3A3OB

Crystal structure of complex between sa-subtilisin and tk-propeptide with deletion of the five c-terminal residues
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
TIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Identification of the interactions critical for propeptide-catalyzed folding of Tk-subtilisin
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2009-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3a3oB00
2W2OP 2XTJP 3A3NB 2Z2ZA 2Z58B 1V5IB 3VHQA 2E1PA 3A3PB 1R6VA 3T41A 3WIUA 3WIVA 3AFGA 2Z30B 1SCJB 2ZWOA 2W2MP 4NMXA 3SQOP 2W2NP 3CNQP 2Z57B 3BPSP 4YN3B 2PMWA 3GCWP 4K8RA 4NE9C 3QFHA 2W2QP 3BGOP 1ITPA 2W2PP 2ZWPA 3WHIA 1SPBP 3A3OB 2Z2YB 3VV2B 3CO0P 2QTWA 3P5BP 3H42A 4JP8A 4OV6A 3GCXP 2Z56B
chains in the Genus database with same CATH superfamily
2OP5A 2RIJA 5E3RA 2ZOGA 4FYWB 2YKOA 4Y00A 2UP1A 4ELVA 1JLAB 3HZEA 4B3RJ 2DR6A 4KH0B 4CLSA 4IFYB 1NK5A 4P75A 4QIGA 1IKXA 1E6VA 4EYHB 4F2SA 1NHKL 4DR5J 3EPGA 1S9GA 1QE1A 4C8MA 1JLFB 1FWKA 4RW4B 4YY3J 3OXFA 3QNWB 2XI3A 4O3QA 2K1RB 1HHTP 1VBZA 2YNIA 3VV2B 3CF5Q 1T3NA 3NRBA 4UZBA 2E9ZA 2I0XA 2H51B 4ED7A 2YNHB 3NGDA 1N5YA 2JHEA 2BKNA 3BSAA 2COLA 3J7YU 3MAAB 3VTIA 1VHIA 5CYMA 1T7PA 3MTJA 1RDRA 4O3NA 3V6DB 3HM9A 4QU6A 3RRGA 5M2PA 4D3GA 4I69A 2V4QA 2HHQA 1HWLA 2EFGA 4DR4J 1GX5A 5KFMA 3T6JA 1AUSL 3L95X 3I0SB 1WHXA 5D4OA 4DSFA 4GVBB 5FIIA 3LP1B 3A4TA 4LR8A 4JI0F 2E5LJ 1ZTTA 2MXYA 4DL4A 2DIVA 4AE5A 3M9MB 5DJBA 3DHXA 1UAWA 4OI4A 4DUZF 4TY9A 4F3OA 4MKAA 4A46A 3M2VA 1LWXA 4B9NA 1RWPB 1F9HA 2MB0B 3IA0A 1IVZA 2WK4A 3IBWA 4M5DA 4F7VA 2DGSA 4JI1J 3MDFA 1EP4A 1PBAA 4LFBF 4TNOA 3AJ2A 5J2QB 3TOQA 2R2SA 3EVWA 1RHUB 4NLYA 2AD9A 2EWHA 1NXIA 2FHKA 2FQQB 3EJMA 3M30B 1KWMA 5DGAA 3VZIA 4RNHA 1N0UA 4FP9A 4ZVUB 3H2VE 4F3MA 3R5AA 2FLLA 1RT6B 1RU2A 3IXQA 5KG1A 2B4UA 3L09A 1R6VA 2Q6CA 4R5PB 3GU0A 1GMUA 1DLOB 2OPPA 3NKYA 1HHSA 2QL5B 1GQEA 2PD1A 3K8VA 2IVYA 1Z4UA 2YNGB 1UW9A 2DHGA 3U1NA 3MM9A 1RE1B 1XIQA 4WF9Q 4FKXA 4DG1A 4C8ZA 3FSIA 1EETB 2P6SA 3OL6A 3KG0A 3OJSA 4JB8B 5B0AA 3PRDA 3QYYA 2YKPA 4ZK7M 5D0HA 2B6AA 1Z2ZA 4OHXA 4WBFA 4NYOA 2VBWA 3NMRA 2WCXA 3B82A 4CO1A 1JLAA 3TQ1A 4LF4J 5DG8A 4IFYA 3LANA 5A0YB 5KFRA 3H40A 2RHQB 2MQMA 2MYFA 1X4DA 3IRXB 3PX0A 2VQEJ 3EX7B 1Z1ZA 2FHJA 1MG7A 4RW4A 2QA4S 2G4BA 2K1RA 3ZZUA 5I3QA 3BS9A 1S6QB 3NGUA 4M5KA 1H7XA 2NZ4A 1JLCB 4NRTA 3R5BA 1GMWD 4ZLLA 2KVQE 2IVMA 2MLXA 2MQNA 2V50A 2XHCA 2ZC4A 2YNHA 1PSDA 1UVNA 2HBRB 1JLQB 2BDPA 4TQRA 4NZ7A 1ZA2B 2MSTA 3MAAA 5HL7Q 2RH3A 4J9QA 3HDSA 1Q86T 3KMQA 3V6DA 4LSLB 3MM8B 1M5OC 3RBEA 5E3AA 3U1MA 4X84A 3FKBA 3ETOA 1NB7A 3C46A 3I0SA 2RDDA 2M70A 4PG6A 2D74B 4RW7B 4GVBA 4I6AA 3LP1A 3HHNB 3B8HA 3M9OB 1VHFA 5EN1A 1U26A 2ZH8A 1VQ4S 3OXLA 5F8JA 4PG5A 2HAIA 3LGNA 1FRLA 3GE9A 3MM6B 2EBGA 1RAAB 4USUA 5MLCV 4WK1A 2F4FA 4P2FA 4LF2A 1KQKA 1RAFB 5KFVA 2KFZA 3ZFVA 2FJXA 2JEIA 3OXGA 4DV0J 1HBOB 3N28A 5J2QA 1HD1A 1X7VA 3CCLS 1U2RA 3NNHA 4M63A 4A8KA 3RW6A 4MKVA 4HTIA 2WSCC 1L3SA 1WKLA 4ID5B 5L1IA 3ZZTA 3M30A 3TJAA 4OYPA 2J0QD 2HBYB 2V4JB 1CG2A 3BBFA 4P6QA 1DFDA 1RT6A 2XNRA 3LPYA 4JV5J 1NK7A 1KOHA 1WUUA 2R3VA 1L5UA 4R5PA 2BW2A 1RACB 1DLOA 1WD6A 4HI1A 4P52A 4KHRA 1HD0A 1KRPA 1AW0A 1TK8A 5IZHA 4K59A 5H9FJ 1OMSA 1RAEB 1JX4A 2YNGA 3Q0AA 2R7SA 2A2CA 4V1Ak 2F4VJ 4DFPA 5ETRA 4OX9J 1WOOA 1EETA 2ZD1A 2EG2A 1I94J 2GW8A 1FNMA 2YWEA 1RWOB 1QTMA 3AD8C 3T41A 1RK8A 3UPFA 4DZ6A 2HFUA 2KG1A 1W26A 2DNRA 4NLWA 1ZZFA 1VQLS 1SH3A 2Y8WA 1FD2A 2HGNA 3PR5B 4ZKAA 2OMLA 1Q8IA 3SMZA 4CO2A 1MWYA 3QZ7A 3T9ZA 1N33F 3DDKA 2VZ9A 4NLRA 3Q86A 5A0YA 4WYLA 2E7VA 2DNMA 2DNLA 2VQFJ 2UUCJ 3IRXA 4YS2A 4LREA 1DAXA 1REGX 1YLXA 3HLUA 4U8VA 5F8NA 1D1UA 1S6QA 5HMZA 3KNGA 3KKFA 1HR0J 3EM1A 1JLCA 1M5HA 1H0HB 1RWKB 4UT4A 3CD6S 4UQGA 4M8LA 4EGLA 5BYRA 1JLQA 4S0MA 2Q43A 3GV5B 1TFYA 1AROP 2QRRA 1S59A 3W2WB 4ZCMA 2GO9A 1S76D 3AB2B 3GSIA 1N0VC 4RO0A 4X4RA 2C3OA 4LSLA 3MM8A 3UNYA 2KJWA 2Z2ZA 4ES1A 4WCEQ 3V2UC 3O5TB 1Y11A 3LA0A 2POKA 2FJDB 3AD7C 3WC0A 5DGBA 1RXOB 1WJ9A 3PRVA 2DGQA 3SYZA 3VAGA 4RW7A 4OV6A 2W25A 4KRWA 4M5HA 1OSDA 2UUWA 3G6VA 2H65B 5E3QA 2DKOB 4XPEA 3MFHA 3MF5A 2D3ZA 1PAEX 3MM6A 3RRHA 1CBKA 2ACYA 4RX6A 2RQ4A 3C14B 2YH0A 1KKHA 1XNQJ 1DURA 1CS4B 1HNXJ 3J7ZT 2QL9B 2DHXA 1HBOA 3TUPA 2DGVA 5L39A 3THTA 4O23A 1U24A 3DXBA 4XIUA 3FZ2A 4ID5A 2FJAB 1RA7A 4K5SA 1U1RA 4DL6A 2V4JA 1YIJS 4ZLJA 1VRTB 3MCNA 1S1XB 1SJ4P 1LK7A 2AEMA 1AUDA 4OX7A 2XZTB 2HK3A 5C2CA 2RQMA 4ZHRB 1YVFA 1NK0A 2C22A 2FY1A 2J7UA 1XBWA 3ZTRA 4QQBA 2Y0BB 2FHJD 1Q0NA 4OLOA 2CQ2A 3CCTA 1EQ0A 3HD1A 1DJ0A 2OSQA 1FE0A 3KNAA 2O66A 2HS4A 1FEHA 3I4PA 4DPUA 1WOPA 1WC0A 3I5AA 5I3UB 3BN4A 1I5OB 4C0HA 2V5HG 2D41A 3G82B 1CSJA 4QWEA 2E5GA 1P1TA 4OHVA 2XEXA 2PMZD 3HVRA 1I1GA 4QR0A 4LRAA 1RGVA 4ZLPA 2VD3A 4ZP8A 2E5JA 2OGUA 2ZJPQ 2A6OA 5L1JA 3B6BA 1TKTA 2CQCA 1J5OB 3RB4A 1S0OA 5LMUF 3KFWX 2W2OP 1JJ4A 1VQ5S 4K4UA 2HHUA 4HH0A 4Q44A 2AIRB 1V3ZA 1FCAA 1Y3JA 4H4KC 2GHWA 1T95A 4NWBA 4EU0A 3RJMB 3K5LA 3VF0B 2BE2B 4MJKA 3K5OA 3DLBA 1LWCB 3W2WA 1J2VA 3ZNJ1 3AHPA 5H9FK 1V6HA 2RKIB 2SXLA 1Y5LB 4AL7A 2BXJA 1M1HA 3GYXB 3VGTA 2ZBPA 2J7KA 2BABA 3HPOA 3WX4A 1CC8A 1FTCA 2DK2A 3IWLA 3OUYB 3ZTPA 3NXZA 3GCXP 5CXTA 5G4DA 3EMTA 2UU9J 4TU9A 3CUNA 3PFOA 5DG9A 3AA9A 4USKA 1S0NA 1WDDA 3PTWA 2VKRA 4PZVA 2DNYA 3C14A 3JQMA 3TR5A 3PYGA 3TJ9A 1CS4A 3HVAA 2V34A 3ILIA 1Y00A 4ECYA 1VS3A 3W5XA 5L1KA 2Q66A 3MPYA 1N4LA 4ZS6A 2QJ3A 2B7BB 2ZHBA 4PWUA 4L6V3 2V69A 3D67A 1P8GA 1VK8A 6FD1A 3TAMB 1VRTA 1S1XA 3LAMA 3FGVA 4NCAA 2FD2A 2JC0A 4IQXA 1UJ5A 2RRAA 3KLIB 2C2KB 1X9SA 4DV4J 1V5VA 2AJQA 4ZHRA 2C3PA 2QIFA 2L9DA 1K47A 2I9SA 4Q0BB 1M5VC 3R9LA 4Q2LA 5J2MB 1FE4A 3JQKA 4AL5A 2GAHC 4M5GA 3DMJB 2XYHB 1FDDA 4DQIA 3UD5A 1FX4A 1S97A 2R2TA 2MQOA 3CD0A 4DV7J 2KVIA 4PUOB 3G8QA 2PEHA 3MR6A 2J76E 3NY0A 4ECWA 4LFCF 4DFKA 2G0JA 3QBCA 3QZ8A 1NSKL 1RWVB 2MQQA 1UZDA 1S1WB 3G82A 2HAFA 5K8PA 3KLEB 2CG8A 2D9PA 3M2UB 2G2ZA 1ICEB 4WTOB 1VLYA 4UW2A 2XMAA 4QR1A 2DD8S 2OUGA 3NS6A 4LF7J 1J5OA 4NASA 3CJKB 1CULB 2ATCB 1CJTB 3BKFA 3PJ9A 4O3PA 2BACA 4ID8A 1F5BA 1S12A 3OT9A 2DXDA 3CJ2A 3CJ3A 4RNOA 4UUWA 3C66A 5KAKA 3CB4A 2BE2A 3OD2A 2ADBA 1WI8A 2ATLA 2VFRA 4B3MF 3GR1A 2ZHOA 2M2BA 2XYGB 2RKIA 4NA1A 3ZZOA 2QLBB 3NCPA 3MXHP 3A3NB 3V6KA 3AY0A 2BW7A 2FJBB 4WKYA 2KRRA 3QRRA 4YB5A 2GA7A 4DX8H 3OUYA 2LCWA 2JVRA 2EW9A 2JLGA 4MMOA 5K20B 4USIA 2BOAA 4L75A 2WBMA 4K8RA 2ZFHA 3QQCD 5T7LA 1NK8A 1CC7A 2H5JB 5HLFB 2AYGA 3W9JA 4B9UA 4K50A 4IH6A 1UWBB 2F1FA 4X64F 2NS1B 4LF9F 2BANB 3R2CJ 3UN3A 1BUXA 3TWZA 4JI5J 4CLTA 5A76A 1OPIA 2ZDOA 1M1KT 5DZ7A 2ZKTA 3H5YA 2CIMA 3D3CJ 2W2QP 3TAMA 2B9YA 2ZH9A 4DBQA 3KJQB 3VAKA 4DI6A 4C0OC 2L48A 2YQ3A 2WVCA 1YJ9S 3KLIA 3Q83A 3AFGA 2QA2A 4DV1F 3HK2A 1M0SA 1G1XA 1VK3A 2LU1A 3L7UA 4Q0BA 2VIHA 3F41A 1R8CA 1J27A 3BSCA 1FKOB 2BE9B 2AQ4A 3JS9A 1MMLA 1HQ2A 2CQIA 1Q5YA 2G9OA 3DMJA 1KR4A 1FRKA 4IFVB 2P2CB 4X4VA 4IKAA 3N4WA 4PUOA 4DX7A 3K5PA 1F9EB 3AAWB 3PIOQ 1UFKA 4KGXB 2KTQA 4I6YA 2Q3PA 4ZOSA 1S1WA 2VFSA 4WFXA 4ELTA 3HD2A 3KLEA 3M2UA 2WVEA 1WI6A 1K1SA 2N4CA 3H0PA 1ZZNA 2XULA 2YNFA 4KGMA 2KRBA 4NCBA 2FY8A 1LXJA 1TL1B 1WF2A 2W4CA 5L46A 1NKBA 5GVQA 3RAQA 3CJKA 1BD6A 2UV8G 4EBDA 1FERA 3OTOJ 2ABYA 2BJ9A 4DR6F 1RB0A 4USJC 2JFDA 3WC2A 1CJTA 1FNOA 2DCUB 3C6UB 5B0CA 1HA1A 4QWDA 5F3ZA 2XWYA 4B3TF 3F56A 2LECA 1ZM4A 2F9JA 2DR9A 3PZPA 2C3YA 2BZ2A 3C15B 1HIYA 3BGRB 2Z2MA 5L38A 2YKMB 3WQPA 1C4CA 3I96A 1S0VA 3SCLE 3D6TB 3F0NA 4FN5A 2E1AA 4KO0B 2QLFB 4JI6F 3L7PA 2LDYA 1ZBTA 3VQSA 3IBFB 1R3NA 2KG0A 3BO3A 3CC7S 1YITS 3KLFB 5FJ4A 1HNVB 4IRKA 4UY8T 4J9NA 2V8PA 2ROGA 3ETMA 2KJVA 1IBMJ 1N32J 1RAGB 2NYHA 3OBIA 1TVRB 1PC5A 3BBCA 2DTJA 3R8YA 5C25B 5F8IA 2G0IA 5KT2A 3FCVA 4AD6A 4QZVB 3CJSA 1MN9A 4JYAJ 1HQUB 5KFWA 5HLFA 5J2NB 4B17A 2UVUA 1UWBA 5DM6Q 1SJ1A 2R8HA 5D6GA 2OFGX 1WC4A 3GV8B 3QJPA 1VC6A 2BANA 1NU4A 1HNWF 4HH1A 1N5VA 3PFEA 4MFBB 5HMXA 1AFJA 1CLFA 2PC6A 4FXDA 4Q43A 1KFDA 4N5SA 2XZWA 1S0MA 3ZZ0A 2AJ0A 2RSQA 4X4UA 3UDLA 1RTZA 3GIRA 2MQLA 3NBPB 1LNQA 1X60A 2WB1D 1T9WA 2EPIA 2OLWA 3ADAC 3NL0A 4FVCA 1FRIA 3TVYA 5K9FA 1EQMA 2F65A 1SC4B 1FKOA 3M8PB 5B0EA 3BR9A 2DH9A 2W8KA 2AJ2A 2BJ3A 3AOAA 2H54B 2FVQA 1TUVA 4NLSA 4J9UE 3Q89A 1U1PA 1WHYA 3TQEA 1PYSB 2R7XA 4CIOA 3SSRA 4RR5A 4J9KA 3G6YA 1LFWA 2DB1A 1AT1B 5HJXA 3KOAA 2D3O1 4O3SA 1JLBB 2HQGA 2NYIA 2R7RA 1Y4ZB 3FCWA 2QYCA 1Q8KA 4BWJA 5F0UA 3HSDA 3WIUA 5F8GA 1WC3A 1U09A 4H4KA 3N01A 1TL1A 3ZNUA 5LM7E 2WW8A 4CLUA 3TUJC 4FS1A 5I42B 1HWKA 2K2PA 3PACA 2RQCA 3OL7A 4B9SA 3D68A 2D69A 3FEZA 4DUYJ 2NR0A 5AE2A 4LF6F 4ZDNA 3C6UA 1KHVA 2HBQB 5F9NA 2MKKA 5EX0A 4LRFA 2HVEA 2HVZA 5KG7A 2W7OA 2M3DA 3C15A 3BGRA 1VQOS 3DLHA 1NJWA 2YKMA 3R7BB 4IG3B 4CO3A 3CULA 2ASJA 2PSZA 2U1AA 2RDJA 1NDLA 5AJ3F 4KO0A 1EB0A 2KB2A 3U1LA 4Q8EA 4CO0A 2F8MA 4LJMA 3AJDA 1NPPA 3NGKA 5BYQA 5KG6A 4NEYA 4MYUA 3KLFA 1HNVA 2HVHA 5BYSA 3OLBA 1RTHB 1QD1A 2I5JB 2WSFC 4OYIA 2QO3A 2DR8A 3H2UB 3O3LA 1TVRA 6FDRA 4ALZA 4U95A 5C25A 3KK3B 2DR7A 1UVMA 3MM7B 3BQ0A 1HQUA 2YXLA 3RAMA 2B3TB 4LRCA 4AQYF 1IQZA 4MT1A 3D66A 5J2NA 4ZPDA 2HIYA 4DF4A 1Q4RA 5GADI 2WTFA 2X1AA 3UDCA 3KJVB 3VR1A 2ZHAA 4X65J 2DNNA 3KUEA 2R7OA 4FZVA 3RRKA 4C0BA 5DETA 3W63A 1KTVA 4MFBA 2IM2A 4HDHA 2R7TA 3OTDA 1X5TA 3S7RA 3BH6B 3KHRA 1UTAA 5SZTA 4NLGA 1XMQJ 2IC3B 4J9VA 5J1NA 3QIPB 2VODA 1RWUA 4WTYA 4KR0B 2ZZNA 3IO1A 1U8SA 2AKWB 2GQCA 1XMOF 3SDEB 1H74A 2BOPA 4CZCA 2NLWA 5KFIA 1NB2A 4NRUA 1M5SA 2VG7B 1TKXB 3M8PA 2CWKA 4WJBA 1SQGA 4L76A 2MY8A 4OI6A 1KLMB 2VPXB 3M2RB 2BRLA 4DJBA 3CGIA 2LEPA 4C8NA 3AH6A 2NCKL 3K7RA 4YUDA 4I68A 3DU5A 1KTQA 1BLUA 4H4MB 4I64A 3TJ8A 4PXBA 4ILMA 1GAOA 4ECTA 4NPOA 3NOGA 4KTQA 2F8HA 2LXFA 1N88A 3I9ZA 3PYDA 5JVHQ 3KXDA 4PXCA 1IQTA 2RF2B 5I42A 3QGGA 1W7WA 2UV8A 5KOWA 1H7WA 2YTCA 4ZN3A 4RPFA 4NLVA 1FJEB 1S1UB 4NLOA 1WSRA 1HARA 1L3UA 2LKZA 4PCQA 1TU0B 2MZJA 1VQ7S 2Z8QA 4LBIA 4IG3A 3G6ES 4WU2A 5EDWA 1R43A 3M4XA 1RLDA 4J9LA 4IDKB 2DT9A 3ZTSA 4ZVFA 4DXLA 4GKJJ 2J6SA 2ZWPA 3IR6B 2XGQA 3C6TB 4XTTA 1NPKA 4YP3A 1K73T 3IAS9 2OPRB 4TVAB 3US5A 5D4LA 3SI8A 1RTHA 2I5JA 1UETA 4FKYA 3CDWA 3QAEA 4K0KF 2IA0A 3MM5B 3DC2A 1T9UA 3W2VB 3KK3A 3SCJE 2JDJA 2DXEA 3MM7A 1DARA 2R8IA 4OZ0A 4ECXA 4NMXA 3D1QA 1T94A 4OQJA 4DV6J 2XYPB 5LL6d 1FNXH 1WHWA 3KJVA 3FUYA 3D2WA 1K44A 4OHWA 2B0GA 4K4WA 1BQMB 4OYXA 1SQFA 5RUBA 3EGVA 3RGIA 4DSIA 3MWBA 2Z2LA 1OWXA 2XO7A 2IC3A 3VGVA 4AXIA 5B0BA 3QIPA 1U48A 3L9ZA 1TELA 3KG4A 2ROPA 2HWTA 3NG8A 2A1BA 2XLJA 3SDEA 2UVVA 3TNVA 2M9KA 1LEOA 4ES2A 4JI4J 2XMWA 4OJ1A 1IBKF 2VG7A 1OS5A 1T05B 1TKXA 1KHWA 4RU9A 5ETVA 2BEFA 3OSPA 2WAQD 5D8HB 3FMWA 4QW8A 2VB6A 2CQ1A 3EICA 3MMJA 4F0MA 1KLMA 4OV1A 3M2RA 3CEDA 4J9SA 4G1IA 1NJXA 2UVRA 5DDRC 4W4MA 1QM9A 4JUZA 1UPPA 5KFZA 1TUGB 4DSJA 1I51B 1FWLA 4KHPJ 5KFUA 3DRSB 2HZVA 4H4MA 1S48A 1NHVA 1WEYA 2DNPA 3KHHA 1ZYQA 4X4TA 2UZAA 4JI8F 2UUBJ 2D7SA 4DN9A 1VQMS 2KFYA 2CDQA 4ZIWA 2RF2A 4OHYA 6AT1B 4IOCQ 2V2QA 1YRTA 1EIYB 2AU0A 3PCOB 3CDEA 3GLJA 1S1UA 2Y1JA 1N5QA 1R27B 1EAYC 1LQ9A 3O6QA 2KHDA 3HHLC 2XSFA 3W9IA 1RTJB 1OY9A 1RAJA 1IR2A 2KM8C 2GQ2A 4DS4A 4LBPA 4CWBA 5DLGA 1ZH5A 4N7TA 4IDKA 2HNDB 1DQAA 2WRMA 1FX2A 2YKQA 2GC8A 2EI5A 3BGOP 3C6TA 3IR7B 3KLHB 2B8PA 2VFVA 5KG4A 2C3MA 4DR2J 5DRKA 3HFKA 3Q2TC 3HJFA 4Q7AA 1UEKA 3D1HA 1L3KA 5LXYA 2DEIA 1FHTA 2P5VA 2CQGA 4WE1B 3PY8A 2CYYA 1YZ6A 1X0PA 3AT1B 4LF5F 1VGYA 1UZHA 4X66F 3MM5A 2RU3A 3W2VA 2KKHA 3PJWA 2RAQA 4B3RF 3TARA 4IR1A 1YHQS 1KVJA 2NSBA 2DNGA 2ZH6A 5K8OA 4QOTA 3HSGA 2ADCA 2B43A 2V6AA 3M6XA 4DR5F 1RISA 4DEZA 3BEGB 1PYTA 3UDVA 4YY3F 2X3DA 2CQ0A 5IC6B 3FEXB 2LU2A 1KVIA 2L3MA 3MMBB 2VJUA 3R6GB 3HSZA 1BQMA 3AQPA 2PI5A 1DTQB 3N79A 3UN2A 4HYKA 4DCJB 2OFHX 2F8EX 2HS0A 5CHCB 2W8LA 5D15A 3A8JA 1O8BA 4PQUB 4ZCLA 3IAM9 4KGVB 2VA3A 2FLOA 3NAHA 3UWTA 1DRZA 4PEOA 4B9LA 2UUAJ 2DISA 2V0NA 1TKDA 3TX0A 5T14A 1RJJA 3RR8A 2CJAA 1GXLA 3MEDB 3T19A 3TUZC 1SV5B 4DR4F 4B3SJ 4Y2MA 1T05A 5THWA 3HVTB 1RADB 4XO0A 2VPYB 2WB4A 3ILOA 2JVOA 1DHMA 2ZBCA 2HEKA 1FO1A 1ULRA 2E5LF 4FYVB 2LQ9A 1H73A 2CWXA 4BHQA 3DNCA 2YWWA 1QAXA 4CTAB 2R8GA 1ZPWX 2FPHX 3DKDA 4ECUA 1B0PA 2Y1IA 3CCSS 2CPEA 2HFZA 3JSYA 4NLUA 4FF2A 2PA3A 4DQQA 3OVBA 1KS2A 3GILA 2HHTA 5A2QY 4ERDA 4JI1F 2MKIA 4JI2J 4EUVA 5KT7A 3OTCA 4FYYB 3MAQA 1TK5A 4F4KA 5J2PB 1ELOA 1RKJA 1U4BA 3TYTA 5GAHI 1RU1A 1FJGJ 1SL2A 3AQOA 1C1CB 1Y7PA 4WZQA 3NNCA 4DF8A 2AGQA 3TO8A 4W92B 4J9MA 1JJCB 2CZ9A 4A8QA 2KZMA 2A6MA 1RTJA 2APOA 1U45A 3E51A 1ZETA 3GIKA 4K5RA 3AD9C 2CDRB 3V4MA 1JLGB 5AXLA 2ZOFA 2HNDA 1FTRA 4EZ9A 2MPUA 2OMOA 3BM7A 4X2BA 1UFWA 3QT5A 3H5UA 4NXMJ 3P49B 4FF1A 1FFWB 3KLHA 3CMQA 2F5GA 3BZQA 4ZVGA 1NH8A 2YQ1A 2A2DA 3UD3P 4WE1A 3CMAS 5H1SV 3GSDA 5JXSA 3QIDA 1PAUB 4CH0S 2GVZB 3T5LA 4HLBA 2OTJS 4LF4F 3C19A 2M88A 3MUVP 1KONA 5JVGQ 3FQLA 2CKWA 2NXJA 2XI2A 2J0SD 3D6HB 4ECVA 2KYZA 2OEJA 2V8GA 4U7UD 3GJTB 4YB7A 1RT5B 1RCXB 3DRYA 2QYGA 1VLOA 3PNIA 2W4DA 5ETNA 3MMBA 3PKMA 2DRDA 2EC2A 1DTQA 1HL6A 5A8RB 3CJ4A 1VYAA 3OVSA 3GFYA 1VFJA 4EBEA 4YOEA 3UN5A 3HP6A 9RUBA 4ZJOA 2CXEA 3DLJA 4HHJA 3CDAA 4OFZA 1IBLF 1Q7LB 4ECSA 2H4WB 4DR7J 1OPZA 3O44A 3LTOA 3X3UA 2BRKA 4ECZA 1SV5A 3JTPA 2I1RA 1NK4A 3L3CA 2MJUA 3CD7A 3HVTA 4EWTA 2ZJQQ 3OJUA 3IRWP 1SIWB 3BPDA 2B5JB 5C42B 5EWGA 4EO8A 2EFPA 3WX8A 1N54B 4OLPA 4CTAA 3M8SA 3F44A 1YJVA 1RA6A 2EK6A 3CT9A 5IT9Y 3RR7A 2GNKA 1HPZB 3LF0A 4DS5A 3PIPQ 1CVJA 1HBMB 5L1LA 2CJQA 3BREA 3VWSA 1X5SA 2I8EA 1NK9A 2PFFB 2CQBA 3TZWA 5J2PA 4M5IA 4PR6A 5KFXA 1HW9A 1N36J 5DDOC 1W2IA 4DSEA 1X5PA 4LQ3A 2VC1A 3M7VA 4DV3J 1O5JA 1T3OA 1C1CA 7AT1B 5J1PA 2KM8B 3PYEA 4LVOP 5ETPA 2UXCJ 1XJWB 4E98A 1ZAXA 1N34J 1W25A 2V2VA 4JV5F 4C3LA 3PO5A 1TL5A 2QE5A 1JNRB 5A6WA 5K8NA 2RU9A 3N0VA 1M1GA 1OY6A 4GC6A 1IWGA 4EMDA 4DR1J 3IWXA 2AYBA 3CC2S 2VJVA 2V2ZA 3SSSA 1H98A 1JLGA 1TL3B 5KFJA 2GZOA 3UQSA 3I9V9 5ETLA 2F4VF 2CZ4A 3S1TA 2AJ4A 4HTJA 1U2FA 2C2EA 3EVOA 4OX9F 4Y28C 2WZ1A 3CSKA 1I94F 2OO4A 2PEBA 5CABA 2H4YB 1EKSA 1RT2B 2GIQA 3X1LB 3V5RA 1H2UX 1RBLA 4CLZA 4D3HA 2W2NP 4K2XA 2AF6A 1YSJA 2GVZA 2J8SA 1KC8T 1GFWB 2JL9A 1FD8A 2A18A 1Q5VA 2VKZG 4DWIA 2OSRA 1ZM9A 1FRHA 2BJEA 3NCQA 4OZLA 3M6VA 5GAEI 2BKOA 1HBNB 1UJ6A 2PI4A 2VQFF 2UUCF 2E1CA 4NXNJ 3N6MA 1RT5A 2CADA 1WC6A 3T9NA 3DRRB 3VGSA 2DHSA 5A8RA 2PGCA 1HR0F 1JJHA 4PXEA 4EZ6A 5CCLA 3M8WA 5DQGA 4O0NA 1JLEB 2OH2A 3NGSA 3H42A 3MTKA 4QIEA 5DO2A 1HQEA 1U2CA 4OI1A 1LKZA 4DX6A 4KB7A 1S5ZA 3UR3C 1FESA 3R7NB 1NCLA 4B08A 2ZITA 3Q2SC 4DCPB 4ZVQB 2FC8A 2GJIA 3OTEA 1RP5A 1Y0HA 4NE9C 1S6UA 3GFZA 2B5JA 1T11A 5C42A 2DNKA 3Q24A 1UVJA 1YBTA 1RAOA 3B4MA 2BR0A 2E9TA 3RU0A 3HO1A 2LVWA 2QA1A 2IY5B 1UW4A 4USTA 4PKDB 1VJQA 1NDPA 2FZGB 1HPZA 5D77A 2N3OA 2BX6A 3HHDA 4X4QA 2UXDJ 3KUGA 2B7CB 5KFYA 1XNQF 3QAUA 3PX6A 1NKEA 3DLEB 1HBMA 2ZC3A 1HNXF 4OI0A 1QVFR 3MR5A 4C9DA 2DNQA 1SPBP 1LXNA 3W65A 1B7YB 2C42A 2ZH7A 2CPHA 4LQ9A 2ROEA 3LUYA 3KJNB 3A8IA 1HNIB 1WACA 1TMJA 5L8RC 2P6TA 2LYVA 4TN2A 3QGIA 3ZZRA 4W98A 3O2IA 4U6PA 4EI2A 2XTJP 2M7SA 2X1BA 3I4HX 4CT8A 1NSQA 3Q8UA 3CIZA 2BM1A 3D7SB 2MQPA 1TL3A 2X7IA 5KG0A 4CRJA 3NLCA 1RT7A 1NPRA 3KDNA 1YJTA 4IH7A 3J7Z5 3RYLA 2AX1A 5HO4A 3W3SA 7FDRA 3CCES 3A1YG 2B8QA 4DV2F 1SXLA 1RT2A 1S99A 3CJRA 3FDSA 4B9VA 2E7XA 3IP0A 4FS2A 1PO6A 1WKKA 4L3NA 2ALYB 1IJFB 3G86A 5LSLA 1RCOB 4ED5A 3FNNA 4PAAA 1HBNA 3DM2B 1G3OA 4IQMA 3BF4A 1X4FA 2HNYB 2GVDB 2BBEA 4Z7YA 1RHMB 4KV8B 1YKWA 3DRRA 2E5IA 3RUBL 1JLEA 2IVFB 1U7LA 3PR4A 4ANEA 3KMSA 3PRBA 5KT6A 4NYZA 2M5YA 1VQPS 1FA0A 4B3TJ 2BUNA 2HWHA 3B78A 3H4DA 1GEHA 3G8SA 4I56A 1PJ7A 1SKSA 3RB3A 4OYWA 1FXDA 2J9DA 3FK4A 2CAJA 2LXIA 2QSFA 3K58A 4IOAQ 2IDLA 2M8DB 1MROB 2GGPB 3RBZA 2G2YA 3WDOA 3TA0A 4M1KA 3PW5A 4KGZB 3JSRA 2QEXS 1MU2B 1JLFA 2UU9F 2W9CB 3T1AA 4P72A 4R8UB 4I2QB 3NWRA 2RJZA 1DQ8A 4DFMA 2E7WA 1VR6A 3CJ0A 2C28A 3DFEA 3LALA 3BGFA 2E9RX 4HKQA 2MZ1A 1D9AA 2ASDA 2AEFA 3I0RB 3V4IB 1RWWB 3DLEA 3R5DA 3GV7B 4ZN1A 4ICLB 2FIUA 2ZH5A 4ZP9A 3IGVA 3OFHA 1XNRJ 4DQPA 3MEEB 2HHWA 2FC9A 2OD4A 3MOJB 3DRXA 4KT0C 4URGA 1F2HA 4C7QA 4U7CA 2J7WA 1MMNA 1HNIA 3D6FB 1RBOB 3SFUA 1JJ2R 2FVSA 3VAJA 2JC1A 2CJ9A 1A0OB 1Q1KA 3LPEA 2J9CA 1YI2S 1R89A 1QTNB 1U6FA 1PBUA 2Z58B 4DV4F 3I82A 1ZM2A 2M8HA 4LR7A 4F3QA 4FXWA 2KDOA 4TY8B 3ICLA 2OELA 4DOZA 5EGYA 2DPJA 2JEGA 4OI3A 1AB8A 3D5MA 3LWLA 5E5NA 4Q8FA 3M32B 2YPYA 3DLKB 4DV7F 3EGWB 3L7OA 4MK8A 2AT1B 2BYCA 1PCAA 4UQTA 2IYIA 4WFAQ 2HGLA 3CO9A 5LJ5Y 1HFEL 4I7FB 5LXRA 1QSSA 3CNQP 3NAIA 4J7CA 2CPZA 4DMZA 1R8BA 2CJYB 4H4OB 1TAUA 3R7SB 2OPQB 2C2NA 2JLEA 3TX8A 5GAGI 2M0GB 1KVKA 2PFDA 2PO4A 2HZCA 2AP6A 2QTWA 1K0TA 4TU8A 1UCNA 4N8NA 3DM2A 2LEBA 2ASLA 1WC5A 1MSWD 1L3VA 4DDFA 1RQ0A 5CH7B 2DR5A 3IGNA 2HNYA 3A3OB 3I6PA 7FD1A 2GVDA 2GV1A 4IRCA 3H98A 3H5SA 4KV8A 1GXUA 4URQU 5HQLA 4LR9A 1TUWA 3W1YC 4KJIA 2YX4A 2ZJRQ 3MHYA 2JEFA 2YY3A 3SBMA 5G0RB 1SJRA 1RLCL 2HFSA 4YHHJ 3CVKA 3IMQJ 4F4ZA 3OQ2A 1R6YA 2DVIA 1R0AB 5CD4H 4Y65A 1V9OA 4A8MP 1RT1B 4FPIA 4QCLA 2C2ZB 3FFIB 1MROA 4HVZA 1PJ6A 2GGPA 2VBYA 4ZITA 2O01C 5LMNJ 1OYEA 2K06A 3N5FA 1Z2LA 1MU2A 3HI9A 2W9CA 4I2QA 4M5MA 2Y8YA 4DL3A 5A2QU 4M5LA 4B3OB 2FTRA 3JAMY 3J80Y 1F3VA 4LFAJ 3I0RA 3V4IA 4LF1A 2F40A 2CG4A 3JSBA 1WTBA 3QRQA 4ICLA 2E1RA 4CNZA 4ZLNA 5L9XA 3DHWC 4CI0B 4ED0A 1R8PA 3MEEA 3HFZB 4HACB 1T9XA 4IG0B 3IM8A 4JI5F 3WZ0A 2IMWP 3UCZP 1V3SA 3BB5A 4PWDB 5D4PA 3GB0A 4PYDA 2HRUA 1GX6A 2KN4A 5L9NA 2EVZA 2R4FA 2QN6B 2EBEA 3GIJA 4BCAA 1NBEB 1IKVB 2B9XA 3OV7A 1RHQB 2W2MP 4JOUA 2OD6A 4QJVA 4YMEA 1C4AA 4TY8A 3W7BA 3TA1A 4ATNA 2E5HA 2D9OA 5GMEA 2B9EA 4FYDA 1F2GA 3BH7B 1AXQA 2ACMA 2V2KA 3MZIA 4Z2XA 1S9EB 3M32A 3DLKA 3SCKE 3TVZA 1NJZA 4NLTA 3OR2B 2HWIA 4M94A 2V4RA 4UOGA 2GMJA 4I7FA 1BC6A 4RW8B 2V67A 2EFVA 2OPQA 3ZTOA 5HVHA 1BQNB 3WHIA 5ETKA 2CNOB 4CP5A 3BQ2A 2HMIB 4ZPVR 4KGKA 4WFBQ 3MPVA 2MZSA 4BS2A 1XC9A 3DOLB 1B0TA 1YJWS 1SI9A 2ZUGA 3VVTA 3M05A 1PYOB 3UW1A 1UJ4A 4UTGA 3GMGA 3HT0A 2U2FA 3I56S 2CA9A 5DDQC 1RI7A 4JI3J 1HNZJ 4QPTA 2ZM6J 3ENVA 5KFFA 1UWAA 4P74A 3W66A 4RUAA 4I4BA 1NHUA 2RS2A 4WK3A 2KHCA 2XBPA 2QA4G 1T8EA 2AWZA 1DZ5A 4IOBA 5G0RA 4NL5A 3R3TA 5SUHA 2MZQA 1R7IA 5KFCA 1R0AA 2IRYA 5E7OB 3HT3A 1RT1A 3T1YJ 2J9EA 4R0JA 2A3JA 2V8VA 4X62J 3FFIA 3RB0A 1RKIA 4J9OA 1IBMF 2XHWA 5IT9U 1S77D 4Y6IA 2CJBA 5K5MA 3GFHA 3QFWA 4WZMA 3ONQA 4NX9A 2VV5A 3BSNA 1Y10A 3R5JB 1SL0A 1TAQA 5I3PA 1YK9A 2IJNA 4JYAF 1SC1B 2GMHA 2QFIA 3NCRA 2AGOA 4YR3A 3UCUP 4WYWA 2VA2A 3SQGB 4J91A 1JXEA 2QLJB 2JEJA 3P8BB 1SIZA 1XR5A 3H8YA 2BQRA 1UA1A 4ETXA 2VF3A 4DL5A 4K4VA 4I1TA 1L3TA 2GHPA 4HACA 1KP6A 1U0HB 4CLPA 4KBIA 1YBUA 2MHNA 4PWDA 1ZOTA 3S01A 1RTDB 3GONA 4USMA 4DV5J 4LF8F 3SV4A 4UY85 5LOQA 2QZ8A 3W8PA 1R0BG 4ER8A 4ZP7A 4JV2A 1KQFB 1IKVA 1RUSA 5IC4B 2CPFA 2VH7A 3G96A 4U8YA 1VQ8S 4PG4A 3R6LB 4USHA 1TP7A 5KT4A 3EZUA 3QT6A 1SVDA 3A12A 2ZBRA 3T1HF 2XS5A 2ILZA 2C2MB 4XAKA 1S9EA 4LRDA 1HI0P 4MKYA 2ZH4A 2VL1A 2VICA 4MH8A 3FQKA 1A7GE 4LIWA 3OR2A 1U02A 3PHEA 4C8KA 4ZJLA 1Q16B 1T02A 3DOMB 2ZZMA 4IO9Q 4C11B 3VALA 1IBKJ 4O4GB 3FVYA 4EK2A 1D8YA 4Y0FA 1H38A 1VBKA 3HZGA 3RBDA 1HYSB 4RW8A 4DPTA 4G1QB 2HNZB 2MEWA 3GTYX 1BQNA 4WIQA 2HMIA 3GPAA 4HT7A 3EVMA 2XMKA 3A13A 3MUMP 4WIIA 3DOLA 4KFBB 1IR0A 2PMWA 3NP5A 3BGUA 2YWGA 2WONB 2J9DE 4JV0A 1RWMB 3FRZA 3H59A 4DUYF 3CCMS 4DR3J 1XEZA 3M8RA 1U0SA 4P9SA 3VAMA 3TANA 3NOCA 2PE8A 1S4FA 3UI3A 1FXLA 2CQPA 5I3UA 1CEZA 4I6WA 2RB7A 1N5TA 4W90B 1R31A 4DU7A 3FZBA 2F63A 1QDUB 1U1MA 2QSWA 4A8YA 3DRPB 2YPZA 3KK1B 2IHR1 2KXHA 4FBUA 2KH9A 2DIUA 2ZKUA 1N6QB 1KLNA 5BR8J 2RS8A 1YQHA 4ZJQA 4WPAA 2QT7A 2B4PA 3EDRB 3KK2B 1IWAA 4DG1B 5C5JA 3FC9A 2VPWB 4XPCA 2HK2A 3G2XA 3G6XA 5DG7A 1TL4A 5KFDA 4LF5J 1PJ5A 2K7JA 3D54A 3P96A 2C1EB 1KFSA 2HFNA 4PG8A 4FF4A 2XG8A 3A3PB 1QAYA 1S6PB 4X65F 1LWCA 3IC1A 2IFXA 1IR1A 2NZCA 4DCOB 3MMAB 4RNNA 1LFPA 1U0HA 3W5ZA 2QV6A 1XMQF 2A10A 1FFSB 2ZE2B 3PVXA 1RTDA 3BYPA 4ZP6A 2BQ3A 2HHVA 1VJWA 5A6PA 2JSXA 1QY7A 4I2PB 8AT1B 2EFOA 1ZAVA 1V3RA 4UZCA 4O4RA 4F4YA 4MAKA 2FHMA 3KWMA 5H9EJ 1FRJA 3QGHA 4RBVA 3M9NB 3DDIA 5B0GA 3K5NA 2XMMA 4GKKJ 2QC3A 2HFVA 1XR7A 3PG9A 4G65A 4DX5A 4QWAA 2VPZB 4P2XA 3DGVA 5GMDA 3DOMA 4LIRA 4C11A 4O4GA 4UOHA 1MWQA 1BWVA 2KFNA 2DNHA 3CTRA 1HYSA 4NEZA 4G1QA 1WF1A 2EG1A 2HNZA 3R1HA 1GNKA 3BPSP 3R97A 3B54A 1NLKL 2AZ3A 3LW5C 1N48A 1N52B 2CQ4A 1S7IA 1UPMB 2E66A 2AGPA 2RUGA 4KFBA 3ISNC 4KH1B 5D3GB 3CW2C 2WONA 2R9LA 1LWEB 2FUG9 3T6BA 2I2YA 1MN7A 4CCHA 2CUYA 1KSPA 3LP0B 4ZPAA 3VGUA 5J2MA 2BMBA 1LWFB 1YWXA 4U96A 3QMQA 3SXLA 2DGTA 5F0WA 2AX0A 3MR3A 2LMIA 2HGMA 3G71S 4ED4A 2K3IA 2RILA 3JQJA 5HQMA 5M2UA 5C2GA 2ERRA 3AXMA 1N56A 2ZNYA 3ET6B 2HZAA 1U6ZA 2E29A 4GKJF 4XDDA 2UXBJ 1ITPA 4DHVA 2W7PA 3HX9A 3DRPA 3KK1A 2XY5A 2IM3A 2BJDA 3LQVA 3MD1A 1GTHA 1N6QA 1HW8A 2DNOA 5E2QA 2XS2A 1WHVA 3P45B 3KK2A 4M95A 2DRBA 2RRBA 3HHKA 4MIAA 5AT1B 3CMES 1CULA 1TR0A 2ZD1B 3RBXA 3H2LA 3HCXA 3RZAA 3QWUA 1QLNA 4DV6F 1NRKA 5ETSA 1H2TZ 2Z2YB 2UUTA 4A47A 1AYEA 1D09B 3T5JA 4WFYA 1S6PA 3J7AN 1QAIA 1RYRA 5CCMA 1AFIA 1FWPA 3MMAA 2ILYA 2RMLA 2HHXA 2X3GA 5CD4A 2ZE2A 2AEJA 4CLKA 2ZDPA 2DRAA 1BY9A 4AFFA 1S10A 2FLNA 5KFEA 3LOUA 4JI7J 5A8WB 3UR0A 2RHSB 4I2PA 3FCHA 4E2FB 2YX1A 2P9EA 1NZ8A 4MKBA 4WFZA 4JI4F 3SQOP 2G0CA 1ZAWA 1WG4A 3D9BA 4A8WA 1R0CB 2JRSA 1IBLJ 3CC4S 1PKUA 5DS7A 5E3PA 1X4GA 4DLGA 1FJ7A 1J5EJ 1H6KX 5DQIA 4NI2B 1F60B 4ED3A 4ELUA 3NMAA 4C2MA 4OZNA 3FJ2A 4Y2AA 1FDNA 3NGTA 1ZPVA 3MEGB 3G87A 3QGPA 3FEYB 1S57A 4KHPF 4WP3A 4K4YA 1UP1A 4ZA1A 4YN3B 3JTOA 4KHMA 4I67A 2XCAA 2H1YA 4WXWA 2XSJB 4MYTA 2F7VA 1SJ3P 4ZCIA 2UUBF 1I6JA 3EZOA 3E3XA 1KN6A 5C7PA 5D3GA 2FVPA 1LWEA 3QPIA 1MW7A 1YDLA 3LP0A 5B0DA 2YWHA 2YBVA 1U6BA 4PABA 1LWFA 4CLYA 5E3CA 2NSCA 4ECQA 4F67A 1VDHA 2IBOA 2Y0SD 5HBMB 1T9YA 4IFVA 5EX3A 4C3MA 3POTB 1EZZB 4U67Q 5AE1A 3Q8RB 5H9EK 3ET6A 3KG1A 4J90A 4HEA9 4OMFG 5IWAJ 3E2EA 3BO2A 4DR2F 3HFVA 3AXKA 3BYRA 3CDBA 1Q78A 1SC6A 3PJXA 3PHTA 2HG4A 3JAMU 3J80U 4P71A 1NM2A 3H20A 4KQZA 3TZXA 1HI1A 2YKNB 1YJ7A 1C1BB 4FXVA 3MMCB 5JMNA 2CPIA 1SL1A 1SC3B 1QUPA 5KFAA 5LJ3Y 5IQQA 1FI4A 1YG0A 3ILJA 3BKTA 2W9AA 3PX4A 1TK0A 4C97A 2GJFA 4RLEA 1P9QC 1WELA 2BM0A 4RKUC 3ZZZA 2R7QA 1UEUA 2LDIA 4JBCA 4KKOB 2HHHJ 4A48A 1TKTB 1FRXA 3RG6A 4RNMA 2UUAF 5F41A 5A8WA 2P8IA 2W9BB 1A9NB 2IAJB 4DFJA 3PEJA 2O1PA 1HWIA 4OHZA 1SBRA 1WG5A 3UO0A 3IBCB 4B3SF 3NEKA 2KL8A 4MK9A 2B56A 3G4SS 1NZAA 3CCZA 3DXSX 4YB6A 2DY9A 2KU7A 3BQ1A 4QW9A 3M8ZA 3Q8PB 1F5CA 2DHAA 3IFEA 5J1EB 2HYIB 4NI2A 5IV3A 1FKPB 2OHDA 4NA3A 3I5BA 3VAIA 3UDEA 2J0WA 3MEGA 3ENWA 3QO9B 3ENQA 1WC1A 4A8OA 4DL0C 4PG7A 2IJRA 2KXNB 1M5KC 1VIOA 1QAJA 4JI2F 3EZ5A 1HI8A 2R2RA 4URSA 2XSJA 1S7HA 2B4OA 1IM4A 4NLQA 1RSCA 1CQMA 2FHOB 4ZVSB 2C3UA 3NBPA 1RWXB 3HULA 2V63A 3BV8A 4HDGA 1FJGF 3AOBA 4C98A 4WU3A 3E01B 1Y5IB 3DLLQ 1U49A 3HSJA 4ZCKA 3VAFA 4OZ1A 3HVWA 4YQWA 1FK9B 1OSCA 4EO6A 5HBMA 2JJ4D 3OFFA 3POTA 4QIVA 4NLXA 3KJFB 4L74A 2DGUA 4ED6A 1QSYA 3OFEA 3C8YA 1D3WA 4NXMF 5IOLA 1JLBA 2DGOA 4C6AA 4JI0J 4G1PA 2E44A 5CYJA 2AHOB 4F36A 4KC5A 2NUUG 1P6TA 4MIBA 3LAKA 2GHVC 5U47A 4DUZJ 3NS5A 3PW4A 2BQUA 2YKNA 1C1BA 4WP8A 2RUSA 2BV3A 1URRA 3MMCA 4LFBJ 4C3KA 2C2DA 4IO1A 1F3FA 3M1VB 3N5BA 4DV2J 4RW6B 2R2UA 2HFOA 1G2EA 1REVB 3CJ5A 1TKZB 2N82B 2X51A 3G8TA 2XWXA 3P6YC 3Q8SB 3OL8A 2Z0GA 2IIHA 3D1OA 2Z4PA 4ZIVA 3QLHB 4RWWA 3FBBA 1PILA 4NMLA 4BLGA 3TVKA 4J37A 3EE3A 1S79A 2HQ3A 3KTQA 2CFXA 4MK7A 4KKOA 2HSEB 2HHSA 5D78A 4OYAA 5ITHA 3UNGC 3GWCA 2N7YA 3BSOA 3ENAA 2MZTA 3SCIE 4P7TA 2RQKA 2QMUB 4LT6A 2W9BA 2IAJA 5AXKA 4DQSA 4DR7F 1RBAA 3S6EA 2WVDA 1YRXA 1X5OA 2RDIA 3KHGA 5D0RA 2JLFA 1JK9B 3ZTQA 1T9TA 1W2BR 3HMJG 1PIEA 1LV5A 3GYNA 1M5PC 4NLDA 4KAIA 4OZ2A 2HRYA 4FBTA 2XS7A 3O8WA 4X4PA 4H54A 3GJSB 5J1EA 5GADU 2RVJA 4FNHA 1FKPA 4KYZA 1YJUA 4LSZB 2DO4A 1X4AA 2LP4A 1JKHB 1FRMA 2XGPA 3QO9A 5HMYA 5CZXA 1UEVA 4OZ3A 3AOCA 3P5BP 2VONA 1KOOA 4TQSA 3OW2R 2AYMA 2QGFB 1OQ3A 3P5TL 4M5NA 2EC0A 5FDLB 5KFGA 3TUIC 1TV6B 1G4CA 5T7LB 4BWMA 1VQ9S 5BJRA 1N36F 3MCOA 3MFIA 3IM9A 4ETZA 4DV3F 1NK6A 2G13A 5DLFA 3E01A 1VQYA 4LVNP 2G1DA 2GCFA 1SQEA 2UXCF 1U1QA 3MR7A 2MKHA 4MTPA 1N34F 1TMMA 4F8RA 5HROB 3N6NA 5ETQA 2DHHA 1TL7B 1FK9A 2EK1A 2HBZB 5B08A 1Q7YT 5IM0B 4DR1F 4NOHA 3G9CA 1B7FA 2XMTA 1XR6A 5FD1A 1WKJA 3PXGa 2YH1A 5DDPC 3JSMB 3DU6A 4NLPA 2W01A 4KSEB 4OZ5A 1GH8A 1APSA 5CYQB 5JUMA 4ECRA 2ZVSA 1TFWA 3VZHA 4E0DA 3TZYA 1WEXA 4IYQA 4C4WA 4DPOA 4HL9A 4DL2A 3B4DA 1K9MT 1KDNA 1NNDA 3M1VA 1EHWA 3L4BC 1Q8BA 4RW6A 5EWEA 3F73A 1REVA 2PA8D 2QLXA 4OJGA 1TKZA 3KUHA 1RHRB 2L08A 4NXNF 2DXFA 1UFLA 4GO5X 2E1MC 2R7VA 2VC0A 2DO0A 4N76A 3JB9k 3J81j 3DI6B 4IUFA 3V6HA 4F02A 4TU7A 1S1TB 1WWHA 3QATA 3QLHA 2GQQA 2PDAA 2XC9A 1XTZA 1X4BA 2YNFB 4F0KA 3BGLA 2V8DA 1LW2B 3EUNA 4ZVRB 2JNJA 1G7CB 2OPRA 4CO4A 4EYIB 5LSOA 3CD5A 3EDQB 4OIXA 5F9LA 1CJVB 1SCJB 3FBEA 3FBFA 2RRNA 1RWNB 4NZ0A 4QYRA 2LLZA 1NAQA 4ZMMA 2NXCA 3ILLA 2W7AA 2MHEA 1IKYB 3K89A 1D9DA 1XK8A 3TP2A 1X0FA 3C3LA 4DPXA 4K4TA 4UUXA 2QMXA 2VU5A 4K7QA 2WVBA 3CO0P 2MSSA 1RHKB 1VRUB 4KPCA 2CRLA 3A8EA 5D0GA 1N33J 4UOCA 1JKHA 2YVSA 4J9PA 5MAOA 4AUKA 2UXDF 2JZ5A 5LSRA 2NUHA 2ZVIA 2CNNB 1PG5B 1FT8A 2HHPA 1P9YA 3W60A 5FDLA 1TV6A 2IRUA 1YZ7A 2DY1A 3KDOA 1B0VA 1SH0A 4OZJA 4DPYA 2C2RA 1XERA 2IMOA 3AJ1A 1X4HA 3QSIA 4Y2KA 2GFFA 3BO4A 4P7VA 2V94A 4OYMA 5HROA 1QJHA 1TL7A 3GJRB 4OYZA 2ZNZA 4OYBA 4Y34A 2XO6A 4ZPTR 4PPDA 1VMBA 2L41A 5IM0A 1KNZA 4BC7A 4WWSA 5IS2A 4N41A 1BQXA 4ILLA 3BDEA 3QT7A 1N5SA 4XK8C 2IPOB 5CZVA 1K8AT 2DITA 1XN9A 3JSMA 2ZBQA 3DRSA 4KPYA 1BHNA 2HRTA 1C2PA 2F3JA 1TTHB 3PDNA 5CA5A 1X31C 5CYQA 2V9KA 3BBBA 1WF0A 4OJ3A 4WFNQ 3H25A 4L73A 4F0HA 4RZRA 3PKYA 1F5AA 3R5GA 4FYXB 3IG1B 4YEAA 1AA1B 2ZH3A 1RT4B 3DN9A 2P9GA 4QR2A 1T9VA 4V19X 2IJFA 5IT4A 5AXMA 5HAOA 1HHQA 2FVCA 4BBYA 1ACMB 1MLAA 1H72C 3CJTA 1VC0A 1F1BB 1WTFA 1B4SA 1UL3A 3P4UB 4M5JA 5K14B 3DI6A 4ED1A 1S1TA 1ROFA 4DPWA 2CVIA 1FJCA 3MPUB 4JV1A 2VUGA 3MGJA 3T3FA 2GIFA 1LW2A 1FEEA 2EXUA 1JB0C 1HMVB 1U1LA 4DUTA 1I3OB 2YWKA 1S9FA 2IRXA 2KI2A 4OX8A 4KY3A 3FMBA 1R8AA 1WNEA 2BKPA 2E1PA 1CJVA 1S49A 1U8WA 3ISND 3PO4A 5EHHA 1JWWA 5HP1B 2FZCB 4NA2A 1VOMA 1HLWA 1B99A 5D4NA 3SIPB 4FVMA 3W62A 1IKYA 2JH3A 4TKTA 1CPZA 2IDEA 4X4OA 2AJ1A 1MNEA 1VRQC 1C0TB 1IN0A 2XY6A 3PM9A 1WEZA 3NGRA 3PV8A 3J81Y 2VQEF 2L9WA 1TZ0A 1VRUA 2DBBA 2J8AA 3CCRS 3THPA 2MLZA 3H90A 3WBZA 1NSPA 1VISA 2CPXA 5HQ8A 2XNQA 1YGYA 2OEKA 2ZBIA 2HQIA 4F2RA 4PQUA 1B64A 4F25A 3MOZA 2VG5B 2NQPA 2LQJA 5LMUJ 1NJIT 5F8MA 1E6YB 3OL9A 1XNRF 2GAGC 1EX8A 4DQRA 3PYFA 1UA0A 3CE8A 3MEDA 1X8DA 4NYPA 1NKCA 4ZPCA 1BWEA 3SFGA 2VBZA 4B9MA 8RUCA 3CCWA 2WW4A 4OI2A 3VHQA 4PPZA 1FXRA 2ASYA 1HBUB 4R25A 4LF8J 2HQFA 4HT5A 3CJ8A 4TYAA 1SKUB 3VQTA 3OR1B 3TRGA 4QWCA 1UVIA 2K3KA 1KQSR 2N4DA 1RT3B 4ZVOB 4Q45A 5KG2A 4DV0F 3I31A 4EFAC 5B0FA 1Q82T 2LQ5A 5C24B 3T5KA 2MKYA 4Z7CA 4Y3CA 4J9RA 1KQGB 4IRDA 2HURA 4C48A 3T1HJ 1YJRA 4GVLA 3ZZYA 3IG1A 5GAHU 2QG9B 3DGPB 3HHLB 1RT4A 2W24A 4TYBA 3Q23A 1R8HA 2ZZTA 4O3OA 5ADZA 3KHLA 1G6BA 3GP9A 1RABB 4CM0A 4L72B 3ZXWA 4RU2A 2GIRA 3OLAA 1OO0B 2CQ3A 3QFHA 4OYOA 3FSXA 1Y3KA 5K14A 5T41A 2FVRA 1RAIB 3QJLA 4K4ZA 3MECB 1NUEA 3M6WA 3MUTP 4X4SA 3RTVA 1HMVA 2LA4A 1BE4A 2FGCA 3EXCX 1YTYA 2LA6A 3O1LA 4CO5A 1U47A 2FJVA 3H5XA 5HP1A 4K4SA 4YHHF 2P9CA 3TZZA 3MCSA 2I38A 3DDNA 3ELHA 4USWA 1ZM3A 2R7WA 2H48B 1C0TA 3D0HE 1Q79A 3MR2A 4AT1B 5LMNF 1S6OA 2HPUA 4Z37A 3AA8A 4LFCJ 5KFHA 1VI7A 3PW7A 2O5DA 2MDAA 2KXFA 4ANCA 2BJ7A 2W4PA 3GIIA 2R8JA 2X1FA 2CVEA 2ZWOA 4ENOA 3C16B 1VQNS 2JFKA 4LFAF 4WP9A 2IA6A 2ZH2A 2VG5A 3H4BA 1DQ9A 1SUQB 5IXUA 1E6YA 2AYEA 1Q95G 3R1LA 4BC9A 2WOMB 5EUHA 3TAQA 3MD3A 4RNFA 1Q8LA 5IV4A 3U02A 1ZTWA 2DEJA 4O3RA 1D9FA 5FLXY 1P27B 2NXUA 3D6MB 5K8MA 2Z57B 3C2PA 3GCWP 4B3MJ 2J6UA 2H5EA 4FNIA 5A8KB 4ZVTB 3CCJS 4N77A 2PN6A 1HBUA 2XMJA 4QYZJ 2FJEB 1KD1T 3GG1A 4QIFA 3UVJB 3OR1A 3N9UC 1RT3A 1UVKA 3OHBA 4DLEA 1TQLA 1RAHB 3Q22A 2O67A 4HR2A 4ANDA 5C24A 2HVDA 4Y2CA 4F04B 5KFTA 4C8OA 3I87A 1GXTA 4RBTA 1NDCA 1XQIA 2MZRA 1QUVA 4A8SA 3HHLA 3DGPA 2DGWA 4XDCA 2VFUA 2VASA 4X64J 4DSKA 2IBKA 2LEAA 1CQNA 4LF9J 3EPIA 1Y9OA 3TAPA 2ZH1A 2BA9A 2M52A 1Q81T 3W8GA 3K59A 2QX0A 1AZSB 3UE2A 2RT3A 1JQGA 4YDDB 3IN5A 2A0FB 3P3DA 2FYXA 2UVWA 3MECA 3KYLA 4YR2A 3CCQS 1U1OA 2EEYA 2V9WA 2CJXB 4JI3F 1GTEA 1HNZF 2ZM6F 3GFXA 4DV1J 1D8ZA 1Q53A 4ITSA 3LWMA 2R8KA 1WDTA 2HIQA 4YFUA 1JXLA 4KE5A 3DYAB 2KYXA 5KTQA 4GC7A 1B70B 3R2DJ 1LK5A 3JTNA 3TA2A 3UD4P 1BMQB 2JWNA 3M8QB 3T1YF 1VQ6S 2J5AA 4AL6A 3PW2A 2MLYA 3KLGB 3ZO7A 4X62F 1WOSA 2CNLB 1GK8A 1BGXT 5GAEU 1KBRA 2AV5A 2IM0A 1P1LA 3Q8QB 2R42A 3DOKB 3UFCX 3MPDA 1HWJA 2X1GA 3T5HA 2K8GA 3I5CA 3IS9B 2OAUA 3QWPA 2WHOA 4LUBA 1CJKB 2IYGA 4Y2IA 3Q8YA 1M90T 3C16A 3EYZA 5KT5A 2B51A 4A8FA 4YDXA 1FVSA 3R5CA 1ZS6A 4LMZA 1H3DA 4F4XA 2DPIA 3W64A 1JMTA 3JXOA 4OL8A 1SUQA 3WIVA 3HHEA 5AXNA 4DR6J 1PC4A 5I4MA 2BJ8A 5ETMA 2G1HA 3MPWA 2V68A 2WOMA 1SKWA 4QU7A 2R7UA 2YKAA 1A6LA 3FBCA 3IWNC 4FPRA 4USVA 1CJUB 4DV5F 2MKSA 3LP2B 1LOUA 2YQ0A 1EKRA 1NMEB 5F8LA 2CNKB 5A8KA 4JI6J 3SEOA 1DTTB 4O44B 2HKEA 2CPYA 1S4EA 3TEGA 2HW3A 2FZKB 4CLLA 2ALZA 4B02A 2K7KA 3UVJA 4MIWA 2WSEC 2KT5A 1OIAA 2W1BA 2Q79A 3BKUA 3PW0A 3BN7A 4F4WA 5KFSA 3KLVA 3K0JA 1NDKA 1T03B 2BE7D 2QL7B 4K2JA 1OYDA 1NO8A 4ED2A 2I6WA 2DH8A 4DL7A 3GQCA 4F26A 2OKQA 3THVA 2RE1A 4EBCA 5IQ6A 4U7UK 1HNWJ 1O51A 4UOFA 2DGXA 4AXJA 3D28A 1RHJB 2KZZA 3OTBA 2HLTA 2XMVA 2CPDA 1AZSA 4RUCA 2VFTA 3NS7B 3DLGB 3A8KA 4QBUA 2LQ8A 1FVQA 3K5MA 3W61A 2B9WA 2VHGA 4UF4A 5HN0A 2FGOA 2GJ2A 4DR3F 5KFPA 2V8HA 1DBDA 5E0OA 3HXMA 2Z30B 4RL1A 2XZDB 4B9TA 1X4CA 2DCLA 5DM7Q 2KO1A 5JJBA 3LH2S 2XB2D 1GT8A 1FKAF 4OJHA 3DYAA 3GIMA 4QYZK 1RTIB 4YR0A 4PRFA 2JX2A 3K8WA 4PQAA 1RYSA 1SJQA 1WG1A 4DSLA 1X9WA 3M8QA 1IXKA 2OTLS 3W9HA 4NZ6A 2WBRA 2YX7A 2GX8A 1YJNS 3KLGA 2VDHA 1OY8A 5BR8F 1QVGR 4PYAA 2NREA 4V19J 4N56A 2OI2A 3DOKA 3ZZPA 4CH7A 5KFOA 4LF7F 3IS9A 2MGZB 1QSLA 1ZA1B 3V81B 3AB4B 3ULHA 2CPJA 4I0WA 4RUHA 1CJKA 2BVZA 4RUBA 5F8HA 2DH7A 5KOXA 1S72S 4FDFA 4RW9B 5HANA 3SZ2A 4RWXA 5F3TA 4IR9A 1VBXA 2G2OA 2Y1LB 5KFNA 3OSNA 3PEHA 5D0EA 3GZ7A 2XM3A 4CNYA 3M8YA 4LF6J 3CJQA 1JNZB 3VCDA 2AW0A 2PIIA 2AMCB 5KFQA 1C0UB 1FDBA 2XY7A 2LXUA 1X4EA 1XMBA 4ED8A 1CJUA 2ZUAA 3LP2A 1WORA 3HHLD 4R0EA 2XMUA 5HVGA 1IKWB 3SV3A 3R27A 5AJ3J 2FJWA 3JYTB 3BDPA 5E41A 2WVFA 2B4VA 2FDNA 1DTTA 4O44A 4TXSA 1S1VB 4R8UA 2PMHA 5M2RA 3EXYA 3K2YA 5ETOA 2N3LA 4DZDA 5ETTA 3CPWR 4GKKF 4FF3A 4N8OA 5KT3A 4K4XA 2Q6BA 2RNEA 3TW0A 3CXCR 2CZVC 1K1QA 2NPFA 1V5IB 1SJFA 4QWBA 4PXDA 4F4AA 2Y1RI 1T03A 5DQHA 3QT8A 3HF5A 2QMWA 4NCGB 4AQYJ 4L3KA 2VOOA 8ATCB 1T0TV 2C2OB 1U1NA 3CDUA 3QRPA 3D0IE 2LFVA 3OVAA 3GG0A 2GS8A 3LGHA 5EWFA 1B3TA 1F0XA 1EARA 4ZPBA 3MEKA 1H2VZ 3D4JA 2NPIA 3OPKA 2HS3A 5KG5A 3N6LA 3CCUS 1WSVA 4YB1P 4TLRA 2OPSB 4IH5A 2GO8A 3V6JA 3DLGA 5AE3A 4A4JA 2NXEA 4GRSA 3K57A 2DYAA 2CQHA 1XMOJ 3OHAA 4WXOA 1O0PA 3NWGA 4BDPA 2VBXA 4N47A 3HJVA 3VAHA 4CDIA 4P73A 1RTIA 1IUJA 4CYUB 2M4MA 2MTLA 1SB6A 4Q5VA 2UXBF 4LRBA 4H4OA 3J81U 1VQKS 2FLPA 1FFGB 5HATA 3SSQA 3GJQB 1Y5NB 1NEEA 4ZVPB 4LSNB 4P2MA 5GAGU 1SKRA 3ITHB 3GR0A 3EWGA 3U7JA 3QSYB 3RAXA 1GMVA 2MKJA 2GMLA 2D1CA 3E8OA 4HHHA 4OX6A 1LW0B 3H7HB 2MGZA 3V81A 2KT2A 3MCMA 3OTOF 2Z56B 2MQ8A 3EGNA 4P10A 3ZC4A 2XLIA 2HVIA 1N8RT 2BJ1A 2ZEJA 4CH1A 1JXVA 4RW9A 1K0VA 5HVFA 2MMYA 1JIHA 3LGMA 2MJNA 1FF2A 3M6UA 1FDAA 2VG6B 2H3EB 4G3IA 2QFJA 1UKUA 4QPXA 9ATCB 1C0UA 1X9MA 2JOQA 2PT0A 3BJYA 3MAHA 4F50A 2EFNA 2VOPA 3EGZA 1HKAA 4PWWA 1D0EA 5LT5A 1IKWA 4AYBD 3I55S 1N32F 2FB0A 2DNZA 4JI7F 3S8SA 4E8UA 3JYTA 4GO7X 2XCPA 1EJ7L 2H5IB 2OEMA 5KFKA 2HQCA 1S1VA 3HKZD 4QIWD 1HWUA 4B3OA 1IBCB 2VDIA 4C8YA 2J6TA 1HQEB 2MY7A 3DCAA 1VC5A 4ILRA 5IT0A 4G6VB 4K0KJ 5HK4A 1NJYA 3QJJA 3RB6A 4HI2A 1J5EF 5KFLA 2XLKA 1IJEB 1XWLA 1NH7A 1URNA 4X4NA 5HI7A 2F9DA 4NCGA 5IFMA 1IKXB 5CQGA 1VBYA 4IG0A 2EKYA 1E6VB 1O6XA 4CT9A 5HSPA 1DY3A 4P2SA 3UCGA 1S9GB 1QE1B 2Y3YA 4J5OA 5B7WA 1F9FA 1OQ6A 2HLUA 1YRUA 4CM2A 2DJWA 3U27A 2YNIB 4ZVEA 3OFGA 3J7A1 2CQDA 3D0GE 1NSAA 2OPSA 2Q1LA 3ISZA 4GMKA 4CLWA 1N5YB 3J7YI 3W5YA 2H9ZA 2AJFE 3LO3A 5CYMB 4RBUA 3MI7X 2RD5C 1U25A 2ZOMA 3NNAA 3FRYA 1BXNA 5B09A 3TI0A 4CLFA 5KG3A 2YWFA 2EFQA 4CYUA 2OIHA 4TLQA 3RW7A 2MKCA 1F6TA 5IWAF 2D3OR 1VQSA 2QLWA 4LSNA 2IM1A 2EKNA 3ITHA 2D3UA 1GMWA 4JP8A 4U9RA 1UVLA 4DN0A 5E33A 3D3BJ 5HMWA 1OJ4A 3M2VB 3VVUA 1RT7B 1RZMA 4M5DB 1LW0A 2N7CA 5BXIA 4C8LA 5KFBA 4ZPWR 1U1KA 2AZ1A 1EP4B 5HJYA 4JI8J 1MWZA 3K17A 3CCVS 4RJVA 4O0IA 2CJKA 1SH2A 5DZ6A 4EEYA 1PGZA 4HHUA 3FSYA 5FLXU 2KT3A 2VG6A 2HQDA 3AODA 5GMKa 1VCTA 4A8XA 4WKRA 2O3DA 2OPPB 2OJ3A 2J0XA 1YBAA 4DU8A 2HHHF 4LBHA 3TEHB 4ZVHA 1MMDA 3CIMA 3CWJA 3GYGA 4KIAA 1KEKA 1IM6A 1UMJA 2NXNA 2XQCA 3I32A 3MM9B 3Q8VA 2W2PP 3HKWA 3BR8A 4CQ1A 2LQBA 3MURP 1YX2A 2L9NA 2Y9HA 4ES3A 5CAAA 2B6AB 4Q2MA 3SQGA 1VIXA 4X66J 3IR5B
chains in the Genus database with same CATH topology
2W2OP 2XTJP 3A3NB 2Z2ZA 2Z58B 1V5IB 3VHQA 2E1PA 3A3PB 1R6VA 3T41A 3WIUA 3WIVA 3AFGA 2Z30B 1SCJB 2ZWOA 2W2MP 4NMXA 3SQOP 2W2NP 3CNQP 2Z57B 3BPSP 4YN3B 2PMWA 3GCWP 4K8RA 4NE9C 3QFHA 2W2QP 3BGOP 1ITPA 2W2PP 2ZWPA 3WHIA 1SPBP 3A3OB 2Z2YB 3VV2B 3CO0P 2QTWA 3P5BP 3H42A 4JP8A 4OV6A 3GCXP 2Z56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2O P;  2XTJ P;  3A3N B;  2Z2Z A;  2Z58 B;  1V5I B;  3VHQ A;  2E1P A;  3A3P B;  1R6V A;  3T41 A;  3WIU A;  3WIV A;  3AFG A;  2Z30 B;  1SCJ B;  2ZWO A;  2W2M P;  4NMX A;  3SQO P;  2W2N P;  3CNQ P;  2Z57 B;  3BPS P;  4YN3 B;  2PMW A;  3GCW P;  4K8R A;  4NE9 C;  3QFH A;  2W2Q P;  3BGO P;  1ITP A;  2W2P P;  2ZWP A;  3WHI A;  1SPB P;  3A3O B;  2Z2Y B;  3VV2 B;  3CO0 P;  2QTW A;  3P5B P;  3H42 A;  4JP8 A;  4OV6 A;  3GCX P;  2Z56 B; 
#chains in the Genus database with same CATH topology
 2OP5 A;  2RIJ A;  5E3R A;  2ZOG A;  4FYW B;  2YKO A;  4Y00 A;  2UP1 A;  4ELV A;  1JLA B;  3HZE A;  4B3R J;  2DR6 A;  4KH0 B;  4CLS A;  4IFY B;  1NK5 A;  4P75 A;  4QIG A;  1IKX A;  1E6V A;  4EYH B;  4F2S A;  1NHK L;  4DR5 J;  3EPG A;  1S9G A;  1QE1 A;  4C8M A;  1JLF B;  1FWK A;  4RW4 B;  4YY3 J;  3OXF A;  3QNW B;  2XI3 A;  4O3Q A;  2K1R B;  1HHT P;  1VBZ A;  2YNI A;  3VV2 B;  3CF5 Q;  1T3N A;  3NRB A;  4UZB A;  2E9Z A;  2I0X A;  2H51 B;  4ED7 A;  2YNH B;  3NGD A;  1N5Y A;  2JHE A;  2BKN A;  3BSA A;  2COL A;  3J7Y U;  3MAA B;  3VTI A;  1VHI A;  5CYM A;  1T7P A;  3MTJ A;  1RDR A;  4O3N A;  3V6D B;  3HM9 A;  4QU6 A;  3RRG A;  5M2P A;  4D3G A;  4I69 A;  2V4Q A;  2HHQ A;  1HWL A;  2EFG A;  4DR4 J;  1GX5 A;  5KFM A;  3T6J A;  1AUS L;  3L95 X;  3I0S B;  1WHX A;  5D4O A;  4DSF A;  4GVB B;  5FII A;  3LP1 B;  3A4T A;  4LR8 A;  4JI0 F;  2E5L J;  1ZTT A;  2MXY A;  4DL4 A;  2DIV A;  4AE5 A;  3M9M B;  5DJB A;  3DHX A;  1UAW A;  4OI4 A;  4DUZ F;  4TY9 A;  4F3O A;  4MKA A;  4A46 A;  3M2V A;  1LWX A;  4B9N A;  1RWP B;  1F9H A;  2MB0 B;  3IA0 A;  1IVZ A;  2WK4 A;  3IBW A;  4M5D A;  4F7V A;  2DGS A;  4JI1 J;  3MDF A;  1EP4 A;  1PBA A;  4LFB F;  4TNO A;  3AJ2 A;  5J2Q B;  3TOQ A;  2R2S A;  3EVW A;  1RHU B;  4NLY A;  2AD9 A;  2EWH A;  1NXI A;  2FHK A;  2FQQ B;  3EJM A;  3M30 B;  1KWM A;  5DGA A;  3VZI A;  4RNH A;  1N0U A;  4FP9 A;  4ZVU B;  3H2V E;  4F3M A;  3R5A A;  2FLL A;  1RT6 B;  1RU2 A;  3IXQ A;  5KG1 A;  2B4U A;  3L09 A;  1R6V A;  2Q6C A;  4R5P B;  3GU0 A;  1GMU A;  1DLO B;  2OPP A;  3NKY A;  1HHS A;  2QL5 B;  1GQE A;  2PD1 A;  3K8V A;  2IVY A;  1Z4U A;  2YNG B;  1UW9 A;  2DHG A;  3U1N A;  3MM9 A;  1RE1 B;  1XIQ A;  4WF9 Q;  4FKX A;  4DG1 A;  4C8Z A;  3FSI A;  1EET B;  2P6S A;  3OL6 A;  3KG0 A;  3OJS A;  4JB8 B;  5B0A A;  3PRD A;  3QYY A;  2YKP A;  4ZK7 M;  5D0H A;  2B6A A;  1Z2Z A;  4OHX A;  4WBF A;  4NYO A;  2VBW A;  3NMR A;  2WCX A;  3B82 A;  4CO1 A;  1JLA A;  3TQ1 A;  4LF4 J;  5DG8 A;  4IFY A;  3LAN A;  5A0Y B;  5KFR A;  3H40 A;  2RHQ B;  2MQM A;  2MYF A;  1X4D A;  3IRX B;  3PX0 A;  2VQE J;  3EX7 B;  1Z1Z A;  2FHJ A;  1MG7 A;  4RW4 A;  2QA4 S;  2G4B A;  2K1R A;  3ZZU A;  5I3Q A;  3BS9 A;  1S6Q B;  3NGU A;  4M5K A;  1H7X A;  2NZ4 A;  1JLC B;  4NRT A;  3R5B A;  1GMW D;  4ZLL A;  2KVQ E;  2IVM A;  2MLX A;  2MQN A;  2V50 A;  2XHC A;  2ZC4 A;  2YNH A;  1PSD A;  1UVN A;  2HBR B;  1JLQ B;  2BDP A;  4TQR A;  4NZ7 A;  1ZA2 B;  2MST A;  3MAA A;  5HL7 Q;  2RH3 A;  4J9Q A;  3HDS A;  1Q86 T;  3KMQ A;  3V6D A;  4LSL B;  3MM8 B;  1M5O C;  3RBE A;  5E3A A;  3U1M A;  4X84 A;  3FKB A;  3ETO A;  1NB7 A;  3C46 A;  3I0S A;  2RDD A;  2M70 A;  4PG6 A;  2D74 B;  4RW7 B;  4GVB A;  4I6A A;  3LP1 A;  3HHN B;  3B8H A;  3M9O B;  1VHF A;  5EN1 A;  1U26 A;  2ZH8 A;  1VQ4 S;  3OXL A;  5F8J A;  4PG5 A;  2HAI A;  3LGN A;  1FRL A;  3GE9 A;  3MM6 B;  2EBG A;  1RAA B;  4USU A;  5MLC V;  4WK1 A;  2F4F A;  4P2F A;  4LF2 A;  1KQK A;  1RAF B;  5KFV A;  2KFZ A;  3ZFV A;  2FJX A;  2JEI A;  3OXG A;  4DV0 J;  1HBO B;  3N28 A;  5J2Q A;  1HD1 A;  1X7V A;  3CCL S;  1U2R A;  3NNH A;  4M63 A;  4A8K A;  3RW6 A;  4MKV A;  4HTI A;  2WSC C;  1L3S A;  1WKL A;  4ID5 B;  5L1I A;  3ZZT A;  3M30 A;  3TJA A;  4OYP A;  2J0Q D;  2HBY B;  2V4J B;  1CG2 A;  3BBF A;  4P6Q A;  1DFD A;  1RT6 A;  2XNR A;  3LPY A;  4JV5 J;  1NK7 A;  1KOH A;  1WUU A;  2R3V A;  1L5U A;  4R5P A;  2BW2 A;  1RAC B;  1DLO A;  1WD6 A;  4HI1 A;  4P52 A;  4KHR A;  1HD0 A;  1KRP A;  1AW0 A;  1TK8 A;  5IZH A;  4K59 A;  5H9F J;  1OMS A;  1RAE B;  1JX4 A;  2YNG A;  3Q0A A;  2R7S A;  2A2C A;  4V1A k;  2F4V J;  4DFP A;  5ETR A;  4OX9 J;  1WOO A;  1EET A;  2ZD1 A;  2EG2 A;  1I94 J;  2GW8 A;  1FNM A;  2YWE A;  1RWO B;  1QTM A;  3AD8 C;  3T41 A;  1RK8 A;  3UPF A;  4DZ6 A;  2HFU A;  2KG1 A;  1W26 A;  2DNR A;  4NLW A;  1ZZF A;  1VQL S;  1SH3 A;  2Y8W A;  1FD2 A;  2HGN A;  3PR5 B;  4ZKA A;  2OML A;  1Q8I A;  3SMZ A;  4CO2 A;  1MWY A;  3QZ7 A;  3T9Z A;  1N33 F;  3DDK A;  2VZ9 A;  4NLR A;  3Q86 A;  5A0Y A;  4WYL A;  2E7V A;  2DNM A;  2DNL A;  2VQF J;  2UUC J;  3IRX A;  4YS2 A;  4LRE A;  1DAX A;  1REG X;  1YLX A;  3HLU A;  4U8V A;  5F8N A;  1D1U A;  1S6Q A;  5HMZ A;  3KNG A;  3KKF A;  1HR0 J;  3EM1 A;  1JLC A;  1M5H A;  1H0H B;  1RWK B;  4UT4 A;  3CD6 S;  4UQG A;  4M8L A;  4EGL A;  5BYR A;  1JLQ A;  4S0M A;  2Q43 A;  3GV5 B;  1TFY A;  1ARO P;  2QRR A;  1S59 A;  3W2W B;  4ZCM A;  2GO9 A;  1S76 D;  3AB2 B;  3GSI A;  1N0V C;  4RO0 A;  4X4R A;  2C3O A;  4LSL A;  3MM8 A;  3UNY A;  2KJW A;  2Z2Z A;  4ES1 A;  4WCE Q;  3V2U C;  3O5T B;  1Y11 A;  3LA0 A;  2POK A;  2FJD B;  3AD7 C;  3WC0 A;  5DGB A;  1RXO B;  1WJ9 A;  3PRV A;  2DGQ A;  3SYZ A;  3VAG A;  4RW7 A;  4OV6 A;  2W25 A;  4KRW A;  4M5H A;  1OSD A;  2UUW A;  3G6V A;  2H65 B;  5E3Q A;  2DKO B;  4XPE A;  3MFH A;  3MF5 A;  2D3Z A;  1PAE X;  3MM6 A;  3RRH A;  1CBK A;  2ACY A;  4RX6 A;  2RQ4 A;  3C14 B;  2YH0 A;  1KKH A;  1XNQ J;  1DUR A;  1CS4 B;  1HNX J;  3J7Z T;  2QL9 B;  2DHX A;  1HBO A;  3TUP A;  2DGV A;  5L39 A;  3THT A;  4O23 A;  1U24 A;  3DXB A;  4XIU A;  3FZ2 A;  4ID5 A;  2FJA B;  1RA7 A;  4K5S A;  1U1R A;  4DL6 A;  2V4J A;  1YIJ S;  4ZLJ A;  1VRT B;  3MCN A;  1S1X B;  1SJ4 P;  1LK7 A;  2AEM A;  1AUD A;  4OX7 A;  2XZT B;  2HK3 A;  5C2C A;  2RQM A;  4ZHR B;  1YVF A;  1NK0 A;  2C22 A;  2FY1 A;  2J7U A;  1XBW A;  3ZTR A;  4QQB A;  2Y0B B;  2FHJ D;  1Q0N A;  4OLO A;  2CQ2 A;  3CCT A;  1EQ0 A;  3HD1 A;  1DJ0 A;  2OSQ A;  1FE0 A;  3KNA A;  2O66 A;  2HS4 A;  1FEH A;  3I4P A;  4DPU A;  1WOP A;  1WC0 A;  3I5A A;  5I3U B;  3BN4 A;  1I5O B;  4C0H A;  2V5H G;  2D41 A;  3G82 B;  1CSJ A;  4QWE A;  2E5G A;  1P1T A;  4OHV A;  2XEX A;  2PMZ D;  3HVR A;  1I1G A;  4QR0 A;  4LRA A;  1RGV A;  4ZLP A;  2VD3 A;  4ZP8 A;  2E5J A;  2OGU A;  2ZJP Q;  2A6O A;  5L1J A;  3B6B A;  1TKT A;  2CQC A;  1J5O B;  3RB4 A;  1S0O A;  5LMU F;  3KFW X;  2W2O P;  1JJ4 A;  1VQ5 S;  4K4U A;  2HHU A;  4HH0 A;  4Q44 A;  2AIR B;  1V3Z A;  1FCA A;  1Y3J A;  4H4K C;  2GHW A;  1T95 A;  4NWB A;  4EU0 A;  3RJM B;  3K5L A;  3VF0 B;  2BE2 B;  4MJK A;  3K5O A;  3DLB A;  1LWC B;  3W2W A;  1J2V A;  3ZNJ 1;  3AHP A;  5H9F K;  1V6H A;  2RKI B;  2SXL A;  1Y5L B;  4AL7 A;  2BXJ A;  1M1H A;  3GYX B;  3VGT A;  2ZBP A;  2J7K A;  2BAB A;  3HPO A;  3WX4 A;  1CC8 A;  1FTC A;  2DK2 A;  3IWL A;  3OUY B;  3ZTP A;  3NXZ A;  3GCX P;  5CXT A;  5G4D A;  3EMT A;  2UU9 J;  4TU9 A;  3CUN A;  3PFO A;  5DG9 A;  3AA9 A;  4USK A;  1S0N A;  1WDD A;  3PTW A;  2VKR A;  4PZV A;  2DNY A;  3C14 A;  3JQM A;  3TR5 A;  3PYG A;  3TJ9 A;  1CS4 A;  3HVA A;  2V34 A;  3ILI A;  1Y00 A;  4ECY A;  1VS3 A;  3W5X A;  5L1K A;  2Q66 A;  3MPY A;  1N4L A;  4ZS6 A;  2QJ3 A;  2B7B B;  2ZHB A;  4PWU A;  4L6V 3;  2V69 A;  3D67 A;  1P8G A;  1VK8 A;  6FD1 A;  3TAM B;  1VRT A;  1S1X A;  3LAM A;  3FGV A;  4NCA A;  2FD2 A;  2JC0 A;  4IQX A;  1UJ5 A;  2RRA A;  3KLI B;  2C2K B;  1X9S A;  4DV4 J;  1V5V A;  2AJQ A;  4ZHR A;  2C3P A;  2QIF A;  2L9D A;  1K47 A;  2I9S A;  4Q0B B;  1M5V C;  3R9L A;  4Q2L A;  5J2M B;  1FE4 A;  3JQK A;  4AL5 A;  2GAH C;  4M5G A;  3DMJ B;  2XYH B;  1FDD A;  4DQI A;  3UD5 A;  1FX4 A;  1S97 A;  2R2T A;  2MQO A;  3CD0 A;  4DV7 J;  2KVI A;  4PUO B;  3G8Q A;  2PEH A;  3MR6 A;  2J76 E;  3NY0 A;  4ECW A;  4LFC F;  4DFK A;  2G0J A;  3QBC A;  3QZ8 A;  1NSK L;  1RWV B;  2MQQ A;  1UZD A;  1S1W B;  3G82 A;  2HAF A;  5K8P A;  3KLE B;  2CG8 A;  2D9P A;  3M2U B;  2G2Z A;  1ICE B;  4WTO B;  1VLY A;  4UW2 A;  2XMA A;  4QR1 A;  2DD8 S;  2OUG A;  3NS6 A;  4LF7 J;  1J5O A;  4NAS A;  3CJK B;  1CUL B;  2ATC B;  1CJT B;  3BKF A;  3PJ9 A;  4O3P A;  2BAC A;  4ID8 A;  1F5B A;  1S12 A;  3OT9 A;  2DXD A;  3CJ2 A;  3CJ3 A;  4RNO A;  4UUW A;  3C66 A;  5KAK A;  3CB4 A;  2BE2 A;  3OD2 A;  2ADB A;  1WI8 A;  2ATL A;  2VFR A;  4B3M F;  3GR1 A;  2ZHO A;  2M2B A;  2XYG B;  2RKI A;  4NA1 A;  3ZZO A;  2QLB B;  3NCP A;  3MXH P;  3A3N B;  3V6K A;  3AY0 A;  2BW7 A;  2FJB B;  4WKY A;  2KRR A;  3QRR A;  4YB5 A;  2GA7 A;  4DX8 H;  3OUY A;  2LCW A;  2JVR A;  2EW9 A;  2JLG A;  4MMO A;  5K20 B;  4USI A;  2BOA A;  4L75 A;  2WBM A;  4K8R A;  2ZFH A;  3QQC D;  5T7L A;  1NK8 A;  1CC7 A;  2H5J B;  5HLF B;  2AYG A;  3W9J A;  4B9U A;  4K50 A;  4IH6 A;  1UWB B;  2F1F A;  4X64 F;  2NS1 B;  4LF9 F;  2BAN B;  3R2C J;  3UN3 A;  1BUX A;  3TWZ A;  4JI5 J;  4CLT A;  5A76 A;  1OPI A;  2ZDO A;  1M1K T;  5DZ7 A;  2ZKT A;  3H5Y A;  2CIM A;  3D3C J;  2W2Q P;  3TAM A;  2B9Y A;  2ZH9 A;  4DBQ A;  3KJQ B;  3VAK A;  4DI6 A;  4C0O C;  2L48 A;  2YQ3 A;  2WVC A;  1YJ9 S;  3KLI A;  3Q83 A;  3AFG A;  2QA2 A;  4DV1 F;  3HK2 A;  1M0S A;  1G1X A;  1VK3 A;  2LU1 A;  3L7U A;  4Q0B A;  2VIH A;  3F41 A;  1R8C A;  1J27 A;  3BSC A;  1FKO B;  2BE9 B;  2AQ4 A;  3JS9 A;  1MML A;  1HQ2 A;  2CQI A;  1Q5Y A;  2G9O A;  3DMJ A;  1KR4 A;  1FRK A;  4IFV B;  2P2C B;  4X4V A;  4IKA A;  3N4W A;  4PUO A;  4DX7 A;  3K5P A;  1F9E B;  3AAW B;  3PIO Q;  1UFK A;  4KGX B;  2KTQ A;  4I6Y A;  2Q3P A;  4ZOS A;  1S1W A;  2VFS A;  4WFX A;  4ELT A;  3HD2 A;  3KLE A;  3M2U A;  2WVE A;  1WI6 A;  1K1S A;  2N4C A;  3H0P A;  1ZZN A;  2XUL A;  2YNF A;  4KGM A;  2KRB A;  4NCB A;  2FY8 A;  1LXJ A;  1TL1 B;  1WF2 A;  2W4C A;  5L46 A;  1NKB A;  5GVQ A;  3RAQ A;  3CJK A;  1BD6 A;  2UV8 G;  4EBD A;  1FER A;  3OTO J;  2ABY A;  2BJ9 A;  4DR6 F;  1RB0 A;  4USJ C;  2JFD A;  3WC2 A;  1CJT A;  1FNO A;  2DCU B;  3C6U B;  5B0C A;  1HA1 A;  4QWD A;  5F3Z A;  2XWY A;  4B3T F;  3F56 A;  2LEC A;  1ZM4 A;  2F9J A;  2DR9 A;  3PZP A;  2C3Y A;  2BZ2 A;  3C15 B;  1HIY A;  3BGR B;  2Z2M A;  5L38 A;  2YKM B;  3WQP A;  1C4C A;  3I96 A;  1S0V A;  3SCL E;  3D6T B;  3F0N A;  4FN5 A;  2E1A A;  4KO0 B;  2QLF B;  4JI6 F;  3L7P A;  2LDY A;  1ZBT A;  3VQS A;  3IBF B;  1R3N A;  2KG0 A;  3BO3 A;  3CC7 S;  1YIT S;  3KLF B;  5FJ4 A;  1HNV B;  4IRK A;  4UY8 T;  4J9N A;  2V8P A;  2ROG A;  3ETM A;  2KJV A;  1IBM J;  1N32 J;  1RAG B;  2NYH A;  3OBI A;  1TVR B;  1PC5 A;  3BBC A;  2DTJ A;  3R8Y A;  5C25 B;  5F8I A;  2G0I A;  5KT2 A;  3FCV A;  4AD6 A;  4QZV B;  3CJS A;  1MN9 A;  4JYA J;  1HQU B;  5KFW A;  5HLF A;  5J2N B;  4B17 A;  2UVU A;  1UWB A;  5DM6 Q;  1SJ1 A;  2R8H A;  5D6G A;  2OFG X;  1WC4 A;  3GV8 B;  3QJP A;  1VC6 A;  2BAN A;  1NU4 A;  1HNW F;  4HH1 A;  1N5V A;  3PFE A;  4MFB B;  5HMX A;  1AFJ A;  1CLF A;  2PC6 A;  4FXD A;  4Q43 A;  1KFD A;  4N5S A;  2XZW A;  1S0M A;  3ZZ0 A;  2AJ0 A;  2RSQ A;  4X4U A;  3UDL A;  1RTZ A;  3GIR A;  2MQL A;  3NBP B;  1LNQ A;  1X60 A;  2WB1 D;  1T9W A;  2EPI A;  2OLW A;  3ADA C;  3NL0 A;  4FVC A;  1FRI A;  3TVY A;  5K9F A;  1EQM A;  2F65 A;  1SC4 B;  1FKO A;  3M8P B;  5B0E A;  3BR9 A;  2DH9 A;  2W8K A;  2AJ2 A;  2BJ3 A;  3AOA A;  2H54 B;  2FVQ A;  1TUV A;  4NLS A;  4J9U E;  3Q89 A;  1U1P A;  1WHY A;  3TQE A;  1PYS B;  2R7X A;  4CIO A;  3SSR A;  4RR5 A;  4J9K A;  3G6Y A;  1LFW A;  2DB1 A;  1AT1 B;  5HJX A;  3KOA A;  2D3O 1;  4O3S A;  1JLB B;  2HQG A;  2NYI A;  2R7R A;  1Y4Z B;  3FCW A;  2QYC A;  1Q8K A;  4BWJ A;  5F0U A;  3HSD A;  3WIU A;  5F8G A;  1WC3 A;  1U09 A;  4H4K A;  3N01 A;  1TL1 A;  3ZNU A;  5LM7 E;  2WW8 A;  4CLU A;  3TUJ C;  4FS1 A;  5I42 B;  1HWK A;  2K2P A;  3PAC A;  2RQC A;  3OL7 A;  4B9S A;  3D68 A;  2D69 A;  3FEZ A;  4DUY J;  2NR0 A;  5AE2 A;  4LF6 F;  4ZDN A;  3C6U A;  1KHV A;  2HBQ B;  5F9N A;  2MKK A;  5EX0 A;  4LRF A;  2HVE A;  2HVZ A;  5KG7 A;  2W7O A;  2M3D A;  3C15 A;  3BGR A;  1VQO S;  3DLH A;  1NJW A;  2YKM A;  3R7B B;  4IG3 B;  4CO3 A;  3CUL A;  2ASJ A;  2PSZ A;  2U1A A;  2RDJ A;  1NDL A;  5AJ3 F;  4KO0 A;  1EB0 A;  2KB2 A;  3U1L A;  4Q8E A;  4CO0 A;  2F8M A;  4LJM A;  3AJD A;  1NPP A;  3NGK A;  5BYQ A;  5KG6 A;  4NEY A;  4MYU A;  3KLF A;  1HNV A;  2HVH A;  5BYS A;  3OLB A;  1RTH B;  1QD1 A;  2I5J B;  2WSF C;  4OYI A;  2QO3 A;  2DR8 A;  3H2U B;  3O3L A;  1TVR A;  6FDR A;  4ALZ A;  4U95 A;  5C25 A;  3KK3 B;  2DR7 A;  1UVM A;  3MM7 B;  3BQ0 A;  1HQU A;  2YXL A;  3RAM A;  2B3T B;  4LRC A;  4AQY F;  1IQZ A;  4MT1 A;  3D66 A;  5J2N A;  4ZPD A;  2HIY A;  4DF4 A;  1Q4R A;  5GAD I;  2WTF A;  2X1A A;  3UDC A;  3KJV B;  3VR1 A;  2ZHA A;  4X65 J;  2DNN A;  3KUE A;  2R7O A;  4FZV A;  3RRK A;  4C0B A;  5DET A;  3W63 A;  1KTV A;  4MFB A;  2IM2 A;  4HDH A;  2R7T A;  3OTD A;  1X5T A;  3S7R A;  3BH6 B;  3KHR A;  1UTA A;  5SZT A;  4NLG A;  1XMQ J;  2IC3 B;  4J9V A;  5J1N A;  3QIP B;  2VOD A;  1RWU A;  4WTY A;  4KR0 B;  2ZZN A;  3IO1 A;  1U8S A;  2AKW B;  2GQC A;  1XMO F;  3SDE B;  1H74 A;  2BOP A;  4CZC A;  2NLW A;  5KFI A;  1NB2 A;  4NRU A;  1M5S A;  2VG7 B;  1TKX B;  3M8P A;  2CWK A;  4WJB A;  1SQG A;  4L76 A;  2MY8 A;  4OI6 A;  1KLM B;  2VPX B;  3M2R B;  2BRL A;  4DJB A;  3CGI A;  2LEP A;  4C8N A;  3AH6 A;  2NCK L;  3K7R A;  4YUD A;  4I68 A;  3DU5 A;  1KTQ A;  1BLU A;  4H4M B;  4I64 A;  3TJ8 A;  4PXB A;  4ILM A;  1GAO A;  4ECT A;  4NPO A;  3NOG A;  4KTQ A;  2F8H A;  2LXF A;  1N88 A;  3I9Z A;  3PYD A;  5JVH Q;  3KXD A;  4PXC A;  1IQT A;  2RF2 B;  5I42 A;  3QGG A;  1W7W A;  2UV8 A;  5KOW A;  1H7W A;  2YTC A;  4ZN3 A;  4RPF A;  4NLV A;  1FJE B;  1S1U B;  4NLO A;  1WSR A;  1HAR A;  1L3U A;  2LKZ A;  4PCQ A;  1TU0 B;  2MZJ A;  1VQ7 S;  2Z8Q A;  4LBI A;  4IG3 A;  3G6E S;  4WU2 A;  5EDW A;  1R43 A;  3M4X A;  1RLD A;  4J9L A;  4IDK B;  2DT9 A;  3ZTS A;  4ZVF A;  4DXL A;  4GKJ J;  2J6S A;  2ZWP A;  3IR6 B;  2XGQ A;  3C6T B;  4XTT A;  1NPK A;  4YP3 A;  1K73 T;  3IAS 9;  2OPR B;  4TVA B;  3US5 A;  5D4L A;  3SI8 A;  1RTH A;  2I5J A;  1UET A;  4FKY A;  3CDW A;  3QAE A;  4K0K F;  2IA0 A;  3MM5 B;  3DC2 A;  1T9U A;  3W2V B;  3KK3 A;  3SCJ E;  2JDJ A;  2DXE A;  3MM7 A;  1DAR A;  2R8I A;  4OZ0 A;  4ECX A;  4NMX A;  3D1Q A;  1T94 A;  4OQJ A;  4DV6 J;  2XYP B;  5LL6 d;  1FNX H;  1WHW A;  3KJV A;  3FUY A;  3D2W A;  1K44 A;  4OHW A;  2B0G A;  4K4W A;  1BQM B;  4OYX A;  1SQF A;  5RUB A;  3EGV A;  3RGI A;  4DSI A;  3MWB A;  2Z2L A;  1OWX A;  2XO7 A;  2IC3 A;  3VGV A;  4AXI A;  5B0B A;  3QIP A;  1U48 A;  3L9Z A;  1TEL A;  3KG4 A;  2ROP A;  2HWT A;  3NG8 A;  2A1B A;  2XLJ A;  3SDE A;  2UVV A;  3TNV A;  2M9K A;  1LEO A;  4ES2 A;  4JI4 J;  2XMW A;  4OJ1 A;  1IBK F;  2VG7 A;  1OS5 A;  1T05 B;  1TKX A;  1KHW A;  4RU9 A;  5ETV A;  2BEF A;  3OSP A;  2WAQ D;  5D8H B;  3FMW A;  4QW8 A;  2VB6 A;  2CQ1 A;  3EIC A;  3MMJ A;  4F0M A;  1KLM A;  4OV1 A;  3M2R A;  3CED A;  4J9S A;  4G1I A;  1NJX A;  2UVR A;  5DDR C;  4W4M A;  1QM9 A;  4JUZ A;  1UPP A;  5KFZ A;  1TUG B;  4DSJ A;  1I51 B;  1FWL A;  4KHP J;  5KFU A;  3DRS B;  2HZV A;  4H4M A;  1S48 A;  1NHV A;  1WEY A;  2DNP A;  3KHH A;  1ZYQ A;  4X4T A;  2UZA A;  4JI8 F;  2UUB J;  2D7S A;  4DN9 A;  1VQM S;  2KFY A;  2CDQ A;  4ZIW A;  2RF2 A;  4OHY A;  6AT1 B;  4IOC Q;  2V2Q A;  1YRT A;  1EIY B;  2AU0 A;  3PCO B;  3CDE A;  3GLJ A;  1S1U A;  2Y1J A;  1N5Q A;  1R27 B;  1EAY C;  1LQ9 A;  3O6Q A;  2KHD A;  3HHL C;  2XSF A;  3W9I A;  1RTJ B;  1OY9 A;  1RAJ A;  1IR2 A;  2KM8 C;  2GQ2 A;  4DS4 A;  4LBP A;  4CWB A;  5DLG A;  1ZH5 A;  4N7T A;  4IDK A;  2HND B;  1DQA A;  2WRM A;  1FX2 A;  2YKQ A;  2GC8 A;  2EI5 A;  3BGO P;  3C6T A;  3IR7 B;  3KLH B;  2B8P A;  2VFV A;  5KG4 A;  2C3M A;  4DR2 J;  5DRK A;  3HFK A;  3Q2T C;  3HJF A;  4Q7A A;  1UEK A;  3D1H A;  1L3K A;  5LXY A;  2DEI A;  1FHT A;  2P5V A;  2CQG A;  4WE1 B;  3PY8 A;  2CYY A;  1YZ6 A;  1X0P A;  3AT1 B;  4LF5 F;  1VGY A;  1UZH A;  4X66 F;  3MM5 A;  2RU3 A;  3W2V A;  2KKH A;  3PJW A;  2RAQ A;  4B3R F;  3TAR A;  4IR1 A;  1YHQ S;  1KVJ A;  2NSB A;  2DNG A;  2ZH6 A;  5K8O A;  4QOT A;  3HSG A;  2ADC A;  2B43 A;  2V6A A;  3M6X A;  4DR5 F;  1RIS A;  4DEZ A;  3BEG B;  1PYT A;  3UDV A;  4YY3 F;  2X3D A;  2CQ0 A;  5IC6 B;  3FEX B;  2LU2 A;  1KVI A;  2L3M A;  3MMB B;  2VJU A;  3R6G B;  3HSZ A;  1BQM A;  3AQP A;  2PI5 A;  1DTQ B;  3N79 A;  3UN2 A;  4HYK A;  4DCJ B;  2OFH X;  2F8E X;  2HS0 A;  5CHC B;  2W8L A;  5D15 A;  3A8J A;  1O8B A;  4PQU B;  4ZCL A;  3IAM 9;  4KGV B;  2VA3 A;  2FLO A;  3NAH A;  3UWT A;  1DRZ A;  4PEO A;  4B9L A;  2UUA J;  2DIS A;  2V0N A;  1TKD A;  3TX0 A;  5T14 A;  1RJJ A;  3RR8 A;  2CJA A;  1GXL A;  3MED B;  3T19 A;  3TUZ C;  1SV5 B;  4DR4 F;  4B3S J;  4Y2M A;  1T05 A;  5THW A;  3HVT B;  1RAD B;  4XO0 A;  2VPY B;  2WB4 A;  3ILO A;  2JVO A;  1DHM A;  2ZBC A;  2HEK A;  1FO1 A;  1ULR A;  2E5L F;  4FYV B;  2LQ9 A;  1H73 A;  2CWX A;  4BHQ A;  3DNC A;  2YWW A;  1QAX A;  4CTA B;  2R8G A;  1ZPW X;  2FPH X;  3DKD A;  4ECU A;  1B0P A;  2Y1I A;  3CCS S;  2CPE A;  2HFZ A;  3JSY A;  4NLU A;  4FF2 A;  2PA3 A;  4DQQ A;  3OVB A;  1KS2 A;  3GIL A;  2HHT A;  5A2Q Y;  4ERD A;  4JI1 F;  2MKI A;  4JI2 J;  4EUV A;  5KT7 A;  3OTC A;  4FYY B;  3MAQ A;  1TK5 A;  4F4K A;  5J2P B;  1ELO A;  1RKJ A;  1U4B A;  3TYT A;  5GAH I;  1RU1 A;  1FJG J;  1SL2 A;  3AQO A;  1C1C B;  1Y7P A;  4WZQ A;  3NNC A;  4DF8 A;  2AGQ A;  3TO8 A;  4W92 B;  4J9M A;  1JJC B;  2CZ9 A;  4A8Q A;  2KZM A;  2A6M A;  1RTJ A;  2APO A;  1U45 A;  3E51 A;  1ZET A;  3GIK A;  4K5R A;  3AD9 C;  2CDR B;  3V4M A;  1JLG B;  5AXL A;  2ZOF A;  2HND A;  1FTR A;  4EZ9 A;  2MPU A;  2OMO A;  3BM7 A;  4X2B A;  1UFW A;  3QT5 A;  3H5U A;  4NXM J;  3P49 B;  4FF1 A;  1FFW B;  3KLH A;  3CMQ A;  2F5G A;  3BZQ A;  4ZVG A;  1NH8 A;  2YQ1 A;  2A2D A;  3UD3 P;  4WE1 A;  3CMA S;  5H1S V;  3GSD A;  5JXS A;  3QID A;  1PAU B;  4CH0 S;  2GVZ B;  3T5L A;  4HLB A;  2OTJ S;  4LF4 F;  3C19 A;  2M88 A;  3MUV P;  1KON A;  5JVG Q;  3FQL A;  2CKW A;  2NXJ A;  2XI2 A;  2J0S D;  3D6H B;  4ECV A;  2KYZ A;  2OEJ A;  2V8G A;  4U7U D;  3GJT B;  4YB7 A;  1RT5 B;  1RCX B;  3DRY A;  2QYG A;  1VLO A;  3PNI A;  2W4D A;  5ETN A;  3MMB A;  3PKM A;  2DRD A;  2EC2 A;  1DTQ A;  1HL6 A;  5A8R B;  3CJ4 A;  1VYA A;  3OVS A;  3GFY A;  1VFJ A;  4EBE A;  4YOE A;  3UN5 A;  3HP6 A;  9RUB A;  4ZJO A;  2CXE A;  3DLJ A;  4HHJ A;  3CDA A;  4OFZ A;  1IBL F;  1Q7L B;  4ECS A;  2H4W B;  4DR7 J;  1OPZ A;  3O44 A;  3LTO A;  3X3U A;  2BRK A;  4ECZ A;  1SV5 A;  3JTP A;  2I1R A;  1NK4 A;  3L3C A;  2MJU A;  3CD7 A;  3HVT A;  4EWT A;  2ZJQ Q;  3OJU A;  3IRW P;  1SIW B;  3BPD A;  2B5J B;  5C42 B;  5EWG A;  4EO8 A;  2EFP A;  3WX8 A;  1N54 B;  4OLP A;  4CTA A;  3M8S A;  3F44 A;  1YJV A;  1RA6 A;  2EK6 A;  3CT9 A;  5IT9 Y;  3RR7 A;  2GNK A;  1HPZ B;  3LF0 A;  4DS5 A;  3PIP Q;  1CVJ A;  1HBM B;  5L1L A;  2CJQ A;  3BRE A;  3VWS A;  1X5S A;  2I8E A;  1NK9 A;  2PFF B;  2CQB A;  3TZW A;  5J2P A;  4M5I A;  4PR6 A;  5KFX A;  1HW9 A;  1N36 J;  5DDO C;  1W2I A;  4DSE A;  1X5P A;  4LQ3 A;  2VC1 A;  3M7V A;  4DV3 J;  1O5J A;  1T3O A;  1C1C A;  7AT1 B;  5J1P A;  2KM8 B;  3PYE A;  4LVO P;  5ETP A;  2UXC J;  1XJW B;  4E98 A;  1ZAX A;  1N34 J;  1W25 A;  2V2V A;  4JV5 F;  4C3L A;  3PO5 A;  1TL5 A;  2QE5 A;  1JNR B;  5A6W A;  5K8N A;  2RU9 A;  3N0V A;  1M1G A;  1OY6 A;  4GC6 A;  1IWG A;  4EMD A;  4DR1 J;  3IWX A;  2AYB A;  3CC2 S;  2VJV A;  2V2Z A;  3SSS A;  1H98 A;  1JLG A;  1TL3 B;  5KFJ A;  2GZO A;  3UQS A;  3I9V 9;  5ETL A;  2F4V F;  2CZ4 A;  3S1T A;  2AJ4 A;  4HTJ A;  1U2F A;  2C2E A;  3EVO A;  4OX9 F;  4Y28 C;  2WZ1 A;  3CSK A;  1I94 F;  2OO4 A;  2PEB A;  5CAB A;  2H4Y B;  1EKS A;  1RT2 B;  2GIQ A;  3X1L B;  3V5R A;  1H2U X;  1RBL A;  4CLZ A;  4D3H A;  2W2N P;  4K2X A;  2AF6 A;  1YSJ A;  2GVZ A;  2J8S A;  1KC8 T;  1GFW B;  2JL9 A;  1FD8 A;  2A18 A;  1Q5V A;  2VKZ G;  4DWI A;  2OSR A;  1ZM9 A;  1FRH A;  2BJE A;  3NCQ A;  4OZL A;  3M6V A;  5GAE I;  2BKO A;  1HBN B;  1UJ6 A;  2PI4 A;  2VQF F;  2UUC F;  2E1C A;  4NXN J;  3N6M A;  1RT5 A;  2CAD A;  1WC6 A;  3T9N A;  3DRR B;  3VGS A;  2DHS A;  5A8R A;  2PGC A;  1HR0 F;  1JJH A;  4PXE A;  4EZ6 A;  5CCL A;  3M8W A;  5DQG A;  4O0N A;  1JLE B;  2OH2 A;  3NGS A;  3H42 A;  3MTK A;  4QIE A;  5DO2 A;  1HQE A;  1U2C A;  4OI1 A;  1LKZ A;  4DX6 A;  4KB7 A;  1S5Z A;  3UR3 C;  1FES A;  3R7N B;  1NCL A;  4B08 A;  2ZIT A;  3Q2S C;  4DCP B;  4ZVQ B;  2FC8 A;  2GJI A;  3OTE A;  1RP5 A;  1Y0H A;  4NE9 C;  1S6U A;  3GFZ A;  2B5J A;  1T11 A;  5C42 A;  2DNK A;  3Q24 A;  1UVJ A;  1YBT A;  1RAO A;  3B4M A;  2BR0 A;  2E9T A;  3RU0 A;  3HO1 A;  2LVW A;  2QA1 A;  2IY5 B;  1UW4 A;  4UST A;  4PKD B;  1VJQ A;  1NDP A;  2FZG B;  1HPZ A;  5D77 A;  2N3O A;  2BX6 A;  3HHD A;  4X4Q A;  2UXD J;  3KUG A;  2B7C B;  5KFY A;  1XNQ F;  3QAU A;  3PX6 A;  1NKE A;  3DLE B;  1HBM A;  2ZC3 A;  1HNX F;  4OI0 A;  1QVF R;  3MR5 A;  4C9D A;  2DNQ A;  1SPB P;  1LXN A;  3W65 A;  1B7Y B;  2C42 A;  2ZH7 A;  2CPH A;  4LQ9 A;  2ROE A;  3LUY A;  3KJN B;  3A8I A;  1HNI B;  1WAC A;  1TMJ A;  5L8R C;  2P6T A;  2LYV A;  4TN2 A;  3QGI A;  3ZZR A;  4W98 A;  3O2I A;  4U6P A;  4EI2 A;  2XTJ P;  2M7S A;  2X1B A;  3I4H X;  4CT8 A;  1NSQ A;  3Q8U A;  3CIZ A;  2BM1 A;  3D7S B;  2MQP A;  1TL3 A;  2X7I A;  5KG0 A;  4CRJ A;  3NLC A;  1RT7 A;  1NPR A;  3KDN A;  1YJT A;  4IH7 A;  3J7Z 5;  3RYL A;  2AX1 A;  5HO4 A;  3W3S A;  7FDR A;  3CCE S;  3A1Y G;  2B8Q A;  4DV2 F;  1SXL A;  1RT2 A;  1S99 A;  3CJR A;  3FDS A;  4B9V A;  2E7X A;  3IP0 A;  4FS2 A;  1PO6 A;  1WKK A;  4L3N A;  2ALY B;  1IJF B;  3G86 A;  5LSL A;  1RCO B;  4ED5 A;  3FNN A;  4PAA A;  1HBN A;  3DM2 B;  1G3O A;  4IQM A;  3BF4 A;  1X4F A;  2HNY B;  2GVD B;  2BBE A;  4Z7Y A;  1RHM B;  4KV8 B;  1YKW A;  3DRR A;  2E5I A;  3RUB L;  1JLE A;  2IVF B;  1U7L A;  3PR4 A;  4ANE A;  3KMS A;  3PRB A;  5KT6 A;  4NYZ A;  2M5Y A;  1VQP S;  1FA0 A;  4B3T J;  2BUN A;  2HWH A;  3B78 A;  3H4D A;  1GEH A;  3G8S A;  4I56 A;  1PJ7 A;  1SKS A;  3RB3 A;  4OYW A;  1FXD A;  2J9D A;  3FK4 A;  2CAJ A;  2LXI A;  2QSF A;  3K58 A;  4IOA Q;  2IDL A;  2M8D B;  1MRO B;  2GGP B;  3RBZ A;  2G2Y A;  3WDO A;  3TA0 A;  4M1K A;  3PW5 A;  4KGZ B;  3JSR A;  2QEX S;  1MU2 B;  1JLF A;  2UU9 F;  2W9C B;  3T1A A;  4P72 A;  4R8U B;  4I2Q B;  3NWR A;  2RJZ A;  1DQ8 A;  4DFM A;  2E7W A;  1VR6 A;  3CJ0 A;  2C28 A;  3DFE A;  3LAL A;  3BGF A;  2E9R X;  4HKQ A;  2MZ1 A;  1D9A A;  2ASD A;  2AEF A;  3I0R B;  3V4I B;  1RWW B;  3DLE A;  3R5D A;  3GV7 B;  4ZN1 A;  4ICL B;  2FIU A;  2ZH5 A;  4ZP9 A;  3IGV A;  3OFH A;  1XNR J;  4DQP A;  3MEE B;  2HHW A;  2FC9 A;  2OD4 A;  3MOJ B;  3DRX A;  4KT0 C;  4URG A;  1F2H A;  4C7Q A;  4U7C A;  2J7W A;  1MMN A;  1HNI A;  3D6F B;  1RBO B;  3SFU A;  1JJ2 R;  2FVS A;  3VAJ A;  2JC1 A;  2CJ9 A;  1A0O B;  1Q1K A;  3LPE A;  2J9C A;  1YI2 S;  1R89 A;  1QTN B;  1U6F A;  1PBU A;  2Z58 B;  4DV4 F;  3I82 A;  1ZM2 A;  2M8H A;  4LR7 A;  4F3Q A;  4FXW A;  2KDO A;  4TY8 B;  3ICL A;  2OEL A;  4DOZ A;  5EGY A;  2DPJ A;  2JEG A;  4OI3 A;  1AB8 A;  3D5M A;  3LWL A;  5E5N A;  4Q8F A;  3M32 B;  2YPY A;  3DLK B;  4DV7 F;  3EGW B;  3L7O A;  4MK8 A;  2AT1 B;  2BYC A;  1PCA A;  4UQT A;  2IYI A;  4WFA Q;  2HGL A;  3CO9 A;  5LJ5 Y;  1HFE L;  4I7F B;  5LXR A;  1QSS A;  3CNQ P;  3NAI A;  4J7C A;  2CPZ A;  4DMZ A;  1R8B A;  2CJY B;  4H4O B;  1TAU A;  3R7S B;  2OPQ B;  2C2N A;  2JLE A;  3TX8 A;  5GAG I;  2M0G B;  1KVK A;  2PFD A;  2PO4 A;  2HZC A;  2AP6 A;  2QTW A;  1K0T A;  4TU8 A;  1UCN A;  4N8N A;  3DM2 A;  2LEB A;  2ASL A;  1WC5 A;  1MSW D;  1L3V A;  4DDF A;  1RQ0 A;  5CH7 B;  2DR5 A;  3IGN A;  2HNY A;  3A3O B;  3I6P A;  7FD1 A;  2GVD A;  2GV1 A;  4IRC A;  3H98 A;  3H5S A;  4KV8 A;  1GXU A;  4URQ U;  5HQL A;  4LR9 A;  1TUW A;  3W1Y C;  4KJI A;  2YX4 A;  2ZJR Q;  3MHY A;  2JEF A;  2YY3 A;  3SBM A;  5G0R B;  1SJR A;  1RLC L;  2HFS A;  4YHH J;  3CVK A;  3IMQ J;  4F4Z A;  3OQ2 A;  1R6Y A;  2DVI A;  1R0A B;  5CD4 H;  4Y65 A;  1V9O A;  4A8M P;  1RT1 B;  4FPI A;  4QCL A;  2C2Z B;  3FFI B;  1MRO A;  4HVZ A;  1PJ6 A;  2GGP A;  2VBY A;  4ZIT A;  2O01 C;  5LMN J;  1OYE A;  2K06 A;  3N5F A;  1Z2L A;  1MU2 A;  3HI9 A;  2W9C A;  4I2Q A;  4M5M A;  2Y8Y A;  4DL3 A;  5A2Q U;  4M5L A;  4B3O B;  2FTR A;  3JAM Y;  3J80 Y;  1F3V A;  4LFA J;  3I0R A;  3V4I A;  4LF1 A;  2F40 A;  2CG4 A;  3JSB A;  1WTB A;  3QRQ A;  4ICL A;  2E1R A;  4CNZ A;  4ZLN A;  5L9X A;  3DHW C;  4CI0 B;  4ED0 A;  1R8P A;  3MEE A;  3HFZ B;  4HAC B;  1T9X A;  4IG0 B;  3IM8 A;  4JI5 F;  3WZ0 A;  2IMW P;  3UCZ P;  1V3S A;  3BB5 A;  4PWD B;  5D4P A;  3GB0 A;  4PYD A;  2HRU A;  1GX6 A;  2KN4 A;  5L9N A;  2EVZ A;  2R4F A;  2QN6 B;  2EBE A;  3GIJ A;  4BCA A;  1NBE B;  1IKV B;  2B9X A;  3OV7 A;  1RHQ B;  2W2M P;  4JOU A;  2OD6 A;  4QJV A;  4YME A;  1C4A A;  4TY8 A;  3W7B A;  3TA1 A;  4ATN A;  2E5H A;  2D9O A;  5GME A;  2B9E A;  4FYD A;  1F2G A;  3BH7 B;  1AXQ A;  2ACM A;  2V2K A;  3MZI A;  4Z2X A;  1S9E B;  3M32 A;  3DLK A;  3SCK E;  3TVZ A;  1NJZ A;  4NLT A;  3OR2 B;  2HWI A;  4M94 A;  2V4R A;  4UOG A;  2GMJ A;  4I7F A;  1BC6 A;  4RW8 B;  2V67 A;  2EFV A;  2OPQ A;  3ZTO A;  5HVH A;  1BQN B;  3WHI A;  5ETK A;  2CNO B;  4CP5 A;  3BQ2 A;  2HMI B;  4ZPV R;  4KGK A;  4WFB Q;  3MPV A;  2MZS A;  4BS2 A;  1XC9 A;  3DOL B;  1B0T A;  1YJW S;  1SI9 A;  2ZUG A;  3VVT A;  3M05 A;  1PYO B;  3UW1 A;  1UJ4 A;  4UTG A;  3GMG A;  3HT0 A;  2U2F A;  3I56 S;  2CA9 A;  5DDQ C;  1RI7 A;  4JI3 J;  1HNZ J;  4QPT A;  2ZM6 J;  3ENV A;  5KFF A;  1UWA A;  4P74 A;  3W66 A;  4RUA A;  4I4B A;  1NHU A;  2RS2 A;  4WK3 A;  2KHC A;  2XBP A;  2QA4 G;  1T8E A;  2AWZ A;  1DZ5 A;  4IOB A;  5G0R A;  4NL5 A;  3R3T A;  5SUH A;  2MZQ A;  1R7I A;  5KFC A;  1R0A A;  2IRY A;  5E7O B;  3HT3 A;  1RT1 A;  3T1Y J;  2J9E A;  4R0J A;  2A3J A;  2V8V A;  4X62 J;  3FFI A;  3RB0 A;  1RKI A;  4J9O A;  1IBM F;  2XHW A;  5IT9 U;  1S77 D;  4Y6I A;  2CJB A;  5K5M A;  3GFH A;  3QFW A;  4WZM A;  3ONQ A;  4NX9 A;  2VV5 A;  3BSN A;  1Y10 A;  3R5J B;  1SL0 A;  1TAQ A;  5I3P A;  1YK9 A;  2IJN A;  4JYA F;  1SC1 B;  2GMH A;  2QFI A;  3NCR A;  2AGO A;  4YR3 A;  3UCU P;  4WYW A;  2VA2 A;  3SQG B;  4J91 A;  1JXE A;  2QLJ B;  2JEJ A;  3P8B B;  1SIZ A;  1XR5 A;  3H8Y A;  2BQR A;  1UA1 A;  4ETX A;  2VF3 A;  4DL5 A;  4K4V A;  4I1T A;  1L3T A;  2GHP A;  4HAC A;  1KP6 A;  1U0H B;  4CLP A;  4KBI A;  1YBU A;  2MHN A;  4PWD A;  1ZOT A;  3S01 A;  1RTD B;  3GON A;  4USM A;  4DV5 J;  4LF8 F;  3SV4 A;  4UY8 5;  5LOQ A;  2QZ8 A;  3W8P A;  1R0B G;  4ER8 A;  4ZP7 A;  4JV2 A;  1KQF B;  1IKV A;  1RUS A;  5IC4 B;  2CPF A;  2VH7 A;  3G96 A;  4U8Y A;  1VQ8 S;  4PG4 A;  3R6L B;  4USH A;  1TP7 A;  5KT4 A;  3EZU A;  3QT6 A;  1SVD A;  3A12 A;  2ZBR A;  3T1H F;  2XS5 A;  2ILZ A;  2C2M B;  4XAK A;  1S9E A;  4LRD A;  1HI0 P;  4MKY A;  2ZH4 A;  2VL1 A;  2VIC A;  4MH8 A;  3FQK A;  1A7G E;  4LIW A;  3OR2 A;  1U02 A;  3PHE A;  4C8K A;  4ZJL A;  1Q16 B;  1T02 A;  3DOM B;  2ZZM A;  4IO9 Q;  4C11 B;  3VAL A;  1IBK J;  4O4G B;  3FVY A;  4EK2 A;  1D8Y A;  4Y0F A;  1H38 A;  1VBK A;  3HZG A;  3RBD A;  1HYS B;  4RW8 A;  4DPT A;  4G1Q B;  2HNZ B;  2MEW A;  3GTY X;  1BQN A;  4WIQ A;  2HMI A;  3GPA A;  4HT7 A;  3EVM A;  2XMK A;  3A13 A;  3MUM P;  4WII A;  3DOL A;  4KFB B;  1IR0 A;  2PMW A;  3NP5 A;  3BGU A;  2YWG A;  2WON B;  2J9D E;  4JV0 A;  1RWM B;  3FRZ A;  3H59 A;  4DUY F;  3CCM S;  4DR3 J;  1XEZ A;  3M8R A;  1U0S A;  4P9S A;  3VAM A;  3TAN A;  3NOC A;  2PE8 A;  1S4F A;  3UI3 A;  1FXL A;  2CQP A;  5I3U A;  1CEZ A;  4I6W A;  2RB7 A;  1N5T A;  4W90 B;  1R31 A;  4DU7 A;  3FZB A;  2F63 A;  1QDU B;  1U1M A;  2QSW A;  4A8Y A;  3DRP B;  2YPZ A;  3KK1 B;  2IHR 1;  2KXH A;  4FBU A;  2KH9 A;  2DIU A;  2ZKU A;  1N6Q B;  1KLN A;  5BR8 J;  2RS8 A;  1YQH A;  4ZJQ A;  4WPA A;  2QT7 A;  2B4P A;  3EDR B;  3KK2 B;  1IWA A;  4DG1 B;  5C5J A;  3FC9 A;  2VPW B;  4XPC A;  2HK2 A;  3G2X A;  3G6X A;  5DG7 A;  1TL4 A;  5KFD A;  4LF5 J;  1PJ5 A;  2K7J A;  3D54 A;  3P96 A;  2C1E B;  1KFS A;  2HFN A;  4PG8 A;  4FF4 A;  2XG8 A;  3A3P B;  1QAY A;  1S6P B;  4X65 F;  1LWC A;  3IC1 A;  2IFX A;  1IR1 A;  2NZC A;  4DCO B;  3MMA B;  4RNN A;  1LFP A;  1U0H A;  3W5Z A;  2QV6 A;  1XMQ F;  2A10 A;  1FFS B;  2ZE2 B;  3PVX A;  1RTD A;  3BYP A;  4ZP6 A;  2BQ3 A;  2HHV A;  1VJW A;  5A6P A;  2JSX A;  1QY7 A;  4I2P B;  8AT1 B;  2EFO A;  1ZAV A;  1V3R A;  4UZC A;  4O4R A;  4F4Y A;  4MAK A;  2FHM A;  3KWM A;  5H9E J;  1FRJ A;  3QGH A;  4RBV A;  3M9N B;  3DDI A;  5B0G A;  3K5N A;  2XMM A;  4GKK J;  2QC3 A;  2HFV A;  1XR7 A;  3PG9 A;  4G65 A;  4DX5 A;  4QWA A;  2VPZ B;  4P2X A;  3DGV A;  5GMD A;  3DOM A;  4LIR A;  4C11 A;  4O4G A;  4UOH A;  1MWQ A;  1BWV A;  2KFN A;  2DNH A;  3CTR A;  1HYS A;  4NEZ A;  4G1Q A;  1WF1 A;  2EG1 A;  2HNZ A;  3R1H A;  1GNK A;  3BPS P;  3R97 A;  3B54 A;  1NLK L;  2AZ3 A;  3LW5 C;  1N48 A;  1N52 B;  2CQ4 A;  1S7I A;  1UPM B;  2E66 A;  2AGP A;  2RUG A;  4KFB A;  3ISN C;  4KH1 B;  5D3G B;  3CW2 C;  2WON A;  2R9L A;  1LWE B;  2FUG 9;  3T6B A;  2I2Y A;  1MN7 A;  4CCH A;  2CUY A;  1KSP A;  3LP0 B;  4ZPA A;  3VGU A;  5J2M A;  2BMB A;  1LWF B;  1YWX A;  4U96 A;  3QMQ A;  3SXL A;  2DGT A;  5F0W A;  2AX0 A;  3MR3 A;  2LMI A;  2HGM A;  3G71 S;  4ED4 A;  2K3I A;  2RIL A;  3JQJ A;  5HQM A;  5M2U A;  5C2G A;  2ERR A;  3AXM A;  1N56 A;  2ZNY A;  3ET6 B;  2HZA A;  1U6Z A;  2E29 A;  4GKJ F;  4XDD A;  2UXB J;  1ITP A;  4DHV A;  2W7P A;  3HX9 A;  3DRP A;  3KK1 A;  2XY5 A;  2IM3 A;  2BJD A;  3LQV A;  3MD1 A;  1GTH A;  1N6Q A;  1HW8 A;  2DNO A;  5E2Q A;  2XS2 A;  1WHV A;  3P45 B;  3KK2 A;  4M95 A;  2DRB A;  2RRB A;  3HHK A;  4MIA A;  5AT1 B;  3CME S;  1CUL A;  1TR0 A;  2ZD1 B;  3RBX A;  3H2L A;  3HCX A;  3RZA A;  3QWU A;  1QLN A;  4DV6 F;  1NRK A;  5ETS A;  1H2T Z;  2Z2Y B;  2UUT A;  4A47 A;  1AYE A;  1D09 B;  3T5J A;  4WFY A;  1S6P A;  3J7A N;  1QAI A;  1RYR A;  5CCM A;  1AFI A;  1FWP A;  3MMA A;  2ILY A;  2RML A;  2HHX A;  2X3G A;  5CD4 A;  2ZE2 A;  2AEJ A;  4CLK A;  2ZDP A;  2DRA A;  1BY9 A;  4AFF A;  1S10 A;  2FLN A;  5KFE A;  3LOU A;  4JI7 J;  5A8W B;  3UR0 A;  2RHS B;  4I2P A;  3FCH A;  4E2F B;  2YX1 A;  2P9E A;  1NZ8 A;  4MKB A;  4WFZ A;  4JI4 F;  3SQO P;  2G0C A;  1ZAW A;  1WG4 A;  3D9B A;  4A8W A;  1R0C B;  2JRS A;  1IBL J;  3CC4 S;  1PKU A;  5DS7 A;  5E3P A;  1X4G A;  4DLG A;  1FJ7 A;  1J5E J;  1H6K X;  5DQI A;  4NI2 B;  1F60 B;  4ED3 A;  4ELU A;  3NMA A;  4C2M A;  4OZN A;  3FJ2 A;  4Y2A A;  1FDN A;  3NGT A;  1ZPV A;  3MEG B;  3G87 A;  3QGP A;  3FEY B;  1S57 A;  4KHP F;  4WP3 A;  4K4Y A;  1UP1 A;  4ZA1 A;  4YN3 B;  3JTO A;  4KHM A;  4I67 A;  2XCA A;  2H1Y A;  4WXW A;  2XSJ B;  4MYT A;  2F7V A;  1SJ3 P;  4ZCI A;  2UUB F;  1I6J A;  3EZO A;  3E3X A;  1KN6 A;  5C7P A;  5D3G A;  2FVP A;  1LWE A;  3QPI A;  1MW7 A;  1YDL A;  3LP0 A;  5B0D A;  2YWH A;  2YBV A;  1U6B A;  4PAB A;  1LWF A;  4CLY A;  5E3C A;  2NSC A;  4ECQ A;  4F67 A;  1VDH A;  2IBO A;  2Y0S D;  5HBM B;  1T9Y A;  4IFV A;  5EX3 A;  4C3M A;  3POT B;  1EZZ B;  4U67 Q;  5AE1 A;  3Q8R B;  5H9E K;  3ET6 A;  3KG1 A;  4J90 A;  4HEA 9;  4OMF G;  5IWA J;  3E2E A;  3BO2 A;  4DR2 F;  3HFV A;  3AXK A;  3BYR A;  3CDB A;  1Q78 A;  1SC6 A;  3PJX A;  3PHT A;  2HG4 A;  3JAM U;  3J80 U;  4P71 A;  1NM2 A;  3H20 A;  4KQZ A;  3TZX A;  1HI1 A;  2YKN B;  1YJ7 A;  1C1B B;  4FXV A;  3MMC B;  5JMN A;  2CPI A;  1SL1 A;  1SC3 B;  1QUP A;  5KFA A;  5LJ3 Y;  5IQQ A;  1FI4 A;  1YG0 A;  3ILJ A;  3BKT A;  2W9A A;  3PX4 A;  1TK0 A;  4C97 A;  2GJF A;  4RLE A;  1P9Q C;  1WEL A;  2BM0 A;  4RKU C;  3ZZZ A;  2R7Q A;  1UEU A;  2LDI A;  4JBC A;  4KKO B;  2HHH J;  4A48 A;  1TKT B;  1FRX A;  3RG6 A;  4RNM A;  2UUA F;  5F41 A;  5A8W A;  2P8I A;  2W9B B;  1A9N B;  2IAJ B;  4DFJ A;  3PEJ A;  2O1P A;  1HWI A;  4OHZ A;  1SBR A;  1WG5 A;  3UO0 A;  3IBC B;  4B3S F;  3NEK A;  2KL8 A;  4MK9 A;  2B56 A;  3G4S S;  1NZA A;  3CCZ A;  3DXS X;  4YB6 A;  2DY9 A;  2KU7 A;  3BQ1 A;  4QW9 A;  3M8Z A;  3Q8P B;  1F5C A;  2DHA A;  3IFE A;  5J1E B;  2HYI B;  4NI2 A;  5IV3 A;  1FKP B;  2OHD A;  4NA3 A;  3I5B A;  3VAI A;  3UDE A;  2J0W A;  3MEG A;  3ENW A;  3QO9 B;  3ENQ A;  1WC1 A;  4A8O A;  4DL0 C;  4PG7 A;  2IJR A;  2KXN B;  1M5K C;  1VIO A;  1QAJ A;  4JI2 F;  3EZ5 A;  1HI8 A;  2R2R A;  4URS A;  2XSJ A;  1S7H A;  2B4O A;  1IM4 A;  4NLQ A;  1RSC A;  1CQM A;  2FHO B;  4ZVS B;  2C3U A;  3NBP A;  1RWX B;  3HUL A;  2V63 A;  3BV8 A;  4HDG A;  1FJG F;  3AOB A;  4C98 A;  4WU3 A;  3E01 B;  1Y5I B;  3DLL Q;  1U49 A;  3HSJ A;  4ZCK A;  3VAF A;  4OZ1 A;  3HVW A;  4YQW A;  1FK9 B;  1OSC A;  4EO6 A;  5HBM A;  2JJ4 D;  3OFF A;  3POT A;  4QIV A;  4NLX A;  3KJF B;  4L74 A;  2DGU A;  4ED6 A;  1QSY A;  3OFE A;  3C8Y A;  1D3W A;  4NXM F;  5IOL A;  1JLB A;  2DGO A;  4C6A A;  4JI0 J;  4G1P A;  2E44 A;  5CYJ A;  2AHO B;  4F36 A;  4KC5 A;  2NUU G;  1P6T A;  4MIB A;  3LAK A;  2GHV C;  5U47 A;  4DUZ J;  3NS5 A;  3PW4 A;  2BQU A;  2YKN A;  1C1B A;  4WP8 A;  2RUS A;  2BV3 A;  1URR A;  3MMC A;  4LFB J;  4C3K A;  2C2D A;  4IO1 A;  1F3F A;  3M1V B;  3N5B A;  4DV2 J;  4RW6 B;  2R2U A;  2HFO A;  1G2E A;  1REV B;  3CJ5 A;  1TKZ B;  2N82 B;  2X51 A;  3G8T A;  2XWX A;  3P6Y C;  3Q8S B;  3OL8 A;  2Z0G A;  2IIH A;  3D1O A;  2Z4P A;  4ZIV A;  3QLH B;  4RWW A;  3FBB A;  1PIL A;  4NML A;  4BLG A;  3TVK A;  4J37 A;  3EE3 A;  1S79 A;  2HQ3 A;  3KTQ A;  2CFX A;  4MK7 A;  4KKO A;  2HSE B;  2HHS A;  5D78 A;  4OYA A;  5ITH A;  3UNG C;  3GWC A;  2N7Y A;  3BSO A;  3ENA A;  2MZT A;  3SCI E;  4P7T A;  2RQK A;  2QMU B;  4LT6 A;  2W9B A;  2IAJ A;  5AXK A;  4DQS A;  4DR7 F;  1RBA A;  3S6E A;  2WVD A;  1YRX A;  1X5O A;  2RDI A;  3KHG A;  5D0R A;  2JLF A;  1JK9 B;  3ZTQ A;  1T9T A;  1W2B R;  3HMJ G;  1PIE A;  1LV5 A;  3GYN A;  1M5P C;  4NLD A;  4KAI A;  4OZ2 A;  2HRY A;  4FBT A;  2XS7 A;  3O8W A;  4X4P A;  4H54 A;  3GJS B;  5J1E A;  5GAD U;  2RVJ A;  4FNH A;  1FKP A;  4KYZ A;  1YJU A;  4LSZ B;  2DO4 A;  1X4A A;  2LP4 A;  1JKH B;  1FRM A;  2XGP A;  3QO9 A;  5HMY A;  5CZX A;  1UEV A;  4OZ3 A;  3AOC A;  3P5B P;  2VON A;  1KOO A;  4TQS A;  3OW2 R;  2AYM A;  2QGF B;  1OQ3 A;  3P5T L;  4M5N A;  2EC0 A;  5FDL B;  5KFG A;  3TUI C;  1TV6 B;  1G4C A;  5T7L B;  4BWM A;  1VQ9 S;  5BJR A;  1N36 F;  3MCO A;  3MFI A;  3IM9 A;  4ETZ A;  4DV3 F;  1NK6 A;  2G13 A;  5DLF A;  3E01 A;  1VQY A;  4LVN P;  2G1D A;  2GCF A;  1SQE A;  2UXC F;  1U1Q A;  3MR7 A;  2MKH A;  4MTP A;  1N34 F;  1TMM A;  4F8R A;  5HRO B;  3N6N A;  5ETQ A;  2DHH A;  1TL7 B;  1FK9 A;  2EK1 A;  2HBZ B;  5B08 A;  1Q7Y T;  5IM0 B;  4DR1 F;  4NOH A;  3G9C A;  1B7F A;  2XMT A;  1XR6 A;  5FD1 A;  1WKJ A;  3PXG a;  2YH1 A;  5DDP C;  3JSM B;  3DU6 A;  4NLP A;  2W01 A;  4KSE B;  4OZ5 A;  1GH8 A;  1APS A;  5CYQ B;  5JUM A;  4ECR A;  2ZVS A;  1TFW A;  3VZH A;  4E0D A;  3TZY A;  1WEX A;  4IYQ A;  4C4W A;  4DPO A;  4HL9 A;  4DL2 A;  3B4D A;  1K9M T;  1KDN A;  1NND A;  3M1V A;  1EHW A;  3L4B C;  1Q8B A;  4RW6 A;  5EWE A;  3F73 A;  1REV A;  2PA8 D;  2QLX A;  4OJG A;  1TKZ A;  3KUH A;  1RHR B;  2L08 A;  4NXN F;  2DXF A;  1UFL A;  4GO5 X;  2E1M C;  2R7V A;  2VC0 A;  2DO0 A;  4N76 A;  3JB9 k;  3J81 j;  3DI6 B;  4IUF A;  3V6H A;  4F02 A;  4TU7 A;  1S1T B;  1WWH A;  3QAT A;  3QLH A;  2GQQ A;  2PDA A;  2XC9 A;  1XTZ A;  1X4B A;  2YNF B;  4F0K A;  3BGL A;  2V8D A;  1LW2 B;  3EUN A;  4ZVR B;  2JNJ A;  1G7C B;  2OPR A;  4CO4 A;  4EYI B;  5LSO A;  3CD5 A;  3EDQ B;  4OIX A;  5F9L A;  1CJV B;  1SCJ B;  3FBE A;  3FBF A;  2RRN A;  1RWN B;  4NZ0 A;  4QYR A;  2LLZ A;  1NAQ A;  4ZMM A;  2NXC A;  3ILL A;  2W7A A;  2MHE A;  1IKY B;  3K89 A;  1D9D A;  1XK8 A;  3TP2 A;  1X0F A;  3C3L A;  4DPX A;  4K4T A;  4UUX A;  2QMX A;  2VU5 A;  4K7Q A;  2WVB A;  3CO0 P;  2MSS A;  1RHK B;  1VRU B;  4KPC A;  2CRL A;  3A8E A;  5D0G A;  1N33 J;  4UOC A;  1JKH A;  2YVS A;  4J9P A;  5MAO A;  4AUK A;  2UXD F;  2JZ5 A;  5LSR A;  2NUH A;  2ZVI A;  2CNN B;  1PG5 B;  1FT8 A;  2HHP A;  1P9Y A;  3W60 A;  5FDL A;  1TV6 A;  2IRU A;  1YZ7 A;  2DY1 A;  3KDO A;  1B0V A;  1SH0 A;  4OZJ A;  4DPY A;  2C2R A;  1XER A;  2IMO A;  3AJ1 A;  1X4H A;  3QSI A;  4Y2K A;  2GFF A;  3BO4 A;  4P7V A;  2V94 A;  4OYM A;  5HRO A;  1QJH A;  1TL7 A;  3GJR B;  4OYZ A;  2ZNZ A;  4OYB A;  4Y34 A;  2XO6 A;  4ZPT R;  4PPD A;  1VMB A;  2L41 A;  5IM0 A;  1KNZ A;  4BC7 A;  4WWS A;  5IS2 A;  4N41 A;  1BQX A;  4ILL A;  3BDE A;  3QT7 A;  1N5S A;  4XK8 C;  2IPO B;  5CZV A;  1K8A T;  2DIT A;  1XN9 A;  3JSM A;  2ZBQ A;  3DRS A;  4KPY A;  1BHN A;  2HRT A;  1C2P A;  2F3J A;  1TTH B;  3PDN A;  5CA5 A;  1X31 C;  5CYQ A;  2V9K A;  3BBB A;  1WF0 A;  4OJ3 A;  4WFN Q;  3H25 A;  4L73 A;  4F0H A;  4RZR A;  3PKY A;  1F5A A;  3R5G A;  4FYX B;  3IG1 B;  4YEA A;  1AA1 B;  2ZH3 A;  1RT4 B;  3DN9 A;  2P9G A;  4QR2 A;  1T9V A;  4V19 X;  2IJF A;  5IT4 A;  5AXM A;  5HAO A;  1HHQ A;  2FVC A;  4BBY A;  1ACM B;  1MLA A;  1H72 C;  3CJT A;  1VC0 A;  1F1B B;  1WTF A;  1B4S A;  1UL3 A;  3P4U B;  4M5J A;  5K14 B;  3DI6 A;  4ED1 A;  1S1T A;  1ROF A;  4DPW A;  2CVI A;  1FJC A;  3MPU B;  4JV1 A;  2VUG A;  3MGJ A;  3T3F A;  2GIF A;  1LW2 A;  1FEE A;  2EXU A;  1JB0 C;  1HMV B;  1U1L A;  4DUT A;  1I3O B;  2YWK A;  1S9F A;  2IRX A;  2KI2 A;  4OX8 A;  4KY3 A;  3FMB A;  1R8A A;  1WNE A;  2BKP A;  2E1P A;  1CJV A;  1S49 A;  1U8W A;  3ISN D;  3PO4 A;  5EHH A;  1JWW A;  5HP1 B;  2FZC B;  4NA2 A;  1VOM A;  1HLW A;  1B99 A;  5D4N A;  3SIP B;  4FVM A;  3W62 A;  1IKY A;  2JH3 A;  4TKT A;  1CPZ A;  2IDE A;  4X4O A;  2AJ1 A;  1MNE A;  1VRQ C;  1C0T B;  1IN0 A;  2XY6 A;  3PM9 A;  1WEZ A;  3NGR A;  3PV8 A;  3J81 Y;  2VQE F;  2L9W A;  1TZ0 A;  1VRU A;  2DBB A;  2J8A A;  3CCR S;  3THP A;  2MLZ A;  3H90 A;  3WBZ A;  1NSP A;  1VIS A;  2CPX A;  5HQ8 A;  2XNQ A;  1YGY A;  2OEK A;  2ZBI A;  2HQI A;  4F2R A;  4PQU A;  1B64 A;  4F25 A;  3MOZ A;  2VG5 B;  2NQP A;  2LQJ A;  5LMU J;  1NJI T;  5F8M A;  1E6Y B;  3OL9 A;  1XNR F;  2GAG C;  1EX8 A;  4DQR A;  3PYF A;  1UA0 A;  3CE8 A;  3MED A;  1X8D A;  4NYP A;  1NKC A;  4ZPC A;  1BWE A;  3SFG A;  2VBZ A;  4B9M A;  8RUC A;  3CCW A;  2WW4 A;  4OI2 A;  3VHQ A;  4PPZ A;  1FXR A;  2ASY A;  1HBU B;  4R25 A;  4LF8 J;  2HQF A;  4HT5 A;  3CJ8 A;  4TYA A;  1SKU B;  3VQT A;  3OR1 B;  3TRG A;  4QWC A;  1UVI A;  2K3K A;  1KQS R;  2N4D A;  1RT3 B;  4ZVO B;  4Q45 A;  5KG2 A;  4DV0 F;  3I31 A;  4EFA C;  5B0F A;  1Q82 T;  2LQ5 A;  5C24 B;  3T5K A;  2MKY A;  4Z7C A;  4Y3C A;  4J9R A;  1KQG B;  4IRD A;  2HUR A;  4C48 A;  3T1H J;  1YJR A;  4GVL A;  3ZZY A;  3IG1 A;  5GAH U;  2QG9 B;  3DGP B;  3HHL B;  1RT4 A;  2W24 A;  4TYB A;  3Q23 A;  1R8H A;  2ZZT A;  4O3O A;  5ADZ A;  3KHL A;  1G6B A;  3GP9 A;  1RAB B;  4CM0 A;  4L72 B;  3ZXW A;  4RU2 A;  2GIR A;  3OLA A;  1OO0 B;  2CQ3 A;  3QFH A;  4OYO A;  3FSX A;  1Y3K A;  5K14 A;  5T41 A;  2FVR A;  1RAI B;  3QJL A;  4K4Z A;  3MEC B;  1NUE A;  3M6W A;  3MUT P;  4X4S A;  3RTV A;  1HMV A;  2LA4 A;  1BE4 A;  2FGC A;  3EXC X;  1YTY A;  2LA6 A;  3O1L A;  4CO5 A;  1U47 A;  2FJV A;  3H5X A;  5HP1 A;  4K4S A;  4YHH F;  2P9C A;  3TZZ A;  3MCS A;  2I38 A;  3DDN A;  3ELH A;  4USW A;  1ZM3 A;  2R7W A;  2H48 B;  1C0T A;  3D0H E;  1Q79 A;  3MR2 A;  4AT1 B;  5LMN F;  1S6O A;  2HPU A;  4Z37 A;  3AA8 A;  4LFC J;  5KFH A;  1VI7 A;  3PW7 A;  2O5D A;  2MDA A;  2KXF A;  4ANC A;  2BJ7 A;  2W4P A;  3GII A;  2R8J A;  2X1F A;  2CVE A;  2ZWO A;  4ENO A;  3C16 B;  1VQN S;  2JFK A;  4LFA F;  4WP9 A;  2IA6 A;  2ZH2 A;  2VG5 A;  3H4B A;  1DQ9 A;  1SUQ B;  5IXU A;  1E6Y A;  2AYE A;  1Q95 G;  3R1L A;  4BC9 A;  2WOM B;  5EUH A;  3TAQ A;  3MD3 A;  4RNF A;  1Q8L A;  5IV4 A;  3U02 A;  1ZTW A;  2DEJ A;  4O3R A;  1D9F A;  5FLX Y;  1P27 B;  2NXU A;  3D6M B;  5K8M A;  2Z57 B;  3C2P A;  3GCW P;  4B3M J;  2J6U A;  2H5E A;  4FNI A;  5A8K B;  4ZVT B;  3CCJ S;  4N77 A;  2PN6 A;  1HBU A;  2XMJ A;  4QYZ J;  2FJE B;  1KD1 T;  3GG1 A;  4QIF A;  3UVJ B;  3OR1 A;  3N9U C;  1RT3 A;  1UVK A;  3OHB A;  4DLE A;  1TQL A;  1RAH B;  3Q22 A;  2O67 A;  4HR2 A;  4AND A;  5C24 A;  2HVD A;  4Y2C A;  4F04 B;  5KFT A;  4C8O A;  3I87 A;  1GXT A;  4RBT A;  1NDC A;  1XQI A;  2MZR A;  1QUV A;  4A8S A;  3HHL A;  3DGP A;  2DGW A;  4XDC A;  2VFU A;  2VAS A;  4X64 J;  4DSK A;  2IBK A;  2LEA A;  1CQN A;  4LF9 J;  3EPI A;  1Y9O A;  3TAP A;  2ZH1 A;  2BA9 A;  2M52 A;  1Q81 T;  3W8G A;  3K59 A;  2QX0 A;  1AZS B;  3UE2 A;  2RT3 A;  1JQG A;  4YDD B;  3IN5 A;  2A0F B;  3P3D A;  2FYX A;  2UVW A;  3MEC A;  3KYL A;  4YR2 A;  3CCQ S;  1U1O A;  2EEY A;  2V9W A;  2CJX B;  4JI3 F;  1GTE A;  1HNZ F;  2ZM6 F;  3GFX A;  4DV1 J;  1D8Z A;  1Q53 A;  4ITS A;  3LWM A;  2R8K A;  1WDT A;  2HIQ A;  4YFU A;  1JXL A;  4KE5 A;  3DYA B;  2KYX A;  5KTQ A;  4GC7 A;  1B70 B;  3R2D J;  1LK5 A;  3JTN A;  3TA2 A;  3UD4 P;  1BMQ B;  2JWN A;  3M8Q B;  3T1Y F;  1VQ6 S;  2J5A A;  4AL6 A;  3PW2 A;  2MLY A;  3KLG B;  3ZO7 A;  4X62 F;  1WOS A;  2CNL B;  1GK8 A;  1BGX T;  5GAE U;  1KBR A;  2AV5 A;  2IM0 A;  1P1L A;  3Q8Q B;  2R42 A;  3DOK B;  3UFC X;  3MPD A;  1HWJ A;  2X1G A;  3T5H A;  2K8G A;  3I5C A;  3IS9 B;  2OAU A;  3QWP A;  2WHO A;  4LUB A;  1CJK B;  2IYG A;  4Y2I A;  3Q8Y A;  1M90 T;  3C16 A;  3EYZ A;  5KT5 A;  2B51 A;  4A8F A;  4YDX A;  1FVS A;  3R5C A;  1ZS6 A;  4LMZ A;  1H3D A;  4F4X A;  2DPI A;  3W64 A;  1JMT A;  3JXO A;  4OL8 A;  1SUQ A;  3WIV A;  3HHE A;  5AXN A;  4DR6 J;  1PC4 A;  5I4M A;  2BJ8 A;  5ETM A;  2G1H A;  3MPW A;  2V68 A;  2WOM A;  1SKW A;  4QU7 A;  2R7U A;  2YKA A;  1A6L A;  3FBC A;  3IWN C;  4FPR A;  4USV A;  1CJU B;  4DV5 F;  2MKS A;  3LP2 B;  1LOU A;  2YQ0 A;  1EKR A;  1NME B;  5F8L A;  2CNK B;  5A8K A;  4JI6 J;  3SEO A;  1DTT B;  4O44 B;  2HKE A;  2CPY A;  1S4E A;  3TEG A;  2HW3 A;  2FZK B;  4CLL A;  2ALZ A;  4B02 A;  2K7K A;  3UVJ A;  4MIW A;  2WSE C;  2KT5 A;  1OIA A;  2W1B A;  2Q79 A;  3BKU A;  3PW0 A;  3BN7 A;  4F4W A;  5KFS A;  3KLV A;  3K0J A;  1NDK A;  1T03 B;  2BE7 D;  2QL7 B;  4K2J A;  1OYD A;  1NO8 A;  4ED2 A;  2I6W A;  2DH8 A;  4DL7 A;  3GQC A;  4F26 A;  2OKQ A;  3THV A;  2RE1 A;  4EBC A;  5IQ6 A;  4U7U K;  1HNW J;  1O51 A;  4UOF A;  2DGX A;  4AXJ A;  3D28 A;  1RHJ B;  2KZZ A;  3OTB A;  2HLT A;  2XMV A;  2CPD A;  1AZS A;  4RUC A;  2VFT A;  3NS7 B;  3DLG B;  3A8K A;  4QBU A;  2LQ8 A;  1FVQ A;  3K5M A;  3W61 A;  2B9W A;  2VHG A;  4UF4 A;  5HN0 A;  2FGO A;  2GJ2 A;  4DR3 F;  5KFP A;  2V8H A;  1DBD A;  5E0O A;  3HXM A;  2Z30 B;  4RL1 A;  2XZD B;  4B9T A;  1X4C A;  2DCL A;  5DM7 Q;  2KO1 A;  5JJB A;  3LH2 S;  2XB2 D;  1GT8 A;  1FKA F;  4OJH A;  3DYA A;  3GIM A;  4QYZ K;  1RTI B;  4YR0 A;  4PRF A;  2JX2 A;  3K8W A;  4PQA A;  1RYS A;  1SJQ A;  1WG1 A;  4DSL A;  1X9W A;  3M8Q A;  1IXK A;  2OTL S;  3W9H A;  4NZ6 A;  2WBR A;  2YX7 A;  2GX8 A;  1YJN S;  3KLG A;  2VDH A;  1OY8 A;  5BR8 F;  1QVG R;  4PYA A;  2NRE A;  4V19 J;  4N56 A;  2OI2 A;  3DOK A;  3ZZP A;  4CH7 A;  5KFO A;  4LF7 F;  3IS9 A;  2MGZ B;  1QSL A;  1ZA1 B;  3V81 B;  3AB4 B;  3ULH A;  2CPJ A;  4I0W A;  4RUH A;  1CJK A;  2BVZ A;  4RUB A;  5F8H A;  2DH7 A;  5KOX A;  1S72 S;  4FDF A;  4RW9 B;  5HAN A;  3SZ2 A;  4RWX A;  5F3T A;  4IR9 A;  1VBX A;  2G2O A;  2Y1L B;  5KFN A;  3OSN A;  3PEH A;  5D0E A;  3GZ7 A;  2XM3 A;  4CNY A;  3M8Y A;  4LF6 J;  3CJQ A;  1JNZ B;  3VCD A;  2AW0 A;  2PII A;  2AMC B;  5KFQ A;  1C0U B;  1FDB A;  2XY7 A;  2LXU A;  1X4E A;  1XMB A;  4ED8 A;  1CJU A;  2ZUA A;  3LP2 A;  1WOR A;  3HHL D;  4R0E A;  2XMU A;  5HVG A;  1IKW B;  3SV3 A;  3R27 A;  5AJ3 J;  2FJW A;  3JYT B;  3BDP A;  5E41 A;  2WVF A;  2B4V A;  2FDN A;  1DTT A;  4O44 A;  4TXS A;  1S1V B;  4R8U A;  2PMH A;  5M2R A;  3EXY A;  3K2Y A;  5ETO A;  2N3L A;  4DZD A;  5ETT A;  3CPW R;  4GKK F;  4FF3 A;  4N8O A;  5KT3 A;  4K4X A;  2Q6B A;  2RNE A;  3TW0 A;  3CXC R;  2CZV C;  1K1Q A;  2NPF A;  1V5I B;  1SJF A;  4QWB A;  4PXD A;  4F4A A;  2Y1R I;  1T03 A;  5DQH A;  3QT8 A;  3HF5 A;  2QMW A;  4NCG B;  4AQY J;  4L3K A;  2VOO A;  8ATC B;  1T0T V;  2C2O B;  1U1N A;  3CDU A;  3QRP A;  3D0I E;  2LFV A;  3OVA A;  3GG0 A;  2GS8 A;  3LGH A;  5EWF A;  1B3T A;  1F0X A;  1EAR A;  4ZPB A;  3MEK A;  1H2V Z;  3D4J A;  2NPI A;  3OPK A;  2HS3 A;  5KG5 A;  3N6L A;  3CCU S;  1WSV A;  4YB1 P;  4TLR A;  2OPS B;  4IH5 A;  2GO8 A;  3V6J A;  3DLG A;  5AE3 A;  4A4J A;  2NXE A;  4GRS A;  3K57 A;  2DYA A;  2CQH A;  1XMO J;  3OHA A;  4WXO A;  1O0P A;  3NWG A;  4BDP A;  2VBX A;  4N47 A;  3HJV A;  3VAH A;  4CDI A;  4P73 A;  1RTI A;  1IUJ A;  4CYU B;  2M4M A;  2MTL A;  1SB6 A;  4Q5V A;  2UXB F;  4LRB A;  4H4O A;  3J81 U;  1VQK S;  2FLP A;  1FFG B;  5HAT A;  3SSQ A;  3GJQ B;  1Y5N B;  1NEE A;  4ZVP B;  4LSN B;  4P2M A;  5GAG U;  1SKR A;  3ITH B;  3GR0 A;  3EWG A;  3U7J A;  3QSY B;  3RAX A;  1GMV A;  2MKJ A;  2GML A;  2D1C A;  3E8O A;  4HHH A;  4OX6 A;  1LW0 B;  3H7H B;  2MGZ A;  3V81 A;  2KT2 A;  3MCM A;  3OTO F;  2Z56 B;  2MQ8 A;  3EGN A;  4P10 A;  3ZC4 A;  2XLI A;  2HVI A;  1N8R T;  2BJ1 A;  2ZEJ A;  4CH1 A;  1JXV A;  4RW9 A;  1K0V A;  5HVF A;  2MMY A;  1JIH A;  3LGM A;  2MJN A;  1FF2 A;  3M6U A;  1FDA A;  2VG6 B;  2H3E B;  4G3I A;  2QFJ A;  1UKU A;  4QPX A;  9ATC B;  1C0U A;  1X9M A;  2JOQ A;  2PT0 A;  3BJY A;  3MAH A;  4F50 A;  2EFN A;  2VOP A;  3EGZ A;  1HKA A;  4PWW A;  1D0E A;  5LT5 A;  1IKW A;  4AYB D;  3I55 S;  1N32 F;  2FB0 A;  2DNZ A;  4JI7 F;  3S8S A;  4E8U A;  3JYT A;  4GO7 X;  2XCP A;  1EJ7 L;  2H5I B;  2OEM A;  5KFK A;  2HQC A;  1S1V A;  3HKZ D;  4QIW D;  1HWU A;  4B3O A;  1IBC B;  2VDI A;  4C8Y A;  2J6T A;  1HQE B;  2MY7 A;  3DCA A;  1VC5 A;  4ILR A;  5IT0 A;  4G6V B;  4K0K J;  5HK4 A;  1NJY A;  3QJJ A;  3RB6 A;  4HI2 A;  1J5E F;  5KFL A;  2XLK A;  1IJE B;  1XWL A;  1NH7 A;  1URN A;  4X4N A;  5HI7 A;  2F9D A;  4NCG A;  5IFM A;  1IKX B;  5CQG A;  1VBY A;  4IG0 A;  2EKY A;  1E6V B;  1O6X A;  4CT9 A;  5HSP A;  1DY3 A;  4P2S A;  3UCG A;  1S9G B;  1QE1 B;  2Y3Y A;  4J5O A;  5B7W A;  1F9F A;  1OQ6 A;  2HLU A;  1YRU A;  4CM2 A;  2DJW A;  3U27 A;  2YNI B;  4ZVE A;  3OFG A;  3J7A 1;  2CQD A;  3D0G E;  1NSA A;  2OPS A;  2Q1L A;  3ISZ A;  4GMK A;  4CLW A;  1N5Y B;  3J7Y I;  3W5Y A;  2H9Z A;  2AJF E;  3LO3 A;  5CYM B;  4RBU A;  3MI7 X;  2RD5 C;  1U25 A;  2ZOM A;  3NNA A;  3FRY A;  1BXN A;  5B09 A;  3TI0 A;  4CLF A;  5KG3 A;  2YWF A;  2EFQ A;  4CYU A;  2OIH A;  4TLQ A;  3RW7 A;  2MKC A;  1F6T A;  5IWA F;  2D3O R;  1VQS A;  2QLW A;  4LSN A;  2IM1 A;  2EKN A;  3ITH A;  2D3U A;  1GMW A;  4JP8 A;  4U9R A;  1UVL A;  4DN0 A;  5E33 A;  3D3B J;  5HMW A;  1OJ4 A;  3M2V B;  3VVU A;  1RT7 B;  1RZM A;  4M5D B;  1LW0 A;  2N7C A;  5BXI A;  4C8L A;  5KFB A;  4ZPW R;  1U1K A;  2AZ1 A;  1EP4 B;  5HJY A;  4JI8 J;  1MWZ A;  3K17 A;  3CCV S;  4RJV A;  4O0I A;  2CJK A;  1SH2 A;  5DZ6 A;  4EEY A;  1PGZ A;  4HHU A;  3FSY A;  5FLX U;  2KT3 A;  2VG6 A;  2HQD A;  3AOD A;  5GMK a;  1VCT A;  4A8X A;  4WKR A;  2O3D A;  2OPP B;  2OJ3 A;  2J0X A;  1YBA A;  4DU8 A;  2HHH F;  4LBH A;  3TEH B;  4ZVH A;  1MMD A;  3CIM A;  3CWJ A;  3GYG A;  4KIA A;  1KEK A;  1IM6 A;  1UMJ A;  2NXN A;  2XQC A;  3I32 A;  3MM9 B;  3Q8V A;  2W2P P;  3HKW A;  3BR8 A;  4CQ1 A;  2LQB A;  3MUR P;  1YX2 A;  2L9N A;  2Y9H A;  4ES3 A;  5CAA A;  2B6A B;  4Q2M A;  3SQG A;  1VIX A;  4X66 J;  3IR5 B; 
#chains in the Genus database with same CATH homology
 2W2O P;  2XTJ P;  3A3N B;  2Z2Z A;  2Z58 B;  1V5I B;  3VHQ A;  2E1P A;  3A3P B;  1R6V A;  3T41 A;  3WIU A;  3WIV A;  3AFG A;  2Z30 B;  1SCJ B;  2ZWO A;  2W2M P;  4NMX A;  3SQO P;  2W2N P;  3CNQ P;  2Z57 B;  3BPS P;  4YN3 B;  2PMW A;  3GCW P;  4K8R A;  4NE9 C;  3QFH A;  2W2Q P;  3BGO P;  1ITP A;  2W2P P;  2ZWP A;  3WHI A;  1SPB P;  3A3O B;  2Z2Y B;  3VV2 B;  3CO0 P;  2QTW A;  3P5B P;  3H42 A;  4JP8 A;  4OV6 A;  3GCX P;  2Z56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...