1OPZA

A core mutation affecting the folding properties of a soluble domain of the atpase protein copa from bacillus subtilis
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGYHVVIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Potential copper-transporting ATPase
publication title A core mutation affecting the folding properties of a soluble domain of the ATPase protein CopA from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 15
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1opzA00
2N4CA 3FRYA 3LGMA 4OIXA 1Q8BA 1YJTA 3I9ZA 1Y3KA 3HHLC 5A6PA 3VTIA 1APSA 1ULRA 1TL5A 5B0CA 2W4CA 1VQSA 1TR0A 3DXSX 4DPOA 2HFNA 2LXFA 3HHLA 2XMJA 2HLTA 3F44A 3QMQA 1YJUA 2RU9A 4OJGA 5B0EA 1URRA 3TRGA 1SB6A 2AP6A 2HIQA 3E8OA 4Q2MA 2FB0A 2K2PA 2LDIA 4Y2MA 1OQ6A 2OFHX 1KVIA 1YJRA 2BJDA 1FEEA 2ASYA 2IFXA 3CJKA 2OP5A 1Y9OA 2QYCA 2XMTA 2GO8A 3BB5A 1FE0A 5IXUA 1MWYA 2ROEA 1V3ZA 1S6OA 2EW9A 1JWWA 2AW0A 2K1RA 1X7VA 2ZDPA 2HFOA 3FGVA 1FVSA 2VV5A 4HH0A 5B0FA 4A47A 5B0DA 2W4PA 1Q8LA 2OD6A 1TL4A 2XMVA 2OFGX 2QLWA 5B0AA 1RJJA 3WDOA 3QGPA 2K7KA 2KYZA 2BUNA 2KKHA 4FNIA 2GV1A 1N5QA 2BJEA 2XMWA 4OJ3A 1QUPA 3KG1A 1CPZA 1SQEA 2OMOA 2RSQA 4Q2LA 1FD8A 2AJ1A 1FE4A 4NPOA 2GGPA 5T7LB 3KG0A 4HI1A 2Q3PA 2KT3A 1YG0A 3BGUA 3HFKA 1X8DA 3K7RA 4Y2KA 1Y0HA 3T9NA 1AFJA 4Y2IA 3BN7A 1Q4RA 4FNHA 2LQBA 2L3MA 2W4DA 2KT2A 4HH1A 1Q53A 2N7YA 2XMMA 4HL9A 2ACYA 3UDCA 2HQIA 3BR8A 1TZ0A 2QLXA 1N5TA 1MWZA 2HLUA 5B09A 1K0VA 2BYCA 1VQYA 2GA7A 2LQ9A 4OJ1A 2RILA 3BF4A 2IYGA 1AW0A 2IYIA 4ZA1A 1YRXA 5B0GA 1YJVA 3KKFA 4HI2A 4A46A 1LQ9A 3HX9A 3TNVA 2N4DA 2OKQA 4DL0C 4ZOSA 2FIUA 1JK9B 2OD4A 3HDSA 2AJ0A 4YDXA 2XMKA 2K1RB 3MCSA 2ZDOA 4F67A 3BM7A 2GCFA 2JDJA 4QOTA 1CC8A 1S6UA 3HHLD 3LGNA 2ROGA 3GZ7A 3TOQA 3IWXA 4OJHA 1FVQA 2FHMA 2PGCA 3LO3A 2CRLA 2BBEA 1Y3JA 2OAUA 1AFIA 3KNGA 5KAKA 2GFFA 4EFAC 3HHLB 2RMLA 5F0UA 2XMUA 5B0BA 2VH7A 1FESA 1OSDA 1OPZA 4DN9A 4NL5A 2ROPA 2PD1A 5F0WA 1CC7A 1TUVA 1OQ3A 2GGPB 1P6TA 1N5SA 2FTRA 3BDEA 3MZIA 1W2IA 3CJKB 2QIFA 1XBWA 4U9RA 1SI9A 2G9OA 1WD6A 3DCAA 5A6WA 4YEAA 1GXTA 1IUJA 5B08A 1N5VA 5T7LA 1X0PA 3HF5A 1P8GA 4A4JA 5K9FA 1KVJA 1KQKA 1GXUA 1U7LA 2K7JA 3FMBA 4A48A 3IWLA 1R6YA
chains in the Genus database with same CATH superfamily
1F2GA 1S79A 5C42B 4G1IA 3CD7A 4UUXA 2MLXA 2NREA 2YNHB 4W98A 3VAHA 5D8HB 2FYXA 4CQ1A 1NB7A 4BDPA 3UD3P 3HKZD 4CDIA 1UVMA 4ZHRA 2G0CA 4PAAA 4FKYA 3F56A 2Z2LA 3D68A 3MF5A 4A47A 2YX4A 1G2EA 4CM2A 3RB4A 4DR2F 4NPOA 3PRBA 3R5CA 2H3EB 1C1BB 1TK0A 3NEKA 1Q53A 4DQQA 1UJ4A 4RW7A 4ECXA 2EFGA 2R8HA 3QPIA 4NZ0A 3QSIA 4AT1B 3MMBA 3HDSA 1HBNB 1L3VA 3ZXWA 5I42B 4C2MA 4WU3A 2U1AA 1IBKF 2YNFA 2GQQA 1NHKL 2FGOA 5KG6A 1RT4A 2H9ZA 3T9ZA 2CQ1A 1IKWB 4OFZA 4UOGA 3L4BC 3W63A 3R7BB 5DETA 3DRSB 3HSZA 4ZN3A 2QE5A 1CJUB 1AZSA 2DNRA 1MMDA 3RBDA 2VHGA 3DOKA 4LSNB 2CQBA 2MKKA 4FVMA 3R6LB 1RHJB 3ADAC 3Q2TC 3H5UA 3QJJA 2P6TA 4P7TA 1OY8A 2DJWA 4YHHJ 2C2DA 3JQJA 4ATNA 3ZFVA 4OZ1A 1U2RA 5AJ3F 4ZVEA 2MEWA 3QT5A 2HHXA 2JWNA 1HYSB 5F41A 4K4SA 2RUGA 2MZTA 1SQEA 2Y1IA 3BGOP 3U1MA 1JX4A 3M1VA 2BW7A 2V4QA 1JLAB 4F4KA 4DV5J 4DWIA 2RHSB 2BV3A 4ZPTR 4F50A 1MU2B 2WVDA 2OD4A 1XERA 4NE9C 4EBEA 5L46A 2RUSA 2QSWA 2RKIB 3DRRA 2R8IA 2EG1A 2PGCA 4TU9A 2Y0BB 3W2VA 2ACMA 2NPIA 1EETA 1S6QA 3ZTPA 1OQ3A 3VZIA 3HKWA 2WVCA 5F8NA 2VDHA 3KK1A 4PWDB 3A8JA 1F60B 5F9NA 3VTIA 1APSA 4OYOA 1PJ6A 1PYOB 1WG1A 3VR1A 2FJVA 1S1WA 3ICLA 4HDGA 4ED7A 4PQUA 1RT1A 4I6WA 2QYGA 4FF3A 1XJWB 4QPXA 2YWEA 1RWPB 1IVZA 3C6UA 1HBMA 4ER8A 3MMCA 4PR6A 2P6SA 2PSZA 5KT2A 3CPWR 4E2FB 3O44A 2ZWOA 1CPZA 2J9CA 2AX0A 4I1TA 2DH7A 1W25A 1UL3A 3KK3B 3NL0A 3BO2A 4CO5A 1PJ7A 1NK8A 1SKUB 3L7OA 5D4NA 2DR6A 1CVJA 4ZK7M 4IH7A 2YVSA 2W9BB 3JYTB 3KKFA 4YDXA 5C7PA 3C3LA 3A3NB 2ROGA 2D9OA 3GWCA 4MKYA 3FCWA 1HLWA 3SSRA 2KFYA 3D9BA 4OI6A 3KNGA 2Y9HA 1OPZA 5KG4A 4BC7A 1HQEA 3E01B 2I8EA 4JI6F 1S9FA 1JJ4A 3LWLA 1N5VA 1XNQF 2V0NA 3W61A 2R2SA 5AXMA 3PYEA 1TL5A 3Q2SC 1SJRA 2PA8D 5LL6d 1FRMA 3GYNA 4H54A 4RW6B 1FRLA 4M5MA 2R7TA 1TVRA 2HBRB 2ZE2A 2W2OP 3SIPB 1BLUA 2EFQA 2MTLA 4NYOA 3DLBA 2IPOB 4P73A 2QLFB 5HROB 4HACB 2B4VA 4CLLA 2JZ5A 1VQ4S 2D3ZA 2LKZA 2APOA 2B4OA 4ZPWR 3FKBA 2DXDA 4DQSA 2DHHA 4ZA1A 4DFJA 1QD1A 3DGPB 4EBDA 4FYWB 4KV8B 3L9ZA 4RUAA 1T3NA 3ISNC 4FVCA 5LM7E 5IC6B 3LA0A 3A13A 3OXLA 3QJPA 1M1KT 2ZJQQ 1KLMA 2MMYA 3HHNB 2KXHA 5E3AA 2R7SA 5K14B 3DYAA 1GMUA 3SSQA 4G1PA 5LJ5Y 4MYTA 2XSFA 1S0OA 3M2VA 1U2FA 2KZMA 2VC0A 3PW0A 1Q78A 1MWYA 3QZ7A 2HZVA 1DURA 3PJWA 5HBMB 2AWZA 3MPVA 4F4XA 1S9EB 3P4UB 3D1OA 3R5BA 4TQSA 3ELHA 2K7KA 4LR9A 1SL2A 4NXNF 3SCJE 3TQ1A 4DG1B 1OYEA 2OMOA 1LWEB 4PWUA 4C7QA 1XQIA 5IS2A 3FBFA 3BR8A 3LAKA 4TQRA 1GK8A 3CMQA 1KD1T 2M8DB 3V6KA 1MLAA 3BM7A 3I55S 3NNHA 1DY3A 1XIQA 3MR2A 2IM1A 5EWFA 3DLEA 3NGRA 2R4FA 2ASJA 4YEAA 3DNCA 2JLGA 4FYYB 4A48A 1U6FA 5CZVA 5IFMA 4OIXA 3RYLA 4TU7A 1C1BA 3QZ8A 3EGWB 1FJGF 3UR0A 5J1EB 2HVZA 3TJ8A 2FJDB 4H4OB 2J9DE 4BCAA 3I5BA 1AA1B 5LSLA 4DR1F 2CG4A 1HBNA 5I42A 1MG7A 2V2QA 1FRXA 2GMHA 4J5OA 1LFWA 3MECB 1B0VA 4AD6A 2MKIA 2JRSA 1JLFA 2IM2A 1IKWA 1X9MA 4E8UA 3B8HA 3DRSA 1X4FA 3HULA 3T9NA 2RJZA 1ZM2A 3VF0B 1RBOB 5HMYA 5BR8J 3PIPQ 4DUZJ 3JQMA 1IKXB 3NMAA 4LSNA 4LFAF 4DXLA 2AF6A 3MM9A 4BBYA 2R3VA 1S6UA 2V4RA 1JKHB 4KGZB 1LXNA 4LQ9A 2ZH3A 2BR0A 5F0UA 5T41A 1JIHA 4DN9A 2DR7A 1VOMA 1HYSA 2DVIA 3GMGA 3IWLA 1ROFA 2DR9A 5KFVA 3G96A 1O8BA 2UVUA 4LF5J 1MU2A 1U24A 1LW2B 2MXYA 2UXDF 4RNHA 1NKCA 5F8MA 1YJNS 1IQTA 1ZM3A 2RKIA 3NS7B 4OI1A 4M5DB 1LWFB 1NDLA 2GV1A 4UZCA 4J9UE 2DYAA 3CCQS 4ECZA 1NXIA 3ZTSA 3J80U 2E5HA 3L95X 3KHRA 5GAEU 1E6YB 1LEOA 1FEHA 2P9EA 2WAQD 3W66A 2B4PA 2RQMA 1MROB 4O4GB 5FLXY 2VA3A 4AL5A 1XMQF 3KLIB 4H4MB 4O3SA 2DHGA 4JI8J 1Q0NA 1UWAA 4N76A 1FKAF 1GXTA 2FHJD 1RAAB 4UQTA 4YHHF 4LF7J 1CQMA 3KK3A 2GHPA 3OV7A 2R8JA 1ULRA 4Q44A 4YQWA 4NZ6A 1U25A 2ZH5A 3F44A 2L48A 2JJ4D 4QWBA 3X3UA 1T9XA 2RDIA 1KDNA 2W9BA 1N5YB 3IRXB 2XMTA 1SC1B 2MQLA 2FVRA 1KNZA 3MPWA 1K1QA 2DK2A 3TVZA 5KG3A 4FBUA 1WEZA 4LF2A 1B0PA 3E01A 1CJKA 4TYBA 7FD1A 3JSMA 3O1LA 3K5OA 4RW8B 3H4DA 4EO6A 2G2ZA 2QJ3A 1FJEB 1L3TA 3CTRA 4RW6A 2R7UA 1ZH5A 2UVRA 2Z57B 1HW9A 3BH7B 2JDJA 1JXVA 3KJVA 3LGHA 2D41A 3MUVP 4O3NA 1R0CB 1WORA 2MQPA 2I2YA 1PIEA 5HJXA 4TYAA 5HROA 4U9RA 1YI2S 4QWEA 3D2WA 1O6XA 2LXUA 5KFJA 4FYDA 2POKA 2MY8A 2C3UA 3GCXP 2H1YA 5HO4A 4AFFA 3HSGA 1HNZF 1VQ8S 4DR4F 4OYMA 1W2BR 2JVOA 1TL4A 2ZBCA 2CQDA 4USWA 1YJ9S 1NUEA 4NXMJ 3B4MA 4KYZA 4WKYA 1IR2A 1RT2B 3TQEA 3UD4P 3K5MA 3K7RA 2WK4A 3MAAB 4ZCKA 4O3RA 1NHVA 5K14A 5C24B 2H5IB 2YH1A 5JVHQ 4OJ1A 1HQ2A 3PRVA 4D3HA 3QIDA 5EHHA 1Q95G 2CDQA 5HVGA 4IO9Q 3PJ9A 3BYRA 1UFKA 2CVEA 5HBMA 1YRUA 1KOHA 3W5ZA 1SL1A 4DV4F 3CDUA 1XBWA 1LWEA 1WKLA 2BZ2A 3AQOA 2ATLA 1XC9A 1VQ9S 3B6BA 2V6AA 1FWKA 5B0CA 2ZFHA 3BR9A 3IAM9 3A3OB 3R9LA 2E7VA 5KT5A 2YXLA 2ZH2A 1YZ6A 2JNJA 3DM2B 4J91A 3GR1A 2D7SA 1JWWA 4C97A 1Q8LA 3FEZA 3V81B 5A8WB 1RT7A 2BJ9A 1WNEA 4Y6IA 4NWBA 3RB6A 3FBEA 3OFHA 4DSLA 1FDAA 2CIMA 4YR3A 3HPOA 1ICEB 3Q22A 5D15A 4U6PA 1RT6A 4UF4A 3RRKA 1DTTB 1S76D 2WVBA 4PXCA 3QSYB 5EUHA 2F65A 4ZCIA 2MSSA 4RUHA 1FVSA 1Q5YA 3MURP 2DHSA 4QW8A 1Q8BA 2NQPA 4WU2A 1IKXA 5D0EA 2KB2A 2DO0A 3MEDB 1JLGB 4DSFA 4I2QB 5D6GA 1XR7A 2YTCA 4DU8A 4CLKA 4FP9A 4WJBA 1PILA 4WTOB 2E29A 2BJ8A 1VQNS 1XWLA 4FNIA 3EZOA 1N5QA 4OZ2A 1U48A 5KT6A 1FXRA 2UVWA 3BGUA 4WP9A 1PGZA 4J9KA 5HQMA 2BEFA 2ZUAA 3W7BA 3TA1A 3NBPB 8AT1B 3I87A 3UN3A 4YY3J 1LW2A 3JTNA 3AQPA 5HSPA 2FLLA 4Y28C 4Y3CA 3THVA 4M5DA 4JI0J 2G13A 3PACA 3HK2A 4PXBA 3EM1A 1LWFA 4R5PB 3RAQA 3B4DA 2OPQA 3DHXA 4QIEA 1S5ZA 1HPZB 2R7OA 3GTYX 3I9ZA 1MWQA 2MLZA 1QSSA 3H2VE 3ZO7A 1GTEA 3RRHA 4C8ZA 4DR3J 1T03B 2OPSB 3HCXA 3M2UA 1MROA 3JSRA 4OLPA 4X4OA 3J81U 4O4GA 1TFWA 1PAEX 4RBVA 3ZZOA 2MYFA 1RTHB 2X3GA 2YKOA 2V2VA 2QLWA 3CDWA 5BR8F 4DUZF 4H4MA 3CMAS 2VJVA 1RDRA 2GJ2A 2HZAA 2HBZB 4RL1A 1X31C 1WC6A 1Y7PA 3HFKA 5E3RA 2Z4PA 4DUYJ 5IV4A 3CCJS 1F5CA 5IC4B 2B4UA 4ZITA 3N0VA 1G6BA 1L3KA 1RAOA 3M32B 4ZVRB 5KFEA 4X64J 1AYEA 5THWA 1S1UA 1QAIA 4RUCA 4L75A 3HX9A 4J7CA 2N82B 4PG5A 4ICLB 4IQXA 4YR0A 2CJXB 1N5YA 3PJXA 3CJ8A 3RB0A 2ALZA 2H5JB 2PFDA 2WBMA 3OTOF 4PUOB 2IBKA 1KKHA 2EFVA 3DC2A 4LF5F 4Q43A 2V8DA 2HNDB 2K3KA 5A8RB 5IWAJ 4WE1B 1WSVA 4K5RA 2PIIA 5DDRC 4RW8A 3TRGA 3ZZ0A 1SC6A 4PG8A 2QT7A 2FGCA 2WRMA 4LRCA 2UUAJ 5K8PA 3AOAA 2J6UA 4WK3A 3OFFA 2PMZD 2CVIA 4ERDA 4RW9A 4NZ7A 3GV7B 2NCKL 2Z58B 1TK8A 1HHQA 3IM8A 3VGUA 2QA4G 3IR5B 2V9WA 1PG5B 3CE8A 2XMWA 4O23A 2O67A 1NJXA 1FKPB 3HFZB 3OVSA 4MH8A 3AJ2A 2NZCA 4KT0C 3TO8A 4OYAA 5CYMA 2YBVA 2IAJB 2MZJA 1RADB 3D54A 1RT5A 1N33F 1NK7A 3I31A 2P5VA 1U47A 3IC1A 1PYSB 2RVJA 1RWMB 1U49A 1SXLA 4KGXB 3TZZA 3KLFB 4DFKA 3WX8A 4QQBA 4JI2J 2DHAA 1LWCA 4DBQA 3C6TB 1RT2A 4YB7A 3VAJA 4NYZA 1UPMB 1FJCA 1LKZA 3FRYA 3IMQJ 2GW8A 3CD0A 3T1HJ 3MAAA 1VRTB 2FDNA 2Y1LB 4ED4A 4ED0A 3G6ES 1HWIA 1OIAA 1WC1A 5ETVA 4U96A 4CLSA 4C0BA 2AW0A 3EGVA 4DV6F 5B0DA 4K4WA 3CNQP 3FNNA 3CJ0A 1UKUA 2GVZA 2FVCA 2DR8A 3GFXA 3DU5A 3ISZA 3I0SA 4NLDA 2F8MA 1XK8A 3BN7A 3H5YA 3M6UA 2CZVC 1KSPA 3MEKA 1ZS6A 5JJBA 1FWLA 2MB0B 2AMCB 2GVDB 2LCWA 3FC9A 2B9WA 2GCFA 3AA8A 3DM2A 3M2RB 3JS9A 1HWUA 4USTA 4ED6A 3HT3A 4P75A 4R0JA 2IIHA 3SYZA 1SI9A 1IUJA 4PG4A 1TUWA 2AIRB 5GMKa 3MEEB 2Y0SD 1Y3KA 4A8OA 1YZ7A 1VRUB 5LT5A 4DPOA 3QLHB 1DJ0A 1FEEA 3ZNUA 1HBOB 2ROEA 1WKJA 2FJWA 5KFQA 1DTTA 1VQ5S 4USVA 4DPWA 1S0VA 1VQPS 5E41A 1NJWA 1WC4A 3UD5A 4L72B 4UOFA 2Q3PA 1HHTP 1S7IA 1CJTA 4PRFA 1UJ5A 3NKYA 4IG3B 2H65B 5CA5A 2YH0A 2WCXA 4MFBA 1KQSR 2DGSA 3V6DB 2F8EX 5HMZA 1FNMA 3MEDA 1TQLA 1JLGA 1SJQA 4I2QA 3I56S 1RHMB 1CC8A 3CJ4A 1FCAA 2IHR1 3MR7A 2G4BA 2GC8A 1IBCB 5DDOC 2GHWA 2ROPA 1KFSA 4C4WA 7FDRA 5C25B 4X65F 3BPDA 3SSSA 2LEAA 4O3OA 2MQ8A 2HPUA 1YJWS 4TY9A 1HWKA 2CQ2A 3QO9B 4NYPA 3Q8RB 3VGTA 4DSKA 3OFEA 2C2KB 3Q8YA 3UE2A 1NB2A 4W4MA 4JBCA 1S6PA 3TAQA 3NBPA 4DMZA 1SKSA 2ASDA 3CCWA 1KC8T 4RO0A 2BUNA 2XM3A 3TVKA 2KRBA 5JMNA 2MQNA 4K4YA 2GIQA 1KHWA 4R5PA 4B3MJ 3GV8B 3PYDA 4F04B 4DF4A 4NCBA 2HSEB 4LBPA 4F8RA 4YR2A 3M8ZA 2HHTA 5KFIA 1WHVA 2DGVA 3AOCA 4K50A 1T03A 2OPSA 3BSCA 3P5TL 2BABA 2C1EB 2OKQA 3MI7X 4KH0B 4I6AA 2HK3A 2R42A 1FF2A 2VQFF 3CB4A 1RTHA 4K2JA 3BJYA 4ES1A 1RCOB 4DJBA 3FFIB 4ZP8A 2DNNA 1DTQB 4WBFA 2BDPA 1NO8A 2CJYB 2ZKTA 4KHPJ 3H40A 2ZOFA 3TUZC 2C22A 5DQHA 1JB0C 1P1TA 5GAGI 3UN5A 1RWUA 1VC6A 4NLWA 1H2TZ 5L9NA 4FDFA 3AB4B 4YP3A 1NDCA 2JC0A 1B4SA 2RHQB 3DLKB 1JLQB 2JLEA 2M9KA 3C16A 5AE1A 4WPAA 1P1LA 3H5SA 5F3TA 1Y5LB 2HNZB 2H4YB 4PUOA 3HFVA 5EGYA 3G82B 1LXJA 4C8KA 3FQLA 1BY9A 1XN9A 4Q8FA 5KFGA 2KVQE 3VCDA 4WK1A 4YY3F 4DCPB 3QATA 3PM9A 5A8RA 3CXCR 1QSYA 3N5FA 4WE1A 4Q0BA 1TZ0A 4NCGB 1XMOJ 2AYBA 4JI0F 1RTIB 2B3TB 4MKAA 3LTOA 4M8LA 3GYXB 1GQEA 3CJQA 2YWHA 1X0FA 4QW9A 1OS5A 3DFEA 1NLKL 3ILOA 4ZLJA 3FBCA 2FVSA 1UA0A 4DR3F 3GIIA 1D9AA 5ETQA 1FKPA 1FX4A 4OX7A 3SQGB 3KHLA 2BW2A 5DLFA 3HZEA 2EG2A 3G87A 1IBLJ 3RZAA 2IAJA 3T19A 1WDDA 4GKJJ 4F4ZA 2CPEA 1X4EA 5DM6Q 3IBCB 2VG6A 3SFUA 2OFHX 3ETMA 4MAKA 5JUMA 2NSBA 2VL1A 2OIHA 4CLYA 2VBYA 4G1QB 3EMTA 3FGVA 4Y65A 1RHUB 4I2PB 2AEJA 2A6MA 4C11B 2RSQA 5KFYA 2G2YA 3CIMA 1N4LA 5AXNA 1YG0A 3C6TA 3QWPA 3AY0A 1UMJA 4ZP6A 4LQ3A 2XHCA 2ZC3A 4P6QA 3U27A 2YKNA 4PZVA 1S49A 4OX8A 3D3CJ 4USJC 1P9QC 4NMLA 5ETSA 3FJ2A 1UPPA 3QAUA 1UETA 5H9FK 4D3GA 4OZJA 2BANA 1WWHA 3UNGC 4OL8A 5IWAF 3W2WB 3KOAA 3KJNB 3DOMB 3HHLB 1U8SA 4ZIWA 4K5SA 1K9MT 3GSIA 2DNYA 2R7WA 2VASA 4WYWA 1VLOA 2AYMA 1ZTTA 2UUAF 1QM9A 1X0PA 2IC3B 2MLYA 1SKRA 4GVBB 3PDNA 2OPPB 4DR6J 4C8YA 4B9NA 1RKIA 1R6VA 5ETKA 2M4MA 3PW2A 5KFHA 2GVDA 1VJQA 1HQUA 2PN6A 5LOQA 1PJ5A 4QJVA 2VIHA 3M2RA 2QGFB 1RT3B 4URQU 3CWJA 1SIZA 1VYAA 1YBTA 1M5OC 3N6NA 2KT3A 4NLXA 2LU2A 4O0NA 4DX6A 1CBKA 2RF2A 1WC0A 3KMQA 3R5DA 2C2RA 3IG1B 3DLHA 3RRGA 4F0MA 4L6V3 1M90T 1H98A 2M2BA 2A1BA 2KZZA 4JI2F 1P9YA 3QLHA 2XEXA 2VDIA 3GYGA 4WYLA 3TAMB 4R25A 1HBOA 1C4AA 4GKKJ 3NS5A 5AT1B 2DRAA 3D7SB 3RUBL 3T1HF 2C2NA 2E1PA 3MTJA 2XC9A 3E51A 1NSPA 2E1AA 4EO8A 5E7OB 2OO4A 5J2MA 1N32J 2GQCA 5HK4A 3R6GB 5KOXA 4IG3A 4JI7J 3MMAA 3QYYA 3DOLB 2LDIA 2MZRA 3A3PB 2BACA 1EX8A 4KO0B 4C98A 1D9FA 3LP1B 4M5HA 4CH0S 1X4GA 1HARA 5B0AA 5L1IA 3AD7C 1K8AT 4A8KA 4ETZA 3HVWA 5HVHA 3CCMS 4Q2LA 3M9NB 2VBXA 4XPEA 1WG4A 4HI1A 2UXBJ 5C25A 2HURA 2BJ7A 3M8QB 3CJ2A 3KG4A 2WBRA 1EQ0A 1HWJA 2DPJA 3QO9A 3GFHA 2QLXA 2KDOA 2HWIA 3LW5C 3EXYA 3BF4A 2IYGA 1TKTA 1D1UA 2KFNA 4F4AA 2HGNA 3S01A 4DL7A 3ZZTA 3UPFA 1C0TB 1Z2LA 2PI4A 1UVKA 3OUYA 1T3OA 5B08A 4KKOB 3H59A 3AB2B 2K7JA 3FMWA 2XS7A 3CDEA 8ATCB 3SV4A 1IBMF 4ANCA 4MK8A 5HATA 5D0RA 2E5LJ 1SIWB 4IYQA 2XSJB 4OHVA 2DNOA 1QAYA 2OP5A 4RLEA 3MM5B 1S59A 5ETTA 2AZ3A 2KL8A 1FRKA 2DHXA 1HI0P 2YKAA 3FFIA 3GJQB 1RWOB 2CPIA 1DTQA 3I0RB 1NHUA 1WF1A 4ZVSB 3W8GA 4J9SA 1J27A 3I32A 4LFBF 2DNQA 2UXCF 3UDCA 2KO1A 1QAJA 1VQMS 5KTQA 5SZTA 5KG2A 3R7SB 3TA0A 2VZ9A 2XNQA 2IVFB 2XO7A 4RNOA 1LW0A 2X1AA 3KUEA 1TP7A 3UCZP 4CLFA 3ZZZA 3POTB 3MMJA 3T5LA 2NYIA 5LSOA 1ZAVA 3O5TB 2QFIA 4NLPA 1UA1A 2HNZA 3D4JA 1WD6A 3PNIA 4RU2A 4X4TA 1KS2A 3VWSA 1XR6A 4NA2A 1ZPVA 3F73A 4NCGA 1CS4B 3ZTQA 2MQMA 1RTIA 2Y8WA 4ELVA 3AXMA 4IR1A 1ACMB 4RPFA 1HIYA 4J37A 2MZQA 1F9HA 1B7YB 1RK8A 2Y8YA 2GIFA 4IFYA 1FD8A 4GC7A 4F4YA 2QA2A 3SQGA 4NASA 4NI2B 4OV1A 2KJVA 4KHMA 2KT2A 1SH2A 3IR7B 3HVAA 1HFEL 2HWTA 2LQ8A 5GMDA 1UWBB 1FNOA 4M5NA 5KFZA 5KT3A 5KG1A 5KFXA 4BWJA 3J7AN 3LH2S 1IBKJ 3EGZA 2K1RB 3IGVA 2AGPA 4KHPF 1SJ4P 1H7WA 3TAPA 3QJLA 3GIKA 4HR2A 1VQLS 2LA4A 1N48A 4I2PA 2JFDA 2PEBA 2Z2MA 4C11A 2BMBA 4DV7J 2UP1A 4JB8B 4QWCA 1OY6A 3RBZA 1KWMA 1ZZFA 1FI4A 4CH1A 1RLDA 1RTDA 2V5HG 2R8KA 2K06A 2MKSA 5C5JA 3UWTA 3HVTB 3GLJA 4UUWA 1ZM4A 4QU7A 1V3ZA 2MGZB 2DH8A 1VHIA 3IGNA 2RAQA 5A2QY 3W2WA 3DOMA 5ITHA 4JV5F 3O3LA 2CDRB 4MJKA 2EFNA 5KFCA 3G71S 1X8DA 2KI2A 1WELA 4I69A 5IZHA 3HHDA 1MMNA 3PFOA 1X4AA 1YLXA 1F0XA 4GVBA 2OPPA 1WSRA 4IOBA 1GMVA 2I9SA 2N4DA 4CO0A 2RDDA 3W8PA 2W2NP 4KR0B 1M0SA 1VBZA 4WP3A 3D0HE 1A9NB 2RQCA 4JI3J 4WF9Q 2BE7D 3UI3A 2YQ1A 3NNAA 3QT8A 1RSCA 5B7WA 4LF8J 4M5KA 2RS8A 1GX6A 5GVQA 3IG1A 2ZNYA 2EFOA 2RRBA 4TVAB 1TAQA 2HQGA 3NWRA 4V1Ak 4MKVA 3SDEA 4LFCF 2HGLA 4OI2A 2C2ZB 3TAMA 4OYXA 1H73A 3BDPA 2QEXS 3OR2B 5E3QA 2IY5B 4DSIA 2KXNB 3CVKA 2FC8A 2GJIA 2VONA 2EKNA 4GC6A 3ZTOA 2DGOA 2ZH1A 1F5BA 1TKXB 1TMJA 2HBQB 4K2XA 2CQ4A 5EWGA 4M1KA 6FDRA 3SEOA 1RHKB 4KO0A 2GZOA 2G1DA 3SZ2A 4ILLA 3MUMP 3LALA 4DR6F 2X1FA 2OI2A 4NMXA 2ATCB 1XNQJ 4FXVA 3BSNA 3FBBA 2UUCJ 5K9FA 4IKAA 3K5LA 4DQIA 3TJAA 2HGMA 4OHXA 2B7BB 4M5GA 3CJKA 4N8OA 4S0MA 1WJ9A 1S12A 1U1OA 4DSJA 2KKHA 1RU2A 4HTIA 5J2NA 2EKYA 1L5UA 2HWHA 1CEZA 4KKOA 1JNZB 1XR5A 1VRQC 1EIYB 4X4RA 3M8WA 3J7YI 1RHQB 1RACB 2DY9A 4EYHB 3DGVA 3I5CA 1S1XA 1S9GB 1SC3B 2R2RA 1N32F 3MM5A 4P74A 4EFAC 1IJEB 2DBBA 5J2QB 4MMOA 4JI7F 1VJWA 1RI7A 2CA9A 2VPYB 3I0RA 5KFUA 3K57A 1R8BA 2Q79A 3C46A 2BKNA 4URGA 4RNMA 2DXFA 4WZMA 1K44A 3QQCD 2A2CA 1UCNA 2UXBF 2RQKA 2CPHA 2EVZA 2VFUA 1WKKA 3NMRA 4NXNJ 3HSJA 2W9CB 2C2EA 1F9EB 4ZVPB 2F63A 2SXLA 1Q7YT 1RE1B 4IG0B 3MOJB 1WHYA 1LK5A 1L3UA 3CC7S 2I0XA 2LQBA 3TUPA 4EU0A 2VG7B 4IRCA 3PHTA 4RBUA 2M88A 3PX0A 2B9EA 2M5YA 3TZYA 2AJFE 3PCOB 1QAXA 1KQFB 4ECSA 3E2EA 1B70B 1S57A 4J90A 4RX6A 3I5AA 3RW7A 3TOQA 5D0GA 3KLGB 3J7A1 2E5LF 5LSRA 1V3RA 2AJQA 4U8VA 3NXZA 3AJ1A 2B51A 4AQYF 4QWAA 2YY3A 1SJ3P 3LGMA 4NI2A 2VC1A 2RD5C 4OJGA 5M2PA 3QMQA 4HTJA 4DR1J 4OX9J 1OO0B 2K1RA 3AOBA 5IQQA 3QIPB 1R0AA 1U6ZA 3MM6B 2MSTA 1X60A 2ZD1B 3G2XA 3ILLA 2A18A 4OZ5A 4DL5A 1I51B 1AUSL 2DKOB 1Y00A 2KM8C 2B9YA 4RW4B 2M7SA 2CZ9A 4QYZJ 4IRKA 1JXLA 3DI6A 3HVTA 3AAWB 4Y2AA 4B3SF 2C42A 3N6MA 2MGZA 3MDFA 4U67Q 1GFWB 4KFBB 3LQVA 1KFDA 2HVEA 3NGTA 2FUG9 2B8PA 3MTKA 3C8YA 2DGXA 2ZVIA 3GP9A 2QX0A 4X66F 4NA1A 3OL6A 4GVLA 3NGDA 1FA0A 3E8OA 2UXDJ 3LWMA 3FRZA 5D4LA 5HI7A 5BXIA 1FE0A 3Q8SB 2W4PA 2H54B 3BN4A 4ENOA 2VD3A 4N77A 2OEJA 3BQ0A 4N8NA 5E0OA 3KJQB 1W7WA 4CRJA 4WFYA 3BGRB 4RBTA 5CYQB 2X1BA 2ASLA 1SL0A 2HFUA 1DLOB 3N5BA 3NCQA 3R5GA 1NK9A 1AW0A 2CQCA 1PCAA 5EWEA 4LF9J 2DPIA 1XMQJ 3BKFA 2OPRB 4NLOA 4DV7F 4HDHA 4F2SA 3UCGA 4P72A 4ED1A 1Y3JA 5KAKA 3H0PA 5LXYA 4WFAQ 1CULA 3OR2A 2R7QA 3SBMA 3W65A 1VQ7S 4QPTA 3W9JA 2NXEA 5FDLB 5HANA 3DLGA 2HHHF 4DOZA 1M5HA 2XMJA 2W2PP 1VBKA 3IN5A 4JOUA 1J2VA 1RTJA 2AGOA 3EDQB 3RGIA 3ET6A 3O2IA 3HMJG 4MYUA 4KC5A 3HXMA 1N52B 2BM1A 2FHKA 4JI5F 4PABA 5A76A 2YKMB 1FE4A 5T7LB 1RA7A 5FIIA 1OPIA 1X4CA 5BYRA 2E5JA 3VAMA 5HAOA 2XYHB 2WHOA 2UV8G 2R8GA 1SUQB 1ZPWX 1MMLA 4JI3F 1YQHA 3UN2A 2HK2A 1NK6A 2MKJA 2CRLA 4LF8F 1AFIA 3PX6A 1TUVA 5L39A 3VGSA 1WEXA 2D74B 1T05B 3HVRA 2WVFA 5G4DA 2WONB 3C14B 1X5SA 2ZJPQ 2XMAA 4IH5A 3GJSB 4FPRA 3DMJA 4CZCA 1HNZJ 4DR4J 3L09A 5U47A 4PPZA 1DRZA 3RBEA 3M8PB 1AB8A 1A0OB 1S9GA 4ZP9A 4KGVB 3H20A 2XMVA 4X4SA 1X5TA 3QFHA 4V19X 5DO2A 1KLNA 3NCPA 2R2TA 4PQAA 1Y5NB 4A8SA 3UFCX 4N41A 5A0YB 3MPDA 4U7UD 3T6JA 4O44A 2Q1LA 2XULA 3AXKA 3P45B 4GMKA 2JL9A 3J7ZT 1RBAA 2UUBJ 4CH7A 3G6XA 1B99A 1UP1A 4EI2A 2UUCF 4KJIA 2F4VJ 4H4KA 4DV4J 2W9CA 1WC3A 1MNEA 2G0JA 4DPTA 4A8QA 3N01A 2DNZA 4CT9A 2F40A 4IG0A 1R7IA 4Y0FA 1H72C 3W60A 4C0HA 4WIIA 5GAHI 2VG7A 1C2PA 1X5PA 2HLTA 1URRA 4OYIA 2Q6CA 4Y2MA 5D4PA 4AE5A 3S7RA 4MIWA 2CADA 3NGUA 3MR3A 4CLPA 3T1YF 3THPA 3BV8A 2IVYA 1T94A 3UDLA 2L41A 2J8SA 1FKOB 1V3SA 2CZ4A 4B9UA 1TTHB 3VGVA 2E5GA 1WOOA 4KQZA 4ES3A 2VFSA 4CLZA 1FFGB 2J9EA 2V68A 1DQ8A 4NOHA 3GB0A 5IQ6A 2EWHA 2HLUA 3TJ9A 1EZZB 4N47A 4JP8A 3OLAA 1LQ9A 1BXNA 2CG8A 4E0DA 1JJ2R 1WUUA 4K4UA 3EXCX 3QIPA 5KT4A 1YWXA 2XMUA 1NSQA 3MM6A 2P9GA 3KWMA 1T95A 2ZD1A 3ONQA 3MWBA 4IH6A 2VFRA 2N4CA 4DR7J 4HLBA 2J9DA 4RW4A 4ZLNA 5B0EA 4ILMA 2HHSA 4J9OA 5GAGU 2ZBPA 1RXOB 5DQGA 4CCHA 3CC2S 1EARA 4UT4A 1RCXB 2ERRA 3BBFA 5C42A 2ABYA 3KLHB 4KSEB 3HD1A 4EGLA 3MPUB 2A2DA 2YNHA 4KFBA 1WF0A 3T1AA 3D5MA 1XTZA 2V4JB 3K17A 4DFMA 1U1QA 5KFBA 1U02A 1S1TB 1FDBA 3I96A 1S72S 1BQMB 1HHSA 4EZ9A 1RP5A 2FZKB 3OJUA 3HSDA 1NJYA 4YB1P 2QL9B 2D3UA 2W2QP 4USUA 4NL5A 1A6LA 1H2VZ 1ELOA 2ZEJA 3M9MB 4OLOA 2VG5B 3VVTA 4OX9F 3RB3A 4Y34A 3VZHA 4N56A 1DLOA 1YJUA 1U1LA 2BX6A 1WHXA 1YTYA 2QMWA 1N0VC 1HKAA 1CJUA 5DG9A 1U2CA 4EYIB 2J7UA 3BSOA 2OPRA 4F36A 4TLQA 4QIFA 2MDAA 4CYUB 3H5XA 3A4TA 3DHWC 2AKWB 5F8JA 4LRDA 5DDQC 2PE8A 2NSCA 3AH6A 5FDLA 5H9EJ 1Y11A 2GO9A 4Z2XA 4B3TF 3A1YG 4LBIA 4K0KJ 1JLAA 3RTVA 3OTOJ 1UFLA 4FS2A 3S1TA 4TKTA 3CCZA 3HT0A 2XHWA 2OSQA 4QBUA 4YMEA 2HVIA 4ZVTB 2ZKUA 5T7LA 3LPEA 3PW7A 2QSFA 2CJ9A 3GR0A 3R2DJ 3CCSS 1UVIA 2IM0A 4ITSA 1QTNB 3OR1B 5I4MA 1NSKL 1Y10A 1SUQA 1I94J 4M95A 3HI9A 4A8WA 4PWDA 1UJ6A 3D3BJ 2FZGB 3FSYA 2PC6A 2AJ4A 3RJMB 4B17A 3RG6A 3LP2B 9RUBA 3KXDA 4LF9F 1H38A 1FDDA 2CQPA 5EDWA 1T05A 2G2OA 1N33J 2DT9A 3C14A 6FD1A 3M8RA 2V2KA 1AZSB 1V5VA 3M8PA 3H8YA 2VF3A 5J1NA 3TX8A 3HHLD 1CSJA 2GMJA 1DAXA 2WSCC 3LO3A 2R7XA 4WP8A 2DCLA 2AHOB 3GILA 1HR0F 2PD1A 4AYBD 3OHBA 4PXDA 3BDEA 3JYTA 2BVZA 1BUXA 3HJFA 2NXNA 1GXUA 1KQKA 4USMA 4EWTA 3EVMA 1U1MA 5IM0B 1S7HA 2E7WA 5A0YA 5AXLA 2CXEA 3AJDA 1S99A 1SH0A 3EE3A 3M1VB 1S0NA 3HM9A 4KH1B 4DV6J 4LMZA 4C3KA 3PVXA 5D78A 2UZAA 4OZLA 1R27B 3ILJA 3W3SA 3GFZA 3PO4A 1TKZB 1C4CA 2IJFA 1GEHA 1IR1A 2WOMB 2E7XA 1FRHA 4NX9A 2KT5A 5AE2A 1WACA 3OT9A 2QRRA 4UTGA 1NPKA 5KFTA 1M5KC 4WZQA 5L38A 2UV8A 3OJSA 3CIZA 4QIGA 1RYSA 4HACA 3NLCA 3P6YC 3TZXA 2J7WA 4ECWA 2J7KA 3KK1B 2JHEA 4WCEQ 4OJHA 3CW2C 2ZC4A 2BQRA 2HFVA 3UDEA 2IMOA 1S1WB 1V5IB 2F5GA 1HWLA 4PQUB 5I3PA 4PXEA 4OHYA 1FRIA 4ED3A 1FKOA 5KFKA 1HNWJ 2QMXA 1M5VC 3DGPA 4KBIA 5KFOA 2V94A 4KV8A 2PMHA 2ZNZA 1L3SA 1T02A 1TL1B 1HW8A 3GONA 1PKUA 2HIQA 5KOWA 2J8AA 1KR4A 3PW5A 1Y9OA 3CMES 3EGNA 2IRYA 1DARA 4E98A 3OBIA 3J81Y 2O1PA 1JLBB 1QE1B 3GIRA 4B3RJ 2JSXA 2W24A 3H7HB 3MFIA 3VQSA 2UUBF 3SCKE 4DCOB 4FYXB 3PW4A 3DRPB 1OMSA 2H4WB 4XDCA 1S9EA 4AUKA 4ED8A 2F4VF 4DG1A 5HMWA 3LAMA 1YJVA 1U8WA 4Z7CA 1YX2A 3MCSA 2ZDOA 3JTPA 2AV5A 5K20B 3W5XA 1O5JA 4LRFA 4WFZA 4DU7A 2FLNA 2CQ3A 4X65J 5J1PA 2YKPA 2BJ3A 2GHVC 2KXFA 1TVRB 1BQNB 3K89A 2ZE2B 4DFPA 1D8YA 4X84A 2DNPA 4ZIVA 2U2FA 4B3OB 2CNLB 3TI0A 1U6BA 2E9RX 4YN3B 3HD2A 2HRYA 3QRPA 4HKQA 1AROP 4XDDA 2HS3A 3G6VA 2V8GA 5JVGQ 5EX0A 2B9XA 2OH2A 1GMWA 1BQMA 4Y00A 3C15B 4ZVHA 5EN1A 4KGKA 1U4BA 4DV2F 2BE2B 3ENWA 4JV2A 4I64A 1VLYA 5J1EA 3JAMU 4HHUA 3M6WA 1MN9A 4H4OA 2FJBB 2LVWA 3AFGA 1FTRA 3DLJA 2VG5A 1UAWA 1C1CB 3G4SS 2BOAA 2IM3A 3MCNA 3MECA 1KTQA 2ZWPA 3KMSA 2E1RA 3NOCA 2HEKA 2DNGA 2GS8A 2FLOA 4C8MA 2VQFJ 2K8GA 1WDTA 2F9JA 3R3TA 5HL7Q 4DR7F 3RR8A 1OSDA 3FCHA 4U7UK 3NS6A 5CZXA 1UVJA 2XZDB 3AD8C 4DV3J 3CD5A 4CYUA 5LMNJ 2EEYA 2QZ8A 1R6YA 3T5HA 1JKHA 2FQQB 5A8KB 2VFTA 4NLQA 2E9TA 2HRTA 4LBHA 3D6TB 3G86A 1GX5A 4ZVOB 1E6VB 4ZP7A 2EW9A 4P2MA 5ADZA 4A8MP 2NXUA 2B8QA 3CGIA 3VALA 3UO0A 3VVUA 2MKCA 2IDEA 5DGAA 3RR7A 2CFXA 1NEEA 1OWXA 3U7JA 3NP5A 1N5TA 1JQGA 3GSDA 3DLEB 3NAHA 1N88A 3H25A 5ETNA 3OR1A 1IKYB 3F0NA 4C8OA 2R7VA 1FVQA 3I6PA 1E6YA 4JI4F 3T41A 2QG9B 2FVQA 3OL8A 2HIYA 3SXLA 3DCAA 3LP2A 3Q24A 1H2UX 4XPCA 2E66A 3KLIA 2J0WA 1JLFB 4TLRA 3EX7B 2X3DA 2A3JA 1KBRA 1R3NA 2GIRA 4AXIA 2E44A 3W62A 2FVPA 3JB9k 1BWVA 3D0GE 1HD1A 2RIJA 1SJFA 2PFFB 3BO4A 3AHPA 5CYJA 3MPYA 2ADCA 3CJRA 1QDUB 2HYIB 2XYGB 4OJ3A 3MM9B 3IRXA 1WI8A 4MT1A 3CCTA 4CO1A 4K0KF 4J9NA 4IR9A 3IBFB 3TWZA 2HQIA 2C3YA 3R2CJ 1FXLA 5IM0A 4LR8A 1QLNA 3TNVA 4DL0C 4ZPVR 1G7CB 2GX8A 3P3DA 4HHJA 5ETPA 4KAIA 1KRPA 1UZHA 1S1VB 1BQXA 2CNOB 4GO7X 2I38A 1N56A 2KN4A 2OEMA 4P7VA 4ZCLA 1N5SA 3G8TA 3QRQA 1U45A 1IN0A 1TKZA 1KVJA 1WOPA 2PMWA 2H5EA 4LREA 3OSPA 4L3KA 1I94F 4MIAA 2WOMA 3SV3A 2CPFA 3FSIA 2IMWP 4DN0A 3IBWA 4LVNP 3ZZRA 1KTVA 2QYCA 3QT7A 2LFVA 3G9CA 5IXUA 3AD9C 4RNFA 2W7OA 3FK4A 3A8KA 2HS0A 3KYLA 2RH3A 3ENQA 3OW2R 2O3DA 3QBCA 4RUBA 2Z30B 2HG4A 3BPSP 2QA4S 3IAS9 4DX8H 1F3VA 4FNHA 4P2XA 2KYXA 4OYBA 4RNNA 1TL1A 2W8LA 3UVJB 1WG5A 3CCES 3PZPA 3J7YU 2DGQA 3G8SA 4UW2A 4LF1A 2MZ1A 3BGFA 3NOGA 1JLBA 4FXWA 2GFFA 1QE1A 5C24A 2C3OA 4V19J 5IT9U 1IJFB 3S8SA 2GAHC 3W64A 4NCAA 5K5MA 3MCMA 5LMUJ 4X4VA 3R1HA 2WVEA 1LOUA 3DRPA 2VQEJ 4EMDA 2HZCA 3OXFA 2ADBA 2HMIB 2J0QD 5L1JA 1CJKB 3ZZPA 2BM0A 3JSMB 2IFXA 2MHEA 1FHTA 4OQJA 4HEA9 2DD8S 1NDPA 3QRRA 3QFWA 3LUYA 2QL5B 3Q89A 4U7CA 2AD9A 2AU0A 1BQNA 3KJVB 5DLGA 3L3CA 2LQJA 2ZBIA 2ACYA 2C2OB 5D77A 4QWDA 4B3OA 4ZCMA 3V81A 5A8WA 3MAQA 1EP4B 2MJNA 2V8VA 2HQ3A 1HNWF 1EHWA 3C15A 2XWXA 4PWWA 1S4FA 2BE2A 3OL7A 2FPHX 4YDDB 4HT5A 1B0TA 3VV2B 4P71A 4WIQA 1WI6A 2UUWA 1TL7B 3HF5A 3GE9A 1U7LA 4HYKA 1IBMJ 4F3MA 1NMEB 2MJUA 3TYTA 1C1CA 2ZH8A 4K4ZA 4ZVFA 4B3RF 4XTTA 5DS7A 2RT3A 3R5JB 4YFUA 4NLSA 1TV6B 2UU9F 2WB4A 4RWXA 4JUZA 3TARA 3UDVA 1BE4A 2X7IA 2J76E 3GPAA 5KG0A 1UEKA 1S6OA 3RBXA 2CNNB 2WW4A 1LFPA 3WDOA 1FK9B 1BHNA 1NH8A 2WW8A 5BYSA 3M6XA 5AXKA 2DRDA 5KG5A 4NLTA 3JXOA 5ETRA 4LFBJ 3BQ1A 4DCJB 2UXCJ 5LJ3Y 3MGJA 5E2QA 3ZZYA 1K73T 3CSKA 3CCVS 1VQYA 5A8KA 4JYAJ 2XGQA 3DKDA 1BWEA 1FFWB 1RABB 2MPUA 1HNXJ 1E6VA 1NJIT 2VODA 2OAUA 3NRBA 3QT6A 3A12A 3RU0A 1FXDA 4A8YA 2FY1A 1VFJA 1VQSA 1RT7B 5C2CA 2IJNA 2Y3YA 4DL3A 2W9AA 3PKMA 4HT7A 2GO8A 5I3UB 3Q86A 1IKYA 2XTJP 1HPZA 4MIBA 2CJKA 1S77D 3QGPA 1AT1B 2KYZA 2M3DA 4OI3A 4N5SA 2V9KA 1WF2A 2UUTA 4QU6A 2AEFA 4O0IA 1RT6B 1URNA 2F7VA 3TZWA 4DQPA 4Y2IA 4IO1A 3K8WA 1RGVA 4DEZA 5IOLA 2D3O1 4HH1A 1WTBA 3EUNA 2V69A 2Z8QA 2JEIA 2DIVA 1R8PA 3BBCA 1NK0A 4DR5J 3GIMA 3KLEB 1RYRA 3HHEA 2XYPB 4ZDNA 5GADI 4DV3F 2RRNA 5LMNF 1H0HB 1KN6A 1NK4A 3M32A 5F0WA 1S10A 2ZZNA 2DXEA 3MXHP 2G9OA 2ZM6J 3KUHA 3DDKA 1SKWA 4A4JA 3PV8A 4ICLA 1RAEB 1Q1KA 1T9WA 2J0SD 3JTOA 4LUBA 5A6PA 2KRRA 3P8BB 4DV1J 5KFWA 2LXFA 1VC0A 1F3FA 2K2PA 1HI8A 4USHA 3P5BP 3M4XA 3WX4A 3LP0B 2VJUA 4IQMA 2HNDA 4OHWA 1S1VA 4WXOA 2B7CB 4NRTA 4JV5J 2D69A 3M8SA 4MK9A 4F26A 4XAKA 4I67A 5F3ZA 1TK5A 4X4QA 4OHZA 2LU1A 4QR2A 2J0XA 4B9LA 3AA9A 3ENAA 2QV6A 4LR7A 5DGBA 2E9ZA 4RKUC 1A7GE 2B43A 1VS3A 2XWYA 2LMIA 2V67A 3PKYA 3I4PA 2OPQB 3QGGA 1VQKS 4QZVB 4RZRA 2FHMA 1UW4A 1H74A 1HL6A 1D9DA 3MAHA 1OY9A 2AEMA 3M2UB 2XY6A 1U1PA 3PTWA 2CWKA 2HRUA 4QYRA 4RR5A 2FJXA 3KLFA 1RAFB 1FERA 3EVWA 4KHRA 2GJFA 3DDIA 2JEGA 3D66A 1H3DA 2ZUGA 4C8LA 4LFCJ 3UVJA 3OTCA 4XIUA 3QAEA 5HLFB 2YNGB 1LV5A 1RAGB 2HFZA 2OMLA 3CEDA 3I9V9 3LANA 2G1HA 1VRTA 2L9WA 1S1UB 2RU3A 1T11A 2DR5A 3CCRS 1NU4A 4LRAA 2IVMA 1GNKA 3L7PA 2HS4A 2JEFA 4CNZA 4DV5F 2F9DA 4B9SA 3FDSA 4URSA 1VIXA 3C66A 2Z2ZA 2HMIA 2HAFA 4QIWD 4DL6A 4HI2A 4ZJLA 4PPDA 4FF1A 4J9MA 2YKQA 4AL7A 2O66A 2KH9A 3TUIC 5KFPA 2HHPA 4UQGA 2VOPA 1XNRJ 2KFZA 5F8IA 1R8AA 4RW9B 2EI5A 3V2UC 1KHVA 2FZCB 3KUGA 4ANEA 2ZOGA 1UEUA 3SCLE 4DX7A 5HVFA 1HA1A 4RWWA 2DRBA 1EP4A 2ASYA 5GAHU 4UY85 1YGYA 5CYMB 1IR0A 1X7VA 4Q8EA 1WHWA 1QJHA 3MEEA 4UZBA 2OFGX 1RT5B 1VRUA 1R89A 3MM8B 3D1HA 4IOAQ 4CI0B 3R7NB 2BKOA 1TL7A 2CKWA 2YWKA 4LSZB 3BZQA 4ECVA 2MHNA 4KIAA 1LWCB 2MKHA 1CLFA 4OZ0A 2OHDA 2HQCA 2FD2A 3T6BA 1TV6A 4X4UA 4F67A 2DGUA 3EYZA 5LMUF 3IWXA 2ZHAA 4DV0J 2A10A 2BKPA 2J6SA 2VQEF 4C48A 1TELA 4NLRA 3V6DA 1FK9A 3N4WA 2NS1B 2QIFA 4B9MA 1MSWD 4AXJA 2LLZA 2Q43A 2RS2A 1NPRA 5CQGA 1RLCL 2EPIA 3HHLC 3D67A 3OPKA 2GVZB 1EQMA 3BQ2A 5CCMA 4TN2A 1NPPA 3I0SB 2HHWA 4OYWA 5CD4A 2PEHA 2HFOA 2DIUA 3SMZA 1OJ4A 1SVDA 4LVOP 2M0GB 5E33A 1GAOA 2YX1A 1PC5A 3RAXA 4EBCA 1H7XA 1TKDA 1F1BB 3KG1A 4NLGA 3PYFA 3ZTRA 1SCJB 2BRKA 1N34J 2DEIA 2CYYA 3MOZA 4F2RA 4HL9A 2XBPA 4B02A 3M30B 1REGX 2HNYB 1YK9A 4F0HA 1ZA1B 5ETMA 4XO0A 1N8RT 5FLXU 2XG8A 1GXLA 4EUVA 2AJ0A 3V4IB 1QUVA 1UVNA 5I3UA 5ETLA 3B78A 1VK8A 3LF0A 4W90B 3QGHA 2AJ2A 2LQ5A 4YOEA 4KTQA 4KGMA 4AQYJ 2EXUA 3M8YA 4R8UB 2BQ3A 3N28A 1Q86T 2NYHA 3CDBA 5F9LA 2V2ZA 3CJ3A 2KVIA 2C28A 2VPZB 2ZH6A 2NPFA 2EBGA 2DO4A 3I82A 2MY7A 1CJTB 4ZLLA 3KLEA 2UVVA 1SH3A 2B56A 3KK2B 4MFBB 3FZ2A 3KNAA 3FUYA 3ENVA 1NZAA 3ETOA 2NUUG 3OQ2A 5DRKA 4UOCA 2AJ1A 4Y2CA 5KFNA 4K4XA 4JYAF 4ECYA 1T9TA 2Q66A 3CCUS 3DLLQ 3DLKA 2ZOMA 3VQTA 2L9NA 1JLQA 1HNXF 1VQ6S 1T9VA 2E1MC 4F7VA 1GMWD 2GNKA 3BKTA 1I1GA 3G82A 1LWXA 3MR5A 3K58A 4G6VB 1V6HA 4B3SJ 3LP0A 1Y4ZB 3CDAA 2XNRA 1NCLA 1N6QB 2RRAA 2ZH7A 4X2BA 4M94A 3AODA 3O6QA 2W1BA 1WC5A 2PI5A 4OMFG 2WSEC 1ZA2B 4NLVA 1S6PB 5K8OA 2CPXA 3US5A 2QLJB 1UZDA 1VI7A 4X66J 4G3IA 1PC4A 2E5IA 2N3OA 2NUHA 2EK6A 4LIWA 2B5JB 2YWFA 4EEYA 5KG7A 3N9UC 3KHGA 3UW1A 1VIOA 4Q2MA 1BMQB 3CO9A 3BS9A 5DZ7A 3BB5A 3C19A 3PR5B 1FWPA 4UOHA 2VV5A 4QYZK 1M5SA 2HQDA 4I56A 4C3MA 1DHMA 4DR5F 2I1RA 1Y0HA 4BWMA 3ITHB 1VCTA 4ZJOA 8RUCA 1WEYA 1J5EJ 4G1QA 4DZDA 1SQGA 4M63A 2M70A 1NK5A 4WFXA 4F4WA 1Q8IA 2ZM6F 1YITS 1ZBTA 3TP2A 2XS5A 5HLFA 1KOOA 1SV5B 1QVGR 4DLEA 3OD2A 2YNGA 4QIVA 4DV1F 2IA6A 1YRTA 4TXSA 1P6TA 3W5YA 4DZ6A 3MZIA 4CLUA 3WZ0A 1CJVB 1J5OB 4C3LA 1VHFA 2CQ0A 1MN7A 4RJVA 2HHHJ 3C16B 2DH9A 2IDLA 4QR0A 3DXSX 4OZNA 3HHLA 9ATCB 4KPCA 2ZH9A 4DX5A 4W92B 2BA9A 1QTMA 3KDOA 3OTBA 2IC3A 2DNHA 4ID5B 2CWXA 2F1FA 4Q0BB 3IO1A 1Z1ZA 3GIJA 4JI5J 2COLA 2KU7A 2JH3A 3MR6A 3H2UB 1GT8A 4I7FB 4KRWA 2OJ3A 3VHQA 1VBXA 4Y2KA 3B82A 4M5IA 1Q4RA 2GMLA 1FJ7A 4L74A 1FT8A 3Q23A 4YB6A 1RT3A 2GA7A 3H42A 1JLEB 5D0HA 1U1NA 2HAIA 5KFLA 3ZNJ1 3BH6B 1MW7A 3KFWX 3Q8UA 1FNXH 2OTLS 2M52A 4USIA 4MK7A 4PKDB 4DSEA 1Q8KA 4O4RA 4U95A 1FESA 2RDJA 5CH7B 4YS2A 1Y5IB 4ZPAA 3MM8A 2VG6B 4JI8F 5L1LA 3EPIA 4ILRA 3N79A 2HHQA 4X62J 2PT0A 3PXGa 3BKUA 3PG9A 2IA0A 4YB5A 5H1SV 1U1RA 4TNOA 1NSAA 4LF7F 2HFNA 3EZUA 5DZ6A 1SB6A 4C8NA 1U0HB 4FYVB 5F8HA 1U0SA 2B6AB 2DB1A 2KJWA 5ETOA 4NA3A 1VDHA 2O01C 3JSYA 4ETXA 1JJCB 2XQCA 2EC0A 2I5JB 4M5JA 4ZS6A 3Q8VA 2YKNB 2R9LA 2GQ2A 1ITPA 2LEBA 2YNIB 3DOLA 3DU6A 1PYTA 3ZC4A 1D8ZA 2BANB 5KFRA 2D9PA 4USKA 4CM0A 1KVKA 1PSDA 2OTJS 1YSJA 2XI3A 3LP1A 1MWZA 1O51A 2BXJA 2IRUA 3SCIE 2IYIA 1YIJS 4G65A 2HBYB 2FJAB 1XNRF 1NKEA 3TA2A 2OLWA 4L76A 2W7AA 3PX4A 3M8QA 1IM6A 1T0TV 4Q45A 2LP4A 4J9RA 5KT7A 2KHCA 2YX7A 3FZBA 3MCOA 4LIRA 1HQUB 2JOQA 4C6AA 2XLIA 4NLYA 4C0OC 1SJ1A 2CJBA 1S4EA 1YHQS 2MKYA 2BOPA 1KQGB 3VAGA 3HZGA 1RUSA 4LRBA 3OXGA 5HN0A 1C0TA 4L3NA 3BGLA 3FEXB 3M30A 3PYGA 4GO5X 2HNYA 1X4BA 4DUTA 2XI2A 1GTHA 1HI1A 2RF2B 3T1YJ 3V4IA 4P10A 3D6FB 4JI1J 2CPZA 4MKBA 5FD1A 4ES2A 2NXCA 4CT8A 3BBBA 1DQ9A 4TY8B 2XSJA 3KG0A 3EVOA 4XK8C 4NXMF 2RNEA 1Q16B 5G0RB 1EJ7L 3W9IA 3M05A 4R8UA 2PA3A 1RTZA 2R7RA 2VB6A 3TW0A 4QR1A 4DV0F 2G0IA 1ZAWA 2XS2A 2CQHA 3NNCA 5J2MB 4ZOSA 2JVRA 1ZAXA 1HD0A 1R43A 1X9WA 3F41A 5CABA 2VICA 3KK2A 5F8GA 2J6TA 1FTCA 2ILYA 3MMAB 1U09A 3IXQA 3G6YA 1HNVB 1M1HA 1RKJA 3BEGB 3SFGA 2KTQA 5GMEA 2WB1D 4ECUA 5M2RA 3SI8A 1YJTA 2YQ0A 2O5DA 3KHHA 4DI6A 1SC4B 3POTA 1RWKB 3KJFB 1TFYA 5KFFA 1N0UA 3NGKA 2YWWA 1N34F 2OEKA 3VAFA 5F8LA 2AYEA 2IRXA 2MQQA 3D6MB 1VGYA 4F25A 1N6QA 1TKTB 1RAHB 2NXJA 1CS4A 2X1GA 2BE9B 3D6HB 4F3QA 2R2UA 1P27B 1NZ8A 4UY8T 2DTJA 4C9DA 3PHEA 2NR0A 3V6JA 1EKSA 3OUYB 2B5JA 1RBLA 4J9LA 2ZHOA 3LGNA 4ZKAA 1B3TA 3TANA 3PY8A 1R8HA 5BJRA 1T8EA 4F0KA 3NGSA 1UWBA 1Z4UA 3H2LA 2FTRA 4I4BA 4ANDA 5L8RC 1M1GA 1R0BG 1P8GA 4ZPCA 2W25A 3ITHA 5HMXA 4B9TA 1RAJA 2N3LA 3IM9A 1G3OA 2W4CA 3GV5B 2CJQA 4WFBQ 3GQCA 3R5AA 3THTA 1VMBA 3IP0A 3GCWP 3KDNA 1YKWA 1ZETA 4DS4A 1IWAA 2HVDA 3HP6A 2CQIA 3R27A 1SV5A 1LW0B 2WZ1A 4P2FA 1CJVA 1J5OA 1M5PC 4H4KC 4ZN1A 2AX1A 2N7YA 2DCUB 3TEGA 1K0VA 3A8EA 3D0IE 4Q5VA 4B3TJ 1NKBA 3BREA 5CD4H 2D3OR 1PAUB 1NJZA 4MTPA 5IV3A 2HQFA 1Z2ZA 4ID5A 2V50A 2ZHBA 2N7CA 1S97A 2VA2A 3PRDA 1U26A 5D4OA 2FHOB 2YPZA 3DRXA 1Q79A 4I7FA 2RE1A 1QVFR 3W9HA 3RW6A 5EX3A 4ZJQA 1K47A 4LF6J 4IFYB 4ZVUB 2W01A 1JLEA 4DS5A 1OQ6A 1YJRA 2ILZA 1RZMA 1T7PA 1JLCB 5H9EK 1UVLA 1J5EF 1Q5VA 5L9XA 4IDKB 3IA0A 2AQ4A 3WIVA 3GJRB 5LXRA 1W26A 1G4CA 4GRSA 4ZPBA 4ECRA 1CG2A 4FBTA 3U02A 2CQGA 4DUYF 2YQ3A 5CXTA 1NBEB 2L9DA 2LQ9A 2ZZMA 1UW9A 4LSLB 2M8HA 1DBDA 2QO3A 3LOUA 1U0HA 4X64F 2B6AA 1YJ7A 3V6HA 1JJHA 3J81j 3VAKA 4OZ3A 2QFJA 3Q0AA 3BO3A 1HR0J 2I5JA 1RTDB 1TKXA 2XLKA 4DPXA 2YNIA 4NRUA 2NLWA 1NH7A 1F6TA 5MLCV 4OYPA 2AT1B 4Q7AA 2J5AA 1HNIB 1D0EA 1OYDA 2JC1A 2ZVSA 1BC6A 2DNMA 3WHIA 1IQZA 1KVIA 4BS2A 2EK1A 4WWSA 2X51A 4K7QA 1KONA 2ALYB 1D3WA 1D09B 4HHHA 2C3PA 4CO4A 4M5LA 5GAEI 2JFKA 3GU0A 6AT1B 1ZYQA 1FX2A 1VISA 2Z0GA 3ISND 2K3IA 4CNYA 1UFWA 3N6LA 2ZBRA 4OYZA 1HMVB 3Q8PB 4X62F 1H6KX 4N7TA 3FEYB 2VH7A 3R97A 2KG0A 1REVB 2Y1RI 5L1KA 4TY8A 5KFMA 4FPIA 3SDEB 4CLWA 3HLUA 1ZM9A 5G0RA 2EFPA 1AXQA 5E5NA 3CUNA 2MZSA 3PEJA 3MM7B 2AP6A 1C0UB 3IFEA 5J2QA 2W7PA 2HKEA 2FLPA 4NEYA 1YBUA 5DG7A 4FKXA 4K4VA 3V5RA 4F02A 4IFVB 2CAJA 1UEVA 2OGUA 4EK2A 4F3OA 1FRJA 2DISA 3K8VA 3K59A 3OL9A 5KFSA 3WQPA 1HNVA 4ZLPA 2VUGA 1N36J 1LK7A 1FDNA 4J9QA 2Q6BA 5HQ8A 3DN9A 4OI4A 1AUDA 4ECQA 4BC9A 1TMMA 5B0GA 2V8HA 2GAGC 2BJ1A 2QC3A 2XMKA 1UTAA 5DQIA 3EZ5A 4B08A 2BQUA 2AZ1A 3GZ7A 1YVFA 3MHYA 5E3PA 2JX2A 4DPYA 1X4DA 2LYVA 2DY1A 4A8XA 1JXEA 3FSXA 4DL2A 1W2IA 3CJKB 3H4BA 5M2UA 4ECTA 3K0JA 3ZZUA 4DPUA 3MD1A 2XB2D 3OHAA 4JI1F 3B54A 4CWBA 3KLGA 5J2NB 5CHCB 4FF2A 2QMUB 4DV2J 3OFGA 4I6YA 1NM2A 3J80Y 4KY3A 4OV6A 2ZBQA 3PR4A 4I68A 1HBUB 2OELA 4BHQA 3WIUA 2H48B 4FS1A 1S1XB 3R8YA 2I6WA 5J2PB 4HVZA 2CPYA 2EC2A 1F9FA 2BYCA 5DDPC 3MUTP 4ELUA 3T3FA 4J9VA 4CLTA 5HP1B 2C3MA 4FN5A 4Z37A 1OSCA 3DRYA 2QTWA 1RAIB 4X4PA 1X9SA 1PBUA 5FJ4A 1Q82T 5GADU 3U1LA 1FD2A 2LDYA 1PBAA 3TEHB 2GGPB 3H98A 1KP6A 2A0FB 3OTDA 4CO2A 4EZ6A 1VC5A 1NNDA 1SBRA 2XY7A 3C2PA 2IJRA 4ZMMA 2V63A 2QN6B 2MQOA 1F5AA 1RWXB 2ZJRQ 3EDRB 1SQFA 3O8WA 3T5KA 2C2MB 5D3GB 2VBWA 3IWNC 1F2HA 2RU9A 4LF4J 3HHKA 3P49B 2Z2YB 3UR3C 4L73A 4K4TA 4IOCQ 2KG1A 2V8PA 4HH0A 3BSAA 2BJEA 2OUGA 1VQOS 5E3CA 1TL3B 1IKVB 2HFSA 2DGWA 2VKRA 3WC0A 3FVYA 4B3MF 1I5OB 3IS9B 5IT0A 2F8HA 1S48A 2B0GA 3NWGA 4DR2J 5KFDA 4ALZA 1YRXA 3MEGB 1RWVB 2FIUA 3EJMA 3BGRA 1JLCA 3PO5A 3CF5Q 5CYQA 4JI4J 3OLBA 1T9YA 3CT9A 2RMLA 2VOOA 5B0BA 4IDKA 2AGQA 4ID8A 4KB7A 1B64A 5CCLA 2FY8A 3M9OB 3PFEA 2LXIA 2NZ4A 3DXBA 5C2GA 3TVYA 2VBZA 3L7UA 2KHDA 1R0AB 2DEJA 3V4MA 2P9CA 1R31A 4AL6A 4LSLA 4K8RA 2PDAA 2BRLA 2BJDA 3BYPA 3NY0A 2CJAA 1RQ0A 5B0FA 2W8KA 2W2MP 4RU9A 3WBZA 1G1XA 2QL7B 4CTAB 1TU0B 4ZVQB 1CQNA 4WKRA 2IBOA 4TU8A 3DI6B 1EB0A 1YDLA 2RQ4A 1K1SA 5AJ3J 2P8IA 3NAIA 2XMMA 4O3QA 5DJBA 1GH8A 2FHJA 3JSBA 2VU5A 1R8CA 3K5PA 3J7Z5 1HNIA 4ZHRB 2HVHA 1EAYC 4CO3A 1XMOF 2YKMA 3QGIA 2CNKB 1QY7A 4PCQA 3OVBA 3PEHA 3JQKA 2A6OA 1DFDA 2ZITA 4R0EA 3TX0A 3FQKA 2QA1A 1JMTA 4LF6F 3WC2A 1Q7LB 1N54B 4RW7B 3ULHA 4IRDA 3DDNA 2CPJA 3OSNA 2RB7A 2VPXB 2H51B 1IBLF 4PEOA 1RHRB 3NG8A 5H9FJ 3MMBB 1YBAA 2V34A 3AT1B 4GKJF 3I4HX 1S0MA 2YNFB 4ELTA 5T14A 1HMVA 2ZDPA 3X1LB 1RT4B 1X4HA 1RU1A 1XMBA 2FC9A 2WONA 3HO1A 1QUPA 4B9VA 3LPYA 3EICA 3R1LA 1VK3A 1REVA 4X4NA 4P2SA 2XCAA 3JAMY 4PYAA 4JV0A 3DOKB 2EBEA 1NRKA 1RISA 3GFYA 1CULB 2Z56B 1K0TA 3MM7A 4A46A 1C0UA 2LEPA 2DGTA 3CC4S 4IFVA 7AT1B 3DLGB 2BBEA 3OVAA 2E1CA 5KFAA 5A6WA 1RTJB 4ED2A 5MAOA 3FMBA 1TUGB 3ET6B 4WTYA 2WSFC 1XEZA 2VKZG 1VR6A 4DL4A 3SQOP 1ZTWA 2L08A 3E3XA 1U1KA 3M7VA 5BYQA 4JI6J 4ZPDA 4LJMA 1NAQA 5RUBA 3D1QA 2LECA 3DRRB 3KTQA 2YWGA 5HQLA 3QNWB 3GJTB 4A8FA 3S6EA 3W2VB 1VBYA 4DDFA 3W1YC 1RB0A 1EETB 1S6QB 1EKRA 4CP5A 4DF8A 1AFJA 4LT6A 3IRWP 2FJEB 1LNQA 1PO6A 1WTFA 5DM7Q 4NLUA 3KLVA 1RT1B 4FF4A 3UNYA 4Z7YA 1JK9B 3C6UB 3CO0P 4IUFA 2DNKA 1HBMB 4I0WA 3PIOQ 3MMCB 4DQRA 2PO4A 2DITA 3DMJB 1IWGA 4ZVGA 4GKKF 1HBUA 3OTEA 4QCLA 3MD3A 3CULA 5J2PA 5SUHA 4P9SA 1TR0A 1FFSB 1BGXT 4KE5A 2UU9J 3EWGA 2FB0A 2Y1JA 3GG1A 1N36F 1O0PA 5HP1A 1DZ5A 4JV1A 5A2QU 5I3QA 1WOSA 1RJJA 3ILIA 4O44B 1HQEB 4DHVA 4CIOA 2KM8B 2XZTB 2GGPA 1SPBP 2CUYA 1I6JA 1Q81T 2LA6A 2CPDA 4P52A 1DQAA 3D28A 3NCRA 2L3MA 3T5JA 3FCVA 5AE3A 2JEJA 4PG7A 2P2CB 5DG8A 1T9UA 4K59A 3CJ5A 5B09A 1RWNB 3KLHA 2WTFA 5D3GA 4PYDA 1I3OB 3HJVA 3G8QA 1JNRB 1ZOTA 3CJTA 1ZZNA 3GG0A 4BLGA 4QOTA 3U1NA 2AYGA 2XO6A 2V4JA 1TAUA 4NEZA 4J9PA 3K5NA 4U8YA 3MFHA 4YUDA 1CC7A 1S1TA 2HHVA 1QSLA 2XGPA 3Q8QB 5K8NA 2XZWA 1TL3A 2QLBB 4FXDA 1IKVA 4FZVA 5K8MA 2XY5A 1RA6A 2D1CA 3IS9A 2VFVA 3CCLS 2JLFA 2DNLA 4O3PA 1RWWB 3UQSA 3UCUP 1BD6A 3CJSA 1KEKA 3MEGA 2XLJA 4WFNQ 1X5OA 5IT4A 3RAMA 3VAIA 1NDKA 4DLGA 1IXKA 4KPYA 2HW3A 3M6VA 2OD6A 3TR5A 1FJGJ 2OSRA 1B7FA 3IR6B 4WXWA 1FO1A 4OI0A 3QWUA 1KLMB 2YPYA 3K2YA 5HJYA 2W4DA 3DYAB 2F3JA 3A8IA 4PG6A 2RILA 1IM4A 5JXSA 3M2VB 2ZH4A 3P96A 2VPWB 3EPGA 4LFAJ 5CAAA 3H90A 2F4FA 2XCPA 4CTAA 4LF4F 5IT9Y 3CD6S 3TUJC 3Q83A 2HHUA 4ED5A 4OX6A 1V9OA 2ZZTA
chains in the Genus database with same CATH topology
1F2GA 1VI7A 5DQHA 1S79A 3RB3A 4G3IA 1PC4A 1JB0C 1P1TA 2E5IA 5C42B 2N3OA 5GAGI 4G1IA 1RWUA 2NUHA 4Y34A 1VC6A 4NLWA 2EK6A 3CD7A 4UUXA 3VZHA 4N56A 4LIWA 2NREA 2B5JB 1DLOA 1H2TZ 2YWFA 2YNHB 3VAHA 1YJUA 4EEYA 1U1LA 5D8HB 5KG7A 1YTYA 1WHXA 3N9UC 3KHGA 3UW1A 1VIOA 4Q2MA 3CO9A 4CQ1A 2QMWA 1NB7A 4BDPA 1N0VC 3UD3P 5L9NA 3AB4B 3BS9A 3HKZD 4YP3A 1UVMA 4ZHRA 2JC0A 2G0CA 5DG9A 3BB5A 3DLKB 4EYIB 3PR5B 3F56A 2J7UA 3BSOA 1JLQB 2Z2LA 2OPRA 2JLEA 3MF5A 2VV5A 4A47A 2M9KA 5AE1A 2YX4A 1G2EA 1P1LA 3H5SA 1M5SA 4TLQA 5F3TA 1Y5LB 2HNZB 3RB4A 4QIFA 2MDAA 4PUOA 4I56A 5EGYA 1LXJA 4DR2F 4C3MA 4NPOA 3PRBA 3R5CA 4C8KA 1DHMA 4DR5F 2I1RA 3FQLA 1BY9A 1XN9A 3H5XA 1Y0HA 4BWMA 3ITHB 1WEYA 4Q8FA 5KFGA 3VCDA 3HK2A 4WK1A 4YY3F 1C1BB 3DHWC 3PM9A 4G1QA 5A8RA 1TK0A 1Q53A 4DQQA 1UJ4A 4RW7A 3CXCR 1QSYA 3N5FA 4WE1A 4ECXA 5F8JA 2EFGA 4Q0BA 5DDQC 2R8HA 2PE8A 4M63A 1TZ0A 2NSCA 2M70A 3AH6A 5FDLA 3QPIA 1NK5A 4NZ0A 4NCGB 5H9EJ 4WFXA 2AYBA 4JI0F 4F4WA 2GO9A 1Q8IA 1RTIB 3MMBA 2B3TB 4Z2XA 4B3TF 3A1YG 4MKAA 3HDSA 1HBNB 1L3VA 5I42B 4M8LA 3GYXB 4C2MA 2ZM6F 1GQEA 1JLAA 4WU3A 2U1AA 3RTVA 1IBKF 1YITS 2YNFA 1ZBTA 3TP2A 2GQQA 1UFLA 2XS5A 5HLFA 4FS2A 1KOOA 1SV5B 2FGOA 3S1TA 2YWHA 1RT4A 2H9ZA 4TKTA 2CQ1A 3CCZA 3T9ZA 1X0FA 4DLEA 4QW9A 2YNGA 1IKWB 4OFZA 2XHWA 1OS5A 3DFEA 2OSQA 4QIVA 4DV1F 2IA6A 4QBUA 1YRTA 4TXSA 1P6TA 3DRSB 5DETA 3MZIA 4YMEA 1UA0A 2FVSA 4DR3F 2QE5A 3WZ0A 3GIIA 1D9AA 2HVIA 1FKPA 4OX7A 3SQGB 1J5OB 2ZKUA 3KHLA 2BW2A 5DLFA 5T7LA 3HZEA 4C3LA 2DNRA 2EG2A 1VHFA 2CQ0A 1MMDA 3RBDA 3RZAA 3PW7A 2IAJA 3T19A 3DOKA 4LSNB 2CQBA 2DH9A 2QSFA 2MKKA 4FVMA 4QR0A 2CJ9A 3DXSX 3GR0A 4OZNA 3HHLA 3CCSS 4F4ZA 2CPEA 2ZH9A 1UVIA 3Q2TC 2IM0A 1X4EA 3H5UA 4ITSA 4W92B 3QJJA 5DM6Q 2P6TA 4P7TA 2VG6A 3OR1B 2BA9A 2OFHX 3SFUA 2DJWA 4MAKA 5I4MA 5JUMA 1QTMA 2NSBA 2C2DA 3OTBA 2VL1A 1SUQA 2OIHA 4ATNA 3ZFVA 4M95A 2VBYA 2IC3A 2DNHA 4ID5B 4OZ1A 3HI9A 4G1QB 4A8WA 4PWDA 3FGVA 1U2RA 2F1FA 1UJ6A 4Y65A 4Q0BB 5AJ3F 3IO1A 1Z1ZA 3GIJA 4ZVEA 3FSYA 2COLA 2PC6A 2KU7A 2HHXA 2AJ4A 4B17A 2JWNA 1HYSB 2JH3A 4I2PB 5F41A 4K4SA 3MR6A 4C11B 2RUGA 2MZTA 1SQEA 2RSQA 3H2UB 3LP2B 1GT8A 5KFYA 2Y1IA 4I7FB 4KRWA 3CIMA 2OJ3A 3U1MA 1JX4A 1N4LA 5AXNA 3M1VA 1YG0A 4Y2KA 1VBXA 2V4QA 3B82A 3C6TA 1JLAB 4LF9F 3QWPA 1H38A 3AY0A 1Q4RA 1UMJA 2GMLA 4ZP6A 4F4KA 1FDDA 4DWIA 1FJ7A 4LQ3A 1FT8A 2CQPA 3Q23A 5EDWA 1T05A 2BV3A 2ZC3A 4YB6A 4P6QA 1RT3A 4ZPTR 2DT9A 3U27A 2YKNA 2GA7A 4F50A 1MU2B 1JLEB 6FD1A 3M8RA 1S49A 4OX8A 2V2KA 1U1NA 2HAIA 5KFLA 4USJC 1P9QC 2OD4A 4NMLA 1XERA 4EBEA 3FJ2A 3QAUA 3M8PA 1MW7A 3H8YA 5J1NA 2RKIB 1UETA 2QSWA 3DRRA 3HHLD 3KFWX 3TX8A 1FNXH 2OTLS 4D3GA 2R8IA 1CSJA 2GMJA 1DAXA 2BANA 2EG1A 4OZJA 1WWHA 2M52A 2PGCA 2WSCC 3LO3A 4MK7A 4USIA 3UNGC 5IWAF 4TU9A 4OL8A 4PKDB 3W2WB 3KOAA 2R7XA 4DSEA 3HHLB 1U8SA 3W2VA 2DCLA 4O4RA 1FESA 2NPIA 4K5SA 3GILA 2RDJA 5CH7B 1EETA 1S6QA 2PD1A 1K9MT 1HR0F 1Y5IB 4ZPAA 1OQ3A 2DNYA 3MM8A 2VG6B 3VZIA 4AYBD 3OHBA 2R7WA 4JI8F 4PXDA 3BDEA 3EPIA 5L1LA 4ILRA 3N79A 2HHQA 3JYTA 2VASA 4WYWA 2AYMA 2PT0A 1ZTTA 2UUAF 3HKWA 2BVZA 5F8NA 1QM9A 1X0PA 2IC3B 1SKRA 3HJFA 3KK1A 1GXUA 3PXGa 1KQKA 4PWDB 1F60B 2IA0A 4YB5A 5F9NA 5H1SV 1U1RA 4EWTA 3VTIA 3PDNA 2OPPB 4TNOA 1U1MA 4LF7F 1WG1A 1APSA 5IM0B 1S7HA 4C8YA 4B9NA 3VR1A 2E7WA 5A0YA 1RKIA 2FJVA 2HFNA 5AXLA 1S1WA 3EZUA 3ICLA 4HDGA 4ED7A 4PQUA 1SB6A 2M4MA 1RT1A 1S99A 1SH0A 4I6WA 4C8NA 5KFHA 3PW2A 5F8HA 2B6AB 3M1VB 3HM9A 1S0NA 2DB1A 4FF3A 2KJWA 4QPXA 4NA3A 1HQUA 2PN6A 2YWEA 2O01C 3JSYA 4LMZA 4ETXA 3C6UA 2EC0A 4QJVA 4C3KA 1HBMA 3PVXA 2I5JB 3M2RA 3MMCA 4PR6A 1RT3B 2P6SA 2PSZA 3CWJA 4URQU 4ZS6A 2YKNB 2UZAA 5D78A 1SIZA 2GQ2A 5KT2A 3CPWR 2R9LA 4OZLA 1R27B 3O44A 2LEBA 1CPZA 3W3SA 3GFZA 2YNIB 2J9CA 3DOLA 1M5OC 3DU6A 3PO4A 2AX0A 3ZC4A 1TKZB 4I1TA 1C4CA 3N6NA 2DH7A 1W25A 2KT3A 1D8ZA 2IJFA 1UL3A 3KK3B 4NLXA 3NL0A 2LU2A 2RF2A 2WOMB 2BANB 5KFRA 2E7XA 3BO2A 4CO5A 2D9PA 1FRHA 4NX9A 1PSDA 1NK8A 3KMQA 2OTJS 2KT5A 5AE2A 1YSJA 1WACA 2XI3A 3LP1A 3R5DA 2C2RA 3IG1B 3DLHA 3RRGA 1MWZA 4L6V3 2QRRA 3L7OA 5D4NA 1M90T 1O51A 1H98A 1CVJA 2M2BA 5KFTA 4IH7A 2A1BA 4ZK7M 1M5KC 4WZQA 2BXJA 2KZZA 2YVSA 2IRUA 5L38A 2UV8A 2IYIA 3SCIE 4JI2F 3JYTB 2W9BB 3QLHA 3OJSA 1YIJS 3CIZA 2XEXA 4QIGA 2FJAB 1RYSA 3KKFA 1XNRF 3NLCA 1NKEA 3TA2A 3P6YC 2J7WA 4ECWA 2J7KA 2OLWA 4YDXA 3KK1B 4WYLA 3TAMB 4R25A 2W7AA 3C3LA 1HBOA 2JHEA 2ROGA 4WCEQ 3PX4A 2D9OA 3GWCA 3M8QA 4OJHA 1C4AA 4MKYA 4Q45A 2ZC4A 3SSRA 2KFYA 4OI6A 2BQRA 3KNGA 3NS5A 2IMOA 2DRAA 1S1WB 4J9RA 5KT7A 1OPZA 5KG4A 4BC7A 1HWLA 3T1HF 2KHCA 1HQEA 3E01B 5I3PA 4PQUB 4PXEA 2YX7A 3MTJA 4OHYA 1FRIA 2XC9A 4ED3A 1FKOA 2I8EA 3E51A 3FZBA 4JI6F 2E1AA 5KFKA 4EO8A 1S9FA 2QMXA 1M5VC 4LIRA 1JJ4A 1HQUB 3LWLA 2JOQA 5E7OB 2OO4A 1N5VA 3DGPA 4KBIA 5J2MA 2XLIA 4NLYA 4C0OC 2GQCA 5KFOA 1XNQF 1SJ1A 2V94A 2CJBA 2PMHA 2V0NA 4KV8A 1YHQS 2BOPA 1KQGB 3VAGA 3HZGA 2R2SA 2ZNZA 5AXMA 1TL5A 3Q2SC 5KOXA 4IG3A 1L3SA 1SJRA 1T02A 3OXGA 2PA8D 5HN0A 5LL6d 1TL1B 1C0TA 1HW8A 3BGLA 3FEXB 1FRMA 3M30A 3MMAA 3QYYA 4L3NA 4GO5X 3GYNA 4H54A 3DOLB 1FRLA 2HNYA 1X4BA 2HIQA 4RW6B 5KOWA 2J8AA 2R7TA 2LDIA 2MZRA 1KR4A 3PW5A 2XI2A 1GTHA 1TVRA 2BACA 1Y9OA 3CMES 3EGNA 2ZE2A 2IRYA 4KO0B 4C98A 1DARA 1HI1A 2RF2B 4E98A 3OBIA 3J81Y 3V4IA 1BLUA 2EFQA 2O1PA 1D9FA 3LP1B 1JLBB 4CH0S 4NYOA 2CPZA 1X4GA 1HARA 4MKBA 5FD1A 5B0AA 1QE1B 4ES2A 5L1IA 3DLBA 1K8AT 2JSXA 2W24A 4A8KA 4ETZA 5HROB 4CT8A 1DQ9A 4TY8B 3MFIA 3HVWA 3CCMS 4Q2LA 3M9NB 2VBXA 2B4VA 2XSJA 4XPEA 3VQSA 1WG4A 3KG0A 4XK8C 4NXMF 4HI1A 1KN6A 2JZ5A 2RNEA 1Q16B 5G0RB 5C25A 1VQ4S 2D3ZA 3M05A 4R8UA 2UUBF 2LKZA 3SCKE 3M8QB 2PA3A 3CJ2A 3KG4A 2WBRA 2R7RA 1HWJA 2VB6A 3DRPB 2APOA 3PW4A 2B4OA 4ZPWR 2DPJA 3QO9A 3GFHA 4XDCA 3TW0A 1S9EA 2QLXA 2KDOA 4QR1A 4DQSA 4DV0F 2HWIA 3LW5C 3EXYA 4AUKA 3BF4A 4ED8A 2F4VF 2IYGA 1TKTA 1D1UA 1ZAWA 2KFNA 4DG1A 4ZA1A 2XS2A 5HMWA 3LAMA 1YJVA 2CQHA 2HGNA 3NNCA 4DFJA 5J2MB 4ZOSA 2JVRA 1ZAXA 1HD0A 4EBDA 3S01A 1R43A 3MCSA 2ZDOA 3JTPA 4KV8B 4DL7A 1X9WA 3F41A 2AV5A 3ZZTA 3KK2A 4RUAA 5F8GA 2J6TA 3UPFA 1FTCA 1C0TB 2ILYA 1T3NA 1O5JA 3MMAB 1U09A 4WFZA 3IXQA 3G6YA 1Z2LA 1HNVB 2FLNA 2CQ3A 1RKJA 3ISNC 4FVCA 2PI4A 5J1PA 2YKPA 2GHVC 3BEGB 1UVKA 2KXFA 3OUYA 1TVRB 1BQNB 3SFGA 2ZE2B 2KTQA 4DFPA 1T3OA 3OXLA 2WB1D 5B08A 4KKOB 3QJPA 4ECUA 1M1KT 3H59A 2ZJQQ 1D8YA 4X84A 1KLMA 2K7JA 3AB2B 3FMWA 2MMYA 2DNPA 5M2RA 3SI8A 2XS7A 3HHNB 2KXHA 3CDEA 5E3AA 1YJTA 2R7SA 2O5DA 2U2FA 3KHHA 5K14B 4B3OB 3TI0A 1U6BA 3SV4A 2E9RX 3DYAA 3POTA 1IBMF 2HRYA 4MK8A 4HKQA 1AROP 3SSQA 4XDDA 4G1PA 1SIWB 1TFYA 4IYQA 2HS3A 3G6VA 5LJ5Y 2V8GA 5JVGQ 5KFFA 2XSJB 4MYTA 1N0UA 2XSFA 3NGKA 4OHVA 1S0OA 3M2VA 1U2FA 2DNOA 1QAYA 2OP5A 5EX0A 2B9XA 2KZMA 4RLEA 2VC0A 3PW0A 1Q78A 1MWYA 3QZ7A 2OH2A 1BQMA 1DURA 3PJWA 4Y00A 3MM5B 4ZVHA 1N34F 5EN1A 4KGKA 1U4BA 5HBMB 2AWZA 3MPVA 3VAFA 4DV2F 5F8LA 1S9EB 4F4XA 2AYEA 2IRXA 2BE2B 2MQQA 3D1OA 3ENWA 3R5BA 4TQSA 1VGYA 2K7KA 1SL2A 4F25A 1N6QA 4JV2A 4I64A 1TKTB 1FRKA 4NXNF 2DHXA 3SCJE 4DG1B 3TQ1A 1HI0P 1VLYA 2OMOA 2YKAA 3FFIA 1LWEB 4PWUA 5J1EA 4C7QA 2CPIA 1DTQA 3I0RB 2X1GA 1NHUA 1WF1A 3M6WA 4H4OA 4F3QA 2R2UA 5IS2A 4J9SA 2FJBB 1P27B 2LVWA 3I32A