3A3OB

Crystal structure of complex between sa-subtilisin and tk-propeptide with deletion of the five c-terminal residues
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
TIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Identification of the interactions critical for propeptide-catalyzed folding of Tk-subtilisin
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2009-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3a3oB00
3GCXP 2ZWOA 1V5IB 4OV6A 4YN3B 3T41A 2ZWPA 3SQOP 1R6VA 2Z2YB 2Z58B 3A3NB 4NMXA 3GCWP 2W2MP 3WHIA 1SPBP 3CO0P 2Z56B 2QTWA 3BGOP 2PMWA 2Z2ZA 3WIVA 2W2PP 2XTJP 2W2QP 3QFHA 2E1PA 3AFGA 3CNQP 3BPSP 1ITPA 3A3PB 2Z57B 1SCJB 3P5BP 4JP8A 2W2OP 3VHQA 4K8RA 3H42A 3WIUA 3A3OB 3VV2B 2W2NP 4NE9C 2Z30B
chains in the Genus database with same CATH superfamily
3R2DJ 1GNKA 3DFEA 1TKZA 2GZOA 4CDIA 4B3TJ 2PI5A 1EP4A 2J6UA 1KVIA 3ZXWA 4ZOSA 1MWZA 2VQEJ 2DRBA 4Q0BA 3HSZA 1SI9A 2KYXA 2UUTA 3WHIA 5KFQA 1N5TA 3VALA 2BJEA 1NU4A 2X1GA 4WKRA 4M5DA 3KNGA 4KYZA 4U8VA 4UT4A 5F9LA 2U2FA 1SH3A 5DO2A 4DV1F 5IT4A 2IYIA 2AKWB 3CW2C 4DS4A 3V4IB 2D1CA 1XIQA 1IWGA 1QUPA 4WFXA 1X4GA 2K1RB 5K8PA 1FVSA 4WU3A 3M8QA 2A10A 3T1HJ 3DRYA 2CJYB 1BQMA 4ECVA 5C25A 3BO4A 4B08A 4ZVEA 2COLA 3MXHP 2AV5A 3DLJA 2HMIA 2NYIA 3K89A 1WEYA 5J2PA 4OHWA 2A6MA 4C8OA 2P6SA 2R7SA 3DXSX 1HNIA 2O01C 2CPHA 4DV3J 2HQFA 1U2FA 1ZM3A 3J7YU 2HZCA 3H4DA 2GHPA 1G2EA 1JLCA 3KK3B 3DOLA 5K20B 4JI1J 1GXUA 3BQ2A 2DNYA 4NLXA 2OO4A 4K4WA 2FC8A 1M5PC 4ZP9A 1S99A 5J2QB 2CPZA 4K59A 4RW6B 4LBPA 1VOMA 1L3TA 2UXDJ 3TQ1A 4HKQA 4ZVGA 5KT4A 3ZTRA 4DV5F 1ZZFA 3NP5A 3HPOA 5JJBA 4NCGA 2NS1B 3V4MA 3BGLA 4WTYA 1JLQA 4WP3A 4OZJA 4KJIA 3WZ0A 1YBAA 4OI0A 2AT1B 2HEKA 2VBZA 4ANDA 3O44A 5ETTA 4EFAC 3FZ2A 1GXTA 3LOUA 1XR7A 1S6PA 1H0HB 3LP0A 2DRAA 3TR5A 3FGVA 2N4CA 4DR4F 3KLIA 4Q45A 3KG0A 3HULA 1H2UX 2UVUA 3HKZD 4UF4A 4I69A 4X4NA 1CJUA 1RZMA 1FTRA 2D3OR 3P5BP 2XWXA 3TAMA 2CPJA 3NGKA 1X5SA 3K0JA 4LF9F 1PYOB 1H6KX 3HKWA 4URSA 1RSCA 3A8KA 1UKUA 4NLGA 4JV0A 5B0AA 2MGZB 1ULRA 1HNZJ 3K5MA 2BBEA 4WTOB 3IMQJ 1JLGB 2HHHF 4L74A 3K2YA 3MURP 1MWYA 2Z4PA 5LSOA 4DR7F 3UCGA 1UZHA 3GFZA 3TRGA 4LR7A 1FESA 4Y2MA 3QJPA 5KFHA 1LKZA 2LFVA 4P6QA 4LMZA 1X7VA 4B9NA 4ZS6A 2Z2ZA 2FJBB 1YJUA 3J81j 1PILA 3OLBA 2OP5A 4OHZA 1FO1A 4DPXA 3C3LA 1TL3B 2ACYA 3UR3C 5AXKA 1HI1A 1U25A 2ZWPA 2B43A 3ENVA 1JMTA 1X0PA 2WONB 2ROEA 3GV7B 2XHWA 3FMBA 2FJWA 2JHEA 1EETA 3GYNA 5M2UA 1XK8A 1F5CA 1C0TA 1JB0C 3ILJA 2RQMA 3A8IA 4OI2A 4ZVFA 2XMVA 4K2XA 3AQOA 3PV8A 2XB2D 1BHNA 1B3TA 4WKYA 3SCLE 1YJNS 2XMKA 3SQGB 4JI5F 2YH1A 2HBQB 2HNDB 4A8XA 2DGWA 3VAMA 4EBEA 2OI2A 1FRIA 1AZSB 1WOPA 3RB3A 4H4MB 3M8YA 4P75A 4U7UK 1CQNA 2D9OA 3DRSB 2BQ3A 1FD2A 5HQMA 2KVQE 1IWAA 4YEAA 2W8LA 5GVQA 4RPFA 2Y1IA 4USVA 4HACA 4ZVSB 1N33J 4DWIA 1S79A 1B4SA 4DUTA 3FRZA 1J5EJ 2MKIA 1ZAVA 5F3TA 1ZPWX 5LSRA 1HNWJ 2QMXA 1HHQA 2XY5A 2F4FA 5E33A 5KOWA 4X66J 4V1Ak 2BJ8A 2ZM6F 2HNYA 3M7VA 4NLSA 4XPEA 2IM1A 5HQLA 6FDRA 2MEWA 4TYAA 1JQGA 5IM0A 4B17A 1DHMA 2RJZA 1FE0A 1S1XB 3M2UB 4ICLB 3LGHA 4F2RA 2E7WA 2BOPA 4RLEA 4YHHJ 1KQGB 5C2GA 2XYPB 3R1HA 5K5MA 2FLOA 2PA3A 4MK8A 3T5HA 3CJKA 4I0WA 1C1BA 1RAEB 3EVOA 5KT6A 5LMUF 2DEJA 3T6JA 4DN9A 1HNVB 1W26A 3N9UC 1QLNA 2N3OA 3BGOP 1BD6A 2N7CA 2DNHA 3KHGA 2X1BA 2HLUA 3SSQA 1AUSL 1LXNA 3PACA 2AIRB 1OS5A 1WORA 1DLOA 3J7YI 3T5JA 3CC7S 2O5DA 4RUBA 3M30A 1ZZNA 3KK1B 2BVZA 4QW9A 5KFEA 2MJNA 2VG6A 3HX9A 5FDLB 3FSYA 3FK4A 3UN5A 1SL2A 5J1PA 4OIXA 1APSA 1NK0A 3KNAA 5ETOA 5HP1A 1IKXB 4RBUA 1U09A 1TKXA 3GR0A 4C7QA 3CDAA 5F3ZA 3RBEA 4J9VA 5B7WA 2ZC4A 1F3FA 4PQUB 4ED2A 2B5JA 3Q86A 1WC6A 4RUHA 3VGSA 2DYAA 4OV1A 1NB2A 5T14A 4OHYA 4CO1A 1MWQA 3CJ4A 2B8QA 5B0CA 3EICA 3QFHA 2KFYA 4R0JA 3HO1A 2LA4A 2IJRA 4J9MA 3MGJA 2R2RA 4C11A 2AGQA 2OIHA 4TN2A 2EFQA 4RNFA 2C2RA 1CS4B 4R25A 1C2PA 1FERA 2YX4A 3GB0A 2RH3A 4DU7A 1SL0A 2QO3A 4TU8A 3A8JA 3SYZA 1Q8LA 1WC4A 4QR2A 4NZ6A 1UEKA 2Y3YA 3FZBA 3I0RB 4GKJF 1UVKA 1LNQA 4U6PA 1LK5A 4DL7A 4FXWA 5CHCB 3WC0A 2F9JA 5A2QY 4USWA 2ZKTA 4GRSA 1TL7A 3N6LA 1RBAA 5KFBA 2H51B 3C19A 4MJKA 2CPEA 5GADU 5HBMB 1N0VC 2H5IB 3RUBL 2DXEA 4O4GA 4JI6J 4PWWA 2YNGA 3NXZA 1XMQF 1S9GB 3G9CA 1YITS 2JVOA 5C24A 4NLRA 3S01A 3DU6A 1UEVA 5M2RA 3D2WA 3AD7C 4IG0A 1FX4A 4TQSA 4NCAA 1PBAA 1PG5B 4RBTA 1J2VA 1WJ9A 3M1VA 2EPIA 1FFSB 2NLWA 4YB6A 5D4PA 2HSEB 1T03B 4ZN1A 5IC6B 2XULA 1FXRA 1TP7A 3J81U 2DR7A 1WDTA 4RU2A 1NPPA 2HURA 1HQEB 1M5KC 1WF0A 2R7VA 3D66A 4KSEB 4ECWA 1I5OB 4F0HA 4MIWA 4K2JA 1GTEA 2AJ2A 2NREA 2FQQB 4PG4A 1WHWA 1JLAA 5EGYA 1RAHB 3ZZPA 2ZH9A 2B6AB 3CWJA 1EB0A 2XSJB 2XHCA 1XERA 4Y65A 1OSCA 3Q83A 2E44A 1S12A 2LA6A 3VAJA 3U1MA 3CULA 1NAQA 3UPFA 2O1PA 4MKBA 7FDRA 2A2CA 4G1QB 4NXMF 2B56A 2NSBA 4ZLLA 2E1AA 4PR6A 3OLAA 2F7VA 3WIUA 1IKYB 2DHGA 5IZHA 1KVKA 1HLWA 2A0FB 3D6HB 4F4YA 4IQXA 3BGFA 1S49A 3GJSB 3OSNA 4X64J 2C2NA 3NCPA 2IVFB 1X5OA 2G0CA 1YK9A 1NSKL 1BGXT 1YSJA 2DNQA 2YVSA 2VG5A 2KDOA 3A4TA 3DLLQ 4JI4J 3IRXA 3EZOA 4QWDA 3GPAA 2WBMA 2YNHB 1T9TA 4JV5J 3JSBA 4TXSA 1ZBTA 1NHKL 3QJLA 2J9DA 2KFZA 4ED7A 5CYQB 2H4YB 1Y9OA 3BDEA 5DDOC 4M5NA 5IS2A 4K4YA 2UXCJ 3MM9A 1WSVA 2ZC3A 5K14A 1RTDB 1S10A 2AX1A 4M5HA 1L3UA 1S6QB 3OXFA 2OUGA 3QRRA 1WTBA 1Y10A 1GT8A 1HPZB 5ETMA 4I1TA 4ZIWA 1NDPA 1Y11A 3MPYA 1Q86T 3RZAA 1I94J 3S1TA 2J5AA 1VISA 3G82B 3UD5A 1NBEB 2OAUA 3R97A 1X4DA 2C2MB 2PD1A 1N6QB 3NMAA 4C8LA 3CD0A 4BWJA 4ZITA 4LFAF 3BR9A 2VA2A 4C8ZA 5A2QU 1IQZA 1W2IA 3OVAA 2BXJA 3C66A 3MCSA 2DNLA 3JB9k 3C46A 1WWHA 4Y00A 3HK2A 2LQ8A 1FJGJ 1FDBA 2X3DA 3SDEB 3W2WA 1EAYC 3OXGA 2KFNA 3CJ5A 1F5AA 3OUYB 3TW0A 4ELUA 3HHKA 2ZKUA 2YY3A 2PMZD 2ZBPA 1J5OA 3EX7B 4YR2A 4FVCA 2MKYA 1WG4A 4FNIA 2W9BA 4MMOA 3UDVA 3ZC4A 1F9HA 3CD7A 4GC7A 3DGPA 3QZ8A 3R5JB 4RWXA 2DNZA 1S1UB 4W90B 1N56A 3QO9A 2VU5A 4AT1B 3M8PA 1FK9B 3OT9A 4DX6A 2IM3A 3DLKA 1IKVB 1YJ9S 4DHVA 1X4EA 2HHUA 1S59A 5LMNJ 5KG5A 4TLQA 3IM9A 2LKZA 2C2KB 4USJC 2A3JA 2CPDA 1UVMA 3RAMA 2OSRA 2IBKA 2QT7A 2PSZA 2AU0A 5A76A 2WBRA 2QN6B 1UEUA 3NGUA 4OYMA 1V3RA 1FJ7A 1RT3B 3ENAA 5DZ7A 4CO4A 1U6BA 4CH0S 5GADI 2DH7A 2HZVA 2NPFA 3UDLA 5AXLA 1N52B 1AW0A 4KGKA 4DQPA 3GIKA 2GA7A 1KRPA 4ETXA 1RAOA 2GQ2A 4AD6A 1IBMF 4X62J 4YS2A 4F04B 3QSIA 2RHSB 1L3VA 3MPWA 1ZH5A 3LGMA 4H54A 4I6WA 1H2TZ 4PPZA 4O0IA 4ERDA 2MKSA 1WELA 3CCES 2R8IA 1N54B 4YY3F 3M8WA 1AFJA 5HMWA 1GTHA 2VFSA 2ZZTA 4E2FB 3TVKA 2V4JB 3A3NB 4C3MA 1JLFA 1PIEA 2JEJA 4OZLA 4ZN3A 2GO8A 1HBUB 3T9ZA 4U7UD 2MSTA 3BGRA 3I5AA 5DGBA 4UW2A 4B9UA 3GYXB 4D3GA 3QJJA 1E6YA 1S9FA 2GGPB 1TVRA 5LL6d 1VQPS 2J0QD 3V6DB 4ZPWR 4F0KA 4NCBA 1WACA 2H4WB 4Y0FA 1RHRB 2DB1A 4Z37A 1CJVB 1H73A 3AT1B 3HFKA 4DPWA 4CLPA 1PJ6A 3LPYA 4HT7A 5E41A 3ILIA 2KT5A 1XJWB 2ZBIA 1HBNB 4U7CA 2VKZG 4UY8T 5KG4A 2XSFA 2YXLA 4DUZF 2C2EA 2ZBCA 4YUDA 3IG1B 4A46A 2XLJA 2CNKB 4N7TA 2ZH8A 3OL7A 4FF3A 1T11A 5I3PA 4J9OA 2HWHA 3PX4A 4N41A 3GSDA 4Q7AA 3WX8A 4DSLA 4AL6A 2M8DB 1CJTB 4XAKA 5EHHA 1XNRF 3MR5A 4WZMA 1UVNA 1RKIA 2R7WA 1WG5A 3MHYA 5L9NA 3FMWA 5B0DA 2CJKA 3MF5A 3CCUS 1KP6A 3RYLA 1RAJA 2CNOB 2HKEA 4DV7J 2BR0A 1JJ2R 2UV8G 4J9QA 1IJFB 1HR0J 4CI0B 1P1TA 1HWUA 1YJVA 4RW8B 2YQ0A 5H9FK 3KLVA 4WP8A 2VDHA 3GV8B 2K3IA 1R8BA 3NWRA 3HHNB 1S97A 4PWDB 1YKWA 1T9WA 2LYVA 3U27A 5A0YB 2BKOA 3EVWA 3VZHA 1L3SA 4P2SA 3PJXA 1MN9A 3VZIA 3X3UA 1X4BA 3MM6B 5IFMA 1RTHB 1X60A 1S0OA 1NXIA 2ASYA 3VVUA 2RKIA 2F40A 2P8IA 3K57A 3V4IA 2VBXA 2LCWA 4FYDA 2K1RA 5AJ3J 4F25A 3NAHA 1M5HA 2ZE2B 4XO0A 3D6FB 4JUZA 3L9ZA 1Y0HA 4ALZA 4YB1P 4NRUA 1T0TV 2J9CA 4NLYA 4E98A 3TZZA 3PKYA 3MECA 3G6XA 2UU9J 3GG0A 2MYFA 2R7TA 2HYIB 4RW7B 4WXWA 3TQEA 2RQKA 3MOZA 4JI8J 4OZ3A 3IP0A 3KK3A 2BW2A 3MEEA 4QWBA 2JLEA 2OPPA 1N5VA 4NLPA 2KJVA 3IGVA 3DLBA 3GG1A 3OW2R 4ZLJA 1DQAA 3SBMA 5G4DA 4RW6A 2XZWA 5EWFA 4LQ9A 3VVTA 2UUAJ 2HVHA 3BBFA 4QCLA 3W2VA 1C1CA 5J1NA 3LPEA 4IUFA 2V94A 3KMQA 2XS5A 1KTQA 2DBBA 2V34A 3PFOA 2JEIA 2DY9A 3IWLA 4I67A 2E1RA 4CLWA 2V63A 3A8EA 1JKHA 4LRAA 1T05A 3HHLB 3IS9A 3I5BA 3QWUA 2UUCJ 4C8KA 2VC0A 1NRKA 2ZVSA 3B82A 3DLGA 3R9LA 1V3ZA 4HR2A 1YG0A 5HVHA 1U2RA 3BV8A 2FYXA 2APOA 3J80Y 3R27A 1R27B 3K5NA 4DX8H 3VGUA 3NRBA 1Z4UA 3PW2A 1UTAA 1JLGA 4LREA 4CH1A 4CQ1A 4DCOB 4ZHRB 1Q8KA 3D67A 4DEZA 2BRKA 2XNQA 3UO0A 3GJQB 5F0UA 3M8RA 4N77A 4OI4A 4DL2A 4J90A 3H5SA 2VFTA 1RWMB 4ECUA 2BOAA 4R5PB 4IYQA 5L8RC 5CXTA 1Q5VA 2HHPA 4ZCLA 1U48A 1EP4B 4UQGA 1DBDA 3TEGA 4U67Q 2GVDA 4ES1A 1KWMA 3PCOB 4Q0BB 4NLOA 3OJUA 3GILA 2MMYA 2BZ2A 1XNQF 2KRBA 1D1UA 2XWYA 2EWHA 1ACMB 1YJTA 2PT0A 5HANA 3CJ3A 1GMVA 2MLYA 2FIUA 2V69A 5G0RB 2L9WA 2QYGA 4FS2A 2VFRA 3GLJA 5EWEA 3I9ZA 2QA4G 3M8QB 2DITA 4M5KA 3SQGA 2MZRA 1RHQB 1BQMB 8AT1B 1RWNB 4X84A 2ZBRA 5C25B 2B7BB 1SC4B 4PXDA 2VJVA 2DGQA 3H42A 3D0GE 2GQQA 4CNYA 2HMIB 5KFSA 5J2PB 4H4MA 1HNIB 1HD1A 4FPIA 4OYBA 4K4XA 4QYZK 3VR1A 4LBHA 3WC2A 5CD4A 2V0NA 3DOLB 2DNPA 1J27A 4UUXA 4OX9J 2GCFA 3GQCA 2R7QA 4J9NA 1WI8A 4NEYA 4QR0A 5RUBA 4LSNB 5HMXA 3OL8A 3IR7B 1M0SA 1AYEA 4Y2AA 5HVGA 2LP4A 1SKUB 1PO6A 4OZ0A 4YB7A 3BSOA 5BR8F 4PZVA 4ID8A 2E5HA 4DSEA 2FJDB 2XLIA 4RW4A 4KHRA 3H98A 4OX7A 2QJ3A 2QSWA 4YMEA 2FDNA 3HHLD 1P27B 2WW4A 1S6PB 4HT5A 2G0IA 4FXDA 2OEKA 1XQIA 5KFJA 3LP0B 3M2UA 4PAAA 2EKYA 3KLIB 3M9NB 3PO5A 1VC0A 1R0CB 1DAXA 1CJUB 1X4FA 2WVDA 3NMRA 1IUJA 5DRKA 2ZJQQ 2UVVA 1VS3A 2B9XA 3TAMB 1JJ4A 2R8KA 1HNVA 1PC5A 4L73A 3Q8YA 4KRWA 1W2BR 2R9LA 2IDEA 3J80U 3EDRB 4DX7A 3QT5A 3D1HA 3HD1A 3V6JA 4YN3B 5H9FJ 2W2PP 2CFXA 4RWWA 1LWFA 4MAKA 1NK8A 4KPCA 1O6XA 1R8AA 4HL9A 4IFYA 1FT8A 1HL6A 3QGIA 3CJQA 2QZ8A 3PXGa 2C3UA 5MLCV 3I82A 3ZTOA 3G71S 3K59A 3P49B 1FKAF 3BKTA 5AE1A 5F8LA 5BYRA 2AZ3A 2ATLA 5F41A 4USUA 2LQBA 1IKXA 2W2MP 1WKJA 5MAOA 4CLTA 1B70B 2X51A 1DQ8A 4L75A 5CQGA 2WSFC 2O66A 3W7BA 2Z0GA 1S57A 4QIVA 2DHAA 2K3KA 3NNAA 3WQPA 1VYAA 1UJ4A 2RU3A 2OPQA 3ZZYA 2KKHA 3UCUP 3BGUA 2CQHA 2J0SD 3R5AA 2XQCA 3AB4B 4DR3J 4KGZB 1PAEX 3ZZUA 2CPXA 1U6ZA 1X4HA 1VJQA 3IR6B 1C0TB 4JI0J 4ZVHA 3KOAA 1N34F 3UD4P 1DFDA 3KG4A 3S6EA 1VQYA 4NLVA 4LR9A 4JI7F 1K44A 1Q8IA 2HVDA 2R7UA 3Q8VA 1TUVA 3NS6A 3NBPA 1CS4A 1UMJA 4JI3J 2MY7A 4MIAA 2CG4A 3NWGA 1XBWA 4I2QB 2BJDA 1X5PA 3MR6A 4J9PA 3QMQA 3DNCA 3KKFA 1RB0A 1RCXB 3OTEA 3FFIB 4NLDA 3BBBA 2F3JA 5D3GA 1NSQA 3H0PA 4OV6A 4KIAA 2CZ4A 2CQ1A 4LVNP 3HHDA 4HACB 1TAUA 3EZUA 1ZM2A 2ASLA 3C6UB 2GIQA 1HWLA 4ZJOA 1REVA 2A18A 4LSLA 4Y2IA 4KV8A 5KFDA 1YJ7A 1S9GA 4LUBA 5KG3A 4F26A 2V5HG 2HNYB 1NB7A 3KLFB 4FBTA 3IR5B 1HWKA 5IM0B 1XMOJ 4A8MP 5AT1B 5K8MA 2KO1A 4RNNA 4B9LA 3SFGA 4F2SA 2FHKA 1KSPA 1NSAA 2MKKA 2YWGA 3VGTA 4Y2KA 3CJKB 5KFFA 2VICA 1C1BB 2I1RA 4M5JA 3LQVA 3ZFVA 2FZKB 2GJIA 5A8RB 4NZ7A 3FBEA 1IJEB 3AD8C 2HG4A 3MR2A 4QU7A 2BJ3A 2CJ9A 1HKAA 2EEYA 3WBZA 3MM7A 1TK8A 1EKSA 4IDKB 4DPYA 5THWA 5E5NA 3DC2A 2XZTB 1N32J 2ZJRQ 1LWEB 3JTNA 1NJXA 1ZOTA 2CPYA 3KJQB 3M30B 1HIYA 3RB0A 2CDRB 2XSJA 3PYDA 2E9ZA 2VG6B 2CRLA 4P72A 4AUKA 4HYKA 3PKMA 3QT7A 3LP2B 5DJBA 3RR7A 1K0VA 3VF0B 2HWIA 2OELA 4AE5A 4ED8A 5HP1B 1NKBA 1VQOS 3BSAA 3KUHA 4JI8F 2V50A 3QAUA 2XEXA 3FEYB 4FPRA 2V4RA 4FYXB 4QWAA 3TO8A 3OR2A 1DJ0A 4ECXA 1X5TA 2JC0A 1PAUB 4PUOB 2B5JB 4LR8A 1FDNA 3PHTA 4DFJA 2ZNZA 1N36F 3HVWA 1GMWA 2C2DA 1RT5A 3G6ES 3CGIA 1HYSA 4LF5J 4C11B 2OEMA 2JRSA 3MTKA 4DV4F 1LEOA 3TX0A 3D7SB 1TQLA 1RP5A 2VQFF 4ED0A 3B4DA 2J6SA 3PEHA 3PEJA 5SUHA 3FEXB 4K4TA 1ZA2B 1BLUA 4NOHA 2C2ZB 4N5SA 5HAOA 1YX2A 4C4WA 2EK1A 2LLZA 2E7VA 2JX2A 2FUG9 1SXLA 1NLKL 1NPKA 2VBWA 4G65A 3UVJA 4F67A 3RB6A 4LIWA 3VAHA 1KHVA 4AXIA 3UI3A 4XDDA 1HD0A 2OPSA 1TL7B 4ED5A 4B3SF 2XMAA 3MI7X 4O4GB 2F4VF 2HQIA 2RUGA 2F8MA 5B0GA 2LQ5A 1N5QA 2CZVC 3U02A 2EFOA 2X1FA 2KT2A 4C48A 2YPZA 2QLBB 4I7FA 3IWXA 1BMQB 2Y1JA 2ZH7A 5FJ4A 4QBUA 3LO3A 3T1AA 3M1VB 4GKKJ 2L48A 3EE3A 3O2IA 3NGDA 3NL0A 3CCSS 4DXLA 2K8GA 2H5JB 4F3MA 4J9LA 3U1NA 4TY9A 4CT8A 2RAQA 4DR1J 4P52A 4LF4J 3A3OB 4BBYA 3QFWA 3TI0A 2XNRA 3FC9A 1B7YB 3G4SS 3RAXA 2CJBA 2CZ9A 3H5UA 4RW9A 3TX8A 1CJKB 2CQ2A 3T6BA 1RU2A 2HVIA 1PC4A 3P5TL 3OTDA 3DOMB 3CXCR 2DISA 4CTAA 2HGMA 1Q81T 1S0MA 4DG1A 3KLHA 1WDDA 3RG6A 1NH8A 2RE1A 4TU7A 2NZCA 2JEFA 2MZTA 3RR8A 3FDSA 1EQMA 2BJ1A 1YVFA 3EUNA 2IM2A 4LF8J 2IC3A 3F41A 1JLEA 4PQAA 4H4OB 2FHOB 2WSCC 2RU9A 3DMJA 4GVBB 3KHHA 2BQRA 1NJZA 4LVOP 3P45B 4M63A 2I0XA 1JIHA 2VG5B 3AY0A 3IRXB 4ZP6A 4TVAB 2W9CA 2HIQA 4FYVB 3Q2TC 1X4AA 4OQJA 3E3XA 3VAKA 3CMES 4JV2A 4PG5A 3QYYA 1HI8A 3MM9B 1I51B 3N0VA 2Q1LA 1NJIT 2N82B 1HBUA 1UP1A 2MQPA 4CO2A 5KFWA 2R7RA 4TNOA 4YP3A 3QATA 3AAWB 1JWWA 1VHIA 4FF2A 2Z2LA 1RT2B 4X65F 2LQJA 3TZYA 4WFNQ 2KXFA 1PJ7A 2HFSA 2B9EA 2ZVIA 5IT9Y 3AXMA 2QLFB 2HFOA 2RD5C 3D0IE 4NLUA 5JVGQ 3MR7A 2V2QA 8ATCB 3T1YF 1YIJS 5GAGU 3ZTSA 2WK4A 2YNFB 3V2UC 3QAEA 2IFXA 4FF1A 3U1LA 2DGXA 1MMLA 2HAIA 4CLSA 1HNXJ 1NK7A 3D1OA 1OJ4A 4DV2J 2XCAA 3W2WB 5D4OA 3MCNA 5A8WA 2JOQA 4M8LA 2VPWB 2RUSA 3AHPA 2MZJA 1GMUA 1GX5A 1J5OB 3IN5A 3EVMA 4YDDB 1HARA 1FWLA 3CIZA 4RR5A 5KT7A 5KFKA 2MDAA 3GSIA 3DGPB 2O67A 4IO1A 2GJ2A 5C42A 1YTYA 3JYTA 5IOLA 3RBDA 3E2EA 1BWVA 1M5OC 2DCUB 3QO9B 4KAIA 3RBZA 2V8GA 3M8PB 2I38A 2AWZA 3H90A 4KGXB 4Y6IA 4LFCJ 2JSXA 2F65A 3MMAA 1BXNA 3DLKB 4OJGA 3L95X 4F3OA 3TOQA 5L46A 4N76A 1CLFA 4WFBQ 5DLFA 4PWDA 2CXEA 2RHQB 2OHDA 2JVRA 4YFUA 2CQPA 4FP9A 1JXEA 4ZJLA 4DX5A 2ZDOA 3KJVB 3D1QA 1U1LA 3MM6A 3ULHA 3ZZ0A 2UUBJ 3P4UB 2BKPA 4URGA 4WFAQ 5IC4B 2W4CA 3FCWA 3FEZA 1SIZA 2BE7D 3CO9A 1FEEA 4B3MF 5HK4A 1NK5A 5D8HB 1KHWA 4NA2A 3AOBA 2BJ7A 2YKAA 4EMDA 4X4UA 4B3RJ 2BYCA 2OH2A 5GAHU 2EFVA 4LBIA 4CO0A 2HFNA 4I6AA 2GO9A 5JMNA 2QFJA 3PHEA 4DFKA 3H25A 3IGNA 2GV1A 5KFAA 2W7AA 4AL5A 2BE9B 2Y1LB 1YLXA 3DDKA 4A4JA 1LWCA 3T3FA 4K50A 1VLOA 1JLFB 2GVZA 2P6TA 1UWBA 4AQYF 4CIOA 2XMWA 4C8NA 3BGRB 2MQNA 4IQMA 1E6YB 1TVRB 5IWAF 4X4RA 3VV2B 2QG9B 4PPDA 2O3DA 2ZD1A 4RNOA 4PG7A 2XY6A 1YZ6A 4LF6J 4FS1A 3C2PA 5IT9U 4HTIA 1T9UA 2DR8A 3A3PB 4DZ6A 3HT3A 3OTOF 1WC3A 4ECZA 4IFVA 4MKYA 3IWNC 4C9DA 3W66A 4F7VA 1QSYA 2RSQA 2W2OP 5KG7A 1NNDA 3GMGA 3BH6B 1HHSA 1IBLF 3SEOA 4KH1B 1NKCA 3ILOA 3UQSA 1SH2A 1PSDA 4KO0B 4KY3A 1N5YB 3D0HE 1DTTA 3Q8QB 3OV7A 2W4DA 3UWTA 2YKNA 4RZRA 3H2VE 2AHOB 1Q16B 3LWMA 3CTRA 3UW1A 1SBRA 3ETMA 3LGNA 3G86A 1VDHA 4ZPAA 1FRXA 1R0AA 3SIPB 2QGFB 5B0BA 1IBKJ 1SJ4P 2GC8A 4ZPVR 3PW5A 2MLZA 4OZNA 5E3PA 1HMVA 1XR5A 2LDIA 3BR8A 4DV0F 4K0KJ 3BZQA 3MAHA 2ZWOA 2K2PA 1FRHA 2PA8D 2IHR1 2AEFA 4O0NA 3NGRA 5D15A 1P6TA 2CVIA 1CC8A 3FBFA 2IRUA 2PMHA 1URNA 1EJ7L 2OEJA 5E3QA 2R7XA 2RKIB 5G0RA 3TVZA 2J7WA 3D54A 4EZ6A 3ISZA 4USKA 1IM4A 2KB2A 3M2VA 1PYSB 4KFBA 5HI7A 5GAGI 1HWJA 3FQLA 2Q6BA 3UDCA 3H7HB 4JI2J 1A6LA 2R42A 3R5CA 2GMLA 1IR2A 1YGYA 4WK1A 3MECB 4FYWB 4N8NA 1A7GE 2GX8A 2HHXA 1H2VZ 4WF9Q 4DR2F 3MUTP 3W3SA 3VCDA 1RT4A 3PJWA 7FD1A 4WK3A 2YWKA 3BBCA 2VPXB 4DV6F 4OJ1A 3I55S 3MEEB 2OPPB 5J1EA 1QSLA 4K4SA 4M94A 2ZH5A 3TUPA 1UW4A 2M9KA 4LSNA 1T7PA 1O51A 2UXBJ 1LXJA 2V8HA 3NY0A 2AJFE 3DOKA 3VAFA 4DI6A 3W2VB 1N48A 1C1CB 1TL5A 3A1YG 4XTTA 4Q2LA 3OHAA 1RWKB 2YKQA 3VGVA 1PGZA 4L3NA 2K7JA 2VOOA 2R4FA 2L41A 2VL1A 1E6VA 1WF1A 4B9TA 1W7WA 2LU2A 1QSSA 1JKHB 1T05B 4FVMA 4ES3A 2YWHA 4Z7CA 3IS9B 3LH2S 2NXJA 1XTZA 4UOGA 4FYYB 1WOOA 4C2MA 3S7RA 2NXUA 4BDPA 2KM8C 3DLGB 2PO4A 3NOCA 4ZIVA 2DR5A 3KTQA 4C8YA 3M2RA 3MEGA 4DSFA 5DG9A 2G9OA 2WB1D 3MMCB 3BB5A 5GAHI 1SPBP 4BC9A 2R8HA 2E1PA 2RS8A 1Q5YA 5AE2A 5FLXY 1JJHA 3LANA 1RCOB 2NYHA 5L1KA 4X4SA 1OY9A 1N0UA 3BYRA 2BUNA 3AODA 2Q43A 5LXRA 2WVBA 3G8SA 2VD3A 3C8YA 2MKJA 1B99A 4O3PA 1VC5A 1ZTTA 3V6HA 2IVYA 5D0EA 2D69A 3ENQA 2I5JA 4U8YA 2HK2A 3OSPA 2GVDB 3PJ9A 3OPKA 3FCVA 3IC1A 5IQ6A 2HFZA 2M3DA 2KXHA 1PJ5A 3RRGA 4DR5J 1R43A 2ZBQA 2UV8A 3HI9A 1TL4A 2VUGA 3TA1A 2VPYB 1U47A 1D3WA 4ZCMA 1U8WA 1AB8A 4KC5A 1U26A 3DRPA 2QTWA 1RUSA 4CLLA 1LW0A 1HWIA 2CQBA 4NYZA 1O5JA 4EZ9A 4KHPF 1X31C 4IR1A 4DUYJ 5D0GA 2QLJB 3DM2A 4JYAF 4WYWA 3L7OA 3MMBB 4ETZA 3HZGA 4I2QA 5C7PA 1Y3KA 3CIMA 2XG8A 3G6YA 3SCJE 1FI4A 5KT2A 4CLZA 3FFIA 1Y5NB 3US5A 1TUWA 1SKWA 2DHXA 4OLPA 1NDLA 4QPTA 1HBMA 4DV2F 3TJAA 1ZYQA 2JEGA 2F8EX 2RB7A 5J2MA 4OYPA 3C6UA 2VKRA 1S6OA 3K7RA 5L1JA 4ATNA 4YR0A 1M1KT 4BHQA 1YDLA 2FHMA 3GE9A 3BQ1A 2EG2A 2C3PA 2C22A 4RW4B 1GAOA 2RQ4A 3PX6A 3KLFA 4DSJA 2V2KA 1HQUA 3BJYA 1Q82T 1JLBA 1S48A 1M1GA 2HRUA 3PW7A 2QSFA 2AJ4A 2NXNA 1QVFR 1GQEA 1WHVA 4DV1J 2DR9A 2MJUA 3OD2A 1CVJA 4I2PA 4ELVA 3V6KA 1KC8T 3GIJA 5LOQA 2AGOA 3IA0A 5A8RA 3CJRA 1TMMA 1P9QC 4P9SA 2FJXA 2DTJA 3AQPA 4BWMA 2PMWA 2IJNA 2DGTA 4ZPCA 1HW9A 5KFOA 2E5LF 2BE2A 2AP6A 3HVTA 2AJQA 1FXLA 2XI2A 5DQIA 2Z57B 4O23A 2MHNA 3P3DA 3QIPA 4IDKA 5FLXU 3PIPQ 2JL9A 1LWFB 4TYBA 1LWEA 3ZZTA 2KRRA 5HVFA 2QMWA 4JV1A 2PE8A 3LTOA 4IFYB 2FZCB 4NRTA 1RA6A 3PDNA 1FX2A 5CCLA 3IBWA 3F56A 5E3CA 1XWLA 3P8BB 2R2UA 1RTJA 1MW7A 3LP2A 3JSMA 4Y3CA 2RNEA 1NPRA 2EC0A 3AJ2A 3HHLC 1DQ9A 3N28A 4L3KA 4A8WA 4DV5J 1FRKA 1TKTB 4HDGA 5HSPA 2CQCA 4FN5A 1Q1KA 4DQSA 3HJFA 2ZUGA 1SQEA 2HNZA 1YRUA 3AJ1A 1M5SA 1Y00A 2OPQB 3PO4A 4PUOA 3KFWX 4IH6A 1SVDA 1FWPA 3PYGA 3K58A 1BQNA 3A12A 4DR4J 1D8ZA 4GC6A 2RMLA 4PEOA 3R2CJ 4PG8A 2CJAA 3OTBA 3NBPB 5A8KA 2FLNA 1WEZA 2XS7A 4IOBA 4DQIA 4OLOA 1C4CA 4LF9J 3V81A 3D68A 4KE5A 2KG1A 1AT1B 1MROA 2V8DA 3H2UB 3W5XA 1SJ3P 3DN9A 1XEZA 1Z2ZA 4WU2A 2HHHJ 3LALA 3O5TB 2FHJD 4DR7J 4U95A 5D3GB 3PIOQ 5EX0A 2OPRA 5D4LA 3M32B 4DCPB 2LMIA 1GH8A 1VQ8S 3CMAS 1KTVA 1NJYA 4LFBF 4KR0B 4B3OA 4RNMA 5F9NA 4W92B 3AD9C 4NPOA 5KFPA 3IRWP 2MSSA 1REVB 4LSLB 3F44A 4KV8B 3PR5B 5ETSA 4A8FA 3GFXA 1KFDA 1QAXA 5B0FA 2RT3A 3MPDA 2AEMA 2QIFA 1S9EA 5EWGA 1M5VC 2DT9A 5DLGA 4B3TF 1YQHA 1RWXB 2HHVA 4LQ3A 1D9FA 1VLYA 3DDIA 4LSZB 2FJAB 4PYDA 2B7CB 4UZCA 2VQEF 2FVPA 2KU7A 1VGYA 4B9SA 3R8YA 2Y1RI 3MAQA 3OL6A 1UPMB 4UUWA 3DXBA 4CZCA 2MXYA 2A6OA 4C98A 2XLKA 1JK9B 3H2LA 4M1KA 1GFWB 4YOEA 1SB6A 5IV4A 1U0HA 1S0NA 3MM7B 4CCHA 3ITHB 1EARA 1WHXA 4K4VA 2YX7A 4LIRA 1OSDA 5L1IA 5HROB 2VB6A 2B3TB 4ER8A 3ZNJ1 3QGGA 2XO6A 1CJKA 2IRXA 3MPUB 4F4ZA 1NH7A 3T1HF 2MPUA 2DGSA 2NQPA 3SI8A 3A13A 1FXDA 3DOMA 4TY8B 2QLXA 1RWWB 3ZO7A 3B78A 2MQQA 1WKKA 2DY1A 4DV3F 2QEXS 1U1RA 2MY8A 3TWZA 3MEKA 3HHEA 3IBFB 4ZMMA 4JI1F 1VQ5S 2DGOA 3KJFB 3SQOP 3GCWP 2ZFHA 2DO0A 3AJDA 2MQLA 1T94A 3BN4A 4H4OA 4OYIA 1UWAA 3OR2B 2ZM6J 1EIYB 4GVBA 3GJTB 2UXDF 4ECRA 1YWXA 2YKMA 4TKTA 3M8SA 3EGVA 2AEJA 4NMXA 1U1MA 2RIJA 3TA2A 1YRXA 1KQSR 2EFNA 2G2YA 2CYYA 4IO9Q 1RT5B 3UNYA 2NCKL 1HYSB 5KFGA 5I3UA 2J8AA 4JB8B 5L9XA 2HGLA 1YBTA 2B51A 2DGUA 3QWPA 4F0MA 5LMUJ 5DG8A 4HH1A 2HRTA 2VPZB 2E9RX 2DKOB 3E8OA 3W65A 3OJSA 4GVLA 3ZTQA 2BDPA 1RT2A 1KR4A 2FJVA 4E8UA 1X0FA 2DGVA 1VQSA 2VZ9A 5HLFA 2ILYA 2IA6A 1D9DA 2HBYB 1SUQA 3JS9A 2XBPA 1IM6A 3W9HA 3CJSA 4ECSA 5HJYA 3OHBA 4K4ZA 3UVJB 5GMKa 4LRDA 4AYBD 3PX0A 2BANA 3SV4A 2BX6A 1HNZF 2OPSB 3OFGA 3BYPA 3M9MB 1S72S 5EX3A 2V2ZA 1C0UB 3NS7B 3GIIA 2HHTA 3CDUA 2YWWA 2DIVA 2YNFA 4ZPTR 3I0SA 3EPGA 1P9YA 1RXOB 3Q8UA 2R7OA 3ELHA 2IRYA 3CCLS 3DRXA 3DCAA 3DRRA 1V3SA 1B64A 1DTQA 2CIMA 1U0SA 2ZITA 3HSGA 1ZAXA 3OFHA 5E3AA 2R3VA 4CLKA 4I7FB 2NUUG 5CZVA 4PWUA 4CLFA 3UNGC 1HW8A 4C3LA 2PC6A 3FJ2A 1R3NA 4KKOB 3OTCA 2XI3A 2J8SA 4CNZA 5LJ5Y 5H1SV 2IA0A 2JH3A 1GK8A 2GW8A 5FIIA 5KT5A 4ID5A 1WC0A 2C1EB 3CJ2A 4A48A 2MZQA 1UA1A 2L9DA 3SMZA 2MHEA 2L9NA 4RW9B 4DL5A 3VQSA 3JTPA 4UY85 3HD2A 1TKDA 4EO6A 1FHTA 4OHVA 3Q23A 3KJVA 3V5RA 2AYBA 4GKJJ 4CTAB 1OO0B 4QIGA 4R0EA 2HWTA 2D7SA 4DG1B 3KLHB 3KLEA 2KYZA 1UFWA 2HHSA 4P7VA 1FDDA 5KG0A 2IDLA 2W24A 3VAIA 3CT9A 2YWFA 3BEGB 4DJBA 2AYMA 4A8QA 1RKJA 2QLWA 2FGOA 2IC3B 4IOCQ 4GO5X 4EWTA 3HP6A 1XMQJ 1JLEB 4F4KA 1N33F 4EEYA 1WF2A 3DMJB 2AX0A 2C28A 1J5EF 2OMLA 4BCAA 1EZZB 2KM8B 5I42B 2ZH3A 2XMTA 1X4CA 1GMWD 2W9CB 1P8GA 3I6PA 4MYTA 1HNWF 4PCQA 3IO1A 4X66F 1L5UA 3LF0A 2J0WA 3NS5A 5KFMA 1SV5B 3NGTA 1Q53A 2IJFA 2N4DA 4X4TA 2BABA 1WUUA 3NCQA 2CAJA 1RAAB 5CYMA 4MTPA 4YHHF 3PVXA 1FRMA 3R6GB 3SXLA 2MKHA 3N4WA 4KPYA 3FBBA 1BQXA 1WOSA 2BKNA 1U1QA 3M05A 1B0TA 2BM1A 4O4RA 4OZ1A 5B0EA 9RUBA 1AROP 5FD1A 2CNLB 1OWXA 1RT7B 3K17A 3QZ7A 1D8YA 1T02A 1D09B 2RVJA 1K73T 1NO8A 1VIXA 4ED4A 4NXMJ 2M0GB 3G96A 4DMZA 2JC1A 1NJWA 5GAEU 5KG1A 1F9EB 4DLGA 3DDNA 2W25A 3G8QA 5A8WB 4N47A 4C0BA 4KO0A 1N5YA 3LP1A 1TR0A 2VONA 3EYZA 1RK8A 5JVHQ 1RBOB 2OMOA 2ROPA 3NKYA 1RQ0A 1F3VA 4QZVB 3C15A 1QTNB 2R8JA 5C42B 3JYTB 3M4XA 4DQQA 2YX1A 5ETPA 3RU0A 3MM5A 1UW9A 3DI6A 2GIRA 5BJRA 2ZNYA 4DL4A 3MDFA 2JFDA 2ZH6A 2IVMA 3MMAB 3ISND 5L39A 3EGWB 2AYGA 2IAJA 4CYUA 2LQ9A 3CDWA 2VFUA 3MM8A 4H4KA 1IR0A 1OY8A 2DNGA 3CDBA 4NE9C 1VI7A 4F4WA 1H7WA 4DL3A 3GFYA 1CULA 1WHYA 2HS0A 5F8GA 1FKOB 2XY7A 4CLUA 1RGVA 3K8VA 3RB4A 4K8RA 3CCMS 4LFAJ 1CG2A 3DKDA 2ZH1A 5JUMA 2DNMA 2H48B 1NEEA 4Q8FA 2ZHBA 5HQ8A 2RRAA 3HSDA 2XZDB 3ICLA 2EFGA 3POTA 4OYZA 1EQ0A 4UTGA 1TTHB 2PI4A 5F8HA 4OFZA 4OX8A 1MMDA 5DQGA 4JI6F 4DFMA 3CJ8A 3SCIE 4FDFA 1LWCB 1D9AA 2NXEA 7AT1B 2B9YA 3IAS9 4S0MA 2GVZB 4CO3A 3PTWA 3CCJS 1UWBB 4J5OA 2JZ5A 3CMQA 3I9V9 2ZEJA 3MUMP 3QGPA 1VBXA 5ETRA 5BXIA 4ILRA 2LEBA 2ROGA 2I2YA 1RWVB 2E7XA 1IQTA 2ZD1B 4U9RA 5AXNA 2CA9A 3TVYA 3P6YC 3J7Z5 2VG7A 5HMYA 4OYWA 1VR6A 4PXBA 1T3OA 4OYXA 1VQ7S 1BUXA 1WNEA 1FRJA 4IFVB 1RU1A 5CH7B 3Q2SC 2VFVA 2E5IA 1W25A 5CCMA 3MMCA 2E9TA 1ZM4A 3W63A 1I1GA 2KHDA 1Q79A 4PXCA 3DGVA 3MMJA 1S5ZA 2H54B 2Z30B 4NI2A 2DNOA 3L4BC 1DTTB 1IBMJ 3I5CA 4NLQA 1UVJA 5C2CA 2LXFA 2CPFA 3ZTPA 2YKNB 2AGPA 5KT3A 1CC7A 2VDIA 4X64F 4YY3J 4EYIB 3IBCB 4ENOA 5E2QA 1R0AB 2C42A 3CB4A 3MR3A 4MK9A 5D0HA 1H72C 4JI4F 2E1MC 4Y28C 4JV5F 2KG0A 5KFZA 5HMZA 1R6VA 1HMVB 4NWBA 4FF4A 3BSNA 2HFUA 3WIVA 3EJMA 2JFKA 3PYFA 4KQZA 4GMKA 4PG6A 1Q7LB 2UXCF 4MIBA 3J81Y 8RUCA 5KTQA 1Z1ZA 4U96A 2AZ1A 1NHVA 5ITHA 3CSKA 3MFHA 3T5KA 3PZPA 4F36A 3PYEA 3N5FA 2W9AA 1N4LA 1S4FA 2ASDA 2V68A 1NZAA 1S1TA 3M2VB 1I94F 4KFBB 3Q8SB 1VQNS 4WIIA 3F0NA 3TJ8A 2ZH2A 3H40A 2CQDA 1MU2A 4DUZJ 3MAAB 1ITPA 5GAEI 4F4AA 2P2CB 3FNNA 3TA0A 3MMBA 5HJXA 4V19X 2FD2A 3OXLA 1LW2B 4ZDNA 2VA3A 3PY8A 2MB0B 1XNRJ 5CYJA 3MWBA 1RT4B 2LEPA 1KNZA 4P73A 4I64A 4KTQA 1TMJA 1IN0A 2YQ1A 2FHJA 5EUHA 5J1EB 3EMTA 2Z8QA 1FJGF 2GNKA 3CO0P 1RTZA 3DOKB 2MZSA 1SCJB 1OQ3A 1RTIA 5B08A 1KLMA 1Q4RA 4CP5A 3PRDA 5IT0A 5F8MA 1ICEB 1FVQA 3OFFA 1FTCA 2VJUA 1E6VB 1CBKA 4XDCA 2K7KA 3WDOA 2HBRB 2PN6A 3NG8A 4O3OA 3D6TB 3C16B 2XMJA 2ABYA 5LMNF 2QMUB 2CVEA 1JX4A 1YHQS 1RHJB 2I8EA 4QJVA 4ELTA 3EDQB 4WYLA 3M2RB 5KFVA 3RRHA 3MEGB 3KXDA 1Y5IB 4RKUC 4HHHA 2PEBA 2XO7A 1TZ0A 2WVFA 4C0HA 3ADAC 2QA1A 2IPOB 2F9DA 1SL1A 4EK2A 2EW9A 3PR4A 2FJEB 2VIHA 3I4PA 3DHXA 3GONA 3QIDA 1NHUA 1MSWD 2QC3A 1A9NB 1X9SA 4NXNJ 3I32A 4O3SA 4C97A 5A6PA 3PW4A 3GU0A 3MOJB 2MQOA 3R7SB 3F73A 3GR1A 2LVWA 4RUAA 2CQ4A 1VJWA 2RS2A 4OL8A 5H9EK 4X4PA 2H65B 2G4BA 2WOMA 2EBEA 5L38A 2BEFA 3J7AN 3W61A 2D9PA 2OLWA 2DEIA 1U49A 1RWUA 3HM9A 4X62F 4HEA9 3IFEA 2YQ3A 2OFHX 1FNXH 5M2PA 4RO0A 2I5JB 1K8AT 4Q8EA 4EI2A 3DYAA 1TKTA 3H8YA 2KH9A 4D3HA 5KFCA 5HATA 2MLXA 4USHA 4I6YA 2Q3PA 3SFUA 4ZA1A 3BO2A 3GZ7A 3KG1A 2EXUA 2Z56B 3K5PA 2WW8A 2CNNB 4DS5A 2YPYA 2Z2MA 2V9KA 4LF1A 3DRPB 1S7HA 4KH0B 1OPIA 3R7NB 2XYGB 5KFYA 1LW0B 5CA5A 1VCTA 4V19J 1TFYA 1FDAA 5E3RA 3OR1A 3DM2B 1G6BA 2WZ1A 1VIOA 1YRTA 4ZCKA 2KZZA 1QAIA 3I87A 1KQKA 5D0RA 4QU6A 2LXUA 2WAQD 1NKEA 2VV5A 1TV6B 2KN4A 2FTRA 4Y2CA 4LT6A 1GEHA 1F60B 1TL1A 2ERRA 3FSXA 2ZDPA 3M32A 1U02A 2V67A 1TAQA 1NSPA 5KOXA 1HBMB 2DK2A 5K8NA 2C3MA 3H20A 3W60A 4HHUA 5J2MB 4H4KC 2EFPA 2D3O1 4X4OA 2NUHA 1CPZA 1RT6A 1U1PA 3THVA 2M2BA 1VQ4S 3CD6S 3AFGA 1UJ6A 1KS2A 4WFYA 4DV7F 1Y3JA 2OSQA 2XMMA 2YWEA 2IMWP 4QIEA 2M5YA 1HQUB 4G1PA 3THTA 2FLLA 1JLBB 1HR0F 3NGSA 1XNQJ 2DD8S 4HH0A 2AMCB 2FGCA 3KK2A 1KVJA 4JP8A 1T9XA 2CPIA 4C6AA 2ZHAA 3OVBA 2I6WA 1KQFB 1G1XA 1S0VA 1QE1B 4I2PB 3NNHA 2B4VA 3NAIA 1FCAA 3T9NA 4CLYA 4N56A 4OYOA 1S1WA 3P96A 4DZDA 4F8RA 4IG3A 4ZKAA 2QV6A 2EK6A 4USMA 3ET6A 2BE2B 3HVTB 1ZETA 3ITHA 2JDJA 4NYOA 4ES2A 1DZ5A 2CJXB 2CWXA 3QIPB 5HROA 2LDYA 1WC1A 5D78A 4KGVB 2P9CA 5AJ3F 2UUWA 4J7CA 4FBUA 3M6WA 3JAMY 2KT3A 1NZ8A 1VRUB 2WVCA 1NCLA 2FB0A 4YDXA 4TY8A 2WCXA 1G7CB 3C14A 2HQ3A 4ECQA 4EU0A 4NYPA 2UU9F 1RTJB 3JSMB 2BQUA 1O0PA 2W7PA 4ZVQB 4HI1A 2FVRA 2L08A 3B6BA 1SJRA 5KAKA 1RHMB 3GTYX 5BR8J 3J7A1 1RWPB 4B02A 2C3YA 2HNZB 2DH9A 3KWMA 2QFIA 4R8UA 3ETOA 4NASA 3AH6A 2OJ3A 1SC1B 5U47A 2HVZA 2UUAF 4LF7J 4LF2A 1BQNB 3EZ5A 4QYZJ 4WIQA 2DNKA 3QPIA 3VHQA 1VRTA 2QL9B 1G3OA 4XK8C 1H7XA 1KEKA 3G87A 2ZOFA 2EBGA 2D41A 5IV3A 5I4MA 3ZZZA 3KMSA 1OYEA 1S1VA 2X3GA 1L3KA 2WRMA 5A8KB 2X1AA 1YBUA 1UJ5A 4NX9A 2B4PA 3V81B 2H5EA 4MKAA 2UUCF 2U1AA 3H5XA 3MEDA 1MROB 4O3QA 3QNWB 5EN1A 4UQTA 4P7TA 1NMEB 3CF5Q 4DN0A 2OPRB 5DS7A 2LEAA 3O1LA 1XC9A 2WHOA 4ED3A 3DLEA 2OKQA 3UN3A 1FKPA 3O6QA 3MD3A 2CKWA 1KKHA 3KLGA 4B3OB 4ZVRB 1C0UA 3BQ0A 1M1HA 4HI2A 3KDOA 4KBIA 2E5JA 3L7UA 1Q95G 1ZTWA 1FNOA 2FY1A 2HW3A 3L3CA 3H5YA 4DQRA 3H4BA 5J2NA 2OD6A 3LA0A 4K7QA 1S9EB 2RF2A 3QLHB 2IY5B 4MFBA 4G3IA 3CPWR 1F1BB 3H59A 3W9IA 5LT5A 4KKOA 2AF6A 4O44A 5H9EJ 1VBKA 1Y7PA 1URRA 1N34J 2YNIA 4ILMA 3CDEA 4JI7J 2GHWA 1RT1A 3HVRA 3O3LA 4KB7A 1P1LA 2CQ0A 3D6MB 4QOTA 4P10A 1T8EA 2J76E 1U0HB 2JJ4D 2QA2A 3BKFA 2H1YA 3R1LA 2GAGC 1T95A 3CCRS 2HHQA 2N7YA 3G8TA 1IR1A 2M4MA 4G1IA 3D5MA 2WSEC 3R5GA 4WPAA 2DPJA 1HBOA 2Y8WA 3JAMU 2AJ0A 3UD3P 3R5BA 1K0TA 1UVIA 5E7OB 3LWLA 3K5OA 3FKBA 2GIFA 2M52A 1AXQA 2OFGX 3RGIA 2CQGA 4URQU 4L76A 4WE1A 1UA0A 1RA7A 3NEKA 1CSJA 2UP1A 2M7SA 4OX9F 5D77A 1F2HA 2QRRA 4QWCA 3S8SA 4OYAA 3QBCA 4NL5A 2YKMB 1IBCB 3M6UA 2B9WA 4LRBA 3AA8A 5I42A 1NDKA 2ZOMA 5T7LB 3D3BJ 5DM7Q 4A47A 4NLWA 5KG2A 1H74A 9ATCB 1QVGR 2DHSA 2GFFA 4CT9A 1F5BA 3I31A 1UETA 4J9KA 5I3UB 2HGNA 1QUVA 2XS2A 1SV5A 1B7FA 4L72B 3PNIA 4X4QA 1RI7A 4HTJA 2IBOA 2ZUAA 4A8YA 1R8CA 4PABA 4KGMA 3FCHA 4M5MA 3W8PA 1X9WA 4M5LA 1YI2S 1GX6A 3M9OB 5HLFB 1SUQB 2ZZNA 1D0EA 2CJQA 3M6XA 2AW0A 4IOAQ 1RT7A 2HPUA 5CD4H 2W1BA 2BANB 1AFIA 1PCAA 3HVAA 3W8GA 4HDHA 1K1QA 2A2DA 2DVIA 2RRBA 4IRKA 4NXNF 4PRFA 2V9WA 2V4QA 3W62A 4ECYA 3I0SB 2AQ4A 2J9DE 3DRRB 4N8OA 3NNCA 1TELA 5D6GA 4W98A 1DTQB 3NCRA 1KLNA 5J2QA 2BJ9A 2GAHC 2QE5A 3JXOA 2KXNB 1IKWB 2DCLA 4RBVA 4CM2A 4Q2MA 2NR0A 3I56S 2XC9A 1JNZB 1TUGB 2GMHA 1N36J 2H9ZA 4USIA 3E01B 4X2BA 4DFPA 5A6WA 2R2SA 1K9MT 2VH7A 2BACA 4OJHA 1FWKA 3Q22A 1T9YA 4WJBA 4DV4J 4DR3F 1VK3A 2VC1A 4ID5B 2VQFJ 1N8RT 2AYEA 2W01A 4ECTA 2Y8YA 4ITSA 4JI0F 3AB2B 4K5RA 1NDCA 3KYLA 2UVRA 4IRCA 3OVSA 4UOCA 1SJFA 4Q44A 1H98A 1MN7A 2W2QP 4JI3F 2J0XA 1U6FA 1RYSA 3KLEB 2MKCA 1FKOA 3SCKE 3C6TB 2W2NP 3U7JA 4ZCIA 2Y0BB 2MGZA 2CDQA 3TZXA 3TUJC 1VRQC 4LJMA 4CM0A 3N5BA 4EGLA 1SH0A 4MYUA 4B3SJ 1YJWS 3K8WA 1YZ7A 3SV3A 4F3QA 3IM8A 2F4VJ 2FC9A 3ONQA 3BH7B 3W64A 5LJ3Y 2HAFA 4TQRA 1SQGA 1LK7A 3ILLA 2F5GA 5BYQA 1TKZB 2AJ1A 2VF3A 1S76D 1GXLA 1RACB 2J6TA 2C3OA 1TL3A 1SIWB 4CRJA 5L1LA 3JSYA 2F63A 3CC4S 3HFZB 3ZZRA 3EXYA 1RBLA 1BWEA 2WONA 3QGHA 4P2XA 1XMOF 3MPVA 3CJTA 5F8NA 2NPIA 2EI5A 2HVEA 2M8HA 4M5DB 1OMSA 1QM9A 3AOCA 5CYMB 4IKAA 4FKYA 1U45A 2ZOGA 3N01A 2ADBA 1VHFA 2M70A 5ETLA 4DL6A 2FVSA 3B8HA 3IAM9 3J7ZT 3BPDA 3EPIA 2IIHA 2XGQA 3HZEA 1RAIB 1Q8BA 1FJCA 2HIYA 3TARA 2SXLA 3O8WA 2HNDA 5DDQC 1JNRB 3SZ2A 3PRBA 2R2TA 1AZSA 4MH8A 2IM0A 1VC6A 1N5SA 1N32F 4P74A 3TJ9A 2E5GA 4FNHA 1HQ2A 2BM0A 3DRSA 2LU1A 4QIFA 3MD1A 4DF4A 1JLCB 1TK0A 5K8OA 1QAYA 3OBIA 4Z2XA 3JTOA 2IMOA 1FF2A 2HQGA 2HQDA 2WTFA 1LOUA 2GHVC 2HS4A 4F50A 1YJRA 3N6MA 3LP1B 3W1YC 3BS9A 2FVQA 3FQKA 3GIRA 3EGNA 4O3RA 3CCZA 4NCGB 3C15B 1EHWA 1JLQB 5KFUA 1FFGB 2B8PA 2KVIA 1VQ6S 4A8SA 4ZK7M 1FJEB 2Q66A 3MM5B 3DI6B 4WXOA 4LF7F 2LECA 4Q43A 1A0OB 1MG7A 1S1XA 4ZVTB 4ICLA 5GMDA 2PFFB 5JXSA 3MZIA 4K4UA 2IAJB 4LF5F 2XGPA 4X65J 1BY9A 4CYUB 4DCJB 5F8IA 4QW8A 1TU0B 2DJWA 4KT0C 3MM8B 4OHXA 1BE4A 1RYRA 2OD4A 2YKOA 4WFZA 1SJ1A 1CULB 2Y9HA 2BA9A 4C0OC 1OQ6A 3JSRA 1S7IA 3R6LB 4NEZA 4J9SA 1DURA 2J7UA 2EC2A 2CWKA 3T1YJ 3FSIA 4M5GA 1M90T 3TUZC 3RAQA 4ZVOB 2DNRA 4YR3A 3CVKA 1U24A 1O8BA 3MAAA 3POTB 2LXIA 3KK1A 5KFXA 4EUVA 1WEXA 1ZAWA 1V9OA 1Z2LA 5KG6A 4DU8A 5FDLA 1LW2A 1RWOB 2HQCA 3TUIC 2DRDA 3BDPA 1B0VA 2HZAA 2RDDA 2RQCA 4GO7X 1UVLA 2HFVA 1K47A 4Q5VA 5E0OA 1SC3B 3AA9A 3ISNC 1FFWB 1JXVA 2CQ3A 4PKDB 3TEHB 3EWGA 2E29A 1F0XA 1VK8A 1U7LA 2OTJS 1HFEL 1F6TA 4PQUA 4CO5A 1T9VA 3THPA 1ZS6A 1WI6A 1EETB 3D9BA 4ZVPB 4GKKF 4I68A 4RU9A 3VQTA 1JXLA 4ZPDA 1SKRA 2GMJA 4J9UE 1R7IA 1EX8A 3DLHA 3AOAA 3UR0A 4DR1F 1U2CA 2P9EA 4LF4F 2BRLA 2VG7B 4FKXA 4PYAA 1EKRA 2UZAA 1N88A 2Q79A 5HO4A 3HMJG 1PYTA 2DXDA 3NLCA 3C16A 1FE4A 4DSIA 4W4MA 4OI1A 2CQIA 4DPOA 3TP2A 2A1BA 2V6AA 2DXFA 4B3MJ 2VODA 3I0RA 1Q7YT 4BS2A 2DPIA 1DY3A 2J9EA 3MTJA 2V8PA 2ILZA 3BM7A 4ZPBA 5KFRA 5GMEA 1UFLA 2I9SA 2XMUA 4LRFA 4NI2B 2OGUA 4TLRA 4HHJA 3E51A 5KFNA 3R3TA 2KTQA 3GV5B 1RAGB 3TYTA 5HBMA 4CH7A 3GYGA 4K5SA 1VQLS 4AFFA 4LF8F 2HHWA 4QWEA 3D4JA 3CUNA 4PXEA 1BC6A 3I4HX 1F9FA 3MCMA 4B9MA 4O3NA 4QPXA 2EKNA 2OTLS 2ASJA 4AQYJ 4WZQA 4KHMA 3DHWC 1UCNA 3W5ZA 2P9GA 4YQWA 1FEHA 4IR9A 4RL1A 1Y5LB 1VFJA 3TANA 1RHUB 1R8PA 5IWAJ 1UZDA 1UFKA 1T03A 2ZHOA 2DR6A 5ETQA 3OL9A 3Q89A 1FRLA 3PW0A 4MT1A 3VTIA 2C2OB 4DL0C 2JLGA 4QQBA 1HHTP 1FNMA 4J91A 1HQEA 1RISA 1RABB 3OTOJ 4DR6J 3UCZP 3TAQA 3UN2A 1S1TB 4UOFA 3PFEA 3MFIA 1DLOB 2HK3A 2L3MA 2YTCA 4AL7A 1MU2B 5DGAA 2B6AA 2E66A 4A8OA 4I56A 1IBLJ 2DNNA 1RHKB 1XR6A 4JOUA 5IXUA 2FZGB 5KFTA 1TV6A 4G1QA 3T41A 4RJVA 2B4UA 4M5IA 2PGCA 1IKYA 2W8KA 1TKXB 5HL7Q 1HNXF 2ZJPQ 2VASA 2QYCA 1MNEA 3SSRA 4ZJQA 2FLPA 4UOHA 2DHHA 1RTIB 4EBCA 1KLMB 2D3UA 2YNHA 1R8HA 5IQQA 1T3NA 5CYQA 2F1FA 3B54A 4DV0J 1H38A 5AE3A 4P2MA 2YKPA 1I3OB 5DM6Q 1HA1A 2QL7B 4P2FA 1RTDA 4LFCF 2KHCA 1U1OA 3NOGA 3M8ZA 2Z2YB 2XYHB 3SSSA 1NK9A 1S6QA 5ETNA 2QL5B 4NMLA 1QTMA 1QE1A 1HPZA 4BLGA 1NUEA 3ENWA 1UPPA 2MTLA 3B4MA 1PKUA 1RJJA 3CCQS 3JQKA 3T5LA 3G82A 2HLTA 3G2XA 2BV3A 4Y34A 3Q0AA 1ZM9A 2UUBF 3N79A 1N6QA 1R6YA 1G4CA 4FXVA 1OIAA 1WTFA 3CCWA 1KDNA 2UVWA 1U1KA 1Q78A 2ADCA 1U1NA 1KD1T 1R0BG 1XN9A 2GQCA 2MZ1A 3GWCA 2GS8A 2ALZA 4DR2J 3BN7A 4XPCA 1VRUA 1DARA 4F4XA 4B3RF 2YNGB 4DV6J 2KI2A 3HJVA 2G2OA 5DETA 2WOMB 3OQ2A 3KJNB 5T41A 3ZZOA 3Q24A 2XM3A 2H3EB 2PFDA 3SDEA 3L09A 3DU5A 3Q8RB 2JLFA 1SQFA 3OUYA 5C24B 5DZ6A 4X4VA 4FZVA 3UDEA 3CD5A 4IG0B 1C4AA 3DYAB 5LXYA 4WP9A 3OFEA 3W5YA 4DOZA 3BREA 1S4EA 3MCOA 5HN0A 2ALYB 2NZ4A 4IH5A 1S1UA 3CJ0A 3MUVP 2RRNA 3R5DA 3KUEA 2B4OA 4QYRA 1FK9A 5CZXA 1SC6A 2M88A 2JWNA 1FA0A 4DSKA 1IKVA 2QA4S 3QRQA 2IYGA 1R31A 6AT1B 1IXKA 1U4BA 2AD9A 4HVZA 4TU9A 1F2GA 1LQ9A 2DO4A 4LF6F 2W7OA 2KL8A 4ZVUB 3RJMB 3OR1B 4HLBA 3GJRB 1JLAB 2VOPA 3VAGA 5DDPC 2BMBA 1K1SA 4QIWD 1VBYA 2HBZB 1ROFA 2J7KA 3EM1A 1KOOA 4B9VA 1RT3A 4OZ5A 2K06A 2DIUA 3BKUA 1V5VA 2RILA 2V2VA 1KN6A 3FUYA 2W4PA 1TK5A 3UE2A 2XTJP 4ZP8A 1TL1B 2VHGA 5SZTA 2D3ZA 4L6V3 5D4NA 3M6VA 3TAPA 4XIUA 4USTA 3KUGA 1VMBA 1R89A 4NA1A 1S77D 2KZMA 4ANCA 4I4BA 3JQMA 1QDUB 2RDIA 1RT6B 2NSCA 4QR1A 4NZ0A 2G13A 1QD1A 3KHLA 2EG1A 1RLDA 4Z7YA 5DQHA 2RDJA 2V4JA 3GFHA 3HXMA 4RX6A 1IBKF 3X1LB 5DG7A 4ZP7A 1MLAA 3QLHA 5K14B 3KK2B 3AXKA 4EO8A 4J37A 3HCXA 2GGPA 4K0KF 4CWBA 3K5LA 3V6DA 1OY6A 1QJHA 4KHPJ 1S1WB 1UL3A 4IG3B 1NK4A 2ZZMA 2HS3A 1CJVA 4JI5J 4JYAJ 3WX4A 3ET6B 3BF4A 5CABA 3GP9A 1RAFB 2EVZA 1HBNA 2MQMA 1Q0NA 1WC5A 2BW7A 3FVYA 2FY8A 1VQMS 4JI2F 4MKVA 2F8HA 1NM2A 3C14B 3IG1A 1X8DA 3D28A 4DLEA 1MMNA 1CJTA 1U8SA 2DH8A 3BO3A 4WCEQ 4A8KA 4LRCA 5BYSA 2XCPA 2Y0SD 2P5VA 3RTVA 2ATCB 6FD1A 5LM7E 1LWXA 3G6VA 3HF5A 4NA3A 5ETVA 3GCXP 2W9BB 3RW7A 4JBCA 4UZBA 5CAAA 2G2ZA 3QT6A 4R8UB 1I6JA 1KONA 3CCVS 2UXBF 4E0DA 1V6HA 3PRVA 5LSLA 3CE8A 2PIIA 2N3LA 4YB5A 4M95A 3HDSA 4ILLA 4IRDA 3CEDA 1ZA1B 1REGX 3PM9A 2FVCA 4OI6A 5T7LA 3HLUA 1VRTB 4RW8A 3PG9A 5ADZA 3UFCX 1SKSA 2CADA 2Q6CA 4C3KA 3RBXA 5A0YA 1S1VB 3BSCA 3N6NA 4ZLPA 3L7PA 1TFWA 1KOHA 1RTHA 1QAJA 1RLCL 5KFIA 2E5LJ 3MEDB 2ACMA 4G6VB 5AXMA 1CQMA 1HI0P 5B09A 2VBYA 2ZE2A 1RDRA 1H3DA 3RW6A 1WSRA 3RRKA 4DBQA 4BC7A 1KFSA 1WG1A 3KDNA 1VBZA 3QSYB 3DLEB 1PBUA 2CUYA 1CEZA 3FBCA 1FKPB 2WVEA 1FD8A 4ZLNA 3KLGB 2NXCA 3KHRA 4NLTA 2G1HA 4P71A 3EGZA 2B0GA 4J9RA 4RW7A 2G1DA 1VQ9S 4RNHA 1DRZA 2E1CA 5DDRC 3QT8A 4ED6A 3CC2S 5J2NB 3TNVA 3I96A 2CG8A 5F8JA 2ZH4A 3JQJA 4DPUA 2RF2B 3W9JA 1OYDA 4MFBB 2Z58B 1LFPA 1IKWA 2QX0A 4EYHB 1XMBA 4OI3A 2JNJA 1SJQA 2YH0A 1S6UA 4DR5F 5ETKA 3CCTA 2PEHA 4O44B 3E01A 1OPZA 4OX6A 2GJFA 2HRYA 4OJ3A 4OMFG 2YNIB 5EDWA 2POKA 2D74B 1LV5A 1RT1B 3HFVA 4ED1A 3LUYA 1ZPVA 2MQ8A 1QY7A 3HHLA 4IH7A 4ANEA 4F02A 4DPTA 3Q8PB 4DR6F 4AXJA 2PDAA 1B0PA 1RADB 5KFLA 4DUYF 3CNQP 3BPSP 1ELOA 1AA1B 2R8GA 2WB4A 4OZ2A 3IXQA 4MK7A 1VQKS 3LAMA 1JJCB 1HBOB 5K9FA 4EBDA 2KJWA 1NK6A 1IVZA 3HT0A 1LFWA 5I3QA 1WD6A 3QRPA 2FPHX 3R7BB 4DDFA 3C6TA 2V8VA 3VWSA 3GIMA 4LFBJ 2YBVA 3T19A 5C5JA 3LAKA 4WE1B 3ZNUA 1UAWA 3TZWA 3D3CJ 3HSJA 4ZHRA 2X7IA 1V5IB 1WKLA 1AUDA 5F0WA 1Y4ZB 3FRYA 3QQCD 3LW5C 2G0JA 4C8MA 1KBRA 4DF8A 1RE1B 4WWSA 1X9MA 4RUCA 4WBFA 3EXCX 4R5PA
chains in the Genus database with same CATH topology
3GCXP 2ZWOA 1V5IB 4OV6A 4YN3B 3T41A 2ZWPA 3SQOP 1R6VA 2Z2YB 2Z58B 3A3NB 4NMXA 3GCWP 2W2MP 3WHIA 1SPBP 3CO0P 2Z56B 2QTWA 3BGOP 2PMWA 2Z2ZA 3WIVA 2W2PP 2XTJP 2W2QP 3QFHA 2E1PA 3AFGA 3CNQP 3BPSP 1ITPA 3A3PB 2Z57B 1SCJB 3P5BP 4JP8A 2W2OP 3VHQA 4K8RA 3H42A 3WIUA 3A3OB 3VV2B 2W2NP 4NE9C 2Z30B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCX P;  2ZWO A;  1V5I B;  4OV6 A;  4YN3 B;  3T41 A;  2ZWP A;  3SQO P;  1R6V A;  2Z2Y B;  2Z58 B;  3A3N B;  4NMX A;  3GCW P;  2W2M P;  3WHI A;  1SPB P;  3CO0 P;  2Z56 B;  2QTW A;  3BGO P;  2PMW A;  2Z2Z A;  3WIV A;  2W2P P;  2XTJ P;  2W2Q P;  3QFH A;  2E1P A;  3AFG A;  3CNQ P;  3BPS P;  1ITP A;  3A3P B;  2Z57 B;  1SCJ B;  3P5B P;  4JP8 A;  2W2O P;  3VHQ A;  4K8R A;  3H42 A;  3WIU A;  3A3O B;  3VV2 B;  2W2N P;  4NE9 C;  2Z30 B; 
#chains in the Genus database with same CATH topology
 3R2D J;  1GNK A;  3DFE A;  1TKZ A;  2GZO A;  4CDI A;  4B3T J;  2PI5 A;  1EP4 A;  2J6U A;  1KVI A;  3ZXW A;  4ZOS A;  1MWZ A;  2VQE J;  2DRB A;  4Q0B A;  3HSZ A;  1SI9 A;  2KYX A;  2UUT A;  3WHI A;  5KFQ A;  1N5T A;  3VAL A;  2BJE A;  1NU4 A;  2X1G A;  4WKR A;  4M5D A;  3KNG A;  4KYZ A;  4U8V A;  4UT4 A;  5F9L A;  2U2F A;  1SH3 A;  5DO2 A;  4DV1 F;  5IT4 A;  2IYI A;  2AKW B;  3CW2 C;  4DS4 A;  3V4I B;  2D1C A;  1XIQ A;  1IWG A;  1QUP A;  4WFX A;  1X4G A;  2K1R B;  5K8P A;  1FVS A;  4WU3 A;  3M8Q A;  2A10 A;  3T1H J;  3DRY A;  2CJY B;  1BQM A;  4ECV A;  5C25 A;  3BO4 A;  4B08 A;  4ZVE A;  2COL A;  3MXH P;  2AV5 A;  3DLJ A;  2HMI A;  2NYI A;  3K89 A;  1WEY A;  5J2P A;  4OHW A;  2A6M A;  4C8O A;  2P6S A;  2R7S A;  3DXS X;  1HNI A;  2O01 C;  2CPH A;  4DV3 J;  2HQF A;  1U2F A;  1ZM3 A;  3J7Y U;  2HZC A;  3H4D A;  2GHP A;  1G2E A;  1JLC A;  3KK3 B;  3DOL A;  5K20 B;  4JI1 J;  1GXU A;  3BQ2 A;  2DNY A;  4NLX A;  2OO4 A;  4K4W A;  2FC8 A;  1M5P C;  4ZP9 A;  1S99 A;  5J2Q B;  2CPZ A;  4K59 A;  4RW6 B;  4LBP A;  1VOM A;  1L3T A;  2UXD J;  3TQ1 A;  4HKQ A;  4ZVG A;  5KT4 A;  3ZTR A;  4DV5 F;  1ZZF A;  3NP5 A;  3HPO A;  5JJB A;  4NCG A;  2NS1 B;  3V4M A;  3BGL A;  4WTY A;  1JLQ A;  4WP3 A;  4OZJ A;  4KJI A;  3WZ0 A;  1YBA A;  4OI0 A;  2AT1 B;  2HEK A;  2VBZ A;  4AND A;  3O44 A;  5ETT A;  4EFA C;  3FZ2 A;  1GXT A;  3LOU A;  1XR7 A;  1S6P A;  1H0H B;  3LP0 A;  2DRA A;  3TR5 A;  3FGV A;  2N4C A;  4DR4 F;  3KLI A;  4Q45 A;  3KG0 A;  3HUL A;  1H2U X;  2UVU A;  3HKZ D;  4UF4 A;  4I69 A;  4X4N A;  1CJU A;  1RZM A;  1FTR A;  2D3O R;  3P5B P;  2XWX A;  3TAM A;  2CPJ A;  3NGK A;  1X5S A;  3K0J A;  4LF9 F;  1PYO B;  1H6K X;  3HKW A;  4URS A;  1RSC A;  3A8K A;  1UKU A;  4NLG A;  4JV0 A;  5B0A A;  2MGZ B;  1ULR A;  1HNZ J;  3K5M A;  2BBE A;  4WTO B;  3IMQ J;  1JLG B;  2HHH F;  4L74 A;  3K2Y A;  3MUR P;  1MWY A;  2Z4P A;  5LSO A;  4DR7 F;  3UCG A;  1UZH A;  3GFZ A;  3TRG A;  4LR7 A;  1FES A;  4Y2M A;  3QJP A;  5KFH A;  1LKZ A;  2LFV A;  4P6Q A;  4LMZ A;  1X7V A;  4B9N A;  4ZS6 A;  2Z2Z A;  2FJB B;  1YJU A;  3J81 j;  1PIL A;  3OLB A;  2OP5 A;  4OHZ A;  1FO1 A;  4DPX A;  3C3L A;  1TL3 B;  2ACY A;  3UR3 C;  5AXK A;  1HI1 A;  1U25 A;  2ZWP A;  2B43 A;  3ENV A;  1JMT A;  1X0P A;  2WON B;  2ROE A;  3GV7 B;  2XHW A;  3FMB A;  2FJW A;  2JHE A;  1EET A;  3GYN A;  5M2U A;  1XK8 A;  1F5C A;  1C0T A;  1JB0 C;  3ILJ A;  2RQM A;  3A8I A;  4OI2 A;  4ZVF A;  2XMV A;  4K2X A;  3AQO A;  3PV8 A;  2XB2 D;  1BHN A;  1B3T A;  4WKY A;  3SCL E;  1YJN S;  2XMK A;  3SQG B;  4JI5 F;  2YH1 A;  2HBQ B;  2HND B;  4A8X A;  2DGW A;  3VAM A;  4EBE A;  2OI2 A;  1FRI A;  1AZS B;  1WOP A;  3RB3 A;  4H4M B;  3M8Y A;  4P75 A;  4U7U K;  1CQN A;  2D9O A;  3DRS B;  2BQ3 A;  1FD2 A;  5HQM A;  2KVQ E;  1IWA A;  4YEA A;  2W8L A;  5GVQ A;  4RPF A;  2Y1I A;  4USV A;  4HAC A;  4ZVS B;  1N33 J;  4DWI A;  1S79 A;  1B4S A;  4DUT A;  3FRZ A;  1J5E J;  2MKI A;  1ZAV A;  5F3T A;  1ZPW X;  5LSR A;  1HNW J;  2QMX A;  1HHQ A;  2XY5 A;  2F4F A;  5E33 A;  5KOW A;  4X66 J;  4V1A k;  2BJ8 A;  2ZM6 F;  2HNY A;  3M7V A;  4NLS A;  4XPE A;  2IM1 A;  5HQL A;  6FDR A;  2MEW A;  4TYA A;  1JQG A;  5IM0 A;  4B17 A;  1DHM A;  2RJZ A;  1FE0 A;  1S1X B;  3M2U B;  4ICL B;  3LGH A;  4F2R A;  2E7W A;  2BOP A;  4RLE A;  4YHH J;  1KQG B;  5C2G A;  2XYP B;  3R1H A;  5K5M A;  2FLO A;  2PA3 A;  4MK8 A;  3T5H A;  3CJK A;  4I0W A;  1C1B A;  1RAE B;  3EVO A;  5KT6 A;  5LMU F;  2DEJ A;  3T6J A;  4DN9 A;  1HNV B;  1W26 A;  3N9U C;  1QLN A;  2N3O A;  3BGO P;  1BD6 A;  2N7C A;  2DNH A;  3KHG A;  2X1B A;  2HLU A;  3SSQ A;  1AUS L;  1LXN A;  3PAC A;  2AIR B;  1OS5 A;  1WOR A;  1DLO A;  3J7Y I;  3T5J A;  3CC7 S;  2O5D A;  4RUB A;  3M30 A;  1ZZN A;  3KK1 B;  2BVZ A;  4QW9 A;  5KFE A;  2MJN A;  2VG6 A;  3HX9 A;  5FDL B;  3FSY A;  3FK4 A;  3UN5 A;  1SL2 A;  5J1P A;  4OIX A;  1APS A;  1NK0 A;  3KNA A;  5ETO A;  5HP1 A;  1IKX B;  4RBU A;  1U09 A;  1TKX A;  3GR0 A;  4C7Q A;  3CDA A;  5F3Z A;  3RBE A;  4J9V A;  5B7W A;  2ZC4 A;  1F3F A;  4PQU B;  4ED2 A;  2B5J A;  3Q86 A;  1WC6 A;  4RUH A;  3VGS A;  2DYA A;  4OV1 A;  1NB2 A;  5T14 A;  4OHY A;  4CO1 A;  1MWQ A;  3CJ4 A;  2B8Q A;  5B0C A;  3EIC A;  3QFH A;  2KFY A;  4R0J A;  3HO1 A;  2LA4 A;  2IJR A;  4J9M A;  3MGJ A;  2R2R A;  4C11 A;  2AGQ A;  2OIH A;  4TN2 A;  2EFQ A;  4RNF A;  2C2R A;  1CS4 B;  4R25 A;  1C2P A;  1FER A;  2YX4 A;  3GB0 A;  2RH3 A;  4DU7 A;  1SL0 A;  2QO3 A;  4TU8 A;  3A8J A;  3SYZ A;  1Q8L A;  1WC4 A;  4QR2 A;  4NZ6 A;  1UEK A;  2Y3Y A;  3FZB A;  3I0R B;  4GKJ F;  1UVK A;  1LNQ A;  4U6P A;  1LK5 A;  4DL7 A;  4FXW A;  5CHC B;  3WC0 A;  2F9J A;  5A2Q Y;  4USW A;  2ZKT A;  4GRS A;  1TL7 A;  3N6L A;  1RBA A;  5KFB A;  2H51 B;  3C19 A;  4MJK A;  2CPE A;  5GAD U;  5HBM B;  1N0V C;  2H5I B;  3RUB L;  2DXE A;  4O4G A;  4JI6 J;  4PWW A;  2YNG A;  3NXZ A;  1XMQ F;  1S9G B;  3G9C A;  1YIT S;  2JVO A;  5C24 A;  4NLR A;  3S01 A;  3DU6 A;  1UEV A;  5M2R A;  3D2W A;  3AD7 C;  4IG0 A;  1FX4 A;  4TQS A;  4NCA A;  1PBA A;  1PG5 B;  4RBT A;  1J2V A;  1WJ9 A;  3M1V A;  2EPI A;  1FFS B;  2NLW A;  4YB6 A;  5D4P A;  2HSE B;  1T03 B;  4ZN1 A;  5IC6 B;  2XUL A;  1FXR A;  1TP7 A;  3J81 U;  2DR7 A;  1WDT A;  4RU2 A;  1NPP A;  2HUR A;  1HQE B;  1M5K C;  1WF0 A;  2R7V A;  3D66 A;  4KSE B;  4ECW A;  1I5O B;  4F0H A;  4MIW A;  4K2J A;  1GTE A;  2AJ2 A;  2NRE A;  2FQQ B;  4PG4 A;  1WHW A;  1JLA A;  5EGY A;  1RAH B;  3ZZP A;  2ZH9 A;  2B6A B;  3CWJ A;  1EB0 A;  2XSJ B;  2XHC A;  1XER A;  4Y65 A;  1OSC A;  3Q83 A;  2E44 A;  1S12 A;  2LA6 A;  3VAJ A;  3U1M A;  3CUL A;  1NAQ A;  3UPF A;  2O1P A;  4MKB A;  7FDR A;  2A2C A;  4G1Q B;  4NXM F;  2B56 A;  2NSB A;  4ZLL A;  2E1A A;  4PR6 A;  3OLA A;  2F7V A;  3WIU A;  1IKY B;  2DHG A;  5IZH A;  1KVK A;  1HLW A;  2A0F B;  3D6H B;  4F4Y A;  4IQX A;  3BGF A;  1S49 A;  3GJS B;  3OSN A;  4X64 J;  2C2N A;  3NCP A;  2IVF B;  1X5O A;  2G0C A;  1YK9 A;  1NSK L;  1BGX T;  1YSJ A;  2DNQ A;  2YVS A;  2VG5 A;  2KDO A;  3A4T A;  3DLL Q;  4JI4 J;  3IRX A;  3EZO A;  4QWD A;  3GPA A;  2WBM A;  2YNH B;  1T9T A;  4JV5 J;  3JSB A;  4TXS A;  1ZBT A;  1NHK L;  3QJL A;  2J9D A;  2KFZ A;  4ED7 A;  5CYQ B;  2H4Y B;  1Y9O A;  3BDE A;  5DDO C;  4M5N A;  5IS2 A;  4K4Y A;  2UXC J;  3MM9 A;  1WSV A;  2ZC3 A;  5K14 A;  1RTD B;  1S10 A;  2AX1 A;  4M5H A;  1L3U A;  1S6Q B;  3OXF A;  2OUG A;  3QRR A;  1WTB A;  1Y10 A;  1GT8 A;  1HPZ B;  5ETM A;  4I1T A;  4ZIW A;  1NDP A;  1Y11 A;  3MPY A;  1Q86 T;  3RZA A;  1I94 J;  3S1T A;  2J5A A;  1VIS A;  3G82 B;  3UD5 A;  1NBE B;  2OAU A;  3R97 A;  1X4D A;  2C2M B;  2PD1 A;  1N6Q B;  3NMA A;  4C8L A;  3CD0 A;  4BWJ A;  4ZIT A;  4LFA F;  3BR9 A;  2VA2 A;  4C8Z A;  5A2Q U;  1IQZ A;  1W2I A;  3OVA A;  2BXJ A;  3C66 A;  3MCS A;  2DNL A;  3JB9 k;  3C46 A;  1WWH A;  4Y00 A;  3HK2 A;  2LQ8 A;  1FJG J;  1FDB A;  2X3D A;  3SDE B;  3W2W A;  1EAY C;  3OXG A;  2KFN A;  3CJ5 A;  1F5A A;  3OUY B;  3TW0 A;  4ELU A;  3HHK A;  2ZKU A;  2YY3 A;  2PMZ D;  2ZBP A;  1J5O A;  3EX7 B;  4YR2 A;  4FVC A;  2MKY A;  1WG4 A;  4FNI A;  2W9B A;  4MMO A;  3UDV A;  3ZC4 A;  1F9H A;  3CD7 A;  4GC7 A;  3DGP A;  3QZ8 A;  3R5J B;  4RWX A;  2DNZ A;  1S1U B;  4W90 B;  1N56 A;  3QO9 A;  2VU5 A;  4AT1 B;  3M8P A;  1FK9 B;  3OT9 A;  4DX6 A;  2IM3 A;  3DLK A;  1IKV B;  1YJ9 S;  4DHV A;  1X4E A;  2HHU A;  1S59 A;  5LMN J;  5KG5 A;  4TLQ A;  3IM9 A;  2LKZ A;  2C2K B;  4USJ C;  2A3J A;  2CPD A;  1UVM A;  3RAM A;  2OSR A;  2IBK A;  2QT7 A;  2PSZ A;  2AU0 A;  5A76 A;  2WBR A;  2QN6 B;  1UEU A;  3NGU A;  4OYM A;  1V3R A;  1FJ7 A;  1RT3 B;  3ENA A;  5DZ7 A;  4CO4 A;  1U6B A;  4CH0 S;  5GAD I;  2DH7 A;  2HZV A;  2NPF A;  3UDL A;  5AXL A;  1N52 B;  1AW0 A;  4KGK A;  4DQP A;  3GIK A;  2GA7 A;  1KRP A;  4ETX A;  1RAO A;  2GQ2 A;  4AD6 A;  1IBM F;  4X62 J;  4YS2 A;  4F04 B;  3QSI A;  2RHS B;  1L3V A;  3MPW A;  1ZH5 A;  3LGM A;  4H54 A;  4I6W A;  1H2T Z;  4PPZ A;  4O0I A;  4ERD A;  2MKS A;  1WEL A;  3CCE S;  2R8I A;  1N54 B;  4YY3 F;  3M8W A;  1AFJ A;  5HMW A;  1GTH A;  2VFS A;  2ZZT A;  4E2F B;  3TVK A;  2V4J B;  3A3N B;  4C3M A;  1JLF A;  1PIE A;  2JEJ A;  4OZL A;  4ZN3 A;  2GO8 A;  1HBU B;  3T9Z A;  4U7U D;  2MST A;  3BGR A;  3I5A A;  5DGB A;  4UW2 A;  4B9U A;  3GYX B;  4D3G A;  3QJJ A;  1E6Y A;  1S9F A;  2GGP B;  1TVR A;  5LL6 d;  1VQP S;  2J0Q D;  3V6D B;  4ZPW R;  4F0K A;  4NCB A;  1WAC A;  2H4W B;  4Y0F A;  1RHR B;  2DB1 A;  4Z37 A;  1CJV B;  1H73 A;  3AT1 B;  3HFK A;  4DPW A;  4CLP A;  1PJ6 A;  3LPY A;  4HT7 A;  5E41 A;  3ILI A;  2KT5 A;  1XJW B;  2ZBI A;  1HBN B;  4U7C A;  2VKZ G;  4UY8 T;  5KG4 A;  2XSF A;  2YXL A;  4DUZ F;  2C2E A;  2ZBC A;  4YUD A;  3IG1 B;  4A46 A;  2XLJ A;  2CNK B;  4N7T A;  2ZH8 A;  3OL7 A;  4FF3 A;  1T11 A;  5I3P A;  4J9O A;  2HWH A;  3PX4 A;  4N41 A;  3GSD A;  4Q7A A;  3WX8 A;  4DSL A;  4AL6 A;  2M8D B;  1CJT B;  4XAK A;  5EHH A;  1XNR F;  3MR5 A;  4WZM A;  1UVN A;  1RKI A;  2R7W A;  1WG5 A;  3MHY A;  5L9N A;  3FMW A;  5B0D A;  2CJK A;  3MF5 A;  3CCU S;  1KP6 A;  3RYL A;  1RAJ A;  2CNO B;  2HKE A;  4DV7 J;  2BR0 A;  1JJ2 R;  2UV8 G;  4J9Q A;  1IJF B;  1HR0 J;  4CI0 B;  1P1T A;  1HWU A;  1YJV A;  4RW8 B;  2YQ0 A;  5H9F K;  3KLV A;  4WP8 A;  2VDH A;  3GV8 B;  2K3I A;  1R8B A;  3NWR A;  3HHN B;  1S97 A;  4PWD B;  1YKW A;  1T9W A;  2LYV A;  3U27 A;  5A0Y B;  2BKO A;  3EVW A;  3VZH A;  1L3S A;  4P2S A;  3PJX A;  1MN9 A;  3VZI A;  3X3U A;  1X4B A;  3MM6 B;  5IFM A;  1RTH B;  1X60 A;  1S0O A;  1NXI A;  2ASY A;  3VVU A;  2RKI A;  2F40 A;  2P8I A;  3K57 A;  3V4I A;  2VBX A;  2LCW A;  4FYD A;  2K1R A;  5AJ3 J;  4F25 A;  3NAH A;  1M5H A;  2ZE2 B;  4XO0 A;  3D6F B;  4JUZ A;  3L9Z A;  1Y0H A;  4ALZ A;  4YB1 P;  4NRU A;  1T0T V;  2J9C A;  4NLY A;  4E98 A;  3TZZ A;  3PKY A;  3MEC A;  3G6X A;  2UU9 J;  3GG0 A;  2MYF A;  2R7T A;  2HYI B;  4RW7 B;  4WXW A;  3TQE A;  2RQK A;  3MOZ A;  4JI8 J;  4OZ3 A;  3IP0 A;  3KK3 A;  2BW2 A;  3MEE A;  4QWB A;  2JLE A;  2OPP A;  1N5V A;  4NLP A;  2KJV A;  3IGV A;  3DLB A;  3GG1 A;  3OW2 R;  4ZLJ A;  1DQA A;  3SBM A;  5G4D A;  4RW6 A;  2XZW A;  5EWF A;  4LQ9 A;  3VVT A;  2UUA J;  2HVH A;  3BBF A;  4QCL A;  3W2V A;  1C1C A;  5J1N A;  3LPE A;  4IUF A;  2V94 A;  3KMQ A;  2XS5 A;  1KTQ A;  2DBB A;  2V34 A;  3PFO A;  2JEI A;  2DY9 A;  3IWL A;  4I67 A;  2E1R A;  4CLW A;  2V63 A;  3A8E A;  1JKH A;  4LRA A;  1T05 A;  3HHL B;  3IS9 A;  3I5B A;  3QWU A;  2UUC J;  4C8K A;  2VC0 A;  1NRK A;  2ZVS A;  3B82 A;  3DLG A;  3R9L A;  1V3Z A;  4HR2 A;  1YG0 A;  5HVH A;  1U2R A;  3BV8 A;  2FYX A;  2APO A;  3J80 Y;  3R27 A;  1R27 B;  3K5N A;  4DX8 H;  3VGU A;  3NRB A;  1Z4U A;  3PW2 A;  1UTA A;  1JLG A;  4LRE A;  4CH1 A;  4CQ1 A;  4DCO B;  4ZHR B;  1Q8K A;  3D67 A;  4DEZ A;  2BRK A;  2XNQ A;  3UO0 A;  3GJQ B;  5F0U A;  3M8R A;  4N77 A;  4OI4 A;  4DL2 A;  4J90 A;  3H5S A;  2VFT A;  1RWM B;  4ECU A;  2BOA A;  4R5P B;  4IYQ A;  5L8R C;  5CXT A;  1Q5V A;  2HHP A;  4ZCL A;  1U48 A;  1EP4 B;  4UQG A;  1DBD A;  3TEG A;  4U67 Q;  2GVD A;  4ES1 A;  1KWM A;  3PCO B;  4Q0B B;  4NLO A;  3OJU A;  3GIL A;  2MMY A;  2BZ2 A;  1XNQ F;  2KRB A;  1D1U A;  2XWY A;  2EWH A;  1ACM B;  1YJT A;  2PT0 A;  5HAN A;  3CJ3 A;  1GMV A;  2MLY A;  2FIU A;  2V69 A;  5G0R B;  2L9W A;  2QYG A;  4FS2 A;  2VFR A;  3GLJ A;  5EWE A;  3I9Z A;  2QA4 G;  3M8Q B;  2DIT A;  4M5K A;  3SQG A;  2MZR A;  1RHQ B;  1BQM B;  8AT1 B;  1RWN B;  4X84 A;  2ZBR A;  5C25 B;  2B7B B;  1SC4 B;  4PXD A;  2VJV A;  2DGQ A;  3H42 A;  3D0G E;  2GQQ A;  4CNY A;  2HMI B;  5KFS A;  5J2P B;  4H4M A;  1HNI B;  1HD1 A;  4FPI A;  4OYB A;  4K4X A;  4QYZ K;  3VR1 A;  4LBH A;  3WC2 A;  5CD4 A;  2V0N A;  3DOL B;  2DNP A;  1J27 A;  4UUX A;  4OX9 J;  2GCF A;  3GQC A;  2R7Q A;  4J9N A;  1WI8 A;  4NEY A;  4QR0 A;  5RUB A;  4LSN B;  5HMX A;  3OL8 A;  3IR7 B;  1M0S A;  1AYE A;  4Y2A A;  5HVG A;  2LP4 A;  1SKU B;  1PO6 A;  4OZ0 A;  4YB7 A;  3BSO A;  5BR8 F;  4PZV A;  4ID8 A;  2E5H A;  4DSE A;  2FJD B;  2XLI A;  4RW4 A;  4KHR A;  3H98 A;  4OX7 A;  2QJ3 A;  2QSW A;  4YME A;  2FDN A;  3HHL D;  1P27 B;  2WW4 A;  1S6P B;  4HT5 A;  2G0I A;  4FXD A;  2OEK A;  1XQI A;  5KFJ A;  3LP0 B;  3M2U A;  4PAA A;  2EKY A;  3KLI B;  3M9N B;  3PO5 A;  1VC0 A;  1R0C B;  1DAX A;  1CJU B;  1X4F A;  2WVD A;  3NMR A;  1IUJ A;  5DRK A;  2ZJQ Q;  2UVV A;  1VS3 A;  2B9X A;  3TAM B;  1JJ4 A;  2R8K A;  1HNV A;  1PC5 A;  4L73 A;  3Q8Y A;  4KRW A;  1W2B R;  2R9L A;  2IDE A;  3J80 U;  3EDR B;  4DX7 A;  3QT5 A;  3D1H A;  3HD1 A;  3V6J A;  4YN3 B;  5H9F J;  2W2P P;  2CFX A;  4RWW A;  1LWF A;  4MAK A;  1NK8 A;  4KPC A;  1O6X A;  1R8A A;  4HL9 A;  4IFY A;  1FT8 A;  1HL6 A;  3QGI A;  3CJQ A;  2QZ8 A;  3PXG a;  2C3U A;  5MLC V;  3I82 A;  3ZTO A;  3G71 S;  3K59 A;  3P49 B;  1FKA F;  3BKT A;  5AE1 A;  5F8L A;  5BYR A;  2AZ3 A;  2ATL A;  5F41 A;  4USU A;  2LQB A;  1IKX A;  2W2M P;  1WKJ A;  5MAO A;  4CLT A;  1B70 B;  2X51 A;  1DQ8 A;  4L75 A;  5CQG A;  2WSF C;  2O66 A;  3W7B A;  2Z0G A;  1S57 A;  4QIV A;  2DHA A;  2K3K A;  3NNA A;  3WQP A;  1VYA A;  1UJ4 A;  2RU3 A;  2OPQ A;  3ZZY A;  2KKH A;  3UCU P;  3BGU A;  2CQH A;  2J0S D;  3R5A A;  2XQC A;  3AB4 B;  4DR3 J;  4KGZ B;  1PAE X;  3ZZU A;  2CPX A;  1U6Z A;  1X4H A;  1VJQ A;  3IR6 B;  1C0T B;  4JI0 J;  4ZVH A;  3KOA A;  1N34 F;  3UD4 P;  1DFD A;  3KG4 A;  3S6E A;  1VQY A;  4NLV A;  4LR9 A;  4JI7 F;  1K44 A;  1Q8I A;  2HVD A;  2R7U A;  3Q8V A;  1TUV A;  3NS6 A;  3NBP A;  1CS4 A;  1UMJ A;  4JI3 J;  2MY7 A;  4MIA A;  2CG4 A;  3NWG A;  1XBW A;  4I2Q B;  2BJD A;  1X5P A;  3MR6 A;  4J9P A;  3QMQ A;  3DNC A;  3KKF A;  1RB0 A;  1RCX B;  3OTE A;  3FFI B;  4NLD A;  3BBB A;  2F3J A;  5D3G A;  1NSQ A;  3H0P A;  4OV6 A;  4KIA A;  2CZ4 A;  2CQ1 A;  4LVN P;  3HHD A;  4HAC B;  1TAU A;  3EZU A;  1ZM2 A;  2ASL A;  3C6U B;  2GIQ A;  1HWL A;  4ZJO A;  1REV A;  2A18 A;  4LSL A;  4Y2I A;  4KV8 A;  5KFD A;  1YJ7 A;  1S9G A;  4LUB A;  5KG3 A;  4F26 A;  2V5H G;  2HNY B;  1NB7 A;  3KLF B;  4FBT A;  3IR5 B;  1HWK A;  5IM0 B;  1XMO J;  4A8M P;  5AT1 B;  5K8M A;  2KO1 A;  4RNN A;  4B9L A;  3SFG A;  4F2S A;  2FHK A;  1KSP A;  1NSA A;  2MKK A;  2YWG A;  3VGT A;  4Y2K A;  3CJK B;  5KFF A;  2VIC A;  1C1B B;  2I1R A;  4M5J A;  3LQV A;  3ZFV A;  2FZK B;  2GJI A;  5A8R B;  4NZ7 A;  3FBE A;  1IJE B;  3AD8 C;  2HG4 A;  3MR2 A;  4QU7 A;  2BJ3 A;  2CJ9 A;  1HKA A;  2EEY A;  3WBZ A;  3MM7 A;  1TK8 A;  1EKS A;  4IDK B;  4DPY A;  5THW A;  5E5N A;  3DC2 A;  2XZT B;  1N32 J;  2ZJR Q;  1LWE B;  3JTN A;  1NJX A;  1ZOT A;  2CPY A;  3KJQ B;  3M30 B;  1HIY A;  3RB0 A;  2CDR B;  2XSJ A;  3PYD A;  2E9Z A;  2VG6 B;  2CRL A;  4P72 A;  4AUK A;  4HYK A;  3PKM A;  3QT7 A;  3LP2 B;  5DJB A;  3RR7 A;  1K0V A;  3VF0 B;  2HWI A;  2OEL A;  4AE5 A;  4ED8 A;  5HP1 B;  1NKB A;  1VQO S;  3BSA A;  3KUH A;  4JI8 F;  2V50 A;  3QAU A;  2XEX A;  3FEY B;  4FPR A;  2V4R A;  4FYX B;  4QWA A;  3TO8 A;  3OR2 A;  1DJ0 A;  4ECX A;  1X5T A;  2JC0 A;  1PAU B;  4PUO B;  2B5J B;  4LR8 A;  1FDN A;  3PHT A;  4DFJ A;  2ZNZ A;  1N36 F;  3HVW A;  1GMW A;  2C2D A;  1RT5 A;  3G6E S;  3CGI A;  1HYS A;  4LF5 J;  4C11 B;  2OEM A;  2JRS A;  3MTK A;  4DV4 F;  1LEO A;  3TX0 A;  3D7S B;  1TQL A;  1RP5 A;  2VQF F;  4ED0 A;  3B4D A;  2J6S A;  3PEH A;  3PEJ A;  5SUH A;  3FEX B;  4K4T A;  1ZA2 B;  1BLU A;  4NOH A;  2C2Z B;  4N5S A;  5HAO A;  1YX2 A;  4C4W A;  2EK1 A;  2LLZ A;  2E7V A;  2JX2 A;  2FUG 9;  1SXL A;  1NLK L;  1NPK A;  2VBW A;  4G65 A;  3UVJ A;  4F67 A;  3RB6 A;  4LIW A;  3VAH A;  1KHV A;  4AXI A;  3UI3 A;  4XDD A;  1HD0 A;  2OPS A;  1TL7 B;  4ED5 A;  4B3S F;  2XMA A;  3MI7 X;  4O4G B;  2F4V F;  2HQI A;  2RUG A;  2F8M A;  5B0G A;  2LQ5 A;  1N5Q A;  2CZV C;  3U02 A;  2EFO A;  2X1F A;  2KT2 A;  4C48 A;  2YPZ A;  2QLB B;  4I7F A;  3IWX A;  1BMQ B;  2Y1J A;  2ZH7 A;  5FJ4 A;  4QBU A;  3LO3 A;  3T1A A;  3M1V B;  4GKK J;  2L48 A;  3EE3 A;  3O2I A;  3NGD A;  3NL0 A;  3CCS S;  4DXL A;  2K8G A;  2H5J B;  4F3M A;  4J9L A;  3U1N A;  4TY9 A;  4CT8 A;  2RAQ A;  4DR1 J;  4P52 A;  4LF4 J;  3A3O B;  4BBY A;  3QFW A;  3TI0 A;  2XNR A;  3FC9 A;  1B7Y B;  3G4S S;  3RAX A;  2CJB A;  2CZ9 A;  3H5U A;  4RW9 A;  3TX8 A;  1CJK B;  2CQ2 A;  3T6B A;  1RU2 A;  2HVI A;  1PC4 A;  3P5T L;  3OTD A;  3DOM B;  3CXC R;  2DIS A;  4CTA A;  2HGM A;  1Q81 T;  1S0M A;  4DG1 A;  3KLH A;  1WDD A;  3RG6 A;  1NH8 A;  2RE1 A;  4TU7 A;  2NZC A;  2JEF A;  2MZT A;  3RR8 A;  3FDS A;  1EQM A;  2BJ1 A;  1YVF A;  3EUN A;  2IM2 A;  4LF8 J;  2IC3 A;  3F41 A;  1JLE A;  4PQA A;  4H4O B;  2FHO B;  2WSC C;  2RU9 A;  3DMJ A;  4GVB B;  3KHH A;  2BQR A;  1NJZ A;  4LVO P;  3P45 B;  4M63 A;  2I0X A;  1JIH A;  2VG5 B;  3AY0 A;  3IRX B;  4ZP6 A;  4TVA B;  2W9C A;  2HIQ A;  4FYV B;  3Q2T C;  1X4A A;  4OQJ A;  3E3X A;  3VAK A;  3CME S;  4JV2 A;  4PG5 A;  3QYY A;  1HI8 A;  3MM9 B;  1I51 B;  3N0V A;  2Q1L A;  1NJI T;  2N82 B;  1HBU A;  1UP1 A;  2MQP A;  4CO2 A;  5KFW A;  2R7R A;  4TNO A;  4YP3 A;  3QAT A;  3AAW B;  1JWW A;  1VHI A;  4FF2 A;  2Z2L A;  1RT2 B;  4X65 F;  2LQJ A;  3TZY A;  4WFN Q;  2KXF A;  1PJ7 A;  2HFS A;  2B9E A;  2ZVI A;  5IT9 Y;  3AXM A;  2QLF B;  2HFO A;  2RD5 C;  3D0I E;  4NLU A;  5JVG Q;  3MR7 A;  2V2Q A;  8ATC B;  3T1Y F;  1YIJ S;  5GAG U;  3ZTS A;  2WK4 A;  2YNF B;  3V2U C;  3QAE A;  2IFX A;  4FF1 A;  3U1L A;  2DGX A;  1MML A;  2HAI A;  4CLS A;  1HNX J;  1NK7 A;  3D1O A;  1OJ4 A;  4DV2 J;  2XCA A;  3W2W B;  5D4O A;  3MCN A;  5A8W A;  2JOQ A;  4M8L A;  2VPW B;  2RUS A;  3AHP A;  2MZJ A;  1GMU A;  1GX5 A;  1J5O B;  3IN5 A;  3EVM A;  4YDD B;  1HAR A;  1FWL A;  3CIZ A;  4RR5 A;  5KT7 A;  5KFK A;  2MDA A;  3GSI A;  3DGP B;  2O67 A;  4IO1 A;  2GJ2 A;  5C42 A;  1YTY A;  3JYT A;  5IOL A;  3RBD A;  3E2E A;  1BWV A;  1M5O C;  2DCU B;  3QO9 B;  4KAI A;  3RBZ A;  2V8G A;  3M8P B;  2I38 A;  2AWZ A;  3H90 A;  4KGX B;  4Y6I A;  4LFC J;  2JSX A;  2F65 A;  3MMA A;  1BXN A;  3DLK B;  4OJG A;  3L95 X;  4F3O A;  3TOQ A;  5L46 A;  4N76 A;  1CLF A;  4WFB Q;  5DLF A;  4PWD A;  2CXE A;  2RHQ B;  2OHD A;  2JVR A;  4YFU A;  2CQP A;  4FP9 A;  1JXE A;  4ZJL A;  4DX5 A;  2ZDO A;  3KJV B;  3D1Q A;  1U1L A;  3MM6 A;  3ULH A;  3ZZ0 A;  2UUB J;  3P4U B;  2BKP A;  4URG A;  4WFA Q;  5IC4 B;  2W4C A;  3FCW A;  3FEZ A;  1SIZ A;  2BE7 D;  3CO9 A;  1FEE A;  4B3M F;  5HK4 A;  1NK5 A;  5D8H B;  1KHW A;  4NA2 A;  3AOB A;  2BJ7 A;  2YKA A;  4EMD A;  4X4U A;  4B3R J;  2BYC A;  2OH2 A;  5GAH U;  2EFV A;  4LBI A;  4CO0 A;  2HFN A;  4I6A A;  2GO9 A;  5JMN A;  2QFJ A;  3PHE A;  4DFK A;  3H25 A;  3IGN A;  2GV1 A;  5KFA A;  2W7A A;  4AL5 A;  2BE9 B;  2Y1L B;  1YLX A;  3DDK A;  4A4J A;  1LWC A;  3T3F A;  4K50 A;  1VLO A;  1JLF B;  2GVZ A;  2P6T A;  1UWB A;  4AQY F;  4CIO A;  2XMW A;  4C8N A;  3BGR B;  2MQN A;  4IQM A;  1E6Y B;  1TVR B;  5IWA F;  4X4R A;  3VV2 B;  2QG9 B;  4PPD A;  2O3D A;  2ZD1 A;  4RNO A;  4PG7 A;  2XY6 A;  1YZ6 A;  4LF6 J;  4FS1 A;  3C2P A;  5IT9 U;  4HTI A;  1T9U A;  2DR8 A;  3A3P B;  4DZ6 A;  3HT3 A;  3OTO F;  1WC3 A;  4ECZ A;  4IFV A;  4MKY A;  3IWN C;  4C9D A;  3W66 A;  4F7V A;  1QSY A;  2RSQ A;  2W2O P;  5KG7 A;  1NND A;  3GMG A;  3BH6 B;  1HHS A;  1IBL F;  3SEO A;  4KH1 B;  1NKC A;  3ILO A;  3UQS A;  1SH2 A;  1PSD A;  4KO0 B;  4KY3 A;  1N5Y B;  3D0H E;  1DTT A;  3Q8Q B;  3OV7 A;  2W4D A;  3UWT A;  2YKN A;  4RZR A;  3H2V E;  2AHO B;  1Q16 B;  3LWM A;  3CTR A;  3UW1 A;  1SBR A;  3ETM A;  3LGN A;  3G86 A;  1VDH A;  4ZPA A;  1FRX A;  1R0A A;  3SIP B;  2QGF B;  5B0B A;  1IBK J;  1SJ4 P;  2GC8 A;  4ZPV R;  3PW5 A;  2MLZ A;  4OZN A;  5E3P A;  1HMV A;  1XR5 A;  2LDI A;  3BR8 A;  4DV0 F;  4K0K J;  3BZQ A;  3MAH A;  2ZWO A;  2K2P A;  1FRH A;  2PA8 D;  2IHR 1;  2AEF A;  4O0N A;  3NGR A;  5D15 A;  1P6T A;  2CVI A;  1CC8 A;  3FBF A;  2IRU A;  2PMH A;  1URN A;  1EJ7 L;  2OEJ A;  5E3Q A;  2R7X A;  2RKI B;  5G0R A;  3TVZ A;  2J7W A;  3D54 A;  4EZ6 A;  3ISZ A;  4USK A;  1IM4 A;  2KB2 A;  3M2V A;  1PYS B;  4KFB A;  5HI7 A;  5GAG I;  1HWJ A;  3FQL A;  2Q6B A;  3UDC A;  3H7H B;  4JI2 J;  1A6L A;  2R42 A;  3R5C A;  2GML A;  1IR2 A;  1YGY A;  4WK1 A;  3MEC B;  4FYW B;  4N8N A;  1A7G E;  2GX8 A;  2HHX A;  1H2V Z;  4WF9 Q;  4DR2 F;  3MUT P;  3W3S A;  3VCD A;  1RT4 A;  3PJW A;  7FD1 A;  4WK3 A;  2YWK A;  3BBC A;  2VPX B;  4DV6 F;  4OJ1 A;  3I55 S;  3MEE B;  2OPP B;  5J1E A;  1QSL A;  4K4S A;  4M94 A;  2ZH5 A;  3TUP A;  1UW4 A;  2M9K A;  4LSN A;  1T7P A;  1O51 A;  2UXB J;  1LXJ A;  2V8H A;  3NY0 A;  2AJF E;  3DOK A;  3VAF A;  4DI6 A;  3W2V B;  1N48 A;  1C1C B;  1TL5 A;  3A1Y G;  4XTT A;  4Q2L A;  3OHA A;  1RWK B;  2YKQ A;  3VGV A;  1PGZ A;  4L3N A;  2K7J A;  2VOO A;  2R4F A;  2L41 A;  2VL1 A;  1E6V A;  1WF1 A;  4B9T A;  1W7W A;  2LU2 A;  1QSS A;  1JKH B;  1T05 B;  4FVM A;  4ES3 A;  2YWH A;  4Z7C A;  3IS9 B;  3LH2 S;  2NXJ A;  1XTZ A;  4UOG A;  4FYY B;  1WOO A;  4C2M A;  3S7R A;  2NXU A;  4BDP A;  2KM8 C;  3DLG B;  2PO4 A;  3NOC A;  4ZIV A;  2DR5 A;  3KTQ A;  4C8Y A;  3M2R A;  3MEG A;  4DSF A;  5DG9 A;  2G9O A;  2WB1 D;  3MMC B;  3BB5 A;  5GAH I;  1SPB P;  4BC9 A;  2R8H A;  2E1P A;  2RS8 A;  1Q5Y A;  5AE2 A;  5FLX Y;  1JJH A;  3LAN A;  1RCO B;  2NYH A;  5L1K A;  4X4S A;  1OY9 A;  1N0U A;  3BYR A;  2BUN A;  3AOD A;  2Q43 A;  5LXR A;  2WVB A;  3G8S A;  2VD3 A;  3C8Y A;  2MKJ A;  1B99 A;  4O3P A;  1VC5 A;  1ZTT A;  3V6H A;  2IVY A;  5D0E A;  2D69 A;  3ENQ A;  2I5J A;  4U8Y A;  2HK2 A;  3OSP A;  2GVD B;  3PJ9 A;  3OPK A;  3FCV A;  3IC1 A;  5IQ6 A;  2HFZ A;  2M3D A;  2KXH A;  1PJ5 A;  3RRG A;  4DR5 J;  1R43 A;  2ZBQ A;  2UV8 A;  3HI9 A;  1TL4 A;  2VUG A;  3TA1 A;  2VPY B;  1U47 A;  1D3W A;  4ZCM A;  1U8W A;  1AB8 A;  4KC5 A;  1U26 A;  3DRP A;  2QTW A;  1RUS A;  4CLL A;  1LW0 A;  1HWI A;  2CQB A;  4NYZ A;  1O5J A;  4EZ9 A;  4KHP F;  1X31 C;  4IR1 A;  4DUY J;  5D0G A;  2QLJ B;  3DM2 A;  4JYA F;  4WYW A;  3L7O A;  3MMB B;  4ETZ A;  3HZG A;  4I2Q A;  5C7P A;  1Y3K A;  3CIM A;  2XG8 A;  3G6Y A;  3SCJ E;  1FI4 A;  5KT2 A;  4CLZ A;  3FFI A;  1Y5N B;  3US5 A;  1TUW A;  1SKW A;  2DHX A;  4OLP A;  1NDL A;  4QPT A;  1HBM A;  4DV2 F;  3TJA A;  1ZYQ A;  2JEG A;  2F8E X;  2RB7 A;  5J2M A;  4OYP A;  3C6U A;  2VKR A;  1S6O A;  3K7R A;  5L1J A;  4ATN A;  4YR0 A;  1M1K T;  4BHQ A;  1YDL A;  2FHM A;  3GE9 A;  3BQ1 A;  2EG2 A;  2C3P A;  2C22 A;  4RW4 B;  1GAO A;  2RQ4 A;  3PX6 A;  3KLF A;  4DSJ A;  2V2K A;  1HQU A;  3BJY A;  1Q82 T;  1JLB A;  1S48 A;  1M1G A;  2HRU A;  3PW7 A;  2QSF A;  2AJ4 A;  2NXN A;  1QVF R;  1GQE A;  1WHV A;  4DV1 J;  2DR9 A;  2MJU A;  3OD2 A;  1CVJ A;  4I2P A;  4ELV A;  3V6K A;  1KC8 T;  3GIJ A;  5LOQ A;  2AGO A;  3IA0 A;  5A8R A;  3CJR A;  1TMM A;  1P9Q C;  4P9S A;  2FJX A;  2DTJ A;  3AQP A;  4BWM A;  2PMW A;  2IJN A;  2DGT A;  4ZPC A;  1HW9 A;  5KFO A;  2E5L F;  2BE2 A;  2AP6 A;  3HVT A;  2AJQ A;  1FXL A;  2XI2 A;  5DQI A;  2Z57 B;  4O23 A;  2MHN A;  3P3D A;  3QIP A;  4IDK A;  5FLX U;  3PIP Q;  2JL9 A;  1LWF B;  4TYB A;  1LWE A;  3ZZT A;  2KRR A;  5HVF A;  2QMW A;  4JV1 A;  2PE8 A;  3LTO A;  4IFY B;  2FZC B;  4NRT A;  1RA6 A;  3PDN A;  1FX2 A;  5CCL A;  3IBW A;  3F56 A;  5E3C A;  1XWL A;  3P8B B;  2R2U A;  1RTJ A;  1MW7 A;  3LP2 A;  3JSM A;  4Y3C A;  2RNE A;  1NPR A;  2EC0 A;  3AJ2 A;  3HHL C;  1DQ9 A;  3N28 A;  4L3K A;  4A8W A;  4DV5 J;  1FRK A;  1TKT B;  4HDG A;  5HSP A;  2CQC A;  4FN5 A;  1Q1K A;  4DQS A;  3HJF A;  2ZUG A;  1SQE A;  2HNZ A;  1YRU A;  3AJ1 A;  1M5S A;  1Y00 A;  2OPQ B;  3PO4 A;  4PUO A;  3KFW X;  4IH6 A;  1SVD A;  1FWP A;  3PYG A;  3K58 A;  1BQN A;  3A12 A;  4DR4 J;  1D8Z A;  4GC6 A;  2RML A;  4PEO A;  3R2C J;  4PG8 A;  2CJA A;  3OTB A;  3NBP B;  5A8K A;  2FLN A;  1WEZ A;  2XS7 A;  4IOB A;  4DQI A;  4OLO A;  1C4C A;  4LF9 J;  3V81 A;  3D68 A;  4KE5 A;  2KG1 A;  1AT1 B;  1MRO A;  2V8D A;  3H2U B;  3W5X A;  1SJ3 P;  3DN9 A;  1XEZ A;  1Z2Z A;  4WU2 A;  2HHH J;  3LAL A;  3O5T B;  2FHJ D;  4DR7 J;  4U95 A;  5D3G B;  3PIO Q;  5EX0 A;  2OPR A;  5D4L A;  3M32 B;  4DCP B;  2LMI A;  1GH8 A;  1VQ8 S;  3CMA S;  1KTV A;  1NJY A;  4LFB F;  4KR0 B;  4B3O A;  4RNM A;  5F9N A;  4W92 B;  3AD9 C;  4NPO A;  5KFP A;  3IRW P;  2MSS A;  1REV B;  4LSL B;  3F44 A;  4KV8 B;  3PR5 B;  5ETS A;  4A8F A;  3GFX A;  1KFD A;  1QAX A;  5B0F A;  2RT3 A;  3MPD A;  2AEM A;  2QIF A;  1S9E A;  5EWG A;  1M5V C;  2DT9 A;  5DLG A;  4B3T F;  1YQH A;  1RWX B;  2HHV A;  4LQ3 A;  1D9F A;  1VLY A;  3DDI A;  4LSZ B;  2FJA B;  4PYD A;  2B7C B;  4UZC A;  2VQE F;  2FVP A;  2KU7 A;  1VGY A;  4B9S A;  3R8Y A;  2Y1R I;  3MAQ A;  3OL6 A;  1UPM B;  4UUW A;  3DXB A;  4CZC A;  2MXY A;  2A6O A;  4C98 A;  2XLK A;  1JK9 B;  3H2L A;  4M1K A;  1GFW B;  4YOE A;  1SB6 A;  5IV4 A;  1U0H A;  1S0N A;  3MM7 B;  4CCH A;  3ITH B;  1EAR A;  1WHX A;  4K4V A;  2YX7 A;  4LIR A;  1OSD A;  5L1I A;  5HRO B;  2VB6 A;  2B3T B;  4ER8 A;  3ZNJ 1;  3QGG A;  2XO6 A;  1CJK A;  2IRX A;  3MPU B;  4F4Z A;  1NH7 A;  3T1H F;  2MPU A;  2DGS A;  2NQP A;  3SI8 A;  3A13 A;  1FXD A;  3DOM A;  4TY8 B;  2QLX A;  1RWW B;  3ZO7 A;  3B78 A;  2MQQ A;  1WKK A;  2DY1 A;  4DV3 F;  2QEX S;  1U1R A;  2MY8 A;  3TWZ A;  3MEK A;  3HHE A;  3IBF B;  4ZMM A;  4JI1 F;  1VQ5 S;  2DGO A;  3KJF B;  3SQO P;  3GCW P;  2ZFH A;  2DO0 A;  3AJD A;  2MQL A;  1T94 A;  3BN4 A;  4H4O A;  4OYI A;  1UWA A;  3OR2 B;  2ZM6 J;  1EIY B;  4GVB A;  3GJT B;  2UXD F;  4ECR A;  1YWX A;  2YKM A;  4TKT A;  3M8S A;  3EGV A;  2AEJ A;  4NMX A;  1U1M A;  2RIJ A;  3TA2 A;  1YRX A;  1KQS R;  2EFN A;  2G2Y A;  2CYY A;  4IO9 Q;  1RT5 B;  3UNY A;  2NCK L;  1HYS B;  5KFG A;  5I3U A;  2J8A A;  4JB8 B;  5L9X A;  2HGL A;  1YBT A;  2B51 A;  2DGU A;  3QWP A;  4F0M A;  5LMU J;  5DG8 A;  4HH1 A;  2HRT A;  2VPZ B;  2E9R X;  2DKO B;  3E8O A;  3W65 A;  3OJS A;  4GVL A;  3ZTQ A;  2BDP A;  1RT2 A;  1KR4 A;  2FJV A;  4E8U A;  1X0F A;  2DGV A;  1VQS A;  2VZ9 A;  5HLF A;  2ILY A;  2IA6 A;  1D9D A;  2HBY B;  1SUQ A;  3JS9 A;  2XBP A;  1IM6 A;  3W9H A;  3CJS A;  4ECS A;  5HJY A;  3OHB A;  4K4Z A;  3UVJ B;  5GMK a;  4LRD A;  4AYB D;  3PX0 A;  2BAN A;  3SV4 A;  2BX6 A;  1HNZ F;  2OPS B;  3OFG A;  3BYP A;  3M9M B;  1S72 S;  5EX3 A;  2V2Z A;  1C0U B;  3NS7 B;  3GII A;  2HHT A;  3CDU A;  2YWW A;  2DIV A;  2YNF A;  4ZPT R;  3I0S A;  3EPG A;  1P9Y A;  1RXO B;  3Q8U A;  2R7O A;  3ELH A;  2IRY A;  3CCL S;  3DRX A;  3DCA A;  3DRR A;  1V3S A;  1B64 A;  1DTQ A;  2CIM A;  1U0S A;  2ZIT A;  3HSG A;  1ZAX A;  3OFH A;  5E3A A;  2R3V A;  4CLK A;  4I7F B;  2NUU G;  5CZV A;  4PWU A;  4CLF A;  3UNG C;  1HW8 A;  4C3L A;  2PC6 A;  3FJ2 A;  1R3N A;  4KKO B;  3OTC A;  2XI3 A;  2J8S A;  4CNZ A;  5LJ5 Y;  5H1S V;  2IA0 A;  2JH3 A;  1GK8 A;  2GW8 A;  5FII A;  5KT5 A;  4ID5 A;  1WC0 A;  2C1E B;  3CJ2 A;  4A48 A;  2MZQ A;  1UA1 A;  2L9D A;  3SMZ A;  2MHE A;  2L9N A;  4RW9 B;  4DL5 A;  3VQS A;  3JTP A;  4UY8 5;  3HD2 A;  1TKD A;  4EO6 A;  1FHT A;  4OHV A;  3Q23 A;  3KJV A;  3V5R A;  2AYB A;  4GKJ J;  4CTA B;  1OO0 B;  4QIG A;  4R0E A;  2HWT A;  2D7S A;  4DG1 B;  3KLH B;  3KLE A;  2KYZ A;  1UFW A;  2HHS A;  4P7V A;  1FDD A;  5KG0 A;  2IDL A;  2W24 A;  3VAI A;  3CT9 A;  2YWF A;  3BEG B;  4DJB A;  2AYM A;  4A8Q A;  1RKJ A;  2QLW A;  2FGO A;  2IC3 B;  4IOC Q;  4GO5 X;  4EWT A;  3HP6 A;  1XMQ J;  1JLE B;  4F4K A;  1N33 F;  4EEY A;  1WF2 A;  3DMJ B;  2AX0 A;  2C28 A;  1J5E F;  2OML A;  4BCA A;  1EZZ B;  2KM8 B;  5I42 B;  2ZH3 A;  2XMT A;  1X4C A;  1GMW D;  2W9C B;  1P8G A;  3I6P A;  4MYT A;  1HNW F;  4PCQ A;  3IO1 A;  4X66 F;  1L5U A;  3LF0 A;  2J0W A;  3NS5 A;  5KFM A;  1SV5 B;  3NGT A;  1Q53 A;  2IJF A;  2N4D A;  4X4T A;  2BAB A;  1WUU A;  3NCQ A;  2CAJ A;  1RAA B;  5CYM A;  4MTP A;  4YHH F;  3PVX A;  1FRM A;  3R6G B;  3SXL A;  2MKH A;  3N4W A;  4KPY A;  3FBB A;  1BQX A;  1WOS A;  2BKN A;  1U1Q A;  3M05 A;  1B0T A;  2BM1 A;  4O4R A;  4OZ1 A;  5B0E A;  9RUB A;  1ARO P;  5FD1 A;  2CNL B;  1OWX A;  1RT7 B;  3K17 A;  3QZ7 A;  1D8Y A;  1T02 A;  1D09 B;  2RVJ A;  1K73 T;  1NO8 A;  1VIX A;  4ED4 A;  4NXM J;  2M0G B;  3G96 A;  4DMZ A;  2JC1 A;  1NJW A;  5GAE U;  5KG1 A;  1F9E B;  4DLG A;  3DDN A;  2W25 A;  3G8Q A;  5A8W B;  4N47 A;  4C0B A;  4KO0 A;  1N5Y A;  3LP1 A;  1TR0 A;  2VON A;  3EYZ A;  1RK8 A;  5JVH Q;  1RBO B;  2OMO A;  2ROP A;  3NKY A;  1RQ0 A;  1F3V A;  4QZV B;  3C15 A;  1QTN B;  2R8J A;  5C42 B;  3JYT B;  3M4X A;  4DQQ A;  2YX1 A;  5ETP A;  3RU0 A;  3MM5 A;  1UW9 A;  3DI6 A;  2GIR A;  5BJR A;  2ZNY A;  4DL4 A;  3MDF A;  2JFD A;  2ZH6 A;  2IVM A;  3MMA B;  3ISN D;  5L39 A;  3EGW B;  2AYG A;  2IAJ A;  4CYU A;  2LQ9 A;  3CDW A;  2VFU A;  3MM8 A;  4H4K A;  1IR0 A;  1OY8 A;  2DNG A;  3CDB A;  4NE9 C;  1VI7 A;  4F4W A;  1H7W A;  4DL3 A;  3GFY A;  1CUL A;  1WHY A;  2HS0 A;  5F8G A;  1FKO B;  2XY7 A;  4CLU A;  1RGV A;  3K8V A;  3RB4 A;  4K8R A;  3CCM S;  4LFA J;  1CG2 A;  3DKD A;  2ZH1 A;  5JUM A;  2DNM A;  2H48 B;  1NEE A;  4Q8F A;  2ZHB A;  5HQ8 A;  2RRA A;  3HSD A;  2XZD B;  3ICL A;  2EFG A;  3POT A;  4OYZ A;  1EQ0 A;  4UTG A;  1TTH B;  2PI4 A;  5F8H A;  4OFZ A;  4OX8 A;  1MMD A;  5DQG A;  4JI6 F;  4DFM A;  3CJ8 A;  3SCI E;  4FDF A;  1LWC B;  1D9A A;  2NXE A;  7AT1 B;  2B9Y A;  3IAS 9;  4S0M A;  2GVZ B;  4CO3 A;  3PTW A;  3CCJ S;  1UWB B;  4J5O A;  2JZ5 A;  3CMQ A;  3I9V 9;  2ZEJ A;  3MUM P;  3QGP A;  1VBX A;  5ETR A;  5BXI A;  4ILR A;  2LEB A;  2ROG A;  2I2Y A;  1RWV B;  2E7X A;  1IQT A;  2ZD1 B;  4U9R A;  5AXN A;  2CA9 A;  3TVY A;  3P6Y C;  3J7Z 5;  2VG7 A;  5HMY A;  4OYW A;  1VR6 A;  4PXB A;  1T3O A;  4OYX A;  1VQ7 S;  1BUX A;  1WNE A;  1FRJ A;  4IFV B;  1RU1 A;  5CH7 B;  3Q2S C;  2VFV A;  2E5I A;  1W25 A;  5CCM A;  3MMC A;  2E9T A;  1ZM4 A;  3W63 A;  1I1G A;  2KHD A;  1Q79 A;  4PXC A;  3DGV A;  3MMJ A;  1S5Z A;  2H54 B;  2Z30 B;  4NI2 A;  2DNO A;  3L4B C;  1DTT B;  1IBM J;  3I5C A;  4NLQ A;  1UVJ A;  5C2C A;  2LXF A;  2CPF A;  3ZTP A;  2YKN B;  2AGP A;  5KT3 A;  1CC7 A;  2VDI A;  4X64 F;  4YY3 J;  4EYI B;  3IBC B;  4ENO A;  5E2Q A;  1R0A B;  2C42 A;  3CB4 A;  3MR3 A;  4MK9 A;  5D0H A;  1H72 C;  4JI4 F;  2E1M C;  4Y28 C;  4JV5 F;  2KG0 A;  5KFZ A;  5HMZ A;  1R6V A;  1HMV B;  4NWB A;  4FF4 A;  3BSN A;  2HFU A;  3WIV A;  3EJM A;  2JFK A;  3PYF A;  4KQZ A;  4GMK A;  4PG6 A;  1Q7L B;  2UXC F;  4MIB A;  3J81 Y;  8RUC A;  5KTQ A;  1Z1Z A;  4U96 A;  2AZ1 A;  1NHV A;  5ITH A;  3CSK A;  3MFH A;  3T5K A;  3PZP A;  4F36 A;  3PYE A;  3N5F A;  2W9A A;  1N4L A;  1S4F A;  2ASD A;  2V68 A;  1NZA A;  1S1T A;  3M2V B;  1I94 F;  4KFB B;  3Q8S B;  1VQN S;  4WII A;  3F0N A;  3TJ8 A;  2ZH2 A;  3H40 A;  2CQD A;  1MU2 A;  4DUZ J;  3MAA B;  1ITP A;  5GAE I;  4F4A A;  2P2C B;  3FNN A;  3TA0 A;  3MMB A;  5HJX A;  4V19 X;  2FD2 A;  3OXL A;  1LW2 B;  4ZDN A;  2VA3 A;  3PY8 A;  2MB0 B;  1XNR J;  5CYJ A;  3MWB A;  1RT4 B;  2LEP A;  1KNZ A;  4P73 A;  4I64 A;  4KTQ A;  1TMJ A;  1IN0 A;  2YQ1 A;  2FHJ A;  5EUH A;  5J1E B;  3EMT A;  2Z8Q A;  1FJG F;  2GNK A;  3CO0 P;  1RTZ A;  3DOK B;  2MZS A;  1SCJ B;  1OQ3 A;  1RTI A;  5B08 A;  1KLM A;  1Q4R A;  4CP5 A;  3PRD A;  5IT0 A;  5F8M A;  1ICE B;  1FVQ A;  3OFF A;  1FTC A;  2VJU A;  1E6V B;  1CBK A;  4XDC A;  2K7K A;  3WDO A;  2HBR B;  2PN6 A;  3NG8 A;  4O3O A;  3D6T B;  3C16 B;  2XMJ A;  2ABY A;  5LMN F;  2QMU B;  2CVE A;  1JX4 A;  1YHQ S;  1RHJ B;  2I8E A;  4QJV A;  4ELT A;  3EDQ B;  4WYL A;  3M2R B;  5KFV A;  3RRH A;  3MEG B;  3KXD A;  1Y5I B;  4RKU C;  4HHH A;  2PEB A;  2XO7 A;  1TZ0 A;  2WVF A;  4C0H A;  3ADA C;  2QA1 A;  2IPO B;  2F9D A;  1SL1 A;  4EK2 A;  2EW9 A;  3PR4 A;  2FJE B;  2VIH A;  3I4P A;  3DHX A;  3GON A;  3QID A;  1NHU A;  1MSW D;  2QC3 A;  1A9N B;  1X9S A;  4NXN J;  3I32 A;  4O3S A;  4C97 A;  5A6P A;  3PW4 A;  3GU0 A;  3MOJ B;  2MQO A;  3R7S B;  3F73 A;  3GR1 A;  2LVW A;  4RUA A;  2CQ4 A;  1VJW A;  2RS2 A;  4OL8 A;  5H9E K;  4X4P A;  2H65 B;  2G4B A;  2WOM A;  2EBE A;  5L38 A;  2BEF A;  3J7A N;  3W61 A;  2D9P A;  2OLW A;  2DEI A;  1U49 A;  1RWU A;  3HM9 A;  4X62 F;  4HEA 9;  3IFE A;  2YQ3 A;  2OFH X;  1FNX H;  5M2P A;  4RO0 A;  2I5J B;  1K8A T;  4Q8E A;  4EI2 A;  3DYA A;  1TKT A;  3H8Y A;  2KH9 A;  4D3H A;  5KFC A;  5HAT A;  2MLX A;  4USH A;  4I6Y A;  2Q3P A;  3SFU A;  4ZA1 A;  3BO2 A;  3GZ7 A;  3KG1 A;  2EXU A;  2Z56 B;  3K5P A;  2WW8 A;  2CNN B;  4DS5 A;  2YPY A;  2Z2M A;  2V9K A;  4LF1 A;  3DRP B;  1S7H A;  4KH0 B;  1OPI A;  3R7N B;  2XYG B;  5KFY A;  1LW0 B;  5CA5 A;  1VCT A;  4V19 J;  1TFY A;  1FDA A;  5E3R A;  3OR1 A;  3DM2 B;  1G6B A;  2WZ1 A;  1VIO A;  1YRT A;  4ZCK A;  2KZZ A;  1QAI A;  3I87 A;  1KQK A;  5D0R A;  4QU6 A;  2LXU A;  2WAQ D;  1NKE A;  2VV5 A;  1TV6 B;  2KN4 A;  2FTR A;  4Y2C A;  4LT6 A;  1GEH A;  1F60 B;  1TL1 A;  2ERR A;  3FSX A;  2ZDP A;  3M32 A;  1U02 A;  2V67 A;  1TAQ A;  1NSP A;  5KOX A;  1HBM B;  2DK2 A;  5K8N A;  2C3M A;  3H20 A;  3W60 A;  4HHU A;  5J2M B;  4H4K C;  2EFP A;  2D3O 1;  4X4O A;  2NUH A;  1CPZ A;  1RT6 A;  1U1P A;  3THV A;  2M2B A;  1VQ4 S;  3CD6 S;  3AFG A;  1UJ6 A;  1KS2 A;  4WFY A;  4DV7 F;  1Y3J A;  2OSQ A;  2XMM A;  2YWE A;  2IMW P;  4QIE A;  2M5Y A;  1HQU B;  4G1P A;  3THT A;  2FLL A;  1JLB B;  1HR0 F;  3NGS A;  1XNQ J;  2DD8 S;  4HH0 A;  2AMC B;  2FGC A;  3KK2 A;  1KVJ A;  4JP8 A;  1T9X A;  2CPI A;  4C6A A;  2ZHA A;  3OVB A;  2I6W A;  1KQF B;  1G1X A;  1S0V A;  1QE1 B;  4I2P B;  3NNH A;  2B4V A;  3NAI A;  1FCA A;  3T9N A;  4CLY A;  4N56 A;  4OYO A;  1S1W A;  3P96 A;  4DZD A;  4F8R A;  4IG3 A;  4ZKA A;  2QV6 A;  2EK6 A;  4USM A;  3ET6 A;  2BE2 B;  3HVT B;  1ZET A;  3ITH A;  2JDJ A;  4NYO A;  4ES2 A;  1DZ5 A;  2CJX B;  2CWX A;  3QIP B;  5HRO A;  2LDY A;  1WC1 A;  5D78 A;  4KGV B;  2P9C A;  5AJ3 F;  2UUW A;  4J7C A;  4FBU A;  3M6W A;  3JAM Y;  2KT3 A;  1NZ8 A;  1VRU B;  2WVC A;  1NCL A;  2FB0 A;  4YDX A;  4TY8 A;  2WCX A;  1G7C B;  3C14 A;  2HQ3 A;  4ECQ A;  4EU0 A;  4NYP A;  2UU9 F;  1RTJ B;  3JSM B;  2BQU A;  1O0P A;  2W7P A;  4ZVQ B;  4HI1 A;  2FVR A;  2L08 A;  3B6B A;  1SJR A;  5KAK A;  1RHM B;  3GTY X;  5BR8 J;  3J7A 1;  1RWP B;  4B02 A;  2C3Y A;  2HNZ B;  2DH9 A;  3KWM A;  2QFI A;  4R8U A;  3ETO A;  4NAS A;  3AH6 A;  2OJ3 A;  1SC1 B;  5U47 A;  2HVZ A;  2UUA F;  4LF7 J;  4LF2 A;  1BQN B;  3EZ5 A;  4QYZ J;  4WIQ A;  2DNK A;  3QPI A;  3VHQ A;  1VRT A;  2QL9 B;  1G3O A;  4XK8 C;  1H7X A;  1KEK A;  3G87 A;  2ZOF A;  2EBG A;  2D41 A;  5IV3 A;  5I4M A;  3ZZZ A;  3KMS A;  1OYE A;  1S1V A;  2X3G A;  1L3K A;  2WRM A;  5A8K B;  2X1A A;  1YBU A;  1UJ5 A;  4NX9 A;  2B4P A;  3V81 B;  2H5E A;  4MKA A;  2UUC F;  2U1A A;  3H5X A;  3MED A;  1MRO B;  4O3Q A;  3QNW B;  5EN1 A;  4UQT A;  4P7T A;  1NME B;  3CF5 Q;  4DN0 A;  2OPR B;  5DS7 A;  2LEA A;  3O1L A;  1XC9 A;  2WHO A;  4ED3 A;  3DLE A;  2OKQ A;  3UN3 A;  1FKP A;  3O6Q A;  3MD3 A;  2CKW A;  1KKH A;  3KLG A;  4B3O B;  4ZVR B;  1C0U A;  3BQ0 A;  1M1H A;  4HI2 A;  3KDO A;  4KBI A;  2E5J A;  3L7U A;  1Q95 G;  1ZTW A;  1FNO A;  2FY1 A;  2HW3 A;  3L3C A;  3H5Y A;  4DQR A;  3H4B A;  5J2N A;  2OD6 A;  3LA0 A;  4K7Q A;  1S9E B;  2RF2 A;  3QLH B;  2IY5 B;  4MFB A;  4G3I A;  3CPW R;  1F1B B;  3H59 A;  3W9I A;  5LT5 A;  4KKO A;  2AF6 A;  4O44 A;  5H9E J;  1VBK A;  1Y7P A;  1URR A;  1N34 J;  2YNI A;  4ILM A;  3CDE A;  4JI7 J;  2GHW A;  1RT1 A;  3HVR A;  3O3L A;  4KB7 A;  1P1L A;  2CQ0 A;  3D6M B;  4QOT A;  4P10 A;  1T8E A;  2J76 E;  1U0H B;  2JJ4 D;  2QA2 A;  3BKF A;  2H1Y A;  3R1L A;  2GAG C;  1T95 A;  3CCR S;  2HHQ A;  2N7Y A;  3G8T A;  1IR1 A;  2M4M A;  4G1I A;  3D5M A;  2WSE C;  3R5G A;  4WPA A;  2DPJ A;  1HBO A;  2Y8W A;  3JAM U;  2AJ0 A;  3UD3 P;  3R5B A;  1K0T A;  1UVI A;  5E7O B;  3LWL A;  3K5O A;  3FKB A;  2GIF A;  2M52 A;  1AXQ A;  2OFG X;  3RGI A;  2CQG A;  4URQ U;  4L76 A;  4WE1 A;  1UA0 A;  1RA7 A;  3NEK A;  1CSJ A;  2UP1 A;  2M7S A;  4OX9 F;  5D77 A;  1F2H A;  2QRR A;  4QWC A;  3S8S A;  4OYA A;  3QBC A;  4NL5 A;  2YKM B;  1IBC B;  3M6U A;  2B9W A;  4LRB A;  3AA8 A;  5I42 A;  1NDK A;  2ZOM A;  5T7L B;  3D3B J;  5DM7 Q;  4A47 A;  4NLW A;  5KG2 A;  1H74 A;  9ATC B;  1QVG R;  2DHS A;  2GFF A;  4CT9 A;  1F5B A;  3I31 A;  1UET A;  4J9K A;  5I3U B;  2HGN A;  1QUV A;  2XS2 A;  1SV5 A;  1B7F A;  4L72 B;  3PNI A;  4X4Q A;  1RI7 A;  4HTJ A;  2IBO A;  2ZUA A;  4A8Y A;  1R8C A;  4PAB A;  4KGM A;  3FCH A;  4M5M A;  3W8P A;  1X9W A;  4M5L A;  1YI2 S;  1GX6 A;  3M9O B;  5HLF B;  1SUQ B;  2ZZN A;  1D0E A;  2CJQ A;  3M6X A;  2AW0 A;  4IOA Q;  1RT7 A;  2HPU A;  5CD4 H;  2W1B A;  2BAN B;  1AFI A;  1PCA A;  3HVA A;  3W8G A;  4HDH A;  1K1Q A;  2A2D A;  2DVI A;  2RRB A;  4IRK A;  4NXN F;  4PRF A;  2V9W A;  2V4Q A;  3W62 A;  4ECY A;  3I0S B;  2AQ4 A;  2J9D E;  3DRR B;  4N8O A;  3NNC A;  1TEL A;  5D6G A;  4W98 A;  1DTQ B;  3NCR A;  1KLN A;  5J2Q A;  2BJ9 A;  2GAH C;  2QE5 A;  3JXO A;  2KXN B;  1IKW B;  2DCL A;  4RBV A;  4CM2 A;  4Q2M A;  2NR0 A;  3I56 S;  2XC9 A;  1JNZ B;  1TUG B;  2GMH A;  1N36 J;  2H9Z A;  4USI A;  3E01 B;  4X2B A;  4DFP A;  5A6W A;  2R2S A;  1K9M T;  2VH7 A;  2BAC A;  4OJH A;  1FWK A;  3Q22 A;  1T9Y A;  4WJB A;  4DV4 J;  4DR3 F;  1VK3 A;  2VC1 A;  4ID5 B;  2VQF J;  1N8R T;  2AYE A;  2W01 A;  4ECT A;  2Y8Y A;  4ITS A;  4JI0 F;  3AB2 B;  4K5R A;  1NDC A;  3KYL A;  2UVR A;  4IRC A;  3OVS A;  4UOC A;  1SJF A;  4Q44 A;  1H98 A;  1MN7 A;  2W2Q P;  4JI3 F;  2J0X A;  1U6F A;  1RYS A;  3KLE B;  2MKC A;  1FKO A;  3SCK E;  3C6T B;  2W2N P;  3U7J A;  4ZCI A;  2Y0B B;  2MGZ A;  2CDQ A;  3TZX A;  3TUJ C;  1VRQ C;  4LJM A;  4CM0 A;  3N5B A;  4EGL A;  1SH0 A;  4MYU A;  4B3S J;  1YJW S;  3K8W A;  1YZ7 A;  3SV3 A;  4F3Q A;  3IM8 A;  2F4V J;  2FC9 A;  3ONQ A;  3BH7 B;  3W64 A;  5LJ3 Y;  2HAF A;  4TQR A;  1SQG A;  1LK7 A;  3ILL A;  2F5G A;  5BYQ A;  1TKZ B;  2AJ1 A;  2VF3 A;  1S76 D;  1GXL A;  1RAC B;  2J6T A;  2C3O A;  1TL3 A;  1SIW B;  4CRJ A;  5L1L A;  3JSY A;  2F63 A;  3CC4 S;  3HFZ B;  3ZZR A;  3EXY A;  1RBL A;  1BWE A;  2WON A;  3QGH A;  4P2X A;  1XMO F;  3MPV A;  3CJT A;  5F8N A;  2NPI A;  2EI5 A;  2HVE A;  2M8H A;  4M5D B;  1OMS A;  1QM9 A;  3AOC A;  5CYM B;  4IKA A;  4FKY A;  1U45 A;  2ZOG A;  3N01 A;  2ADB A;  1VHF A;  2M70 A;  5ETL A;  4DL6 A;  2FVS A;  3B8H A;  3IAM 9;  3J7Z T;  3BPD A;  3EPI A;  2IIH A;  2XGQ A;  3HZE A;  1RAI B;  1Q8B A;  1FJC A;  2HIY A;  3TAR A;  2SXL A;  3O8W A;  2HND A;  5DDQ C;  1JNR B;  3SZ2 A;  3PRB A;  2R2T A;  1AZS A;  4MH8 A;  2IM0 A;  1VC6 A;  1N5S A;  1N32 F;  4P74 A;  3TJ9 A;  2E5G A;  4FNH A;  1HQ2 A;  2BM0 A;  3DRS A;  2LU1 A;  4QIF A;  3MD1 A;  4DF4 A;  1JLC B;  1TK0 A;  5K8O A;  1QAY A;  3OBI A;  4Z2X A;  3JTO A;  2IMO A;  1FF2 A;  2HQG A;  2HQD A;  2WTF A;  1LOU A;  2GHV C;  2HS4 A;  4F50 A;  1YJR A;  3N6M A;  3LP1 B;  3W1Y C;  3BS9 A;  2FVQ A;  3FQK A;  3GIR A;  3EGN A;  4O3R A;  3CCZ A;  4NCG B;  3C15 B;  1EHW A;  1JLQ B;  5KFU A;  1FFG B;  2B8P A;  2KVI A;  1VQ6 S;  4A8S A;  4ZK7 M;  1FJE B;  2Q66 A;  3MM5 B;  3DI6 B;  4WXO A;  4LF7 F;  2LEC A;  4Q43 A;  1A0O B;  1MG7 A;  1S1X A;  4ZVT B;  4ICL A;  5GMD A;  2PFF B;  5JXS A;  3MZI A;  4K4U A;  2IAJ B;  4LF5 F;  2XGP A;  4X65 J;  1BY9 A;  4CYU B;  4DCJ B;  5F8I A;  4QW8 A;  1TU0 B;  2DJW A;  4KT0 C;  3MM8 B;  4OHX A;  1BE4 A;  1RYR A;  2OD4 A;  2YKO A;  4WFZ A;  1SJ1 A;  1CUL B;  2Y9H A;  2BA9 A;  4C0O C;  1OQ6 A;  3JSR A;  1S7I A;  3R6L B;  4NEZ A;  4J9S A;  1DUR A;  2J7U A;  2EC2 A;  2CWK A;  3T1Y J;  3FSI A;  4M5G A;  1M90 T;  3TUZ C;  3RAQ A;  4ZVO B;  2DNR A;  4YR3 A;  3CVK A;  1U24 A;  1O8B A;  3MAA A;  3POT B;  2LXI A;  3KK1 A;  5KFX A;  4EUV A;  1WEX A;  1ZAW A;  1V9O A;  1Z2L A;  5KG6 A;  4DU8 A;  5FDL A;  1LW2 A;  1RWO B;  2HQC A;  3TUI C;  2DRD A;  3BDP A;  1B0V A;  2HZA A;  2RDD A;  2RQC A;  4GO7 X;  1UVL A;  2HFV A;  1K47 A;  4Q5V A;  5E0O A;  1SC3 B;  3AA9 A;  3ISN C;  1FFW B;  1JXV A;  2CQ3 A;  4PKD B;  3TEH B;  3EWG A;  2E29 A;  1F0X A;  1VK8 A;  1U7L A;  2OTJ S;  1HFE L;  1F6T A;  4PQU A;  4CO5 A;  1T9V A;  3THP A;  1ZS6 A;  1WI6 A;  1EET B;  3D9B A;  4ZVP B;  4GKK F;  4I68 A;  4RU9 A;  3VQT A;  1JXL A;  4ZPD A;  1SKR A;  2GMJ A;  4J9U E;  1R7I A;  1EX8 A;  3DLH A;  3AOA A;  3UR0 A;  4DR1 F;  1U2C A;  2P9E A;  4LF4 F;  2BRL A;  2VG7 B;  4FKX A;  4PYA A;  1EKR A;  2UZA A;  1N88 A;  2Q79 A;  5HO4 A;  3HMJ G;  1PYT A;  2DXD A;  3NLC A;  3C16 A;  1FE4 A;  4DSI A;  4W4M A;  4OI1 A;  2CQI A;  4DPO A;  3TP2 A;  2A1B A;  2V6A A;  2DXF A;  4B3M J;  2VOD A;  3I0R A;  1Q7Y T;  4BS2 A;  2DPI A;  1DY3 A;  2J9E A;  3MTJ A;  2V8P A;  2ILZ A;  3BM7 A;  4ZPB A;  5KFR A;  5GME A;  1UFL A;  2I9S A;  2XMU A;  4LRF A;  4NI2 B;  2OGU A;  4TLR A;  4HHJ A;  3E51 A;  5KFN A;  3R3T A;  2KTQ A;  3GV5 B;  1RAG B;  3TYT A;  5HBM A;  4CH7 A;  3GYG A;  4K5S A;  1VQL S;  4AFF A;  4LF8 F;  2HHW A;  4QWE A;  3D4J A;  3CUN A;  4PXE A;  1BC6 A;  3I4H X;  1F9F A;  3MCM A;  4B9M A;  4O3N A;  4QPX A;  2EKN A;  2OTL S;  2ASJ A;  4AQY J;  4WZQ A;  4KHM A;  3DHW C;  1UCN A;  3W5Z A;  2P9G A;  4YQW A;  1FEH A;  4IR9 A;  4RL1 A;  1Y5L B;  1VFJ A;  3TAN A;  1RHU B;  1R8P A;  5IWA J;  1UZD A;  1UFK A;  1T03 A;  2ZHO A;  2DR6 A;  5ETQ A;  3OL9 A;  3Q89 A;  1FRL A;  3PW0 A;  4MT1 A;  3VTI A;  2C2O B;  4DL0 C;  2JLG A;  4QQB A;  1HHT P;  1FNM A;  4J91 A;  1HQE A;  1RIS A;  1RAB B;  3OTO J;  4DR6 J;  3UCZ P;  3TAQ A;  3UN2 A;  1S1T B;  4UOF A;  3PFE A;  3MFI A;  1DLO B;  2HK3 A;  2L3M A;  2YTC A;  4AL7 A;  1MU2 B;  5DGA A;  2B6A A;  2E66 A;  4A8O A;  4I56 A;  1IBL J;  2DNN A;  1RHK B;  1XR6 A;  4JOU A;  5IXU A;  2FZG B;  5KFT A;  1TV6 A;  4G1Q A;  3T41 A;  4RJV A;  2B4U A;  4M5I A;  2PGC A;  1IKY A;  2W8K A;  1TKX B;  5HL7 Q;  1HNX F;  2ZJP Q;  2VAS A;  2QYC A;  1MNE A;  3SSR A;  4ZJQ A;  2FLP A;  4UOH A;  2DHH A;  1RTI B;  4EBC A;  1KLM B;  2D3U A;  2YNH A;  1R8H A;  5IQQ A;  1T3N A;  5CYQ A;  2F1F A;  3B54 A;  4DV0 J;  1H38 A;  5AE3 A;  4P2M A;  2YKP A;  1I3O B;  5DM6 Q;  1HA1 A;  2QL7 B;  4P2F A;  1RTD A;  4LFC F;  2KHC A;  1U1O A;  3NOG A;  3M8Z A;  2Z2Y B;  2XYH B;  3SSS A;  1NK9 A;  1S6Q A;  5ETN A;  2QL5 B;  4NML A;  1QTM A;  1QE1 A;  1HPZ A;  4BLG A;  1NUE A;  3ENW A;  1UPP A;  2MTL A;  3B4M A;  1PKU A;  1RJJ A;  3CCQ S;  3JQK A;  3T5L A;  3G82 A;  2HLT A;  3G2X A;  2BV3 A;  4Y34 A;  3Q0A A;  1ZM9 A;  2UUB F;  3N79 A;  1N6Q A;  1R6Y A;  1G4C A;  4FXV A;  1OIA A;  1WTF A;  3CCW A;  1KDN A;  2UVW A;  1U1K A;  1Q78 A;  2ADC A;  1U1N A;  1KD1 T;  1R0B G;  1XN9 A;  2GQC A;  2MZ1 A;  3GWC A;  2GS8 A;  2ALZ A;  4DR2 J;  3BN7 A;  4XPC A;  1VRU A;  1DAR A;  4F4X A;  4B3R F;  2YNG B;  4DV6 J;  2KI2 A;  3HJV A;  2G2O A;  5DET A;  2WOM B;  3OQ2 A;  3KJN B;  5T41 A;  3ZZO A;  3Q24 A;  2XM3 A;  2H3E B;  2PFD A;  3SDE A;  3L09 A;  3DU5 A;  3Q8R B;  2JLF A;  1SQF A;  3OUY A;  5C24 B;  5DZ6 A;  4X4V A;  4FZV A;  3UDE A;  3CD5 A;  4IG0 B;  1C4A A;  3DYA B;  5LXY A;  4WP9 A;  3OFE A;  3W5Y A;  4DOZ A;  3BRE A;  1S4E A;  3MCO A;  5HN0 A;  2ALY B;  2NZ4 A;  4IH5 A;  1S1U A;  3CJ0 A;  3MUV P;  2RRN A;  3R5D A;  3KUE A;  2B4O A;  4QYR A;  1FK9 A;  5CZX A;  1SC6 A;  2M88 A;  2JWN A;  1FA0 A;  4DSK A;  1IKV A;  2QA4 S;  3QRQ A;  2IYG A;  1R31 A;  6AT1 B;  1IXK A;  1U4B A;  2AD9 A;  4HVZ A;  4TU9 A;  1F2G A;  1LQ9 A;  2DO4 A;  4LF6 F;  2W7O A;  2KL8 A;  4ZVU B;  3RJM B;  3OR1 B;  4HLB A;  3GJR B;  1JLA B;  2VOP A;  3VAG A;  5DDP C;  2BMB A;  1K1S A;  4QIW D;  1VBY A;  2HBZ B;  1ROF A;  2J7K A;  3EM1 A;  1KOO A;  4B9V A;  1RT3 A;  4OZ5 A;  2K06 A;  2DIU A;  3BKU A;  1V5V A;  2RIL A;  2V2V A;  1KN6 A;  3FUY A;  2W4P A;  1TK5 A;  3UE2 A;  2XTJ P;  4ZP8 A;  1TL1 B;  2VHG A;  5SZT A;  2D3Z A;  4L6V 3;  5D4N A;  3M6V A;  3TAP A;  4XIU A;  4UST A;  3KUG A;  1VMB A;  1R89 A;  4NA1 A;  1S77 D;  2KZM A;  4ANC A;  4I4B A;  3JQM A;  1QDU B;  2RDI A;  1RT6 B;  2NSC A;  4QR1 A;  4NZ0 A;  2G13 A;  1QD1 A;  3KHL A;  2EG1 A;  1RLD A;  4Z7Y A;  5DQH A;  2RDJ A;  2V4J A;  3GFH A;  3HXM A;  4RX6 A;  1IBK F;  3X1L B;  5DG7 A;  4ZP7 A;  1MLA A;  3QLH A;  5K14 B;  3KK2 B;  3AXK A;  4EO8 A;  4J37 A;  3HCX A;  2GGP A;  4K0K F;  4CWB A;  3K5L A;  3V6D A;  1OY6 A;  1QJH A;  4KHP J;  1S1W B;  1UL3 A;  4IG3 B;  1NK4 A;  2ZZM A;  2HS3 A;  1CJV A;  4JI5 J;  4JYA J;  3WX4 A;  3ET6 B;  3BF4 A;  5CAB A;  3GP9 A;  1RAF B;  2EVZ A;  1HBN A;  2MQM A;  1Q0N A;  1WC5 A;  2BW7 A;  3FVY A;  2FY8 A;  1VQM S;  4JI2 F;  4MKV A;  2F8H A;  1NM2 A;  3C14 B;  3IG1 A;  1X8D A;  3D28 A;  4DLE A;  1MMN A;  1CJT A;  1U8S A;  2DH8 A;  3BO3 A;  4WCE Q;  4A8K A;  4LRC A;  5BYS A;  2XCP A;  2Y0S D;  2P5V A;  3RTV A;  2ATC B;  6FD1 A;  5LM7 E;  1LWX A;  3G6V A;  3HF5 A;  4NA3 A;  5ETV A;  3GCX P;  2W9B B;  3RW7 A;  4JBC A;  4UZB A;  5CAA A;  2G2Z A;  3QT6 A;  4R8U B;  1I6J A;  1KON A;  3CCV S;  2UXB F;  4E0D A;  1V6H A;  3PRV A;  5LSL A;  3CE8 A;  2PII A;  2N3L A;  4YB5 A;  4M95 A;  3HDS A;  4ILL A;  4IRD A;  3CED A;  1ZA1 B;  1REG X;  3PM9 A;  2FVC A;  4OI6 A;  5T7L A;  3HLU A;  1VRT B;  4RW8 A;  3PG9 A;  5ADZ A;  3UFC X;  1SKS A;  2CAD A;  2Q6C A;  4C3K A;  3RBX A;  5A0Y A;  1S1V B;  3BSC A;  3N6N A;  4ZLP A;  3L7P A;  1TFW A;  1KOH A;  1RTH A;  1QAJ A;  1RLC L;  5KFI A;  2E5L J;  3MED B;  2ACM A;  4G6V B;  5AXM A;  1CQM A;  1HI0 P;  5B09 A;  2VBY A;  2ZE2 A;  1RDR A;  1H3D A;  3RW6 A;  1WSR A;  3RRK A;  4DBQ A;  4BC7 A;  1KFS A;  1WG1 A;  3KDN A;  1VBZ A;  3QSY B;  3DLE B;  1PBU A;  2CUY A;  1CEZ A;  3FBC A;  1FKP B;  2WVE A;  1FD8 A;  4ZLN A;  3KLG B;  2NXC A;  3KHR A;  4NLT A;  2G1H A;  4P71 A;  3EGZ A;  2B0G A;  4J9R A;  4RW7 A;  2G1D A;  1VQ9 S;  4RNH A;  1DRZ A;  2E1C A;  5DDR C;  3QT8 A;  4ED6 A;  3CC2 S;  5J2N B;  3TNV A;  3I96 A;  2CG8 A;  5F8J A;  2ZH4 A;  3JQJ A;  4DPU A;  2RF2 B;  3W9J A;  1OYD A;  4MFB B;  2Z58 B;  1LFP A;  1IKW A;  2QX0 A;  4EYH B;  1XMB A;  4OI3 A;  2JNJ A;  1SJQ A;  2YH0 A;  1S6U A;  4DR5 F;  5ETK A;  3CCT A;  2PEH A;  4O44 B;  3E01 A;  1OPZ A;  4OX6 A;  2GJF A;  2HRY A;  4OJ3 A;  4OMF G;  2YNI B;  5EDW A;  2POK A;  2D74 B;  1LV5 A;  1RT1 B;  3HFV A;  4ED1 A;  3LUY A;  1ZPV A;  2MQ8 A;  1QY7 A;  3HHL A;  4IH7 A;  4ANE A;  4F02 A;  4DPT A;  3Q8P B;  4DR6 F;  4AXJ A;  2PDA A;  1B0P A;  1RAD B;  5KFL A;  4DUY F;  3CNQ P;  3BPS P;  1ELO A;  1AA1 B;  2R8G A;  2WB4 A;  4OZ2 A;  3IXQ A;  4MK7 A;  1VQK S;  3LAM A;  1JJC B;  1HBO B;  5K9F A;  4EBD A;  2KJW A;  1NK6 A;  1IVZ A;  3HT0 A;  1LFW A;  5I3Q A;  1WD6 A;  3QRP A;  2FPH X;  3R7B B;  4DDF A;  3C6T A;  2V8V A;  3VWS A;  3GIM A;  4LFB J;  2YBV A;  3T19 A;  5C5J A;  3LAK A;  4WE1 B;  3ZNU A;  1UAW A;  3TZW A;  3D3C J;  3HSJ A;  4ZHR A;  2X7I A;  1V5I B;  1WKL A;  1AUD A;  5F0W A;  1Y4Z B;  3FRY A;  3QQC D;  3LW5 C;  2G0J A;  4C8M A;  1KBR A;  4DF8 A;  1RE1 B;  4WWS A;  1X9M A;  4RUC A;  4WBF A;  3EXC X;  4R5P A; 
#chains in the Genus database with same CATH homology
 3GCX P;  2ZWO A;  1V5I B;  4OV6 A;  4YN3 B;  3T41 A;  2ZWP A;  3SQO P;  1R6V A;  2Z2Y B;  2Z58 B;  3A3N B;  4NMX A;  3GCW P;  2W2M P;  3WHI A;  1SPB P;  3CO0 P;  2Z56 B;  2QTW A;  3BGO P;  2PMW A;  2Z2Z A;  3WIV A;  2W2P P;  2XTJ P;  2W2Q P;  3QFH A;  2E1P A;  3AFG A;  3CNQ P;  3BPS P;  1ITP A;  3A3P B;  2Z57 B;  1SCJ B;  3P5B P;  4JP8 A;  2W2O P;  3VHQ A;  4K8R A;  3H42 A;  3WIU A;  3A3O B;  3VV2 B;  2W2N P;  4NE9 C;  2Z30 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...