3HJVA

1.7 angstrom resolution crystal structure of an acyl carrier protein s-malonyltransferase from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
307
structure length
306
Chain Sequence
MSKFAIVFPGQGSQAVGMLADLAEQYAVVKQTFAEASEVLGYDLWALVQDGPVEDLNQTFRTQPALLAASVAIWRVWQQLGLEQPAVLAGHSLGEYSALVCAGVIDFKQAIKLVELRGQLMQQAVPAGTGAMYAIIGLEDEAIAKACADAAQGEVVSPVNFNSPGQVVIAGQKDAVERAGVLCKEAGAKRALPLPVSVPSHCALMKPAADELAKTLAELEFNAPQIPVINNVDVVAETDPVKIKDALIRQLYSPVRWTECVEQMSAQGVEKLIEGPGKVLTGLTKRIVKTLEGVAVNDVASLDAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Malonyl Coa-acyl carrier protein transacylase
publication title 1.7 Angstrom resolution crystal structure of an acyl carrier protein S-malonyltransferase from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae
total genus 103
structure length 306
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3hjvA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3hjvA01
3CJ8A 2QC3A 4RR5A 2G2OA 5CZDA 3BV8A 3EZOA 3HMJG 3H0PA 3RGIA 2HG4A 3HJVA 2CUYA 3TZYA 2VZ8A 1MLAA 3R97A 2VKZG 5DZ6A 5DZ7A 2C2NA 3K89A 3PTWA 2PFFB 4QBUA 2JFKA 3HHDA 1NM2A 3TZXA 2VZ9A 2G2ZA 2JFDA 5CZCA 3TZWA 3TQEA 2UV8G 2G1HA 3QATA 2G2YA 3SBMA 2QO3A 3IM8A 3R8YA 2QJ3A 3TZZA 2H1YA 3IM9A 3G87A 4RL1A
chains in the Genus database with same CATH superfamily
4OIXA 3DRXA 1KD1T 4LFCJ 3V81B 4Q2LA 1BQXA 1RTIB 3Q8SB 3QO9B 1ZTTA 3DC2A 2YPYA 4NASA 2OPQA 4NCGA 1MMLA 4WFAQ 5AJ3F 1ZA1B 1W2IA 3LH2S 5F41A 3JTPA 4DPTA 4NMXA 3IO1A 4OZ2A 2XMWA 2JC1A 4BWMA 4QIGA 4KBIA 1L3KA 4NCBA 2PC6A 3PYFA 3HMJG 1BWVA 4QCLA 1S10A 1RCXB 8AT1B 2RUSA 4UZCA 4I6YA 2YXLA 4J90A 2L41A 4AD6A 3T5HA 5DM6Q 1DTQB 5CYJA 5KFXA 1Q8BA 2XS5A 2HVIA 1PGZA 4YFUA 3Q83A 2WCXA 1X31C 1S1WA 3MTKA 3UWTA 4FVCA 3W61A 2ASLA 3IWLA 1F1BB 4P2FA 3M30B 3TVZA 2W24A 3S01A 2QLWA 3T41A 4RO0A 4RUHA 3VAKA 2E9RX 1T0TV 1YZ6A 2ERRA 3N01A 4ED6A 5EWFA 2PFDA 1C0TA 1T9YA 3CD6S 2HRTA 4ZVPB 4EEYA 1CJVA 4DL2A 4C8OA 3RG6A 3B6BA 3HVAA 2LP4A 2CJ9A 4V19X 3PKYA 1P1LA 2G2ZA 4YMEA 3J7A1 4OQJA 1RAHB 1NPPA 2IY5B 3KFWX 4W92B 3DYAB 1UEVA 2POKA 3OSNA 4AXIA 3KLHA 4EYIB 2W9CA 4WK3A 1DY3A 1UJ5A 2F3JA 1CS4A 3JSRA 1WHXA 1M5KC 5HLFA 1F2HA 1DRZA 3TO8A 4JI2J 3C16B 1IBLF 2HNZB 5DDRC 3CULA 1YBAA 5C42A 2QL5B 4FYYB 1SH2A 2C3UA 1N5VA 2WBRA 3SSRA 2XYGB 5DLFA 4U7UD 5IXUA 4DPWA 3HT0A 4NYOA 2D1CA 1Y5LB 3GP9A 2CQ0A 3PHEA 1R0AA 4R0EA 1LW2A 2HQIA 3PFEA 5T7LA 3IA0A 1CSJA 1XJWB 2VASA 3W64A 3MM7A 3IM8A 4WK1A 1MW7A 3W2WA 3BN7A 3TA2A 3F41A 1GQEA 4F25A 4Y28C 1QTMA 2R7VA 1P27B 4DR5J 2LDYA 2X1BA 5HATA 2KKHA 3GIMA 2F8EX 1HW9A 4AQYF 1FE4A 1Q5YA 3UDVA 1WSRA 3ZFVA 3P4UB 2DY9A 1T03B 3QLHB 1Q79A 1V6HA 2DRDA 4OL8A 3R1LA 2DHGA 2NPIA 3IRWP 1RAGB 1N48A 3BBCA 4ICLB 2AX1A 2VUGA 5DZ6A 3CC2S 4LR7A 2XY7A 1U45A 1Y11A 4KR0B 3R5DA 4U7UK 2R9LA 3MUTP 4DV6F 3ZZYA 2DBBA 1VJWA 4NA2A 4FN5A 1DLOB 5LL6d 3OL8A 1SQEA 1Q4RA 4YR2A 3AFGA 5A0YB 3UCUP 3MEGA 3OXLA 1L3VA 2G13A 2HGLA 4I7FA 1QVGR 5K8MA 2UVUA 5B0GA 1TQLA 2IM3A 4QWDA 4TYBA 1YX2A 1KFSA 1VIXA 5K9FA 5GAGU 2FDNA 3ISZA 3I4HX 3RR8A 3KK1A 1JKHB 4RW8B 4M5GA 1B3TA 4LFCF 1KLMA 4DG1B 1IBMJ 1TMJA 5HBMA 4DUZJ 4IOBA 3G82A 5F8LA 3CD0A 4FF3A 2H5JB 4EU0A 4O3NA 4DI6A 3PW5A 3RB4A 2I8EA 3M1VA 3V6DA 3QNWB 3MM5B 2K7KA 3LTOA 4DHVA 9ATCB 1VC5A 1KOHA 1WSVA 3N4WA 4ZP6A 5C24B 4OMFG 2MYFA 2FJWA 1HBUA 3OTDA 3OPKA 2F5GA 1CVJA 3ET6B 4YR0A 4F26A 2PGCA 1I3OB 2YPZA 3DRRB 4RPFA 3FQKA 1HYSA 1VRTB 3EUNA 4USWA 2J7WA 4ZJQA 1QLNA 5KFSA 1WOOA 2MZJA 1D0EA 1S9GB 1HLWA 2DVIA 1B7YB 3SCKE 3PEHA 5J2MA 4B9UA 1UVNA 2KYXA 2DT9A 2OMLA 2PT0A 2AJQA 2EC2A 2VFVA 3HD1A 5DDQC 1TK8A 2KM8B 4P75A 2CNNB 4F67A 3M8SA 3RAXA 3MAAB 3GIRA 2H51B 1B0TA 4WFYA 2IDLA 5D0GA 2OTLS 1GXTA 3DRSB 4RUAA 1U1PA 3OR1B 4RUCA 2YNIB 2H5IB 4NLRA 1S7HA 3PIPQ 5A8WB 2JRSA 2NXUA 3TAPA 1K9MT 2BACA 4DX8H 5ETTA 3I0SA 2HNYA 1S48A 1U2CA 1F3FA 3VF0B 3W2VB 4DZDA 2R7OA 4Y34A 4DU7A 4YDXA 1URRA 5AXNA 3WQPA 4X4SA 2CQDA 4J9RA 1Q16B 1VQYA 1LK5A 1UAWA 4HACA 2NXCA 1KBRA 3IAS9 4C8NA 5F3TA 4JI2F 1SQGA 4IQXA 2L9NA 3BGOP 4OHZA 3PTWA 5H9EK 1U26A 2KRRA 2J0XA 2AU0A 5K5MA 2BOAA 4RU9A 2R8IA 2B4PA 4OHYA 5D15A 3GIKA 2B56A 5I4MA 4KFBB 4L3NA 1NO8A 4MMOA 4OJ3A 2JNJA 2BXJA 5A2QY 2VG6A 3MMJA 4XPEA 5L38A 3RAMA 2GW8A 2B4UA 2ZE2B 2BEFA 3H98A 1FNMA 3OXGA 4IR9A 3R6LB 1UPMB 4K7QA 1CBKA 4CH1A 1NDPA 1MWZA 3Q2TC 2ZKUA 4DR5F 2ATLA 1U7LA 3IXQA 3K2YA 3BJYA 4NA1A 2YBVA 1XNRJ 4MKVA 4Y0FA 1GNKA 2QFJA 3MM9B 1NK6A 3BS9A 1WELA 4K4UA 2CPZA 2XBPA 2NQPA 3CXCR 2PSZA 1H98A 2MQMA 4TQSA 2R7SA 2FLOA 2XNQA 1RA7A 1HHSA 4NLPA 5HQMA 3NGRA 6FD1A 4C97A 2QA4G 2CJXB 3F0NA 1TL3A 3RYLA 5F0UA 1R27B 4ANDA 4PR6A 4X64J 4NZ7A 2L08A 5H9FK 2ZD1A 2RSQA 3J7AN 3T1HJ 1LWFB 4CTAA 2DNZA 1HD1A 2IYIA 1RT7B 3V81A 1HI0P 4RW7A 1JWWA 3OLBA 3MCOA 3QO9A 3BN4A 2ZWPA 1NSQA 2P6SA 3M9NB 3TR5A 4RUBA 4ZVFA 4QR1A 3K5PA 1OY6A 3D28A 2Z30B 4I2QB 1UWAA 2HAFA 4EBEA 3D0HE 3HSDA 5HN0A 1IBMF 1V3ZA 2BANB 4DUZF 2MZ1A 1A0OB 3M6XA 2DNOA 2OGUA 3FZ2A 1J5OB 4LF1A 3OTOJ 1VBYA 2VQEJ 1B0VA 1U2RA 5KFGA 5C25A 1DTQA 2CJKA 4ZP9A 5HQ8A 4KYZA 3P96A 3PJ9A 1H74A 4C4WA 2BE2A 2YWWA 3M30A 2IMOA 1RAEB 4ED3A 1GX6A 3MXHP 2D9OA 2GGPB 2BJ9A 2BZ2A 3CCES 2BRLA 3M2RA 3K8WA 4ECTA 1S9EB 1RWNB 2QN6B 2W4DA 4ZK7M 2EK1A 3CCQS 2DR8A 4QYZK 2AQ4A 3NGSA 2COLA 2RHQB 3PY8A 2BQ3A 1R31A 1S9FA 4Q8FA 3SCJE 2C2DA 1U09A 1Q7YT 2W4PA 4ED4A 4OX9J 4X84A 2GVZB 5BXIA 2F8HA 3TA0A 2DHXA 1VIOA 4OYPA 1IM6A 2HQ3A 2ZDOA 4KHRA 4KIAA 3C16A 2BDPA 2HNZA 1U1OA 5KFYA 2E66A 3HHDA 2XYHB 3FUYA 2B7BB 5KFRA 4N41A 4OJHA 2ROPA 2GNKA 1IKVB 2ZZNA 1GK8A 3A1YG 3VVTA 5MAOA 5LSRA 3MR3A 4ECWA 2IM2A 1HQUB 4PXEA 3H40A 3DOLB 2UU9J 1HWJA 2HVHA 2HHUA 5KG4A 3DOMB 4J9UE 3MEDB 4PG5A 5BYQA 4HH0A 1EJ7L 3THVA 3CMES 3RGIA 2Z57B 1FTRA 5IFMA 1PAEX 2GIFA 4FZVA 3EWGA 4K4XA 5EWEA 2VC1A 1IQTA 3VR1A 3W9JA 3NNCA 3AXKA 2KJVA 4DSJA 2AP6A 4B08A 3WX8A 3U1MA 3UE2A 3CD7A 4PG7A 3O1LA 3OTEA 4URSA 1WKKA 2ZM6J 3QZ7A 3RB3A 3QLHA 3W3SA 1CLFA 3CD5A 1HBMB 1HHTP 3QJJA 4ICLA 3M8YA 1NB2A 1J5EJ 4C9DA 3EXCX 2HW3A 3LANA 2GFFA 1XNRF 2ABYA 5HJYA 4M5JA 3R5AA 4ANEA 4QWCA 4LF9J 4DQSA 1OQ3A 4H4KC 4PWUA 3ZZRA 4OHXA 4X4OA 1JLQA 4GO5X 3BSNA 3CCWA 4DWIA 2IIHA 1XTZA 1DLOA 2ZVSA 3KLFA 5J2NB 3J80U 5A0YA 1JLEB 2ZOGA 4PUOB 2OO4A 4A8QA 3PNIA 4UY8T 3QGGA 1HD0A 3HSJA 4X64F 1TFWA 4DQRA 2AV5A 2O67A 4Y2CA 3NL0A 1CPZA 3T1HF 1KLNA 3MR2A 1KWMA 2HBYB 4HHHA 2ACMA 1FNOA 4LFAJ 1JKHA 3OVAA 2DY1A 1RZMA 3RW7A 1AROP 2BKPA 4YB7A 5FDLB 3PYEA 2HQCA 1D9FA 3WX4A 4ED7A 3SYZA 1RWWB 3R7SB 4ZVUB 4NXNJ 2OLWA 1IKXB 2DHAA 1TAQA 1MROA 2C3MA 3MM5A 1IWAA 3R6GB 2IC3B 2XSJA 2CQCA 3MD3A 3C6UB 5C24A 4QPTA 3QSIA 3VAFA 1TAUA 4ELUA 3KHGA 2R7UA 4NYPA 3DLBA 3DDIA 3DLEB 3CO9A 2HHVA 2CDQA 1VGYA 4TYAA 3GILA 1EB0A 3OTOF 5KFFA 4P74A 3G6ES 1SV5B 5D0RA 3O5TB 1XWLA 2I2YA 1FVQA 2B6AB 4MKYA 2YWKA 4NI2A 2HNDB 3OQ2A 3VZHA 3IG1A 4FKXA 1K73T 2BJDA 1NJIT 1JQGA 2WOMB 2J6TA 4ZLLA 2VG5B 1IKYA 2MJUA 1RWXB 1D9AA 1CULB 3MAAA 4B9NA 3BKUA 4MIBA 2DGXA 2W9BA 3B82A 4LSZB 2W7OA 3LPYA 5CYMB 3TUJC 2CPEA 2YNIA 2X3DA 2HGNA 5A8WA 2LU1A 2P5VA 2YNGB 4KE5A 4OI6A 4URQU 4I67A 2QV6A 4O44A 1SIZA 1RAJA 2YNHB 1HBNB 5JJBA 4OX9F 1X4DA 2A0FB 3UDCA 3D1OA 4LIWA 3LA0A 2CA9A 2GMHA 4ED1A 1C1CB 4PQUB 1IWGA 1W2BR 4K4VA 2DIVA 2OPPA 3C8YA 5BJRA 3KTQA 1FRKA 3EXYA 5KFDA 3UO0A 3UQSA 1FK9A 2GVDA 2IBKA 2L9DA 4USTA 1G3OA 2XMAA 3EX7B 3F73A 4OV6A 1SI9A 1NKBA 1FX2A 3A13A 5AE2A 5CXTA 2K2PA 3LAMA 1KVJA 1YI2S 4M5NA 1AB8A 2M2BA 2I5JB 2KB2A 2ZJRQ 2UU9F 3LPEA 1R8HA 1QAIA 2KZMA 4EZ9A 2GQ2A 1TR0A 3L7PA 4C6AA 2LEBA 1FKAF 4U8VA 2Z2ZA 1RT4B 1R43A 4MAKA 1RT3B 4KO0B 3MFIA 1WORA 3ZNJ1 2D3UA 3IGNA 1WEZA 1Z1ZA 1HNVB 1T3NA 2MKCA 2QLXA 4DSIA 2B5JB 4NLQA 1UETA 5G0RA 2RT3A 1RABB 4DV2J 1UFWA 4Y00A 3Q24A 2JX2A 4IRCA 3TVYA 4C48A 4P7VA 2HMIB 4FBUA 3AXMA 1WEXA 5SUHA 3IR5B 2J0SD 1RTZA 3H2VE 4F3OA 1GXLA 3TI0A 1LQ9A 2ZM6F 2F8MA 4LRBA 4KGXB 1IM4A 3NCQA 4KKOA 4LBHA 4U67Q 1X5TA 2QZ8A 1NHUA 1J5EF 3GPAA 3NMRA 2ROEA 5B0BA 4O3SA 4LF9F 2BYCA 1U1LA 2VFUA 1H2TZ 4DX6A 2CNLB 1FX4A 1I1GA 3WIUA 3BSCA 1J27A 5KT3A 4Y2KA 1TVRB 3CF5Q 2AEMA 3FQLA 2VPYB 3OTBA 1NUEA 2X1GA 2YKOA 4WP8A 2F9JA 2DXDA 1JJ4A 2HYIB 4USJC 3B8HA 1N5SA 4X4QA 2JOQA 3AB4B 2WAQD 3FC9A 1X9SA 1N52B 4BHQA 1YRXA 2ZBQA 4LFAF 1PSDA 2K1RB 4F3MA 4Y2IA 4UQGA 1I94J 4TLRA 4YR3A 1IN0A 2MHNA 2MLXA 4NEZA 2VU5A 4F0HA 4J9QA 3KK2B 5LMNJ 3UNYA 4GVLA 3QFHA 3H59A 4NXNF 1F2GA 3W5YA 4DPOA 1J5OA 3G6XA 1L3TA 3R5BA 4ED0A 3KG1A 3LWMA 2BJ7A 1QE1A 1FDDA 2OI2A 4IFYB 2NR0A 3R8YA 1JJ2R 2GHVC 3IM9A 2H3EB 2FJVA 3VTIA 3KJQB 3M2UA 2YWGA 5B09A 1UJ6A 1GTHA 3HHLC 1TKZB 2GGPA 4KHPJ 4C3MA 1VQLS 5K14B 3MM8A 2B9YA 5E3CA 3RAQA 4X4TA 4JV0A 2VV5A 5HMZA 5HP1A 1AUSL 3KLGB 3HXMA 4N8OA 4ECYA 4B17A 4X66J 3EGZA 4YUDA 3C3LA 1IJEB 5IT0A 3CVKA 3EZ5A 3HCXA 5I3PA 1S5ZA 3PR4A 1E6VB 2DO0A 1VRUB 2IAJB 2G0JA 1Q7LB 1T9UA 4IRDA 4ECRA 3I55S 3K8VA 3SXLA 2EC0A 2FLLA 3J81Y 2GVZA 3E01B 2HQGA 4LSLB 3W63A 5DG9A 1Q5VA 3KG4A 1KN6A 2E9ZA 1PJ6A 3CPWR 1FFWB 3HLUA 2HVZA 2J0WA 5D0EA 5A8KB 3JAMY 1GEHA 3GFXA 4ES2A 1AZSA 5J1NA 3VAMA 5GADU 4DDFA 2X1FA 5DG7A 1YK9A 2HIYA 1HQUA 4ZJOA 1YJ7A 3C2PA 1WG1A 5CCMA 4K59A 4UQTA 3UDEA 2BMBA 1F9FA 1G4CA 3DOMA 1K1QA 3IMQJ 2CNOB 2DR9A 2JLGA 4XTTA 2RRNA 3VALA 3AY0A 4OV1A 2IA6A 1RWVB 5T41A 2EW9A 1FXRA 2X7IA 1NZ8A 2KI2A 2VA2A 4WJBA 2EFQA 3V2UC 2JEIA 3A8IA 2BKOA 1YJ9S 3W8PA 2BA9A 2YX7A 2MKHA 1VFJA 2KVIA 4YY3J 1FKOB 1HBMA 2E29A 3PRVA 3Q89A 3RBZA 2KT5A 4R5PA 3FCWA 2D7SA 5KFQA 2EXUA 1YJUA 4G3IA 3EGVA 4DV2F 2OKQA 4Q0BB 1AFIA 2NPFA 4USHA 3CCTA 2CPYA 2JVRA 3C46A 1T9TA 2FPHX 1OMSA 5L1KA 1YIJS 2XB2D 5IT9Y 3N28A 2C2RA 4ZCKA 1UP1A 2XWYA 2VJUA 5J2NA 1JLEA 5BR8J 2CJQA 2V50A 2EEYA 5KFPA 1OPIA 1RT5A 4I68A 2N4DA 4KH1B 5DJBA 3N5FA 4CIOA 4IG3B 5KFAA 4OX8A 4OZ1A 4IH7A 4X4RA 3MECB 1FJCA 4A8SA 2IJNA 1AA1B 3ELHA 3SEOA 5ETQA 2W2MP 3K0JA 2G0CA 5FDLA 4WIQA 3VAGA 3NXZA 2HHWA 1PIEA 1UFKA 3SCIE 1U8WA 2PEBA 1JXLA 3D68A 3TWZA 4C3KA 1S4FA 2IC3A 4LRAA 2ZBCA 4B9SA 3SQOP 2R7QA 1NAQA 4HHJA 3EVOA 1I94F 1MWQA 4ID8A 2BABA 2N7CA 4H4OA 2EI5A 4OZ0A 5LMNF 3PX0A 3PJXA 4H4MB 3ETMA 1S59A 1WF2A 5K8NA 2QYCA 3NBPB 3O44A 1HWKA 4AMMA 4MKBA 3M2VB 3BM7A 2GMJA 4YP3A 2WOMA 5I42A 4F02A 2FVSA 4P10A 2LKZA 4KHPF 4TY9A 1U1RA 4F7VA 2HG4A 1CULA 1MN9A 2X1AA 1U24A 1PYOB 1K1SA 2AIRB 3CO0P 3V6KA 1U8SA 2BRKA 1HWUA 1XQIA 2G0IA 2QG9B 1VMBA 1TZ0A 4YOEA 3OR2B 4X66F 3MM6B 5E3RA 2ZHAA 4NA3A 3QT7A 2Q66A 4YN3B 2R8GA 4DQIA 4Q2MA 4NLYA 2MZQA 3KDOA 2E7XA 4LMZA 3TAMB 3CJKA 3HHKA 2RF2A 3LGNA 4ZLJA 3U1LA 2UXBJ 2K3KA 5KFJA 3JYTB 1HBNA 2E7WA 5HMXA 3JSMB 2QLBB 1S1TA 5IS2A 3JQKA 1NXIA 3NOGA 2MGZB 3KOAA 4D3HA 5LXYA 1RAFB 2VBWA 2OP5A 3TAQA 1ZM9A 1BQNA 2OEJA 4BC9A 4USIA 1EP4A 2V8GA 1F9HA 1RLCL 4IH5A 4KGMA 4RBVA 1T9XA 2C2KB 1SBRA 3O2IA 1O8BA 2E1PA 3A8KA 2DR5A 1QY7A 3HULA 4ZS6A 2QGFB 3ZO7A 4WCEQ 3GQCA 5L46A 2EPIA 5MLCV 2I5JA 3KG0A 4IR1A 2BQUA 4I6WA 1ROFA 2VQFJ 2VL1A 1NKEA 3OXFA 1TKDA 1FERA 3DN9A 3R7NB 2XGPA 3LGMA 1RT3A 4KO0A 3BV8A 2J8SA 1QVFR 2OD4A 3O6QA 2BJ1A 3BH7B 3PW0A 1UPPA 3DDKA 3CUNA 3L4BC 3ZZOA 4DU8A 2Z8QA 2AMCB 1IBCB 3DLKA 1N33J 1L3UA 4DV7J 5KG7A 1OY9A 3HPOA 1FJGJ 1RTHB 3WC2A 2ZH7A 4PQAA 3G8SA 1Z2ZA 4R0JA 2BW7A 4NLVA 1LWEB 4YY3F 4Q43A 3CDAA 2QX0A 2YX1A 3NOCA 1S79A 5C2GA 1TKTA 3P6YC 1FJ7A 2HIQA 4RNHA 5HQLA 2OPQB 2AKWB 1VQ9S 3DDNA 1X5SA 2KFZA 3TZWA 3CIZA 1R8CA 3C15A 5DDOC 2OUGA 1LNQA 4QIVA 4QOTA 1VQOS 3U1NA 5CD4H 1JLAB 5E7OB 3BGRA 2H4YB 3SFGA 3PO5A 1C0UB 1FXDA 5EDWA 2N3OA 1KC8T 4ECSA 2DHHA 6AT1B 5BR8F 4RL1A 2CQHA 3QAUA 2DGTA 3J7ZT 4FF4A 1RUSA 3CDEA 1HPZA 5HI7A 4L73A 2KT2A 2VPXB 1VQ6S 2ZNYA 3GYXB 1VQNS 5L1IA 1S1WB 2DNYA 1KEKA 4FXVA 2J9DE 3HJVA 1TMMA 4ERDA 3G9CA 2J7KA 2K1RA 3QMQA 1B70B 2KN4A 2ILZA 4EI2A 5D78A 4LREA 2FIUA 3NLCA 1Y5IB 2FC9A 1Y9OA 3EGWB 2HRYA 1RKIA 4G65A 2R8HA 5CZVA 1CJVB 2XZDB 2QO3A 2FZKB 1NHKL 1P9QC 4CZCA 2HFZA 3M8WA 1SQFA 3ZTOA 2MDAA 5E2QA 2WVBA 4ECXA 4J9KA 2GS8A 2CJYB 4ZPBA 1Q81T 5J2QA 2CZ9A 3QGPA 5K14A 2W9CB 4DR4J 3MMAA 1IR2A 4ES3A 1CS4B 2CFXA 1EKRA 3V5RA 5HLFB 2V8PA 2E44A 3KLGA 2DGQA 2A6OA 3NNAA 4BC7A 1FA0A 1B4SA 5ETPA 4PG4A 2ROGA 1U6FA 3LOUA 4LBIA 1Q78A 1E6VA 2HHPA 2IAJA 3BREA 4UOHA 4ZPAA 4HT7A 1T11A 1KSPA 5FLXY 3I4PA 2HQDA 2A6MA 5J1EA 3E01A 3RUBL 3CIMA 4LSLA 3D67A 5D3GB 2HFNA 5T7LB 3EPGA 4LQ9A 3KUHA 2ZUGA 2RQ4A 2N4CA 3MM7B 1NM2A 2WK4A 4ZPTR 1UVKA 1NK9A 2MLYA 4FKYA 2V8DA 4QR2A 5A8KA 2KU7A 1K44A 1SXLA 3RBXA 1TP7A 4OI1A 2V2VA 3GMGA 2UXBF 4LIRA 1NK4A 3G71S 2JDJA 2XM3A 1IJFB 1QUVA 3I0RA 5IQQA 2MSTA 1HI8A 1FVSA 2OTJS 3IBCB 2XCPA 3I5AA 2DISA 2HVEA 1N5YA 2FC8A 5KFLA 3R1HA 1JNZB 2GQQA 2XG8A 1SCJB 3BBFA 2KG0A 2GJIA 4HYKA 3V6JA 2KYZA 2P6TA 5FJ4A 1BHNA 2AYBA 2VQFF 2QA4S 3CJ5A 3JS9A 1SKRA 2QMWA 3Q8UA 3GJTB 2LXUA 1MU2A 2P9CA 4NLGA 2HHSA 1KRPA 2XQCA 2HLTA 3ITHA 4F36A 1FKOA 3DKDA 3LF0A 4R8UA 4CLLA 3MOJB 3MD1A 4EK2A 1ZZFA 2DNRA 4G6VB 2QT7A 1N33F 4YB1P 4DV7F 2EFPA 4Y2AA 4P71A 4ALZA 4Q0BA 1FJGF 4LRDA 1FF2A 2CDRB 2WB4A 4N77A 2QMUB 3ZC4A 1F9EB 5M2UA 2P2CB 1KLMB 1R6VA 1PC5A 3EM1A 4B3SJ 1RSCA 2Q43A 1S6UA 3L7UA 2E7VA 3R5GA 5HBMB 3G82B 2IM1A 2W01A 4IO9Q 3JB9k 4LRFA 4PXCA 4FDFA 3R2DJ 2I9SA 3M1VB 2JH3A 3QWUA 2B7CB 3ETOA 1V5VA 1VHFA 4C7QA 1CG2A 1HBUB 3UR0A 1SL2A 3FCHA 1BUXA 3D54A 3HVRA 4UW2A 4BCAA 5CZDA 2QLJB 3PX4A 4GKKJ 3R5JB 4F8RA 4HTJA 2F1FA 4M5MA 5ETKA 3BR8A 3OFEA 5KFEA 3U02A 3QFWA 1Y5NB 1ZETA 4DF4A 2RQMA 1HBOB 3E51A 3OHBA 2DITA 1UJ4A 3TA1A 4HVZA 5KT2A 1PYSB 4ER8A 4ZVRB 1FNXH 2FD2A 3I96A 3HO1A 4I4BA 1H0HB 1X5PA 1Y4ZB 2X3GA 4IG0B 1NJYA 3R2CJ 5HO4A 1DURA 1RWPB 3ISNC 1H7XA 4AUKA 2F7VA 2VFRA 5EHHA 5A2QU 3CCRS 1VC0A 2GO9A 4QIEA 4EWTA 2NUHA 2HRUA 1CC8A 2J9CA 5DM7Q 1KR4A 3VCDA 4IO1A 2MY8A 4WYWA 3R9LA 1XR7A 3NBPA 5HVFA 3D6HB 3I0SB 4J91A 3QAEA 1S72S 2B9XA 4DR4F 4A8WA 3W8GA 4Z2XA 3NS5A 4HACB 4W4MA 3PACA 2LQ9A 1LK7A 4FPIA 3OR2A 4ELTA 4EMDA 2HHQA 5ETOA 3ZTQA 1BLUA 4ZCLA 1KHWA 1TKXB 4HLBA 1PC4A 3PFOA 3QGIA 1BQMB 3EVWA 3TAMA 5D4LA 3RRGA 3TVKA 2AZ1A 3MI7X 3JYTA 4N56A 3CEDA 3LAKA 2ZH5A 1D09B 2VG6B 5T14A 1RHMB 2DB1A 3UCZP 4LQ3A 3DM2B 3ONQA 4J9LA 2YKQA 4NE9C 3HVTA 3EZOA 4NLOA 1ZBTA 5IOLA 2VODA 3NRBA 4B9VA 2VBZA 4TLQA 3D6MB 4QW8A 4CLZA 1BXNA 1S49A 2UUAJ 4WBFA 1OJ4A 4MK8A 2FJBB 4DV0J 1GMVA 1NJZA 4G1QB 2CAJA 4TNOA 1HR0J 1S1UB 2KXFA 3LALA 3J81j 4MFBB 4U9RA 2VHGA 2ZWOA 4F2SA 2MKYA 1CJUB 1NH8A 4O3QA 3D7SB 2OSQA 1NK8A 2XTJP 4YEAA 2GIRA 2PEHA 3CC7S 4DR7J 4CO0A 3OVBA 1D9DA 4KPCA 4DN0A 1SC6A 3IP0A 1H6KX 3PXGa 4OHVA 1R8AA 3DHXA 2CG4A 2K3IA 1RK8A 2V4RA 3BSAA 1S57A 2Z2YB 1MNEA 2VOPA 4ZLPA 4HEA9 3JSYA 4WE1B 3VAHA 4RW7B 1DQ9A 1D8ZA 2GHPA 1QSYA 1V9OA 1EARA 1FRXA 1HARA 1NNDA 2JEGA 1S0MA 1BE4A 3LP1A 1HMVB 4M5IA 1VQSA 3WZ0A 2RJZA 2HLUA 1JJCB 4DFKA 3ENQA 1KDNA 1T02A 1H7WA 2V63A 3GFYA 3UI3A 4DJBA 4ECVA 1G2EA 2J6SA 1JLAA 5JUMA 1ZAWA 1RQ0A 4B3SF 2CPHA 1C0UA 2FVQA 2AJ2A 3POTB 3C6TA 2OD6A 2ZH1A 3BBBA 1MG7A 2HS3A 2VONA 3BKTA 2IMWP 4Y3CA 4DX5A 3AAWB 1TL5A 4B3OB 2CPFA 2Z4PA 4FS1A 5C25B 2QEXS 2XS7A 4K4TA 4OYZA 1FRMA 4CI0B 2ZEJA 4Y65A 3K7RA 2MKKA 4DN9A 3VGTA 4LJMA 2BE2B 3SFUA 1F3VA 3BDEA 4GKKF 3M8PA 1NRKA 4KQZA 2XS2A 1YBUA 3M7VA 4RR5A 1BY9A 3M2RB 2RS2A 3CJRA 4CLSA 2DNMA 2J0QD 2EG2A 3LWLA 3WC0A 2DNGA 1VDHA 2R8KA 2WVDA 2ZBIA 4HT5A 1Q95G 2ZFHA 4EBDA 1M1KT 2XHCA 5B0CA 5LSLA 4FNHA 5AE3A 3QT6A 2CZ4A 3PR5B 4HL9A 1KVIA 4F4YA 2MLZA 2M52A 4LF2A 1D1UA 2CQBA 2ZITA 3CJQA 4WP9A 2RDIA 3LGHA 2QA1A 3W9HA 4ZN3A 4OLPA 1EAYC 3TARA 2ZDPA 4C0OC 3FMBA 2RILA 2RQKA 1FD2A 3GSDA 2CNKB 4K50A 2GA7A 2VDHA 5IWAJ 1Y0HA 2E1CA 3QIPA 3TJAA 3FNNA 3M05A 3AJ2A 1S97A 4LFBJ 4N7TA 3OJSA 2HAIA 3K57A 5D3GA 4JV2A 3D0GE 4V1Ak 4A48A 5EUHA 2FY1A 3FK4A 2LXIA 1QD1A 1TU0B 4ECZA 1I5OB 4ETZA 1IUJA 3GSIA 1S1XB 3LP0B 1NKCA 4XDCA 1AXQA 1EQMA 1UA0A 3EMTA 2H65B 3EGNA 1OO0B 3NNHA 3CCUS 1NB7A 3DLHA 1JJHA 3GLJA 2HZCA 2XLIA 1JLFA 3KXDA 2V0NA 3CC4S 4A8KA 2O66A 3KHHA 2V34A 2FJDB 4O4GB 4JOUA 2JEJA 1M90T 3DCAA 1R0CB 2XMMA 3W62A 2IRUA 2UUAF 1OYDA 1R8BA 3MWBA 4DV0F 3FFIB 3TUIC 4JI8J 4ENOA 1JMTA 1HR0F 3EZUA 5H1SV 2DRAA 2D3O1 1JLQB 1V5IB 5F0WA 2GC8A 4DV3J 1WJ9A 3QT5A 1SL0A 1VBXA 4X4VA 1RHJB 3KLFB 2ZJQQ 3K58A 1MMNA 3BO3A 1Q82T 1Q8KA 4P7TA 1U6BA 4DR7F 2MY7A 2K7JA 1P6TA 2GV1A 2UVRA 4CLYA 2JFKA 4ZPDA 2UXDJ 1RTJB 4J37A 5B0EA 3PRBA 1ZS6A 1T7PA 1VQ7S 4JI5J 3CCZA 3FDSA 5KFVA 2LEPA 2LFVA 3UD3P 3OUYA 2SXLA 1ZA2B 2CJAA 2FLNA 3UD4P 3TJ8A 2ZH9A 3HHLA 4DX7A 2CQ3A 3OV7A 2HBRB 1LFWA 1MROB 3IRXA 2XSJB 2EKYA 1MSWD 5DLGA 2QJ3A 2E5IA 3W9IA 2N3LA 2A2CA 3VWSA 4ECQA 1QSSA 2DCLA 3BB5A 4DOZA 4W90B 1U1QA 3J7YU 1LFPA 2E1RA 1QUPA 2XY5A 3EPIA 3GCWP 4O3RA 2VZ8A 2GO8A 3NGTA 1HBOA 2DNLA 3MMBB 3RRHA 4NI2B 5F9LA 3BPSP 3IG1B 2O1PA 3ZZUA 3D9BA 3NGKA 2VC0A 1Y3KA 3CJ4A 3OL7A 2RUGA 2C3YA 1FDAA 3W5ZA 1J2VA 2DNPA 3AD9C 5THWA 4IG0A 1IKYB 3JSBA 1GT8A 3KWMA 4PXBA 4P72A 2HBZB 3H5XA 4PAAA 2W9BB 4C2MA 1U0HB 1Y10A 3KJNB 4CRJA 5IC4B 2OPSB 2E5HA 3BZQA 4XPCA 1TUVA 1M1GA 3MGJA 1DTTB 4FF1A 3UN3A 4O44B 2FZCB 5CA5A 1WDDA 3NCPA 4LF4J 4R25A 4C8MA 4L76A 5AT1B 4MYUA 3EDRB 2W8LA 4ZVGA 1Y00A 2ZC4A 4FXWA 2OPPB 5LOQA 1XMOJ 4G1PA 2H9ZA 1X60A 2Y1RI 3ZXWA 1FK9B 2GVDB 3R5CA 5HMYA 5D6GA 4RW6A 1TKXA 3T5JA 1WEYA 4HTIA 3P3DA 1BQMA 5L39A 4DFMA 2P9EA 2XMUA 4XIUA 1DZ5A 5IWAF 3GU0A 5L1LA 4HDHA 4JBCA 4OX6A 4LFBF 3GONA 4MKAA 2F63A 1VLOA 2ZJPQ 5CHCB 3DM2A 2R2TA 3IS9B 2VPWB 1SVDA 2PFFB 1N5TA 3Q0AA 3L9ZA 3KK3A 4PRFA 3HHNB 3BO4A 1UEUA 4B9MA 3RBDA 1ZH5A 3UFCX 5GMKa 2KM8C 5G0RB 3C66A 5E3AA 4ITSA 4G1QA 5AXKA 4X4PA 4RU2A 1QAXA 1S1UA 3VVUA 1HL6A 2RMLA 4O23A 4MFBA 3IBWA 4FYXB 3OHAA 2ZHBA 1CJUA 1U6ZA 4KKOB 4JI7J 4KTQA 3CNQP 2RNEA 1UMJA 2VZ9A 2VBYA 4KB7A 2FVCA 2N82B 1D3WA 1WC3A 5ETRA 4JI8F 3KUEA 2BVZA 3IC1A 5GAEI 2IDEA 1XR6A 1HNWJ 4A8YA 1B0PA 3MOZA 2IRXA 3FRZA 5F8NA 2VFSA 4DV3F 2O5DA 3RR7A 1C1BA 1LKZA 1X8DA 3KLEA 8ATCB 3BQ0A 4WE1A 5D77A 3CSKA 2F9DA 1Z4UA 3GE9A 2PMZD 4IOCQ 2FJAB 2M8HA 4O4RA 2J5AA 4JP8A 2UXDF 2IA0A 1HMVA 1EZZB 4WZMA 2M0GB 3TZYA 3BQ2A 3D0IE 4P2MA 4FF2A 2NSBA 4JI5F 4NZ0A 1RKJA 3KLIB 1OYEA 1RACB 1SH0A 1XC9A 1JLCB 1P8GA 2XC9A 3X1LB 4O0IA 4AXJA 3POTA 2IJRA 5JMNA 4NYZA 3ILJA 2W2NP 3J81U 1N34J 1BMQB 1S4EA 3QWPA 4V19J 1RWOB 4LUBA 1LV5A 1NSKL 2ZVIA 4B3OA 2XMVA 4DSFA 1QE1B 1JB0C 1UVJA 1ZPWX 3A8JA 7AT1B 3JAMU 2WW4A 2Z2MA 3HFVA 2ASJA 1VI7A 2HFVA 4K2XA 3NAHA 2FHMA 4DQPA 1FRHA 1NCLA 3M2UB 2H48B 3DXSX 1N8RT 2D74B 1UKUA 4OYAA 2MXYA 1OQ6A 3MR5A 3MM8B 3BO2A 1I6JA 2XGQA 1S0VA 2VBXA 7FDRA 2G9OA 3GYGA 3C14B 5HP1B 1WC4A 1S6QB 4ID5A 3OBIA 5IM0A 4EO6A 1PAUB 2DIUA 3TANA 5KTQA 4OJGA 3OFFA 3VQSA 4QPXA 2BUNA 4NLTA 1RLDA 3UCGA 1YKWA 4DSKA 3FBFA 2M70A 1WG5A 3S1TA 2IHR1 4CWBA 2C3PA 4DCJB 4YQWA 1SJ1A 4AMOA 3RU0A 3FJ2A 3FSYA 2UXCJ 2MHEA 1RTDA 3OFHA 2WBMA 5JVHQ 3DRYA 2EFVA 1RAAB 5DDPC 1HA1A 3NY0A 3MR6A 3S6EA 1ZM4A 2M9KA 3I56S 1AZSB 1IVZA 1SKUB 1JK9B 2JFDA 3HM9A 2UV8G 2VG7A 1APSA 4ZIVA 4ES1A 1RYRA 1LWXA 4LF4F 3CJ2A 3HFKA 3DI6A 3H5SA 1SKSA 2Z56B 1X4CA 4K4YA 3CJ0A 3DXBA 4PYAA 2KXHA 3H7HB 4CLTA 2PD1A 1XMOF 2DEJA 2NZCA 1RT2B 5IT9U 2KTQA 1JLBA 2VJVA 2LA6A 3AT1B 2C2MB 5B0AA 1WC1A 1HNIB 3CMAS 2W2QP 1R7IA 3QPIA 1S1XA 3LP0A 2FB0A 3I32A 1S77D 1VISA 2VICA 4C8KA 4CLFA 3GFHA 1RCOB 2HHHJ 3UD5A 2BKNA 1VQKS 3NWRA 4CM0A 2VKZG 1G7CB 5HVGA 2V2KA 3HP6A 2GZOA 5ETNA 4ZVHA 5RUBA 2H4WB 4USVA 4DCOB 4CH7A 3VGVA 4O4GA 2ZH2A 1WI6A 2CPDA 2HFSA 1DQAA 2UUBJ 1RBAA 4R5PB 2WSCC 5F8IA 1Y3JA 3KKFA 2DNHA 3FFIA 3H4BA 1QAJA 4JYAJ 2HWIA 4P9SA 3BF4A 3F44A 2J7UA 4F50A 2DD8S 4N5SA 4QU7A 2GJ2A 3HHLD 1AW0A 1EIYB 1MWYA 2AF6A 1RBOB 1N5QA 1S1VB 2QSFA 5KFHA 2IYGA 1PBUA 4JI7F 1YVFA 4KHMA 3UPFA 4OZ3A 4WP3A 2QC3A 2R7RA 3V4IB 1RT1A 2U1AA 3MDFA 2AT1B 2WSFC 2XHWA 4GKJJ 2V9WA 5JVGQ 5IC6B 2ASDA 2CJBA 1RT5B 4MH8A 3ZNUA 5B0DA 3M8ZA 2YKMA 1HNWF 1RA6A 4U6PA 2DYAA 1RTJA 2AYEA 1C4AA 4M95A 5I3UB 2AHOB 2QIFA 4M5DB 2RQCA 3N6LA 1YJRA 3D4JA 4GMKA 3G4SS 2Y1LB 1FFGB 4RW4B 3J7YI 4Z7YA 4C8YA 4OJ1A 4TN2A 4JI0J 5LSOA 4QBUA 1TUWA 2FUG9 3H4DA 3B78A 4DR1J 4CO2A 4Y6IA 2XLKA 3W1YC 1Q8IA 1KTQA 2U2FA 2AEJA 2CWXA 3D2WA 2OEKA 3DLGA 2LA4A 2V4JB 4H4OB 4DS5A 1N34F 2FY8A 2AYMA 3UW1A 3Q86A 5GMEA 3SQGA 4CH0S 2VQEF 4ZN1A 2RVJA 4B9TA 1PO6A 1IKWA 3MMBA 2HBQB 1GMWD 2V4QA 4NLSA 2CPXA 3SIPB 1R0BG 2MKJA 1DARA 2WVCA 5KFIA 2OIHA 3HKWA 2EBEA 3GG0A 4EZ6A 5C2CA 5D4NA 4ED2A 5I42B 1YWXA 4ZOSA 3PYGA 5K8PA 1Y7PA 3TRGA 4IFVA 2KJWA 4U95A 3A3NB 2IBOA 1M5OC 2D69A 4F04B 2MQQA 1U0HA 3V6HA 4HHUA 2PI5A 2OPSA 4KGKA 5D4OA 2E1MC 4C0HA 2XY6A 4GO7X 4ZCMA 2NXEA 1M5VC 3TJ9A 2KG1A 2XSFA 5HAOA 1DTTA 2OFGX 4ECUA 2D9PA 3CJKB 2RF2B 4P2SA 2NYHA 1VS3A 2OJ3A 1YBTA 4K4WA 4CT8A 2HSEB 1EX8A 4DFPA 3IAM9 4B9LA 3I9V9 1S1TB 3LQVA 2GMLA 1IXKA 1NBEB 1UVMA 2UXCF 3KJFB 1YJTA 5KG3A 1BQNB 2HURA 5EX3A 4ZHRB 1EP4B 3X3UA 3H2UB 5CYQB 1YLXA 3FSXA 3FZBA 2XO7A 1ZAXA 4N47A 3ZZTA 3PG9A 4LR9A 3THTA 3HSGA 2FGCA 1G6BA 1T94A 2DH7A 5KFWA 1RHQB 4WFZA 4DPUA 5E3PA 5HVHA 4U7CA 2BJ3A 4AYBD 1R89A 1V3RA 2AWZA 4UUWA 4Q5VA 5ETMA 3RBEA 2M7SA 2IRYA 4QQBA 4IYQA 3IS9A 3BR9A 2XI2A 2G1HA 1U02A 2R4FA 4ED8A 2Q3PA 5K8OA 1PKUA 4CO4A 3N6NA 2B8PA 2HHHF 3DLKB 2C2NA 1YSJA 2GCFA 1HQ2A 2MTLA 1B7FA 1HNXJ 1N6QB 4AMNA 2G2YA 2R42A 2OSRA 1TL7A 3Q2SC 1R6YA 3Q22A 1CJKA 3DRPB 1CC7A 1NJXA 1B99A 4FNIA 4PYDA 3MPDA 1Z2LA 4A46A 2YKPA 4LSNA 2UUBF 3PVXA 1TKTB 1U48A 4ZCIA 2VF3A 3EE3A 1W7WA 4K2JA 4JYAF 3U7JA 4KV8B 1WF1A 2ATCB 2YKAA 3AQPA 1ZPVA 2VB6A 5DG8A 1Q0NA 2Q6BA 3C15B 1RT6B 1YTYA 4PZVA 4AL5A 4I56A 1D8YA 2LDIA 3BGRB 3ULHA 1GXUA 2YX4A 5L9XA 2NLWA 5DETA 3GV5B 3MEEA 4GKJF 1T05A 2RDDA 1VCTA 1M5PC 2Y8YA 3MPUB 2DH8A 1HPZB 4GRSA 2C2ZB 4WXOA 4OI2A 1ZZNA 1RDRA 4A4JA 1FCAA 5SZTA 5FD1A 3KLIA 2LQBA 5IT4A 4UTGA 4J9SA 4ZVEA 2NXNA 3NS6A 3QIDA 3WIVA 1KP6A 1FDNA 1JLCA 1FEHA 2PMWA 5K20B 2OPRB 5FLXU 2QA2A 3DNCA 1LEOA 4JI0F 3D3CJ 1CQNA 1YDLA 4FYWB 2EFGA 2DNQA 4DR1F 4C98A 4PPDA 3TP2A 3MURP 4NRTA 4RJVA 4RBTA 1WC6A 4EYHB 3A12A 1YJNS 3VAIA 2V69A 4ZP7A 3RJMB 3HKZD 2E9TA 2MB0B 4NEYA 5LJ5Y 2B9EA 5GAHI 4WU2A 2YQ1A 3FKBA 4TU9A 1TK5A 1BD6A 4YHHJ 2QE5A 4ZITA 3NWGA 4OI0A 3WDOA 5J2QB 2DHSA 2ZBPA 3MMAB 4NWBA 3NGDA 3QT8A 3ZZPA 4F0MA 3OT9A 1X0PA 3C14A 1S6QA 4UF4A 5L9NA 2MEWA 5KFTA 4I64A 3G8QA 1UWBB 1YRTA 2YNFB 2H54B 2UVVA 1F0XA 2NYIA 4ZA1A 1T3OA 2DXFA 3JTOA 2I38A 2E5GA 2CADA 2GX8A 4O0NA 4OYXA 2HWHA 4Q45A 4AL6A 2HHXA 5J1EB 1UVIA 5I3QA 1X5OA 2Q79A 2J9DA 1FFSB 4IH6A 1WUUA 4IOAQ 3AH6A 3FEXB 2UV8A 3US5A 3MAQA 3CCMS 4JV5J 4L72B 1OY8A 1S6PB 1DBDA 3WHIA 4WU3A 2OAUA 3GV8B 2B9WA 3HD2A 4CNZA 3I9ZA 3I0RB 5J2PA 3R27A 2Z0GA 2LXFA 3CMQA 3WBZA 1N5YB 1RT2A 2BX6A 1SL1A 5HJXA 4B3TJ 4RLEA 3NAIA 1NEEA 1S0NA 2QTWA 4OYOA 1HNIA 1NMEB 3QZ8A 2ZNZA 2CQIA 1WD6A 1KQFB 4O3OA 1WNEA 5KG5A 1FD8A 5CH7B 2F4VJ 2DPIA 1X4GA 3KUGA 1VHIA 2M3DA 2DRBA 3SMZA 2M5YA 1NH7A 3TEGA 5KFMA 3KNAA 1RU2A 4WYLA 2YVSA 2IM0A 1P1TA 3DHWC 1MU2B 5B08A 3BGFA 1NLKL 2RKIB 3CDWA 1YZ7A 3ITHB 3I5CA 4ZDNA 4MIWA 4UT4A 4RZRA 1LW0A 3CGIA 4ZVSB 1VRQC 4R8UB 2MQPA 1DJ0A 3CW2C 2V67A 4K4ZA 4OI3A 4L74A 2H1YA 4CNYA 2DJWA 1HNXF 3OL6A 2AJ4A 2DEIA 2P8IA 1UZHA 2FJXA 1RI7A 4HH1A 1KFDA 5G4DA 3KNGA 4NZ6A 4F4ZA 4ED5A 2LQ5A 2HPUA 3BPDA 1O51A 1ZAVA 1VK3A 4QWEA 1YQHA 4Q7AA 1S1VA 3K59A 5A8RA 1U1MA 3H90A 5F3ZA 3H20A 3OFGA 4C11A 3V4IA 1H2VZ 3E8OA 2UUWA 1WC5A 2AZ3A 2E1AA 4UY85 4K8RA 3HX9A 1U49A 2D41A 5CABA 5DGAA 1SB6A 5I3UA 4A8OA 3W65A 3PV8A 1VQMS 4M5DA 1RB0A 4RNNA 5KG1A 2E5LJ 2DGUA 2LQ8A 4OLOA 4RW4A 5HSPA 3AODA 4MT1A 3W60A 2OHDA 2RD5C 1SJQA 4P6QA 4WKRA 5J1PA 4NMLA 5HROB 4DV4J 2FHOB 3K17A 3H5YA 1RTIA 4Q44A 1KKHA 2L9WA 3KJVB 4GC6A 3BH6B 1JX4A 1RBLA 3NEKA 2NCKL 4OYBA 2QFIA 1RADB 3SDEB 2FVRA 1Q1KA 4DFJA 6FDRA 4CLWA 5EX0A 5C5JA 2V4JA 5GMDA 3HDSA 1O0PA 2DO4A 5CAAA 4B3MJ 3DOKB 2LLZA 3W66A 4NLUA 1RYSA 3TUPA 3FBBA 4P73A 5ETLA 1WC0A 4LF5J 1KONA 1OPZA 3CDUA 5DQGA 1X0FA 3A3PB 2VIHA 4FP9A 1QSLA 1SJRA 3C19A 5KFUA 4NXMJ 4YHHF 3MEKA 3CCJS 2AEFA 2UUCJ 3GV7B 3HZGA 5D4PA 2B51A 1H72C 4PEOA 3G6VA 4FVMA 2RRAA 2M8DB 2BR0A 4N8NA 2CQ1A 3RZAA 2XWXA 1AUDA 3MMCB 1T9VA 3QYYA 3PKMA 1GTEA 3PW2A 3TX8A 3D3BJ 3CWJA 4DL6A 2HEKA 2JC0A 3MAHA 3ENAA 2WRMA 3CCVS 4A8XA 4KGVB 2F65A 2JHEA 3D5MA 3I31A 3FEYB 4OFZA 3DYAA 4WFNQ 4Z7CA 1PJ7A 4F2RA 1FXLA 1X7VA 3JQMA 3TNVA 3TOQA 3UN5A 2P9GA 1S12A 3EJMA 3HVTB 4ZHRA 1NU4A 4ANCA 2MZSA 3BGLA 5CYQA 1VC6A 2GIQA 4DQQA 1FEEA 4JV5F 4DV5J 1P9YA 3AA8A 3R97A 4LRCA 3SCLE 3MFHA 3RB0A 4OZNA 2CWKA 3H25A 3OW2R 5HL7Q 2HWTA 3S8SA 3AHPA 2FQQB 4B3TF 4FS2A 3D6TB 1H73A 1I51B 5CZCA 4AFFA 1HKAA 1KTVA 4PCQA 4URGA 4QWBA 2L3MA 3FBCA 3IBFB 3CTRA 3BEGB 4MK9A 4J9VA 2RDJA 2F4VF 3M8QB 4DMZA 1TV6B 3VHQA 4XK8C 4ETXA 1WTFA 2DR7A 5E33A 2GHWA 2UP1A 1AYEA 2V8VA 3DGPB 1N6QA 2AJ0A 3ISND 5E0OA 4I2PB 3B4DA 3P45B 3DRPA 4WFBQ 2UUTA 5IQ6A 1NK5A 2ZH6A 1UFLA 4WIIA 1T03A 1WHYA 3FRYA 3JTNA 2J8AA 5DZ7A 2M88A 3LP1B 4RX6A 3IGVA 3GTYX 4KV8A 4XO0A 2WZ1A 1F5BA 1RT6A 5KFOA 4DF8A 2DTJA 2PI4A 5GAGI 1G1XA 3DU5A 1OS5A 1XERA 3EDQB 5D0HA 1OSDA 4DXLA 3TUZC 1GH8A 3N0VA 5LMUJ 4KAIA 3C6TB 2QSWA 4UOCA 1LOUA 3NKYA 1UA1A 3QJLA 2CVIA 1NDKA 3T6BA 2GAGC 4ZJLA 1KHVA 5KG0A 1L3SA 2HKEA 3HFZB 2EFOA 3AJDA 4DR6J 3GFZA 3G96A 2HFUA 4RNFA 4PWDB 2F40A 2FHKA 2FZGB 3FBEA 2CQ4A 1QJHA 1REGX 4DPXA 1WOSA 2E5LF 2ZH3A 4KJIA 1DHMA 3LP2B 3GJQB 3CT9A 3MUMP 3M8PB 1GMUA 4E0DA 5FIIA 1S0OA 1R3NA 4RW8A 3OJUA 1UTAA 2WTFA 3RB6A 2OPRA 2JVOA 2R2UA 4J9PA 4USKA 4DG1A 4DR3J 4DV4F 2O01C 2YKNB 1WOPA 1ZTWA 3H0PA 1H38A 2KZZA 4ZLNA 1SKWA 2AGOA 2CYYA 2Y0BB 2FYXA 2RB7A 2UZAA 3BYPA 4O3PA 3G87A 1UCNA 3AQOA 3ILOA 2XYPB 4QJVA 2G1DA 1RE1B 2HVDA 3PIOQ 5LM7E 4B3MF 1W25A 4NLDA 1VQPS 2A3JA 2YQ0A 3ET6A 2BV3A 2WSEC 4FYVB 2QL9B 2PIIA 5GVQA 3DRRA 1NPKA 3CJ8A 2CVEA 3N9UC 2C1EB 1FO1A 2OH2A 1S6OA 1VRTA 4LF5F 1LXJA 1UWBA 3NGUA 2YNFA 4ZVTB 4KPYA 1S9GA 3R3TA 4NXMF 2UUCF 3MPWA 3ZTSA 2DGOA 1X4HA 2ZH4A 4M5KA 5BYRA 4K4SA 5ETVA 5EGYA 2C3OA 2Y9HA 4S0MA 2R8JA 3BKFA 3QIPB 3A8EA 4JI1J 3PHTA 1W26A 2D3ZA 3D1HA 5KG2A 4E8UA 3AA9A 1X4EA 2BE7D 1SPBP 2YTCA 2DKOB 3RTVA 3CJTA 3DRSA 3OR1A 4BS2A 2LYVA 1N32J 1S6PA 3AOCA 2Y1IA 5AE1A 4QIFA 2EBGA 3KHRA 2B4VA 3CCSS 4LF8J 3N79A 2MZTA 4DR2J 1PYTA 2W8KA 4F4WA 3W2VA 4TU7A 1X4AA 2NUUG 1JLFB 3EYZA 3P5TL 4JB8B 3FMWA 4QIWD 3NMAA 2OFHX 5KFKA 2J6UA 3E3XA 3VAJA 4E98A 4DV5F 3SV4A 2EFNA 2NXJA 1RWKB 4WTYA 4TQRA 2LCWA 4K5SA 2XI3A 3GG1A 4RWXA 2VPZB 4KFBA 3D66A 1FWPA 3MCNA 2WB1D 4AL7A 2NZ4A 4ZVOB 2I6WA 1S76D 2J9EA 3H5UA 4F4XA 1XNQJ 4AMPA 2KT3A 2RKIA 1UL3A 2HZVA 2UVWA 2ZE2A 5EWGA 3DLJA 2ZBRA 2FVPA 2RE1A 3KDNA 7FD1A 2MZRA 3KHLA 3P5BP 3M32B 2MKIA 2KH9A 1IBKJ 2O3DA 1WG4A 1T9WA 3MM9A 1JNRB 1L5UA 1YHQS 1EQ0A 2QLFB 4JI4J 2QL7B 3OUYB 4HR2A 3HHLB 2CKWA 4ZPCA 4ATNA 3QRRA 1CJTB 3LW5C 3ENVA 4USUA 3IRXB 1ULRA 1CQMA 4LF6J 5CD4A 2GQCA 2OELA 2QYGA 1R8PA 1HWLA 1XBWA 3L09A 3KMQA 2WW8A 5LMUF 3Q23A 1BC6A 1M5HA 1LWFA 2Z58B 2KXNB 4U8YA 2KO1A 1SUQB 4KGZB 1RT7A 1LXNA 5HROA 1N54B 5LT5A 4DR6F 1HWIA 5ADZA 2CQGA 3KJVA 1K8AT 3I6PA 4YS2A 4DCPB 1SC3B 3MZIA 4YB5A 1F60B 2DGSA 3SDEA 3RRKA 1XMQJ 4ZKAA 4I2QA 4DR3F 3PZPA 3DOKA 2BANA 4CM2A 4PG8A 1YRUA 4A8MP 3L95X 1FRLA 3PCOB 3GIJA 1TL1B 2V6AA 1RAOA 4RNOA 4EBCA 4L6V3 5E5NA 1VQ8S 2YH0A 2XZTB 1YITS 2RH3A 3MHYA 3OVSA 3UDLA 3W7BA 3N5BA 1JLGB 5DO2A 3SI8A 5CQGA 4PWWA 4QW9A 3Q8VA 4FBTA 3MMCA 3PEJA 1S9EA 1KQGB 1TL4A 4DBQA 3PM9A 3MCSA 3OL9A 5IZHA 4DV1J 4RW6B 1A9NB 3HSZA 1WI8A 1TFYA 4C8ZA 1BGXT 1UZDA 2MPUA 3VGSA 3UN2A 3BYRA 2G2OA 2V8HA 1GFWB 4JI1F 2V5HG 3T1AA 4YDDB 4QWAA 2KHCA 4H4KA 4XDDA 4EUVA 1N56A 2PN6A 3OSPA 2KFNA 2DGWA 2MQLA 1VBKA 3I87A 2V94A 3KK3B 3NS7B 3FGVA 2DK2A 2R7WA 2VDIA 1NDCA 1U47A 4JUZA 4NPOA 3D1QA 2BBEA 1N32F 2OMOA 4PKDB 2IVFB 2BOPA 3S7RA 4LF8F 3B4MA 4H54A 4DR2F 2I1RA 3TW0A 2RIJA 5ETSA 2AJ1A 1IKVA 2D3OR 3M6UA 4BWJA 3KYLA 2JJ4D 2A1BA 1X9WA 3QBCA 3DOLA 4PPZA 5HMWA 2PA3A 3TZZA 2ZKTA 3MEDA 2V9KA 2DCUB 1WACA 1WKJA 4ZPVR 1T8EA 4OX7A 1XIQA 3VQTA 1SC4B 1WHWA 3M8QA 1TV6A 4OZ5A 1NK7A 2EKNA 4BDPA 3BQ1A 5LXRA 5F8MA 1PILA 4LBPA 2BJ8A 3DGPA 5D8HB 3QSYB 4WF9Q 4AE5A 1U4BA 3ZTRA 2PE8A 4CO5A 4I2PA 2DH9A 5DQIA 4X65J 1XNQF 5AXLA 1SH3A 4CYUB 4UZBA 3PW7A 2ZOMA 1C1BB 3A4TA 3KLEB 3MTJA 4U96A 3PRDA 4RBUA 4ZIWA 1SIWB 1N36J 1TTHB 3LUYA 1RHKB 2JL9A 1NSPA 1Q8LA 1FT8A 1VYAA 4TVAB 1IBKF 3K5MA 1XMBA 4JV1A 2KL8A 2Y3YA 5GAEU 1ICEB 2HK3A 1U0SA 2V2QA 1FDBA 4Y2MA 3AB2B 2FLPA 4QZVB 3PW4A 4MJKA 2R2RA 1EETB 4IDKB 4JI4F 2EVZA 1U2FA 3SV3A 2VKRA 2ILYA 5A6WA 4DL4A 3MPVA 2FGOA 2DNKA 4FPRA 4RW9B 4HI2A 3DFEA 3ICLA 3J7Z5 2A10A 4PUOA 2NREA 2RU9A 1RWUA 3F56A 1DQ8A 3QGHA 4LF6F 4PWDA 2YQ3A 2WHOA 1S7IA 3AD8C 2C42A 5KT7A 2MJNA 2HHTA 3GR1A 3LP2A 2BE9B 3K5OA 3H42A 3Q8PB 5B7WA 1RISA 5A76A 1O6XA 1FWLA 2RS8A 1RXOB 4TY8B 5BYSA 5F8JA 2YKNA 2OEMA 3FEZA 4TKTA 2Q6CA 1REVB 1LWCB 4ID5B 5IM0B 3PJWA 1IKXA 1OSCA 4M8LA 2HFOA 5ITHA 4Q8EA 4I0WA 3ZZZA 2AJFE 2CZVC 4IQMA 3C6UA 4PABA 1X4BA 2N7YA 4TXSA 4FYDA 2F4FA 2CXEA 2PMHA 1XMQF 1URNA 2IPOB 4IUFA 1WF0A 4M94A 2ALZA 3DLEA 2HZAA 3FCVA 1C4CA 3HVWA 1BWEA 1RTDB 3J80Y 3T1YJ 1SV5A 1U1KA 1SJFA 5HK4A 3GZ7A 4WZQA 2JSXA 4K0KJ 3M9OB 3IR7B 4B02A 1A7GE 1KOOA 1E6YB 2B6AA 2R7XA 1UW9A 2R3VA 4KRWA 2HNDA 2VG7B 3MR7A 3GIIA 2MQOA 2RRBA 2CIMA 1RGVA 1GAOA 4LF7J 2ZZTA 3DI6B 2XLJA 4M63A 2GAHC 1IQZA 2WONB 1GX5A 4I1TA 4D3GA 1HIYA 4ZP8A 4A47A 2L48A 5F8HA 2VG5A 3IN5A 4DUTA 4OI4A 3GCXP 4QU6A 1HQEB 4WKYA 2XMKA 1HHQA 2MQ8A 1JLBB 4WPAA 4DV1F 4KH0B 2IFXA 4BLGA 1VQ4S 2NS1B 4EO8A 5CYMA 4DZ6A 4DUYJ 1AT1B 3G6YA 4FXDA 1QTNB 1RWMB 3O3LA 1YGYA 2W4CA 3OD2A 3IWXA 1IR0A 2YNGA 2YWFA 2E5JA 4CDIA 2MKSA 4X2BA 2W7AA 4X4NA 2LMIA 3M8RA 4J9OA 2CG8A 2YNHA 5KG6A 1FJEB 3U27A 2NSCA 4ZPWR 3ZTPA 2IJFA 1WTBA 3BSOA 1C1CA 4PQUA 5IV4A 1ZM3A 5C7PA 3BGUA 2RU3A 1XN9A 4X4UA 2BM0A 2KVQE 2IVMA 3E2EA 3NG8A 4X62J 4XAKA 3GJSB 3T3FA 4E2FB 2EWHA 2XMTA 5EN1A 3UVJB 5E41A 2I0XA 1WWHA 1KS2A 5KFCA 2YWHA 3QRPA 4C3LA 3ENWA 1FKPB 2PO4A 3TQEA 1JIHA 3Q8YA 4WFXA 5KT6A 4ILMA 1X9MA 2HQFA 1F5AA 1RP5A 3HF5A 1ZM2A 1FTCA 2JEFA 3AJ1A 1WHVA 1H2UX 2YWEA 4JI6J 1RT1B 1RT4A 9RUBA 3M4XA 3M6WA 3NP5A 1HFEL 1F5CA 4C8LA 4KT0C 2XZWA 1HNVA 4GVBB 2LU2A 3RW6A 3DU6A 2B5JA 2YKMB 3M32A 2C2OB 4NOHA 3DMJB 2CQPA 1NPRA 4X65F 1UVLA 2HMIA 3L3CA 4F0KA 2Q1LA 3M9MB 2KFYA 1N36F 3SSQA 3G8TA 1MMDA 1KQSR 1S99A 1B64A 1YJVA 2CPIA 4NLXA 4RKUC 2MSSA 1CJTA 3K89A 5DRKA 2B8QA 2ZC3A 4NCGB 4K5RA 4GC7A 4MYTA 4DSEA 4PG6A 4NRUA 4CCHA 2W7PA 4LR8A 4QR0A 1KNZA 4WWSA 3DLGB 3UR3C 2PDAA 1ZYQA 2H5EA 4J9MA 1TVRA 2HGMA 3PX6A 2DXEA 2DNNA 5E3QA 3SQGB 2CPJA 1SUQA 1NDLA 2CRLA 2ZUAA 4CP5A 4LVNP 3LO3A 5KFZA 1NHVA 2FHJA 1IKWB 3IFEA 4OHWA 4UOFA 5F8GA 1PCAA 2J76E 1Q86T 4OZLA 1K0TA 4ILLA 4F4AA 4KY3A 4C0BA 2ZHOA 1YJWS 2QMXA 2DR6A 4KSEB 3OTCA 2G4BA 4IFVB 1XR5A 4DL0C 4DLEA 5KFBA 1NK0A 3KK2A 1VOMA 3GWCA 2CUYA 1HNZJ 1DAXA 1TK0A 2X51A 1C0TB 2W2OP 1TL1A 3T9NA 4P2XA 4B3RJ 1RU1A 5KT4A 2XNRA 4IFYA 4DPYA 1PJ5A 3TX0A 4MTPA 3SZ2A 3TZXA 1WDTA 4PXDA 1GMWA 3EVMA 1JLGA 2AW0A 4MK7A 1NZAA 5DS7A 3SBMA 3MPYA 1HI1A 3KLHB 3T1YF 1TKZA 4J7CA 2C2EA 1JXVA 3H8YA 3GYNA 2DGVA 4K0KF 3AOAA 2AGPA 3IWNC 1M5SA 3CCLS 3V4MA 4CLUA 4IKAA 4P52A 4CT9A 4DS4A 5F9NA 8RUCA 1K47A 1VK8A 2Z2LA 5C42B 2ZOFA 4LF7F 3ILLA 2B0GA 5GADI 2JZ5A 4J5OA 1VRUA 3QJPA 2VA3A 3T9ZA 4RNMA 4JI3J 1MN7A 4RWWA 1R0AB 4N76A 1N0VC 3M6VA 1LW2B 4NX9A 3TEHB 4DUYF 2AX0A 3ZZ0A 3W2WB 2ADCA 2K8GA 2ZZMA 3UNGC 1QDUB 2APOA 1M0SA 2JWNA 1FHTA 4AT1B 4CLKA 3DGVA 1VLYA 1AFJA 4DL7A 4F3QA 1TL7B 3HT3A 3OLAA 2K06A 3O8WA 2A2DA 2DPJA 1CJKB 2IVYA 4M1KA 4BBYA 1CEZA 1FI4A 4X62F 4DEZA 4HI1A 4LSNB 4KC5A 2KDOA 1T95A 4QYRA 3PO4A 2XMJA 1ZOTA 4CO1A 4WXWA 4ZVQB 1C2PA 1OWXA 1UEKA 3K5NA 2BW2A 3GJRB 2BJEA 1XK8A 4M5HA 3B54A 2Y8WA 4CYUA 5U47A 2AYGA 5M2RA 4ELVA 4JI6F 2ASYA 1FESA 3MEEB 5DQHA 3GB0A 2ADBA 1T05B 1IR1A 3G2XA 3HHEA 2W9AA 2V68A 2W1BA 1PBAA 3MEGB 2RAQA 4W98A 5CZXA 3W5XA 1ACMB 2XULA 1HW8A 2AD9A 4I7FB 3JQJA 3QRQA 2VFTA 4USMA 3HJFA 1QM9A 5AJ3J 5L1JA 2VH7A 1VQ5S 2ZH8A 2W25A 2LVWA 2FTRA 5IV3A 1EETA 4IDKA 3AOBA 3KK1B 2B4OA 3FSIA 1K0VA 4DL5A 1DFDA 4RW9A 5KOXA 3TYTA 1EKSA 2HK2A 3QATA 4F4KA 3I5BA 1VJQA 3GR0A 3V6DB 3H2LA 1FWKA 4G1IA 2R7TA 2HS4A 3KMSA 3CJSA 4IG3A 2Y1JA 4NLWA 3BDPA 2W2PP 4CO3A 2KRBA 2JLFA 5H9EJ 5A6PA 2CQ2A 2LQJA 2GJFA 3MECA 3AD7C 4UUXA 2M4MA 3T5KA 5KOWA 4MIAA 4TY8A 1HYSB 5DGBA 1N4LA 3DLLQ 4A8FA 2C22A 2WVEA 3MCMA 3TQ1A 1REVA 1LWCA 1ELOA 1KQKA 3Q8QB 2EG1A 5HANA 4EFAC 2ALYB 2BQRA 1XEZA 2R2SA 5J2MB 2PA8D 3VV2B 4LT6A 5GAHU 3FVYA 5AXMA 3THPA 3N6MA 1SJ4P 2WVFA 4YB6A 3ILIA 1TUGB 3HI9A 5KAKA 4H4MA 1A6LA 1HNZF 2XO6A 2LECA 4B3RF 4DL3A 3SSSA 1SC1B 4OYIA 4HKQA 3HK2A 1O5JA 1E6YA 1QAYA 1TELA 3PDNA 5KT5A 3CJ3A 1IBLJ 1NSAA 2B43A 1H3DA 4NCAA 1OIAA 1M1HA 3T6JA 2HNYB 3M2VA 3PYDA 2LEAA 1EHWA 2WONA 3VGUA 5B0FA 1WKLA 2C28A 4TU8A 1MLAA 1FRIA 5J2PB 2XCAA 1Q53A 3R7BB 1HQEA 2QRRA 3CE8A 3G86A 4IRKA 4OYMA 2EK6A 5H9FJ 4I6AA 5JXSA 3MM6A 3I82A 3K5LA 3A3OB 2MQNA 2V2ZA 2RHSB 2FJEB 1VR6A 1N0UA 2XEXA 2A18A 4CQ1A 4ZMMA 2MMYA 4JI3F 1NJWA 4ILRA 4DSLA 1VBZA 4Z37A 4OZJA 4CLPA 2VD3A 3JSMA 3HZEA 2YH1A 3EICA 4UOGA 3QQCD 4AQYJ 1U25A 2MGZA 4M5LA 3Q8RB 1N88A 1X4FA 3L7OA 1LW0B 1V3SA 4WTOB 2KHDA 1SJ3P 4HDGA 3T5LA 5KFNA 3UVJA 5M2PA 2BM1A 3CB4A 3ADAC 2AGQA 1F6TA 1FE0A 1RHRB 5LJ3Y 2ACYA 1JXEA 3T19A 3MUVP 1FKPA 2YY3A 1FRJA 1RJJA 3CDBA 1ITPA 3VZIA 5L8RC 2Y0SD 5A8RB 4J9NA 2VOOA 4L3KA 4DV6J 4OYWA 4C11B 1U1NA 3NCRA 4L75A 2HS0A 4I69A 4EGLA 3JXOA 4GVBA 3D6FB 1TL3B 4LVOP 2B3TB 5CCLA 3P49B 3DMJA 3IR6B 4DLGA 1PG5B 1RHUB 1UW4A 3P8BB 2JLEA 2ZD1B 3MF5A 1RTHA 4QYZJ 2FHJD 4NL5A 1RAIB 1YG0A 3KLVA 4CTAB 1LWEA 1KVKA
chains in the Genus database with same CATH topology
3CJ8A 2QC3A 4RR5A 2G2OA 5CZDA 3BV8A 3EZOA 3HMJG 3H0PA 3RGIA 2HG4A 3HJVA 2CUYA 3TZYA 2VZ8A 1MLAA 3R97A 2VKZG 5DZ6A 5DZ7A 2C2NA 3K89A 3PTWA 2PFFB 4QBUA 2JFKA 3HHDA 1NM2A 3TZXA 2VZ9A 2G2ZA 2JFDA 5CZCA 3TZWA 3TQEA 2UV8G 2G1HA 3QATA 2G2YA 3SBMA 2QO3A 3IM8A 3R8YA 2QJ3A 3TZZA 2H1YA 3IM9A 3G87A 4RL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJ8 A;  2QC3 A;  4RR5 A;  2G2O A;  5CZD A;  3BV8 A;  3EZO A;  3HMJ G;  3H0P A;  3RGI A;  2HG4 A;  3HJV A;  2CUY A;  3TZY A;  2VZ8 A;  1MLA A;  3R97 A;  2VKZ G;  5DZ6 A;  5DZ7 A;  2C2N A;  3K89 A;  3PTW A;  2PFF B;  4QBU A;  2JFK A;  3HHD A;  1NM2 A;  3TZX A;  2VZ9 A;  2G2Z A;  2JFD A;  5CZC A;  3TZW A;  3TQE A;  2UV8 G;  2G1H A;  3QAT A;  2G2Y A;  3SBM A;  2QO3 A;  3IM8 A;  3R8Y A;  2QJ3 A;  3TZZ A;  2H1Y A;  3IM9 A;  3G87 A;  4RL1 A; 
#chains in the Genus database with same CATH topology
 4OIX A;  3DRX A;  1KD1 T;  4LFC J;  3V81 B;  4Q2L A;  1BQX A;  1RTI B;  3Q8S B;  3QO9 B;  1ZTT A;  3DC2 A;  2YPY A;  4NAS A;  2OPQ A;  4NCG A;  1MML A;  4WFA Q;  5AJ3 F;  1ZA1 B;  1W2I A;  3LH2 S;  5F41 A;  3JTP A;  4DPT A;  4NMX A;  3IO1 A;  4OZ2 A;  2XMW A;  2JC1 A;  4BWM A;  4QIG A;  4KBI A;  1L3K A;  4NCB A;  2PC6 A;  3PYF A;  3HMJ G;  1BWV A;  4QCL A;  1S10 A;  1RCX B;  8AT1 B;  2RUS A;  4UZC A;  4I6Y A;  2YXL A;  4J90 A;  2L41 A;  4AD6 A;  3T5H A;  5DM6 Q;  1DTQ B;  5CYJ A;  5KFX A;  1Q8B A;  2XS5 A;  2HVI A;  1PGZ A;  4YFU A;  3Q83 A;  2WCX A;  1X31 C;  1S1W A;  3MTK A;  3UWT A;  4FVC A;  3W61 A;  2ASL A;  3IWL A;  1F1B B;  4P2F A;  3M30 B;  3TVZ A;  2W24 A;  3S01 A;  2QLW A;  3T41 A;  4RO0 A;  4RUH A;  3VAK A;  2E9R X;  1T0T V;  1YZ6 A;  2ERR A;  3N01 A;  4ED6 A;  5EWF A;  2PFD A;  1C0T A;  1T9Y A;  3CD6 S;  2HRT A;  4ZVP B;  4EEY A;  1CJV A;  4DL2 A;  4C8O A;  3RG6 A;  3B6B A;  3HVA A;  2LP4 A;  2CJ9 A;  4V19 X;  3PKY A;  1P1L A;  2G2Z A;  4YME A;  3J7A 1;  4OQJ A;  1RAH B;  1NPP A;  2IY5 B;  3KFW X;  4W92 B;  3DYA B;  1UEV A;  2POK A;  3OSN A;  4AXI A;  3KLH A;  4EYI B;  2W9C A;  4WK3 A;  1DY3 A;  1UJ5 A;  2F3J A;  1CS4 A;  3JSR A;  1WHX A;  1M5K C;  5HLF A;  1F2H A;  1DRZ A;  3TO8 A;  4JI2 J;  3C16 B;  1IBL F;  2HNZ B;  5DDR C;  3CUL A;  1YBA A;  5C42 A;  2QL5 B;  4FYY B;  1SH2 A;  2C3U A;  1N5V A;  2WBR A;  3SSR A;  2XYG B;  5DLF A;  4U7U D;  5IXU A;  4DPW A;  3HT0 A;  4NYO A;  2D1C A;  1Y5L B;  3GP9 A;  2CQ0 A;  3PHE A;  1R0A A;  4R0E A;  1LW2 A;  2HQI A;  3PFE A;  5T7L A;  3IA0 A;  1CSJ A;  1XJW B;  2VAS A;  3W64 A;  3MM7 A;  3IM8 A;  4WK1 A;  1MW7 A;  3W2W A;  3BN7 A;  3TA2 A;  3F41 A;  1GQE A;  4F25 A;  4Y28 C;  1QTM A;  2R7V A;  1P27 B;  4DR5 J;  2LDY A;  2X1B A;  5HAT A;  2KKH A;  3GIM A;  2F8E X;  1HW9 A;  4AQY F;  1FE4 A;  1Q5Y A;  3UDV A;  1WSR A;  3ZFV A;  3P4U B;  2DY9 A;  1T03 B;  3QLH B;  1Q79 A;  1V6H A;  2DRD A;  4OL8 A;  3R1L A;  2DHG A;  2NPI A;  3IRW P;  1RAG B;  1N48 A;  3BBC A;  4ICL B;  2AX1 A;  2VUG A;  5DZ6 A;  3CC2 S;  4LR7 A;  2XY7 A;  1U45 A;  1Y11 A;  4KR0 B;  3R5D A;  4U7U K;  2R9L A;  3MUT P;  4DV6 F;  3ZZY A;  2DBB A;  1VJW A;  4NA2 A;  4FN5 A;  1DLO B;  5LL6 d;  3OL8 A;  1SQE A;  1Q4R A;  4YR2 A;  3AFG A;  5A0Y B;  3UCU P;  3MEG A;  3OXL A;  1L3V A;  2G13 A;  2HGL A;  4I7F A;  1QVG R;  5K8M A;  2UVU A;  5B0G A;  1TQL A;  2IM3 A;  4QWD A;  4TYB A;  1YX2 A;  1KFS A;  1VIX A;  5K9F A;  5GAG U;  2FDN A;  3ISZ A;  3I4H X;  3RR8 A;  3KK1 A;  1JKH B;  4RW8 B;  4M5G A;  1B3T A;  4LFC F;  1KLM A;  4DG1 B;  1IBM J;  1TMJ A;  5HBM A;  4DUZ J;  4IOB A;  3G82 A;  5F8L A;  3CD0 A;  4FF3 A;  2H5J B;  4EU0 A;  4O3N A;  4DI6 A;  3PW5 A;  3RB4 A;  2I8E A;  3M1V A;  3V6D A;  3QNW B;  3MM5 B;  2K7K A;  3LTO A;  4DHV A;  9ATC B;  1VC5 A;  1KOH A;  1WSV A;  3N4W A;  4ZP6 A;  5C24 B;  4OMF G;  2MYF A;  2FJW A;  1HBU A;  3OTD A;  3OPK A;  2F5G A;  1CVJ A;  3ET6 B;  4YR0 A;  4F26 A;  2PGC A;  1I3O B;  2YPZ A;  3DRR B;  4RPF A;  3FQK A;  1HYS A;  1VRT B;  3EUN A;  4USW A;  2J7W A;  4ZJQ A;  1QLN A;  5KFS A;  1WOO A;  2MZJ A;  1D0E A;  1S9G B;  1HLW A;  2DVI A;  1B7Y B;  3SCK E;  3PEH A;  5J2M A;  4B9U A;  1UVN A;  2KYX A;  2DT9 A;  2OML A;  2PT0 A;  2AJQ A;  2EC2 A;  2VFV A;  3HD1 A;  5DDQ C;  1TK8 A;  2KM8 B;  4P75 A;  2CNN B;  4F67 A;  3M8S A;  3RAX A;  3MAA B;  3GIR A;  2H51 B;  1B0T A;  4WFY A;  2IDL A;  5D0G A;  2OTL S;  1GXT A;  3DRS B;  4RUA A;  1U1P A;  3OR1 B;  4RUC A;  2YNI B;  2H5I B;  4NLR A;  1S7H A;  3PIP Q;  5A8W B;  2JRS A;  2NXU A;  3TAP A;  1K9M T;  2BAC A;  4DX8 H;  5ETT A;  3I0S A;  2HNY A;  1S48 A;  1U2C A;  1F3F A;  3VF0 B;  3W2V B;  4DZD A;  2R7O A;  4Y34 A;  4DU7 A;  4YDX A;  1URR A;  5AXN A;  3WQP A;  4X4S A;  2CQD A;  4J9R A;  1Q16 B;  1VQY A;  1LK5 A;  1UAW A;  4HAC A;  2NXC A;  1KBR A;  3IAS 9;  4C8N A;  5F3T A;  4JI2 F;  1SQG A;  4IQX A;  2L9N A;  3BGO P;  4OHZ A;  3PTW A;  5H9E K;  1U26 A;  2KRR A;  2J0X A;  2AU0 A;  5K5M A;  2BOA A;  4RU9 A;  2R8I A;  2B4P A;  4OHY A;  5D15 A;  3GIK A;  2B56 A;  5I4M A;  4KFB B;  4L3N A;  1NO8 A;  4MMO A;  4OJ3 A;  2JNJ A;  2BXJ A;  5A2Q Y;  2VG6 A;  3MMJ A;  4XPE A;  5L38 A;  3RAM A;  2GW8 A;  2B4U A;  2ZE2 B;  2BEF A;  3H98 A;  1FNM A;  3OXG A;  4IR9 A;  3R6L B;  1UPM B;  4K7Q A;  1CBK A;  4CH1 A;  1NDP A;  1MWZ A;  3Q2T C;  2ZKU A;  4DR5 F;  2ATL A;  1U7L A;  3IXQ A;  3K2Y A;  3BJY A;  4NA1 A;  2YBV A;  1XNR J;  4MKV A;  4Y0F A;  1GNK A;  2QFJ A;  3MM9 B;  1NK6 A;  3BS9 A;  1WEL A;  4K4U A;  2CPZ A;  2XBP A;  2NQP A;  3CXC R;  2PSZ A;  1H98 A;  2MQM A;  4TQS A;  2R7S A;  2FLO A;  2XNQ A;  1RA7 A;  1HHS A;  4NLP A;  5HQM A;  3NGR A;  6FD1 A;  4C97 A;  2QA4 G;  2CJX B;  3F0N A;  1TL3 A;  3RYL A;  5F0U A;  1R27 B;  4AND A;  4PR6 A;  4X64 J;  4NZ7 A;  2L08 A;  5H9F K;  2ZD1 A;  2RSQ A;  3J7A N;  3T1H J;  1LWF B;  4CTA A;  2DNZ A;  1HD1 A;  2IYI A;  1RT7 B;  3V81 A;  1HI0 P;  4RW7 A;  1JWW A;  3OLB A;  3MCO A;  3QO9 A;  3BN4 A;  2ZWP A;  1NSQ A;  2P6S A;  3M9N B;  3TR5 A;  4RUB A;  4ZVF A;  4QR1 A;  3K5P A;  1OY6 A;  3D28 A;  2Z30 B;  4I2Q B;  1UWA A;  2HAF A;  4EBE A;  3D0H E;  3HSD A;  5HN0 A;  1IBM F;  1V3Z A;  2BAN B;  4DUZ F;  2MZ1 A;  1A0O B;  3M6X A;  2DNO A;  2OGU A;  3FZ2 A;  1J5O B;  4LF1 A;  3OTO J;  1VBY A;  2VQE J;  1B0V A;  1U2R A;  5KFG A;  5C25 A;  1DTQ A;  2CJK A;  4ZP9 A;  5HQ8 A;  4KYZ A;  3P96 A;  3PJ9 A;  1H74 A;  4C4W A;  2BE2 A;  2YWW A;  3M30 A;  2IMO A;  1RAE B;  4ED3 A;  1GX6 A;  3MXH P;  2D9O A;  2GGP B;  2BJ9 A;  2BZ2 A;  3CCE S;  2BRL A;  3M2R A;  3K8W A;  4ECT A;  1S9E B;  1RWN B;  2QN6 B;  2W4D A;  4ZK7 M;  2EK1 A;  3CCQ S;  2DR8 A;  4QYZ K;  2AQ4 A;  3NGS A;  2COL A;  2RHQ B;  3PY8 A;  2BQ3 A;  1R31 A;  1S9F A;  4Q8F A;  3SCJ E;  2C2D A;  1U09 A;  1Q7Y T;  2W4P A;  4ED4 A;  4OX9 J;  4X84 A;  2GVZ B;  5BXI A;  2F8H A;  3TA0 A;  2DHX A;  1VIO A;  4OYP A;  1IM6 A;  2HQ3 A;  2ZDO A;  4KHR A;  4KIA A;  3C16 A;  2BDP A;  2HNZ A;  1U1O A;  5KFY A;  2E66 A;  3HHD A;  2XYH B;  3FUY A;  2B7B B;  5KFR A;  4N41 A;  4OJH A;  2ROP A;  2GNK A;  1IKV B;  2ZZN A;  1GK8 A;  3A1Y G;  3VVT A;  5MAO A;  5LSR A;  3MR3 A;  4ECW A;  2IM2 A;  1HQU B;  4PXE A;  3H40 A;  3DOL B;  2UU9 J;  1HWJ A;  2HVH A;  2HHU A;  5KG4 A;  3DOM B;  4J9U E;  3MED B;  4PG5 A;  5BYQ A;  4HH0 A;  1EJ7 L;  3THV A;  3CME S;  3RGI A;  2Z57 B;  1FTR A;  5IFM A;  1PAE X;  2GIF A;  4FZV A;  3EWG A;  4K4X A;  5EWE A;  2VC1 A;  1IQT A;  3VR1 A;  3W9J A;  3NNC A;  3AXK A;  2KJV A;  4DSJ A;  2AP6 A;  4B08 A;  3WX8 A;  3U1M A;  3UE2 A;  3CD7 A;  4PG7 A;  3O1L A;  3OTE A;  4URS A;  1WKK A;  2ZM6 J;  3QZ7 A;  3RB3 A;  3QLH A;  3W3S A;  1CLF A;  3CD5 A;  1HBM B;  1HHT P;  3QJJ A;  4ICL A;  3M8Y A;  1NB2 A;  1J5E J;  4C9D A;  3EXC X;  2HW3 A;  3LAN A;  2GFF A;  1XNR F;  2ABY A;  5HJY A;  4M5J A;  3R5A A;  4ANE A;  4QWC A;  4LF9 J;  4DQS A;  1OQ3 A;  4H4K C;  4PWU A;  3ZZR A;  4OHX A;  4X4O A;  1JLQ A;  4GO5 X;  3BSN A;  3CCW A;  4DWI A;  2IIH A;  1XTZ A;  1DLO A;  2ZVS A;  3KLF A;  5J2N B;  3J80 U;  5A0Y A;  1JLE B;  2ZOG A;  4PUO B;  2OO4 A;  4A8Q A;  3PNI A;  4UY8 T;  3QGG A;  1HD0 A;  3HSJ A;  4X64 F;  1TFW A;  4DQR A;  2AV5 A;  2O67 A;  4Y2C A;  3NL0 A;  1CPZ A;  3T1H F;  1KLN A;  3MR2 A;  1KWM A;  2HBY B;  4HHH A;  2ACM A;  1FNO A;  4LFA J;  1JKH A;  3OVA A;  2DY1 A;  1RZM A;  3RW7 A;  1ARO P;  2BKP A;  4YB7 A;  5FDL B;  3PYE A;  2HQC A;  1D9F A;  3WX4 A;  4ED7 A;  3SYZ A;  1RWW B;  3R7S B;  4ZVU B;  4NXN J;  2OLW A;  1IKX B;  2DHA A;  1TAQ A;  1MRO A;  2C3M A;  3MM5 A;  1IWA A;  3R6G B;  2IC3 B;  2XSJ A;  2CQC A;  3MD3 A;  3C6U B;  5C24 A;  4QPT A;  3QSI A;  3VAF A;  1TAU A;  4ELU A;  3KHG A;  2R7U A;  4NYP A;  3DLB A;  3DDI A;  3DLE B;  3CO9 A;  2HHV A;  2CDQ A;  1VGY A;  4TYA A;  3GIL A;  1EB0 A;  3OTO F;  5KFF A;  4P74 A;  3G6E S;  1SV5 B;  5D0R A;  3O5T B;  1XWL A;  2I2Y A;  1FVQ A;  2B6A B;  4MKY A;  2YWK A;  4NI2 A;  2HND B;  3OQ2 A;  3VZH A;  3IG1 A;  4FKX A;  1K73 T;  2BJD A;  1NJI T;  1JQG A;  2WOM B;  2J6T A;  4ZLL A;  2VG5 B;  1IKY A;  2MJU A;  1RWX B;  1D9A A;  1CUL B;  3MAA A;  4B9N A;  3BKU A;  4MIB A;  2DGX A;  2W9B A;  3B82 A;  4LSZ B;  2W7O A;  3LPY A;  5CYM B;  3TUJ C;  2CPE A;  2YNI A;  2X3D A;  2HGN A;  5A8W A;  2LU1 A;  2P5V A;  2YNG B;  4KE5 A;  4OI6 A;  4URQ U;  4I67 A;  2QV6 A;  4O44 A;  1SIZ A;  1RAJ A;  2YNH B;  1HBN B;  5JJB A;  4OX9 F;  1X4D A;  2A0F B;  3UDC A;  3D1O A;  4LIW A;  3LA0 A;  2CA9 A;  2GMH A;  4ED1 A;  1C1C B;  4PQU B;  1IWG A;  1W2B R;  4K4V A;  2DIV A;  2OPP A;  3C8Y A;  5BJR A;  3KTQ A;  1FRK A;  3EXY A;  5KFD A;  3UO0 A;  3UQS A;  1FK9 A;  2GVD A;  2IBK A;  2L9D A;  4UST A;  1G3O A;  2XMA A;  3EX7 B;  3F73 A;  4OV6 A;  1SI9 A;  1NKB A;  1FX2 A;  3A13 A;  5AE2 A;  5CXT A;  2K2P A;  3LAM A;  1KVJ A;  1YI2 S;  4M5N A;  1AB8 A;  2M2B A;  2I5J B;  2KB2 A;  2ZJR Q;  2UU9 F;  3LPE A;  1R8H A;  1QAI A;  2KZM A;  4EZ9 A;  2GQ2 A;  1TR0 A;  3L7P A;  4C6A A;  2LEB A;  1FKA F;  4U8V A;  2Z2Z A;  1RT4 B;  1R43 A;  4MAK A;  1RT3 B;  4KO0 B;  3MFI A;  1WOR A;  3ZNJ 1;  2D3U A;  3IGN A;  1WEZ A;  1Z1Z A;  1HNV B;  1T3N A;  2MKC A;  2QLX A;  4DSI A;  2B5J B;  4NLQ A;  1UET A;  5G0R A;  2RT3 A;  1RAB B;  4DV2 J;  1UFW A;  4Y00 A;  3Q24 A;  2JX2 A;  4IRC A;  3TVY A;  4C48 A;  4P7V A;  2HMI B;  4FBU A;  3AXM A;  1WEX A;  5SUH A;  3IR5 B;  2J0S D;  1RTZ A;  3H2V E;  4F3O A;  1GXL A;  3TI0 A;  1LQ9 A;  2ZM6 F;  2F8M A;  4LRB A;  4KGX B;  1IM4 A;  3NCQ A;  4KKO A;  4LBH A;  4U67 Q;  1X5T A;  2QZ8 A;  1NHU A;  1J5E F;  3GPA A;  3NMR A;  2ROE A;  5B0B A;  4O3S A;  4LF9 F;  2BYC A;  1U1L A;  2VFU A;  1H2T Z;  4DX6 A;  2CNL B;  1FX4 A;  1I1G A;  3WIU A;  3BSC A;  1J27 A;  5KT3 A;  4Y2K A;  1TVR B;  3CF5 Q;  2AEM A;  3FQL A;  2VPY B;  3OTB A;  1NUE A;  2X1G A;  2YKO A;  4WP8 A;  2F9J A;  2DXD A;  1JJ4 A;  2HYI B;  4USJ C;  3B8H A;  1N5S A;  4X4Q A;  2JOQ A;  3AB4 B;  2WAQ D;  3FC9 A;  1X9S A;  1N52 B;  4BHQ A;  1YRX A;  2ZBQ A;  4LFA F;  1PSD A;  2K1R B;  4F3M A;  4Y2I A;  4UQG A;  1I94 J;  4TLR A;  4YR3 A;  1IN0 A;  2MHN A;  2MLX A;  4NEZ A;  2VU5 A;  4F0H A;  4J9Q A;  3KK2 B;  5LMN J;  3UNY A;  4GVL A;  3QFH A;  3H59 A;  4NXN F;  1F2G A;  3W5Y A;  4DPO A;  1J5O A;  3G6X A;  1L3T A;  3R5B A;  4ED0 A;  3KG1 A;  3LWM A;  2BJ7 A;  1QE1 A;  1FDD A;  2OI2 A;  4IFY B;  2NR0 A;  3R8Y A;  1JJ2 R;  2GHV C;  3IM9 A;  2H3E B;  2FJV A;  3VTI A;  3KJQ B;  3M2U A;  2YWG A;  5B09 A;  1UJ6 A;  1GTH A;  3HHL C;  1TKZ B;  2GGP A;  4KHP J;  4C3M A;  1VQL S;  5K14 B;  3MM8 A;  2B9Y A;  5E3C A;  3RAQ A;  4X4T A;  4JV0 A;  2VV5 A;  5HMZ A;  5HP1 A;  1AUS L;  3KLG B;  3HXM A;  4N8O A;  4ECY A;  4B17 A;  4X66 J;  3EGZ A;  4YUD A;  3C3L A;  1IJE B;  5IT0 A;  3CVK A;  3EZ5 A;  3HCX A;  5I3P A;  1S5Z A;  3PR4 A;  1E6V B;  2DO0 A;  1VRU B;  2IAJ B;  2G0J A;  1Q7L B;  1T9U A;  4IRD A;  4ECR A;  3I55 S;  3K8V A;  3SXL A;  2EC0 A;  2FLL A;  3J81 Y;  2GVZ A;  3E01 B;  2HQG A;  4LSL B;  3W63 A;  5DG9 A;  1Q5V A;  3KG4 A;  1KN6 A;  2E9Z A;  1PJ6 A;  3CPW R;  1FFW B;  3HLU A;  2HVZ A;  2J0W A;  5D0E A;  5A8K B;  3JAM Y;  1GEH A;  3GFX A;  4ES2 A;  1AZS A;  5J1N A;  3VAM A;  5GAD U;  4DDF A;  2X1F A;  5DG7 A;  1YK9 A;  2HIY A;  1HQU A;  4ZJO A;  1YJ7 A;  3C2P A;  1WG1 A;  5CCM A;  4K59 A;  4UQT A;  3UDE A;  2BMB A;  1F9F A;  1G4C A;  3DOM A;  1K1Q A;  3IMQ J;  2CNO B;  2DR9 A;  2JLG A;  4XTT A;  2RRN A;  3VAL A;  3AY0 A;  4OV1 A;  2IA6 A;  1RWV B;  5T41 A;  2EW9 A;  1FXR A;  2X7I A;  1NZ8 A;  2KI2 A;  2VA2 A;  4WJB A;  2EFQ A;  3V2U C;  2JEI A;  3A8I A;  2BKO A;  1YJ9 S;  3W8P A;  2BA9 A;  2YX7 A;  2MKH A;  1VFJ A;  2KVI A;  4YY3 J;  1FKO B;  1HBM A;  2E29 A;  3PRV A;  3Q89 A;  3RBZ A;  2KT5 A;  4R5P A;  3FCW A;  2D7S A;  5KFQ A;  2EXU A;  1YJU A;  4G3I A;  3EGV A;  4DV2 F;  2OKQ A;  4Q0B B;  1AFI A;  2NPF A;  4USH A;  3CCT A;  2CPY A;  2JVR A;  3C46 A;  1T9T A;  2FPH X;  1OMS A;  5L1K A;  1YIJ S;  2XB2 D;  5IT9 Y;  3N28 A;  2C2R A;  4ZCK A;  1UP1 A;  2XWY A;  2VJU A;  5J2N A;  1JLE A;  5BR8 J;  2CJQ A;  2V50 A;  2EEY A;  5KFP A;  1OPI A;  1RT5 A;  4I68 A;  2N4D A;  4KH1 B;  5DJB A;  3N5F A;  4CIO A;  4IG3 B;  5KFA A;  4OX8 A;  4OZ1 A;  4IH7 A;  4X4R A;  3MEC B;  1FJC A;  4A8S A;  2IJN A;  1AA1 B;  3ELH A;  3SEO A;  5ETQ A;  2W2M P;  3K0J A;  2G0C A;  5FDL A;  4WIQ A;  3VAG A;  3NXZ A;  2HHW A;  1PIE A;  1UFK A;  3SCI E;  1U8W A;  2PEB A;  1JXL A;  3D68 A;  3TWZ A;  4C3K A;  1S4F A;  2IC3 A;  4LRA A;  2ZBC A;  4B9S A;  3SQO P;  2R7Q A;  1NAQ A;  4HHJ A;  3EVO A;  1I94 F;  1MWQ A;  4ID8 A;  2BAB A;  2N7C A;  4H4O A;  2EI5 A;  4OZ0 A;  5LMN F;  3PX0 A;  3PJX A;  4H4M B;  3ETM A;  1S59 A;  1WF2 A;  5K8N A;  2QYC A;  3NBP B;  3O44 A;  1HWK A;  4AMM A;  4MKB A;  3M2V B;  3BM7 A;  2GMJ A;  4YP3 A;  2WOM A;  5I42 A;  4F02 A;  2FVS A;  4P10 A;  2LKZ A;  4KHP F;  4TY9 A;  1U1R A;  4F7V A;  2HG4 A;  1CUL A;  1MN9 A;  2X1A A;  1U24 A;  1PYO B;  1K1S A;  2AIR B;  3CO0 P;  3V6K A;  1U8S A;  2BRK A;  1HWU A;  1XQI A;  2G0I A;  2QG9 B;  1VMB A;  1TZ0 A;  4YOE A;  3OR2 B;  4X66 F;  3MM6 B;  5E3R A;  2ZHA A;  4NA3 A;  3QT7 A;  2Q66 A;  4YN3 B;  2R8G A;  4DQI A;  4Q2M A;  4NLY A;  2MZQ A;  3KDO A;  2E7X A;  4LMZ A;  3TAM B;  3CJK A;  3HHK A;  2RF2 A;  3LGN A;  4ZLJ A;  3U1L A;  2UXB J;  2K3K A;  5KFJ A;  3JYT B;  1HBN A;  2E7W A;  5HMX A;  3JSM B;  2QLB B;  1S1T A;  5IS2 A;  3JQK A;  1NXI A;  3NOG A;  2MGZ B;  3KOA A;  4D3H A;  5LXY A;  1RAF B;  2VBW A;  2OP5 A;  3TAQ A;  1ZM9 A;  1BQN A;  2OEJ A;  4BC9 A;  4USI A;  1EP4 A;  2V8G A;  1F9H A;  1RLC L;  4IH5 A;  4KGM A;  4RBV A;  1T9X A;  2C2K B;  1SBR A;  3O2I A;  1O8B A;  2E1P A;  3A8K A;  2DR5 A;  1QY7 A;  3HUL A;  4ZS6 A;  2QGF B;  3ZO7 A;  4WCE Q;  3GQC A;  5L46 A;  2EPI A;  5MLC V;  2I5J A;  3KG0 A;  4IR1 A;  2BQU A;  4I6W A;  1ROF A;  2VQF J;  2VL1 A;  1NKE A;  3OXF A;  1TKD A;  1FER A;  3DN9 A;  3R7N B;  2XGP A;  3LGM A;  1RT3 A;  4KO0 A;  3BV8 A;  2J8S A;  1QVF R;  2OD4 A;  3O6Q A;  2BJ1 A;  3BH7 B;  3PW0 A;  1UPP A;  3DDK A;  3CUN A;  3L4B C;  3ZZO A;  4DU8 A;  2Z8Q A;  2AMC B;  1IBC B;  3DLK A;  1N33 J;  1L3U A;  4DV7 J;  5KG7 A;  1OY9 A;  3HPO A;  1FJG J;  1RTH B;  3WC2 A;  2ZH7 A;  4PQA A;  3G8S A;  1Z2Z A;  4R0J A;  2BW7 A;  4NLV A;  1LWE B;  4YY3 F;  4Q43 A;  3CDA A;  2QX0 A;  2YX1 A;  3NOC A;  1S79 A;  5C2G A;  1TKT A;  3P6Y C;  1FJ7 A;  2HIQ A;  4RNH A;  5HQL A;  2OPQ B;  2AKW B;  1VQ9 S;  3DDN A;  1X5S A;  2KFZ A;  3TZW A;  3CIZ A;  1R8C A;  3C15 A;  5DDO C;  2OUG A;  1LNQ A;  4QIV A;  4QOT A;  1VQO S;  3U1N A;  5CD4 H;  1JLA B;  5E7O B;  3BGR A;  2H4Y B;  3SFG A;  3PO5 A;  1C0U B;  1FXD A;  5EDW A;  2N3O A;  1KC8 T;  4ECS A;  2DHH A;  6AT1 B;  5BR8 F;  4RL1 A;  2CQH A;  3QAU A;  2DGT A;  3J7Z T;  4FF4 A;  1RUS A;  3CDE A;  1HPZ A;  5HI7 A;  4L73 A;  2KT2 A;  2VPX B;  1VQ6 S;  2ZNY A;  3GYX B;  1VQN S;  5L1I A;  1S1W B;  2DNY A;  1KEK A;  4FXV A;  2J9D E;  3HJV A;  1TMM A;  4ERD A;  3G9C A;  2J7K A;  2K1R A;  3QMQ A;  1B70 B;  2KN4 A;  2ILZ A;  4EI2 A;  5D78 A;  4LRE A;  2FIU A;  3NLC A;  1Y5I B;  2FC9 A;  1Y9O A;  3EGW B;  2HRY A;  1RKI A;  4G65 A;  2R8H A;  5CZV A;  1CJV B;  2XZD B;  2QO3 A;  2FZK B;  1NHK L;  1P9Q C;  4CZC A;  2HFZ A;  3M8W A;  1SQF A;  3ZTO A;  2MDA A;  5E2Q A;  2WVB A;  4ECX A;  4J9K A;  2GS8 A;  2CJY B;  4ZPB A;  1Q81 T;  5J2Q A;  2CZ9 A;  3QGP A;  5K14 A;  2W9C B;  4DR4 J;  3MMA A;  1IR2 A;  4ES3 A;  1CS4 B;  2CFX A;  1EKR A;  3V5R A;  5HLF B;  2V8P A;  2E44 A;  3KLG A;  2DGQ A;  2A6O A;  3NNA A;  4BC7 A;  1FA0 A;  1B4S A;  5ETP A;  4PG4 A;  2ROG A;  1U6F A;  3LOU A;  4LBI A;  1Q78 A;  1E6V A;  2HHP A;  2IAJ A;  3BRE A;  4UOH A;  4ZPA A;  4HT7 A;  1T11 A;  1KSP A;  5FLX Y;  3I4P A;  2HQD A;  2A6M A;  5J1E A;  3E01 A;  3RUB L;  3CIM A;  4LSL A;  3D67 A;  5D3G B;  2HFN A;  5T7L B;  3EPG A;  4LQ9 A;  3KUH A;  2ZUG A;  2RQ4 A;  2N4C A;  3MM7 B;  1NM2 A;  2WK4 A;  4ZPT R;  1UVK A;  1NK9 A;  2MLY A;  4FKY A;  2V8D A;  4QR2 A;  5A8K A;  2KU7 A;  1K44 A;  1SXL A;  3RBX A;  1TP7 A;  4OI1 A;  2V2V A;  3GMG A;  2UXB F;  4LIR A;  1NK4 A;  3G71 S;  2JDJ A;  2XM3 A;  1IJF B;  1QUV A;  3I0R A;  5IQQ A;  2MST A;  1HI8 A;  1FVS A;  2OTJ S;  3IBC B;  2XCP A;  3I5A A;  2DIS A;  2HVE A;  1N5Y A;  2FC8 A;  5KFL A;  3R1H A;  1JNZ B;  2GQQ A;  2XG8 A;  1SCJ B;  3BBF A;  2KG0 A;  2GJI A;  4HYK A;  3V6J A;  2KYZ A;  2P6T A;  5FJ4 A;  1BHN A;  2AYB A;  2VQF F;  2QA4 S;  3CJ5 A;  3JS9 A;  1SKR A;  2QMW A;  3Q8U A;  3GJT B;  2LXU A;  1MU2 A;  2P9C A;  4NLG A;  2HHS A;  1KRP A;  2XQC A;  2HLT A;  3ITH A;  4F36 A;  1FKO A;  3DKD A;  3LF0 A;  4R8U A;  4CLL A;  3MOJ B;  3MD1 A;  4EK2 A;  1ZZF A;  2DNR A;  4G6V B;  2QT7 A;  1N33 F;  4YB1 P;  4DV7 F;  2EFP A;  4Y2A A;  4P71 A;  4ALZ A;  4Q0B A;  1FJG F;  4LRD A;  1FF2 A;  2CDR B;  2WB4 A;  4N77 A;  2QMU B;  3ZC4 A;  1F9E B;  5M2U A;  2P2C B;  1KLM B;  1R6V A;  1PC5 A;  3EM1 A;  4B3S J;  1RSC A;  2Q43 A;  1S6U A;  3L7U A;  2E7V A;  3R5G A;  5HBM B;  3G82 B;  2IM1 A;  2W01 A;  4IO9 Q;  3JB9 k;  4LRF A;  4PXC A;  4FDF A;  3R2D J;  2I9S A;  3M1V B;  2JH3 A;  3QWU A;  2B7C B;  3ETO A;  1V5V A;  1VHF A;  4C7Q A;  1CG2 A;  1HBU B;  3UR0 A;  1SL2 A;  3FCH A;  1BUX A;  3D54 A;  3HVR A;  4UW2 A;  4BCA A;  5CZD A;  2QLJ B;  3PX4 A;  4GKK J;  3R5J B;  4F8R A;  4HTJ A;  2F1F A;  4M5M A;  5ETK A;  3BR8 A;  3OFE A;  5KFE A;  3U02 A;  3QFW A;  1Y5N B;  1ZET A;  4DF4 A;  2RQM A;  1HBO B;  3E51 A;  3OHB A;  2DIT A;  1UJ4 A;  3TA1 A;  4HVZ A;  5KT2 A;  1PYS B;  4ER8 A;  4ZVR B;  1FNX H;  2FD2 A;  3I96 A;  3HO1 A;  4I4B A;  1H0H B;  1X5P A;  1Y4Z B;  2X3G A;  4IG0 B;  1NJY A;  3R2C J;  5HO4 A;  1DUR A;  1RWP B;  3ISN C;  1H7X A;  4AUK A;  2F7V A;  2VFR A;  5EHH A;  5A2Q U;  3CCR S;  1VC0 A;  2GO9 A;  4QIE A;  4EWT A;  2NUH A;  2HRU A;  1CC8 A;  2J9C A;  5DM7 Q;  1KR4 A;  3VCD A;  4IO1 A;  2MY8 A;  4WYW A;  3R9L A;  1XR7 A;  3NBP A;  5HVF A;  3D6H B;  3I0S B;  4J91 A;  3QAE A;  1S72 S;  2B9X A;  4DR4 F;  4A8W A;  3W8G A;  4Z2X A;  3NS5 A;  4HAC B;  4W4M A;  3PAC A;  2LQ9 A;  1LK7 A;  4FPI A;  3OR2 A;  4ELT A;  4EMD A;  2HHQ A;  5ETO A;  3ZTQ A;  1BLU A;  4ZCL A;  1KHW A;  1TKX B;  4HLB A;  1PC4 A;  3PFO A;  3QGI A;  1BQM B;  3EVW A;  3TAM A;  5D4L A;  3RRG A;  3TVK A;  2AZ1 A;  3MI7 X;  3JYT A;  4N56 A;  3CED A;  3LAK A;  2ZH5 A;  1D09 B;  2VG6 B;  5T14 A;  1RHM B;  2DB1 A;  3UCZ P;  4LQ3 A;  3DM2 B;  3ONQ A;  4J9L A;  2YKQ A;  4NE9 C;  3HVT A;  3EZO A;  4NLO A;  1ZBT A;  5IOL A;  2VOD A;  3NRB A;  4B9V A;  2VBZ A;  4TLQ A;  3D6M B;  4QW8 A;  4CLZ A;  1BXN A;  1S49 A;  2UUA J;  4WBF A;  1OJ4 A;  4MK8 A;  2FJB B;  4DV0 J;  1GMV A;  1NJZ A;  4G1Q B;  2CAJ A;  4TNO A;  1HR0 J;  1S1U B;  2KXF A;  3LAL A;  3J81 j;  4MFB B;  4U9R A;  2VHG A;  2ZWO A;  4F2S A;  2MKY A;  1CJU B;  1NH8 A;  4O3Q A;  3D7S B;  2OSQ A;  1NK8 A;  2XTJ P;  4YEA A;  2GIR A;  2PEH A;  3CC7 S;  4DR7 J;  4CO0 A;  3OVB A;  1D9D A;  4KPC A;  4DN0 A;  1SC6 A;  3IP0 A;  1H6K X;  3PXG a;  4OHV A;  1R8A A;  3DHX A;  2CG4 A;  2K3I A;  1RK8 A;  2V4R A;  3BSA A;  1S57 A;  2Z2Y B;  1MNE A;  2VOP A;  4ZLP A;  4HEA 9;  3JSY A;  4WE1 B;  3VAH A;  4RW7 B;  1DQ9 A;  1D8Z A;  2GHP A;  1QSY A;  1V9O A;  1EAR A;  1FRX A;  1HAR A;  1NND A;  2JEG A;  1S0M A;  1BE4 A;  3LP1 A;  1HMV B;  4M5I A;  1VQS A;  3WZ0 A;  2RJZ A;  2HLU A;  1JJC B;  4DFK A;  3ENQ A;  1KDN A;  1T02 A;  1H7W A;  2V63 A;  3GFY A;  3UI3 A;  4DJB A;  4ECV A;  1G2E A;  2J6S A;  1JLA A;  5JUM A;  1ZAW A;  1RQ0 A;  4B3S F;  2CPH A;  1C0U A;  2FVQ A;  2AJ2 A;  3POT B;  3C6T A;  2OD6 A;  2ZH1 A;  3BBB A;  1MG7 A;  2HS3 A;  2VON A;  3BKT A;  2IMW P;  4Y3C A;  4DX5 A;  3AAW B;  1TL5 A;  4B3O B;  2CPF A;  2Z4P A;  4FS1 A;  5C25 B;  2QEX S;  2XS7 A;  4K4T A;  4OYZ A;  1FRM A;  4CI0 B;  2ZEJ A;  4Y65 A;  3K7R A;  2MKK A;  4DN9 A;  3VGT A;  4LJM A;  2BE2 B;  3SFU A;  1F3V A;  3BDE A;  4GKK F;  3M8P A;  1NRK A;  4KQZ A;  2XS2 A;  1YBU A;  3M7V A;  4RR5 A;  1BY9 A;  3M2R B;  2RS2 A;  3CJR A;  4CLS A;  2DNM A;  2J0Q D;  2EG2 A;  3LWL A;  3WC0 A;  2DNG A;  1VDH A;  2R8K A;  2WVD A;  2ZBI A;  4HT5 A;  1Q95 G;  2ZFH A;  4EBD A;  1M1K T;  2XHC A;  5B0C A;  5LSL A;  4FNH A;  5AE3 A;  3QT6 A;  2CZ4 A;  3PR5 B;  4HL9 A;  1KVI A;  4F4Y A;  2MLZ A;  2M52 A;  4LF2 A;  1D1U A;  2CQB A;  2ZIT A;  3CJQ A;  4WP9 A;  2RDI A;  3LGH A;  2QA1 A;  3W9H A;  4ZN3 A;  4OLP A;  1EAY C;  3TAR A;  2ZDP A;  4C0O C;  3FMB A;  2RIL A;  2RQK A;  1FD2 A;  3GSD A;  2CNK B;  4K50 A;  2GA7 A;  2VDH A;  5IWA J;  1Y0H A;  2E1C A;  3QIP A;  3TJA A;  3FNN A;  3M05 A;  3AJ2 A;  1S97 A;  4LFB J;  4N7T A;  3OJS A;  2HAI A;  3K57 A;  5D3G A;  4JV2 A;  3D0G E;  4V1A k;  4A48 A;  5EUH A;  2FY1 A;  3FK4 A;  2LXI A;  1QD1 A;  1TU0 B;  4ECZ A;  1I5O B;  4ETZ A;  1IUJ A;  3GSI A;  1S1X B;  3LP0 B;  1NKC A;  4XDC A;  1AXQ A;  1EQM A;  1UA0 A;  3EMT A;  2H65 B;  3EGN A;  1OO0 B;  3NNH A;  3CCU S;  1NB7 A;  3DLH A;  1JJH A;  3GLJ A;  2HZC A;  2XLI A;  1JLF A;  3KXD A;  2V0N A;  3CC4 S;  4A8K A;  2O66 A;  3KHH A;  2V34 A;  2FJD B;  4O4G B;  4JOU A;  2JEJ A;  1M90 T;  3DCA A;  1R0C B;  2XMM A;  3W62 A;  2IRU A;  2UUA F;  1OYD A;  1R8B A;  3MWB A;  4DV0 F;  3FFI B;  3TUI C;  4JI8 J;  4ENO A;  1JMT A;  1HR0 F;  3EZU A;  5H1S V;  2DRA A;  2D3O 1;  1JLQ B;  1V5I B;  5F0W A;  2GC8 A;  4DV3 J;  1WJ9 A;  3QT5 A;  1SL0 A;  1VBX A;  4X4V A;  1RHJ B;  3KLF B;  2ZJQ Q;  3K58 A;  1MMN A;  3BO3 A;  1Q82 T;  1Q8K A;  4P7T A;  1U6B A;  4DR7 F;  2MY7 A;  2K7J A;  1P6T A;  2GV1 A;  2UVR A;  4CLY A;  2JFK A;  4ZPD A;  2UXD J;  1RTJ B;  4J37 A;  5B0E A;  3PRB A;  1ZS6 A;  1T7P A;  1VQ7 S;  4JI5 J;  3CCZ A;  3FDS A;  5KFV A;  2LEP A;  2LFV A;  3UD3 P;  3OUY A;  2SXL A;  1ZA2 B;  2CJA A;  2FLN A;  3UD4 P;  3TJ8 A;  2ZH9 A;  3HHL A;  4DX7 A;  2CQ3 A;  3OV7 A;  2HBR B;  1LFW A;  1MRO B;  3IRX A;  2XSJ B;  2EKY A;  1MSW D;  5DLG A;  2QJ3 A;  2E5I A;  3W9I A;  2N3L A;  2A2C A;  3VWS A;  4ECQ A;  1QSS A;  2DCL A;  3BB5 A;  4DOZ A;  4W90 B;  1U1Q A;  3J7Y U;  1LFP A;  2E1R A;  1QUP A;  2XY5 A;  3EPI A;  3GCW P;  4O3R A;  2VZ8 A;  2GO8 A;  3NGT A;  1HBO A;  2DNL A;  3MMB B;  3RRH A;  4NI2 B;  5F9L A;  3BPS P;  3IG1 B;  2O1P A;  3ZZU A;  3D9B A;  3NGK A;  2VC0 A;  1Y3K A;  3CJ4 A;  3OL7 A;  2RUG A;  2C3Y A;  1FDA A;  3W5Z A;  1J2V A;  2DNP A;  3AD9 C;  5THW A;  4IG0 A;  1IKY B;  3JSB A;  1GT8 A;  3KWM A;  4PXB A;  4P72 A;  2HBZ B;  3H5X A;  4PAA A;  2W9B B;  4C2M A;  1U0H B;  1Y10 A;  3KJN B;  4CRJ A;  5IC4 B;  2OPS B;  2E5H A;  3BZQ A;  4XPC A;  1TUV A;  1M1G A;  3MGJ A;  1DTT B;  4FF1 A;  3UN3 A;  4O44 B;  2FZC B;  5CA5 A;  1WDD A;  3NCP A;  4LF4 J;  4R25 A;  4C8M A;  4L76 A;  5AT1 B;  4MYU A;  3EDR B;  2W8L A;  4ZVG A;  1Y00 A;  2ZC4 A;  4FXW A;  2OPP B;  5LOQ A;  1XMO J;  4G1P A;  2H9Z A;  1X60 A;  2Y1R I;  3ZXW A;  1FK9 B;  2GVD B;  3R5C A;  5HMY A;  5D6G A;  4RW6 A;  1TKX A;  3T5J A;  1WEY A;  4HTI A;  3P3D A;  1BQM A;  5L39 A;  4DFM A;  2P9E A;  2XMU A;  4XIU A;  1DZ5 A;  5IWA F;  3GU0 A;  5L1L A;  4HDH A;  4JBC A;  4OX6 A;  4LFB F;  3GON A;  4MKA A;  2F63 A;  1VLO A;  2ZJP Q;  5CHC B;  3DM2 A;  2R2T A;  3IS9 B;  2VPW B;  1SVD A;  2PFF B;  1N5T A;  3Q0A A;  3L9Z A;  3KK3 A;  4PRF A;  3HHN B;  3BO4 A;  1UEU A;  4B9M A;  3RBD A;  1ZH5 A;  3UFC X;  5GMK a;  2KM8 C;  5G0R B;  3C66 A;  5E3A A;  4ITS A;  4G1Q A;  5AXK A;  4X4P A;  4RU2 A;  1QAX A;  1S1U A;  3VVU A;  1HL6 A;  2RML A;  4O23 A;  4MFB A;  3IBW A;  4FYX B;  3OHA A;  2ZHB A;  1CJU A;  1U6Z A;  4KKO B;  4JI7 J;  4KTQ A;  3CNQ P;  2RNE A;  1UMJ A;  2VZ9 A;  2VBY A;  4KB7 A;  2FVC A;  2N82 B;  1D3W A;  1WC3 A;  5ETR A;  4JI8 F;  3KUE A;  2BVZ A;  3IC1 A;  5GAE I;  2IDE A;  1XR6 A;  1HNW J;  4A8Y A;  1B0P A;  3MOZ A;  2IRX A;  3FRZ A;  5F8N A;  2VFS A;  4DV3 F;  2O5D A;  3RR7 A;  1C1B A;  1LKZ A;  1X8D A;  3KLE A;  8ATC B;  3BQ0 A;  4WE1 A;  5D77 A;  3CSK A;  2F9D A;  1Z4U A;  3GE9 A;  2PMZ D;  4IOC Q;  2FJA B;  2M8H A;  4O4R A;  2J5A A;  4JP8 A;  2UXD F;  2IA0 A;  1HMV A;  1EZZ B;  4WZM A;  2M0G B;  3TZY A;  3BQ2 A;  3D0I E;  4P2M A;  4FF2 A;  2NSB A;  4JI5 F;  4NZ0 A;  1RKJ A;  3KLI B;  1OYE A;  1RAC B;  1SH0 A;  1XC9 A;  1JLC B;  1P8G A;  2XC9 A;  3X1L B;  4O0I A;  4AXJ A;  3POT A;  2IJR A;  5JMN A;  4NYZ A;  3ILJ A;  2W2N P;  3J81 U;  1N34 J;  1BMQ B;  1S4E A;  3QWP A;  4V19 J;  1RWO B;  4LUB A;  1LV5 A;  1NSK L;  2ZVI A;  4B3O A;  2XMV A;  4DSF A;  1QE1 B;  1JB0 C;  1UVJ A;  1ZPW X;  3A8J A;  7AT1 B;  3JAM U;  2WW4 A;  2Z2M A;  3HFV A;  2ASJ A;  1VI7 A;  2HFV A;  4K2X A;  3NAH A;  2FHM A;  4DQP A;  1FRH A;  1NCL A;  3M2U B;  2H48 B;  3DXS X;  1N8R T;  2D74 B;  1UKU A;  4OYA A;  2MXY A;  1OQ6 A;  3MR5 A;  3MM8 B;  3BO2 A;  1I6J A;  2XGQ A;  1S0V A;  2VBX A;  7FDR A;  2G9O A;  3GYG A;  3C14 B;  5HP1 B;  1WC4 A;  1S6Q B;  4ID5 A;  3OBI A;  5IM0 A;  4EO6 A;  1PAU B;  2DIU A;  3TAN A;  5KTQ A;  4OJG A;  3OFF A;  3VQS A;  4QPX A;  2BUN A;  4NLT A;  1RLD A;  3UCG A;  1YKW A;  4DSK A;  3FBF A;  2M70 A;  1WG5 A;  3S1T A;  2IHR 1;  4CWB A;  2C3P A;  4DCJ B;  4YQW A;  1SJ1 A;  4AMO A;  3RU0 A;  3FJ2 A;  3FSY A;  2UXC J;  2MHE A;  1RTD A;  3OFH A;  2WBM A;  5JVH Q;  3DRY A;  2EFV A;  1RAA B;  5DDP C;  1HA1 A;  3NY0 A;  3MR6 A;  3S6E A;  1ZM4 A;  2M9K A;  3I56 S;  1AZS B;  1IVZ A;  1SKU B;  1JK9 B;  2JFD A;  3HM9 A;  2UV8 G;  2VG7 A;  1APS A;  4ZIV A;  4ES1 A;  1RYR A;  1LWX A;  4LF4 F;  3CJ2 A;  3HFK A;  3DI6 A;  3H5S A;  1SKS A;  2Z56 B;  1X4C A;  4K4Y A;  3CJ0 A;  3DXB A;  4PYA A;  2KXH A;  3H7H B;  4CLT A;  2PD1 A;  1XMO F;  2DEJ A;  2NZC A;  1RT2 B;  5IT9 U;  2KTQ A;  1JLB A;  2VJV A;  2LA6 A;  3AT1 B;  2C2M B;  5B0A A;  1WC1 A;  1HNI B;  3CMA S;  2W2Q P;  1R7I A;  3QPI A;  1S1X A;  3LP0 A;  2FB0 A;  3I32 A;  1S77 D;  1VIS A;  2VIC A;  4C8K A;  4CLF A;  3GFH A;  1RCO B;  2HHH J;  3UD5 A;  2BKN A;  1VQK S;  3NWR A;  4CM0 A;  2VKZ G;  1G7C B;  5HVG A;  2V2K A;  3HP6 A;  2GZO A;  5ETN A;  4ZVH A;  5RUB A;  2H4W B;  4USV A;  4DCO B;  4CH7 A;  3VGV A;  4O4G A;  2ZH2 A;  1WI6 A;  2CPD A;  2HFS A;  1DQA A;  2UUB J;  1RBA A;  4R5P B;  2WSC C;  5F8I A;  1Y3J A;  3KKF A;  2DNH A;  3FFI A;  3H4B A;  1QAJ A;  4JYA J;  2HWI A;  4P9S A;  3BF4 A;  3F44 A;  2J7U A;  4F50 A;  2DD8 S;  4N5S A;  4QU7 A;  2GJ2 A;  3HHL D;  1AW0 A;  1EIY B;  1MWY A;  2AF6 A;  1RBO B;  1N5Q A;  1S1V B;  2QSF A;  5KFH A;  2IYG A;  1PBU A;  4JI7 F;  1YVF A;  4KHM A;  3UPF A;  4OZ3 A;  4WP3 A;  2QC3 A;  2R7R A;  3V4I B;  1RT1 A;  2U1A A;  3MDF A;  2AT1 B;  2WSF C;  2XHW A;  4GKJ J;  2V9W A;  5JVG Q;  5IC6 B;  2ASD A;  2CJB A;  1RT5 B;  4MH8 A;  3ZNU A;  5B0D A;  3M8Z A;  2YKM A;  1HNW F;  1RA6 A;  4U6P A;  2DYA A;  1RTJ A;  2AYE A;  1C4A A;  4M95 A;  5I3U B;  2AHO B;  2QIF A;  4M5D B;  2RQC A;  3N6L A;  1YJR A;  3D4J A;  4GMK A;  3G4S S;  2Y1L B;  1FFG B;  4RW4 B;  3J7Y I;  4Z7Y A;  4C8Y A;  4OJ1 A;  4TN2 A;  4JI0 J;  5LSO A;  4QBU A;  1TUW A;  2FUG 9;  3H4D A;  3B78 A;  4DR1 J;  4CO2 A;  4Y6I A;  2XLK A;  3W1Y C;  1Q8I A;  1KTQ A;  2U2F A;  2AEJ A;  2CWX A;  3D2W A;  2OEK A;  3DLG A;  2LA4 A;  2V4J B;  4H4O B;  4DS5 A;  1N34 F;  2FY8 A;  2AYM A;  3UW1 A;  3Q86 A;  5GME A;  3SQG A;  4CH0 S;  2VQE F;  4ZN1 A;  2RVJ A;  4B9T A;  1PO6 A;  1IKW A;  3MMB A;  2HBQ B;  1GMW D;  2V4Q A;  4NLS A;  2CPX A;  3SIP B;  1R0B G;  2MKJ A;  1DAR A;  2WVC A;  5KFI A;  2OIH A;  3HKW A;  2EBE A;  3GG0 A;  4EZ6 A;  5C2C A;  5D4N A;  4ED2 A;  5I42 B;  1YWX A;  4ZOS A;  3PYG A;  5K8P A;  1Y7P A;  3TRG A;  4IFV A;  2KJW A;  4U95 A;  3A3N B;  2IBO A;  1M5O C;  2D69 A;  4F04 B;  2MQQ A;  1U0H A;  3V6H A;  4HHU A;  2PI5 A;  2OPS A;  4KGK A;  5D4O A;  2E1M C;  4C0H A;  2XY6 A;  4GO7 X;  4ZCM A;  2NXE A;  1M5V C;  3TJ9 A;  2KG1 A;  2XSF A;  5HAO A;  1DTT A;  2OFG X;  4ECU A;  2D9P A;  3CJK B;  2RF2 B;  4P2S A;  2NYH A;  1VS3 A;  2OJ3 A;  1YBT A;  4K4W A;  4CT8 A;  2HSE B;  1EX8 A;  4DFP A;  3IAM 9;  4B9L A;  3I9V 9;  1S1T B;  3LQV A;  2GML A;  1IXK A;  1NBE B;  1UVM A;  2UXC F;  3KJF B;  1YJT A;  5KG3 A;  1BQN B;  2HUR A;  5EX3 A;  4ZHR B;  1EP4 B;  3X3U A;  3H2U B;  5CYQ B;  1YLX A;  3FSX A;  3FZB A;  2XO7 A;  1ZAX A;  4N47 A;  3ZZT A;  3PG9 A;  4LR9 A;  3THT A;  3HSG A;  2FGC A;  1G6B A;  1T94 A;  2DH7 A;  5KFW A;  1RHQ B;  4WFZ A;  4DPU A;  5E3P A;  5HVH A;  4U7C A;  2BJ3 A;  4AYB D;  1R89 A;  1V3R A;  2AWZ A;  4UUW A;  4Q5V A;  5ETM A;  3RBE A;  2M7S A;  2IRY A;  4QQB A;  4IYQ A;  3IS9 A;  3BR9 A;  2XI2 A;  2G1H A;  1U02 A;  2R4F A;  4ED8 A;  2Q3P A;  5K8O A;  1PKU A;  4CO4 A;  3N6N A;  2B8P A;  2HHH F;  3DLK B;  2C2N A;  1YSJ A;  2GCF A;  1HQ2 A;  2MTL A;  1B7F A;  1HNX J;  1N6Q B;  4AMN A;  2G2Y A;  2R42 A;  2OSR A;  1TL7 A;  3Q2S C;  1R6Y A;  3Q22 A;  1CJK A;  3DRP B;  1CC7 A;  1NJX A;  1B99 A;  4FNI A;  4PYD A;  3MPD A;  1Z2L A;  4A46 A;  2YKP A;  4LSN A;  2UUB F;  3PVX A;  1TKT B;  1U48 A;  4ZCI A;  2VF3 A;  3EE3 A;  1W7W A;  4K2J A;  4JYA F;  3U7J A;  4KV8 B;  1WF1 A;  2ATC B;  2YKA A;  3AQP A;  1ZPV A;  2VB6 A;  5DG8 A;  1Q0N A;  2Q6B A;  3C15 B;  1RT6 B;  1YTY A;  4PZV A;  4AL5 A;  4I56 A;  1D8Y A;  2LDI A;  3BGR B;  3ULH A;  1GXU A;  2YX4 A;  5L9X A;  2NLW A;  5DET A;  3GV5 B;  3MEE A;  4GKJ F;  1T05 A;  2RDD A;  1VCT A;  1M5P C;  2Y8Y A;  3MPU B;  2DH8 A;  1HPZ B;  4GRS A;  2C2Z B;  4WXO A;  4OI2 A;  1ZZN A;  1RDR A;  4A4J A;  1FCA A;  5SZT A;  5FD1 A;  3KLI A;  2LQB A;  5IT4 A;  4UTG A;  4J9S A;  4ZVE A;  2NXN A;  3NS6 A;  3QID A;  3WIV A;  1KP6 A;  1FDN A;  1JLC A;  1FEH A;  2PMW A;  5K20 B;  2OPR B;  5FLX U;  2QA2 A;  3DNC A;  1LEO A;  4JI0 F;  3D3C J;  1CQN A;  1YDL A;  4FYW B;  2EFG A;  2DNQ A;  4DR1 F;  4C98 A;  4PPD A;  3TP2 A;  3MUR P;  4NRT A;  4RJV A;  4RBT A;  1WC6 A;  4EYH B;  3A12 A;  1YJN S;  3VAI A;  2V69 A;  4ZP7 A;  3RJM B;  3HKZ D;  2E9T A;  2MB0 B;  4NEY A;  5LJ5 Y;  2B9E A;  5GAH I;  4WU2 A;  2YQ1 A;  3FKB A;  4TU9 A;  1TK5 A;  1BD6 A;  4YHH J;  2QE5 A;  4ZIT A;  3NWG A;  4OI0 A;  3WDO A;  5J2Q B;  2DHS A;  2ZBP A;  3MMA B;  4NWB A;  3NGD A;  3QT8 A;  3ZZP A;  4F0M A;  3OT9 A;  1X0P A;  3C14 A;  1S6Q A;  4UF4 A;  5L9N A;  2MEW A;  5KFT A;  4I64 A;  3G8Q A;  1UWB B;  1YRT A;  2YNF B;  2H54 B;  2UVV A;  1F0X A;  2NYI A;  4ZA1 A;  1T3O A;  2DXF A;  3JTO A;  2I38 A;  2E5G A;  2CAD A;  2GX8 A;  4O0N A;  4OYX A;  2HWH A;  4Q45 A;  4AL6 A;  2HHX A;  5J1E B;  1UVI A;  5I3Q A;  1X5O A;  2Q79 A;  2J9D A;  1FFS B;  4IH6 A;  1WUU A;  4IOA Q;  3AH6 A;  3FEX B;  2UV8 A;  3US5 A;  3MAQ A;  3CCM S;  4JV5 J;  4L72 B;  1OY8 A;  1S6P B;  1DBD A;  3WHI A;  4WU3 A;  2OAU A;  3GV8 B;  2B9W A;  3HD2 A;  4CNZ A;  3I9Z A;  3I0R B;  5J2P A;  3R27 A;  2Z0G A;  2LXF A;  3CMQ A;  3WBZ A;  1N5Y B;  1RT2 A;  2BX6 A;  1SL1 A;  5HJX A;  4B3T J;  4RLE A;  3NAI A;  1NEE A;  1S0N A;  2QTW A;  4OYO A;  1HNI A;  1NME B;  3QZ8 A;  2ZNZ A;  2CQI A;  1WD6 A;  1KQF B;  4O3O A;  1WNE A;  5KG5 A;  1FD8 A;  5CH7 B;  2F4V J;  2DPI A;  1X4G A;  3KUG A;  1VHI A;  2M3D A;  2DRB A;  3SMZ A;  2M5Y A;  1NH7 A;  3TEG A;  5KFM A;  3KNA A;  1RU2 A;  4WYL A;  2YVS A;  2IM0 A;  1P1T A;  3DHW C;  1MU2 B;  5B08 A;  3BGF A;  1NLK L;  2RKI B;  3CDW A;  1YZ7 A;  3ITH B;  3I5C A;  4ZDN A;  4MIW A;  4UT4 A;  4RZR A;  1LW0 A;  3CGI A;  4ZVS B;  1VRQ C;  4R8U B;  2MQP A;  1DJ0 A;  3CW2 C;  2V67 A;  4K4Z A;  4OI3 A;  4L74 A;  2H1Y A;  4CNY A;  2DJW A;  1HNX F;  3OL6 A;  2AJ4 A;  2DEI A;  2P8I A;  1UZH A;  2FJX A;  1RI7 A;  4HH1 A;  1KFD A;  5G4D A;  3KNG A;  4NZ6 A;  4F4Z A;  4ED5 A;  2LQ5 A;  2HPU A;  3BPD A;  1O51 A;  1ZAV A;  1VK3 A;  4QWE A;  1YQH A;  4Q7A A;  1S1V A;  3K59 A;  5A8R A;  1U1M A;  3H90 A;  5F3Z A;  3H20 A;  3OFG A;  4C11 A;  3V4I A;  1H2V Z;  3E8O A;  2UUW A;  1WC5 A;  2AZ3 A;  2E1A A;  4UY8 5;  4K8R A;  3HX9 A;  1U49 A;  2D41 A;  5CAB A;  5DGA A;  1SB6 A;  5I3U A;  4A8O A;  3W65 A;  3PV8 A;  1VQM S;  4M5D A;  1RB0 A;  4RNN A;  5KG1 A;  2E5L J;  2DGU A;  2LQ8 A;  4OLO A;  4RW4 A;  5HSP A;  3AOD A;  4MT1 A;  3W60 A;  2OHD A;  2RD5 C;  1SJQ A;  4P6Q A;  4WKR A;  5J1P A;  4NML A;  5HRO B;  4DV4 J;  2FHO B;  3K17 A;  3H5Y A;  1RTI A;  4Q44 A;  1KKH A;  2L9W A;  3KJV B;  4GC6 A;  3BH6 B;  1JX4 A;  1RBL A;  3NEK A;  2NCK L;  4OYB A;  2QFI A;  1RAD B;  3SDE B;  2FVR A;  1Q1K A;  4DFJ A;  6FDR A;  4CLW A;  5EX0 A;  5C5J A;  2V4J A;  5GMD A;  3HDS A;  1O0P A;  2DO4 A;  5CAA A;  4B3M J;  3DOK B;  2LLZ A;  3W66 A;  4NLU A;  1RYS A;  3TUP A;  3FBB A;  4P73 A;  5ETL A;  1WC0 A;  4LF5 J;  1KON A;  1OPZ A;  3CDU A;  5DQG A;  1X0F A;  3A3P B;  2VIH A;  4FP9 A;  1QSL A;  1SJR A;  3C19 A;  5KFU A;  4NXM J;  4YHH F;  3MEK A;  3CCJ S;  2AEF A;  2UUC J;  3GV7 B;  3HZG A;  5D4P A;  2B51 A;  1H72 C;  4PEO A;  3G6V A;  4FVM A;  2RRA A;  2M8D B;  2BR0 A;  4N8N A;  2CQ1 A;  3RZA A;  2XWX A;  1AUD A;  3MMC B;  1T9V A;  3QYY A;  3PKM A;  1GTE A;  3PW2 A;  3TX8 A;  3D3B J;  3CWJ A;  4DL6 A;  2HEK A;  2JC0 A;  3MAH A;  3ENA A;  2WRM A;  3CCV S;  4A8X A;  4KGV B;  2F65 A;  2JHE A;  3D5M A;  3I31 A;  3FEY B;  4OFZ A;  3DYA A;  4WFN Q;  4Z7C A;  1PJ7 A;  4F2R A;  1FXL A;  1X7V A;  3JQM A;  3TNV A;  3TOQ A;  3UN5 A;  2P9G A;  1S12 A;  3EJM A;  3HVT B;  4ZHR A;  1NU4 A;  4ANC A;  2MZS A;  3BGL A;  5CYQ A;  1VC6 A;  2GIQ A;  4DQQ A;  1FEE A;  4JV5 F;  4DV5 J;  1P9Y A;  3AA8 A;  3R97 A;  4LRC A;  3SCL E;  3MFH A;  3RB0 A;  4OZN A;  2CWK A;  3H25 A;  3OW2 R;  5HL7 Q;  2HWT A;  3S8S A;  3AHP A;  2FQQ B;  4B3T F;  4FS2 A;  3D6T B;  1H73 A;  1I51 B;  5CZC A;  4AFF A;  1HKA A;  1KTV A;  4PCQ A;  4URG A;  4QWB A;  2L3M A;  3FBC A;  3IBF B;  3CTR A;  3BEG B;  4MK9 A;  4J9V A;  2RDJ A;  2F4V F;  3M8Q B;  4DMZ A;  1TV6 B;  3VHQ A;  4XK8 C;  4ETX A;  1WTF A;  2DR7 A;  5E33 A;  2GHW A;  2UP1 A;  1AYE A;  2V8V A;  3DGP B;  1N6Q A;  2AJ0 A;  3ISN D;  5E0O A;  4I2P B;  3B4D A;  3P45 B;  3DRP A;  4WFB Q;  2UUT A;  5IQ6 A;  1NK5 A;  2ZH6 A;  1UFL A;  4WII A;  1T03 A;  1WHY A;  3FRY A;  3JTN A;  2J8A A;  5DZ7 A;  2M88 A;  3LP1 B;  4RX6 A;  3IGV A;  3GTY X;  4KV8 A;  4XO0 A;  2WZ1 A;  1F5B A;  1RT6 A;  5KFO A;  4DF8 A;  2DTJ A;  2PI4 A;  5GAG I;  1G1X A;  3DU5 A;  1OS5 A;  1XER A;  3EDQ B;  5D0H A;  1OSD A;  4DXL A;  3TUZ C;  1GH8 A;  3N0V A;  5LMU J;  4KAI A;  3C6T B;  2QSW A;  4UOC A;  1LOU A;  3NKY A;  1UA1 A;  3QJL A;  2CVI A;  1NDK A;  3T6B A;  2GAG C;  4ZJL A;  1KHV A;  5KG0 A;  1L3S A;  2HKE A;  3HFZ B;  2EFO A;  3AJD A;  4DR6 J;  3GFZ A;  3G96 A;  2HFU A;  4RNF A;  4PWD B;  2F40 A;  2FHK A;  2FZG B;  3FBE A;  2CQ4 A;  1QJH A;  1REG X;  4DPX A;  1WOS A;  2E5L F;  2ZH3 A;  4KJI A;  1DHM A;  3LP2 B;  3GJQ B;  3CT9 A;  3MUM P;  3M8P B;  1GMU A;  4E0D A;  5FII A;  1S0O A;  1R3N A;  4RW8 A;  3OJU A;  1UTA A;  2WTF A;  3RB6 A;  2OPR A;  2JVO A;  2R2U A;  4J9P A;  4USK A;  4DG1 A;  4DR3 J;  4DV4 F;  2O01 C;  2YKN B;  1WOP A;  1ZTW A;  3H0P A;  1H38 A;  2KZZ A;  4ZLN A;  1SKW A;  2AGO A;  2CYY A;  2Y0B B;  2FYX A;  2RB7 A;  2UZA A;  3BYP A;  4O3P A;  3G87 A;  1UCN A;  3AQO A;  3ILO A;  2XYP B;  4QJV A;  2G1D A;  1RE1 B;  2HVD A;  3PIO Q;  5LM7 E;  4B3M F;  1W25 A;  4NLD A;  1VQP S;  2A3J A;  2YQ0 A;  3ET6 A;  2BV3 A;  2WSE C;  4FYV B;  2QL9 B;  2PII A;  5GVQ A;  3DRR A;  1NPK A;  3CJ8 A;  2CVE A;  3N9U C;  2C1E B;  1FO1 A;  2OH2 A;  1S6O A;  1VRT A;  4LF5 F;  1LXJ A;  1UWB A;  3NGU A;  2YNF A;  4ZVT B;  4KPY A;  1S9G A;  3R3T A;  4NXM F;  2UUC F;  3MPW A;  3ZTS A;  2DGO A;  1X4H A;  2ZH4 A;  4M5K A;  5BYR A;  4K4S A;  5ETV A;  5EGY A;  2C3O A;  2Y9H A;  4S0M A;  2R8J A;  3BKF A;  3QIP B;  3A8E A;  4JI1 J;  3PHT A;  1W26 A;  2D3Z A;  3D1H A;  5KG2 A;  4E8U A;  3AA9 A;  1X4E A;  2BE7 D;  1SPB P;  2YTC A;  2DKO B;  3RTV A;  3CJT A;  3DRS A;  3OR1 A;  4BS2 A;  2LYV A;  1N32 J;  1S6P A;  3AOC A;  2Y1I A;  5AE1 A;  4QIF A;  2EBG A;  3KHR A;  2B4V A;  3CCS S;  4LF8 J;  3N79 A;  2MZT A;  4DR2 J;  1PYT A;  2W8K A;  4F4W A;  3W2V A;  4TU7 A;  1X4A A;  2NUU G;  1JLF B;  3EYZ A;  3P5T L;  4JB8 B;  3FMW A;  4QIW D;  3NMA A;  2OFH X;  5KFK A;  2J6U A;  3E3X A;  3VAJ A;  4E98 A;  4DV5 F;  3SV4 A;  2EFN A;  2NXJ A;  1RWK B;  4WTY A;  4TQR A;  2LCW A;  4K5S A;  2XI3 A;  3GG1 A;  4RWX A;  2VPZ B;  4KFB A;  3D66 A;  1FWP A;  3MCN A;  2WB1 D;  4AL7 A;  2NZ4 A;  4ZVO B;  2I6W A;  1S76 D;  2J9E A;  3H5U A;  4F4X A;  1XNQ J;  4AMP A;  2KT3 A;  2RKI A;  1UL3 A;  2HZV A;  2UVW A;  2ZE2 A;  5EWG A;  3DLJ A;  2ZBR A;  2FVP A;  2RE1 A;  3KDN A;  7FD1 A;  2MZR A;  3KHL A;  3P5B P;  3M32 B;  2MKI A;  2KH9 A;  1IBK J;  2O3D A;  1WG4 A;  1T9W A;  3MM9 A;  1JNR B;  1L5U A;  1YHQ S;  1EQ0 A;  2QLF B;  4JI4 J;  2QL7 B;  3OUY B;  4HR2 A;  3HHL B;  2CKW A;  4ZPC A;  4ATN A;  3QRR A;  1CJT B;  3LW5 C;  3ENV A;  4USU A;  3IRX B;  1ULR A;  1CQM A;  4LF6 J;  5CD4 A;  2GQC A;  2OEL A;  2QYG A;  1R8P A;  1HWL A;  1XBW A;  3L09 A;  3KMQ A;  2WW8 A;  5LMU F;  3Q23 A;  1BC6 A;  1M5H A;  1LWF A;  2Z58 B;  2KXN B;  4U8Y A;  2KO1 A;  1SUQ B;  4KGZ B;  1RT7 A;  1LXN A;  5HRO A;  1N54 B;  5LT5 A;  4DR6 F;  1HWI A;  5ADZ A;  2CQG A;  3KJV A;  1K8A T;  3I6P A;  4YS2 A;  4DCP B;  1SC3 B;  3MZI A;  4YB5 A;  1F60 B;  2DGS A;  3SDE A;  3RRK A;  1XMQ J;  4ZKA A;  4I2Q A;  4DR3 F;  3PZP A;  3DOK A;  2BAN A;  4CM2 A;  4PG8 A;  1YRU A;  4A8M P;  3L95 X;  1FRL A;  3PCO B;  3GIJ A;  1TL1 B;  2V6A A;  1RAO A;  4RNO A;  4EBC A;  4L6V 3;  5E5N A;  1VQ8 S;  2YH0 A;  2XZT B;  1YIT S;  2RH3 A;  3MHY A;  3OVS A;  3UDL A;  3W7B A;  3N5B A;  1JLG B;  5DO2 A;  3SI8 A;  5CQG A;  4PWW A;  4QW9 A;  3Q8V A;  4FBT A;  3MMC A;  3PEJ A;  1S9E A;  1KQG B;  1TL4 A;  4DBQ A;  3PM9 A;  3MCS A;  3OL9 A;  5IZH A;  4DV1 J;  4RW6 B;  1A9N B;  3HSZ A;  1WI8 A;  1TFY A;  4C8Z A;  1BGX T;  1UZD A;  2MPU A;  3VGS A;  3UN2 A;  3BYR A;  2G2O A;  2V8H A;  1GFW B;  4JI1 F;  2V5H G;  3T1A A;  4YDD B;  4QWA A;  2KHC A;  4H4K A;  4XDD A;  4EUV A;  1N56 A;  2PN6 A;  3OSP A;  2KFN A;  2DGW A;  2MQL A;  1VBK A;  3I87 A;  2V94 A;  3KK3 B;  3NS7 B;  3FGV A;  2DK2 A;  2R7W A;  2VDI A;  1NDC A;  1U47 A;  4JUZ A;  4NPO A;  3D1Q A;  2BBE A;  1N32 F;  2OMO A;  4PKD B;  2IVF B;  2BOP A;  3S7R A;  4LF8 F;  3B4M A;  4H54 A;  4DR2 F;  2I1R A;  3TW0 A;  2RIJ A;  5ETS A;  2AJ1 A;  1IKV A;  2D3O R;  3M6U A;  4BWJ A;  3KYL A;  2JJ4 D;  2A1B A;  1X9W A;  3QBC A;  3DOL A;  4PPZ A;  5HMW A;  2PA3 A;  3TZZ A;  2ZKT A;  3MED A;  2V9K A;  2DCU B;  1WAC A;  1WKJ A;  4ZPV R;  1T8E A;  4OX7 A;  1XIQ A;  3VQT A;  1SC4 B;  1WHW A;  3M8Q A;  1TV6 A;  4OZ5 A;  1NK7 A;  2EKN A;  4BDP A;  3BQ1 A;  5LXR A;  5F8M A;  1PIL A;  4LBP A;  2BJ8 A;  3DGP A;  5D8H B;  3QSY B;  4WF9 Q;  4AE5 A;  1U4B A;  3ZTR A;  2PE8 A;  4CO5 A;  4I2P A;  2DH9 A;  5DQI A;  4X65 J;  1XNQ F;  5AXL A;  1SH3 A;  4CYU B;  4UZB A;  3PW7 A;  2ZOM A;  1C1B B;  3A4T A;  3KLE B;  3MTJ A;  4U96 A;  3PRD A;  4RBU A;  4ZIW A;  1SIW B;  1N36 J;  1TTH B;  3LUY A;  1RHK B;  2JL9 A;  1NSP A;  1Q8L A;  1FT8 A;  1VYA A;  4TVA B;  1IBK F;  3K5M A;  1XMB A;  4JV1 A;  2KL8 A;  2Y3Y A;  5GAE U;  1ICE B;  2HK3 A;  1U0S A;  2V2Q A;  1FDB A;  4Y2M A;  3AB2 B;  2FLP A;  4QZV B;  3PW4 A;  4MJK A;  2R2R A;  1EET B;  4IDK B;  4JI4 F;  2EVZ A;  1U2F A;  3SV3 A;  2VKR A;  2ILY A;  5A6W A;  4DL4 A;  3MPV A;  2FGO A;  2DNK A;  4FPR A;  4RW9 B;  4HI2 A;  3DFE A;  3ICL A;  3J7Z 5;  2A10 A;  4PUO A;  2NRE A;  2RU9 A;  1RWU A;  3F56 A;  1DQ8 A;  3QGH A;  4LF6 F;  4PWD A;  2YQ3 A;  2WHO A;  1S7I A;  3AD8 C;  2C42 A;  5KT7 A;  2MJN A;  2HHT A;  3GR1 A;  3LP2 A;  2BE9 B;  3K5O A;  3H42 A;  3Q8P B;  5B7W A;  1RIS A;  5A76 A;  1O6X A;  1FWL A;  2RS8 A;  1RXO B;  4TY8 B;  5BYS A;  5F8J A;  2YKN A;  2OEM A;  3FEZ A;  4TKT A;  2Q6C A;  1REV B;  1LWC B;  4ID5 B;  5IM0 B;  3PJW A;  1IKX A;  1OSC A;  4M8L A;  2HFO A;  5ITH A;  4Q8E A;  4I0W A;  3ZZZ A;  2AJF E;  2CZV C;  4IQM A;  3C6U A;  4PAB A;  1X4B A;  2N7Y A;  4TXS A;  4FYD A;  2F4F A;  2CXE A;  2PMH A;  1XMQ F;  1URN A;  2IPO B;  4IUF A;  1WF0 A;  4M94 A;  2ALZ A;  3DLE A;  2HZA A;  3FCV A;  1C4C A;  3HVW A;  1BWE A;  1RTD B;  3J80 Y;  3T1Y J;  1SV5 A;  1U1K A;  1SJF A;  5HK4 A;  3GZ7 A;  4WZQ A;  2JSX A;  4K0K J;  3M9O B;  3IR7 B;  4B02 A;  1A7G E;  1KOO A;  1E6Y B;  2B6A A;  2R7X A;  1UW9 A;  2R3V A;  4KRW A;  2HND A;  2VG7 B;  3MR7 A;  3GII A;  2MQO A;  2RRB A;  2CIM A;  1RGV A;  1GAO A;  4LF7 J;  2ZZT A;  3DI6 B;  2XLJ A;  4M63 A;  2GAH C;  1IQZ A;  2WON B;  1GX5 A;  4I1T A;  4D3G A;  1HIY A;  4ZP8 A;  4A47 A;  2L48 A;  5F8H A;  2VG5 A;  3IN5 A;  4DUT A;  4OI4 A;  3GCX P;  4QU6 A;  1HQE B;  4WKY A;  2XMK A;  1HHQ A;  2MQ8 A;  1JLB B;  4WPA A;  4DV1 F;  4KH0 B;  2IFX A;  4BLG A;  1VQ4 S;  2NS1 B;  4EO8 A;  5CYM A;  4DZ6 A;  4DUY J;  1AT1 B;  3G6Y A;  4FXD A;  1QTN B;  1RWM B;  3O3L A;  1YGY A;  2W4C A;  3OD2 A;  3IWX A;  1IR0 A;  2YNG A;  2YWF A;  2E5J A;  4CDI A;  2MKS A;  4X2B A;  2W7A A;  4X4N A;  2LMI A;  3M8R A;  4J9O A;  2CG8 A;  2YNH A;  5KG6 A;  1FJE B;  3U27 A;  2NSC A;  4ZPW R;  3ZTP A;  2IJF A;  1WTB A;  3BSO A;  1C1C A;  4PQU A;  5IV4 A;  1ZM3 A;  5C7P A;  3BGU A;  2RU3 A;  1XN9 A;  4X4U A;  2BM0 A;  2KVQ E;  2IVM A;  3E2E A;  3NG8 A;  4X62 J;  4XAK A;  3GJS B;  3T3F A;  4E2F B;  2EWH A;  2XMT A;  5EN1 A;  3UVJ B;  5E41 A;  2I0X A;  1WWH A;  1KS2 A;  5KFC A;  2YWH A;  3QRP A;  4C3L A;  3ENW A;  1FKP B;  2PO4 A;  3TQE A;  1JIH A;  3Q8Y A;  4WFX A;  5KT6 A;  4ILM A;  1X9M A;  2HQF A;  1F5A A;  1RP5 A;  3HF5 A;  1ZM2 A;  1FTC A;  2JEF A;  3AJ1 A;  1WHV A;  1H2U X;  2YWE A;  4JI6 J;  1RT1 B;  1RT4 A;  9RUB A;  3M4X A;  3M6W A;  3NP5 A;  1HFE L;  1F5C A;  4C8L A;  4KT0 C;  2XZW A;  1HNV A;  4GVB B;  2LU2 A;  3RW6 A;  3DU6 A;  2B5J A;  2YKM B;  3M32 A;  2C2O B;  4NOH A;  3DMJ B;  2CQP A;  1NPR A;  4X65 F;  1UVL A;  2HMI A;  3L3C A;  4F0K A;  2Q1L A;  3M9M B;  2KFY A;  1N36 F;  3SSQ A;  3G8T A;  1MMD A;  1KQS R;  1S99 A;  1B64 A;  1YJV A;  2CPI A;  4NLX A;  4RKU C;  2MSS A;  1CJT A;  3K89 A;  5DRK A;  2B8Q A;  2ZC3 A;  4NCG B;  4K5R A;  4GC7 A;  4MYT A;  4DSE A;  4PG6 A;  4NRU A;  4CCH A;  2W7P A;  4LR8 A;  4QR0 A;  1KNZ A;  4WWS A;  3DLG B;  3UR3 C;  2PDA A;  1ZYQ A;  2H5E A;  4J9M A;  1TVR A;  2HGM A;  3PX6 A;  2DXE A;  2DNN A;  5E3Q A;  3SQG B;  2CPJ A;  1SUQ A;  1NDL A;  2CRL A;  2ZUA A;  4CP5 A;  4LVN P;  3LO3 A;  5KFZ A;  1NHV A;  2FHJ A;  1IKW B;  3IFE A;  4OHW A;  4UOF A;  5F8G A;  1PCA A;  2J76 E;  1Q86 T;  4OZL A;  1K0T A;  4ILL A;  4F4A A;  4KY3 A;  4C0B A;  2ZHO A;  1YJW S;  2QMX A;  2DR6 A;  4KSE B;  3OTC A;  2G4B A;  4IFV B;  1XR5 A;  4DL0 C;  4DLE A;  5KFB A;  1NK0 A;  3KK2 A;  1VOM A;  3GWC A;  2CUY A;  1HNZ J;  1DAX A;  1TK0 A;  2X51 A;  1C0T B;  2W2O P;  1TL1 A;  3T9N A;  4P2X A;  4B3R J;  1RU1 A;  5KT4 A;  2XNR A;  4IFY A;  4DPY A;  1PJ5 A;  3TX0 A;  4MTP A;  3SZ2 A;  3TZX A;  1WDT A;  4PXD A;  1GMW A;  3EVM A;  1JLG A;  2AW0 A;  4MK7 A;  1NZA A;  5DS7 A;  3SBM A;  3MPY A;  1HI1 A;  3KLH B;  3T1Y F;  1TKZ A;  4J7C A;  2C2E A;  1JXV A;  3H8Y A;  3GYN A;  2DGV A;  4K0K F;  3AOA A;  2AGP A;  3IWN C;  1M5S A;  3CCL S;  3V4M A;  4CLU A;  4IKA A;  4P52 A;  4CT9 A;  4DS4 A;  5F9N A;  8RUC A;  1K47 A;  1VK8 A;  2Z2L A;  5C42 B;  2ZOF A;  4LF7 F;  3ILL A;  2B0G A;  5GAD I;  2JZ5 A;  4J5O A;  1VRU A;  3QJP A;  2VA3 A;  3T9Z A;  4RNM A;  4JI3 J;  1MN7 A;  4RWW A;  1R0A B;  4N76 A;  1N0V C;  3M6V A;  1LW2 B;  4NX9 A;  3TEH B;  4DUY F;  2AX0 A;  3ZZ0 A;  3W2W B;  2ADC A;  2K8G A;  2ZZM A;  3UNG C;  1QDU B;  2APO A;  1M0S A;  2JWN A;  1FHT A;  4AT1 B;  4CLK A;  3DGV A;  1VLY A;  1AFJ A;  4DL7 A;  4F3Q A;  1TL7 B;  3HT3 A;  3OLA A;  2K06 A;  3O8W A;  2A2D A;  2DPJ A;  1CJK B;  2IVY A;  4M1K A;  4BBY A;  1CEZ A;  1FI4 A;  4X62 F;  4DEZ A;  4HI1 A;  4LSN B;  4KC5 A;  2KDO A;  1T95 A;  4QYR A;  3PO4 A;  2XMJ A;  1ZOT A;  4CO1 A;  4WXW A;  4ZVQ B;  1C2P A;  1OWX A;  1UEK A;  3K5N A;  2BW2 A;  3GJR B;  2BJE A;  1XK8 A;  4M5H A;  3B54 A;  2Y8W A;  4CYU A;  5U47 A;  2AYG A;  5M2R A;  4ELV A;  4JI6 F;  2ASY A;  1FES A;  3MEE B;  5DQH A;  3GB0 A;  2ADB A;  1T05 B;  1IR1 A;  3G2X A;  3HHE A;  2W9A A;  2V68 A;  2W1B A;  1PBA A;  3MEG B;  2RAQ A;  4W98 A;  5CZX A;  3W5X A;  1ACM B;  2XUL A;  1HW8 A;  2AD9 A;  4I7F B;  3JQJ A;  3QRQ A;  2VFT A;  4USM A;  3HJF A;  1QM9 A;  5AJ3 J;  5L1J A;  2VH7 A;  1VQ5 S;  2ZH8 A;  2W25 A;  2LVW A;  2FTR A;  5IV3 A;  1EET A;  4IDK A;  3AOB A;  3KK1 B;  2B4O A;  3FSI A;  1K0V A;  4DL5 A;  1DFD A;  4RW9 A;  5KOX A;  3TYT A;  1EKS A;  2HK2 A;  3QAT A;  4F4K A;  3I5B A;  1VJQ A;  3GR0 A;  3V6D B;  3H2L A;  1FWK A;  4G1I A;  2R7T A;  2HS4 A;  3KMS A;  3CJS A;  4IG3 A;  2Y1J A;  4NLW A;  3BDP A;  2W2P P;  4CO3 A;  2KRB A;  2JLF A;  5H9E J;  5A6P A;  2CQ2 A;  2LQJ A;  2GJF A;  3MEC A;  3AD7 C;  4UUX A;  2M4M A;  3T5K A;  5KOW A;  4MIA A;  4TY8 A;  1HYS B;  5DGB A;  1N4L A;  3DLL Q;  4A8F A;  2C22 A;  2WVE A;  3MCM A;  3TQ1 A;  1REV A;  1LWC A;  1ELO A;  1KQK A;  3Q8Q B;  2EG1 A;  5HAN A;  4EFA C;  2ALY B;  2BQR A;  1XEZ A;  2R2S A;  5J2M B;  2PA8 D;  3VV2 B;  4LT6 A;  5GAH U;  3FVY A;  5AXM A;  3THP A;  3N6M A;  1SJ4 P;  2WVF A;  4YB6 A;  3ILI A;  1TUG B;  3HI9 A;  5KAK A;  4H4M A;  1A6L A;  1HNZ F;  2XO6 A;  2LEC A;  4B3R F;  4DL3 A;  3SSS A;  1SC1 B;  4OYI A;  4HKQ A;  3HK2 A;  1O5J A;  1E6Y A;  1QAY A;  1TEL A;  3PDN A;  5KT5 A;  3CJ3 A;  1IBL J;  1NSA A;  2B43 A;  1H3D A;  4NCA A;  1OIA A;  1M1H A;  3T6J A;  2HNY B;  3M2V A;  3PYD A;  2LEA A;  1EHW A;  2WON A;  3VGU A;  5B0F A;  1WKL A;  2C28 A;  4TU8 A;  1MLA A;  1FRI A;  5J2P B;  2XCA A;  1Q53 A;  3R7B B;  1HQE A;  2QRR A;  3CE8 A;  3G86 A;  4IRK A;  4OYM A;  2EK6 A;  5H9F J;  4I6A A;  5JXS A;  3MM6 A;  3I82 A;  3K5L A;  3A3O B;  2MQN A;  2V2Z A;  2RHS B;  2FJE B;  1VR6 A;  1N0U A;  2XEX A;  2A18 A;  4CQ1 A;  4ZMM A;  2MMY A;  4JI3 F;  1NJW A;  4ILR A;  4DSL A;  1VBZ A;  4Z37 A;  4OZJ A;  4CLP A;  2VD3 A;  3JSM A;  3HZE A;  2YH1 A;  3EIC A;  4UOG A;  3QQC D;  4AQY J;  1U25 A;  2MGZ A;  4M5L A;  3Q8R B;  1N88 A;  1X4F A;  3L7O A;  1LW0 B;  1V3S A;  4WTO B;  2KHD A;  1SJ3 P;  4HDG A;  3T5L A;  5KFN A;  3UVJ A;  5M2P A;  2BM1 A;  3CB4 A;  3ADA C;  2AGQ A;  1F6T A;  1FE0 A;  1RHR B;  5LJ3 Y;  2ACY A;  1JXE A;  3T19 A;  3MUV P;  1FKP A;  2YY3 A;  1FRJ A;  1RJJ A;  3CDB A;  1ITP A;  3VZI A;  5L8R C;  2Y0S D;  5A8R B;  4J9N A;  2VOO A;  4L3K A;  4DV6 J;  4OYW A;  4C11 B;  1U1N A;  3NCR A;  4L75 A;  2HS0 A;  4I69 A;  4EGL A;  3JXO A;  4GVB A;  3D6F B;  1TL3 B;  4LVO P;  2B3T B;  5CCL A;  3P49 B;  3DMJ A;  3IR6 B;  4DLG A;  1PG5 B;  1RHU B;  1UW4 A;  3P8B B;  2JLE A;  2ZD1 B;  3MF5 A;  1RTH A;  4QYZ J;  2FHJ D;  4NL5 A;  1RAI B;  1YG0 A;  3KLV A;  4CTA B;  1LWE A;  1KVK A; 
#chains in the Genus database with same CATH homology
 3CJ8 A;  2QC3 A;  4RR5 A;  2G2O A;  5CZD A;  3BV8 A;  3EZO A;  3HMJ G;  3H0P A;  3RGI A;  2HG4 A;  3HJV A;  2CUY A;  3TZY A;  2VZ8 A;  1MLA A;  3R97 A;  2VKZ G;  5DZ6 A;  5DZ7 A;  2C2N A;  3K89 A;  3PTW A;  2PFF B;  4QBU A;  2JFK A;  3HHD A;  1NM2 A;  3TZX A;  2VZ9 A;  2G2Z A;  2JFD A;  5CZC A;  3TZW A;  3TQE A;  2UV8 G;  2G1H A;  3QAT A;  2G2Y A;  3SBM A;  2QO3 A;  3IM8 A;  3R8Y A;  2QJ3 A;  3TZZ A;  2H1Y A;  3IM9 A;  3G87 A;  4RL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...