1RHQB

Crystal structure of the complex of caspase-3 with a bromomethoxyphenyl inhibitor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 14
structure length 91
sequence length 91
chains with identical sequence E
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhqB00
2HBQB 2DKOB 1SC1B 2H5JB 1RHRB 2H4WB 2HBYB 2C2MB 2H4YB 3NS7B 1PYOB 2FQQB 1IBCB 3GJRB 3IBCB 5K20B 1RHJB 1RHQB 2XYGB 2H48B 3R7BB 3GJQB 2XZDB 3R5JB 2HBZB 1RHUB 4ZVOB 1RWOB 2CDRB 1QTNB 1RWNB 3D6FB 2QL9B 2QL7B 2QL5B 3GJTB 1RWPB 2CJXB 3KJFB 3RJMB 3D6HB 1GFWB 2QLBB 2QLJB 4DCJB 2H65B 1RWMB 3D6MB 4ZVQB 2Y1LB 2C2KB 5IC4B 2XYHB 1NMEB 1RWXB 1ICEB 3SIPB 1RHMB 1SC4B 3P45B 4ZVSB 4DCPB 2C1EB 1I3OB 5IC6B 1RHKB 3R6GB 3IBFB 1PAUB 4ZVPB 4ZVTB 4LSZB 2P2CB 1RWVB 2QLFB 2Y0BB 2C2OB 2C2ZB 4ZVUB 3KJNB 2CNNB 3GJSB 3KJQB 2XZTB 2H54B 1BMQB 3EDQB 4JB8B 4ZVRB 3R7SB 4DCOB 1RWWB 2CNOB 2CJYB 2H51B 1RWKB 2CNLB 1I51B 3EDRB 1QDUB 1SC3B 3R7NB 2H5IB 1RE1B 1F9EB 3P4UB 2XYPB 3QNWB 3R6LB 2CNKB 2HBRB
chains in the Genus database with same CATH superfamily
4PG4A 3ENQA 3CJTA 4JI8J 3MUVP 2HZAA 2HHTA 3IP0A 4JI7F 2JEFA 3QRQA 5DG7A 4WU3A 2J6TA 3LGHA 4CDIA 3VAMA 1B0TA 2R3VA 1P1TA 2CG4A 2A6MA 4DG1A 3AODA 4CLWA 3M6VA 5KT4A 3U1LA 4RWXA 4NA3A 2MQPA 4OV6A 4EFAC 2XMJA 3DLLQ 4AQYF 2DH8A 4LSZB 2M8DB 5FIIA 1S9EB 1EHWA 1R8PA 3MAHA 1FA0A 2FVCA 3MR7A 2JC1A 2SXLA 2V2ZA 4F25A 4ZPTR 1QVFR 1NB7A 4U8VA 1YBTA 3JQKA 3QGIA 1FF2A 2DR9A 1Y3JA 5L1LA 4WFBQ 1C1BB 1DTTB 2BE2B 3IM8A 2V4RA 1FFSB 4G1QA 1FEEA 2FHJA 2CPYA 4K2JA 1TFWA 4WF9Q 5D4LA 1MNEA 1TMMA 4U7CA 3O8WA 1X5SA 2E7VA 1JK9B 4MYUA 5J2MB 2W9CB 3MM9B 2GJ2A 1TKZA 2HGNA 2C3MA 2GAHC 1S1TB 5CHCB 1RA7A 4P9SA 1IM4A 1RWMB 3D6MB 1AZSB 5THWA 4B3RF 5E5NA 2K1RB 2RT3A 3JSBA 4OZ2A 2PMWA 2YNGB 2M9KA 2C3YA 4GVBB 2UVVA 1V9OA 2E9RX 1VBXA 1CJTA 1DLOB 5IM0A 1R0AA 1JLGA 3P5BP 3T41A 2VONA 1NEEA 3BQ2A 1M5OC 2JEJA 4C3MA 1TUGB 3NWRA 3S8SA 3BS9A 2BZ2A 2CYYA 5E7OB 3PEHA 5J2NA 2BQRA 4P74A 2BJ7A 1NDPA 3P4UB 5HJYA 4WWSA 4LRFA 2F8MA 5A6PA 4JI1J 1X9SA 2ZKTA 3CNQP 4C3KA 2EFOA 4Y34A 1EIYB 3BR8A 1FCAA 1O0PA 1W25A 2GJFA 1X5OA 3RJMB 4DV6J 4CZCA 2R7WA 5L39A 2V50A 1SXLA 5EWEA 4Y00A 3RRKA 3D54A 2M4MA 5KFCA 4E8UA 2AGPA 3A8KA 1SV5A 3JXOA 1RHMB 3CD0A 4NLPA 1ZAWA 3TWZA 4NLRA 4MJKA 2DNKA 1PJ5A 4M95A 2V4JA 4ZIVA 2EC0A 2QYCA 4IG3A 3IA0A 4QU7A 1V5IB 3CCQS 3C16B 2CPXA 1SJ3P 4NLGA 1NK9A 2AW0A 4LF2A 1NCLA 1SUQB 4ZOSA 1B7FA 2E29A 1DLOA 1WUUA 3O5TB 1J27A 1Q7YT 3QJJA 2DNZA 1RABB 3HD1A 2QSWA 1UKUA 1NK5A 2VBWA 2WZ1A 3VZIA 4U7UD 1TKTB 4CT9A 4UOFA 1IR2A 2QLBB 4KGXB 2IYIA 2YNIA 3CWJA 2VFSA 1Q8LA 3BH6B 1RAFB 3SCLE 2WW8A 3A1YG 2Z2MA 2HHXA 8RUCA 4EK2A 1NKEA 1NMEB 5L9XA 2XY7A 3PM9A 4NYZA 4ZCMA 1S7HA 2V8DA 3KUHA 4ZP8A 4UW2A 4G3IA 3CC4S 1DQ8A 4OQJA 3MM5B 1KDNA 4O4GB 3KNAA 1Q8KA 1IBMJ 2C2RA 2BX6A 3BZQA 3TZWA 1U09A 1TL7A 3IGNA 2EG2A 2E66A 1T95A 3N6MA 1FJGJ 2GW8A 4C48A 4ZP7A 3I96A 4MK8A 2I0XA 3DHXA 1U1LA 3PYDA 2HHQA 3UD5A 4WIIA 3PACA 4DPTA 1OIAA 3MHYA 1LFWA 1DTQA 2HBYB 4PXBA 5C2CA 5KFFA 4O44B 1IR0A 3FSXA 2DVIA 5B0DA 4CH1A 2EKYA 3IBWA 2AGOA 2PO4A 3ZZYA 1SQEA 4GC6A 5I42A 4DL7A 5BYRA 2V2QA 4DU8A 1SUQA 3GTYX 2AYMA 3DRPB 1U6FA 5FJ4A 1R31A 2W2OP 2F3JA 3FK4A 4YR2A 3TUZC 3FGVA 3W8GA 1JLAA 3OR1B 1RT5A 4PUOA 1UA0A 3RBDA 4NZ7A 2DJWA 4LRBA 2RHQB 3MD3A 2HGMA 2B9EA 3FEYB 2LU1A 1VQMS 4LSLB 2UVWA 4DV7F 3EZOA 2EK6A 4AQYJ 3GQCA 2DNRA 4OX7A 2HMIB 2KHDA 2HPUA 3ILJA 2E7XA 2BBEA 1C4CA 4A47A 1RT7B 4OYPA 3H90A 4O4GA 5T7LB 1KVKA 3W60A 1FFGB 1VQOS 4WIQA 1UJ4A 3SV4A 3O1LA 3HDSA 5EX0A 2HEKA 2AV5A 3KG0A 3W64A 4IR9A 3AQOA 1FJ7A 1U1RA 4I64A 3CDBA 1VR6A 5IS2A 2BJ1A 3SQGA 1JLEB 3J81j 2XHWA 4DN9A 3M7VA 4CO1A 4I69A 4BWJA 1ROFA 1K9MT 4I2PA 1L3KA 4JI4F 2FLNA 4AXJA 4B3RJ 1HHTP 1X0PA 5CZXA 4Q44A 4YUDA 2ADCA 1RTIB 1WHVA 1RWKB 1L5UA 7FDRA 5DGAA 1NH7A 2CRLA 4F0MA 3GSIA 1IN0A 2Q3PA 2YKPA 1EAYC 4DL4A 5HANA 4ZLPA 3QAEA 4LF1A 1TAUA 1Y5NB 2ZNYA 3EX7B 2YX7A 1SIZA 3O3LA 3NL0A 1HKAA 1JQGA 1OPIA 1XQIA 4DUYF 2XEXA 2O01C 2G2YA 4H4MB 3HZEA 1UEVA 5DZ6A 4DS4A 2MGZA 3KLGB 2R7UA 1ZM9A 1IKWB 2QLXA 3PKYA 4ED0A 1F3FA 1ZZFA 1PBAA 2R7QA 2W8KA 4GKKJ 2LQJA 2ZUAA 1HNVA 4Q8FA 2RD5C 3KHHA 3HSZA 1O6XA 3EGZA 4KYZA 1IUJA 2QIFA 5DGBA 1HPZB 3OLBA 4DR7F 3TEGA 2E5JA 2HRTA 3G86A 1HNWF 1DFDA 3R3TA 3MMBA 1XWLA 2CQ3A 4FF4A 2GIFA 1JLEA 1HBUB 5LJ5Y 4AFFA 1F6TA 2MQ8A 1MG7A 2B9XA 5BJRA 1RUSA 5KT6A 2B0GA 4WXWA 3G8SA 3GILA 4WJBA 4USMA 2WB1D 3RB0A 1Y3KA 1RADB 2X1GA 1BQNB 2BM1A 1EB0A 3D2WA 2FY1A 1FEHA 4DQIA 4C7QA 3RAMA 1M1GA 3HI9A 3SDEA 2NYIA 5DDOC 3S01A 1CG2A 4OYOA 4M5DA 2RNEA 3FQKA 2QA4G 3BQ1A 2B6AA 2HURA 1RACB 2EG1A 3GYNA 2ZBCA 3Q86A 3ETOA 1FRHA 3C15A 4MFBA 4K5SA 4L74A 2KM8B 2RUSA 4OYAA 3X3UA 3BPSP 2RDIA 2D41A 2DR8A 3V81B 4C9DA 2JJ4D 2BJDA 2ZZTA 1H72C 3GONA 5CYJA 5HQ8A 1TFYA 3M8QA 4USJC 2ZC4A 4O3QA 2ASLA 2V0NA 4EEYA 1IKWA 5I3QA 2YWKA 3SEOA 5D8HB 3OTOF 4NOHA 3JAMU 2QRRA 1WKJA 1RTDB 4MIWA 4F50A 4J9PA 2WCXA 2CNKB 3O2IA 2RE1A 1RSCA 3M32A 3IAM9 1HPZA 1FDDA 1VYAA 2HVEA 3OLAA 3MM8B 2BYCA 3GIIA 4OYXA 1U2CA 2IC3A 4EBDA 3H2UB 4C0OC 4EO6A 4CRJA 3J7Z5 4Y0FA 2YKNA 1RDRA 3A4TA 3UQSA 3D1OA 5HMXA 1VIOA 4OI1A 2ZITA 2J9EA 2RMLA 4C0HA 4LSNB 2DGUA 5DQHA 1UVIA 4C97A 2YQ1A 3NGDA 1S49A 1N0VC 4FPIA 3CCRS 1RT2B 1V3ZA 1IKVA 1B4SA 4DR6F 4PWWA 3T9ZA 4BS2A 2FHMA 1JLFB 2PFFB 2AQ4A 3R5DA 1TL3B 1Z4UA 1RAJA 2M52A 2IM3A 3I5BA 1KFSA 5SUHA 3BSCA 5KFGA 3GV5B 4ILLA 4TN2A 4P72A 3J7YI 2NZ4A 2IRXA 1HQEB 4JV5F 3GFXA 5B0FA 3H5UA 2XM3A 2X51A 3DKDA 3EDRB 1LK5A 3MMCA 3DFEA 1N33F 4FF2A 2AIRB 2HFUA 1ZYQA 2RF2B 3VGVA 1VJWA 1REGX 3OVBA 4DXLA 5IT0A 4QWEA 3PY8A 1MW7A 1KQFB 1SJ1A 4DV7J 1U1NA 1WOSA 5D4NA 3UCUP 1T3NA 1X4AA 3LAMA 2ASDA 4XPEA 3LOUA 1HNXJ 4CLYA 1TK5A 1I5OB 2HSEB 4QPTA 3T19A 3KK1B 3TVZA 4ZPVR 1CC7A 4CLZA 4IFYA 4J9UE 4LRDA 4WFAQ 3EZ5A 4P52A 1I3OB 3QT5A 2D69A 2L9DA 1S6PA 3CCES 3TOQA 2HHHF 3DLJA 3R8YA 4X66F 3KJNB 3OJUA 3GV7B 3MMAA 1U8WA 3KJQB 1Z2ZA 2VFRA 4DS5A 5K8NA 1N6QA 1JJ2R 4B9LA 1UFLA 4UTGA 1NJXA 4C4WA 1OO0B 4JI4J 1FJEB 2GCFA 3THVA 2J7UA 1WWHA 2XS7A 1KHWA 4JI2F 2G0JA 3RB4A 2HS3A 2E44A 3UD4P 2MB0B 3ZTQA 1NRKA 3IWXA 2KFNA 5E3RA 3H2VE 4I0WA 2PI5A 3DGPA 1MROB 1IBKF 2MY8A 3TX8A 4YR0A 3HD2A 2YH1A 3BSAA 3NAIA 4I2QB 2FVQA 1P27B 1XMOF 2RQ4A 2FJBB 3K58A 2WRMA 2FHOB 1SL2A 1V3SA 4OJGA 5KFKA 5IZHA 4DUYJ 5U47A 4XIUA 4P2SA 2DNMA 1WF1A 2OPQB 4PEOA 1Q8IA 4HT7A 3CMQA 1CJVA 5I4MA 1JLBA 4R5PB 2VOPA 2IAJA 5K14B 1KP6A 3VQTA 3M8PB 5AE2A 3POTB 3M30A 4UOHA 3JSMB 3W8PA 3K8WA 3Q89A 1X4GA 4CNYA 5DQGA 1RTJB 4DV4F 5AJ3F 4DR7J 1TK0A 2IVYA 2P9EA 1HNWJ 4QW9A 5D15A 3TAPA 4HHHA 2G9OA 3CJSA 1NKCA 2BXJA 2L48A 2VV5A 5BYQA 4NI2B 5G4DA 3PJWA 2BW2A 3R7BB 3G6VA 2CIMA 2NSBA 4ZJQA 2MQLA 1J5EF 1WNEA 3BB5A 5HQMA 1CQMA 5A76A 1SKSA 4KC5A 4U96A 1PKUA 2OMOA 2CJKA 2VDIA 2YY3A 1S9GB 1V5VA 4F0HA 2KT5A 1N36F 1HL6A 5DZ7A 1G3OA 1DJ0A 2ZH7A 1SH0A 3LP1B 3A3PB 3EMTA 2HNDB 3OJSA 4ICLB 2CKWA 3RB6A 2HZCA 2MSSA 2HRYA 3BREA 2BKOA 1ELOA 3FZ2A 1YJNS 3B82A 2AEJA 3LO3A 4DR4F 4WE1A 2WAQD 4YS2A 4I2QA 4FKYA 4U67Q 3NNAA 4JB8B 2CWKA 3BKTA 2D1CA 3NRBA 1RTZA 3ENWA 2ROPA 4ZPWR 2N4CA 3OXLA 1GXLA 3AOAA 4DSEA 2KZMA 1NLKL 4LR7A 2EKNA 5ETPA 4C8ZA 3VAFA 3CJKB 1RBLA 2F65A 4I68A 1VRTB 4TY9A 1PGZA 4OLPA 4PKDB 3Q2TC 5HVHA 3VVTA 2XCAA 1LWCB 4DFPA 5K9FA 4YOEA 3KK2A 3M8PA 4Q5VA 3JTPA 4H4OA 4NE9C 3B54A 2DNLA 1R6YA 4DSFA 3MECA 5B0BA 2B51A 3RW6A 4LF8F 2CJBA 2A6OA 3H4BA 2CPIA 5KTQA 3IMQJ 1GQEA 2B5JB 1IBLJ 5DM6Q 2CQ0A 2XZWA 5A8WB 1U49A 4OZ1A 2VICA 4WP9A 1FTCA 4EMDA 1KOHA 3EM1A 4X4NA 1HYSA 2VFVA 4Y2KA 4O4RA 3A8EA 1S1WA 5HN0A 1S9GA 5IWAF 2J8SA 1HIYA 4N5SA 5HROB 3CCSS 4DUTA 2MZJA 1S1UA 3NCRA 2ACMA 3DYAB 5HATA 2DGWA 4ED4A 4TXSA 1X4EA 4A8QA 1VQKS 4NMLA 3N5BA 4FYWB 3TVKA 2NLWA 2VBYA 1S10A 4LF5J 4B02A 1ZTTA 4JV5J 4ER8A 5T14A 1F5CA 3VAIA 3PDNA 2PIIA 2QTWA 1Y9OA 4ILMA 1N33J 2OO4A 2DHGA 4OJ1A 1OY9A 5KAKA 1RBOB 5H9FJ 4WFYA 2C2NA 1Y5LB 3OHAA 2VJVA 1YLXA 1YDLA 1A6LA 1SL1A 1XR6A 2AHOB 1LWFB 2XMUA 3M9MB 2EFVA 2F4VF 3MPVA 2HNZA 1Z1ZA 5KG2A 2EPIA 4CLTA 2EVZA 3LW5C 5A0YB 5JVHQ 1GXUA 4QBUA 4EZ9A 2CPZA 1S6QB 1KWMA 1OWXA 4JYAF 3HJFA 4G65A 5AT1B 2GZOA 3ILOA 4RU2A 1ZS6A 4CLLA 3R5BA 3HVAA 3OFGA 1REVB 3CMES 5DS7A 4DV1J 2HQFA 3IRXB 4X66J 1VMBA 4ERDA 2YXLA 1RWUA 8ATCB 1Y11A 4BWMA 4AT1B 3R5CA 1CJUB 3VAKA 3L09A 2CXEA 3W9IA 4AL6A 3LP2B 3H5SA 1YJRA 2CVIA 4USHA 4AXIA 3TZYA 1WTFA 3DYAA 4JI2J 4I1TA 2ATLA 3A8JA 3JTOA 3NGSA 4QIGA 4JI0F 1DBDA 2KYZA 4XTTA 2V8HA 1JKHB 2PE8A 5F8GA 2LU2A 1I94F 1A7GE 3CDEA 1P9YA 4R0EA 4IOBA 2VG7A 2KVIA 1BWEA 5HLFA 4OV1A 3AD8C 2UXBF 4URGA 3TANA 2XSJA 1YJWS 1PC5A 2B4OA 5G0RA 4NYOA 4CO4A 3DN9A 2KU7A 2V5HG 5IFMA 4N41A 1LXNA 2DGSA 1VQ6S 1LWEA 1SJQA 4PG8A 3TZXA 2RU9A 3G96A 1GNKA 3R7SB 2WVFA 2O5DA 4UOCA 3CPWR 3PZPA 2LLZA 1RK8A 1H7XA 1RT1B 5A0YA 3R2DJ 3L4BC 1YRTA 1YJUA 3M4XA 3ADAC 2QT7A 4I4BA 3DOKA 2H4YB 3TA1A 2XYGB 4O23A 4A46A 1K1QA 2BM0A 1FJCA 2HFSA 1RWOB 4DV4J 5AJ3J 4P73A 3AH6A 4KKOB 2VG6B 2FZCB 1EX8A 1YIJS 3OFEA 1GTHA 2J7KA 4FYDA 2QYGA 4Z7CA 2JVOA 2BUNA 4ANEA 4DBQA 4ED6A 5L1KA 5JMNA 4TKTA 3ZTPA 3MXHP 1CJUA 4DHVA 1WF0A 3W2WB 4CYUA 3LP2A 1UVJA 4FNIA 1JIHA 4UOGA 1JJHA 2Q43A 1N36J 4WXOA 1X31C 2FC9A 3PHEA 2HFNA 2NREA 5M2PA 1DAXA 2CQDA 2BR0A 1KVJA 4AUKA 2VC0A 1HBNB 2FTRA 1WC3A 1I1GA 4O0IA 2YQ3A 5J1EA 1KFDA 2P8IA 4ELTA 4KV8A 2NYHA 4DR4J 2E1PA 4DU7A 3I4PA 2F8EX 1VQLS 3LTOA 3AFGA 2CQHA 3VHQA 1JXEA 1VFJA 2WVCA 4F4YA 1M1KT 2B7CB 3NMAA 3W66A 2OFGX 5K8PA 4K2XA 2Q1LA 3ITHB 2LEBA 1RT4A 2D9PA 2YX1A 1WOOA 1HBMA 1VRUB 1RT3B 4B3SF 2OPPA 1U47A 3PX0A 4NL5A 3N6NA 2LEAA 3P45B 1T05B 4DX8H 1N5YA 4FYXB 4DPWA 3C6UB 2BW7A 5CD4H 5D3GA 2FJVA 1B70B 4FF1A 3AHPA 1FVQA 3QQCD 2BANB 1N5SA 4LF8J 3H0PA 4X4VA 1TR0A 2AF6A 1X4FA 1XK8A 3E01B 4TU8A 4ECQA 1F3VA 2W4CA 3RRHA 4PCQA 4U7UK 4X84A 2DB1A 5H9FK 1HWKA 1N5QA 1S1XB 5ETOA 3W2WA 4ECUA 4EYIB 3T3FA 2Y8WA 3ZO7A 4JOUA 3F0NA 1Y0HA 2M0GB 3V4IA 4X65F 3PW7A 4NA2A 4BDPA 2Y0SD 4KH0B 4RW4B 3IWNC 5E33A 3P5TL 3TAQA 1T7PA 1NDCA 3W63A 3RTVA 1SVDA 2C2KB 1VC5A 1EP4A 2GO9A 2WVDA 1NSAA 3K5LA 1X5TA 4LIRA 2PEHA 1S57A 1VK8A 2P9CA 1VC6A 5ETNA 2MKJA 4ES3A 3HHLD 5KOWA 2QZ8A 1X4DA 2JH3A 2ZBPA 1SQGA 2HK3A 1XEZA 4P2FA 5D77A 2F4VJ 3D0HE 1VC0A 3MD1A 1PYTA 3VWSA 1GX5A 2YWHA 3IWLA 4DX5A 1WDDA 1WF2A 4WKYA 1WEXA 4F3QA 4ZLLA 3PW0A 2IY5B 2Z0GA 3ZXWA 2DBBA 4JYAJ 3GIRA 3MPWA 2CPDA 2HBQB 4ED1A 4BLGA 4IFVA 3R9LA 1T9XA 2C28A 2MDAA 1LW2B 4CP5A 4JP8A 2UZAA 2XG8A 1CVJA 2YBVA 4P71A 2VFTA 2QG9B 4F4ZA 3GJTB 3M8WA 3J80Y 2XMWA 1IXKA 4F02A 1ZM4A 2FVRA 1NNDA 5ETKA 5A2QU 4OYMA 1UJ6A 1GMWA 2F1FA 2V63A 1BD6A 1VQ7S 3QLHB 5GAEI 4M5LA 2DPJA 2KXNB 3MM7A 3SSSA 3NBPB 1FWPA 4LF7F 2QLWA 2CQIA 4EU0A 4I67A 2PFDA 2QE5A 1I94J 1G4CA 2GHWA 2MSTA 3C14B 4N76A 1NSKL 1X4HA 2D3UA 1NO8A 3QO9A 3QFHA 4QWDA 4ZCLA 5GMKa 4I6YA 3UVJB 1K0VA 2UXBJ 1RAAB 3KUEA 4C11A 4RW9A 3TZZA 4XPCA 5H9EJ 4EYHB 5A6WA 4ZPDA 3KOAA 3KDNA 3VGTA 3EPIA 3THPA 4Q7AA 1Z2LA 4OMFG 3OPKA 3BBBA 3B4DA 3FRYA 1TKXA 4TY8B 1AFJA 2RS2A 5A8KB 3G8QA 2AU0A 2VG5B 4EO8A 1HWJA 1SJFA 4M1KA 3UNYA 1VRQC 4GVLA 2XLKA 2LVWA 3RBXA 1PJ7A 4M5GA 5ETMA 1LW2A 4LJMA 1YVFA 2CG8A 3ULHA 1QAIA 2IA0A 3TO8A 4DF8A 4NMXA 2HGLA 4RUBA 4B17A 4WTYA 3BN4A 4DQQA 2FDNA 3QLHA 5H1SV 2DXFA 3V4MA 2UV8A 2M5YA 3MM6B 4DSJA 1TK8A 2RRBA 5KT5A 2IM2A 4F2RA 1RHJB 2E5IA 2XSFA 1VLYA 4U9RA 3KHGA 1QAJA 2KHCA 1N8RT 2DRAA 1NK6A 1CULB 3JSYA 1PBUA 3N0VA 2MPUA 4N47A 1GXTA 1C0UB 2Z56B 4DV2F 3LH2S 1NHVA 1YBUA 2HVDA 3KWMA 1N34F 3Q8QB 1B0PA 4E98A 1PO6A 4DF4A 3BEGB 3QAUA 4IQMA 2R8KA 4B3SJ 3G82A 2I38A 3RAQA 5AE1A 3DNCA 4USIA 4DR3F 4IDKB 1RWWB 2ZVIA 3H2LA 4WK3A 1UWBB 4A8FA 2O67A 1RB0A 1ZTWA 2R7VA 3GG1A 1D09B 5DG9A 3AA8A 1RLCL 5FDLA 1LQ9A 2HWHA 2PC6A 2HNYA 4PXDA 2HYIB 2FQQB 4B3MF 3GIMA 3KMQA 4DEZA 5DDRC 3PO4A 3K0JA 3QJPA 2XI3A 3ENAA 5DDQC 2XCPA 4G1IA 1RT6A 4EZ6A 3TR5A 2GIQA 2OKQA 2I5JB 2OEMA 1FESA 2JFKA 3N28A 3UWTA 4J9VA 4Z2XA 3I56S 4QQBA 1FXRA 3ISNC 3OXFA 3T6BA 5CYMB 2IBKA 3D6TB 1YZ6A 4X65J 3KLIA 3SIPB 4ZKAA 2KDOA 4HT5A 3SCKE 3T5KA 5F9NA 3FBCA 3KG4A 4FP9A 3FCHA 1UWAA 4LF9F 4ANDA 3CB4A 1HHSA 4J9OA 1CULA 3AXKA 3Q2SC 2FLOA 2JLGA 1KEKA 4NCGB 1VHIA 2HWTA 4ETXA 5F8IA 5HBMB 1JLQB 5LJ3Y 4KO0A 4K5RA 2ZH2A 5HP1B 1UW4A 3CVKA 3KLEA 1NK4A 2Z30B 3QGGA 4NA1A 4HEA9 5B0GA 1CJKB 2K3KA 3CC7S 1TAQA 3EWGA 2GGPA 2I9SA 1K1SA 1NH8A 4IDKA 1MSWD 2R2SA 2F9JA 2HQ3A 2ZOGA 1UWBA 3DLEA 4CLPA 3CXCR 1QE1A 5IQ6A 4LFBF 3OV7A 4M5JA 5IC4B 3M9NB 2VQEF 3BGLA 3IXQA 3UDEA 2NXUA 1GTEA 2DHSA 1WHYA 2NUHA 1M5SA 2V34A 3HFKA 5J1NA 3MF5A 4M5IA 1D9DA 4ZA1A 2UXCF 5H9EK 3QZ8A 2BRKA 3PCOB 5HJXA 2GVZB 2RB7A 1WD6A 5KG3A 4KT0C 5FLXU 3TAMB 3G71S 2DEJA 2OAUA 3W2VB 5CYMA 2ZDOA 2MKCA 3FFIA 3BSOA 3MAAB 2OPRB 4K50A 4LF7J 3U1NA 1GAOA 2FD2A 4LQ3A 4G6VB 1UPMB 3TRGA 4X64F 1HD1A 3FNNA 1D9FA 4LRAA 4RNFA 2XS5A 3GYXB 5L38A 3ONQA 4OFZA 3DLGB 5JUMA 1NSQA 2ZWPA 2X7IA 3V6DA 3CD5A 1EETA 4KGMA 1XC9A 3UFCX 1H2TZ 2RVJA 2XY6A 2VBZA 3PTWA 2H9ZA 1WEYA 5HI7A 4OJ3A 2V94A 4OX8A 4Q0BA 3PJXA 3FBFA 4TLQA 3GIJA 2UP1A 1G7CB 5GADI 3L7PA 5B7WA 2DHHA 3N01A 1M90T 1IQZA 1C4AA 3OUYB 3SXLA 3GE9A 2NZCA 2YNFB 4QCLA 5JXSA 5EWGA 3B8HA 4HDHA 4J91A 1OS5A 3PVXA 4DZDA 5B09A 3NP5A 1QAYA 3EE3A 1S77D 5LMUF 3K2YA 1CPZA 2KO1A 3A12A 1H6KX 3RBZA 1P8GA 3UCZP 2WBRA 3OVAA 1SBRA 1RBAA 5CA5A 1OMSA 1KRPA 5E3PA 3HHEA 3NS7B 3GJRB 5K20B 1Q86T 2FHJD 4V19X 3DLHA 1QSSA 2DNHA 3TAMA 3ZNUA 1TELA 4CLUA 4NLVA 4FDFA 3RUBL 4UY8T 1RGVA 4I6WA 2OPRA 4M94A 4PQUB 1GMVA 1U26A 3DOMB 2CQGA 2NSCA 4RBUA 4MKVA 1BY9A 2GS8A 1L3TA 1APSA 2G2OA 1SC4B 1FHTA 2AD9A 3DLGA 1NJZA 2BKPA 4PG6A 4QYRA 2W25A 2R2TA 1YJTA 1T02A 4ES1A 4YDDB 4HH1A 4F67A 2WHOA 4J9LA 4A8OA 4OI0A 2LKZA 1X8DA 3L7UA 3UI3A 4Q8EA 3TQEA 3AOCA 2UUWA 3KLHA 4KSEB 3HP6A 3MAQA 2QC3A 3OUYA 2GO8A 2YKMA 1FVSA 3GP9A 3ET6A 4P2XA 3CCUS 1D0EA 2R4FA 4HI2A 4GKJF 3RR7A 2QJ3A 4DR3J 2AYEA 1J2VA 2FJDB 4RUHA 3BH7B 3QZ7A 3HK2A 1YI2S 3PR4A 4K4SA 4OZ3A 3ZZRA 3D6FB 5J1PA 5AXNA 1R43A 5J2PB 4B3MJ 3W9JA 3M2UA 1TL1A 4EBCA 2V2VA 1S1VA 3IFEA 2MZQA 1RTHA 1LV5A 1T11A 1FKPB 2HS0A 2JOQA 2KL8A 4G1PA 2QSFA 4DL6A 1UVMA 3D5MA 1Q95G 2Q79A 1BXNA 3DM2B 4MIAA 5ETQA 4ZCIA 1Q53A 3MTKA 1JNZB 2RH3A 3M6WA 3PW4A 2DNOA 4TQRA 1K8AT 2FZGB 2E5LF 1XNQF 2BE9B 1QLNA 2HW3A 1NHKL 1F2GA 2FC8A 3J81Y 2VZ9A 1KLMB 3LWMA 1TV6A 4IG0A 3K17A 3MEDA 4RW8B 4L76A 3CJ4A 2ZE2A 3LUYA 3NNCA 4KBIA 4CTAB 2CQ2A 2GQ2A 3CULA 1Q81T 2R8IA 2WW4A 3CC2S 1XNRF 2H4WB 2LDYA 4Q2MA 2YKOA 5KFVA 4USTA 4NASA 1AFIA 3BBFA 4OHZA 5MAOA 3R5JB 2W7PA 3BPDA 5I3UB 4YQWA 1FE4A 3ILLA 4WKRA 3MEKA 2F5GA 2FY8A 2MXYA 5DLGA 1WHXA 1L3VA 1S4EA 3GB0A 1X4CA 2M8HA 2ILZA 1ZAVA 2VL1A 3SFUA 5GAGI 3KLFA 3KK3B 3SI8A 2B4UA 3M2VA 1ZH5A 4DV0F 4QWCA 1T9WA 3HVRA 2CPHA 4LFBJ 4ETZA 3BBCA 2QA1A 2R7XA 3VTIA 3L7OA 4RUCA 2DNYA 5BXIA 2W9BB 3OR2B 2W01A 2ZJPQ 2QFJA 3D9BA 2UXCJ 1PYSB 2GAGC 1KQKA 5CCMA 5D4OA 1S4FA 4IOCQ 3M1VB 4Y3CA 2HQGA 4F4AA 2RQCA 1FRXA 3LAKA 3I0SB 3FBBA 2J0WA 2XMVA 2IBOA 3KJFB 2IVFB 4DPXA 2C3PA 3ZTOA 4KHRA 4CTAA 2AJFE 3GFZA 2EXUA 4PAAA 3H98A 4KTQA 2WONB 3QT7A 1IKYB 1WHWA 2GMLA 5E41A 5I3UA 1TL4A 3TI0A 4J7CA 2RRNA 2EBEA 2IRUA 3OTEA 3M8ZA 5C42A 2ZH9A 3OL7A 4MAKA 1LOUA 2QV6A 3LP0A 1LEOA 2NR0A 1NJIT 3MUTP 5L8RC 3VGUA 2EC2A 2I2YA 4X4RA 3DMJA 1YHQS 1NU4A 3KJVB 2Y8YA 4J9MA 5EGYA 3G8TA 4J37A 5LMUJ 4K4XA 4FYVB 1UTAA 2WSEC 2GVDB 1FDNA 4JV2A 4M8LA 3PEJA 2O3DA 3O44A 4B3OB 3FBEA 4FNHA 5E3CA 3OR2A 4KFBB 1IKXB 4JBCA 1X60A 3QBCA 1TVRB 1NM2A 4U8YA 5RUBA 2Y1LB 1KD1T 4KHPF 3TUJC 3PYGA 3TJ9A 1IQTA 1C0TB 3I0SA 3HVTB 1OY8A 1HMVB 3EPGA 1RQ0A 5KFSA 2DO4A 4UUWA 2BE7D 2E9TA 2MHEA 5DM7Q 2R2UA 1S9EA 1XBWA 2WSCC 3HCXA 1W7WA 1FDAA 1Q79A 3NGTA 4BCAA 4NCBA 1RCXB 2OPSB 1C1BA 1DTTA 4USUA 3QT6A 2BE2A 4PZVA 4H4KA 1S76D 4YY3F 1ZZNA 3T5JA 1R27B 1H98A 4GKJJ 2VIHA 2EFNA 3PG9A 5J2MA 2W9CA 2ALYB 3MM9A 3HHNB 3KJVA 4EUVA 1VIXA 1HLWA 1S1TA 1OJ4A 1AZSA 1VQ5S 4K0KF 2B56A 2K1RA 2ADBA 1S9FA 3CE8A 2YNGA 4B3OA 5B08A 4GVBA 4DJBA 1R0BG 3MPYA 1HI0P 1HD0A 4KFBA 2LQ8A 1CBKA 4Y2AA 1WSRA 1R8CA 3W3SA 2MKHA 3PFOA 3BO2A 3BYRA 3T1HF 1XIQA 3AD7C 1YZ7A 2CNOB 4ED2A 4ED3A 4JI6F 1FWLA 4ZK7M 4FXDA 1WC0A 4M63A 1RKJA 4RNHA 2WVEA 1VQPS 1ACMB 3AJ1A 4RW6B 2HLTA 2C2EA 1KTQA 2E5LJ 3MR3A 2JRSA 3HVTA 2DNNA 3BGOP 2N82B 4NLSA 3J7ZT 2FIUA 4IKAA 3I0RB 1FXLA 2XY5A 2YKAA 2PMZD 2JL9A 1XNRJ 3RRGA 3IG1B 3H7HB 9RUBA 2K7KA 3W9HA 1L3UA 3GSDA 1R89A 4OYWA 3P8BB 2V8PA 1VJQA 4ZVSB 2XGPA 4J5OA 3TEHB 2J5AA 2DCUB 1FX2A 2CVEA 2Z2YB 5LM7E 3RW7A 3QFWA 4XO0A 5D78A 2QFIA 5CAAA 3J7A1 3N4WA 5J2QB 1KONA 4DOZA 2AZ1A 2ZJQQ 3QYYA 3W65A 4DL0C 3GFHA 4TYBA 4OJHA 1K73T 1RAGB 3QIPB 2ZZNA 2CNLB 2IVMA 1C2PA 3C16A 3GFYA 4LF4J 3D68A 1BE4A 1DARA 2HBRB 5F8JA 1U0HB 4FZVA 3DDNA 5DG8A 2AWZA 1FRJA 4ZHRB 4UT4A 5F8NA 3T5LA 2VA2A 1JX4A 4JI7J 4C3LA 4F04B 3MMJA 2MKYA 5GAHI 3DI6B 3IO1A 2W9AA 2QA4S 4N8OA 2QL7B 3IM9A 1HQUB 2K06A 4I6AA 4M5MA 1JLCB 4A48A 2DR7A 4HTIA 2H65B 3MURP 1EARA 5AXMA 1TKTA 3C19A 3VZHA 1WG1A 2PEBA 3ZZOA 1S0OA 1DURA 1QSLA 4NEZA 3BM7A 3DRSB 5GMDA 1EKRA 3O6QA 5CH7B 1VDHA 2HHUA 2F9DA 3R2CJ 3MM5A 4OHXA 2V9WA 2E1AA 4RLEA 5CABA 2LCWA 3W5XA 3TUIC 3RBEA 1S12A 2GFFA 3RR8A 4OX6A 2ZD1B 2OSQA 4ILRA 2F40A 3HX9A 5EX3A 1FRIA 3AB4B 2Z57B 2UUCF 2MLZA 3ZTRA 4RU9A 2KYXA 2JDJA 2HVHA 2XNQA 5GVQA 2VJUA 2A18A 4KQZA 3M6XA 1FI4A 5B0AA 2PDAA 2X3GA 4BHQA 1NXIA 4O44A 5F9LA 1C1CB 4GMKA 2I6WA 3E3XA 2CZ4A 1UVLA 1CLFA 1Q78A 3DLKB 4PYDA 3C46A 2W2MP 1U0HA 5IT9Y 4XDCA 2ZH8A 1IJEB 3DRPA 3RU0A 4JI5F 2K2PA 2FB0A 1T03B 3I4HX 1WKKA 5M2UA 4FS1A 1YJVA 2W1BA 1MWZA 3WHIA 4RNOA 2AYBA 2R7RA 4UQTA 3OR1A 3GJSB 3MPDA 2HLUA 2XMMA 2OUGA 2HRUA 2X1AA 3FJ2A 1BQXA 3BJYA 5DLFA 3C6TB 1Y5IB 1R0CB 5KG1A 4TLRA 4LSLA 3VALA 4PXCA 2AEMA 4YFUA 1M5PC 2VC1A 3FCVA 2HMIA 2W7OA 2OTLS 4RX6A 3CJ8A 3WZ0A 1TMJA 3W1YC 2YQ0A 1P1LA 4ZVGA 1RT7A 2POKA 1OQ3A 1N32F 2OIHA 5T7LA 4J9QA 1AROP 2BJ3A 3ZFVA 3G9CA 4A4JA 4ZDNA 4JV0A 1JXVA 1FNOA 1RKIA 1O5JA 2YX4A 5LSLA 2E5HA 3UCGA 3OW2R 4NZ0A 3NG8A 4YY3J 2HIQA 5CQGA 3UW1A 4ZJOA 2EK1A 4K59A 4A8YA 1RU1A 3EGNA 3OHBA 2C2OB 3PFEA 1FDBA 4BBYA 2PI4A 3U02A 3EDQB 4F4XA 1M5HA 1KHVA 5C25B 4K0KJ 4HVZA 1RLDA 1MWYA 3OL9A 2M3DA 3KYLA 2A0FB 1B7YB 1RTIA 1CSJA 1HFEL 3T1HJ 2HHSA 1TTHB 4QIVA 4Z7YA 3V2UC 1UFKA 4CO2A 2L3MA 1MU2B 4YB1P 4LF6F 5DQIA 3C6TA 1UMJA 2UV8G 3KLVA 1E6VB 2XHCA 1UL3A 4H4MA 3TP2A 3D67A 4R0JA 5HQLA 4DSIA 2AYGA 3KLGA 4IO9Q 4BC7A 2WTFA 2RQMA 1NB2A 4NRUA 2B8QA 1VI7A 2UUAF 3B4MA 5KFQA 4N56A 4I7FB 2FGOA 4B9MA 2BOPA 4URQU 1QAXA 4DDFA 5F0UA 3BO3A 1NDKA 3GU0A 3MFHA 2JNJA 4DCOB 1HWUA 2LMIA 2XO7A 2ZBQA 5CD4A 2H5EA 1VQNS 3PX4A 1HBUA 4O3NA 3Q83A 1OQ6A 2HFZA 3ZZUA 2ZH6A 3DDIA 2MQNA 4HDGA 1BQNA 3MOJB 5LXYA 2B7BB 3CIMA 5L46A 2VF3A 4NRTA 3UNGC 2PA3A 5F8HA 2X3DA 4KPCA 4DQRA 5C24B 5KFBA 1F2HA 2FJEB 5E3QA 2RDJA 2MTLA 2YNHB 3M8RA 3L95X 3IS9B 4W4MA 2VD3A 4HKQA 2XMAA 1SQFA 4DCPB 4U6PA 4PWDB 4K7QA 3JB9k 1TU0B 2L41A 4LT6A 5HK4A 1YSJA 5E0OA 4WFZA 1CEZA 3M9OB 4FBTA 3V81A 1FK9B 4RUAA 2ZNZA 3WX4A 5K8OA 1WORA 1F9HA 4RW7B 3SMZA 2HVZA 2JX2A 4IH5A 3QSIA 3D0IE 2GIRA 3G6XA 2V8VA 3PKMA 1PG5B 2RDDA 1GT8A 3N5FA 4EBEA 1HWLA 1RHRB 2R7SA 3IR6B 1RTDA 3SCJE 3ISND 2M7SA 3SSQA 1YKWA 2G0IA 4F2SA 3MM8A 2UXDF 2R7OA 3DGVA 1Q82T 3MUMP 5IXUA 2LFVA 4NLXA 2QL9B 4DG1B 4IUFA 3D3BJ 1IWAA 3D6HB 4QR1A 4TNOA 5LSOA 3MDFA 4MIBA 3EVMA 4LSNA 4PG7A 1W2IA 3VCDA 1CQNA 3H40A 1RT2A 1RI7A 4X62F 1RYRA 3CJQA 4QIWD 3BSNA 1RWVB 1WC1A 1JLFA 3BKFA 5C24A 3QPIA 5A8RB 4KGVB 1TL3A 3JTNA 3DU5A 4CM2A 2XZTB 2MZTA 2HQDA 4JI5J 2AZ3A 4G1QB 1VLOA 1RXOB 2ASYA 4PWDA 3IR5B 1QUPA 2LXUA 1HQEA 3J7YU 4QR2A 2OELA 1K47A 2ZHBA 3EZUA 5B0CA 2DR5A 2J6SA 4RKUC 1TKZB 2EW9A 3P96A 4ZPBA 1FK9A 4DR2F 1VHFA 3GYGA 2RF2A 1F60B 3W62A 2CDRB 4L3KA 3F73A 2NS1B 3N6LA 1T0TV 1ZM3A 4DFJA 5F41A 1T94A 3NAHA 4WK1A 1ZBTA 1CJTB 3HVWA 4PRFA 5IM0B 1R0AB 1JLGB 1N32J 3C66A 3KK1A 4NXNF 4DLGA 1YG0A 3I32A 3IRWP 4WCEQ 1BWVA 1ZETA 1DZ5A 2MLYA 2IMOA 5J2NB 4WP3A 1EQ0A 4MTPA 4RPFA 3UN5A 4KPYA 3A3OB 2LQ5A 2KFYA 4OZ5A 8AT1B 3CJ0A 2G4BA 3RB3A 3GWCA 2FLLA 1N5VA 1OSDA 5D0HA 2DY9A 2H5JB 2KG1A 2E7WA 2NCKL 1M5VC 4J9NA 1U8SA 2BACA 3UR0A 5A8RA 1W2BR 2VODA 3TA0A 4NLDA 4YB6A 4X4TA 1ZPVA 5KT3A 3P6YC 4KY3A 3G6YA 1IJFB 1SV5B 1NJYA 2RUGA 3FCWA 1S0MA 2IJRA 4LUBA 1UEUA 2CZVC 1FRLA 1Q4RA 3K8VA 1MROA 5KFAA 3JSRA 2V4JB 4LF6J 2QO3A 3QGPA 4IG3B 1SKWA 4A8MP 2YWGA 3BV8A 3PXGa 3EVOA 1D8ZA 1A9NB 4EI2A 2HFVA 3HSGA 1TUWA 2EWHA 3US5A 1F5BA 3LF0A 2OPQA 3OTDA 2YPYA 2DCLA 4ZVRB 2H51B 4UF4A 1FKOB 3OTOJ 1HI1A 4R5PA 2UUAJ 3S1TA 4DZ6A 4X4PA 4QPXA 5K14A 2AKWB 2NUUG 1FO1A 2DXDA 3POTA 2CDQA 2MEWA 4UQGA 4FS2A 3JSMA 1RTJA 2RIJA 1WKLA 2KJWA 2OD6A 4DV3F 4ELUA 3CIZA 2YNIB 4ZN1A 4PQAA 2IMWP 3TJAA 4OI2A 2ERRA 2LXIA 4NI2A 2Z2LA 1NHUA 3MEGB 3FDSA 3TYTA 1NPPA 4DCJB 1HA1A 2KRRA 1VBYA 4X4UA 3RGIA 1MN7A 2N4DA 4GKKF 2QMXA 2JEGA 3M8YA 4X4OA 4DR6J 3SYZA 3BGFA 4NZ6A 4UY85 1SC6A 1FT8A 2XB2D 3CCWA 1NPKA 1TL7B 3L9ZA 3LP1A 2G13A 1U7LA 4NCAA 2QLFB 2HNDA 2Y0BB 2FGCA 5EN1A 2DIUA 1PIEA 4YR3A 4H54A 3GR1A 4ICLA 3V5RA 3OD2A 4J9KA 1YJ7A 3BF4A 5DRKA 1U4BA 1SB6A 1XN9A 2XS2A 5DDPC 2OH2A 1DTQB 2J9DA 3DCAA 2W24A 3W5YA 2KI2A 2QMUB 4S0MA 3HSDA 3OSPA 3C3LA 5HMWA 1PYOB 4ENOA 5I42B 2PD1A 4AE5A 2MZ1A 5LXRA 2A2CA 3HHLC 3HO1A 2ATCB 3FSIA 3OQ2A 2J0XA 2ZC3A 3CJKA 4ECYA 1VRTA 2HFOA 1R7IA 1FKOA 2DGXA 2PN6A 1N5TA 5HL7Q 5EDWA 1LWCA 1OY6A 3NLCA 1JLAB 2RU3A 1RT5B 4PUOB 1R8AA 2UXDJ 3FEXB 4TYAA 2GHVC 3H5YA 2J9DE 2ZH1A 4OHYA 2HHHJ 4DR5F 1R6VA 3MEGA 2AJ0A 1S6UA 4OI4A 3HSJA 4WP8A 3EGWB 2YWFA 2XO6A 2B5JA 3D1QA 1A0OB 4HI1A 3TA2A 4YEAA 5A8WA 5HMZA 3SSRA 1I6JA 4X62J 2MJNA 3A13A 3I55S 4FKXA 3AXMA 3H25A 1QDUB 4KE5A 1PCAA 5K5MA 4OZLA 5E2QA 5HROA 2F63A 4F4WA 1DY3A 2QA2A 4TVAB 2HQCA 1UVNA 2DTJA 4K4ZA 4D3HA 2GNKA 2YTCA 3EUNA 1ZM2A 5KG4A 3K59A 3SQGB 3TW0A 2CPEA 4FVMA 4MK7A 3NGKA 3JS9A 2MZRA 1IBKJ 2RS8A 2MLXA 1LWXA 2UUTA 1XMOJ 4I2PB 4DR2J 2A3JA 3Q8PB 1FRKA 2JSXA 2EEYA 2C1EB 1U6BA 2IYGA 3UDLA 1H3DA 1LWFA 3ILIA 1GMWD 1G2EA 3MI7X 1YGYA 3AJ2A 4ZVTB 2EBGA 2D74B 1NK7A 3OTCA 5D0EA 3QRPA 2FZKB 4LR8A 2LA6A 2ZM6F 4ECSA 1S97A 5DO2A 4ZVFA 1S6QA 2CZ9A 1ZOTA 4NXNJ 4RNMA 4K8RA 2J8AA 4ZLNA 1U1KA 1QTMA 2ZH3A 2LQBA 1SC3B 2ZZMA 3UD3P 4WPAA 3QNWB 2I1RA 1IVZA 4C8NA 1REVA 1HNZF 2RAQA 2QGFB 3IRXA 4W92B 1B3TA 1E6YB 2MGZB 1HNXF 2LP4A 2N7YA 2MY7A 1ITPA 1J5EJ 4ZITA 4DSLA 1HR0F 3L3CA 2M2BA 1H38A 1HNVB 3TUPA 2J0QD 1U1PA 4Y2MA 3P49B 2KTQA 3OSNA 1ICEB 1Q16B 5IQQA 3MMBB 4ECTA 3B78A 1JKHA 2Z4PA 3G2XA 3Q23A 1S59A 3WDOA 1KLNA 1VS3A 1FKAF 2G0CA 2EFPA 4B9UA 5M2RA 5KFIA 2AT1B 1K0TA 2F7VA 2AJ4A 3A8IA 3I5CA 2YWEA 2U2FA 1Q7LB 3ZZTA 4CH0S 2PSZA 2HVIA 3SDEB 3J80U 4YB5A 1BLUA 4DPYA 1JJ4A 4M5DB 1RT1A 2B6AB 3WC2A 4C0BA 4EWTA 1NUEA 3OXGA 2J6UA 4OYIA 1VBZA 1FNXH 3RYLA 3Q0AA 4WZMA 5IOLA 3C15B 4MFBB 3F56A 2MMYA 5KFPA 1KOOA 1RISA 2OI2A 2UUBF 3GPAA 4V19J 3JYTB 2CQ4A 4DFKA 2AX1A 1O8BA 4KKOA 4DV3J 1SH3A 1NSPA 2VG6A 4K4YA 2BOAA 3DXSX 2C3UA 4USWA 4OI3A 5C5JA 3VF0B 4X4QA 3M8QB 1E6YA 2ZBRA 1WI8A 4Q2LA 2O66A 3ZZZA 3MEEB 1KKHA 3ISZA 5L1JA 2Q66A 5KFOA 5KG6A 3TNVA 2PA8D 3MGJA 1WI6A 2BJEA 5IWAJ 3HHDA 1KBRA 2CQCA 3M32B 1SJRA 2Y1RI 3K5OA 3DDKA 3BDPA 2OMLA 4LBPA 3D4JA 1YRXA 4HHJA 2IC3B 5KFNA 1HBNA 2ROEA 4PYAA 2YKNB 1YITS 3EXCX 3T5HA 1YJ9S 3E8OA 2ZKUA 3M8SA 1HWIA 3JQMA 3CCMS 1IKVB 2BQUA 2CJXB 5ADZA 2DH7A 2B4PA 1H0HB 3BN7A 1M0SA 1HQ2A 3D7SB 1SL0A 3HHKA 3D28A 2DITA 1D1UA 3HM9A 3ITHA 4DX6A 3SV3A 4Q43A 4B3TF 1HI8A 2OSRA 3D66A 1VRUA 2R9LA 3HLUA 1RT3A 4YMEA 3OL8A 1KVIA 1T9UA 1X0FA 4L72B 3QGHA 2Y9HA 1AA1B 5EHHA 2J9CA 1T05A 3NCPA 2JHEA 4ANCA 1N54B 3C6UA 4MK9A 3UR3C 2YVSA 3MMCB 3JYTA 1BMQB 3IGVA 1CC8A 4K4UA 1UW9A 4JUZA 2BANA 4W90B 4DR5J 1TP7A 4LREA 2F8HA 3E01A 3CEDA 6AT1B 2XYPB 2MZSA 3DU6A 5KOXA 3WQPA 3MEEA 1S1XA 4LVNP 3MCMA 1KR4A 3AA9A 9ATCB 2R7TA 3OVSA 1EZZB 2JVRA 1QY7A 2HZVA 4IQXA 1S72S 4D3GA 1PSDA 3PNIA 3LA0A 4IFYB 3DRRB 1HW9A 4NLYA 1VK3A 4CCHA 1FERA 4JI0J 2CJQA 1XJWB 1F5AA 4RW4A 1S6PB 3SBMA 1U6ZA 3NXZA 1XMBA 3ZZ0A 3I5AA 2HHVA 2BMBA 5GMEA 2KN4A 2RQKA 4KH1B 1IBLF 3MMAB 4P6QA 4PPDA 4UZCA 1N6QB 2MHNA 1O51A 1Q0NA 2CNNB 4NEYA 2XGQA 4ELVA 1HNIB 2KVQE 3BGRB 2LEPA 5KFUA 3I87A 1SH2A 3A3NB 1QJHA 4CLSA 2CWXA 1Q8BA 4WU2A 5K8MA 2RILA 2ZM6J 1KC8T 4QIFA 2OLWA 2WVBA 4LF5F 4J9RA 2ZBIA 2DO0A 3DGPB 2XBPA 4F7VA 4Y6IA 2XZDB 1U25A 3NS5A 4QWAA 4MKAA 4ED8A 4L75A 1G6BA 2BV3A 5D0GA 1HNZJ 2CJ9A 4NXMF 2ZVSA 3EGVA 3Q8YA 2VASA 3PW2A 1PAEX 2IPOB 4F3OA 4AL7A 2V67A 2ZH5A 1HR0J 5CZVA 1CJVB 1SI9A 1JLBB 1UZHA 3ENVA 4AYBD 4HH0A 3RAXA 2IAJB 5GAEU 5D4PA 2VKRA 5FD1A 3DRRA 2G1DA 1IR1A 3M30B 3NBPA 4KRWA 2BJ9A 3M05A 1RA6A 4DV5F 1RYSA 2FUG9 4LMZA 3DRXA 2R8GA 2NPFA 5HMYA 4A8KA 4FVCA 2W4DA 1KQSR 1NJWA 1F9FA 1F9EB 4DV1F 3C14A 3SQOP 2VQFF 2YH0A 1GH8A 2V2KA 1R8BA 2DKOB 2E9ZA 3UVJA 2IDEA 2NQPA 5HO4A 3IBCB 3H59A 5L1IA 3JAMY 3F44A 5KFZA 2ZEJA 4RNNA 4NLTA 4XK8C 1HNIA 3BGRA 4TU9A 3W5ZA 4FXWA 3Q8VA 4ATNA 2X1BA 5ETLA 2DNGA 4TY8A 4DFMA 3CCTA 2DHAA 5A8KA 3CDUA 2VG5A 4A8WA 3U7JA 3K7RA 5IC6B 3PV8A 4MMOA 3PYFA 4WE1B 2UUBJ 3ZZPA 1YQHA 4FBUA 4B08A 2RSQA 1NKBA 3FKBA 5BR8F 1IM6A 5KFTA 2A10A 1FX4A 4FXVA 1JB0C 5KT2A 3GCWP 2HG4A 2IRYA 5F0WA 1VQYA 1WSVA 3UDCA 3KG1A 4R8UB 4P75A 3FUYA 1BUXA 2MKSA 4RL1A 3KK2B 1RAOA 1URNA 3QATA 5KG5A 3T1YF 4YHHF 4H4KC 3MM6A 1PILA 3CSKA 4H4OB 2APOA 3FC9A 4AD6A 2FHKA 1QTNB 3HULA 3MECB 3T1AA 2XLIA 1J5OB 2W2QP 5D0RA 4ZN3A 3HXMA 3HJVA 2MKIA 4F8RA 5MLCV 3GCXP 3C8YA 4RJVA 1RWXB 2OGUA 4HR2A 2C42A 1C0UA 2AJ2A 3HKZD 3MCNA 3T6JA 1HYSB 1S1WB 2DR6A 1MMLA 4P7VA 4ED5A 3TJ8A 3MCOA 2ZDPA 4DL2A 1S1UB 2IDLA 3MR5A 4ZS6A 4C8YA 2NXJA 5T41A 1YTYA 4B3TJ 3MCSA 2FVPA 2ZH4A 2CJYB 4DWIA 2P6TA 2VPWB 2MQQA 4W98A 3EXYA 3QSYB 3MR2A 2E1CA 1S5ZA 4K4TA 1G1XA 3Q24A 3K89A 2ZJRQ 4WBFA 3EYZA 5KFRA 2GA7A 4QYZJ 3CUNA 1RWNB 4GO7X 2QL5B 2AJ1A 1FFWB 2HNZB 2GQCA 1M5KC 1MLAA 1X4BA 4WYLA 2OFHX 4ZVQB 4R8UA 1VQ8S 3CDWA 1CS4B 1VGYA 2CPFA 4ECXA 2I5JA 1UPPA 3KXDA 5KFDA 1TZ0A 1T9TA 2VH7A 2Y1JA 1AT1B 2LA4A 4RZRA 3MFIA 4YP3A 3EVWA 1NBEB 3IBFB 2W2NP 2E1RA 3GMGA 3PRVA 1LNQA 2LXFA 2HHPA 5JVGQ 1J5OA 4AL5A 1X7VA 2R2RA 3NKYA 2XQCA 4N77A 2JWNA 3HPOA 2KKHA 2VPXB 4DUZF 3E51A 3KTQA 1Q5YA 3R7NB 3LWLA 5HVFA 2FJWA 4NWBA 4QWBA 3R6LB 3BYPA 2DXEA 2RHSB 4DMZA 2O1PA 2E1MC 3F41A 4NCGA 4DSKA 5HBMA 4CQ1A 1JLQA 5HP1A 4NLWA 3MPUB 2ZHOA 2DYAA 1RWPB 1CJKA 1GFWB 1GMUA 1URRA 3SFGA 4ECRA 1RAIB 3J81U 4IRCA 2KXFA 2VG7B 5HLFB 3PRDA 3VR1A 4RBTA 2XSJB 5G0RB 3CTRA 2FYXA 1PAUB 1LWEB 3FMWA 3FSYA 4O0NA 3U1MA 5HVGA 4NXMJ 2RRAA 2ZHAA 1T9YA 3MZIA 4F26A 1HHQA 3PO5A 3QWPA 4C98A 1YX2A 1CS4A 3J7AN 5F8MA 2WB4A 3DOKB 3VV2B 2GVZA 2BJ8A 4ITSA 3D1HA 3W2VA 3OFFA 2AX0A 4ZPCA 3OBIA 1V6HA 3MAAA 2QEXS 4DV5J 1U1QA 2XTJP 4FYYB 1BQMB 3K57A 1RHUB 4QR0A 4PXEA 3DC2A 2GC8A 2VQFJ 3UN2A 4O3SA 7FD1A 3THTA 4DL5A 2OHDA 3ELHA 4ZVHA 3LPYA 2J76E 3FVYA 4CYUB 2XYHB 2D3OR 5B0EA 4KIAA 4DN0A 4DV2J 1S7IA 5GADU 1RHKB 1N34J 1WC6A 5LSRA 2W8LA 3QRRA 1TL5A 3PJ9A 1WELA 4MH8A 2BDPA 4PR6A 2YNFA 1M1HA 3TVYA 3H42A 5J1EB 4DQSA 3CO0P 2OEJA 2KJVA 4KV8B 2VHGA 2OEKA 3PR5B 4A8XA 1UEKA 4ZP6A 3VAJA 4DI6A 5IT4A 5BR8J 2HAIA 1RJJA 4N8NA 2B8PA 2PT0A 2Q6BA 2Y3YA 1U1OA 2BKNA 2IHR1 1JWWA 4NYPA 2ACYA 3KKFA 1RT4B 3CW2C 4LRCA 5KFEA 1HBMB 3FQLA 2OPPB 3GLJA 3Q8UA 4HHUA 5SZTA 1TKDA 1N5YB 2KRBA 1NK8A 4F36A 3T1YJ 4YHHJ 5D3GB 1NPRA 5L9NA 1KNZA 4PQUA 1WTBA 1SIWB 2JLEA 3DOMA 1S99A 5HSPA 1BQMA 2IJFA 3CT9A 3NNHA 4PWUA 2M88A 4LF9J 3KMSA 1WEZA 3BQ0A 1FXDA 1NZAA 2JLFA 1GK8A 2ZOMA 4M5NA 5KFHA 1DQ9A 4QYZK 4OZ0A 3CD6S 2A2DA 3CCJS 1HW8A 2B4VA 1D8YA 1LKZA 5DJBA 2HQIA 3AAWB 4UUXA 1NZ8A 2WK4A 3V4IB 3P3DA 1DQAA 3HF5A 1JNRB 4CWBA 1VISA 1RHQB 2XC9A 2WOMB 2VBXA 1LFPA 2IIHA 1SJ4P 2B9YA 3KUGA 1XMQF 4KR0B 2KT2A 4GRSA 5IV4A 3LQVA 1P9QC 4QJVA 1EP4B 2QX0A 3R5AA 2Q6CA 2ABYA 2VPZB 2P5VA 3ETMA 4QU6A 2IFXA 3GR0A 3AQPA 2EI5A 2VQEJ 3BO4A 3AT1B 3LALA 1Y10A 2JFDA 1QSYA 5J2PA 3IR7B 4EGLA 2DNQA 1FKPA 4IR1A 4F3MA 4ECWA 2K3IA 3DM2A 4ZVUB 3VQSA 2DK2A 4ZP9A 1VQ4S 1N52B 4CLFA 2KB2A 2QMWA 4PABA 1KQGB 1KS2A 3GV8B 2VFUA 4IH6A 2DEIA 4IFVB 3HT0A 1Y4ZB 1KLMA 2H5IB 1N4LA 2HWIA 4QOTA 1SPBP 1AYEA 3QIDA 3HFVA 4RW8A 1YRUA 1QVGR 1JJCB 4X64J 4NX9A 4E2FB 2HS4A 1QD1A 2UVRA 5F3ZA 1SKUB 2Z8QA 1XR5A 2YPZA 3GJQB 3VVUA 4IH7A 4DUZJ 2VDHA 4UZBA 5ETVA 3WIUA 2ZWOA 1S79A 1UAWA 1WG5A 4ID5B 2RKIB 1AW0A 2VUGA 4QIEA 3MM7B 1Y00A 3TARA 3IAS9 3AD9C 4BC9A 4ALZA 2KM8C 4FF3A 2WOMA 2GJIA 4CNZA 3BR9A 3R1HA 3KK3A 2Z58B 5GAGU 5EUHA 2UU9F 4C8OA 4P10A 3AB2B 3FEZA 1V3RA 3QO9B 5LMNF 3N79A 1RU2A 1VQ9S 4NPOA 2FLPA 1R3NA 5I3PA 4C11B 2R8HA 4LVOP 4RW9B 1MN9A 3W61A 4LFAF 1S48A 3EICA 4LBHA 1D9AA 2P9GA 1N48A 2L08A 2OJ3A 5AXLA 2W9BA 1LW0B 3X1LB 1OPZA 3S7RA 2D9OA 1TKXB 3CCZA 2W4PA 2DGVA 4ZIWA 2LDIA 2K7JA 6FDRA 4B9SA 3MOZA 1S0VA 3M1VA 5LL6d 4ZVEA 1H73A 4RO0A 3KHLA 2DIVA 3HZGA 1H74A 3Q22A 3I9ZA 4RR5A 4IOAQ 4RWWA 2DGOA 3ICLA 1P6TA 1UETA 2C2DA 4V1Ak 3R6GB 3PIPQ 4Q45A 3CJ5A 2WONA 3B6BA 4ID5A 1IKYA 2RKIA 4YN3B 5KFWA 4LBIA 4Y65A 3NGUA 2NPIA 2H1YA 1PC4A 2P6SA 3V6HA 2HK2A 2CJAA 1UZDA 2N3LA 1K44A 1VOMA 2CFXA 4ED7A 5F8LA 5C2GA 1QM9A 3I82A 4K4VA 3AOBA 4LQ9A 2XULA 1LK7A 4B9TA 3G4SS 2G1HA 5CYQB 1RZMA 4B9VA 4GC7A 5KT7A 3PHTA 3OTBA 1VQSA 1N0UA 3PIOQ 1UCNA 4L3NA 3NGRA 4OLOA 1U1MA 2NXNA 2KZZA 3NS6A 4DLEA 4C8LA 4CO0A 2HBZB 2GX8A 1ZA1B 1BGXT 4MKBA 2J0SD 2GVDA 3I31A 4DPUA 1WDTA 5CCLA 3TQ1A 3QT8A 4ECZA 2DGQA 5KFXA 2AGQA 1FD8A 2CAJA 3KFWX 4Y28C 1LW0A 1IKXA 3ZC4A 2IM0A 1FTRA 1TVRA 2DPIA 4JI3F 4DPOA 4KB7A 1L3SA 1MMNA 2FVSA 3G82B 2CA9A 1PJ6A 2GMJA 4LFCF 4ECVA 2N7CA 4MKYA 4MYTA 4OHVA 1GEHA 1OSCA 3VAHA 2B9WA 3PX6A 1FNMA 4JV1A 3SZ2A 4LR9A 3CGIA 1XNQJ 1C0TA 4ES2A 4ZCKA 2BABA 1HMVA 2PMHA 4YDXA 4NLOA 5FDLB 1U24A 1S0NA 3UDVA 2HNYB 3SCIE 1AXQA 3N9UC 2MQMA 4ZPAA 2YWWA 3HHLB 1RT6B 5IT9U 1BHNA 3AJDA 2OPSA 1DRZA 1D3WA 1RAEB 2M70A 3M2RB 4WYWA 1NAQA 4Z37A 4OX9F 4OYBA 3D0GE 4C8KA 2CUYA 4GO5X 4CO5A 2G2ZA 3KLIB 2X1FA 2XMTA 4YB7A 3CJRA 1XR7A 1FWKA 3DHWC 3MWBA 5CYQA 3RZAA 4K4WA 3QJLA 2BA9A 1XMQJ 4KGZB 4I56A 1QUVA 3IN5A 2D3O1 3CF5Q 4OHWA 2AEFA 4DV0J 2ROGA 3CCLS 1AUSL 3Q8RB 2ASJA 1EJ7L 2OD4A 3QMQA 5A2QY 3HFZB 1TQLA 3R97A 2XWXA 1KSPA 2IJNA 4R25A 3DLBA 7AT1B 2MYFA 1B99A 4CIOA 4DR1F 2DT9A 2JZ5A 3UN3A 1ZAXA 1JMTA 2AMCB 4KO0B 1YBAA 2H3EB 2F4FA 2XWYA 3LPEA 3DXBA 3KLEB 3FMBA 2QN6B 5E3AA 3TX0A 4HL9A 2GGPB 2GMHA 1IBCB 4OI6A 1WC5A 1Q5VA 3AY0A 4RW6A 2WSFC 4O3PA 3DLEB 3Q8SB 3WBZA 3WIVA 1WACA 4OZJA 4KAIA 1QE1B 1RAHB 3H4DA 4WFNQ 3K5NA 1U48A 5KG0A 2MKKA 2DRBA 2QLJB 4LIWA 2D3ZA 4A8SA 3I0RA 3ZNJ1 1ZA2B 1S6OA 1B0VA 4C2MA 3HHLA 3IG1A 4J9SA 3PRBA 4URSA 2W2PP 2XI2A 2CQ1A 3FRZA 2V69A 1WC4A 1T8EA 3M2RA 2GV1A 3QWUA 3I6PA 3FFIB 4OIXA 2V6AA 2ILYA 1KTVA 1X9MA 2E5GA 3OT9A 1UJ5A 5KG7A 5AE3A 5J2QA 2CADA 2DGTA 2C3OA 2UU9J 2VPYB 5KFYA 4NLQA 4HACB 3DRYA 2NXCA 3V6DB 5KFMA 1EETB 3QIPA 5LMNJ 1SC1B 4WTOB 2N3OA 4ZMMA 2C2MB 1ULRA 4Q0BB 4LFAJ 3CJ3A 1YK9A 4ZHRA 4CLKA 3CDAA 4B9NA 2V68A 1LXJA 1EQMA 2EFGA 3DI6A 5GAHU 3NEKA 4RBVA 4IYQA 2JEIA 1UP1A 3I9V9 2AP6A 1AB8A 4DL3A 2HKEA 1HQUA 2DH9A 2B43A 2R42A 4QZVB 1JLCA 4KHPJ 4P7TA 3U27A 1SCJB 2EFQA 1HBOB 2NXEA 4FPRA 2IM1A 3HKWA 3CD7A 4X2BA 3DRSA 4ZLJA 3NWGA 4JI8F 1RP5A 3NOCA 5F3TA 3HT3A 5D6GA 2AJQA 1F0XA 1BC6A 4OYZA 1X5PA 1U0SA 3UO0A 3CCVS 2VU5A 5CXTA 2VA3A 2ZD1A 1UA1A 2HHWA 2L9WA 4QW8A 3KHRA 3H20A 1WG4A 3R5GA 4PPZA 3H8YA 4J90A 3BKUA 2DHXA 1C1CA 4HACA 3W7BA 2L9NA 3EJMA 1XERA 2CQBA 2R8JA 3DLKA 2DY1A 2YKQA 5DETA 3NY0A 2KG0A 1NDLA 4DX7A 5ITHA 2DISA 2V9KA 3R1LA 2HAFA 2U1AA 2B3TB 4M5KA 3E2EA 3KLHB 2KT3A 1T03A 5ETTA 1ZPWX 3G87A 2YKMB 2H54B 4JI3J 3ET6B 4Y2CA 5JJBA 4CO3A 4JI6J 3CO9A 4LFCJ 4USVA 4U95A 2Y1IA 3CMAS 1DHMA 2OTJS 4P2MA 1HBOA 3R27A 3K5PA 4HLBA 3NOGA 2KH9A 3JQJA 2V4QA 3K5MA 4KGKA 1H7WA 4KJIA 3LGNA 1U2RA 1U2FA 2V8GA 3GG0A 4HTJA 1WJ9A 2WBMA 1XTZA 3M2UB 1TL1B 3IC1A 3RG6A 1S1VB 2DRDA 1U45A 1RTHB 5BYSA 2OP5A 4DQPA 4KHMA 2CPJA 5ETSA 4F4KA 4OL8A 2VB6A 4F0KA 3HMJG 5C7PA 2ALZA 4WZQA 4CM0A 3NCQA 2BRLA 3LANA 5LOQA 1X9WA 2D7SA 2IA6A 3UPFA 1TUVA 4OX9J 1IWGA 2FJXA 2BVZA 5ETRA 2FJAB 4ZVPB 3V6JA 1TV6B 4L6V3 2CQPA 4IG0B 2ZOFA 3MEDB 2J7WA 4ID8A 3BGUA 2ZE2B 1MMDA 4JI1F 1KN6A 1UVKA 2Z2ZA 3MR6A 2FPHX 1VCTA 4IRDA 3KDOA 1RCOB 2LYVA 1RE1B 1UFWA 4C6AA 5C25A 2DD8S 4DV6F 3C2PA 2GHPA 5FLXY 2I8EA 4ZJLA 2COLA 4IO1A 2ZUGA 4DR1J 3LGMA 4X4SA 5AXKA 1EKSA 2C22A 1H2VZ 3DOLB 4L73A 1H2UX 4USKA 4OZNA 3KLFB 2VKZG 3M2VB 1MU2A 2XLJA 2LECA 4O3OA 2LQ9A 4WFXA 1E6VA 2RJZA 1HARA 6FD1A 3D3CJ 4Y2IA 1W26A 3NMRA 2UVUA 2GQQA 4O3RA 1FD2A 3VAGA 2P2CB 2DNPA 1B64A 3GZ7A 3WX8A 2C2ZB 2MQOA 4CH7A 3VGSA 3G6ES 2XMKA 3T9NA 2A1BA 3PYEA 2K8GA 1Q1KA 2KXHA 3PW5A 4I7FA 1NK0A 5KFJA 1JXLA 1N88A 4FN5A 3OL6A 4E0DA 1N56A 3H5XA 4MT1A 1FRMA 2UUCJ 2H48B 2PGCA 2KFZA 1T9VA 3V6KA 4IRKA 4ZVOB 4CT8A 4C8MA 1OYEA 3S6EA 4HYKA 3MTJA 1WOPA 4N7TA 4XAKA 1T3OA 1MWQA 1YWXA 1IBMF 4NLUA 1SKRA 5IV3A 5HAOA 4TQSA 2BQ3A 3KNGA 1OYDA 3FZBA 3CJ2A 3GIKA 4TU7A 2VOOA 3WC0A 2MJUA 2YNHA 5C42B 2XNRA 2BEFA 2W7AA 2JC0A 3IS9A 1FJGF 1FE0A 3LP0B 1F1BB 2HIYA 3DOLA 3ZTSA 3UE2A 4XDDA 5KFLA 4PG5A 1U02A 5LT5A 3DMJB 2ZFHA 3OFHA 4CI0B 5EWFA 1Y7PA 1GX6A 1I51B 4M5HA 4LF4F 1AUDA 1R8HA 4RW7A 3BDEA 1VBKA 3M6UA
chains in the Genus database with same CATH topology
2HBQB 2DKOB 1SC1B 2H5JB 1RHRB 2H4WB 2HBYB 2C2MB 2H4YB 3NS7B 1PYOB 2FQQB 1IBCB 3GJRB 3IBCB 5K20B 1RHJB 1RHQB 2XYGB 2H48B 3R7BB 3GJQB 2XZDB 3R5JB 2HBZB 1RHUB 4ZVOB 1RWOB 2CDRB 1QTNB 1RWNB 3D6FB 2QL9B 2QL7B 2QL5B 3GJTB 1RWPB 2CJXB 3KJFB 3RJMB 3D6HB 1GFWB 2QLBB 2QLJB 4DCJB 2H65B 1RWMB 3D6MB 4ZVQB 2Y1LB 2C2KB 5IC4B 2XYHB 1NMEB 1RWXB 1ICEB 3SIPB 1RHMB 1SC4B 3P45B 4ZVSB 4DCPB 2C1EB 1I3OB 5IC6B 1RHKB 3R6GB 3IBFB 1PAUB 4ZVPB 4ZVTB 4LSZB 2P2CB 1RWVB 2QLFB 2Y0BB 2C2OB 2C2ZB 4ZVUB 3KJNB 2CNNB 3GJSB 3KJQB 2XZTB 2H54B 1BMQB 3EDQB 4JB8B 4ZVRB 3R7SB 4DCOB 1RWWB 2CNOB 2CJYB 2H51B 1RWKB 2CNLB 1I51B 3EDRB 1QDUB 1SC3B 3R7NB 2H5IB 1RE1B 1F9EB 3P4UB 2XYPB 3QNWB 3R6LB 2CNKB 2HBRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBQ B;  2DKO B;  1SC1 B;  2H5J B;  1RHR B;  2H4W B;  2HBY B;  2C2M B;  2H4Y B;  3NS7 B;  1PYO B;  2FQQ B;  1IBC B;  3GJR B;  3IBC B;  5K20 B;  1RHJ B;  1RHQ B;  2XYG B;  2H48 B;  3R7B B;  3GJQ B;  2XZD B;  3R5J B;  2HBZ B;  1RHU B;  4ZVO B;  1RWO B;  2CDR B;  1QTN B;  1RWN B;  3D6F B;  2QL9 B;  2QL7 B;  2QL5 B;  3GJT B;  1RWP B;  2CJX B;  3KJF B;  3RJM B;  3D6H B;  1GFW B;  2QLB B;  2QLJ B;  4DCJ B;  2H65 B;  1RWM B;  3D6M B;  4ZVQ B;  2Y1L B;  2C2K B;  5IC4 B;  2XYH B;  1NME B;  1RWX B;  1ICE B;  3SIP B;  1RHM B;  1SC4 B;  3P45 B;  4ZVS B;  4DCP B;  2C1E B;  1I3O B;  5IC6 B;  1RHK B;  3R6G B;  3IBF B;  1PAU B;  4ZVP B;  4ZVT B;  4LSZ B;  2P2C B;  1RWV B;  2QLF B;  2Y0B B;  2C2O B;  2C2Z B;  4ZVU B;  3KJN B;  2CNN B;  3GJS B;  3KJQ B;  2XZT B;  2H54 B;  1BMQ B;  3EDQ B;  4JB8 B;  4ZVR B;  3R7S B;  4DCO B;  1RWW B;  2CNO B;  2CJY B;  2H51 B;  1RWK B;  2CNL B;  1I51 B;  3EDR B;  1QDU B;  1SC3 B;  3R7N B;  2H5I B;  1RE1 B;  1F9E B;  3P4U B;  2XYP B;  3QNW B;  3R6L B;  2CNK B;  2HBR B; 
#chains in the Genus database with same CATH topology
 4PG4 A;  3ENQ A;  3CJT A;  4JI8 J;  3MUV P;  2HZA A;  2HHT A;  3IP0 A;  4JI7 F;  2JEF A;  3QRQ A;  5DG7 A;  4WU3 A;  2J6T A;  3LGH A;  4CDI A;  3VAM A;  1B0T A;  2R3V A;  1P1T A;  2CG4 A;  2A6M A;  4DG1 A;  3AOD A;  4CLW A;  3M6V A;  5KT4 A;  3U1L A;  4RWX A;  4NA3 A;  2MQP A;  4OV6 A;  4EFA C;  2XMJ A;  3DLL Q;  4AQY F;  2DH8 A;  4LSZ B;  2M8D B;  5FII A;  1S9E B;  1EHW A;  1R8P A;  3MAH A;  1FA0 A;  2FVC A;  3MR7 A;  2JC1 A;  2SXL A;  2V2Z A;  4F25 A;  4ZPT R;  1QVF R;  1NB7 A;  4U8V A;  1YBT A;  3JQK A;  3QGI A;  1FF2 A;  2DR9 A;  1Y3J A;  5L1L A;  4WFB Q;  1C1B B;  1DTT B;  2BE2 B;  3IM8 A;  2V4R A;  1FFS B;  4G1Q A;  1FEE A;  2FHJ A;  2CPY A;  4K2J A;  1TFW A;  4WF9 Q;  5D4L A;  1MNE A;  1TMM A;  4U7C A;  3O8W A;  1X5S A;  2E7V A;  1JK9 B;  4MYU A;  5J2M B;  2W9C B;  3MM9 B;  2GJ2 A;  1TKZ A;  2HGN A;  2C3M A;  2GAH C;  1S1T B;  5CHC B;  1RA7 A;  4P9S A;  1IM4 A;  1RWM B;  3D6M B;  1AZS B;  5THW A;  4B3R F;  5E5N A;  2K1R B;  2RT3 A;  3JSB A;  4OZ2 A;  2PMW A;  2YNG B;  2M9K A;  2C3Y A;  4GVB B;  2UVV A;  1V9O A;  2E9R X;  1VBX A;  1CJT A;  1DLO B;  5IM0 A;  1R0A A;  1JLG A;  3P5B P;  3T41 A;  2VON A;  1NEE A;  3BQ2 A;  1M5O C;  2JEJ A;  4C3M A;  1TUG B;  3NWR A;  3S8S A;  3BS9 A;  2BZ2 A;  2CYY A;  5E7O B;  3PEH A;  5J2N A;  2BQR A;  4P74 A;  2BJ7 A;  1NDP A;  3P4U B;  5HJY A;  4WWS A;  4LRF A;  2F8M A;  5A6P A;  4JI1 J;  1X9S A;  2ZKT A;  3CNQ P;  4C3K A;  2EFO A;  4Y34 A;  1EIY B;  3BR8 A;  1FCA A;  1O0P A;  1W25 A;  2GJF A;  1X5O A;  3RJM B;  4DV6 J;  4CZC A;  2R7W A;  5L39 A;  2V50 A;  1SXL A;  5EWE A;  4Y00 A;  3RRK A;  3D54 A;  2M4M A;  5KFC A;  4E8U A;  2AGP A;  3A8K A;  1SV5 A;  3JXO A;  1RHM B;  3CD0 A;  4NLP A;  1ZAW A;  3TWZ A;  4NLR A;  4MJK A;  2DNK A;  1PJ5 A;  4M95 A;  2V4J A;  4ZIV A;  2EC0 A;  2QYC A;  4IG3 A;  3IA0 A;  4QU7 A;  1V5I B;  3CCQ S;  3C16 B;  2CPX A;  1SJ3 P;  4NLG A;  1NK9 A;  2AW0 A;  4LF2 A;  1NCL A;  1SUQ B;  4ZOS A;  1B7F A;  2E29 A;  1DLO A;  1WUU A;  3O5T B;  1J27 A;  1Q7Y T;  3QJJ A;  2DNZ A;  1RAB B;  3HD1 A;  2QSW A;  1UKU A;  1NK5 A;  2VBW A;  2WZ1 A;  3VZI A;  4U7U D;  1TKT B;  4CT9 A;  4UOF A;  1IR2 A;  2QLB B;  4KGX B;  2IYI A;  2YNI A;  3CWJ A;  2VFS A;  1Q8L A;  3BH6 B;  1RAF B;  3SCL E;  2WW8 A;  3A1Y G;  2Z2M A;  2HHX A;  8RUC A;  4EK2 A;  1NKE A;  1NME B;  5L9X A;  2XY7 A;  3PM9 A;  4NYZ A;  4ZCM A;  1S7H A;  2V8D A;  3KUH A;  4ZP8 A;  4UW2 A;  4G3I A;  3CC4 S;  1DQ8 A;  4OQJ A;  3MM5 B;  1KDN A;  4O4G B;  3KNA A;  1Q8K A;  1IBM J;  2C2R A;  2BX6 A;  3BZQ A;  3TZW A;  1U09 A;  1TL7 A;  3IGN A;  2EG2 A;  2E66 A;  1T95 A;  3N6M A;  1FJG J;  2GW8 A;  4C48 A;  4ZP7 A;  3I96 A;  4MK8 A;  2I0X A;  3DHX A;  1U1L A;  3PYD A;  2HHQ A;  3UD5 A;  4WII A;  3PAC A;  4DPT A;  1OIA A;  3MHY A;  1LFW A;  1DTQ A;  2HBY B;  4PXB A;  5C2C A;  5KFF A;  4O44 B;  1IR0 A;  3FSX A;  2DVI A;  5B0D A;  4CH1 A;  2EKY A;  3IBW A;  2AGO A;  2PO4 A;  3ZZY A;  1SQE A;  4GC6 A;  5I42 A;  4DL7 A;  5BYR A;  2V2Q A;  4DU8 A;  1SUQ A;  3GTY X;  2AYM A;  3DRP B;  1U6F A;  5FJ4 A;  1R31 A;  2W2O P;  2F3J A;  3FK4 A;  4YR2 A;  3TUZ C;  3FGV A;  3W8G A;  1JLA A;  3OR1 B;  1RT5 A;  4PUO A;  1UA0 A;  3RBD A;  4NZ7 A;  2DJW A;  4LRB A;  2RHQ B;  3MD3 A;  2HGM A;  2B9E A;  3FEY B;  2LU1 A;  1VQM S;  4LSL B;  2UVW A;  4DV7 F;  3EZO A;  2EK6 A;  4AQY J;  3GQC A;  2DNR A;  4OX7 A;  2HMI B;  2KHD A;  2HPU A;  3ILJ A;  2E7X A;  2BBE A;  1C4C A;  4A47 A;  1RT7 B;  4OYP A;  3H90 A;  4O4G A;  5T7L B;  1KVK A;  3W60 A;  1FFG B;  1VQO S;  4WIQ A;  1UJ4 A;  3SV4 A;  3O1L A;  3HDS A;  5EX0 A;  2HEK A;  2AV5 A;  3KG0 A;  3W64 A;  4IR9 A;  3AQO A;  1FJ7 A;  1U1R A;  4I64 A;  3CDB A;  1VR6 A;  5IS2 A;  2BJ1 A;  3SQG A;  1JLE B;  3J81 j;  2XHW A;  4DN9 A;  3M7V A;  4CO1 A;  4I69 A;  4BWJ A;  1ROF A;  1K9M T;  4I2P A;  1L3K A;  4JI4 F;  2FLN A;  4AXJ A;  4B3R J;  1HHT P;  1X0P A;  5CZX A;  4Q44 A;  4YUD A;  2ADC A;  1RTI B;  1WHV A;  1RWK B;  1L5U A;  7FDR A;  5DGA A;  1NH7 A;  2CRL A;  4F0M A;  3GSI A;  1IN0 A;  2Q3P A;  2YKP A;  1EAY C;  4DL4 A;  5HAN A;  4ZLP A;  3QAE A;  4LF1 A;  1TAU A;  1Y5N B;  2ZNY A;  3EX7 B;  2YX7 A;  1SIZ A;  3O3L A;  3NL0 A;  1HKA A;  1JQG A;  1OPI A;  1XQI A;  4DUY F;  2XEX A;  2O01 C;  2G2Y A;  4H4M B;  3HZE A;  1UEV A;  5DZ6 A;  4DS4 A;  2MGZ A;  3KLG B;  2R7U A;  1ZM9 A;  1IKW B;  2QLX A;  3PKY A;  4ED0 A;  1F3F A;  1ZZF A;  1PBA A;  2R7Q A;  2W8K A;  4GKK J;  2LQJ A;  2ZUA A;  1HNV A;  4Q8F A;  2RD5 C;  3KHH A;  3HSZ A;  1O6X A;  3EGZ A;  4KYZ A;  1IUJ A;  2QIF A;  5DGB A;  1HPZ B;  3OLB A;  4DR7 F;  3TEG A;  2E5J A;  2HRT A;  3G86 A;  1HNW F;  1DFD A;  3R3T A;  3MMB A;  1XWL A;  2CQ3 A;  4FF4 A;  2GIF A;  1JLE A;  1HBU B;  5LJ5 Y;  4AFF A;  1F6T A;  2MQ8 A;  1MG7 A;  2B9X A;  5BJR A;  1RUS A;  5KT6 A;  2B0G A;  4WXW A;  3G8S A;  3GIL A;  4WJB A;  4USM A;  2WB1 D;  3RB0 A;  1Y3K A;  1RAD B;  2X1G A;  1BQN B;  2BM1 A;  1EB0 A;  3D2W A;  2FY1 A;  1FEH A;  4DQI A;  4C7Q A;  3RAM A;  1M1G A;  3HI9 A;  3SDE A;  2NYI A;  5DDO C;  3S01 A;  1CG2 A;  4OYO A;  4M5D A;  2RNE A;  3FQK A;  2QA4 G;  3BQ1 A;  2B6A A;  2HUR A;  1RAC B;  2EG1 A;  3GYN A;  2ZBC A;  3Q86 A;  3ETO A;  1FRH A;  3C15 A;  4MFB A;  4K5S A;  4L74 A;  2KM8 B;  2RUS A;  4OYA A;  3X3U A;  3BPS P;  2RDI A;  2D41 A;  2DR8 A;  3V81 B;  4C9D A;  2JJ4 D;  2BJD A;  2ZZT A;  1H72 C;  3GON A;  5CYJ A;  5HQ8 A;  1TFY A;  3M8Q A;  4USJ C;  2ZC4 A;  4O3Q A;  2ASL A;  2V0N A;  4EEY A;  1IKW A;  5I3Q A;  2YWK A;  3SEO A;  5D8H B;  3OTO F;  4NOH A;  3JAM U;  2QRR A;  1WKJ A;  1RTD B;  4MIW A;  4F50 A;  4J9P A;  2WCX A;  2CNK B;  3O2I A;  2RE1 A;  1RSC A;  3M32 A;  3IAM 9;  1HPZ A;  1FDD A;  1VYA A;  2HVE A;  3OLA A;  3MM8 B;  2BYC A;  3GII A;  4OYX A;  1U2C A;  2IC3 A;  4EBD A;  3H2U B;  4C0O C;  4EO6 A;  4CRJ A;  3J7Z 5;  4Y0F A;  2YKN A;  1RDR A;  3A4T A;  3UQS A;  3D1O A;  5HMX A;  1VIO A;  4OI1 A;  2ZIT A;  2J9E A;  2RML A;  4C0H A;  4LSN B;  2DGU A;  5DQH A;  1UVI A;  4C97 A;  2YQ1 A;  3NGD A;  1S49 A;  1N0V C;  4FPI A;  3CCR S;  1RT2 B;  1V3Z A;  1IKV A;  1B4S A;  4DR6 F;  4PWW A;  3T9Z A;  4BS2 A;  2FHM A;  1JLF B;  2PFF B;  2AQ4 A;  3R5D A;  1TL3 B;  1Z4U A;  1RAJ A;  2M52 A;  2IM3 A;  3I5B A;  1KFS A;  5SUH A;  3BSC A;  5KFG A;  3GV5 B;  4ILL A;  4TN2 A;  4P72 A;  3J7Y I;  2NZ4 A;  2IRX A;  1HQE B;  4JV5 F;  3GFX A;  5B0F A;  3H5U A;  2XM3 A;  2X51 A;  3DKD A;  3EDR B;  1LK5 A;  3MMC A;  3DFE A;  1N33 F;  4FF2 A;  2AIR B;  2HFU A;  1ZYQ A;  2RF2 B;  3VGV A;  1VJW A;  1REG X;  3OVB A;  4DXL A;  5IT0 A;  4QWE A;  3PY8 A;  1MW7 A;  1KQF B;  1SJ1 A;  4DV7 J;  1U1N A;  1WOS A;  5D4N A;  3UCU P;  1T3N A;  1X4A A;  3LAM A;  2ASD A;  4XPE A;  3LOU A;  1HNX J;  4CLY A;  1TK5 A;  1I5O B;  2HSE B;  4QPT A;  3T19 A;  3KK1 B;  3TVZ A;  4ZPV R;  1CC7 A;  4CLZ A;  4IFY A;  4J9U E;  4LRD A;  4WFA Q;  3EZ5 A;  4P52 A;  1I3O B;  3QT5 A;  2D69 A;  2L9D A;  1S6P A;  3CCE S;  3TOQ A;  2HHH F;  3DLJ A;  3R8Y A;  4X66 F;  3KJN B;  3OJU A;  3GV7 B;  3MMA A;  1U8W A;  3KJQ B;  1Z2Z A;  2VFR A;  4DS5 A;  5K8N A;  1N6Q A;  1JJ2 R;  4B9L A;  1UFL A;  4UTG A;  1NJX A;  4C4W A;  1OO0 B;  4JI4 J;  1FJE B;  2GCF A;  3THV A;  2J7U A;  1WWH A;  2XS7 A;  1KHW A;  4JI2 F;  2G0J A;  3RB4 A;  2HS3 A;  2E44 A;  3UD4 P;  2MB0 B;  3ZTQ A;  1NRK A;  3IWX A;  2KFN A;  5E3R A;  3H2V E;  4I0W A;  2PI5 A;  3DGP A;  1MRO B;  1IBK F;  2MY8 A;  3TX8 A;  4YR0 A;  3HD2 A;  2YH1 A;  3BSA A;  3NAI A;  4I2Q B;  2FVQ A;  1P27 B;  1XMO F;  2RQ4 A;  2FJB B;  3K58 A;  2WRM A;  2FHO B;  1SL2 A;  1V3S A;  4OJG A;  5KFK A;  5IZH A;  4DUY J;  5U47 A;  4XIU A;  4P2S A;  2DNM A;  1WF1 A;  2OPQ B;  4PEO A;  1Q8I A;  4HT7 A;  3CMQ A;  1CJV A;  5I4M A;  1JLB A;  4R5P B;  2VOP A;  2IAJ A;  5K14 B;  1KP6 A;  3VQT A;  3M8P B;  5AE2 A;  3POT B;  3M30 A;  4UOH A;  3JSM B;  3W8P A;  3K8W A;  3Q89 A;  1X4G A;  4CNY A;  5DQG A;  1RTJ B;  4DV4 F;  5AJ3 F;  4DR7 J;  1TK0 A;  2IVY A;  2P9E A;  1HNW J;  4QW9 A;  5D15 A;  3TAP A;  4HHH A;  2G9O A;  3CJS A;  1NKC A;  2BXJ A;  2L48 A;  2VV5 A;  5BYQ A;  4NI2 B;  5G4D A;  3PJW A;  2BW2 A;  3R7B B;  3G6V A;  2CIM A;  2NSB A;  4ZJQ A;  2MQL A;  1J5E F;  1WNE A;  3BB5 A;  5HQM A;  1CQM A;  5A76 A;  1SKS A;  4KC5 A;  4U96 A;  1PKU A;  2OMO A;  2CJK A;  2VDI A;  2YY3 A;  1S9G B;  1V5V A;  4F0H A;  2KT5 A;  1N36 F;  1HL6 A;  5DZ7 A;  1G3O A;  1DJ0 A;  2ZH7 A;  1SH0 A;  3LP1 B;  3A3P B;  3EMT A;  2HND B;  3OJS A;  4ICL B;  2CKW A;  3RB6 A;  2HZC A;  2MSS A;  2HRY A;  3BRE A;  2BKO A;  1ELO A;  3FZ2 A;  1YJN S;  3B82 A;  2AEJ A;  3LO3 A;  4DR4 F;  4WE1 A;  2WAQ D;  4YS2 A;  4I2Q A;  4FKY A;  4U67 Q;  3NNA A;  4JB8 B;  2CWK A;  3BKT A;  2D1C A;  3NRB A;  1RTZ A;  3ENW A;  2ROP A;  4ZPW R;  2N4C A;  3OXL A;  1GXL A;  3AOA A;  4DSE A;  2KZM A;  1NLK L;  4LR7 A;  2EKN A;  5ETP A;  4C8Z A;  3VAF A;  3CJK B;  1RBL A;  2F65 A;  4I68 A;  1VRT B;  4TY9 A;  1PGZ A;  4OLP A;  4PKD B;  3Q2T C;  5HVH A;  3VVT A;  2XCA A;  1LWC B;  4DFP A;  5K9F A;  4YOE A;  3KK2 A;  3M8P A;  4Q5V A;  3JTP A;  4H4O A;  4NE9 C;  3B54 A;  2DNL A;  1R6Y A;  4DSF A;  3MEC A;  5B0B A;  2B51 A;  3RW6 A;  4LF8 F;  2CJB A;  2A6O A;  3H4B A;  2CPI A;  5KTQ A;  3IMQ J;  1GQE A;  2B5J B;  1IBL J;  5DM6 Q;  2CQ0 A;  2XZW A;  5A8W B;  1U49 A;  4OZ1 A;  2VIC A;  4WP9 A;  1FTC A;  4EMD A;  1KOH A;  3EM1 A;  4X4N A;  1HYS A;  2VFV A;  4Y2K A;  4O4R A;  3A8E A;  1S1W A;  5HN0 A;  1S9G A;  5IWA F;  2J8S A;  1HIY A;  4N5S A;  5HRO B;  3CCS S;  4DUT A;  2MZJ A;  1S1U A;  3NCR A;  2ACM A;  3DYA B;  5HAT A;  2DGW A;  4ED4 A;  4TXS A;  1X4E A;  4A8Q A;  1VQK S;  4NML A;  3N5B A;  4FYW B;  3TVK A;  2NLW A;  2VBY A;  1S10 A;  4LF5 J;  4B02 A;  1ZTT A;  4JV5 J;  4ER8 A;  5T14 A;  1F5C A;  3VAI A;  3PDN A;  2PII A;  2QTW A;  1Y9O A;  4ILM A;  1N33 J;  2OO4 A;  2DHG A;  4OJ1 A;  1OY9 A;  5KAK A;  1RBO B;  5H9F J;  4WFY A;  2C2N A;  1Y5L B;  3OHA A;  2VJV A;  1YLX A;  1YDL A;  1A6L A;  1SL1 A;  1XR6 A;  2AHO B;  1LWF B;  2XMU A;  3M9M B;  2EFV A;  2F4V F;  3MPV A;  2HNZ A;  1Z1Z A;  5KG2 A;  2EPI A;  4CLT A;  2EVZ A;  3LW5 C;  5A0Y B;  5JVH Q;  1GXU A;  4QBU A;  4EZ9 A;  2CPZ A;  1S6Q B;  1KWM A;  1OWX A;  4JYA F;  3HJF A;  4G65 A;  5AT1 B;  2GZO A;  3ILO A;  4RU2 A;  1ZS6 A;  4CLL A;  3R5B A;  3HVA A;  3OFG A;  1REV B;  3CME S;  5DS7 A;  4DV1 J;  2HQF A;  3IRX B;  4X66 J;  1VMB A;  4ERD A;  2YXL A;  1RWU A;  8ATC B;  1Y11 A;  4BWM A;  4AT1 B;  3R5C A;  1CJU B;  3VAK A;  3L09 A;  2CXE A;  3W9I A;  4AL6 A;  3LP2 B;  3H5S A;  1YJR A;  2CVI A;  4USH A;  4AXI A;  3TZY A;  1WTF A;  3DYA A;  4JI2 J;  4I1T A;  2ATL A;  3A8J A;  3JTO A;  3NGS A;  4QIG A;  4JI0 F;  1DBD A;  2KYZ A;  4XTT A;  2V8H A;  1JKH B;  2PE8 A;  5F8G A;  2LU2 A;  1I94 F;  1A7G E;  3CDE A;  1P9Y A;  4R0E A;  4IOB A;  2VG7 A;  2KVI A;  1BWE A;  5HLF A;  4OV1 A;  3AD8 C;  2UXB F;  4URG A;  3TAN A;  2XSJ A;  1YJW S;  1PC5 A;  2B4O A;  5G0R A;  4NYO A;  4CO4 A;  3DN9 A;  2KU7 A;  2V5H G;  5IFM A;  4N41 A;  1LXN A;  2DGS A;  1VQ6 S;  1LWE A;  1SJQ A;  4PG8 A;  3TZX A;  2RU9 A;  3G96 A;  1GNK A;  3R7S B;  2WVF A;  2O5D A;  4UOC A;  3CPW R;  3PZP A;  2LLZ A;  1RK8 A;  1H7X A;  1RT1 B;  5A0Y A;  3R2D J;  3L4B C;  1YRT A;  1YJU A;  3M4X A;  3ADA C;  2QT7 A;  4I4B A;  3DOK A;  2H4Y B;  3TA1 A;  2XYG B;  4O23 A;  4A46 A;  1K1Q A;  2BM0 A;  1FJC A;  2HFS A;  1RWO B;  4DV4 J;  5AJ3 J;  4P73 A;  3AH6 A;  4KKO B;  2VG6 B;  2FZC B;  1EX8 A;  1YIJ S;  3OFE A;  1GTH A;  2J7K A;  4FYD A;  2QYG A;  4Z7C A;  2JVO A;  2BUN A;  4ANE A;  4DBQ A;  4ED6 A;  5L1K A;  5JMN A;  4TKT A;  3ZTP A;  3MXH P;  1CJU A;  4DHV A;  1WF0 A;  3W2W B;  4CYU A;  3LP2 A;  1UVJ A;  4FNI A;  1JIH A;  4UOG A;  1JJH A;  2Q43 A;  1N36 J;  4WXO A;  1X31 C;  2FC9 A;  3PHE A;  2HFN A;  2NRE A;  5M2P A;  1DAX A;  2CQD A;  2BR0 A;  1KVJ A;  4AUK A;  2VC0 A;  1HBN B;  2FTR A;  1WC3 A;  1I1G A;  4O0I A;  2YQ3 A;  5J1E A;  1KFD A;  2P8I A;  4ELT A;  4KV8 A;  2NYH A;  4DR4 J;  2E1P A;  4DU7 A;  3I4P A;  2F8E X;  1VQL S;  3LTO A;  3AFG A;  2CQH A;  3VHQ A;  1JXE A;  1VFJ A;  2WVC A;  4F4Y A;  1M1K T;  2B7C B;  3NMA A;  3W66 A;  2OFG X;  5K8P A;  4K2X A;  2Q1L A;  3ITH B;  2LEB A;  1RT4 A;  2D9P A;  2YX1 A;  1WOO A;  1HBM A;  1VRU B;  1RT3 B;  4B3S F;  2OPP A;  1U47 A;  3PX0 A;  4NL5 A;  3N6N A;  2LEA A;  3P45 B;  1T05 B;  4DX8 H;  1N5Y A;  4FYX B;  4DPW A;  3C6U B;  2BW7 A;  5CD4 H;  5D3G A;  2FJV A;  1B70 B;  4FF1 A;  3AHP A;  1FVQ A;  3QQC D;  2BAN B;  1N5S A;  4LF8 J;  3H0P A;  4X4V A;  1TR0 A;  2AF6 A;  1X4F A;  1XK8 A;  3E01 B;  4TU8 A;  4ECQ A;  1F3V A;  2W4C A;  3RRH A;  4PCQ A;  4U7U K;  4X84 A;  2DB1 A;  5H9F K;  1HWK A;  1N5Q A;  1S1X B;  5ETO A;  3W2W A;  4ECU A;  4EYI B;  3T3F A;  2Y8W A;  3ZO7 A;  4JOU A;  3F0N A;  1Y0H A;  2M0G B;  3V4I A;  4X65 F;  3PW7 A;  4NA2 A;  4BDP A;  2Y0S D;  4KH0 B;  4RW4 B;  3IWN C;  5E33 A;  3P5T L;  3TAQ A;  1T7P A;  1NDC A;  3W63 A;  3RTV A;  1SVD A;  2C2K B;  1VC5 A;  1EP4 A;  2GO9 A;  2WVD A;  1NSA A;  3K5L A;  1X5T A;  4LIR A;  2PEH A;  1S57 A;  1VK8 A;  2P9C A;  1VC6 A;  5ETN A;  2MKJ A;  4ES3 A;  3HHL D;  5KOW A;  2QZ8 A;  1X4D A;  2JH3 A;  2ZBP A;  1SQG A;  2HK3 A;  1XEZ A;  4P2F A;  5D77 A;  2F4V J;  3D0H E;  1VC0 A;  3MD1 A;  1PYT A;  3VWS A;  1GX5 A;  2YWH A;  3IWL A;  4DX5 A;  1WDD A;  1WF2 A;  4WKY A;  1WEX A;  4F3Q A;  4ZLL A;  3PW0 A;  2IY5 B;  2Z0G A;  3ZXW A;  2DBB A;  4JYA J;  3GIR A;  3MPW A;  2CPD A;  2HBQ B;  4ED1 A;  4BLG A;  4IFV A;  3R9L A;  1T9X A;  2C28 A;  2MDA A;  1LW2 B;  4CP5 A;  4JP8 A;  2UZA A;  2XG8 A;  1CVJ A;  2YBV A;  4P71 A;  2VFT A;  2QG9 B;  4F4Z A;  3GJT B;  3M8W A;  3J80 Y;  2XMW A;  1IXK A;  4F02 A;  1ZM4 A;  2FVR A;  1NND A;  5ETK A;  5A2Q U;  4OYM A;  1UJ6 A;  1GMW A;  2F1F A;  2V63 A;  1BD6 A;  1VQ7 S;  3QLH B;  5GAE I;  4M5L A;  2DPJ A;  2KXN B;  3MM7 A;  3SSS A;  3NBP B;  1FWP A;  4LF7 F;  2QLW A;  2CQI A;  4EU0 A;  4I67 A;  2PFD A;  2QE5 A;  1I94 J;  1G4C A;  2GHW A;  2MST A;  3C14 B;  4N76 A;  1NSK L;  1X4H A;  2D3U A;  1NO8 A;  3QO9 A;  3QFH A;  4QWD A;  4ZCL A;  5GMK a;  4I6Y A;  3UVJ B;  1K0V A;  2UXB J;  1RAA B;  3KUE A;  4C11 A;  4RW9 A;  3TZZ A;  4XPC A;  5H9E J;  4EYH B;  5A6W A;  4ZPD A;  3KOA A;  3KDN A;  3VGT A;  3EPI A;  3THP A;  4Q7A A;  1Z2L A;  4OMF G;  3OPK A;  3BBB A;  3B4D A;  3FRY A;  1TKX A;  4TY8 B;  1AFJ A;  2RS2 A;  5A8K B;  3G8Q A;  2AU0 A;  2VG5 B;  4EO8 A;  1HWJ A;  1SJF A;  4M1K A;  3UNY A;  1VRQ C;  4GVL A;  2XLK A;  2LVW A;  3RBX A;  1PJ7 A;  4M5G A;  5ETM A;  1LW2 A;  4LJM A;  1YVF A;  2CG8 A;  3ULH A;  1QAI A;  2IA0 A;  3TO8 A;  4DF8 A;  4NMX A;  2HGL A;  4RUB A;  4B17 A;  4WTY A;  3BN4 A;  4DQQ A;  2FDN A;  3QLH A;  5H1S V;  2DXF A;  3V4M A;  2UV8 A;  2M5Y A;  3MM6 B;  4DSJ A;  1TK8 A;  2RRB A;  5KT5 A;  2IM2 A;  4F2R A;  1RHJ B;  2E5I A;  2XSF A;  1VLY A;  4U9R A;  3KHG A;  1QAJ A;  2KHC A;  1N8R T;  2DRA A;  1NK6 A;  1CUL B;  3JSY A;  1PBU A;  3N0V A;  2MPU A;  4N47 A;  1GXT A;  1C0U B;  2Z56 B;  4DV2 F;  3LH2 S;  1NHV A;  1YBU A;  2HVD A;  3KWM A;  1N34 F;  3Q8Q B;  1B0P A;  4E98 A;  1PO6 A;  4DF4 A;  3BEG B;  3QAU A;  4IQM A;  2R8K A;  4B3S J;  3G82 A;  2I38 A;  3RAQ A;  5AE1 A;  3DNC A;  4USI A;  4DR3 F;  4IDK B;  1RWW B;  2ZVI A;  3H2L A;  4WK3 A;  1UWB B;  4A8F A;  2O67 A;  1RB0 A;  1ZTW A;  2R7V A;  3GG1 A;  1D09 B;  5DG9 A;  3AA8 A;  1RLC L;  5FDL A;  1LQ9 A;  2HWH A;  2PC6 A;  2HNY A;  4PXD A;  2HYI B;  2FQQ B;  4B3M F;  3GIM A;  3KMQ A;  4DEZ A;  5DDR C;  3PO4 A;  3K0J A;  3QJP A;  2XI3 A;  3ENA A;  5DDQ C;  2XCP A;  4G1I A;  1RT6 A;  4EZ6 A;  3TR5 A;  2GIQ A;  2OKQ A;  2I5J B;  2OEM A;  1FES A;  2JFK A;  3N28 A;  3UWT A;  4J9V A;  4Z2X A;  3I56 S;  4QQB A;  1FXR A;  3ISN C;  3OXF A;  3T6B A;  5CYM B;  2IBK A;  3D6T B;  1YZ6 A;  4X65 J;  3KLI A;  3SIP B;  4ZKA A;  2KDO A;  4HT5 A;  3SCK E;  3T5K A;  5F9N A;  3FBC A;  3KG4 A;  4FP9 A;  3FCH A;  1UWA A;  4LF9 F;  4AND A;  3CB4 A;  1HHS A;  4J9O A;  1CUL A;  3AXK A;  3Q2S C;  2FLO A;  2JLG A;  1KEK A;  4NCG B;  1VHI A;  2HWT A;  4ETX A;  5F8I A;  5HBM B;  1JLQ B;  5LJ3 Y;  4KO0 A;  4K5R A;  2ZH2 A;  5HP1 B;  1UW4 A;  3CVK A;  3KLE A;  1NK4 A;  2Z30 B;  3QGG A;  4NA1 A;  4HEA 9;  5B0G A;  1CJK B;  2K3K A;  3CC7 S;  1TAQ A;  3EWG A;  2GGP A;  2I9S A;  1K1S A;  1NH8 A;  4IDK A;  1MSW D;  2R2S A;  2F9J A;  2HQ3 A;  2ZOG A;  1UWB A;  3DLE A;  4CLP A;  3CXC R;  1QE1 A;  5IQ6 A;  4LFB F;  3OV7 A;  4M5J A;  5IC4 B;  3M9N B;  2VQE F;  3BGL A;  3IXQ A;  3UDE A;  2NXU A;  1GTE A;  2DHS A;  1WHY A;  2NUH A;  1M5S A;  2V34 A;  3HFK A;  5J1N A;  3MF5 A;  4M5I A;  1D9D A;  4ZA1 A;  2UXC F;  5H9E K;  3QZ8 A;  2BRK A;  3PCO B;  5HJX A;  2GVZ B;  2RB7 A;  1WD6 A;  5KG3 A;  4KT0 C;  5FLX U;  3TAM B;  3G71 S;  2DEJ A;  2OAU A;  3W2V B;  5CYM A;  2ZDO A;  2MKC A;  3FFI A;  3BSO A;  3MAA B;  2OPR B;  4K50 A;  4LF7 J;  3U1N A;  1GAO A;  2FD2 A;  4LQ3 A;  4G6V B;  1UPM B;  3TRG A;  4X64 F;  1HD1 A;  3FNN A;  1D9F A;  4LRA A;  4RNF A;  2XS5 A;  3GYX B;  5L38 A;  3ONQ A;  4OFZ A;  3DLG B;  5JUM A;  1NSQ A;  2ZWP A;  2X7I A;  3V6D A;  3CD5 A;  1EET A;  4KGM A;  1XC9 A;  3UFC X;  1H2T Z;  2RVJ A;  2XY6 A;  2VBZ A;  3PTW A;  2H9Z A;  1WEY A;  5HI7 A;  4OJ3 A;  2V94 A;  4OX8 A;  4Q0B A;  3PJX A;  3FBF A;  4TLQ A;  3GIJ A;  2UP1 A;  1G7C B;  5GAD I;  3L7P A;  5B7W A;  2DHH A;  3N01 A;  1M90 T;  1IQZ A;  1C4A A;  3OUY B;  3SXL A;  3GE9 A;  2NZC A;  2YNF B;  4QCL A;  5JXS A;  5EWG A;  3B8H A;  4HDH A;  4J91 A;  1OS5 A;  3PVX A;  4DZD A;  5B09 A;  3NP5 A;  1QAY A;  3EE3 A;  1S77 D;  5LMU F;  3K2Y A;  1CPZ A;  2KO1 A;  3A12 A;  1H6K X;  3RBZ A;  1P8G A;  3UCZ P;  2WBR A;  3OVA A;  1SBR A;  1RBA A;  5CA5 A;  1OMS A;  1KRP A;  5E3P A;  3HHE A;  3NS7 B;  3GJR B;  5K20 B;  1Q86 T;  2FHJ D;  4V19 X;  3DLH A;  1QSS A;  2DNH A;  3TAM A;  3ZNU A;  1TEL A;  4CLU A;  4NLV A;  4FDF A;  3RUB L;  4UY8 T;  1RGV A;  4I6W A;  2OPR A;  4M94 A;  4PQU B;  1GMV A;  1U26 A;  3DOM B;  2CQG A;  2NSC A;  4RBU A;  4MKV A;  1BY9 A;  2GS8 A;  1L3T A;  1APS A;  2G2O A;  1SC4 B;  1FHT A;  2AD9 A;  3DLG A;  1NJZ A;  2BKP A;  4PG6 A;  4QYR A;  2W25 A;  2R2T A;  1YJT A;  1T02 A;  4ES1 A;  4YDD B;  4HH1 A;  4F67 A;  2WHO A;  4J9L A;  4A8O A;  4OI0 A;  2LKZ A;  1X8D A;  3L7U A;  3UI3 A;  4Q8E A;  3TQE A;  3AOC A;  2UUW A;  3KLH A;  4KSE B;  3HP6 A;  3MAQ A;  2QC3 A;  3OUY A;  2GO8 A;  2YKM A;  1FVS A;  3GP9 A;  3ET6 A;  4P2X A;  3CCU S;  1D0E A;  2R4F A;  4HI2 A;  4GKJ F;  3RR7 A;  2QJ3 A;  4DR3 J;  2AYE A;  1J2V A;  2FJD B;  4RUH A;  3BH7 B;  3QZ7 A;  3HK2 A;  1YI2 S;  3PR4 A;  4K4S A;  4OZ3 A;  3ZZR A;  3D6F B;  5J1P A;  5AXN A;  1R43 A;  5J2P B;  4B3M J;  3W9J A;  3M2U A;  1TL1 A;  4EBC A;  2V2V A;  1S1V A;  3IFE A;  2MZQ A;  1RTH A;  1LV5 A;  1T11 A;  1FKP B;  2HS0 A;  2JOQ A;  2KL8 A;  4G1P A;  2QSF A;  4DL6 A;  1UVM A;  3D5M A;  1Q95 G;  2Q79 A;  1BXN A;  3DM2 B;  4MIA A;  5ETQ A;  4ZCI A;  1Q53 A;  3MTK A;  1JNZ B;  2RH3 A;  3M6W A;  3PW4 A;  2DNO A;  4TQR A;  1K8A T;  2FZG B;  2E5L F;  1XNQ F;  2BE9 B;  1QLN A;  2HW3 A;  1NHK L;  1F2G A;  2FC8 A;  3J81 Y;  2VZ9 A;  1KLM B;  3LWM A;  1TV6 A;  4IG0 A;  3K17 A;  3MED A;  4RW8 B;  4L76 A;  3CJ4 A;  2ZE2 A;  3LUY A;  3NNC A;  4KBI A;  4CTA B;  2CQ2 A;  2GQ2 A;  3CUL A;  1Q81 T;  2R8I A;  2WW4 A;  3CC2 S;  1XNR F;  2H4W B;  2LDY A;  4Q2M A;  2YKO A;  5KFV A;  4UST A;  4NAS A;  1AFI A;  3BBF A;  4OHZ A;  5MAO A;  3R5J B;  2W7P A;  3BPD A;  5I3U B;  4YQW A;  1FE4 A;  3ILL A;  4WKR A;  3MEK A;  2F5G A;  2FY8 A;  2MXY A;  5DLG A;  1WHX A;  1L3V A;  1S4E A;  3GB0 A;  1X4C A;  2M8H A;  2ILZ A;  1ZAV A;  2VL1 A;  3SFU A;  5GAG I;  3KLF A;  3KK3 B;  3SI8 A;  2B4U A;  3M2V A;  1ZH5 A;  4DV0 F;  4QWC A;  1T9W A;  3HVR A;  2CPH A;  4LFB J;  4ETZ A;  3BBC A;  2QA1 A;  2R7X A;  3VTI A;  3L7O A;  4RUC A;  2DNY A;  5BXI A;  2W9B B;  3OR2 B;  2W01 A;  2ZJP Q;  2QFJ A;  3D9B A;  2UXC J;  1PYS B;  2GAG C;  1KQK A;  5CCM A;  5D4O A;  1S4F A;  4IOC Q;  3M1V B;  4Y3C A;  2HQG A;  4F4A A;  2RQC A;  1FRX A;  3LAK A;  3I0S B;  3FBB A;  2J0W A;  2XMV A;  2IBO A;  3KJF B;  2IVF B;  4DPX A;  2C3P A;  3ZTO A;  4KHR A;  4CTA A;  2AJF E;  3GFZ A;  2EXU A;  4PAA A;  3H98 A;  4KTQ A;  2WON B;  3QT7 A;  1IKY B;  1WHW A;  2GML A;  5E41 A;  5I3U A;  1TL4 A;  3TI0 A;  4J7C A;  2RRN A;  2EBE A;  2IRU A;  3OTE A;  3M8Z A;  5C42 A;  2ZH9 A;  3OL7 A;  4MAK A;  1LOU A;  2QV6 A;  3LP0 A;  1LEO A;  2NR0 A;  1NJI T;  3MUT P;  5L8R C;  3VGU A;  2EC2 A;  2I2Y A;  4X4R A;  3DMJ A;  1YHQ S;  1NU4 A;  3KJV B;  2Y8Y A;  4J9M A;  5EGY A;  3G8T A;  4J37 A;  5LMU J;  4K4X A;  4FYV B;  1UTA A;  2WSE C;  2GVD B;  1FDN A;  4JV2 A;  4M8L A;  3PEJ A;  2O3D A;  3O44 A;  4B3O B;  3FBE A;  4FNH A;  5E3C A;  3OR2 A;  4KFB B;  1IKX B;  4JBC A;  1X60 A;  3QBC A;  1TVR B;  1NM2 A;  4U8Y A;  5RUB A;  2Y1L B;  1KD1 T;  4KHP F;  3TUJ C;  3PYG A;  3TJ9 A;  1IQT A;  1C0T B;  3I0S A;  3HVT B;  1OY8 A;  1HMV B;  3EPG A;  1RQ0 A;  5KFS A;  2DO4 A;  4UUW A;  2BE7 D;  2E9T A;  2MHE A;  5DM7 Q;  2R2U A;  1S9E A;  1XBW A;  2WSC C;  3HCX A;  1W7W A;  1FDA A;  1Q79 A;  3NGT A;  4BCA A;  4NCB A;  1RCX B;  2OPS B;  1C1B A;  1DTT A;  4USU A;  3QT6 A;  2BE2 A;  4PZV A;  4H4K A;  1S76 D;  4YY3 F;  1ZZN A;  3T5J A;  1R27 B;  1H98 A;  4GKJ J;  2VIH A;  2EFN A;  3PG9 A;  5J2M A;  2W9C A;  2ALY B;  3MM9 A;  3HHN B;  3KJV A;  4EUV A;  1VIX A;  1HLW A;  1S1T A;  1OJ4 A;  1AZS A;  1VQ5 S;  4K0K F;  2B56 A;  2K1R A;  2ADB A;  1S9F A;  3CE8 A;  2YNG A;  4B3O A;  5B08 A;  4GVB A;  4DJB A;  1R0B G;  3MPY A;  1HI0 P;  1HD0 A;  4KFB A;  2LQ8 A;  1CBK A;  4Y2A A;  1WSR A;  1R8C A;  3W3S A;  2MKH A;  3PFO A;  3BO2 A;  3BYR A;  3T1H F;  1XIQ A;  3AD7 C;  1YZ7 A;  2CNO B;  4ED2 A;  4ED3 A;  4JI6 F;  1FWL A;  4ZK7 M;  4FXD A;  1WC0 A;  4M63 A;  1RKJ A;  4RNH A;  2WVE A;  1VQP S;  1ACM B;  3AJ1 A;  4RW6 B;  2HLT A;  2C2E A;  1KTQ A;  2E5L J;  3MR3 A;  2JRS A;  3HVT A;  2DNN A;  3BGO P;  2N82 B;  4NLS A;  3J7Z T;  2FIU A;  4IKA A;  3I0R B;  1FXL A;  2XY5 A;  2YKA A;  2PMZ D;  2JL9 A;  1XNR J;  3RRG A;  3IG1 B;  3H7H B;  9RUB A;  2K7K A;  3W9H A;  1L3U A;  3GSD A;  1R89 A;  4OYW A;  3P8B B;  2V8P A;  1VJQ A;  4ZVS B;  2XGP A;  4J5O A;  3TEH B;  2J5A A;  2DCU B;  1FX2 A;  2CVE A;  2Z2Y B;  5LM7 E;  3RW7 A;  3QFW A;  4XO0 A;  5D78 A;  2QFI A;  5CAA A;  3J7A 1;  3N4W A;  5J2Q B;  1KON A;  4DOZ A;  2AZ1 A;  2ZJQ Q;  3QYY A;  3W65 A;  4DL0 C;  3GFH A;  4TYB A;  4OJH A;  1K73 T;  1RAG B;  3QIP B;  2ZZN A;  2CNL B;  2IVM A;  1C2P A;  3C16 A;  3GFY A;  4LF4 J;  3D68 A;  1BE4 A;  1DAR A;  2HBR B;  5F8J A;  1U0H B;  4FZV A;  3DDN A;  5DG8 A;  2AWZ A;  1FRJ A;  4ZHR B;  4UT4 A;  5F8N A;  3T5L A;  2VA2 A;  1JX4 A;  4JI7 J;  4C3L A;  4F04 B;  3MMJ A;  2MKY A;  5GAH I;  3DI6 B;  3IO1 A;  2W9A A;  2QA4 S;  4N8O A;  2QL7 B;  3IM9 A;  1HQU B;  2K06 A;  4I6A A;  4M5M A;  1JLC B;  4A48 A;  2DR7 A;  4HTI A;  2H65 B;  3MUR P;  1EAR A;  5AXM A;  1TKT A;  3C19 A;  3VZH A;  1WG1 A;  2PEB A;  3ZZO A;  1S0O A;  1DUR A;  1QSL A;  4NEZ A;  3BM7 A;  3DRS B;  5GMD A;  1EKR A;  3O6Q A;  5CH7 B;  1VDH A;  2HHU A;  2F9D A;  3R2C J;  3MM5 A;  4OHX A;  2V9W A;  2E1A A;  4RLE A;  5CAB A;  2LCW A;  3W5X A;  3TUI C;  3RBE A;  1S12 A;  2GFF A;  3RR8 A;  4OX6 A;  2ZD1 B;  2OSQ A;  4ILR A;  2F40 A;  3HX9 A;  5EX3 A;  1FRI A;  3AB4 B;  2Z57 B;  2UUC F;  2MLZ A;  3ZTR A;  4RU9 A;  2KYX A;  2JDJ A;  2HVH A;  2XNQ A;  5GVQ A;  2VJU A;  2A18 A;  4KQZ A;  3M6X A;  1FI4 A;  5B0A A;  2PDA A;  2X3G A;  4BHQ A;  1NXI A;  4O44 A;  5F9L A;  1C1C B;  4GMK A;  2I6W A;  3E3X A;  2CZ4 A;  1UVL A;  1CLF A;  1Q78 A;  3DLK B;  4PYD A;  3C46 A;  2W2M P;  1U0H A;  5IT9 Y;  4XDC A;  2ZH8 A;  1IJE B;  3DRP A;  3RU0 A;  4JI5 F;  2K2P A;  2FB0 A;  1T03 B;  3I4H X;  1WKK A;  5M2U A;  4FS1 A;  1YJV A;  2W1B A;  1MWZ A;  3WHI A;  4RNO A;  2AYB A;  2R7R A;  4UQT A;  3OR1 A;  3GJS B;  3MPD A;  2HLU A;  2XMM A;  2OUG A;  2HRU A;  2X1A A;  3FJ2 A;  1BQX A;  3BJY A;  5DLF A;  3C6T B;  1Y5I B;  1R0C B;  5KG1 A;  4TLR A;  4LSL A;  3VAL A;  4PXC A;  2AEM A;  4YFU A;  1M5P C;  2VC1 A;  3FCV A;  2HMI A;  2W7O A;  2OTL S;  4RX6 A;  3CJ8 A;  3WZ0 A;  1TMJ A;  3W1Y C;  2YQ0 A;  1P1L A;  4ZVG A;  1RT7 A;  2POK A;  1OQ3 A;  1N32 F;  2OIH A;  5T7L A;  4J9Q A;  1ARO P;  2BJ3 A;  3ZFV A;  3G9C A;  4A4J A;  4ZDN A;  4JV0 A;  1JXV A;  1FNO A;  1RKI A;  1O5J A;  2YX4 A;  5LSL A;  2E5H A;  3UCG A;  3OW2 R;  4NZ0 A;  3NG8 A;  4YY3 J;  2HIQ A;  5CQG A;  3UW1 A;  4ZJO A;  2EK1 A;  4K59 A;  4A8Y A;  1RU1 A;  3EGN A;  3OHB A;  2C2O B;  3PFE A;  1FDB A;  4BBY A;  2PI4 A;  3U02 A;  3EDQ B;  4F4X A;  1M5H A;  1KHV A;  5C25 B;  4K0K J;  4HVZ A;  1RLD A;  1MWY A;  3OL9 A;  2M3D A;  3KYL A;  2A0F B;  1B7Y B;  1RTI A;  1CSJ A;  1HFE L;  3T1H J;  2HHS A;  1TTH B;  4QIV A;  4Z7Y A;  3V2U C;  1UFK A;  4CO2 A;  2L3M A;  1MU2 B;  4YB1 P;  4LF6 F;  5DQI A;  3C6T A;  1UMJ A;  2UV8 G;  3KLV A;  1E6V B;  2XHC A;  1UL3 A;  4H4M A;  3TP2 A;  3D67 A;  4R0J A;  5HQL A;  4DSI A;  2AYG A;  3KLG A;  4IO9 Q;  4BC7 A;  2WTF A;  2RQM A;  1NB2 A;  4NRU A;  2B8Q A;  1VI7 A;  2UUA F;  3B4M A;  5KFQ A;  4N56 A;  4I7F B;  2FGO A;  4B9M A;  2BOP A;  4URQ U;  1QAX A;  4DDF A;  5F0U A;  3BO3 A;  1NDK A;  3GU0 A;  3MFH A;  2JNJ A;  4DCO B;  1HWU A;  2LMI A;  2XO7 A;  2ZBQ A;  5CD4 A;  2H5E A;  1VQN S;  3PX4 A;  1HBU A;  4O3N A;  3Q83 A;  1OQ6 A;  2HFZ A;  3ZZU A;  2ZH6 A;  3DDI A;  2MQN A;  4HDG A;  1BQN A;  3MOJ B;  5LXY A;  2B7B B;  3CIM A;  5L46 A;  2VF3 A;  4NRT A;  3UNG C;  2PA3 A;  5F8H A;  2X3D A;  4KPC A;  4DQR A;  5C24 B;  5KFB A;  1F2H A;  2FJE B;  5E3Q A;  2RDJ A;  2MTL A;  2YNH B;  3M8R A;  3L95 X;  3IS9 B;  4W4M A;  2VD3 A;  4HKQ A;  2XMA A;  1SQF A;  4DCP B;  4U6P A;  4PWD B;  4K7Q A;  3JB9 k;  1TU0 B;  2L41 A;  4LT6 A;  5HK4 A;  1YSJ A;  5E0O A;  4WFZ A;  1CEZ A;  3M9O B;  4FBT A;  3V81 A;  1FK9 B;  4RUA A;  2ZNZ A;  3WX4 A;  5K8O A;  1WOR A;  1F9H A;  4RW7 B;  3SMZ A;  2HVZ A;  2JX2 A;  4IH5 A;  3QSI A;  3D0I E;  2GIR A;  3G6X A;  2V8V A;  3PKM A;  1PG5 B;  2RDD A;  1GT8 A;  3N5F A;  4EBE A;  1HWL A;  1RHR B;  2R7S A;  3IR6 B;  1RTD A;  3SCJ E;  3ISN D;  2M7S A;  3SSQ A;  1YKW A;  2G0I A;  4F2S A;  3MM8 A;  2UXD F;  2R7O A;  3DGV A;  1Q82 T;  3MUM P;  5IXU A;  2LFV A;  4NLX A;  2QL9 B;  4DG1 B;  4IUF A;  3D3B J;  1IWA A;  3D6H B;  4QR1 A;  4TNO A;  5LSO A;  3MDF A;  4MIB A;  3EVM A;  4LSN A;  4PG7 A;  1W2I A;  3VCD A;  1CQN A;  3H40 A;  1RT2 A;  1RI7 A;  4X62 F;  1RYR A;  3CJQ A;  4QIW D;  3BSN A;  1RWV B;  1WC1 A;  1JLF A;  3BKF A;  5C24 A;  3QPI A;  5A8R B;  4KGV B;  1TL3 A;  3JTN A;  3DU5 A;  4CM2 A;  2XZT B;  2MZT A;  2HQD A;  4JI5 J;  2AZ3 A;  4G1Q B;  1VLO A;  1RXO B;  2ASY A;  4PWD A;  3IR5 B;  1QUP A;  2LXU A;  1HQE A;  3J7Y U;  4QR2 A;  2OEL A;  1K47 A;  2ZHB A;  3EZU A;  5B0C A;  2DR5 A;  2J6S A;  4RKU C;  1TKZ B;  2EW9 A;  3P96 A;  4ZPB A;  1FK9 A;  4DR2 F;  1VHF A;  3GYG A;  2RF2 A;  1F60 B;  3W62 A;  2CDR B;  4L3K A;  3F73 A;  2NS1 B;  3N6L A;  1T0T V;  1ZM3 A;  4DFJ A;  5F41 A;  1T94 A;  3NAH A;  4WK1 A;  1ZBT A;  1CJT B;  3HVW A;  4PRF A;  5IM0 B;  1R0A B;  1JLG B;  1N32 J;  3C66 A;  3KK1 A;  4NXN F;  4DLG A;  1YG0 A;  3I32 A;  3IRW P;  4WCE Q;  1BWV A;  1ZET A;  1DZ5 A;  2MLY A;  2IMO A;  5J2N B;  4WP3 A;  1EQ0 A;  4MTP A;  4RPF A;  3UN5 A;  4KPY A;  3A3O B;  2LQ5 A;  2KFY A;  4OZ5 A;  8AT1 B;  3CJ0 A;  2G4B A;  3RB3 A;  3GWC A;  2FLL A;  1N5V A;  1OSD A;  5D0H A;  2DY9 A;  2H5J B;  2KG1 A;  2E7W A;  2NCK L;  1M5V C;  4J9N A;  1U8S A;  2BAC A;  3UR0 A;  5A8R A;  1W2B R;  2VOD A;  3TA0 A;  4NLD A;  4YB6 A;  4X4T A;  1ZPV A;  5KT3 A;  3P6Y C;  4KY3 A;  3G6Y A;  1IJF B;  1SV5 B;  1NJY A;  2RUG A;  3FCW A;  1S0M A;  2IJR A;  4LUB A;  1UEU A;  2CZV C;  1FRL A;  1Q4R A;  3K8V A;  1MRO A;  5KFA A;  3JSR A;  2V4J B;  4LF6 J;  2QO3 A;  3QGP A;  4IG3 B;  1SKW A;  4A8M P;  2YWG A;  3BV8 A;  3PXG a;  3EVO A;  1D8Z A;  1A9N B;  4EI2 A;  2HFV A;  3HSG A;  1TUW A;  2EWH A;  3US5 A;  1F5B A;  3LF0 A;  2OPQ A;  3OTD A;  2YPY A;  2DCL A;  4ZVR B;  2H51 B;  4UF4 A;  1FKO B;  3OTO J;  1HI1 A;  4R5P A;  2UUA J;  3S1T A;  4DZ6 A;  4X4P A;  4QPX A;  5K14 A;  2AKW B;  2NUU G;  1FO1 A;  2DXD A;  3POT A;  2CDQ A;  2MEW A;  4UQG A;  4FS2 A;  3JSM A;  1RTJ A;  2RIJ A;  1WKL A;  2KJW A;  2OD6 A;  4DV3 F;  4ELU A;  3CIZ A;  2YNI B;  4ZN1 A;  4PQA A;  2IMW P;  3TJA A;  4OI2 A;  2ERR A;  2LXI A;  4NI2 A;  2Z2L A;  1NHU A;  3MEG B;  3FDS A;  3TYT A;  1NPP A;  4DCJ B;  1HA1 A;  2KRR A;  1VBY A;  4X4U A;  3RGI A;  1MN7 A;  2N4D A;  4GKK F;  2QMX A;  2JEG A;  3M8Y A;  4X4O A;  4DR6 J;  3SYZ A;  3BGF A;  4NZ6 A;  4UY8 5;  1SC6 A;  1FT8 A;  2XB2 D;  3CCW A;  1NPK A;  1TL7 B;  3L9Z A;  3LP1 A;  2G13 A;  1U7L A;  4NCA A;  2QLF B;  2HND A;  2Y0B B;  2FGC A;  5EN1 A;  2DIU A;  1PIE A;  4YR3 A;  4H54 A;  3GR1 A;  4ICL A;  3V5R A;  3OD2 A;  4J9K A;  1YJ7 A;  3BF4 A;  5DRK A;  1U4B A;  1SB6 A;  1XN9 A;  2XS2 A;  5DDP C;  2OH2 A;  1DTQ B;  2J9D A;  3DCA A;  2W24 A;  3W5Y A;  2KI2 A;  2QMU B;  4S0M A;  3HSD A;  3OSP A;  3C3L A;  5HMW A;  1PYO B;  4ENO A;  5I42 B;  2PD1 A;  4AE5 A;  2MZ1 A;  5LXR A;  2A2C A;  3HHL C;  3HO1 A;  2ATC B;  3FSI A;  3OQ2 A;  2J0X A;  2ZC3 A;  3CJK A;  4ECY A;  1VRT A;  2HFO A;  1R7I A;  1FKO A;  2DGX A;  2PN6 A;  1N5T A;  5HL7 Q;  5EDW A;  1LWC A;  1OY6 A;  3NLC A;  1JLA B;  2RU3 A;  1RT5 B;  4PUO B;  1R8A A;  2UXD J;  3FEX B;  4TYA A;  2GHV C;  3H5Y A;  2J9D E;  2ZH1 A;  4OHY A;  2HHH J;  4DR5 F;  1R6V A;  3MEG A;  2AJ0 A;  1S6U A;  4OI4 A;  3HSJ A;  4WP8 A;  3EGW B;  2YWF A;  2XO6 A;  2B5J A;  3D1Q A;  1A0O B;  4HI1 A;  3TA2 A;  4YEA A;  5A8W A;  5HMZ A;  3SSR A;  1I6J A;  4X62 J;  2MJN A;  3A13 A;  3I55 S;  4FKX A;  3AXM A;  3H25 A;  1QDU B;  4KE5 A;  1PCA A;  5K5M A;  4OZL A;  5E2Q A;  5HRO A;  2F63 A;  4F4W A;  1DY3 A;  2QA2 A;  4TVA B;  2HQC A;  1UVN A;  2DTJ A;  4K4Z A;  4D3H A;  2GNK A;  2YTC A;  3EUN A;  1ZM2 A;  5KG4 A;  3K59 A;  3SQG B;  3TW0 A;  2CPE A;  4FVM A;  4MK7 A;  3NGK A;  3JS9 A;  2MZR A;  1IBK J;  2RS8 A;  2MLX A;  1LWX A;  2UUT A;  1XMO J;  4I2P B;  4DR2 J;  2A3J A;  3Q8P B;  1FRK A;  2JSX A;  2EEY A;  2C1E B;  1U6B A;  2IYG A;  3UDL A;  1H3D A;  1LWF A;  3ILI A;  1GMW D;  1G2E A;  3MI7 X;  1YGY A;  3AJ2 A;  4ZVT B;  2EBG A;  2D74 B;  1NK7 A;  3OTC A;  5D0E A;  3QRP A;  2FZK B;  4LR8 A;  2LA6 A;  2ZM6 F;  4ECS A;  1S97 A;  5DO2 A;  4ZVF A;  1S6Q A;  2CZ9 A;  1ZOT A;  4NXN J;  4RNM A;  4K8R A;  2J8A A;  4ZLN A;  1U1K A;  1QTM A;  2ZH3 A;  2LQB A;  1SC3 B;  2ZZM A;  3UD3 P;  4WPA A;  3QNW B;  2I1R A;  1IVZ A;  4C8N A;  1REV A;  1HNZ F;  2RAQ A;  2QGF B;  3IRX A;  4W92 B;  1B3T A;  1E6Y B;  2MGZ B;  1HNX F;  2LP4 A;  2N7Y A;  2MY7 A;  1ITP A;  1J5E J;  4ZIT A;  4DSL A;  1HR0 F;  3L3C A;  2M2B A;  1H38 A;  1HNV B;  3TUP A;  2J0Q D;  1U1P A;  4Y2M A;  3P49 B;  2KTQ A;  3OSN A;  1ICE B;  1Q16 B;  5IQQ A;  3MMB B;  4ECT A;  3B78 A;  1JKH A;  2Z4P A;  3G2X A;  3Q23 A;  1S59 A;  3WDO A;  1KLN A;  1VS3 A;  1FKA F;  2G0C A;  2EFP A;  4B9U A;  5M2R A;  5KFI A;  2AT1 B;  1K0T A;  2F7V A;  2AJ4 A;  3A8I A;  3I5C A;  2YWE A;  2U2F A;  1Q7L B;  3ZZT A;  4CH0 S;  2PSZ A;  2HVI A;  3SDE B;  3J80 U;  4YB5 A;  1BLU A;  4DPY A;  1JJ4 A;  4M5D B;  1RT1 A;  2B6A B;  3WC2 A;  4C0B A;  4EWT A;  1NUE A;  3OXG A;  2J6U A;  4OYI A;  1VBZ A;  1FNX H;  3RYL A;  3Q0A A;  4WZM A;  5IOL A;  3C15 B;  4MFB B;  3F56 A;  2MMY A;  5KFP A;  1KOO A;  1RIS A;  2OI2 A;  2UUB F;  3GPA A;  4V19 J;  3JYT B;  2CQ4 A;  4DFK A;  2AX1 A;  1O8B A;  4KKO A;  4DV3 J;  1SH3 A;  1NSP A;  2VG6 A;  4K4Y A;  2BOA A;  3DXS X;  2C3U A;  4USW A;  4OI3 A;  5C5J A;  3VF0 B;  4X4Q A;  3M8Q B;  1E6Y A;  2ZBR A;  1WI8 A;  4Q2L A;  2O66 A;  3ZZZ A;  3MEE B;  1KKH A;  3ISZ A;  5L1J A;  2Q66 A;  5KFO A;  5KG6 A;  3TNV A;  2PA8 D;  3MGJ A;  1WI6 A;  2BJE A;  5IWA J;  3HHD A;  1KBR A;  2CQC A;  3M32 B;  1SJR A;  2Y1R I;  3K5O A;  3DDK A;  3BDP A;  2OML A;  4LBP A;  3D4J A;  1YRX A;  4HHJ A;  2IC3 B;  5KFN A;  1HBN A;  2ROE A;  4PYA A;  2YKN B;  1YIT S;  3EXC X;  3T5H A;  1YJ9 S;  3E8O A;  2ZKU A;  3M8S A;  1HWI A;  3JQM A;  3CCM S;  1IKV B;  2BQU A;  2CJX B;  5ADZ A;  2DH7 A;  2B4P A;  1H0H B;  3BN7 A;  1M0S A;  1HQ2 A;  3D7S B;  1SL0 A;  3HHK A;  3D28 A;  2DIT A;  1D1U A;  3HM9 A;  3ITH A;  4DX6 A;  3SV3 A;  4Q43 A;  4B3T F;  1HI8 A;  2OSR A;  3D66 A;  1VRU A;  2R9L A;  3HLU A;  1RT3 A;  4YME A;  3OL8 A;  1KVI A;  1T9U A;  1X0F A;  4L72 B;  3QGH A;  2Y9H A;  1AA1 B;  5EHH A;  2J9C A;  1T05 A;  3NCP A;  2JHE A;  4ANC A;  1N54 B;  3C6U A;  4MK9 A;  3UR3 C;  2YVS A;  3MMC B;  3JYT A;  1BMQ B;  3IGV A;  1CC8 A;  4K4U A;  1UW9 A;  4JUZ A;  2BAN A;  4W90 B;  4DR5 J;  1TP7 A;  4LRE A;  2F8H A;  3E01 A;  3CED A;  6AT1 B;  2XYP B;  2MZS A;  3DU6 A;  5KOX A;  3WQP A;  3MEE A;  1S1X A;  4LVN P;  3MCM A;  1KR4 A;  3AA9 A;  9ATC B;  2R7T A;  3OVS A;  1EZZ B;  2JVR A;  1QY7 A;  2HZV A;  4IQX A;  1S72 S;  4D3G A;  1PSD A;  3PNI A;  3LA0 A;  4IFY B;  3DRR B;  1HW9 A;  4NLY A;  1VK3 A;  4CCH A;  1FER A;  4JI0 J;  2CJQ A;  1XJW B;  1F5A A;  4RW4 A;  1S6P B;  3SBM A;  1U6Z A;  3NXZ A;  1XMB A;  3ZZ0 A;  3I5A A;  2HHV A;  2BMB A;  5GME A;  2KN4 A;  2RQK A;  4KH1 B;  1IBL F;  3MMA B;  4P6Q A;  4PPD A;  4UZC A;  1N6Q B;  2MHN A;  1O51 A;  1Q0N A;  2CNN B;  4NEY A;  2XGQ A;  4ELV A;  1HNI B;  2KVQ E;  3BGR B;  2LEP A;  5KFU A;  3I87 A;  1SH2 A;  3A3N B;  1QJH A;  4CLS A;  2CWX A;  1Q8B A;  4WU2 A;  5K8M A;  2RIL A;  2ZM6 J;  1KC8 T;  4QIF A;  2OLW A;  2WVB A;  4LF5 F;  4J9R A;  2ZBI A;  2DO0 A;  3DGP B;  2XBP A;  4F7V A;  4Y6I A;  2XZD B;  1U25 A;  3NS5 A;  4QWA A;  4MKA A;  4ED8 A;  4L75 A;  1G6B A;  2BV3 A;  5D0G A;  1HNZ J;  2CJ9 A;  4NXM F;  2ZVS A;  3EGV A;  3Q8Y A;  2VAS A;  3PW2 A;  1PAE X;  2IPO B;  4F3O A;  4AL7 A;  2V67 A;  2ZH5 A;  1HR0 J;  5CZV A;  1CJV B;  1SI9 A;  1JLB B;  1UZH A;  3ENV A;  4AYB D;  4HH0 A;  3RAX A;  2IAJ B;  5GAE U;  5D4P A;  2VKR A;  5FD1 A;  3DRR A;  2G1D A;  1IR1 A;  3M30 B;  3NBP A;  4KRW A;  2BJ9 A;  3M05 A;  1RA6 A;  4DV5 F;  1RYS A;  2FUG 9;  4LMZ A;  3DRX A;  2R8G A;  2NPF A;  5HMY A;  4A8K A;  4FVC A;  2W4D A;  1KQS R;  1NJW A;  1F9F A;  1F9E B;  4DV1 F;  3C14 A;  3SQO P;  2VQF F;  2YH0 A;  1GH8 A;  2V2K A;  1R8B A;  2DKO B;  2E9Z A;  3UVJ A;  2IDE A;  2NQP A;  5HO4 A;  3IBC B;  3H59 A;  5L1I A;  3JAM Y;  3F44 A;  5KFZ A;  2ZEJ A;  4RNN A;  4NLT A;  4XK8 C;  1HNI A;  3BGR A;  4TU9 A;  3W5Z A;  4FXW A;  3Q8V A;  4ATN A;  2X1B A;  5ETL A;  2DNG A;  4TY8 A;  4DFM A;  3CCT A;  2DHA A;  5A8K A;  3CDU A;  2VG5 A;  4A8W A;  3U7J A;  3K7R A;  5IC6 B;  3PV8 A;  4MMO A;  3PYF A;  4WE1 B;  2UUB J;  3ZZP A;  1YQH A;  4FBU A;  4B08 A;  2RSQ A;  1NKB A;  3FKB A;  5BR8 F;  1IM6 A;  5KFT A;  2A10 A;  1FX4 A;  4FXV A;  1JB0 C;  5KT2 A;  3GCW P;  2HG4 A;  2IRY A;  5F0W A;  1VQY A;  1WSV A;  3UDC A;  3KG1 A;  4R8U B;  4P75 A;  3FUY A;  1BUX A;  2MKS A;  4RL1 A;  3KK2 B;  1RAO A;  1URN A;  3QAT A;  5KG5 A;  3T1Y F;  4YHH F;  4H4K C;  3MM6 A;  1PIL A;  3CSK A;  4H4O B;  2APO A;  3FC9 A;  4AD6 A;  2FHK A;  1QTN B;  3HUL A;  3MEC B;  3T1A A;  2XLI A;  1J5O B;  2W2Q P;  5D0R A;  4ZN3 A;  3HXM A;  3HJV A;  2MKI A;  4F8R A;  5MLC V;  3GCX P;  3C8Y A;  4RJV A;  1RWX B;  2OGU A;  4HR2 A;  2C42 A;  1C0U A;  2AJ2 A;  3HKZ D;  3MCN A;  3T6J A;  1HYS B;  1S1W B;  2DR6 A;  1MML A;  4P7V A;  4ED5 A;  3TJ8 A;  3MCO A;  2ZDP A;  4DL2 A;  1S1U B;  2IDL A;  3MR5 A;  4ZS6 A;  4C8Y A;  2NXJ A;  5T41 A;  1YTY A;  4B3T J;  3MCS A;  2FVP A;  2ZH4 A;  2CJY B;  4DWI A;  2P6T A;  2VPW B;  2MQQ A;  4W98 A;  3EXY A;  3QSY B;  3MR2 A;  2E1C A;  1S5Z A;  4K4T A;  1G1X A;  3Q24 A;  3K89 A;  2ZJR Q;  4WBF A;  3EYZ A;  5KFR A;  2GA7 A;  4QYZ J;  3CUN A;  1RWN B;  4GO7 X;  2QL5 B;  2AJ1 A;  1FFW B;  2HNZ B;  2GQC A;  1M5K C;  1MLA A;  1X4B A;  4WYL A;  2OFH X;  4ZVQ B;  4R8U A;  1VQ8 S;  3CDW A;  1CS4 B;  1VGY A;  2CPF A;  4ECX A;  2I5J A;  1UPP A;  3KXD A;  5KFD A;  1TZ0 A;  1T9T A;  2VH7 A;  2Y1J A;  1AT1 B;  2LA4 A;  4RZR A;  3MFI A;  4YP3 A;  3EVW A;  1NBE B;  3IBF B;  2W2N P;  2E1R A;  3GMG A;  3PRV A;  1LNQ A;  2LXF A;  2HHP A;  5JVG Q;  1J5O A;  4AL5 A;  1X7V A;  2R2R A;  3NKY A;  2XQC A;  4N77 A;  2JWN A;  3HPO A;  2KKH A;  2VPX B;  4DUZ F;  3E51 A;  3KTQ A;  1Q5Y A;  3R7N B;  3LWL A;  5HVF A;  2FJW A;  4NWB A;  4QWB A;  3R6L B;  3BYP A;  2DXE A;  2RHS B;  4DMZ A;  2O1P A;  2E1M C;  3F41 A;  4NCG A;  4DSK A;  5HBM A;  4CQ1 A;  1JLQ A;  5HP1 A;  4NLW A;  3MPU B;  2ZHO A;  2DYA A;  1RWP B;  1CJK A;  1GFW B;  1GMU A;  1URR A;  3SFG A;  4ECR A;  1RAI B;  3J81 U;  4IRC A;  2KXF A;  2VG7 B;  5HLF B;  3PRD A;  3VR1 A;  4RBT A;  2XSJ B;  5G0R B;  3CTR A;  2FYX A;  1PAU B;  1LWE B;  3FMW A;  3FSY A;  4O0N A;  3U1M A;  5HVG A;  4NXM J;  2RRA A;  2ZHA A;  1T9Y A;  3MZI A;  4F26 A;  1HHQ A;  3PO5 A;  3QWP A;  4C98 A;  1YX2 A;  1CS4 A;  3J7A N;  5F8M A;  2WB4 A;  3DOK B;  3VV2 B;  2GVZ A;  2BJ8 A;  4ITS A;  3D1H A;  3W2V A;  3OFF A;  2AX0 A;  4ZPC A;  3OBI A;  1V6H A;  3MAA A;  2QEX S;  4DV5 J;  1U1Q A;  2XTJ P;  4FYY B;  1BQM B;  3K57 A;  1RHU B;  4QR0 A;  4PXE A;  3DC2 A;  2GC8 A;  2VQF J;  3UN2 A;  4O3S A;  7FD1 A;  3THT A;  4DL5 A;  2OHD A;  3ELH A;  4ZVH A;  3LPY A;  2J76 E;  3FVY A;  4CYU B;  2XYH B;  2D3O R;  5B0E A;  4KIA A;  4DN0 A;  4DV2 J;  1S7I A;  5GAD U;  1RHK B;  1N34 J;  1WC6 A;  5LSR A;  2W8L A;  3QRR A;  1TL5 A;  3PJ9 A;  1WEL A;  4MH8 A;  2BDP A;  4PR6 A;  2YNF A;  1M1H A;  3TVY A;  3H42 A;  5J1E B;  4DQS A;  3CO0 P;  2OEJ A;  2KJV A;  4KV8 B;  2VHG A;  2OEK A;  3PR5 B;  4A8X A;  1UEK A;  4ZP6 A;  3VAJ A;  4DI6 A;  5IT4 A;  5BR8 J;  2HAI A;  1RJJ A;  4N8N A;  2B8P A;  2PT0 A;  2Q6B A;  2Y3Y A;  1U1O A;  2BKN A;  2IHR 1;  1JWW A;  4NYP A;  2ACY A;  3KKF A;  1RT4 B;  3CW2 C;  4LRC A;  5KFE A;  1HBM B;  3FQL A;  2OPP B;  3GLJ A;  3Q8U A;  4HHU A;  5SZT A;  1TKD A;  1N5Y B;  2KRB A;  1NK8 A;  4F36 A;  3T1Y J;  4YHH J;  5D3G B;  1NPR A;  5L9N A;  1KNZ A;  4PQU A;  1WTB A;  1SIW B;  2JLE A;  3DOM A;  1S99 A;  5HSP A;  1BQM A;  2IJF A;  3CT9 A;  3NNH A;  4PWU A;  2M88 A;  4LF9 J;  3KMS A;  1WEZ A;  3BQ0 A;  1FXD A;  1NZA A;  2JLF A;  1GK8 A;  2ZOM A;  4M5N A;  5KFH A;  1DQ9 A;  4QYZ K;  4OZ0 A;  3CD6 S;  2A2D A;  3CCJ S;  1HW8 A;  2B4V A;  1D8Y A;  1LKZ A;  5DJB A;  2HQI A;  3AAW B;  4UUX A;  1NZ8 A;  2WK4 A;  3V4I B;  3P3D A;  1DQA A;  3HF5 A;  1JNR B;  4CWB A;  1VIS A;  1RHQ B;  2XC9 A;  2WOM B;  2VBX A;  1LFP A;  2IIH A;  1SJ4 P;  2B9Y A;  3KUG A;  1XMQ F;  4KR0 B;  2KT2 A;  4GRS A;  5IV4 A;  3LQV A;  1P9Q C;  4QJV A;  1EP4 B;  2QX0 A;  3R5A A;  2Q6C A;  2ABY A;  2VPZ B;  2P5V A;  3ETM A;  4QU6 A;  2IFX A;  3GR0 A;  3AQP A;  2EI5 A;  2VQE J;  3BO4 A;  3AT1 B;  3LAL A;  1Y10 A;  2JFD A;  1QSY A;  5J2P A;  3IR7 B;  4EGL A;  2DNQ A;  1FKP A;  4IR1 A;  4F3M A;  4ECW A;  2K3I A;  3DM2 A;  4ZVU B;  3VQS A;  2DK2 A;  4ZP9 A;  1VQ4 S;  1N52 B;  4CLF A;  2KB2 A;  2QMW A;  4PAB A;  1KQG B;  1KS2 A;  3GV8 B;  2VFU A;  4IH6 A;  2DEI A;  4IFV B;  3HT0 A;  1Y4Z B;  1KLM A;  2H5I B;  1N4L A;  2HWI A;  4QOT A;  1SPB P;  1AYE A;  3QID A;  3HFV A;  4RW8 A;  1YRU A;  1QVG R;  1JJC B;  4X64 J;  4NX9 A;  4E2F B;  2HS4 A;  1QD1 A;  2UVR A;  5F3Z A;  1SKU B;  2Z8Q A;  1XR5 A;  2YPZ A;  3GJQ B;  3VVU A;  4IH7 A;  4DUZ J;  2VDH A;  4UZB A;  5ETV A;  3WIU A;  2ZWO A;  1S79 A;  1UAW A;  1WG5 A;  4ID5 B;  2RKI B;  1AW0 A;  2VUG A;  4QIE A;  3MM7 B;  1Y00 A;  3TAR A;  3IAS 9;  3AD9 C;  4BC9 A;  4ALZ A;  2KM8 C;  4FF3 A;  2WOM A;  2GJI A;  4CNZ A;  3BR9 A;  3R1H A;  3KK3 A;  2Z58 B;  5GAG U;  5EUH A;  2UU9 F;  4C8O A;  4P10 A;  3AB2 B;  3FEZ A;  1V3R A;  3QO9 B;  5LMN F;  3N79 A;  1RU2 A;  1VQ9 S;  4NPO A;  2FLP A;  1R3N A;  5I3P A;  4C11 B;  2R8H A;  4LVO P;  4RW9 B;  1MN9 A;  3W61 A;  4LFA F;  1S48 A;  3EIC A;  4LBH A;  1D9A A;  2P9G A;  1N48 A;  2L08 A;  2OJ3 A;  5AXL A;  2W9B A;  1LW0 B;  3X1L B;  1OPZ A;  3S7R A;  2D9O A;  1TKX B;  3CCZ A;  2W4P A;  2DGV A;  4ZIW A;  2LDI A;  2K7J A;  6FDR A;  4B9S A;  3MOZ A;  1S0V A;  3M1V A;  5LL6 d;  4ZVE A;  1H73 A;  4RO0 A;  3KHL A;  2DIV A;  3HZG A;  1H74 A;  3Q22 A;  3I9Z A;  4RR5 A;  4IOA Q;  4RWW A;  2DGO A;  3ICL A;  1P6T A;  1UET A;  2C2D A;  4V1A k;  3R6G B;  3PIP Q;  4Q45 A;  3CJ5 A;  2WON A;  3B6B A;  4ID5 A;  1IKY A;  2RKI A;  4YN3 B;  5KFW A;  4LBI A;  4Y65 A;  3NGU A;  2NPI A;  2H1Y A;  1PC4 A;  2P6S A;  3V6H A;  2HK2 A;  2CJA A;  1UZD A;  2N3L A;  1K44 A;  1VOM A;  2CFX A;  4ED7 A;  5F8L A;  5C2G A;  1QM9 A;  3I82 A;  4K4V A;  3AOB A;  4LQ9 A;  2XUL A;  1LK7 A;  4B9T A;  3G4S S;  2G1H A;  5CYQ B;  1RZM A;  4B9V A;  4GC7 A;  5KT7 A;  3PHT A;  3OTB A;  1VQS A;  1N0U A;  3PIO Q;  1UCN A;  4L3N A;  3NGR A;  4OLO A;  1U1M A;  2NXN A;  2KZZ A;  3NS6 A;  4DLE A;  4C8L A;  4CO0 A;  2HBZ B;  2GX8 A;  1ZA1 B;  1BGX T;  4MKB A;  2J0S D;  2GVD A;  3I31 A;  4DPU A;  1WDT A;  5CCL A;  3TQ1 A;  3QT8 A;  4ECZ A;  2DGQ A;  5KFX A;  2AGQ A;  1FD8 A;  2CAJ A;  3KFW X;  4Y28 C;  1LW0 A;  1IKX A;  3ZC4 A;  2IM0 A;  1FTR A;  1TVR A;  2DPI A;  4JI3 F;  4DPO A;  4KB7 A;  1L3S A;  1MMN A;  2FVS A;  3G82 B;  2CA9 A;  1PJ6 A;  2GMJ A;  4LFC F;  4ECV A;  2N7C A;  4MKY A;  4MYT A;  4OHV A;  1GEH A;  1OSC A;  3VAH A;  2B9W A;  3PX6 A;  1FNM A;  4JV1 A;  3SZ2 A;  4LR9 A;  3CGI A;  1XNQ J;  1C0T A;  4ES2 A;  4ZCK A;  2BAB A;  1HMV A;  2PMH A;  4YDX A;  4NLO A;  5FDL B;  1U24 A;  1S0N A;  3UDV A;  2HNY B;  3SCI E;  1AXQ A;  3N9U C;  2MQM A;  4ZPA A;  2YWW A;  3HHL B;  1RT6 B;  5IT9 U;  1BHN A;  3AJD A;  2OPS A;  1DRZ A;  1D3W A;  1RAE B;  2M70 A;  3M2R B;  4WYW A;  1NAQ A;  4Z37 A;  4OX9 F;  4OYB A;  3D0G E;  4C8K A;  2CUY A;  4GO5 X;  4CO5 A;  2G2Z A;  3KLI B;  2X1F A;  2XMT A;  4YB7 A;  3CJR A;  1XR7 A;  1FWK A;  3DHW C;  3MWB A;  5CYQ A;  3RZA A;  4K4W A;  3QJL A;  2BA9 A;  1XMQ J;  4KGZ B;  4I56 A;  1QUV A;  3IN5 A;  2D3O 1;  3CF5 Q;  4OHW A;  2AEF A;  4DV0 J;  2ROG A;  3CCL S;  1AUS L;  3Q8R B;  2ASJ A;  1EJ7 L;  2OD4 A;  3QMQ A;  5A2Q Y;  3HFZ B;  1TQL A;  3R97 A;  2XWX A;  1KSP A;  2IJN A;  4R25 A;  3DLB A;  7AT1 B;  2MYF A;  1B99 A;  4CIO A;  4DR1 F;  2DT9 A;  2JZ5 A;  3UN3 A;  1ZAX A;  1JMT A;  2AMC B;  4KO0 B;  1YBA A;  2H3E B;  2F4F A;  2XWY A;  3LPE A;  3DXB A;  3KLE B;  3FMB A;  2QN6 B;  5E3A A;  3TX0 A;  4HL9 A;  2GGP B;  2GMH A;  1IBC B;  4OI6 A;  1WC5 A;  1Q5V A;  3AY0 A;  4RW6 A;  2WSF C;  4O3P A;  3DLE B;  3Q8S B;  3WBZ A;  3WIV A;  1WAC A;  4OZJ A;  4KAI A;  1QE1 B;  1RAH B;  3H4D A;  4WFN Q;  3K5N A;  1U48 A;  5KG0 A;  2MKK A;  2DRB A;  2QLJ B;  4LIW A;  2D3Z A;  4A8S A;  3I0R A;  3ZNJ 1;  1ZA2 B;  1S6O A;  1B0V A;  4C2M A;  3HHL A;  3IG1 A;  4J9S A;  3PRB A;  4URS A;  2W2P P;  2XI2 A;  2CQ1 A;  3FRZ A;  2V69 A;  1WC4 A;  1T8E A;  3M2R A;  2GV1 A;  3QWU A;  3I6P A;  3FFI B;  4OIX A;  2V6A A;  2ILY A;  1KTV A;  1X9M A;  2E5G A;  3OT9 A;  1UJ5 A;  5KG7 A;  5AE3 A;  5J2Q A;  2CAD A;  2DGT A;  2C3O A;  2UU9 J;  2VPY B;  5KFY A;  4NLQ A;  4HAC B;  3DRY A;  2NXC A;  3V6D B;  5KFM A;  1EET B;  3QIP A;  5LMN J;  1SC1 B;  4WTO B;  2N3O A;  4ZMM A;  2C2M B;  1ULR A;  4Q0B B;  4LFA J;  3CJ3 A;  1YK9 A;  4ZHR A;  4CLK A;  3CDA A;  4B9N A;  2V68 A;  1LXJ A;  1EQM A;  2EFG A;  3DI6 A;  5GAH U;  3NEK A;  4RBV A;  4IYQ A;  2JEI A;  1UP1 A;  3I9V 9;  2AP6 A;  1AB8 A;  4DL3 A;  2HKE A;  1HQU A;  2DH9 A;  2B43 A;  2R42 A;  4QZV B;  1JLC A;  4KHP J;  4P7T A;  3U27 A;  1SCJ B;  2EFQ A;  1HBO B;  2NXE A;  4FPR A;  2IM1 A;  3HKW A;  3CD7 A;  4X2B A;  3DRS A;  4ZLJ A;  3NWG A;  4JI8 F;  1RP5 A;  3NOC A;  5F3T A;  3HT3 A;  5D6G A;  2AJQ A;  1F0X A;  1BC6 A;  4OYZ A;  1X5P A;  1U0S A;  3UO0 A;  3CCV S;  2VU5 A;  5CXT A;  2VA3 A;  2ZD1 A;  1UA1 A;  2HHW A;  2L9W A;  4QW8 A;  3KHR A;  3H20 A;  1WG4 A;  3R5G A;  4PPZ A;  3H8Y A;  4J90 A;  3BKU A;  2DHX A;  1C1C A;  4HAC A;  3W7B A;  2L9N A;  3EJM A;  1XER A;  2CQB A;  2R8J A;  3DLK A;  2DY1 A;  2YKQ A;  5DET A;  3NY0 A;  2KG0 A;  1NDL A;  4DX7 A;  5ITH A;  2DIS A;  2V9K A;  3R1L A;  2HAF A;  2U1A A;  2B3T B;  4M5K A;  3E2E A;  3KLH B;  2KT3 A;  1T03 A;  5ETT A;  1ZPW X;  3G87 A;  2YKM B;  2H54 B;  4JI3 J;  3ET6 B;  4Y2C A;  5JJB A;  4CO3 A;  4JI6 J;  3CO9 A;  4LFC J;  4USV A;  4U95 A;  2Y1I A;  3CMA S;  1DHM A;  2OTJ S;  4P2M A;  1HBO A;  3R27 A;  3K5P A;  4HLB A;  3NOG A;  2KH9 A;  3JQJ A;  2V4Q A;  3K5M A;  4KGK A;  1H7W A;  4KJI A;  3LGN A;  1U2R A;  1U2F A;  2V8G A;  3GG0 A;  4HTJ A;  1WJ9 A;  2WBM A;  1XTZ A;  3M2U B;  1TL1 B;  3IC1 A;  3RG6 A;  1S1V B;  2DRD A;  1U45 A;  1RTH B;  5BYS A;  2OP5 A;  4DQP A;  4KHM A;  2CPJ A;  5ETS A;  4F4K A;  4OL8 A;  2VB6 A;  4F0K A;  3HMJ G;  5C7P A;  2ALZ A;  4WZQ A;  4CM0 A;  3NCQ A;  2BRL A;  3LAN A;  5LOQ A;  1X9W A;  2D7S A;  2IA6 A;  3UPF A;  1TUV A;  4OX9 J;  1IWG A;  2FJX A;  2BVZ A;  5ETR A;  2FJA B;  4ZVP B;  3V6J A;  1TV6 B;  4L6V 3;  2CQP A;  4IG0 B;  2ZOF A;  3MED B;  2J7W A;  4ID8 A;  3BGU A;  2ZE2 B;  1MMD A;  4JI1 F;  1KN6 A;  1UVK A;  2Z2Z A;  3MR6 A;  2FPH X;  1VCT A;  4IRD A;  3KDO A;  1RCO B;  2LYV A;  1RE1 B;  1UFW A;  4C6A A;  5C25 A;  2DD8 S;  4DV6 F;  3C2P A;  2GHP A;  5FLX Y;  2I8E A;  4ZJL A;  2COL A;  4IO1 A;  2ZUG A;  4DR1 J;  3LGM A;  4X4S A;  5AXK A;  1EKS A;  2C22 A;  1H2V Z;  3DOL B;  4L73 A;  1H2U X;  4USK A;  4OZN A;  3KLF B;  2VKZ G;  3M2V B;  1MU2 A;  2XLJ A;  2LEC A;  4O3O A;  2LQ9 A;  4WFX A;  1E6V A;  2RJZ A;  1HAR A;  6FD1 A;  3D3C J;  4Y2I A;  1W26 A;  3NMR A;  2UVU A;  2GQQ A;  4O3R A;  1FD2 A;  3VAG A;  2P2C B;  2DNP A;  1B64 A;  3GZ7 A;  3WX8 A;  2C2Z B;  2MQO A;  4CH7 A;  3VGS A;  3G6E S;  2XMK A;  3T9N A;  2A1B A;  3PYE A;  2K8G A;  1Q1K A;  2KXH A;  3PW5 A;  4I7F A;  1NK0 A;  5KFJ A;  1JXL A;  1N88 A;  4FN5 A;  3OL6 A;  4E0D A;  1N56 A;  3H5X A;  4MT1 A;  1FRM A;  2UUC J;  2H48 B;  2PGC A;  2KFZ A;  1T9V A;  3V6K A;  4IRK A;  4ZVO B;  4CT8 A;  4C8M A;  1OYE A;  3S6E A;  4HYK A;  3MTJ A;  1WOP A;  4N7T A;  4XAK A;  1T3O A;  1MWQ A;  1YWX A;  1IBM F;  4NLU A;  1SKR A;  5IV3 A;  5HAO A;  4TQS A;  2BQ3 A;  3KNG A;  1OYD A;  3FZB A;  3CJ2 A;  3GIK A;  4TU7 A;  2VOO A;  3WC0 A;  2MJU A;  2YNH A;  5C42 B;  2XNR A;  2BEF A;  2W7A A;  2JC0 A;  3IS9 A;  1FJG F;  1FE0 A;  3LP0 B;  1F1B B;  2HIY A;  3DOL A;  3ZTS A;  3UE2 A;  4XDD A;  5KFL A;  4PG5 A;  1U02 A;  5LT5 A;  3DMJ B;  2ZFH A;  3OFH A;  4CI0 B;  5EWF A;  1Y7P A;  1GX6 A;  1I51 B;  4M5H A;  4LF4 F;  1AUD A;  1R8H A;  4RW7 A;  3BDE A;  1VBK A;  3M6U A; 
#chains in the Genus database with same CATH homology
 2HBQ B;  2DKO B;  1SC1 B;  2H5J B;  1RHR B;  2H4W B;  2HBY B;  2C2M B;  2H4Y B;  3NS7 B;  1PYO B;  2FQQ B;  1IBC B;  3GJR B;  3IBC B;  5K20 B;  1RHJ B;  1RHQ B;  2XYG B;  2H48 B;  3R7B B;  3GJQ B;  2XZD B;  3R5J B;  2HBZ B;  1RHU B;  4ZVO B;  1RWO B;  2CDR B;  1QTN B;  1RWN B;  3D6F B;  2QL9 B;  2QL7 B;  2QL5 B;  3GJT B;  1RWP B;  2CJX B;  3KJF B;  3RJM B;  3D6H B;  1GFW B;  2QLB B;  2QLJ B;  4DCJ B;  2H65 B;  1RWM B;  3D6M B;  4ZVQ B;  2Y1L B;  2C2K B;  5IC4 B;  2XYH B;  1NME B;  1RWX B;  1ICE B;  3SIP B;  1RHM B;  1SC4 B;  3P45 B;  4ZVS B;  4DCP B;  2C1E B;  1I3O B;  5IC6 B;  1RHK B;  3R6G B;  3IBF B;  1PAU B;  4ZVP B;  4ZVT B;  4LSZ B;  2P2C B;  1RWV B;  2QLF B;  2Y0B B;  2C2O B;  2C2Z B;  4ZVU B;  3KJN B;  2CNN B;  3GJS B;  3KJQ B;  2XZT B;  2H54 B;  1BMQ B;  3EDQ B;  4JB8 B;  4ZVR B;  3R7S B;  4DCO B;  1RWW B;  2CNO B;  2CJY B;  2H51 B;  1RWK B;  2CNL B;  1I51 B;  3EDR B;  1QDU B;  1SC3 B;  3R7N B;  2H5I B;  1RE1 B;  1F9E B;  3P4U B;  2XYP B;  3QNW B;  3R6L B;  2CNK B;  2HBR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...