1IN0A

Yajq protein (hi1034)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
PSFDIVSEITLHEVRNAVENANRVLSTRYDFRGVEAVIELNEKNETIKITTESDFQLEQLIEILIGSCIKRGIEHSSLDIPAESEHHGKLYSKEIKLKQGIETEMAKKITKLVKDSKIKVQTQIQGEQVRVTGKSRDDLQAVIQLVKSAELGQPFQFNNFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YAJQ PROTEIN
publication title Crystal structure of the YajQ protein from Haemophilus influenzae reveals a tandem of RNP-like domains
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 53
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04461 DUF520 Protein of unknown function (DUF520)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1in0A01
3.30.70.990 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits YajQ-like, domain 2 1in0A02
2KHDA 1IN0A 2JZ5A 5B7WA 2K3IA
chains in the Genus database with same CATH superfamily
2XMAA 4RW7A 2FVRA 1FKOB 4P6QA 3SQGA 4ZJOA 2DHGA 2DGWA 1NK0A 3M2UA 3R3TA 2FHMA 3F0NA 2KM8C 1S9EA 4ZCKA 4FF1A 5J2NB 3QRPA 2WONB 3ENQA 3RB0A 3GIJA 1H74A 1H2UX 4ZIVA 3BGUA 2HNYA 1X4DA 2F8MA 4WP3A 2XLKA 2QFIA 2PMZD 3FEXB 3IC1A 4NX9A 2CAJA 1RKJA 4L3NA 1UWBA 3VF0B 4DR3F 2UUTA 2ZE2B 4DQPA 4RUBA 1VLYA 4LBIA 3M9NB 2CG8A 2OPSA 2ADCA 4NXMJ 1KVKA 3J81Y 2ZOGA 1CJKA 3M2VA 4ETXA 1I5OB 4NCAA 1K73T 4M5IA 3MGJA 4O44B 3GYNA 2PA3A 3FVYA 3AY0A 2GX8A 1U1PA 1WG5A 5LXRA 2CPYA 3W8GA 1GQEA 3P3DA 5KFEA 3AQOA 1UW4A 4ILRA 3MM8B 2QA1A 3BGLA 2BW2A 3BKTA 1VQ7S 1Y9OA 1AXQA 1WOPA 2OTLS 2DEJA 4CH7A 1A6LA 1IBMJ 5KFPA 2AD9A 4O3NA 3U1NA 2ZH5A 2BJ3A 2DNRA 3PFEA 3I9ZA 3ITHA 3H59A 1TKXA 5KFSA 5EGYA 4EWTA 3IM8A 1LWCA 3SCKE 5C2GA 1NDLA 2UXDJ 1ZAWA 2LXIA 3AXMA 3HCXA 1WJ9A 3MD1A 1HNVA 3T5KA 2XY7A 4B3RJ 4KO0A 3KLFB 2N3OA 4DFJA 1PBUA 2DGOA 4PQUA 5HMYA 2DB1A 3HHLB 4OIXA 2VG5B 1Q16B 3PZPA 1VBKA 2CJXB 1ITPA 3W63A 1NKEA 2J8AA 2BKNA 1WG4A 1CJTB 4DR2F 1M5OC 2D9OA 1R43A 4F4AA 1NKCA 1RKIA 2GIRA 2UU9J 4ZVSB 2DGXA 4N5SA 4KHMA 3CDAA 2E1PA 4CYUB 4YY3F 2D3ZA 1X0FA 2QO3A 4ED2A 3J7YI 4DS4A 2H4YB 3AOCA 3DOLA 1S9FA 1U02A 2DGUA 4RW9A 5AXLA 3MPYA 1N5TA 3NGUA 1RACB 1IVZA 4DQIA 3R6GB 1T05A 2F4VJ 4WTYA 1XMQF 1P6TA 4IFYB 4EGLA 3B6BA 3QMQA 4YR2A 1PBAA 3HO1A 4F4KA 5L1IA 1VQ8S 2V34A 3SCLE 3RAXA 3RR7A 1AUSL 3AQPA 2WOMA 2MKYA 3KG1A 4RW7B 3SQGB 2UUAF 3AH6A 3DRPA 1JK9B 2CWXA 4FF4A 1ZOTA 3G9CA 1NCLA 3C6TA 2VG7A 1BQNB 2CVEA 3ZZPA 2VU5A 2ZNZA 1S9EB 3CCLS 1VJWA 4DSJA 4PG7A 4ZHRB 2CQIA 3OLBA 1S1WA 1TMJA 5DDOC 1YRXA 3A12A 4DG1A 1N0VC 2XS2A 1P27B 4M5DB 2JC0A 3Q8PB 3D6TB 1HLWA 3GJSB 1R0BG 1LOUA 1S0MA 2ROGA 4DXLA 3DLGB 2XZWA 1YJVA 2Q1LA 3B78A 4P75A 2YWGA 2AJQA 4DV0F 2OPSB 2QYCA 3EYZA 1CJVB 2Z57B 3BYRA 4J90A 5IWAJ 1ZS6A 3PDNA 1CJKB 1U6ZA 2MZSA 4NXNF 3FJ2A 4F36A 3MEKA 3BSCA 2Y8WA 3TQEA 2LVWA 3OXGA 3D1HA 2EFNA 3LGNA 1VQ6S 1ZM9A 4RNOA 4DV4F 3M9OB 1GXLA 4AL7A 2R8JA 2XGQA 2K7KA 1VQOS 3KLGA 2NZCA 3KLIA 2IJNA 1EQMA 4DZDA 1Q86T 3M2RA 4EBEA 3AA8A 3HHNB 4MK7A 3DGVA 2OP5A 3HD2A 1TKXB 4I2PA 2ZH4A 5L9XA 5ETLA 2V8DA 5IT4A 1WHVA 2HHHJ 3B8HA 2HFZA 1R7IA 1N52B 3S7RA 2AGOA 3G8SA 3MEGB 2JLGA 2RAQA 3KJQB 1FA0A 1H7XA 4FXDA 3Q8QB 1LWEA 1NK4A 1ZAVA 3VQSA 3MPVA 4PQUB 3ZFVA 2M7SA 1Y3JA 2DXDA 1Q53A 1MROA 2CJ9A 1UEUA 3QLHA 1S9GA 3EM1A 3BH7B 1KR4A 2YKNA 3QRRA 3CO0P 4KY3A 2Y9HA 2YKMA 3M8SA 3RTVA 3BGRB 2Y8YA 3LPEA 4NXMF 2QEXS 2W8KA 2X1AA 5ETPA 2C2DA 1UA1A 3E3XA 2IRXA 1TUVA 3OL7A 2XBPA 3AHPA 4CLYA 4RW9B 4NA2A 2M70A 2IPOB 2LKZA 2CQ0A 1GXTA 3CCES 1OJ4A 1MLAA 5HVHA 1CJUB 2A1BA 2V4QA 2WOMB 1TKZA 2HMIB 5D0GA 2CRLA 4QIVA 2M2BA 2FTRA 4N76A 1JLBA 3G2XA 1FRKA 5B0BA 2FJDB 1BHNA 3C6TB 2UXDF 3CCUS 4JV5J 2AJ2A 4X4QA 1T7PA 4GMKA 1KLNA 4PWDA 4KKOB 4B3RF 4OYAA 4DQRA 4A8FA 1S1WB 5KFLA 2MEWA 4ZN1A 2V4JA 2FYXA 4DG1B 3O2IA 2HRTA 2OJ3A 3PW2A 2PA8D 4KIAA 4OI3A 4NZ0A 4OX7A 2OHDA 1P9QC 1B3TA 4BBYA 4M8LA 5KFTA 2UU9F 3NOGA 3LTOA 4G1QB 2YH1A 2IY5B 4MKYA 2RE1A 4H4MA 2HHUA 2HSEB 4USMA 1Q8BA 1WUUA 4AFFA 1SC1B 1LKZA 2IBKA 3P5BP 1F60B 4B3MJ 1MN9A 1KSPA 4DX6A 4FNIA 2C2NA 1QE1A 1W26A 5HQMA 5D78A 2IA0A 2KRRA 2B5JA 5EWGA 5BYSA 2C2MB 2IC3B 2XB2D 2F4VF 4YOEA 1WEZA 3MM5A 2R7WA 1HWIA 1DARA 1NMEB 4LRBA 3KLGB 4KPCA 4OV6A 3KLIB 2LQ8A 1B7YB 4MJKA 1WTFA 5D4LA 4K4XA 2DNLA 3UN3A 4I2PB 3QWUA 3PYGA 4A8OA 4RW4A 2J8SA 2XLJA 4I6WA 2CPZA 2QIFA 2BX6A 2F8EX 1U1RA 3F56A 1XK8A 1LWEB 2B3TB 2QSWA 1ULRA 2OPPA 1QVFR 2Z2ZA 3J80U 2XNRA 1HBUB 1MROB 1YJWS 3WIVA 2F5GA 4ZLJA 1S9GB 4Y3CA 4WFZA 1DAXA 2GQQA 2E1MC 2DCUB 5HQLA 1Q7LB 1U2CA 4ZPBA 1YSJA 2B51A 2Q43A 1LXJA 3AB2B 4UY8T 1HHSA 1X7VA 1OS5A 1U24A 1KDNA 1NAQA 4K2XA 5GAGU 5CYJA 2Q79A 5KTQA 3C2PA 3GCWP 4OJ1A 2ZH3A 3MR2A 4HT7A 4LSLA 4JYAJ 2YQ1A 4ID5A 3HK2A 4FZVA 1L3UA 3K17A 1MSWD 3LP1A 2B6AA 4RUCA 2U2FA 3BQ2A 2GJIA 3HXMA 3VAFA 3BR8A 5A2QU 3V5RA 3R5AA 2HQCA 4HL9A 3UE2A 4EFAC 2CQPA 3ZZRA 1C0TA 2HYIB 3CWJA 2HHHF 2XMMA 5A76A 4PWDB 1JLGA 1NJIT 3NS6A 5DM6Q 3GV7B 3HFKA 4I1TA 2QFJA 2UVVA 4ILMA 1SBRA 1IWAA 2NYHA 4R0JA 1RU1A 2LLZA 3V4MA 3SCIE 1QJHA 1EZZB 5E33A 1RGVA 4JOUA 1UVLA 1I94J 4CDIA 5AE1A 8RUCA 1JB0C 4I68A 4I56A 4H4MB 4ECZA 4ENOA 2CPFA 3V81A 3W5YA 3CCVS 5IQQA 5KG4A 2XCPA 2CPDA 2RIJA 3E8OA 1IUJA 2K1RA 1DTQB 2JNJA 3FZ2A 2DPIA 1KKHA 4TNOA 1S7HA 2KXFA 5KT2A 5E3RA 3GWCA 4ZN3A 1LWFA 4MKAA 3AA9A 3AOBA 2MKKA 3QJPA 2W24A 3CDBA 4IQMA 1WC5A 1M5KC 2C2RA 1T02A 3ENVA 3H7HB 4M5MA 2GC8A 4FPRA 4O4RA 3RBXA 3MF5A 4FS2A 1TKDA 3THVA 3M1VA 3LAKA 1NPKA 4YP3A 1MWZA 4CLSA 4CI0B 4ITSA 4F26A 3HKWA 1RWXB 1QY7A 5ETOA 3OSPA 4QPXA 1RTDA 1AYEA 4NMLA 3ISZA 4RW4B 1IM6A 4JV5F 4MYTA 5M2RA 4OZNA 1KOHA 1K47A 1RTIB 3CW2C 4IO9Q 4H54A 4RL1A 4DR5J 4XPCA 1U1QA 2HGMA 3PG9A 4QWCA 3G6ES 1R8AA 3PJ9A 4RX6A 2E5LJ 2HFVA 3GJRB 1NJZA 2R7UA 3H2LA 1JNRB 3A13A 4HYKA 4Y2CA 3PIOQ 1YG0A 1U1NA 2BRKA 1FERA 3VALA 3JYTA 4DCJB 3GPAA 2BMBA 1H2TZ 3KLHA 1UW9A 1KTVA 1DY3A 2CQGA 2D3O1 4B3MF 3QT5A 3MAQA 1ZETA 5HVFA 2JEFA 5F8HA 4LSLB 2QE5A 4UY85 1PAEX 2FVCA 1HBOA 2YPZA 4TKTA 1D3WA 2GMJA 3LP1B 4B9SA 4PEOA 5F8LA 2B6AB 2ZOFA 2ZNYA 2DRAA 3D6HB 2PGCA 4ZVOB 3GSIA 3PCOB 1FKPB 2HQGA 4B9VA 5IS2A 4L76A 4FF2A 4P2XA 5B0FA 1G3OA 2YNHB 3FBEA 1FF2A 1AA1B 2CNNB 3CDWA 3GJQB 1NJXA 2PEBA 1HBMA 1Y4ZB 2GO9A 1VQ9S 1GH8A 1C0TB 1SQGA 3SYZA 4N41A 4K4UA 1ROFA 2JHEA 4HI1A 1X5SA 2VG6A 3IR5B 3AJ1A 4B3SF 2WTFA 4NCBA 3TR5A 4LF7J 1OSCA 2A10A 3FSXA 2VICA 3AOAA 2MLYA 4F50A 4P9SA 1N34J 1HNIA 4TLQA 5HJXA 4OFZA 4JI7J 4ZIWA 1IJEB 4DU7A 4LF5J 3M4XA 4LF2A 2CJQA 5CA5A 3N28A 3G96A 4OX8A 4LJMA 3K2YA 3KJNB 3BBFA 2CNOB 4F0HA 2VZ9A 1N6QA 3R2CJ 1Y00A 2KXHA 2K1RB 2FGCA 3W3SA 2BJ7A 2LYVA 2RDJA 5B0GA 5GAGI 4JYAF 4USUA 2MQNA 3K59A 2A6OA 2V68A 1T03A 2ZZNA 1EX8A 2FHKA 4KAIA 1AB8A 4C8NA 2VV5A 1R0CB 1N88A 3JSMA 3T1AA 3OD2A 1IQZA 4LFBJ 3M1VB 4O0NA 4G6VB 3D0IE 2EFGA 1L3TA 1FDNA 1PYSB 4Z37A 2OFGX 3ZTOA 1WSVA 3TUZC 3HPOA 2WW8A 4ED8A 3P8BB 2NXUA 2ZH6A 5KAKA 3UQSA 2C28A 3CJKA 1AT1B 4DF4A 1WDDA 3DRSA 4MKBA 4OYZA 4NLPA 4RU9A 3AAWB 2LEBA 4HDGA 1FVQA 3RBEA 2Y0SD 4KB7A 4C0HA 4J9NA 4LIWA 3ISND 3L3CA 3G8QA 3KK2A 2O3DA 2W9CB 1U45A 1WC0A 1GAOA 4WYWA 5BYQA 4C7QA 2K8GA 1I94F 2ZITA 5G0RA 2NREA 1M1HA 1ZZNA 3VAJA 4WZMA 4DR1J 1M5VC 2XYGB 3N5BA 1RZMA 3LP0A 1URRA 2AEMA 3KHGA 3KLEA 1DQAA 5KG6A 2LQJA 4KSEB 5IT9Y 5ETVA 2N4CA 2HPUA 3H90A 4F2SA 3PKMA 3FMBA 1C4AA 2KN4A 1SJ3P 3CPWR 5J2PB 4Y28C 4HR2A 1NSKL 1RK8A 1WKJA 3IBCB 1KONA 4U67Q 5A8RB 3KXDA 2XS5A 1TUGB 1L3VA 2YBVA 3AB4B 1BQMB 3C6UB 5L1KA 3EDQB 3NS7B 1KQFB 4DR7J 2IVYA 3P45B 4JV1A 4Y2AA 3MFHA 3IS9B 1RHRB 2DGTA 3TZZA 2BQRA 1JLCA 1UZDA 3PJXA 4ZVPB 2OO4A 4YR3A 3HFVA 4BLGA 1A0OB 2NUHA 5HANA 5T14A 2XI2A 4P2SA 1RWNB 5C5JA 2GNKA 3OL8A 2VG6B 2YTCA 3HHLD 1W2IA 3QGHA 1RISA 4X4OA 4LVOP 5KG1A 4DR5F 2QGFB 2F63A 4RUAA 3O6QA 1JWWA 1Y5IB 5D8HB 4DBQA 4U7UD 3H5UA 3VGSA 2EVZA 3I96A 3RYLA 3CF5Q 2E5LF 2BA9A 4UT4A 1HNIB 3JTOA 2BZ2A 3QGPA 3FDSA 5CYQA 1TAUA 2AYEA 3UPFA 2HHVA 5CYMB 1Q95G 1ZA2B 4DX8H 4GKJJ 3UO0A 5JJBA 2V2QA 3H0PA 5HMWA 3FNNA 4FXVA 3L09A 1S48A 2CADA 1N6QB 1K8AT 3C14A 4F04B 2F3JA 4Y6IA 3R2DJ 1T11A 4LF9J 4J9MA 3GYXB 2AEFA 5ETMA 2ZJPQ 2AT1B 1X4EA 3JSMB 3NGDA 2DNMA 3S8SA 4F0MA 2QTWA 3NAHA 3PR4A 2XC9A 2B9EA 2J7UA 2VHGA 2IM3A 4FN5A 3MAAA 2HS4A 4FVMA 2MZJA 1Q7YT 2FLNA 3DC2A 2ACMA 2C1EB 2VQFJ 2E66A 1C4CA 1T9TA 4Y00A 2W8LA 4RWXA 3DRSB 2DO0A 4URQU 3GILA 3BS9A 2CVIA 1LW0A 2PD1A 6FDRA 3VAIA 1QVGR 4LF7F 1URNA 2CPEA 4GO7X 3KK2B 3VAMA 2R8GA 3BDEA 3DOMB 1RBOB 3OTOJ 4DI6A 4W90B 2WHOA 5EX3A 1Q8LA 1IN0A 2YKQA 3CIZA 1DTTB 1TKTB 1N34F 3QJJA 4HTIA 3X3UA 4WFYA 4CLZA 3LALA 5L9NA 2WRMA 4WXWA 5A6WA 3NMAA 2CWKA 4BHQA 2NSCA 2HHWA 2K2PA 3LP0B 2FVQA 4AT1B 2WVEA 1RYSA 4FXWA 3UD5A 2ZM6J 1L3SA 1R3NA 2DH9A 4JI6F 1UFKA 5D4OA 2NPIA 3RU0A 4HEA9 2M9KA 1R8BA 1NU4A 5ETRA 4OZ0A 1KRPA 3NCRA 2ZBRA 4NEZA 4Y2KA 4QIWD 1G6BA 3WHIA 3HLUA 4LFBF 4UOGA 1GTEA 2V9KA 3KG0A 1RHQB 3JQKA 2VKRA 1T9VA 3V4IA 5I3UA 1PCAA 3HDSA 2JWNA 3UI3A 3IR7B 2OLWA 3HZGA 1YLXA 1RCXB 5HMXA 3WBZA 2JFKA 2G0JA 4LRAA 5KT3A 4QW8A 1N5QA 5HVGA 3ZZ0A 3NOCA 1B99A 1ZBTA 3CDEA 4X65J 1SL1A 2J0WA 4CT9A 3GFXA 2RJZA 3OJSA 4ED1A 4C2MA 2CQ1A 2VBXA 4EO6A 2HGNA 4C8ZA 2E5GA 4X4PA 1EARA 4DL7A 2MZTA 1X8DA 3BKUA 5CYQB 2ATCB 2CQHA 1YJRA 2DY9A 4H4OA 4DR1F 3R7BB 3VZHA 4ZP7A 2AYBA 1CLFA 1XMOJ 2ADBA 2ACYA 4DUZF 1VC6A 5FLXU 2N7YA 3FBCA 2HW3A 5HBMB 1N33J 3QSYB 3NLCA 1C1BA 3DLLQ 5KFHA 3C14B 4I2QB 1L5UA 5IFMA 3QIPB 4HT5A 4QYRA 1RT4B 3DYAA 4P72A 3W7BA 4DX5A 2NR0A 2RILA 4OJ3A 4XIUA 1R6YA 2IRUA 3MMBB 4DR7F 1R31A 9ATCB 5J1NA 1U6BA 2E5JA 3BJYA 1TVRA 1UP1A 5K8NA 2IM2A 2MHEA 4ELTA 2BBEA 1QAXA 3IMQJ 2VA3A 3N01A 5CCLA 1QUVA 1G4CA 4Y2MA 3HHEA 1HHQA 1UFWA 2UXCJ 2C42A 2RQMA 2BANA 4CLTA 4IH6A 3KWMA 3PRBA 1SL2A 4OHWA 1U48A 1FDBA 3FSYA 5BR8J 4WZQA 4X4SA 5LM7E 4FP9A 1PC4A 2ATLA 2FJBB 3ULHA 3FK4A 4RW6B 2RT3A 5KFDA 2MY7A 4UZBA 2DIVA 1GNKA 2W01A 2ILYA 5RUBA 3JQJA 1S6PA 1MMNA 3TZWA 4GKJF 2PE8A 4KQZA 1NH8A 4TY8A 1S4EA 1E6YB 2F9JA 1RT6B 4ZPVR 1YITS 2NXNA 1UEKA 2HG4A 4LR9A 3I32A 2LEAA 1RI7A 2CDQA 1LWXA 4DL3A 4FYVB 3ZZUA 4IG0B 4LF9F 3SZ2A 1JNZB 3PR5B 1ZPWX 1UVMA 4LBHA 4ZA1A 4ED3A 3V4IB 1RUSA 3FQLA 4WFXA 3TO8A 4Q44A 3LA0A 3RBDA 3SDEA 2V8GA 3AJDA 4JI2J 4KYZA 2FGOA 2AJ0A 3EZ5A 4RKUC 3QAUA 2IAJA 3G6XA 2LECA 4KC5A 2XHWA 2BUNA 2J6SA 3L95X 2QL5B 5KFRA 1V9OA 1E6VA 2PEHA 4JI3J 3R7NB 2NLWA 4E2FB 1HQEB 1REVA 1RT5A 3OTOF 3GR1A 2QMXA 2MTLA 1WSRA 5LXYA 1MU2A 5IV3A 4X84A 4LIRA 1F2GA 3J7AN 2RKIA 5AXMA 5F8IA 1QSSA 4W98A 3PFOA 4J9PA 2WCXA 2ZM6F 4PRFA 4J9UE 3MMAA 5HK4A 3FGVA 5IOLA 2E9ZA 1EJ7L 4CLKA 3RB6A 3KK3B 1OYDA 5DM7Q 4FF3A 2OD6A 2BV3A 3M30B 3TVKA 3SV4A 4DSKA 4JI4J 2G4BA 3FSIA 3KTQA 4FBTA 4RNHA 2V9WA 3I0RA 3ETOA 4NEYA 2IVFB 5HSPA 3I5BA 2D3OR 5IT0A 3CMES 1J2VA 1OY9A 2LMIA 4WCEQ 2E5HA 2KTQA 2AJFE 3KG4A 4J9OA 3BGOP 3SMZA 1HWKA 4CO1A 2MHNA 2A3JA 2DO4A 3M6VA 3OLAA 2VDHA 1X4BA 5IZHA 4X65F 3KUEA 1GMUA 4EBDA 4LVNP 1QTNB 3EJMA 4HACA 1KFSA 4RW8B 2E7VA 4A8XA 3HZEA 2FC9A 1FCAA 3HHKA 3NRBA 4Q0BA 4AD6A 1FK9B 1OY8A 1X9SA 4PPDA 4C9DA 3EXCX 4IOBA 1S6PB 5KT7A 1NDPA 2VF3A 3EGZA 1FXRA 1X60A 1N0UA 1Z2LA 2VOOA 4W4MA 1XMOF 3WIUA 1KHVA 1F5BA 1VGYA 4JI5F 4CTAA 4U7UK 1N33F 1UJ4A 1RWMB 3C15A 3JAMU 5DGBA 1S1XA 4DPTA 4ZCLA 1XTZA 4E8UA 2D69A 4QR1A 1WF2A 2B9WA 2HNDA 2HWTA 1X9WA 4B9TA 2KRBA 1RT2A 4ZCMA 4HLBA 3NNHA 2OPRA 3CJSA 1FNOA 2DD8S 4GO5X 4U95A 4NLGA 4NWBA 2XULA 3A8KA 2QMUB 3ENAA 5KFKA 3BSNA 4YR0A 3SDEB 2I9SA 5KFWA 1FD2A 1N5VA 2Z8QA 3K89A 3R97A 4HH0A 1M5HA 2F4FA 5D6GA 3KK1A 1H2VZ 3N9UC 1SXLA 5BR8F 4XDDA 1PO6A 3D9BA 2J6UA 1SV5A 5DG8A 4FS1A 2P9GA 4N47A 1J5OB 4OQJA 4AXJA 2P2CB 4C11B 2JVRA 2ASYA 3QFWA 1MU2B 3FBFA 3E01B 1VLOA 2Z0GA 4F0KA 1XR5A 1DFDA 3GONA 1Q4RA 1FI4A 2ASLA 2W4DA 4E0DA 4RU2A 3B54A 1SJQA 4P7VA 2A2DA 3DNCA 3MZIA 3R5GA 2KJVA 3EICA 4TVAB 1F2HA 5FDLB 1KLMA 1S6QB 2MY8A 3MMAB 3F41A 1DLOB 1NXIA 3NL0A 1YQHA 3S1TA 2Y1IA 5DDRC 1WDTA 2R8HA 3GG0A 1NJWA 2EKYA 1D9FA 2HQDA 4HDHA 3NNCA 2D74B 2K3IA 2W9BA 3LP2A 2BYCA 2KT3A 4WK1A 1SKSA 1AW0A 3FQKA 1S6UA 4JI2F 2R2SA 2HRUA 3A8EA 4QZVB 2VD3A 2I6WA 5A2QY 4USIA 2IJFA 4O0IA 4FDFA 2R2RA 2E1AA 4M5KA 3ETMA 1XNRJ 1KVJA 4L73A 1QLNA 1J5EJ 3VGTA 4JI3F 3DLBA 1QUPA 2JEJA 3VAKA 2NSBA 5F8JA 1G1XA 4Q0BB 2OSRA 2KJWA 4J9VA 2IDLA 3BF4A 2LU1A 4LF6J 5KT5A 1EKRA 4YDXA 2JX2A 3AD8C 3A1YG 1OPZA 4PG4A 5M2UA 5EHHA 1PIEA 4L75A 4DMZA 1NO8A 7FD1A 3DOKB 1SJ4P 1NSPA 1Y10A 4LSZB 1ZH5A 1CC8A 1VJQA 1Q5YA 2EC2A 1FVSA 4NLYA 3CCTA 4ZPTR 2UV8A 1S1XB 2LA4A 4HH1A 4NCGA 3LH2S 2J9DA 2EC0A 1X5PA 1UETA 4USWA 4DF8A 4ZCIA 4JI4F 2OPRB 4EEYA 2MSSA 3FCHA 3ONQA 3CCZA 1F3FA 1FD8A 5LMUJ 5HLFB 1BE4A 1U2FA 3GIIA 1QSYA 3DGPA 2R8KA 4ECRA 1IBKJ 2YWFA 3C16A 2YX4A 1C2PA 2QT7A 3JTPA 3OTEA 3GG1A 2RMLA 1IR2A 4X4RA 2EFOA 2XMWA 3OQ2A 3FEYB 4U6PA 5CQGA 3TARA 4O4GA 2G1DA 4C6AA 2OAUA 1S1TB 4GVBA 1SV5B 2JJ4D 1QAJA 1WF0A 4YEAA 3R7SB 1RCOB 3EPGA 4AYBD 1S6OA 4IOCQ 5DQHA 3MMCA 4CH1A 1GFWB 1X5TA 1P9YA 2RUSA 3ILIA 2JOQA 2GVZA 1F9FA 3LOUA 4H4KA 3NWRA 3GP9A 1KS2A 2KM8B 4WU2A 1VRTA 2IYGA 4ZJQA 2R4FA 1HNWJ 2A2CA 1KLMB 4LR7A 2DR7A 5HL7Q 3BPSP 3UR0A 4DV1J 1WKKA 2EKNA 1AFJA 3H8YA 4WP9A 5D15A 3Q8UA 5A8WB 1S59A 2EG2A 1VI7A 3CO9A 1SUQA 3SV3A 2HBZB 3LP2B 1UEVA 5H9EJ 5KFAA 2VPWB 2AGQA 4UUWA 3I9V9 2KFNA 5DGAA 2V69A 2PMHA 2RQ4A 2D9PA 2J9EA 1K44A 1JX4A 2P6TA 3O3LA 2ZH8A 2BW7A 5A8KA 3QATA 4IKAA 3Q2SC 4LRDA 1JLEB 4YN3B 4MIWA 3Q8SB 3H2VE 3MR7A 1O0PA 4I6AA 1XWLA 3EGNA 3QT8A 8ATCB 4OYOA 2ZVSA 4YMEA 3EMTA 4K0KJ 2G0IA 3NGSA 1MNEA 1UWAA 4PYDA 2BE2A 1D0EA 4J9SA 2N4DA 2BJDA 3A3PB 2WAQD 1NH7A 1KQSR 1M90T 1PAUB 1HNXJ 2R7VA 4C4WA 2XMTA 3IWLA 3EUNA 1FWPA 1EP4A 5E3CA 4CRJA 2GCFA 2C3PA 2DNHA 4ZKAA 5J2MA 1JLFA 2HFSA 4QWBA 2KKHA 1CS4A 5KT4A 2YNGA 2VQEJ 2FDNA 1M0SA 2AV5A 3J7YU 2PFDA 1JJCB 2A0FB 3MCOA 4NCGB 2IVMA 4R8UA 4QIEA 1TR0A 2G13A 2HLTA 3L7PA 4PKDB 1FX2A 3PYFA 3OSNA 5F0UA 3LWMA 4LF4F 3OFGA 1S0VA 5EX0A 2VOPA 4QR2A 2JSXA 3G82A 2OEKA 1T9YA 2B4OA 4TXSA 3EPIA 2V94A 3CT9A 1A7GE 4M1KA 1NSAA 3EE3A 3DGPB 2R7XA 3M32B 3DLJA 3C16B 2ZJQQ 4DU8A 1IQTA 2KZZA 3MR3A 1J27A 4ED4A 4YS2A 2PO4A 3K5PA 3QO9A 2ZVIA 4YFUA 1J5EF 3W66A 2MGZB 2VFRA 5A6PA 2MB0B 3T3FA 3M9MB 3V6HA 3VAHA 4PPZA 4IG3A 4LF6F 1KVIA 2RUGA 1U0HB 1JKHB 1T9WA 2BABA 3TX0A 3QBCA 5E0OA 2YKOA 4LRFA 2L9WA 2DR6A 3NY0A 5C7PA 1VRTB 3M6UA 3ILJA 1V3ZA 4A8MP 4NA1A 1OY6A 3CNQP 4K4TA 4WXOA 4OL8A 4ZP8A 2VL1A 4QCLA 3PYDA 3I0SA 1S1VB 2B7BB 2WBRA 2VH7A 4DSEA 1VQYA 2DHAA 1VMBA 3K0JA 1OQ3A 3Q89A 4X64J 1PYTA 5E2QA 5F8NA 1D9AA 5D77A 3POTB 1SUQB 2QA2A 4GRSA 4UF4A 3C3LA 3FKBA 2GZOA 2B43A 2OMOA 2XI3A 1YWXA 2PI5A 5LMUF 2OTJS 1F0XA 1KQGB 3IWXA 5HP1A 2ASJA 3AJ2A 1XEZA 1ELOA 3TAQA 1QTMA 1RTJA 3OR2B 2BEFA 1S99A 1IBKF 3NGTA 5J2QA 4WFAQ 1Y7PA 5C25B 1BWEA 3GV5B 1GT8A 4B02A 1K1QA 4F4YA 4I0WA 5SUHA 3TWZA 3R5JB 2YWWA 2ZBQA 4IR1A 1RT1A 2LDIA 1NLKL 1D8ZA 1SIWB 3TVZA 2P9CA 1TUWA 2GA7A 1WWHA 3L4BC 5LT5A 2NXEA 2DGQA 3TAMA 2B4UA 2CXEA 3CD5A 3BN7A 3FMWA 1RWKB 1LV5A 1VFJA 5J1EB 1R6VA 1S49A 3HF5A 4PWUA 2KG1A 1Y5LB 2E9TA 3GJTB 2MDAA 2HAFA 3QJLA 2NYIA 2N82B 2EFVA 2R7TA 4B3OB 2BM1A 3UDLA 5DLGA 3NBPB 5J2MB 5KFYA 3ILOA 3HSZA 2YNGB 1B0TA 5D0EA 1IKWB 3THPA 4IFVB 1VC5A 5DS7A 4X62F 2BKPA 4NLSA 4DV1F 4USTA 3PVXA 2PMWA 4UQTA 2FJAB 3DDNA 4L72B 4CO2A 5F9NA 1NM2A 1N32J 4TQRA 4ANEA 2ZKTA 2B9YA 3QZ8A 1LW2A 3WDOA 4F67A 4ELVA 4MH8A 1UKUA 4O23A 4DLGA 3DXSX 3Q24A 1RT3B 3H5XA 3ZTRA 2ZWPA 4PUOA 4OJGA 1IKVA 5LSOA 2B9XA 2BKOA 1H72C 1JLAB 2QX0A 4ECWA 4HHUA 2W7PA 1GX6A 1NK8A 1SH2A 2ABYA 2F9DA 5D3GA 1PG5B 5B0EA 4C98A 3KUHA 1Q8IA 2PT0A 4E98A 1TQLA 4DL0C 4IH5A 4K0KF 3U7JA 1U8SA 3G86A 3RR8A 3BB5A 3MEEB 5GMDA 2OEJA 2PC6A 1RLCL 1HNXF 1H3DA 1ZM3A 2YH0A 1EETA 1NRKA 4PG6A 5FIIA 1VQ4S 1R0AA 5DZ7A 5G4DA 2GVDB 4C3LA 2ZBIA 1JIHA 2MMYA 3P5TL 3E2EA 3PW0A 3JQMA 2J7WA 1WELA 2XSJB 4L3KA 1XR7A 4AUKA 3PYEA 3W2VB 3DRYA 2CUYA 4CQ1A 4QU7A 1SH3A 1WHXA 1OMSA 3TRGA 3TANA 1WNEA 2NXCA 3HFZB 1XMBA 4F02A 3KYLA 4B9NA 3D28A 3M8PB 3W60A 2ZD1A 3HX9A 1WOOA 1VQ5S 2Y1JA 1M1GA 2IFXA 1G2EA 4USVA 3RJMB 4OYMA 2OEMA 3NXZA 4LMZA 9RUBA 4RNFA 1CQMA 4Y34A 4TU7A 3MTKA 1FWKA 2AZ3A 3DI6A 5KFMA 1IJFB 4H4KC 1LK7A 2BVZA 3M2UB 4USJC 4MIAA 4XPEA 1FEEA 4U9RA 2X3DA 2VIHA 3C8YA 2Z4PA 5KFGA 2KB2A 2D3UA 2RRBA 2DH8A 3I4HX 5I42A 4A8QA 4F4ZA 4BWJA 2HNYB 1FDDA 3KJVA 2AX0A 3P96A 2LQ9A 5DG9A 1PJ5A 2FD2A 3PW5A 2CPIA 4EMDA 1UWBB 4XAKA 1WOSA 2M52A 1VISA 4DN9A 3AODA 2QL7B 3GFZA 1HR0J 3D6FB 3RZAA 1TTHB 3RRGA 3UN5A 1NHUA 1DRZA 2KT2A 2Z2LA 3MPDA 3M2VB 2BACA 2CJYB 1B0VA 3IG1A 1DHMA 2QLBB 5AE3A 1OSDA 5FLXY 3HT0A 4X64F 2XLIA 2AMCB 1NK6A 3CGIA 5B7WA 5H1SV 1X4FA 4D3HA 3R5BA 1LW2B 4WBFA 1XNQJ 3R27A 3DDKA 1ZPVA 1YX2A 4TYBA 3CJRA 3K7RA 4PUOB 1YKWA 1IKXA 4PQAA 2IM0A 2OI2A 1S77D 4QWEA 4UW2A 4K5SA 4ZPDA 3ITHB 2AWZA 2MYFA 2HHXA 4CLFA 3DHXA 2FUG9 1LWCB 5JUMA 1CC7A 2KXNB 2HWIA 4WYLA 4JBCA 1HNVB 3ADAC 3D54A 1JXLA 1UPMB 4KO0B 3BKFA 2QLXA 1SC4B 2HQFA 4U7CA 4EBCA 2C2KB 2DPJA 2MLZA 1WI8A 4DOZA 3PTWA 3R1LA 1Z4UA 3IGNA 4A46A 1V5VA 3MDFA 1ICEB 4MK8A 3TUJC 1TL5A 2VFUA 2XEXA 3X1LB 1U4BA 4HI2A 2DNPA 3W2WA 2HK3A 2C2EA 2CNKB 3G8TA 4ZVUB 1HI8A 2OSQA 3DLKA 1HQUA 2G2ZA 4J91A 2AGPA 2FJWA 3Q0AA 1N32F 2VBYA 4F4XA 1AUDA 3DOLB 3JTNA 1X9MA 3A8IA 3I87A 3UNYA 2MQLA 5AE2A 3T5LA 2LCWA 4DUTA 1T05B 2ZD1B 2ZDPA 2P9EA 2YKAA 4DR6J 1CPZA 3PNIA 4ECQA 5I3QA 1RAJA 2AEJA 3MTJA 3SXLA 1IBMF 2HAIA 3UDEA 5JMNA 5L8RC 1TMMA 1VOMA 3HVTA 5CD4H 2KYXA 3DRPB 4YQWA 1C1CA 2BDPA 4XO0A 4K4WA 2VG7B 1KTQA 4QR0A 3CJ2A 4DR4J 4EYHB 1Q0NA 3NCQA 1WEXA 3M6XA 1YZ6A 2CZ4A 5C2CA 5CZXA 1EKSA 3TQ1A 3ENWA 3G6YA 4TN2A 1B4SA 3W1YC 1UA0A 4K4YA 4N7TA 2YNIA 2D7SA 3H25A 4URGA 3CUNA 4XK8C 1VHIA 3KHHA 2EEYA 1D9DA 1S0OA 2AYMA 2CQCA 1YBTA 4WFNQ 4A48A 2IRYA 4C8LA 1OYEA 4AL6A 1VK8A 2DHXA 2F1FA 3JSBA 1N54B 2X51A 1AZSA 1RWWB 3W9IA 3WX4A 1TZ0A 4LQ9A 4I6YA 3P4UB 4R25A 1QDUB 1LFPA 3MECA 3GLJA 4KV8A 3M2RB 4KR0B 1RADB 1PYOB 4NZ7A 2CZ9A 2I8EA 1FKAF 3OHBA 4ZOSA 2ZKUA 1JXVA 3FBBA 3J81j 2BQUA 2AZ1A 3F73A 2J0SD 3OUYA 4UZCA 2JZ5A 1T3OA 2BJ9A 2XO6A 2OGUA 1TELA 4HKQA 4LR8A 1B0PA 3DFEA 1DJ0A 3QLHB 2IM1A 3PY8A 2RRAA 2UXBJ 5EWFA 1SKUB 2EFQA 4O3QA 2YKNB 1C0UA 4DL5A 3FUYA 3VVUA 1LQ9A 1TV6A 2E5IA 1D1UA 2EG1A 3MURP 2YKMB 5K20B 4CNYA 4UUXA 3AFGA 3UN2A 2CG4A 4CWBA 5IWAF 2DBBA 1VR6A 3PEJA 1YRTA 3EGVA 4PG8A 3R1HA 4KFBA 2Y3YA 6FD1A 3WX8A 4JV2A 3BZQA 1VS3A 4NLRA 1RAFB 1AFIA 3P49B 3JAMY 2NS1B 3OR1A 3W62A 4C97A 1XNQF 1W7WA 1WG1A 4WWSA 3DRRA 3TA2A 1CEZA 1TL7A 5BXIA 1Q79A 2FC8A 4KPYA 2R7QA 4MTPA 4YHHJ 1TKZB 1PGZA 4P71A 2XTJP 3I31A 1JLBB 5F9LA 4IQXA 1GMWA 2HWHA 5A0YA 3K5LA 2WVCA 1FJGJ 5HMZA 1HBNA 2ZH2A 2QA4G 1RE1B 3DDIA 1RT7A 2OPQA 4WF9Q 2VASA 4OYWA 2V4JB 2X1GA 3TUPA 2QV6A 3W61A 2BXJA 3B4DA 3VQTA 2KT5A 2CNLB 2VFTA 3MXHP 2KG0A 2CFXA 1U0SA 5KFUA 2EWHA 2V2VA 1HKAA 3MM6A 5T41A 1RBAA 1FJCA 3UNGC 1KNZA 1H7WA 2EBGA 2WONA 2F8HA 2IMWP 3G6VA 3IAM9 4ZPCA 2R7RA 1QE1B 2WSEC 1U1LA 1UZHA 3ZZTA 4XTTA 3N0VA 2B5JB 1HNZJ 5IT9U 1FNMA 2FJXA 2DISA 2ZE2A 2DH7A 4YUDA 3MM5B 5AT1B 4YY3J 4DR6F 3D1QA 1SC6A 4OJHA 5CD4A 2DHSA 2C3YA 1RHKB 4O44A 3BBBA 2F7VA 3T41A 4WU3A 1K9MT 2B4VA 2B7CB 2GJ2A 4ES3A 4PWWA 2FJEB 2K06A 3MM8A 1YVFA 2ZWOA 4DR4F 3N79A 1UJ6A 1UFLA 1RTHA 3OUYB 4P52A 4C8OA 3LPYA 3BO4A 2OPPB 2FB0A 1UMJA 4C8KA 2E44A 1AROP 3KLVA 5K14A 2QLWA 2N7CA 1NK9A 1VCTA 2XHCA 1HMVA 3GCXP 4KH1B 3JSRA 4ER8A 4EK2A 2J0QD 3CJ5A 1SPBP 2W4CA 2CQ4A 1I3OB 2GMLA 3OJUA 3KLFA 4B3TJ 4OHVA 3HHLA 4BS2A 1XR6A 4FYWB 2VG5A 1X5OA 5EUHA 2WVBA 2KL8A 4KFBB 1U7LA 3A3OB 1WACA 4DPOA 3HKZD 2DGVA 4EO8A 1YJUA 3MOZA 4ID5B 3LUYA 2OD4A 4ANDA 2GMHA 2K7JA 3RRHA 5CH7B 2YVSA 2WVDA 4O3OA 3G4SS 4BDPA 4JB8B 3DRRB 4Z7YA 3H4DA 1T94A 4M5GA 2VC0A 3PEHA 4DCPB 2KHDA 1O5JA 2FIUA 1X31C 3CC4S 3AD7C 4ED5A 4B9LA 4N77A 1GX5A 1UVJA 1WC6A 4I67A 1CULA 2UVWA 3QRQA 1JLGB 4IFYA 2DNQA 3IRXA 2JFDA 1RP5A 2OPQB 1RWUA 3CJQA 2HZCA 4KBIA 1T9UA 2HVDA 3M8ZA 2MQOA 1FXDA 2OKQA 1V5IB 2XSFA 3BDPA 2UXBF 2VBZA 3MPWA 1BQNA 4DUYJ 3CCRS 1H98A 3O8WA 4TLRA 1HI0P 4ZHRA 1UVIA 3MM6B 2RH3A 1RHMB 2E1CA 4FKYA 5GMEA 3V81B 5KFQA 1OPIA 1VQKS 2BE9B 2YX7A 3F44A 4M5DA 5KFFA 1RDRA 1Y5NB 2DNNA 3CJ0A 4X4NA 4Z2XA 1Q8KA 7AT1B 2W2NP 2V8PA 2EBEA 3SCJE 2Y0BB 4N8OA 3DLGA 5K8OA 1MMDA 1LWFB 5DZ6A 2C2OB 4CNZA 2RDDA 1YJTA 1NEEA 3BSAA 4ATNA 1HIYA 1YRUA 4IYQA 4PXBA 4KE5A 3KNGA 1CJVA 2HKEA 4M5HA 4Q8EA 4DSIA 4ZJLA 5I4MA 2GO8A 1HWJA 4YHHF 1RTDB 2I2YA 1ZZFA 2B8QA 3SFUA 2ZH1A 2CPXA 2ZHBA 1WORA 2MSTA 2VKZG 3C19A 4DLEA 4FVCA 2GHWA 1FJGF 2QYGA 1WF1A 3NNAA 4M5NA 2JVOA 2LXFA 3H40A 2EXUA 1RTHB 1NB2A 2YKPA 5ADZA 1TK5A 4I64A 5K14B 1FNXH 4NYPA 2R2UA 2R42A 3GE9A 1B70B 1ZM2A 3KJFB 1HMVB 1NDCA 4NRTA 2K3KA 2DR9A 2EPIA 3PX0A 1ACMB 4LFAJ 3NS5A 3J7ZT 1NPRA 2JH3A 3HVAA 1PC5A 3MEGA 3JYTB 2QC3A 4NMXA 4X4TA 2R8IA 3KLHB 4F2RA 2HLUA 3L9ZA 3FC9A 2H1YA 2GJFA 1VRUA 3ZO7A 4LT6A 5HQ8A 3PW7A 1MMLA 2DY1A 5ETQA 1HBOB 2CQDA 1HNZF 3EWGA 1Y3KA 4NLVA 2QJ3A 3SSQA 5U47A 4NLOA 3BGRA 3MUTP 2O5DA 2N3LA 1VIXA 4HTJA 1EQ0A 3DN9A 4OYBA 2H5EA 1VHFA 5IC4B 4NI2A 3GTYX 4P74A 1T8EA 1HBMB 2X3GA 2AW0A 2MKHA 4J9RA 1CULB 1UPPA 4PXCA 3VZIA 2AKWB 3CD6S 3IRXB 1U8WA 3CJ3A 2UVRA 3OVAA 3IGVA 2RU3A 1CJUA 3OTBA 2YX1A 1RA6A 3DM2A 1Y0HA 4OYPA 2HMIA 3VTIA 5C24A 3BPDA 1ZAXA 1KN6A 4QW9A 1NK7A 3UDCA 5FJ4A 2EW9A 1PKUA 2HVHA 3CCQS 2AJ4A 4KKOA 3VCDA 1YBUA 3DHWC 4B3TF 4FYDA 1NHKL 2UUWA 4V1Ak 3OFHA 5E3QA 1RLDA 1PSDA 4DPUA 3D68A 4WFBQ 3ZZYA 3QAEA 3QYYA 3HJVA 4ZDNA 1TAQA 3TP2A 1BLUA 1T03B 1BQXA 1Y11A 4J7CA 2ZJRQ 4ZVQB 2MZRA 3IXQA 4G1QA 1ZTWA 4J5OA 2LEPA 2W4PA 3MHYA 4OMFG 1VC0A 1YHQS 3ZNUA 3MEDA 4PYAA 3D66A 3MCSA 1SC3B 1HARA 1N8RT 2VPYB 2ZDOA 4I69A 2OIHA 2RNEA 2FZGB 4KTQA 4ZVFA 3DRXA 4LREA 1XN9A 3OBIA 3CJKB 1A9NB 2IC3A 2WB4A 1KEKA 2KU7A 2M88A 3EX7B 1Q1KA 1UAWA 3DCAA 1UJ5A 3MUMP 2RHSB 5D4PA 5F3TA 2G2YA 5L39A 2WSFC 2YWKA 4WE1A 3ISNC 4X2BA 3RB4A 2XZTB 3DXBA 2J0XA 4DUYF 3ZZOA 4AE5A 5G0RB 1SJ1A 3BO2A 4JI7F 5BJRA 2GV1A 3THTA 3B82A 3VGUA 4CO3A 4LF5F 4F3MA 1EAYC 2RD5C 3MCMA 4UOFA 4NE9C 2DGSA 3KLEB 1HBUA 1VRUB 3GV8B 3MM7A 1X0PA 4ZLPA 3J7Z5 4ALZA 2XO7A 3GB0A 3BQ1A 3NAIA 1IWGA 4OYXA 2QL9B 3HM9A 1T95A 4M95A 4W92B 3BGFA 1S4FA 3BO3A 6AT1B 3O1LA 3Q22A 2J76E 4QIFA 4U96A 2XMKA 4NL5A 4PABA 2OELA 1S7IA 1Q82T 4NI2B 3TEHB 1JLCB 5C42A 4FKXA 1YTYA 1T3NA 3MR5A 2A6MA 1UTAA 1PILA 2P6SA 2HIYA 3T6JA 4B9MA 1R8PA 1ZM4A 3ELHA 2XG8A 2UUCJ 1RAHB 1Z2ZA 2D1CA 4BC7A 3EGWB 5KFBA 1XERA 4JI1J 1NZ8A 2FVPA 3HHLC 3IRWP 4NLUA 3B4MA 3DM2B 1M1KT 2CKWA 2P5VA 4L6V3 4DEZA 5C24B 2M8DB 2KYZA 1FRJA 3LF0A 1H0HB 3DU5A 3SBMA 4DV5J 4RLEA 4OZ3A 3HJFA 4BWMA 3A4TA 4LFAF 3K5MA 2HBRB 5DQGA 3UDVA 1FESA 4C3MA 3RG6A 2CPJA 4A47A 2M4MA 4KHPJ 5HJYA 3QIDA 1QAIA 3TX8A 4I7FA 3RRKA 2HBQB 1VRQC 1BGXT 1JJ4A 2HFNA 2FZKB 1U49A 2H5IB 1RHUB 3TJ9A 3OXLA 3MEDB 4P7TA 1NPPA 1CVJA 5LSRA 2D41A 1X4CA 5CZVA 5DDQC 5ITHA 1DTQA 3TOQA 3MAAB 1U1OA 2HZAA 3BBCA 1LXNA 2ASDA 4QU6A 2RU9A 1KP6A 2MZ1A 4B17A 1ZYQA 1FEHA 1LW0B 4CCHA 1VQLS 2ROEA 5K9FA 2HFUA 2MQ8A 1HWLA 4DWIA 4WE1B 3K5OA 3FZBA 2ALZA 2LA6A 1NB7A 3PW4A 4DQQA 3NEKA 1TU0B 1RTIA 4RBTA 4V19X 4B3SJ 1RJJA 1MWYA 5B08A 4MAKA 3MM7B 1W2BR 3GIRA 1SH0A 3LGHA 1VQPS 4EYIB 1VBZA 2YQ0A 3ICLA 3T1HJ 4DFKA 2C3UA 5B0DA 3LW5C 4KT0C 3I6PA 2HS3A 4FYXB 3UFCX 2M0GB 3CEDA 1FDAA 4DHVA 5I3UB 3OHAA 3PX6A 3WC2A 2DJWA 2YY3A 3D3BJ 4HHJA 4F8RA 5C42B 3I56S 3NCPA 4Q8FA 2J9CA 5GADU 2VQFF 5L1JA 3A3NB 3BN4A 2FLPA 2GAHC 2KVIA 4K2JA 5K8PA 1VBYA 1YI2S 1FKPA 2NCKL 3US5A 2DNKA 1RAAB 3ET6A 1Z1ZA 3VV2B 2YNHA 2WBMA 5KFZA 5E7OB 1SJRA 3D7SB 4B08A 1V3RA 4K4ZA 5HI7A 1RAOA 1EB0A 5DLFA 4Q45A 2XNQA 3CSKA 4K4SA 1RU2A 1VBXA 3RW6A 3H98A 2UVUA 4H4OB 5MAOA 3UVJA 3U1MA 2DK2A 1WI6A 4S0MA 2L9NA 4YB6A 3K58A 3HI9A 3D1OA 3D0HE 1OIAA 4ELUA 2QRRA 3P6YC 2JEGA 1RBLA 2DNZA 2E29A 3BV8A 1C1BB 3PRVA 1VQSA 2QG9B 1CQNA 4I7FB 3GIKA 2DRBA 4ZLNA 3MAHA 3NGKA 4MFBA 3NP5A 1XJWB 1SL0A 5E41A 5AXNA 3DYAB 3W5XA 5CHCB 2G9OA 2DRDA 3GQCA 3TJAA 4RNMA 3N4WA 2HBYB 2MPUA 2RF2A 3JXOA 1TVRB 5H9FK 1H38A 1SQFA 1V6HA 4JI0J 3GR0A 3AD9C 1IR0A 4WIQA 5KG2A 4F3OA 3GSDA 1HQ2A 4ECTA 3O44A 3GMGA 3DLHA 5LJ5Y 2XWXA 2R7SA 4Q7AA 3TA1A 2DEIA 2W7AA 2RS2A 2UUCF 2VDIA 3R5DA 3M8YA 4K4VA 5T7LA 4JI1F 3A8JA 2BANB 5KFJA 4ED6A 1I6JA 1U6FA 2DTJA 3Q8YA 1WC3A 4QWDA 2Q6CA 2L3MA 2MLXA 2L08A 3EVMA 4DJBA 4IUFA 4DV5F 1VQMS 2AHOB 3PHEA 4LQ3A 3FEZA 4QOTA 2W25A 4OZ1A 4CLPA 1QAYA 1WD6A 4RPFA 4ECYA 3RBZA 4TY8B 5F0WA 2RRNA 1HI1A 3OFFA 5F41A 2FVSA 1JXEA 4NZ6A 2FHJA 5H9FJ 2W9CA 4KHPF 2CQBA 4G3IA 5LL6d 1GEHA 3J7A1 2CJBA 4GKKJ 2AX1A 1D09B 5DG7A 2HIQA 2JLEA 5LMNJ 3C46A 1KC8T 3T9NA 5AJ3J 4NOHA 2L9DA 4P73A 3KMQA 4CM0A 2BM0A 1GK8A 4A8KA 5J2PA 3R5CA 5D4NA 1BMQB 3CVKA 3GZ7A 4M5LA 4MKVA 2HNZA 5KT6A 3TAPA 4WK3A 4IRKA 4X66J 2UP1A 4ZITA 3IP0A 5A8RA 3N6LA 3SSSA 1F5AA 2IAJB 2OUGA 4LRCA 1BQMA 3C6UA 2UXCF 5CCMA 2UV8G 4FNHA 2QLJB 2CA9A 2SXLA 3ET6B 2V0NA 4ZVTB 2O1PA 5KFNA 5LJ3Y 2XMUA 4Q43A 4N56A 1APSA 3EDRB 3DMJA 3IS9A 3K8WA 3IWNC 1KWMA 3OTDA 2ROPA 2PFFB 3LWLA 1E6VB 4C0OC 5M2PA 3MI7X 1REVB 1RT5B 2HFOA 3SI8A 4Q2LA 2XMJA 3QT7A 3V6JA 5B0CA 4DDFA 3E51A 1F9HA 3IA0A 1NSQA 3J80Y 4ECUA 4KGXB 3UVJB 2GW8A 2KH9A 2W2QP 4OHZA 2RKIB 4PCQA 1QD1A 3HMJG 1WC4A 3QFHA 3T5HA 3LANA 3LGMA 3M7VA 4K5RA 5D0RA 2CJAA 1ZTTA 2CYYA 4WTOB 2HVIA 3D67A 1OO0B 3T1HF 4FYYB 4LBPA 4MFBB 1DURA 3RUBL 1O6XA 2EFPA 2GQ2A 5CYMA 2XY5A 2F40A 3I5AA 4ED0A 1FJ7A 1FE0A 4RO0A 4UTGA 2BOPA 3D3CJ 5E3AA 2ZUGA 3T9ZA 3KHRA 5I3PA 2O67A 2V2KA 3I0RB 3HP6A 2RF2B 2HHPA 1LEOA 2ZFHA 1GMWD 2HS0A 4JI6J 3IFEA 2CZVC 2FQQB 4OHYA 4FPIA 3TEGA 5SZTA 1RTZA 5GADI 1FWLA 2QMWA 3BEGB 2AP6A 3UWTA 2V4RA 4G1PA 5T7LB 1N4LA 4F3QA 1IXKA 2OFHX 1U1KA 1N5SA 1S72S 5JVHQ 1P1TA 1TL1A 4HACB 3CMAS 2RQCA 2Y1LB 4PXDA 2VODA 3TUIC 2C3OA 4X4VA 4UOCA 2VJUA 1R27B 3RGIA 1U09A 3N6MA 1F5CA 2ZEJA 2Z58B 1SCJB 3CE8A 3BH6B 2FPHX 1DQ9A 2V8HA 4CTAB 4OX9J 4DV2J 3C15B 5KOXA 3DOMA 2VPZB 1I51B 1WTBA 1DTTA 1TKTA 2HQ3A 2ZBPA 3MCNA 2HNDB 1TK0A 1OWXA 2XZDB 1F3VA 1S12A 2E1RA 2J9DE 1RT2B 4BCAA 3C66A 4GC7A 3PJWA 2I0XA 1SIZA 1X4AA 3L7UA 5J1PA 4DUZJ 2A18A 3T19A 2B56A 3CIMA 4R0EA 2F65A 3ZZZA 4JI0F 2X1FA 2DKOB 2HNZB 2KO1A 2JC1A 4RUHA 1O51A 3MFIA 2R9LA 2PN6A 2WSCC 1XBWA 2I5JA 4Y2IA 4Y0FA 3CC2S 3I5CA 2C2ZB 3UCGA 1IKYA 3S01A 3KK1B 4IDKA 3HVRA 1N36J 4NPOA 4ID8A 2NUUG 4PXEA 5K8MA 5H9EK 5IQ6A 3DMJB 4OV1A 1LK5A 4ZVGA 1YZ7A 3KUGA 4DN0A 2Z2YB 4L74A 1TL3A 3LQVA 1GXUA 3VHQA 4YB7A 4ZPAA 2LDYA 1YK9A 3ILLA 5KG0A 4A4JA 1SQEA 2PDAA 1XQIA 4PAAA 2DNYA 3JSYA 4DCOB 3EVOA 4ES1A 4CIOA 3KDNA 2L41A 4Q5VA 2DR8A 3CULA 2VPXB 2MXYA 2W1BA 2E9RX 3N5FA 2KZMA 2H3EB 3OTCA 2J6TA 4EZ9A 3FFIA 4GKKF 2RQKA 1BUXA 4YDDB 1H73A 2WZ1A 3MR6A 2E7WA 3J81U 4RBUA 5LMNF 3R8YA 5DQIA 1YJ9S 2BJEA 5AJ3F 3Q23A 2W9BB 1I1GA 4TYAA 2V6AA 3W9JA 3DU6A 5HBMA 2IHR1 4PR6A 4I2QA 1B64A 3WZ0A 3QIPA 2MQQA 4X66F 5JXSA 3CCMS 1S79A 1RT4A 4KJIA 3N6NA 1CG2A 1H6KX 3CTRA 2NXJA 5HO4A 3MMBA 2FY1A 2M5YA 3BYPA 5LSLA 1FFWB 1U47A 2QZ8A 2UUBJ 1TL1B 5ETKA 2R7OA 1FRHA 2GIFA 4A8YA 4XDCA 4ANCA 3W8PA 5AXKA 2M3DA 1S57A 1SB6A 2XCAA 4O3SA 4CH0S 2G2OA 4LF8J 4OI2A 2Z56B 3KKFA 2EK6A 4OZ2A 2IIHA 4LF1A 2HK2A 2LFVA 5HATA 4RW6A 3PO5A 4TY9A 4RZRA 3MM9A 4C0BA 3FCWA 4HVZA 2AJ1A 3OXFA 1F6TA 3T6BA 2DXEA 1E6YA 4J9KA 4RBVA 4WP8A 1V3SA 2WW4A 4V19J 1RT6A 1F1BB 4K50A 5K5MA 1FHTA 3DLEA 3QGGA 1YIJS 3QQCD 3NWGA 5FD1A 2HQIA 4IG0A 4DL4A 4M5JA 2I5JB 2Z2MA 2ZOMA 2U1AA 3UW1A 5DRKA 3H2UB 1BC6A 1IKYB 2ZHAA 1XNRF 1WHWA 4IDKB 4O4GB 4KGZB 4QYZK 5KG5A 4GVBB 1MWQA 4EZ6A 3FRZA 3TA0A 1SI9A 3PIPQ 3MMCB 4GVLA 4DFPA 4ICLA 3Q8RB 1TL3B 1FT8A 3GFYA 2YWEA 4ZPWR 1PJ7A 4C8YA 3AXKA 3CMQA 5F3ZA 2GVZB 2O01C 2MJUA 2J5AA 4FBUA 4IRCA 4KGMA 5IM0A 1DBDA 2CIMA 4OX9F 2FY8A 5IXUA 4DV2F 1HQEA 3T1YJ 3HSDA 1EIYB 4O3RA 1UCNA 4TQSA 2VUGA 3FFIB 1LNQA 3FRYA 3AT1B 4ZMMA 1FFSB 4CLWA 4DV7J 5GAHU 4QYZJ 4RR5A 1JQGA 3OFEA 5GAEU 5B0AA 4JI5J 1HD1A 2NQPA 1RAIB 3TW0A 3IBFB 3KK3A 2ALYB 2FLLA 4DPYA 4C48A 3CD0A 2AF6A 1REGX 3VAGA 2XYHB 1RAEB 3M30A 3PRDA 5A8KB 4OI4A 2YQ3A 3NG8A 1N36F 4ZVRB 2DR5A 1MN7A 1XIQA 2HGLA 3CC7S 1U1MA 2BE2B 4QPTA 4RWWA 5GMKa 4LSNA 2FLOA 3BR9A 2KFYA 1S1UA 3W65A 3M8RA 1S0NA 1EP4B 4ECVA 4WJBA 1HPZA 2B0GA 2JEIA 1JLFB 1FTCA 5ETSA 4F7VA 1CS4B 3S6EA 2R3VA 4DPXA 4RW8A 1HNWF 2RDIA 4KH0B 3CJ4A 1D8YA 4A8WA 3KDOA 1FK9A 3MM9B 4OHXA 4R8UB 5DETA 3BQ0A 1BWVA 5ETNA 8AT1B 3G82B 2QN6B 4OI0A 3H4BA 3DLEB 1KBRA 7FDRA 2PIIA 1S97A 4OLOA 1QSLA 4NLDA 4D3GA 1RHJB 2MQMA 2Q66A 2MKJA 3UR3C 1R8HA 3W5ZA 5B09A 3PKYA 1TP7A 4WPAA 3ZNJ1 2OH2A 3ZC4A 3K57A 3QO9B 1PJ6A 3CB4A 3HD1A 1FRMA 2UUBF 1S5ZA 1HL6A 3LO3A 3QGIA 3MOJB 3UD4P 2BJ1A 4ICLB 3KHLA 2WK4A 1JJ2R 4IG3B 4DZ6A 2V8VA 2BRLA 5ETTA 1NZAA 3GFHA 4LF8F 4F4WA 2DNGA 5EDWA 3PXGa 1YJ7A 2GFFA 4OZJA 2VQEF 5IM0B 3K8VA 2P8IA 1J5OA 2IA6A 2ZH9A 3HULA 3TI0A 3OV7A 4C11A 3Q86A 3I0SB 1X4GA 1RWPB 2AIRB 3E01A 1HW8A 1B7FA 1NKBA 4TU8A 1UVKA 1DQ8A 1HW9A 3CJTA 4Q2MA 2HEKA 1MG7A 5FDLA 1S6QA 5HP1B 1X4HA 3EZUA 1DLOA 1RTJB 2GHVC 4J37A 2YNFA 4ECSA 5J2QB 4PG5A 4M63A 1YJNS 5EWEA 2PI4A 4JV0A 2YXLA 3VGVA 2HURA 1RT1B 3Q8VA 1QM9A 1BXNA 3QSIA 1XC9A 2COLA 5LOQA 2LQBA 3GU0A 3QT6A 3TAMB 4MMOA 2W2OP 2H9ZA 2KVQE 4LSNB 1BY9A 2XWYA 2BR0A 4CLLA 3RB3A 1S1UB 5CAAA 1Q78A 1VK3A 4IR9A 2C22A 4OZ5A 2POKA 2HVEA 1HPZB 1IBLJ 3G87A 2DIUA 2FZCB 2CDRB 1WEYA 4GC6A 2VBWA 2GS8A 4ZP9A 2CQ2A 4YB5A 2GAGC 5CXTA 5HAOA 2IYIA 3T1YF 2KHCA 4IO1A 2X7IA 4A8SA 4JI8J 4DSLA 4CP5A 3TZXA 3SQOP 4OX6A 5L46A 3DOKA 2EI5A 2Y1RI 1T0TV 3L7OA 4DV7F 3PM9A 1LFWA 1K0VA 3H20A 4EUVA 1KFDA 3U02A 5GAHI 2W9AA 2VB6A 4KRWA 5GAEI 4AQYJ 2MQPA 1CBKA 1IKVB 4DS5A 3OVSA 1FRIA 2QLFB 1O8BA 2H65B 3ZTQA 1K0TA 2DITA 4CO0A 5D3GB 1SKWA 4MYUA 4I4BA 3QPIA 1FFGB 2V5HG 1N56A 3V6DA 2WVFA 2H5JB 4P2MA 4ECXA 3H5YA 2Z30B 5HLFA 2RVJA 4NYOA 1UVNA 1KOOA 1RWOB 2XM3A 5L38A 5BYRA 2VFSA 3HT3A 1EETB 3I82A 1R0AB 1N48A 3M8WA 4UOHA 3RAMA 2ZZMA 2HVZA 3LAMA 4NASA 1RA7A 1GMVA 5IV4A 2BJ8A 2X1BA 1S1TA 4DX7A 5F8MA 4DQSA 3NMRA 2HHTA 2DXFA 2HZVA 2MKCA 2QSFA 2KI2A 4U8VA 4ZVEA 4MIBA 3U27A 3SIPB 4NA3A 1HYSA 1YBAA 3CJ8A 3UCZP 5KFIA 1BD6A 1U2RA 2KFZA 2DHHA 5D0HA 4DV6J 3JB9k 2L48A 2XYPB 2G1HA 1WKLA 2XQCA 3CCWA 3VVTA 2KDOA 4ILLA 3HHDA 3O5TB 3IBWA 2DYAA 3MPUB 3VWSA 5DO2A 4DV3J 1U26A 1ZA1B 2YNFB 2H48B 3GIMA 2GGPA 3ZXWA 3IN5A 5A8WA 3TNVA 2VONA 3DI6B 2H4WB 3D2WA 4LF4J 4IRDA 3HVWA 1KHWA 1TFYA 1HFEL 1HD0A 3WQPA 5IC6B 4OYIA 3EXYA 3OPKA 2XMVA 5L1LA 3RW7A 5I42B 4KGVB 3SSRA 1NBEB 2W2PP 1WC1A 1VDHA 2ZC4A 3MUVP 2XY6A 3KJVB 2MKSA 2V67A 2H54B 4DL6A 4RNNA 1JLEA 3CD7A 1IBCB 3D4JA 3H42A 4IOAQ 4JP8A 4DSFA 2LQ5A 4CT8A 2AQ4A 1CSJA 3OW2R 3MD3A 4AL5A 3IG1B 3VR1A 3ZTPA 4HHHA 4X4UA 1EHWA 1NHVA 3NGRA 4QQBA 1FTRA 1VIOA 1DZ5A 2ZBCA 3D0GE 5GVQA 3KMSA 1YDLA 2LP4A 1SVDA 2B4PA 2DNOA 2C3MA 4OLPA 1IKXB 1HHTP 3D6MB 5KFCA 4R5PA 4WKRA 3KFWX 4QIGA 1R89A 3OVBA 3PHTA 3SEOA 2QA4S 4WKYA 4KGKA 2VC1A 3MMJA 4U8YA 4KHRA 2HRYA 2Q3PA 4ZP6A 3OL9A 3V6DB 5HROA 3R6LB 3QWPA 3HSGA 1RXOB 3PACA 2JRSA 1JJHA 3UCUP 2DCLA 3KNAA 2RS8A 2VJVA 5KOWA 2LXUA 3M32A 4LUBA 1K1SA 4LFCJ 1JLQA 4NYZA 2G0CA 4USHA 1OQ6A 5CABA 3H5SA 5KFOA 1FRXA 2FJVA 1IBLF 2IMOA 4NLXA 2W2MP 2FHJD 5THWA 3GYGA 3Q2TC 2PSZA 3U1LA 1N5YA 1HR0F 2V2ZA 2MJNA 4CM2A 3W2WB 2MGZA 2XGPA 2JDJA 1HYSB 3DLKB 4M94A 1HQUB 2WB1D 4JI8F 3QZ7A 4WIIA 4ES2A 3I55S 1RYRA 1TL4A 4ED7A 1NNDA 1M5SA 3M8QA 1U0HA 3KOAA 5KFVA 1JKHA 4J9QA 2I1RA 4BC9A 2FHOB 1G7CB 4DR3J 1KD1T 1W25A 4ERDA 2UZAA 3T5JA 2M8HA 4QJVA 4Y65A 4X62J 3V2UC 4AQYF 1RB0A 2ZZTA 4MT1A 1VYAA 4F25A 5F8GA 2YPYA 2V50A 3M05A 3TVYA 1FE4A 1S1VA 2V63A 3WC0A 2GGPB 5DJBA 3DKDA 3HVTB 3IO1A 1FJEB 1VQNS 1C1CB 4N8NA 2VA2A 2RB7A 3POTA 1RABB 3OT9A 4AXIA 1IR1A 4NLQA 3R9LA 2JLFA 4P10A 4USKA 1WHYA 2APOA 1TK8A 4ZK7M 1RSCA 2YWHA 2ZC3A 3OL6A 3OR2A 4ZLLA 1MW7A 4YB1P 2ZUAA 4C8MA 1FKOA 3M6WA 2GHPA 5C25A 3TZYA 3EVWA 4B9UA 3TYTA 2OMLA 4CZCA 2H51B 2ZHOA 1S10A 4K59A 1FO1A 2RHQB 3IAS9 3CDUA 2BE7D 2YNIB 1FRLA 1YGYA 5J2NA 4OI1A 4K8RA 3K5NA 3CCSS 2ERRA 4K7QA 1P8GA 3V6KA 2VFVA 5J1EA 1RAGB 4ZVHA 2O66A 3IR6B 1SKRA 4ZS6A 2E7XA 2ZH7A 4DV6F 4DFMA 4B3OA 4DPWA 4DR2J 5MLCV 3NBPA 4G65A 1JMTA 3EZOA 1UL3A 4O3PA 4NLTA 1AZSB 4NRUA 2IJRA 3IM9A 1IKWA 4IFVA 2NZ4A 5E5NA 4DV3F 3W9HA 4IH7A 3G71S 4Z7CA 2IDEA 4R5PB 3MECB 4KV8B 2HHSA 1GTHA 2RSQA 3PO4A 1FX4A 3SFGA 2BQ3A 2AYGA 2NPFA 4C3KA 4EU0A 1NK5A 1Q5VA 2HHQA 5HROB 1XMQJ 1IM4A 3ZTSA 5KG7A 3BSOA 1RT3A 2MZQA 3W64A 2GIQA 2Q6BA 2MKIA 4G1IA 4J9LA 5EN1A 3QNWB 1NJYA 1HWUA 1JLQB 1JLAA 1FXLA 1KQKA 3BM7A 3JS9A 2BOAA 2UUAJ 2AU0A 3NKYA 1RQ0A 2CQ3A 4RJVA 1SJFA 2ILZA 1S76D 2J7KA 1C0UB 3BREA 2LU2A 2R2TA 1TV6B 2JL9A 1NDKA 1Q81T 2W7OA 1N5YB 1F9EB 2DVIA 1M5PC 4QWAA 2CJKA 4CO5A 3MEEA 5HN0A 3UD3P 4URSA 2IBOA 1TFWA 2XS7A 2EK1A 3D5MA 3M8QB 5DDPC 2GVDA 3PV8A 1CJTA 4DL2A 2I38A 1T9XA 4ETZA 2XSJA 3OR1B 4DV0J 1P1LA 4OI6A 3W2VA 1R8CA 2CPHA 4MK9A 3FCVA 4CYUA 1TL7B 1L3KA 5E3PA 4TU9A 4NLWA 4CO4A 4NXNJ 4CLUA 3CCJS 3RAQA 5KFXA 2GQCA 4P2FA 2B8PA 3PX4A 3TJ8A 1U25A 4PZVA 3M8PA 5A0YB 4OZLA 3HSJA 3I4PA 4QBUA 3CXCR 5JVGQ 1HBNB 3Q83A 4EI2A 1RT7B 4DV4J 1HA1A 3MWBA 1RWVB 2DT9A 1NUEA 4JUZA 5KG3A 4LFCF 4UQGA
chains in the Genus database with same CATH topology
4MFBB 3CJ2A 1DURA 4RW7A 1VC6A 2FVRA 1FKOB 2N7YA 4P6QA 3SQGA 2HW3A 2EFPA 2GQ2A 4EYHB 5CYMA 5HBMB 2XY5A 2F40A 3NCQA 1WEXA 3NLCA 3M6XA 2DHGA 1C1BA 2DGWA 3DLLQ 5KFHA 2CZ4A 3I5AA 1NK0A 4ED0A 1FJ7A 4I2QB 1FE0A 3M2UA 3R3TA 1L5UA 2FHMA 5IFMA 3QIPB 2KM8C 1S9EA 2BOPA 5E3AA 2ZUGA 3T9ZA 4HT5A 4QYRA 5CZXA 5I3PA 3KHRA 2O67A 3TQ1A 2V2KA 1RT4B 3I0RB 3DYAA 3HP6A 2RF2B 2HHPA 3W7BA 4ZCKA 3ENWA 4FF1A 2RILA 2NR0A 4OJ3A 2ZFHA 2HS0A 5J2NB 3G6YA 3IFEA 1R6YA 4XIUA 2IRUA 2CZVC 4OHYA 3MMBB 2WONB 3ENQA 3RB0A 4TN2A 4DR7F 3GIJA 1H2UX 1R31A 1UA0A 5SZTA 4K4YA 5J1NA 5GADI 2QMWA 3BEGB 2E5JA 1U6BA 3BGUA 3BJYA 2AP6A 2HNYA 2YNIA 1TVRA 1UP1A 5K8NA 1X4DA 2D7SA 2IM2A 3UWTA 2V4RA 2MHEA 4G1PA 5T7LB 4ELTA 2BBEA 1QAXA 2F8MA 3H25A 4URGA 3CUNA 2XLKA 2VA3A 2PMZD 3N01A 4XK8C 3KHHA 1N4LA 5CCLA 3FEXB 3IC1A 4NX9A 1RKJA 1QUVA 1UWBA 4L3NA 3VF0B 4F3QA 4DR3F 4Y2MA 2UUTA 1IXKA 2OFHX 2ZE2B 1D9DA 4DQPA 1S0OA 2AYMA 1U1KA 2CQCA 1N5SA 1VLYA 1S72S 5JVHQ 1P1TA 4WFNQ 1TL1A 3HHEA 1UFWA 4A48A 3M9NB 3CMAS 2IRYA 2RQCA 4C8LA 4AL6A 2C42A 2OPSA 4PXDA 2ADCA 2VODA 1VK8A 3TUIC 2C3OA 2RQMA 3J81Y 2BANA 4IH6A 2ZOGA 3KWMA 3PRBA 2DHXA 2F1FA 3JSBA 4X4VA 1SL2A 4UOCA 4OHWA 3M2VA 1U48A 1FDBA 3FSYA 4WZQA 4ETXA 1N54B 4X4SA 2X51A 4NCAA 4FP9A 1R27B 1K73T 1PC4A 2ATLA 3WX4A 3MGJA 1TZ0A 4LQ9A 4O44B 4I6YA 2FJBB 3GYNA 2PA3A 3ULHA 4RW6B 2RT3A 5KFDA 3FVYA 3AY0A 2MY7A 2GX8A 1U1PA 1U09A 1WG5A 2DIVA 4R25A 1GNKA 5LXRA 2CPYA 3N6MA 1GQEA 1F5CA 1LFPA 3P3DA 5KFEA 3MECA 3CE8A 3AQOA 4KV8A 2FPHX 2ILYA 1UW4A 3M2RB 4ILRA 4KR0B 1DQ9A 3MM8B 2V8HA 4CTAB 1S6PA 1MMNA 2QA1A 3BGLA 2BW2A 4GKJF 2PE8A 1VQ7S 1Y9OA 1AXQA 4KQZA 4NZ7A 1NH8A 4TY8A 2OTLS 2I8EA 1FKAF 4CH7A 5KOXA 3OHBA 3DOMA 2VPZB 1A6LA 4ZOSA 1E6YB 2F9JA 1DTTA 1RT6B 1TKTA 4ZPVR 1YITS 1WTBA 5KFPA 2AD9A 4O3NA 2HQ3A 2ZKUA 3U1NA 2HG4A 2ZH5A 2HNDB 1TK0A 1OWXA 3I32A 2DNRA 2E1RA 2LEAA 1RI7A 3PFEA 2J9DE 3I9ZA 1RT2B 2CDQA 3ITHA 4BCAA 4DL3A 2BQUA 3C66A 3F73A 3H59A 1TKXA 5KFSA 4GC7A 2J0SD 5EGYA 3ZZUA 4EWTA 3OUYA 3PJWA 2I0XA 3SCKE 1LWCA 1SIZA 1X4AA 1ZAWA 2LXIA 2JZ5A 1T3OA 4IG0B 3MD1A 4LF9F 5J1PA 2A18A 3T19A 1HNVA 4HKQA 2B56A 3T5KA 3CIMA 2XY7A 4R0EA 1B0PA 3DFEA 3SZ2A 4KO0A 1DJ0A 3QLHB 3ZZZA 3KLFB 1JNZB 2N3OA 3PR5B 4DFJA 4JI0F 2IM1A 3PY8A 2X1FA 2DGOA 1ZPWX 2RRAA 1UVMA 4PQUA 5EWFA 2HNZB 2EFQA 5HMYA 2KO1A 2DB1A 3HHLB 4OIXA 2JC1A 4RUHA 1O51A 4O3QA 2YKNB 1C0UA 4DL5A 2VG5B 4ZA1A 3MFIA 2R9LA 4ED3A 3V4IB 3FQLA 1LQ9A 2PN6A 1TV6A 2WSCC 4WFXA 3TO8A 4Q44A 2E5IA 1XBWA 2I5JA 4Y2IA 2EG1A 4Y0FA 1D1UA 3MURP 2YKMB 1Q16B 3PZPA 4CNYA 3CC2S 4UUXA 3RBDA 3I5CA 1NKEA 2CG4A 2J8AA 3UCGA 1IKYA 3S01A 3SDEA 3KK1B 1WG4A 4IDKA 3HVRA 4DR2F 1M5OC 2D9OA 1R43A 2V8GA 4NPOA 2DBBA 5IWAF 4ID8A 1NKCA 3PEJA 1RKIA 2FGOA 1YRTA 2GIRA 2AJ0A 2NUUG 4PXEA 4PG8A 5K8MA 3EZ5A 5IQ6A 3R1HA 4KFBA 3DMJB 4RKUC 3QAUA 6FD1A 2IAJA 4OV1A 4JV2A 3G6XA 3BZQA 1VS3A 2DGXA 2LECA 1LK5A 4KC5A 4N5SA 4KHMA 3CDAA 4NLRA 2XHWA 4ZVGA 2BUNA 4YY3F 2D3ZA 1X0FA 1AFIA 2J6SA 3L95X 2QO3A 4DN0A 3P49B 3JAMY 1TL3A 4ED2A 3LQVA 3J7YI 1GXUA 5KFRA 1V9OA 2NS1B 3OR1A 4C97A 4DS4A 1E6VA 1XNQF 4YB7A 4ZPAA 1WG1A 2LDYA 3DRRA 2PEHA 3TA2A 5KG0A 4A4JA 2NLWA 3DOLA 1SQEA 1S9FA 1HQEB 1REVA 1RT5A 1CEZA 2DGUA 4RW9A 2PDAA 5AXLA 3OTOF 3GR1A 3MPYA 2DNYA 3JSYA 1N5TA 1Q79A 2QMXA 4ES1A 2FC8A 4CIOA 4KPYA 2R7QA 4DQIA 5LXYA 1MU2A 4MTPA 2L41A 1T05A 4X84A 1PGZA 1TKZB 4WTYA 4Q5VA 2DR8A 1XMQF 1P6TA 4LIRA 1F2GA 3CULA 4IFYB 2VPXB 4EGLA 3I31A 1JLBB 2MXYA 3QMQA 2E9RX 3N5FA 5F9LA 4YR2A 4IQXA 2RKIA 3HO1A 2KZMA 4F4KA 5L1IA 2HWHA 5AXMA 1VQ8S 5A0YA 3SCLE 5F8IA 3OTCA 3K5LA 3RAXA 1QSSA 3RR7A 2J6TA 4EZ9A 3AQPA 3FFIA 2WOMA 5HMZA 4GKKF 3KG1A 2RQKA 4RW7B 1HBNA 2ZH2A 4YDDB 3SQGB 2QA4G 2UUAF 3PFOA 3AH6A 4J9PA 1RT7A 2WCXA 2ZM6F 3DRPA 4PRFA 3MR6A 2E7WA 3MMAA 1JK9B 4RBUA 5LMNF 4FF4A 2OPQA 4WF9Q 2VASA 1ZOTA 3FGVA 5DQIA 3G9CA 3C6TA 2VG7A 1BQNB 2CVEA 2V4JB 2X1GA 1YJ9S 2E9ZA 3RB6A 3ZZPA 2BJEA 2ZNZA 3KK3B 5AJ3F 1S9EB 3Q23A 2W9BB 3CCLS 1VJWA 2QV6A 1I1GA 4TYAA 4DSJA 5DM7Q 4FF3A 4PG7A 2BXJA 2OD6A 4ZHRB 3DU6A 5HBMA 3B4DA 3VQTA 2BV3A 2CQIA 3M30B 3OLBA 1S1WA 3TVKA 3SV4A 4DSKA 2G4BA 2IHR1 5DDOC 2KT5A 3FSIA 1YRXA 3KTQA 4PR6A 4I2QA 1B64A 2VFTA 3MXHP 4FBTA 4DG1A 3WZ0A 4RNHA 3QIPA 2MQQA 1N0VC 2KG0A 2XS2A 4X66F 1P27B 5JXSA 2CFXA 4M5DB 5KFUA 2JC0A 3Q8PB 3CCMS 2EWHA 1S79A 1RT4A 2V9WA 3I0RA 4KJIA 3N6NA 3MM6A 3ETOA 2IVFB 5T41A 1CG2A 1FJCA 3UNGC 3I5BA 2D3OR 1LOUA 1S0MA 2ROGA 1KNZA 1H7WA 1H6KX 5IT0A 3CMES 3CTRA 5HO4A 3DLGB 1J2VA 2EBGA 2WONA 3MMBA 2FY1A 2LMIA 2F8HA 2IMWP 4WCEQ 2E5HA 2XZWA 2KTQA 2M5YA 2AJFE 3KG4A 3G6VA 3IAM9 4J9OA 1YJVA 2Q1LA 3B78A 4ZPCA 5LSLA 2R7RA 2YWGA 4DV0F 3SMZA 2AJQA 1U47A 1HWKA 1QE1B 2WSEC 2MHNA 2QZ8A 4CO1A 1U1LA 1TL1B 2A3JA 2R7OA 1FRHA 3ZZTA 2OPSB 2QYCA 2DO4A 3M6VA 3OLAA 1X4BA 4A8YA 3N0VA 5IZHA 4XDCA 2B5JB 4X65F 3EYZA 3PDNA 1FNMA 2FJXA 1U6ZA 2DISA 2MZSA 5AXKA 2ZE2A 2DH7A 4EBDA 4NXNF 3FJ2A 4LVNP 4YUDA 2M3DA 1SB6A 1KFSA 4RW8B 4A8XA 3MM5B 3HZEA 3MEKA 2FC9A 1FCAA 3HHKA 4CH0S 2XCAA 4O3SA 4DR6F 3NRBA 3BSCA 3D1QA 4Q0BA 1SC6A 4OJHA 2LVWA 4OI2A 1FK9B 3KKFA 3OXGA 2EK6A 3D1HA 1X9SA 2DHSA 4PPDA 2EFNA 2C3YA 3LGNA 1VQ6S 4C9DA 1ZM9A 3EXCX 4IOBA 1S6PB 4O44A 5KT7A 4RNOA 4DV4F 4RW6A 2F7VA 3M9OB 3PO5A 1FXRA 3EGZA 1GXLA 1N0UA 4TY9A 4WU3A 1Z2LA 4AL7A 1K9MT 2R8JA 2XGQA 2K7KA 4RZRA 1VQOS 2VOOA 3KLGA 2B4VA 3KLIA 2B7CB 2GJ2A 3MM9A 4ES3A 1XMOF 2IJNA 4C0BA 1KHVA 1Q86T 3M2RA 2FJEB 1F5BA 4HVZA 1VGYA 3MM8A 1YVFA 3AA8A 4EBEA 4JI5F 4DR4F 3N79A 4CTAA 4U7UK 3HHNB 4MK7A 1N33F 1UJ6A 1UFLA 2OP5A 2AJ1A 1UJ4A 3OXFA 1TKXB 1RTHA 4I2PA 3OUYB 3T6BA 5DGBA 2ZH4A 1S1XA 5L9XA 4C8OA 1E6YA 4ZCLA 3LPYA 4RBVA 4J9KA 1XTZA 2V8DA 1V3SA 4E8UA 3BO4A 4QR1A 1RT6A 1WF2A 4V19J 2OPPB 4K50A 5IT4A 1WHVA 2FB0A 1UMJA 5K5MA 4C8KA 3B8HA 2B9WA 1FHTA 2HFZA 2HNDA 3DLEA 2HWTA 1R7IA 1X9WA 2E44A 4B9TA 1AROP 3QGGA 1N52B 3S7RA 5K14A 3KLVA 2AGOA 1YIJS 2QLWA 2N7CA 3G8SA 1NK9A 2KRBA 3MEGB 1RT2A 4ZCMA 2JLGA 1FA0A 4HLBA 1H7XA 3NNHA 2OPRA 4FXDA 3Q8QB 1LWEA 3NWGA 5FD1A 1HMVA 1ZAVA 3VQSA 3MPVA 1NK4A 4PQUB 3JSRA 2HQIA 3ZFVA 2M7SA 1FNOA 2DD8S 4GO5X 1Y3JA 4IG0A 4NLGA 2J0QD 4NWBA 4DL4A 2XULA 3CJ5A 1Q53A 2I5JB 1MROA 2Z2MA 2W4CA 2CQ4A 5KFKA 2ZOMA 2U1AA 2CJ9A 3UW1A 3Q2TC 5DRKA 2GMLA 3OJUA 1UEUA 3KLFA 3QLHA 1S9GA 3BSNA 3H2UB 1BC6A 1IKYB 4YR0A 2ZHAA 3SDEB 1XNRF 2I9SA 1WHWA 1KR4A 5KFWA 1FD2A 4OHVA 4IDKB 3HHLA 4O4GB 2YKNA 4BS2A 1XR6A 1N5VA 2VG5A 1X5OA 2Z8QA 5EUHA 5KG5A 4HH0A 4KFBB 1M5HA 4EZ6A 2YKMA 1U7LA 3M8SA 3FRZA 1WACA 3RTVA 4DPOA 3TA0A 3BGRB 5D6GA 1SI9A 3HKZD 2DGVA 4NXMF 4EO8A 2QEXS 3PIPQ 3MMCB 3KK1A 1YJUA 2W8KA 3MOZA 4ID5B 2X1AA 1H2VZ 3LUYA 3N9UC 2OD4A 4DFPA 1SXLA 4ICLA 5BR8F 3Q8RB 1TL3B 2C2DA 2GMHA 2K7JA 4XDDA 3RRHA 5CH7B 2YVSA 1PO6A 1FT8A 2J6UA 4O3OA 3GFYA 1UA1A 1SV5A 2YWEA 3E3XA 4ZPWR 5DG8A 4FS1A 2IRXA 3G4SS 4C8YA 1TUVA 2P9GA 5F3ZA 4BDPA 2O01C 3OL7A 4N47A 3DRRB 3H4DA 1J5OB 2XBPA 1T94A 2VC0A 3AHPA 3PEHA 2KHDA 4RW9B 2MJUA 4NA2A 4OQJA 4AXJA 2J5AA 4C11B 2JVRA 1O5JA 2M70A 4FBUA 2FIUA 3CC4S 2ASYA 2LKZA 4IRCA 4KGMA 1MU2B 2CQ0A 3E01B 1GXTA 5IM0A 4ED5A 2Z0GA 1DBDA 2CIMA 4B9LA 1XR5A 3CCES 4OX9F 1DFDA 5IXUA 4DV2F 1HQEA 4N77A 1Q4RA 1GX5A 1UVJA 4O3RA 2A1BA 2ASLA 2W4DA 4TQSA 2VUGA 4E0DA 4RU2A 2V4QA 4I67A 1SJQA 3FFIB 4P7VA 2A2DA 3DNCA 2WOMB 3MZIA 2UVWA 2KJVA 1TKZA 2HMIB 1JLGB 4IFYA 2CRLA 2DNQA 3FRYA 2M2BA 2JFDA 3IRXA 4QIVA 4ZMMA 2FTRA 5FDLB 1KLMA 1S6QB 2MY8A 3MMAB 4N76A 1RP5A 1JLBA 3F41A 2OPQB 1FRKA 1RWUA 5B0BA 2FJDB 1DLOB 2HZCA 3C6TB 4KBIA 2UXDF 3CCUS 3NL0A 1YQHA 2MQOA 5GAHU 4QYZJ 4X4QA 3OFEA 5GAEU 1FXDA 5B0AA 3S1TA 4GMKA 2Y1IA 1T7PA 1KLNA 4PWDA 4KKOB 2OKQA 5DDRC 4B3RF 4DQRA 4A8FA 1HD1A 2R8HA 1S1WB 5KFLA 2XSFA 2NQPA 3BDPA 3GG0A 1NJWA 3TW0A 2UXBF 2EKYA 2VBZA 3MPWA 1D9FA 1BQNA 2V4JA 4HDHA 3CCRS 4DG1B 3NNCA 3KK3A 3O2IA 2D74B 2K3IA 2FLLA 2W9BA 3LP2A 2BYCA 2OJ3A 2KT3A 3CD0A 1H98A 3O8WA 2AF6A 4TLRA 3PW2A 2PA8D 3VAGA 4ZHRA 1HI0P 1UVIA 3MM6B 2RH3A 4WK1A 1SKSA 4KIAA 3M30A 4OI3A 3PRDA 4NZ0A 5A8KB 2E1CA 4OX7A 4OI4A 1P9QC 3V81B 5KFQA 1OPIA 2YQ3A 1VQKS 2YX7A 3NG8A 3F44A 1N36F 4BBYA 4M5DA 3FQKA 1S6UA 4JI2F 5KFFA 2R2SA 1AW0A 4M8LA 5KFTA 2DR5A 2UU9F 2HRUA 3A8EA 1RDRA 1Y5NB 2DNNA 4QZVB 3CJ0A 4G1QB 2VD3A 2YH1A 4X4NA 2HGLA 5A2QY 3CC7S 4USIA 2IJFA 4O0IA 2RE1A 4Z2XA 2R2RA 1U1MA 2BE2B 4MKYA 4H4MA 2EBEA 4QPTA 2E1AA 3SCJE 2HHUA 4RWWA 4N8OA 3DLGA 5GMKa 1Q8BA 5K8OA 1MMDA 4AFFA 1LWFB 4LSNA 4CNZA 2FLOA 3BR9A 1LKZA 1KVJA 2KFYA 2IBKA 1F60B 1KSPA 4FNIA 1S1UA 1QE1A 1YJTA 1NEEA 3BSAA 1QLNA 4ATNA 3M8RA 1S0NA 4JI3F 3DLBA 1YRUA 1QUPA 5D78A 3VAKA 2IA0A 4IYQA 2NSBA 2JEJA 1EP4B 5F8JA 4PXBA 4ECVA 1G1XA 2KRRA 4WJBA 2B5JA 4KE5A 1HPZA 4Q0BB 3KNGA 5EWGA 5BYSA 2OSRA 2B0GA 2KJWA 2JEIA 4Q8EA 1JLFB 1FTCA 2LU1A 3BF4A 4DSIA 5I4MA 2GO8A 2IC3B 2XB2D 5KT5A 3S6EA 1HWJA 4YHHF 1RTDB 2F4VF