1RHQB

Crystal structure of the complex of caspase-3 with a bromomethoxyphenyl inhibitor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 91
sequence length 91
chains with identical sequence E
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhqB00
5K20B 2H4WB 1RHKB 4LSZB 3R7SB 3KJQB 3QNWB 3R5JB 1BMQB 2HBZB 1RWKB 3R6LB 1PYOB 2HBQB 2CNKB 1RHJB 3R7BB 1RE1B 3KJNB 2XZDB 3D6MB 4DCPB 5IC4B 2CDRB 3RJMB 2CNNB 2QLBB 1SC3B 4ZVRB 3D6HB 3P4UB 4DCJB 2CNOB 1RWMB 1RWOB 2C2OB 1RWPB 1RHUB 2QLFB 1SC1B 2H4YB 4ZVUB 2FQQB 3GJTB 3R6GB 1RWWB 4ZVOB 2QL7B 1RHRB 4DCOB 3IBFB 3KJFB 2CNLB 2Y0BB 1QDUB 1RWNB 4ZVSB 2H5JB 2CJYB 3NS7B 1PAUB 2XYPB 3EDRB 2HBRB 1ICEB 2H54B 2H48B 2H51B 3GJSB 2XZTB 4ZVQB 3IBCB 2Y1LB 1RWXB 3GJQB 3R7NB 2DKOB 4JB8B 2HBYB 1QTNB 4ZVPB 5IC6B 1RWVB 2XYHB 2CJXB 3EDQB 1I51B 1RHMB 2QLJB 2QL9B 2H65B 1NMEB 1RHQB 2QL5B 3D6FB 2P2CB 1F9EB 1I3OB 2C1EB 2H5IB 4ZVTB 3SIPB 2C2KB 1SC4B 2C2MB 2XYGB 1IBCB 3P45B 2C2ZB 3GJRB 1GFWB
chains in the Genus database with same CATH superfamily
3FFIB 2OMLA 3CIZA 2DGOA 1NDKA 4U67Q 2W2QP 1K0TA 2K7JA 2KFNA 3QMQA 4LFBJ 4TYBA 3J81j 2ZHBA 2J0QD 4LQ9A 4RW8A 1Y5LB 2FUG9 5KOXA 1V3RA 3MUVP 1S48A 1UEVA 1KLMB 4X2BA 2JEGA 2G13A 2N3OA 2Y8YA 4DV3J 2DIUA 5DG9A 3EZ5A 2DHAA 3MZIA 1YIJS 4MFBB 4X62F 2HEKA 1HMVB 4J9MA 1DHMA 3PR5B 3GILA 1L5UA 1RWVB 4DG1A 1KSPA 1WJ9A 1PJ6A 4C8YA 4FF1A 1RT4B 4J5OA 4RNFA 3M8QA 3DLGB 2BEFA 3FC9A 2M8HA 3VGSA 3H40A 5HJXA 4ZJQA 4CH1A 3OFEA 5MAOA 2C28A 3O6QA 4NA1A 3E8OA 4IH7A 1RHKB 4ED2A 2WCXA 4OV1A 1QSLA 5IT4A 1BMQB 4ECVA 2XMMA 4YB1P 1WI8A 2GMHA 4HH0A 2FJWA 4O3NA 1XEZA 2E1PA 4WYLA 2MQOA 5C24A 3CDWA 4NRTA 1T9XA 1FJGJ 2J6TA 4I67A 2BE2A 1KTVA 3AA8A 3BV8A 4RW8B 4FKXA 3MPUB 1JLEB 2LU2A 1VISA 2J8AA 2NLWA 1XIQA 2HLUA 2H5JB 3GCXP 3VAJA 3I5BA 1FRMA 3MEDA 4Q2MA 4GC7A 3PRBA 4ZPCA 3DLLQ 1LWCA 3HHDA 3CIMA 2FLLA 2LU1A 5A6PA 1RDRA 5ETTA 3ISND 4MKBA 2FVPA 2VOPA 4CDIA 2BX6A 2ZC4A 4FXVA 1QY7A 4JI0J 1IQZA 5IQ6A 1TFWA 2AGOA 5E41A 2NPFA 3M8QB 3GP9A 3K8VA 4AL5A 5CD4H 4FXWA 4E2FB 3QJJA 2R7WA 3R7BB 3V6DA 1R0AB 4DBQA 1GK8A 2DR7A 4ZPVR 3R9LA 1VFJA 1MU2A 3W5ZA 3MM5A 1RP5A 1U1PA 4BDPA 5C24B 1G2EA 5BR8J 2AJQA 1RAHB 1EB0A 1JLBB 3AAWB 4W92B 1FWKA 4WFXA 3DCAA 3TEGA 4LUBA 1FXLA 3TX0A 4B3RF 3M6WA 1JQGA 1UKUA 1AFIA 3CCQS 1KQGB 4DR3F 4DPUA 2AYMA 3R7NB 2AQ4A 2Q1LA 3PO4A 2JZ5A 3MEDB 2I38A 5J2QA 1LWCB 4X65F 4QWEA 1Q16B 2PGCA 4RBUA 2K1RA 1MG7A 3TX8A 2KJWA 2YNIA 3N5BA 2BQRA 4HACA 1JXVA 5LOQA 4XO0A 4RR5A 4B3SF 1FNMA 1SI9A 1FKOB 3KUHA 2VOOA 4KHMA 4ZVFA 3G6YA 3KXDA 3KOAA 3MMAB 3BSCA 3DHXA 4ZDNA 1M5OC 3DYAB 4KTQA 2IYGA 4USWA 2MQNA 3JQJA 4Y34A 4ED0A 2BJ8A 2VFVA 5KT5A 3TQ1A 4IG3A 3TA2A 3KK2A 4FP9A 2JNJA 1X4DA 5KFKA 1N0UA 3H5XA 2JFKA 1LEOA 4C3MA 4L76A 1RAAB 1H98A 2ZFHA 2YWHA 4IQXA 1IBLJ 1FWPA 2GQQA 1V9OA 1R0CB 1ROFA 1OPIA 3BO3A 3DHWC 1I51B 2H65B 3NOCA 2QMXA 3BDEA 5J2QB 5KT4A 1HR0J 3KHHA 5IT9Y 3UD5A 2B8QA 1TMJA 2VBWA 3LTOA 5JVHQ 3CO0P 4AQYJ 2YY3A 4TLRA 3H20A 5A8WB 3N0VA 2JRSA 3H98A 5KG4A 3GG0A 1UWBB 4UOFA 3ADAC 3DLJA 5A2QY 3NCQA 1TKDA 2KU7A 1WC1A 4OHZA 2Z57B 3CDEA 1C0UA 2HVDA 4QR1A 5HMWA 3C6UB 5D78A 1BHNA 4JI3J 1ICEB 1SXLA 1FKPA 3MCMA 4DMZA 3GV7B 3DRYA 3QBCA 5IV3A 5EUHA 1R8AA 1H2UX 1F9HA 4YR3A 4JI6F 1SCJB 3EZUA 1B70B 4MT1A 4WK1A 3LALA 1T3OA 3M4XA 4KFBA 4CLKA 3OXLA 2KL8A 1IBCB 2L48A 1AROP 3J7ZT 1KVJA 2VG6A 4CTAB 3FZBA 3KG0A 5KFRA 1HNXJ 3MEEB 3I0RA 1YJNS 2GZOA 1R8BA 2GW8A 4J9PA 5J2PB 2D9PA 2YNFA 1SKWA 1N0VC 4A8XA 3D67A 4BHQA 5ITHA 3SCJE 2RHSB 3OL6A 1IBKF 4IYQA 1X7VA 4CO1A 2QLFB 3LAKA 1LXNA 4JV2A 2M0GB 1NK5A 1N33F 3E2EA 3P5BP 3TVYA 3A1YG 3EVOA 1AFJA 2CNLB 4ZOSA 4RBVA 3TEHB 1RLDA 2A3JA 4J9RA 3J80Y 1L3TA 1HI8A 2ZHAA 2R8HA 4KJIA 4X4TA 2M8DB 1REGX 2C42A 1Y11A 1C2PA 3NGUA 2KFYA 1U4BA 5LJ5Y 4B17A 4M5GA 4CO3A 3KMSA 5H9FJ 1CS4B 1U0HA 3KLIA 4W98A 2G0JA 1TZ0A 2UXCJ 4OI2A 4C48A 2XQCA 2Z4PA 1AA1B 2XMWA 1CBKA 2QX0A 4Q5VA 1NLKL 2ZWPA 1K9MT 4BS2A 5DLFA 2ASYA 4A47A 3FEXB 4KFBB 3MD3A 4FYDA 3KMQA 1YDLA 4K5SA 1EKRA 9ATCB 1RAOA 4X4OA 3CMQA 4K4SA 2OSRA 5DO2A 1YRTA 1N6QB 1H0HB 2A18A 5AT1B 4QW8A 4NLOA 3OXGA 2IMOA 4F7VA 1C0TA 1G1XA 5C5JA 2NYIA 1V3SA 1PCAA 3ZTOA 5E7OB 2IA6A 4WE1B 2PE8A 2HFVA 2CZ4A 1NU4A 3KUGA 4CH0S 3M05A 3HO1A 4YOEA 3PRVA 3QO9A 2YKMB 5KFLA 3D1OA 4MKYA 3OVBA 2GCFA 2W9CA 1ZAWA 3FSYA 2RRNA 2AYGA 1N4LA 4F0HA 3PCOB 3DKDA 3GSDA 1NSPA 2Z2YB 3SSQA 2B5JA 5RUBA 3IFEA 1SJ1A 1H38A 1FRIA 2XGQA 1KONA 1Q8BA 5HVGA 2ZNZA 3QT5A 4DR7J 5GMDA 4K0KJ 2EFNA 2HG4A 2IPOB 4DFJA 1VQYA 1P6TA 1WDTA 1HI1A 4B02A 3BSOA 1S9EA 1SV5B 5KT3A 3PTWA 5HMZA 4ED1A 4I2QB 4A46A 2WONA 4M94A 1YGYA 3UVJA 3CW2C 2HW3A 4ICLB 2B7BB 2Y9HA 2MLYA 2O5DA 2POKA 4KBIA 3OUYB 4DPYA 1BWVA 3VTIA 3M7VA 3CCSS 2QRRA 3AT1B 1LWEA 1YTYA 2HZCA 2Y1LB 4HVZA 5BXIA 4LF1A 4ITSA 4YY3F 5DJBA 1X4CA 3IM9A 1GQEA 2W9CB 4OYPA 4WXOA 1SL1A 4IRKA 4NZ0A 2OTJS 1AUSL 3RUBL 2HNDA 2B5JB 4YHHF 3CDAA 3BSAA 4F4WA 4AL6A 1RQ0A 4HH1A 3WIUA 4Q44A 3SYZA 4EYIB 4FVCA 5IV4A 3ELHA 3L7PA 2E66A 1IWGA 1Q8IA 2NS1B 5LMNJ 1FHTA 5K14A 2U2FA 2NSBA 3A13A 4Q45A 1TKTB 5GAEU 2BE7D 2QJ3A 3K7RA 1F5BA 3MAQA 2VDIA 4A8KA 1TK5A 1Y5IB 4ZVOB 4AD6A 1YSJA 3HFKA 2GGPA 3MCOA 4OZ3A 2WONB 1XC9A 2W1BA 4QWAA 3TYTA 3UVJB 5M2UA 2MDAA 1KVIA 1ZTTA 2ZJQQ 4NYOA 5HSPA 1L3VA 3DGPA 4Y0FA 1UVMA 3TI0A 4KYZA 1V5IB 3NNCA 3CC2S 1HFEL 1N32J 3BZQA 3VGVA 1FK9A 4A4JA 4F2RA 1VIXA 3L9ZA 3THVA 3MURP 3MXHP 2V9KA 5KFOA 5GAGU 3HSGA 1NSQA 5IQQA 5FDLA 4KT0C 3TP2A 2VL1A 4QWDA 2MKHA 3WC0A 1KBRA 1BQNA 4NL5A 4D3GA 4G1QB 2VC1A 2BJ3A 1YBAA 2C3UA 2L08A 4CI0B 3Q8VA 1SBRA 3KKFA 4H4OA 2AJ1A 2V4QA 1HQ2A 3R2DJ 1UPPA 3K59A 1HBOA 2FLNA 4UY85 3UR0A 1ELOA 5FLXY 2OEMA 2BRLA 3TO8A 3M2UA 4WP8A 2IC3A 2D7SA 1GMUA 2KO1A 4USMA 3A8KA 4RW9A 1IBMF 5G0RA 2KVIA 4BLGA 4PWDB 2GGPB 2BRKA 4OFZA 4YUDA 1SKUB 3GYXB 3I5CA 3DLEA 1CJTB 1WG4A 3LOUA 4ZCMA 5K8PA 3KHLA 2ZBRA 3DGPB 2GHWA 3IC1A 3V81A 1FRHA 1HD0A 1SUQA 1V5VA 3GWCA 2C1EB 4KHPJ 1HBNB 3AQPA 4NRUA 1VJWA 3TQEA 3CCWA 3CTRA 3LGMA 4USJC 5L39A 3TAQA 4XAKA 5KFSA 2C3OA 4CLUA 3W7BA 2Y0SD 1FRJA 2ROEA 4DSEA 3EGZA 2OPRB 2LDYA 2IHR1 2NXCA 1JIHA 9RUBA 2CQBA 2XLIA 4RX6A 4MYTA 1SC3B 1T02A 5C42A 1NRKA 4PXEA 3P4UB 1WKKA 2KTQA 1VQMS 4C8MA 2I9SA 3VGTA 3P6YC 1P9YA 4H4OB 2UP1A 4DV4F 2W7PA 2IBKA 3N79A 4WIQA 2BDPA 5HATA 3TUPA 1RXOB 1SJ3P 2DEJA 2IC3B 2CVEA 3GE9A 2M3DA 4ZCLA 4DN0A 1N48A 3ZNJ1 1MLAA 2KYZA 2I1RA 1F2GA 2O66A 2B6AA 4ZJOA 4EO8A 1SIWB 3MPVA 1SJQA 4DV1J 4B3OA 3JS9A 2W7AA 2R8JA 1J5EJ 3NGKA 4QW9A 3TZZA 3M9MB 2QMUB 2MQQA 3MAHA 1QD1A 1VRUA 3BKUA 2FB0A 1K1SA 4K2XA 1FD8A 1YQHA 4PABA 2AT1B 4DR1F 3MI7X 2BM1A 2AEFA 4FYVB 2ZEJA 4JYAJ 4DX8H 3C14B 1RWMB 4NXMF 1CJVB 2B56A 1RAEB 1Y0HA 5I3UA 4NMXA 2XCAA 1T9VA 1U6BA 1RWWB 2PEBA 2UZAA 1SQGA 4CO4A 3D9BA 4CWBA 5HP1A 4X4VA 4QR0A 2IM0A 2QGFB 2DT9A 1Q79A 1T03A 3KHRA 3IR6B 2UUBF 4B9NA 1FE0A 2ZJPQ 1VHFA 3THTA 2PSZA 3IN5A 3JTPA 2D3ZA 1UETA 1N36J 2ERRA 4DPTA 1WHXA 1ULRA 1GAOA 2B6AB 4UZCA 3R5BA 5CD4A 4R8UA 1YJ9S 1C1CA 5GAEI 1SJ4P 5E3CA 3DXBA 4MTPA 4Z37A 1WOSA 1CQNA 5IM0A 1RCOB 1IJEB 4DUYJ 2ZHOA 3ZTRA 2VKZG 1KLNA 1S6UA 4ZA1A 4ED4A 4WZMA 2J5AA 1TR0A 4OHVA 1BQXA 2DIVA 2IVMA 1TK8A 1MN9A 5KFFA 4OQJA 1LWFB 3DU5A 1UVJA 4LMZA 3MECB 5EGYA 1HWLA 3FQLA 3TUJC 2CKWA 4LFCJ 5I3PA 1RHRB 3K17A 3V4MA 2AKWB 1JK9B 2AGQA 4MIBA 3V5RA 1KQSR 4U7UK 3ET6A 4PG8A 5HP1B 1FEEA 3IAM9 3RZAA 3GIMA 1Y9OA 4PAAA 3E3XA 2H51B 3NAHA 2CJKA 3KJVB 5E3AA 2JOQA 4GVBA 3GYGA 2UUAF 1SQEA 1QLNA 3MM7A 2DNQA 1FT8A 3MM9B 3HP6A 3SIPB 2LQ9A 2DY1A 2HQGA 2I8EA 4R8UB 4KB7A 1RTZA 1QE1A 1C1CB 2G0IA 3R5JB 1ZM3A 1XMOF 5SZTA 4P7TA 3BR9A 3ITHA 3HKWA 3BEGB 1S1TA 2VPXB 4UUWA 2XMAA 4DPOA 3T5KA 2KXFA 3GJTB 2DNOA 4PG6A 1IN0A 5B0AA 4WWSA 1CPZA 2A2DA 4O3OA 2HFNA 5D8HB 5ETVA 3QWPA 3QRRA 2IRXA 2KYXA 2BJ9A 3ET6B 1UJ6A 2KXNB 3RR8A 4MMOA 3S8SA 4NASA 4IRCA 1HNIA 4RU2A 2VICA 3HDSA 1Q8LA 3TARA 3AD7C 3RBDA 3DOMB 1BE4A 4TVAB 2YNGA 5AXNA 1YWXA 3V4IB 1DQAA 1S0MA 1CJKA 1QTMA 5EWEA 4B3MJ 4CO2A 4K5RA 2CPXA 4IDKB 3BBCA 3PW4A 1HD1A 3IRXA 4NYZA 4LF8J 2K06A 3T19A 2VQEJ 3TAMB 4TLQA 1VK8A 1C4CA 2Z0GA 3I5AA 3ITHB 1IWAA 2HS4A 3GIJA 1S1TB 1CVJA 3Q2TC 3HHLC 4QYRA 2F4VJ 1FJCA 2MLXA 2KM8C 1PIEA 5LXYA 1F1BB 3ENQA 3GU0A 3T5JA 1VQ5S 2EI5A 2DRDA 3AXMA 2FHJD 2FZGB 4LFAJ 4M5DA 5H9EJ 2OTLS 4DF8A 1EKSA 4DQQA 3MMBA 4YS2A 2V67A 1VQ8S 3V6JA 2RKIB 1RSCA 1N5SA 5M2RA 3LA0A 1ZS6A 4KE5A 3W63A 3RBXA 4OJ3A 5KFXA 4KSEB 1KQKA 1S9GB 2LKZA 3QNWB 2KDOA 5DG8A 3BBFA 5IWAF 5I4MA 3N6LA 5HK4A 2FD2A 2RD5C 3ZO7A 3IGVA 2ZH5A 4PG5A 3HSDA 2V5HG 5J2MB 4X4RA 2M7SA 3G8SA 1IXKA 1NDLA 4A48A 1T7PA 4NYPA 2CQ0A 2G2OA 3LP1B 3GR0A 3EICA 2FJAB 3NNHA 3NS6A 1YX2A 1X4FA 1ZAVA 3S1TA 3ETOA 4AXIA 1X9MA 1FKAF 1NK7A 4V19J 3DFEA 3TW0A 2RJZA 1RT1B 2B9EA 4M5DB 2R2TA 2BKOA 3A8IA 2BR0A 2ZC3A 2QL5B 2E5JA 4K4YA 4DV5F 1QVGR 5KFUA 1RTDB 1ZYQA 1L3UA 4DL3A 3FCWA 2CPHA 1CJUA 1G6BA 5K20B 1S1VB 4IOAQ 2B9WA 3CD0A 5D77A 5F0UA 4Y2IA 2VPWB 1RABB 4DCPB 4GKJF 1M1KT 3RU0A 2QLWA 2HHSA 2LFVA 3G71S 4PXBA 1H73A 1RA6A 3HT0A 2UV8G 1IM6A 1WF0A 3N28A 3OL7A 1T3NA 2CG8A 1TAUA 2YH0A 1OY9A 4LRAA 3PZPA 3A8EA 3OR2B 2V4RA 1QSSA 1IKVB 2P6TA 3M9OB 2W25A 3HD1A 2BOAA 3M8ZA 2HK3A 2RF2A 1IR1A 5DDQC 2M4MA 3M32A 2DY9A 3DRSB 2XMKA 5CYMB 5GMKa 2B51A 4Y2CA 1DARA 3CJKB 3X1LB 3O8WA 2DNHA 2EC0A 1S10A 1G7CB 1YITS 4WFNQ 1JLFB 1KHVA 4I68A 3ZZOA 2VIHA 1JB0C 1IUJA 3A8JA 3R5CA 1HNVB 1WELA 1HQEB 2E9RX 3EMTA 4YEAA 1R8PA 5F8NA 3TZXA 3CJ2A 3ZTPA 1E6YA 3K2YA 3CJ3A 1XBWA 3IM8A 1K0VA 4OIXA 5T7LA 2HHXA 2HZAA 4X66J 2MGZB 3CD5A 4NWBA 1RT5A 4DDFA 2XBPA 2KRBA 1NDCA 1WKJA 1X9WA 1KRPA 4P73A 3ULHA 2ZVSA 2P9GA 2H48B 1P1TA 3TR5A 2RF2B 4K59A 1NKBA 3OW2R 3K8WA 5EWFA 3OQ2A 1VCTA 1IVZA 1SIZA 3CJRA 3BGRB 4Q0BB 2RDJA 1LFPA 3HXMA 4WFZA 1FJGF 3KNAA 2HAFA 4HLBA 1ZZFA 2KHCA 5D3GA 4C97A 2OD4A 4QBUA 3CSKA 1WACA 4DUZF 3N01A 4PRFA 4UUXA 2IVFB 3GR1A 2IJRA 3MMCA 4OX9J 2ZVIA 1Q8KA 2FJBB 4B9VA 2XNQA 4HTJA 4ZPBA 2WSCC 3DRRA 2FHJA 2QA4G 3K89A 1TVRA 2YKNB 4CH7A 3CO9A 4USUA 3NWGA 5L1KA 2CZ9A 4JV1A 2IAJA 5HVHA 4JV5J 4ZP8A 3O1LA 3AQOA 4JI0F 4LR8A 3ZC4A 3CGIA 2MYFA 3UDVA 2ZE2B 2YX4A 5E2QA 4ANDA 4A8FA 4NI2A 3GZ7A 3FBBA 3D54A 3HZGA 4CLYA 3LPYA 4RW7A 2ZH7A 1RT3B 2OPSA 1U1RA 3JYTA 3HVWA 3FCHA 3CJ4A 3RB4A 2W9BB 3HHLD 1TL1A 4PPDA 3IR5B 1WC0A 4IOCQ 2BW2A 2XMUA 1UMJA 2ACYA 5BR8F 2QTWA 3NXZA 4ZS6A 2QSWA 2YKPA 4NCAA 2HMIA 5CYJA 5D3GB 3D0GE 5D4LA 2KKHA 2XMVA 5HROA 2FVCA 2CWXA 2CJQA 4DXLA 2P9EA 2R2SA 3FBCA 1JLGA 1NPRA 1UVLA 4ELUA 2V8DA 2JWNA 2M70A 3N4WA 2OIHA 3J80U 3DRRB 1ZA2B 3KWMA 2CVIA 2IM2A 4CLPA 1VGYA 4L73A 3BGLA 2IAJB 2MSSA 1PO6A 2ZH1A 2DXFA 4EK2A 5CABA 2VBZA 5ETKA 4M5IA 2B0GA 2IA0A 1T94A 3F44A 1DJ0A 3IAS9 1HI0P 3MOZA 4RW7B 1KKHA 3IO1A 4V1Ak 1YRUA 1PJ7A 2BYCA 1VBXA 4QIVA 3JYTB 1SKRA 2DGUA 4KO0A 4K2JA 3M8PB 3U1MA 2K3IA 5HJYA 5HI7A 2FPHX 1KFSA 4OYBA 1OS5A 3R6LB 4U9RA 1KVKA 3ZZ0A 3KK1A 2C3MA 3FZ2A 3ZZTA 1K8AT 4RW4A 1IBLF 5BYRA 1RBAA 3AOCA 4IFVB 2GO8A 1VYAA 2W4CA 2Y8WA 4H4MA 2CQIA 3QYYA 4DFPA 1D8YA 1JLGB 1CULB 1HLWA 3HHKA 4CT9A 2GV1A 3T6JA 2Z8QA 1ZAXA 3D28A 1X9SA 1Y10A 2LEAA 4QU6A 3GV8B 5I42B 1HR0F 2ADCA 1TV6B 1YJWS 5F8GA 2V68A 1WHYA 4UQGA 1R27B 1H7XA 3OR1A 3J7AN 4ZJLA 4PYDA 2BZ2A 4A8WA 1NK9A 2HHVA 2D3UA 2H5IB 2R8GA 2WAQD 3ILJA 3KLGA 1UW4A 2VG7B 3PW5A 5F8MA 3MR6A 3LP0A 3VZIA 2PI5A 4YN3B 4ERDA 3HT3A 2RILA 1R43A 2ZBPA 3H59A 3EE3A 4FPRA 3T1HJ 2HLTA 4CRJA 3KLFB 4JI3F 1RJJA 4ZCIA 1IQTA 4KPCA 4C9DA 4F3MA 5DDPC 3GG1A 3KK1B 4X62J 4UF4A 2H1YA 4KAIA 3PFEA 1UA0A 3KHGA 2IBOA 4RW4B 1WC4A 4F67A 1NPPA 3WBZA 4ES1A 5KFGA 2CQPA 3WQPA 3D5MA 2VUGA 1ZA1B 3TOQA 4H4MB 3HF5A 3D1HA 2RQMA 2GVDB 2DR6A 1JLQB 5MLCV 1KWMA 4JV0A 4ALZA 4ZP9A 1DTTB 1HNXF 3QIPB 3PO5A 1RHQB 3BN4A 3PVXA 4AUKA 3OTOJ 1JXLA 4NXNF 2V2QA 4YB6A 4IKAA 2E9ZA 2QYCA 2YQ1A 3ZFVA 2HNZA 4P2SA 1S1UB 1RAIB 2WVEA 5CAAA 2MKSA 3CCVS 1MMLA 3Q23A 4EEYA 5J1EA 1GNKA 1Q81T 3LP0B 4PYAA 2D69A 4ZVHA 3IG1A 2BJDA 1NUEA 4Q7AA 2XSFA 1RLCL 1SL2A 1HHQA 4ZVUB 4ECUA 3M1VB 4KH1B 2I2YA 3Q8PB 4ECXA 3AD9C 2J7UA 3T1YJ 2UXCF 5KFVA 3I4PA 2ZH4A 4ATNA 5F3TA 4LSNA 2XEXA 1RWNB 2OLWA 4TNOA 3CNQP 2L9DA 1SC6A 1PAUB 5A0YA 1WORA 3HHLA 3RB0A 2PIIA 4B9SA 1EP4A 2RB7A 1PC5A 3KG1A 2CIMA 3SCKE 1B0TA 3MR2A 2VPZB 5IS2A 1FFGB 2B9YA 5KTQA 3KLHA 1IKWA 4P2XA 2BKNA 2FLPA 2BQUA 4AYBD 2YKQA 2ZH3A 3HD2A 5IT0A 3RAQA 4RKUC 2C2ZB 1HWJA 1F9FA 5HN0A 2ZOGA 5IXUA 3HJFA 2NQPA 4QIEA 2DHGA 1D1UA 2HNZB 2W8KA 1OO0B 2XWXA 4A8QA 2G1HA 3RJMB 4LF6J 1U7LA 2CG4A 2CFXA 2J0XA 2EW9A 5J1EB 3DOKA 2VKRA 1SQFA 4MK7A 4J7CA 3I96A 1RT6B 3OBIA 1U1QA 4WTOB 4X65J 3CCJS 2JLFA 3PFOA 1ZTWA 3Q2SC 3JAMY 4LSNB 1F5AA 5A0YB 2BABA 1HIYA 1MMNA 5EN1A 4DR7F 1B7YB 3DRPA 4K0KF 1KC8T 1NJZA 2N82B 2ZD1B 2VG5A 1F3FA 3HM9A 1R6VA 2F65A 1RK8A 3R27A 4XDCA 2RU3A 4CYUA 3HFVA 4OYAA 3PJ9A 3ISNC 1FVSA 5KT7A 4X84A 5KFNA 2UXDF 3K0JA 1YKWA 2CQ1A 5IC4B 3FQKA 4ECSA 1K47A 3IR7B 4ZITA 2P9CA 3BYRA 3BPSP 5DG7A 2V9WA 5AJ3J 1RWOB 4RL1A 4NPOA 1RTJA 3L4BC 1RTHA 3OV7A 1ZOTA 1M5KC 2B43A 3DOKB 3O3LA 4X4SA 1F3VA 4QR2A 3C16B 3PJWA 3EZOA 3H25A 5CA5A 4DWIA 4X4NA 1KR4A 2HBRB 4O23A 3M30A 2LLZA 4EYHB 2VF3A 2EG2A 1AZSA 4RUCA 1X4BA 1FEHA 2VJUA 1RU1A 2A6MA 1WHWA 4EUVA 3DM2A 1QUVA 4K8RA 4NMLA 3I32A 3H5SA 3ENWA 4K4XA 2JSXA 1PGZA 2PN6A 2DRBA 2VG5B 3POTA 1N52B 1Q4RA 3MAAB 2V94A 1RWKB 3GB0A 5C25A 3BS9A 2J0SD 5D0GA 5HANA 4GKKJ 2R4FA 2HRTA 4KKOA 1A0OB 3NGRA 4MIAA 4RLEA 5A8RA 1TL4A 5LMUJ 1N32F 1OMSA 3E01A 1T05A 3OTBA 1FX4A 1URRA 3PXGa 5HAOA 1I6JA 1RTJB 2Q6CA 1XNRJ 4EWTA 2MY8A 1RTHB 1MROA 2UU9J 5KG7A 2M9KA 5F8JA 2VHGA 3FFIA 4OX7A 2ZH2A 3NWRA 3GJQB 4C0HA 5DDOC 1DZ5A 3OD2A 4ZPAA 4C4WA 3TVKA 2BE9B 2VBXA 3BBBA 1XNQJ 1VOMA 4J9VA 1AZSB 1H6KX 2HHUA 3NP5A 3VAFA 5DLGA 3DM2B 3HX9A 4ED3A 1HA1A 3T6BA 3G8QA 1TQLA 1URNA 3ZZPA 2WVBA 4B3TF 1JMTA 1PYOB 4QJVA 4QPTA 2UVUA 3ENAA 2UXBJ 1RT7B 4LRCA 4TXSA 1N5YB 2MZSA 2XC9A 4MFBA 2KRRA 1FXRA 1DURA 2YWKA 2EK6A 4S0MA 3HFZB 3CJSA 5IZHA 2KH9A 2B3TB 5FD1A 3CJQA 4ETZA 2ZITA 1RT4A 3RBZA 1T95A 2CRLA 3DU6A 3E01B 2QA4S 5J1PA 1FX2A 4KHPF 3DLGA 2KI2A 2FDNA 2MZRA 3CCZA 3LANA 3CCTA 5KFZA 4IOBA 2C3PA 5B0CA 2CPDA 1S72S 2GIFA 2AZ3A 1NCLA 1UEKA 3FMWA 1SL0A 2YNHA 3J81Y 4P6QA 4EI2A 3ONQA 2MZJA 5BJRA 1CSJA 2DEIA 1TELA 2P2CB 2OGUA 4XTTA 1DRZA 3DN9A 4B9LA 3GSIA 4B08A 4DX5A 2BBEA 1VR6A 4Y00A 2FY8A 3OVSA 1VI7A 2F1FA 3KJQB 3W2VB 4B9UA 1JLEA 2DH8A 4Q8EA 2HFZA 3EVWA 2R2RA 3T1AA 2E1RA 4WKRA 2LXUA 3H0PA 4M5KA 1S1WB 1ZM4A 2XULA 4Y2KA 4W90B 1LK5A 4UW2A 2CQGA 3LH2S 4EMDA 4O44B 4WYWA 3C15A 1YJVA 2ZBIA 5LM7E 3TJ8A 4DV1F 2B4PA 3H7HB 1DAXA 2RE1A 3PHTA 4I4BA 1J5EF 4LVNP 1VDHA 3VV2B 1GT8A 4LSLB 2RQCA 3GLJA 1X8DA 1OSDA 4P75A 4U6PA 4FDFA 4IO1A 1R0AA 3VAGA 3CB4A 3IA0A 4JYAF 2YNHB 3HVTA 3B6BA 3ZNUA 4ECYA 3EXYA 2VH7A 3QWUA 1B99A 4P10A 3G87A 4CIOA 1IR0A 2ZZTA 2DGTA 4MYUA 1JLBA 2CNKB 2CPFA 1D9AA 4MKAA 2VODA 2XZDB 4BWJA 1MWZA 1W25A 2J9CA 2PO4A 4ID5B 1ZM9A 4URGA 2U1AA 4I64A 4DSLA 3RG6A 3CF5Q 1N36F 3M2RB 4LF7J 4ELVA 2PD1A 1FRLA 5FJ4A 4PEOA 1JX4A 1WHVA 3GTYX 3D66A 3MFHA 1KOHA 4YB7A 2RUGA 4I6WA 3C15B 1IKXB 2PMZD 3AOBA 4DLEA 3SXLA 3ETMA 1FKOA 5E3RA 4DUYF 1R3NA 4F50A 4NLQA 3MMAA 4ZVPB 3BH6B 4YQWA 3KK3A 3IXQA 4DL7A 1JNRB 4G65A 4B9MA 4TU8A 3TA1A 5HMYA 3DYAA 3ZTQA 3QATA 3HVTB 4KV8B 3GJRB 4DR4J 2HQFA 4LFCF 2W2MP 1OQ6A 3EYZA 2GQ2A 1UVIA 4M8LA 2A6OA 5J1NA 4ZHRA 1SH2A 2KG0A 1R89A 6AT1B 1N34J 4DPWA 3OFGA 5M2PA 4OYIA 3CPWR 2MKJA 2YWWA 3UDLA 1NM2A 3A3OB 1T9WA 3K5MA 4OYOA 3P49B 4F02A 1SB6A 3DLHA 1Y5NB 4RW6A 2IJNA 3KTQA 3Q8YA 1N5TA 3CJ5A 1EJ7L 3PW0A 1KEKA 1X4AA 4M5HA 4Z7CA 1U1NA 1X5OA 1JKHB 3UO0A 4P9SA 4HL9A 4HTIA 3LO3A 3EWGA 2CYYA 3OFFA 4F36A 3PACA 2W01A 1RYSA 4CZCA 2DR9A 3GQCA 3QGGA 2DXDA 2EK1A 2R9LA 5A8WA 2CAJA 2OHDA 1HBMA 1SC4B 3HPOA 3HHNB 3KK3B 3Q0AA 3O5TB 2LQBA 5AXLA 1HW9A 2VJVA 1UWBA 1PG5B 5ETMA 1FWLA 4K7QA 4FZVA 1BY9A 1QAXA 4Q43A 2X1GA 4ZHRB 3C6UA 3OXFA 1MWYA 3QZ7A 3M8SA 4J9LA 2C3YA 3LGHA 5CZVA 4RNMA 1RHUB 1ZBTA 5KG3A 2Y3YA 2OSQA 2LEPA 4ECRA 2OH2A 1VC6A 3MD1A 4RW6B 2DNGA 4H54A 1LW0B 3W60A 2FYXA 3PKYA 2E7WA 2WHOA 2LYVA 4CLFA 4B3MF 4CTAA 2D1CA 4DR5J 1H74A 4JBCA 3MEEA 2XS2A 1WEYA 4F2SA 3DDNA 4LF8F 2GAGC 3D3BJ 4USVA 4M1KA 5J2PA 1NMEB 2VQEF 1I94J 4B9TA 3WIVA 5DDRC 2DTJA 2Q3PA 1IKYA 5KFTA 4UQTA 4WJBA 1HBMB 5GAHU 3GCWP 1S6QB 1QSYA 2F4VF 2AEJA 3UNYA 4AE5A 3DGVA 4F4AA 1B4SA 1N56A 3T3FA 3HHEA 3L09A 4LFAF 2W7OA 5SUHA 3SZ2A 1Z1ZA 3H90A 3AB4B 5E5NA 3W2WA 1CS4A 3JB9k 4M5LA 2DCLA 2ZH9A 3NBPB 5D0EA 2UV8A 2MKCA 1JLAB 1WF2A 1NSKL 4FBUA 1X4GA 3QGIA 3UN3A 2I5JB 4YR2A 4TY8B 3H2UB 5L46A 2AP6A 4FXDA 1SH0A 2N7CA 2B8PA 2P6SA 3LP2B 3U27A 1N6QA 2CJXB 1NBEB 1EIYB 2VFSA 5B7WA 1GXUA 3AA9A 3UN2A 3PIPQ 3X3UA 1YI2S 4LF4J 2XNRA 1TKZB 1NXIA 3UDEA 2H5EA 4LQ3A 4ED7A 1APSA 2J7KA 1VLOA 4LT6A 1RCXB 4KC5A 2FJDB 2RDDA 4WE1A 3R7SB 4YFUA 3GIKA 1IKYB 4LF9J 4ZVEA 1XR7A 4QZVB 1KFDA 2KT2A 3IWNC 3G2XA 5THWA 2YKMA 3WC2A 3N9UC 3K58A 4FS1A 5ETNA 1NJWA 4MK8A 1Q95G 2YKOA 2IFXA 1B0VA 2VQFF 1O5JA 2QL7B 1Y3JA 3NL0A 1M1HA 3W2WB 1VQOS 1NHKL 1RAJA 2GQCA 2HK2A 2XB2D 1FDAA 4KGVB 1HBUB 3NS5A 4KGMA 4O4GB 2HGNA 2JLGA 3LUYA 2Z58B 2IDLA 1VJQA 1VQSA 3IBCB 5LXRA 3L7UA 2BXJA 2QE5A 4DL4A 5KG0A 1WWHA 5AXKA 1UWAA 1FESA 5KFJA 4F4ZA 3Q24A 2BMBA 1SV5A 3D6FB 1DBDA 2E1AA 3HSZA 1X5PA 3CD6S 2DGXA 4I2QA 4ZP7A 5CQGA 3QT7A 3JSRA 2EKNA 1KDNA 1XMQJ 1HPZB 1C1BB 4JI2J 3B82A 2HAIA 4FKYA 2CPJA 4ICLA 3N6MA 4WPAA 3OUYA 2W2NP 3SSSA 1BQMB 2HS3A 4USIA 2GVZA 4C8LA 3MF5A 4YDDB 4WCEQ 4L3NA 2Z2ZA 4GRSA 3Q8QB 1WSRA 3BYPA 4C2MA 4USHA 1QAYA 4ER8A 3KJFB 4ZLPA 2I0XA 5H1SV 3RYLA 3HCXA 3DI6B 3NNAA 5B08A 2R7VA 2DISA 3MM8A 1U09A 3PEHA 2XCPA 1Q7YT 2R7XA 2J9EA 2BJ1A 4F3QA 2GNKA 5HVFA 2AF6A 3EUNA 2VA2A 1I3OB 4U7UD 1TKTA 2LQJA 2QFIA 4ELTA 2W2PP 4PPZA 3P45B 5AE3A 3BF4A 4X66F 1EQMA 4DL2A 5KFPA 3M6VA 2YWGA 1U8WA 3WX8A 2XLKA 4DV6F 1O0PA 3I87A 3EPGA 3AJ2A 4DFKA 4R0JA 2OPPB 3JTNA 1HHTP 4WFAQ 4L6V3 3ZTSA 1FDNA 2F8MA 1BXNA 3UI3A 2VZ9A 4TQRA 1YJTA 2G9OA 3DC2A 2VFRA 3PY8A 4DR2F 2GVZB 2FHKA 5H9EK 4LF2A 4DCOB 4URQU 2FTRA 5F41A 4PXCA 3BQ1A 2OEJA 1X0FA 2BANA 4NLXA 2DNYA 3MCSA 4ZIWA 1DY3A 5KFMA 2KVQE 1S76D 2X7IA 3VZHA 3LWLA 2LXIA 5DGBA 4HT5A 5GAHI 5CHCB 1FNXH 4HI1A 2KG1A 2ALZA 4G1QA 3U1LA 4EZ9A 3GIIA 5KFQA 5KT6A 1AYEA 4OX9F 3MM8B 2E5HA 4AL7A 2ZM6J 3T9NA 2XI3A 4C7QA 3SI8A 3K5LA 4CLWA 5HLFB 3W65A 3W66A 4HKQA 3UQSA 1GXTA 4DQIA 2ZJRQ 3AD8C 5ETRA 3H5UA 2LP4A 2APOA 3QSYB 4JV5F 1NKEA 4PWDA 1NPKA 4FVMA 1OQ3A 1FF2A 2WW8A 4K4TA 3N5FA 3D6HB 2JJ4D 4U8VA 1CJTA 1H72C 1ZH5A 4HHJA 4J9QA 4L3KA 4M63A 2Q6BA 5CZXA 2B4VA 8AT1B 3PX6A 1U02A 3W8GA 3TWZA 1HBNA 4DQSA 2VB6A 4F4YA 1U2CA 3M6XA 3D2WA 2BANB 2CQDA 2RRBA 4OYWA 2MKIA 2F4FA 3CULA 1J5OA 1S9FA 2OPRA 3DOLB 2KN4A 2RS2A 1LXJA 1Q53A 4IG0B 2FZKB 5A76A 4U96A 5D4PA 2IY5B 2RQKA 5G4DA 1FA0A 5CYQA 3THPA 3PW2A 3TRGA 4CNZA 1M5PC 1M1GA 4LSZB 3SCIE 1M5HA 4OHWA 3MHYA 1SJRA 4GVLA 2M2BA 3KG4A 4ES2A 1PILA 4LIWA 3P3DA 1B0PA 1B7FA 2XSJB 4HYKA 1R6YA 3FEZA 2Z30B 4YR0A 2MXYA 5E3PA 1NO8A 5J2NA 1RB0A 2J6UA 2A0FB 4U7CA 5C2GA 2H54B 1R8HA 2WOMB 1FVQA 3S6EA 5KG1A 4RNNA 1RWXB 4RWWA 1V3ZA 1IJFB 2N4DA 1J5OB 3EDQB 2QLJB 1YBUA 3UDCA 4BBYA 4ED5A 3C14A 4LF5J 2LQ5A 1HWIA 2W4PA 3G86A 1AW0A 1CJVA 2WSFC 4KY3A 2HQ3A 3QZ8A 1HNZF 1FERA 1FJ7A 4NLPA 3VF0B 3IS9B 4MJKA 4FF3A 1EETA 4N5SA 2XGPA 5AE1A 3VWSA 3DRXA 5ADZA 4RZRA 5CYQB 5C2CA 4TYAA 3T5HA 2UVVA 2IRYA 1WOOA 1UVKA 1X0PA 3SMZA 4I1TA 2LMIA 1FDDA 5DETA 1B3TA 2EFOA 3WHIA 2W9AA 2IYIA 2VPYB 3CWJA 1BWEA 3J7YI 3FEYB 4R0EA 4LJMA 1U0SA 3J7A1 3JAMU 1S5ZA 1W2IA 3W5YA 4UOCA 4ZK7M 2AJ0A 2JC0A 2HIYA 2DB1A 1H2VZ 2JEJA 4XPCA 3PEJA 1FXDA 4KRWA 4TU9A 5J2NB 3UPFA 1K73T 2RMLA 2OUGA 5GMEA 4HHHA 2YWFA 3OL8A 4JI7J 4JI8J 3EGNA 4IH5A 3T1HF 3PW7A 2MQPA 2AJFE 3D3CJ 4CLLA 1X4HA 1FNOA 1LWFA 4FN5A 3SV3A 3PYEA 3MECA 1SH3A 3I9V9 3JSMA 2AJ2A 2QEXS 2K2PA 3VAMA 2D41A 4A8OA 4JI1J 1EETB 4RUBA 2DNLA 3QPIA 3IMQJ 7FDRA 3KJVA 3AXKA 3FJ2A 2GMJA 2LXFA 3R8YA 3QAEA 1OPZA 2QA2A 4C3LA 2E5LJ 3JQMA 1U2FA 2F9DA 2ZZMA 3BJYA 5F9LA 4OZNA 4DV2J 4OZ0A 2ZH6A 1NB2A 5DRKA 1X5SA 3MM9A 5D0RA 2XM3A 1QVFR 3OTOF 3M2VA 2FHOB 3EJMA 4WF9Q 2CPYA 3RAXA 1TUVA 4NEZA 4DUZJ 1YZ7A 4JI5J 3LPEA 5LSOA 3ILOA 1M0SA 3BM7A 1TMMA 2ZZNA 4NLSA 4P2FA 3NLCA 3D0IE 4PXDA 1VMBA 2XHWA 2XS5A 1YHQS 2VBYA 2DNRA 2YTCA 3T5LA 4OI0A 5DQIA 4OYXA 2CQ4A 3UN5A 3T1YF 5L1IA 3NMAA 3JSMB 1SJFA 1UZHA 1WTBA 2XY7A 4DG1B 3MPYA 4CQ1A 3PYGA 1RUSA 4OZ1A 4MIWA 3AY0A 3L95X 3TA0A 2WTFA 1PKUA 3RB3A 4G1IA 1GX5A 4Z2XA 5LSLA 2MY7A 3HMJG 3EX7B 5KOWA 3G6XA 3JXOA 1GMWD 2FVSA 4Y2AA 1S6OA 1TL3A 8ATCB 1ZZNA 3TAPA 3DOMA 4L75A 2NCKL 1LW2A 1QDUB 5E33A 4TU7A 1WKLA 2ZDPA 5B0EA 3V4IA 1KD1T 4QIGA 3AFGA 3M2VB 2XHCA 4HHUA 4WTYA 4C0BA 4IDKA 1KHWA 1AT1B 2BE2B 3AOAA 2V8GA 2F40A 3H4BA 2DO0A 4DSJA 2QL9B 4LF6F 1U1LA 3TAMA 1YZ6A 4F0MA 2V6AA 4N76A 3UD4P 4OX6A 2YBVA 3QQCD 2HVIA 4OZJA 3H5YA 3CMAS 3KJNB 3JTOA 4FBTA 3WZ0A 2V69A 1PYSB 2PMHA 3DMJA 2JVOA 5B09A 3K5NA 1RWPB 4K4WA 3LW5C 4M95A 2H9ZA 1TK0A 1VQ7S 3SBMA 3G96A 2RKIA 2R8KA 1YVFA 3F73A 2WVFA 2HHQA 4EO6A 1VC0A 3J81U 2NREA 3V6DB 1TL3B 1PC4A 3FDSA 1MU2B 3MM5B 1LW2B 4R25A 1S9GA 5C7PA 3GONA 4JB8B 2LA4A 2XTJP 4CCHA 3VAHA 2DGWA 1AXQA 4DLGA 1D0EA 5J2MA 1P1LA 5AJ3F 2QFJA 4Y2MA 1PAEX 2QV6A 2WK4A 4PKDB 2Z2LA 1VLYA 3BO2A 3LP1A 4QIFA 3B78A 3FRYA 3A3NB 1TUWA 4PZVA 4DN9A 2AEMA 1UFKA 2KZZA 2WW4A 2ROPA 3MCNA 3O44A 3PIOQ 3H42A 2QG9B 4DSKA 2K1RB 4DL0C 2XLJA 2YNIB 2ZNYA 1RT1A 2MHEA 4HACB 4UOGA 1WNEA 3DMJB 4P2MA 5ETOA 1WTFA 2E7XA 1JWWA 2ACMA 4KGKA 1Q0NA 2VDHA 4I69A 1X31C 1RTDA 4DR6J 2F5GA 3J7Z5 1VBZA 4P74A 2I6WA 1S1VA 5JVGQ 4DPXA 4IQMA 4JI4J 2XZTB 2FC8A 1HWKA 2E5GA 4CP5A 4U8YA 4F3OA 4ZPDA 4IG3B 3PYFA 2QA1A 3KK2B 4GKKF 3DDIA 2C2MB 2OJ3A 3NEKA 1U24A 3HJVA 3F41A 5LMUF 4DQPA 1U48A 1CLFA 3DDKA 3OR2A 1IKVA 1XNRF 1JJ2R 1M5VC 3VVUA 2XO7A 2HPUA 2JDJA 4CM0A 2BW7A 1XWLA 2UUCJ 1TUGB 2UU9F 3DRSA 5CYMA 2HNYA 2O1PA 3U02A 4OZ2A 2C2RA 1F6TA 2DGVA 4DU8A 2Z2MA 3CJKA 1AB8A 3PRDA 5T14A 1TP7A 1XNQF 4CM2A 1T11A 2F7VA 4O3SA 2JH3A 4OJHA 1LNQA 5E3QA 1JLFA 4ZLLA 1WEXA 4NXNJ 2CDQA 3K5PA 4RBTA 2JL9A 3T9ZA 3PX0A 2O67A 1HNVA 4C8ZA 1LV5A 3FBEA 3KYLA 1HQEA 4F4XA 3HLUA 5F8IA 4Y28C 3F0NA 4C6AA 5JUMA 2GHPA 4NOHA 2UXBF 4QYZK 1V6HA 1F2HA 3C19A 1R0BG 1YJUA 1S97A 2MPUA 2VC0A 1C0UB 2MGZA 2ZDOA 1FKPB 3C6TA 1X5TA 3LGNA 4DV7J 3H2VE 3NAIA 5DS7A 1PJ5A 1XMBA 2HHHJ 1GMWA 2AZ1A 2BV3A 1JJ4A 3BN7A 3M8WA 2QLBB 4WXWA 1T9UA 2AWZA 4Q8FA 1W26A 2OEKA 2HNYB 4WBFA 1RACB 1WOPA 3WDOA 2VG6B 3KDOA 4JP8A 2UUWA 3CUNA 1PBUA 4BWMA 3BGRA 3I0RB 4Q0BA 1NJXA 4LFBF 2Y1JA 5LJ3Y 2PA3A 1LKZA 3CCUS 2YNFB 3GPAA 4P52A 1UA1A 3CJ0A 2L41A 3IWLA 1R7IA 3L7OA 2PT0A 4NLRA 2LA6A 3MTJA 2VASA 3CCRS 4NCBA 4N77A 4DV3F 4OYZA 3ISZA 5I3QA 3FBFA 1VC5A 3QT8A 2MKKA 2YH1A 2YKNA 2CQ2A 5JJBA 2FJXA 3NGDA 2RS8A 2RSQA 2DGQA 5KG5A 2X1FA 4EZ6A 2OI2A 1JXEA 3GFZA 4WU2A 3BB5A 3SV4A 3RW6A 3FKBA 3C6TB 1U0HB 3KLIB 2CJBA 2DXEA 3ZZYA 4DV0J 4ED6A 2ZE2A 1OY8A 2RU9A 3BR8A 1O51A 4N8OA 4N7TA 2MJNA 3G4SS 2FIUA 1CQMA 3R1LA 4LR9A 2GX8A 1RT3A 1HQUA 2AGPA 4J9SA 1VBYA 2BA9A 4KHRA 2AJ4A 1D8ZA 4GO5X 2W9BA 3VHQA 4Z7YA 3R97A 2HSEB 3ZXWA 1RAGB 5K8NA 3BH7B 4OHYA 4WFYA 1S4EA 3UE2A 3DNCA 5HQMA 2DHXA 1C0TB 4MKVA 4NLWA 1WC6A 3F56A 1CG2A 1S99A 4E8UA 5IC6B 2UXDJ 3RRKA 5FIIA 4QPXA 5KFCA 2C2KB 2HWHA 2EFGA 3FSXA 1LFWA 1RBOB 4LF7F 3GYNA 2FY1A 2MMYA 4QU7A 3QO9B 4ECZA 5D0HA 1GX6A 2FVRA 2PEHA 2M5YA 2NPIA 1XR5A 4M5MA 4J90A 5K8MA 2DH9A 3OTDA 2ZOMA 2V2VA 4DSFA 1VQNS 2HVEA 2ZUAA 4J9NA 1HNWJ 3ILIA 2Z56B 4TN2A 3OTCA 4WU3A 3V6HA 4YMEA 2IMWP 1R8CA 1HQUB 3I55S 4A8YA 3C66A 2NXJA 3I56S 4DR4F 2VFTA 1S9EB 3M8PA 1VQ9S 1NZ8A 2E7VA 3D4JA 2UVRA 4X4QA 3VVTA 5HL7Q 1T9YA 4USTA 4K4UA 4D3HA 2R7UA 1MMDA 1N34F 4X64J 1S57A 4ZLJA 3R5DA 2ROGA 1HYSA 2HFSA 2R42A 2FVQA 2DVIA 3MUMP 4IFVA 1RZMA 1RKIA 1NSAA 1LWEB 2UUTA 1QUPA 1UJ4A 1CULA 4WP3A 3KLVA 4OLOA 3AHPA 1FJEB 3HZEA 5KFAA 1UEUA 2ZOFA 3ICLA 5CH7B 3OLAA 3VQTA 1OYEA 3PNIA 5I42A 1TV6A 3NRBA 1YBTA 5DQHA 2FJEB 3V2UC 3US5A 2HNDB 2GFFA 4ETXA 1NJIT 4RJVA 1Y3KA 2YWEA 2JVRA 3S01A 1NH7A 3IWXA 2F8HA 3D7SB 3MM6A 3M6UA 4PG7A 2VG7A 1CEZA 5K14B 3ZZRA 3K57A 2VV5A 2V2ZA 4ECWA 4B3TJ 3RAMA 2EG1A 3MPWA 3C3LA 2HQIA 3M8YA 1QTNB 3RBEA 3LQVA 4KGXB 1XTZA 3CJTA 5ETSA 3KLFA 1RGVA 3MFIA 4LRBA 4NLUA 7FD1A 3FSIA 3CXCR 2IM3A 1L3KA 2Q43A 2F8EX 1NK8A 1HYSB 4DL6A 3AB2B 4O3RA 1S7HA 4DFMA 4C8NA 2NYHA 1I1GA 5LSRA 4OV6A 3R3TA 2WZ1A 3GFHA 3PHEA 1FK9B 3D6MB 4NZ6A 1RYRA 2MZQA 2MEWA 2DK2A 2CJ9A 2GVDA 1JLQA 1DTQA 1A9NB 1FRXA 3OFHA 5BYQA 2GO9A 4DR5F 1DTTA 3RRHA 3QIPA 2LQ8A 5FDLB 1F60B 2HVHA 1WF1A 2CUYA 4YDXA 4AQYF 1MWQA 3RGIA 2RRAA 1BQNB 1KQFB 1I94F 1OIAA 4H4KC 1P9QC 1WEZA 5DM7Q 4RU9A 2GHVC 4NLDA 1S1UA 4N41A 2XWYA 3MM6B 4K4VA 1FFWB 1HBOB 3MR5A 5HQ8A 2WVCA 2DKOB 4RO0A 3GIRA 2ZUGA 4YP3A 3M2UB 1VK3A 1Q5VA 4Y6IA 5DQGA 4G1PA 3ZZZA 3IBWA 4RW9B 5DZ6A 5G0RB 1HARA 1S12A 3Q89A 3M1VA 1YG0A 4DJBA 4OJ1A 1UFWA 1XN9A 4FYWB 3DLEB 1Z4UA 4TQSA 6FDRA 5A6WA 4P7VA 2MQLA 2HBQB 4L74A 2DGSA 3LF0A 4J9OA 2EC2A 1P27B 2GC8A 3V81B 3W9HA 1SUQB 2JFDA 1S1XA 2HZVA 2VA3A 1TL7A 3HVRA 3AH6A 2KHDA 3HULA 2LEBA 4ZLNA 2CZVC 3AJ1A 1DTQB 4WK3A 5CCLA 4LF4F 4P72A 4NA2A 3W5XA 2ADBA 2LVWA 5K5MA 4RUHA 1N88A 2GIRA 1RWUA 1SVDA 5C42B 2DR5A 2JC1A 3PM9A 1O8BA 3OVAA 4LF9F 2PMWA 1IR2A 5EX0A 3IGNA 2KB2A 4ZVTB 4LIRA 2OD6A 4DEZA 4RPFA 4J91A 4PG4A 1Q86T 4DHVA 3EVMA 1RT6A 4XPEA 1RBLA 2BM0A 2N4CA 1CC7A 3G9CA 2RHQB 2PC6A 1MSWD 2DNKA 3EGWB 4RWXA 4DI6A 4B3OB 2DNPA 1FFSB 5JMNA 5EX3A 2YX1A 2V63A 2WB1D 1H7WA 1S1XB 2NZCA 1F5CA 2CQ3A 2QN6B 3B8HA 2X51A 1TL7B 4CO5A 2ZD1A 2FGOA 4IUFA 1VRUB 1NHVA 1DLOA 4ZVSB 2OP5A 1NJYA 2EFVA 2G1DA 3I31A 3BQ0A 1VQ6S 1XMQF 4JI2F 2HKEA 3QJLA 4RUAA 3G8TA 5KG2A 2XG8A 5I3UB 1VRQC 3H8YA 4UZBA 3RTVA 2FZCB 3VALA 4QYZJ 1U2RA 3MOJB 2BUNA 3HI9A 2DPJA 5GAGI 4J9KA 2ILYA 3BKTA 1T03B 5DGAA 1EARA 4PWWA 1YJRA 4B3RJ 4F4KA 5F8HA 3Q86A 4PR6A 4LVOP 1RAFB 1OYDA 4DR3J 1KN6A 3VR1A 3SDEA 3TUZC 2YX7A 5DM6Q 5GVQA 3C16A 3PJXA 2OFGX 5IOLA 2DCUB 2RUSA 2QSFA 2QZ8A 1W2BR 4UT4A 4DCJB 4WZQA 3W9IA 1XQIA 1GMVA 1U1MA 3Q8SB 4ANCA 3O2IA 2H4YB 3P5TL 2D9OA 2XI2A 4B3SJ 1O6XA 1S49A 3JSBA 5IM0B 1NK6A 1VIOA 4TKTA 1A7GE 4V19X 2ATLA 3TANA 5L9NA 3C8YA 2YXLA 3BO4A 3UCZP 2HQCA 1DLOB 3GJSB 1F0XA 3G6VA 1FRKA 3MAAA 3NKYA 4YB5A 4NCGA 2XYHB 2PDAA 5F0WA 4NEYA 2HYIB 2D3O1 1S7IA 4LR7A 1E6VA 4WFBQ 4AXJA 3A4TA 1WDDA 3FK4A 1T0TV 1KOOA 4PQAA 1UVNA 2V8PA 4NLVA 2H4WB 2HGMA 2DHSA 4E0DA 2BQ3A 4GVBB 5L1JA 1B64A 3MM7B 4ZPWR 1LWXA 3SDEB 2R8IA 4KIAA 4DX6A 2M88A 1OWXA 4DX7A 4N47A 3PDNA 2R7RA 1JJCB 2ASJA 3DXSX 4OX8A 3FRZA 2HWTA 4ED8A 2IM1A 1QE1B 3B4MA 2ZM6F 1S0OA 2QMWA 3CEDA 4DU7A 2DH7A 3MMJA 5HQLA 5LMNF 2DD8S 3EDRB 4L72B 4W4MA 1TFYA 2B4UA 2QIFA 1P8GA 3W3SA 1Y7PA 4DZ6A 4NLGA 1X60A 1RT7A 4U95A 1WG5A 2LCWA 2AX0A 2W24A 1N5YA 2R7QA 2W8LA 5KG6A 2YVSA 1RI7A 1TKXA 1RKJA 1GEHA 4NCGB 4ZCKA 4RNHA 2N7YA 2WRMA 1WD6A 1EHWA 3MUTP 1U8SA 3MEGA 1GFWB 4XK8C 3UFCX 1E6VB 3CD7A 3QFWA 4JOUA 2FJVA 3E51A 2GMLA 4JI6J 1HNIB 6FD1A 1U25A 2CNNB 4TY9A 3HSJA 4C8OA 4HT7A 2OPQA 3SQGA 3TVZA 4PQUA 2DO4A 2YNGB 1FO1A 2KJVA 2CPIA 1HL6A 3SSRA 4RNOA 1CJKB 4XIUA 3FGVA 4ID8A 4OL8A 3FUYA 3IRXB 1ZPWX 3W62A 4ZVGA 2J9DE 3A3PB 3HVAA 3KDNA 3D1QA 2X3DA 4NLYA 3NY0A 2F3JA 1REVA 2E1CA 2NXEA 3W2VA 3QT6A 1IBKJ 3CE8A 2C2DA 1N33J 2AMCB 3JQKA 2XZWA 5KT2A 4ES3A 2EBEA 4CO0A 1S1WA 4PUOA 1C4AA 3CDUA 1UPMB 4C11A 4I0WA 2A2CA 3L3CA 1EAYC 1TKXB 4DL5A 4C98A 4O44A 4QWBA 3HK2A 3S7RA 2VQFJ 3PKMA 4LBHA 2HBZB 3U1NA 1J2VA 3MEGB 3QIDA 1T8EA 3MMBB 1Q1KA 4WP9A 4O0NA 1S4FA 4QWCA 2F63A 1N8RT 2VU5A 2C22A 4IFYA 3QJPA 5U47A 4CT8A 2ZKUA 4LSLA 4EBEA 5CCMA 4GO7X 1SPBP 2V2KA 4O0IA 2OPQB 3SQGB 4PQUB 3IBFB 4I6YA 3JSYA 2E1MC 2PI4A 4LF5F 2YPZA 2AHOB 1NH8A 3W1YC 1S79A 2CJYB 2GS8A 2COLA 4Q2LA 3OHBA 2ATCB 3G6ES 2D74B 2JLEA 4OMFG 2PA8D 4C3KA 1VQLS 1REVB 2X1AA 1XR6A 1SKSA 4N8NA 2ILZA 4ILLA 4ID5A 2HWIA 1UZDA 4ZIVA 2XMJA 2IVYA 3M2RA 3QRPA 2RNEA 4PUOB 2YQ3A 1NK0A 1UCNA 2X1BA 1NNDA 2X3GA 4FPIA 4C11B 3NCRA 3M8RA 2YQ0A 1D09B 1KNZA 3BSNA 2LDIA 2A1BA 2W2OP 1IKXA 4K50A 3OJUA 5ETLA 2YPYA 3QSIA 3CCLS 1NZAA 1FD2A 4HEA9 3BKFA 3BGFA 1FDBA 4F26A 2FQQB 4IFYB 4EU0A 5BYSA 1CJUB 4JI7F 3NMRA 4JI8F 3OSPA 1K44A 1CC8A 2HGLA 5A8KA 3QRQA 1Q78A 3I0SA 1FTCA 5L9XA 2N3LA 4CLSA 2E29A 2G2YA 2ABYA 1M5SA 4DF4A 4HDHA 4GC6A 4KV8A 1Z2ZA 3CCES 3KUEA 5D15A 1U1OA 1GXLA 4DV6J 5KFEA 2DYAA 5ETPA 4JI1F 5D4NA 3W61A 2MB0B 4QQBA 2YKAA 2V4JA 4ECTA 4G6VB 2RVJA 1D9FA 3CT9A 1RT2A 2MTLA 5L1LA 1A6LA 4Y3CA 2JHEA 2FC9A 1UJ5A 2RQ4A 1WG1A 3M32B 2E5LF 3MTKA 4DR2J 4IR1A 2DNZA 4DV2F 2EVZA 1WC3A 1NDPA 5IT9U 2V34A 2ALYB 4DUTA 1RHJB 1OY6A 4MH8A 4PCQA 1PBAA 4IO9Q 3DLBA 1TTHB 2MKYA 4YY3J 1JKHA 1GTHA 3M9NB 2C2EA 2L3MA 2C2OB 7AT1B 5KAKA 4JI5F 2WSEC 5KFBA 1N5VA 4NLTA 4YHHJ 4OI4A 2E44A 2HS0A 4JUZA 1Y00A 3CMES 1MNEA 3MGJA 2NR0A 2HIQA 3TUIC 1BUXA 2HQDA 4KQZA 3UW1A 4ZKAA 5A8KB 4FF2A 3I0SB 5A2QU 4Y65A 2GJFA 1E6YB 4HI2A 1EX8A 2BKPA 2ZBQA 5T7LB 4H4KA 3PV8A 2GIQA 5K9FA 1RT5B 1HHSA 1OJ4A 2HBYB 5B0GA 1QJHA 2MZ1A 1MW7A 2CQHA 2CXEA 3PX4A 3R1HA 4A8MP 2XYGB 3C2PA 2V4JB 3B4DA 1RT2B 2AW0A 2BACA 2JEFA 3WX4A 2P8IA 1U6ZA 2LECA 3NOGA 2AU0A 2RAQA 1TL5A 1KTQA 5B0DA 4F0KA 1NHUA 1QM9A 3UWTA 3Q83A 3GFYA 2OMOA 1LW0A 1YRXA 1BLUA 2Q79A 3N6NA 2B4OA 4OZLA 4OI1A 2CNOB 4LRFA 5HO4A 4I2PA 2DBBA 3DLKA 3SFGA 4K4ZA 3BREA 2XO6A 1S59A 3I4HX 3C46A 1U45A 5AXMA 3RW7A 1BC6A 2L9WA 2EEYA 1XK8A 2DNNA 1L3SA 2MZTA 3MMCB 1VQPS 4F8RA 1S6QA 3U7JA 3AODA 3BQ2A 1S0NA 1TVRB 1NKCA 1WI6A 2QO3A 2MHNA 1PSDA 1J27A 4BC7A 4QOTA 3R5GA 1ZPVA 1JJHA 2R7TA 3UCGA 4I7FA 2R7SA 1IBMJ 3VAIA 4ILMA 5AE2A 4P71A 3OLBA 3T41A 4DS4A 1YK9A 4MK9A 1M90T 2MJUA 4C8KA 3TJAA 1H2TZ 3A12A 2JEIA 1RTIA 3B54A 3NBPA 4NI2B 3NGTA 2HHWA 5EHHA 3AJDA 1JLAA 2OPSB 2I5JA 1JLCA 1AUDA 3EM1A 4TY8A 2HRUA 4ZN1A 4ZN3A 1TL1B 5KFIA 2JX2A 4DZDA 2OKQA 3LP2A 1JNZB 1RISA 4I2PB 2QYGA 2HMIB 3DLKB 4M5JA 4OYMA 3SQOP 1TAQA 1TKZA 2Y0BB 2CJAA 4HDGA 3KLEA 3PR4A 4ILRA 2KZMA 4DS5A 1HNZJ 2GAHC 2IIHA 5HROB 2K8GA 4N56A 2EFPA 1VBKA 3RRGA 2HHTA 1HW8A 1FCAA 2FGCA 4DV4J 4FF4A 2QT7A 4LBPA 1D9DA 2Y1RI 3QAUA 2V8HA 4OHXA 4EBCA 4M5NA 4NE9C 2H3EB 4O3QA 2OO4A 2IDEA 3OL9A 2MLZA 4I7FB 2W4DA 3EGVA 3MPDA 1NAQA 4ENOA 4DSIA 1UTAA 3BPDA 1UFLA 3FCVA 4J9UE 1Z2LA 2BJEA 4CLZA 4DR6F 1RTIB 4EGLA 3W64A 1HBUA 3I82A 4O4GA 5IFMA 1YJ7A 3MDFA 2GA7A 1FTRA 1W7WA 4JI4F 3I9ZA 4OJGA 1SC1B 1JLCB 4KO0B 1DFDA 3R5AA 4O3PA 3NCPA 2CWKA 2G0CA 4DR1J 3Q8UA 3TZWA 5JXSA 1EZZB 5KFYA 3CJ8A 1HPZA 3TZYA 5LL6d 1C1BA 3VAKA 4UOHA 1Q5YA 3KLEB 1U1KA 4NXMJ 2UUCF 1BQMA 1RU2A 4I56A 1U26A 1Y4ZB 1F9EB 4O4RA 3PG9A 3VQSA 3FNNA 2HHPA 2UUBJ 2IJFA 8RUCA 2J0WA 2CPEA 4GMKA 3KNGA 3P8BB 3Q8RB 5L8RC 4KH0B 2ASLA 1U49A 2DJWA 3K5OA 5F8LA 5GADU 3OR1B 1WUUA 4BC9A 2WBRA 1HWUA 3DI6A 3OT9A 5E0OA 2RH3A 4F04B 1HKAA 3KLGB 1GH8A 2C2NA 4CNYA 3D0HE 2OAUA 3MR7A 1VQ4S 1PYTA 4DOZA 1MN7A 3EXCX 2NZ4A 3H2LA 4DV7F 2Q66A 2F9JA 1I5OB 4WKYA 4URSA 2V8VA 2OPPA 2HHHF 4EFAC 3VGUA 2AV5A 1WSVA 1N54B 5DZ7A 2XS7A 3ILLA 2GJ2A 1ACMB 5KFHA 2NUUG 3I6PA 1FI4A 2DITA 3W9JA 2G4BA 3H4DA 2KFZA 1OSCA 1QAJA 2UUAJ 1ZETA 1RE1B 3R2CJ 2FLOA 2J8SA 2AYEA 2MSTA 4OI3A 2DNMA 2HFUA 1N5QA 3QLHA 2OELA 2MQMA 3ENVA 1Q7LB 2CQCA 3VCDA 2G2ZA 2AD9A 5FLXU 1XMOJ 3J7YU 5HLFA 4IR9A 2MQ8A 4KGZB 3NS7B 4BCAA 2HURA 3QGHA 3IG1B 1XERA 1UAWA 3UD3P 4LBIA 4WIIA 2KXHA 4QCLA 1BD6A 3PYDA 5L38A 4LREA 2KT5A 2DRAA 3RR7A 2B9XA 3UNGC 2DHHA 5T41A 3IRWP 4DV0F 5ETQA 1ITPA 2V0NA 3NG8A 1TU0B 4J37A 2AX1A 2DPIA 5KFDA 3LAMA 3GMGA 2RT3A 2SXLA 3UCUP 3ZZUA 2O3DA 3HHLB 1D3WA 2KM8B 2V50A 1LOUA 2BJ7A 1EP4B 1QAIA 1RADB 3BDPA 2RIJA 2CA9A 1VS3A 4ECQA 5HBMA 2OFHX 3FMBA 3KLHB 4OZ5A 1IKWB 2J76E 1H3DA 1DQ9A 3HKZD 3SCLE 1NB7A 2RDIA 2CPZA 2XY6A 1RA7A 3DOLA 2D3OR 4HR2A 4IG0A 4QIWD 3MEKA 3QFHA 1KS2A 1T9TA 2K7KA 2NSCA 3CC4S 3CVKA 4ANEA 3QLHB 2ZWOA 3SFUA 4ZMMA 1K1QA 2HVZA 3EPIA 1U47A 1G3OA 3BGOP 4KR0B 3OSNA 3OHAA 4IRDA 2ASDA 1ZM2A 2NXNA 4FYYB 5F3ZA 2EFQA 1LK7A 2E5IA 4NA3A 2ZBCA 4FYXB 4XDDA 2FHMA 1VHIA 4DQRA 2WVDA 2UVWA 2CADA 1S0VA 1YLXA 4F25A 4OI6A 3NGSA 2QLXA 1R31A 2WBMA 5CXTA 2J6SA 3SEOA 3V6KA 1HNWF 2R3VA 2AIRB 5EDWA 2NXUA 2XSJA 2Y1IA 3BGUA 2K3KA 3IP0A 5B0BA 2IRUA 3DRPB 3G82A 4C0OC 4R5PA 1VRTA 2CDRB 3CC7S 4ZVRB 2EWHA 1BGXT 5D6GA 3OTEA 2P5VA 2WOMA 5HBMB 4MAKA 1S6PA 5B0FA 2KT3A 4X64F 1NK4A 1NEEA 2J7WA 1DQ8A 3GV5B 2HFOA 4CYUB 5D4OA 1GTEA 3FVYA 5IWAJ 2EKYA 2VFUA 2R7OA 2XMTA 1XJWB 3IS9A 4IH6A 1VQKS 4AT1B 4ZVQB 4NZ7A 4UTGA 4NX9A 1UW9A 3UR3C 2BOPA 5H9FK 2BVZA 1KP6A 5GADI 5K8OA 1S77D 1RHMB 4ZP6A 2J9DA 2QC3A 3TNVA 2VD3A 2PFDA 1FE4A 2DR8A 3MWBA 1X4EA 3GFXA 5EWGA 5F9NA 3CDBA 2WB4A 3CCMS 5KFWA 3M30B 3MR3A 2EBGA 4EBDA 3QGPA 1UL3A 1Q82T 2AYBA 3D68A 4FS2A 3RB6A 3D6TB 3OJSA 4DV5J 1KLMA 3G82B 4R5PB 2R2UA 4I6AA 5LT5A 1VRTB 4FNHA 2A10A 4AFFA 4KPYA 4E98A 2M52A 4PWUA 3R6GB 4A8SA 3POTB 4LRDA 2HRYA 2EXUA 1S6PB 3LWMA 4X4PA 4UY8T 1EQ0A 5C25B 3Q22A 1LQ9A 4GKJJ 4X4UA 1HMVA 2XYPB 4CLTA 2O01C 3W8PA 4KKOB 4USKA 5A8RB 2PFFB 3P96A 1WC5A 1T05B 3TJ9A 3OPKA 2XY5A 4FNIA 2B7CB 1IM4A 2ZH8A 4OLPA 2NUHA 4G3IA 1U6FA 1MROB 2GJIA 2ZKTA 1G4CA 5HMXA 2VONA 4ZPTR 2E9TA 1UP1A 2L9NA 2EPIA 3KFWX
chains in the Genus database with same CATH topology
5K20B 2H4WB 1RHKB 4LSZB 3R7SB 3KJQB 3QNWB 3R5JB 1BMQB 2HBZB 1RWKB 3R6LB 1PYOB 2HBQB 2CNKB 1RHJB 3R7BB 1RE1B 3KJNB 2XZDB 3D6MB 4DCPB 5IC4B 2CDRB 3RJMB 2CNNB 2QLBB 1SC3B 4ZVRB 3D6HB 3P4UB 4DCJB 2CNOB 1RWMB 1RWOB 2C2OB 1RWPB 1RHUB 2QLFB 1SC1B 2H4YB 4ZVUB 2FQQB 3GJTB 3R6GB 1RWWB 4ZVOB 2QL7B 1RHRB 4DCOB 3IBFB 3KJFB 2CNLB 2Y0BB 1QDUB 1RWNB 4ZVSB 2H5JB 2CJYB 3NS7B 1PAUB 2XYPB 3EDRB 2HBRB 1ICEB 2H54B 2H48B 2H51B 3GJSB 2XZTB 4ZVQB 3IBCB 2Y1LB 1RWXB 3GJQB 3R7NB 2DKOB 4JB8B 2HBYB 1QTNB 4ZVPB 5IC6B 1RWVB 2XYHB 2CJXB 3EDQB 1I51B 1RHMB 2QLJB 2QL9B 2H65B 1NMEB 1RHQB 2QL5B 3D6FB 2P2CB 1F9EB 1I3OB 2C1EB 2H5IB 4ZVTB 3SIPB 2C2KB 1SC4B 2C2MB 2XYGB 1IBCB 3P45B 2C2ZB 3GJRB 1GFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K20 B;  2H4W B;  1RHK B;  4LSZ B;  3R7S B;  3KJQ B;  3QNW B;  3R5J B;  1BMQ B;  2HBZ B;  1RWK B;  3R6L B;  1PYO B;  2HBQ B;  2CNK B;  1RHJ B;  3R7B B;  1RE1 B;  3KJN B;  2XZD B;  3D6M B;  4DCP B;  5IC4 B;  2CDR B;  3RJM B;  2CNN B;  2QLB B;  1SC3 B;  4ZVR B;  3D6H B;  3P4U B;  4DCJ B;  2CNO B;  1RWM B;  1RWO B;  2C2O B;  1RWP B;  1RHU B;  2QLF B;  1SC1 B;  2H4Y B;  4ZVU B;  2FQQ B;  3GJT B;  3R6G B;  1RWW B;  4ZVO B;  2QL7 B;  1RHR B;  4DCO B;  3IBF B;  3KJF B;  2CNL B;  2Y0B B;  1QDU B;  1RWN B;  4ZVS B;  2H5J B;  2CJY B;  3NS7 B;  1PAU B;  2XYP B;  3EDR B;  2HBR B;  1ICE B;  2H54 B;  2H48 B;  2H51 B;  3GJS B;  2XZT B;  4ZVQ B;  3IBC B;  2Y1L B;  1RWX B;  3GJQ B;  3R7N B;  2DKO B;  4JB8 B;  2HBY B;  1QTN B;  4ZVP B;  5IC6 B;  1RWV B;  2XYH B;  2CJX B;  3EDQ B;  1I51 B;  1RHM B;  2QLJ B;  2QL9 B;  2H65 B;  1NME B;  1RHQ B;  2QL5 B;  3D6F B;  2P2C B;  1F9E B;  1I3O B;  2C1E B;  2H5I B;  4ZVT B;  3SIP B;  2C2K B;  1SC4 B;  2C2M B;  2XYG B;  1IBC B;  3P45 B;  2C2Z B;  3GJR B;  1GFW B; 
#chains in the Genus database with same CATH topology
 3FFI B;  2OML A;  3CIZ A;  2DGO A;  1NDK A;  4U67 Q;  2W2Q P;  1K0T A;  2K7J A;  2KFN A;  3QMQ A;  4LFB J;  4TYB A;  3J81 j;  2ZHB A;  2J0Q D;  4LQ9 A;  4RW8 A;  1Y5L B;  2FUG 9;  5KOX A;  1V3R A;  3MUV P;  1S48 A;  1UEV A;  1KLM B;  4X2B A;  2JEG A;  2G13 A;  2N3O A;  2Y8Y A;  4DV3 J;  2DIU A;  5DG9 A;  3EZ5 A;  2DHA A;  3MZI A;  1YIJ S;  4MFB B;  4X62 F;  2HEK A;  1HMV B;  4J9M A;  1DHM A;  3PR5 B;  3GIL A;  1L5U A;  1RWV B;  4DG1 A;  1KSP A;  1WJ9 A;  1PJ6 A;  4C8Y A;  4FF1 A;  1RT4 B;  4J5O A;  4RNF A;  3M8Q A;  3DLG B;  2BEF A;  3FC9 A;  2M8H A;  3VGS A;  3H40 A;  5HJX A;  4ZJQ A;  4CH1 A;  3OFE A;  5MAO A;  2C28 A;  3O6Q A;  4NA1 A;  3E8O A;  4IH7 A;  1RHK B;  4ED2 A;  2WCX A;  4OV1 A;  1QSL A;  5IT4 A;  1BMQ B;  4ECV A;  2XMM A;  4YB1 P;  1WI8 A;  2GMH A;  4HH0 A;  2FJW A;  4O3N A;  1XEZ A;  2E1P A;  4WYL A;  2MQO A;  5C24 A;  3CDW A;  4NRT A;  1T9X A;  1FJG J;  2J6T A;  4I67 A;  2BE2 A;  1KTV A;  3AA8 A;  3BV8 A;  4RW8 B;  4FKX A;  3MPU B;  1JLE B;  2LU2 A;  1VIS A;  2J8A A;  2NLW A;  1XIQ A;  2HLU A;  2H5J B;  3GCX P;  3VAJ A;  3I5B A;  1FRM A;  3MED A;  4Q2M A;  4GC7 A;  3PRB A;  4ZPC A;  3DLL Q;  1LWC A;  3HHD A;  3CIM A;  2FLL A;  2LU1 A;  5A6P A;  1RDR A;  5ETT A;  3ISN D;  4MKB A;  2FVP A;  2VOP A;  4CDI A;  2BX6 A;  2ZC4 A;  4FXV A;  1QY7 A;  4JI0 J;  1IQZ A;  5IQ6 A;  1TFW A;  2AGO A;  5E41 A;  2NPF A;  3M8Q B;  3GP9 A;  3K8V A;  4AL5 A;  5CD4 H;  4FXW A;  4E2F B;  3QJJ A;  2R7W A;  3R7B B;  3V6D A;  1R0A B;  4DBQ A;  1GK8 A;  2DR7 A;  4ZPV R;  3R9L A;  1VFJ A;  1MU2 A;  3W5Z A;  3MM5 A;  1RP5 A;  1U1P A;  4BDP A;  5C24 B;  1G2E A;  5BR8 J;  2AJQ A;  1RAH B;  1EB0 A;  1JLB B;  3AAW B;  4W92 B;  1FWK A;  4WFX A;  3DCA A;  3TEG A;  4LUB A;  1FXL A;  3TX0 A;  4B3R F;  3M6W A;  1JQG A;  1UKU A;  1AFI A;  3CCQ S;  1KQG B;  4DR3 F;  4DPU A;  2AYM A;  3R7N B;  2AQ4 A;  2Q1L A;  3PO4 A;  2JZ5 A;  3MED B;  2I38 A;  5J2Q A;  1LWC B;  4X65 F;  4QWE A;  1Q16 B;  2PGC A;  4RBU A;  2K1R A;  1MG7 A;  3TX8 A;  2KJW A;  2YNI A;  3N5B A;  2BQR A;  4HAC A;  1JXV A;  5LOQ A;  4XO0 A;  4RR5 A;  4B3S F;  1FNM A;  1SI9 A;  1FKO B;  3KUH A;  2VOO A;  4KHM A;  4ZVF A;  3G6Y A;  3KXD A;  3KOA A;  3MMA B;  3BSC A;  3DHX A;  4ZDN A;  1M5O C;  3DYA B;  4KTQ A;  2IYG A;  4USW A;  2MQN A;  3JQJ A;  4Y34 A;  4ED0 A;  2BJ8 A;  2VFV A;  5KT5 A;  3TQ1 A;  4IG3 A;  3TA2 A;  3KK2 A;  4FP9 A;  2JNJ A;  1X4D A;  5KFK A;  1N0U A;  3H5X A;  2JFK A;  1LEO A;  4C3M A;  4L76 A;  1RAA B;  1H98 A;  2ZFH A;  2YWH A;  4IQX A;  1IBL J;  1FWP A;  2GQQ A;  1V9O A;  1R0C B;  1ROF A;  1OPI A;  3BO3 A;  3DHW C;  1I51 B;  2H65 B;  3NOC A;  2QMX A;  3BDE A;  5J2Q B;  5KT4 A;  1HR0 J;  3KHH A;  5IT9 Y;  3UD5 A;  2B8Q A;  1TMJ A;  2VBW A;  3LTO A;  5JVH Q;  3CO0 P;  4AQY J;  2YY3 A;  4TLR A;  3H20 A;  5A8W B;  3N0V A;  2JRS A;  3H98 A;  5KG4 A;  3GG0 A;  1UWB B;  4UOF A;  3ADA C;  3DLJ A;  5A2Q Y;  3NCQ A;  1TKD A;  2KU7 A;  1WC1 A;  4OHZ A;  2Z57 B;  3CDE A;  1C0U A;  2HVD A;  4QR1 A;  5HMW A;  3C6U B;  5D78 A;  1BHN A;  4JI3 J;  1ICE B;  1SXL A;  1FKP A;  3MCM A;  4DMZ A;  3GV7 B;  3DRY A;  3QBC A;  5IV3 A;  5EUH A;  1R8A A;  1H2U X;  1F9H A;  4YR3 A;  4JI6 F;  1SCJ B;  3EZU A;  1B70 B;  4MT1 A;  4WK1 A;  3LAL A;  1T3O A;  3M4X A;  4KFB A;  4CLK A;  3OXL A;  2KL8 A;  1IBC B;  2L48 A;  1ARO P;  3J7Z T;  1KVJ A;  2VG6 A;  4CTA B;  3FZB A;  3KG0 A;  5KFR A;  1HNX J;  3MEE B;  3I0R A;  1YJN S;  2GZO A;  1R8B A;  2GW8 A;  4J9P A;  5J2P B;  2D9P A;  2YNF A;  1SKW A;  1N0V C;  4A8X A;  3D67 A;  4BHQ A;  5ITH A;  3SCJ E;  2RHS B;  3OL6 A;  1IBK F;  4IYQ A;  1X7V A;  4CO1 A;  2QLF B;  3LAK A;  1LXN A;  4JV2 A;  2M0G B;  1NK5 A;  1N33 F;  3E2E A;  3P5B P;  3TVY A;  3A1Y G;  3EVO A;  1AFJ A;  2CNL B;  4ZOS A;  4RBV A;  3TEH B;  1RLD A;  2A3J A;  4J9R A;  3J80 Y;  1L3T A;  1HI8 A;  2ZHA A;  2R8H A;  4KJI A;  4X4T A;  2M8D B;  1REG X;  2C42 A;  1Y11 A;  1C2P A;  3NGU A;  2KFY A;  1U4B A;  5LJ5 Y;  4B17 A;  4M5G A;  4CO3 A;  3KMS A;  5H9F J;  1CS4 B;  1U0H A;  3KLI A;  4W98 A;  2G0J A;  1TZ0 A;  2UXC J;  4OI2 A;  4C48 A;  2XQC A;  2Z4P A;  1AA1 B;  2XMW A;  1CBK A;  2QX0 A;  4Q5V A;  1NLK L;  2ZWP A;  1K9M T;  4BS2 A;  5DLF A;  2ASY A;  4A47 A;  3FEX B;  4KFB B;  3MD3 A;  4FYD A;  3KMQ A;  1YDL A;  4K5S A;  1EKR A;  9ATC B;  1RAO A;  4X4O A;  3CMQ A;  4K4S A;  2OSR A;  5DO2 A;  1YRT A;  1N6Q B;  1H0H B;  2A18 A;  5AT1 B;  4QW8 A;  4NLO A;  3OXG A;  2IMO A;  4F7V A;  1C0T A;  1G1X A;  5C5J A;  2NYI A;  1V3S A;  1PCA A;  3ZTO A;  5E7O B;  2IA6 A;  4WE1 B;  2PE8 A;  2HFV A;  2CZ4 A;  1NU4 A;  3KUG A;  4CH0 S;  3M05 A;  3HO1 A;  4YOE A;  3PRV A;  3QO9 A;  2YKM B;  5KFL A;  3D1O A;  4MKY A;  3OVB A;  2GCF A;  2W9C A;  1ZAW A;  3FSY A;  2RRN A;  2AYG A;  1N4L A;  4F0H A;  3PCO B;  3DKD A;  3GSD A;  1NSP A;  2Z2Y B;  3SSQ A;  2B5J A;  5RUB A;  3IFE A;  1SJ1 A;  1H38 A;  1FRI A;  2XGQ A;  1KON A;  1Q8B A;  5HVG A;  2ZNZ A;  3QT5 A;  4DR7 J;  5GMD A;  4K0K J;  2EFN A;  2HG4 A;  2IPO B;  4DFJ A;  1VQY A;  1P6T A;  1WDT A;  1HI1 A;  4B02 A;  3BSO A;  1S9E A;  1SV5 B;  5KT3 A;  3PTW A;  5HMZ A;  4ED1 A;  4I2Q B;  4A46 A;  2WON A;  4M94 A;  1YGY A;  3UVJ A;  3CW2 C;  2HW3 A;  4ICL B;  2B7B B;  2Y9H A;  2MLY A;  2O5D A;  2POK A;  4KBI A;  3OUY B;  4DPY A;  1BWV A;  3VTI A;  3M7V A;  3CCS S;  2QRR A;  3AT1 B;  1LWE A;  1YTY A;  2HZC A;  2Y1L B;  4HVZ A;  5BXI A;  4LF1 A;  4ITS A;  4YY3 F;  5DJB A;  1X4C A;  3IM9 A;  1GQE A;  2W9C B;  4OYP A;  4WXO A;  1SL1 A;  4IRK A;  4NZ0 A;  2OTJ S;  1AUS L;  3RUB L;  2HND A;  2B5J B;  4YHH F;  3CDA A;  3BSA A;  4F4W A;  4AL6 A;  1RQ0 A;  4HH1 A;  3WIU A;  4Q44 A;  3SYZ A;  4EYI B;  4FVC A;  5IV4 A;  3ELH A;  3L7P A;  2E66 A;  1IWG A;  1Q8I A;  2NS1 B;  5LMN J;  1FHT A;  5K14 A;  2U2F A;  2NSB A;  3A13 A;  4Q45 A;  1TKT B;  5GAE U;  2BE7 D;  2QJ3 A;  3K7R A;  1F5B A;  3MAQ A;  2VDI A;  4A8K A;  1TK5 A;  1Y5I B;  4ZVO B;  4AD6 A;  1YSJ A;  3HFK A;  2GGP A;  3MCO A;  4OZ3 A;  2WON B;  1XC9 A;  2W1B A;  4QWA A;  3TYT A;  3UVJ B;  5M2U A;  2MDA A;  1KVI A;  1ZTT A;  2ZJQ Q;  4NYO A;  5HSP A;  1L3V A;  3DGP A;  4Y0F A;  1UVM A;  3TI0 A;  4KYZ A;  1V5I B;  3NNC A;  3CC2 S;  1HFE L;  1N32 J;  3BZQ A;  3VGV A;  1FK9 A;  4A4J A;  4F2R A;  1VIX A;  3L9Z A;  3THV A;  3MUR P;  3MXH P;  2V9K A;  5KFO A;  5GAG U;  3HSG A;  1NSQ A;  5IQQ A;  5FDL A;  4KT0 C;  3TP2 A;  2VL1 A;  4QWD A;  2MKH A;  3WC0 A;  1KBR A;  1BQN A;  4NL5 A;  4D3G A;  4G1Q B;  2VC1 A;  2BJ3 A;  1YBA A;  2C3U A;  2L08 A;  4CI0 B;  3Q8V A;  1SBR A;  3KKF A;  4H4O A;  2AJ1 A;  2V4Q A;  1HQ2 A;  3R2D J;  1UPP A;  3K59 A;  1HBO A;  2FLN A;  4UY8 5;  3UR0 A;  1ELO A;  5FLX Y;  2OEM A;  2BRL A;  3TO8 A;  3M2U A;  4WP8 A;  2IC3 A;  2D7S A;  1GMU A;  2KO1 A;  4USM A;  3A8K A;  4RW9 A;  1IBM F;  5G0R A;  2KVI A;  4BLG A;  4PWD B;  2GGP B;  2BRK A;  4OFZ A;  4YUD A;  1SKU B;  3GYX B;  3I5C A;  3DLE A;  1CJT B;  1WG4 A;  3LOU A;  4ZCM A;  5K8P A;  3KHL A;  2ZBR A;  3DGP B;  2GHW A;  3IC1 A;  3V81 A;  1FRH A;  1HD0 A;  1SUQ A;  1V5V A;  3GWC A;  2C1E B;  4KHP J;  1HBN B;  3AQP A;  4NRU A;  1VJW A;  3TQE A;  3CCW A;  3CTR A;  3LGM A;  4USJ C;  5L39 A;  3TAQ A;  4XAK A;  5KFS A;  2C3O A;  4CLU A;  3W7B A;  2Y0S D;  1FRJ A;  2ROE A;  4DSE A;  3EGZ A;  2OPR B;  2LDY A;  2IHR 1;  2NXC A;  1JIH A;  9RUB A;  2CQB A;  2XLI A;  4RX6 A;  4MYT A;  1SC3 B;  1T02 A;  5C42 A;  1NRK A;  4PXE A;  3P4U B;  1WKK A;  2KTQ A;  1VQM S;  4C8M A;  2I9S A;  3VGT A;  3P6Y C;  1P9Y A;  4H4O B;  2UP1 A;  4DV4 F;  2W7P A;  2IBK A;  3N79 A;  4WIQ A;  2BDP A;  5HAT A;  3TUP A;  1RXO B;  1SJ3 P;  2DEJ A;  2IC3 B;  2CVE A;  3GE9 A;  2M3D A;  4ZCL A;  4DN0 A;  1N48 A;  3ZNJ 1;  1MLA A;  2KYZ A;  2I1R A;  1F2G A;  2O66 A;  2B6A A;  4ZJO A;  4EO8 A;  1SIW B;  3MPV A;  1SJQ A;  4DV1 J;  4B3O A;  3JS9 A;  2W7A A;  2R8J A;  1J5E J;  3NGK A;  4QW9 A;  3TZZ A;  3M9M B;  2QMU B;  2MQQ A;  3MAH A;  1QD1 A;  1VRU A;  3BKU A;  2FB0 A;  1K1S A;  4K2X A;  1FD8 A;  1YQH A;  4PAB A;  2AT1 B;  4DR1 F;  3MI7 X;  2BM1 A;  2AEF A;  4FYV B;  2ZEJ A;  4JYA J;  4DX8 H;  3C14 B;  1RWM B;  4NXM F;  1CJV B;  2B56 A;  1RAE B;  1Y0H A;  5I3U A;  4NMX A;  2XCA A;  1T9V A;  1U6B A;  1RWW B;  2PEB A;  2UZA A;  1SQG A;  4CO4 A;  3D9B A;  4CWB A;  5HP1 A;  4X4V A;  4QR0 A;  2IM0 A;  2QGF B;  2DT9 A;  1Q79 A;  1T03 A;  3KHR A;  3IR6 B;  2UUB F;  4B9N A;  1FE0 A;  2ZJP Q;  1VHF A;  3THT A;  2PSZ A;  3IN5 A;  3JTP A;  2D3Z A;  1UET A;  1N36 J;  2ERR A;  4DPT A;  1WHX A;  1ULR A;  1GAO A;  2B6A B;  4UZC A;  3R5B A;  5CD4 A;  4R8U A;  1YJ9 S;  1C1C A;  5GAE I;  1SJ4 P;  5E3C A;  3DXB A;  4MTP A;  4Z37 A;  1WOS A;  1CQN A;  5IM0 A;  1RCO B;  1IJE B;  4DUY J;  2ZHO A;  3ZTR A;  2VKZ G;  1KLN A;  1S6U A;  4ZA1 A;  4ED4 A;  4WZM A;  2J5A A;  1TR0 A;  4OHV A;  1BQX A;  2DIV A;  2IVM A;  1TK8 A;  1MN9 A;  5KFF A;  4OQJ A;  1LWF B;  3DU5 A;  1UVJ A;  4LMZ A;  3MEC B;  5EGY A;  1HWL A;  3FQL A;  3TUJ C;  2CKW A;  4LFC J;  5I3P A;  1RHR B;  3K17 A;  3V4M A;  2AKW B;  1JK9 B;  2AGQ A;  4MIB A;  3V5R A;  1KQS R;  4U7U K;  3ET6 A;  4PG8 A;  5HP1 B;  1FEE A;  3IAM 9;  3RZA A;  3GIM A;  1Y9O A;  4PAA A;  3E3X A;  2H51 B;  3NAH A;  2CJK A;  3KJV B;  5E3A A;  2JOQ A;  4GVB A;  3GYG A;  2UUA F;  1SQE A;  1QLN A;  3MM7 A;  2DNQ A;  1FT8 A;  3MM9 B;  3HP6 A;  3SIP B;  2LQ9 A;  2DY1 A;  2HQG A;  2I8E A;  4R8U B;  4KB7 A;  1RTZ A;  1QE1 A;  1C1C B;  2G0I A;  3R5J B;  1ZM3 A;  1XMO F;  5SZT A;  4P7T A;  3BR9 A;  3ITH A;  3HKW A;  3BEG B;  1S1T A;  2VPX B;  4UUW A;  2XMA A;  4DPO A;  3T5K A;  2KXF A;  3GJT B;  2DNO A;  4PG6 A;  1IN0 A;  5B0A A;  4WWS A;  1CPZ A;  2A2D A;  4O3O A;  2HFN A;  5D8H B;  5ETV A;  3QWP A;  3QRR A;  2IRX A;  2KYX A;  2BJ9 A;  3ET6 B;  1UJ6 A;  2KXN B;  3RR8 A;  4MMO A;  3S8S A;  4NAS A;  4IRC A;  1HNI A;  4RU2 A;  2VIC A;  3HDS A;  1Q8L A;  3TAR A;  3AD7 C;  3RBD A;  3DOM B;  1BE4 A;  4TVA B;  2YNG A;  5AXN A;  1YWX A;  3V4I B;  1DQA A;  1S0M A;  1CJK A;  1QTM A;  5EWE A;  4B3M J;  4CO2 A;  4K5R A;  2CPX A;  4IDK B;  3BBC A;  3PW4 A;  1HD1 A;  3IRX A;  4NYZ A;  4LF8 J;  2K06 A;  3T19 A;  2VQE J;  3TAM B;  4TLQ A;  1VK8 A;  1C4C A;  2Z0G A;  3I5A A;  3ITH B;  1IWA A;  2HS4 A;  3GIJ A;  1S1T B;  1CVJ A;  3Q2T C;  3HHL C;  4QYR A;  2F4V J;  1FJC A;  2MLX A;  2KM8 C;  1PIE A;  5LXY A;  1F1B B;  3ENQ A;  3GU0 A;  3T5J A;  1VQ5 S;  2EI5 A;  2DRD A;  3AXM A;  2FHJ D;  2FZG B;  4LFA J;  4M5D A;  5H9E J;  2OTL S;  4DF8 A;  1EKS A;  4DQQ A;  3MMB A;  4YS2 A;  2V67 A;  1VQ8 S;  3V6J A;  2RKI B;  1RSC A;  1N5S A;  5M2R A;  3LA0 A;  1ZS6 A;  4KE5 A;  3W63 A;  3RBX A;  4OJ3 A;  5KFX A;  4KSE B;  1KQK A;  1S9G B;  2LKZ A;  3QNW B;  2KDO A;  5DG8 A;  3BBF A;  5IWA F;  5I4M A;  3N6L A;  5HK4 A;  2FD2 A;  2RD5 C;  3ZO7 A;  3IGV A;  2ZH5 A;  4PG5 A;  3HSD A;  2V5H G;  5J2M B;  4X4R A;  2M7S A;  3G8S A;  1IXK A;  1NDL A;  4A48 A;  1T7P A;  4NYP A;  2CQ0 A;  2G2O A;  3LP1 B;  3GR0 A;  3EIC A;  2FJA B;  3NNH A;  3NS6 A;  1YX2 A;  1X4F A;  1ZAV A;  3S1T A;  3ETO A;  4AXI A;  1X9M A;  1FKA F;  1NK7 A;  4V19 J;  3DFE A;  3TW0 A;  2RJZ A;  1RT1 B;  2B9E A;  4M5D B;  2R2T A;  2BKO A;  3A8I A;  2BR0 A;  2ZC3 A;  2QL5 B;  2E5J A;  4K4Y A;  4DV5 F;  1QVG R;  5KFU A;  1RTD B;  1ZYQ A;  1L3U A;  4DL3 A;  3FCW A;  2CPH A;  1CJU A;  1G6B A;  5K20 B;  1S1V B;  4IOA Q;  2B9W A;  3CD0 A;  5D77 A;  5F0U A;  4Y2I A;  2VPW B;  1RAB B;  4DCP B;  4GKJ F;  1M1K T;  3RU0 A;  2QLW A;  2HHS A;  2LFV A;  3G71 S;  4PXB A;  1H73 A;  1RA6 A;  3HT0 A;  2UV8 G;  1IM6 A;  1WF0 A;  3N28 A;  3OL7 A;  1T3N A;  2CG8 A;  1TAU A;  2YH0 A;  1OY9 A;  4LRA A;  3PZP A;  3A8E A;  3OR2 B;  2V4R A;  1QSS A;  1IKV B;  2P6T A;  3M9O B;  2W25 A;  3HD1 A;  2BOA A;  3M8Z A;  2HK3 A;  2RF2 A;  1IR1 A;  5DDQ C;  2M4M A;  3M32 A;  2DY9 A;  3DRS B;  2XMK A;  5CYM B;  5GMK a;  2B51 A;  4Y2C A;  1DAR A;  3CJK B;  3X1L B;  3O8W A;  2DNH A;  2EC0 A;  1S10 A;  1G7C B;  1YIT S;  4WFN Q;  1JLF B;  1KHV A;  4I68 A;  3ZZO A;  2VIH A;  1JB0 C;  1IUJ A;  3A8J A;  3R5C A;  1HNV B;  1WEL A;  1HQE B;  2E9R X;  3EMT A;  4YEA A;  1R8P A;  5F8N A;  3TZX A;  3CJ2 A;  3ZTP A;  1E6Y A;  3K2Y A;  3CJ3 A;  1XBW A;  3IM8 A;  1K0V A;  4OIX A;  5T7L A;  2HHX A;  2HZA A;  4X66 J;  2MGZ B;  3CD5 A;  4NWB A;  1RT5 A;  4DDF A;  2XBP A;  2KRB A;  1NDC A;  1WKJ A;  1X9W A;  1KRP A;  4P73 A;  3ULH A;  2ZVS A;  2P9G A;  2H48 B;  1P1T A;  3TR5 A;  2RF2 B;  4K59 A;  1NKB A;  3OW2 R;  3K8W A;  5EWF A;  3OQ2 A;  1VCT A;  1IVZ A;  1SIZ A;  3CJR A;  3BGR B;  4Q0B B;  2RDJ A;  1LFP A;  3HXM A;  4WFZ A;  1FJG F;  3KNA A;  2HAF A;  4HLB A;  1ZZF A;  2KHC A;  5D3G A;  4C97 A;  2OD4 A;  4QBU A;  3CSK A;  1WAC A;  4DUZ F;  3N01 A;  4PRF A;  4UUX A;  2IVF B;  3GR1 A;  2IJR A;  3MMC A;  4OX9 J;  2ZVI A;  1Q8K A;  2FJB B;  4B9V A;  2XNQ A;  4HTJ A;  4ZPB A;  2WSC C;  3DRR A;  2FHJ A;  2QA4 G;  3K89 A;  1TVR A;  2YKN B;  4CH7 A;  3CO9 A;  4USU A;  3NWG A;  5L1K A;  2CZ9 A;  4JV1 A;  2IAJ A;  5HVH A;  4JV5 J;  4ZP8 A;  3O1L A;  3AQO A;  4JI0 F;  4LR8 A;  3ZC4 A;  3CGI A;  2MYF A;  3UDV A;  2ZE2 B;  2YX4 A;  5E2Q A;  4AND A;  4A8F A;  4NI2 A;  3GZ7 A;  3FBB A;  3D54 A;  3HZG A;  4CLY A;  3LPY A;  4RW7 A;  2ZH7 A;  1RT3 B;  2OPS A;  1U1R A;  3JYT A;  3HVW A;  3FCH A;  3CJ4 A;  3RB4 A;  2W9B B;  3HHL D;  1TL1 A;  4PPD A;  3IR5 B;  1WC0 A;  4IOC Q;  2BW2 A;  2XMU A;  1UMJ A;  2ACY A;  5BR8 F;  2QTW A;  3NXZ A;  4ZS6 A;  2QSW A;  2YKP A;  4NCA A;  2HMI A;  5CYJ A;  5D3G B;  3D0G E;  5D4L A;  2KKH A;  2XMV A;  5HRO A;  2FVC A;  2CWX A;  2CJQ A;  4DXL A;  2P9E A;  2R2S A;  3FBC A;  1JLG A;  1NPR A;  1UVL A;  4ELU A;  2V8D A;  2JWN A;  2M70 A;  3N4W A;  2OIH A;  3J80 U;  3DRR B;  1ZA2 B;  3KWM A;  2CVI A;  2IM2 A;  4CLP A;  1VGY A;  4L73 A;  3BGL A;  2IAJ B;  2MSS A;  1PO6 A;  2ZH1 A;  2DXF A;  4EK2 A;  5CAB A;  2VBZ A;  5ETK A;  4M5I A;  2B0G A;  2IA0 A;  1T94 A;  3F44 A;  1DJ0 A;  3IAS 9;  1HI0 P;  3MOZ A;  4RW7 B;  1KKH A;  3IO1 A;  4V1A k;  1YRU A;  1PJ7 A;  2BYC A;  1VBX A;  4QIV A;  3JYT B;  1SKR A;  2DGU A;  4KO0 A;  4K2J A;  3M8P B;  3U1M A;  2K3I A;  5HJY A;  5HI7 A;  2FPH X;  1KFS A;  4OYB A;  1OS5 A;  3R6L B;  4U9R A;  1KVK A;  3ZZ0 A;  3KK1 A;  2C3M A;  3FZ2 A;  3ZZT A;  1K8A T;  4RW4 A;  1IBL F;  5BYR A;  1RBA A;  3AOC A;  4IFV B;  2GO8 A;  1VYA A;  2W4C A;  2Y8W A;  4H4M A;  2CQI A;  3QYY A;  4DFP A;  1D8Y A;  1JLG B;  1CUL B;  1HLW A;  3HHK A;  4CT9 A;  2GV1 A;  3T6J A;  2Z8Q A;  1ZAX A;  3D28 A;  1X9S A;  1Y10 A;  2LEA A;  4QU6 A;  3GV8 B;  5I42 B;  1HR0 F;  2ADC A;  1TV6 B;  1YJW S;  5F8G A;  2V68 A;  1WHY A;  4UQG A;  1R27 B;  1H7X A;  3OR1 A;  3J7A N;  4ZJL A;  4PYD A;  2BZ2 A;  4A8W A;  1NK9 A;  2HHV A;  2D3U A;  2H5I B;  2R8G A;  2WAQ D;  3ILJ A;  3KLG A;  1UW4 A;  2VG7 B;  3PW5 A;  5F8M A;  3MR6 A;  3LP0 A;  3VZI A;  2PI5 A;  4YN3 B;  4ERD A;  3HT3 A;  2RIL A;  1R43 A;  2ZBP A;  3H59 A;  3EE3 A;  4FPR A;  3T1H J;  2HLT A;  4CRJ A;  3KLF B;  4JI3 F;  1RJJ A;  4ZCI A;  1IQT A;  4KPC A;  4C9D A;  4F3M A;  5DDP C;  3GG1 A;  3KK1 B;  4X62 J;  4UF4 A;  2H1Y A;  4KAI A;  3PFE A;  1UA0 A;  3KHG A;  2IBO A;  4RW4 B;  1WC4 A;  4F67 A;  1NPP A;  3WBZ A;  4ES1 A;  5KFG A;  2CQP A;  3WQP A;  3D5M A;  2VUG A;  1ZA1 B;  3TOQ A;  4H4M B;  3HF5 A;  3D1H A;  2RQM A;  2GVD B;  2DR6 A;  1JLQ B;  5MLC V;  1KWM A;  4JV0 A;  4ALZ A;  4ZP9 A;  1DTT B;  1HNX F;  3QIP B;  3PO5 A;  1RHQ B;  3BN4 A;  3PVX A;  4AUK A;  3OTO J;  1JXL A;  4NXN F;  2V2Q A;  4YB6 A;  4IKA A;  2E9Z A;  2QYC A;  2YQ1 A;  3ZFV A;  2HNZ A;  4P2S A;  1S1U B;  1RAI B;  2WVE A;  5CAA A;  2MKS A;  3CCV S;  1MML A;  3Q23 A;  4EEY A;  5J1E A;  1GNK A;  1Q81 T;  3LP0 B;  4PYA A;  2D69 A;  4ZVH A;  3IG1 A;  2BJD A;  1NUE A;  4Q7A A;  2XSF A;  1RLC L;  1SL2 A;  1HHQ A;  4ZVU B;  4ECU A;  3M1V B;  4KH1 B;  2I2Y A;  3Q8P B;  4ECX A;  3AD9 C;  2J7U A;  3T1Y J;  2UXC F;  5KFV A;  3I4P A;  2ZH4 A;  4ATN A;  5F3T A;  4LSN A;  2XEX A;  1RWN B;  2OLW A;  4TNO A;  3CNQ P;  2L9D A;  1SC6 A;  1PAU B;  5A0Y A;  1WOR A;  3HHL A;  3RB0 A;  2PII A;  4B9S A;  1EP4 A;  2RB7 A;  1PC5 A;  3KG1 A;  2CIM A;  3SCK E;  1B0T A;  3MR2 A;  2VPZ B;  5IS2 A;  1FFG B;  2B9Y A;  5KTQ A;  3KLH A;  1IKW A;  4P2X A;  2BKN A;  2FLP A;  2BQU A;  4AYB D;  2YKQ A;  2ZH3 A;  3HD2 A;  5IT0 A;  3RAQ A;  4RKU C;  2C2Z B;  1HWJ A;  1F9F A;  5HN0 A;  2ZOG A;  5IXU A;  3HJF A;  2NQP A;  4QIE A;  2DHG A;  1D1U A;  2HNZ B;  2W8K A;  1OO0 B;  2XWX A;  4A8Q A;  2G1H A;  3RJM B;  4LF6 J;  1U7L A;  2CG4 A;  2CFX A;  2J0X A;  2EW9 A;  5J1E B;  3DOK A;  2VKR A;  1SQF A;  4MK7 A;  4J7C A;  3I96 A;  1RT6 B;  3OBI A;  1U1Q A;  4WTO B;  4X65 J;  3CCJ S;  2JLF A;  3PFO A;  1ZTW A;  3Q2S C;  3JAM Y;  4LSN B;  1F5A A;  5A0Y B;  2BAB A;  1HIY A;  1MMN A;  5EN1 A;  4DR7 F;  1B7Y B;  3DRP A;  4K0K F;  1KC8 T;  1NJZ A;  2N82 B;  2ZD1 B;  2VG5 A;  1F3F A;  3HM9 A;  1R6V A;  2F65 A;  1RK8 A;  3R27 A;  4XDC A;  2RU3 A;  4CYU A;  3HFV A;  4OYA A;  3PJ9 A;  3ISN C;  1FVS A;  5KT7 A;  4X84 A;  5KFN A;  2UXD F;  3K0J A;  1YKW A;  2CQ1 A;  5IC4 B;  3FQK A;  4ECS A;  1K47 A;  3IR7 B;  4ZIT A;  2P9C A;  3BYR A;  3BPS P;  5DG7 A;  2V9W A;  5AJ3 J;  1RWO B;  4RL1 A;  4NPO A;  1RTJ A;  3L4B C;  1RTH A;  3OV7 A;  1ZOT A;  1M5K C;  2B43 A;  3DOK B;  3O3L A;  4X4S A;  1F3V A;  4QR2 A;  3C16 B;  3PJW A;  3EZO A;  3H25 A;  5CA5 A;  4DWI A;  4X4N A;  1KR4 A;  2HBR B;  4O23 A;  3M30 A;  2LLZ A;  4EYH B;  2VF3 A;  2EG2 A;  1AZS A;  4RUC A;  1X4B A;  1FEH A;  2VJU A;  1RU1 A;  2A6M A;  1WHW A;  4EUV A;  3DM2 A;  1QUV A;  4K8R A;  4NML A;  3I32 A;  3H5S A;  3ENW A;  4K4X A;  2JSX A;  1PGZ A;  2PN6 A;  2DRB A;  2VG5 B;  3POT A;  1N52 B;  1Q4R A;  3MAA B;  2V94 A;  1RWK B;  3GB0 A;  5C25 A;  3BS9 A;  2J0S D;  5D0G A;  5HAN A;  4GKK J;  2R4F A;  2HRT A;  4KKO A;  1A0O B;  3NGR A;  4MIA A;  4RLE A;  5A8R A;  1TL4 A;  5LMU J;  1N32 F;  1OMS A;  3E01 A;  1T05 A;  3OTB A;  1FX4 A;  1URR A;  3PXG a;  5HAO A;  1I6J A;  1RTJ B;  2Q6C A;  1XNR J;  4EWT A;  2MY8 A;  1RTH B;  1MRO A;  2UU9 J;  5KG7 A;  2M9K A;  5F8J A;  2VHG A;  3FFI A;  4OX7 A;  2ZH2 A;  3NWR A;  3GJQ B;  4C0H A;  5DDO C;  1DZ5 A;  3OD2 A;  4ZPA A;  4C4W A;  3TVK A;  2BE9 B;  2VBX A;  3BBB A;  1XNQ J;  1VOM A;  4J9V A;  1AZS B;  1H6K X;  2HHU A;  3NP5 A;  3VAF A;  5DLG A;  3DM2 B;  3HX9 A;  4ED3 A;  1HA1 A;  3T6B A;  3G8Q A;  1TQL A;  1URN A;  3ZZP A;  2WVB A;  4B3T F;  1JMT A;  1PYO B;  4QJV A;  4QPT A;  2UVU A;  3ENA A;  2UXB J;  1RT7 B;  4LRC A;  4TXS A;  1N5Y B;  2MZS A;  2XC9 A;  4MFB A;  2KRR A;  1FXR A;  1DUR A;  2YWK A;  2EK6 A;  4S0M A;  3HFZ B;  3CJS A;  5IZH A;  2KH9 A;  2B3T B;  5FD1 A;  3CJQ A;  4ETZ A;  2ZIT A;  1RT4 A;  3RBZ A;  1T95 A;  2CRL A;  3DU6 A;  3E01 B;  2QA4 S;  5J1P A;  1FX2 A;  4KHP F;  3DLG A;  2KI2 A;  2FDN A;  2MZR A;  3CCZ A;  3LAN A;  3CCT A;  5KFZ A;  4IOB A;  2C3P A;  5B0C A;  2CPD A;  1S72 S;  2GIF A;  2AZ3 A;  1NCL A;  1UEK A;  3FMW A;  1SL0 A;  2YNH A;  3J81 Y;  4P6Q A;  4EI2 A;  3ONQ A;  2MZJ A;  5BJR A;  1CSJ A;  2DEI A;  1TEL A;  2P2C B;  2OGU A;  4XTT A;  1DRZ A;  3DN9 A;  4B9L A;  3GSI A;  4B08 A;  4DX5 A;  2BBE A;  1VR6 A;  4Y00 A;  2FY8 A;  3OVS A;  1VI7 A;  2F1F A;  3KJQ B;  3W2V B;  4B9U A;  1JLE A;  2DH8 A;  4Q8E A;  2HFZ A;  3EVW A;  2R2R A;  3T1A A;  2E1R A;  4WKR A;  2LXU A;  3H0P A;  4M5K A;  1S1W B;  1ZM4 A;  2XUL A;  4Y2K A;  4W90 B;  1LK5 A;  4UW2 A;  2CQG A;  3LH2 S;  4EMD A;  4O44 B;  4WYW A;  3C15 A;  1YJV A;  2ZBI A;  5LM7 E;  3TJ8 A;  4DV1 F;  2B4P A;  3H7H B;  1DAX A;  2RE1 A;  3PHT A;  4I4B A;  1J5E F;  4LVN P;  1VDH A;  3VV2 B;  1GT8 A;  4LSL B;  2RQC A;  3GLJ A;  1X8D A;  1OSD A;  4P75 A;  4U6P A;  4FDF A;  4IO1 A;  1R0A A;  3VAG A;  3CB4 A;  3IA0 A;  4JYA F;  2YNH B;  3HVT A;  3B6B A;  3ZNU A;  4ECY A;  3EXY A;  2VH7 A;  3QWU A;  1B99 A;  4P10 A;  3G87 A;  4CIO A;  1IR0 A;  2ZZT A;  2DGT A;  4MYU A;  1JLB A;  2CNK B;  2CPF A;  1D9A A;  4MKA A;  2VOD A;  2XZD B;  4BWJ A;  1MWZ A;  1W25 A;  2J9C A;  2PO4 A;  4ID5 B;  1ZM9 A;  4URG A;  2U1A A;  4I64 A;  4DSL A;  3RG6 A;  3CF5 Q;  1N36 F;  3M2R B;  4LF7 J;  4ELV A;  2PD1 A;  1FRL A;  5FJ4 A;  4PEO A;  1JX4 A;  1WHV A;  3GTY X;  3D66 A;  3MFH A;  1KOH A;  4YB7 A;  2RUG A;  4I6W A;  3C15 B;  1IKX B;  2PMZ D;  3AOB A;  4DLE A;  3SXL A;  3ETM A;  1FKO A;  5E3R A;  4DUY F;  1R3N A;  4F50 A;  4NLQ A;  3MMA A;  4ZVP B;  3BH6 B;  4YQW A;  3KK3 A;  3IXQ A;  4DL7 A;  1JNR B;  4G65 A;  4B9M A;  4TU8 A;  3TA1 A;  5HMY A;  3DYA A;  3ZTQ A;  3QAT A;  3HVT B;  4KV8 B;  3GJR B;  4DR4 J;  2HQF A;  4LFC F;  2W2M P;  1OQ6 A;  3EYZ A;  2GQ2 A;  1UVI A;  4M8L A;  2A6O A;  5J1N A;  4ZHR A;  1SH2 A;  2KG0 A;  1R89 A;  6AT1 B;  1N34 J;  4DPW A;  3OFG A;  5M2P A;  4OYI A;  3CPW R;  2MKJ A;  2YWW A;  3UDL A;  1NM2 A;  3A3O B;  1T9W A;  3K5M A;  4OYO A;  3P49 B;  4F02 A;  1SB6 A;  3DLH A;  1Y5N B;  4RW6 A;  2IJN A;  3KTQ A;  3Q8Y A;  1N5T A;  3CJ5 A;  1EJ7 L;  3PW0 A;  1KEK A;  1X4A A;  4M5H A;  4Z7C A;  1U1N A;  1X5O A;  1JKH B;  3UO0 A;  4P9S A;  4HL9 A;  4HTI A;  3LO3 A;  3EWG A;  2CYY A;  3OFF A;  4F36 A;  3PAC A;  2W01 A;  1RYS A;  4CZC A;  2DR9 A;  3GQC A;  3QGG A;  2DXD A;  2EK1 A;  2R9L A;  5A8W A;  2CAJ A;  2OHD A;  1HBM A;  1SC4 B;  3HPO A;  3HHN B;  3KK3 B;  3Q0A A;  3O5T B;  2LQB A;  5AXL A;  1HW9 A;  2VJV A;  1UWB A;  1PG5 B;  5ETM A;  1FWL A;  4K7Q A;  4FZV A;  1BY9 A;  1QAX A;  4Q43 A;  2X1G A;  4ZHR B;  3C6U A;  3OXF A;  1MWY A;  3QZ7 A;  3M8S A;  4J9L A;  2C3Y A;  3LGH A;  5CZV A;  4RNM A;  1RHU B;  1ZBT A;  5KG3 A;  2Y3Y A;  2OSQ A;  2LEP A;  4ECR A;  2OH2 A;  1VC6 A;  3MD1 A;  4RW6 B;  2DNG A;  4H54 A;  1LW0 B;  3W60 A;  2FYX A;  3PKY A;  2E7W A;  2WHO A;  2LYV A;  4CLF A;  4B3M F;  4CTA A;  2D1C A;  4DR5 J;  1H74 A;  4JBC A;  3MEE A;  2XS2 A;  1WEY A;  4F2S A;  3DDN A;  4LF8 F;  2GAG C;  3D3B J;  4USV A;  4M1K A;  5J2P A;  1NME B;  2VQE F;  1I94 J;  4B9T A;  3WIV A;  5DDR C;  2DTJ A;  2Q3P A;  1IKY A;  5KFT A;  4UQT A;  4WJB A;  1HBM B;  5GAH U;  3GCW P;  1S6Q B;  1QSY A;  2F4V F;  2AEJ A;  3UNY A;  4AE5 A;  3DGV A;  4F4A A;  1B4S A;  1N56 A;  3T3F A;  3HHE A;  3L09 A;  4LFA F;  2W7O A;  5SUH A;  3SZ2 A;  1Z1Z A;  3H90 A;  3AB4 B;  5E5N A;  3W2W A;  1CS4 A;  3JB9 k;  4M5L A;  2DCL A;  2ZH9 A;  3NBP B;  5D0E A;  2UV8 A;  2MKC A;  1JLA B;  1WF2 A;  1NSK L;  4FBU A;  1X4G A;  3QGI A;  3UN3 A;  2I5J B;  4YR2 A;  4TY8 B;  3H2U B;  5L46 A;  2AP6 A;  4FXD A;  1SH0 A;  2N7C A;  2B8P A;  2P6S A;  3LP2 B;  3U27 A;  1N6Q A;  2CJX B;  1NBE B;  1EIY B;  2VFS A;  5B7W A;  1GXU A;  3AA9 A;  3UN2 A;  3PIP Q;  3X3U A;  1YI2 S;  4LF4 J;  2XNR A;  1TKZ B;  1NXI A;  3UDE A;  2H5E A;  4LQ3 A;  4ED7 A;  1APS A;  2J7K A;  1VLO A;  4LT6 A;  1RCX B;  4KC5 A;  2FJD B;  2RDD A;  4WE1 A;  3R7S B;  4YFU A;  3GIK A;  1IKY B;  4LF9 J;  4ZVE A;  1XR7 A;  4QZV B;  1KFD A;  2KT2 A;  3IWN C;  3G2X A;  5THW A;  2YKM A;  3WC2 A;  3N9U C;  3K58 A;  4FS1 A;  5ETN A;  1NJW A;  4MK8 A;  1Q95 G;  2YKO A;  2IFX A;  1B0V A;  2VQF F;  1O5J A;  2QL7 B;  1Y3J A;  3NL0 A;  1M1H A;  3W2W B;  1VQO S;  1NHK L;  1RAJ A;  2GQC A;  2HK2 A;  2XB2 D;  1FDA A;  4KGV B;  1HBU B;  3NS5 A;  4KGM A;  4O4G B;  2HGN A;  2JLG A;  3LUY A;  2Z58 B;  2IDL A;  1VJQ A;  1VQS A;  3IBC B;  5LXR A;  3L7U A;  2BXJ A;  2QE5 A;  4DL4 A;  5KG0 A;  1WWH A;  5AXK A;  1UWA A;  1FES A;  5KFJ A;  4F4Z A;  3Q24 A;  2BMB A;  1SV5 A;  3D6F B;  1DBD A;  2E1A A;  3HSZ A;  1X5P A;  3CD6 S;  2DGX A;  4I2Q A;  4ZP7 A;  5CQG A;  3QT7 A;  3JSR A;  2EKN A;  1KDN A;  1XMQ J;  1HPZ B;  1C1B B;  4JI2 J;  3B82 A;  2HAI A;  4FKY A;  2CPJ A;  4ICL A;  3N6M A;  4WPA A;  3OUY A;  2W2N P;  3SSS A;  1BQM B;  2HS3 A;  4USI A;  2GVZ A;  4C8L A;  3MF5 A;  4YDD B;  4WCE Q;  4L3N A;  2Z2Z A;  4GRS A;  3Q8Q B;  1WSR A;  3BYP A;  4C2M A;  4USH A;  1QAY A;  4ER8 A;  3KJF B;  4ZLP A;  2I0X A;  5H1S V;  3RYL A;  3HCX A;  3DI6 B;  3NNA A;  5B08 A;  2R7V A;  2DIS A;  3MM8 A;  1U09 A;  3PEH A;  2XCP A;  1Q7Y T;  2R7X A;  2J9E A;  2BJ1 A;  4F3Q A;  2GNK A;  5HVF A;  2AF6 A;  3EUN A;  2VA2 A;  1I3O B;  4U7U D;  1TKT A;  2LQJ A;  2QFI A;  4ELT A;  2W2P P;  4PPZ A;  3P45 B;  5AE3 A;  3BF4 A;  4X66 F;  1EQM A;  4DL2 A;  5KFP A;  3M6V A;  2YWG A;  1U8W A;  3WX8 A;  2XLK A;  4DV6 F;  1O0P A;  3I87 A;  3EPG A;  3AJ2 A;  4DFK A;  4R0J A;  2OPP B;  3JTN A;  1HHT P;  4WFA Q;  4L6V 3;  3ZTS A;  1FDN A;  2F8M A;  1BXN A;  3UI3 A;  2VZ9 A;  4TQR A;  1YJT A;  2G9O A;  3DC2 A;  2VFR A;  3PY8 A;  4DR2 F;  2GVZ B;  2FHK A;  5H9E K;  4LF2 A;  4DCO B;  4URQ U;  2FTR A;  5F41 A;  4PXC A;  3BQ1 A;  2OEJ A;  1X0F A;  2BAN A;  4NLX A;  2DNY A;  3MCS A;  4ZIW A;  1DY3 A;  5KFM A;  2KVQ E;  1S76 D;  2X7I A;  3VZH A;  3LWL A;  2LXI A;  5DGB A;  4HT5 A;  5GAH I;  5CHC B;  1FNX H;  4HI1 A;  2KG1 A;  2ALZ A;  4G1Q A;  3U1L A;  4EZ9 A;  3GII A;  5KFQ A;  5KT6 A;  1AYE A;  4OX9 F;  3MM8 B;  2E5H A;  4AL7 A;  2ZM6 J;  3T9N A;  2XI3 A;  4C7Q A;  3SI8 A;  3K5L A;  4CLW A;  5HLF B;  3W65 A;  3W66 A;  4HKQ A;  3UQS A;  1GXT A;  4DQI A;  2ZJR Q;  3AD8 C;  5ETR A;  3H5U A;  2LP4 A;  2APO A;  3QSY B;  4JV5 F;  1NKE A;  4PWD A;  1NPK A;  4FVM A;  1OQ3 A;  1FF2 A;  2WW8 A;  4K4T A;  3N5F A;  3D6H B;  2JJ4 D;  4U8V A;  1CJT A;  1H72 C;  1ZH5 A;  4HHJ A;  4J9Q A;  4L3K A;  4M63 A;  2Q6B A;  5CZX A;  2B4V A;  8AT1 B;  3PX6 A;  1U02 A;  3W8G A;  3TWZ A;  1HBN A;  4DQS A;  2VB6 A;  4F4Y A;  1U2C A;  3M6X A;  3D2W A;  2BAN B;  2CQD A;  2RRB A;  4OYW A;  2MKI A;  2F4F A;  3CUL A;  1J5O A;  1S9F A;  2OPR A;  3DOL B;  2KN4 A;  2RS2 A;  1LXJ A;  1Q53 A;  4IG0 B;  2FZK B;  5A76 A;  4U96 A;  5D4P A;  2IY5 B;  2RQK A;  5G4D A;  1FA0 A;  5CYQ A;  3THP A;  3PW2 A;  3TRG A;  4CNZ A;  1M5P C;  1M1G A;  4LSZ B;  3SCI E;  1M5H A;  4OHW A;  3MHY A;  1SJR A;  4GVL A;  2M2B A;  3KG4 A;  4ES2 A;  1PIL A;  4LIW A;  3P3D A;  1B0P A;  1B7F A;  2XSJ B;  4HYK A;  1R6Y A;  3FEZ A;  2Z30 B;  4YR0 A;  2MXY A;  5E3P A;  1NO8 A;  5J2N A;  1RB0 A;  2J6U A;  2A0F B;  4U7C A;  5C2G A;  2H54 B;  1R8H A;  2WOM B;  1FVQ A;  3S6E A;  5KG1 A;  4RNN A;  1RWX B;  4RWW A;  1V3Z A;  1IJF B;  2N4D A;  1J5O B;  3EDQ B;  2QLJ B;  1YBU A;  3UDC A;  4BBY A;  4ED5 A;  3C14 A;  4LF5 J;  2LQ5 A;  1HWI A;  2W4P A;  3G86 A;  1AW0 A;  1CJV A;  2WSF C;  4KY3 A;  2HQ3 A;  3QZ8 A;  1HNZ F;  1FER A;  1FJ7 A;  4NLP A;  3VF0 B;  3IS9 B;  4MJK A;  4FF3 A;  1EET A;  4N5S A;  2XGP A;  5AE1 A;  3VWS A;  3DRX A;  5ADZ A;  4RZR A;  5CYQ B;  5C2C A;  4TYA A;  3T5H A;  2UVV A;  2IRY A;  1WOO A;  1UVK A;  1X0P A;  3SMZ A;  4I1T A;  2LMI A;  1FDD A;  5DET A;  1B3T A;  2EFO A;  3WHI A;  2W9A A;  2IYI A;  2VPY B;  3CWJ A;  1BWE A;  3J7Y I;  3FEY B;  4R0E A;  4LJM A;  1U0S A;  3J7A 1;  3JAM U;  1S5Z A;  1W2I A;  3W5Y A;  4UOC A;  4ZK7 M;  2AJ0 A;  2JC0 A;  2HIY A;  2DB1 A;  1H2V Z;  2JEJ A;  4XPC A;  3PEJ A;  1FXD A;  4KRW A;  4TU9 A;  5J2N B;  3UPF A;  1K73 T;  2RML A;  2OUG A;  5GME A;  4HHH A;  2YWF A;  3OL8 A;  4JI7 J;  4JI8 J;  3EGN A;  4IH5 A;  3T1H F;  3PW7 A;  2MQP A;  2AJF E;  3D3C J;  4CLL A;  1X4H A;  1FNO A;  1LWF A;  4FN5 A;  3SV3 A;  3PYE A;  3MEC A;  1SH3 A;  3I9V 9;  3JSM A;  2AJ2 A;  2QEX S;  2K2P A;  3VAM A;  2D41 A;  4A8O A;  4JI1 J;  1EET B;  4RUB A;  2DNL A;  3QPI A;  3IMQ J;  7FDR A;  3KJV A;  3AXK A;  3FJ2 A;  2GMJ A;  2LXF A;  3R8Y A;  3QAE A;  1OPZ A;  2QA2 A;  4C3L A;  2E5L J;  3JQM A;  1U2F A;  2F9D A;  2ZZM A;  3BJY A;  5F9L A;  4OZN A;  4DV2 J;  4OZ0 A;  2ZH6 A;  1NB2 A;  5DRK A;  1X5S A;  3MM9 A;  5D0R A;  2XM3 A;  1QVF R;  3OTO F;  3M2V A;  2FHO B;  3EJM A;  4WF9 Q;  2CPY A;  3RAX A;  1TUV A;  4NEZ A;  4DUZ J;  1YZ7 A;  4JI5 J;  3LPE A;  5LSO A;  3ILO A;  1M0S A;  3BM7 A;  1TMM A;  2ZZN A;  4NLS A;  4P2F A;  3NLC A;  3D0I E;  4PXD A;  1VMB A;  2XHW A;  2XS5 A;  1YHQ S;  2VBY A;  2DNR A;  2YTC A;  3T5L A;  4OI0 A;  5DQI A;  4OYX A;  2CQ4 A;  3UN5 A;  3T1Y F;  5L1I A;  3NMA A;  3JSM B;  1SJF A;  1UZH A;  1WTB A;  2XY7 A;  4DG1 B;  3MPY A;  4CQ1 A;  3PYG A;  1RUS A;  4OZ1 A;  4MIW A;  3AY0 A;  3L95 X;  3TA0 A;  2WTF A;  1PKU A;  3RB3 A;  4G1I A;  1GX5 A;  4Z2X A;  5LSL A;  2MY7 A;  3HMJ G;  3EX7 B;  5KOW A;  3G6X A;  3JXO A;  1GMW D;  2FVS A;  4Y2A A;  1S6O A;  1TL3 A;  8ATC B;  1ZZN A;  3TAP A;  3DOM A;  4L75 A;  2NCK L;  1LW2 A;  1QDU B;  5E33 A;  4TU7 A;  1WKL A;  2ZDP A;  5B0E A;  3V4I A;  1KD1 T;  4QIG A;  3AFG A;  3M2V B;  2XHC A;  4HHU A;  4WTY A;  4C0B A;  4IDK A;  1KHW A;  1AT1 B;  2BE2 B;  3AOA A;  2V8G A;  2F40 A;  3H4B A;  2DO0 A;  4DSJ A;  2QL9 B;  4LF6 F;  1U1L A;  3TAM A;  1YZ6 A;  4F0M A;  2V6A A;  4N76 A;  3UD4 P;  4OX6 A;  2YBV A;  3QQC D;  2HVI A;  4OZJ A;  3H5Y A;  3CMA S;  3KJN B;  3JTO A;  4FBT A;  3WZ0 A;  2V69 A;  1PYS B;  2PMH A;  3DMJ A;  2JVO A;  5B09 A;  3K5N A;  1RWP B;  4K4W A;  3LW5 C;  4M95 A;  2H9Z A;  1TK0 A;  1VQ7 S;  3SBM A;  3G96 A;  2RKI A;  2R8K A;  1YVF A;  3F73 A;  2WVF A;  2HHQ A;  4EO6 A;  1VC0 A;  3J81 U;  2NRE A;  3V6D B;  1TL3 B;  1PC4 A;  3FDS A;  1MU2 B;  3MM5 B;  1LW2 B;  4R25 A;  1S9G A;  5C7P A;  3GON A;  4JB8 B;  2LA4 A;  2XTJ P;  4CCH A;  3VAH A;  2DGW A;  1AXQ A;  4DLG A;  1D0E A;  5J2M A;  1P1L A;  5AJ3 F;  2QFJ A;  4Y2M A;  1PAE X;  2QV6 A;  2WK4 A;  4PKD B;  2Z2L A;  1VLY A;  3BO2 A;  3LP1 A;  4QIF A;  3B78 A;  3FRY A;  3A3N B;  1TUW A;  4PZV A;  4DN9 A;  2AEM A;  1UFK A;  2KZZ A;  2WW4 A;  2ROP A;  3MCN A;  3O44 A;  3PIO Q;  3H42 A;  2QG9 B;  4DSK A;  2K1R B;  4DL0 C;  2XLJ A;  2YNI B;  2ZNY A;  1RT1 A;  2MHE A;  4HAC B;  4UOG A;  1WNE A;  3DMJ B;  4P2M A;  5ETO A;  1WTF A;  2E7X A;  1JWW A;  2ACM A;  4KGK A;  1Q0N A;  2VDH A;  4I69 A;  1X31 C;  1RTD A;  4DR6 J;  2F5G A;  3J7Z 5;  1VBZ A;  4P74 A;  2I6W A;  1S1V A;  5JVG Q;  4DPX A;  4IQM A;  4JI4 J;  2XZT B;  2FC8 A;  1HWK A;  2E5G A;  4CP5 A;  4U8Y A;  4F3O A;  4ZPD A;  4IG3 B;  3PYF A;  2QA1 A;  3KK2 B;  4GKK F;  3DDI A;  2C2M B;  2OJ3 A;  3NEK A;  1U24 A;  3HJV A;  3F41 A;  5LMU F;  4DQP A;  1U48 A;  1CLF A;  3DDK A;  3OR2 A;  1IKV A;  1XNR F;  1JJ2 R;  1M5V C;  3VVU A;  2XO7 A;  2HPU A;  2JDJ A;  4CM0 A;  2BW7 A;  1XWL A;  2UUC J;  1TUG B;  2UU9 F;  3DRS A;  5CYM A;  2HNY A;  2O1P A;  3U02 A;  4OZ2 A;  2C2R A;  1F6T A;  2DGV A;  4DU8 A;  2Z2M A;  3CJK A;  1AB8 A;  3PRD A;  5T14 A;  1TP7 A;  1XNQ F;  4CM2 A;  1T11 A;  2F7V A;  4O3S A;  2JH3 A;  4OJH A;  1LNQ A;  5E3Q A;  1JLF A;  4ZLL A;  1WEX A;  4NXN J;  2CDQ A;  3K5P A;  4RBT A;  2JL9 A;  3T9Z A;  3PX0 A;  2O67 A;  1HNV A;  4C8Z A;  1LV5 A;  3FBE A;  3KYL A;  1HQE A;  4F4X A;  3HLU A;  5F8I A;  4Y28 C;  3F0N A;  4C6A A;  5JUM A;  2GHP A;  4NOH A;  2UXB F;  4QYZ K;  1V6H A;  1F2H A;  3C19 A;  1R0B G;  1YJU A;  1S97 A;  2MPU A;  2VC0 A;  1C0U B;  2MGZ A;  2ZDO A;  1FKP B;  3C6T A;  1X5T A;  3LGN A;  4DV7 J;  3H2V E;  3NAI A;  5DS7 A;  1PJ5 A;  1XMB A;  2HHH J;  1GMW A;  2AZ1 A;  2BV3 A;  1JJ4 A;  3BN7 A;  3M8W A;  2QLB B;  4WXW A;  1T9U A;  2AWZ A;  4Q8F A;  1W26 A;  2OEK A;  2HNY B;  4WBF A;  1RAC B;  1WOP A;  3WDO A;  2VG6 B;  3KDO A;  4JP8 A;  2UUW A;  3CUN A;  1PBU A;  4BWM A;  3BGR A;  3I0R B;  4Q0B A;  1NJX A;  4LFB F;  2Y1J A;  5LJ3 Y;  2PA3 A;  1LKZ A;  3CCU S;  2YNF B;  3GPA A;  4P52 A;  1UA1 A;  3CJ0 A;  2L41 A;  3IWL A;  1R7I A;  3L7O A;  2PT0 A;  4NLR A;  2LA6 A;  3MTJ A;  2VAS A;  3CCR S;  4NCB A;  4N77 A;  4DV3 F;  4OYZ A;  3ISZ A;  5I3Q A;  3FBF A;  1VC5 A;  3QT8 A;  2MKK A;  2YH1 A;  2YKN A;  2CQ2 A;  5JJB A;  2FJX A;  3NGD A;  2RS8 A;  2RSQ A;  2DGQ A;  5KG5 A;  2X1F A;  4EZ6 A;  2OI2 A;  1JXE A;  3GFZ A;  4WU2 A;  3BB5 A;  3SV4 A;  3RW6 A;  3FKB A;  3C6T B;  1U0H B;  3KLI B;  2CJB A;  2DXE A;  3ZZY A;  4DV0 J;  4ED6 A;  2ZE2 A;  1OY8 A;  2RU9 A;  3BR8 A;  1O51 A;  4N8O A;  4N7T A;  2MJN A;  3G4S S;  2FIU A;  1CQM A;  3R1L A;  4LR9 A;  2GX8 A;  1RT3 A;  1HQU A;  2AGP A;  4J9S A;  1VBY A;  2BA9 A;  4KHR A;  2AJ4 A;  1D8Z A;  4GO5 X;  2W9B A;  3VHQ A;  4Z7Y A;  3R97 A;  2HSE B;  3ZXW A;  1RAG B;  5K8N A;  3BH7 B;  4OHY A;  4WFY A;  1S4E A;  3UE2 A;  3DNC A;  5HQM A;  2DHX A;  1C0T B;  4MKV A;  4NLW A;  1WC6 A;  3F56 A;  1CG2 A;  1S99 A;  4E8U A;  5IC6 B;  2UXD J;  3RRK A;  5FII A;  4QPX A;  5KFC A;  2C2K B;  2HWH A;  2EFG A;  3FSX A;  1LFW A;  1RBO B;  4LF7 F;  3GYN A;  2FY1 A;  2MMY A;  4QU7 A;  3QO9 B;  4ECZ A;  5D0H A;  1GX6 A;  2FVR A;  2PEH A;  2M5Y A;  2NPI A;  1XR5 A;  4M5M A;  4J90 A;  5K8M A;  2DH9 A;  3OTD A;  2ZOM A;  2V2V A;  4DSF A;  1VQN S;  2HVE A;  2ZUA A;  4J9N A;  1HNW J;  3ILI A;  2Z56 B;  4TN2 A;  3OTC A;  4WU3 A;  3V6H A;  4YME A;  2IMW P;  1R8C A;  1HQU B;  3I55 S;  4A8Y A;  3C66 A;  2NXJ A;  3I56 S;  4DR4 F;  2VFT A;  1S9E B;  3M8P A;  1VQ9 S;  1NZ8 A;  2E7V A;  3D4J A;  2UVR A;  4X4Q A;  3VVT A;  5HL7 Q;  1T9Y A;  4UST A;  4K4U A;  4D3H A;  2R7U A;  1MMD A;  1N34 F;  4X64 J;  1S57 A;  4ZLJ A;  3R5D A;  2ROG A;  1HYS A;  2HFS A;  2R42 A;  2FVQ A;  2DVI A;  3MUM P;  4IFV A;  1RZM A;  1RKI A;  1NSA A;  1LWE B;  2UUT A;  1QUP A;  1UJ4 A;  1CUL A;  4WP3 A;  3KLV A;  4OLO A;  3AHP A;  1FJE B;  3HZE A;  5KFA A;  1UEU A;  2ZOF A;  3ICL A;  5CH7 B;  3OLA A;  3VQT A;  1OYE A;  3PNI A;  5I42 A;  1TV6 A;  3NRB A;  1YBT A;  5DQH A;  2FJE B;  3V2U C;  3US5 A;  2HND B;  2GFF A;  4ETX A;  1NJI T;  4RJV A;  1Y3K A;  2YWE A;  2JVR A;  3S01 A;  1NH7 A;  3IWX A;  2F8H A;  3D7S B;  3MM6 A;  3M6U A;  4PG7 A;  2VG7 A;  1CEZ A;  5K14 B;  3ZZR A;  3K57 A;  2VV5 A;  2V2Z A;  4ECW A;  4B3T J;  3RAM A;  2EG1 A;  3MPW A;  3C3L A;  2HQI A;  3M8Y A;  1QTN B;  3RBE A;  3LQV A;  4KGX B;  1XTZ A;  3CJT A;  5ETS A;  3KLF A;  1RGV A;  3MFI A;  4LRB A;  4NLU A;  7FD1 A;  3FSI A;  3CXC R;  2IM3 A;  1L3K A;  2Q43 A;  2F8E X;  1NK8 A;  1HYS B;  4DL6 A;  3AB2 B;  4O3R A;  1S7H A;  4DFM A;  4C8N A;  2NYH A;  1I1G A;  5LSR A;  4OV6 A;  3R3T A;  2WZ1 A;  3GFH A;  3PHE A;  1FK9 B;  3D6M B;  4NZ6 A;  1RYR A;  2MZQ A;  2MEW A;  2DK2 A;  2CJ9 A;  2GVD A;  1JLQ A;  1DTQ A;  1A9N B;  1FRX A;  3OFH A;  5BYQ A;  2GO9 A;  4DR5 F;  1DTT A;  3RRH A;  3QIP A;  2LQ8 A;  5FDL B;  1F60 B;  2HVH A;  1WF1 A;  2CUY A;  4YDX A;  4AQY F;  1MWQ A;  3RGI A;  2RRA A;  1BQN B;  1KQF B;  1I94 F;  1OIA A;  4H4K C;  1P9Q C;  1WEZ A;  5DM7 Q;  4RU9 A;  2GHV C;  4NLD A;  1S1U A;  4N41 A;  2XWY A;  3MM6 B;  4K4V A;  1FFW B;  1HBO B;  3MR5 A;  5HQ8 A;  2WVC A;  2DKO B;  4RO0 A;  3GIR A;  2ZUG A;  4YP3 A;  3M2U B;  1VK3 A;  1Q5V A;  4Y6I A;  5DQG A;  4G1P A;  3ZZZ A;  3IBW A;  4RW9 B;  5DZ6 A;  5G0R B;  1HAR A;  1S12 A;  3Q89 A;  3M1V A;  1YG0 A;  4DJB A;  4OJ1 A;  1UFW A;  1XN9 A;  4FYW B;  3DLE B;  1Z4U A;  4TQS A;  6FDR A;  5A6W A;  4P7V A;  2MQL A;  2HBQ B;  4L74 A;  2DGS A;  3LF0 A;  4J9O A;  2EC2 A;  1P27 B;  2GC8 A;  3V81 B;  3W9H A;  1SUQ B;  2JFD A;  1S1X A;  2HZV A;  2VA3 A;  1TL7 A;  3HVR A;  3AH6 A;  2KHD A;  3HUL A;  2LEB A;  4ZLN A;  2CZV C;  3AJ1 A;  1DTQ B;  4WK3 A;  5CCL A;  4LF4 F;  4P72 A;  4NA2 A;  3W5X A;  2ADB A;  2LVW A;  5K5M A;  4RUH A;  1N88 A;  2GIR A;  1RWU A;  1SVD A;  5C42 B;  2DR5 A;  2JC1 A;  3PM9 A;  1O8B A;  3OVA A;  4LF9 F;  2PMW A;  1IR2 A;  5EX0 A;  3IGN A;  2KB2 A;  4ZVT B;  4LIR A;  2OD6 A;  4DEZ A;  4RPF A;  4J91 A;  4PG4 A;  1Q86 T;  4DHV A;  3EVM A;  1RT6 A;  4XPE A;  1RBL A;  2BM0 A;  2N4C A;  1CC7 A;  3G9C A;  2RHQ B;  2PC6 A;  1MSW D;  2DNK A;  3EGW B;  4RWX A;  4DI6 A;  4B3O B;  2DNP A;  1FFS B;  5JMN A;  5EX3 A;  2YX1 A;  2V63 A;  2WB1 D;  1H7W A;  1S1X B;  2NZC A;  1F5C A;  2CQ3 A;  2QN6 B;  3B8H A;  2X51 A;  1TL7 B;  4CO5 A;  2ZD1 A;  2FGO A;  4IUF A;  1VRU B;  1NHV A;  1DLO A;  4ZVS B;  2OP5 A;  1NJY A;  2EFV A;  2G1D A;  3I31 A;  3BQ0 A;  1VQ6 S;  1XMQ F;  4JI2 F;  2HKE A;  3QJL A;  4RUA A;  3G8T A;  5KG2 A;  2XG8 A;  5I3U B;  1VRQ C;  3H8Y A;  4UZB A;  3RTV A;  2FZC B;  3VAL A;  4QYZ J;  1U2R A;  3MOJ B;  2BUN A;  3HI9 A;  2DPJ A;  5GAG I;  4J9K A;  2ILY A;  3BKT A;  1T03 B;  5DGA A;  1EAR A;  4PWW A;  1YJR A;  4B3R J;  4F4K A;  5F8H A;  3Q86 A;  4PR6 A;  4LVO P;  1RAF B;  1OYD A;  4DR3 J;  1KN6 A;  3VR1 A;  3SDE A;  3TUZ C;  2YX7 A;  5DM6 Q;  5GVQ A;  3C16 A;  3PJX A;  2OFG X;  5IOL A;  2DCU B;  2RUS A;  2QSF A;  2QZ8 A;  1W2B R;  4UT4 A;  4DCJ B;  4WZQ A;  3W9I A;  1XQI A;  1GMV A;  1U1M A;  3Q8S B;  4ANC A;  3O2I A;  2H4Y B;  3P5T L;  2D9O A;  2XI2 A;  4B3S J;  1O6X A;  1S49 A;  3JSB A;  5IM0 B;  1NK6 A;  1VIO A;  4TKT A;  1A7G E;  4V19 X;  2ATL A;  3TAN A;  5L9N A;  3C8Y A;  2YXL A;  3BO4 A;  3UCZ P;  2HQC A;  1DLO B;  3GJS B;  1F0X A;  3G6V A;  1FRK A;  3MAA A;  3NKY A;  4YB5 A;  4NCG A;  2XYH B;  2PDA A;  5F0W A;  4NEY A;  2HYI B;  2D3O 1;  1S7I A;  4LR7 A;  1E6V A;  4WFB Q;  4AXJ A;  3A4T A;  1WDD A;  3FK4 A;  1T0T V;  1KOO A;  4PQA A;  1UVN A;  2V8P A;  4NLV A;  2H4W B;  2HGM A;  2DHS A;  4E0D A;  2BQ3 A;  4GVB B;  5L1J A;  1B64 A;  3MM7 B;  4ZPW R;  1LWX A;  3SDE B;  2R8I A;  4KIA A;  4DX6 A;  2M88 A;  1OWX A;  4DX7 A;  4N47 A;  3PDN A;  2R7R A;  1JJC B;  2ASJ A;  3DXS X;  4OX8 A;  3FRZ A;  2HWT A;  4ED8 A;  2IM1 A;  1QE1 B;  3B4M A;  2ZM6 F;  1S0O A;  2QMW A;  3CED A;  4DU7 A;  2DH7 A;  3MMJ A;  5HQL A;  5LMN F;  2DD8 S;  3EDR B;  4L72 B;  4W4M A;  1TFY A;  2B4U A;  2QIF A;  1P8G A;  3W3S A;  1Y7P A;  4DZ6 A;  4NLG A;  1X60 A;  1RT7 A;  4U95 A;  1WG5 A;  2LCW A;  2AX0 A;  2W24 A;  1N5Y A;  2R7Q A;  2W8L A;  5KG6 A;  2YVS A;  1RI7 A;  1TKX A;  1RKJ A;  1GEH A;  4NCG B;  4ZCK A;  4RNH A;  2N7Y A;  2WRM A;  1WD6 A;  1EHW A;  3MUT P;  1U8S A;  3MEG A;  1GFW B;  4XK8 C;  3UFC X;  1E6V B;  3CD7 A;  3QFW A;  4JOU A;  2FJV A;  3E51 A;  2GML A;  4JI6 J;  1HNI B;  6FD1 A;  1U25 A;  2CNN B;  4TY9 A;  3HSJ A;  4C8O A;  4HT7 A;  2OPQ A;  3SQG A;  3TVZ A;  4PQU A;  2DO4 A;  2YNG B;  1FO1 A;  2KJV A;  2CPI A;  1HL6 A;  3SSR A;  4RNO A;  1CJK B;  4XIU A;  3FGV A;  4ID8 A;  4OL8 A;  3FUY A;  3IRX B;  1ZPW X;  3W62 A;  4ZVG A;  2J9D E;  3A3P B;  3HVA A;  3KDN A;  3D1Q A;  2X3D A;  4NLY A;  3NY0 A;  2F3J A;  1REV A;  2E1C A;  2NXE A;  3W2V A;  3QT6 A;  1IBK J;  3CE8 A;  2C2D A;  1N33 J;  2AMC B;  3JQK A;  2XZW A;  5KT2 A;  4ES3 A;  2EBE A;  4CO0 A;  1S1W A;  4PUO A;  1C4A A;  3CDU A;  1UPM B;  4C11 A;  4I0W A;  2A2C A;  3L3C A;  1EAY C;  1TKX B;  4DL5 A;  4C98 A;  4O44 A;  4QWB A;  3HK2 A;  3S7R A;  2VQF J;  3PKM A;  4LBH A;  2HBZ B;  3U1N A;  1J2V A;  3MEG B;  3QID A;  1T8E A;  3MMB B;  1Q1K A;  4WP9 A;  4O0N A;  1S4F A;  4QWC A;  2F63 A;  1N8R T;  2VU5 A;  2C22 A;  4IFY A;  3QJP A;  5U47 A;  4CT8 A;  2ZKU A;  4LSL A;  4EBE A;  5CCM A;  4GO7 X;  1SPB P;  2V2K A;  4O0I A;  2OPQ B;  3SQG B;  4PQU B;  3IBF B;  4I6Y A;  3JSY A;  2E1M C;  2PI4 A;  4LF5 F;  2YPZ A;  2AHO B;  1NH8 A;  3W1Y C;  1S79 A;  2CJY B;  2GS8 A;  2COL A;  4Q2L A;  3OHB A;  2ATC B;  3G6E S;  2D74 B;  2JLE A;  4OMF G;  2PA8 D;  4C3K A;  1VQL S;  1REV B;  2X1A A;  1XR6 A;  1SKS A;  4N8N A;  2ILZ A;  4ILL A;  4ID5 A;  2HWI A;  1UZD A;  4ZIV A;  2XMJ A;  2IVY A;  3M2R A;  3QRP A;  2RNE A;  4PUO B;  2YQ3 A;  1NK0 A;  1UCN A;  2X1B A;  1NND A;  2X3G A;  4FPI A;  4C11 B;  3NCR A;  3M8R A;  2YQ0 A;  1D09 B;  1KNZ A;  3BSN A;  2LDI A;  2A1B A;  2W2O P;  1IKX A;  4K50 A;  3OJU A;  5ETL A;  2YPY A;  3QSI A;  3CCL S;  1NZA A;  1FD2 A;  4HEA 9;  3BKF A;  3BGF A;  1FDB A;  4F26 A;  2FQQ B;  4IFY B;  4EU0 A;  5BYS A;  1CJU B;  4JI7 F;  3NMR A;  4JI8 F;  3OSP A;  1K44 A;  1CC8 A;  2HGL A;  5A8K A;  3QRQ A;  1Q78 A;  3I0S A;  1FTC A;  5L9X A;  2N3L A;  4CLS A;  2E29 A;  2G2Y A;  2ABY A;  1M5S A;  4DF4 A;  4HDH A;  4GC6 A;  4KV8 A;  1Z2Z A;  3CCE S;  3KUE A;  5D15 A;  1U1O A;  1GXL A;  4DV6 J;  5KFE A;  2DYA A;  5ETP A;  4JI1 F;  5D4N A;  3W61 A;  2MB0 B;  4QQB A;  2YKA A;  2V4J A;  4ECT A;  4G6V B;  2RVJ A;  1D9F A;  3CT9 A;  1RT2 A;  2MTL A;  5L1L A;  1A6L A;  4Y3C A;  2JHE A;  2FC9 A;  1UJ5 A;  2RQ4 A;  1WG1 A;  3M32 B;  2E5L F;  3MTK A;  4DR2 J;  4IR1 A;  2DNZ A;  4DV2 F;  2EVZ A;  1WC3 A;  1NDP A;  5IT9 U;  2V34 A;  2ALY B;  4DUT A;  1RHJ B;  1OY6 A;  4MH8 A;  4PCQ A;  1PBA A;  4IO9 Q;  3DLB A;  1TTH B;  2MKY A;  4YY3 J;  1JKH A;  1GTH A;  3M9N B;  2C2E A;  2L3M A;  2C2O B;  7AT1 B;  5KAK A;  4JI5 F;  2WSE C;  5KFB A;  1N5V A;  4NLT A;  4YHH J;  4OI4 A;  2E44 A;  2HS0 A;  4JUZ A;  1Y00 A;  3CME S;  1MNE A;  3MGJ A;  2NR0 A;  2HIQ A;  3TUI C;  1BUX A;  2HQD A;  4KQZ A;  3UW1 A;  4ZKA A;  5A8K B;  4FF2 A;  3I0S B;  5A2Q U;  4Y65 A;  2GJF A;  1E6Y B;  4HI2 A;  1EX8 A;  2BKP A;  2ZBQ A;  5T7L B;  4H4K A;  3PV8 A;  2GIQ A;  5K9F A;  1RT5 B;  1HHS A;  1OJ4 A;  2HBY B;  5B0G A;  1QJH A;  2MZ1 A;  1MW7 A;  2CQH A;  2CXE A;  3PX4 A;  3R1H A;  4A8M P;  2XYG B;  3C2P A;  2V4J B;  3B4D A;  1RT2 B;  2AW0 A;  2BAC A;  2JEF A;  3WX4 A;  2P8I A;  1U6Z A;  2LEC A;  3NOG A;  2AU0 A;  2RAQ A;  1TL5 A;  1KTQ A;  5B0D A;  4F0K A;  1NHU A;  1QM9 A;  3UWT A;  3Q83 A;  3GFY A;  2OMO A;  1LW0 A;  1YRX A;  1BLU A;  2Q79 A;  3N6N A;  2B4O A;  4OZL A;  4OI1 A;  2CNO B;  4LRF A;  5HO4 A;  4I2P A;  2DBB A;  3DLK A;  3SFG A;  4K4Z A;  3BRE A;  2XO6 A;  1S59 A;  3I4H X;  3C46 A;  1U45 A;  5AXM A;  3RW7 A;  1BC6 A;  2L9W A;  2EEY A;  1XK8 A;  2DNN A;  1L3S A;  2MZT A;  3MMC B;  1VQP S;  4F8R A;  1S6Q A;  3U7J A;  3AOD A;  3BQ2 A;  1S0N A;  1TVR B;  1NKC A;  1WI6 A;  2QO3 A;  2MHN A;  1PSD A;  1J27 A;  4BC7 A;  4QOT A;  3R5G A;  1ZPV A;  1JJH A;  2R7T A;  3UCG A;  4I7F A;  2R7S A;  1IBM J;  3VAI A;  4ILM A;  5AE2 A;  4P71 A;  3OLB A;  3T41 A;  4DS4 A;  1YK9 A;  4MK9 A;  1M90 T;  2MJU A;  4C8K A;  3TJA A;  1H2T Z;  3A12 A;  2JEI A;  1RTI A;  3B54 A;  3NBP A;  4NI2 B;  3NGT A;  2HHW A;  5EHH A;  3AJD A;  1JLA A;  2OPS B;  2I5J A;  1JLC A;  1AUD A;  3EM1 A;  4TY8 A;  2HRU A;  4ZN1 A;  4ZN3 A;  1TL1 B;  5KFI A;  2JX2 A;  4DZD A;  2OKQ A;  3LP2 A;  1JNZ B;  1RIS A;  4I2P B;  2QYG A;  2HMI B;  3DLK B;  4M5J A;  4OYM A;  3SQO P;  1TAQ A;  1TKZ A;  2Y0B B;  2CJA A;  4HDG A;  3KLE A;  3PR4 A;  4ILR A;  2KZM A;  4DS5 A;  1HNZ J;  2GAH C;  2IIH A;  5HRO B;  2K8G A;  4N56 A;  2EFP A;  1VBK A;  3RRG A;  2HHT A;  1HW8 A;  1FCA A;  2FGC A;  4DV4 J;  4FF4 A;  2QT7 A;  4LBP A;  1D9D A;  2Y1R I;  3QAU A;  2V8H A;  4OHX A;  4EBC A;  4M5N A;  4NE9 C;  2H3E B;  4O3Q A;  2OO4 A;  2IDE A;  3OL9 A;  2MLZ A;  4I7F B;  2W4D A;  3EGV A;  3MPD A;  1NAQ A;  4ENO A;  4DSI A;  1UTA A;  3BPD A;  1UFL A;  3FCV A;  4J9U E;  1Z2L A;  2BJE A;  4CLZ A;  4DR6 F;  1RTI B;  4EGL A;  3W64 A;  1HBU A;  3I82 A;  4O4G A;  5IFM A;  1YJ7 A;  3MDF A;  2GA7 A;  1FTR A;  1W7W A;  4JI4 F;  3I9Z A;  4OJG A;  1SC1 B;  1JLC B;  4KO0 B;  1DFD A;  3R5A A;  4O3P A;  3NCP A;  2CWK A;  2G0C A;  4DR1 J;  3Q8U A;  3TZW A;  5JXS A;  1EZZ B;  5KFY A;  3CJ8 A;  1HPZ A;  3TZY A;  5LL6 d;  1C1B A;  3VAK A;  4UOH A;  1Q5Y A;  3KLE B;  1U1K A;  4NXM J;  2UUC F;  1BQM A;  1RU2 A;  4I56 A;  1U26 A;  1Y4Z B;  1F9E B;  4O4R A;  3PG9 A;  3VQS A;  3FNN A;  2HHP A;  2UUB J;  2IJF A;  8RUC A;  2J0W A;  2CPE A;  4GMK A;  3KNG A;  3P8B B;  3Q8R B;  5L8R C;  4KH0 B;  2ASL A;  1U49 A;  2DJW A;  3K5O A;  5F8L A;  5GAD U;  3OR1 B;  1WUU A;  4BC9 A;  2WBR A;  1HWU A;  3DI6 A;  3OT9 A;  5E0O A;  2RH3 A;  4F04 B;  1HKA A;  3KLG B;  1GH8 A;  2C2N A;  4CNY A;  3D0H E;  2OAU A;  3MR7 A;  1VQ4 S;  1PYT A;  4DOZ A;  1MN7 A;  3EXC X;  2NZ4 A;  3H2L A;  4DV7 F;  2Q66 A;  2F9J A;  1I5O B;  4WKY A;  4URS A;  2V8V A;  2OPP A;  2HHH F;  4EFA C;  3VGU A;  2AV5 A;  1WSV A;  1N54 B;  5DZ7 A;  2XS7 A;  3ILL A;  2GJ2 A;  1ACM B;  5KFH A;  2NUU G;  3I6P A;  1FI4 A;  2DIT A;  3W9J A;  2G4B A;  3H4D A;  2KFZ A;  1OSC A;  1QAJ A;  2UUA J;  1ZET A;  1RE1 B;  3R2C J;  2FLO A;  2J8S A;  2AYE A;  2MST A;  4OI3 A;  2DNM A;  2HFU A;  1N5Q A;  3QLH A;  2OEL A;  2MQM A;  3ENV A;  1Q7L B;  2CQC A;  3VCD A;  2G2Z A;  2AD9 A;  5FLX U;  1XMO J;  3J7Y U;  5HLF A;  4IR9 A;  2MQ8 A;  4KGZ B;  3NS7 B;  4BCA A;  2HUR A;  3QGH A;  3IG1 B;  1XER A;  1UAW A;  3UD3 P;  4LBI A;  4WII A;  2KXH A;  4QCL A;  1BD6 A;  3PYD A;  5L38 A;  4LRE A;  2KT5 A;  2DRA A;  3RR7 A;  2B9X A;  3UNG C;  2DHH A;  5T41 A;  3IRW P;  4DV0 F;  5ETQ A;  1ITP A;  2V0N A;  3NG8 A;  1TU0 B;  4J37 A;  2AX1 A;  2DPI A;  5KFD A;  3LAM A;  3GMG A;  2RT3 A;  2SXL A;  3UCU P;  3ZZU A;  2O3D A;  3HHL B;  1D3W A;  2KM8 B;  2V50 A;  1LOU A;  2BJ7 A;  1EP4 B;  1QAI A;  1RAD B;  3BDP A;  2RIJ A;  2CA9 A;  1VS3 A;  4ECQ A;  5HBM A;  2OFH X;  3FMB A;  3KLH B;  4OZ5 A;  1IKW B;  2J76 E;  1H3D A;  1DQ9 A;  3HKZ D;  3SCL E;  1NB7 A;  2RDI A;  2CPZ A;  2XY6 A;  1RA7 A;  3DOL A;  2D3O R;  4HR2 A;  4IG0 A;  4QIW D;  3MEK A;  3QFH A;  1KS2 A;  1T9T A;  2K7K A;  2NSC A;  3CC4 S;  3CVK A;  4ANE A;  3QLH B;  2ZWO A;  3SFU A;  4ZMM A;  1K1Q A;  2HVZ A;  3EPI A;  1U47 A;  1G3O A;  3BGO P;  4KR0 B;  3OSN A;  3OHA A;  4IRD A;  2ASD A;  1ZM2 A;  2NXN A;  4FYY B;  5F3Z A;  2EFQ A;  1LK7 A;  2E5I A;  4NA3 A;  2ZBC A;  4FYX B;  4XDD A;  2FHM A;  1VHI A;  4DQR A;  2WVD A;  2UVW A;  2CAD A;  1S0V A;  1YLX A;  4F25 A;  4OI6 A;  3NGS A;  2QLX A;  1R31 A;  2WBM A;  5CXT A;  2J6S A;  3SEO A;  3V6K A;  1HNW F;  2R3V A;  2AIR B;  5EDW A;  2NXU A;  2XSJ A;  2Y1I A;  3BGU A;  2K3K A;  3IP0 A;  5B0B A;  2IRU A;  3DRP B;  3G82 A;  4C0O C;  4R5P A;  1VRT A;  2CDR B;  3CC7 S;  4ZVR B;  2EWH A;  1BGX T;  5D6G A;  3OTE A;  2P5V A;  2WOM A;  5HBM B;  4MAK A;  1S6P A;  5B0F A;  2KT3 A;  4X64 F;  1NK4 A;  1NEE A;  2J7W A;  1DQ8 A;  3GV5 B;  2HFO A;  4CYU B;  5D4O A;  1GTE A;  3FVY A;  5IWA J;  2EKY A;  2VFU A;  2R7O A;  2XMT A;  1XJW B;  3IS9 A;  4IH6 A;  1VQK S;  4AT1 B;  4ZVQ B;  4NZ7 A;  4UTG A;  4NX9 A;  1UW9 A;  3UR3 C;  2BOP A;  5H9F K;  2BVZ A;  1KP6 A;  5GAD I;  5K8O A;  1S77 D;  1RHM B;  4ZP6 A;  2J9D A;  2QC3 A;  3TNV A;  2VD3 A;  2PFD A;  1FE4 A;  2DR8 A;  3MWB A;  1X4E A;  3GFX A;  5EWG A;  5F9N A;  3CDB A;  2WB4 A;  3CCM S;  5KFW A;  3M30 B;  3MR3 A;  2EBG A;  4EBD A;  3QGP A;  1UL3 A;  1Q82 T;  2AYB A;  3D68 A;  4FS2 A;  3RB6 A;  3D6T B;  3OJS A;  4DV5 J;  1KLM A;  3G82 B;  4R5P B;  2R2U A;  4I6A A;  5LT5 A;  1VRT B;  4FNH A;  2A10 A;  4AFF A;  4KPY A;  4E98 A;  2M52 A;  4PWU A;  3R6G B;  4A8S A;  3POT B;  4LRD A;  2HRY A;  2EXU A;  1S6P B;  3LWM A;  4X4P A;  4UY8 T;  1EQ0 A;  5C25 B;  3Q22 A;  1LQ9 A;  4GKJ J;  4X4U A;  1HMV A;  2XYP B;  4CLT A;  2O01 C;  3W8P A;  4KKO B;  4USK A;  5A8R B;  2PFF B;  3P96 A;  1WC5 A;  1T05 B;  3TJ9 A;  3OPK A;  2XY5 A;  4FNI A;  2B7C B;  1IM4 A;  2ZH8 A;  4OLP A;  2NUH A;  4G3I A;  1U6F A;  1MRO B;  2GJI A;  2ZKT A;  1G4C A;  5HMX A;  2VON A;  4ZPT R;  2E9T A;  1UP1 A;  2L9N A;  2EPI A;  3KFW X; 
#chains in the Genus database with same CATH homology
 5K20 B;  2H4W B;  1RHK B;  4LSZ B;  3R7S B;  3KJQ B;  3QNW B;  3R5J B;  1BMQ B;  2HBZ B;  1RWK B;  3R6L B;  1PYO B;  2HBQ B;  2CNK B;  1RHJ B;  3R7B B;  1RE1 B;  3KJN B;  2XZD B;  3D6M B;  4DCP B;  5IC4 B;  2CDR B;  3RJM B;  2CNN B;  2QLB B;  1SC3 B;  4ZVR B;  3D6H B;  3P4U B;  4DCJ B;  2CNO B;  1RWM B;  1RWO B;  2C2O B;  1RWP B;  1RHU B;  2QLF B;  1SC1 B;  2H4Y B;  4ZVU B;  2FQQ B;  3GJT B;  3R6G B;  1RWW B;  4ZVO B;  2QL7 B;  1RHR B;  4DCO B;  3IBF B;  3KJF B;  2CNL B;  2Y0B B;  1QDU B;  1RWN B;  4ZVS B;  2H5J B;  2CJY B;  3NS7 B;  1PAU B;  2XYP B;  3EDR B;  2HBR B;  1ICE B;  2H54 B;  2H48 B;  2H51 B;  3GJS B;  2XZT B;  4ZVQ B;  3IBC B;  2Y1L B;  1RWX B;  3GJQ B;  3R7N B;  2DKO B;  4JB8 B;  2HBY B;  1QTN B;  4ZVP B;  5IC6 B;  1RWV B;  2XYH B;  2CJX B;  3EDQ B;  1I51 B;  1RHM B;  2QLJ B;  2QL9 B;  2H65 B;  1NME B;  1RHQ B;  2QL5 B;  3D6F B;  2P2C B;  1F9E B;  1I3O B;  2C1E B;  2H5I B;  4ZVT B;  3SIP B;  2C2K B;  1SC4 B;  2C2M B;  2XYG B;  1IBC B;  3P45 B;  2C2Z B;  3GJR B;  1GFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...