3HJVA

1.7 angstrom resolution crystal structure of an acyl carrier protein s-malonyltransferase from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
307
structure length
306
Chain Sequence
MSKFAIVFPGQGSQAVGMLADLAEQYAVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRTQPALLAASVAIWRVWQQLGLEQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQLMQQAVPAGTGAMYAIIGLEDEAIAKACADAAQGEVVSPVNFNSPGQVVIAGQKDAVERAGVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNAPQIPVINNVDVVAETDPVKIKDALIRQLYSPVRWTECVEQMSAQGVEKLIEGPGKVLTGLTKRIVKTLEGVAVNDVASLDAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malonyl Coa-acyl carrier protein transacylase
publication title 1.7 Angstrom resolution crystal structure of an acyl carrier protein S-malonyltransferase from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 103
structure length 306
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3hjvA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3hjvA01
3TZZA 2G2OA 1NM2A 2G2ZA 2G1HA 2C2NA 2UV8G 2VKZG 3IM9A 3K89A 4RR5A 4RL1A 5CZDA 1MLAA 2G2YA 5DZ6A 2VZ9A 2VZ8A 2CUYA 3EZOA 3PTWA 3TZXA 3R8YA 5CZCA 3SBMA 3CJ8A 3TZYA 3BV8A 2H1YA 2PFFB 3H0PA 3IM8A 2QO3A 3HJVA 5DZ7A 3HHDA 3TQEA 2QJ3A 3QATA 3HMJG 3TZWA 2HG4A 2JFKA 2QC3A 3G87A 4QBUA 3RGIA 2JFDA 3R97A
chains in the Genus database with same CATH superfamily
1MU2B 2I5JB 1R3NA 1WC5A 2BKOA 2NPFA 4YR2A 5THWA 1X9MA 3M9MB 2VDHA 3HHDA 5D4NA 3VGTA 3VWSA 4ZP8A 1Q53A 4ZLNA 3BREA 5BJRA 4YY3J 2V94A 3GYGA 3EZUA 4DV3J 3F41A 2XG8A 1S0NA 5GAEI 4DUZF 4OHZA 3NGDA 2RF2B 1C1BA 3W9IA 1XBWA 2XS7A 2V9KA 1KQSR 2V8PA 3R3TA 5KFNA 3I6PA 3CCSS 1TKDA 5J1EA 4ZVEA 1MWQA 4O3RA 1UWBA 1UJ5A 3BDPA 3BGRB 1FTCA 1TV6B 1H98A 2C2ZB 5CYMB 2N3OA 4Z7CA 2DR8A 4B3OB 4B3SJ 1ZAVA 3J7A1 4RZRA 5H9EJ 1AZSA 1I51B 1BLUA 3M30A 5HVFA 2HRYA 2U1AA 3CWJA 4P2SA 4USHA 2ZHBA 2OSQA 3QGIA 4WFYA 1EP4B 3QQCD 1MNEA 4EZ9A 5I4MA 3MUMP 2MKHA 1E6VB 1KFDA 4DR6J 3H42A 3MAQA 4MFBB 2B4OA 2VFUA 2QSWA 3QBCA 4OLOA 1KOOA 4KIAA 2G2ZA 2RHQB 2NQPA 2W01A 1SC1B 3J7AN 3MXHP 4A8OA 5B08A 4B17A 4MIWA 3PKMA 1JJHA 1NHUA 4TYBA 3H25A 2DIUA 3M8PB 4LIRA 3TQEA 2W4CA 4NLDA 1HNWJ 4PG5A 2XY6A 5AT1B 2LDIA 1S0MA 4LF7J 2VICA 3BSCA 4RJVA 4XPEA 3VV2B 4DBQA 1SI9A 3JXOA 4OL8A 4IG0A 2W9CB 4OZ0A 3PRDA 1KP6A 3N0VA 4NYZA 3R9LA 1YBTA 5HMZA 5A0YA 2L3MA 4PEOA 4TU8A 3GFYA 8RUCA 2UUAF 2ZZTA 2QE5A 4L6V3 3LANA 4NYPA 4ITSA 2B43A 5B0EA 3IBFB 1F9HA 2AW0A 3KLGA 3ENQA 1L3SA 4ZPTR 5HQMA 4IKAA 3SSSA 5IV3A 1FWPA 1TK0A 4KO0A 5HP1A 3U27A 2Y8WA 1WKJA 3CDWA 2MYFA 1FKAF 3NBPB 1NAQA 3FJ2A 2VG5B 2NXNA 2LMIA 3G2XA 5LJ3Y 3KTQA 1FI4A 5DLFA 2CQPA 1UFKA 1S1WB 3MAAA 1M1GA 1S49A 3LWLA 3BO4A 4QU6A 2H48B 2DISA 3BJYA 3UE2A 1RWXB 1BXNA 5T14A 2BKNA 3SCJE 3CULA 1G4CA 1JJ2R 1XTZA 2NXCA 3ZNJ1 4LFCJ 2LQ9A 4PYAA 3HKWA 3BM7A 1OY6A 2XHCA 4ECUA 2CJQA 4OYWA 4Q2LA 4PG7A 4ECSA 2B8QA 1C2PA 2H3EB 1KKHA 2AJFE 1NJYA 2EKNA 4FN5A 2DPJA 2NXJA 1JLBB 2W7AA 3B6BA 3G9CA 3POTB 1R89A 3I9ZA 1KSPA 3KG4A 2ZKUA 5ETQA 3UN2A 2HMIB 2XWXA 2RQCA 4DFPA 1RT5B 3DXBA 5E41A 1HBNA 1JJCB 4FYVB 5I3UA 1T02A 3LO3A 1TP7A 4QWDA 2AHOB 1B7YB 5D3GB 5IT4A 3KNGA 4ETZA 5KAKA 2Z2ZA 4U9RA 1HWJA 4IG3B 4CLLA 2CPHA 2EFQA 3VALA 3CJ2A 1N54B 3ZTQA 4K4ZA 2NLWA 4DL6A 3HULA 4TU7A 5F41A 5GMEA 1F2GA 2VB6A 2Q6BA 4BWMA 3J81Y 4GMKA 4H4OA 3VAJA 4GKJF 4OX7A 1IWGA 3IGVA 3M6WA 2ROPA 1FRHA 2YKNA 4IO9Q 1RU2A 2XWYA 4ZKAA 2MY7A 3G8TA 2XGQA 4RBUA 1BUXA 4HYKA 2K1RB 5E3AA 1VBXA 3W9JA 1RAJA 1MLAA 1KC8T 4LT6A 3UN3A 5ETKA 3NGRA 2C1EB 4CO2A 4PKDB 3QT6A 2VBYA 3Q8RB 1CULB 5KFEA 4QIWD 4ED8A 1F5AA 4LFBJ 3NS7B 4ZMMA 3CCMS 4KB7A 3G6VA 4DS4A 2UXCJ 2VPYB 3GYXB 4CLZA 1K9MT 2VBWA 4FS1A 3D0GE 2OPQB 4ZPVR 2BYCA 1VJQA 3HPOA 3BGOP 5E33A 3IFEA 4B9TA 2J8SA 3A8IA 2G13A 1NJZA 4CLYA 4QIGA 3R5AA 4IQXA 2M9KA 1AFJA 1DHMA 3OTBA 2FPHX 3GJQB 2UUBJ 3RR8A 3MZIA 4N8OA 2DNLA 2VZ9A 1T9WA 1R43A 3TZXA 3EE3A 2FZCB 3CD6S 2MKYA 3OTEA 5K14A 3R1LA 2VPXB 3NY0A 2XSJA 4KKOA 2QC3A 4B9LA 1RAIB 5J1PA 2GIQA 2RNEA 4LUBA 2DY9A 2MZRA 3BPDA 2XYHB 4ED5A 2ZBRA 4J9VA 4U6PA 4DX7A 6AT1B 1F9FA 3AD9C 5KG3A 1ZTTA 1YK9A 2NZ4A 2HSEB 4OYOA 2UVUA 2N3LA 1Q1KA 2J0WA 1FRIA 1SV5A 3B82A 3PJXA 1YG0A 3HP6A 2WAQD 3K57A 1X5SA 1T94A 2MKIA 4IFVB 4WP3A 1RT2A 2DGQA 2G4BA 5KFUA 3HT3A 3FCWA 3QMQA 2E5LF 3TX8A 4RW4B 3F73A 2VA2A 4OX6A 2OFGX 3WHIA 2W2MP 4IFYA 5E2QA 1SJQA 4I68A 3JAMY 3N5BA 4MTPA 3B4MA 3VAMA 1QVGR 3W60A 3IR6B 2F8EX 2GJIA 3PIPQ 1KD1T 4NYOA 1X60A 2RDJA 3EVOA 3HDSA 3LOUA 4P7VA 2DGXA 3BR8A 1NPPA 2HZAA 1R7IA 1YWXA 5KOWA 4EBCA 1XJWB 1UW9A 3R2CJ 3HVWA 2DEIA 4ED0A 2BE2B 1NBEB 3M8ZA 3QLHB 4AMOA 3J80U 2GVDB 1RSCA 1DTTB 1Q5VA 5IOLA 4FS2A 4BS2A 2CNNB 2VJVA 1KRPA 1PC5A 1U2FA 7AT1B 3BN7A 5L9XA 1TVRB 2R8GA 1TKZA 2LQ5A 2BQUA 2CXEA 3K5OA 4P2XA 3NGKA 1VJWA 2LU1A 4ELVA 4I6WA 4P74A 4EEYA 3FBFA 1BY9A 1FK9A 3KLHB 2AYBA 3MR6A 5IT9Y 1HR0F 2PO4A 3ILOA 4G1QB 1FF2A 3BDEA 1DBDA 3FSIA 1I6JA 1CLFA 1LW2B 1N5YB 3IS9A 2LFVA 2XS2A 1IWAA 2LXFA 3ONQA 2HBZB 1QE1B 2D1CA 5J2NB 2GMJA 2WVDA 2IMWP 1RA6A 1WEZA 3DOMA 5EX3A 4F50A 4LBIA 3TNVA 8ATCB 2W8LA 3PV8A 3ZFVA 2RHSB 4MK9A 2FVRA 2VZ8A 1WOSA 3KK2B 1HWIA 2VONA 1JLCA 2DR5A 4ATNA 2MJUA 5JUMA 2P2CB 2RRBA 4GC6A 2VG7A 1BD6A 3C46A 3KJVA 4OI3A 2DBBA 4ANEA 1P6TA 1OMSA 1KR4A 1EZZB 1TELA 1MSWD 3KWMA 2ZVIA 3MMCA 3I5CA 3K5NA 1S6PB 3V6KA 2CQ4A 1H74A 4B9MA 3HSJA 4F25A 3AHPA 1R8HA 1XMOJ 1EB0A 2JEGA 2KDOA 5J1NA 2U2FA 3IBCB 3D7SB 1F3VA 2L9WA 2Z2MA 3TJ9A 4RWWA 3D1QA 4LF9J 3V5RA 2CWXA 1Q82T 2YH0A 4OZ3A 2YWEA 2PI4A 1S6OA 5CD4A 2PGCA 2H9ZA 1O5JA 3GJRB 1UFWA 3LUYA 2DGTA 3GTYX 1Y5NB 1RAAB 1FD8A 5CCMA 3N6LA 3AXMA 1NDCA 5EX0A 2QL5B 1TKTA 2FZGB 1VQPS 3W5XA 1YGYA 4IRKA 3D6HB 2RQMA 1GNKA 2Q66A 2UV8A 4JI0F 2VD3A 3Q2SC 5U47A 2RDIA 4RO0A 3AB2B 1X8DA 1J5OB 5HMXA 1KQFB 3HCXA 1RLCL 1YJRA 1ITPA 2MJNA 4QR2A 1TQLA 3EM1A 4LF5J 4OZJA 4ZVQB 4Z2XA 1FE4A 1HI0P 1GK8A 1VI7A 4MK7A 1S1UB 4DFKA 2WOMA 1P27B 4LF1A 4PRFA 4X2BA 2IJRA 2MKCA 2XO7A 2A0FB 1G6BA 1KLMB 3P4UB 4I56A 2AWZA 4ZITA 2EK6A 4DQPA 3ET6B 4OV1A 3RZAA 2HRUA 3UI3A 3BV8A 4KTQA 4ZPBA 2JC1A 2HRTA 3IP0A 4RX6A 2H5EA 2AX0A 3B78A 4DPYA 3JSMA 2F9DA 3OR2B 4WU3A 5AE2A 4C11A 4ECRA 3T1YJ 4CLKA 3UN5A 2OD4A 4DV0J 1VQYA 1S9GA 3BYRA 4YS2A 3DLKB 4ES1A 3ZZ0A 1U6BA 3FBBA 2YNIA 2VJUA 3LPYA 3QWPA 2FUG9 3EPGA 2KT5A 1H2TZ 4FYWB 2DNRA 3ILJA 3W61A 4Z37A 5EWFA 5D8HB 4Q43A 4CRJA 5HQ8A 1VLOA 1CJTA 4WKRA 2V4JA 3KHHA 1PILA 2M4MA 2YVSA 4EUVA 3H0PA 3MMAA 1N88A 4NLQA 4PG6A 3CD5A 2JEJA 4HLBA 3GQCA 4CWBA 1JK9B 3DYAB 4DQSA 5EHHA 1RYRA 2C28A 4F2RA 3CCQS 1M90T 2CZ9A 3M9OB 5BYQA 4ZP6A 2R7OA 1T9VA 4JB8B 3OW2R 4ZVOB 2CAJA 2Y1LB 3H2VE 2YTCA 3M2RB 3R27A 3GE9A 1H0HB 2XHWA 3UR0A 3KHGA 3MOJB 2KVQE 3BGFA 3TAQA 3H40A 4Q7AA 1KVKA 2V8HA 1REVB 1T9UA 1DQAA 2C2OB 2DT9A 1NJXA 2OH2A 1T05A 2EFVA 2EPIA 2RE1A 1RADB 4J5OA 1GX5A 1YJVA 1NM2A 2GQCA 2J6UA 1PBAA 1DLOA 2ABYA 2HURA 2LQBA 3AJ2A 3JB9k 2OGUA 5SZTA 5E5NA 1ZYQA 1K1SA 4PQUA 1MU2A 3DLGB 2PMHA 4JBCA 2BQ3A 4V19X 1QUPA 2XY5A 2LQJA 2CVIA 5C42A 1ZETA 2NREA 1RHJB 2KT2A 1QSYA 4JI3J 4O23A 3MD1A 4K59A 3N28A 2O1PA 1LK5A 2VOPA 3HVTA 2HHUA 3PHEA 4LR9A 3N9UC 3PKYA 2ERRA 4ANCA 1YRUA 3K59A 1QD1A 1IM4A 4USIA 4HT7A 1RWWB 2QFJA 1U47A 2XZWA 5KT6A 2V4QA 3ZZTA 2CJYB 1Q81T 4B9SA 5K8MA 1WC6A 1IXKA 2EFPA 2C3UA 2V34A 4Z7YA 2DNZA 4OZLA 1WG1A 3DI6A 1TV6A 2PE8A 3HFVA 4NE9C 1R8CA 5FDLB 2VPWB 3SEOA 2HK3A 3IWNC 2UVRA 1RUSA 1WACA 1Q8KA 1FJCA 3OTOF 3WIUA 3JYTA 1ACMB 3JSYA 2L9NA 2P8IA 3R5BA 3QIDA 2QN6B 3WC2A 4RW8B 3DLLQ 1TL1B 2V4RA 3ENWA 1EP4A 3Q8PB 3K5PA 3HM9A 4DUYJ 3TVKA 4DF4A 3SXLA 1B0VA 2FLOA 2EG2A 5GAGU 4X62F 1RTDB 1ZM2A 3R6LB 2HKEA 4JUZA 3VZHA 3C6TA 4N8NA 3BYPA 1N56A 4IRDA 3CB4A 4QU7A 1PO6A 3M8PA 1QUVA 1UVIA 3HD2A 4J9RA 4A46A 3W65A 4MKAA 2DD8S 1X4DA 2F9JA 3DMJA 1WSVA 4AUKA 4TKTA 2WVCA 2ZZMA 4XAKA 3W3SA 2AU0A 1GH8A 3TA0A 4DQQA 4JI2J 2FHJD 5HROA 3ICLA 2JRSA 4B08A 1HD0A 3VAFA 3JQJA 4M5HA 4QIFA 2HQIA 1G2EA 1RT7B 1WF1A 1WUUA 4PPZA 1OS5A 4KFBB 1R6YA 2X51A 1C0TB 3TANA 3CJ3A 2B4UA 1FRKA 4CO1A 4TN2A 1RTIB 1H6KX 1KVJA 5DZ7A 4C3KA 5IV4A 4NI2B 2I6WA 5ETSA 2LEAA 1WC4A 4MIAA 4CLFA 3C15A 5L9NA 4ZN3A 1JLFB 1Y5LB 5B09A 3OPKA 2NYIA 4IR9A 3QZ8A 2J9DA 4I69A 5LMUJ 2M8DB 1RE1B 2M3DA 1F5CA 4URQU 1TL7B 1VHFA 4F04B 4BC7A 5A8RA 3NBPA 1VDHA 2VG5A 1G3OA 4WU2A 3UCGA 1RHMB 5BXIA 4WFNQ 3OL9A 4ECQA 3GFXA 1V5IB 2QA2A 5CYQB 5ETTA 3OLBA 4ECWA 4IDKB 2DR9A 4NMXA 4YDXA 2XLKA 3DOLA 1WEYA 4L3NA 1YBUA 2IRYA 4C0BA 2GCFA 3HHNB 2F65A 4JI8F 2UU9F 1SL1A 2DY1A 2HG4A 1B4SA 3FCVA 1YRTA 5F8LA 2J6TA 3MM6B 1RAOA 3IN5A 1ZM4A 3THPA 2E9RX 3DRPA 3N4WA 1PIEA 1HNVB 1VQSA 1HPZB 4DR5J 5CD4H 3POTA 2B9YA 1GXUA 1RT4B 3SI8A 4FYDA 4DV7F 1FHTA 2HMIA 2HHQA 5L38A 1IBLJ 3OFGA 4X64J 4LRFA 2EBEA 1FRXA 4F4ZA 1LV5A 5KFAA 1HNZF 5KFGA 3KLEB 1OSCA 2HQDA 5AE3A 5KFJA 3BQ0A 3MM9A 4B3MF 4IG3A 4CO5A 2PIIA 4DS5A 3HKZD 1EQMA 4FNHA 1C0UB 2ZHAA 2F4VJ 4RBTA 2H5JB 3FMBA 2HBQB 4NCGB 2XQCA 1U26A 1V9OA 3SFUA 2X1BA 2DRAA 2QL9B 4WYLA 2BE7D 4I1TA 3G8QA 3CJQA 4V19J 3PZPA 1R0AA 1H73A 6FD1A 1SKUB 4QZVB 2GJ2A 2QJ3A 3GV8B 2BOPA 4NLRA 2K1RA 1PYSB 5HBMB 4IUFA 2OPPB 3Q8YA 1ULRA 4RW6B 3V6JA 2W25A 3MTKA 4UOCA 2OAUA 1N34F 4FYXB 1OYDA 2EG1A 2KFZA 1LWFA 1NZAA 4Q44A 1M5KC 2AJQA 2M2BA 4M63A 4OHXA 1WD6A 2OPQA 1QAYA 3OD2A 5T7LB 5KFWA 4LFAJ 2CQ0A 1TL3B 4DF8A 5IFMA 3GR0A 4MIBA 2B9WA 4LF4F 2ZVSA 1G7CB 2N4CA 2WVEA 3UFCX 3FZ2A 1RKIA 7FDRA 4BC9A 4B9VA 2NPIA 2V6AA 1U8SA 3PW5A 4KV8B 1U09A 4CM2A 2HFZA 2IVFB 2FY1A 4M5LA 3BKUA 3HF5A 3H4DA 3OFHA 4I7FB 1JKHB 2SXLA 4ZP7A 1GX6A 4OJ1A 4EFAC 5K8OA 1NK6A 1S1VB 5HO4A 1QSLA 3OQ2A 4L72B 3D66A 3I87A 2I38A 3TW0A 2MHEA 2AT1B 5GAGI 1K0TA 2EFNA 2DH9A 1IR1A 2QRRA 2LVWA 1S7IA 4NWBA 2ILYA 2MGZB 5HL7Q 4YB6A 4PWDB 2HQ3A 2IJNA 3H2UB 3ZC4A 4LRBA 1FVQA 3A8JA 3HSDA 3SFGA 4IFVA 4CLWA 2F8MA 2EC0A 1SUQB 5H1SV 4RW4A 2HHSA 3FBCA 2MSTA 4HTIA 1NJIT 2KN4A 2MQQA 3OSPA 3OL6A 2A6OA 3BR9A 4HACB 5HK4A 2CJBA 4O4GB 2D9PA 3RR7A 4EYHB 2VFVA 2ZWPA 4JI4F 1JLGB 1CJUB 3NLCA 2KG0A 1URRA 3NMAA 2K3KA 3NXZA 4ZCKA 3MM7B 1KDNA 3SSQA 4KPYA 3PX6A 4GKKJ 2B6AA 2DNOA 4K2JA 1U1OA 2CWKA 3O2IA 3Q22A 2GVDA 1NKBA 3TZWA 1IKVA 2CA9A 4TLRA 1DTTA 1N5VA 3PG9A 4Y3CA 1CEZA 1HMVA 2CKWA 2ZWOA 1RJJA 1NK4A 3RW6A 2HFOA 2V0NA 3M6UA 3UO0A 3LALA 2H65B 2R8IA 2UXBF 4F4AA 1QJHA 2RUGA 4DR2J 1YQHA 1YIJS 3E3XA 3KLHA 5IM0A 1T9TA 4UQTA 4NZ6A 2W9BA 2HNZA 1IKYB 1VRTA 1FJGJ 3V4IA 4JYAF 1KWMA 4YB1P 3WIVA 3O44A 1GT8A 3DM2B 3MFIA 2Y9HA 4CH7A 3CJRA 2KM8B 2W2NP 1N5YA 3DGPB 1T03B 3DLEB 3DRRB 1QE1A 2HGLA 1VFJA 4JV5F 2J9CA 2QLWA 3T1HJ 1N36J 4FF1A 4CTAB 4WTYA 2MLXA 3UW1A 3G6ES 3FEXB 4K8RA 4LSNB 4I64A 5CA5A 2XBPA 1HBMA 1RWMB 3UCUP 2Q43A 2JLEA 2RILA 3KK2A 1UJ4A 1HBUA 2YX7A 4DV2F 4LSZB 4TXSA 4NPOA 2VIHA 2UUCJ 5I3QA 1HNXJ 3DHWC 2X1AA 1B64A 2UXDJ 3BB5A 4RWXA 3C2PA 3P8BB 2IAJB 3T6JA 3HHLB 2BOAA 3D5MA 4LSLA 1IJEB 3J81j 2KHCA 1HBOB 5EGYA 4USKA 3I5BA 4P72A 3M7VA 4DX8H 5KG7A 3TR5A 4A8SA 1X5PA 1E6YA 1S1XB 2ZJQQ 3MM8B 5RUBA 3DLJA 2O67A 4ALZA 4I6YA 2GC8A 1FX2A 2FVSA 2XNQA 3O1LA 4AQYF 4OI0A 3SIPB 1SVDA 2HQGA 4PQAA 2J0QD 5HLFA 5FJ4A 3RGIA 1ZM9A 1N8RT 3CDAA 3M8QA 3CEDA 1YJTA 2O66A 4ZA1A 2JX2A 1IKXB 2B56A 5FLXY 5KFTA 3TAMB 1T0TV 3MR3A 2MZ1A 3A1YG 3MEGB 4Q8EA 5KFBA 4JOUA 5L1LA 1RHRB 2BE9B 4IO1A 1J5OA 4FBUA 1VHIA 2KU7A 2ZH2A 4TQRA 2GHWA 4C3LA 2WCXA 1N32J 1SH0A 2HHTA 5C24A 1N48A 3U1MA 3BSAA 4DUTA 4DV5J 1TMJA 3ITHB 2DNPA 1RWVB 1SKRA 2QYCA 3S7RA 5CQGA 3F44A 2DCUB 2B51A 4FYYB 2OMLA 1S48A 1UZHA 4HTJA 3FK4A 3MM5A 2CIMA 3BSNA 4M5GA 4F4YA 5KG2A 3OR2A 1NO8A 1LXJA 2QIFA 4PXBA 2R7TA 1LWCB 1Z1ZA 2AKWB 2DR6A 1N33J 2PA3A 1OQ6A 5EUHA 1C1CA 4NZ7A 3HXMA 1X9WA 3IRWP 3M2VB 1ZAWA 3T9ZA 4F4KA 5J2MB 1A6LA 3NNAA 2IJFA 4RPFA 1EARA 1NZ8A 2IRXA 3G86A 2R7XA 5A8WB 5F9NA 4J9MA 2VDIA 1HI8A 3MMBA 1FFGB 4YY3F 3WDOA 4DV3F 5H9EK 4DR3J 4J9UE 1FCAA 3ZNUA 4DL5A 3OTDA 4HR2A 4QWEA 2VFTA 4Q2MA 3CVKA 3SBMA 4YB7A 5D0HA 4TNOA 4ICLB 1UKUA 2HFNA 2AIRB 2BXJA 4YFUA 1RACB 2AGQA 4LR7A 4J9OA 1NDKA 3ENVA 3AY0A 2H5IB 2R3VA 4RW9B 3M1VB 2OJ3A 2IBKA 2BJ7A 4DFJA 5G4DA 4WP8A 4B3SF 3BKFA 3NL0A 1M1HA 4R8UB 1NK5A 2PMZD 4G1IA 3SSRA 4K0KF 1REVA 3IR7B 1HQEB 1HNIA 3EGWB 3VAGA 2DPIA 3PJ9A 3QSYB 3SCKE 2AJ1A 4TYAA 2MZSA 4EO6A 4LQ3A 1YBAA 4F4XA 4DSLA 3SQOP 2F8HA 3CMAS 3ZTRA 3FZBA 4NZ0A 3A8KA 2DGWA 3I82A 4O3PA 4FXWA 2I1RA 4DSIA 2KTQA 3T5HA 1VQ9S 1TL4A 2KXFA 2F5GA 1HNWF 4QQBA 1D8YA 3CJ0A 2VHGA 4LF7F 4WIQA 2BW2A 3MDFA 3PW7A 4ILMA 1U24A 4NLUA 3PY8A 4ZCMA 1S10A 2WBRA 1LFWA 3OXGA 5DLGA 4LRDA 3Q86A 1XR5A 3CGIA 4FPIA 4HH1A 4I2PB 1LFPA 2MXYA 1X4GA 2MPUA 1T8EA 2KKHA 3LW5C 3QNWB 1PAEX 1Q0NA 3UDEA 5HMWA 4DX6A 3FSYA 4K7QA 4AD6A 1YITS 5FDLA 5IZHA 2O3DA 4PUOA 4DLGA 2PFDA 3G8SA 2DHGA 4RUAA 1QTMA 3C14B 2XMWA 5DDQC 3VAKA 3I4HX 3MWBA 3IRXB 1W7WA 2XULA 4P71A 3IO1A 3G71S 4NLSA 3CMQA 1YTYA 3R5GA 3PRVA 3NMRA 2F63A 4USMA 1TL1A 4NXMJ 2H1YA 1WTBA 2M0GB 2GVZB 4ZK7M 2HPUA 3BO3A 4Q5VA 1LOUA 2H4WB 4M1KA 3MOZA 4WIIA 3SV4A 3WC0A 2ATLA 4WF9Q 5CAAA 3KMSA 4OZ2A 1X5OA 1VOMA 3KK3A 3BEGB 3CDEA 2KXNB 3TZYA 1RTDA 2CJKA 1ZZNA 1S9EB 3W8PA 4AXIA 2Z4PA 3TUJC 3HHEA 1PG5B 3IM9A 2ADBA 2IHR1 3QO9B 4LFCF 4ZCLA 2W8KA 3VHQA 4LF6J 4U95A 2G1DA 3V81A 2KH9A 4N77A 2R2SA 3DFEA 1HR0J 3OXFA 4Y6IA 1VQ6S 3OVAA 3L4BC 5C2CA 1RT7A 4EI2A 4LRAA 4IH6A 2CPJA 4KFBA 2ZDOA 1GMUA 4GC7A 1K0VA 1X4HA 4Y34A 3UCZP 3P5BP 2XMMA 2OMOA 1U0SA 2GMLA 2FHJA 2FVPA 2ZH4A 1FNXH 3Q0AA 1QSSA 2VUGA 1TKXB 1JLFA 1KN6A 4XDDA 2PMWA 1RWPB 2YNGB 3EXYA 2E9ZA 2XNRA 5T41A 5IXUA 3NWGA 1N0UA 2L48A 2NSCA 2WW8A 3OFEA 1T7PA 4ZPCA 2JLFA 1RCOB 3NNHA 1JLQA 4LF2A 2AZ1A 2FVQA 2MLZA 4IDKA 2CUYA 3AXKA 5KFVA 4O4RA 5A8KB 3LAKA 1S7HA 1QLNA 3KLFA 1UFLA 3W62A 1SPBP 4C3MA 4E0DA 3R5DA 3R1HA 4FF4A 3RBEA 1HQUA 1EKRA 4DZ6A 2VASA 3IAM9 3MM6A 3G87A 1TFYA 2XLJA 4DR7J 4ID5B 5L1IA 4ES3A 2DIVA 1NSQA 3U1NA 4DSEA 2YPZA 5J2QB 4LFBF 3VQSA 5DGAA 2ZNZA 4ED6A 2IC3B 2DK2A 1KEKA 2MQLA 4FVMA 3KHLA 5LSOA 2HS4A 1HPZA 3UD4P 1JMTA 5B0BA 3CCUS 5KT2A 3U1LA 4F3OA 2X3DA 2V68A 4OIXA 4WE1B 4J9LA 1SIWB 1FD2A 4DLEA 1VK3A 3TQ1A 1L3VA 3CCJS 3O3LA 2UUBF 2RRNA 2XMAA 4EK2A 3MMJA 4AMMA 2JHEA 5IS2A 2YY3A 1KQGB 4DMZA 1S72S 2JFKA 4W90B 1XWLA 2K06A 1SJRA 3DDNA 3DU5A 1SH3A 4NCGA 4WWSA 1X4EA 1HA1A 3GWCA 4Y2MA 4N41A 2YPYA 3O5TB 2QX0A 1RTJA 3C6UB 3RG6A 1ZPWX 2LECA 5LL6d 5A2QY 3NGSA 2YXLA 1X5TA 4F3MA 4U7CA 5HBMA 4NRUA 1T9XA 2AJ2A 2ZC4A 4HI1A 3PVXA 4DOZA 1HIYA 3L7UA 2QA4G 1RQ0A 4M94A 3NRBA 2LP4A 4DSFA 3PX0A 3BGUA 4OZNA 4J91A 1WG4A 2QLJB 2VPZB 3W2WB 2CJ9A 4TY9A 4K4WA 2FC9A 2XEXA 4LMZA 4ILLA 2CG8A 4K4YA 1RISA 4OMFG 5T7LA 4DR4J 3F0NA 2LXUA 1FERA 1KONA 4HDGA 4NCAA 5D4PA 3TZZA 2NUHA 3W2VB 4IH7A 3P5TL 4M5DA 2HBRB 2HNYA 4QIEA 3I55S 1QY7A 2WONA 3WX8A 5CXTA 2IYGA 2QTWA 4EWTA 5LOQA 4KV8A 2YKOA 3M32A 4L75A 2MB0B 3H5XA 3MF5A 2HGMA 4XDCA 1C1BB 4I7FA 3R97A 3PO4A 2BMBA 2VV5A 2AJ4A 1TZ0A 5B0DA 5KFOA 2HNDB 3EZOA 4ZJQA 5KOXA 1S1VA 4O3QA 2BRLA 5J1EB 3BO2A 3JQKA 3OR1A 3MEDA 2QA4S 4YR0A 3LP2B 5F8HA 2DHSA 3JQMA 4CO0A 2W9AA 4FXDA 1U4BA 3RRGA 1RZMA 1CBKA 1NSAA 2EEYA 4R0JA 3PJWA 3AA8A 4DQIA 3KUHA 3K58A 4QWBA 1XR7A 8AT1B 2DNHA 1AZSB 5KFYA 2VG6A 4PWDA 1Y5IB 1SB6A 1DTQA 4DPOA 5D4LA 3M8RA 1NUEA 2GIRA 2OEKA 1SUQA 3SMZA 4PCQA 2BR0A 1WF2A 2W7PA 3C8YA 3EGZA 1VQLS 4NLTA 1Q79A 2CDQA 5BYRA 2IM1A 1VR6A 1D8ZA 3D1HA 3BBBA 2CQ3A 4YP3A 2R42A 4HACA 4KGVB 5G0RA 1X4CA 4EBEA 1JLGA 1OSDA 4DWIA 3IGNA 3PCOB 2Z0GA 3PW4A 3MD3A 2Z2YB 2Y1RI 2R7RA 4Q0BB 4KGZB 5D4OA 3BH6B 3MR7A 1NEEA 4IG0B 1SJ1A 2VQFJ 5K8NA 2HVEA 4F67A 4R25A 2IM3A 5A0YB 2FDNA 4QWAA 3TA2A 3KJQB 3SQGA 4NX9A 1S0VA 2ZM6J 1APSA 3BS9A 2KM8C 3MCOA 1RWOB 3KLGB 2Z2LA 1P9QC 5KTQA 2YWHA 1FVSA 4JI1J 2ZEJA 4KO0B 2YNHA 1YKWA 3TRGA 5HP1B 4LF9F 1X4FA 2KJWA 4OQJA 4UY85 3ISZA 1LW0A 3V6DA 2ZE2A 2AJ0A 2RRAA 3E01A 1BQNB 3R5JB 2DYAA 3DM2A 1MROA 2WRMA 2RU9A 4HDHA 4E98A 3BQ1A 3KKFA 3MAAB 2FHMA 3KJNB 4EYIB 1PC4A 3OL7A 2MY8A 4Y00A 1FNOA 3DRRA 4NL5A 5FIIA 3HZEA 5ETRA 2QZ8A 1AUDA 3M8WA 3K0JA 2JVOA 4LSNA 4O3SA 2ZDPA 2BANB 2IDEA 1RT3A 4C4WA 1T95A 1NRKA 3W8GA 2N4DA 3D0IE 1NXIA 4LF5F 2OHDA 3RB4A 3G82A 2W4DA 2OTLS 5HVHA 1L3TA 3KYLA 1NJWA 2DH7A 3GJTB 4HHHA 5DG9A 2BX6A 2IAJA 3UR3C 1RWUA 3FMWA 4NLXA 1TUVA 3EDQB 2CNOB 3LGMA 4CQ1A 5B0CA 1DQ8A 1HBNB 5I3UB 1IUJA 4O0NA 4X4TA 3LQVA 3DC2A 9ATCB 1XR6A 1RTHA 3ILLA 2WZ1A 4BDPA 3GG0A 2CPEA 4MMOA 1W2IA 1DZ5A 2P9GA 3T1YF 1NK0A 5A76A 2EVZA 3MM8A 2KZMA 3QIPB 4DV0F 1RT1A 4L3KA 1Y3KA 1NH8A 4YDDB 3NOGA 1F2HA 2E5IA 4DPXA 4CT9A 4P2MA 5DETA 3IG1A 4RNMA 4P9SA 4O44B 1VRUB 4H4OB 1ZZFA 3PYEA 2MZTA 1RP5A 2VF3A 2YKNB 3GU0A 1YLXA 1HKAA 2EI5A 4URGA 1J5EJ 2XI3A 1RABB 2QT7A 2CQ1A 1EJ7L 1FRMA 1XNRJ 5IC4B 3TAMA 2BM0A 4ERDA 2ACMA 4ZVUB 4NRTA 2B0GA 1HARA 3MEGA 4GVBA 2QL7B 4A8XA 1M5OC 1SXLA 3VGVA 1YHQS 3C19A 3KK1B 4DG1A 4OJHA 2D69A 3C66A 1VS3A 2AX1A 4TY8A 1S99A 5A6WA 1OYEA 3NNCA 4RW7A 5DG8A 4B3TJ 2YWWA 4F3QA 3WZ0A 1IBKJ 4CH0S 3A12A 3ITHA 2AEFA 4Y2CA 1QAXA 3BF4A 5EN1A 4ZHRA 1JLAB 5B0FA 2RUSA 3DCAA 4ZS6A 3ETOA 3Q23A 2FYXA 1MMLA 3FC9A 1XMQJ 1TFWA 3CIMA 5K14B 2WB4A 2XSJB 4KKOB 3H59A 3AOBA 2VA3A 1I3OB 3M2VA 3M05A 2V2ZA 1FRJA 3GLJA 4NEYA 2AEMA 1N52B 1NNDA 4OYIA 2Y3YA 1EIYB 2QV6A 4JI3F 1WNEA 3GONA 1FTRA 3ZTSA 4USWA 3TP2A 2IM2A 4A47A 3FNNA 1SV5B 3RW7A 5HVGA 1UEKA 4L73A 5F0UA 2PA8D 1JWWA 1VBKA 1BMQB 1N6QA 4LQ9A 4ICLA 2GHVC 3CCWA 5GMDA 5C25A 1SL0A 4WBFA 5GADU 2CDRB 1D9AA 3OJUA 2ZH9A 3QFWA 4IFYB 4WJBA 4DPTA 4UT4A 3EVWA 4B3RJ 2GAHC 2WVBA 5AE1A 1WC3A 1YI2S 3HFKA 3M1VA 4Y2KA 4J9SA 5KFQA 1IBMJ 2CZ4A 3C16B 1PKUA 3I5AA 4R8UA 4ED3A 1SIZA 2G2YA 7FD1A 4QYZK 1HYSB 2L9DA 2YQ0A 1FKPA 3WQPA 2D3OR 1I94J 1UWAA 2J7KA 2AGPA 4C8LA 4IOCQ 2DGUA 1TAUA 1H7WA 4DUYF 2VFRA 2Z56B 1VBZA 1MN7A 3HSGA 2V5HG 5IT0A 2JOQA 3K5LA 1AUSL 2R7UA 4MH8A 1R0CB 4IR1A 3JTOA 2VQEJ 3TUIC 3D28A 5CZCA 4KHRA 4TVAB 1WC1A 4ENOA 3W63A 1S77D 4QPTA 2XMKA 1WOPA 3LAMA 5DG7A 2NCKL 4D3HA 2LCWA 3V6HA 3KUEA 5DDOC 2DXFA 4JI2F 2GA7A 5HN0A 2OUGA 4NA2A 2DXEA 1YZ6A 2XZDB 2YKMA 2O5DA 1U1LA 3MCSA 3P45B 1FWLA 1G1XA 4LVNP 4PPDA 3IS9B 2BJ9A 1TK8A 3N6NA 2BEFA 4P2FA 3HSZA 4OLPA 4C6AA 3DOMB 3W1YC 5KFXA 2CG4A 3I96A 5E3RA 1S59A 3Q8UA 1H2VZ 3ISND 2YNFB 1KNZA 4B9UA 3RUBL 5LMUF 3C14A 3C3LA 1JLEB 1NSKL 3VZIA 1VBYA 1RT6A 4K4TA 1BQMB 3OSNA 3CJSA 1V6HA 4H4MB 3H20A 1RHKB 2GVZA 2E5JA 2BUNA 2MSSA 4TU9A 3J80Y 3MCNA 5KFDA 3TVZA 2VG7B 4KQZA 2E5GA 2ACYA 3KJVB 1RI7A 4HVZA 2OPRB 1Q86T 3LP0B 1VQ8S 2EW9A 1UVLA 3K8VA 5E7OB 4MKVA 3I9V9 4ECXA 1HW8A 3ETMA 2UUWA 5IQQA 2WHOA 2C2RA 3VQTA 2NXUA 3PX4A 2YWFA 2V67A 2DJWA 1NLKL 2OELA 4ID8A 2FJXA 1H2UX 4KJIA 1CJVA 2ASJA 1TTHB 3TO8A 1JIHA 4DR5F 3HFZB 3PM9A 1WOOA 2VODA 2P9CA 5BR8J 1B7FA 3EX7B 1Q5YA 2D9OA 1IBLF 3PIOQ 3W64A 5HJYA 3UQSA 1ZS6A 4X64F 5EWGA 3F56A 2FZKB 2KYXA 3W7BA 3RTVA 3FEYB 5KFCA 2MEWA 4USJC 3G6YA 2DXDA 5AJ3J 2JH3A 1C4AA 4NA3A 2B5JB 4PAAA 2YNGA 2DHAA 3PR5B 2J8AA 2OP5A 4USTA 2F4VF 1FKOA 3CT9A 2XMJA 5D15A 2HS0A 3AJDA 2F4FA 3R8YA 4DV2J 1OWXA 1WJ9A 4X4UA 1UEUA 4CLTA 3CD7A 4K2XA 4DXLA 5B0AA 4J9KA 2BA9A 3UVJB 2EK1A 1M5PC 2J76E 3HX9A 2OPSA 4JI6J 1P1TA 1PCAA 5A8KA 4Y2IA 1XERA 4DSJA 5JJBA 1UZDA 4QOTA 3AAWB 4K4SA 2JSXA 4DX5A 3CCVS 3FEZA 2WSEC 3FRYA 3T41A 3HI9A 1F60B 9RUBA 3GV7B 4NEZA 3MECA 3P49B 4DV6J 4MJKA 3NWRA 3AODA 1S9FA 5KG5A 3DHXA 4C48A 4F02A 1Q8BA 1CJKA 5F3TA 3JSMB 5IWAJ 5D0GA 2QGFB 2CQGA 1FFSB 1O51A 4U67Q 2ALZA 2IY5B 4NLWA 2YNIB 3VVTA 5GADI 4LFAF 1WHXA 4X4PA 4A4JA 4N5SA 2DRBA 1S76D 4OX9J 2E7XA 5CZDA 1JXLA 1PJ7A 4CNYA 4KSEB 2V4JB 3AD7C 3FCHA 2A2DA 3G4SS 4JI5J 3H98A 3MMAB 3CPWR 3HVRA 3H7HB 2ZOGA 3TVYA 4CYUA 5C5JA 2DHXA 4J90A 1KBRA 1U2CA 1JXVA 1U1NA 3THTA 3HK2A 4N76A 4RNNA 1RU1A 2DVIA 2DTJA 3IMQJ 3KDOA 1M5HA 4USVA 3T1AA 3MR5A 4H4KC 4KAIA 1LEOA 1WI8A 4ZP9A 3EGVA 3CXCR 4ZVHA 2FJAB 2C2DA 1HL6A 1ZM3A 1LKZA 4DQRA 1FJEB 1VQNS 1FXDA 4RNHA 4NXNJ 4AE5A 5I42A 2PFFB 1HLWA 5ETMA 1T05B 4MYUA 4EGLA 1HHQA 1YJUA 1OY8A 2GO9A 4H4KA 4ZDNA 3QFHA 4ZVPB 3W2WA 2RDDA 2XMVA 1Q8IA 2CVEA 2C3OA 2E66A 2RKIB 4DL3A 5F8NA 2HZVA 3KOAA 2FJWA 3TJ8A 4PQUB 2XTJP 2LA4A 2D3O1 5D6GA 4F36A 3BPSP 1RAGB 5C42B 3I0RA 1ROFA 2GS8A 3R5CA 3W2VA 5LJ5Y 1IKWA 2J9DE 4R5PA 4M5IA 3HVTB 4GKKF 1VQMS 2P5VA 1TKXA 3NAHA 2FLNA 3TOQA 4NLPA 2BJ3A 2I5JA 3ZZRA 2ALYB 1K8AT 1N4LA 1SJ3P 2C3YA 3PO5A 2HNDA 2HHHJ 1M5VC 4ETXA 1FE0A 3D67A 3DKDA 4ZVTB 3LP2A 1AW0A 4RLEA 2CQDA 2HEKA 3W9HA 1H7XA 2R2UA 4YOEA 3TAPA 1KOHA 2D7SA 3DI6B 1Q7LB 1F0XA 2RF2A 2E7WA 4DR2F 2H51B 2W2QP 5EWEA 4C7QA 4WFBQ 2BM1A 2DR7A 3JYTB 2XB2D 2CPYA 2AMCB 1BWEA 2K7KA 3CMES 1FJGF 3TYTA 4LF8J 1P1LA 1NDLA 4K0KJ 2ZOFA 2CADA 4UOHA 3MR2A 3JTNA 3BGRA 2QFIA 4F7VA 5D77A 3NAIA 1ICEB 5CYMA 1SC3B 4B3OA 3D9BA 1H3DA 1RWNB 2OIHA 1OIAA 4UF4A 3AQOA 3W66A 3T1HF 1N36F 3CC7S 1DURA 1ZA1B 2IVMA 4DI6A 4QPXA 3C6TB 1VIOA 2H54B 2Q79A 2AGOA 3M8YA 2E7VA 3DGVA 1E6VA 1CVJA 1RAHB 3DMJB 4ZCIA 4Q0BA 4MFBA 4MKYA 2KFNA 1NDPA 5HROB 2UUCF 1HNXF 3D54A 3E8OA 1B0TA 4AT1B 2VBZA 2GJFA 1VIXA 3GYNA 1OJ4A 4K4VA 4OYXA 2UXDF 4MKBA 5M2UA 1VQ4S 5KG0A 4FZVA 2JDJA 4OJGA 1QDUB 2JLGA 4IOBA 3VF0B 2Q6CA 1TUGB 1NK8A 4F0HA 4QYZJ 4KRWA 4DU7A 2J9EA 4Q45A 3A4TA 4K4XA 5F8JA 1MN9A 4F8RA 1KQKA 5HJXA 1Y10A 3Q83A 3Q8QB 2R7WA 1CSJA 1B99A 3C15B 1N5QA 2W9CA 3P6YC 3M9NB 1PGZA 1ELOA 2J7WA 2FHKA 4AYBD 3QJLA 1WDDA 5A8RB 1NHVA 2W7OA 2DNYA 5KFHA 3L09A 1B70B 4ED4A 1CPZA 1BQNA 1W26A 1S79A 4FNIA 3UNYA 4HI2A 1AFIA 1GXLA 1Q8LA 1N5SA 2HLUA 1D0EA 2HVDA 3DOLB 2E1MC 2OEJA 5DRKA 2W1BA 4B02A 3R7SB 2UZAA 4CO3A 2R8HA 2GIFA 1XK8A 3KG0A 1FFWB 3N5FA 2HYIB 2HQFA 1WHWA 2V2VA 1NCLA 2BANA 4YQWA 4O0IA 2C2KB 1S1WA 3QRRA 4YHHJ 5BYSA 3J81U 2FVCA 1W2BR 2CPXA 3DDIA 1UW4A 3DRPB 5JXSA 3H90A 1RA7A 3MPUB 2K7JA 1NK7A 1URNA 1S6QB 2VBXA 4CZCA 1B3TA 4JV0A 4RU2A 1N32F 4KHPJ 2ZH8A 2UUTA 1UVNA 3OJSA 4DV5F 3MEEB 4WYWA 3PYFA 1Q16B 4HT5A 3QZ7A 2XYGB 1OPIA 3J7YU 1VC6A 3A3OB 3FKBA 3TA1A 2HAFA 2ZHOA 2R8KA 2LLZA 4PYDA 2R4FA 4HKQA 1T9YA 3L9ZA 1U8WA 2BABA 4LIWA 4NOHA 1JLBA 1M0SA 3MM9B 1SQEA 1T11A 4CLSA 2R2RA 3Q8SB 3QIPA 3PYDA 1GEHA 1N33F 4DV4J 1JB0C 4FXVA 4J9QA 1IM6A 1RT5A 2WVFA 1UAWA 3QAUA 3AOCA 4X65J 4RNFA 5F8IA 1WDTA 1M5SA 4O44A 3EGNA 1WKKA 1VRUA 1LWEB 2KI2A 1WELA 2Y1JA 5D3GA 4AMNA 4RUCA 2CNLB 1R0AB 4DR3F 3ZZUA 1REGX 3L7OA 1GQEA 4AL5A 2YX1A 4G1PA 1TR0A 4UZCA 1WORA 3HJFA 1RB0A 1WG5A 3LP1B 4U96A 3T19A 1RCXB 2DNNA 2MZJA 1GMWD 3KK1A 3OUYB 2V2QA 2P6SA 4OHYA 1WC0A 3CCTA 4DV1J 1LWFB 1S6UA 2K8GA 4UOFA 4ZJOA 2HLTA 4DPUA 1U1MA 3G96A 2PC6A 3R7NB 5LMNJ 4OHWA 5HSPA 3ZO7A 4WFXA 2PEBA 4CO4A 4C2MA 1PJ5A 1CULA 1X0PA 1XNQJ 4X66J 3MUTP 3NCPA 3U02A 1JLAA 2IMOA 1VC5A 3KMQA 3B8HA 5EDWA 4KGMA 2RB7A 5DQHA 3HO1A 4EO8A 5E0OA 2GNKA 4DFMA 3JAMU 3I32A 1Z4UA 3P96A 1L3UA 4A8KA 2Q3PA 1EQ0A 3W5ZA 2DEJA 4DSKA 4I6AA 3DRYA 1RKJA 1FNMA 2W2OP 2ASDA 3AH6A 2RSQA 4HEA9 4UUWA 2Q1LA 1VLYA 3CDBA 2EBGA 4AFFA 1OY9A 3D6TB 1FDNA 2XGPA 1O6XA 4FDFA 4ZPWR 3HD1A 4WXWA 3QJJA 3P3DA 3KXDA 1R6VA 2HAIA 3EYZA 4I0WA 5I3PA 2F3JA 5ETPA 3QT5A 1J2VA 2X1GA 4ECTA 3RJMB 3HVAA 1CG2A 3K8WA 1D9DA 3T3FA 2GGPB 1PJ6A 2HFSA 4JI7J 1R0BG 1C4CA 2V69A 2YWKA 3LWMA 4QR0A 2A18A 3T9NA 2BZ2A 4DCPB 2D74B 3SYZA 1P9YA 5IT9U 3C16A 1RAEB 3CUNA 3KLIB 4JP8A 1BQXA 1EETB 5CHCB 1FXRA 1D3WA 2M8HA 4XK8C 1HYSA 4N56A 2QEXS 2MLYA 4NXMF 1RK8A 4KY3A 2FQQB 2B6AB 2IRUA 2NXEA 3PEJA 2DGOA 4R0EA 3GMGA 4X4VA 3RAXA 2CYYA 1IKVB 3K2YA 4M5MA 4ZJLA 5DO2A 3KDNA 1HMVB 3OL8A 4DU8A 3NGTA 1ZTWA 4ZN1A 4MAKA 4DUZJ 1Y7PA 1TUWA 4LF6F 4RNOA 2BE2A 2YQ3A 3QLHA 4K5RA 5IM0B 4KR0B 3CJTA 2W9BB 4G6VB 2C2NA 3CE8A 3VCDA 2HNZB 2HGNA 1VRTB 2MDAA 2AQ4A 2E1AA 3V4IB 4OYMA 3B4DA 1TVRA 3T5LA 5ETLA 3DNCA 1LK7A 3PNIA 1K44A 5AXKA 3FRZA 3D6FB 2X1FA 3FBEA 4UW2A 4J37A 1SBRA 4FKYA 4C8KA 1RXOB 1HI1A 3HJVA 3ISNC 3GCWP 5SUHA 2ROGA 3NG8A 4G1QA 2YNFA 1HBMB 3J7YI 2RT3A 5KFIA 2MQPA 1JLEA 3RAQA 1LW2A 2AZ3A 3DRSB 4DL2A 1NB2A 1BQMA 1HBUB 3NCRA 3IM8A 2VC0A 1OPZA 4PG4A 4H4MA 2MQ8A 5KFRA 3LPEA 5J2NA 3EPIA 4NLGA 3O8WA 3US5A 4J9PA 2ZH5A 1JXEA 4N47A 3OXLA 4LBHA 2OPRA 1N0VC 3HHLD 2HFVA 3LP0A 2YBVA 4LSLB 2XM3A 3FSXA 1X0FA 5F9LA 1R27B 3M2UB 2ZD1B 4DR7F 3MUVP 2P6TA 1E6YB 1L5UA 4P7TA 4FPRA 4BHQA 1NU4A 3THVA 1S6PA 2UUAJ 2R8JA 2JEIA 4WZQA 5HLFB 4YN3B 4I2QB 3IXQA 3AD8C 4O3NA 3SDEB 1U1PA 3M8QB 2HFUA 2KRBA 2HZCA 3TWZA 2MKJA 3TX0A 2QSFA 4DL4A 3OVBA 4ZVFA 2DNQA 5L39A 2BRKA 3AQPA 4ER8A 2ILZA 2BVZA 2HVHA 2B5JA 2LA6A 1U6FA 3AT1B 1U02A 4O3OA 2HVZA 4FP9A 2CNKB 3M4XA 1QM9A 5GMKa 4DR1F 2RS2A 1I1GA 1FDAA 4OYZA 1RHQB 2DITA 2HIQA 2IBOA 3UVJA 2FJEB 4C8OA 5C24B 2N82B 1O8BA 1HWKA 2JEFA 5KFZA 2CQIA 1NPKA 3LTOA 3H2LA 2WSCC 3A8EA 2E1PA 2CPZA 3A3NB 2FB0A 2R9LA 3MM5B 1S1UA 3N01A 4RBVA 1KHVA 1YJNS 2HHVA 4BCAA 4K50A 3U7JA 2FLPA 2IVYA 3EZ5A 1MW7A 4ZVRB 2G0JA 1KLMA 2VH7A 1NHKL 3NOCA 1WF0A 1FXLA 3CSKA 5GVQA 3CJKB 4CI0B 3ET6A 1C1CB 2NS1B 5LT5A 2BV3A 4KT0C 1UEVA 2VC1A 4OYAA 4PXCA 2W4PA 4DR4F 2AF6A 5B7WA 5D0RA 2AYMA 5DS7A 2X7IA 5H9FK 2W2PP 3MMBB 5DJBA 2ZUAA 3CDUA 3DLKA 4A8QA 2IDLA 4ECZA 2BJ1A 1S1TB 2B9EA 4ECVA 2PDAA 2QLBB 4D3GA 2CQCA 4KGXB 1WTFA 4LREA 3BQ2A 4GKJJ 4KC5A 5E3QA 3ZZZA 2V63A 1LXNA 4QWCA 4OI6A 1DQ9A 1HFEL 2ZC3A 4QW9A 1FA0A 3SCIE 3RB3A 2E44A 2G1HA 3D4JA 2HW3A 5FD1A 1AROP 1KS2A 3H5UA 2DGSA 1U49A 4U8YA 3MPDA 4FKXA 1FEEA 1DFDA 3DYAA 1TK5A 4OI2A 4ZVGA 2HVIA 2QYGA 3FDSA 2BBEA 1S57A 1SH2A 1S4FA 1IR0A 2OI2A 1HNIB 5AXMA 1GTHA 3Q8VA 3CO9A 1GAOA 2B3TB 1GFWB 1UL3A 4RR5A 1F9EB 2Y0SD 2ADCA 5CABA 3ADAC 2RKIA 1J27A 3M2RA 2DHHA 5DM6Q 1NKEA 3G6XA 2BJ8A 1Y9OA 2JZ5A 3KG1A 3GIMA 3GFHA 1UJ6A 1U0HB 1MG7A 4ZPAA 4IH5A 1VQ5S 4DR6F 3IWLA 2RJZA 3QATA 3CJ4A 2MQMA 4A8WA 3B54A 1UA1A 3I56S 2VQFF 2CQBA 3D0HE 4M95A 3DOKB 3UDCA 3DLGA 3AA9A 3QRPA 1PYOB 3UWTA 1UMJA 2GMHA 4IRCA 4YEAA 2XSFA 4DHVA 3OV7A 2ZM6F 2G0CA 1U6ZA 3EJMA 3CNQP 2ZZNA 1ZPVA 1S0OA 2KZZA 3JTPA 1XIQA 3GIJA 3GFZA 4PUOB 2QMUB 4JI1F 3TARA 1YVFA 2OKQA 4JV1A 5J2PB 3PTWA 3OTCA 2GX8A 3AB4B 2E5LJ 1MMNA 4RKUC 4B9NA 4ZOSA 1PAUB 3L7PA 1UCNA 2CJXB 3ZZOA 4ZLPA 3KHRA 1QVFR 2B4PA 4ZIWA 1KVIA 4J7CA 1U7LA 1BGXT 3IBWA 3PR4A 2BKPA 3CJ8A 1VMBA 2DB1A 3LF0A 1PYTA 3KK3B 2DO0A 4QYRA 3ZZPA 1NSPA 1ZH5A 2F40A 4ZLLA 2LDYA 5DZ6A 4RW8A 2HS3A 3FFIB 3CCLS 1SJFA 2KT3A 4QIVA 2RIJA 2BDPA 4U8VA 1F1BB 1SKSA 4DCJB 2L41A 3V81B 2K2PA 2LEBA 4FVCA 5CZXA 1D09B 4C8YA 4OI1A 1OQ3A 1Y00A 2MQOA 4DJBA 3GP9A 2XS5A 2V8VA 2R7SA 4DZDA 4PXDA 4KPCA 2ROEA 3EXCX 2P9EA 3M6VA 5KFPA 1Y11A 3PHTA 5CCLA 4ZIVA 2GQQA 3CIZA 2PD1A 3ZXWA 2ASYA 6FDRA 4JV2A 3H5SA 4ZVSB 2GQ2A 3PXGa 2M7SA 1RGVA 1RDRA 4K4UA 2COLA 2B7BB 3GZ7A 2ZBQA 2GZOA 2QLFB 4F0MA 1C0TA 1MWZA 2I2YA 3DU6A 1RTIA 1T3OA 3SCLE 2ZUGA 2BJEA 4NI2A 1XEZA 2CJAA 1JLQB 3E2EA 3QGHA 4C9DA 4AXJA 5CYJA 1M1KT 1DY3A 2DNGA 1J5EF 2MHNA 1XNRF 1TL7A 3KLFB 1A7GE 1L3KA 2V50A 3QSIA 2FJDB 5D78A 1H72C 1HQUB 5DM7Q 4GO7X 4UTGA 5LSRA 5CYQA 3V4MA 2JJ4D 2UP1A 3BKTA 4LVOP 1WHYA 2UVWA 2LXIA 2DCLA 4WK1A 4CCHA 1S6QA 4XO0A 4PWUA 4A8YA 2JWNA 4M5NA 2LYVA 3NGUA 2VKZG 4B3TF 2YX4A 4ANDA 2NZCA 3E51A 1IBKF 4X4NA 4P73A 5E3CA 1CQNA 3MEEA 1JNZB 1F6TA 2WTFA 2CZVC 2I8EA 4IOAQ 4KBIA 3X3UA 4RUHA 2MQNA 2UXCF 1HNVA 2L08A 2Y8YA 3FQLA 1T3NA 1VC0A 2HHXA 5HMYA 2E9TA 1XMQF 3TEGA 3DDKA 1RT4A 4ZPDA 3RBZA 3CW2C 4AL6A 4CM0A 2PEHA 2C3MA 4OZ5A 3UDLA 1RTJB 1LWEA 3KLEA 3LGNA 1GMVA 4LR8A 4JI0J 3RU0A 1JX4A 2BACA 3K89A 3PDNA 4F2SA 3VR1A 3MHYA 4BWJA 2RD5C 2UVVA 1C0UA 4YB5A 2KVIA 5ETNA 3I31A 1X31C 2LEPA 2DNKA 2ZBIA 1WEXA 5ETOA 1IQZA 3AJ1A 1YZ7A 3PEHA 4ED1A 3LP1A 2MKKA 1RHUB 2FGOA 2B7CB 2R2TA 3IAS9 1CS4B 4WFZA 4IQMA 3OUYA 5M2PA 2V8DA 1UA0A 3I0SB 3TEHB 5KG6A 2D3ZA 1AYEA 4P52A 1H38A 4P10A 4B3RF 2B4VA 4V1Ak 2C22A 1RWKB 3Q24A 3S6EA 4E8UA 2OPPA 3UD3P 4RW6A 1IVZA 1IBMF 4WZMA 2XCPA 4J9NA 2XI2A 5LXYA 4NLVA 4CLPA 3MURP 1GMWA 4I4BA 1NK9A 4M5DB 3IC1A 2HNYB 1XMBA 1I94F 2WONB 2RAQA 2GAGC 2IA6A 3RB0A 1RTZA 5KT3A 3M32B 1RBAA 1XN9A 2A10A 1YDLA 2HBYB 1ZBTA 1TL3A 2RVJA 1DRZA 3ILIA 2EC2A 3OR1B 2V8GA 3MEDB 2APOA 4NA1A 4WP9A 2IIHA 2VQEF 2WSFC 5A6PA 1IR2A 4ELTA 1F3FA 1DAXA 4OZ1A 1PSDA 3GPAA 3IWXA 1SKWA 3DLHA 1JKHA 3IR5B 1BWVA 3GCXP 4W92B 1HHSA 2KO1A 1AXQA 2C2MB 2VG6B 4FF2A 4YR3A 1WKLA 2C42A 2YKPA 1S4EA 4PZVA 3RRKA 4EMDA 4WK3A 1UWBB 1DTQB 2HK2A 3OLAA 3MPYA 1YJ7A 5H9FJ 3DN9A 3QPIA 2GGPA 1HHTP 3EDRB 1FT8A 3UD5A 4IYQA 4MT1A 3PW0A 5ADZA 1UVMA 3QT8A 2O01C 2HHPA 3R2DJ 4UZBA 3M30B 3NP5A 2MGZA 1Q95G 1F5BA 3ENAA 5G0RB 2ATCB 5C7PA 3KLIA 1EETA 1S5ZA 3CF5Q 4PXEA 2DO4A 3MEKA 4W4MA 5K8PA 5M2RA 1RBLA 1YX2A 3RBXA 2C3PA 4LBPA 2I9SA 2F1FA 4X4QA 4PG8A 4LRCA 4EZ6A 4O4GA 1P8GA 2Y0BB 1YSJA 1CJUA 3GJSB 3SQGB 3KNAA 2FLLA 2CPFA 2FHOB 2FGCA 3S8SA 3D68A 4Y0FA 2YQ1A 3MM7A 1SQGA 2Z8QA 2DKOB 5B0GA 3R6GB 2EWHA 2B8PA 2OD6A 4YUDA 2YNHB 2EFOA 4C0OC 1MMDA 2R7QA 1ZA2B 5HI7A 2AV5A 1KFSA 2IFXA 1LW0B 4AMPA 1HWUA 3V6DB 2ZE2B 2FIUA 3N6MA 3E01B 3A3PB 1RYSA 2OTJS 5E3PA 2YKQA 4PWWA 3AFGA 3OHBA 1MROB 3EUNA 1XMOF 2MZQA 4XIUA 2WB1D 2Z58B 1B0PA 3CD0A 5BR8F 2G0IA 3L95X 2LQ8A 1KLNA 2BQRA 2KHDA 3K7RA 4DDFA 4QBUA 3OTOJ 3KUGA 3GB0A 2EKYA 1KTQA 4PR6A 2YWGA 5AJ3F 3VVUA 1NH7A 4Y2AA 1IKYA 4QJVA 3QT7A 3MFHA 1VQ7S 5CZVA 4QW8A 1SC6A 2GHPA 1NKCA 2KG1A 3Q89A 2M52A 1RT3B 3JS9A 3DRSA 4ED2A 3DGPA 4OV6A 4G3IA 1T03A 2PSZA 4FBTA 3DLEA 1AB8A 2KRRA 3G82B 3BBCA 4ECYA 3T6BA 3NCQA 4X62J 4CTAA 3OHAA 4WTOB 2AYEA 1NPRA 5FLXU 2WBMA 4JI6F 4NLOA 1IN0A 3EMTA 3HHLC 4URSA 4ILRA 2M70A 1U1QA 3EVMA 5ITHA 2FJVA 4XTTA 4CT8A 4HHJA 5CH7B 3VAIA 4DV6F 4WCEQ 1HD1A 2QMXA 3M2UA 2OEMA 1RTHB 2N7CA 4UUXA 1V3SA 2ZD1A 4F0KA 5IWAF 5JMNA 1V5VA 4M5JA 1MWYA 3PW2A 3FUYA 3D2WA 2FC8A 1RT1B 3HHLA 3QWUA 1Q4RA 1JNRB 2A3JA 2A2CA 3BBFA 1HBOA 3IG1B 3OBIA 3RBDA 3H8YA 2XMTA 2ZH1A 1X4BA 2XMUA 4GVLA 1U1KA 2GV1A 5DDPC 4I2QA 3SDEA 4OX9F 2X3GA 4C8MA 2JL9A 1S1XA 1Z2ZA 3CCES 3LGHA 2QO3A 3QAEA 2YKAA 2J5AA 3W5YA 1UP1A 4ELUA 5IQ6A 4JI5F 4DCOB 5D0EA 3KLVA 5C2GA 4QCLA 4GVBB 2GO8A 3BGLA 4KE5A 1LQ9A 4N7TA 3I4PA 1NMEB 5IC6B 4DG1B 3RAMA 1PBUA 1IKXA 4TY8B 3QRQA 2LU2A 4RW7B 2DNMA 1SC4B 3PRBA 3DXSX 3ZZYA 4JI8J 2UU9J 4L76A 3D6MB 3QGPA 2KFYA 2OO4A 2MKSA 1SJ4P 1V3ZA 2HIYA 5F0WA 3S01A 4ZHRB 4NXNF 2QLXA 3HZGA 3AOAA 4H54A 2ZJPQ 5KG1A 4OJ3A 2RQKA 3GSDA 1UPMB 1Q7YT 3GV5B 1CC8A 3LH2S 5KG4A 4WFAQ 2AD9A 3RYLA 5KT5A 1UVJA 3NS6A 4WPAA 4DV7J 3CJKA 2XY7A 1VK8A 5K20B 2KB2A 2RH3A 3DRXA 4S0MA 1TU0B 1S12A 3V2UC 2IYIA 2CQ2A 1HNZJ 1A0OB 3HLUA 3K17A 2AEJA 2ZBCA 4B3MJ 3OFFA 4OHVA 1FO1A 2M88A 1UVKA 5AXLA 4I67A 2H4YB 1LWCA 5F3ZA 2C2EA 1XQIA 2E1RA 1IBCB 1S1TA 3UDVA 4A48A 2RU3A 4UOGA 1N6QB 2RS8A 2ZBPA 5KFKA 5J2MA 2K3IA 4EU0A 4X84A 5JVGQ 1O0PA 5C25B 4Y28C 2HHHF 5DDRC 4M8LA 5A8WA 1AT1B 2XLIA 3CJ5A 3MCMA 3GIKA 3ELHA 5KFLA 1Y4ZB 2XCAA 1SQFA 3CC4S 5KFMA 1SCJB 4OYPA 1JQGA 4GRSA 3D3BJ 4CIOA 4CLUA 4E2FB 2QG9B 4X4OA 3OT9A 4NMLA 5GAHU 4NCBA 3PFOA 2V2KA 4AL7A 2JVRA 2PT0A 1RT2B 1N34J 5MLCV 2E29A 1QAIA 4UY8T 5L1KA 1WSRA 2IPOB 1FKPB 1R8PA 1VYAA 4LF8F 1VGYA 3WBZA 4OI4A 3GIRA 4RW9A 3PYGA 3BN4A 4USUA 2XZTB 1QAJA 1VQKS 3NKYA 2FD2A 4LF4J 2ZFHA 3ULHA 1X4AA 3MTJA 3TI0A 1Y3JA 4M5KA 2BW7A 3HT0A 4CH1A 3J7Z5 2JNJA 4KYZA 2FY8A 2E5HA 3GR1A 1HQEA 1WHVA 2NUUG 3TUZC 1U0HA 2A6MA 3MI7X 3KFWX 3NS5A 2RQ4A 1U2RA 3DLBA 3SZ2A 2VU5A 5K5MA 2POKA 2DH8A 4HH0A 3M6XA 4TLQA 1JJ4A 3DOKA 3GIIA 2NSBA 2YKMB 1TKZB 1CQMA 3TJAA 1K73T 2ZITA 4K5SA 2CFXA 1QTNB 1R8BA 2OSRA 1U1RA 2JFDA 1K1QA 2PN6A 1FK9B 4DL7A 4I2PA 3GSIA 2HQCA 2W24A 5HANA 4A8FA 2QMWA 5LM7E 3CCZA 4XPCA 5J2PA 1RT6B 3WX4A 1OO0B 2VKRA 5KT4A 4FF3A 1FEHA 3VTIA 1BE4A 3HHKA 2ZH7A 2EXUA 1A9NB 1DARA 5K9FA 4PABA 5GAEU 3D1OA 3ZTPA 4JI4J 4TQSA 3GG1A 1RBOB 5KT7A 3IRXA 5KFSA 4GO5X 4U7UK 3MAHA 1S97A 1I5OB 1JLCB 5HAOA 1YJ9S 2CPDA 2FTRA 3FFIA 1D1UA 4P75A 3PACA 4EBDA 4HL9A 3IA0A 2B9XA 1FDBA 2V9WA 4YHHF 1LNQA 3R7BB 2E1CA 2KYZA 5L1JA 1EKSA 4MYTA 2NYHA 2ZJRQ 5JVHQ 2Z30B 4P6QA 1WWHA 4BLGA 3K5MA 1CJVB 3MMCB 4RL1A 1S9EA 3FGVA 4KHPF 2KJVA 2CRLA 3KJFB 4CP5A 2F7VA 3CC2S 4MK8A 3HMJG 4RUBA 3EICA 3H4BA 1X9SA 2UXBJ 4KH0B 3QO9A 4C8NA 2HWHA 1GXTA 5LXRA 2ASLA 4X4RA 1W25A 3Q2TC 3BZQA 2ZH6A 4JYAJ 2LKZA 3SV3A 4KGKA 4KH1B 2AYGA 3S1TA 1FKOB 2HWTA 2WW4A 4DV4F 2Z57B 1TAQA 2KXHA 4F4WA 2GFFA 1TKTB 2EFGA 1XC9A 4DPWA 4JV5J 4X65F 5AXNA 2I0XA 2M5YA 1BC6A 1KTVA 2OPSB 4W98A 1FJ7A 3JSBA 4NLYA 2YH1A 3QGGA 4G65A 2GW8A 1UTAA 1UPPA 1NB7A 3UNGC 1EAYC 4WKYA 3N79A 3BH7B 5KFFA 1FESA 4OFZA 1EHWA 3MECB 2D3UA 2OLWA 3T5JA 5HATA 2HWIA 2MMYA 4CDIA 5DQGA 4QR1A 2WOMB 4A8MP 5DQIA 1Z2LA 1ZOTA 1CJKB 1IJFB 2J6SA 2NR0A 3LA0A 2XC9A 2ZOMA 1ZAXA 4NASA 3MPVA 4DV1F 2MTLA 5MAOA 3EWGA 5A2QU 1FWKA 1FX4A 2DRDA 2R7VA 5HQLA 3VGUA 3RB6A 4ED7A 3MPWA 2XO6A 1HW9A 4DL0C 2IA0A 5LMNF 3QJPA 3PFEA 4DN0A 3L3CA 3CCRS 1V3RA 4C98A 3GILA 2KL8A 3JSRA 4ID5A 1GTEA 1XNQF 4X66F 2QA1A 1Y0HA 4C11B 4ES2A 5J2QA 2XYPB 3CO0P 1N5TA 2G2OA 3J7ZT 2IC3A 1VCTA 1S9GB 5GAHI 3BSOA 4C0HA 1R8AA 4AQYJ 1K47A 1CC7A 2WK4A 3D3CJ 4LJMA 4YMEA 1FRLA 1YRXA 5L8RC 4CYUB 1LWXA 3OVSA 4HHUA 1D9FA 1VRQC 2ZNYA 2ZH3A 4DR1J 2OFHX 2Y1IA 3H5YA 3UPFA 4WE1A 2G9OA 1AA1B 1CJTB 1VISA 2FJBB 1FDDA 2A1BA 2CQHA 3CTRA 1TL5A 3MGJA 1RLDA 3ZTOA 3NEKA 2N7YA 4RU9A 3FVYA 1WI6A 4F26A 1DJ0A 1RAFB 1UETA 3M8SA 4KHMA 5L46A 3VAHA 2VFSA 2J0SD 5F8GA 3FQKA 2PI5A 5I42B 2CPIA 4BBYA 1EX8A 1YJWS 3A13A 2J0XA 2VOOA 1KHWA 4Q8FA 1X7VA 3C6UA 1CS4A 4ZLJA 3VGSA 5DGBA 5LSLA 2ZKTA 1R31A 3I0SA 4JI7F 1U48A 1Q78A 1BHNA 1U45A 1TMMA 4UQGA 3O6QA 2D41A 2DGVA 1HWLA 3T5KA 1IQTA 2RMLA 2HHWA 4DN9A 1SL2A 4OYBA 1U25A 4U7UD 2J7UA 3I0RB 5ETVA 4Y65A 4OX8A 1VQOS 2AP6A 2UV8G 5F8MA 3TUPA 4L74A 1IKWB 2BJDA 4WXOA 2JC0A 4R5PB 1DLOB 4C97A 1HQ2A 2IM0A 4CNZA 3QYYA 4C8ZA 4DEZA 3X1LB 3RRHA 2VL1A 4X4SA
chains in the Genus database with same CATH topology
3TZZA 2G2OA 1NM2A 2G2ZA 2G1HA 2C2NA 2UV8G 2VKZG 3IM9A 3K89A 4RR5A 4RL1A 5CZDA 1MLAA 2G2YA 5DZ6A 2VZ9A 2VZ8A 2CUYA 3EZOA 3PTWA 3TZXA 3R8YA 5CZCA 3SBMA 3CJ8A 3TZYA 3BV8A 2H1YA 2PFFB 3H0PA 3IM8A 2QO3A 3HJVA 5DZ7A 3HHDA 3TQEA 2QJ3A 3QATA 3HMJG 3TZWA 2HG4A 2JFKA 2QC3A 3G87A 4QBUA 3RGIA 2JFDA 3R97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TZZ A;  2G2O A;  1NM2 A;  2G2Z A;  2G1H A;  2C2N A;  2UV8 G;  2VKZ G;  3IM9 A;  3K89 A;  4RR5 A;  4RL1 A;  5CZD A;  1MLA A;  2G2Y A;  5DZ6 A;  2VZ9 A;  2VZ8 A;  2CUY A;  3EZO A;  3PTW A;  3TZX A;  3R8Y A;  5CZC A;  3SBM A;  3CJ8 A;  3TZY A;  3BV8 A;  2H1Y A;  2PFF B;  3H0P A;  3IM8 A;  2QO3 A;  3HJV A;  5DZ7 A;  3HHD A;  3TQE A;  2QJ3 A;  3QAT A;  3HMJ G;  3TZW A;  2HG4 A;  2JFK A;  2QC3 A;  3G87 A;  4QBU A;  3RGI A;  2JFD A;  3R97 A; 
#chains in the Genus database with same CATH topology
 1MU2 B;  2I5J B;  1R3N A;  1WC5 A;  2BKO A;  2NPF A;  4YR2 A;  5THW A;  1X9M A;  3M9M B;  2VDH A;  3HHD A;  5D4N A;  3VGT A;  3VWS A;  4ZP8 A;  1Q53 A;  4ZLN A;  3BRE A;  5BJR A;  4YY3 J;  2V94 A;  3GYG A;  3EZU A;  4DV3 J;  3F41 A;  2XG8 A;  1S0N A;  5GAE I;  4DUZ F;  4OHZ A;  3NGD A;  2RF2 B;  1C1B A;  3W9I A;  1XBW A;  2XS7 A;  2V9K A;  1KQS R;  2V8P A;  3R3T A;  5KFN A;  3I6P A;  3CCS S;  1TKD A;  5J1E A;  4ZVE A;  1MWQ A;  4O3R A;  1UWB A;  1UJ5 A;  3BDP A;  3BGR B;  1FTC A;  1TV6 B;  1H98 A;  2C2Z B;  5CYM B;  2N3O A;  4Z7C A;  2DR8 A;  4B3O B;  4B3S J;  1ZAV A;  3J7A 1;  4RZR A;  5H9E J;  1AZS A;  1I51 B;  1BLU A;  3M30 A;  5HVF A;  2HRY A;  2U1A A;  3CWJ A;  4P2S A;  4USH A;  2ZHB A;  2OSQ A;  3QGI A;  4WFY A;  1EP4 B;  3QQC D;  1MNE A;  4EZ9 A;  5I4M A;  3MUM P;  2MKH A;  1E6V B;  1KFD A;  4DR6 J;  3H42 A;  3MAQ A;  4MFB B;  2B4O A;  2VFU A;  2QSW A;  3QBC A;  4OLO A;  1KOO A;  4KIA A;  2G2Z A;  2RHQ B;  2NQP A;  2W01 A;  1SC1 B;  3J7A N;  3MXH P;  4A8O A;  5B08 A;  4B17 A;  4MIW A;  3PKM A;  1JJH A;  1NHU A;  4TYB A;  3H25 A;  2DIU A;  3M8P B;  4LIR A;  3TQE A;  2W4C A;  4NLD A;  1HNW J;  4PG5 A;  2XY6 A;  5AT1 B;  2LDI A;  1S0M A;  4LF7 J;  2VIC A;  3BSC A;  4RJV A;  4XPE A;  3VV2 B;  4DBQ A;  1SI9 A;  3JXO A;  4OL8 A;  4IG0 A;  2W9C B;  4OZ0 A;  3PRD A;  1KP6 A;  3N0V A;  4NYZ A;  3R9L A;  1YBT A;  5HMZ A;  5A0Y A;  2L3M A;  4PEO A;  4TU8 A;  3GFY A;  8RUC A;  2UUA F;  2ZZT A;  2QE5 A;  4L6V 3;  3LAN A;  4NYP A;  4ITS A;  2B43 A;  5B0E A;  3IBF B;  1F9H A;  2AW0 A;  3KLG A;  3ENQ A;  1L3S A;  4ZPT R;  5HQM A;  4IKA A;  3SSS A;  5IV3 A;  1FWP A;  1TK0 A;  4KO0 A;  5HP1 A;  3U27 A;  2Y8W A;  1WKJ A;  3CDW A;  2MYF A;  1FKA F;  3NBP B;  1NAQ A;  3FJ2 A;  2VG5 B;  2NXN A;  2LMI A;  3G2X A;  5LJ3 Y;  3KTQ A;  1FI4 A;  5DLF A;  2CQP A;  1UFK A;  1S1W B;  3MAA A;  1M1G A;  1S49 A;  3LWL A;  3BO4 A;  4QU6 A;  2H48 B;  2DIS A;  3BJY A;  3UE2 A;  1RWX B;  1BXN A;  5T14 A;  2BKN A;  3SCJ E;  3CUL A;  1G4C A;  1JJ2 R;  1XTZ A;  2NXC A;  3ZNJ 1;  4LFC J;  2LQ9 A;  4PYA A;  3HKW A;  3BM7 A;  1OY6 A;  2XHC A;  4ECU A;  2CJQ A;  4OYW A;  4Q2L A;  4PG7 A;  4ECS A;  2B8Q A;  1C2P A;  2H3E B;  1KKH A;  2AJF E;  1NJY A;  2EKN A;  4FN5 A;  2DPJ A;  2NXJ A;  1JLB B;  2W7A A;  3B6B A;  3G9C A;  3POT B;  1R89 A;  3I9Z A;  1KSP A;  3KG4 A;  2ZKU A;  5ETQ A;  3UN2 A;  2HMI B;  2XWX A;  2RQC A;  4DFP A;  1RT5 B;  3DXB A;  5E41 A;  1HBN A;  1JJC B;  4FYV B;  5I3U A;  1T02 A;  3LO3 A;  1TP7 A;  4QWD A;  2AHO B;  1B7Y B;  5D3G B;  5IT4 A;  3KNG A;  4ETZ A;  5KAK A;  2Z2Z A;  4U9R A;  1HWJ A;  4IG3 B;  4CLL A;  2CPH A;  2EFQ A;  3VAL A;  3CJ2 A;  1N54 B;  3ZTQ A;  4K4Z A;  2NLW A;  4DL6 A;  3HUL A;  4TU7 A;  5F41 A;  5GME A;  1F2G A;  2VB6 A;  2Q6B A;  4BWM A;  3J81 Y;  4GMK A;  4H4O A;  3VAJ A;  4GKJ F;  4OX7 A;  1IWG A;  3IGV A;  3M6W A;  2ROP A;  1FRH A;  2YKN A;  4IO9 Q;  1RU2 A;  2XWY A;  4ZKA A;  2MY7 A;  3G8T A;  2XGQ A;  4RBU A;  1BUX A;  4HYK A;  2K1R B;  5E3A A;  1VBX A;  3W9J A;  1RAJ A;  1MLA A;  1KC8 T;  4LT6 A;  3UN3 A;  5ETK A;  3NGR A;  2C1E B;  4CO2 A;  4PKD B;  3QT6 A;  2VBY A;  3Q8R B;  1CUL B;  5KFE A;  4QIW D;  4ED8 A;  1F5A A;  4LFB J;  3NS7 B;  4ZMM A;  3CCM S;  4KB7 A;  3G6V A;  4DS4 A;  2UXC J;  2VPY B;  3GYX B;  4CLZ A;  1K9M T;  2VBW A;  4FS1 A;  3D0G E;  2OPQ B;  4ZPV R;  2BYC A;  1VJQ A;  3HPO A;  3BGO P;  5E33 A;  3IFE A;  4B9T A;  2J8S A;  3A8I A;  2G13 A;  1NJZ A;  4CLY A;  4QIG A;  3R5A A;  4IQX A;  2M9K A;  1AFJ A;  1DHM A;  3OTB A;  2FPH X;  3GJQ B;  2UUB J;  3RR8 A;  3MZI A;  4N8O A;  2DNL A;  2VZ9 A;  1T9W A;  1R43 A;  3TZX A;  3EE3 A;  2FZC B;  3CD6 S;  2MKY A;  3OTE A;  5K14 A;  3R1L A;  2VPX B;  3NY0 A;  2XSJ A;  4KKO A;  2QC3 A;  4B9L A;  1RAI B;  5J1P A;  2GIQ A;  2RNE A;  4LUB A;  2DY9 A;  2MZR A;  3BPD A;  2XYH B;  4ED5 A;  2ZBR A;  4J9V A;  4U6P A;  4DX7 A;  6AT1 B;  1F9F A;  3AD9 C;  5KG3 A;  1ZTT A;  1YK9 A;  2NZ4 A;  2HSE B;  4OYO A;  2UVU A;  2N3L A;  1Q1K A;  2J0W A;  1FRI A;  1SV5 A;  3B82 A;  3PJX A;  1YG0 A;  3HP6 A;  2WAQ D;  3K57 A;  1X5S A;  1T94 A;  2MKI A;  4IFV B;  4WP3 A;  1RT2 A;  2DGQ A;  2G4B A;  5KFU A;  3HT3 A;  3FCW A;  3QMQ A;  2E5L F;  3TX8 A;  4RW4 B;  3F73 A;  2VA2 A;  4OX6 A;  2OFG X;  3WHI A;  2W2M P;  4IFY A;  5E2Q A;  1SJQ A;  4I68 A;  3JAM Y;  3N5B A;  4MTP A;  3B4M A;  3VAM A;  1QVG R;  3W60 A;  3IR6 B;  2F8E X;  2GJI A;  3PIP Q;  1KD1 T;  4NYO A;  1X60 A;  2RDJ A;  3EVO A;  3HDS A;  3LOU A;  4P7V A;  2DGX A;  3BR8 A;  1NPP A;  2HZA A;  1R7I A;  1YWX A;  5KOW A;  4EBC A;  1XJW B;  1UW9 A;  3R2C J;  3HVW A;  2DEI A;  4ED0 A;  2BE2 B;  1NBE B;  3M8Z A;  3QLH B;  4AMO A;  3J80 U;  2GVD B;  1RSC A;  1DTT B;  1Q5V A;  5IOL A;  4FS2 A;  4BS2 A;  2CNN B;  2VJV A;  1KRP A;  1PC5 A;  1U2F A;  7AT1 B;  3BN7 A;  5L9X A;  1TVR B;  2R8G A;  1TKZ A;  2LQ5 A;  2BQU A;  2CXE A;  3K5O A;  4P2X A;  3NGK A;  1VJW A;  2LU1 A;  4ELV A;  4I6W A;  4P74 A;  4EEY A;  3FBF A;  1BY9 A;  1FK9 A;  3KLH B;  2AYB A;  3MR6 A;  5IT9 Y;  1HR0 F;  2PO4 A;  3ILO A;  4G1Q B;  1FF2 A;  3BDE A;  1DBD A;  3FSI A;  1I6J A;  1CLF A;  1LW2 B;  1N5Y B;  3IS9 A;  2LFV A;  2XS2 A;  1IWA A;  2LXF A;  3ONQ A;  2HBZ B;  1QE1 B;  2D1C A;  5J2N B;  2GMJ A;  2WVD A;  2IMW P;  1RA6 A;  1WEZ A;  3DOM A;  5EX3 A;  4F50 A;  4LBI A;  3TNV A;  8ATC B;  2W8L A;  3PV8 A;  3ZFV A;  2RHS B;  4MK9 A;  2FVR A;  2VZ8 A;  1WOS A;  3KK2 B;  1HWI A;  2VON A;  1JLC A;  2DR5 A;  4ATN A;  2MJU A;  5JUM A;  2P2C B;  2RRB A;  4GC6 A;  2VG7 A;  1BD6 A;  3C46 A;  3KJV A;  4OI3 A;  2DBB A;  4ANE A;  1P6T A;  1OMS A;  1KR4 A;  1EZZ B;  1TEL A;  1MSW D;  3KWM A;  2ZVI A;  3MMC A;  3I5C A;  3K5N A;  1S6P B;  3V6K A;  2CQ4 A;  1H74 A;  4B9M A;  3HSJ A;  4F25 A;  3AHP A;  1R8H A;  1XMO J;  1EB0 A;  2JEG A;  2KDO A;  5J1N A;  2U2F A;  3IBC B;  3D7S B;  1F3V A;  2L9W A;  2Z2M A;  3TJ9 A;  4RWW A;  3D1Q A;  4LF9 J;  3V5R A;  2CWX A;  1Q82 T;  2YH0 A;  4OZ3 A;  2YWE A;  2PI4 A;  1S6O A;  5CD4 A;  2PGC A;  2H9Z A;  1O5J A;  3GJR B;  1UFW A;  3LUY A;  2DGT A;  3GTY X;  1Y5N B;  1RAA B;  1FD8 A;  5CCM A;  3N6L A;  3AXM A;  1NDC A;  5EX0 A;  2QL5 B;  1TKT A;  2FZG B;  1VQP S;  3W5X A;  1YGY A;  4IRK A;  3D6H B;  2RQM A;  1GNK A;  2Q66 A;  2UV8 A;  4JI0 F;  2VD3 A;  3Q2S C;  5U47 A;  2RDI A;  4RO0 A;  3AB2 B;  1X8D A;  1J5O B;  5HMX A;  1KQF B;  3HCX A;  1RLC L;  1YJR A;  1ITP A;  2MJN A;  4QR2 A;  1TQL A;  3EM1 A;  4LF5 J;  4OZJ A;  4ZVQ B;  4Z2X A;  1FE4 A;  1HI0 P;  1GK8 A;  1VI7 A;  4MK7 A;  1S1U B;  4DFK A;  2WOM A;  1P27 B;  4LF1 A;  4PRF A;  4X2B A;  2IJR A;  2MKC A;  2XO7 A;  2A0F B;  1G6B A;  1KLM B;  3P4U B;  4I56 A;  2AWZ A;  4ZIT A;  2EK6 A;  4DQP A;  3ET6 B;  4OV1 A;  3RZA A;  2HRU A;  3UI3 A;  3BV8 A;  4KTQ A;  4ZPB A;  2JC1 A;  2HRT A;  3IP0 A;  4RX6 A;  2H5E A;  2AX0 A;  3B78 A;  4DPY A;  3JSM A;  2F9D A;  3OR2 B;  4WU3 A;  5AE2 A;  4C11 A;  4ECR A;  3T1Y J;  4CLK A;  3UN5 A;  2OD4 A;  4DV0 J;  1VQY A;  1S9G A;  3BYR A;  4YS2 A;  3DLK B;  4ES1 A;  3ZZ0 A;  1U6B A;  3FBB A;  2YNI A;  2VJU A;  3LPY A;  3QWP A;  2FUG 9;  3EPG A;  2KT5 A;  1H2T Z;  4FYW B;  2DNR A;  3ILJ A;  3W61 A;  4Z37 A;  5EWF A;  5D8H B;  4Q43 A;  4CRJ A;  5HQ8 A;  1VLO A;  1CJT A;  4WKR A;  2V4J A;  3KHH A;  1PIL A;  2M4M A;  2YVS A;  4EUV A;  3H0P A;  3MMA A;  1N88 A;  4NLQ A;  4PG6 A;  3CD5 A;  2JEJ A;  4HLB A;  3GQC A;  4CWB A;  1JK9 B;  3DYA B;  4DQS A;  5EHH A;  1RYR A;  2C28 A;  4F2R A;  3CCQ S;  1M90 T;  2CZ9 A;  3M9O B;  5BYQ A;  4ZP6 A;  2R7O A;  1T9V A;  4JB8 B;  3OW2 R;  4ZVO B;  2CAJ A;  2Y1L B;  3H2V E;  2YTC A;  3M2R B;  3R27 A;  3GE9 A;  1H0H B;  2XHW A;  3UR0 A;  3KHG A;  3MOJ B;  2KVQ E;  3BGF A;  3TAQ A;  3H40 A;  4Q7A A;  1KVK A;  2V8H A;  1REV B;  1T9U A;  1DQA A;  2C2O B;  2DT9 A;  1NJX A;  2OH2 A;  1T05 A;  2EFV A;  2EPI A;  2RE1 A;  1RAD B;  4J5O A;  1GX5 A;  1YJV A;  1NM2 A;  2GQC A;  2J6U A;  1PBA A;  1DLO A;  2ABY A;  2HUR A;  2LQB A;  3AJ2 A;  3JB9 k;  2OGU A;  5SZT A;  5E5N A;  1ZYQ A;  1K1S A;  4PQU A;  1MU2 A;  3DLG B;  2PMH A;  4JBC A;  2BQ3 A;  4V19 X;  1QUP A;  2XY5 A;  2LQJ A;  2CVI A;  5C42 A;  1ZET A;  2NRE A;  1RHJ B;  2KT2 A;  1QSY A;  4JI3 J;  4O23 A;  3MD1 A;  4K59 A;  3N28 A;  2O1P A;  1LK5 A;  2VOP A;  3HVT A;  2HHU A;  3PHE A;  4LR9 A;  3N9U C;  3PKY A;  2ERR A;  4ANC A;  1YRU A;  3K59 A;  1QD1 A;  1IM4 A;  4USI A;  4HT7 A;  1RWW B;  2QFJ A;  1U47 A;  2XZW A;  5KT6 A;  2V4Q A;  3ZZT A;  2CJY B;  1Q81 T;  4B9S A;  5K8M A;  1WC6 A;  1IXK A;  2EFP A;  2C3U A;  2V34 A;  4Z7Y A;  2DNZ A;  4OZL A;  1WG1 A;  3DI6 A;  1TV6 A;  2PE8 A;  3HFV A;  4NE9 C;  1R8C A;  5FDL B;  2VPW B;  3SEO A;  2HK3 A;  3IWN C;  2UVR A;  1RUS A;  1WAC A;  1Q8K A;  1FJC A;  3OTO F;  3WIU A;  3JYT A;  1ACM B;  3JSY A;  2L9N A;  2P8I A;  3R5B A;  3QID A;  2QN6 B;  3WC2 A;  4RW8 B;  3DLL Q;  1TL1 B;  2V4R A;  3ENW A;  1EP4 A;  3Q8P B;  3K5P A;  3HM9 A;  4DUY J;  3TVK A;  4DF4 A;  3SXL A;  1B0V A;  2FLO A;  2EG2 A;  5GAG U;  4X62 F;  1RTD B;  1ZM2 A;  3R6L B;  2HKE A;  4JUZ A;  3VZH A;  3C6T A;  4N8N A;  3BYP A;  1N56 A;  4IRD A;  3CB4 A;  4QU7 A;  1PO6 A;  3M8P A;  1QUV A;  1UVI A;  3HD2 A;  4J9R A;  4A46 A;  3W65 A;  4MKA A;  2DD8 S;  1X4D A;  2F9J A;  3DMJ A;  1WSV A;  4AUK A;  4TKT A;  2WVC A;  2ZZM A;  4XAK A;  3W3S A;  2AU0 A;  1GH8 A;  3TA0 A;  4DQQ A;  4JI2 J;  2FHJ D;  5HRO A;  3ICL A;  2JRS A;  4B08 A;  1HD0 A;  3VAF A;  3JQJ A;  4M5H A;  4QIF A;  2HQI A;  1G2E A;  1RT7 B;  1WF1 A;  1WUU A;  4PPZ A;  1OS5 A;  4KFB B;  1R6Y A;  2X51 A;  1C0T B;  3TAN A;  3CJ3 A;  2B4U A;  1FRK A;  4CO1 A;  4TN2 A;  1RTI B;  1H6K X;  1KVJ A;  5DZ7 A;  4C3K A;  5IV4 A;  4NI2 B;  2I6W A;  5ETS A;  2LEA A;  1WC4 A;  4MIA A;  4CLF A;  3C15 A;  5L9N A;  4ZN3 A;  1JLF B;  1Y5L B;  5B09 A;  3OPK A;  2NYI A;  4IR9 A;  3QZ8 A;  2J9D A;  4I69 A;  5LMU J;  2M8D B;  1RE1 B;  2M3D A;  1F5C A;  4URQ U;  1TL7 B;  1VHF A;  4F04 B;  4BC7 A;  5A8R A;  3NBP A;  1VDH A;  2VG5 A;  1G3O A;  4WU2 A;  3UCG A;  1RHM B;  5BXI A;  4WFN Q;  3OL9 A;  4ECQ A;  3GFX A;  1V5I B;  2QA2 A;  5CYQ B;  5ETT A;  3OLB A;  4ECW A;  4IDK B;  2DR9 A;  4NMX A;  4YDX A;  2XLK A;  3DOL A;  1WEY A;  4L3N A;  1YBU A;  2IRY A;  4C0B A;  2GCF A;  3HHN B;  2F65 A;  4JI8 F;  2UU9 F;  1SL1 A;  2DY1 A;  2HG4 A;  1B4S A;  3FCV A;  1YRT A;  5F8L A;  2J6T A;  3MM6 B;  1RAO A;  3IN5 A;  1ZM4 A;  3THP A;  2E9R X;  3DRP A;  3N4W A;  1PIE A;  1HNV B;  1VQS A;  1HPZ B;  4DR5 J;  5CD4 H;  3POT A;  2B9Y A;  1GXU A;  1RT4 B;  3SI8 A;  4FYD A;  4DV7 F;  1FHT A;  2HMI A;  2HHQ A;  5L38 A;  1IBL J;  3OFG A;  4X64 J;  4LRF A;  2EBE A;  1FRX A;  4F4Z A;  1LV5 A;  5KFA A;  1HNZ F;  5KFG A;  3KLE B;  1OSC A;  2HQD A;  5AE3 A;  5KFJ A;  3BQ0 A;  3MM9 A;  4B3M F;  4IG3 A;  4CO5 A;  2PII A;  4DS5 A;  3HKZ D;  1EQM A;  4FNH A;  1C0U B;  2ZHA A;  2F4V J;  4RBT A;  2H5J B;  3FMB A;  2HBQ B;  4NCG B;  2XQC A;  1U26 A;  1V9O A;  3SFU A;  2X1B A;  2DRA A;  2QL9 B;  4WYL A;  2BE7 D;  4I1T A;  3G8Q A;  3CJQ A;  4V19 J;  3PZP A;  1R0A A;  1H73 A;  6FD1 A;  1SKU B;  4QZV B;  2GJ2 A;  2QJ3 A;  3GV8 B;  2BOP A;  4NLR A;  2K1R A;  1PYS B;  5HBM B;  4IUF A;  2OPP B;  3Q8Y A;  1ULR A;  4RW6 B;  3V6J A;  2W25 A;  3MTK A;  4UOC A;  2OAU A;  1N34 F;  4FYX B;  1OYD A;  2EG1 A;  2KFZ A;  1LWF A;  1NZA A;  4Q44 A;  1M5K C;  2AJQ A;  2M2B A;  4M63 A;  4OHX A;  1WD6 A;  2OPQ A;  1QAY A;  3OD2 A;  5T7L B;  5KFW A;  4LFA J;  2CQ0 A;  1TL3 B;  4DF8 A;  5IFM A;  3GR0 A;  4MIB A;  2B9W A;  4LF4 F;  2ZVS A;  1G7C B;  2N4C A;  2WVE A;  3UFC X;  3FZ2 A;  1RKI A;  7FDR A;  4BC9 A;  4B9V A;  2NPI A;  2V6A A;  1U8S A;  3PW5 A;  4KV8 B;  1U09 A;  4CM2 A;  2HFZ A;  2IVF B;  2FY1 A;  4M5L A;  3BKU A;  3HF5 A;  3H4D A;  3OFH A;  4I7F B;  1JKH B;  2SXL A;  4ZP7 A;  1GX6 A;  4OJ1 A;  4EFA C;  5K8O A;  1NK6 A;  1S1V B;  5HO4 A;  1QSL A;  3OQ2 A;  4L72 B;  3D66 A;  3I87 A;  2I38 A;  3TW0 A;  2MHE A;  2AT1 B;  5GAG I;  1K0T A;  2EFN A;  2DH9 A;  1IR1 A;  2QRR A;  2LVW A;  1S7I A;  4NWB A;  2ILY A;  2MGZ B;  5HL7 Q;  4YB6 A;  4PWD B;  2HQ3 A;  2IJN A;  3H2U B;  3ZC4 A;  4LRB A;  1FVQ A;  3A8J A;  3HSD A;  3SFG A;  4IFV A;  4CLW A;  2F8M A;  2EC0 A;  1SUQ B;  5H1S V;  4RW4 A;  2HHS A;  3FBC A;  2MST A;  4HTI A;  1NJI T;  2KN4 A;  2MQQ A;  3OSP A;  3OL6 A;  2A6O A;  3BR9 A;  4HAC B;  5HK4 A;  2CJB A;  4O4G B;  2D9P A;  3RR7 A;  4EYH B;  2VFV A;  2ZWP A;  4JI4 F;  1JLG B;  1CJU B;  3NLC A;  2KG0 A;  1URR A;  3NMA A;  2K3K A;  3NXZ A;  4ZCK A;  3MM7 B;  1KDN A;  3SSQ A;  4KPY A;  3PX6 A;  4GKK J;  2B6A A;  2DNO A;  4K2J A;  1U1O A;  2CWK A;  3O2I A;  3Q22 A;  2GVD A;  1NKB A;  3TZW A;  1IKV A;  2CA9 A;  4TLR A;  1DTT A;  1N5V A;  3PG9 A;  4Y3C A;  1CEZ A;  1HMV A;  2CKW A;  2ZWO A;  1RJJ A;  1NK4 A;  3RW6 A;  2HFO A;  2V0N A;  3M6U A;  3UO0 A;  3LAL A;  2H65 B;  2R8I A;  2UXB F;  4F4A A;  1QJH A;  2RUG A;  4DR2 J;  1YQH A;  1YIJ S;  3E3X A;  3KLH A;  5IM0 A;  1T9T A;  4UQT A;  4NZ6 A;  2W9B A;  2HNZ A;  1IKY B;  1VRT A;  1FJG J;  3V4I A;  4JYA F;  1KWM A;  4YB1 P;  3WIV A;  3O44 A;  1GT8 A;  3DM2 B;  3MFI A;  2Y9H A;  4CH7 A;  3CJR A;  2KM8 B;  2W2N P;  1N5Y A;  3DGP B;  1T03 B;  3DLE B;  3DRR B;  1QE1 A;  2HGL A;  1VFJ A;  4JV5 F;  2J9C A;  2QLW A;  3T1H J;  1N36 J;  4FF1 A;  4CTA B;  4WTY A;  2MLX A;  3UW1 A;  3G6E S;  3FEX B;  4K8R A;  4LSN B;  4I64 A;  5CA5 A;  2XBP A;  1HBM A;  1RWM B;  3UCU P;  2Q43 A;  2JLE A;  2RIL A;  3KK2 A;  1UJ4 A;  1HBU A;  2YX7 A;  4DV2 F;  4LSZ B;  4TXS A;  4NPO A;  2VIH A;  2UUC J;  5I3Q A;  1HNX J;  3DHW C;  2X1A A;  1B64 A;  2UXD J;  3BB5 A;  4RWX A;  3C2P A;  3P8B B;  2IAJ B;  3T6J A;  3HHL B;  2BOA A;  3D5M A;  4LSL A;  1IJE B;  3J81 j;  2KHC A;  1HBO B;  5EGY A;  4USK A;  3I5B A;  4P72 A;  3M7V A;  4DX8 H;  5KG7 A;  3TR5 A;  4A8S A;  1X5P A;  1E6Y A;  1S1X B;  2ZJQ Q;  3MM8 B;  5RUB A;  3DLJ A;  2O67 A;  4ALZ A;  4I6Y A;  2GC8 A;  1FX2 A;  2FVS A;  2XNQ A;  3O1L A;  4AQY F;  4OI0 A;  3SIP B;  1SVD A;  2HQG A;  4PQA A;  2J0Q D;  5HLF A;  5FJ4 A;  3RGI A;  1ZM9 A;  1N8R T;  3CDA A;  3M8Q A;  3CED A;  1YJT A;  2O66 A;  4ZA1 A;  2JX2 A;  1IKX B;  2B56 A;  5FLX Y;  5KFT A;  3TAM B;  1T0T V;  3MR3 A;  2MZ1 A;  3A1Y G;  3MEG B;  4Q8E A;  5KFB A;  4JOU A;  5L1L A;  1RHR B;  2BE9 B;  4IO1 A;  1J5O A;  4FBU A;  1VHI A;  2KU7 A;  2ZH2 A;  4TQR A;  2GHW A;  4C3L A;  2WCX A;  1N32 J;  1SH0 A;  2HHT A;  5C24 A;  1N48 A;  3U1M A;  3BSA A;  4DUT A;  4DV5 J;  1TMJ A;  3ITH B;  2DNP A;  1RWV B;  1SKR A;  2QYC A;  3S7R A;  5CQG A;  3F44 A;  2DCU B;  2B51 A;  4FYY B;  2OML A;  1S48 A;  1UZH A;  4HTJ A;  3FK4 A;  3MM5 A;  2CIM A;  3BSN A;  4M5G A;  4F4Y A;  5KG2 A;  3OR2 A;  1NO8 A;  1LXJ A;  2QIF A;  4PXB A;  2R7T A;  1LWC B;  1Z1Z A;  2AKW B;  2DR6 A;  1N33 J;  2PA3 A;  1OQ6 A;  5EUH A;  1C1C A;  4NZ7 A;  3HXM A;  1X9W A;  3IRW P;  3M2V B;  1ZAW A;  3T9Z A;  4F4K A;  5J2M B;  1A6L A;  3NNA A;  2IJF A;  4RPF A;  1EAR A;  1NZ8 A;  2IRX A;  3G86 A;  2R7X A;  5A8W B;  5F9N A;  4J9M A;  2VDI A;  1HI8 A;  3MMB A;  1FFG B;  4YY3 F;  3WDO A;  4DV3 F;  5H9E K;  4DR3 J;  4J9U E;  1FCA A;  3ZNU A;  4DL5 A;  3OTD A;  4HR2 A;  4QWE A;  2VFT A;  4Q2M A;  3CVK A;  3SBM A;  4YB7 A;  5D0H A;  4TNO A;  4ICL B;  1UKU A;  2HFN A;  2AIR B;  2BXJ A;  4YFU A;  1RAC B;  2AGQ A;  4LR7 A;  4J9O A;  1NDK A;  3ENV A;  3AY0 A;  2H5I B;  2R3V A;  4RW9 B;  3M1V B;  2OJ3 A;  2IBK A;  2BJ7 A;  4DFJ A;  5G4D A;  4WP8 A;  4B3S F;  3BKF A;  3NL0 A;  1M1H A;  4R8U B;  1NK5 A;  2PMZ D;  4G1I A;  3SSR A;  4K0K F;  1REV A;  3IR7 B;  1HQE B;  1HNI A;  3EGW B;  3VAG A;  2DPI A;  3PJ9 A;  3QSY B;  3SCK E;  2AJ1 A;  4TYA A;  2MZS A;  4EO6 A;  4LQ3 A;  1YBA A;  4F4X A;  4DSL A;  3SQO P;  2F8H A;  3CMA S;  3ZTR A;  3FZB A;  4NZ0 A;  3A8K A;  2DGW A;  3I82 A;  4O3P A;  4FXW A;  2I1R A;  4DSI A;  2KTQ A;  3T5H A;  1VQ9 S;  1TL4 A;  2KXF A;  2F5G A;  1HNW F;  4QQB A;  1D8Y A;  3CJ0 A;  2VHG A;  4LF7 F;  4WIQ A;  2BW2 A;  3MDF A;  3PW7 A;  4ILM A;  1U24 A;  4NLU A;  3PY8 A;  4ZCM A;  1S10 A;  2WBR A;  1LFW A;  3OXG A;  5DLG A;  4LRD A;  3Q86 A;  1XR5 A;  3CGI A;  4FPI A;  4HH1 A;  4I2P B;  1LFP A;  2MXY A;  1X4G A;  2MPU A;  1T8E A;  2KKH A;  3LW5 C;  3QNW B;  1PAE X;  1Q0N A;  3UDE A;  5HMW A;  4DX6 A;  3FSY A;  4K7Q A;  4AD6 A;  1YIT S;  5FDL A;  5IZH A;  2O3D A;  4PUO A;  4DLG A;  2PFD A;  3G8S A;  2DHG A;  4RUA A;  1QTM A;  3C14 B;  2XMW A;  5DDQ C;  3VAK A;  3I4H X;  3MWB A;  3IRX B;  1W7W A;  2XUL A;  4P71 A;  3IO1 A;  3G71 S;  4NLS A;  3CMQ A;  1YTY A;  3R5G A;  3PRV A;  3NMR A;  2F63 A;  4USM A;  1TL1 A;  4NXM J;  2H1Y A;  1WTB A;  2M0G B;  2GVZ B;  4ZK7 M;  2HPU A;  3BO3 A;  4Q5V A;  1LOU A;  2H4W B;  4M1K A;  3MOZ A;  4WII A;  3SV4 A;  3WC0 A;  2ATL A;  4WF9 Q;  5CAA A;  3KMS A;  4OZ2 A;  1X5O A;  1VOM A;  3KK3 A;  3BEG B;  3CDE A;  2KXN B;  3TZY A;  1RTD A;  2CJK A;  1ZZN A;  1S9E B;  3W8P A;  4AXI A;  2Z4P A;  3TUJ C;  3HHE A;  1PG5 B;  3IM9 A;  2ADB A;  2IHR 1;  3QO9 B;  4LFC F;  4ZCL A;  2W8K A;  3VHQ A;  4LF6 J;  4U95 A;  2G1D A;  3V81 A;  2KH9 A;  4N77 A;  2R2S A;  3DFE A;  1HR0 J;  3OXF A;  4Y6I A;  1VQ6 S;  3OVA A;  3L4B C;  5C2C A;  1RT7 A;  4EI2 A;  4LRA A;  4IH6 A;  2CPJ A;  4KFB A;  2ZDO A;  1GMU A;  4GC7 A;  1K0V A;  1X4H A;  4Y34 A;  3UCZ P;  3P5B P;  2XMM A;  2OMO A;  1U0S A;  2GML A;  2FHJ A;  2FVP A;  2ZH4 A;  1FNX H;  3Q0A A;  1QSS A;  2VUG A;  1TKX B;  1JLF A;  1KN6 A;  4XDD A;  2PMW A;  1RWP B;  2YNG B;  3EXY A;  2E9Z A;  2XNR A;  5T41 A;  5IXU A;  3NWG A;  1N0U A;  2L48 A;  2NSC A;  2WW8 A;  3OFE A;  1T7P A;  4ZPC A;  2JLF A;  1RCO B;  3NNH A;  1JLQ A;  4LF2 A;  2AZ1 A;  2FVQ A;  2MLZ A;  4IDK A;  2CUY A;  3AXK A;  5KFV A;  4O4R A;  5A8K B;  3LAK A;  1S7H A;  1QLN A;  3KLF A;  1UFL A;  3W62 A;  1SPB P;  4C3M A;  4E0D A;  3R5D A;  3R1H A;  4FF4 A;  3RBE A;  1HQU A;  1EKR A;  4DZ6 A;  2VAS A;  3IAM 9;  3MM6 A;  3G87 A;  1TFY A;  2XLJ A;  4DR7 J;  4ID5 B;  5L1I A;  4ES3 A;  2DIV A;  1NSQ A;  3U1N A;  4DSE A;  2YPZ A;  5J2Q B;  4LFB F;  3VQS A;  5DGA A;  2ZNZ A;  4ED6 A;  2IC3 B;  2DK2 A;  1KEK A;  2MQL A;  4FVM A;  3KHL A;  5LSO A;  2HS4 A;  1HPZ A;  3UD4 P;  1JMT A;  5B0B A;  3CCU S;  5KT2 A;  3U1L A;  4F3O A;  2X3D A;  2V68 A;  4OIX A;  4WE1 B;  4J9L A;  1SIW B;  1FD2 A;  4DLE A;  1VK3 A;  3TQ1 A;  1L3V A;  3CCJ S;  3O3L A;  2UUB F;  2RRN A;  2XMA A;  4EK2 A;  3MMJ A;  4AMM A;  2JHE A;  5IS2 A;  2YY3 A;  1KQG B;  4DMZ A;  1S72 S;  2JFK A;  4W90 B;  1XWL A;  2K06 A;  1SJR A;  3DDN A;  3DU5 A;  1SH3 A;  4NCG A;  4WWS A;  1X4E A;  1HA1 A;  3GWC A;  4Y2M A;  4N41 A;  2YPY A;  3O5T B;  2QX0 A;  1RTJ A;  3C6U B;  3RG6 A;  1ZPW X;  2LEC A;  5LL6 d;  5A2Q Y;  3NGS A;  2YXL A;  1X5T A;  4F3M A;  4U7C A;  5HBM A;  4NRU A;  1T9X A;  2AJ2 A;  2ZC4 A;  4HI1 A;  3PVX A;  4DOZ A;  1HIY A;  3L7U A;  2QA4 G;  1RQ0 A;  4M94 A;  3NRB A;  2LP4 A;  4DSF A;  3PX0 A;  3BGU A;  4OZN A;  4J91 A;  1WG4 A;  2QLJ B;  2VPZ B;  3W2W B;  2CJ9 A;  4TY9 A;  4K4W A;  2FC9 A;  2XEX A;  4LMZ A;  4ILL A;  2CG8 A;  4K4Y A;  1RIS A;  4OMF G;  5T7L A;  4DR4 J;  3F0N A;  2LXU A;  1FER A;  1KON A;  4HDG A;  4NCA A;  5D4P A;  3TZZ A;  2NUH A;  3W2V B;  4IH7 A;  3P5T L;  4M5D A;  2HBR B;  2HNY A;  4QIE A;  3I55 S;  1QY7 A;  2WON A;  3WX8 A;  5CXT A;  2IYG A;  2QTW A;  4EWT A;  5LOQ A;  4KV8 A;  2YKO A;  3M32 A;  4L75 A;  2MB0 B;  3H5X A;  3MF5 A;  2HGM A;  4XDC A;  1C1B B;  4I7F A;  3R97 A;  3PO4 A;  2BMB A;  2VV5 A;  2AJ4 A;  1TZ0 A;  5B0D A;  5KFO A;  2HND B;  3EZO A;  4ZJQ A;  5KOX A;  1S1V A;  4O3Q A;  2BRL A;  5J1E B;  3BO2 A;  3JQK A;  3OR1 A;  3MED A;  2QA4 S;  4YR0 A;  3LP2 B;  5F8H A;  2DHS A;  3JQM A;  4CO0 A;  2W9A A;  4FXD A;  1U4B A;  3RRG A;  1RZM A;  1CBK A;  1NSA A;  2EEY A;  4R0J A;  3PJW A;  3AA8 A;  4DQI A;  3KUH A;  3K58 A;  4QWB A;  1XR7 A;  8AT1 B;  2DNH A;  1AZS B;  5KFY A;  2VG6 A;  4PWD A;  1Y5I B;  1SB6 A;  1DTQ A;  4DPO A;  5D4L A;  3M8R A;  1NUE A;  2GIR A;  2OEK A;  1SUQ A;  3SMZ A;  4PCQ A;  2BR0 A;  1WF2 A;  2W7P A;  3C8Y A;  3EGZ A;  1VQL S;  4NLT A;  1Q79 A;  2CDQ A;  5BYR A;  2IM1 A;  1VR6 A;  1D8Z A;  3D1H A;  3BBB A;  2CQ3 A;  4YP3 A;  2R42 A;  4HAC A;  4KGV B;  5G0R A;  1X4C A;  4EBE A;  1JLG A;  1OSD A;  4DWI A;  3IGN A;  3PCO B;  2Z0G A;  3PW4 A;  3MD3 A;  2Z2Y B;  2Y1R I;  2R7R A;  4Q0B B;  4KGZ B;  5D4O A;  3BH6 B;  3MR7 A;  1NEE A;  4IG0 B;  1SJ1 A;  2VQF J;  5K8N A;  2HVE A;  4F67 A;  4R25 A;  2IM3 A;  5A0Y B;  2FDN A;  4QWA A;  3TA2 A;  3KJQ B;  3SQG A;  4NX9 A;  1S0V A;  2ZM6 J;  1APS A;  3BS9 A;  2KM8 C;  3MCO A;  1RWO B;  3KLG B;  2Z2L A;  1P9Q C;  5KTQ A;  2YWH A;  1FVS A;  4JI1 J;  2ZEJ A;  4KO0 B;  2YNH A;  1YKW A;  3TRG A;  5HP1 B;  4LF9 F;  1X4F A;  2KJW A;  4OQJ A;  4UY8 5;  3ISZ A;  1LW0 A;  3V6D A;  2ZE2 A;  2AJ0 A;  2RRA A;  3E01 A;  1BQN B;  3R5J B;  2DYA A;  3DM2 A;  1MRO A;  2WRM A;  2RU9 A;  4HDH A;  4E98 A;  3BQ1 A;  3KKF A;  3MAA B;  2FHM A;  3KJN B;  4EYI B;  1PC4 A;  3OL7 A;  2MY8 A;  4Y00 A;  1FNO A;  3DRR A;  4NL5 A;  5FII A;  3HZE A;  5ETR A;  2QZ8 A;  1AUD A;  3M8W A;  3K0J A;  2JVO A;  4LSN A;  4O3S A;  2ZDP A;  2BAN B;  2IDE A;  1RT3 A;  4C4W A;  1T95 A;  1NRK A;  3W8G A;  2N4D A;  3D0I E;  1NXI A;  4LF5 F;  2OHD A;  3RB4 A;  3G82 A;  2W4D A;  2OTL S;  5HVH A;  1L3T A;  3KYL A;  1NJW A;  2DH7 A;  3GJT B;  4HHH A;  5DG9 A;  2BX6 A;  2IAJ A;  3UR3 C;  1RWU A;  3FMW A;  4NLX A;  1TUV A;  3EDQ B;  2CNO B;  3LGM A;  4CQ1 A;  5B0C A;  1DQ8 A;  1HBN B;  5I3U B;  1IUJ A;  4O0N A;  4X4T A;  3LQV A;  3DC2 A;  9ATC B;  1XR6 A;  1RTH A;  3ILL A;  2WZ1 A;  4BDP A;  3GG0 A;  2CPE A;  4MMO A;  1W2I A;  1DZ5 A;  2P9G A;  3T1Y F;  1NK0 A;  5A76 A;  2EVZ A;  3MM8 A;  2KZM A;  3QIP B;  4DV0 F;  1RT1 A;  4L3K A;  1Y3K A;  1NH8 A;  4YDD B;  3NOG A;  1F2H A;  2E5I A;  4DPX A;  4CT9 A;  4P2M A;  5DET A;  3IG1 A;  4RNM A;  4P9S A;  4O44 B;  1VRU B;  4H4O B;  1ZZF A;  3PYE A;  2MZT A;  1RP5 A;  2VF3 A;  2YKN B;  3GU0 A;  1YLX A;  1HKA A;  2EI5 A;  4URG A;  1J5E J;  2XI3 A;  1RAB B;  2QT7 A;  2CQ1 A;  1EJ7 L;  1FRM A;  1XNR J;  5IC4 B;  3TAM A;  2BM0 A;  4ERD A;  2ACM A;  4ZVU B;  4NRT A;  2B0G A;  1HAR A;  3MEG A;  4GVB A;  2QL7 B;  4A8X A;  1M5O C;  1SXL A;  3VGV A;  1YHQ S;  3C19 A;  3KK1 B;  4DG1 A;  4OJH A;  2D69 A;  3C66 A;  1VS3 A;  2AX1 A;  4TY8 A;  1S99 A;  5A6W A;  1OYE A;  3NNC A;  4RW7 A;  5DG8 A;  4B3T J;  2YWW A;  4F3Q A;  3WZ0 A;  1IBK J;  4CH0 S;  3A12 A;  3ITH A;  2AEF A;  4Y2C A;  1QAX A;  3BF4 A;  5EN1 A;  4ZHR A;  1JLA B;  5B0F A;  2RUS A;  3DCA A;  4ZS6 A;  3ETO A;  3Q23 A;  2FYX A;  1MML A;  3FC9 A;  1XMQ J;  1TFW A;  3CIM A;  5K14 B;  2WB4 A;  2XSJ B;  4KKO B;  3H59 A;  3AOB A;  2VA3 A;  1I3O B;  3M2V A;  3M05 A;  2V2Z A;  1FRJ A;  3GLJ A;  4NEY A;  2AEM A;  1N52 B;  1NND A;  4OYI A;  2Y3Y A;  1EIY B;  2QV6 A;  4JI3 F;  1WNE A;  3GON A;  1FTR A;  3ZTS A;  4USW A;  3TP2 A;  2IM2 A;  4A47 A;  3FNN A;  1SV5 B;  3RW7 A;  5HVG A;  1UEK A;  4L73 A;  5F0U A;  2PA8 D;  1JWW A;  1VBK A;  1BMQ B;  1N6Q A;  4LQ9 A;  4ICL A;  2GHV C;  3CCW A;  5GMD A;  5C25 A;  1SL0 A;  4WBF A;  5GAD U;  2CDR B;  1D9A A;  3OJU A;  2ZH9 A;  3QFW A;  4IFY B;  4WJB A;  4DPT A;  4UT4 A;  3EVW A;  4B3R J;  2GAH C;  2WVB A;  5AE1 A;  1WC3 A;  1YI2 S;  3HFK A;  3M1V A;  4Y2K A;  4J9S A;  5KFQ A;  1IBM J;  2CZ4 A;  3C16 B;  1PKU A;  3I5A A;  4R8U A;  4ED3 A;  1SIZ A;  2G2Y A;  7FD1 A;  4QYZ K;  1HYS B;  2L9D A;  2YQ0 A;  1FKP A;  3WQP A;  2D3O R;  1I94 J;  1UWA A;  2J7K A;  2AGP A;  4C8L A;  4IOC Q;  2DGU A;  1TAU A;  1H7W A;  4DUY F;  2VFR A;  2Z56 B;  1VBZ A;  1MN7 A;  3HSG A;  2V5H G;  5IT0 A;  2JOQ A;  3K5L A;  1AUS L;  2R7U A;  4MH8 A;  1R0C B;  4IR1 A;  3JTO A;  2VQE J;  3TUI C;  3D28 A;  5CZC A;  4KHR A;  4TVA B;  1WC1 A;  4ENO A;  3W63 A;  1S77 D;  4QPT A;  2XMK A;  1WOP A;  3LAM A;  5DG7 A;  2NCK L;  4D3H A;  2LCW A;  3V6H A;  3KUE A;  5DDO C;  2DXF A;  4JI2 F;  2GA7 A;  5HN0 A;  2OUG A;  4NA2 A;  2DXE A;  1YZ6 A;  2XZD B;  2YKM A;  2O5D A;  1U1L A;  3MCS A;  3P45 B;  1FWL A;  1G1X A;  4LVN P;  4PPD A;  3IS9 B;  2BJ9 A;  1TK8 A;  3N6N A;  2BEF A;  4P2F A;  3HSZ A;  4OLP A;  4C6A A;  3DOM B;  3W1Y C;  5KFX A;  2CG4 A;  3I96 A;  5E3R A;  1S59 A;  3Q8U A;  1H2V Z;  3ISN D;  2YNF B;  1KNZ A;  4B9U A;  3RUB L;  5LMU F;  3C14 A;  3C3L A;  1JLE B;  1NSK L;  3VZI A;  1VBY A;  1RT6 A;  4K4T A;  1BQM B;  3OSN A;  3CJS A;  1V6H A;  4H4M B;  3H20 A;  1RHK B;  2GVZ A;  2E5J A;  2BUN A;  2MSS A;  4TU9 A;  3J80 Y;  3MCN A;  5KFD A;  3TVZ A;  2VG7 B;  4KQZ A;  2E5G A;  2ACY A;  3KJV B;  1RI7 A;  4HVZ A;  2OPR B;  1Q86 T;  3LP0 B;  1VQ8 S;  2EW9 A;  1UVL A;  3K8V A;  5E7O B;  4MKV A;  3I9V 9;  4ECX A;  1HW8 A;  3ETM A;  2UUW A;  5IQQ A;  2WHO A;  2C2R A;  3VQT A;  2NXU A;  3PX4 A;  2YWF A;  2V67 A;  2DJW A;  1NLK L;  2OEL A;  4ID8 A;  2FJX A;  1H2U X;  4KJI A;  1CJV A;  2ASJ A;  1TTH B;  3TO8 A;  1JIH A;  4DR5 F;  3HFZ B;  3PM9 A;  1WOO A;  2VOD A;  2P9C A;  5BR8 J;  1B7F A;  3EX7 B;  1Q5Y A;  2D9O A;  1IBL F;  3PIO Q;  3W64 A;  5HJY A;  3UQS A;  1ZS6 A;  4X64 F;  5EWG A;  3F56 A;  2FZK B;  2KYX A;  3W7B A;  3RTV A;  3FEY B;  5KFC A;  2MEW A;  4USJ C;  3G6Y A;  2DXD A;  5AJ3 J;  2JH3 A;  1C4A A;  4NA3 A;  2B5J B;  4PAA A;  2YNG A;  2DHA A;  3PR5 B;  2J8A A;  2OP5 A;  4UST A;  2F4V F;  1FKO A;  3CT9 A;  2XMJ A;  5D15 A;  2HS0 A;  3AJD A;  2F4F A;  3R8Y A;  4DV2 J;  1OWX A;  1WJ9 A;  4X4U A;  1UEU A;  4CLT A;  3CD7 A;  4K2X A;  4DXL A;  5B0A A;  4J9K A;  2BA9 A;  3UVJ B;  2EK1 A;  1M5P C;  2J76 E;  3HX9 A;  2OPS A;  4JI6 J;  1P1T A;  1PCA A;  5A8K A;  4Y2I A;  1XER A;  4DSJ A;  5JJB A;  1UZD A;  4QOT A;  3AAW B;  4K4S A;  2JSX A;  4DX5 A;  3CCV S;  3FEZ A;  2WSE C;  3FRY A;  3T41 A;  3HI9 A;  1F60 B;  9RUB A;  3GV7 B;  4NEZ A;  3MEC A;  3P49 B;  4DV6 J;  4MJK A;  3NWR A;  3AOD A;  1S9F A;  5KG5 A;  3DHX A;  4C48 A;  4F02 A;  1Q8B A;  1CJK A;  5F3T A;  3JSM B;  5IWA J;  5D0G A;  2QGF B;  2CQG A;  1FFS B;  1O51 A;  4U67 Q;  2ALZ A;  2IY5 B;  4NLW A;  2YNI B;  3VVT A;  5GAD I;  4LFA F;  1WHX A;  4X4P A;  4A4J A;  4N5S A;  2DRB A;  1S76 D;  4OX9 J;  2E7X A;  5CZD A;  1JXL A;  1PJ7 A;  4CNY A;  4KSE B;  2V4J B;  3AD7 C;  3FCH A;  2A2D A;  3G4S S;  4JI5 J;  3H98 A;  3MMA B;  3CPW R;  3HVR A;  3H7H B;  2ZOG A;  3TVY A;  4CYU A;  5C5J A;  2DHX A;  4J90 A;  1KBR A;  1U2C A;  1JXV A;  1U1N A;  3THT A;  3HK2 A;  4N76 A;  4RNN A;  1RU1 A;  2DVI A;  2DTJ A;  3IMQ J;  3KDO A;  1M5H A;  4USV A;  3T1A A;  3MR5 A;  4H4K C;  4KAI A;  1LEO A;  1WI8 A;  4ZP9 A;  3EGV A;  3CXC R;  4ZVH A;  2FJA B;  2C2D A;  1HL6 A;  1ZM3 A;  1LKZ A;  4DQR A;  1FJE B;  1VQN S;  1FXD A;  4RNH A;  4NXN J;  4AE5 A;  5I42 A;  2PFF B;  1HLW A;  5ETM A;  1T05 B;  4MYU A;  4EGL A;  1HHQ A;  1YJU A;  1OY8 A;  2GO9 A;  4H4K A;  4ZDN A;  3QFH A;  4ZVP B;  3W2W A;  2RDD A;  2XMV A;  1Q8I A;  2CVE A;  2C3O A;  2E66 A;  2RKI B;  4DL3 A;  5F8N A;  2HZV A;  3KOA A;  2FJW A;  3TJ8 A;  4PQU B;  2XTJ P;  2LA4 A;  2D3O 1;  5D6G A;  4F36 A;  3BPS P;  1RAG B;  5C42 B;  3I0R A;  1ROF A;  2GS8 A;  3R5C A;  3W2V A;  5LJ5 Y;  1IKW A;  2J9D E;  4R5P A;  4M5I A;  3HVT B;  4GKK F;  1VQM S;  2P5V A;  1TKX A;  3NAH A;  2FLN A;  3TOQ A;  4NLP A;  2BJ3 A;  2I5J A;  3ZZR A;  2ALY B;  1K8A T;  1N4L A;  1SJ3 P;  2C3Y A;  3PO5 A;  2HND A;  2HHH J;  1M5V C;  4ETX A;  1FE0 A;  3D67 A;  3DKD A;  4ZVT B;  3LP2 A;  1AW0 A;  4RLE A;  2CQD A;  2HEK A;  3W9H A;  1H7X A;  2R2U A;  4YOE A;  3TAP A;  1KOH A;  2D7S A;  3DI6 B;  1Q7L B;  1F0X A;  2RF2 A;  2E7W A;  4DR2 F;  2H51 B;  2W2Q P;  5EWE A;  4C7Q A;  4WFB Q;  2BM1 A;  2DR7 A;  3JYT B;  2XB2 D;  2CPY A;  2AMC B;  1BWE A;  2K7K A;  3CME S;  1FJG F;  3TYT A;  4LF8 J;  1P1L A;  1NDL A;  4K0K J;  2ZOF A;  2CAD A;  4UOH A;  3MR2 A;  3JTN A;  3BGR A;  2QFI A;  4F7V A;  5D77 A;  3NAI A;  1ICE B;  5CYM A;  1SC3 B;  4B3O A;  3D9B A;  1H3D A;  1RWN B;  2OIH A;  1OIA A;  4UF4 A;  3AQO A;  3W66 A;  3T1H F;  1N36 F;  3CC7 S;  1DUR A;  1ZA1 B;  2IVM A;  4DI6 A;  4QPX A;  3C6T B;  1VIO A;  2H54 B;  2Q79 A;  2AGO A;  3M8Y A;  2E7V A;  3DGV A;  1E6V A;  1CVJ A;  1RAH B;  3DMJ B;  4ZCI A;  4Q0B A;  4MFB A;  4MKY A;  2KFN A;  1NDP A;  5HRO B;  2UUC F;  1HNX F;  3D54 A;  3E8O A;  1B0T A;  4AT1 B;  2VBZ A;  2GJF A;  1VIX A;  3GYN A;  1OJ4 A;  4K4V A;  4OYX A;  2UXD F;  4MKB A;  5M2U A;  1VQ4 S;  5KG0 A;  4FZV A;  2JDJ A;  4OJG A;  1QDU B;  2JLG A;  4IOB A;  3VF0 B;  2Q6C A;  1TUG B;  1NK8 A;  4F0H A;  4QYZ J;  4KRW A;  4DU7 A;  2J9E A;  4Q45 A;  3A4T A;  4K4X A;  5F8J A;  1MN9 A;  4F8R A;  1KQK A;  5HJX A;  1Y10 A;  3Q83 A;  3Q8Q B;  2R7W A;  1CSJ A;  1B99 A;  3C15 B;  1N5Q A;  2W9C A;  3P6Y C;  3M9N B;  1PGZ A;  1ELO A;  2J7W A;  2FHK A;  4AYB D;  3QJL A;  1WDD A;  5A8R B;  1NHV A;  2W7O A;  2DNY A;  5KFH A;  3L09 A;  1B70 B;  4ED4 A;  1CPZ A;  1BQN A;  1W26 A;  1S79 A;  4FNI A;  3UNY A;  4HI2 A;  1AFI A;  1GXL A;  1Q8L A;  1N5S A;  2HLU A;  1D0E A;  2HVD A;  3DOL B;  2E1M C;  2OEJ A;  5DRK A;  2W1B A;  4B02 A;  3R7S B;  2UZA A;  4CO3 A;  2R8H A;  2GIF A;  1XK8 A;  3KG0 A;  1FFW B;  3N5F A;  2HYI B;  2HQF A;  1WHW A;  2V2V A;  1NCL A;  2BAN A;  4YQW A;  4O0I A;  2C2K B;  1S1W A;  3QRR A;  4YHH J;  5BYS A;  3J81 U;  2FVC A;  1W2B R;  2CPX A;  3DDI A;  1UW4 A;  3DRP B;  5JXS A;  3H90 A;  1RA7 A;  3MPU B;  2K7J A;  1NK7 A;  1URN A;  1S6Q B;  2VBX A;  4CZC A;  1B3T A;  4JV0 A;  4RU2 A;  1N32 F;  4KHP J;  2ZH8 A;  2UUT A;  1UVN A;  3OJS A;  4DV5 F;  3MEE B;  4WYW A;  3PYF A;  1Q16 B;  4HT5 A;  3QZ7 A;  2XYG B;  1OPI A;  3J7Y U;  1VC6 A;  3A3O B;  3FKB A;  3TA1 A;  2HAF A;  2ZHO A;  2R8K A;  2LLZ A;  4PYD A;  2R4F A;  4HKQ A;  1T9Y A;  3L9Z A;  1U8W A;  2BAB A;  4LIW A;  4NOH A;  1JLB A;  1M0S A;  3MM9 B;  1SQE A;  1T11 A;  4CLS A;  2R2R A;  3Q8S B;  3QIP A;  3PYD A;  1GEH A;  1N33 F;  4DV4 J;  1JB0 C;  4FXV A;  4J9Q A;  1IM6 A;  1RT5 A;  2WVF A;  1UAW A;  3QAU A;  3AOC A;  4X65 J;  4RNF A;  5F8I A;  1WDT A;  1M5S A;  4O44 A;  3EGN A;  1WKK A;  1VRU A;  1LWE B;  2KI2 A;  1WEL A;  2Y1J A;  5D3G A;  4AMN A;  4RUC A;  2CNL B;  1R0A B;  4DR3 F;  3ZZU A;  1REG X;  3L7O A;  1GQE A;  4AL5 A;  2YX1 A;  4G1P A;  1TR0 A;  4UZC A;  1WOR A;  3HJF A;  1RB0 A;  1WG5 A;  3LP1 B;  4U96 A;  3T19 A;  1RCX B;  2DNN A;  2MZJ A;  1GMW D;  3KK1 A;  3OUY B;  2V2Q A;  2P6S A;  4OHY A;  1WC0 A;  3CCT A;  4DV1 J;  1LWF B;  1S6U A;  2K8G A;  4UOF A;  4ZJO A;  2HLT A;  4DPU A;  1U1M A;  3G96 A;  2PC6 A;  3R7N B;  5LMN J;  4OHW A;  5HSP A;  3ZO7 A;  4WFX A;  2PEB A;  4CO4 A;  4C2M A;  1PJ5 A;  1CUL A;  1X0P A;  1XNQ J;  4X66 J;  3MUT P;  3NCP A;  3U02 A;  1JLA A;  2IMO A;  1VC5 A;  3KMQ A;  3B8H A;  5EDW A;  4KGM A;  2RB7 A;  5DQH A;  3HO1 A;  4EO8 A;  5E0O A;  2GNK A;  4DFM A;  3JAM U;  3I32 A;  1Z4U A;  3P96 A;  1L3U A;  4A8K A;  2Q3P A;  1EQ0 A;  3W5Z A;  2DEJ A;  4DSK A;  4I6A A;  3DRY A;  1RKJ A;  1FNM A;  2W2O P;  2ASD A;  3AH6 A;  2RSQ A;  4HEA 9;  4UUW A;  2Q1L A;  1VLY A;  3CDB A;  2EBG A;  4AFF A;  1OY9 A;  3D6T B;  1FDN A;  2XGP A;  1O6X A;  4FDF A;  4ZPW R;  3HD1 A;  4WXW A;  3QJJ A;  3P3D A;  3KXD A;  1R6V A;  2HAI A;  3EYZ A;  4I0W A;  5I3P A;  2F3J A;  5ETP A;  3QT5 A;  1J2V A;  2X1G A;  4ECT A;  3RJM B;  3HVA A;  1CG2 A;  3K8W A;  1D9D A;  3T3F A;  2GGP B;  1PJ6 A;  2HFS A;  4JI7 J;  1R0B G;  1C4C A;  2V69 A;  2YWK A;  3LWM A;  4QR0 A;  2A18 A;  3T9N A;  2BZ2 A;  4DCP B;  2D74 B;  3SYZ A;  1P9Y A;  5IT9 U;  3C16 A;  1RAE B;  3CUN A;  3KLI B;  4JP8 A;  1BQX A;  1EET B;  5CHC B;  1FXR A;  1D3W A;  2M8H A;  4XK8 C;  1HYS A;  4N56 A;  2QEX S;  2MLY A;  4NXM F;  1RK8 A;  4KY3 A;  2FQQ B;  2B6A B;  2IRU A;  2NXE A;  3PEJ A;  2DGO A;  4R0E A;  3GMG A;  4X4V A;  3RAX A;  2CYY A;  1IKV B;  3K2Y A;  4M5M A;  4ZJL A;  5DO2 A;  3KDN A;  1HMV B;  3OL8 A;  4DU8 A;  3NGT A;  1ZTW A;  4ZN1 A;  4MAK A;  4DUZ J;  1Y7P A;  1TUW A;  4LF6 F;  4RNO A;  2BE2 A;  2YQ3 A;  3QLH A;  4K5R A;  5IM0 B;  4KR0 B;  3CJT A;  2W9B B;  4G6V B;  2C2N A;  3CE8 A;  3VCD A;  2HNZ B;  2HGN A;  1VRT B;  2MDA A;  2AQ4 A;  2E1A A;  3V4I B;  4OYM A;  3B4D A;  1TVR A;  3T5L A;  5ETL A;  3DNC A;  1LK7 A;  3PNI A;  1K44 A;  5AXK A;  3FRZ A;  3D6F B;  2X1F A;  3FBE A;  4UW2 A;  4J37 A;  1SBR A;  4FKY A;  4C8K A;  1RXO B;  1HI1 A;  3HJV A;  3ISN C;  3GCW P;  5SUH A;  2ROG A;  3NG8 A;  4G1Q A;  2YNF A;  1HBM B;  3J7Y I;  2RT3 A;  5KFI A;  2MQP A;  1JLE A;  3RAQ A;  1LW2 A;  2AZ3 A;  3DRS B;  4DL2 A;  1NB2 A;  1BQM A;  1HBU B;  3NCR A;  3IM8 A;  2VC0 A;  1OPZ A;  4PG4 A;  4H4M A;  2MQ8 A;  5KFR A;  3LPE A;  5J2N A;  3EPI A;  4NLG A;  3O8W A;  3US5 A;  4J9P A;  2ZH5 A;  1JXE A;  4N47 A;  3OXL A;  4LBH A;  2OPR A;  1N0V C;  3HHL D;  2HFV A;  3LP0 A;  2YBV A;  4LSL B;  2XM3 A;  3FSX A;  1X0F A;  5F9L A;  1R27 B;  3M2U B;  2ZD1 B;  4DR7 F;  3MUV P;  2P6T A;  1E6Y B;  1L5U A;  4P7T A;  4FPR A;  4BHQ A;  1NU4 A;  3THV A;  1S6P A;  2UUA J;  2R8J A;  2JEI A;  4WZQ A;  5HLF B;  4YN3 B;  4I2Q B;  3IXQ A;  3AD8 C;  4O3N A;  3SDE B;  1U1P A;  3M8Q B;  2HFU A;  2KRB A;  2HZC A;  3TWZ A;  2MKJ A;  3TX0 A;  2QSF A;  4DL4 A;  3OVB A;  4ZVF A;  2DNQ A;  5L39 A;  2BRK A;  3AQP A;  4ER8 A;  2ILZ A;  2BVZ A;  2HVH A;  2B5J A;  2LA6 A;  1U6F A;  3AT1 B;  1U02 A;  4O3O A;  2HVZ A;  4FP9 A;  2CNK B;  3M4X A;  1QM9 A;  5GMK a;  4DR1 F;  2RS2 A;  1I1G A;  1FDA A;  4OYZ A;  1RHQ B;  2DIT A;  2HIQ A;  2IBO A;  3UVJ A;  2FJE B;  4C8O A;  5C24 B;  2N82 B;  1O8B A;  1HWK A;  2JEF A;  5KFZ A;  2CQI A;  1NPK A;  3LTO A;  3H2L A;  2WSC C;  3A8E A;  2E1P A;  2CPZ A;  3A3N B;  2FB0 A;  2R9L A;  3MM5 B;  1S1U A;  3N01 A;  4RBV A;  1KHV A;  1YJN S;  2HHV A;  4BCA A;  4K50 A;  3U7J A;  2FLP A;  2IVY A;  3EZ5 A;  1MW7 A;  4ZVR B;  2G0J A;  1KLM A;  2VH7 A;  1NHK L;  3NOC A;  1WF0 A;  1FXL A;  3CSK A;  5GVQ A;  3CJK B;  4CI0 B;  3ET6 A;  1C1C B;  2NS1 B;  5LT5 A;  2BV3 A;  4KT0 C;  1UEV A;  2VC1 A;  4OYA A;  4PXC A;  2W4P A;  4DR4 F;  2AF6 A;  5B7W A;  5D0R A;  2AYM A;  5DS7 A;  2X7I A;  5H9F K;  2W2P P;  3MMB B;  5DJB A;  2ZUA A;  3CDU A;  3DLK A;  4A8Q A;  2IDL A;  4ECZ A;  2BJ1 A;  1S1T B;  2B9E A;  4ECV A;  2PDA A;  2QLB B;  4D3G A;  2CQC A;  4KGX B;  1WTF A;  4LRE A;  3BQ2 A;  4GKJ J;  4KC5 A;  5E3Q A;  3ZZZ A;  2V63 A;  1LXN A;  4QWC A;  4OI6 A;  1DQ9 A;  1HFE L;  2ZC3 A;  4QW9 A;  1FA0 A;  3SCI E;  3RB3 A;  2E44 A;  2G1H A;  3D4J A;  2HW3 A;  5FD1 A;  1ARO P;  1KS2 A;  3H5U A;  2DGS A;  1U49 A;  4U8Y A;  3MPD A;  4FKX A;  1FEE A;  1DFD A;  3DYA A;  1TK5 A;  4OI2 A;  4ZVG A;  2HVI A;  2QYG A;  3FDS A;  2BBE A;  1S57 A;  1SH2 A;  1S4F A;  1IR0 A;  2OI2 A;  1HNI B;  5AXM A;  1GTH A;  3Q8V A;  3CO9 A;  1GAO A;  2B3T B;  1GFW B;  1UL3 A;  4RR5 A;  1F9E B;  2Y0S D;  2ADC A;  5CAB A;  3ADA C;  2RKI A;  1J27 A;  3M2R A;  2DHH A;  5DM6 Q;  1NKE A;  3G6X A;  2BJ8 A;  1Y9O A;  2JZ5 A;  3KG1 A;  3GIM A;  3GFH A;  1UJ6 A;  1U0H B;  1MG7 A;  4ZPA A;  4IH5 A;  1VQ5 S;  4DR6 F;  3IWL A;  2RJZ A;  3QAT A;  3CJ4 A;  2MQM A;  4A8W A;  3B54 A;  1UA1 A;  3I56 S;  2VQF F;  2CQB A;  3D0H E;  4M95 A;  3DOK B;  3UDC A;  3DLG A;  3AA9 A;  3QRP A;  1PYO B;  3UWT A;  1UMJ A;  2GMH A;  4IRC A;  4YEA A;  2XSF A;  4DHV A;  3OV7 A;  2ZM6 F;  2G0C A;  1U6Z A;  3EJM A;  3CNQ P;  2ZZN A;  1ZPV A;  1S0O A;  2KZZ A;  3JTP A;  1XIQ A;  3GIJ A;  3GFZ A;  4PUO B;  2QMU B;  4JI1 F;  3TAR A;  1YVF A;  2OKQ A;  4JV1 A;  5J2P B;  3PTW A;  3OTC A;  2GX8 A;  3AB4 B;  2E5L J;  1MMN A;  4RKU C;  4B9N A;  4ZOS A;  1PAU B;  3L7P A;  1UCN A;  2CJX B;  3ZZO A;  4ZLP A;  3KHR A;  1QVF R;  2B4P A;  4ZIW A;  1KVI A;  4J7C A;  1U7L A;  1BGX T;  3IBW A;  3PR4 A;  2BKP A;  3CJ8 A;  1VMB A;  2DB1 A;  3LF0 A;  1PYT A;  3KK3 B;  2DO0 A;  4QYR A;  3ZZP A;  1NSP A;  1ZH5 A;  2F40 A;  4ZLL A;  2LDY A;  5DZ6 A;  4RW8 A;  2HS3 A;  3FFI B;  3CCL S;  1SJF A;  2KT3 A;  4QIV A;  2RIJ A;  2BDP A;  4U8V A;  1F1B B;  1SKS A;  4DCJ B;  2L41 A;  3V81 B;  2K2P A;  2LEB A;  4FVC A;  5CZX A;  1D09 B;  4C8Y A;  4OI1 A;  1OQ3 A;  1Y00 A;  2MQO A;  4DJB A;  3GP9 A;  2XS5 A;  2V8V A;  2R7S A;  4DZD A;  4PXD A;  4KPC A;  2ROE A;  3EXC X;  2P9E A;  3M6V A;  5KFP A;  1Y11 A;  3PHT A;  5CCL A;  4ZIV A;  2GQQ A;  3CIZ A;  2PD1 A;  3ZXW A;  2ASY A;  6FDR A;  4JV2 A;  3H5S A;  4ZVS B;  2GQ2 A;  3PXG a;  2M7S A;  1RGV A;  1RDR A;  4K4U A;  2COL A;  2B7B B;  3GZ7 A;  2ZBQ A;  2GZO A;  2QLF B;  4F0M A;  1C0T A;  1MWZ A;  2I2Y A;  3DU6 A;  1RTI A;  1T3O A;  3SCL E;  2ZUG A;  2BJE A;  4NI2 A;  1XEZ A;  2CJA A;  1JLQ B;  3E2E A;  3QGH A;  4C9D A;  4AXJ A;  5CYJ A;  1M1K T;  1DY3 A;  2DNG A;  1J5E F;  2MHN A;  1XNR F;  1TL7 A;  3KLF B;  1A7G E;  1L3K A;  2V50 A;  3QSI A;  2FJD B;  5D78 A;  1H72 C;  1HQU B;  5DM7 Q;  4GO7 X;  4UTG A;  5LSR A;  5CYQ A;  3V4M A;  2JJ4 D;  2UP1 A;  3BKT A;  4LVO P;  1WHY A;  2UVW A;  2LXI A;  2DCL A;  4WK1 A;  4CCH A;  1S6Q A;  4XO0 A;  4PWU A;  4A8Y A;  2JWN A;  4M5N A;  2LYV A;  3NGU A;  2VKZ G;  4B3T F;  2YX4 A;  4AND A;  2NZC A;  3E51 A;  1IBK F;  4X4N A;  4P73 A;  5E3C A;  1CQN A;  3MEE A;  1JNZ B;  1F6T A;  2WTF A;  2CZV C;  2I8E A;  4IOA Q;  4KBI A;  3X3U A;  4RUH A;  2MQN A;  2UXC F;  1HNV A;  2L08 A;  2Y8Y A;  3FQL A;  1T3N A;  1VC0 A;  2HHX A;  5HMY A;  2E9T A;  1XMQ F;  3TEG A;  3DDK A;  1RT4 A;  4ZPD A;  3RBZ A;  3CW2 C;  4AL6 A;  4CM0 A;  2PEH A;  2C3M A;  4OZ5 A;  3UDL A;  1RTJ B;  1LWE A;  3KLE A;  3LGN A;  1GMV A;  4LR8 A;  4JI0 J;  3RU0 A;  1JX4 A;  2BAC A;  3K89 A;  3PDN A;  4F2S A;  3VR1 A;  3MHY A;  4BWJ A;  2RD5 C;  2UVV A;  1C0U A;  4YB5 A;  2KVI A;  5ETN A;  3I31 A;  1X31 C;  2LEP A;  2DNK A;  2ZBI A;  1WEX A;  5ETO A;  1IQZ A;  3AJ1 A;  1YZ7 A;  3PEH A;  4ED1 A;  3LP1 A;  2MKK A;  1RHU B;  2FGO A;  2B7C B;  2R2T A;  3IAS 9;  1CS4 B;  4WFZ A;  4IQM A;  3OUY A;  5M2P A;  2V8D A;  1UA0 A;  3I0S B;  3TEH B;  5KG6 A;  2D3Z A;  1AYE A;  4P52 A;  1H38 A;  4P10 A;  4B3R F;  2B4V A;  4V1A k;  2C22 A;  1RWK B;  3Q24 A;  3S6E A;  4E8U A;  2OPP A;  3UD3 P;  4RW6 A;  1IVZ A;  1IBM F;  4WZM A;  2XCP A;  4J9N A;  2XI2 A;  5LXY A;  4NLV A;  4CLP A;  3MUR P;  1GMW A;  4I4B A;  1NK9 A;  4M5D B;  3IC1 A;  2HNY B;  1XMB A;  1I94 F;  2WON B;  2RAQ A;  2GAG C;  2IA6 A;  3RB0 A;  1RTZ A;  5KT3 A;  3M32 B;  1RBA A;  1XN9 A;  2A10 A;  1YDL A;  2HBY B;  1ZBT A;  1TL3 A;  2RVJ A;  1DRZ A;  3ILI A;  2EC2 A;  3OR1 B;  2V8G A;  3MED B;  2APO A;  4NA1 A;  4WP9 A;  2IIH A;  2VQE F;  2WSF C;  5A6P A;  1IR2 A;  4ELT A;  1F3F A;  1DAX A;  4OZ1 A;  1PSD A;  3GPA A;  3IWX A;  1SKW A;  3DLH A;  1JKH A;  3IR5 B;  1BWV A;  3GCX P;  4W92 B;  1HHS A;  2KO1 A;  1AXQ A;  2C2M B;  2VG6 B;  4FF2 A;  4YR3 A;  1WKL A;  2C42 A;  2YKP A;  1S4E A;  4PZV A;  3RRK A;  4EMD A;  4WK3 A;  1UWB B;  1DTQ B;  2HK2 A;  3OLA A;  3MPY A;  1YJ7 A;  5H9F J;  3DN9 A;  3QPI A;  2GGP A;  1HHT P;  3EDR B;  1FT8 A;  3UD5 A;  4IYQ A;  4MT1 A;  3PW0 A;  5ADZ A;  1UVM A;  3QT8 A;  2O01 C;  2HHP A;  3R2D J;  4UZB A;  3M30 B;  3NP5 A;  2MGZ A;  1Q95 G;  1F5B A;  3ENA A;  5G0R B;  2ATC B;  5C7P A;  3KLI A;  1EET A;  1S5Z A;  3CF5 Q;  4PXE A;  2DO4 A;  3MEK A;  4W4M A;  5K8P A;  5M2R A;  1RBL A;  1YX2 A;  3RBX A;  2C3P A;  4LBP A;  2I9S A;  2F1F A;  4X4Q A;  4PG8 A;  4LRC A;  4EZ6 A;  4O4G A;  1P8G A;  2Y0B B;  1YSJ A;  1CJU A;  3GJS B;  3SQG B;  3KNA A;  2FLL A;  2CPF A;  2FHO B;  2FGC A;  3S8S A;  3D68 A;  4Y0F A;  2YQ1 A;  3MM7 A;  1SQG A;  2Z8Q A;  2DKO B;  5B0G A;  3R6G B;  2EWH A;  2B8P A;  2OD6 A;  4YUD A;  2YNH B;  2EFO A;  4C0O C;  1MMD A;  2R7Q A;  1ZA2 B;  5HI7 A;  2AV5 A;  1KFS A;  2IFX A;  1LW0 B;  4AMP A;  1HWU A;  3V6D B;  2ZE2 B;  2FIU A;  3N6M A;  3E01 B;  3A3P B;  1RYS A;  2OTJ S;  5E3P A;  2YKQ A;  4PWW A;  3AFG A;  3OHB A;  1MRO B;  3EUN A;  1XMO F;  2MZQ A;  4XIU A;  2WB1 D;  2Z58 B;  1B0P A;  3CD0 A;  5BR8 F;  2G0I A;  3L95 X;  2LQ8 A;  1KLN A;  2BQR A;  2KHD A;  3K7R A;  4DDF A;  4QBU A;  3OTO J;  3KUG A;  3GB0 A;  2EKY A;  1KTQ A;  4PR6 A;  2YWG A;  5AJ3 F;  3VVU A;  1NH7 A;  4Y2A A;  1IKY A;  4QJV A;  3QT7 A;  3MFH A;  1VQ7 S;  5CZV A;  4QW8 A;  1SC6 A;  2GHP A;  1NKC A;  2KG1 A;  3Q89 A;  2M52 A;  1RT3 B;  3JS9 A;  3DRS A;  4ED2 A;  3DGP A;  4OV6 A;  4G3I A;  1T03 A;  2PSZ A;  4FBT A;  3DLE A;  1AB8 A;  2KRR A;  3G82 B;  3BBC A;  4ECY A;  3T6B A;  3NCQ A;  4X62 J;  4CTA A;  3OHA A;  4WTO B;  2AYE A;  1NPR A;  5FLX U;  2WBM A;  4JI6 F;  4NLO A;  1IN0 A;  3EMT A;  3HHL C;  4URS A;  4ILR A;  2M70 A;  1U1Q A;  3EVM A;  5ITH A;  2FJV A;  4XTT A;  4CT8 A;  4HHJ A;  5CH7 B;  3VAI A;  4DV6 F;  4WCE Q;  1HD1 A;  2QMX A;  3M2U A;  2OEM A;  1RTH B;  2N7C A;  4UUX A;  1V3S A;  2ZD1 A;  4F0K A;  5IWA F;  5JMN A;  1V5V A;  4M5J A;  1MWY A;  3PW2 A;  3FUY A;  3D2W A;  2FC8 A;  1RT1 B;  3HHL A;  3QWU A;  1Q4R A;  1JNR B;  2A3J A;  2A2C A;  3BBF A;  1HBO A;  3IG1 B;  3OBI A;  3RBD A;  3H8Y A;  2XMT A;  2ZH1 A;  1X4B A;  2XMU A;  4GVL A;  1U1K A;  2GV1 A;  5DDP C;  4I2Q A;  3SDE A;  4OX9 F;  2X3G A;  4C8M A;  2JL9 A;  1S1X A;  1Z2Z A;  3CCE S;  3LGH A;  2QO3 A;  3QAE A;  2YKA A;  2J5A A;  3W5Y A;  1UP1 A;  4ELU A;  5IQ6 A;  4JI5 F;  4DCO B;  5D0E A;  3KLV A;  5C2G A;  4QCL A;  4GVB B;  2GO8 A;  3BGL A;  4KE5 A;  1LQ9 A;  4N7T A;  3I4P A;  1NME B;  5IC6 B;  4DG1 B;  3RAM A;  1PBU A;  1IKX A;  4TY8 B;  3QRQ A;  2LU2 A;  4RW7 B;  2DNM A;  1SC4 B;  3PRB A;  3DXS X;  3ZZY A;  4JI8 J;  2UU9 J;  4L76 A;  3D6M B;  3QGP A;  2KFY A;  2OO4 A;  2MKS A;  1SJ4 P;  1V3Z A;  2HIY A;  5F0W A;  3S01 A;  4ZHR B;  4NXN F;  2QLX A;  3HZG A;  3AOA A;  4H54 A;  2ZJP Q;  5KG1 A;  4OJ3 A;  2RQK A;  3GSD A;  1UPM B;  1Q7Y T;  3GV5 B;  1CC8 A;  3LH2 S;  5KG4 A;  4WFA Q;  2AD9 A;  3RYL A;  5KT5 A;  1UVJ A;  3NS6 A;  4WPA A;  4DV7 J;  3CJK A;  2XY7 A;  1VK8 A;  5K20 B;  2KB2 A;  2RH3 A;  3DRX A;  4S0M A;  1TU0 B;  1S12 A;  3V2U C;  2IYI A;  2CQ2 A;  1HNZ J;  1A0O B;  3HLU A;  3K17 A;  2AEJ A;  2ZBC A;  4B3M J;  3OFF A;  4OHV A;  1FO1 A;  2M88 A;  1UVK A;  5AXL A;  4I67 A;  2H4Y B;  1LWC A;  5F3Z A;  2C2E A;  1XQI A;  2E1R A;  1IBC B;  1S1T A;  3UDV A;  4A48 A;  2RU3 A;  4UOG A;  1N6Q B;  2RS8 A;  2ZBP A;  5KFK A;  5J2M A;  2K3I A;  4EU0 A;  4X84 A;  5JVG Q;  1O0P A;  5C25 B;  4Y28 C;  2HHH F;  5DDR C;  4M8L A;  5A8W A;  1AT1 B;  2XLI A;  3CJ5 A;  3MCM A;  3GIK A;  3ELH A;  5KFL A;  1Y4Z B;  2XCA A;  1SQF A;  3CC4 S;  5KFM A;  1SCJ B;  4OYP A;  1JQG A;  4GRS A;  3D3B J;  4CIO A;  4CLU A;  4E2F B;  2QG9 B;  4X4O A;  3OT9 A;  4NML A;  5GAH U;  4NCB A;  3PFO A;  2V2K A;  4AL7 A;  2JVR A;  2PT0 A;  1RT2 B;  1N34 J;  5MLC V;  2E29 A;  1QAI A;  4UY8 T;  5L1K A;  1WSR A;  2IPO B;  1FKP B;  1R8P A;  1VYA A;  4LF8 F;  1VGY A;  3WBZ A;  4OI4 A;  3GIR A;  4RW9 A;  3PYG A;  3BN4 A;  4USU A;  2XZT B;  1QAJ A;  1VQK S;  3NKY A;  2FD2 A;  4LF4 J;  2ZFH A;  3ULH A;  1X4A A;  3MTJ A;  3TI0 A;  1Y3J A;  4M5K A;  2BW7 A;  3HT0 A;  4CH1 A;  3J7Z 5;  2JNJ A;  4KYZ A;  2FY8 A;  2E5H A;  3GR1 A;  1HQE A;  1WHV A;  2NUU G;  3TUZ C;  1U0H A;  2A6M A;  3MI7 X;  3KFW X;  3NS5 A;  2RQ4 A;  1U2R A;  3DLB A;  3SZ2 A;  2VU5 A;  5K5M A;  2POK A;  2DH8 A;  4HH0 A;  3M6X A;  4TLQ A;  1JJ4 A;  3DOK A;  3GII A;  2NSB A;  2YKM B;  1TKZ B;  1CQM A;  3TJA A;  1K73 T;  2ZIT A;  4K5S A;  2CFX A;  1QTN B;  1R8B A;  2OSR A;  1U1R A;  2JFD A;  1K1Q A;  2PN6 A;  1FK9 B;  4DL7 A;  4I2P A;  3GSI A;  2HQC A;  2W24 A;  5HAN A;  4A8F A;  2QMW A;  5LM7 E;  3CCZ A;  4XPC A;  5J2P A;  1RT6 B;  3WX4 A;  1OO0 B;  2VKR A;  5KT4 A;  4FF3 A;  1FEH A;  3VTI A;  1BE4 A;  3HHK A;  2ZH7 A;  2EXU A;  1A9N B;  1DAR A;  5K9F A;  4PAB A;  5GAE U;  3D1O A;  3ZTP A;  4JI4 J;  4TQS A;  3GG1 A;  1RBO B;  5KT7 A;  3IRX A;  5KFS A;  4GO5 X;  4U7U K;  3MAH A;  1S97 A;  1I5O B;  1JLC B;  5HAO A;  1YJ9 S;  2CPD A;  2FTR A;  3FFI A;  1D1U A;  4P75 A;  3PAC A;  4EBD A;  4HL9 A;  3IA0 A;  2B9X A;  1FDB A;  2V9W A;  4YHH F;  1LNQ A;  3R7B B;  2E1C A;  2KYZ A;  5L1J A;  1EKS A;  4MYT A;  2NYH A;  2ZJR Q;  5JVH Q;  2Z30 B;  4P6Q A;  1WWH A;  4BLG A;  3K5M A;  1CJV B;  3MMC B;  4RL1 A;  1S9E A;  3FGV A;  4KHP F;  2KJV A;  2CRL A;  3KJF B;  4CP5 A;  2F7V A;  3CC2 S;  4MK8 A;  3HMJ G;  4RUB A;  3EIC A;  3H4B A;  1X9S A;  2UXB J;  4KH0 B;  3QO9 A;  4C8N A;  2HWH A;  1GXT A;  5LXR A;  2ASL A;  4X4R A;  1W25 A;  3Q2T C;  3BZQ A;  2ZH6 A;  4JYA J;  2LKZ A;  3SV3 A;  4KGK A;  4KH1 B;  2AYG A;  3S1T A;  1FKO B;  2HWT A;  2WW4 A;  4DV4 F;  2Z57 B;  1TAQ A;  2KXH A;  4F4W A;  2GFF A;  1TKT B;  2EFG A;  1XC9 A;  4DPW A;  4JV5 J;  4X65 F;  5AXN A;  2I0X A;  2M5Y A;  1BC6 A;  1KTV A;  2OPS B;  4W98 A;  1FJ7 A;  3JSB A;  4NLY A;  2YH1 A;  3QGG A;  4G65 A;  2GW8 A;  1UTA A;  1UPP A;  1NB7 A;  3UNG C;  1EAY C;  4WKY A;  3N79 A;  3BH7 B;  5KFF A;  1FES A;  4OFZ A;  1EHW A;  3MEC B;  2D3U A;  2OLW A;  3T5J A;  5HAT A;  2HWI A;  2MMY A;  4CDI A;  5DQG A;  4QR1 A;  2WOM B;  4A8M P;  5DQI A;  1Z2L A;  1ZOT A;  1CJK B;  1IJF B;  2J6S A;  2NR0 A;  3LA0 A;  2XC9 A;  2ZOM A;  1ZAX A;  4NAS A;  3MPV A;  4DV1 F;  2MTL A;  5MAO A;  3EWG A;  5A2Q U;  1FWK A;  1FX4 A;  2DRD A;  2R7V A;  5HQL A;  3VGU A;  3RB6 A;  4ED7 A;  3MPW A;  2XO6 A;  1HW9 A;  4DL0 C;  2IA0 A;  5LMN F;  3QJP A;  3PFE A;  4DN0 A;  3L3C A;  3CCR S;  1V3R A;  4C98 A;  3GIL A;  2KL8 A;  3JSR A;  4ID5 A;  1GTE A;  1XNQ F;  4X66 F;  2QA1 A;  1Y0H A;  4C11 B;  4ES2 A;  5J2Q A;  2XYP B;  3CO0 P;  1N5T A;  2G2O A;  3J7Z T;  2IC3 A;  1VCT A;  1S9G B;  5GAH I;  3BSO A;  4C0H A;  1R8A A;  4AQY J;  1K47 A;  1CC7 A;  2WK4 A;  3D3C J;  4LJM A;  4YME A;  1FRL A;  1YRX A;  5L8R C;  4CYU B;  1LWX A;  3OVS A;  4HHU A;  1D9F A;  1VRQ C;  2ZNY A;  2ZH3 A;  4DR1 J;  2OFH X;  2Y1I A;  3H5Y A;  3UPF A;  4WE1 A;  2G9O A;  1AA1 B;  1CJT B;  1VIS A;  2FJB B;  1FDD A;  2A1B A;  2CQH A;  3CTR A;  1TL5 A;  3MGJ A;  1RLD A;  3ZTO A;  3NEK A;  2N7Y A;  4RU9 A;  3FVY A;  1WI6 A;  4F26 A;  1DJ0 A;  1RAF B;  1UET A;  3M8S A;  4KHM A;  5L46 A;  3VAH A;  2VFS A;  2J0S D;  5F8G A;  3FQK A;  2PI5 A;  5I42 B;  2CPI A;  4BBY A;  1EX8 A;  1YJW S;  3A13 A;  2J0X A;  2VOO A;  1KHW A;  4Q8F A;  1X7V A;  3C6U A;  1CS4 A;  4ZLJ A;  3VGS A;  5DGB A;  5LSL A;  2ZKT A;  1R31 A;  3I0S A;  4JI7 F;  1U48 A;  1Q78 A;  1BHN A;  1U45 A;  1TMM A;  4UQG A;  3O6Q A;  2D41 A;  2DGV A;  1HWL A;  3T5K A;  1IQT A;  2RML A;  2HHW A;  4DN9 A;  1SL2 A;  4OYB A;  1U25 A;  4U7U D;  2J7U A;  3I0R B;  5ETV A;  4Y65 A;  4OX8 A;  1VQO S;  2AP6 A;  2UV8 G;  5F8M A;  3TUP A;  4L74 A;  1IKW B;  2BJD A;  4WXO A;  2JC0 A;  4R5P B;  1DLO B;  4C97 A;  1HQ2 A;  2IM0 A;  4CNZ A;  3QYY A;  4C8Z A;  4DEZ A;  3X1L B;  3RRH A;  2VL1 A;  4X4S A; 
#chains in the Genus database with same CATH homology
 3TZZ A;  2G2O A;  1NM2 A;  2G2Z A;  2G1H A;  2C2N A;  2UV8 G;  2VKZ G;  3IM9 A;  3K89 A;  4RR5 A;  4RL1 A;  5CZD A;  1MLA A;  2G2Y A;  5DZ6 A;  2VZ9 A;  2VZ8 A;  2CUY A;  3EZO A;  3PTW A;  3TZX A;  3R8Y A;  5CZC A;  3SBM A;  3CJ8 A;  3TZY A;  3BV8 A;  2H1Y A;  2PFF B;  3H0P A;  3IM8 A;  2QO3 A;  3HJV A;  5DZ7 A;  3HHD A;  3TQE A;  2QJ3 A;  3QAT A;  3HMJ G;  3TZW A;  2HG4 A;  2JFK A;  2QC3 A;  3G87 A;  4QBU A;  3RGI A;  2JFD A;  3R97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...