;  3KXD A;  1ZA1 B;  3D6T B;  1N5Y A;  2EFG A;  4ZMM A;  4K5R A;  2W7O A;  2D3O R;  3QGG A;  2MKK A;  2M0G B;  3DRP A;  3IAM 9;  3D5M A;  4DR3 F;  1VQN S;  2W4D A;  3LOU A;  1GT8 A;  1BY9 A;  2AWZ A;  1U0S A;  5KT2 A;  2NUH A;  4QYZ J;  5A8K A;  2FJB B;  3A8K A;  3BGO P;  2XM3 A;  4DLG A;  1C0U A;  2Y9H A;  4F4W A;  2KO1 A;  1CLF A;  1FKA F;  2PMZ D;  3FNN A;  1HW9 A;  1DUR A;  3DOK B;  1HPZ B;  2R4F A;  2MJU A;  2MKY A;  3B4D A;  2YWG A;  2H4Y B;  2GHW A;  1DQ9 A;  2CJB A;  2MLZ A;  2IHR 1;  4LRB A;  1XWL A;  2GGP A;  2GQC A;  1NK5 A;  4MYT A;  4P52 A;  2DH9 A;  5HVF A;  3VAJ A;  1SKW A;  3TX8 A;  2M7S A;  4PZV A;  4Q2L A;  3HVT B;  1RWV B;  4OLO A;  3IGN A;  4FXW A;  3DYA B;  4M5K A;  2BAN A;  4TKT A;  2HND B;  2P6S A;  3HSD A;  3PTW A;  1CBK A;  3M1V A;  3HFZ B;  5A0Y A;  1X4H A;  2OGU A;  4U9R A;  1IKX B;  4QR1 A;  4ZPV R;  5EGY A;  2H1Y A;  1BUX A;  2XWX A;  4XIU A;  3GYX B;  2DT9 A;  2N4C A;  3RAX A;  4NZ7 A;  4JOU A;  1D0E A;  2HQD A;  4LF8 J;  2OFH X;  1RWW B;  4QPT A;  1DLO B;  4DSL A;  1V3R A;  2YH1 A;  1ZAV A;  3CF5 Q;  2XS2 A;  2FDN A;  5CZX A;  1VJQ A;  2HVZ A;  4AE5 A;  1CVJ A;  2IFX A;  1TAU A;  4NLW A;  2KB2 A;  2Z0G A;  4LF9 J;  1IBM J;  1G4C A;  2DR8 A;  4DU7 A;  3GMG A;  4ZHR A;  3SDE A;  3MD3 A;  5DDO C;  2UUT A;  4HVZ A;  5GAD I;  2FVR A;  4ZVU B;  2E7V A;  2YKO A;  2U2F A;  8ATC B;  5J2M A;  1Z2L A;  4M8L A;  5FLX U;  4CNY A;  3W9H A;  3DLE B;  2HG4 A;  2ROP A;  4QWE A;  5J2N A;  1VQP S;  4YB7 A;  2APO A;  1U8W A;  2JFD A;  2PN6 A;  3HI9 A;  1JLA B;  4LRC A;  3CDU A;  2MKH A;  5C24 B;  5IM0 B;  1HI0 P;  1FVS A;  4YB1 P;  2XUL A;  4PG4 A;  5KFT A;  3N28 A;  1L3S A;  2NXC A;  2VD3 A;  2XSJ B;  3GII A;  3MMJ A;  4PQU A;  1IM4 A;  2ZHB A;  4DV4 F;  1CJK B;  3G82 A;  3PJW A;  2I2Y A;  4JI1 J;  4JI2 F;  3V81 A;  3MM6 B;  5D4L A;  2O01 C;  1B3T A;  1QUV A;  4HDH A;  2DHX A;  3I96 A;  2CZ9 A;  2RQK A;  4F36 A;  2H5I B;  2YNG A;  2M2B A;  3QSY B;  4ED6 A;  4K7Q A;  2HFV A;  1VRU B;  2C2D A;  2POK A;  1F6T A;  4ZS6 A;  1N32 J;  2JC1 A;  1UJ6 A;  1S10 A;  2KT2 A;  3KK2 A;  2JZ5 A;  3K7R A;  1NM2 A;  3TQ1 A;  4RUC A;  3I5A A;  2OEK A;  2GIF A;  1VHI A;  2KXN B;  4K4W A;  2RD5 C;  5KFA A;  3HJF A;  1KC8 T;  2E44 A;  3J7Z T;  3CUN A;  2IRU A;  4NCG A;  4FPR A;  2B9W A;  3K57 A;  1IXK A;  4NLY A;  4TNO A;  5K8M A;  2KHD A; 
#chains in the Genus database with same CATH homology
 3HJV A;  4QBU A;  3TZZ A;  5CZD A;  2PFF B;  2CUY A;  3TQE A;  2VKZ G;  5DZ6 A;  3K89 A;  3TZW A;  2C2N A;  4RL1 A;  2QO3 A;  3SBM A;  3IM8 A;  3PTW A;  2VZ8 A;  3TZX A;  1MLA A;  3R97 A;  2JFD A;  3TZY A;  2G2Y A;  2UV8 G;  2QJ3 A;  3HHD A;  2VZ9 A;  2G1H A;  2H1Y A;  3H0P A;  3R8Y A;  3BV8 A;  4RR5 A;  3IM9 A;  3QAT A;  5CZC A;  2G2Z A;  3RGI A;  3CJ8 A;  1NM2 A;  3G87 A;  3EZO A;  5DZ7 A;  2G2O A;  3HMJ G;  2JFK A;  2QC3 A;  2HG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...