1IN0A

Yajq protein (hi1034)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
PSFDIVSEITLHEVRNAVENANRVLSTRYDFRGVEAVIELNEKNETIKITTESDFQLEQLIEILIGSCIKRGIEHSSLDIPAESEHHGKLYSKEIKLKQGIETEMAKKITKLVKDSKIKVQTQIQGEQVRVTGKSRDDLQAVIQLVKSAELGQPFQFNNFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YAJQ PROTEIN
publication title Crystal structure of the YajQ protein from Haemophilus influenzae reveals a tandem of RNP-like domains
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 53
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04461 DUF520 Protein of unknown function (DUF520)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1in0A01
3.30.70.990 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits YajQ-like, domain 2 1in0A02
1IN0A 5B7WA 2KHDA 2K3IA 2JZ5A
chains in the Genus database with same CATH superfamily
2B6AA 3QPIA 2ADCA 3ZNUA 1UEUA 4F4ZA 2VHGA 4YHHF 3GJQB 1U6BA 1DQ8A 2HZCA 3MM5B 2VZ9A 1C4CA 1S57A 4LFCF 4PXEA 5KFHA 3DRRA 3M8ZA 2D69A 1S72S 1TKXA 2V4QA 3RRKA 5KOWA 3D1OA 3T1YJ 1VRQC 4R5PB 2GAGC 2NUUG 1A6LA 4ZCKA 4X64F 3NXZA 2B43A 4HKQA 4ECYA 1HWKA 2QL9B 5E3PA 2W7OA 4WK1A 2GVDA 3VV2B 4DMZA 2ACYA 1FXLA 1SV5B 1UEKA 4UY85 1U4BA 1SKWA 4OZ5A 4RUBA 4RW4B 4C3LA 2ZH4A 4FYVB 3MFIA 2E5LJ 3LAMA 4OIXA 4C8NA 1U24A 3V4IA 4WZQA 2XHCA 4IG0B 2FJEB 5JXSA 2GIQA 4HDHA 1RA6A 4TVAB 4DV7J 5CAAA 2DGTA 4X4UA 4RLEA 4ZLJA 2OEMA 3UNYA 3UQSA 5HMWA 3UN2A 3OSPA 2HLTA 2HHXA 1WI6A 1X9MA 2R7QA 3VZHA 1VCTA 4YEAA 4LRAA 4PG7A 1RWPB 1N5QA 2VF3A 1U1KA 1SI9A 5E5NA 2J7KA 3KWMA 4KFBA 3EXYA 4DPWA 3CC2S 3KLHB 4HTIA 1XC9A 2AP6A 3GTYX 2OPPB 1NRKA 4BWMA 3AA8A 3LANA 2HHQA 2QYCA 2FC9A 1SC4B 1KC8T 3OR2A 5HAOA 3ZTQA 5DQIA 5J2MA 4RW6A 3GFYA 1TK8A 4C9DA 3AQPA 2HVIA 2GAHC 1SKSA 3MECB 4DG1B 4I64A 4F2RA 4L6V3 1WACA 5K20B 1JLGA 3TW0A 3VGSA 3NS7B 2XWYA 3UN5A 2QL7B 4OZ1A 4CYUA 2MZRA 1HR0J 2M3DA 2W9BB 3GG0A 1UW9A 2DXEA 3P45B 2EVZA 1FJEB 1NZAA 2IRUA 1S1UA 4AUKA 5KG2A 4HLBA 4B08A 1WF2A 4QWBA 1B99A 5FJ4A 3ILJA 4DQSA 3B6BA 4JI1F 4DQIA 2IVYA 2BR0A 2IRXA 4QQBA 2HIQA 4KGKA 3FVYA 2FB0A 1ZOTA 4K59A 5LJ5Y 2COLA 3H59A 2UZAA 4J9OA 4C8KA 5ETMA 4C97A 2DNOA 2AEJA 1LW2B 4BCAA 5F8JA 1XQIA 1HPZA 2HK3A 1HBMB 3P4UB 2DTJA 2GC8A 1FRHA 4H4KC 4C98A 2HW3A 3AOBA 1WOOA 4NLSA 3CJ0A 3X1LB 1GMWD 4MKAA 2PEBA 3E2EA 3EGWB 3ENAA 1U0HB 2C28A 1NH7A 3WBZA 5KT6A 3KJVA 2DH8A 4J5OA 4KAIA 2V34A 2N82B 1LWEB 1UVLA 3HHDA 1EQMA 3CCMS 4N77A 4C8OA 3POTA 4DR2J 3T1YF 2B5JA 2AJ1A 1S99A 3BQ1A 2GO9A 5CCMA 3MCSA 4CI0B 3G96A 1WOPA 4WFZA 1FKOA 3T5JA 1HYSB 4DWIA 3QFWA 3N6MA 3IGNA 3N6LA 3FBEA 3JQJA 4TXSA 2OUGA 1UFLA 3H90A 2E5LF 1F2GA 3NGTA 1JLAB 2BJ7A 1H74A 4DR4J 2CVIA 1ZM9A 4QWAA 4ZIWA 3ZZTA 4CLTA 2UVUA 3EZUA 4HACB 3HSZA 3EJMA 4DPYA 4TNOA 2IAJB 2GMLA 4HR2A 1RHJB 4DV7F 3AB4B 4WKRA 3FUYA 2CPXA 4LF7J 1KP6A 3IMQJ 4Y3CA 2UV8G 2ZJPQ 2I1RA 1BQNA 2APOA 1GK8A 3HKZD 3K7RA 4OI0A 2OELA 3NG8A 4DU7A 3TQEA 5A8RB 4CM2A 1BD6A 1IKXB 4Q0BA 2KKHA 3CGIA 4F50A 3AQOA 4AYBD 3I0RA 1JKHB 2VL1A 3CJ8A 3ENQA 1WF1A 4WXOA 2KXNB 1DARA 1TQLA 5HLFB 3F56A 1N5YB 2F9DA 2W2OP 4C7QA 1O6XA 5K8MA 4HT7A 2JC0A 1QD1A 3ITHA 2E5IA 1M5OC 3M6UA 1VC0A 3TANA 3M2VB 1VYAA 3ZO7A 1NKBA 2DNZA 3HKWA 1VLYA 2DNGA 4RBTA 1WJ9A 3JQKA 4DR5F 2YXLA 3M9MB 2CPFA 1YX2A 2FZCB 4IRCA 1FCAA 5KFZA 2G0IA 2QT7A 2YNFB 4YFUA 3THVA 1KDNA 3M8WA 3HT3A 3L4BC 1FJ7A 4B17A 4LQ9A 3DRSA 2RDJA 4ZVTB 5D4OA 3I9V9 1PBAA 4G3IA 2L9WA 9ATCB 3D7SB 3H25A 1FRKA 5BXIA 4OJ1A 2L41A 2GJIA 3KLVA 4H4KA 1CJUB 1M0SA 1KLNA 2B9YA 1HNIB 4XDDA 4E98A 2CG8A 1SH0A 2IDLA 1VMBA 4ZVHA 2F8HA 1HQUB 3RG6A 1RE1B 3ETMA 3M2UB 2MQNA 2JL9A 2ZKUA 3CDWA 3G2XA 3R2CJ 2FVCA 1M1HA 5C42B 4LF6J 1VK3A 3KK3A 5DGBA 4UOGA 2DITA 4QYRA 3ZTRA 3HFKA 4J91A 2J7UA 3L09A 1RTDB 3P5TL 3MAHA 5EWGA 1P27B 3BSNA 5DRKA 5JUMA 3SCIE 2EFGA 2UXBJ 4TQSA 1WD6A 1MWQA 2CPIA 1YBAA 2OPSB 2CJ9A 1S6UA 2GNKA 3JTNA 2Z2MA 3C2PA 3TA2A 3KHGA 4JV5F 1P9YA 3HPOA 5IV3A 2J8AA 3DLKB 3BGOP 2M7SA 1F0XA 4HDGA 3G82B 5I3QA 4NLRA 3UR0A 1VGYA 2DBBA 4O3RA 2IC3B 2IA6A 4HHJA 1LEOA 4RZRA 3M05A 1UFKA 5LSRA 2V50A 5KFLA 4OI3A 5FDLA 1J5OA 3MD3A 5IQQA 4DR2F 1UWBB 1IKVA 3I31A 3QAEA 2N4CA 2F4FA 3LOUA 2VU5A 1FT8A 3G6YA 3U1NA 4ZJQA 3J7YI 3U27A 1EKSA 3UR3C 4DV2J 1S1TB 1WC0A 1X60A 4KC5A 1EIYB 4X4NA 3GR1A 4DR4F 2AGPA 2HKEA 4L3KA 3OLBA 2KFYA 2M0GB 1C0TA 2AEFA 4J9QA 2YNIA 2GQCA 4DPTA 1N6QA 2NXCA 4EEYA 2HIYA 4ELUA 4LF7F 2MMYA 4MK9A 3DLEB 2W9CA 2KHCA 3G8QA 2CYYA 1YDLA 1YJ9S 5J1EB 4QIFA 2OIHA 2MGZB 4WTYA 1R6YA 3M6VA 4DL0C 5GAEI 4ZHRB 4DXLA 1RAEB 3W2WB 4ELVA 1T9YA 4QJVA 4IO1A 4QU6A 2C42A 1T3NA 2IDEA 4X4PA 5DM7Q 1HQEB 1SB6A 3OFGA 3RUBL 1T3OA 1UETA 1H6KX 1TL7A 4EU0A 1UJ6A 1AFIA 3JXOA 3DOMB 3ZZ0A 5GAGI 1TV6A 1VIOA 1X8DA 1RBLA 4A8OA 2XMAA 2CNLB 1RAIB 3IBCB 2QLXA 3JQMA 2LQBA 4WK3A 1I1GA 5IM0A 2V8GA 3MI7X 1NO8A 4IFYA 2HNYB 1H7WA 4L76A 2BJDA 3A8IA 3TOQA 5LL6d 4PXBA 4KGVB 4WXWA 3V5RA 3BKFA 1S79A 3D0IE 1S7IA 5A2QY 4IDKB 2DRAA 4CH0S 3EZ5A 3HSGA 2LU2A 1JQGA 4PG6A 4EFAC 3UDEA 3CJ4A 4M5LA 2G13A 4O4GB 1QUPA 4X4OA 5HMXA 1ZA2B 4WIIA 1X4GA 1SXLA 4CLLA 4DN0A 3K5NA 2VPXB 1BQMB 3VGUA 4CDIA 4KRWA 2YNHB 3R27A 2IM1A 3MMAA 3Q8QB 2DHGA 4OYZA 3TAMB 2R2TA 4AL6A 2R42A 1NJXA 4WYLA 3IXQA 1OY8A 2ZHBA 1IR2A 4DV4F 5HQLA 5D0HA 2ZBCA 2MZ1A 1F5BA 5IC6B 3CCZA 4QZVB 2JWNA 2LDIA 2X1BA 4OYOA 3PZPA 4IOBA 2VASA 2VG6B 2CPJA 2HVDA 3N5FA 4USJC 4QU7A 1N0VC 4RUHA 2UXBF 1VQ6S 3DGPB 3RYLA 3Q0AA 3RBZA 3WQPA 3PYFA 1S6PB 3IWLA 4F2SA 1MROB 3TUJC 4IRDA 2R7TA 1UFWA 2PA3A 1RP5A 4NLVA 4I6AA 4KKOB 2M8DB 1Q82T 4CTAB 3TUIC 4NX9A 4NA2A 4AFFA 2CQHA 2KI2A 2CDQA 3HFVA 1D9AA 4XK8C 3MEGB 1RT4B 1N36J 3H42A 3LPYA 3OUYB 2HFSA 1T9TA 3DXSX 2E1PA 4DV2F 1ZZNA 2DRBA 3G6XA 1HLWA 1TTHB 3OL8A 4IR1A 3DDIA 1OPIA 4HTJA 5KAKA 3FK4A 4FBUA 1VR6A 2HMIB 3KK1A 5HP1B 5HO4A 4OYXA 1NBEB 2BW7A 3LAKA 4QBUA 5A6PA 1VBKA 4C8ZA 1S1WB 4IRKA 1K9MT 1U1QA 3UVJB 1QSLA 3EDRB 4F4WA 4F36A 2DB1A 2RS2A 4RW7A 4BDPA 4NXNF 2KT3A 1J27A 2N4DA 1LXNA 3R2DJ 1W7WA 5K14A 2ASDA 1FERA 1YI2S 1E6VA 4DFJA 4M8LA 1O5JA 2UVRA 3I82A 2G2YA 2HZAA 3ZTPA 2Y8WA 3IR7B 4WFAQ 4OHVA 2D3ZA 3UNGC 4KGXB 5A6WA 2CPYA 3MAAA 4DFMA 2BRKA 3HVTA 2GVDB 3OT9A 7FD1A 1Z4UA 2KM8C 5LMUF 1TL1A 4NLPA 3I5AA 5D6GA 1H0HB 2DNNA 3R5AA 4Q8FA 4OHXA 3H98A 3MDFA 1CLFA 1NHKL 4G1QA 1XMQJ 1LWFA 2CJBA 2C1EB 3CO9A 4PRFA 5E3AA 2WONB 3O6QA 2KU7A 1SH3A 2MYFA 2FVPA 4MK7A 2LXFA 4FNHA 3TEHB 1RA7A 2FVRA 3W7BA 3GFHA 4I2PA 4QIVA 1C0UA 1K1SA 2FJVA 5GAHI 4DSLA 3T9NA 1UZHA 1KSPA 2IY5B 1KR4A 2AJQA 4JI0J 1QY7A 3TJ9A 4GO7X 4B9MA 4ED7A 1RQ0A 1OIAA 4WE1A 1JJ2R 4RJVA 1DZ5A 3UPFA 2BZ2A 2J5AA 4KFBB 2C3MA 1R8BA 3RB6A 3OTDA 1MW7A 4K2XA 4EGLA 1M5SA 2BRLA 2VBXA 1NPRA 4QIWD 4DL4A 4ECQA 3K8WA 4EK2A 3D28A 4P52A 3MM7A 2BJEA 4DL3A 4QR0A 1SJ1A 3PR5B 5HJYA 3W8GA 1KFDA 3ISND 2OKQA 3CJSA 2NSBA 3QZ7A 5J2MB 4FPRA 4RW6B 3GCXP 4FXVA 1W26A 1FX2A 1IQZA 3VALA 3T1AA 5DZ6A 3H4BA 4XPEA 2HBQB 5EWEA 1RT2A 2B4OA 3LGNA 4CLKA 1NPPA 1PYTA 3SDEB 2ZC3A 3NGDA 1L3KA 1U2CA 1WORA 2XYHB 1KQGB 5D15A 4PQAA 2QG9B 2CVEA 3QNWB 3THPA 1X4HA 5L46A 1U1PA 3FSXA 2BE9B 5F41A 2HHWA 4JI4J 2ABYA 3MWBA 4P72A 2XNRA 3W9JA 3R7SB 4ED4A 2E9TA 4P6QA 4NLDA 3BBCA 1U1NA 2QYGA 4LF5J 5KFDA 2IBOA 5I3UB 2ATCB 2IPOB 1FDBA 3J7AN 5F8MA 3DLBA 1S4EA 2G0CA 1VQ7S 1SCJB 1GXUA 4RU9A 4DV5J 1HNWJ 2QFJA 1EJ7L 1QDUB 1H2VZ 3K57A 2WBRA 3D1QA 4TQRA 4OZLA 2NLWA 3NL0A 5KFUA 2LXIA 2CQ0A 2UUWA 3PX6A 2LXUA 3R5CA 1TL5A 1RKJA 3MEKA 5KFTA 1NLKL 2CQIA 1Q4RA 3UCZP 3EMTA 4O3OA 1BWEA 4O44A 5F3TA 4DLEA 1SIWB 2BJ1A 4USUA 5FIIA 1CULA 2AT1B 3MM9A 1ZZFA 1NNDA 1Y3KA 4ZCLA 2RMLA 1SKRA 4DS4A 3VGTA 1NDPA 4TU7A 4A8FA 3QZ8A 3C8YA 2E44A 1RADB 2BA9A 2CKWA 4YR3A 3M30A 5IXUA 2RH3A 3MUVP 1PYOB 1XMQF 1MWZA 2BYCA 1NSAA 2H4YB 4PWUA 5KT3A 1RTHA 5F0UA 2V4JB 5KFQA 5JMNA 3NMAA 4ILLA 4O3NA 2OSRA 2DNRA 5AXKA 3ZTSA 1R89A 3TVZA 5AT1B 4A8YA 2VC1A 1V3RA 3TX0A 1KQSR 2O01C 4DSKA 1RWMB 4PG4A 3GV8B 3OBIA 1BQNB 5A8WA 3S7RA 1T9WA 2WBMA 4NA1A 2LQ9A 5DG7A 1RUSA 5I4MA 4QR2A 2HNZA 2GO8A 4Q0BB 2HS3A 5C2CA 2XMVA 3H20A 2IMOA 2AMCB 3KG1A 2RRNA 4FYDA 1TELA 2LP4A 4OZ3A 1HMVA 3OL6A 3MM8B 1X5SA 2YKPA 1VC5A 3AB2B 1Z2LA 2K7JA 2UV8A 4CLPA 1TAQA 4OX8A 2MLXA 4Z37A 3ELHA 2EFOA 3CCRS 5KFAA 2FLPA 2L08A 4OX9J 3PYEA 1QJHA 2XC9A 3TVKA 1UVJA 3M32B 2A0FB 2ZBRA 4DPOA 4OQJA 4IYQA 2JEIA 1KTVA 2C3YA 3MXHP 3DLGA 2AQ4A 3VAMA 3MPVA 1AB8A 1S0NA 2PE8A 4C0HA 4DI6A 4M1KA 2G4BA 2QMWA 1YJWS 3N9UC 2OLWA 4X65F 1S1VA 1XK8A 4GKKJ 3GIJA 2QJ3A 3TUZC 2HQGA 2V8VA 4B3TJ 2DY1A 2Y1JA 2MEWA 1GNKA 4CLFA 3J81j 2LYVA 2XZDB 2GMHA 4LSLB 2PEHA 4IQXA 2OPRA 1ZTWA 2B9WA 3S8SA 2P9EA 3SZ2A 4CLYA 1KLMA 3KK3B 4K4XA 4DL6A 3I6PA 1RT6A 2FLOA 4LREA 3TX8A 1UKUA 3OTCA 3S6EA 4LF5F 1T0TV 2DYAA 4ZLNA 1EP4A 3CXCR 2YBVA 4DX8H 4PAAA 3VCDA 3CULA 3BKUA 3TP2A 3CUNA 1HNWF 4JYAF 3NWRA 2EKNA 2QC3A 4KGMA 4Q44A 3GP9A 1FHTA 1MMLA 5B08A 3VAJA 4CO1A 1NSQA 2MQMA 4CH7A 4I7FB 2OTLS 1KKHA 3MCNA 2ZH8A 1U6ZA 2KTQA 4OI2A 1N8RT 2QO3A 2EG1A 2YKMA 1R0AA 4URQU 5DJBA 2B4UA 3UI3A 2D9OA 2NPFA 4N8OA 3Q8VA 1J5OB 4LT6A 4ED8A 1YIJS 2L48A 2OFHX 1HI8A 5KG1A 4OYPA 2RQKA 3KXDA 1U0SA 2ZBIA 1CSJA 2BX6A 1S59A 2BJ9A 4LRCA 3IAM9 3T1HJ 4PEOA 2HAIA 2YKNB 1Q5VA 1YJTA 3K17A 3KJNB 4UUXA 4DQQA 1RTJA 1RYRA 3IFEA 4DHVA 4PG5A 2ZOGA 1VHIA 4V1Ak 1YQHA 1UMJA 3QYYA 5EWFA 2BQUA 5LM7E 2GX8A 2AX1A 2VG7A 4YB1P 1D1UA 1C0TB 3DYAA 5HL7Q 1JIHA 1PAEX 1N6QB 4NCAA 3T5LA 4KV8A 3GJTB 3RTVA 1OY9A 2R7SA 3BKTA 3D0HE 2W9CB 4HEA9 3QJJA 1YG0A 2H54B 1RHKB 1U25A 2HBZB 4X4VA 4OI6A 2ZKTA 1U1OA 4JV2A 3OHBA 1DURA 2MTLA 4DCOB 2O3DA 2ZVSA 2DCUB 2V8HA 4MKVA 1K1QA 1OQ6A 1IBCB 1F1BB 4U95A 2CZ4A 5KFOA 1M90T 4ER8A 1TL7B 3JAMY 1D0EA 2G2OA 1TV6B 4M63A 3KLFA 4WWSA 5ADZA 1H2UX 1X4EA 1FRXA 3QAUA 3ZZZA 1SQEA 4IFYB 3IO1A 3MEEA 2Z57B 1FKPB 3J7ZT 5JVGQ 3G9CA 1HD1A 2BW2A 2JEFA 4OX9F 3SCKE 4XO0A 2HGNA 3QWPA 2E9ZA 1HW8A 4DPUA 5FLXU 3OLAA 1RWWB 4G1PA 1YHQS 4AL7A 4XDCA 4WFBQ 1WG5A 4OYBA 1S4FA 1L3VA 2ZH3A 1R8HA 1T94A 2BE7D 3HD1A 1MSWD 1EB0A 3O1LA 3CD6S 2B0GA 4P75A 4GKKF 2DR5A 1J5EJ 1QSYA 3ADAC 1S6QA 4B3MJ 3M7VA 4RBVA 1Q8BA 3HI9A 3FCWA 1HA1A 1XN9A 4WP8A 1CS4A 1IQTA 1CG2A 2HWIA 4ZCMA 1HW9A 3HVRA 3KKFA 4RBUA 1ZM2A 3ENWA 2AYMA 3BGUA 2V94A 4EBDA 2E1RA 1X5TA 3RJMB 3G86A 1S1XB 3RRGA 2WVFA 3GILA 1YZ6A 3SIPB 4LQ3A 2M9KA 4FYWB 2M52A 2CZ9A 2ZDPA 3K8VA 1ZPVA 3A13A 4MH8A 2C2EA 3MR2A 2EC0A 4S0MA 3ICLA 1PKUA 4IO9Q 2KL8A 5IT9U 2VG5A 1KOOA 4CH1A 4N41A 1TUVA 2DGWA 3CE8A 2EXUA 3CIZA 2XY5A 4GMKA 2ZH9A 1PGZA 3AD7C 2YVSA 2DGXA 3M6XA 4ETXA 5J2NB 2AYGA 3C6UB 2GGPA 1F5CA 4I1TA 2GHWA 4R8UA 1ZTTA 4NLUA 1NDKA 3CDAA 3J81Y 3N0VA 1MU2B 3OXLA 3B54A 1A0OB 3JYTA 3Q8SB 2GHPA 2OI2A 1U49A 3R9LA 2AX0A 4KR0B 3QGGA 1YLXA 2E7WA 2XLJA 2VKRA 3NAIA 1HIYA 3DRPA 3HHLC 2LEAA 4AXJA 4UZCA 3BPSP 5HBMA 2MKSA 4ED0A 3EVOA 1VQOS 3MR6A 1N48A 4P2SA 2A6OA 1U02A 2E7XA 3DMJB 3C14A 3MM6A 2W7AA 2EFPA 2DR6A 3KLEA 3LA0A 2XHWA 2G1HA 3FQLA 2R2UA 4RW8B 3M8SA 4RW7B 2RF2A 4NLQA 3SXLA 2I2YA 3QT7A 5KT4A 2FVQA 1FE0A 2GIRA 3FFIA 5L1LA 2E1CA 2CWXA 1E6VB 1JLFA 1WG4A 2W8LA 2C2OB 2HSEB 3QLHA 5KFCA 5K8OA 1HBOA 2FHMA 2J6SA 1IBLJ 2WHOA 2F4VF 1K0TA 3MAAB 3HVTB 5T41A 3GZ7A 5F0WA 2H5JB 3T5HA 1XNQJ 1AA1B 2KJVA 4P7TA 1GEHA 4I0WA 2KO1A 1G3OA 2FJWA 5G4DA 4ALZA 4G1QB 5K8PA 3GIKA 1LWFB 1URNA 4X4SA 3FMBA 1P1LA 3BQ2A 2HVEA 4DV6J 3TQ1A 1NCLA 5DO2A 2B4VA 3IS9B 3Q86A 2HG4A 1HBNB 2EPIA 4RNHA 3BR8A 5KOXA 2YQ0A 3PDNA 3W1YC 5AXLA 4RPFA 3PV8A 3WIUA 4I2PB 5L38A 2DD8S 4J37A 4LR9A 2B3TB 4X62J 4LBPA 3GV5B 4G1IA 1B3TA 1IKYA 1HI1A 2ASJA 1N0UA 4UZBA 1J5EF 1BXNA 4B3MF 2R8IA 5THWA 3DLHA 5JJBA 4P71A 4WE1B 2R7VA 2ZE2A 4DUTA 1S9EB 1TP7A 4K4YA 5IV4A 1UWAA 2DIVA 2P6TA 1KEKA 1GMVA 4L72B 3CD0A 2K3KA 2V8DA 3FQKA 3E01A 4OJ3A 5KG6A 4GC6A 2PT0A 6AT1B 3NKYA 4LIWA 4BBYA 4DV0F 3L7OA 5IT4A 4I68A 5DG8A 3A12A 2ZC4A 3CCWA 3I4HX 5EX0A 3R5GA 4FF4A 3LGHA 3SSQA 2DH7A 3W66A 5ETSA 2ADBA 2XG8A 4OMFG 2R8GA 4C0OC 4M5GA 3G8TA 1T02A 3KLGA 3OJUA 3SCLE 2GVZA 2DT9A 2BDPA 3PM9A 3PO4A 2FDNA 2IM0A 4LF4J 4B9SA 3T6JA 2VKZG 1FESA 4QYZK 4K4WA 3FSYA 1QE1B 4ECSA 4LR7A 3I0SA 3FCHA 5L39A 2CQDA 4XAKA 1TFYA 1Z1ZA 2HHTA 4GVLA 1AUDA 2HHHF 7AT1B 2AZ1A 1Y11A 1U1MA 1UJ5A 3G8SA 2LQ5A 2NXJA 4ZDNA 3L7PA 2HZVA 3MZIA 5HROA 2P2CB 3UDCA 4F3MA 3CJ2A 1SJQA 4R25A 3Q22A 3NY0A 3QIPA 4J9VA 3QJPA 2KM8B 2GMJA 1FWKA 2MKKA 3IBWA 2J76E 3AFGA 1RTIA 1S76D 3IP0A 1JLBA 4NEZA 2WB1D 2A1BA 1AW0A 2HQFA 4EYHB 3R5JB 2Z8QA 1Q16B 2CQGA 3C46A 2OTJS 4Z7CA 4QR1A 3CJRA 2AYBA 3BN4A 4UOFA 1PJ7A 1HFEL 1RLCL 2R7RA 3FNNA 3GSIA 1NSKL 3LP2A 1PAUB 5KT2A 4O44B 3CJQA 4GKJJ 3W64A 3E51A 5HMZA 3MM9B 2DGUA 2BKOA 4DV3F 3V4MA 4QIGA 4DSJA 3V81A 1N54B 3GYNA 4ATNA 2QLJB 2IRYA 3OFHA 2EW9A 1S0OA 3QRRA 1JWWA 2YTCA 2DRDA 3VHQA 1MN7A 3M30B 4I6WA 2V8PA 2YNGB 2RS8A 3F73A 4M95A 2YKQA 3KLIA 4MFBA 2UP1A 2XI2A 2WW8A 3MF5A 2ZD1A 3OL7A 1X9WA 2XCAA 1YJNS 1HHQA 1YRTA 2PC6A 2FHJD 5KG3A 4NCGA 5A8WB 4DR3F 3C3LA 2RDDA 3FMWA 3P5BP 2RRBA 5H1SV 4C6AA 4LF1A 1B4SA 4DOZA 3O8WA 3UCGA 1Y9OA 3NWGA 2JRSA 4ICLB 2KHDA 3PJWA 4UOHA 5D0RA 2XS7A 1SC6A 4DSIA 2OPQA 1JK9B 2XZTB 2CJKA 3NBPB 3CCVS 5F8IA 5CCLA 1R43A 3J80U 1T9UA 5DDOC 1SPBP 4RWXA 3G87A 4HVZA 2E9RX 3AD9C 1IM4A 3R6LB 4DJBA 4NPOA 5KFBA 4O0IA 2RQMA 1XNRJ 3DOLA 2DJWA 2YQ1A 1SIZA 3D3CJ 3OPKA 5B09A 1YZ7A 1RT3A 5KG0A 3EICA 1OJ4A 5AE1A 2FZKB 1TU0B 1O0PA 5BYSA 3DRXA 3IC1A 1NK4A 3PX4A 2Y9HA 1S1VB 3GB0A 4DUYJ 3NGKA 4K7QA 1WDTA 4JP8A 3AXMA 1UA1A 1ZAXA 5F9LA 3X3UA 5DDPC 1UPMB 2OPRB 1NK0A 1RAHB 4KY3A 3PIPQ 4QPTA 3ENVA 2Y1IA 2VQEJ 1N33J 2VQFJ 1EARA 1DFDA 2FYXA 5D4PA 4FS2A 2FHJA 3QSIA 5ITHA 3IM8A 1MMDA 4FP9A 4R0EA 4DF8A 4P9SA 1YBTA 2KB2A 2VPZB 1TR0A 1VBXA 8AT1B 5T7LA 3QO9A 4GVBB 4FVCA 2KDOA 1V6HA 3CCSS 3CCTA 1WHWA 1U09A 4DR6J 4RKUC 1PC5A 2FY1A 5KFJA 4LFBJ 1DTTA 1WC5A 1T9VA 3OHAA 4RO0A 2BQRA 2KYZA 3W2VA 1R0AB 5D77A 3I55S 5IZHA 1IBKJ 5CZXA 2WZ1A 3D3BJ 1VQPS 4OYWA 2XULA 4JI5J 2PMHA 4GKJF 2DNMA 2WVCA 2X3GA 5MLCV 2VFUA 4C8MA 4J9LA 2FGOA 2CPDA 1IN0A 3BDEA 4TLQA 4EWTA 1TUWA 3MM5A 4URSA 1IBMJ 1KRPA 5DGAA 3I96A 4LVNP 4J9NA 2MLYA 4WCEQ 4J9RA 1VRTA 2O5DA 4AE5A 1KS2A 1Y5IB 4CLWA 2E5HA 2MXYA 4R5PA 1U6FA 2BUNA 1NSPA 2OMOA 2JOQA 3VAGA 4EBEA 2YPYA 2BOAA 2DNYA 1SV5A 1Y5LB 4W92B 2QRRA 1OMSA 1TMJA 3MPUB 3M8QA 2W2QP 4USTA 2JLEA 1V5IB 2PA8D 4KV8B 1IKWA 2MQ8A 2CRLA 4DR7J 1D3WA 2XI3A 2PSZA 3PKMA 1LK5A 3M1VA 3I56S 2JDJA 4KJIA 3VQTA 3HX9A 3DRYA 3ETOA 1HARA 3D54A 2Z2YB 4MAKA 1YKWA 5CHCB 4K0KJ 1F9EB 4UQTA 4RU2A 2VD3A 1VQNS 2CUYA 3OFFA 2AJ2A 1FD8A 1X4DA 4XTTA 4OJGA 5C7PA 5F8NA 3KLFB 2CG4A 1N4LA 4LFAJ 2WSFC 4HHHA 2XNQA 1DTQA 2VICA 3MEEB 1PYSB 3OSNA 1S97A 1YJ7A 4NCBA 4LUBA 2OPPA 2UVWA 3OD2A 2D3O1 1U26A 1XNRF 1WC1A 4IG3B 2HURA 3BDPA 4OV6A 1VFJA 1IR1A 1RBOB 4O3SA 2RAQA 3MECA 3M8PB 4WFYA 2WVDA 2LA4A 3IAS9 5A76A 1LV5A 4B3RJ 4DUYF 4LR8A 4TYAA 1S6QB 2CNNB 2QL5B 2V2ZA 3B78A 2KN4A 3TWZA 4JI6J 3R5DA 1NU4A 2RILA 1CS4B 3JTOA 4ZVPB 2K06A 2Z30B 3IM9A 2ROPA 2LEBA 2B9XA 5B0EA 2GIFA 2VQEF 3OVAA 1PSDA 5GADI 3NS6A 2DNQA 3ET6B 3TRGA 5BYRA 3DOKA 4G65A 5D4NA 2VBZA 3J7A1 3QQCD 1X4AA 3GIMA 4NYOA 2Z2ZA 3RAXA 3I9ZA 3PEJA 2XZWA 3VAIA 1D8ZA 3DU5A 1U8WA 2U2FA 2VG5B 1H72C 2H48B 1WWHA 3QBCA 3NCPA 3LWMA 2OMLA 2UUAJ 1KVKA 4HT5A 4Y6IA 5AXNA 4DR6F 3FZBA 1JLQB 3VVTA 4C0BA 5DLFA 4LFBF 2CJXB 1OYEA 1FF2A 2GGPB 5HQ8A 1IBKF 2ZITA 2PIIA 2RDIA 2QLBB 3CJ3A 4JI5F 1NEEA 2XY6A 1LKZA 3JYTB 4USMA 4DF4A 2Z56B 2YX1A 1JMTA 1JJ4A 4N7TA 3K89A 1VHFA 2Y0BB 3H5UA 2LQJA 1ZH5A 1IBMF 1X0PA 3OVBA 2D3UA 4PABA 2F8MA 1RHQB 2YX4A 2H3EB 5KFPA 3KJFB 4NMLA 3D6MB 5GVQA 1J2VA 3DRPB 2HFOA 2KFZA 1V3ZA 2FHOB 3VAHA 5HBMB 2WTFA 4WYWA 2XYPB 3SBMA 1AZSA 2M70A 4DQRA 1WNEA 4ZVRB 4KO0B 3WX4A 2ERRA 2E5JA 2WCXA 3MUMP 2M8HA 2QGFB 3KLEB 2B4PA 1SL2A 4F4KA 5I42A 1ZETA 1HI0P 1KOHA 2K1RB 2RF2B 2QFIA 1WEZA 3PEHA 2BKNA 3KNAA 4DR7F 5M2PA 3FFIB 2IIHA 4A48A 1CJVA 1NJIT 5HSPA 2W01A 2I9SA 1F6TA 3OXGA 3CD7A 1C1BA 4TLRA 3QLHB 2W25A 4UW2A 2CAJA 1HBOB 1WC3A 2MZJA 4K0KF 3PYDA 4JBCA 2BANA 5HVGA 4MTPA 3TJ8A 1WTBA 4M5DA 1N56A 4OHYA 2ZH1A 3K58A 1SC1B 1QTNB 2Q6CA 4Q5VA 3PYGA 1BLUA 2HQ3A 4LRDA 1C2PA 3FSIA 2KG0A 1YITS 2RU3A 3HFZB 3KNGA 1FO1A 2ILYA 4YQWA 3ISZA 3ONQA 1RT1A 1GX5A 3BV8A 3KUEA 3DHWC 1CJKB 1KD1T 4Q7AA 3W5YA 3D6FB 1P6TA 3CCUS 3GSDA 5KFXA 1HR0F 3O2IA 2YKAA 1MWYA 5IWAJ 3GV7B 2HGLA 4F7VA 2JFDA 3I5BA 4QWCA 2YNFA 2ASLA 4B3RF 2V9WA 5HATA 3HK2A 1Q8LA 2V68A 4OYIA 3A8EA 4FYXB 3HT0A 3H40A 1O8BA 2W8KA 1I94J 3TI0A 3TYTA 5EHHA 2ZVIA 4KT0C 2KH9A 5E3RA 5ETOA 2VPWB 2NXUA 2YX7A 2WVEA 4RUCA 3AHPA 1VRUB 3G6VA 3TR5A 1RJJA 5D0EA 3E01B 2ZHOA 4ED3A 1B0PA 2VC0A 3TZZA 2QSFA 1JNRB 3MMBA 3W5ZA 2LU1A 4D3GA 3M2UA 3FCVA 4Y2CA 4KHRA 4Z2XA 4HH0A 1WEYA 1JLCB 5C42A 5T14A 2XLIA 1FFWB 2JVOA 2O67A 3UO0A 2RIJA 2I5JA 2HEKA 4LIRA 4DX7A 3OFEA 3QRQA 1RTDA 2ZH2A 3W8PA 3ZZOA 3CMQA 4PUOA 5CYQA 4MKYA 4OX7A 2HVHA 5IC4B 5ETKA 2VODA 3HSDA 3AJ1A 2XB2D 4V19J 3R7NB 1VQMS 4Q2MA 4CRJA 1Q7YT 2QV6A 4DCPB 1RT7A 2OPSA 1F2HA 3TA0A 3I0SB 1RHUB 4ZMMA 4X4QA 4A8MP 5ETLA 1BUXA 4PYAA 4MT1A 4F4AA 3G82A 2A3JA 2IC3A 3HJVA 4NRUA 3BBBA 1R31A 3I87A 2FJXA 1L3TA 4YDDB 5HROB 3JSYA 2EFVA 4OFZA 2VONA 3D0GE 1YK9A 4Y2IA 4L74A 3U02A 2ZOFA 1DLOA 1Q7LB 4DUZJ 2XSJB 2KJWA 3QIPB 2H65B 3PJXA 1P8GA 4OYAA 3FBFA 1LFWA 1JX4A 3CPWR 2XCPA 4N8NA 2MY7A 2OSQA 2ZH6A 1RTIB 4QWEA 2H5IB 4AD6A 1JLBB 3O5TB 5SZTA 2XMUA 1IXKA 4ANCA 2CADA 3LP1A 2CQ2A 2JH3A 2FD2A 3CT9A 1OYDA 3ZZYA 4TN2A 3LP2B 4DV1J 4F8RA 3R1LA 2C2DA 3DI6B 2X7IA 4U6PA 2QMUB 4RX6A 4WF9Q 2VA3A 3CMAS 4YHHJ 4NEYA 2A10A 1DAXA 1NK8A 4MIAA 2P8IA 3OW2R 2ACMA 5J1EA 1PG5B 1WHYA 3BM7A 3V81B 2V2KA 3UN3A 4QYZJ 2XSFA 4DS5A 1HHTP 2IM3A 4JI8J 1G2EA 3K2YA 3B82A 2OFGX 3EPGA 4K5RA 2R3VA 2HRUA 3R5BA 4X64J 3R1HA 1TVRB 2EBEA 3VTIA 4ZIVA 3S1TA 1R8PA 1HQEA 1GX6A 1GH8A 3T41A 4DL7A 1EX8A 3PR4A 3M8RA 3KLIB 2FZGB 3V6HA 3NEKA 2LEPA 3C16A 4HL9A 1LWCA 3FGVA 2ZNYA 1VQSA 3KYLA 1C1CA 2IFXA 2MSSA 1ZM3A 3N01A 3JSBA 1XTZA 2DO4A 2XTJP 4NCGB 1MN9A 4DDFA 4A4JA 3QFHA 1FDNA 5A2QU 3FEYB 4ILMA 2ZOMA 2ZEJA 2EFQA 1TL4A 2L9NA 5E41A 2CQPA 3BSCA 4LBHA 4JI3J 3NAHA 4I56A 4FNIA 2BEFA 2HFZA 4O4GA 2MKJA 3P96A 2NZ4A 1NDLA 1FRMA 1Q95G 4LF6F 2DNLA 3CMES 2DNHA 1ULRA 1WF0A 4AXIA 3V6DA 1UVMA 2GW8A 3TAMA 4Q45A 1LW0A 1OS5A 5H9FK 1XIQA 3K5MA 2YH1A 1T11A 3PTWA 3EGZA 1M1KT 4X4RA 1YVFA 1WUUA 5GMDA 3KDOA 1RLDA 5CYMB 4NZ7A 2DCLA 2CPEA 4ILRA 1RT3B 3RB4A 2Z58B 2KXHA 2HK2A 4ZVQB 2P9GA 2J0XA 5F3ZA 3QGPA 1RXOB 4J9MA 1UVKA 3M4XA 1D8YA 1T9XA 3CC4S 3SQGA 1YRUA 3EDQB 2CFXA 5DLGA 3G71S 2BBEA 2CPHA 4OI4A 1FWLA 5ETRA 4BC9A 1T8EA 1S6PA 3S01A 1MROA 1Y4ZB 4OLOA 1CC8A 2Q1LA 3J7YU 2ZJRQ 1YSJA 5K5MA 4KKOA 4IUFA 3W62A 3H2LA 3OR1A 2C2NA 2VIHA 3BB5A 3IG1A 4QPXA 2OJ3A 2HHSA 3LW5C 4JB8B 2XS5A 2FJDB 4FDFA 1AUSL 1NB7A 4USWA 1RT4A 2MPUA 2MSTA 3EPIA 1WG1A 1RAFB 4FKXA 3VGVA 1EAYC 1QVGR 1U45A 2WW4A 3ZXWA 3RW6A 3KHLA 1F3FA 3Q2SC 3R6GB 1NH8A 1C4AA 5C25A 5G0RB 5IT0A 2CQ3A 4Q2LA 1N5VA 5B0AA 4WP9A 1DTTB 3KUGA 2B6AB 5KFEA 2HMIA 2CQBA 5HP1A 2XO6A 3W2VB 3MCMA 1D9DA 3MTKA 1S1WA 2IJFA 3A4TA 1QTMA 3UVJA 2F9JA 4DV1F 3MPWA 4KE5A 2LCWA 1IJEB 1IR0A 3DRRB 2ZJQQ 2RU9A 5ETPA 1TKXB 4W90B 3CTRA 4USVA 4MYTA 2IJRA 4QWDA 2L3MA 3R8YA 3NCRA 2YH0A 5L1IA 2ATLA 5GAGU 1KWMA 1VRTB 2IA0A 2HBRB 2HWHA 2XM3A 4JI8F 1M1GA 4A8WA 1XBWA 2IHR1 4AT1B 3NRBA 4DZDA 2M2BA 3CCLS 4DFKA 3W61A 2BACA 5B0BA 1LQ9A 3N28A 3HHNB 4L75A 3RB0A 3CC7S 3V4IB 3ZZPA 1W2BR 4Y00A 4PWWA 3M8QB 2CNOB 2YKOA 4YP3A 2E7VA 4USKA 2F65A 3D66A 2CZVC 3Q8PB 6FD1A 3PW4A 3EX7B 1SL1A 1IKWB 3SV3A 1JXLA 2WONA 1LWXA 1ZPWX 4F25A 3DLJA 4NLGA 2W4PA 3KHHA 2HVZA 3M1VB 3PACA 4NLYA 3AJ2A 2RHQB 3RB3A 2QA2A 2AZ3A 3T6BA 2KT2A 2Z4PA 3CDUA 1R7IA 4JI3F 1SL0A 3UDVA 2ALZA 4DN9A 2CPZA 4ZN3A 2PDAA 5DDQC 2B8PA 4FF1A 2AGOA 2OGUA 1Y0HA 3Q8RB 2DHXA 2BMBA 2DGSA 3IWXA 1RU1A 5J2PA 3QT5A 5DM6Q 2ZM6J 4C3MA 4ZPTR 3MHYA 1RSCA 2I6WA 1DTQB 2I8EA 3BGLA 4EMDA 3Q83A 2KRRA 3ZZRA 2NYHA 3OR2B 1JB0C 1U7LA 2BM1A 1VISA 1M5HA 3US5A 4WTOB 1K44A 2IVMA 3K5LA 1S48A 2EEYA 3H0PA 2RB7A 4MIBA 2DPJA 7FDRA 1JLGB 3AODA 1XWLA 4F26A 5J1PA 4RW9A 4CYUB 1NUEA 5HI7A 4DR5J 1UP1A 5DQHA 3CEDA 3VF0B 3SV4A 1NXIA 2LMIA 4RWWA 3HZGA 1BY9A 5B0GA 1Q79A 5GMEA 2GFFA 1S1UB 1PC4A 4PXDA 5HMYA 1VQ9S 3MD1A 4O0NA 1UVIA 5B7WA 3SDEA 2FLLA 4KH0B 2KG1A 2GV1A 1GT8A 1QVFR 1CC7A 2N3LA 1ZA1B 2MJNA 4U67Q 1CQNA 1N36F 1AXQA 3GONA 5EDWA 4A46A 1APSA 1VBZA 5B0FA 2F40A 3DOKB 3RBEA 1HHSA 3T5KA 3FRYA 1HPZB 3MPDA 2DR8A 2MKYA 3BEGB 2G2ZA 1CBKA 1YJUA 4M5MA 1DJ0A 4USIA 3C15A 2V0NA 1GQEA 3PKYA 3TAPA 2FUG9 4WU2A 2LLZA 4C3KA 5I3UA 1WC4A 3AOAA 4NOHA 2HLUA 3HM9A 4B9VA 4Q43A 1KQFB 2CXEA 5LT5A 3HHKA 4M5KA 3KJVB 1DQ9A 3NNCA 2JLGA 3MGJA 2NS1B 2MB0B 2EI5A 2GS8A 4JV5J 2O1PA 4CQ1A 3POTB 2DISA 4KBIA 2B5JB 2F5GA 1QLNA 4FYYB 2D7SA 1FJGJ 2R2SA 4M5NA 3BS9A 5EGYA 3ZC4A 1NKCA 2PI4A 2KXFA 1U1LA 1FKOB 3EGNA 4B9LA 1VDHA 4DPXA 1ZM4A 1UW4A 2RHSB 3OV7A 5KFWA 4B9UA 2FJBB 4IQMA 2EKYA 3LP0A 3DCAA 1AZSB 1FKAF 2ZBQA 2JHEA 3N5BA 3MUTP 1TMMA 2V69A 1X5PA 5D3GA 3FEXB 2OH2A 1M5KC 2CIMA 3D6HB 4J7CA 4NA3A 5I42B 4HI1A 5GAHU 5KFFA 3KOAA 2HS4A 4DEZA 3OTEA 4EZ6A 4IH7A 1NHUA 2WAQD 3SYZA 5JVHQ 4OJHA 4K4SA 2UXDJ 4O4RA 2VFRA 2GZOA 1ZYQA 2V4JA 1CJVB 3PO5A 1IUJA 4JI0F 3JS9A 1N32J 1VJQA 1VQLS 1C1BB 4CIOA 4TKTA 1U1RA 1UEVA 4HYKA 4MJKA 5BR8J 1WSVA 5KFVA 2ZWOA 1TFWA 5CABA 3KFWX 1SJ4P 3H5SA 1D09B 1B0VA 3I0RB 1I51B 1RWXB 2BANB 4M5DB 4AQYJ 1Q53A 2KZZA 4I67A 3GIIA 3FJ2A 2ZM6F 4ZN1A 1YWXA 3ITHB 3CD5A 3LQVA 2WK4A 1XMOJ 2ROEA 4K4TA 1Q8KA 1BHNA 3MM8A 3AJDA 1LFPA 4LJMA 3U1LA 2DGOA 5LOQA 4ECRA 4EO6A 4H4MA 2J7WA 2GHVC 1M5VC 1EETA 5KFGA 1GMWA 1RT1B 3QJLA 4FPIA 1AYEA 2DEJA 1FTRA 2JC1A 3PW0A 3DRSB 3HVAA 4AL5A 2WOMA 3L3CA 1F3VA 5H9EK 4J9PA 4KQZA 1UJ4A 3DDKA 1HBUA 3M32A 4CP5A 1L3SA 1G1XA 3DLLQ 3UCUP 3C6TA 3W9IA 3KMQA 4ZS6A 3D4JA 4ZJLA 4MK8A 2DIUA 3HSJA 1X0FA 1REGX 2QA4G 1UA0A 1YJRA 4DU8A 2NSCA 5LXYA 1YJVA 1XR7A 2PGCA 1U8SA 4CM0A 4FF3A 1H2TZ 4WPAA 4JI4F 4KYZA 2DHHA 1XERA 2Y3YA 4HHUA 2X1AA 3QGIA 1Q86T 3DC2A 3MMBB 4PR6A 4IFVA 4LSLA 3HLUA 1T03A 3K5PA 1M5PC 4QIEA 4ZP9A 3KK2A 2IM2A 5CQGA 4DV4J 2C22A 1YBUA 3R97A 4FXWA 4TY9A 1S5ZA 3PHEA 4CLUA 4DV5F 4LSNA 2I5JB 4P10A 3GJRB 4JV0A 1RT5A 4JUZA 1QUVA 1RU2A 4PUOB 2J0QD 5CYQB 4LBIA 4L73A 1ROFA 3QGHA 2RUGA 1O51A 1Q8IA 2CJQA 2AJ0A 3CB4A 1RT7B 2RNEA 3GYXB 4F4YA 3RGIA 3CDBA 4F04B 2N7CA 5L9NA 2AJ4A 5FDLB 4I7FA 3O44A 5KG7A 4WZMA 4YB5A 1X7VA 3ILOA 1B7YB 4UTGA 1IKVB 3MOJB 5CYJA 3BJYA 4NYZA 1FJGF 3KUHA 4BWJA 3AA9A 4ZVUB 3ILIA 2QX0A 2J9EA 3CJKA 4ZVEA 3BREA 2JVRA 5IOLA 2B56A 4NLOA 1KBRA 2XYGB 4EZ9A 1RYSA 1DLOB 5AE2A 1KHVA 1UAWA 1VI7A 4MMOA 2YWKA 2BE2A 2JEGA 2YKNA 2ZZTA 4IH6A 5M2UA 3RRHA 1RWOB 4YOEA 2R7UA 2NXNA 5CXTA 3JSMA 1NKEA 2YNIB 1SKUB 2UUTA 4FF2A 1F9FA 3VAKA 2UXDF 1U2RA 4P2XA 3LP1B 1HNXJ 4ZPCA 2AF6A 2YWEA 4RUAA 3M2RA 3RW7A 2R8KA 1N32F 4EI2A 1G6BA 1PO6A 1TKZA 5BR8F 3M6WA 2JNJA 4TY8A 4NXNJ 4YN3B 4ZJOA 1MG7A 5EX3A 4CLSA 1Q81T 2MY8A 4AQYF 2AJFE 1R3NA 2LFVA 3VR1A 4ED6A 2V4RA 3W9HA 1QM9A 3CF5Q 2W24A 2B9EA 4OZ2A 1XMOF 1WSRA 1I5OB 2BV3A 2E1AA 2VFTA 4LSZB 1WKKA 2MQLA 3H8YA 1KNZA 5IM0B 4UUWA 1GAOA 1DRZA 5HJXA 2ZFHA 1KQKA 2MLZA 5LMUJ 3FZ2A 2DR9A 2PFDA 4JOUA 2I38A 3JAMU 5LMNJ 1TL3A 3C16B 1LWCB 4I4BA 3BR9A 1C1CB 3AT1B 2OD6A 1SH2A 3GG1A 4CCHA 1R6VA 1FKPA 2W7PA 2Y8YA 3TEGA 1JJHA 4M5JA 1ITPA 4LF2A 2BJ3A 4ZK7M 4P74A 2XBPA 2H5EA 3CNQP 2DGQA 3P3DA 2XEXA 3CIMA 2VFVA 3BYPA 3UE2A 4GRSA 4B3TF 4CWBA 1G4CA 1B7FA 1JLEA 2BABA 2R9LA 3CDEA 3MMAB 1OY6A 1Z2ZA 5KFYA 1JXEA 1WHVA 3TJAA 1SJ3P 1HWLA 1SUQA 2WB4A 3VZIA 3CCQS 3P8BB 2VV5A 4Y65A 2ZUGA 3SI8A 3BO2A 1SQGA 2PN6A 1LOUA 4C11A 4B3OA 4PQUA 2BQ3A 3V6DB 3I5CA 1LW0B 2Z2LA 3BO3A 4ETZA 1CVJA 2IBKA 2KZMA 2HWTA 2HNDA 1RKIA 3NGRA 2M5YA 1S1XA 4KIAA 4YB6A 5KFIA 1S10A 4JI2J 2RD5C 3NGSA 1X31C 4NLXA 3WX8A 1BMQB 3CO0P 3PFEA 3PHTA 5LXRA 5B0DA 1FX4A 3MMJA 4V19X 3WHIA 4OHWA 3C19A 3OVSA 3UD4P 1VBYA 2D3OR 3RBXA 4KPCA 4WFNQ 2LECA 4PWDA 1GFWB 4P2FA 3BSAA 3SQGB 3DNCA 3PXGa 4ECXA 3LF0A 4QW8A 1Q0NA 4H4OA 3DM2A 2LVWA 1B70B 1RCXB 3TZWA 4J90A 5SUHA 3DFEA 4ZPVR 3IN5A 1SJRA 4FKYA 1VQYA 5J2NA 3KDNA 3C6UA 1NK5A 5ETVA 2V2VA 4TYBA 2OHDA 3J81U 3T1HF 5C24A 1MU2A 3OR1B 2A6MA 3IG1B 2F3JA 2XMMA 3GIRA 4C8LA 2U1AA 2CNKB 4Z7YA 3MTJA 1D9FA 3D5MA 1BGXT 3KK1B 3THTA 1R0CB 3SMZA 2RUSA 2YY3A 1KFSA 2DEIA 3A8KA 4X66J 4ZA1A 3TO8A 5C25B 1S9FA 4CO5A 5C2GA 2VA2A 2E5GA 2KVQE 5H9FJ 1HNXF 3IRWP 3CCJS 3DMJA 5K14B 5K8NA 1GTEA 4ZP6A 4GO5X 4RNFA 1HL6A 4LF9J 3MEDA 3OTBA 2NYIA 2PD1A 4A8QA 1G7CB 4DX6A 4RW8A 2LDYA 3NOCA 2PFFB 3HHLD 4ECWA 1TZ0A 4NI2A 4YR0A 2AYEA 3Q89A 4YB7A 4IOAQ 3QRPA 4U8VA 3ULHA 1TL1B 1DHMA 3E8OA 3MCOA 2J6TA 5AXMA 3PW2A 3P49B 4IKAA 1TKTA 4ZPDA 2JX2A 4F67A 3EZOA 5KFNA 2UUCJ 2VFSA 3LPEA 4IR9A 3H5YA 1P9QC 4LF8J 2FJAB 1HKAA 4WBFA 5LMNF 1B64A 4PKDB 5AE3A 3FEZA 3TA1A 1FE4A 4QCLA 4K50A 4E0DA 1FFSB 2EK6A 2C3UA 1S0MA 3R7BB 1C0UB 4HI2A 1SJFA 2WSCC 4ZPBA 2H51B 3IS9A 4USHA 1HBNA 2W1BA 4K4ZA 3V6JA 2ZHAA 3IRXA 1S7HA 3ISNC 2A2CA 2HRTA 2R2RA 2PI5A 1WEXA 2BXJA 1YGYA 1VQ5S 1SBRA 5D4LA 2GQ2A 4OLPA 2DY9A 3GQCA 2VUGA 3SCJE 5HN0A 2V6AA 2M4MA 4DR1J 1U48A 3CSKA 4ITSA 4NMXA 3HZEA 2Y1RI 2RKIA 5J2PB 1X4CA 3MM7B 5A8KA 3JB9k 2VBWA 3PW7A 1S9EA 5DETA 1Y3JA 4MYUA 2DGVA 2N3OA 1N34J 1TK0A 2L9DA 4ECTA 1XJWB 1K0VA 2EFNA 2Z0GA 1HNVA 5LSOA 3K59A 3W65A 4L3NA 1RWNB 4JI2F 2V63A 2VJUA 3PW5A 3IA0A 4RW9B 5E7OB 3HHLA 2HAFA 3VWSA 4PYDA 1RT2B 4D3HA 1N5SA 2FY8A 2IVFB 3CW2C 4I2QA 3D9BA 4ZP8A 1FRLA 2KRBA 2C3PA 1JNZB 2AWZA 4FN5A 1HNZJ 1DY3A 1WKLA 1VS3A 4ANDA 1V9OA 1NK9A 4FZVA 4ZLPA 4NYPA 1R8CA 3GYGA 3MFHA 5IFMA 5F8LA 2P6SA 4HH1A 4X65J 2OEJA 1LK7A 1QE1A 1T7PA 2AW0A 2HBYB 1H3DA 2YWFA 3T19A 4YDXA 1ZBTA 1NZ8A 1R0BG 1ZAWA 5DZ7A 2D1CA 2W4CA 1RACB 1S9GA 3I32A 4O3PA 1S12A 1CQMA 3M8YA 1FK9A 2DKOB 2X1FA 2NUHA 1E6YA 1IVZA 3MAQA 2X3DA 3MPYA 3WDOA 1EHWA 2DK2A 3C15B 4TU8A 1UVNA 5D8HB 4URGA 5K9FA 2CJYB 5KT7A 4X66F 4ZOSA 2JEJA 4B9TA 3EE3A 3DGVA 1TAUA 4WU3A 2W9AA 4B3SJ 2AEMA 4DX5A 2ZZNA 5DS7A 3GFXA 1T95A 1RTZA 2DXFA 3IR6B 2RVJA 2C2ZB 1WHXA 4JYAJ 1X9SA 2RQ4A 4KPYA 4LF9F 2ILZA 3RAMA 4O3QA 2M88A 1MLAA 4CT8A 2DO0A 4LRFA 1NK7A 4ID5A 3FBBA 1CULB 3N4WA 4ZPWR 1IBLF 1W2IA 4R0JA 4DQPA 1XNQF 2AGQA 2HYIB 4WKYA 3FDSA 2ROGA 3Q2TC 1NPKA 1BWVA 2UUCF 2MZQA 2SXLA 3DXBA 1RHRB 3DN9A 5HANA 4LF8F 3LP0B 3RR7A 2E29A 2MHEA 5ETQA 4DV6F 1PILA 1RTHB 3W5XA 1ACMB 1SQFA 5ETTA 5D3GB 1AT1B 1KVIA 5J2QA 4PPZA 3OJSA 2YNGA 4OL8A 1AROP 2GCFA 2V5HG 4XPCA 1HWJA 3PNIA 5RUBA 2WRMA 4X62F 1NK6A 3IGVA 1URRA 3Q24A 2HNZB 1BQXA 2UVVA 2MZSA 3A1YG 1FFGB 1MNEA 4BLGA 3H5XA 3QIDA 3BBFA 1VQKS 3W3SA 3K5OA 1FRJA 1HMVB 4YMEA 4DR1F 1ICEB 1FJCA 3KJQB 2POKA 3O3LA 3FRZA 2HHPA 2BJ8A 1V3SA 2DVIA 2K7KA 1H73A 2XO7A 2HQDA 3CCES 2IYGA 1GXLA 4ICLA 2XS2A 2FHKA 3JSRA 1N34F 3EM1A 4WFXA 5E0OA 4KB7A 5L9XA 2UXCJ 1PIEA 3H4DA 1CJTA 3DU6A 4C4WA 2J6UA 1PJ5A 4H4MB 3NBPA 1EETB 4LRBA 4ECVA 4FS1A 2B8QA 3MMCA 2ASYA 2B51A 4ZPAA 1X4BA 1SC3B 2MQPA 1HWIA 3PRBA 3BZQA 1IWAA 4M5IA 1PCAA 1N52B 1N5TA 2WOMB 3DLGB 4ES1A 3HD2A 1Q78A 1FVSA 4ZVFA 3GPAA 3K0JA 1HBUB 2DXDA 2K8GA 4LF4F 4CLZA 3GMGA 2KT5A 3N79A 3Q23A 1BC6A 1OO0B 4ANEA 3DKDA 2JLFA 1HNZF 4I6YA 1REVA 2QTWA 3C6TB 3HJFA 3BGRA 2GQQA 1WKJA 3HF5A 2AU0A 2ZZMA 4OV1A 2VOOA 1NM2A 4ZVOB 4UY8T 5KFSA 4U7UD 4N47A 4K4VA 4FBTA 2DPIA 4JI7J 3T3FA 2HPUA 2LA6A 4EYIB 1KLMB 4F3OA 1JXVA 2E66A 1L3UA 2H1YA 2VB6A 1KVJA 5A0YA 2ZDOA 1RT6B 4EO8A 2EC2A 3KG0A 4IFVB 4O23A 5HQMA 1R27B 1PBUA 1T03B 3SEOA 2FQQB 1EP4B 1FTCA 4NXMJ 2XY7A 4NASA 3KK2B 4NLTA 3B4MA 4FXDA 1F5AA 9RUBA 4LSNB 1UCNA 1CPZA 5CZVA 2QMXA 1T05A 4UF4A 1B0TA 1NAQA 1RT5B 3BQ0A 1KN6A 4DL5A 4J9KA 3QWUA 1VQ4S 4B02A 1NB2A 4B3SF 1RWUA 1KONA 3W60A 3EYZA 4ZITA 3D1HA 2EG2A 2YKMB 4GVBA 5KFMA 5DG9A 3CJ5A 2W4DA 2H9ZA 3GFZA 5AJ3J 4RNNA 4Y2MA 2CQ1A 4NWBA 3W63A 3UWTA 2MHNA 3Q8UA 5IS2A 3QSYB 2AKWB 4ZKAA 5H9EJ 5C5JA 1VK8A 4CNYA 2MJUA 3CJKB 1XEZA 1YTYA 1ZS6A 1S0VA 4G6VB 1RTJB 3GCWP 4N5SA 2ZUAA 2MQQA 4JV1A 4CO3A 4N56A 3PCOB 2YWGA 3GLJA 1N88A 4KH1B 4K2JA 3EVWA 1RI7A 4CT9A 2BE2B 5D0GA 4YR2A 2G1DA 2R7WA 1FNOA 1QAIA 2VG7B 3DYAB 2Y0SD 4A47A 3JSMB 4RW4A 3AH6A 5F8GA 3HO1A 2NCKL 2YWHA 3TAQA 2W2NP 3CVKA 2UUBJ 4EBCA 2NREA 1OSCA 4IG0A 5LJ3Y 3M2RB 1WOSA 3TNVA 2OD4A 1TKZB 4DCJB 3D6TB 1RAGB 4TY8B 3AOCA 4KHPJ 3NGUA 3FC9A 4C8YA 2O66A 2JSXA 2V67A 4PCQA 4RL1A 2HQIA 5CD4H 1IM6A 1QAXA 2F63A 4ERDA 2C2MB 2OO4A 2MKIA 1RBAA 2Q66A 3G6ES 2P5VA 5CH7B 5KFKA 4K4UA 2CQCA 4ZVSB 5E3QA 1CEZA 2F4VJ 2ZH7A 3UFCX 3A3NB 1RAOA 4J9UE 1TK5A 1UL3A 3KLHA 2UXCF 1VQ8S 1NJZA 4RNOA 3FBCA 3E3XA 3RZAA 2JFKA 5FLXY 1TL3B 1FA0A 1VJWA 2FPHX 3H2UB 3OTOJ 3NOGA 2IMWP 2CJAA 5E3CA 3H7HB 2BVZA 4OHZA 3IR5B 3KMSA 3PVXA 3GWCA 4DG1A 1YRXA 3FKBA 2NXEA 4B9NA 4IG3A 2KFNA 4BC7A 1KHWA 4WIQA 3MURP 4H54A 2WSEC 2W9BA 1JLEB 2QLFB 3M8PA 1RCOB 1A9NB 2F8EX 3QMQA 5B0CA 2EBGA 1UZDA 1Y00A 4JI7F 8ATCB 4CNZA 3AD8C 2HFUA 1SUQB 3RU0A 1WDDA 3G4SS 2QIFA 1Y5NB 2HHUA 1N33F 2HFVA 2EK1A 2ZNZA 3SQOP 3H2VE 3BH6B 5CD4A 2VQFF 4C11B 3WC0A 4B3OB 4PQUB 3SSSA 4Q8EA 5CA5A 1UPPA 3V2UC 2IYIA 6FDRA 1EQ0A 4NXMF 4OZNA 2J9DE 2HNDB 1A7GE 3U1MA 5I3PA 5EN1A 4DV0J 3ET6A 4YS2A 3TVYA 1Q5YA 2HFNA 5IT9Y 3A8JA 1HQ2A 2BKPA 2R7OA 1U47A 1LW2A 2R7XA 5L8RC 2IJNA 4ECZA 2QA4S 1HBMA 1LXJA 4OX6A 1FEEA 3LTOA 2X1GA 2YPZA 2J9CA 5KT5A 3IWNC 1MMNA 2P9CA 2C2RA 4P73A 3DHXA 3HULA 3J7Z5 4PWDB 3I4PA 4R8UB 1FI4A 5AJ3F 4NZ6A 5J1NA 3QT6A 1UTAA 1JLQA 4H4OB 2GJ2A 3DM2B 2A18A 4Y0FA 5E2QA 1U0HA 5DDRC 2R8HA 4KHMA 3QT8A 2D9PA 4DSFA 5L1KA 2R8JA 2ZH5A 2DHAA 2V9KA 3PX0A 3EWGA 4ZCIA 1LWEA 4NZ0A 1K8AT 5C24B 2RE1A 3HHEA 1Q1KA 4Y28C 4MIWA 4Y2KA 4GC7A 3LUYA 1FD2A 2D41A 2V2QA 2CA9A 1FNXH 2H4WB 1S77D 2NQPA 3EGVA 3NMRA 1LNQA 1W25A 1JJCB 2HHHJ 3U7JA 1NJWA 4DZ6A 1K73T 1HYSA 3C14B 3MM6B 3PIOQ 1SVDA 3NP5A 2ZBPA 3QATA 2PO4A 4ID8A 3BO4A 3PJ9A 1JLAA 4EUVA 3GU0A 4KO0A 2A2DA 2UUBF 3PY8A 5EUHA 3ZNJ1 3BPDA 4F3QA 3A3PB 1XMBA 3F41A 1JLFB 4HACA 1QAYA 2QLWA 3MEDB 5M2RA 4LVOP 2IAJA 4OI1A 1P1TA 4QW9A 1WC6A 1XR5A 2K1RA 4KHPF 3N6NA 2B7BB 4NI2B 5FD1A 2RJZA 1GTHA 2OEKA 2RSQA 5A8RA 2KYXA 1IKXA 4W98A 5D78A 1TKTB 2F7VA 4I69A 1DQAA 4LFAF 2B7CB 1JKHA 4DV3J 4KSEB 4CO4A 2ZWPA 2MKCA 1TKDA 1OWXA 5E33A 1OPZA 3KHRA 5HLFA 3BF4A 1N5YA 2XLKA 2QE5A 2VBYA 3MR3A 3UD5A 4IH5A 3EVMA 3IBFB 2CQ4A 3NNAA 3TUPA 3OTOF 3M2VA 4F0HA 2CWKA 5LSLA 3KG4A 1FDDA 2HGMA 4DFPA 3T9ZA 1S6OA 3BN7A 1BE4A 2QZ8A 2NZCA 1IKYB 5L1JA 1X5OA 1RWVB 8RUCA 5F8HA 3IRXB 2Q6BA 1CJKA 4UOCA 2FIUA 1RHMB 4DBQA 4M94A 1TUGB 2DNPA 4JI6F 2HRYA 4C2MA 2GA7A 2ZE2B 4DR3J 1VIXA 2AHOB 3RAQA 4LMZA 1DBDA 2VOPA 3V6KA 5GADU 4E2FB 4IOCQ 2DH9A 2RKIB 1CJUA 1WI8A 3AAWB 1HNIA 4P2MA 3PFOA 3BSOA 5A8KB 3WC2A 5MAOA 1HD0A 3VAFA 2EWHA 2LQ8A 1HQUA 2QEXS 1VRUA 2I0XA 4WP3A 2MQOA 3A3OB 1RWKB 1HNVB 4PG8A 2NPIA 4K5SA 1HWUA 3SFUA 2MZTA 3PRDA 2HHVA 3HHLB 3KLGB 4OZ0A 2UUAF 1FRIA 3TZXA 2GVZB 1RISA 1JLCA 2AV5A 2HS0A 2RQCA 4I2QB 4KGZB 3UW1A 3HCXA 4J9SA 4A8XA 1RAJA 4CO2A 3LALA 1NJYA 2K3IA 3Q8YA 1H7XA 4DL2A 4F0MA 2XMKA 3RBDA 2Q3PA 3WZ0A 4ED5A 4DLGA 3DLKA 4ECUA 4PZVA 2XMTA 4UT4A 1ZAVA 2XGPA 2ALYB 5BYQA 2FTRA 2C2KB 3JTPA 5DQGA 3LWLA 1GXTA 3UDLA 2Q43A 3L9ZA 3UD3P 1FXDA 4PXCA 3BYRA 1UWBA 1S9GB 2UU9J 1FK9B 3VVUA 2WVBA 1H38A 1E6YB 4QOTA 4ZVGA 5KG4A 1NHVA 1U2FA 4A8KA 2XQCA 1F60B 3NS5A 3TARA 4YUDA 2J8SA 2R4FA 1S1TA 2YWWA 2XSJA 4X84A 2HQCA 3OXFA 3NCQA 2XGQA 3C66A 4UQGA 5KTQA 4ED1A 1QSSA 4YY3J 2OP5A 2JZ5A 2AD9A 4MKBA 4U96A 3GE9A 1IJFB 3AXKA 3R3TA 2JJ4D 1RDRA 5U47A 4ID5B 4ES2A 5ETNA 4OYMA 4K8RA 1V5VA 3DLEA 5KFRA 3NLCA 1IWGA 1S49A 2MGZA 2VH7A 1PJ6A 1RZMA 5BJRA 3F44A 4ELTA 3DI6A 4ZHRA 1Y7PA 4KTQA 4LFCJ 2GJFA 2X51A 2J0WA 3W2WA 3OQ2A 3AY0A 3DDNA 1EZZB 2FGCA 3LH2S 3L7UA 3EUNA 4DSEA 4NE9C 4N76A 5IQ6A 5F9NA 4U8YA 3RR8A 4MFBB 4W4MA 2QN6B 2J9DA 2W2MP 4BHQA 3DOMA 5J2QB 2ZD1B 3OL9A 4NL5A 1FNMA 3B8HA 1FWPA 1TVRA 1FDAA 2YQ3A 1F9HA 2HNYA 3M9OB 4CO0A 4F02A 4Y34A 5IWAF 4TU9A 2QSWA 2DHSA 3BGFA 5GMKa 4XIUA 1FXRA 4U9RA 1L5UA 4IDKA 4M5HA 2FC8A 3KTQA 3NNHA 1RGVA 4BS2A 1I94F 3HXMA 2LKZA 1OQ3A 2XWXA 1RABB 1WELA 2FVSA 2OPQB 1K47A 1RAAB 4PPDA 2Y1LB 3TZYA 3D2WA 4U7CA 4C48A 3ZTOA 4ZP7A 1BQMA 5HVHA 2YNHA 3HMJG 4Y2AA 3CWJA 3B4DA 1NDCA 2VDIA 3J80Y 4X2BA 2C3OA 2G0JA 2AIRB 2RT3A 1CJTB 2W2PP 1FEHA 1I3OB 3P6YC 2PMZD 2K2PA 3HP6A 3D67A 2F1FA 3DOLB 4WJBA 4F0KA 4ZLLA 3MMCB 1VOMA 2QA1A 3EXCX 4NRTA 2Q79A 3HDSA 3SFGA 2RRAA 3PRVA 1FVQA 3LO3A 3MR5A 1ELOA 3L95X 1RK8A 2VG6A 1R8AA 4FVMA 1WTFA 3GJSB 3PG9A 1REVB 1OSDA 5CYMA 3DGPA 3ZZUA 3BGRB 1X4FA 2CDRB 1Y10A 5HK4A 1XR6A 1AFJA 4OZJA 4U7UK 4ES3A 2VPYB 1NMEB 2MDAA 1QAJA 2XMJA 4NLWA 3M9NB 2D74B 4A8SA 1GMUA 2PMWA 2J0SD 2NR0A 2KVIA 3LGMA 4CTAA 3D68A 2FLNA 5A0YB 4F4XA 3HVWA 4RR5A 1KTQA 4JI1J 4E8UA 5KG5A 2G9OA 3GR0A 2UU9F 2BM0A 1H98A 3ZFVA 4ENOA 4DUZF 3ILLA 1VLOA 3VQSA 3WIVA 3MEGA 4ED2A 4P7VA 3OUYA 4CZCA 2N7YA 3BH7B 5T7LB 1VC6A 3QO9B 2XMWA 2MKHA 1RB0A 1T05B 4RNMA 4X4TA 3F0NA 2E1MC 3MR7A 5HVFA 1EKRA 2DNKA 4YY3F 3SSRA 5GAEU 3MOZA 2VDHA 2DR7A 2OAUA 3CJTA 2VJVA 5G0RA 1I6JA 2BOPA
chains in the Genus database with same CATH topology
1RT6A 2B6AA 3QPIA 3HK2A 2FLOA 2ADCA 1Q8LA 1UEUA 3TX8A 4F4ZA 1UKUA 3OTCA 4YHHF 3A8EA 3S6EA 5LMNF 4LF5F 1B64A 3H40A 1U6BA 1O8BA 4PKDB 1DQ8A 2W8KA 1EP4A 3TI0A 2HZCA 5AE3A 3TYTA 3CXCR 3FEZA 3MM5B 4DX8H 5EHHA 3VCDA 4KT0C 2KH9A 2VZ9A 5E3RA 3TA1A 2VPWB 1FE4A 4QCLA 3CULA 2NXUA 2YX7A 4K50A 1C4CA 4RUCA 4E0DA 3AHPA 1VRUB 3TP2A 4LFCF 2EK6A 2C3UA 3G6VA 3CUNA 1HNWF 3TR5A 4PXEA 5KFHA 1S0MA 3DRRA 4JYAF 1S72S 1RJJA 1C0UB 1TKXA 4HI2A 2V4QA 1SJFA 3E01B 4KGMA 3D1OA 3RRKA 5KOWA 4Q44A 2WSCC 4ZPBA 4R5PB 2ZHOA 3IS9A 2NUUG 1A6LA 4USHA 4ZCKA 4X64F 1FHTA 1HBNA 1MMLA 5B08A 4ED3A 2B43A 1B0PA 2VC0A 3VAJA 4ECYA 4HKQA 1HWKA 2QSFA 5E3PA 4CO1A 2W7OA 4WK1A 3V6JA 1JNRB 4K4ZA 4DMZA 2ACYA 2ZHAA 2MQMA 3IRXA 4I7FB 4CH7A 2OTLS 3MMBA 1S7HA 2LU1A 1U6ZA 2A2CA 3ISNC 2ZH8A 2KTQA 1FXLA 4OI2A 1SV5B 4D3GA 2R2RA 2PI5A 3M2UA 1WEXA 4Y2CA 2BXJA 1N8RT 1U4BA 4UY85 2QO3A 1YGYA 2EG1A 2YKMA 1R0AA 4URQU 1SBRA 1VQ5S 4KHRA 1SKWA 4Z2XA 5DJBA 4HH0A 1WEYA 2B4UA 4OZ5A 1JLCB 5D4LA 3UI3A 2GQ2A 4OLPA 5C42A 3GQCA 4RW4B 2VUGA 3SCJE 5T14A 4C3LA 5HN0A 2D9OA 2NPFA 2XLIA 2ZH4A 2M4MA 3MFIA 4N8OA 1U48A 2JVOA 3CSKA 2O67A 4ITSA 3LAMA 1J5OB 4LT6A 4OIXA 4C8NA 3HZEA 4ED8A 1YIJS 2Y1RI 2L48A 2OFHX 2RIJA 2I5JA 1HI8A 1U24A 4LIRA 2RKIA 3V4IA 4WZQA 3OFEA 5KG1A 5J2PB 4IG0B 2RQKA 1RTDA 2FJEB 2ZH2A 3ZZOA 5JXSA 2ZBIA 1X4CA 1CSJA 3MM7B 5A8KA 4PUOA 3JB9k 2VBWA 3PW7A 1S9EA 5CYQA 2GIQA 4MKYA 4OX7A 5DETA 1Y3JA 4MYUA 3IAM9 2HVHA 2DGVA 4HDHA 1RA6A 2N3OA 2VODA 3AJ1A 2HAIA 2YKNB 1TK0A 2L9DA 2XB2D 4ECTA 4V19J 1VQMS 1YJTA 4Q2MA 4UUXA 4DQQA 1Q7YT 1RTJA 1RYRA 2DGTA 2QV6A 3IFEA 4X4UA 1RT7A 1K0VA 4GC6A 4DHVA 4RLEA 4PG5A 2ZOGA 2EFNA 2Z0GA 3UQSA 1HNVA 2OPSA 5HMWA 5LSOA 3OSPA 2HLTA 3K59A 1YQHA 4L3NA 3TA0A 2HHXA 1WI6A 1X9MA 2R7QA 3I0SB 4JI2F 3VZHA 4X4QA 4ZMMA 4YEAA 1UMJA 3QYYA 4A8MP 3PW5A 3IA0A 5EWFA 4RW9B 2BQUA 5E7OB 3HHLA 2GX8A 2AX1A 2VG7A 2A3JA 4YB1P 1D1UA 1C0TB 3DYAA 4PG7A 3VWSA 1RT2B 4D3HA 1N5QA 1N5SA 2IVFB 1U1KA 1SI9A 2IC3A 5E5NA 4I2QA 5HL7Q 2J7KA 3KWMA 1JIHA 4KFBA 4ZP8A 1N6QB 3EXYA 1FRLA 2KRBA 4NCAA 4NRUA 3CC2S 2C3PA 1JNZB 3T5LA 2AWZA 1R31A 3I87A 4KV8A 3KLHB 1L3TA 2FJXA 4YDDB 5HROB 3JSYA 4FN5A 4HTIA 3RTVA 2R7SA 2EFVA 1XC9A 4OFZA 2VONA 3D0GE 2AP6A 4Y2IA 3D0HE 2OPPB 2W9CB 1VS3A 4HEA9 3QJJA 1V9OA 1NK9A 4FZVA 3U02A 2ZOFA 4ZLPA 1DLOA 1YG0A 1Q7LB 1NRKA 2XSJB 2KJWA 1U25A 4NYPA 4BWMA 4X4VA 3AA8A 3QIPB 1R8CA 3PJXA 1P8GA 3LANA 2HHQA 3MFHA 2QYCA 5IFMA 2FC9A 1LFWA 4OI6A 2ZKTA 1U1OA 5F8LA 1JX4A 2P6SA 4HH1A 3CPWR 1KC8T 4JV2A 3OHBA 2XCPA 3OR2A 5J2MA 5DQIA 4RW6A 1DURA 1LK7A 3GFYA 1TK8A 4C9DA 4N8NA 2MY7A 2O3DA 3AQPA 2ZVSA 2HVIA 2OSQA 1QE1A 2ZH6A 2DCUB 3MECB 1SKSA 1RTIB 2AW0A 1T7PA 1H3DA 2YWFA 2V8HA 4QWEA 4DG1B 1JLBB 3T19A 3O5TB 4YDXA 5SZTA 4I64A 4F2RA 2XMUA 1IXKA 1ZBTA 1K1QA 1OQ6A 4L6V3 1WACA 2CZ4A 5KFOA 1JLGA 1M90T 3TW0A 1ZAWA 2D1CA 2W4CA 2CQ2A 2XWYA 3LP1A 2JH3A 4OZ1A 2FD2A 3JAMY 1D0EA 3CT9A 2MZRA 1S9GA 3I32A 4O3PA 1TV6B 2M3DA 1CQMA 4M63A 2W9BB 3KLFA 3GG0A 3ZZYA 1FK9A 2X1FA 5ADZA 1H2UX 4TN2A 3LP2B 1X4EA 1FRXA 2NUHA 4F8RA 1E6YA 3QAUA 3ZZZA 3MAQA 3R1LA 3MPYA 1SQEA 4IFYB 3WDOA 3IO1A 3DI6B 3MEEA 2C2DA 1FKPB 3J7ZT 4U6PA 5JVGQ 2EVZA 4RX6A 4WF9Q 3G9CA 2DK2A 1FJEB 4TU8A 1UVNA 5D8HB 2BW2A 2JEFA 1NZAA 2IRUA 1HD1A 4OX9F 4URGA 3SCKE 4XO0A 1S1UA 4AUKA 3CMAS 2VA3A 2HGNA 5K9FA 3QWPA 5KG2A 1HW8A 5KT7A 2E9ZA 4X66F 2A10A 4HLBA 4B08A 4ZOSA 2JEJA 4B9TA 3OLAA 1DAXA 1NK8A 1WF2A 4MIAA 4QWBA 4G1PA 1YHQS 3OW2R 5J1EA 1WHYA 3BM7A 3V81B 1TAUA 2V2KA 4WU3A 2W9AA 5FJ4A 2ZZNA 4DQSA 5DS7A 4AL7A 4XDCA 4WFBQ 1WG5A 1T95A 3GFXA 4QYZJ 2XSFA 4DS5A 1HHTP 2IM3A 4JI1F 1S4FA 3IR6B 2RVJA 1G2EA 1L3VA 1WHXA 4DQIA 2IVYA 2BR0A 3K2YA 3B82A 1X9SA 2RQ4A 2IRXA 4QQBA 4KPYA 2OFGX 2HIQA 3EPGA 4KGKA 4K5RA 4LF9F 2ILZA 3RAMA 2HRUA 3FVYA 3R5BA 2ZH3A 2FB0A 3R1HA 1TVRB 1ZOTA 1R8HA 1T94A 2EBEA 4K59A 3VTIA 5LJ5Y 2COLA 4O3QA 3H59A 2M88A 3S1TA 1R8PA 2DO0A 1HQEA 4CT8A 1NK7A 2UZAA 1MSWD 3O1LA 1GX6A 4ID5A 2B0GA 3CD6S 4GKKF 2DR5A 1GH8A 4DL7A 3N4WA 4J9OA 1QSYA 1S6QA 4ZPWR 1IBLF 4C8KA 3PR4A 3M8RA 4C97A 3KLIB 3V6HA 2DNOA 4RBVA 1LW2B 4BCAA 5F8JA 1Q8BA 1W2IA 2LEPA 3HI9A 1HPZA 4R0JA 4HL9A 1LWCA 1HBMB 1HA1A 1XN9A 2DTJA 3FGVA 2ZNYA 1VQSA 2GC8A 4DQPA 3KYLA 1XNQF 1C1CA 1IQTA 1CG2A 2HWIA 4ZCMA 2AGQA 1FRHA 2IFXA 2HYIB 1HW9A 4WKYA 2MSSA 1ZM3A 3FDSA 4H4KC 4C98A 2HW3A 2ROGA 3Q2TC 3HVRA 3KKFA 4RBUA 1ZM2A 3ENWA 3JSBA 3N01A 2AYMA 1XTZA 3BGUA 4NLSA 3CJ0A 2UUCF 2DO4A 2V94A 4EBDA 4NCGB 2E1RA 3X1LB 2MZQA 2SXLA 1X5TA 4MKAA 4DDFA 3DXBA 3DN9A 3G86A 4A4JA 1S1XB 3RRGA 4LF8F 3E2EA 3LP0B 3RR7A 1FDNA 2E29A 2MHEA 3FEYB 3GILA 3EGWB 4DV6F 2C28A 4ILMA 1NH7A 1PILA 2ZOMA 1RTHB 3WBZA 4LQ3A 5KT6A 2M9KA 2EFQA 2M52A 1TL4A 2ZDPA 3KJVA 2L9NA 5E41A 2DH8A 2CQPA 5D3GB 3K8VA 4J5OA 4KAIA 3BSCA 1KVIA 5J2QA 4PPZA 2N82B 1ZPVA 1LWEB 3OJSA 3NAHA 4I56A 1UVLA 4MH8A 2C2EA 3HHDA 3MR2A 4FNIA 2HFZA 2YNGA 2EC0A 4OL8A 3ICLA 3CCMS 1AROP 4N77A 4O4GA 4IO9Q 2GCFA 2V5HG 2MKJA 3P96A 4XPCA 4C8OA 3POTA 1HWJA 2VG5A 3PNIA 2NZ4A 1KOOA 4CH1A 4N41A 2WRMA 4X62F 3T1YF 1FRMA 1NK6A 2B5JA 1TUVA 2DGWA 3IGVA 1URRA 3CE8A 4LF6F 2AJ1A 1S99A 2DNLA 3CIZA 3BQ1A 3Q24A 2XY5A 2GO9A 3CMES 5CCMA 2DNHA 4GMKA 2ZH9A 1ULRA 3MCSA 1WF0A 1PGZA 4CI0B 2HNZB 1BQXA 3G96A 4AXIA 2UVVA 2YVSA 2MZSA 3A1YG 1FKOA 2DGXA 4WFZA 3V6DA 1UVMA 2GW8A 3TAMA 1MNEA 1LW0A 1OS5A 4Q45A 3T5JA 4DWIA 3M6XA 1HYSB 3N6MA 3H5XA 3IGNA 3QIDA 4ETXA 5J2NB 2AYGA 1VQKS 3N6LA 3C6UB 2GGPA 4TXSA 3K5MA 1F5CA 1UFLA 4I1TA 3W3SA 2GHWA 4R8UA 1ZTTA 3K5OA 4NLUA 2YH1A 1FRJA 3CDAA 3J81Y 1HMVB 3N0VA 2E5LF 1MU2B 4YMEA 4DR1F 1F2GA 3OXLA 1JLAB 3EGZA 1FJCA 1M1KT 4X4RA 3JYTA 2POKA 1YVFA 2CVIA 3O3LA 1ZM9A 3FRZA 2HHPA 4QWAA 1V3SA 2DVIA 2K7KA 3Q8SB 5CYMB 2XO7A 3ZZTA 2GHPA 3CCES 2IYGA 2DCLA 4NZ7A 2CPEA 4ILRA 1GXLA 1RT3B 1U49A 2UVUA 3EZUA 4ICLA 3RB4A 2XS2A 2KXHA 2AX0A 2FHKA 3QGGA 4KR0B 2E7WA 3JSRA 1N34F 2XLJA 2VKRA 2IAJB 4TNOA 2GMLA 3NAIA 4WFXA 4DV7F 5E0OA 3AB4B 2P9GA 4KB7A 5L9XA 2J0XA 3DRPA 3QGPA 5F3ZA 4WKRA 3HHLC 2LEAA 2CPXA 3H4DA 4J9MA 1UVKA 3DU6A 4C4WA 3M4XA 1D8YA 2J6UA 3CC4S 4AXJA 4Y3CA 5HBMA 2UV8G 3NBPA 4H4MB 3SQGA 2ZJPQ 1YRUA 1BQNA 2CFXA 1EETB 2APOA 2I1RA 2MKSA 4ED0A 5DLGA 3HKZD 3K7RA 4ECVA 3G71S 4FS1A 4OI0A 3NG8A 2BBEA 2CPHA 4OI4A 1VQOS 3MR6A 3MMCA 1N48A 5A8RB 4P2SA 2ASYA 2B51A 4BC9A 4ZPAA 1T8EA 1BD6A 1IKXB 1S6PA 4Q0BA 2KKHA 3CGIA 3S01A 2E7XA 4F50A 1X4BA 1MROA 1Y4ZB 2MQPA 3DMJB 1HWIA 4OLOA 3PRBA 3AQOA 3BZQA 3MM6A 4AYBD 2W7AA 3I0RA 1CC8A 2Q1LA 1N52B 1N5TA 2EFPA 2WOMB 3DLGB 3J7YU 3KLEA 4ES1A 2XHWA 1Q78A 2ZJRQ 1JKHB 2VL1A 1FVSA 3FQLA 4ZVFA 3ENQA 1YSJA 5K5MA 1WF1A 4KKOA 3K0JA 1HBUB 2K8GA 4IUFA 4LF4F 3GMGA 2KT5A 3N79A 4WXOA 2KXNB 3Q23A 1DARA 3H2LA 1TQLA 3OR1A 4RW8B 2R2UA 3M8SA 1BC6A 1OO0B 4RW7B 2RF2A 4NLQA 5HLFB 3F56A 3BB5A 3SXLA 3IG1A 1N5YB 2JLFA 1HNZF 2F9DA 4I6YA 4C7QA 2I2YA 1REVA 4QPXA 5KT4A 2OJ3A 2FVQA 2HHSA 5K8MA 1FE0A 2GIRA 3FFIA 3LW5C 5L1LA 2E1CA 3C6TB 4HT7A 2JC0A 2XS5A 3HJFA 2FJDB 3ITHA 3BGRA 2GQQA 2E5IA 1E6VB 1M5OC 3M6UA 1NB7A 1JLFA 1VC0A 1WG4A 3HF5A 3TANA 2AU0A 2ZZMA 3M2VB 4OV1A 2VOOA 2W8LA 1RT4A 2MPUA 2MSTA 3EPIA 1NKBA 3QLHA 4UY8T 5KFSA 1WG1A 2DNZA 3HKWA 1VLYA 2DNGA 4RBTA 5KFCA 4N47A 1QVGR 4K4VA 4FBTA 5K8OA 1U45A 1HBOA 4DR5F 2DPIA 2FHMA 3T3FA 2HPUA 3RW6A 2J6SA 3M9MB 2WHOA 2CPFA 2LA6A 3KHLA 4EYIB 2F4VF 1KLMB 1K0TA 3Q2SC 4IRCA 1FCAA 4F3OA 1NH8A 1C4AA 2E66A 3HVTB 5T41A 5KFZA 5C25A 3GZ7A 5G0RB 5IT0A 2CQ3A 1L3UA 2QT7A 2YNFB 4Q2LA 1N5VA 5F0WA 4YFUA 5B0AA 3THVA 3T5HA 1KVJA 2VB6A 3HT3A 1DTTB 5A0YA 2ZDOA 1RT6B 2B6AB 4EO8A 5KFEA 2HMIA 2CQBA 3KG0A 4IFVB 2KJVA 4P7TA 5HP1A 1FJ7A 4O23A 4B17A 1R27B 4LQ9A 3W2VB 3DRSA 2RDJA 1T03B 4I0WA 1D9DA 5D4OA 3I9V9 3SEOA 3MTKA 1S1WA 1EP4B 4G3IA 2KO1A 2L9WA 2IJFA 1FTCA 1G3OA 1QTMA 2XY7A 2FJWA 2F9JA 5G4DA 4DV1F 4ALZA 3KK2B 4G1QB 3H25A 5K8PA 4NLTA 3B4MA 3GIKA 1LWFB 3MPWA 1URNA 1FRKA 4OJ1A 4FXDA 4X4SA 1F5AA 3FMBA 1P1LA 2L41A 4KE5A 2LCWA 3BQ2A 1IJEB 4LSNB 3TQ1A 1IR0A 3DRRB 1CPZA 2GJIA 3KLVA 2RU9A 5DO2A 2ZJQQ 4H4KA 5CZVA 2QMXA 1M0SA 1TKXB 4W90B 1KLNA 3CTRA 1T05A 2B4VA 2B9YA 1B0TA 1NAQA 1RT5B 4MYTA 3BQ0A 3IS9B 1HNIB 4XDDA 4E98A 2HG4A 1KN6A 1HBNB 2EPIA 4DL5A 4RNHA 3BR8A 4QWDA 2L3MA 4J9KA 3QWUA 5KOXA 1VQ4S 3NCRA 4B02A 1SH0A 4B3SF 2YH0A 5L1IA 2ATLA 5GAGU 1VMBA 3PDNA 4ZVHA 1RWUA 2F8HA 5AXLA 1HQUB 1VRTB 1KONA 2IA0A 3EYZA 2HWHA 3D1HA 4JI8F 2EG2A 3M2UB 3PV8A 4A8WA 4I2PB 5L38A 1XBWA 2DD8S 2MQNA 2IHR1 2YKMB 2JL9A 4J37A 2ZKUA 3CDWA 3NRBA 2B3TB 2M2BA 3CCLS 5KFMA 5DG9A 2FVCA 3CJ5A 4DFKA 2W4DA 2H9ZA 3GFZA 5C42B 3GV5B 4G1IA 2BACA 4RNNA 1IKYA 4Y2MA 1VK3A 5B0BA 1LQ9A 1HI1A 2CQ1A 3KK3A 2ASJA 3N28A 1N0UA 3HHNB 4NWBA 5DGBA 3UWTA 1J5EF 3RB0A 3CC7S 2MHNA 2DITA 4QYRA 3V4IB 3ZZPA 4B3MF 2R8IA 5THWA 5IS2A 1W2BR 3HFKA 4Y00A 2J7UA 3DLHA 5JJBA 3L09A 1RTDB 4WE1B 4ZKAA 5H9EJ