1OPZA

A core mutation affecting the folding properties of a soluble domain of the atpase protein copa from bacillus subtilis
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGYHVVIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A core mutation affecting the folding properties of a soluble domain of the ATPase protein CopA from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Potential copper-transporting ATPase
total genus 15
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1opzA00
2XMKA 5B0AA 2ZDOA 1Y9OA 3HHLD 1Y3JA 2OAUA 2FTRA 4EFAC 2FIUA 3MZIA 2Q3PA 2ROPA 1MWZA 1SQEA 5A6PA 1U7LA 1QUPA 1OPZA 2ASYA 2CRLA 1SI9A 2QLXA 5F0UA 4HH0A 2W4DA 2VV5A 3HDSA 3HFKA 4NL5A 5K9FA 3IWLA 3HHLC 2BUNA 3FRYA 3DXSX 1RJJA 2GCFA 3QMQA 2OP5A 4ZOSA 3VTIA 3HX9A 5B0FA 2LDIA 3HHLB 1FD8A 1XBWA 1TUVA 1YJRA 1Q8BA 1YJUA 1FE0A 1WD6A 5T7LA 1GXUA 4NPOA 2GO8A 1LQ9A 3I9ZA 3F44A 5IXUA 1K0VA 1S6UA 4HL9A 2G9OA 1KVIA 2AW0A 3HF5A 2XMUA 2BYCA 1P6TA 5T7LB 3FMBA 3LO3A 1JK9B 1TL4A 3TNVA 1S6OA 1N5TA 4Q2MA 4DL0C 2K7JA 2HLTA 2N4CA 2W4PA 2XMJA 3WDOA 2FHMA 2PD1A 3IWXA 4HI1A 3FGVA 5KAKA 2GA7A 2GV1A 3K7RA 3BB5A 3MCSA 2KT2A 3BN7A 3BM7A 2HIQA 3QGPA 3TOQA 2AJ1A 2RMLA 4A47A 3TRGA 1X7VA 1ULRA 4OJHA 1FEEA 1X8DA 1Y3KA 2LQBA 2OKQA 1TZ0A 2ROEA 1KVJA 2K1RA 2BJEA 2GFFA 4OJ3A 2HQIA 4A48A 2HLUA 2XMVA 1CC7A 1TR0A 1OQ3A 1SB6A 2IYGA 4U9RA 3BGUA 3KG1A 4DN9A 2LQ9A 1APSA 4Q2LA 3CJKB 2FB0A 2KKHA 3KKFA 2GGPA 4OJ1A 2JDJA 2KT3A 2N4DA 1MWYA 1YJVA 4OJGA 1FE4A 2PGCA 4DPOA 3KNGA 2OMOA 2ACYA 2QYCA 4A46A 5B0DA 2XMMA 1KQKA 1R6YA 2AJ0A 2OFGX 1FESA 1AFJA 3DCAA 1Q4RA 5B0GA 3KG0A 1CC8A 2IYIA 2OD6A 2RU9A 1X0PA 3E8OA 4FNIA 4OIXA 4Y2IA 5B0EA 5B0BA 1GXTA 2EW9A 2QLWA 5B0CA 4HH1A 2OFHX 2HFNA 4F67A 4A4JA 2LXFA 1VQYA 2GGPB 5F0WA 2XMTA 2AP6A 3BF4A 1AW0A 3LGMA 1OQ6A 1YG0A 2BBEA 3T9NA 2K1RB 1W2IA 2ROGA 1CPZA 2ZDPA 1URRA 2VH7A 1N5SA 4QOTA 1TL5A 3CJKA 1Y0HA 2HFOA 5B08A 1AFIA 1OSDA 1JWWA 1V3ZA 2BJDA 1VQSA 2KYZA 2QIFA 3LGNA 4Y2KA 1YRXA 2RSQA 3UDCA 2K2PA 4ZA1A 1FVQA 5A6WA 1FVSA 3BDEA 4HI2A 2W4CA 1Q8LA 2RILA 2N7YA 1YJTA 1N5QA 4Y2MA 4FNHA 1Q53A 3HHLA 3BR8A 2K7KA 1IUJA 2L3MA 2XMWA 1N5VA 4YDXA 2IFXA 2OD4A 3GZ7A 5B09A 1P8GA 4YEAA
chains in the Genus database with same CATH superfamily
1N6QB 4B08A 4P2SA 5BXIA 2R7RA 3GCXP 2PA3A 5HSPA 2G1HA 3CJ2A 2ROPA 4MFBA 5A6PA 2JEJA 5KG2A 4DV1J 3WZ0A 3W9IA 3GFHA 1GFWB 1RA7A 1WTBA 5HLFA 2OEMA 4ELVA 1FA0A 2XB2D 3AAWB 3CMAS 3B4MA 5E3RA 4NL5A 2D3O1 1S77D 3Q83A 2F4FA 2F5GA 2YQ3A 4GVLA 4KHPF 5I42B 5DQIA 4I7FB 3FBFA 4OHWA 3R5CA 1NK7A 2R8JA 2LDIA 2V94A 4PYAA 1XNQF 2OPPB 1TUVA 4P2XA 4QIWD 2J7UA 3UN3A 4I7FA 2YWEA 2E7WA 4OYIA 4NMXA 3OFGA 4CO0A 3PFOA 4MAKA 4LRDA 3IRXA 2HFVA 4LF8J 2ALYB 4ED2A 1S59A 2IMOA 3UNGC 4DR6J 3G8QA 4K5SA 5EWGA 4HVZA 4LR9A 1TMJA 3D0IE 1HYSA 1ROFA 2C3YA 4LREA 4IOCQ 2ASLA 4ZPTR 1BD6A 2HIYA 3LOUA 4FVMA 3CB4A 2D9PA 4PEOA 5L9XA 2BJ9A 2QJ3A 4WFYA 4TU7A 2C42A 1YX2A 3R5BA 3MM6A 4CLWA 5KAKA 4Z37A 2MKJA 1C0TB 3HKWA 5BYQA 2R7SA 3TX0A 4CM0A 1EZZB 4OZ5A 5LMUJ 4ZVFA 1E6VB 3Q8UA 4OFZA 5MLCV 3DDIA 1DTTB 3MD3A 3H5XA 1NH8A 1M5OC 2DHAA 2CDQA 4OZJA 5H9EK 3T6JA 3SCLE 4JI7F 1VK8A 3NGUA 4C11B 2JJ4D 4DN9A 2FY8A 2RIJA 4HHHA 3BJYA 3CPWR 4B9VA 2YH1A 2CPEA 3IR5B 4DBQA 1LXJA 4I69A 1VDHA 1S9EA 3MM9A 4ES2A 4F4AA 1ZZNA 3KUHA 1OYEA 1U0HB 4H4MB 5HMXA 1YGYA 1V5VA 2HRUA 2GVDA 1AZSB 1T0TV 2BANA 5FDLB 4GC6A 1EP4A 3PACA 5EX0A 2QYCA 1RTDB 1UAWA 1APSA 1LV5A 3KJVA 3K59A 2HFZA 2O1PA 1WOPA 5C42B 5J2NB 1JKHA 4WFAQ 4DV5F 2F7VA 4FF1A 3V6KA 1TAQA 3I82A 1KFSA 5B0EA 5F8NA 2CFXA 3ENQA 4NYOA 1VQKS 4KAIA 2K3IA 5SUHA 2ZUGA 1VQYA 1OY6A 3C66A 2ABYA 4TU8A 3WX4A 5J1EA 4UUWA 4I67A 3J81Y 4ZIVA 3M8WA 3L9ZA 2COLA 4C8ZA 4USUA 2VFVA 1TVRB 4R0EA 3MPWA 4CLKA 3W8PA 2KB2A 5D6GA 1RT7A 2ZJQQ 1CULA 2OPRB 4IUFA 2WSCC 4OL8A 3E51A 4UOCA 1Q7YT 5HANA 3C3LA 2ZZTA 3SCIE 1IR2A 4ZPCA 2LQ8A 4FYXB 4DJBA 2HFSA 2XY7A 4KGKA 3N6MA 2VQEJ 1FVQA 5FLXU 3MPDA 4P52A 4DL4A 3BDEA 1HWUA 5F3ZA 5LSOA 2KG0A 4ECZA 1S76D 4CQ1A 2I2YA 3C2PA 3HHLA 2CJYB 1AROP 4G6VB 2P6SA 4U95A 2AJ4A 2EC0A 4LFBF 1JJCB 2XSFA 3AOAA 3NL0A 2JSXA 2ZVIA 2OD4A 2RRNA 1HNVA 2NUHA 3D5MA 4O3RA 2VC1A 5EDWA 4MJKA 2DJWA 2NSBA 2CJKA 1ICEB 3D1OA 3BSNA 5A8KB 1LFPA 3O5TB 5FLXY 2GZOA 1PYSB 3FEZA 4FS1A 2XWYA 1VRTA 3H20A 1Q0NA 3MEGB 2UUBF 1RT6A 5A8RA 4UQGA 3SQGA 3PX6A 2OSQA 2M52A 1R7IA 3W9JA 1S1XA 1IBKJ 1CJUA 1HPZB 2YKMA 3M6VA 1KC8T 5DGAA 5KT3A 1ZETA 1DZ5A 2VPWB 3G8TA 3RR8A 3IWLA 4A8QA 2XS7A 2BUNA 1RADB 3Q8QB 3H8YA 2HRYA 2IJNA 2XCAA 2ZHBA 3Q24A 5EGYA 5B0FA 2DITA 5GAEI 1JMTA 2BV3A 2LMIA 1GAOA 4BLGA 2DRDA 2CJQA 2HZVA 2DPJA 3NXZA 4QWEA 1S48A 3H2UB 2MZRA 3RBEA 4CT8A 4DR4J 1NDPA 1JLAA 3M30A 4IOBA 4PKDB 5K20B 1JXLA 2BJ3A 3TNVA 2DHHA 2LQ5A 3MMCA 2XC9A 2VODA 3JTPA 1IKWA 1U47A 5HL7Q 5ITHA 1KLMA 1HQEB 1NXIA 2DHXA 2XMJA 3RYLA 2JVRA 1UW9A 5AE1A 1FDAA 3DU5A 1LWXA 5KFWA 3KLHB 4B3TF 1MNEA 3NWRA 2D69A 3MR7A 4JBCA 3VAJA 4K4WA 4JYAF 1TL7A 4U6PA 1Q78A 4FXDA 1SIZA 2V68A 2WW4A 1YLXA 2WVCA 1DURA 1FKOB 3ZZOA 5HJXA 3DXBA 4F4ZA 1SB6A 3BDPA 3C14A 4QR2A 3W64A 3W60A 3NKYA 4YY3J 3NNHA 2B6AB 2KKHA 2LCWA 1HNIA 3MAAB 1J5OB 1KRPA 2UXDF 1QUVA 4M5IA 3W2WB 4J91A 3MF5A 1KS2A 5HJYA 5HMZA 1KLNA 2IRYA 1GMUA 3PTWA 1U0SA 1YBUA 4S0MA 3RBXA 3CVKA 1D1UA 4IRCA 2KFYA 2ACYA 4KB7A 4MKYA 1Z1ZA 3KK3A 4K2XA 2PN6A 4ZCIA 3ILOA 3JS9A 5DQGA 1KHVA 1UFLA 2EFOA 2DGWA 3DLKB 1Q4RA 3DDNA 4NYPA 4RX6A 4OZ2A 1WI8A 5A0YA 5C5JA 5KFEA 2ADCA 4B17A 2QLJB 4Y6IA 4PCQA 1UJ4A 3M8SA 2FY1A 3PG9A 2DT9A 3M6UA 1IR0A 1H2UX 1S12A 2QLWA 3AB4B 4OI4A 3V4IB 4DR4F 4Y3CA 3JQMA 3L4BC 3MEEA 2PMWA 5AT1B 3PXGa 1PIEA 1PJ7A 3G6XA 2ZJRQ 5KFRA 4P2MA 2ZM6F 2BKNA 1RAHB 4HTJA 2YWWA 1B0VA 1B3TA 2HKEA 3BGRA 2BBEA 4KV8B 1UVMA 2WCXA 1TP7A 3DN9A 2AHOB 3DLEB 3CJ3A 4A8KA 3K58A 2AQ4A 3MTKA 3ZTSA 2VPZB 5ETLA 1HW9A 1HA1A 2IRXA 2MEWA 3TVZA 4FZVA 3L7UA 3W5ZA 3ZTOA 2ASDA 2HAIA 2I8EA 3EDRB 4LFCJ 1C1CA 1ZBTA 1EARA 3K2YA 1KOHA 2KYZA 4K8RA 3R1LA 3UDCA 3EZOA 2YKNB 2IJFA 4ZA1A 1UPPA 3VGTA 5GAHI 3UVJA 4PUOA 2RILA 1JLEA 4PXDA 4Y2MA 4FNHA 4CWBA 5KT4A 3GSDA 2DR7A 2DXFA 3AOCA 2QMXA 1IUJA 2L3MA 2RJZA 4ED0A 2CQBA 2C28A 2QN6B 2YX4A 3DGVA 4EBCA 3ENWA 1LK7A 1NPRA 2VJVA 1BLUA 1IQTA 3WBZA 2IM1A 1S10A 3MEKA 4ZLNA 2KVQE 2V8DA 3G82A 4RW6B 2DNPA 4KTQA 1RABB 2UUCF 4HACA 2IDEA 2WRMA 2VOPA 4KC5A 3PDNA 4ZVEA 2SXLA 1RHMB 4XPCA 3TAQA 3W62A 4X4OA 2F63A 1WOSA 1QUPA 1VCTA 2CRLA 4ZP8A 4B9LA 1KHWA 1T3NA 4B3RF 1RWPB 2J9DA 2P9EA 2RQ4A 4H4KA 2FVSA 2UVWA 2Z2ZA 2X7IA 3HHLC 2WVDA 3TAPA 1PYTA 2RB7A 4IG0B 2BX6A 4J9UE 2XGQA 3GILA 4B9MA 1BQXA 3HMJG 1FJGF 1RAEB 2YWHA 5A2QY 2W24A 3D66A 1B70B 1NZAA 1RT3B 1RAOA 2KG1A 2BQUA 4DR2J 3A3PB 3V6DB 3K8WA 2BRLA 1H3DA 2GQ2A 3JYTB 1YJWS 2YNGA 4KGMA 4K4YA 2C2KB 3GJQB 4QU6A 3VAIA 4KGZB 2GVZA 1N5TA 1X9WA 1ITPA 1HBMA 5D0GA 2N4CA 4OV6A 1P1TA 1T3OA 1GMVA 4ZDNA 5KFNA 4FBTA 4Z7CA 1HW8A 2GA7A 3AXKA 3VVUA 4OZLA 3PJ9A 5K8NA 2DH8A 2FVQA 4UOFA 1IQZA 1KFDA 3CJ4A 3CT9A 4U67Q 1BC6A 2DKOB 2FVRA 3DLGA 4OV1A 1PSDA 4GVBB 2G13A 2UUCJ 1S4EA 3PEJA 4OJ3A 4X4QA 3MEDA 5A8WA 2N3LA 4GVBA 1TUWA 4W4MA 2X51A 3UDLA 4DXLA 2CPFA 3CJKB 4DX6A 3CJQA 4Q44A 1SJQA 3IG1B 5LM7E 2H54B 1HI1A 3KNAA 4UF4A 5ETKA 1ZS6A 2RD5C 3DRYA 4NXNF 2W8LA 2DNGA 2WBRA 1U0HA 4H4MA 2PMHA 4YR2A 5GAHU 2XMMA 2DRAA 1T9UA 2Z2YB 2LVWA 4WPAA 1YIJS 5DJBA 4R5PA 3EPGA 3E3XA 3L7PA 4I64A 4IO1A 3FMWA 1WF2A 3CJ8A 3Q89A 4RWWA 5B0BA 1JLFB 1VRUA 3OVBA 3RAMA 2F9DA 3US5A 4HLBA 3N6LA 3AQOA 2OFHX 4DV4J 4D3GA 3I4HX 3P5TL 2BABA 2LXFA 4UQTA 2HNZB 3TZXA 1E6YB 1YKWA 2RNEA 4DFMA 1CULB 1CJUB 1HPZA 2OPRA 4OI3A 5M2PA 4JI1F 3IS9B 1CQNA 3QYYA 1YG0A 3M1VB 1QAJA 2QSWA 2B4OA 1FRHA 2OJ3A 1DQ8A 3RRGA 1KTVA 1CPZA 1UMJA 4NX9A 3CSKA 3THPA 1VQMS 1FNMA 3RR7A 4QYZK 4LBIA 4BC7A 2EKYA 1M5KC 5CABA 3CEDA 4RU9A 3NS5A 4HDHA 4XPEA 2B9WA 3FDSA 4TXSA 4IH6A 2EFPA 2DGSA 1FDNA 4QWBA 5E3PA 2DHGA 5I3QA 1FRIA 4PWWA 3M4XA 1UVIA 4HI2A 5HBMB 1C4AA 1VQ7S 1VQPS 3GIIA 3IMQJ 1W7WA 1RT5A 3SV3A 1N36J 4OI2A 1JLCA 2O67A 3BR8A 3NOGA 4YUDA 2CZ4A 1AUDA 3Q2SC 2FVPA 3W8GA 4ETXA 4C2MA 3UI3A 4JV1A 2DR5A 4FVCA 3LP2B 4MT1A 2FGOA 3KDNA 5KFJA 3W3SA 2G4BA 3K5PA 2BKOA 2C2MB 4JV0A 4OYAA 4EYIB 5DDRC 3OQ2A 2Q6CA 3HHLD 1TKTB 2LKZA 4NLXA 3T1HJ 3ZTQA 4L74A 3U27A 5KT6A 4UT4A 1D9DA 1S99A 4FYDA 3KDOA 2DCLA 4IYQA 2RU3A 2W7OA 2EEYA 5LXRA 5IT9U 2H5IB 4JV2A 3CE8A 1HQUA 2D3ZA 5DM6Q 4PZVA 4NLPA 4PPDA 1FTRA 1X4CA 1NZ8A 2LXIA 4ZOSA 2PE8A 4I6AA 2L9WA 4IQMA 4C97A 1I94F 2PI4A 1XBWA 2VOOA 4ZN3A 2QG9B 1FE0A 1GT8A 1RWVB 3SI8A 3A8JA 3FKBA 1S6UA 1XR7A 2DNRA 2J76E 2VJUA 3HSGA 3VAMA 2GVDB 3FMBA 3DMJB 3GG1A 3PNIA 2LQJA 1R89A 2OPPA 4DOZA 4DV3J 4DL0C 3QFWA 5KFDA 2BQ3A 2DIVA 2V69A 3KK1A 1QVGR 2MQPA 2VHGA 2MSSA 4NLRA 4U8YA 5A2QU 3C15B 2AEMA 2ZE2B 3D6HB 3R5GA 4BC9A 2FPHX 1N48A 4F4XA 4EI2A 3DLJA 2IIHA 4F26A 1VQLS 2BE9B 4F36A 2K06A 4EZ6A 4OZ1A 3DC2A 2GNKA 3VAHA 1NJXA 3MAQA 3LA0A 3N6NA 2OKQA 1K1SA 3PR5B 3BH7B 4X64J 1VQ8S 5LSLA 2M8HA 1UVJA 2C3UA 4RUHA 2G2OA 2HLUA 1FXDA 3KJQB 3HPOA 3SYZA 9ATCB 1S9GB 1IN0A 2N82B 1NSKL 3G96A 2AZ1A 3QATA 3PW5A 3H25A 4I2QA 3PR4A 1B7YB 1FKOA 2CQGA 5CHCB 1NMEB 1LWFA 1TV6B 4XDCA 4CH1A 3PIOQ 1J5OA 2NXCA 4TLQA 1RYRA 2OFGX 1AFJA 4CO2A 2XS5A 2J0WA 2D3OR 3KG0A 2YY3A 1S0NA 4OIXA 1IBMF 1X0PA 4DQIA 2DGQA 2QT7A 4RUBA 2XYGB 3CJ5A 2CNKB 4RJVA 1SJ3P 2HHTA 4FKXA 2HW3A 3BGRB 3ONQA 3I5AA 4FDFA 1GEHA 2HFNA 3CJTA 5E3AA 5CCLA 3DLKA 5A0YB 2DTJA 3TI0A 4J5OA 3BO4A 1YZ6A 3MMCB 2CG8A 1UP1A 2HVDA 1QJHA 3ZZZA 4DX8H 4OMFG 4YQWA 2P8IA 2ZM6J 1FDBA 4JI8F 2WZ1A 4I4BA 4CLYA 1UA1A 3QJJA 1MLAA 2VH7A 4KY3A 2GIQA 1PJ6A 1AB8A 1UETA 1JNZB 1ZM2A 2BACA 2K3KA 3O44A 3PCOB 1Y0HA 3K89A 2Y0BB 4DDFA 2G0JA 2VFTA 3T1YJ 1QVFR 2MDAA 4PQUA 3P96A 3FNNA 4TVAB 4WYLA 2IRUA 2RH3A 3QWUA 4H4OA 4K4XA 3GONA 4DL5A 1S9FA 3VALA 2H3EB 3BGOP 4OZ3A 5KG5A 2MB0B 1SIWB 3VAGA 1F9FA 1IBLJ 2IBKA 4JI1J 3M8PA 2Z0GA 1T9VA 3OHBA 3LP0A 1WI6A 2EVZA 4YDXA 4DFPA 2D9OA 5E33A 1HBOB 4QWDA 2XULA 4CRJA 3TJ9A 3GCWP 5DS7A 3M8ZA 2A6OA 2AYGA 1HNWJ 3ISZA 2ZDOA 4OI0A 5DQHA 3GTYX 1M1GA 2LA4A 3RB0A 1SBRA 3LAMA 3FSIA 2VC0A 2Q3PA 3RBZA 2EFNA 4RLEA 3U02A 4AT1B 5H1SV 3CF5Q 4AE5A 3IR6B 2J5AA 1QDUB 4QYRA 2NPFA 4ES3A 2AYEA 4N47A 4RW9B 3OTEA 3UN5A 4WKRA 4AFFA 2FJAB 3HFZB 3CXCR 2DY9A 2VV5A 4KO0B 3BSAA 1NSPA 2R3VA 2Z56B 3TZYA 1H2VZ 3CCTA 4Q5VA 1O0PA 1GXLA 4DPUA 3ICLA 2UUTA 3MDFA 4KO0A 2NR0A 4ECWA 2YNIB 1RLDA 3NBPB 2MZSA 4DQSA 1BXNA 5A8KA 1NLKL 1PBUA 4EEYA 4G1IA 1FD2A 3PV8A 4USTA 4ZVTB 3GMGA 2PFFB 5D0EA 2NXEA 3V81A 3OD2A 4RU2A 4O3SA 1RT3A 2B0GA 2DD8S 4ER8A 3TARA 3UNYA 1KVIA 4LRAA 2GAGC 3KLFA 1UEUA 2MYFA 1YTYA 2QEXS 3TAMB 3VWSA 4X62J 4UOGA 1FK9B 3KLIB 2GC8A 3PRDA 1VQ5S 4N8NA 3M2VB 4RNOA 4EBEA 4NXMJ 5KFAA 2PD1A 5THWA 1FNOA 2PSZA 2CZ9A 3C6TA 2R8KA 4C8LA 2M5YA 1NB7A 3K7RA 2AF6A 3A12A 3MCSA 4GRSA 4MYUA 4HHJA 3PX4A 2PEHA 2V4JB 3AJ1A 3AOBA 3R7BB 4ANEA 1W25A 4DV2J 1SJRA 2EWHA 1GQEA 3MEEB 4M1KA 1WDDA 4OZNA 5DDOC 4DR7J 2HHWA 2VPXB 2HYIB 5I3UA 1QD1A 3PRVA 5E0OA 5GVQA 1HNZJ 1H7XA 1REVA 4ZVHA 4LF1A 1CC7A 5KFKA 5EWFA 1D8YA 2NXUA 1W26A 4NEZA 1CBKA 2XNQA 3DLGB 3FQLA 2H5JB 4KH0B 4USMA 2N7CA 2W01A 4M5NA 1VRQC 5LL6d 4CLZA 1N52B 1BHNA 3OLBA 1KN6A 1I3OB 2IC3B 3OUYA 1MWYA 3ITHB 1BE4A 1OIAA 3JQJA 1Z4UA 3FCHA 4P74A 1JLFA 2B43A 3ZTPA 4A46A 2DR9A 2Q66A 3LP1B 4YB5A 4YDDB 1R8CA 5T14A 4DFKA 3GP9A 3JSRA 3UVJB 1UA0A 1FWLA 3BZQA 1TFWA 3A3NB 1IBCB 5ETMA 3ZFVA 3GYXB 3SDEB 1VC5A 5KFQA 1RT2A 2DXDA 2HMIA 5D4OA 4ECSA 1N33J 3IBFB 1FKAF 4X4UA 1RAAB 4RW7B 4A4JA 2C2RA 1OYDA 4CYUA 5ADZA 2MLZA 4Q45A 2VPYB 2GX8A 1EQ0A 1WTFA 3GIJA 4TU9A 2NZ4A 1AW0A 3CC7S 2WVEA 3E01B 3H5UA 3I31A 5M2RA 2CQ3A 2HZCA 2K1RB 2LA6A 2J8SA 3R3TA 4MFBB 4O23A 4JUZA 4DEZA 1QLNA 2HNYA 4TY9A 3TQ1A 3WC2A 5HATA 2ZH8A 2MPUA 4QOTA 1RTIB 2YKOA 5B08A 1CJVA 2Q43A 2RQKA 1CEZA 1MWQA 2KZZA 2WSFC 2ZJPQ 1LWEA 2X1AA 5DRKA 1AUSL 3NCQA 4DZ6A 2W4CA 4Q8FA 3CD5A 2HK2A 2ZEJA 4YOEA 3A3OB 3N28A 3ZNUA 1VBKA 4LRFA 2QFJA 4F4KA 2I6WA 3RB3A 2RKIB 2O01C 4J9PA 2R2UA 3ETMA 3FCWA 2YKNA 5B09A 1HL6A 3MTJA 4X4VA 2RKIA 4XK8C 2ZC3A 1N33F 4EMDA 3MR3A 3MPUB 3CDEA 2I5JA 3I32A 2R7TA 2UUAJ 4NLVA 2BZ2A 2FD2A 3FBEA 3AH6A 4F4YA 1G1XA 5KFUA 2R42A 4J9MA 1SQEA 2CQHA 2UUWA 4USHA 1ZAWA 4IFYB 4IR1A 1OPZA 5J1NA 2XO7A 3R2CJ 4WU2A 4RW4A 3BGLA 4QPXA 4FF2A 2JZ5A 4ZP9A 4RL1A 4CYUB 2HGMA 1VQNS 5G0RA 1YITS 1WC6A 2ZH6A 3QZ7A 3EGNA 2F8HA 2V5HG 2HNDB 1PAEX 2CXEA 3FRYA 5IT0A 2OP5A 3PW7A 3UDVA 2FC8A 4IG3B 4WCEQ 4M63A 2YKPA 1SKUB 3TAMA 2RHQB 1WC5A 3G82B 2GW8A 4P10A 4YB7A 1HBUA 2DNHA 5D4NA 1N6QA 1DY3A 3SQOP 5CYMB 1LQ9A 3OV7A 1K0VA 3OL9A 1HWIA 1FERA 1S0VA 2AW0A 1WACA 1V6HA 2Z8QA 3D0GE 1ZM9A 3E01A 3H2VE 1U24A 2E5JA 1DQAA 3QO9B 4V1Ak 4BHQA 2DNLA 2QA4G 5HLFB 1FFSB 2BE7D 3IBCB 1OJ4A 2G2ZA 3WQPA 4DPXA 4IDKB 4KGVB 4H54A 2CQ2A 3C46A 2DEIA 1NHUA 4X66F 1WC3A 2XSJA 1HBNB 3D6TB 2QLFB 2KRBA 4OX8A 1IJEB 1VRUB 3R8YA 1TL1B 3FK4A 3JSMA 5DLGA 2W2NP 3C16A 4UY8T 4FYWB 3B82A 1D3WA 2RRBA 4QIFA 3G6YA 4ZS6A 4J9QA 2E5HA 4LMZA 1X8DA 4WE1B 1U1NA 4LF7F 4OZ0A 4XDDA 4RNFA 3HVWA 4DV6J 1YI2S 2CUYA 1ZM4A 2MKCA 2XMVA 3CIMA 3IFEA 3UW1A 3HVRA 2MQ8A 3L7OA 3EGZA 4WF9Q 5KT7A 3DYAB 5B7WA 2GGPA 1ZA1B 1IBKF 4AQYJ 2QZ8A 4YHHF 2N4DA 4L3KA 5LT5A 2K8GA 3MMJA 1SL2A 3PFEA 4JV5J 1RXOB 3H4BA 1RTJA 3D3BJ 5B0DA 4DV7J 3A13A 1MROA 2A3JA 3BKUA 3Q8YA 2EFVA 4B9SA 3ULHA 3RG6A 5HBMA 1FESA 2ZBPA 2V4JA 3S7RA 5IM0A 3EYZA 3WDOA 1R0AA 1RT4B 2GS8A 2R2RA 2WOMB 5EUHA 3H40A 3SEOA 1TELA 1JLQA 2HVEA 4CP5A 4YB6A 2E1RA 1V5IB 3GFZA 1R0AB 1LK5A 1S1VB 1WC4A 5F8MA 3DGPA 1F3FA 2KU7A 4L6V3 5F0WA 1WC0A 5LXYA 1YK9A 1UEKA 2Z57B 4LSZB 1X4GA 2FJWA 5D0RA 4C4WA 3THTA 1RHJB 3MOZA 2V2ZA 3HJVA 1K73T 2KVIA 1VMBA 3CMQA 2JOQA 3TEGA 2IVYA 3JXOA 4KKOB 4KBIA 3Q2TC 4DV6F 1E6YA 1XJWB 3WX8A 2YX7A 3MECB 2C2DA 4PXEA 1S1XB 1IWAA 1UCNA 2V8PA 3BS9A 3RZAA 5JJBA 2JH3A 5DM7Q 2D41A 1TAUA 2JVOA 2OEJA 2JFKA 3KHGA 3M6XA 4KSEB 2APOA 8RUCA 2MGZA 4QWAA 1SJFA 3KLHA 3HI9A 2AWZA 4K4SA 4ZPDA 3W2VB 2GQCA 3NAIA 1N56A 2W25A 4ZVOB 2K7KA 1Q8IA 4J9RA 1C0UB 1PKUA 4ID5A 2IA6A 2UU9F 2EFQA 1X9SA 1V3SA 2AKWB 2CKWA 2IVMA 2ZOMA 4QWCA 4C48A 3GE9A 2NXNA 1HBMB 2ZVSA 3NG8A 4DV7F 3M32A 2MHEA 4P72A 1JJ2R 4DCOB 3QAEA 1Y9OA 4ATNA 1QAIA 5F3TA 3SCKE 3NP5A 1P9QC 1I1GA 2KHCA 2AJQA 4DV0J 2FLLA 1RWKB 1QE1B 4Y00A 2OPSB 3BEGB 1L3UA 3GPAA 2EK6A 4TNOA 1X4DA 2EG2A 2H48B 4ZCLA 4RNNA 4YR0A 3KUGA 4GO5X 2W9BB 3W7BA 1EAYC 2B4UA 5F0UA 2YNIA 2HK3A 3CD0A 4H4KC 2H51B 4LVOP 5L39A 5KFYA 2HS4A 4RO0A 3OTBA 3HT3A 2OELA 3F73A 2QRRA 2KZMA 2GCFA 2VUGA 2W2PP 2DGUA 3W63A 4B9TA 4LSNA 3QLHB 3TW0A 1DHMA 2O5DA 3HX9A 2VG5B 2QLBB 3AD9C 1U49A 2VA2A 4OYPA 1J2VA 4KHRA 4A8MP 3C19A 3T1YF 1FJGJ 1U02A 2GO8A 4N7TA 4LIWA 2ZZMA 2FJDB 3TUPA 4L76A 3DLLQ 4FYYB 4DR2F 1JNRB 3G6VA 4X4RA 5I3PA 4MKVA 1WG4A 2K7JA 3M8QA 4ED8A 1Y11A 2R8IA 1UVLA 2HNYB 1FJ7A 1Y5IB 5LOQA 3IWXA 1VJQA 1DTQA 5K8OA 4I1TA 5KT5A 1TFYA 2AT1B 2J0XA 4M5JA 4YS2A 3W2WA 5HQ8A 1S7IA 3NAHA 3UCZP 4E2FB 2GO9A 3MM7A 2PDAA 4P73A 4NLUA 2IAJB 3M2UB 4BS2A 4PUOB 4P7TA 3KK3B 1RT7B 2I0XA 2M0GB 2G0CA 3AJ2A 1TZ0A 3B4DA 2VZ9A 3MMBA 3UE2A 3D68A 3CC2S 2HAFA 3CCJS 1J5EJ 2J9DE 4LUBA 3JAMY 3GIKA 1HWJA 2L9DA 1CS4B 1RK8A 4J7CA 3GB0A 1GMWA 3NRBA 2FB0A 2KHDA 1R43A 3KKFA 2DR8A 3SCJE 3Q8RB 2BA9A 1ZZFA 2R8HA 2F9JA 4NA3A 1ZH5A 4C8KA 1UJ6A 1SKWA 2CJBA 2OMOA 1RHUB 1RHQB 4DSFA 3HJFA 1RT5B 2WVFA 2PFDA 2XHWA 5K5MA 2MJNA 4LT6A 3TJ8A 2XMAA 1B7FA 4EO6A 3H0PA 1NK9A 3TA2A 4K2JA 2OHDA 1TL3A 3J81j 3CCWA 3DRPA 4CT9A 4Y2AA 2AGPA 1GXTA 3JSYA 5B0CA 4CTAA 2HBZB 5HQLA 3L95X 2GMLA 2W8KA 3BQ2A 1R27B 2U2FA 4ZITA 3FC9A 3LAKA 4KPYA 2B7CB 2LECA 1VK3A 2Y3YA 2AD9A 4ELUA 1NDLA 3DFEA 3V2UC 1SC4B 2ROGA 3RRHA 3RAQA 5KFSA 4B3SJ 3GG0A 1SPBP 4UUXA 3IRWP 2XGPA 1AYEA 2UP1A 1U1RA 4C8OA 4PXCA 5GAGU 3L3CA 4CI0B 2ZH3A 1JLAB 4QR1A 5CD4H 1XNRF 2DB1A 1RLCL 4XIUA 2KM8B 1FCAA 1YRXA 2V2KA 4ECRA 3I0RA 2NUUG 3UCGA 3P49B 2B8QA 3BSCA 1IKVA 3DOMB 4ZPVR 4IFVB 2QE5A 5GAEU 2DCUB 1SC3B 4ANCA 1FTCA 5KFLA 3TWZA 2ZH2A 4A8WA 1R0CB 4NEYA 4NASA 4OYXA 4DR5F 1TKDA 1FT8A 3M30B 3NGTA 4IRKA 3ENVA 1X5TA 1HQ2A 1HNXJ 1N5VA 4DQQA 1QE1A 1F60B 2V8GA 1X0FA 2H9ZA 4EGLA 1Y5NB 1CJTB 4WKYA 4K0KJ 3VAKA 1A0OB 3MHYA 3FEXB 4WXOA 4ZMMA 3D7SB 4FP9A 2MZTA 2QL7B 2LDYA 4NI2A 3J81U 4DR3J 3HLUA 5D78A 2DBBA 2QTWA 5C25A 2Q6BA 3T19A 4DLGA 1NDCA 4ERDA 3CCZA 5KG3A 2J9CA 1N54B 1VRTB 3VGVA 3CDUA 3OXFA 3Q8VA 4NI2B 4ETZA 2VKZG 3P4UB 4WTYA 2UUBJ 2HGNA 2H65B 2HS3A 1XERA 4NLTA 3MUMP 3SQGB 1M0SA 3HFKA 4IH5A 2KXFA 2WBMA 3R6GB 4TY8A 3MUTP 3OL8A 3HXMA 2EK1A 3DHWC 3NWGA 3EGWB 3GV5B 2E9TA 5E2QA 3A8EA 3CCLS 4F8RA 5FJ4A 1HQUB 2WOMA 3QT8A 4TQRA 1X9MA 1Q16B 4DSEA 1YJUA 4JV5F 1N0UA 2VDHA 3EZUA 1D9FA 3I9ZA 5KFZA 4C7QA 3I56S 4B9UA 3HP6A 4FBUA 3OFEA 1RU1A 1RAGB 1KOOA 2O3DA 1P6TA 3OUYB 2RHSB 3CGIA 3DOLB 2DR6A 1RTHA 5KFGA 1P9YA 4N77A 2R7XA 3K5MA 2Z4PA 3LTOA 1JKHB 2W4PA 3FZ2A 3LH2S 3R97A 4JI4J 2CPHA 2DY1A 2OIHA 3K5LA 2EBGA 3R9LA 3BQ1A 3BQ0A 3K0JA 4P6QA 1HKAA 3QIPB 3HT0A 3DRRA 4NLQA 5T41A 3DOKA 3SIPB 1T03B 2F4VF 4LF7J 4LF4J 5C42A 1U1QA 4X65F 3UR3C 3NNAA 2E5IA 1R31A 1S5ZA 2V6AA 3OTDA 2H5EA 3C6TB 2Z2MA 1RE1B 1WEXA 2CQ1A 3BSOA 2F3JA 2NYIA 4IO9Q 2FUG9 4C8NA 4C0BA 2DHSA 2KT3A 3IR7B 5CD4A 1UFKA 3KMSA 3SV4A 1DBDA 1WUUA 2BOAA 2ZUAA 4G1QB 3KJFB 2RQCA 4MK9A 4G1PA 3UFCX 2HBYB 4W90B 3OFFA 3BR9A 3P5BP 1BWVA 2AZ3A 4K4TA 4CLSA 4RW8A 1H7WA 4USVA 4O3PA 4C0OC 5K8MA 4Y0FA 2HURA 4KQZA 1SQGA 4OI6A 2VQFF 1LW2A 1WHYA 4DUYF 1RTJB 1IKYB 4ZLLA 5LJ3Y 2ZZNA 1NO8A 4USWA 2W7PA 3V6JA 2Q79A 3MMBB 3VQSA 2X1GA 2VICA 1L3TA 4Q8EA 7FDRA 3I96A 1KQSR 4JI7J 1RDRA 2AYBA 2W1BA 3CJ0A 2ATCB 2E29A 5C2CA 1S1VA 2AJFE 2AP6A 3HCXA 3G6ES 3CCQS 2NREA 1OQ6A 1FJCA 2OLWA 3H42A 3M8YA 3N0VA 4X66J 1U45A 1FNXH 1AZSA 3B8HA 2BMBA 4OHXA 4RBVA 3POTA 2YBVA 1DQ9A 5KFIA 1Q95G 3JAMU 1S79A 1RT1B 4HDGA 3DDKA 1JXVA 3QGHA 4OYWA 3DRRB 2C22A 2UUAF 2UVVA 5AXMA 2VBZA 2YKAA 2W9CA 1SKSA 1NK6A 2MZ1A 2UXCF 3R5JB 1XMBA 4IH7A 2Y1JA 1XN9A 2A18A 3GV7B 4WP3A 1FVSA 5J1PA 3QBCA 2KXNB 1KD1T 1SJ1A 3K8VA 5J2NA 5KFTA 3OW2R 5DDQC 1S97A 3FCVA 4K4VA 5IZHA 4MTPA 2AGQA 1L3KA 4LF5J 4M5KA 5DGBA 3T1AA 1GTHA 4WZMA 3KLGB 4AD6A 3QSYB 2B9XA 2KRRA 3BKFA 3FSXA 3R7SB 1U1OA 4CH7A 2C3OA 5EN1A 5H9FJ 2BJ7A 4I0WA 3HD2A 3FUYA 1HYSB 1N5YA 2XMKA 1M5PC 1T11A 4ZVSB 1VHIA 5L1LA 2RF2B 4ZHRA 2J6UA 1LWEB 1HBNA 2KDOA 1HI8A 2MZJA 2N3OA 3ELHA 3K5NA 1P27B 5ETPA 3D6FB 1RWWB 5LMNJ 2X3GA 4G65A 4U7UK 4J9NA 1J5EF 4NCBA 2XY5A 1QTNB 3S6EA 1V3RA 5KFPA 2Q1LA 3SFGA 4USKA 3DXSX 1CJKA 1R6VA 3QMQA 2XCPA 3KK1B 2L48A 4JI8J 1T02A 1TL3B 3D0HE 3N79A 5IV3A 5L8RC 5CQGA 2DPIA 2X1FA 4ZCMA 1S1UB 5T7LA 3ZZYA 3T1HF 3F44A 3PM9A 4CZCA 2MQOA 4JOUA 2BR0A 4HTIA 2V50A 3EICA 1FFGB 5JVGQ 1OO0B 4PWDA 1S1UA 2V63A 5T7LB 1PAUB 5KOWA 4RWXA 3U1LA 1MN9A 2D3UA 2D74B 4DSIA 2RUGA 1S1WA 2R2TA 2XYPB 1RT1A 3OHAA 4JI6J 2WVBA 4OX7A 1FRXA 2LYVA 2YQ1A 4RBUA 4CLUA 1LOUA 3TZWA 3ZZUA 1H98A 4HI1A 1U2RA 3JQKA 3GJRB 2WW8A 3TA1A 3J7AN 3IS9A 2IM3A 4FPIA 3BN7A 1F9HA 4R25A 1NBEB 3QGPA 3AFGA 1I6JA 3M32B 2RMLA 4GO7X 4P71A 4WFBQ 1MMNA 1ULRA 1VI7A 1SJ4P 2E9RX 1RI7A 2ADBA 2ROEA 2HBRB 2DNZA 2FHKA 2FJBB 2XZDB 5LMNF 4DV2F 2AGOA 4XO0A 3J7A1 2AIRB 1BQNA 1Q5YA 1CG2A 1RAIB 3HSJA 2DNNA 1TR0A 1YWXA 1TKXB 2C3MA 1SC6A 3DM2B 2F8MA 3WIUA 3A8IA 3DLHA 2A1BA 5HMWA 2CQCA 3TO8A 1VC0A 1SXLA 3N01A 4GKKF 1QAXA 3QZ8A 3BKTA 1TKZB 5F8IA 1DLOA 2HFUA 1YJVA 2JLGA 1FE4A 3TR5A 2QA2A 2FLOA 1JLCB 1TK8A 9RUBA 4IR9A 3W9HA 4ED1A 2OTJS 1G4CA 1U6FA 4E8UA 3TYTA 4QR0A 1WWHA 1ZYQA 2WONA 4NOHA 3MOJB 1SVDA 1NHKL 1RAJA 3MUVP 5EHHA 3OT9A 2CPYA 3MM5B 1XMOF 3H90A 2UV8G 4I68A 4OLOA 4ZK7M 1VHFA 2XMTA 1HWKA 3EX7B 2EFGA 2UZAA 1T95A 3CCSS 1R3NA 2ZBCA 3PY8A 4NLGA 1VLOA 3OR2A 5KFHA 1RT6B 3EUNA 3TVYA 2BE2A 5J2QA 5J2MB 2VIHA 2CQ4A 1RP5A 2KJWA 5F9NA 4BCAA 2H4YB 3D4JA 2XWXA 3H5YA 1U8SA 5JUMA 2W9BA 4QW9A 2XBPA 3P45B 3W5YA 4DL7A 2EG1A 3PHTA 3LGNA 1JLQB 4RZRA 1JWWA 3QWPA 4URGA 5A6WA 3IG1A 4E98A 1SL0A 1GK8A 1HBUB 3IXQA 1YJTA 3UWTA 3DLBA 2I9SA 2LLZA 3AJDA 3SFUA 5K8PA 5KG7A 3OXLA 3KJVB 2H4WB 4F50A 4KRWA 4LFAJ 3G9CA 2BVZA 5KFBA 1X5SA 2W2MP 2MGZB 2FLPA 2OUGA 4LSLA 2FZGB 4F0MA 4ZPBA 2BM1A 4PG6A 1IKWB 3TX8A 2B5JB 3ILJA 2PT0A 1NM2A 2YXLA 3MGJA 2FQQB 2JRSA 2LP4A 1XMOJ 1T03A 2E7XA 4DSLA 1Y10A 4KYZA 2G1DA 1N4LA 4CCHA 3OLAA 3OSNA 4R8UA 1C2PA 3CNQP 1NB2A 3M05A 4PAAA 4B3MJ 2WB1D 1U7LA 3ZZ0A 3U1MA 1UTAA 1D8ZA 1FRKA 2CAJA 1N0VC 2GAHC 1NRKA 3BH6B 2DNOA 3GIRA 3HKZD 3RUBL 5BR8J 2AEFA 4OLPA 2ZH1A 4U8VA 4EU0A 4YHHJ 2J6SA 4NXMF 2M9KA 2I38A 2YWFA 3M6WA 1ZPVA 4WFNQ 1HBOA 3AA9A 4DUZJ 4IRDA 5KG0A 3IM9A 3ZZTA 2ZWOA 5AE3A 2ZOFA 4Z2XA 3LWLA 4DS4A 1DAXA 3UCUP 3KG4A 2VASA 1JLEB 2MHNA 3TUIC 3UD5A 1Q8BA 4NLSA 4DS5A 1GXUA 2EXUA 1WG5A 2YPYA 1HR0J 2XI2A 3PYDA 4DR5J 4K50A 3BPSP 3SSRA 3G8SA 1UZHA 2FVCA 3M2RB 5ETVA 2HHXA 2ZOGA 3LO3A 1LW0B 5C24B 3HFVA 3MM8B 3VVTA 3P6YC 3QRPA 3THVA 2HLTA 3PJXA 3TANA 3LWMA 2FHMA 4MH8A 4WP9A 3Q8PB 1NJYA 4BDPA 1C1BA 3GYNA 3HHDA 3RU0A 1SL1A 2CJAA 4PQUB 2NCKL 2MSTA 3VAFA 2XYHB 3I9V9 1FF2A 3MPVA 2PC6A 2Z30B 4X64F 5KFVA 1Z2ZA 3BBBA 3D2WA 3UDEA 3HHNB 2XY6A 3KWMA 3CMES 2A10A 2BJEA 2GFFA 1N88A 1JJHA 1NAQA 3CD7A 3KHLA 1HNXF 1NKEA 1K44A 1SC1B 3EXCX 4WE1A 4DPWA 2VA3A 3PYEA 3R7NB 3AD8C 4OJ1A 1H6KX 4LRCA 1JQGA 4ZP7A 1RBAA 1S4FA 1U4BA 1H2TZ 4B3OB 2HHHJ 1ZAVA 5BYRA 4FKYA 2GJFA 1T05B 1FEHA 1ACMB 2B51A 1KQKA 3KK2B 1T9TA 4LBHA 4WYWA 5KFFA 2CYYA 1IKVB 3DOMA 3MM7B 3AD7C 1FO1A 2J7WA 5B0GA 4ZKAA 4P7VA 1MG7A 3BN4A 4YB1P 1YRTA 2RAQA 1ELOA 1KQFB 4F3MA 3M9OB 1NKBA 5BJRA 5CZVA 5J2PA 2CADA 4DR1F 4RNHA 1B99A 1LW0A 5C24A 2L9NA 4M5MA 5AE2A 4CO1A 1EP4B 2IA0A 3OL7A 1PG5B 3GSIA 2ZD1A 2V4QA 2W7AA 1UKUA 3NCRA 5DO2A 3NGSA 1TL5A 4DPTA 1F2HA 3LP1A 3C14B 4DR6F 3GQCA 4DR3F 5CXTA 4UZCA 1AFIA 1AT1B 1UWAA 2HMIB 1RCOB 3DRPB 4YY3F 1XNQJ 4GKJF 2M4MA 1RISA 2BW7A 2M88A 4ZVPB 4O3OA 5GAGI 4I2QB 3KLGA 2HRTA 1FX2A 4A8FA 2XQCA 2C3PA 3G2XA 2N7YA 2MLXA 4J9KA 1Q82T 1Q53A 3MR5A 3IN5A 1N5YB 3NMRA 2VFUA 1WF1A 2GJ2A 4ZCKA 1ZTTA 2B8PA 1CLFA 1FRJA 2AX0A 2RF2A 2HHPA 4AL7A 1I94J 2FDNA 3DRSB 1KSPA 2EBEA 2E5LF 2KJVA 2VBWA 3EDQB 5DG9A 1X4HA 2MZQA 1REVB 3JB9k 2JFDA 3T9ZA 1RBOB 2P9CA 4DHVA 3EZ5A 1U1KA 3LF0A 2J6TA 3FSYA 3NNCA 3OTOF 3KOAA 2FLNA 2GQQA 1K0TA 2XZWA 2MKSA 4NZ6A 1UPMB 2RRAA 2RDJA 3T5LA 1EETB 2F40A 3VF0B 2IDLA 2GIRA 3CCRS 2W2QP 2QLXA 3KYLA 1EIYB 5HMYA 1X4EA 2ZKTA 5I42A 1H72C 4JI2F 2DH9A 4WWSA 1VOMA 2YNFB 1KLMB 4JI3J 1RWUA 2CDRB 3IBWA 4FXVA 2EI5A 3HHLB 2DO0A 2I5JB 3ZO7A 3PO4A 1YJRA 2XM3A 3WIVA 2ATLA 3QJLA 4ECXA 3I0SB 2VB6A 1WD6A 3IO1A 1CVJA 4NPOA 1WOOA 4RW7A 4ZPAA 3MEGA 4V19X 3RW6A 2BXJA 5CZXA 2A2DA 5HVGA 1TU0B 1M1HA 2ZKUA 2CQ0A 4UZBA 3SZ2A 3T5JA 3MCOA 4NCGB 3V6DA 5D3GB 2GMHA 5J2QB 2CIMA 2NYHA 2CZVC 4L73A 1RAFB 1R8PA 3FGVA 3FJ2A 5E3QA 3IAS9 1RKJA 1NEEA 4HKQA 3TEHB 1NSAA 4FS2A 4C6AA 1HMVA 1JLGB 2L41A 3D1QA 4A47A 3KLEA 3TRGA 3N4WA 2EPIA 4NLDA 3KXDA 2KFNA 3NLCA 2QC3A 4EYHB 1KVJA 3V6HA 2HQIA 4A48A 4MMOA 2F65A 3W66A 1RT4A 5IFMA 5I3UB 2R8GA 2IYGA 4OHYA 1VR6A 4DCJB 1HQEA 3MECA 5HN0A 3CO0P 2RDDA 3V5RA 4UOHA 4LSLB 1VYAA 2JDJA 4NRUA 4O3NA 4CO5A 4C0HA 3TQEA 1Q1KA 1RWNB 2V2VA 4FN5A 4OJGA 5CYJA 3KNGA 2DEJA 3EVOA 1TUGB 5ETOA 4CLLA 1U09A 1N8RT 3W2VA 3NGDA 2OH2A 3MCMA 4DG1A 1REGX 2QO3A 2GVZB 2ZBIA 1CC8A 1NNDA 1WELA 2IYIA 1R0BG 2MY7A 3PRBA 4F7VA 4A8OA 4DSJA 1UFWA 1UVNA 4C3KA 1HLWA 3RB4A 2DK2A 2ZNZA 2WONB 3T5HA 4HH1A 3W61A 3CDAA 5J1EB 2ZFHA 2GGPB 1FWKA 4USJC 6AT1B 3H2LA 3PVXA 2F1FA 1A7GE 4RKUC 1IWGA 4OI1A 3H98A 3VGUA 1MMDA 3W5XA 4QPTA 3LGMA 4NZ0A 3HZGA 4F25A 5A8RB 4ZJQA 4KFBB 4AQYF 1I51B 4QCLA 2HEKA 3ETOA 3KLVA 4ECQA 3MR6A 3CC4S 2AX1A 5G0RB 1B0TA 1LWCA 2JNJA 2QA1A 3MMAA 1DJ0A 4DZDA 5DDPC 2MQLA 1MROB 4RW6A 1NCLA 1BGXT 5HVFA 3ZZRA 3QSIA 1OSDA 2HBQB 3HSZA 4IG3A 5JXSA 2W9AA 1UWBB 2GHPA 1HHSA 4MIWA 2K2PA 4HT5A 4J9OA 3Q23A 1VQOS 4YMEA 5CYMA 3DHXA 2AV5A 1HFEL 1XEZA 2CG4A 1HIYA 1MU2B 3VZIA 5CCMA 1CSJA 3R1HA 1WKJA 1VFJA 3A8KA 5M2UA 1Y4ZB 4F2SA 1KONA 5L9NA 4DX5A 1RTDA 1TL1A 5KG1A 1T9YA 4C3MA 1FRMA 2XMWA 1TKZA 3NGKA 4LJMA 2POKA 4JI3F 1WF0A 4F02A 3ADAC 1P8GA 1S9EB 2MKYA 2V2QA 3MM9B 4OYOA 4ZVRB 4WFXA 3V81B 4LF6F 4NMLA 5HROA 4K4UA 1YDLA 4PYDA 3WC0A 3MWBA 3FQKA 1Y3JA 3NBPA 4ZJOA 4AL5A 2X1BA 4IG0A 1VBZA 2ZE2A 4ECTA 1EKSA 1F9EB 4O44A 2YQ0A 2YWGA 4EUVA 3WHIA 3JTOA 1LFWA 3TUZC 1DARA 3LALA 3G71S 1NH7A 1HD0A 2CPZA 4DFJA 2VFSA 1B64A 1VIOA 4M95A 2YNGB 3HDSA 4HHUA 4DQPA 1KNZA 2AMCB 4O0NA 2XZTB 3HULA 1RJJA 1RU2A 5L46A 3UR0A 3BO2A 1CJVB 5H9EJ 2GIFA 2KYXA 3AXMA 4CNYA 3RTVA 4D3HA 1QY7A 1R8AA 2A6MA 2RT3A 4TYAA 1S57A 2B9YA 3UO0A 5ETRA 1N34F 1X31C 1SH3A 4W92B 4K7QA 4X4SA 4A8XA 2FHJD 5J2PB 3LGHA 1NK0A 2ACMA 4NE9C 2KL8A 4ZHRB 2BOPA 5D3GA 4IOAQ 2RVJA 2XMUA 3QT7A 1DLOB 5E7OB 3ZTRA 5JMNA 1C4CA 1U6BA 4ZLPA 2QSFA 5HK4A 1EETA 3BYPA 4MYTA 1Q8KA 4GKKJ 2OO4A 1CS4A 2FYXA 3Q0AA 1WC1A 2BJ8A 4KPCA 1Q79A 2KT5A 4CLPA 5I4MA 2V8HA 1X4AA 4ZPWR 4MKBA 2IC3A 5IC6B 5LSRA 3OL6A 5DG7A 3BB5A 4KHPJ 3H59A 3MURP 2R7OA 2E66A 2A2CA 1R8BA 1EJ7L 2C2ZB 3UD3P 2BW2A 4B3MF 4ELTA 1J27A 1PC4A 1X7VA 2UV8A 1U25A 1RHKB 2ZITA 3FBBA 1SQFA 3VGSA 3ET6A 5CH7B 4NLYA 2MKKA 4OYBA 1PILA 4GC7A 4DF8A 4ZP6A 1HWLA 1Z2LA 1LEOA 3GR0A 1C1CB 1WSRA 1Y00A 2ZBRA 3QFHA 3BGUA 1UJ5A 1HNIB 3H7HB 4QJVA 3S1TA 1JX4A 1F2GA 1FHTA 1OY9A 4KR0B 3KK2A 1RSCA 2V4RA 4C98A 4JI6F 1IR1A 1RHRB 1Q86T 3EXYA 3PX0A 1VQ4S 2PGCA 4DPOA 1DTQB 3MPYA 2VQFJ 3D9BA 3IGNA 2HHHF 3FRZA 1EQMA 1WJ9A 1WSVA 2IAJA 3M2UA 1ZOTA 2XTJP 4I2PA 4PXBA 1QTMA 3R2DJ 2QL5B 3A4TA 1DFDA 2B4VA 4QW8A 2O66A 3QNWB 3CCES 2EW9A 3NS7B 4C8MA 4F0KA 4QZVB 2VL1A 2KH9A 3EPIA 3QPIA 2VONA 2AJ2A 5DZ6A 3PKYA 2FHJA 2GHWA 4RUAA 3MM8A 1ZPWX 5C2GA 4A8SA 4O4GA 1KP6A 1ZM3A 1HR0F 2XG8A 1X4BA 4NLWA 4NA2A 1XMQF 1I5OB 1WHXA 3T9NA 3ITHA 4M94A 4X65J 5F41A 2LFVA 4LF6J 1KVKA 2HHSA 2I1RA 4U7UD 1YJ7A 3GLJA 4JB8B 4ICLA 3Q8SB 4DX7A 1EX8A 3PW4A 4DI6A 1U6ZA 4J9LA 1LXNA 2M8DB 1RTHB 3QGGA 4QQBA 1WHVA 1TL7B 4LSNB 3KTQA 3GFXA 4MK7A 2L08A 4C9DA 3SDEA 4I6YA 4Y2KA 3VHQA 4NA1A 3CD6S 2LXUA 2V8VA 1FXRA 2NLWA 4DL3A 5AJ3J 2ERRA 5EWEA 2VG7A 4CIOA 4GMKA 2QA4S 4OYZA 5IV4A 1U1LA 2YKMB 3OSPA 4M5DA 4QIVA 4URSA 3QIPA 3B78A 4TQSA 1F0XA 2MQMA 3O2IA 2XNRA 3I5BA 5GMEA 1RUSA 2OPQB 1GX6A 5CYQB 3QRRA 2E1AA 1HNWF 4ED7A 1HHTP 2R7WA 3DI6A 4AL6A 3FFIB 3I87A 3M7VA 5SZTA 3PO5A 2CNOB 1JLGA 2DGOA 2DIUA 3J7ZT 1F3VA 1Q81T 1VQ6S 2B7BB 5BYSA 4X2BA 2OAUA 4ECUA 1T94A 2Z58B 3DI6B 1O5JA 3FEYB 3I4PA 5HI7A 1VJWA 3N9UC 2CWXA 1T8EA 1KBRA 3BGFA 3G86A 3O6QA 1QSYA 1YSJA 1TQLA 2LEAA 2UXBF 3GV8B 2BKPA 1HHQA 5ETQA 3PEHA 5IQ6A 1RA6A 1G6BA 1H74A 2C2OB 3O8WA 4ES1A 1XR6A 2W4DA 5KG4A 1FKPB 4C3LA 2ZH9A 2FZKB 4NXNJ 3IAM9 1XMQJ 4L72B 4R8UB 2VBYA 2XSJB 2HHVA 1KQGB 5AXLA 5GADI 5IC4B 4LQ3A 2R9LA 3EE3A 2NQPA 3S8SA 3F0NA 4Q0BB 4CLFA 3NCPA 1Y5LB 3HSDA 2CNLB 3OFHA 2MKHA 1S49A 3H4DA 3PIPQ 2XS2A 4C8YA 2CWKA 2VKRA 5DZ7A 2HVIA 3SMZA 1WG1A 2LU2A 4RPFA 5IXUA 4ED4A 2YKQA 4PG5A 4LQ9A 4X62F 1GH8A 5C25B 4DV4F 3LP0B 4RUCA 2BYCA 2PEBA 2XLJA 2BQRA 1C0UA 4ID5B 3SXLA 2HWHA 4ED5A 1PO6A 1WKLA 3RGIA 5IS2A 3PW0A 1ZA2B 2FZCB 2JEFA 4M5HA 2VF3A 2XI3A 2MQQA 2LEBA 1U1MA 4PPZA 4TY8B 2DGVA 3GJTB 3MFHA 1XC9A 1WORA 4BWJA 2ZNYA 4UY85 3W1YC 4ILRA 2AJ1A 3VR1A 3EGVA 4DMZA 3FFIA 4WIIA 5JVHQ 3KUEA 5A76A 2QX0A 1HMVB 2MMYA 3FBCA 3VZHA 2B9EA 1HNVB 3UPFA 3KLEB 2IY5B 5LMUF 4DUTA 3FVYA 4WK1A 3J80U 2DISA 3HVAA 1OQ3A 2CPDA 4U9RA 3E2EA 3NMAA 5KFCA 1FDDA 4L3NA 1IKXA 1RQ0A 4IDKA 4J9VA 4LFBJ 1KDNA 3DGPB 4MIBA 1TKXA 3DM2A 4I56A 3JSMB 3TJAA 5GMDA 4ZIWA 4H4OB 1UVKA 5D15A 1TTHB 4KJIA 5KFOA 2GJIA 3Q22A 2JLFA 1R6YA 2AJ0A 2YX1A 2PO4A 2BJ1A 3X1LB 2QMWA 3DCAA 4RNMA 3OXGA 2M70A 1S7HA 2HG4A 2R7UA 3N5FA 1BMQB 4F67A 1BQMA 2W2OP 4O3QA 1SUQB 2VG6B 1XK8A 1S6QB 4ICLB 1M1KT 2P5VA 5H9FK 2CVEA 2LEPA 2KFZA 1GX5A 3NY0A 1OWXA 5D77A 5G4DA 1LWFB 1TV6A 3M1VA 8ATCB 2DNKA 4M5GA 4NLOA 1XIQA 1L5UA 4PWUA 2ZDPA 1URRA 2R7QA 3EVMA 2G2YA 2ILYA 1XNRJ 1JIHA 3KHHA 1A6LA 5KTQA 2UVRA 2HFOA 2HWIA 2PA8D 2WAQD 1RTZA 4Y2CA 5E5NA 1UL3A 4LR8A 4OX9F 5E41A 2MTLA 4DUYJ 3OPKA 1U8WA 2XHCA 1Q5VA 1UZDA 4IKAA 1PYOB 1JXEA 3BPDA 3EMTA 3IA0A 2FJVA 4LF2A 4N56A 1VC6A 1RACB 1RBLA 2KXHA 4LR7A 4PG4A 4DV3F 4B9NA 2OGUA 1SH0A 7FD1A 3IWNC 4WXWA 4C11A 2VG5A 1S0MA 2YTCA 3DMJA 2DYAA 4K5RA 3AA8A 3AODA 2P9GA 4CM2A 1NK5A 1N36F 4F3OA 2IFXA 1HARA 3GZ7A 4N41A 3D54A 5RUBA 4QYZJ 2YPZA 1RWMB 6FDRA 3OR1A 1TKTA 1OY8A 3ILIA 5B0AA 3J7Z5 3AY0A 4B3TJ 6FD1A 5HROB 1QSLA 3QQCD 3OR1B 2C1EB 4FF4A 2UXCJ 2ZHOA 3LANA 3D3CJ 2WTFA 2VU5A 2HQGA 3DLEA 2F4VJ 3PKMA 3D28A 2JEIA 3KJNB 1GTEA 2HQ3A 2ASYA 4URQU 4HH0A 1G7CB 4YFUA 2QYGA 4Y65A 2EC2A 3NGRA 4LF5F 2IMWP 4PABA 3R6LB 4O4RA 3V4IA 5L1IA 3UN2A 4ZLJA 1D09B 2AEJA 4FYVB 3R27A 4MKAA 4WZQA 3DU6A 1FD8A 2OSRA 4CLTA 3PYFA 1YHQS 3BBFA 2MLYA 1IBMJ 2UVUA 1D9AA 1SUQA 1SH2A 2VG6A 2JC0A 1NDKA 4OX9J 2HWTA 3CCVS 1N34J 4F04B 2G9OA 1YVFA 3MR2A 2QGFB 1X5PA 2WK4A 4TYBA 1NK4A 2BDPA 4WFZA 2MXYA 2Y8WA 4LBPA 4ECVA 1L3VA 2BRKA 2RUSA 3CCUS 4OX6A 2Z2LA 1IVZA 3FZBA 1RT2B 2GV1A 2AYMA 2ZBQA 1RGVA 3TOQA 4KH1B 1SKRA 1IKXB 2YWKA 4Q7AA 1EKRA 4RR5A 2P2CB 3LP2A 3DOKB 3O3LA 2HGLA 1YBAA 4WBFA 1U1PA 2LQBA 4A8YA 3TZZA 4O44B 2K1RA 4HEA9 3K5OA 2FJEB 4KFBA 2G0IA 1S1TB 4DUZF 3CULA 3QJPA 3KG1A 2DGTA 4BBYA 2LQ9A 3AHPA 3HVTA 3M2VA 1RTIA 3QGIA 4PQAA 4ANDA 4QBUA 3M8QB 1LWCB 3MMAB 2HNZA 4NRTA 5AXKA 2C2EA 3CCMS 1S1TA 4KT0C 1B0PA 2LU1A 4F0HA 1RCXB 4U96A 4Z7YA 2BEFA 4G1QA 1IXKA 1YBTA 2J8AA 2XEXA 5DG8A 4N76A 1FJEB 3NEKA 1URNA 1AXQA 2VFRA 3U7JA 1S6QA 1L3SA 2JWNA 2OTLS 1XWLA 1RWXB 2Y8YA 4RW8B 3X3UA 2BE2B 3CW2C 5KFXA 1YZ7A 2OD6A 3DOLA 4KV8A 3L09A 4Y2IA 1BQNB 4EO8A 4DLEA 3AB2B 1ZAXA 2NXJA 3CJSA 4W98A 2R2SA 5K14B 1RZMA 4I6WA 1NJZA 1FRLA 4F3QA 1MW7A 3QIDA 2QL9B 3C16B 4LFAF 5MAOA 3F56A 3KMQA 4Q0BA 3QAUA 3AT1B 3JYTA 2IM0A 3O1LA 4Y34A 4TN2A 1RYSA 4LF4F 1EHWA 3G4SS 3BYRA 1N5SA 5F8GA 5DLFA 3I0SA 4ZVUB 3R5DA 4V19J 1G2EA 3CJKA 2DXEA 2QFIA 4N8OA 2CVIA 5HQMA 1AA1B 2B56A 1V3ZA 2QIFA 3JSBA 5FDLA 1RKIA 2YNFA 3SSQA 1MN7A 2RDIA 4CNZA 4B02A 3RBDA 2WB4A 3TA0A 3UD4P 2HQFA 2Y0SD 2E44A 1U48A 2OI2A 3K17A 1N5QA 1VIXA 3M8PB 3R5AA 2H1YA 5GADU 5IT4A 1K8AT 3GYGA 4M5DB 2HZAA 3RJMB 1WDTA 4JI0F 3KLFB 4JYAJ 1F1BB 2VG7B 3CDBA 1VS3A 1FWPA 2D7SA 3B54A 2M3DA 1CQMA 2UXBJ 4X4TA 4HACB 2GMJA 2JLEA 2X3DA 2CJ9A 4YEAA 2MQNA 1NJIT 2ZH4A 4ITSA 4B3SF 4ZVQB 1M5HA 3J7YU 1WHWA 4DPYA 3IM8A 4EZ9A 4L75A 2UU9J 5EX3A 2FTRA 3MCNA 4EFAC 3QT5A 3LQVA 4EBDA 1F5AA 3MZIA 1NSQA 2Y1IA 1K47A 3ISND 2RQMA 3PHEA 2PI5A 4B3RJ 1IM4A 2KN4A 4OYMA 5D0HA 7AT1B 3C6UA 3HM9A 2ZH7A 4MIAA 4JI2J 1WEZA 1RWOB 2VD3A 2E7VA 1IJFB 1CJTA 1FX4A 3C15A 5IQQA 5K9FA 2B3TB 4UTGA 1X5OA 4YP3A 2DGXA 1EB0A 3VTIA 5C7PA 1A9NB 2J9EA 1O8BA 1VGYA 4KGXB 1JLBB 3BBCA 4KE5A 4ED6A 5AJ3F 3CUNA 2B5JA 2HQCA 1NHVA 5ETNA 2J7KA 1H0HB 4CO4A 3N5BA 4OHZA 4JP8A 1O6XA 3W65A 4DL2A 3J7YI 2IM2A 3A1YG 2OMLA 3ENAA 3GU0A 4HL9A 2VBXA 3MD1A 3BO3A 2JHEA 1H73A 2IPOB 2FJXA 3GJSB 4RW4B 5KG6A 5HP1A 1JK9B 4ZVGA 2ZWPA 1VISA 3EWGA 3QT6A 2V67A 3DYAA 4Q2MA 5U47A 4I2PB 3NS6A 2IBOA 2FGCA 3PZPA 3QRQA 2CJXB 2HNDA 3V4MA 2YNHB 4CTAB 5F8HA 2R4FA 2NSCA 1NU4A 2AU0A 1W2BR 4NCAA 4DL6A 2ZHAA 2BM0A 3VCDA 2KT2A 3D1HA 1B4SA 1SV5A 1U2CA 2HIQA 3G87A 1DTTA 3HHEA 3OBIA 3T6BA 5KFMA 1YJ9S 4JI5J 3I55S 4PRFA 1HD1A 4OJHA 3C8YA 2ALZA 1PBAA 2QMUB 4USIA 5J2MA 1Y3KA 1T05A 4BWMA 1VQ9S 4IQXA 4LIRA 4TLRA 3KHRA 4JI5F 4G3IA 2GHVC 2Y9HA 3EJMA 4FPRA 4ENOA 3ZZPA 3IC1A 3OJSA 4DV1F 4HT7A 3B6BA 4Q2LA 4WU3A 1SCJB 3HZEA 3DRSA 1OS5A 2DNYA 1HNZF 2E1CA 2C2NA 4DU8A 3IP0A 4PR6A 3I0RB 5L1JA 1VBXA 5HO4A 1C1BB 1JJ4A 3QO9A 5FD1A 3MFIA 2V9WA 2QV6A 1TMMA 1X60A 4MK8A 1F6TA 5CA5A 4WTOB 1OPIA 4J90A 2CA9A 2A0FB 1BQMB 1LNQA 2ZC4A 3T41A 2ZD1B 4FNIA 2RU9A 8AT1B 2DO4A 4J9SA 4RBTA 4WP8A 2IVFB 1T7PA 1PC5A 1KR4A 1PJ5A 1OSCA 3IRXB 3MAHA 3I5CA 2W9CB 5L1KA 3CIZA 5FIIA 2ILZA 2V9KA 4DR1J 4LF8F 4LF9F 4DN0A 2KTQA 3CJRA 1NK8A 4P75A 2CQDA 5HP1B 1JLBA 2HHUA 2HQDA 4NYZA 4AXJA 1Y7PA 2JX2A 4IFYA 2DRBA 1MMLA 3CWJA 2MJUA 4NCGA 1XTZA 2OPSA 4ILLA 1G3OA 4B3OA 1LW2B 2CPXA 5IT9Y 2NPIA 4QIGA 3S01A 2B6AA 3MAAA 1S6PB 3SBMA 2R7VA 1IM6A 2DNMA 2U1AA 1X4FA 3M8RA 5KOXA 4WIQA 3M2RA 1C0TA 5L38A 4DV0F 2BJDA 4OHVA 4DR7F 4QU7A 1IKYA 2ASJA 2Y1LB 5F8LA 4WK3A 2OEKA 2YNHA 4ECYA 4R0JA 3HHKA 1WEYA 3DNCA 3TVKA 4X4PA 1Q8LA 2KM8C 4HYKA 2J0SD 3JTNA 1SV5B 4RW9A 2WSEC 4UW2A 1M90T 4CO3A 3ISNC 4QIEA 3T5KA 2PIIA 2JEGA 3PJWA 4EWTA 4HR2A 3J80Y 4NWBA 1HI0P 1V9OA 2KO1A 2NZCA 3OVSA 3EVWA 3NOCA 3HO1A 1T9WA 3QLHA 4ED3A 2CPIA 2FIUA 4DU7A 1XQIA 4J37A 1MWZA 4DCPB 5F8JA 3POTB 5BR8F 3GIMA 1TK0A 1UW4A 4LVNP 5IWAJ 2VDIA 3VQTA 1FK9A 3KLIA 3MI7X 1QSSA 2RS8A 3MXHP 1SI9A 3DKDA 3RB6A 4O0IA 4TKTA 1T9XA 4JI0J 4FF3A 2OPQA 4P9SA 3K57A 4U7CA 2XO6A 1PCAA 1F5BA 2P6TA 3RW7A 3U1NA 1VBYA 4ZN1A 5F9LA 2Y1RI 3T3FA 4IFVA 2JL9A 2HVZA 4YN3B 1FI4A 3HK2A 1K9MT 5K14A 1NKCA 4X4NA 1QAYA 2YH0A 3H5SA 3HF5A 4DF4A 4K4ZA 2B4PA 2VQEF 2MKIA 1NUEA 1NPKA 4JI4F 5CAAA 1TL4A 3KFWX 1BUXA 1S6OA 4NZ7A 4ZJLA 3C6UB 3LPEA 4DG1B 3GFYA 1N32F 3OTCA 2KI2A 1FXLA 3CDWA 1DRZA 4KHMA 4WJBA 3UQSA 1UEVA 4DQRA 1UWBA 2CPJA 4DV5J 1YQHA 1GNKA 2HS0A 3BM7A 4O4GB 2D1CA 2E1PA 3OVAA 4FXWA 1F5CA 4R5PB 4Y28C 1MU2A 3GR1A 1KKHA 3HVTB 4ID8A 1FEEA 3RRKA 4PG8A 4KKOA 3ZXWA 5E3CA 3GWCA 3P8BB 2WHOA 1H38A 5HAOA 3LUYA 3EM1A 3OR2B 2PMZD 3VV2B 5D4LA 1P1LA 1YJNS 2FHOB 4CH0S 5GMKa 1TK5A 2HVHA 1Q7LB 2M2BA 1BY9A 3CO9A 3P3DA 4OQJA 4M5LA 4P2FA 1K1QA 4XAKA 4XTTA 2NS1B 3ZNJ1 4ALZA 4EK2A 1WNEA 5DETA 4GKJJ 2HHQA 5CYQA 1TVRA 3BV8A 4LRBA 1KEKA 3ZC4A 5KT2A 5ETSA 3M9NB 1KWMA 4M8LA 3SSSA 2V0NA 1D0EA 4X84A 2J0QD 3I6PA 4AXIA 3DRXA 5IM0B 2F8EX 3D67A 1BWEA 1LKZA 1S1WB 1S72S 2E5GA 1U26A 3E8OA 1N32J 2DH7A 2E1MC 1WKKA 2BANB 5IOLA 1NPPA 2E5LJ 1PGZA 2M7SA 5AXNA 1S6PA 1FKPA 4AYBD 5D8HB 3BREA 3OTOJ 2JC1A 3TP2A 1OMSA 1R8HA 2CQIA 3BF4A 5HVHA 3M9MB 3PW2A 3MEDB 5A8WB 4YR3A 3TUJC 4DWIA 1W2IA 2XLKA 1ZTWA 4K0KF 3CTRA 3LW5C 2MY8A 1KTQA 3RAXA 2IJRA 2HPUA 2IHR1 2RE1A 1M5VC 1MSWD 2RS2A 3D6MB 3IGVA 4K59A 4N5SA 3Q86A 2CNNB 3MM5A 5D4PA 3F41A 4CDIA 1RB0A 1NJWA 2E9ZA 1VQSA 3MM6B 1CJKB 3HD1A 2DNQA 4Q43A 4DSKA 2RSQA 3LPYA 4F4WA 1YRUA 2XLIA 1U2FA 5IWAF 4E0DA 2DVIA 4LFCF 2YVSA 4ILMA 3OJUA 3PYGA 1FFWB 1GMWD 1XR5A 3AQPA 2CQPA 5ETTA 3ILLA 1QM9A 1VLYA 4LF9J 2V34A 2HSEB 4F2RA 1S9GA 4AUKA 4KIAA 1M5SA 1IBLF 4PWDB 2UXDJ 1S0OA 3ET6B 2EKNA 4PG7A 5LJ5Y 2ZH5A 1JB0C 1O51A 1E6VA 2FC9A
chains in the Genus database with same CATH topology
1N6QB 4B08A 4P2SA 2R7RA 2PA3A 3CJ2A 2ROPA 4MFBA 5A6PA 2JEJA 5KG2A 3WZ0A 3GFHA 1RA7A 1WTBA 5HLFA 4ELVA 1FA0A 2XB2D 3AAWB 3CMAS 3B4MA 5E3RA 4NL5A 1S77D 2YQ3A 4KHPF 5I42B 5DQIA 4I7FB 4OHWA 3R5CA 1NK7A 2R8JA 2LDIA 2V94A 1XNQF 2OPPB 1TUVA 4QIWD 2J7UA 4I7FA 2YWEA 2E7WA 4CO0A 3OFGA 3PFOA 4MAKA 3IRXA 4ED2A 2IMOA 3UNGC 3G8QA 4K5SA 5EWGA 4HVZA 3D0IE 1HYSA 1ROFA 2C3YA 4IOCQ 2ASLA 4ZPTR 1BD6A 3LOUA 4FVMA 4ED0A 3CB4A 2D9PA 4TU7A 5L9XA 4WFYA 2C42A 3R5BA 3MM6A 5KAKA 4Z37A 2MKJA 1C0TB 3HKWA 5BYQA 2R7SA 4OZ5A 4ZVFA 1E6VB 4OFZA 5MLCV 1DTTB 3MD3A 3H5XA 1NH8A 1M5OC 2DHAA 2CDQA 4OZJA 3T6JA 3SCLE 4JI7F 1VK8A 4C11B 2R8GA 2JJ4D 4DN9A 3BJYA 2RIJA 3CPWR 4B9VA 2YH1A 2CPEA 3IR5B 4DBQA 1LXJA 4I69A 1S9EA 3MM9A 4ES2A 1ZZNA 4H4MB 5HMXA 1YGYA 2HRUA 2BANA 5FDLB 4GC6A 1EP4A 3PACA 5EX0A 2QYCA 1RTDB 1UAWA 1LV5A 3KJVA 3K59A 2HFZA 2O1PA 4DV5F 5C42B 5J2NB 1JKHA 4WFAQ 2F7VA 3V6KA 1TAQA 3I82A 1KFSA 5B0EA 5F8NA 2CFXA 3ENQA 4NYOA 1VQKS 4KAIA 2K3IA 5SUHA 2ZUGA 1VQYA 3C66A 2ABYA 4TU8A 3WX4A 5J1EA 4UUWA 4I67A 3J81Y 4C8ZA 2COLA 2VFVA 1TVRB 4R0EA 3MPWA 1U48A 5D6GA 2KB2A 4IUFA 1RT7A 2ZJQQ 2OPRB 4OL8A 2WSCC 3E51A 4UOCA 1Q7YT 3C3LA 3SCIE 4ZPCA 4DJBA 2XY7A 4KGKA 3N6MA 1FVQA 4DL4A 3BDEA 1HWUA 5F3ZA 5LSOA 2KG0A 4ECZA 1S76D 4CQ1A 2I2YA 3C2PA 3HHLA 1AROP 4G6VB 2P6SA 2EC0A 2AJ4A 4LFBF 2XSFA 3NL0A 2JSXA 2OD4A 2RRNA 1HNVA 2NUHA 3D5MA 4O3RA 2VC1A 5EDWA 4MJKA 2DJWA 2NSBA 2CJKA 3D1OA 3BSNA 5A8KB 1LFPA 3O5TB 5FLXY 3FEZA 4FS1A 2XWYA 1VRTA 3H20A 3MEGB 2UUBF 1RT6A 5A8RA 4UQGA 3SQGA 3PX6A 2OSQA 2M52A 1R7IA 1S1XA 1HPZB 1KC8T 2YKMA 3M6VA 1DZ5A 5DGAA 5KT3A 1ZETA 3RR8A 2VPWB 3G8TA 3IWLA 4A8QA 2XS7A 2BUNA 3Q8QB 3H8YA 2HRYA 2IJNA 2XCAA 3Q24A 5EGYA 5B0FA 2DITA 5GAEI 1JMTA 2BV3A 2LMIA 1GAOA 2CJQA 2DPJA 4QWEA 1S48A 3H2UB 2MZRA 3RBEA 4CT8A 4PKDB 1JLAA 3M30A 4IOBA 1JXLA 3TNVA 2LQ5A 3MMCA 2XC9A 2VODA 3JTPA 1IKWA 1U47A 5HL7Q 5ITHA 1KLMA 1HQEB 2DHXA 2XMJA 3RYLA 2HHUA 2JVRA 5AE1A 5KFWA 1FDAA 3DU5A 3KLHB 4B3TF 1MNEA 4JYAF 4JBCA 3VAJA 4K4WA 4U6PA 1Q78A 1SIZA 1DURA 1FKOB 3ZZOA 3DXBA 4F4ZA 1SB6A 3BDPA 4QR2A 3NKYA 3NNHA 2B6AB 2KKHA 2LCWA 1HNIA 1J5OB 1KRPA 2UXDF 1QUVA 3W2WB 3MF5A 1KS2A 5HMZA 1KLNA 2IRYA 1D1UA 4MKYA 1TFYA 3CVKA 4IRCA 2KFYA 2ACYA 4KB7A 1Z1ZA 3KK3A 4K2XA 2PN6A 4ZCIA 5DQGA 1KHVA 1UFLA 2EFOA 2DGWA 3DLKB 3DDNA 1Q4RA 4NYPA 4RX6A 5A0YA 1WI8A 5C5JA 5KFEA 2ADCA 4B17A 4Y6IA 2FY1A 4PCQA 1UJ4A 3M8SA 2DT9A 3M6UA 1IR0A 1H2UX 2QLWA 3AB4B 4OI4A 3V4IB 4Y3CA 3PXGa 3MEEA 3G6XA 5KFRA 2ZM6F 4HTJA 1B0VA 3BGRA 2BBEA 4KV8B 1UVMA 2WCXA 1TP7A 3DN9A 3DLEB 3CJ3A 4A8KA 3K58A 2AQ4A 3MTKA 2VPZB 1HW9A 1HA1A 2IRXA 3TVZA 4FZVA 2ASDA 2HAIA 2I8EA 1C1CA 1ZBTA 3K2YA 1KOHA 2KYZA 3R1LA 3UDCA 2YKNB 2IJFA 4ZA1A 5GAHI 4PUOA 2RILA 1JLEA 4PXDA 4Y2MA 4FNHA 5KT4A 4FF1A 3GSDA 2DR7A 2QMXA 1IUJA 2L3MA 2RJZA 2C28A 2CQBA 2YX4A 4EBCA 3ENWA 1LK7A 1BLUA 1IQTA 3WBZA 2IM1A 1S10A 3MEKA 2V8DA 4KTQA 4RW6B 2DNPA 2UUCF 2WRMA 2VOPA 4KC5A 3PDNA 4ZVEA 2SXLA 4XPCA 3TAQA 4X4OA 1QUPA 2CRLA 4ZP8A 4B9LA 1KHWA 1T3NA 4B3RF 2J9DA 2P9EA 2RQ4A 4H4KA 2FVSA 2UVWA 3HHLC 3TAPA 2RB7A 4IG0B 2XGQA 3GILA 4B9MA 1BQXA 3HMJG 2YWHA 5A2QY 2W24A 1NZAA 1RT3B 2KG1A 2BQUA 3K8WA 2BRLA 1H3DA 2GQ2A 3JYTB 1YJWS 2YNGA 4KGMA 4K4YA 4QU6A 3VAIA 1N5TA 1X9WA 1HBMA 2N4CA 1P1TA 1T3OA 4ZDNA 5KFNA 4FBTA 1HW8A 2GA7A 4OZLA 5K8NA 2DH8A 2FVQA 1IQZA 1KFDA 3CJ4A 3CT9A 4U67Q 1BC6A 2FVRA 3DLGA 4OV1A 1PSDA 2G13A 3PEJA 4OJ3A 4X4QA 3MEDA 5A8WA 2N3LA 2X51A 3UDLA 2CPFA 3CJKB 4Q44A 1SJQA 3IG1B 3KNAA 1HI1A 2RD5C 3DRYA 4NXNF 2W8LA 2DNGA 2WBRA 4H4MA 2PMHA 4YR2A 5GAHU 2XMMA 2DRAA 2LVWA 1YIJS 5DJBA 4R5PA 3EPGA 3E3XA 3L7PA 4I64A 4IO1A 3FMWA 1WF2A 5B0BA 3OVBA 1JLFB 1VRUA 3RAMA 2F9DA 3US5A 4HLBA 3N6LA 3AQOA 2OFHX 4D3GA 3I4HX 3P5TL 2BABA 2LXFA 4UQTA 2HNZB 4ED3A 1E6YB 2RNEA 4DFMA 2OPRA 1HPZA 5M2PA 4JI1F 4OI3A 3IS9B 1CQNA 3QYYA 1YG0A 3M1VB 1QAJA 2QSWA 2B4OA 1FRHA 2OJ3A 1DQ8A 3RRGA 1KTVA 1CPZA 1UMJA 4NX9A 3CSKA 3THPA 1VQMS 1FNMA 3RR7A 4BC7A 2EKYA 1M5KC 3CEDA 4RU9A 3NS5A 4HDHA 4XPEA 2B9WA 3FDSA 4TXSA 4IH6A 2EFPA 2DGSA 1FDNA 4QWBA 5E3PA 2DHGA 5I3QA 1FRIA 3M4XA 1UVIA 4HI2A 5HBMB 1C4AA 1VQ7S 1VQPS 3GIIA 1RT5A 3SV3A 4OI2A 1JLCA 2O67A 3BR8A 4YUDA 2CZ4A 1AUDA 3Q2SC 2FVPA 4ETXA 4C2MA 3UI3A 4JV1A 2DR5A 4FVCA 3LP2B 5KFJA 2FGOA 3W3SA 2G4BA 3K5PA 4JV0A 4EYIB 5DDRC 3OQ2A 2Q6CA 3HHLD 1TKTB 2LKZA 4NLXA 3U27A 5KT6A 1D9DA 1S99A 4FYDA 2DCLA 4IYQA 2RU3A 2W7OA 5LXRA 4JV2A 3CE8A 1HQUA 2D3ZA 5DM6Q 4NLPA 4PPDA 1FTRA 1X4CA 2LXIA 4ZOSA 2PE8A 4I6AA 2L9WA 4IQMA 4C97A 1I94F 2PI4A 1XBWA 2VOOA 1FE0A 1GT8A 3SI8A 1S6UA 1XR7A 2DNRA 2J76E 3VAMA 3FMBA 3DMJB 3GG1A 3PNIA 2LQJA 1R89A 2OPPA 4DOZA 4DL0C 5KFDA 2BQ3A 2DIVA 3KK1A 1QVGR 2MQPA 2MSSA 4NLRA 2ZE2B 4BC9A 2FPHX 1N48A 4F4XA 3DLJA 4F26A 1VQLS 4EZ6A 4OZ1A 3DC2A 2GNKA 3VAHA 1NJXA 3MAQA 3N6NA 2OKQA 1K1SA 3PR5B 1VQ8S 5LSLA 2M8HA 1UVJA 2C3UA 4RUHA 2HLUA 1FXDA 3HPOA 3SYZA 2N82B 1S9GB 1IN0A 3G96A 3PW5A 3H25A 4I2QA 3PR4A 1FKOA 2CQGA 5CHCB 1LWFA 1TV6B 4XDCA 4CH1A 3PIOQ 1J5OA 4TLQA 1RYRA 2OFGX 1AFJA 4CO2A 2XS5A 2J0WA 2D3OR 3KG0A 2YY3A 1S0NA 4OIXA 1IBMF 1X0PA 4DQIA 2DGQA 2QT7A 1SJ3P 3CJ5A 2HHTA 2HW3A 3BGRB 3ONQA 3I5AA 5CCLA 2HFNA 1VQ4S 5E3AA 3DLKA 5A0YB 2DTJA 3TI0A 4J5OA 3BO4A 3MMCB 1UP1A 1QJHA 3ZZZA 4DX8H 4OMFG 4YQWA 1FDBA 4JI8F 3QJJA 4I4BA 1UA1A 2VH7A 2GIQA 2BACA 1UETA 1JNZB 1ZM2A 4RWWA 2K3KA 3O44A 4DDFA 1Y0HA 1FJGF 2VFTA 1QVFR 2MDAA 4PQUA 3P96A 3FNNA 4WYLA 2IRUA 2RH3A 3QWUA 4H4OA 4K4XA 1S9FA 4DL5A 3VALA 5KG5A 2MB0B 1SIWB 3VAGA 1F9FA 2IBKA 3M8PA 2Z0GA 3OHBA 3LP0A 1WI6A 2EVZA 4YDXA 4DFPA 2D9OA 5E33A 1HBOB 4QWDA 2XULA 5DS7A 2AYGA 3ISZA 2ZDOA 4OI0A 5DQHA 3RB0A 2LA4A 1SBRA 3LAMA 3FSIA 2VC0A 2Q3PA 2EFNA 4RLEA 3U02A 5H1SV 3CF5Q 4AE5A 3IR6B 2J5AA 4QYRA 2NPFA 4ES3A 2AYEA 4N47A 4RW9B 3OTEA 4AFFA 2FJAB 3CXCR 2VV5A 4KO0B 3BSAA 1H2VZ 3CCTA 4Q5VA 1O0PA 1GXLA 3ICLA 2UUTA 3MDFA 4KO0A 2NR0A 4ECWA 2YNIB 4DQSA 3NBPB 2MZSA 5A8KA 3PV8A 4EEYA 4G1IA 1FD2A 3GMGA 2PFFB 3V81A 4O3SA 4RU2A 1RT3A 2B0GA 2DD8S 3TARA 1KVIA 3KLFA 1UEUA 2MYFA 1YTYA 2QEXS 3TAMB 3VWSA 1FK9B 3KLIB 2GC8A 3PRDA 1VQ5S 4N8NA 3M2VB 4RNOA 4EBEA 5KFAA 2PD1A 5THWA 1FNOA 2PSZA 3C6TA 2R8KA 4C8LA 2M5YA 1NB7A 3K7RA 2AF6A 3MCSA 4MYUA 2UXBF 4HHJA 3PX4A 2PEHA 2V4JB 3AJ1A 1W25A 1SJRA 2EWHA 1GQEA 3MEEB 4M1KA 4OZNA 5DDOC 2HHWA 2VPXB 2HYIB 5I3UA 5E0OA 5GVQA 1H7XA 1REVA 4ZVHA 5KFKA 1CC7A 5EWFA 1D8YA 2NXUA 2N7CA 2XNQA 3DLGB 3FQLA 5LL6d 1KN6A 3OLBA 1N52B 2IC3B 3OUYA 1MWYA 3ITHB 1OIAA 4XO0A 2Q66A 1Z4UA 3FCHA 1JLFA 2B43A 4A46A 2DR9A 3LP1B 4YB5A 4YDDB 1R8CA 5T14A 4DFKA 3JSRA 1UA0A 3BZQA 1TFWA 3ZFVA 3GYXB 3SDEB 1VC5A 5KFQA 1RT2A 2HMIA 5D4OA 4ECSA 1FKAF 4X4UA 4RW7B 4A4JA 2C2RA 5ADZA 4Q45A 2VPYB 2GX8A 1WTFA 3GIJA 4TU9A 2NZ4A 1AW0A 3CC7S 3E01B 3H5UA 3I31A 5M2RA 2CQ3A 2HZCA 2K1RB 2LA6A 3R3TA 4MFBB 4O23A 4JUZA 4DEZA 1QLNA 2HNYA 4TY9A 3TQ1A 3WC2A 2ZH8A 2MPUA 4QOTA 1RTIB 2YKOA 5B08A 2Q43A 2RQKA 1CEZA 2KZZA 2WSFC 2ZJPQ 1LWEA 2X1AA 5DRKA 3NCQA 2W4CA 4Q8FA 3CD5A 4YOEA 3N28A 2QFJA 4F4KA 3RB3A 2RKIB 2O01C 4J9PA 2R2UA 2YKNA 5B09A 1HL6A 3MTJA 4X4VA 2RKIA 4XK8C 2ZC3A 1N33F 3MR3A 3CDEA 2I5JA 3I32A 2R7TA 4NLVA 2BZ2A 2FD2A 3AH6A 4F4YA