1IN0A

Yajq protein (hi1034)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
b'PSFDIVSEITLHEVRNAVENANRVLSTRYDFRGVEAVIELNEKNETIKITTESDFQLEQLIEILIGSCIKRGIEHSSLDIPAESEHHGKLYSKEIKLKQGIETEMAKKITKLVKDSKIKVQTQIQGEQVRVTGKSRDDLQAVIQLVKSAELGQPFQFNNFRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YAJQ PROTEIN
publication title Crystal structure of the YajQ protein from Haemophilus influenzae reveals a tandem of RNP-like domains
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 53
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04461 DUF520 Protein of unknown function (DUF520)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1in0A01
3.30.70.990 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits YajQ-like, domain 2 1in0A02
2KHDA 1IN0A 2K3IA 5B7WA 2JZ5A
chains in the Genus database with same CATH superfamily
3QFHA 2VDHA 4G65A 4PG6A 4IDKA 1K1QA 3ZZRA 3HHLD 2G9OA 3PW0A 2R7OA 3O6QA 3DYAB 2A1BA 3PCOB 3P8BB 4M5DB 5C24A 1EJ7L 5KOXA 4KY3A 3SDEA 1N52B 2VA2A 1UWAA 4BS2A 2AJ2A 3RRKA 2FZCB 4N77A 2R8GA 1VDHA 3SEOA 5L9XA 7AT1B 2IJFA 3DLKA 4GO5X 1FKPB 3LGNA 4I67A 5F8IA 1I5OB 2YWKA 1HI8A 5T7LB 1NEEA 1LWXA 2CA9A 4KGXB 1HNXF 5D4LA 4PG4A 1DAXA 1E6YA 3LAMA 4ETZA 1BGXT 5CZVA 2RH3A 4QIFA 2BW2A 5DGBA 2X7IA 2AYEA 3NGTA 3HI9A 3TQ1A 4OX9J 3NGDA 1KWMA 4OI2A 2PO4A 3GJSB 3ZNUA 3TP2A 4WFNQ 3QWPA 2HQDA 1WORA 4KRWA 4O3OA 4C98A 3BM7A 1KLMB 1N36F 4LVOP 4JYAF 1S7HA 4C11B 4OI1A 3K8WA 2B9YA 2OD6A 1GMUA 1U1NA 2BR0A 1JJ2R 2XNQA 4ED0A 1BQNA 1RAIB 4ECTA 2D9PA 2YKPA 2CPXA 4CM0A 1ZZFA 4XDCA 3KLVA 1LV5A 3DOKA 1XMQF 4LFBF 2R8IA 2MSTA 4FNIA 4YR3A 2CVIA 3KG4A 4F4XA 3U1NA 4KGMA 5DDQC 3NWRA 3D9BA 2MZRA 4WFZA 2VBXA 3HJVA 1WC1A 2F7VA 1U1KA 1QUVA 1HNWF 1Y5LB 2JJ4D 1VBXA 3CJRA 5IWAJ 3PVXA 3VZIA 2C3MA 3V2UC 3M9OB 3IBCB 3T1AA 4N76A 3CCJS 3KLHB 3BSAA 5L1IA 2KJVA 3HHNB 4PXEA 1GXTA 2C28A 3EWGA 3M8WA 1T02A 2HS3A 1N5TA 1DQ8A 2ZHBA 4MFBA 4RLEA 2CQ3A 5E7OB 1OPZA 2OGUA 4C9DA 3H25A 4IG0A 4ECWA 2WW4A 2J7KA 1I94J 5SZTA 2AP6A 1IWGA 4OQJA 1A6LA 2JLGA 2HQ3A 2VFRA 1HI0P 1K9MT 3HJFA 4H4KC 4G1QA 3HXMA 2OMOA 4DSLA 3QIDA 4AE5A 1SUQA 1FDDA 3WC0A 1U0HA 4FF1A 2OAUA 2XI2A 1H38A 3W2WA 3IAS9 3WQPA 2UUAJ 4LF7J 2PFDA 4ECVA 3KK3B 4FKYA 3D6TB 4NE9C 4BCAA 1VQ9S 2F40A 2W9CA 1O5JA 1SH2A 5F8GA 4OYWA 4NCBA 3PNIA 2UXCJ 2FJVA 1FWLA 1W7WA 3H2VE 5J1NA 2V34A 3CO9A 1JLEB 2EBEA 2HWTA 4H4OA 5DETA 4RU9A 2XCAA 3ZZZA 2HS0A 4OYPA 3MM7A 3AT1B 3MM5B 2U2FA 1CLFA 1DJ0A 1N33F 4I2PA 2EVZA 3D1QA 3TX8A 1UWBB 1JJCB 2W2OP 1FJEB 2OHDA 2FDNA 1C1CA 1IXKA 1RTDA 2GO8A 4ERDA 5KT4A 2DGUA 2IAJA 1QTNB 3NS7B 3SCIE 4TU7A 4DL4A 1TV6A 3BBCA 5EX3A 1YKWA 4LRBA 5F9LA 3GB0A 5D0GA 1AUSL 3BSOA 1VQLS 2M4MA 2F8MA 3CJ0A 4WF9Q 3I4HX 4F7VA 1S10A 4O23A 2KT5A 1GX6A 4Y2MA 1RAHB 5IXUA 1BMQB 1F6TA 3FUYA 1U0SA 3OXGA 4UY8T 1RTZA 2HHQA 2WSCC 3J7A1 1WSVA 1TU0B 3AHPA 5THWA 3TJ9A 3KLIA 1MN7A 3WHIA 3KDOA 2X3DA 3GONA 1RHUB 4ANDA 2KG0A 5HMWA 3CSKA 5GVQA 2O66A 4QZVB 4DPWA 3N28A 2GS8A 3Q24A 5I42A 2LDYA 2M8HA 5HVFA 1I3OB 1UVIA 2F8HA 3KHHA 4N41A 1HBMB 2X51A 3G6VA 4HH1A 4ZVRB 2RMLA 1RT3B 5C42B 3GP9A 5JUMA 5K8MA 3GIMA 3QRQA 2X3GA 4JV5F 3MMJA 2JDJA 2K3IA 1R8BA 3EYZA 4LR8A 2QG9B 1UPMB 2MQQA 3MR7A 2JC0A 3SFGA 5L1JA 1U25A 1UL3A 4MIBA 1DLOB 1D9AA 3VGTA 2B4VA 1S9EA 2QLBB 2QZ8A 2HHHF 3M6XA 2I2YA 3OW2R 2CJXB 1RQ0A 4DFKA 3FZBA 3RUBL 5D77A 1PO6A 1FRHA 1U1RA 2JVRA 4U7CA 1RAEB 4OI4A 4B9UA 2HGNA 2OSQA 4W4MA 1Z1ZA 4YHHF 1Y11A 3BSCA 1QDUB 4QWDA 2D69A 3ET6B 4DJBA 4OMFG 3A8JA 5H9FK 3AQOA 2DNYA 2QX0A 1F2HA 2CADA 2XYGB 3UDEA 1CJKA 1FJGJ 3GYGA 2IYGA 2FJAB 2DHXA 3NWGA 5AXKA 2Q79A 2PSZA 3KNGA 2PC6A 2QO3A 3DMJB 3MFIA 3GIKA 4B9NA 1N6QA 5FLXY 4J9OA 3PTWA 3DRRB 3DN9A 1IKVB 2VONA 1FXLA 5I3PA 4V19X 4DCPB 4ZLLA 4X64F 2B8PA 2EPIA 3VAFA 2W24A 5HAOA 1RU2A 4OZ2A 2OTJS 2AIRB 2DRAA 4X4VA 1TK5A 3O1LA 1QM9A 4J9PA 3C6TB 3PYFA 3L9ZA 4NCAA 3MAAA 2ZKTA 3WX4A 2IIHA 1MROB 3HVRA 2WOMA 4LIWA 4BWMA 4P71A 3FFIB 4L75A 4RW9B 2VFTA 3WIVA 2A3JA 2UXBJ 1IR2A 2DHGA 3MEGB 4I56A 2LQBA 4HH0A 2JNJA 4DR7F 2V2KA 1RADB 4IUFA 1CEZA 2V6AA 1EQMA 2G1DA 4RX6A 2E1RA 1X9MA 1RXOB 1DTQB 3OV7A 3OLBA 2SXLA 4RW4A 2ACMA 2LQ8A 2HHVA 2AX0A 2HK3A 1I1GA 3NOGA 3A3OB 1GX5A 3KHRA 4B3OB 1GMWD 4ZVPB 4JBCA 4KBIA 4HHHA 2HHPA 2NUHA 3M8PA 4CTAB 4BDPA 1YTYA 1AT1B 1F9EB 4DSEA 2OPQB 2QEXS 1HI1A 2ZUGA 1KR4A 1TMJA 1S76D 1XR7A 4BBYA 4AXIA 3PFEA 3VTIA 4KB7A 2WBRA 1JLQB 2CAJA 2VF3A 1XIQA 4EUVA 1RT5B 5J2NA 3V6DA 2MKKA 3AB2B 3VV2B 3BGUA 5FIIA 1PJ7A 1LWCA 3D0HE 1X9SA 3MCMA 4K8RA 2VQFF 2ZDOA 3TYTA 4OZJA 1NKEA 3MEDA 4X2BA 1WG1A 3U27A 1X5SA 1IM4A 2NXEA 2LFVA 4ZP8A 2EFNA 9RUBA 3ILOA 5GMDA 3IR7B 1OY6A 1SC3B 4IH5A 2KN4A 4JI5F 2EC2A 1IKYA 2BANA 4A8MP 1VOMA 2A0FB 2CJKA 1TKDA 4OHVA 2MQMA 1VBYA 1X5OA 4NLXA 4YY3F 1M5KC 2ZE2B 3V81A 3BYRA 2ASYA 4KH0B 1VRUB 4PUOB 4NYPA 1SXLA 3NEKA 1MNEA 4GKJJ 3NBPA 1FFWB 3RBEA 3OR1A 4O0NA 4NI2A 4JI7J 1IR1A 3T41A 2KFNA 2FZKB 1IBCB 4DSIA 3HSDA 2LQ9A 3LPEA 3H90A 4KGVB 4RWXA 4J9KA 1ZS6A 1YQHA 3GR1A 1URNA 3RR7A 3P4UB 2Z2LA 1QSLA 1NSPA 4B3RF 4DV5J 3PFOA 3NS5A 4GKKJ 3RTVA 3MAQA 1T95A 3D67A 3EZUA 2MQPA 2VPYB 2ZWOA 3DGPA 4WYLA 3MMBA 4EYHB 1KQKA 3M4XA 3MF5A 2CPEA 1VQMS 4ICLB 1YZ7A 4FPIA 2GVZB 3NMAA 4FYDA 2ADCA 1GK8A 4DV7J 2UUBF 2GW8A 2Y1IA 3GSIA 1IWAA 4G3IA 3W8PA 1D8YA 2JHEA 1NDLA 2WW8A 3CGIA 1Q5VA 3VAJA 4YB1P 3G4SS 2Z2MA 4NLRA 1TAQA 4LF8J 4X4QA 1RAGB 1UFWA 2LEBA 1G6BA 1IR0A 5F8MA 4BC7A 4KAIA 3MR5A 3BGOP 1RT6A 3SI8A 5L8RC 2ZC3A 3CDUA 3BKUA 3UCGA 1XMBA 1ZM2A 3RRGA 5C5JA 4WFXA 2LXUA 2EWHA 3FQKA 5IOLA 4WCEQ 4DPYA 2VOPA 1IKXA 4DG1B 3VF0B 3U02A 4B9VA 4P2SA 3J7YU 1VLYA 1U8WA 3PW7A 4LF4J 4CYUB 4J5OA 4EWTA 4QQBA 1XTZA 2MZTA 1M1KT 3EUNA 4CH1A 3OJUA 3K5PA 5D0EA 3O3LA 3KK2B 4FS1A 1SIZA 5KFAA 3AJ1A 1Q86T 3DCAA 2EC0A 1VRTA 5H1SV 3FEXB 3MI7X 4HTJA 4XO0A 2YNHB 2A2DA 7FD1A 3IR5B 4ER8A 3NNAA 2DY1A 1R3NA 3VGUA 2VG5A 3G8SA 1YHQS 5JVGQ 2HFVA 4IRDA 5CAAA 1V5IB 2DK2A 3UPFA 2E29A 3D68A 2AMCB 3LP2A 1RT2B 1VQSA 5CYQB 3LP1B 3SQGB 3KJQB 2GJIA 2KL8A 2HNYA 4OX9F 3TZXA 3ZC4A 4WKRA 3ISNC 3TA1A 3CPWR 2CDQA 2EFPA 2ZVIA 2JEJA 3EVOA 1MU2A 3IGVA 4OV1A 1HMVA 2DNOA 5HQMA 3GIRA 4P2XA 2KRBA 2V9KA 1S0OA 1KVJA 1M0SA 2XMVA 1YIJS 1V3RA 3WIUA 2KM8C 3MPYA 4DBQA 1M5PC 4NLYA 2V4QA 3OR2B 1CJTB 1S79A 9ATCB 1WC5A 1NK6A 5KT5A 2AJFE 2YKMA 1ACMB 3TEGA 3LWMA 1FE4A 1LK5A 5FDLB 4GVLA 2RILA 2IRXA 1FRLA 3DLGA 3T9NA 4C6AA 2QA1A 3JSMB 2LQJA 2QT7A 2L3MA 3OFEA 1SIWB 2MEWA 1K0VA 2E5IA 2R7QA 4PRFA 1BQMA 2DO0A 1XR6A 2XB2D 1UVNA 1N54B 5HMZA 4O3RA 2H9ZA 2NLWA 3P96A 4ZIWA 2FC9A 4IOCQ 4I6YA 1HLWA 4ECXA 1S1WA 2EFVA 5IWAF 3C6UA 4X84A 4RBTA 2A18A 4RNHA 3VGSA 3UD3P 3CJ2A 3DRSA 2ADBA 4DPXA 2ZBIA 1M90T 2Z2ZA 3TX0A 4ZJQA 2EFGA 1T11A 3UW1A 3M8RA 2VOOA 1S7IA 2OIHA 3AD9C 3MURP 3IGNA 4UOFA 1F3VA 2GIFA 4DQSA 4USWA 5C2GA 2I0XA 4HHUA 4Z37A 4C4WA 2R3VA 1I94F 3FBBA 2HEKA 4ZJOA 4OHZA 2UVWA 1RTHB 3ZTSA 2AJ1A 3G9CA 5KFXA 4CM2A 4LSLA 4ZIVA 1L3KA 4PYAA 3OPKA 3V4IA 5HMXA 3K7RA 4JUZA 4MTPA 1HBOA 2YH1A 1G7CB 2KRRA 1RAJA 1UAWA 4F0MA 1RYRA 2GX8A 1TFWA 3I87A 2UUAF 1KLNA 4LF7F 2UP1A 2GZOA 4ED6A 2HURA 4DPTA 2MGZA 2CQBA 4DR4J 4IOAQ 4NRTA 2C3UA 3C15B 2HAFA 3J81j 2DD8S 2UXCF 3N5BA 4LBHA 3LF0A 4YR2A 4DL3A 2FJBB 4O0IA 4RW7B 3HHEA 2K1RA 3RBDA 2BX6A 1PSDA 1EB0A 2M5YA 5KT7A 3T5JA 3QIPA 3FRZA 4AD6A 4CLLA 1WI8A 3RAXA 2ACYA 1DTTA 2LXFA 1N4LA 2I5JA 1X31C 2M70A 4QYZK 2VODA 2HBYB 2HMIA 3UNGC 4X4OA 2W25A 3QFWA 1PAEX 3MR6A 2HQCA 4NXNJ 3M2RB 4IRCA 3M1VA 1S9GB 4OHXA 3LGHA 3UCUP 5AE2A 3CCMS 1FRMA 4I6AA 1UW4A 3TAPA 3NGKA 4WTOB 1ZPWX 3QGIA 4I2QA 1XC9A 3OJSA 3MM9B 3GFZA 2VG7A 1LW0B 4ZCMA 3GE9A 3BKFA 3MPWA 3UWTA 2DYAA 1RA7A 1M5SA 1TP7A 1LXNA 2RSQA 4K50A 1AFJA 2YNIB 1HWLA 4P7VA 2BJ9A 5DDRC 5HLFB 1OY8A 2XM3A 1CG2A 3AFGA 1ZTTA 4DQIA 1YJTA 3K59A 2QFJA 1QAYA 4RW6A 5ETQA 1NBEB 1KOOA 2HNDB 4KO0A 1NB2A 5KFQA 2Q66A 3HVTA 2XMTA 2BKPA 1FNXH 2HWHA 1V5VA 1UZDA 1UZHA 1YRUA 3TO8A 3QO9A 2BE2A 4U9RA 1NKCA 2DNLA 1HWIA 4LF9J 4IDKB 4M5HA 1VBKA 2QC3A 5HBMA 4IR9A 3PXGa 1VJWA 4TNOA 2ZITA 4CT9A 5D0RA 3K2YA 2BRKA 3OTOJ 1BUXA 5C24B 4C8MA 2VFVA 1RABB 1OYEA 2BJ7A 4LFCJ 3M2VA 3IS9A 3NL0A 4PQUA 2ZVSA 3BBBA 4K0KJ 3MZIA 1RACB 1RE1B 2ATLA 2JEIA 2HGLA 4QU6A 3FZ2A 1GEHA 4B9TA 1X5TA 3DC2A 1FKOA 4K7QA 2QL7B 3F73A 1VRQC 3HSZA 3UDCA 1GXLA 4I68A 4TVAB 1K73T 3M8QA 4ZN3A 1NHKL 3DHWC 3CIZA 3DM2A 2L9WA 2Z0GA 1WOOA 1N5YB 2QN6B 3AXKA 3RR8A 3Q89A 1FJGF 3U1LA 1AA1B 3LTOA 3CMQA 1P27B 2KB2A 1UEVA 1HHQA 3I31A 5E3QA 1NJWA 4YR0A 1MN9A 3ELHA 3Q83A 1TELA 3FC9A 1QSSA 3T1HJ 4A47A 3HF5A 1FRJA 3HKZD 2AJ0A 4RUBA 2HSEB 4ZDNA 1RAOA 4F50A 4YDXA 4CH0S 1VCTA 1HPZA 1ELOA 4ED1A 1OYDA 1U2CA 2AGQA 3T3FA 5B0GA 4LF6J 1RWUA 4ZCIA 1JLGA 3POTA 1YRTA 4ZPTR 4DL0C 1DZ5A 1BQNB 1R89A 1JLAA 1YJUA 2ZBQA 3M9MB 2KT3A 5KFWA 4ZLPA 2FY1A 2B4PA 2BDPA 3UO0A 2DR8A 3FQLA 3ADAC 1N8RT 1RB0A 3AQPA 4RWWA 1OMSA 2C2DA 1Y9OA 3WZ0A 3LWLA 2OP5A 3R8YA 2OEJA 1ZAXA 2DB1A 2X1GA 3KJVA 2UXBF 4DQQA 2CQGA 1NU4A 3LP0A 4DR6J 1ZBTA 2FIUA 2HPUA 1T9UA 4HDGA 1IUJA 3LH2S 1WHVA 2WB1D 3BQ0A 1EKRA 1CJVA 2QJ3A 4Y00A 2ZZMA 3V5RA 3KHLA 1IQZA 2ZBCA 2WCXA 3HD2A 2DXFA 3CCVS 1P1LA 4F4KA 2D3ZA 4NCGA 4ES2A 4MFBB 4QPXA 4RKUC 3QT5A 3P6YC 4IG0B 4JI2F 4FXVA 2CG4A 2ZH5A 4NLWA 5LT5A 2GJFA 3NG8A 1ZETA 4G1QB 2IVMA 4WZQA 2G13A 4M94A 1Q53A 2E7XA 4IKAA 1SUQB 1X5PA 4LFAJ 1LW2A 1NHUA 2NREA 4M5LA 1U0HB 1PBAA 1VMBA 1FTCA 3E8OA 3K5NA 3IA0A 3R27A 3TNVA 4C8NA 5HROA 3PJXA 3IWLA 5KOWA 4M5GA 2W9CB 3R2CJ 3D0GE 4A4JA 3TVYA 2GIRA 5GADU 4OYOA 2E9TA 5DQGA 2B5JA 1UA1A 4ID8A 2QYCA 2FUG9 4QR0A 5LSOA 1RA6A 3EICA 3KUGA 2LDIA 3X3UA 1SI9A 2H5JB 2DNMA 1K0TA 3MM7B 1NSQA 3TOQA 4CLWA 3UCZP 1YJVA 3H5UA 4L74A 3QZ8A 4I2PB 1XEZA 5LMUJ 3RYLA 1JLBA 1O6XA 3MAHA 4KPYA 5IM0A 2V4RA 1HHSA 1C1CB 2UU9F 1WG4A 2RUGA 1X60A 2R2SA 1RTDB 4J91A 2IAJB 2AQ4A 3CT9A 4G6VB 4ZPAA 1VQOS 5LJ3Y 2F65A 4CT8A 1TV6B 3O44A 3R2DJ 1JK9B 4Y3CA 2GVDA 5HMYA 2DNHA 1RGVA 3EXCX 1FRIA 4DV5F 4GKKF 2CNNB 1JLCA 4A46A 5CD4H 3ZZYA 2WONA 2NCKL 1S0MA 4C3KA 1YJ9S 4OI0A 2HQIA 2BQ3A 2XHWA 1UVMA 4F67A 5DZ6A 3TEHB 1PJ6A 4Q44A 3PM9A 1P6TA 3FCVA 1C0TB 1DQAA 4TYBA 1SH3A 4ED8A 3T5HA 4ZVEA 1WUUA 1TVRA 3MOJB 3CCWA 3T6JA 4DV7F 1S72S 5EX0A 3FEZA 3G71S 4O4GB 4OX8A 5FJ4A 1EIYB 3GJTB 2CYYA 2BA9A 1H6KX 5CZXA 1H0HB 1AFIA 4LF8F 2CQ4A 3A3NB 3PRBA 2MYFA 2J6UA 4GC6A 1RTIA 3QPIA 3EX7B 1OIAA 2Y1LB 2VIHA 2MKCA 2IVFB 1G4CA 2KTQA 3JB9k 4ZHRA 2KDOA 3GV5B 3J80U 3C3LA 1WDDA 4HEA9 3CJKB 3WDOA 2KYXA 5E3RA 1FO1A 4LF4F 4FF3A 1Q95G 4UOHA 4OJ3A 4ES3A 3IC1A 4DR3J 1S0NA 4ED4A 1IJEB 4B3MF 2OD4A 3KG1A 3QMQA 2CXEA 3D3BJ 2DNKA 4C2MA 3H42A 1HNWJ 4DSFA 4J9SA 2X1FA 2BMBA 4CWBA 2PEHA 3DOLA 3UVJA 3KNAA 1B0VA 2BQRA 1GQEA 2I38A 2HFUA 3RB4A 4LJMA 2LEPA 3BQ1A 3KHGA 1KONA 5DDOC 4E0DA 4OX7A 1FRXA 4TY8A 5RUBA 4NYZA 2HVZA 1CJKB 3C46A 1L5UA 4M8LA 3ZO7A 4TXSA 2BJ8A 3I32A 2YKOA 2DVIA 5K8PA 2MKYA 4KGZB 3DDKA 4RBVA 3NCPA 3VQTA 3TWZA 4DZ6A 2H1YA 2WTFA 1REVA 3HHLC 4X4RA 1UEKA 4ZPVR 2KHDA 2JLEA 1B0PA 2V2QA 1RCOB 3HFZB 4ZVTB 2CPYA 3KKFA 4KKOA 1WKJA 1HNVB 3ETMA 3GLJA 5B09A 1LXJA 1N0VC 4MKYA 5E41A 4O3PA 3PEJA 1D3WA 1SV5A 1HQEA 3JAMU 2VH7A 4BLGA 2V2VA 2XMMA 1NK4A 2PDAA 4UW2A 3N4WA 3GFYA 4R8UB 3CJ8A 1RP5A 4CO5A 5M2UA 4UUXA 2MJNA 1M5VC 1VQ6S 3ZZTA 2HHUA 1VBZA 3CXCR 1RWVB 2WOMB 1JWWA 3W5YA 2CG8A 4OLOA 2C2EA 1MW7A 1FCAA 1VISA 1PC4A 2XGPA 4DU7A 2HBQB 4JI0J 3GIJA 4DL6A 4FYVB 4NXMJ 3G87A 4FN5A 2X1AA 4P9SA 1IKWA 3KWMA 1FD2A 3ZTQA 3W9IA 1RT1A 4CLUA 1Y00A 1I6JA 4NX9A 4B9SA 1QAXA 4OX6A 3FBEA 5GAGU 2IBKA 4LQ3A 1RZMA 2LQ5A 4Q0BA 5IC4B 4HDHA 4NLOA 1NHVA 3ZTRA 1S49A 2YX1A 1FK9B 3CDWA 2B7CB 3QJJA 1WJ9A 3M8PB 4CH7A 4DCOB 2CPZA 1QLNA 2ATCB 4ZVHA 4URQU 2XMAA 4DF4A 4FKXA 3W62A 3BO2A 1N34J 2H65B 2DH8A 1R7IA 2EXUA 1HNZJ 5KG7A 2RRBA 4ZVUB 3MHYA 2KT2A 5H9FJ 2OTLS 4U7UD 2DR7A 3L3CA 4F2RA 3TAQA 5J2NB 4KFBA 1B0TA 3V6DB 3BR9A 4LUBA 3PW2A 1LWCB 1WDTA 1P9QC 3MEDB 4NYOA 4K59A 2AJ4A 3SCLE 4DR4F 1RT4A 2UUTA 3RU0A 5KG2A 2E1MC 1R6VA 4N8OA 4NL5A 3A13A 1IKYB 3W1YC 2BANB 4M5JA 3H7HB 5E0OA 3KXDA 5HVGA 1I51B 1KRPA 2MJUA 3H5YA 2J8AA 4MYTA 3U7JA 4I0WA 4A48A 1Q1KA 4KR0B 4X4PA 1OQ3A 2DNRA 3OTBA 5IT9Y 5D4NA 3DLEA 5ETOA 4X62J 2AF6A 2W4DA 1S5ZA 5BJRA 5CQGA 2NS1B 2XGQA 5C7PA 4RNFA 3NBPB 5B0CA 2B6AA 3OR1B 1FERA 2QSFA 3AJ2A 4NI2B 1RTJA 2RRNA 4ZVSB 4CO3A 1SKUB 1T94A 5BYRA 2E5GA 3Q8UA 1U1PA 4NXNF 3DOMB 5KFPA 5L1KA 2R4FA 2CDRB 3JAMY 5KFGA 5CH7B 5B0FA 1HWKA 2YQ0A 4P7TA 3TRGA 2R7UA 1FVSA 1DFDA 1CS4B 1KQSR 3DGPB 1KDNA 5KG3A 4LQ9A 4XK8C 2A6OA 5KFDA 1N5QA 3CO0P 4PXDA 3CCSS 1X0PA 4PXBA 1QAIA 2R7VA 4OZ3A 4ELVA 3MGJA 2W9BA 2XS2A 2DITA 4O3QA 2IC3A 3Q8SB 2N3LA 2PA8D 4DQRA 4XAKA 1HL6A 3KUEA 2FHJA 4L73A 4Y2KA 2XEXA 1NH7A 3W61A 3KLFA 2P6SA 4ID5A 2QA4G 1Q5YA 4LT6A 3W8GA 4U67Q 1RT6B 3EGWB 4M5DA 3NLCA 4LRCA 4DR2J 1TAUA 2DBBA 5LXYA 3F41A 3R1HA 2VJUA 2ROPA 3VVTA 5KG5A 4J9RA 1FJ7A 1EZZB 2B4OA 4LF9F 2QLWA 2DNZA 1SL1A 3H8YA 1IKXB 2W01A 2R9LA 2W4CA 5IFMA 2FD2A 2LU2A 2XZTB 5BYQA 4X66F 3ZZOA 3MCNA 2CNKB 2YNGA 4O3NA 1BQXA 3J7AN 3PYEA 3OTOF 1JB0C 3IN5A 5T7LA 3AB4B 2KZMA 4DZDA 4YB6A 4LFCF 2F63A 4WIQA 3OTCA 3RAQA 4K0KF 1GH8A 4DMZA 3LQVA 1VI7A 1AZSA 2AKWB 5T41A 3KK1A 4RPFA 1M1GA 2LLZA 1T03A 1VS3A 2NXCA 3P5TL 3KLGA 2XY6A 5KG6A 1L3UA 2DJWA 3CC2S 1X9WA 4RNMA 2FVQA 3E2EA 4C3MA 3NMRA 4BHQA 4ED7A 2PMZD 3LP2B 1TKZA 1CBKA 2B7BB 3DLBA 4MKAA 1JLFB 3A8IA 4XDDA 1PG5B 1KLMA 1VJQA 3HKWA 2HHWA 2V5HG 2VPWB 4FDFA 4C11A 4OZLA 1XR5A 4CLFA 2KH9A 2LU1A 4NRUA 2JFDA 3I0SA 3T1HF 4K4VA 1MU2B 4UQTA 2MKJA 2Y8WA 1R8PA 2DCLA 4FYXB 3NCRA 2CZ4A 2MLXA 2UV8A 1RKIA 4MIWA 1U1MA 2W9AA 3KUHA 1X7VA 4NLPA 2ZD1A 4LF6F 5CCMA 5DGAA 2BBEA 4DXLA 2YKMB 1FI4A 1S97A 4B17A 4D3HA 1WELA 2HK2A 2XLKA 1FFGB 3OL8A 4DF8A 1NPRA 4OYMA 5LOQA 2GO9A 4K4UA 2WVEA 1FEEA 4ZLNA 1BQMB 2DRBA 1S6QA 3TZZA 2W7PA 2ZH3A 1H3DA 2Z4PA 3Q8PB 3NS6A 2YWWA 4DR6F 3H5SA 4TN2A 2NYIA 1S1WB 1PILA 2WSFC 3UR3C 3C6UB 5E3PA 2CKWA 1LQ9A 4YOEA 3P5BP 2H5EA 2HS4A 5D8HB 4WFAQ 3L7OA 2C3OA 4V19J 3DXSX 1EETB 4ITSA 3V6HA 4JI6J 5ADZA 2QLFB 2D3OR 2XZDB 1KBRA 1ZH5A 2FZGB 3RBZA 3V6KA 4ZITA 4K4TA 5EWGA 5ETSA 1IBKJ 2PD1A 1KEKA 2JSXA 2D41A 1VQ5S 5CABA 4UUWA 1S1TB 3SV4A 4RJVA 3GCXP 4DL2A 4KC5A 4LSLB 1N48A 2K2PA 3V4IB 5L38A 4LFAF 5MLCV 1HBOB 1Y7PA 4WFYA 2YTCA 3R7BB 1KHWA 5F8NA 2IVYA 4RNNA 4JB8B 3QSIA 3CDBA 5KFVA 2MGZB 2MZ1A 2E1PA 4X4UA 2HAIA 1PBUA 4WU2A 2WVDA 4J9QA 1RLDA 4OJGA 3TJ8A 2K1RB 1BE4A 3N6MA 2PT0A 4RZRA 4KSEB 1S6PB 1LFWA 4A8SA 2JH3A 3N01A 3QIPB 1XNRJ 2Q6BA 4WP9A 1DTTB 1XBWA 4QWCA 4PKDB 3J7Z5 2CWKA 5LMUF 2G0IA 4HACA 1EP4A 2I5JB 4PYDA 4F3QA 2HMIB 1X4GA 2JFKA 3Q86A 1WG5A 2FJXA 3OXLA 1KFDA 1TKTA 2RIJA 3AD7C 2WVCA 1E6VA 4IFVA 1KVKA 1SJ4P 3QRPA 3PG9A 3LO3A 2XY5A 4CP5A 3PO4A 5DG7A 2CFXA 3FSXA 1G1XA 1QTMA 2R42A 3EGNA 3JTNA 3ZZ0A 1X4EA 1APSA 5ETMA 3N6NA 5DDPC 4IQXA 3BREA 3M1VB 3JXOA 5B0BA 4USVA 2XSJA 2RDDA 3FCWA 1WKLA 1R0CB 3TVKA 1WEXA 1KC8T 5D78A 2DR5A 1H2UX 2RT3A 1DY3A 2VG7B 3W65A 5J2QA 1REGX 3EPGA 1KS2A 3Q8QB 1VQ8S 2JEGA 3E01A 4F25A 2MQNA 3D3CJ 2B4UA 5E3CA 5F8LA 1GAOA 3PACA 1R8HA 4W92B 4ZPDA 4F0HA 4DL7A 5C42A 1C2PA 2LA6A 2HFSA 3GZ7A 4L76A 3NGRA 5HJYA 3OD2A 3RB6A 2E9RX 4M5KA 4RW6B 3FMBA 1Q8IA 4KO0B 3K5LA 2XC9A 4JI1J 3HVTB 3CW2C 3MMAA 5F0WA 3AD8C 1FWKA 2V9WA 2I8EA 3KTQA 4NZ0A 3CD5A 3V6JA 3I96A 3QAEA 1CQNA 5A8WA 2BE2B 3G2XA 2DH9A 1OSDA 4ATNA 3C16A 1W25A 5HBMB 3BGRA 1LEOA 4IO1A 2MQOA 2DHAA 1U7LA 1IJFB 1R8CA 1V9OA 1RI7A 1WEZA 4B08A 4CQ1A 3M2VB 4DR3F 3IM8A 3IS9B 4PQUB 2J6TA 1X4CA 4J7CA 4BC9A 5AT1B 5IZHA 2Y3YA 4AQYJ 2YKQA 1FKOB 1NPKA 1J5OA 3HVAA 2DNPA 1C1BB 1T9TA 3W9JA 2V8GA 5CHCB 4L3KA 4A8WA 1QY7A 3HD1A 3M8QB 2EFOA 3Q8YA 4QYZJ 2PA3A 3DM2B 3JTPA 5D4PA 1NO8A 5I3UA 2YNFA 4ANCA 1L3TA 3PX4A 1GT8A 1P9YA 2QA4S 4A8YA 3BGLA 2C1EB 3RW6A 4ZP6A 2QSWA 5KFZA 3W2VA 4GC7A 4FBTA 4DS5A 1U2FA 1Y4ZB 1WF0A 2ZWPA 2CJ9A 2GMJA 4EFAC 3BN4A 4F0KA 4HKQA 2K7KA 5C2CA 4AL6A 1HPZB 2AX1A 2LA4A 5DG9A 1T0TV 2EKNA 3HSGA 3GILA 2UVVA 1MROA 2H48B 2IRYA 1JLGB 3POTB 4ZP9A 1UJ4A 1FFSB 4EBDA 5CA5A 2DNNA 3EM1A 4Q2LA 3VGVA 4ILLA 3T6BA 1S9FA 1OSCA 2GAHC 1SC4B 2RKIA 5G0RA 1SJQA 5I3QA 3BF4A 4YB5A 3ULHA 1NZAA 1DTQA 2G0JA 3BH7B 4NWBA 4DN9A 2F4VJ 4OV6A 5J2PA 3KJVB 3SFUA 1DRZA 1W2IA 3AOBA 4JI0F 3LP0B 5HI7A 1MWZA 2FJDB 2XMKA 4NXMF 5FLXU 1GTHA 3RB3A 2VD3A 4MT1A 4B3OA 3ICLA 1CC7A 2MB0B 4FYYB 2DHHA 2KFYA 3QGGA 4X4NA 1RAFB 2DGSA 5K8NA 1FD8A 4DV2J 3SSSA 2IM3A 1IBMJ 1VIXA 3AJDA 2LYVA 2NXUA 1SBRA 1YBTA 2AV5A 4AYBD 4M63A 4C7QA 4NCGB 4ZVFA 3D1HA 4WE1A 5DQHA 1SL0A 3AA9A 5LSRA 4LSNA 3TUPA 2OMLA 5KAKA 1AROP 1NNDA 4DI6A 1ZAVA 2CQ2A 1N34F 4DV6J 1VK8A 2DGTA 1NJZA 1TL1A 4KV8A 1C4AA 1U02A 2FB0A 3QRRA 1HNZF 3L7UA 1WTFA 1C0UB 3IRXB 4FXDA 3T5LA 1LW2B 2VQEJ 1RU1A 3TR5A 5B0AA 1B70B 2ZOGA 3Q2SC 3AOCA 3DRYA 3ITHA 1VR6A 2KKHA 4DUZJ 3BR8A 2BYCA 4OJHA 1X4AA 5HROB 4IFYA 1NJIT 4EO8A 4C8LA 4PAAA 1N32J 3NOCA 2N82B 2VJVA 1QE1A 3MOZA 1WEYA 2IMOA 1LWFA 4ZN1A 4I4BA 2XLJA 4CLPA 4NLTA 2PFFB 1JIHA 4QJVA 3M30A 2L41A 4X62F 3BSNA 2IDLA 4F02A 1JLBB 2Z58B 2V67A 1SQEA 3ZZPA 3KMSA 5IM0B 4LRFA 1UJ6A 2OLWA 2O3DA 2NR0A 3B4DA 3BH6B 1YX2A 4NOHA 2WVBA 3EZ5A 2HZAA 4F4YA 2AGPA 3CD6S 1YITS 4H4KA 1QSYA 4OI6A 3OHAA 3D54A 5AXNA 2GVDB 1WHXA 3O5TB 2RJZA 2MDAA 4NLGA 1SQGA 2YXLA 2ZH2A 5GAEU 1R8AA 1UW9A 2EG1A 4DX5A 3OBIA 2WONB 1NLKL 4UY85 2Q1LA 2WVFA 1TKXA 4DLEA 4QPTA 3AXMA 3SQOP 4G1PA 4H54A 2GGPA 5T14A 2F4FA 4W98A 2FHOB 2FVCA 2XLIA 4C0BA 1WD6A 1HARA 2MZJA 3CDEA 1TVRB 3MTKA 5J1PA 4DN0A 1O8BA 2IA6A 1HQ2A 2MMYA 2I1RA 1YK9A 2NXJA 4Z7CA 1Q16B 4FF2A 2J5AA 4URGA 1ZM9A 2BJEA 3R5BA 3B4MA 3R9LA 4DG1A 2OI2A 1WHWA 3OQ2A 2HRUA 2BOAA 1M5OC 1RTIB 3IWNC 1SC6A 4DV3J 2FY8A 1WC4A 1FHTA 1HD0A 4DR2F 1NH8A 1NMEB 1TTHB 5C25A 3IBWA 4F36A 4C8YA 4ZHRB 3FSYA 3H98A 4GO7X 3EVWA 3PR5B 4O44A 4IYQA 4WBFA 2QMXA 3I5CA 5M2RA 4WU3A 2E1AA 4WYWA 1EARA 1VC0A 2M0GB 4QW8A 3HHDA 4CI0B 5K14A 1NK8A 3HT3A 3ZFVA 2HZVA 3D7SB 3DRXA 2WZ1A 2ZFHA 2WSEC 4N7TA 1Q8KA 2WBMA 1WF1A 4RR5A 3AA8A 3NY0A 1RT2A 2MKHA 1PYSB 1NM2A 5CYQA 3LP1A 3PIOQ 3AODA 4N47A 3OL9A 1DBDA 4CLSA 1S4FA 1HHTP 2F5GA 3D5MA 1YDLA 4GRSA 1NPPA 1WTBA 1WSRA 3TZWA 1YJRA 1A0OB 4RO0A 3Q23A 2J0WA 4TY8B 5HK4A 4LR9A 4NLDA 5MAOA 3GG0A 2V4JA 2B3TB 4HVZA 4DX7A 1YVFA 3B54A 2Y8YA 2BE9B 4JV2A 1S1XA 4JI2J 3IFEA 1RWKB 5LL6d 2VHGA 3FRYA 4NZ7A 2JC1A 2QFIA 4LREA 2HQGA 2VZ9A 3NP5A 2XWXA 4A8XA 3BBFA 1JJ4A 4KPCA 1CULB 3MM6A 4KKOB 4C97A 2H4YB 3GWCA 2W4PA 4PQAA 2CQPA 2PMWA 3UN5A 2BV3A 2E44A 2K7JA 3W5ZA 1ZYQA 1SV5B 1HQEB 2BACA 2DY9A 1KP6A 4U95A 3I56S 1FT8A 1TFYA 1UJ5A 4UZBA 3KLEA 2QV6A 4AL5A 4E2FB 2F8EX 5CXTA 2ZBRA 4USUA 3MR3A 4QW9A 3OUYB 3G86A 2RDJA 2OKQA 1XQIA 3UNYA 4YUDA 2XCPA 4ZOSA 1EKSA 5IC6B 1JXVA 5DM7Q 4C8ZA 3LALA 3UI3A 2YX4A 2DRDA 5KTQA 1RWMB 1RT7A 3ILIA 2XY7A 1U49A 4CIOA 2WAQD 2RQ4A 1IKWB 2CJAA 1ZM4A 1QD1A 2RQMA 2UU9J 3C19A 1U1LA 4ZPWR 1L3VA 4A8OA 2OPRA 5AXLA 2AEMA 1RTHA 4JI6F 4Q0BB 2Z2YB 1NDCA 3VR1A 2BM0A 3C14A 2DGVA 4CRJA 1RHRB 3FBFA 1IBKF 3MCSA 4RL1A 2BOPA 1X4FA 4IG3A 1NZ8A 3SBMA 2HYIB 4OZ1A 1HNIB 1TL5A 1ZTWA 2RNEA 1UTAA 1AB8A 3J81U 3NKYA 2VV5A 2CJYB 3BJYA 2JL9A 3C15A 2FLLA 2QE5A 1IN0A 1JKHB 1Q79A 3UDLA 4DV0J 3DU6A 4RUAA 2EEYA 3BZQA 1CVJA 2FHMA 4KFBB 2K3KA 1NAQA 1NJYA 2O5DA 1XN9A 2AHOB 5GAEI 1LKZA 5GAHI 1T05A 2BW7A 3HDSA 1RT4B 4BWJA 3HFKA 4Z2XA 1FNOA 1NK7A 4CO1A 2EI5A 4DSKA 1MMNA 3CIMA 3M6UA 1QVFR 2AU0A 2AYGA 5HN0A 3TVZA 2OEKA 2DO4A 3R3TA 5ETLA 3J7ZT 1VFJA 2XYHB 3I9ZA 1Q4RA 3DLEB 1XNRF 4R25A 3HP6A 3D6FB 2DTJA 5BR8F 4DR5J 5J2MA 4K4ZA 2NPFA 2ZJRQ 2BE7D 5L1LA 2C2MB 1OS5A 2B6AB 4EYIB 3I55S 1RTJB 3QGHA 4ZK7M 4B3MJ 3CC4S 1F3FA 5DZ7A 2VKRA 4UOCA 1ICEB 2B51A 5AXMA 2B0GA 2RB7A 3CD7A 3H4DA 2BKNA 2W2QP 3TUZC 2BABA 4B9MA 4DFMA 1ZOTA 2VPZB 4KQZA 3BPDA 4MKBA 4ZCLA 3UD5A 3VAMA 2KHCA 4K4WA 1S1UB 3GFHA 1V3ZA 1HBUA 1CSJA 4QWBA 3AY0A 5F3TA 2HNDA 4P2FA 4I1TA 2W9BB 4N56A 2PGCA 1PJ5A 1YJ7A 3S6EA 2IC3B 4QWEA 2ILZA 4Y34A 1PYTA 4I7FA 5HO4A 1D8ZA 5E2QA 5AJ3J 2V50A 4YDDB 2MLYA 2OPSA 2V8PA 1NSKL 3VWSA 3KLFB 2R2TA 4N5SA 3MUTP 2IFXA 4ID5B 4J90A 2NUUG 4JI1F 4PWUA 1T9WA 3K89A 2IJRA 3R5AA 4KHPJ 2E66A 5B08A 5E3AA 1S6UA 2KI2A 3OVSA 2H4WB 1MWQA 5IV3A 8ATCB 4TQRA 4ILMA 5HJXA 1B7YB 4F4ZA 4XTTA 1U47A 3JQKA 2YNGB 2FJWA 2DISA 3QATA 3DI6B 4DUYJ 3J81Y 3PKMA 2FVPA 1WF2A 3SSQA 1NB7A 4TLQA 1N5YA 1AZSB 2YWFA 3QAUA 5GMEA 3KK1B 4AQYF 1URRA 2QL9B 1T03B 4OHYA 3KLGB 2FHJD 4F4WA 2IBOA 2GAGC 4I6WA 2KXNB 5J1EA 4XIUA 2FGOA 4WP3A 4KE5A 2YVSA 3H5XA 1TKZB 4DDFA 4DFJA 3G82B 3K17A 1J5EJ 4ECSA 1EHWA 8AT1B 1B4SA 3MUVP 2FLPA 3SXLA 5L9NA 4MIAA 2B9WA 3D66A 1M5HA 3G6ES 2OO4A 3I0SB 3A1YG 1N56A 1DQ9A 2R7SA 2PMHA 3UE2A 4AUKA 1FF2A 2B43A 4ECZA 3MMCA 4YP3A 5DG8A 2ZD1B 3UD4P 2YWGA 1WKKA 4DQPA 1HQUA 4J9MA 3W66A 3C8YA 1FESA 3GV8B 4C0HA 4PEOA 2PI5A 2MY7A 2QMUB 4Q7AA 4P6QA 2QTWA 2ZOMA 3PKYA 3KOAA 1S6QB 1Q78A 2F4VF 3MPVA 2CJQA 4HTIA 2OELA 2VC1A 3FMWA 2BJ1A 1YBAA 2LEAA 1RHMB 3MD1A 4PWDA 3RRHA 5ITHA 4ZPBA 3L4BC 3Q8VA 1FA0A 3CCLS 3GQCA 3SCJE 3CVKA 1SJRA 2RF2A 3VALA 5HANA 4HYKA 3DRPA 2YH0A 4DV2F 1IBMF 4JI8J 2XNRA 3CCRS 2Y1JA 3CCTA 4DX8H 3B82A 1S12A 1VQ4S 5L39A 4RUCA 1SQFA 5KFLA 2OUGA 2FVSA 3S8SA 1P8GA 4F8RA 1RAAB 2IM1A 2GQQA 2RAQA 4DV6F 4CO2A 3E51A 3IO1A 3BEGB 3MPUB 3CCES 2JRSA 3MR2A 2ZEJA 4M1KA 2H5IB 2D7SA 4DOZA 3QT6A 4X65J 1Y5NB 4EO6A 1RBOB 2VQEF 1R43A 5F41A 4OZ5A 4DUZF 4P75A 4AXJA 4XPEA 1S1VB 4B3TJ 4USKA 4Q45A 2CNOB 1N32F 1HBNA 5DJBA 3PV8A 4L6V3 3UR0A 3GFXA 2FTRA 5ETNA 3BO3A 3UFCX 3TW0A 1YRXA 1CQMA 3M9NB 2AYBA 5KFEA 3SSRA 2CPDA 3TI0A 1XMOJ 1S59A 5DLFA 2BUNA 3CDAA 5B7WA 2GMHA 4HACB 1ZPVA 4X66J 3HVWA 1EP4B 2OPPA 4WK3A 2V0NA 2ZDPA 2Q3PA 4CLZA 1JNRB 3EPIA 1WWHA 1TKTB 2RU9A 2AEJA 3SDEB 2LMIA 2N4CA 2DR9A 3BV8A 1E6VB 3JQJA 4IFVB 2M88A 3DKDA 3D6MB 3DLKB 1SH0A 2KXFA 1C0TA 2XMUA 1MLAA 2CIMA 2JZ5A 3HCXA 2XSJB 2ROGA 3OFGA 4J9VA 3HZEA 3DLLQ 1E6YB 3G8QA 5D3GA 4O4GA 2CZ9A 4E98A 1O51A 5IT0A 2PEBA 5J2QB 1X4HA 2VICA 3E01B 1M1HA 3TA0A 1RHKB 3LW5C 3CJ3A 2KO1A 4QIEA 2M8DB 2AEFA 4ED3A 4O4RA 4AT1B 3A12A 3PJWA 4RW8A 3OLAA 2J9DA 2UV8G 1TR0A 3I5BA 4MMOA 1RWOB 1KD1T 4KT0C 3VZHA 3ZNJ1 2YBVA 3CJKA 1UVKA 4PPZA 3FK4A 4R5PA 1FJCA 3PHTA 2FLOA 3MMAB 1HD1A 1RWNB 4PG8A 3D1OA 4DV3F 1HR0J 3KMQA 4ECUA 3G96A 5A8WB 2YWEA 2V63A 2O67A 2CQ0A 1SVDA 3HK2A 4NLVA 3C16B 3VAKA 3DOKB 3BGRB 5A8RA 2RQKA 3TUJC 1FKAF 3ZXWA 5DRKA 1H2TZ 5K20B 4B02A 4DV4J 2NSBA 3PRDA 4MH8A 4E8UA 4NMXA 4ENOA 2KU7A 2QYGA 4F3OA 3NAHA 1J5OB 2RQCA 1T9XA 3MFHA 4IR1A 2HWIA 1XNQJ 2BKOA 4CLYA 5I3UB 2YNFB 4QIGA 2E7WA 3W63A 3VHQA 2JOQA 1G3OA 1OWXA 3W2VB 1HNVA 2HNZA 3HT0A 1Z2LA 7FDRA 6AT1B 3FJ2A 3Q8RB 2LKZA 3I4PA 3T1YJ 4R8UA 1D0EA 2VPXB 1TL3A 3VAHA 1R27B 2ZH8A 4R0JA 2RS8A 4LMZA 2UVUA 4ECYA 3RW7A 3G6YA 4DFPA 5A6PA 3W2WB 2DGQA 2GFFA 1U1QA 3DU5A 4PABA 3GCWP 2RDIA 4DPUA 2E5LJ 4GVBA 1JJHA 2N7CA 2C2OB 1PCAA 2CQCA 1F0XA 2VC0A 3KYLA 1UVLA 4K4XA 5D15A 3OVBA 3DGVA 3R6GB 5ETTA 3QSYB 2KVQE 3PR4A 2NPIA 2RKIB 5G0RB 2DNQA 4KJIA 2NSCA 2X1BA 3LOUA 4H4OB 1WHYA 3QLHA 3WC2A 1IVZA 2MKIA 5J2PB 2XS5A 1VLOA 2RU3A 4F4AA 4OZNA 1QJHA 2KYZA 2UXDJ 4DV1J 4KHRA 1JQGA 1D9DA 2VU5A 1FDNA 1FK9A 5CYMA 1Y5IB 5KFMA 2G2YA 3K0JA 2NYHA 4JOUA 3T5KA 2ASDA 1J2VA 2YQ3A 4JI4J 4DX6A 3CCZA 1HFEL 3DLHA 4UZCA 3H20A 2FC8A 3DNCA 4ZVQB 1WI6A 5CD4A 2W2MP 2W8KA 4TLRA 3O2IA 3FVYA 3K57A 4WE1B 5D0HA 2R2RA 2MSSA 3CJTA 4PXCA 1KNZA 2P9CA 4LSNB 3QT8A 1OPIA 1TL1B 4KV8B 1O0PA 3CJSA 3TAMA 4CNYA 1B64A 3CEDA 2MZSA 4WIIA 2DGXA 2EG2A 5KFKA 4DR1J 5IQQA 1MMLA 4CNZA 4DV0F 4NZ6A 2YWHA 3H2UB 3KLIB 4YQWA 3TANA 3FBCA 3ITHB 2D3O1 2V94A 2R7WA 2V69A 4L72B 1LK7A 2YKNA 1MSWD 2CPIA 3OVAA 3CD0A 4IFYB 4MKVA 1YJNS 3CNQP 2POKA 2ZH9A 2CPHA 5A0YA 3MM8A 2GA7A 2QLJB 5I42B 4OHWA 5HATA 1VQKS 4ES1A 1QE1B 2R7XA 1RWPB 1LWFB 4J9NA 2D9OA 4MK7A 2RRAA 5A8KA 3QJLA 3OSPA 4NEZA 3EGVA 2PN6A 5AE1A 2BZ2A 2YPYA 4P10A 2CPJA 3M30B 2VG6A 3DOMA 1TUGB 4DR5F 3QNWB 2HQFA 2DEIA 3IXQA 1F5CA 2VFSA 2C42A 1S9EB 4WP8A 2EKYA 2C2RA 5KT6A 1XK8A 1D1UA 5LXRA 3ONQA 2Q6CA 3JYTA 1CS4A 3OTEA 4CDIA 2HFZA 1KOHA 1VC5A 4PG7A 4CLKA 1TL7A 5G4DA 3X1LB 3MUMP 4LIRA 2LXIA 2P6TA 4EU0A 1OQ6A 3FEYB 4ZCKA 1TKXB 4OYIA 2AT1B 1P1TA 1RKJA 5K8OA 2GGPB 2Q43A 2DCUB 2DPIA 5IT9U 1RBLA 1YWXA 1UEUA 2K8GA 2P2CB 1UCNA 1S6OA 2FPHX 4F26A 2R2UA 2UUCJ 1LFPA 3LANA 2N4DA 3LA0A 1N6QB 3AH6A 3GR0A 3PYGA 5AJ3F 4KH1B 1QAJA 4Y2IA 1JXEA 4TU9A 1F9HA 4B3SJ 4P52A 1VHIA 1WACA 2ZUAA 5ETPA 4TU8A 3PO5A 5EN1A 2M2BA 1H98A 4KHPF 1U48A 3ISZA 1UETA 5C25B 5HSPA 1HIYA 1H74A 3RAMA 4O44B 2D74B 1PGZA 3M32A 3MAAB 2MPUA 3CJ5A 5KT2A 2AZ1A 3M6VA 2VBWA 2F9DA 4USTA 2B9XA 4USHA 1LWEA 4LF5J 4DL5A 3R6LB 5K14B 4DUYF 4IOBA 1U24A 1U09A 4NMLA 3H2LA 4K2JA 5LSLA 3GYNA 5H9EK 5FD1A 1KSPA 4J9LA 4EI2A 2R8JA 1JLFA 5KFFA 1TK0A 1LNQA 2CWXA 1SKWA 4LSZB 1K8AT 1F5BA 5KFYA 1U8SA 1H7XA 4X4SA 3L09A 6FDRA 2GQCA 4RW4B 2CQHA 3ILLA 5LMNJ 3GU0A 3HM9A 2CQDA 2XQCA 3R1LA 1J5EF 1GXUA 3B8HA 4QIVA 2V4JB 4A8QA 2WK4A 1QUPA 2ZJQQ 4B9LA 4QCLA 3OT9A 2ZM6J 2WRMA 1S1XB 1FDBA 1DHMA 3FSIA 2ZOFA 3MTJA 3I0RA 2MTLA 3ENWA 1IM6A 3S01A 3EVMA 2GQ2A 3I82A 4FS2A 5A76A 3MM6B 1HYSA 1GFWB 3MEEA 3IG1A 1S48A 4V1Ak 1BWEA 1VC6A 4PCQA 1NDPA 4Q5VA 5KFOA 3QBCA 4C8OA 2OFGX 4IQMA 1SC1B 3D4JA 4DEZA 1K47A 3PX0A 1HA1A 1RWWB 4WXOA 5D6GA 3KLEB 2HVHA 2DGWA 4QOTA 1TMMA 4MYUA 1WNEA 3NNCA 4YFUA 1Y10A 4H4MA 4NPOA 4Y28C 2HFOA 3A8KA 5K9FA 5KFNA 3OFFA 2Z30B 4NEYA 1EETA 3RGIA 3V81B 4M5IA 4OYXA 1RT7B 3M2UA 2PE8A 2HZCA 3HFVA 3HPOA 1Q8BA 5SUHA 4ETXA 1IBLJ 1R0AA 4Q8EA 4JP8A 3MECA 2UVRA 3JTOA 1S1TA 2HBRB 2OPRB 2W2PP 2CQ1A 2W7OA 4JI8F 1BWVA 4WZMA 2VUGA 3HHLA 1Q7YT 3KDNA 3C14B 3IR6B 1SB6A 3B78A 1YSJA 4NA2A 4UF4A 2OH2A 1D09B 1CJUA 3RZAA 4IG3B 2XI3A 4EEYA 4IO9Q 3MMBB 5HP1A 3JQMA 2ZZNA 3GJRB 5B0DA 3JS9A 4YEAA 4X65F 4URSA 2ERRA 1DARA 2Z57B 4PG5A 4FXWA 1VIOA 2DNGA 5JJBA 3QWUA 2QRRA 1S6PA 4OIXA 4A8KA 4B3TF 1T05B 1KN6A 1BHNA 3A3PB 2FQQB 3G6XA 4G1IA 2KFZA 4KYZA 1KTQA 2JVOA 3QT7A 4KIAA 4ZS6A 3BDPA 2E5JA 2MQ8A 2HKEA 5IT4A 2I9SA 2RVJA 3DYAA 5KFCA 3ENAA 3DHXA 1UPPA 1WOPA 2OFHX 4O3SA 2CZVC 2ASJA 1ZA1B 4FF4A 3IRWP 1W26A 2C2NA 4P2MA 3M05A 1XMOF 2GIQA 4FNHA 1VYAA 4M95A 5J2MB 3Q2TC 1YG0A 2GHPA 1FKPA 3EXYA 3MWBA 3GSDA 2DR6A 2Z8QA 3L95X 2YQ1A 3BO4A 3J7YI 4IH6A 1UP1A 3QYYA 1UA0A 4LVNP 3W7BA 5BXIA 4IH7A 2K06A 1VQYA 1Y0HA 4U8YA 1VRTB 3BYPA 2Y0SD 2ZH1A 2CJBA 1H73A 4QR2A 4WPAA 2D3UA 2GMLA 1N0UA 2P8IA 4ZLJA 2VG5B 2J7WA 4TY9A 1ITPA 2XHCA 3QJPA 2W8LA 3Q0AA 4HI2A 1UMJA 3QQCD 2R8KA 1HBUB 2HNYB 2CQIA 2G4BA 2IDEA 2RUSA 2NQPA 1BLUA 3WX8A 2HHTA 5I4MA 4NLUA 2MLZA 1HMVB 5KFTA 3SYZA 4I7FB 1ULRA 2DT9A 3D0IE 3OTDA 2U1AA 1WC6A 2MY8A 2OPSB 2AZ3A 2L9DA 4P72A 2OJ3A 4FZVA 1ZAWA 1HWJA 1N88A 2IRUA 2C22A 4KGKA 3ETOA 1HR0F 4D3GA 3M8YA 3DLGB 1N5SA 4ALZA 2J0QD 3IWXA 4DHVA 2A10A 3PYDA 3L7PA 2VFUA 1C1BA 2XO6A 2XMJA 3VAGA 3KLHA 4DV4F 3H59A 1TL4A 1XWLA 4A8FA 5KFUA 2VB6A 1AXQA 3GMGA 2PI4A 1KQFB 4CO0A 3RB0A 1ZZNA 2RHQB 3I5AA 3PIPQ 3PZPA 1JX4A 4EZ6A 4NASA 3W60A 1HKAA 3TJAA 3CCQS 3NXZA 4QU7A 3DRSB 5U47A 5J1EB 2IPOB 4C48A 3D28A 2OEMA 3W9HA 1XNQF 2GC8A 2AWZA 3R7NB 2GHVC 1PKUA 5A2QU 3M6WA 2HIYA 2C3YA 4LBIA 4JV0A 5HL7Q 1U6ZA 3PDNA 2HIQA 3OFHA 4R0EA 5IV4A 3FCHA 2RE1A 3NGUA 2N3OA 4ZA1A 3R5CA 4Q43A 2AD9A 1N5VA 2GHWA 3WBZA 1NDKA 4WTYA 2LECA 1GMVA 3KK3A 4RBUA 5B0EA 1SKSA 5A6WA 4Z7YA 3NAIA 3T1YF 3F44A 2LVWA 4IRKA 5DO2A 3QZ7A 1QVGR 4M5MA 2ROEA 1ZM3A 3KJFB 1V6HA 5LJ5Y 1KQGB 5ETKA 1JLEA 3MMCB 4EBEA 3JSYA 2ZNYA 2R8HA 1HQUB 4W90B 1RISA 2E5LF 2V8DA 3MM5A 1VHFA 1CPZA 3Q22A 1VGYA 4HHJA 1UWBA 3HZGA 3P45B 1FX4A 3PY8A 2C2ZB 5CCLA 1B99A 3UN3A 2L48A 2ILYA 3K5MA 1BC6A 4DUTA 3PEHA 2FGCA 5F9NA 3CUNA 2UXDF 3DXBA 4DV1F 4PWDB 5BR8J 2QL5B 4UTGA 4OL8A 1JNZB 4ANEA 2JEFA 4ELUA 4JI4F 2RF2B 3FDSA 1YLXA 2P5VA 2DXDA 3DRPB 4ZP7A 2G1HA 1YJWS 2B9EA 3BDEA 3PX6A 2J9EA 1TK8A 1S77D 1MMDA 2KM8B 1C0UA 5F8JA 3IRXA 5K5MA 4Y2AA 1U6BA 3IAM9 1U45A 3OL6A 4OYZA 3MCOA 1FXRA 4I2QB 4ECRA 1FX2A 3OL7A 2HBZB 2VA3A 3KFWX 2E7VA 2COLA 3SZ2A 2FHKA 3N79A 3NNHA 3EE3A 1UVJA 4EK2A 3V4MA 4DR1F 2CUYA 3HSJA 4LRDA 1AW0A 4USIA 3OSNA 1HBMA 2ZNZA 1TQLA 4HLBA 1RT3A 2LCWA 4JI3J 1R31A 1F9FA 2G0CA 1SJ3P 3ISND 4DU8A 1Q82T 2J7UA 4KHMA 2GCFA 3R5DA 3T19A 4HL9A 2HFNA 4OJ1A 3PW4A 3PW5A 1NK0A 3BS9A 3H4BA 2V8HA 1EAYC 4I64A 1BXNA 4P73A 3ENQA 1VQ7S 1HBNB 2FVRA 3THPA 1WC3A 4EGLA 3NGSA 1SCJB 1Q0NA 1DLOA 1Y3JA 5F0UA 4YMEA 1IQTA 2HHXA 4GKJF 2BVZA 4QBUA 1U4BA 2QIFA 2HVIA 3NCQA 4YN3B 1JXLA 5A2QY 2W2NP 4JI7F 2J6SA 1VQNS 3EZOA 3W64A 3QO9B 1RDRA 3MEKA 1A9NB 5KG4A 2M9KA 2NXNA 3IBFB 4NA1A 1OJ4A 1Q7LB 2OPPB 4FYWB 2IY5B 1F2GA 4YS2A 1HNXJ 1D9FA 3ET6A 3DFEA 1KKHA 5IS2A 5M2PA 4YB7A 3GV7B 2BJDA 3I6PA 2F9JA 3W3SA 5KG1A 2DHSA 2G2OA 2XSFA 3K58A 3SCKE 2MHEA 5BYSA 2Y1RI 1XJWB 2M7SA 2HRTA 1UFLA 2J9DE 3VVUA 4HR2A 3DMJA 4CCHA 4CO4A 2J9CA 2XG8A 1PYOB 1BD6A 5D3GB 3BQ2A 3SIPB 1AUDA 1FNMA 4ZJLA 3DRRA 3FNNA 5HQLA 1NJXA 1IKVA 1N36J 3MXHP 4JYAJ 1WOSA 5KFJA 1Z2ZA 1FXDA 5EWFA 3EMTA 2HGMA 4ZKAA 2UUCF 2XWYA 1VK3A 1K1SA 2HLTA 2IYIA 3M8ZA 4RW8B 1GMWA 3GG1A 1RCXB 2ALZA 2RHSB 3C6TA 3CJ4A 2IA0A 1U1OA 1XMQJ 4B3SF 4LFBJ 1R6YA 3GPAA 4MJKA 5KT3A 1Q8LA 1PIEA 4S0MA 4R5PB 3TZYA 5EGYA 4GMKA 5DM6Q 1KFSA 3EDQB 3FFIA 3CC7S 2GNKA 4RW9A 1U2RA 3R97A 1JLAB 3MEGA 3O8WA 2O01C 2BQUA 4X4TA 1S4EA 2EFQA 4DS4A 4PWWA 5A8RB 3LAKA 2QMWA 3K8VA 3CMAS 4NLQA 1T3NA 1U26A 3I9V9 1NK9A 4LF5F 4LF2A 3OXFA 1R0BG 2F3JA 2DH7A 3CTRA 4PPDA 3PHEA 4K5RA 2VKZG 2XZWA 1X4BA 2DIVA 1RSCA 1H2VZ 2GV1A 5F3ZA 2C2KB 5DQIA 1RHQB 1H72C 2A2CA 2MKSA 4CTAA 1Q81T 3H0PA 1H7WA 1CJVB 2DIUA 4FP9A 4DLGA 2OPQA 1RWXB 3BN7A 3C66A 1VQPS 1NXIA 5LMNF 3CJQA 3VQSA 1EX8A 4ED5A 1FVQA 1FWPA 2CRLA 3LGMA 1ZA2B 1JLQA 1CULA 3HMJG 2HNZB 1RT5A 2ZM6F 5KFRA 2OSRA 3N5FA 4I69A 4MK9A 3VCDA 2JLFA 1EQ0A 1NRKA 4PZVA 2C3PA 5DS7A 5KFBA 4AFFA 1A7GE 2CNLB 4Y0FA 1NKBA 4UOGA 1CC8A 5E5NA 2ZZTA 5GMKa 1TL3B 3R5JB 2APOA 2WB4A 3OUYA 3IM9A 2QA2A 4M5NA 3GTYX 3N6LA 2XBPA 3CULA 3HX9A 2Y9HA 2VBZA 8RUCA 1Y3KA 1GTEA 4GVBB 2ZE2A 2ZHAA 2V2ZA 1N33J 5IQ6A 1HW8A 3GIIA 4P74A 1VRUA 4PUOA 2B5JB 2HG4A 2AYMA 3TUIC 2E5HA 2BXJA 3QLHB 5GADI 2EBGA 2NZ4A 2MZQA 2KZZA 1F5AA 2B8QA 3NRBA 4QYRA 3E3XA 3R5GA 5DLGA 4LBPA 3G8TA 5CYMB 4OFZA 4MAKA 5D4OA 3SV3A 2VDIA 3DDNA 1IBLF 2UZAA 3JSRA 4QWAA 5HVHA 2RD5C 1HNIA 3J80Y 4ICLA 3IP0A 1HW9A 4C3LA 2J76E 4KTQA 5CYJA 5EWEA 2GVZA 4JV1A 2DPJA 1JKHA 2KVIA 2VL1A 3M8SA 1JLCB 3A4TA 5GAHU 1S57A 2DXEA 2E9ZA 2Y0BB 5JVHQ 4WFBQ 4EBCA 4ELTA 3FGVA 5KFSA 1V3SA 3TAMB 2MQLA 2ZH4A 5ETRA 3D2WA 1SKRA 2YPZA 4WJBA 1PAUB 2A6MA 1NSAA 2LP4A 2DGOA 4LRAA 5EUHA 4QR1A 2O1PA 4NA3A 3ZTOA 4ED2A 4FPRA 4OLPA 2YKNB 3DLJA 3QGPA 3CF5Q 4JV5J 1DURA 3CCUS 3AAWB 4WWSA 2BRLA 3PJ9A 4HT5A 3M7VA 1OO0B 5A0YB 3MM8B 4EMDA 1TUVA 3MD3A 1WC0A 1SPBP 1F60B 3DDIA 4C0OC 1FDAA 2YX7A 3A8EA 4CYUA 4WK1A 3S7RA 5A8KB 2HHHJ 2UUWA 1KHVA 2M52A 2ZHOA 3KK2A 4LF1A 4USMA 1XERA 2IHR1 2VG6B 2VBYA 5LM7E 1X4DA 2BM1A 3B6BA 3BB5A 5EDWA 3HLUA 5JXSA 4YHHJ 2YNHA 4J37A 3UDVA 3JYTB 4ZVOB 3CB4A 4TKTA 1NK5A 4K4YA 2XTJP 1S1UA 4ECQA 1G2EA 1RLCL 4AL7A 3SQGA 3UN2A 2ALYB 3F0NA 2IJNA 4U7UK 3DOLB 2ZH6A 3UVJB 4XPCA 1TL7B 2J0SD 2CVEA 4OZ0A 3P49B 2HHSA 2B56A 2JX2A 3CE8A 2H3EB 3T9ZA 4EZ9A 2MXYA 3ILJA 3UQSA 3F56A 2KG1A 3N0VA 1SJ1A 4Y6IA 1FTRA 4QIWD 2PIIA 1S0VA 4UQGA 4U96A 3MPDA 4F3MA 4X64J 1U6FA 3OR2A 1CJTA 1SJFA 5F8HA 4U6PA 2P9GA 5FDLA 1ROFA 2NZCA 3HHKA 4Q2MA 1REVB 3ZTPA 3HO1A 4USJC 1GNKA 1UFKA 4TQSA 4OI3A 5EHHA 3JSMA 1OY9A 1K44A 2H51B 1T7PA 5HQ8A 3TQEA 1B7FA 4DCJB 1BY9A 2XS7A 1T3OA 3DI6A 3JSBA 4U8VA 3LUYA 3W5XA 2GJ2A 2FJEB 4Y65A 2XMWA 1L3SA 4Y2CA 2ZH7A 2I6WA 3D6HB 2KJWA 3GYXB 1YGYA 4DR7J 3M32B 2XO7A 2FYXA 5KG0A 4TYAA 3TARA 1NUEA 1LWEB 2IM0A 1NCLA 2ABYA 2V68A 4MK8A 4F04B 1KTVA 1YI2S 3RBXA 3G82A 2FLNA 3P3DA 2J8SA 1YZ6A 3VAIA 3EDRB 3S1TA 2G2ZA 1RT1B 3BKTA 2HVDA 3KJNB 2YY3A 2E1CA 3BPSP 2AJQA 4NLSA 1YBUA 1X0FA 3AOAA 1Z4UA 4Q8FA 4K5SA 3CWJA 4ZPCA 1RUSA 3R7SB 3OHBA 2L9NA 1T9YA 4CLTA 3SMZA 2H54B 5GAGI 1AYEA 4N8NA 3TA2A 2QLXA 4HI1A 4OYAA 1LOUA 2DEJA 3RG6A 4WKYA 2ZKUA 4ZVGA 3EJMA 2QGFB 4LR7A 2VQFJ 1X8DA 3THVA 3PRVA 3EGZA 2AGOA 3I0RB 2RS2A 2VASA 2D1CA 4J9UE 4DPOA 1T9VA 4JI5J 1HYSB 4FBUA 3MEEB 3IG1B 2EK6A 2HVEA 2ZJPQ 4RW7A 2F1FA 2R7RA 3HULA 3IMQJ 1RK8A 4F2SA 5L46A 2WHOA 3U1MA 1T8EA 1RHJB 3N9UC 4YY3J 2EW9A 3BGFA 2DKOB 2IM2A 2EK1A 4ILRA 4DSJA 4C8KA 5KFIA 1FEHA 2JWNA 4RU2A 4K2XA 4H4MB 1FE0A 2HLUA 4OYBA 1FRKA 1RBAA 2HRYA 1RYSA 1UKUA 4ZMMA 2ZBPA 1MG7A 1J27A 3M2RA 3US5A 2M3DA 3M2UB 4HT7A 4WXWA 4B3RJ 1S9GA 2IMWP 2BJ3A 1HWUA 1R0AB 2W1BA 3FKBA 3GJQB 3MDFA 3MECB 2XULA 1F1BB 3CMES 2N7YA 2J0XA 3MM9A 1LW0A 3HHLB 5E33A 3ZZUA 3RJMB 5KFHA 1SL2A 3K5OA 2V8VA 4DWIA 5ETVA 4RNOA 1TUWA 5H9EJ 2XYPB 1PC5A 2HW3A 1CJUB 2YNIA 4FVMA 2UUBJ 5HLFA 2AW0A 2YKAA 2CPFA 3THTA 5HP1B 4K4SA 5JMNA 1B3TA 1S1VA 4L3NA 1RJJA 4PR6A 2Z56B 2ZC4A 3LPYA 1C4CA 4UT4A 3H40A 2R7TA 2L08A 2P9EA 4FVCA 4RUHA 1TZ0A 1JMTA 4JI3F 2W7AA 2ASLA 3C2PA 2BEFA 1S99A 2KXHA 3KG0A 5AE3A 3ENVA 4CZCA 1W2BR 1MWYA 6FD1A 2MHNA 1KVIA
chains in the Genus database with same CATH topology
2ZH2A 3FSIA 5GAEU 1R8AA 2HPUA 2EG1A 3OBIA 4PG6A 4HDGA 1IUJA 2ZOFA 2WONB 4IDKA 3MTJA 4UY85 2Q1LA 3LH2S 3I0RA 1K1QA 3ENWA 1TKXA 3ZZRA 3HHLD 2G9OA 3PW0A 1WHVA 3S01A 2WB1D 4DLEA 2GQ2A 2R7OA 3I82A 3O6QA 4QPTA 3BQ0A 3DYAB 2A1BA 4FS2A 3MM6B 1HYSA 4Y00A 4G1PA 3MEEA 2ZZMA 3IG1A 3V5RA 4M5DB 4H54A 2GGPA 1S48A 5C24A 5T14A 5KOXA 3KHLA 1IQZA 1BWEA 1VC6A 2ZBCA 4PCQA 4Q5VA 2FHOB 3SDEA 2WCXA 5KFOA 1N52B 4C8OA 2FVCA 2OFGX 2XLIA 2VA2A 4C0BA 3CCVS 1P1LA 1WD6A 1HARA 4BS2A 2MZJA 4IQMA 3CDEA 4DEZA 3RRKA 1TVRB 4N77A 4F4KA 2D3ZA 4NCGA 3MTKA 3PX0A 1HA1A 4ES2A 4MFBB 2R8GA 5J1PA 4DN0A 4QPXA 1O8BA 3SEOA 2IA6A 4RKUC 4WXOA 2MMYA 5D6GA 3KLEB 2HVHA 2DGWA 2I1RA 5L9XA 3P6YC 2IJFA 4QOTA 3DLKA 4IG0B 4GO5X 1Q16B 4FF2A 1FKPB 3LGNA 4MYUA 1WNEA 4I67A 4JI2F 3NNCA 5F8IA 2J5AA 4URGA 4YFUA 2YWKA 1HI8A 5T7LB 1NEEA 1ZM9A 4FXVA 2CG4A 2ZH5A 2BJEA 3R5BA 3B4MA 4H4MA 1HNXF 4NPOA 4Y28C 5D4LA 4PG4A 4DG1A 1DAXA 1E6YA 2HFOA 1WHWA 4NLWA 3OQ2A 3LAMA 2HRUA 5K9FA 5LT5A 3NG8A 4ETZA 1ZETA 1M5OC 4G1QB 2IVMA 5KFNA 4WZQA 1RTIB 1BGXT 2G13A 3OFFA 4M94A 5CZVA 1Q53A 2RH3A 2E7XA 4QIFA 3IWNC 1SC6A 4IKAA 2BW2A 1SUQB 1X5PA 5DGBA 1LW2A 1EETA 1NHUA 2AYEA 1FHTA 1HD0A 3HI9A 3TQ1A 2NREA 3V81B 4DR2F 1NH8A 3NGDA 1VMBA 5C25A 1RT7B 1FTCA 3IBWA 4C8YA 3M2UA 3E8OA 2PE8A 2HZCA 4OI2A 3HPOA 1Q8BA 3K5NA 2PO4A 4ZHRB 3FSYA 3IA0A 3H98A 4GO7X 3R27A 5SUHA 3TNVA 4O44A 4C8NA 4ETXA 3PR5B 5HROA 3PJXA 3IWLA 3TP2A 5KOWA 4IYQA 1R0AA 2QMXA 4WFNQ 3QWPA 4Q8EA 2W9CB 3I5CA 3MECA 2UVRA 3JTOA 4WU3A 5M2RA 3D0GE 1S1TA 4A4JA 4KRWA 2E1AA 4O3OA 4WYWA 3TVYA 2OPRB 1VC0A 2GIRA 2M0GB 5GADU 4QW8A 4C98A 3HHDA 2E9TA 2CQ1A 4CI0B 2W7OA 5K14A 4JI8F 1NK8A 5DQGA 3HT3A 4WZMA 2VUGA 2B5JA 3ZFVA 3HHLA 1UA1A 4ID8A 1Q7YT 3BM7A 1KLMB 1N36F 4LVOP 4JYAF 3DRXA 2ZFHA 2WSEC 1S7HA 2QYCA 2FUG9 1SB6A 3IR6B 1RA6A 2WBMA 3B78A 4QR0A 4OI1A 4C11B 1WF1A 3K8WA 2LDIA 1YSJA 3AA8A 2B9YA 1SI9A 3X3UA 1RT2A 2DNMA 1K0TA 2OD6A 3MM7B 4NA2A 3TOQA 2MKHA 2OH2A 1U1NA 3UCZP 5CYQA 3LP1A 1YJVA 3PIOQ 4N47A 3H5UA 3OL9A 3RZAA 4IG3B 1DBDA 2BR0A 3QZ8A 1S4FA 1JJ2R 1HHTP 2XNQA 2XI3A 4ED0A 1BQNA 4I2PB 4EEYA 3D5MA 1XEZA 4IO9Q 3MMBB 3RYLA 4ECTA 1JLBA 2D9PA 2YKPA 3MAHA 5HP1A 2CPXA 1WTBA 1ZZFA 4XDCA 5IM0A 4KPYA 2ZZNA 3KLVA 1YJRA 1LV5A 2V4RA 1HHSA 1C1CB 3DOKA 5B0DA 1XMQF 2UU9F 4LFBF 1WG4A 2RUGA 3Q23A 2R8IA 2J0WA 2MSTA 2R2SA 1RTDB 4FNIA 4YR3A 2IAJB 4YEAA 4X65F 4URSA 3CT9A 2ERRA 2AQ4A 4TY8B 4G6VB 4ZPAA 1VQOS 2CVIA 3KG4A 4F4XA 3U1NA 1DARA 4NLDA 4PG5A 4FXWA 5MAOA 4CT8A 5LJ3Y 3GG0A 1TV6B 2V4JA 3O44A 2B3TB 1VIOA 4HVZA 4KGMA 5DDQC 2MZRA 1YVFA 4WFZA 2VBXA 1JK9B 4Y3CA 2DNGA 1S1XA 5HMYA 4JV2A 2DNHA 5JJBA 1RGVA 3QWUA 2F7VA 1U1KA 1QUVA 2QRRA 3EXCX 1FRIA 1S6PA 3IFEA 4OIXA 4DV5F 4A8KA 4B3TF 4GKKF 1T05B 1KN6A 5LL6d 3G6XA 4G1IA 1HNWF 2KFZA 1KTQA 1Y5LB 2JVOA 3FRYA 1JLCA 4NZ7A 2JJ4D 1VBXA 4KIAA 4ZS6A 4A46A 5CD4H 3ZZYA 2JC1A 3BDPA 2WONA 1S0MA 2E5JA 4C3KA 3PVXA 3VZIA 2C3MA 3V2UC 2VZ9A 1YJ9S 3NP5A 3M9OB 4OI0A 2HQIA 2BQ3A 3T1AA 2XHWA 5IT4A 1UVMA 2XWXA 4F67A 2I9SA 4N76A 2RVJA 4A8XA 3DYAA 3BSAA 3KLHB 3CCJS 5L1IA 2KJVA 5KFCA 1JJ4A 3DHXA 3MM6A 4KKOB 4C97A 3GWCA 4Q44A 3HHNB 4PXEA 2W4PA 3PM9A 1P6TA 4PQAA 2CQPA 1GXTA 2BV3A 2C28A 1C0TB 1DQAA 4TYBA 2OFHX 4O3SA 2CZVC 1T02A 2E44A 1SH3A 2HS3A 2ASJA 4ED8A 3T5HA 2K7JA 1ZYQA 1SV5B 1HQEB 1N5TA 1DQ8A 2BACA 2ZHBA 4ZVEA 3IRWP 4FF4A 3I56S 1FT8A 1TVRA 3MOJB 3M05A 1XMOF 2GIQA 1TFYA 4FNHA 3CCWA 4MFBA 3T6JA 4DV7F 4RLEA 2CQ3A 5E7OB 1UJ5A 1OPZA 3KLEA 1S72S 4M95A 4C9DA 2QV6A 5J2MB 5EX0A 3Q2TC 3FEZA 1YG0A 3H25A 3G71S 4IG0A 4O4GB 4AL5A 4ECWA 2GHPA 1FKPA 2J7KA 4OX8A 5FJ4A 5SZTA 2CYYA 2F8EX 5CXTA 2BA9A 3EXYA 3MR3A 3MWBA 1H6KX 2AP6A 4QW9A 5CZXA 3GSDA 4OQJA 1A6LA 2Z8QA 1H0HB 1AFIA 3L95X 2JLGA 2HQ3A 2VFRA 4LF8F 3OUYB 1HI0P 3G86A 2RDJA 2OKQA 2CQ4A 3PRBA 3BO4A 1K9MT 3J7YI 4IH6A 3HJFA 4H4KC 1UP1A 2MYFA 4YUDA 3QYYA 2XCPA 2J6UA 4G1QA 4ZOSA 1UA0A 4GC6A 3HXMA 1RTIA 2OMOA 4LVNP 3W7BA 4DSLA 3QPIA 3QIDA 4AE5A 1SUQA 1FDDA 5DM7Q 4C8ZA 4IH7A 3LALA 3WC0A 1VQYA 1Y0HA 3EX7B 3UI3A 2YX4A 1VRTB 5KTQA 2Y0SD 1OIAA 2ZH1A 2OAUA 4FF1A 2XI2A 2CJBA 1RT7A 2XY7A 1H38A 2MKCA 4QR2A 2IVFB 2KTQA 1U49A 3W2WA 3JB9k 3IAS9 4ZHRA 4CIOA 2WAQD 2KDOA 2D3UA 3GV5B 4ECVA 2RQ4A 1IKWB 2GMLA 3C3LA 1N0UA 2CJAA 3KK3B 1ZM4A 2VG5B 2RQMA 2J7WA 4TY9A 4HEA9 4BCAA 1U1LA 1VQ9S 2F40A 3CJKB 2W9CA 1O5JA 4ZPWR 1SH2A 3QJPA 3WDOA 5F8GA 4NCBA 3PNIA 2KYXA 5E3RA 2W8LA 1L3VA 1FO1A 4A8OA 3Q0AA 2FJVA 2OPRA 5AXLA 4HI2A 4LF4F 3H2VE 1UMJA 4FF3A 5J1NA 1RTHA 4JI6F 3CO9A 2R8KA 4OJ3A 1HBUB 4Q0BB 1JLEB 4ES3A 2HNYB 2CQIA 3VR1A 3IC1A 1S0NA 2G4BA 2BM0A 2EBEA 2HWTA 1IJEB 4B3MF 2OD4A 4H4OA 3KG1A 5DETA 2DGVA 4RU9A 3QMQA 2XCAA 3ZZZA 2HS0A 2NQPA 1BLUA 1IBKF 3MM7A 2DNKA 3MCSA 4C2MA 2HHTA 2BOPA 3MM5B 1X4FA 5I4MA 2U2FA 1CLFA 4DSFA 4NLUA 1HMVB 4IG3A 5KFTA 4J9SA 1DJ0A 2X1FA 1N33F 3SYZA 2PEHA 3DOLA 4I7FB 2HYIB 4OZ1A 4I2PA 1ULRA 2EVZA 2DT9A 1HNIB 3D0IE 1TL5A 3D1QA 3OTDA 2U1AA 3KNAA 1B0VA 3TX8A 1UWBB 2BQRA 2MY8A 1ZTWA 1GQEA 2OPSB 2I38A 2L9DA 1FJEB 3RB4A 4LJMA 2RNEA 2LEPA 2OJ3A 3BQ1A 2FDNA 1C1CA 3NKYA 3KHGA 1KONA 1IXKA 2VV5A 5DDOC 1RTDA 2GO8A 4FZVA 3BJYA 4E0DA 1ZAWA 2JL9A 4OX7A 5KT4A 4ERDA 1FRXA 2FLLA 2DGUA 2IAJA 1HWJA 1IN0A 2QE5A 4TY8A 1JKHB 1N88A 1Q79A 2IRUA 2C22A 4NYZA 3SCIE 3UDLA 4TU7A 4KGKA 2HVZA 3ETOA 1HR0F 4DL4A 1TV6A 4D3GA 3DU6A 4RUAA 3BZQA 1CVJA 2FHMA 4KFBB 2K3KA 1NAQA 1L5UA 3C46A 4M8LA 5EX3A 4TXSA 1NJYA 3DLGB 1N5SA 3I32A 2YKOA 2DVIA 4ALZA 2O5DA 1XN9A 5K8PA 3GB0A 5F9LA 5GAEI 3BSOA 1VQLS 2J0QD 3IWXA 1LKZA 5GAHI 2M4MA 1T05A 2F8MA 3CJ0A 3HDSA 3DDKA 4DHVA 3I4HX 4RBVA 2A10A 4WF9Q 1RT4B 3NCPA 3VQTA 4BWJA 1S10A 3HFKA 2WTFA 4O23A 3L7PA 2VFUA 2KT5A 4Z2XA 1REVA 1FNOA 1NK7A 1C1BA 3HHLC 4CO1A 4X4RA 1GX6A 4Y2MA 2XMJA 2EI5A 4ZPVR 3VAGA 4DSKA 2KHDA 5IXUA 1MMNA 1B0PA 2JLEA 3CIMA 3KLHA 3M6UA 2CPYA 3KKFA 1QVFR 4DV4F 4KKOA 3H59A 2AU0A 1HNVB 2AYGA 1TL4A 1XWLA 4A8FA 5KFUA 2VB6A 1AXQA 5B09A 1LXJA 5HN0A 3OXGA 3GMGA 3TVZA 4UY8T 2DO4A 2PI4A 1N0VC 3R3TA 2HHQA 4MKYA 5E41A 3J7ZT 1KQFB 1VFJA 2WSCC 4O3PA 3PEJA 1D3WA 4CO0A 3RB0A 1SV5A 1ZZNA 1HQEA 3J7A1 2VH7A 3AHPA 5THWA 3I9ZA 1Q4RA 2XMMA 3DLEB 3KLIA 1NK4A 2PDAA 3I5AA 4UW2A 3PIPQ 3PZPA 1XNRF 3N4WA 1JX4A 4EZ6A 4R25A 3HP6A 3GFYA 2DTJA 4R8UB 5BR8F 5J2MA 3CCQS 2KG0A 5HMWA 4K4ZA 4QU7A 2NPFA 3DRSB 1RP5A 4CO5A 5M2UA 5U47A 5J1EB 3CSKA 2ZJRQ 4UUXA 5GVQA 5L1LA 2MJNA 2O66A 3D28A 1M5VC 4QZVB 1XNQF 1OS5A 2B6AB 2GC8A 3N28A 2AWZA 1VQ6S 2GHVC 3ZZTA 3Q24A 3I55S 4EYIB 1RTJB 5I42A 2LDYA 2M8HA 3QGHA 2HHUA 3M6WA 2C3YA 1VBZA 4ZK7M 3CXCR 1UVIA 2WOMB 2F8HA 4JV0A 5HL7Q 1U6ZA 3KHHA 3CC4S 4N41A 4OLOA 1HBMB 3PDNA 2C2EA 2HIQA 2X51A 3G6VA 1MW7A 3OFHA 1FCAA 4HH1A 1PC4A 2RMLA 2VKRA 4R0EA 1RT3B 5C42B 4UOCA 2B51A 3FCHA 2RE1A 5AXMA 2B0GA 2RB7A 5K8MA 5JUMA 2N3OA 2XGPA 3GIMA 4ZA1A 2X3GA 3CD7A 3R5CA 4Q43A 4JV5F 2AD9A 3MMJA 1N5VA 3GIJA 3H4DA 2JDJA 4DL6A 3TUZC 2BABA 2GHWA 4B9MA 4DFMA 3WBZA 2K3IA 4FN5A 1R8BA 1ZOTA 2VPZB 4WTYA 2X1AA 3EYZA 1IKWA 3KWMA 4KQZA 2LECA 1FD2A 2MQQA 4RBUA 5B0EA 3KK3A 1SKSA 5A6WA 1RT1A 3NAIA 3T1YF 4MKBA 3F44A 4ZCLA 2LVWA 2JC0A 3SFGA 4IRKA 5L1JA 1U25A 1UL3A 1Y00A 2KHCA 4MIBA 4NX9A 5DO2A 1DLOB 3QZ7A 3VAMA 4K4WA 1D9AA 1QVGR 4B9SA 1QAXA 2B4VA 4OX6A 1S1UB 1S9EA 2ROEA 1ZM3A 5GAGU 2IBKA 4LQ3A 3GFHA 1V6HA 1V3ZA 5LJ5Y 2LQ5A 1KQGB 2QZ8A 2HHHF 1HBUA 1CSJA 1JLEA 3M6XA 3MMCB 4QWBA 4EBEA 2I2YA 4HDHA 3OW2R 4NLOA 1RQ0A 1NHVA 4DFKA 3AY0A 5F3TA 2HNDA 3JSYA 3FZBA 4I1TA 2ZNYA 2W9BB 1S49A 2YX1A 1JWWA 4N56A 1FK9B 2PGCA 2R8HA 3CDWA 2B7CB 3QJJA 1HQUB 4W90B 5D77A 3S6EA 1PO6A 1FRHA 1RISA 1U1RA 2E5LF 3M8PB 2IC3B 2V8DA 4QWEA 3MM5A 2ILZA 4CH7A 1VHFA 4Y34A 2JVRA 2CPZA 1CPZA 4U7CA 1QLNA 4OI4A 3Q22A 4ZVHA 4DF4A 1VGYA 4I7FA 4URQU 5HO4A 4B9UA 1D8ZA 5E2QA 2HGNA 4HHJA 2OSQA 3BO2A 1UWBA 1Z1ZA 4YDDB 4YHHF 3BSCA 2DH8A 2OPSA 3HZGA 4QWDA 3VWSA 3KLFB 3PY8A 1R7IA 4DJBA 5KG7A 4OMFG 2R2TA 4N5SA 2RRBA 5CCLA 2IFXA 3MUTP 3MHYA 4ID5B 2KT2A 5H9FJ 3AQOA 2DNYA 2L48A 2NUUG 4JI1F 2ILYA 3K5MA 4PWUA 1BC6A 2OTLS 2DR7A 3L3CA 4F2RA 3R5AA 3PEHA 2FGCA 3TAQA 5F9NA 2IYGA 2E66A 5J2NB 4KFBA 1B0TA 5B08A 3V6DB 3CUNA 2UXDF 2FJAB 5E3AA 2DHXA 3NWGA 3DXBA 5AXKA 4DV1F 3BR9A 2Q79A 4LUBA 4PWDB 3PW2A 2PSZA 1S6UA 1LWCB 2KI2A 3OVSA 4OL8A 3KNGA 1P9QC 1JNZB 3MEDB 2JEFA 4ELUA 4TQRA 4ILMA 4NYOA 4K59A 2PC6A 2AJ4A 3SCLE 4DR4F 2QO3A 3DMJB 3MFIA 4F4ZA 4JI4F 2RF2B 1RT4A 2UUTA 3RU0A 5KG2A 1U47A 3FDSA 2E1MC 2YNGB 3GIKA 2FJWA 2DISA 5FLXY 1N6QA 4B9NA 2P5VA 3DI6B 4J9OA 3DRPB 4ZP7A 4N8OA 4NL5A 1IKYB 3DRRB 1YJWS 3DN9A 2BANB 3BDEA 1IKVB 3J81Y 3PX6A 2VONA 3PKMA 5E0OA 1FXLA 2J9EA 5I3PA 1TK8A 1KRPA 2MJUA 3H5YA 4V19X 2J8AA 4MYTA 1WF2A 2FVPA 3SSQA 1S77D 1NB7A 4TLQA 4X64F 1MMDA 2KM8B 1C0UA 3U7JA 2EPIA 3VAFA 4I0WA 2W24A 4A48A 1N5YA 5F8JA 3IRXA 2YWFA 3QAUA 5K5MA 1Q1KA 4KR0B 4X4PA 3KK1B 1OQ3A