4OJHA

The crystal structure of truncated, y86e mutant of s. solfataricus acylphosphatase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
b'MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDESFSEYKGEFEDFETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
publication title Edge strand engineering prevents native-like aggregation in Sulfolobus solfataricus acylphosphatase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 22
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ojhA00
2OAUA 1U7LA 1MWYA 2GFFA 2LQBA 3F44A 4NL5A 2XMJA 4DPOA 1OQ6A 1FE0A 4FNIA 1Q8BA 3DXSX 1FVSA 4FNHA 3BN7A 1N5QA 5B0EA 3HHLA 2EW9A 2GGPA 2AJ0A 3KKFA 3QMQA 2ASYA 2FHMA 2FTRA 5B0CA 5A6WA 5F0WA 1GXTA 3HF5A 2N4CA 3LGNA 2AW0A 4Q2MA 2CRLA 5F0UA 4Q2LA 5KAKA 1IUJA 2L3MA 2BJDA 5T7LB 1Q8LA 4QOTA 2AP6A 5B08A 1QUPA 2LDIA 4OJHA 1FD8A 5B0DA 2OD6A 2KYZA 3E8OA 5B0FA 3TNVA 4A47A 4DN9A 1FVQA 3KG1A 1OPZA 2HFOA 3MZIA 2QLXA 2ZDOA 4YEAA 3DCAA 3VTIA 3BM7A 3QGPA 1AFJA 1Y3KA 5T7LA 1TUVA 4EFAC 1AW0A 1YJTA 2N7YA 1TL4A 1YJUA 4F67A 1Y9OA 2VV5A 1P6TA 3I9ZA 2HLUA 4A4JA 2XMKA 1FEEA 5A6PA 2OMOA 1RJJA 3BDEA 1Y3JA 2PD1A 4HI1A 1JWWA 1N5VA 2KT2A 2OKQA 2QLWA 3UDCA 3FGVA 2RU9A 2K2PA 1TL5A 1Y0HA 3MCSA 3K7RA 1YG0A 1GXUA 1KQKA 1XBWA 3LO3A 1APSA 3KNGA 1YJVA 3T9NA 2QIFA 3HX9A 1CC7A 2W4PA 2FIUA 4HI2A 4OJ3A 2XMTA 2XMWA 2XMUA 3BR8A 4A46A 1WD6A 2HQIA 3HHLD 1SB6A 5K9FA 3FMBA 2K1RB 2RMLA 4ZOSA 1OQ3A 2KT3A 4OJ1A 1AFIA 1W2IA 2GA7A 2Q3PA 1FESA 1VQSA 2LQ9A 1Q53A 2PGCA 1S6OA 4HL9A 1SQEA 4NPOA 3KG0A 2W4DA 3TOQA 2BBEA 1LQ9A 2GCFA 2HLTA 2OFHX 1TZ0A 1FE4A 2K1RA 2RSQA 2XMMA 1K0VA 5B0GA 1N5TA 2RILA 3WDOA 1ULRA 1X7VA 1R6YA 2ACYA 3HDSA 2BYCA 4Y2KA 2FB0A 2IYIA 4OIXA 2VH7A 2W4CA 4U9RA 4Y2MA 1MWZA 5B09A 2LXFA 1X0PA 3HHLC 1Q4RA 2QYCA 1P8GA 3GZ7A 3HFKA 3CJKB 5B0BA 1N5SA 4YDXA 2HFNA 2ROEA 3BF4A 2XMVA 3FRYA 2OP5A 1TR0A 2K7JA 2GO8A 3IWLA 1CC8A 2K7KA 2JDJA 2ZDPA 2BUNA 2IYGA 2GV1A 2G9OA 2BJEA 1KVIA 2OFGX 1YRXA 4HH1A 4DL0C 3CJKA 1CPZA 2ROGA 1X8DA 1VQYA 2OD4A 2ROPA 1KVJA 3TRGA 5IXUA 1OSDA 4OJGA 1S6UA 3HHLB 2GGPB 2HIQA 4Y2IA 2AJ1A 3BGUA 1JK9B 1SI9A 2N4DA 3IWXA 4ZA1A 4A48A 3LGMA 2KKHA 3BB5A 2IFXA 1YJRA 1V3ZA 5B0AA 1URRA 4HH0A
chains in the Genus database with same CATH superfamily
2MLZA 1RHKB 3K5OA 4WFBQ 3VAMA 4I1TA 3G8SA 2LYVA 1S6PA 3SSQA 4TY8A 4DI6A 1BY9A 4CLSA 5EDWA 2BE2A 4DMZA 2CPEA 2EG2A 4NOHA 2QMUB 4EU0A 4E98A 2AEJA 4DN0A 5IM0B 1VQNS 3ZTSA 3NCPA 2H5EA 5KFCA 4Y2AA 2RDDA 2HRUA 2RVJA 3CJ3A 1HKAA 4GRSA 3U27A 3CVKA 3CDBA 3ZZOA 1T9WA 4BWJA 5I42A 3CUNA 4JV5F 5KFJA 2K1RB 2LFVA 1QUVA 4WZQA 4HEA9 1WELA 3A4TA 4LSLA 5E3RA 1LQ9A 3K8WA 3D6MB 1WKLA 5KFHA 3LGHA 5FLXY 1XR7A 4KE5A 3ILJA 1EHWA 1T9UA 2C3PA 2BJEA 5C5JA 5ETSA 3UI3A 3H2VE 3GR0A 4NLXA 3GCWP 4CWBA 4ZA1A 1PSDA 5KT2A 1VQPS 1VQ6S 3TVYA 1FE0A 3N6LA 1FVSA 4OYMA 2RQMA 2L48A 2O01C 4HKQA 2IAJB 1W7WA 1JLGB 2XGQA 1NEEA 4KV8A 1RGVA 5M2UA 5KOXA 5AXLA 2YKMA 4PWUA 3ILLA 4F25A 2YKOA 3CEDA 2AYGA 5KFEA 1FXDA 1H2VZ 1QAXA 4OX8A 4USIA 3U1LA 1YZ6A 3MR5A 4RW9A 2DEJA 4QW9A 3BO3A 4KHRA 1KOOA 3MECA 5KG5A 1UJ5A 5J2PA 1PO6A 5JVHQ 2MTLA 1VRTA 2UUCF 1X60A 5J1PA 1ZPWX 2UP1A 2YNIB 3FEZA 2C3UA 1Y4ZB 1WOPA 2E9TA 2GVZB 3EZ5A 2I1RA 1RT5A 1XQIA 1MW7A 3IBCB 2DH7A 2CPZA 3LUYA 2GO8A 3TZWA 3J7A1 1N32F 3M9NB 2XZTB 4DR2F 3EVWA 3QWUA 4KHMA 1RAEB 1SJFA 3JAMY 3O5TB 3VAIA 3RB0A 3HK2A 1YKWA 3NKYA 3Q8YA 3J7Z5 4ZKAA 1AROP 2RHQB 2AW0A 4U7UK 5AT1B 2CRLA 1J5OA 2E5HA 3MD1A 1GAOA 4OYXA 1KNZA 2XHWA 4RZRA 5HMXA 4NXMJ 1I51B 1R8PA 2RRBA 4N5SA 2XYHB 3MR2A 4O4GB 3JYTB 1TL3A 3ET6A 3K5LA 1FRLA 3V2UC 3HHLD 1N8RT 1M5HA 3CJQA 2ACMA 5KFNA 1IBKJ 1NZAA 1HBMB 1VQSA 2FLLA 1FX4A 3A8EA 1HLWA 2C1EB 3W8PA 1N48A 4USUA 1NK7A 1K8AT 1NNDA 2H3EB 2HHTA 2GIQA 5AXKA 2JX2A 3KJFB 4WTOB 5C24B 1GXLA 2WOMA 2J9EA 4I2QA 3J80Y 2HBZB 2ILZA 3QT6A 1UJ4A 3HXMA 4RBVA 1ZAWA 5D3GA 2B6AA 2ZH8A 2HRYA 4LBHA 2HKEA 2BANA 2F9DA 3KK2B 2GVDB 1IBMF 1JLEB 1RHRB 3MEGA 4M5NA 1TKZB 4B9MA 2OMOA 2ZEJA 3R5GA 3AJDA 4IRCA 2VD3A 1QLNA 2YWKA 1UFLA 2ZVSA 1R0AB 1VC0A 4M5LA 1PYOB 2DD8S 5L1KA 1JIHA 2HNYA 2AEMA 4TU7A 1I5OB 3I0RA 5E41A 2UXDJ 2ABYA 1E6YA 5KG7A 3KJQB 3KLVA 1TR0A 2YX4A 3PFEA 4FF1A 4L73A 4LUBA 4QWCA 1JJHA 1YRXA 2VKRA 1UCNA 1I1GA 4TYAA 5F8LA 5IXUA 2W2QP 5GAGU 2LP4A 3QGHA 5IS2A 2QFIA 4DPOA 4ZVTB 3LP2B 4RUBA 4X65F 1MMNA 4K4VA 2CZ4A 2XGPA 3HVWA 2E5IA 1L3SA 3SQGA 1S97A 3OXLA 1H3DA 4KAIA 5HBMA 3WIVA 2JVOA 1Z4UA 2WSFC 1S4FA 3CPWR 1S79A 4F0KA 3PRVA 4KFBA 2MSSA 3RTVA 3NRBA 2LCWA 2XLIA 4C8KA 2HYIB 2AJFE 4F4ZA 2IDLA 4MK8A 3M8ZA 3NGSA 1X4FA 1R6YA 3M2VA 1RWKB 2R4FA 2A2DA 2Y8YA 3PNIA 4OZ5A 3HVTB 2HGLA 3C15B 2XTJP 3KK3B 3VQTA 2IYGA 3F41A 3M2UB 4ED0A 2VONA 3W8GA 2NQPA 4LF1A 2RQKA 2ZH2A 1U8SA 1RABB 2L3MA 4ELVA 3MM7B 2OHDA 1N0VC 2XZWA 4ZHRA 4OYIA 3NCRA 1RHUB 3WX8A 4FZVA 4DR1F 2ADBA 4ECQA 4CQ1A 1AW0A 1FCAA 4Z2XA 3ENWA 2M4MA 3BGRA 2KRBA 4FS1A 4V19X 2RQ4A 4NEYA 2MQMA 4A8OA 2KT2A 2DRDA 1H6KX 4P75A 3PW7A 2PO4A 3JSYA 3CE8A 3WZ0A 1SKRA 3FNNA 3CCQS 2CPFA 3I56S 2LQ5A 2KG1A 3BSNA 3DXBA 4ZJOA 2D3OR 2B51A 1IN0A 3UVJA 1IJFB 4WJBA 2R7XA 1U24A 3IRXB 5KFRA 3CCWA 1N52B 1U25A 1FRJA 4A8WA 3KLIA 1NPRA 4RW4B 2DXEA 4PQUA 4FPIA 5KFXA 3QYYA 3RU0A 4A48A 3ULHA 3LWMA 2XY5A 2FPHX 1ZM4A 3CIZA 2FGCA 2C3MA 3GLJA 3KTQA 2BRKA 1VOMA 2IJNA 2OTLS 1PCAA 4NLQA 3KDOA 2CQ0A 2XS7A 1RYSA 3FMWA 3MEDB 2R7VA 1TKDA 4DXLA 1RTHA 3W64A 4X4QA 4TN2A 3P4UB 1YSJA 4TQSA 4O3PA 2CPYA 1X5TA 2LA4A 3PV8A 2VG7A 2MGZA 1HWUA 4XPCA 5IQQA 4M1KA 3IC1A 4K5RA 2LQ9A 4B9SA 2HNDA 5CQGA 4KB7A 2E29A 2XWXA 2BE9B 4PXDA 4AD6A 3ZZTA 2R2RA 2YKPA 3C16B 4KY3A 3PW4A 3CF5Q 4R5PB 1MLAA 3SSRA 3BBBA 4DCOB 3TA2A 4C8NA 3A12A 2IFXA 3Q23A 2OGUA 1Q5YA 3DXSX 1RK8A 4I64A 1R7IA 2KVQE 1MWQA 4QOTA 1X4AA 4CLTA 1S48A 4Q8FA 3V6DB 3DCAA 5DDOC 4EMDA 2HBQB 5IV3A 5DQIA 2B8QA 1HI0P 3ZZ0A 1REVA 3UDCA 3IP0A 2BOAA 1BUXA 3SDEA 2H4YB 2HQIA 1VC6A 2O3DA 2HPUA 4C0HA 4LF2A 5C42A 2XQCA 4DV4J 2CA9A 4ED7A 3AD8C 4BS2A 3FK4A 1GTHA 1V5VA 1HWIA 3NAIA 2EG1A 5KT5A 4M5GA 4WIQA 2ZOMA 4DQRA 3HFKA 2QGFB 1TL1B 2P5VA 4ZPVR 3SQOP 3BH7B 4O4RA 1HR0J 4DL0C 2QL7B 1UZDA 3I9V9 2B43A 1CJVA 1GTEA 1ZYQA 4F02A 4LVNP 2RKIB 1M5PC 1VRUB 1X4DA 3KKFA 4LRBA 3M8WA 2R2SA 2XZDB 2D3O1 3IGVA 2BABA 1TKTA 2QLXA 4ANCA 1NPKA 3OFEA 2GS8A 2D69A 3SBMA 1IKXB 1VBKA 5H9EJ 1SJRA 1BD6A 1S72S 2RF2B 4L72B 3OXGA 3MEEA 3N28A 1U26A 2YTCA 4QJVA 3ETMA 2JRSA 1S76D 2H9ZA 3VQSA 3CJ0A 1HQEB 1UKUA 3OFHA 3CB4A 2XLKA 2C2KB 2AIRB 1U0HB 2RDJA 4ED1A 2AGQA 3Q8SB 3ENVA 4OZ0A 3TX0A 4FF3A 2ZKUA 3CJRA 1NCLA 3DDKA 2BJ9A 2FLOA 4ECWA 3PW5A 4TU8A 3OV7A 2NUHA 3UR3C 2IMWP 4IFYA 4A47A 1N36J 2XNRA 3C2PA 2MHEA 4EYIB 1S9EA 1HQ2A 2E5GA 1HQUB 1RLCL 3ADAC 1IQTA 2PMHA 2FJEB 3HHKA 2V8DA 3SI8A 3V6KA 3KNGA 4UY85 2WONA 1JLQA 2ZBIA 4RUAA 2LA6A 1E6VB 2XMTA 1GK8A 1S1UA 2DO0A 2LEBA 3GG1A 2YKQA 2UUTA 2ZE2B 3OTEA 5HAOA 1OYDA 4X62F 1L5UA 4I2PA 4IH6A 1Q7LB 1EB0A 4KHPJ 2Z56B 3D5MA 4DS5A 5A76A 3BF4A 4J9VA 3VAKA 2B9WA 1WI8A 5CCLA 4P6QA 4ZITA 3AD7C 2W9BB 3KLHB 3M9OB 1HHSA 2W1BA 3UQSA 2RNEA 7FD1A 4U8VA 2L41A 2MZJA 4ES3A 3H25A 3DLLQ 3IAS9 1RT2A 2DNZA 4F4XA 3TWZA 4B3OB 4ECSA 1DQAA 3DHWC 2ZH3A 1NRKA 5KFSA 4DL5A 3RAXA 4ZVFA 4RNMA 1F3FA 5D4OA 4KT0C 3G2XA 1CC7A 4OL8A 4BDPA 2QLFB 3TJAA 4JI5J 2R7OA 2FQQB 3H5XA 2WAQD 2C3YA 2NLWA 2F8EX 3V81A 4DUZF 1LWXA 1Q86T 3HKZD 2OFHX 2MQNA 3IN5A 3NMRA 1VHFA 3VGTA 3DLGA 3ZTRA 4BCAA 3JTPA 1G6BA 4FPRA 3SCLE 3SSSA 3U7JA 2GV1A 5U47A 4TXSA 3O6QA 1R8BA 3I55S 3QRRA 4R0EA 1V3ZA 2NXJA 4NL5A 2LVWA 5F3ZA 1GXTA 5KFFA 1VGYA 2DPJA 3TP2A 4Q45A 2FJWA 2UXDF 1RAOA 4USWA 4UUWA 3R5CA 2EC0A 4ERDA 3MZIA 4CZCA 3FCVA 4PPZA 3L95X 2QA2A 1AUDA 1XERA 1S9GA 3LAMA 4CI0B 5K5MA 4B3SJ 1WG5A 3H2LA 5JJBA 3W9JA 3Q2TC 3MGJA 3BQ1A 2A1BA 1CG2A 2EVZA 3IM9A 1U1KA 3MAAA 3HD2A 2VQEF 3NEKA 5F3TA 2RJZA 3LTOA 2NS1B 4PWDB 4BBYA 1NJXA 3ZTOA 2W4CA 2WBMA 3HVRA 3MMAB 1R27B 1VQ7S 4ED5A 3DDNA 1UWBA 3CT9A 4QPTA 4FKYA 1UPMB 1EP4B 3G8QA 3EGWB 1LWFB 4LVOP 4G1QA 4URGA 4NA1A 4Z7CA 4RJVA 4IDKB 2CADA 3CTRA 1R6VA 1WDTA 1WG4A 3V4IA 1G2EA 3MPYA 5F9LA 3OUYB 2BMBA 3ZZPA 2GHWA 2V8GA 2VB6A 3QJJA 1YI2S 4OYOA 5K14B 2FVQA 2QL9B 4F2RA 1SL2A 2HGMA 4MFBA 2ZH1A 2HAIA 4ED6A 3T9NA 4ZS6A 1DRZA 5A8RA 4YS2A 3M6VA 4I69A 2KH9A 5F8GA 5EGYA 2JEGA 5FD1A 1U45A 4EEYA 3N4WA 2XMMA 4LRAA 1PC4A 2FLNA 2Q6BA 4XK8C 1JQGA 5BJRA 1A0OB 4C8MA 4E2FB 2QYCA 5HATA 3KHRA 3MCNA 3KUHA 2WTFA 3QIPA 3HHDA 4JI7J 4YP3A 2W7PA 1FJGJ 2V34A 1C1CA 4DSLA 3HI9A 2YQ1A 4PG5A 4O44A 1C1BA 5DQHA 3OR1B 4QCLA 1S99A 1GEHA 1LW2B 4JI8F 4LSNB 3QLHA 2I0XA 5D8HB 1BQNA 1HWKA 1EETA 2XSFA 3PEJA 3FSIA 5H9FK 1OPIA 4R8UA 4NLUA 1DTTA 1IKYB 4UQTA 1RJJA 2K2PA 3ICLA 1FO1A 4NLDA 1PKUA 5BXIA 5DG7A 3CCZA 2B9EA 3NXZA 3M8YA 1D0EA 3DYAA 2YVSA 4ZPBA 2XWYA 1DURA 3GV7B 3BKFA 2G0CA 1J27A 1QSSA 2HURA 3DFEA 3QZ7A 1ULRA 3OL7A 2L9NA 1BQMB 3NS6A 3CSKA 4QR0A 3DM2B 2VASA 1RXOB 5B0BA 2MMYA 3EICA 3CCTA 4GKKJ 4FN5A 3KHGA 2B4PA 2C2RA 1HD0A 1T02A 5AJ3J 1RT4A 2ATCB 2JC0A 4O23A 2BX6A 1SIZA 2OD4A 1IWGA 2AJ1A 1JK9B 4ZVGA 2J8AA 3M32A 5LMUJ 4QYRA 2IA6A 5DDRC 1FDNA 3L7OA 2AJ0A 5A6WA 3M6WA 3GCXP 1I94F 4C8YA 2UV8A 1EIYB 2CNKB 4I7FB 1HI1A 2D1CA 4CT9A 4RKUC 3G9CA 3OTCA 1VMBA 4ZJLA 1U6BA 3KWMA 3C6UB 2ZJPQ 5GAHI 4HT5A 1FDAA 1RWOB 1T7PA 1NKCA 2B3TB 3K7RA 4RU2A 1I3OB 3CO0P 3LW5C 1MU2A 3TUZC 2PSZA 2G13A 3BO4A 2GAGC 5L1LA 4HTJA 1S6QB 4FXDA 1C0TA 2ZHAA 4IOAQ 3GIIA 1T94A 1CJTA 3PX0A 2VOOA 3MTJA 1YWXA 3BSOA 1URNA 4OZJA 2EWHA 3AXKA 5J2MB 2H65B 3QAUA 2M0GB 3NG8A 3MCOA 2A0FB 2VBWA 4LIRA 2XI2A 3Q2SC 4P7VA 4LQ9A 4DPYA 3PACA 4DFPA 1HYSA 4XDDA 5B0DA 2N7CA 2LDYA 1TKXA 3MAQA 3BYPA 1P9YA 5B7WA 2KTQA 3NBPA 2DGWA 5HSPA 2UVRA 5FLXU 4ZCKA 5E3PA 1RT3A 5HO4A 2E1MC 1NKBA 3P49B 1DQ8A 2DKOB 5L1JA 1SC3B 2RILA 1H7WA 3WX4A 3DOLA 1WEZA 5ETLA 1LK5A 4XAKA 1HPZA 1NM2A 1IVZA 3ILOA 1QTNB 2V8PA 1CS4B 4IO1A 4M63A 5HMYA 1OYEA 4PG7A 3P8BB 3GYGA 3ZZZA 3BKUA 1DQ9A 3W3SA 1UVIA 5DZ7A 4ECTA 3OVAA 5A8KB 1VQMS 4JI0J 1RT7B 5I3UB 3Q83A 4H4MA 2CFXA 2ZH7A 2UVVA 5THWA 3TANA 5C2CA 5T7LB 1A7GE 4KR0B 4KKOA 1VISA 1BC6A 5HANA 1LXJA 1T05B 4LFCJ 2YQ0A 3NP5A 2Y0BB 1JLBB 3HVAA 2ZC3A 3GIRA 1IM4A 1FEEA 2R8HA 2DITA 3US5A 4JB8B 3NWGA 4EBDA 3G96A 2DB1A 1ZTWA 4OZ1A 1BWEA 3AJ1A 1HBNA 1MROB 3UO0A 4DQSA 4CP5A 5ETOA 1YBTA 1J2VA 2NYHA 2R8JA 1N6QB 1HBUA 3KLFB 2ZZTA 4FYDA 1IKWA 3L7UA 2BXJA 5ETRA 1GMWD 3HHEA 4LSLB 2EKNA 4ZVOB 2AJ4A 4B3RJ 1SKSA 2NUUG 4OV6A 3W9HA 2QYGA 3TA0A 1U48A 2PMWA 5IC6B 4M5DB 1OJ4A 5F9NA 5A0YB 1GMUA 2MYFA 1KR4A 2GZOA 2LLZA 1ROFA 1VBXA 1B7YB 1IJEB 4DFKA 3GV5B 3HLUA 3M05A 5CA5A 3O2IA 5HVGA 1YVFA 1RT6B 5B0EA 3CCMS 1WF0A 3L4BC 1YDLA 3EXYA 2E1PA 2CQ2A 3D66A 4KHPF 3M8QB 3GMGA 4DX7A 1XEZA 2J9CA 3NGKA 2WCXA 4FYVB 4UOGA 3LQVA 1QSYA 4NZ0A 1XMQJ 1LV5A 3HFZB 4KV8B 4DL6A 2OO4A 1VQKS 2DT9A 2FJDB 2VFRA 3JB9k 5KFPA 1RADB 1TQLA 1V5IB 4J9RA 2ZKTA 4DR6F 5DRKA 1BLUA 3QIDA 3AY0A 1KBRA 4LF9J 3NGDA 4ECXA 2OPSA 1DARA 2Y9HA 1T11A 3H4BA 3IS9B 4O0IA 2IYIA 3UNYA 1HBOB 3RJMB 1RAFB 2DGUA 2BKNA 4IR1A 2ZDPA 2DPIA 2DNRA 1PJ7A 3DI6B 2RIJA 2BDPA 3Q0AA 1S1WB 3VGVA 1O8BA 2GMLA 2N4CA 5CABA 1KVKA 3V6HA 2VFUA 3BS9A 1VQOS 3TEGA 2DISA 2HEKA 4DPWA 5L8RC 3DOKB 2X1AA 5ETTA 4YB1P 1F3VA 2MQ8A 2J0QD 4HR2A 1UA1A 1T0TV 1YGYA 4ZMMA 1U2CA 3LO3A 4OYPA 2JHEA 3Q8UA 2GO9A 3GJSB 2Z4PA 2V9KA 4CH7A 1ACMB 2IRUA 3E01A 2DVIA 3IO1A 5KTQA 3G82B 3FQKA 5E3CA 3D0GE 4DG1B 1WC3A 2WK4A 2WVBA 1PBAA 1SPBP 3KLGB 4IYQA 1R8CA 1T9VA 4DUYF 3FBEA 1X9MA 1WNEA 2AWZA 2ZM6J 3IWLA 5LMNJ 3BYRA 1KVIA 1VR6A 1ZBTA 2BM0A 4B3SF 3OL9A 4K7QA 3QSIA 1X5SA 5CYMB 4ZP9A 2KRRA 2HBRB 1K1SA 5GAEU 1UVKA 2ASYA 2FTRA 5HP1A 4H4OB 3CGIA 5H1SV 4NZ6A 3E2EA 3THTA 3JSRA 3DLKA 4ICLB 1T03A 2J5AA 5RUBA 2HFOA 1WG1A 1U6ZA 2OUGA 3H0PA 1N5VA 3PTWA 4WP3A 2KFNA 4CYUA 2QG9B 5KOWA 1R8HA 4N56A 4LF5F 4IR9A 3GSIA 4KPCA 3IG1B 5IT9U 4GO5X 2NZ4A 2I8EA 4DX8H 2Y0SD 3TUJC 2GA7A 1JLCB 4Y0FA 4IG3A 3RBZA 4ZIVA 4ED3A 4EZ6A 2KFYA 4RR5A 4IKAA 2WHOA 3PG9A 2BOPA 4A8XA 3KFWX 1HMVB 2ZBQA 4JBCA 3QO9B 4J37A 1S0OA 1S4EA 1N5SA 2J6TA 2ROEA 3MMBB 4ZLNA 2FC9A 3T41A 3ITHA 4CRJA 3B54A 1SH2A 4LT6A 3OVBA 5IV4A 3LP0A 5KT7A 2XYGB 2J7KA 1HNIA 3P5TL 2QA4G 4NCBA 1CULA 2L9WA 1VDHA 3RB4A 4AQYJ 5KAKA 2IJFA 4DSJA 1FKOA 4U95A 1IBCB 4X64F 5K20B 1QE1A 3CULA 4UTGA 1CJKA 1CBKA 3BDEA 2JEIA 4CTAA 1DZ5A 1JLAA 4LFBJ 4JI7F 2BEFA 1FJGF 5J2NB 4IFVA 5CD4A 1WTFA 3MM5B 4PAAA 4BC9A 3QFHA 5E3AA 2R7WA 2AJ2A 3KG0A 2YWEA 5SUHA 1VK3A 3WDOA 5J1EA 5D4PA 1CEZA 4N76A 2BACA 4QQBA 2LXUA 4F04B 1KHWA 3PX6A 2OP5A 4ID5B 2Q43A 1ZM2A 3FZ2A 1TAUA 1RZMA 4YR2A 2VC0A 4OJGA 2DNLA 1K0TA 3BGFA 2DH9A 2WBRA 2MKJA 3BB5A 4K59A 3F44A 3FSXA 4F4AA 2YNGA 3A13A 5DS7A 2VHGA 4L76A 2HHSA 1SH3A 2KYXA 2MDAA 3GG0A 1Q8LA 1N4LA 3IBWA 4GMKA 3QRQA 3F73A 1FT8A 1HNVB 4EI2A 1U1LA 3H5SA 1AT1B 1TP7A 4OI1A 3D1QA 4GKKF 5IM0A 2HWIA 2RH3A 5FDLB 5LXRA 3M7VA 4ZK7M 3D54A 1B3TA 3OL6A 5KFOA 1HWJA 2ZNZA 4JI2F 4RW7A 2COLA 2K1RA 3C66A 2ERRA 1WHVA 5DJBA 2GC8A 3WQPA 1D9FA 5KT4A 2EFQA 2V5HG 2ALZA 4C6AA 3H42A 2R2TA 1WWHA 2P8IA 2AGOA 2ROGA 3A3NB 3H4DA 4C3LA 3LGMA 2AYBA 2HMIB 2VA3A 2M70A 4NE9C 3EX7B 1VQ4S 3W5XA 5B0CA 1B7FA 1DJ0A 4NYOA 5KG3A 4PQAA 2J9DE 2KHCA 4IOCQ 4NXNJ 1GH8A 2OPPB 1D09B 2G1HA 4KC5A 2AD9A 3J81j 2IAJA 3RYLA 1JLGA 2CJBA 2HVIA 1KS2A 2OKQA 1B70B 4DSKA 5CAAA 2WW8A 4RBUA 1LEOA 3B8HA 4Y2CA 5K8OA 2GAHC 2YKAA 1RI7A 2DHHA 2WVEA 2VC1A 3ZZRA 1FKPB 4CO0A 3FFIB 3CMES 1S12A 4DU8A 2JOQA 2DRBA 2BBEA 2VG7B 3KMQA 4HHHA 4NI2B 3FQLA 2YNIA 5D4LA 4GKJJ 1M5VC 4QIGA 4DWIA 1KQFB 1L3KA 5E7OB 1JXEA 2D3UA 4L3NA 2F3JA 2OI2A 2MQPA 5G0RB 4C0BA 2AT1B 2DYAA 4QR1A 5MLCV 3WBZA 3UN2A 1UWAA 5CHCB 5L9XA 3GE9A 3M6XA 2DJWA 4ID8A 4QIWD 2NSCA 2I9SA 1YJTA 3UNGC 4WF9Q 5A6PA 2P9CA 2VG5B 4B9LA 5C7PA 4U8YA 3CD0A 3NCQA 3EGVA 3BO2A 2JSXA 5ETVA 3ISNC 3CCLS 4O4GA 5K9FA 1FF2A 3JYTA 2HQFA 1VQLS 1WKJA 1G4CA 4JI0F 1RHMB 4TKTA 4P2FA 2JNJA 3R5DA 1O51A 4YUDA 5EUHA 1HBMA 2BYCA 4ECVA 3UN3A 4A8YA 5BR8F 3D68A 4QZVB 3ONQA 3HJFA 3BEGB 2AX1A 3GTYX 4JI6F 4AT1B 2V2ZA 4ZP7A 1UEUA 4K8RA 2ROPA 1WC6A 3DRPA 3JTOA 5C24A 2MQOA 1D3WA 4F8RA 1RTJA 3CIMA 3ZTPA 2NPIA 2FHJA 1UMJA 4Z37A 4PYAA 3D1OA 5HQ8A 2LQ8A 1S10A 2MKYA 3BKTA 3QT5A 3PKMA 4TNOA 3R7BB 4Y00A 3W65A 2ADCA 3MD3A 2W2OP 5CYQB 3PYDA 2HLUA 4B3RF 1K73T 3KK2A 1XJWB 2GVDA 1JLEA 5L38A 3GFXA 4PYDA 2ZH9A 1TKZA 2HFSA 1NAQA 1S1TB 4NZ7A 4ECUA 1X4CA 4DBQA 1R0AA 2SXLA 2ZBCA 1C0UB 2UUBJ 1B0PA 3A8KA 4ZVRB 3AQPA 5KG0A 1F60B 4K4XA 1GT8A 1NK5A 2GMHA 4JOUA 1SIWB 1XMQF 3W1YC 5KG4A 3Q89A 4WYLA 1NJYA 3RRHA 2HK3A 2OELA 4ZN3A 2G0JA 3ISZA 4BWMA 2GW8A 4ZPWR 4FF2A 4DV0F 1RWUA 5SZTA 6FDRA 1UJ6A 4J9NA 1HD1A 3UFCX 2FHMA 4LF9F 1RAHB 3P6YC 2ALYB 3CNQP 4CO5A 4UOCA 4A8FA 3LP2A 4ES2A 4OX9J 3R6GB 2OD6A 2KYZA 4V1Ak 2Q1LA 1ZM3A 2HS3A 4XTTA 3FBCA 5F8HA 2IIHA 1UTAA 2NSBA 1TL5A 2BJ7A 1NDCA 3RB6A 3I32A 1FWLA 2CPDA 4OV1A 1FJEB 3D0HE 4OLOA 3JQKA 3V4MA 4ZPAA 3DLBA 2KT3A 2FZGB 4IQMA 1VBZA 1JLQB 5ETMA 2Z2LA 2GIRA 2B4UA 1R8AA 1DTQB 3AB4B 3MOZA 4WP9A 3HDSA 2VF3A 1JJ2R 2U2FA 3CJKB 2CG8A 3BGLA 4DQPA 3N5BA 2VG6B 4H4KA 4QYZJ 2BUNA 2QN6B 5ITHA 3JTNA 2GMJA 3HVTA 1X8DA 1EQMA 1RWNB 1YJWS 2IHR1 1U02A 3EDQB 3C15A 4GO7X 3KK3A 4KGZB 2WW4A 2JWNA 4DX5A 3M2UA 3VHQA 3RRGA 1U6FA 6FD1A 5I3PA 3J7YI 4DLEA 3GSDA 2ZJQQ 2DEIA 1LWEB 2M52A 2HZCA 3TZXA 3MM7A 2XYPB 3CWJA 2PI5A 5D15A 4OMFG 4C0OC 3QSYB 1V3SA 3PYGA 2QA4S 5M2RA 3RR7A 4YHHJ 4LFAJ 2DGQA 3UPFA 4DR7F 3PZPA 4LIWA 3VZHA 3PR5B 3HFVA 4F26A 2HQDA 4F3QA 2HNZB 3T6BA 1UW4A 1IBLJ 5B0GA 2HHUA 1WHXA 3ZXWA 1SH0A 2W24A 2RRAA 3V81B 4Q7AA 4OZ3A 2DO4A 1XMBA 4AUKA 1UEKA 2I38A 3W2WB 3GB0A 3K5NA 4YN3B 1GQEA 2J6SA 2NR0A 3IRXA 3GFZA 3FZBA 4TLQA 4RW4A 4NA3A 1C2PA 4R25A 4EGLA 5J2QB 2K3IA 1GMWA 4FNIA 4ANEA 5KFWA 3LP1B 2B7CB 4X4VA 1PC5A 3TVZA 1SVDA 4V19J 2CAJA 4PABA 3S7RA 2C28A 5IQ6A 4UW2A 3M9MB 2CQ4A 3QGPA 3QATA 3T1YJ 2ILYA 3V6JA 1IKVB 3MEDA 3HULA 4QIVA 1CSJA 2CUYA 4G1PA 2FVSA 1SJ4P 1N56A 2MY8A 5CZVA 4F0HA 3MPDA 2DIVA 3DGPB 4AQYF 3KJVB 3KUEA 3MM6B 1XR6A 2VBZA 4DL3A 4DV7F 4O3SA 1HA1A 3RG6A 4LF6F 4NLGA 5ETKA 1W26A 2CQHA 3HHLC 5HLFB 2DIUA 4DV3J 2IVYA 4CH0S 4DPXA 2HHVA 1QVGR 3C16A 1T95A 1S6UA 4R5PA 4PR6A 1F5CA 1PJ6A 5DLGA 4I6AA 2LEAA 3DKDA 3EGZA 3SZ2A 2C2MB 2CQGA 2UUAJ 3UWTA 3JQMA 4G1QB 1T9TA 2IBOA 3V5RA 4O3RA 4WFYA 3VCDA 2H5IB 2XEXA 2CG4A 1HHQA 3PIPQ 1Q0NA 5HMZA 4RPFA 3V6DA 2ZH4A 2GHPA 2DR9A 1EQ0A 2LU2A 5KG2A 4RLEA 4FF4A 4LQ3A 4AL7A 4NLRA 1FJ7A 2J6UA 4WTYA 2Z57B 3Q8QB 1TK8A 3C19A 2VBXA 1Y10A 3HPOA 3LF0A 4PRFA 3PDNA 3FEYB 2QLJB 3DNCA 4H54A 2UXCJ 1SV5B 1GMVA 2OEMA 3IM8A 3J81U 4U9RA 3UCZP 1CQMA 4GC6A 1P1LA 2FZCB 2J7WA 2YPZA 2OJ3A 4QR2A 2BJ1A 2V94A 3CCUS 5BYSA 2CDQA 4JYAF 1C4CA 2MZ1A 2YWHA 2B9XA 1Q81T 1CPZA 1TL1A 1YQHA 2W7AA 1YJ9S 4K0KJ 3HHLB 3QBCA 1FTCA 2KHDA 1FK9B 4HH0A 2GJIA 2GFFA 2WSCC 4D3HA 4LF7J 5CXTA 3CDAA 3IXQA 5C25B 3HJVA 2RKIA 3OHAA 1OS5A 4ZDNA 1Q82T 1VRUA 1XWLA 2MEWA 5A8WB 1B99A 4KO0B 4CM0A 3BM7A 4C11B 1Q16B 4ZVUB 1Y3JA 2YWWA 2GJFA 3D4JA 3NNCA 2HQCA 5DGBA 3MCSA 4J9SA 1IKXA 3VGSA 3HSZA 2NXNA 1EAYC 1VQ5S 3MURP 1HNXJ 2HK2A 4QWEA 1I6JA 2QFJA 2CWXA 2PC6A 2RF2A 4P7TA 3S1TA 3LWLA 3GJQB 3LANA 1KTVA 3W62A 2YY3A 3VVTA 1Q53A 2CVEA 1S6OA 4UT4A 3H8YA 1YHQS 1AZSB 1ZA2B 3QWPA 4CO4A 4NXNF 3UD4P 3HZEA 4KSEB 3CJ8A 3EPGA 4QU6A 2M8HA 1R89A 2F4FA 1HQEA 2UZAA 4DV5F 1MN9A 4XDCA 3RAQA 1U0HA 2MJUA 4DZDA 4USVA 2B7BB 4DR5J 1LW0B 2DGSA 2CJXB 3TAMB 3PFOA 5GVQA 2I5JB 1OQ6A 3PCOB 4Y34A 2HZAA 3HM9A 4WWSA 1IUJA 1X31C 4DSEA 5IOLA 3VZIA 1RCXB 3P3DA 2IA0A 3DLEB 1N33J 4NASA 1QAIA 1WOSA 4YB6A 1U1MA 5DLFA 1IWAA 3BPSP 4ECYA 1SUQB 1WEXA 5GADU 3M2RA 1UVLA 3AXMA 1O6XA 1HQUA 4A46A 7AT1B 2RB7A 3G6VA 2RQCA 3UCUP 5HJXA 1HNZF 4YB5A 3BSAA 1KDNA 3SV3A 2ZE2A 4GVBB 3KDNA 4RUHA 2KI2A 5DO2A 4K4TA 2W9CB 1Q79A 4ITSA 3GWCA 3GIJA 2K7KA 1NDPA 3KYLA 1YBUA 4FP9A 2MSTA 4RNOA 4LBPA 3TEHB 5HN0A 2W9BA 1NK6A 3KLHA 4IRKA 4KIAA 2RUSA 1FKAF 3MR6A 2F7VA 4K4YA 2CPHA 1V3RA 1XNRF 4O3OA 3RW7A 2QA1A 1TL7B 3C14B 4W90B 2MKSA 1JLFB 1HYSB 4ATNA 4B3OA 4F3MA 4IG0B 4X84A 3KLEB 1KLMB 1KP6A 7FDRA 1AUSL 1YJVA 1ZA1B 1H74A 4FVMA 2XM3A 4OI2A 1HARA 5AE3A 2KDOA 3O8WA 2LECA 4RNNA 3MFIA 3JSMB 4HT7A 4LR8A 1PJ5A 4DV6F 2A6OA 2HLTA 3BR9A 1PAUB 4IQXA 4P10A 4K2JA 4M5IA 1Q7YT 4WE1B 4DV2J 2EFVA 1Q4RA 1FEHA 3G6ES 2E1AA 3QGIA 5IZHA 4OQJA 3DRSB 3QT7A 3W60A 4X4PA 1FWKA 4NCGA 1YK9A 2V4QA 1UETA 2QLBB 1YX2A 2JL9A 1L3UA 2AQ4A 3N5FA 2O5DA 3T3FA 1KFSA 4ZPDA 1K1QA 3MMCB 2HGNA 2VBYA 4I0WA 1K9MT 1XN9A 2KJVA 1VC5A 1SXLA 2C42A 1Y5NB 4FXWA 1ZS6A 1RT1B 4GVLA 3F0NA 1TV6B 2CPXA 4CIOA 2QMXA 2M2BA 1YJUA 1JMTA 4ZP6A 1SL1A 3T5JA 3PHEA 1CQNA 1KWMA 1FFSB 2JFDA 4FS2A 1RTDB 3OJUA 3BBFA 1VK8A 1J5EF 3Q8VA 2FJVA 3ENQA 2Q66A 2CQDA 1W2IA 4A8KA 3CJ4A 1FESA 4KGXB 2CQ3A 2HHHF 1K47A 4B02A 4IOBA 2YKNA 2HQ3A 3ZTQA 3F56A 2WVFA 4CLWA 3MTKA 4CNZA 2FDNA 1H2TZ 2XMVA 3VAFA 3MMAA 4MIAA 3G71S 2H51B 2ZUGA 2VZ9A 2W8LA 4RNHA 4OI4A 1IBMJ 1W25A 4B3MF 1EP4A 1KHVA 3EUNA 1LWFA 3LOUA 5KFZA 1U4BA 3N6MA 4IDKA 1HW8A 1Z1ZA 4I6YA 3OBIA 4EO8A 2BW2A 4OX6A 4RNFA 2DHGA 3OUYA 2U1AA 1VJQA 1RHQB 3EDRB 3VAHA 2CPIA 4A8QA 3W5YA 3ZO7A 1IXKA 4E0DA 2QIFA 2MKCA 3PKYA 1R43A 4OI3A 4AXJA 5KT3A 1TK5A 2W4DA 4X2BA 2XS2A 3PHTA 4USKA 3GU0A 1SL0A 4HYKA 1H72C 1RU2A 1PG5B 1CLFA 3M8PB 3SV4A 1LK7A 2PDAA 4HLBA 2KXHA 4TLRA 4Y2IA 3BGUA 2FHKA 3PJ9A 2IM1A 3RZAA 3G4SS 1NDKA 5K8NA 4YHHF 2EFPA 4LFAF 4NMLA 2RU3A 2EW9A 4YR3A 1FA0A 5ETNA 1JNRB 1LW2A 4RWXA 3M8SA 4LSNA 1WSVA 2LU1A 2B5JB 4JI1J 2LEPA 4QWDA 3QFWA 2VIHA 4G6VB 3X1LB 1PILA 1T3NA 4RW6A 2AZ3A 4HTIA 3E51A 2YNFB 4I56A 5CZXA 2RU9A 3RRKA 1NO8A 3IR5B 4ETZA 5AXMA 1IKYA 4WCEQ 3AODA 1H73A 3KJNB 3GYNA 2FUG9 4JI3J 1U2RA 2QV6A 1X9WA 2OPQB 2VFSA 2ASJA 1CJUA 4UF4A 2FLPA 4TY9A 2R3VA 3AD9C 3OW2R 2Z2MA 1D9AA 2VQFJ 2HIYA 3T1YF 1BQMA 1NK9A 5F8MA 2F4VJ 2QC3A 2KU7A 4RW8B 3DM2A 1XNQJ 4WK1A 5DDPC 4NMXA 2NXUA 4EUVA 2L9DA 3ZNUA 1G1XA 2IC3B 3BN7A 3QJLA 1X5PA 3B4MA 4URSA 1H7XA 3HHNB 4YMEA 3CDWA 4CLZA 3OVSA 1ZAVA 4LF8J 4DR4J 1Z2LA 2HS4A 4QIEA 2IDEA 3I4PA 3TAPA 1FXRA 2ZDOA 3I5CA 2GIFA 4RX6A 4F36A 1A6LA 1WKKA 4I7FA 2PEBA 3EE3A 3BZQA 1R0BG 4ZLJA 1JKHB 1S1XB 4ES1A 3C6UA 4L75A 5JUMA 4I4BA 2XMWA 2XMUA 1YJNS 2J0WA 3IGNA 2PI4A 1ZPVA 2RE1A 3HD1A 4F7VA 3BQ2A 4P71A 3D6FB 3RBDA 5AXNA 3VAJA 3W63A 1K0VA 1S6QA 4DR3J 1H2UX 2BVZA 4XIUA 1N54B 1SC4B 3WHIA 3PYFA 3D0IE 1TFWA 2NCKL 4WPAA 2HFNA 4LR9A 1FXLA 3I4HX 2PFFB 2V63A 4DV1J 3DC2A 2EK1A 4MYTA 2CJKA 2XCPA 4MYUA 5J2MA 4M95A 5AE2A 1LWCB 4Q2MA 3NS5A 4QU7A 2CKWA 2NXEA 2UXCF 4OHZA 1KONA 1B0VA 1SCJB 5CD4H 1SKUB 1M1KT 2VOPA 2J0SD 3M1VB 2VKZG 3EJMA 2KZMA 4MIBA 4YB7A 1OY6A 1WSRA 2CQ1A 3TZYA 1TUGB 3B78A 4CLPA 3J7AN 4K0KF 1WJ9A 4NXMF 3HX9A 4CTAB 3UD5A 1YBAA 4LF7F 1FFWB 4M94A 2WB1D 1TK0A 1TU0B 5HJYA 4AE5A 4QWBA 5D0HA 3MUVP 2IM0A 2E5LJ 1VI7A 1X5OA 1SC6A 2E7VA 3KUGA 3KMSA 2AF6A 3L7PA 3M30B 3Q24A 4NLYA 4YDXA 3I0SB 1V6HA 1IBKF 4X66J 5EWGA 5F8JA 2XY7A 3CO9A 3DOMB 4Q0BB 5IWAJ 4B9TA 3DN9A 1HNXF 1WEYA 2ZH5A 1KC8T 5ETQA 3AT1B 3DGVA 5DM6Q 4JI4J 2A18A 4Q43A 1CS4A 1NSAA 2BZ2A 3H59A 2UUWA 2CPJA 1NJZA 2AP6A 3H7HB 4HHUA 5LL6d 3OL8A 5A8KA 1BQXA 1RT7A 5I3UA 1UPPA 2C2ZB 3TYTA 5T7LA 1NB2A 3I9ZA 4HACB 4HI1A 3TUIC 2F9JA 3UE2A 4CT8A 2AMCB 2XO6A 1T05A 2AZ1A 2B56A 3MM8B 5GAGI 1NHKL 1JLBA 4FBUA 4DR5F 2HG4A 1ZZFA 3SYZA 2O66A 2V4RA 2DNOA 2H1YA 2K3KA 4K50A 1NSPA 2J76E 3O3LA 1MROA 1WF1A 4ZIWA 1X4EA 3DU6A 2DTJA 5I3QA 3P5BP 3HSDA 2WSEC 1N6QA 2H4WB 3MUMP 3KLFA 4RW7B 1N33F 1P27B 5HROB 1XTZA 4X4SA 1TVRB 5KFQA 3BJYA 4WK3A 2V50A 2IY5B 3G6YA 1NZ8A 1KVJA 4EZ9A 1S5ZA 1ZM9A 3IAM9 4JV2A 2C2NA 4M5DA 4PUOB 5A0YA 3MM9B 3OR2B 1U49A 2V4JB 4CLLA 2IVFB 4K2XA 3N0VA 5D6GA 5E0OA 1WOOA 2KG0A 1RT6A 2RRNA 4I68A 4JUZA 2E1CA 4UZBA 1HHTP 4K4SA 1FRKA 3M8QA 2Y1IA 1S49A 1VFJA 1KQKA 5D0GA 2XG8A 4P52A 4Y3CA 2OLWA 1EJ7L 4ER8A 2V9WA 3RB3A 4WXWA 3NGUA 4HL9A 2FY8A 3KG4A 2EFGA 4UOFA 3DDIA 3K0JA 2V2QA 2R8GA 4B9NA 2ZJRQ 1U09A 3IS9A 4TYBA 2EK6A 3KK1B 1HBOA 1QDUB 1XC9A 5DG8A 1VQYA 2OPRB 1SQGA 1MMLA 2EC2A 3MHYA 3QMQA 3DI6A 5EN1A 5AE1A 1SQFA 3QGGA 4C9DA 5A2QY 2Z8QA 1S1WA 3FUYA 3PJXA 4FXVA 3PYEA 3E8OA 4DL2A 1OPZA 1RWMB 3HO1A 4DV2F 3SXLA 2ZNYA 4X62J 1VIXA 1Y7PA 3EZOA 2CXEA 3DOKA 3C6TB 3HZGA 3OT9A 2W4PA 2XC9A 1RTIB 4NRTA 2PMZD 2NZCA 1F5AA 2J7UA 1UW9A 3PR4A 3G82A 4E8UA 2Y1RI 4DG1A 2XNQA 3FVYA 2DNQA 3KLGA 2DCUB 4WU3A 3K57A 5KFTA 2KVIA 3R9LA 4MK7A 1N5YB 2YNHB 3T6JA 1D1UA 3W2VB 4RWWA 2FC8A 1X4BA 5H9FJ 4UUXA 1OO0B 3S8SA 3I5AA 4UOHA 4N8OA 4P2SA 2AV5A 4FNHA 2AX0A 3FRZA 3DRPB 5CYMA 1KD1T 5DG9A 1RTJB 5HK4A 3EGNA 2CZVC 2IRXA 4H4OA 2RHSB 4YEAA 1Y3KA 2F65A 2LQJA 3H90A 3EYZA 5L39A 2JFKA 4ICLA 2KT5A 3VR1A 1S1VB 2XSJB 1TMMA 4DUZJ 3I82A 1Y00A 2I6WA 2FHJD 2R7SA 1OWXA 2XULA 3OHBA 2RT3A 5F41A 3IG1A 4X4NA 4OJ1A 5CYJA 1VIOA 3U1MA 2IVMA 1RCOB 3BQ0A 2ASLA 2E9ZA 2K8GA 4S0MA 4ZP8A 1RYRA 5D0EA 2A6MA 1X7VA 1JLCA 2Y1LB 1P8GA 4H4KC 1HMVA 3OTOJ 2OIHA 1CVJA 3B6BA 3BSCA 4F4WA 3QO9A 2DY1A 5LT5A 2FHOB 8RUCA 2GGPB 3MMBA 1BXNA 2W7OA 1RKJA 4Z7YA 4ZVEA 1AXQA 4IO9Q 2QX0A 1DLOB 1MNEA 3FDSA 4PZVA 1RE1B 5EWEA 3OFFA 4CCHA 4DLGA 2VQEJ 4NEZA 2FJBB 4NLWA 3CDEA 1B4SA 3DLHA 3MPWA 3SFUA 4DQIA 2P2CB 2FIUA 5J2NA 1PAEX 3OTBA 5JVGQ 1NDLA 2HVHA 3MM5A 3KHLA 4JI1F 3IRWP 2QL5B 3PVXA 1NSQA 4ZCMA 2CZ9A 1IM6A 1UAWA 2FJXA 4PG8A 2W25A 2MJNA 1Q8IA 2GQQA 4DV4F 4J9UE 4G3IA 4U96A 5MAOA 1F2GA 4FBTA 1B0TA 4DFMA 2QSFA 2F8MA 4ID5A 3CJTA 1FHTA 1URRA 3CMAS 5KFKA 1SKWA 3M8RA 5IT9Y 2APOA 2DXDA 3CCJS 3AA9A 1UVNA 4JI3F 1HR0F 2YWGA 3DRRB 3T5KA 3TZZA 3QRPA 1T9YA 4NWBA 9ATCB 3UDLA 2VQFF 4OZ2A 2HHWA 4ILRA 1HFEL 2F4VF 1HNVA 4WP8A 4ETXA 1XNQF 2IM2A 5D0RA 4CNYA 2JH3A 1Q1KA 1D9DA 4PWWA 5FDLA 2CJQA 4OI6A 4AXIA 1HNWJ 1UFWA 3GFHA 1R3NA 1WHWA 4Q8EA 2RSQA 2QJ3A 4LF8F 4DR4F 4USTA 3NNAA 4JI8J 1X0PA 3DHXA 3K5PA 4XPEA 4WXOA 2MB0B 3DMJB 4C3KA 4J9PA 2L08A 3ELHA 1QM9A 3IWXA 1S6PB 4TY8B 1YJRA 1WTBA 1VS3A 2BE2B 2V2VA 5DZ6A 3I96A 2HMIA 2HAFA 3QT8A 2J9DA 3D9BA 4DF4A 4DR3F 2OEJA 2RDIA 3GJTB 5E3QA 2MQQA 3BN4A 4USMA 2OPPA 3TUPA 4DL7A 1RA6A 4P72A 4DV1F 1NK4A 5I42B 3JAMU 1GXUA 5KFDA 1FNMA 3CD7A 4DDFA 1N36F 3BBCA 3NY0A 2KXNB 4MT1A 2G0IA 4KGVB 1FKPA 3H40A 2V68A 3FFIA 5DETA 2XO7A 3I5BA 3BGOP 3R7NB 4RBTA 1S0MA 4NI2A 4OHXA 3DRYA 1S0NA 1HWLA 4WIIA 1I94J 2X3GA 4C4WA 3WIUA 5ADZA 3T5LA 1EKRA 2JZ5A 5L9NA 2R8IA 1YITS 3JQJA 3H98A 4C98A 3QPIA 2CQCA 5G0RA 2YKMB 3HF5A 1KQSR 2Z58B 1UZHA 2KB2A 4FVCA 2ZITA 1B64A 4AL5A 5KFIA 2LDIA 2E5LF 1HIYA 1VCTA 1QAJA 3CJ5A 2C3OA 4RW9B 3J80U 1NJIT 3IMQJ 4X66F 2C2DA 1WDDA 5D78A 3MECB 5J2PB 1N34J 1YTYA 3OSNA 4PKDB 1XBWA 1VRTB 5IWAF 2H54B 2VG5A 3T1HJ 2ZH6A 4JI4F 2F63A 4JV1A 4URQU 1AFIA 3N79A 2PN6A 3CC2S 3MEKA 3I31A 1RT5B 3TJ9A 4YY3J 3O1LA 2PE8A 3A8JA 1U1NA 4J9KA 2A3JA 1QTMA 2KXFA 1REGX 3D7SB 4JI5F 4MKVA 4OFZA 2ZD1A 1FDBA 4F2SA 1UVMA 3NOCA 5GAHU 2DNMA 3EMTA 4X4TA 1J5OB 3PXGa 2EI5A 3IR6B 3AOAA 4MAKA 2KO1A 2YH1A 5B08A 4DSFA 3UD3P 2QSWA 3FBBA 2CWKA 2ZWPA 1MG7A 1TL3B 3ET6B 3R97A 3H5YA 3LA0A 4X4UA 2HWHA 5LM7E 4DZ6A 2XHCA 4USHA 4C2MA 3MAHA 4JP8A 3N9UC 1KFDA 5CYQA 1TMJA 1FTRA 3L9ZA 4MKBA 3CCES 2ATLA 3R2CJ 2M3DA 2DXFA 1S1TA 5H9EK 4DFJA 2M88A 1FE4A 3POTA 2EEYA 3R6LB 1C0UA 2FB0A 4KH0B 2WOMB 2J8SA 2X51A 4I2QB 1DBDA 3K58A 4DL4A 3VGUA 1RU1A 4K4UA 1FD2A 4LREA 3TQ1A 3D6TB 2OFGX 3ZZYA 4MKAA 1RP5A 3EXCX 2JEFA 1RB0A 4KYZA 2B6AB 5D3GB 2CQIA 3W7BA 1U7LA 5KFMA 3CMQA 5C2GA 4LBIA 3PJWA 4F50A 2DNGA 3RR8A 2BANB 2BQ3A 3MEGB 1RWVB 3K2YA 4ZN1A 2R42A 3OPKA 4DCPB 4OJHA 2C2EA 4C3MA 3KG1A 1IR0A 4F67A 1Y9OA 2YX1A 3MR7A 2ASDA 5CH7B 3D67A 2V6AA 5KFUA 4QPXA 2ZWOA 1F2HA 2HNYB 4ELUA 1RHJB 1T8EA 4Y6IA 2HZVA 3I0RB 5GMDA 2R7UA 4ZOSA 3A8IA 4Y28C 3BREA 2BKPA 3M2RB 4DSIA 1E6YB 3QZ8A 4ECZA 3S6EA 1LFWA 3M6UA 4Y2KA 2M7SA 2ZOGA 3GQCA 1DTQA 2N3OA 3H5UA 2V69A 1JB0C 1M1HA 4USJC 2B4OA 3CJKA 2HW3A 4XO0A 2VG6A 1NMEB 5KFAA 2E66A 1KTQA 2W9AA 1VLYA 2DR5A 3KOAA 4WU2A 4KJIA 4B3TJ 3SQGB 3BV8A 4MKYA 2QZ8A 2HHPA 1JJ4A 5HBMB 2HSEB 1RA7A 3EZUA 4DR6J 4QIFA 1P6TA 2E1RA 3R5JB 2MQLA 1ZOTA 4OYZA 3PIOQ 2Q79A 4KFBB 2XBPA 1LWEA 2KJWA 4C97A 4P2MA 2AKWB 5JXSA 2CYYA 3FBFA 4I67A 3MPUB 3W66A 3M2VB 5LOQA 2G1DA 2HVDA 4NPOA 2JVRA 2NYIA 3DLJA 4IUFA 1N5TA 2X3DA 4C48A 2DGTA 2HNZA 2BR0A 3VALA 1UP1A 1Q8KA 4O3NA 1VQ8S 3VAGA 4FKXA 4QWAA 5L46A 2G9OA 2J0XA 4FYYB 1F0XA 2MZSA 2MLYA 4F3OA 2Z2YB 3G87A 4WFNQ 3W2WA 2MZTA 2EFNA 1BWVA 4NCGB 4ZHRB 1U1RA 1Y11A 2Y8WA 4EBEA 5AJ3F 5J2QA 3MCMA 3LP1A 2M9KA 1X4GA 3BGRB 5LMUF 2VA2A 3UR0A 4ILMA 2BKOA 4A4JA 5JMNA 3FC9A 4YOEA 3OTOF 4N8NA 3EPIA 4ZPTR 2KN4A 2AYEA 2EBGA 4DUYJ 4HI2A 3G8TA 1IKVA 3AQOA 3K8VA 3UVJB 4X4RA 4K4WA 2DBBA 3K89A 2ZHBA 3TOQA 2UU9J 4FYXB 2CJ9A 4KGKA 4CLYA 4CO1A 4DU7A 3KLIB 2ACYA 1BHNA 5LSRA 3DGPA 5LXYA 2DRAA 1MWZA 5CCMA 3Q8RB 3KJVA 4PQUB 2YQ3A 1RAJA 3MM6A 4W98A 2JLGA 3FRYA 1SJ3P 3AA8A 1FRIA 1A9NB 2YKNB 3HSGA 4PXEA 5HLFA 2EBEA 2A2CA 1VBYA 3Q22A 3K17A 1Y5IB 1XR5A 1G7CB 5IFMA 1RTZA 1Z2ZA 3FCHA 3TVKA 5F8IA 2PIIA 4LF5J 2DHAA 4RL1A 1RTHB 1L3TA 1TUVA 4EFAC 2XMKA 1C4AA 4B9UA 5M2PA 3UW1A 1YZ7A 1M1GA 1NUEA 1ZAXA 5G4DA 1ZZNA 2MGZB 3D3BJ 1VRQC 4NLPA 3TO8A 1VLOA 2N82B 2HNDB 1EX8A 4YQWA 1WD6A 3AFGA 1S9FA 2GVZA 4DX6A 5K8PA 3Q86A 5LSLA 1S7HA 3P96A 2XCAA 4YR0A 2V0NA 2QTWA 2MPUA 5KFGA 4U6PA 4CLUA 1S0VA 1EZZB 4ZVQB 1SV5A 2P9GA 3IFEA 3AJ2A 3CCRS 4HH1A 4ECRA 3VWSA 4X64J 1SBRA 3J7ZT 3OSPA 1MWYA 3RUBL 4L74A 1Q8BA 1VJWA 1HNWF 3HHLA 5HMWA 6AT1B 1FK9A 3LAKA 2D7SA 3SEOA 1WC4A 4LRCA 4Q44A 1RUSA 2G2YA 5C25A 1REVB 4A8SA 2DNYA 4L3KA 3SDEB 1RDRA 4HDHA 5A8WA 4Y65A 1NSKL 4KO0A 3G6XA 1IQZA 1KQGB 5EX3A 1JJCB 4C11A 4WFZA 3A3OB 4RW6B 3ETOA 1P1TA 5C42B 3D3CJ 5HQMA 3RW6A 3TA1A 4LFCF 3FEXB 1OY9A 2BM1A 3MXHP 3ENAA 2W8KA 2Q3PA 3R7SB 1ZETA 5T41A 1FRMA 1YJ7A 2BJ8A 3NOGA 5J1NA 2BA9A 2EPIA 3E3XA 4MTPA 4PG6A 1AZSA 3GZ7A 3FSYA 1CJVB 3ZNJ1 1CJUB 1YLXA 4NX9A 2UV8G 3CC7S 4DPTA 1F9EB 2QEXS 2PA8D 1NHVA 4ZJQA 2KKHA 4J7CA 4ANDA 1MMDA 3AOCA 1FNXH 1N5QA 1LW0A 1U0SA 2FYXA 1TKTB 1H98A 1M5SA 3TAMA 3PM9A 2I5JA 1AA1B 1IR2A 2ZOFA 3TNVA 3RBEA 5KG6A 3GIKA 2XS5A 2IM3A 1TL4A 2DH8A 3J81Y 3D6HB 3S01A 3UCGA 3TJ8A 3MEEB 4JI2J 3DLEA 4O3QA 5EWFA 3ZC4A 2UVUA 4OJ3A 1SUQA 3MF5A 2QMWA 3NGRA 1O5JA 4U7CA 2R2UA 3L3CA 2DNPA 4KH1B 4GVBA 3TR5A 1RSCA 4J90A 3NMAA 2W9CA 4DHVA 1N34F 5HL7Q 3AAWB 2N4DA 3T1HF 2F40A 2VPXB 4GC7A 4QBUA 1FFGB 2WVCA 4IFYB 3LGNA 5F0UA 3AHPA 1S9EB 3QNWB 4YY3F 4IH7A 2B9YA 4Q5VA 5B0FA 2Y1JA 3THVA 1UFKA 2BW7A 4R0JA 1TUWA 1Q78A 3NL0A 1YIJS 2WONB 2CQBA 4OHVA 1Q5VA 3VV2B 1TL7A 1S1UB 1Y0HA 4DS4A 3C14A 1JXLA 2GJ2A 1JLFA 3C46A 4J91A 5GAEI 1NKEA 2V8VA 3R2DJ 4IG0A 4I2PB 2XI3A 3KLEA 2PA3A 1KLMA 2VFVA 2Q6CA 4CH1A 1YRUA 2YXLA 1S57A 3JSMA 1PYSB 1U1QA 2Y3YA 4F4YA 1NJWA 2DHSA 2K7JA 4WE1A 2CVIA 2VJUA 3O44A 1M5OC 4J9MA 1SJ1A 3DRSA 4C8OA 2X7IA 4K4ZA 3A1YG 2DGOA 5T14A 1RT2B 2ZM6F 4MIWA 2XLJA 4RU9A 5LMNF 4K5SA 2NXCA 4ZLLA 3W5ZA 3R27A 5LJ5Y 4CLKA 2QE5A 1GNKA 2YX7A 1FVQA 3JXOA 3DRXA 3MMCA 4M5HA 5FIIA 1JWWA 4N41A 2R8KA 1RT1A 2CNLB 3PY8A 4WFXA 1TV6A 2HFZA 4C7QA 3OJSA 2I2YA 1KRPA 1F1BB 2D41A 4PXCA 3UDEA 2HVZA 2WRMA 1UL3A 1RTDA 5BR8J 3PO4A 1NH7A 2CQPA 3SCIE 4JV0A 8ATCB 3KHHA 3FJ2A 1X4HA 4JI6J 1ZH5A 3DLGB 2XB2D 3TQEA 2HHQA 3T19A 2JC1A 4DJBA 5A2QU 1R31A 2CNOB 3X3UA 1CC8A 2AJQA 1RKIA 4LJMA 3HCXA 2DK2A 1ICEB 1SC1B 4P2XA 1T9XA 4ED2A 4OX7A 3KNAA 2CNNB 1LNQA 2VU5A 4AFFA 2F5GA 2BJDA 1ZTTA 3ZZUA 1S9GB 4FYWB 1RBOB 4B9VA 1QVFR 2Z0GA 4KGMA 3GIMA 1BMQB 5EX0A 5KT6A 2HHXA 3R8YA 4ALZA 1Q95G 4N77A 1DHMA 4ILLA 2OSQA 3PEHA 3VVUA 3MAAB 2GQ2A 4EK2A 2OH2A 3LALA 5DDQC 4LMZA 2E44A 1SB6A 1P9QC 4ZVHA 4KPYA 2UXBJ 4B3TF 4J9OA 1FI4A 1RWWB 4LFBF 3CD6S 3OFGA 1QD1A 4NCAA 2P6SA 2MHNA 3IA0A 1IR1A 1UWBB 1QAYA 2LXFA 4DV0J 3NAHA 4PCQA 4EWTA 3HKWA 1WUUA 3PO5A 2JDJA 3FCWA 1U2FA 1XMOJ 4M5KA 4G1IA 3EVOA 3TRGA 3W9IA 4TQRA 1KKHA 3ILIA 3M8PA 3V4IB 4PEOA 3R3TA 3P45B 3T1AA 1RWXB 2O67A 5IC4B 1HL6A 1WHYA 2VJVA 4DN9A 1BE4A 2W2PP 2B5JA 3MDFA 4MFBB 2ZC4A 2WVDA 4WFAQ 4LF4J 5A8RB 1NPPA 2BJ3A 3PRBA 2C2OB 1NK8A 3D1HA 2VODA 1OY8A 3OXFA 3EVMA 2YNFA 5KFYA 3BR8A 4W92B 2F1FA 5KFBA 3NS7B 2UVWA 4KTQA 1RAAB 2M5YA 3SCKE 1FDDA 4B17A 2E5JA 4EYHB 3QIPB 2JLFA 3GFYA 1GFWB 1C1CB 2OPQA 4O44B 1C1BB 4MJKA 2POKA 3R1HA 2P9EA 3QLHB 2ZZMA 3I87A 3I6PA 4YFUA 2DR7A 1BQNB 1EETB 4RW8A 1X0FA 1RQ0A 1RBAA 4LRFA 3NWRA 1PGZA 4R8UB 2PEHA 3C3LA 1DTTB 2UU9F 4DPUA 2IC3A 1PBUA 1QUPA 4HHJA 2OTJS 1WC0A 4ZVSB 4OLPA 3VTIA 3RGIA 2MKIA 1AB8A 4DR7J 4WKYA 2VV5A 3EM1A 3TAQA 4FDFA 2PD1A 3DYAB 1L3VA 2ZZNA 2H5JB 2E9RX 1KLNA 2D3ZA 2H48B 2MY7A 5E33A 4CM2A 3MUTP 4PPDA 1JKHA 1S1XA 1NU4A 3TW0A 4TVAB 1NBEB 2HFUA 3HP6A 1U47A 1SQEA 1NXIA 1U1OA 2YPYA 2G4BA 1FRXA 2GCFA 3KXDA 1WORA 3J7YU 3R1LA 1RT4B 4DOZA 4DQQA 1D8YA 3GJRB 4WYWA 3JSBA 4NLTA 3M32B 2WZ1A 2BRLA 4NRUA 3D28A 8AT1B 4GKJF 2HRTA 2OAUA 3MWBA 4JV5J 4F4KA 3MI7X 2FGOA 1NB7A 2MKKA 1JX4A 1LWCA 1VHIA 2DNKA 2FY1A 3GPAA 4KBIA 4OYAA 1MU2B 3EWGA 3M1VA 1E6VA 4I6WA 3FGVA 3IR7B 1PIEA 3IBFB 2JJ4D 4UY8T 2XMAA 4DV7J 3QAEA 4LF6J 1WF2A 2BE7D 1C0TB 4P74A 4IRDA 1W2BR 2MXYA 2DY9A 4ELTA 1CJTB 1BGXT 5E2QA 2IBKA 1YRTA 3IWNC 1HW9A 2NPFA 1TAQA 4ED8A 2IMOA 1R0CB 2WB4A 3M30A 2EFOA 3WC2A 1S59A 3G86A 4ZCLA 3I0SA 4P73A 2LXIA 5GMEA 5IT0A 1SI9A 2ZUAA 1U8WA 3DOMA 5K8MA 4Q0BA 2UUCJ 2HWTA 3D2WA 9RUBA 2MLXA 4Q2LA 4M5JA 2VDHA 1FWPA 2R9LA 1TKXB 1SJQA 2YBVA 1N88A 2ZFHA 2VPWB 3NBPB 5F8NA 3TI0A 1D8ZA 4N7TA 4LSZB 4QW8A 2AGPA 1LKZA 1N32J 3CW2C 1M90T 1NK0A 2DR6A 4DR2J 3TX8A 1RLDA 1RT3B 2QO3A 3PX4A 5LJ3Y 2R7TA 4HACA 1UEVA 4P9SA 3MM8A 2HQGA 2V2KA 2DR8A 3DOLB 4PXBA 1RAIB 2ZHOA 4JYAJ 2KZZA 2VDIA 1GX5A 4MMOA 1TZ0A 2R7QA 2RUGA 2RS2A 1HPZB 1X9SA 1HI8A 4NLOA 2PFDA 2FJAB 2ZBRA 2PT0A 4BLGA 2UUBF 2VPZB 2QT7A 4KQZA 3M4XA 5HROA 2JLEA 1TVRA 4LRDA 3MOJB 4G65A 5GMKa 4H4MB 3OD2A 4KKOB 2B8PA 1S7IA 1G3OA 4L6V3 4ZLPA 1EKSA 1RWPB 4PUOA 3MM9A 1NLKL 3OR2A 1FERA 4J9LA 2V4JA 4WBFA 5HVFA 4DEZA 1XIQA 1LOUA 2X1BA 1GX6A 3HT3A 2ZVIA 3CD5A 4W4MA 2YH0A 1HBNB 1RBLA 2KL8A 4OX9F 3SMZA 3OTDA 4CLFA 2CIMA 1HBUB 5DQGA 1KOHA 3CCVS 3FMBA 4UQGA 2EXUA 1IKWB 4M5MA 3TARA 2FVCA 4PWDA 4OZLA 3GILA 4DV5J 2D9PA 1TTHB 4OYWA 1F5BA 1U1PA 3UN5A 2VFTA 3BPDA 4OIXA 4M8LA 5L1IA 4Y2MA 4CO2A 1V9OA 1DAXA 1T3OA 2KFZA 2OSRA 3UDVA 3RAMA 3U1NA 2GX8A 3W61A 2RS8A 3B82A 2MZRA 3KK1A 2XMJA 1MSWD 4OHYA 3H20A 5DM7Q 2EKYA 4EO6A 1PYTA 4EBCA 4B08A 2OPRA 5F0WA 1UVJA 2Z2ZA 1F9FA 5K14A 1M5KC 1ELOA 5FJ4A 4AYBD 2DGVA 1QJHA 2V67A 2RAQA 5D4NA 1H0HB 1OSCA 1F9HA 5HVHA 2QLWA 4RO0A 1HNZJ 2K06A 5LSOA 4J5OA 4BC7A 3AOBA 2OPSB 4HDGA 1NH8A 4D3GA 5D77A 4HVZA 1LXNA 3C6TA 4X65J 1TELA 3CJ2A 1RTIA 4F0MA 3T9ZA 3NGTA 2VH7A 1OIAA 4OYBA 2C22A 2FVRA 3CXCR 4OZNA 2OMLA 3OR1A 3OLAA 3BDPA 2VL1A 4NYPA 1WC1A 2P6TA 2G2OA 2HBYB 1IBLF 1OSDA 1RISA 1N5YA 2YNHA 1XNRJ 4ENOA 2ZD1B 1FJCA 1KSPA 3W2VA 1DFDA 2G2ZA 2O1PA 4NLSA 2OEKA 3PW0A 3H2UB 3MR3A 1RACB 2HVEA 4WZMA 3OQ2A 4PG4A 4N47A 1AYEA 5BYRA 2R7RA 1AFJA 2N7YA 4NA2A 3CCSS 1XK8A 2F8HA 3B4DA 2A10A 2MZQA 2GQCA 4DV6J 4A8MP 3E01B 4OI0A 1APSA 4O0NA 1QY7A 2BQUA 1S1VA 2XSJA 1QSLA 2CJYB 5BYQA 2AU0A 4OHWA 2BQRA 1NHUA 1EARA 2BV3A 1TFYA 2PGCA 3PRDA 2GNKA 3N01A 2D74B 1JXVA 4X4OA 4J9QA 4DR1J 4CO3A 1WI6A 3HSJA 3GONA 4RUCA 3AB2B 2AHOB 4AL6A 3POTB 1VQ9S 4DCJB 4BHQA 3QQCD 3SCJE 2DHXA 2NREA 3A3PB 3HMJG 3LPYA 5HP1B 3WC0A 1M0SA 3JS9A 1LFPA 4DF8A 4DV3F 3DLKB 2GGPA 3FKBA 2IRYA 2MKHA 1T03B 2UXBF 3MFHA 3LPEA 4U67Q 3GP9A 2X1GA 3R5BA 2DNNA 2XY6A 2W01A 1J5EJ 3LH2S 4CYUB 2KM8C 3ISND 1WC5A 2VICA 1DLOA 3DU5A 2VUGA 2B0GA 2UUAF 5KFLA 4IH5A 5EHHA 2HHHJ 3K5MA 1XMOF 1YG0A 4MH8A 1JNZB 1WACA 3GV8B 2E7WA 2VPYB 4ZPCA 4IG3B 2CDRB 2AEFA 3PW2A 1OQ3A 3CDUA 2FD2A 1DY3A 3AH6A 4WKRA 2W2MP 5KG1A 5E5NA 2FVPA 2DGXA 1ITPA 5B09A 2YWFA 2D9OA 3ITHB 1OMSA 1O0PA 4B3MJ 1H38A 3RBXA 5IT4A 4LF4F 3LP0B 1K44A 4ZVPB 2HFVA 1HNIB 3OLBA 2IJRA 2LMIA 4TU9A 1CULB 2HIQA 2FZKB 4LR7A 4DUTA 2LKZA 5B0AA 1MN7A 2DNHA 2LQBA 2AYMA 1FNOA 1FKOB 4NYZA 4UZCA 4ZCIA 1QE1B 1KN6A 4KRWA 3T5HA 4QYZK 2JEJA 2RD5C 4U7UD 1CJKB 1FD8A 5I4MA 2V8HA 5HI7A 1JLAB 3CJSA 3DRRA 3Q8PB 5KFVA 3U02A 4IFVB 2HS0A 3MPVA 3ZFVA 3THPA 3MMJA 2E7XA 3BH6B 2KM8B 3SIPB 3K59A 5DGAA 1RAGB 2GHVC 3SFGA 2M8DB 5ETPA 5HQLA 2Z30B 1FX2A 4MK9A 1N0UA 4NLVA 3CC4S 3C8YA 2RMLA 2ZBPA 5J1EB 4ED4A 1VYAA 2X1FA 3GYXB 1F6TA 2N3LA 3GR1A 4YDDB 2IPOB 2DCLA 1S77D 4C8LA 4C8ZA 2W2NP 3NLCA 2QRRA 3HT0A 3N6NA 1FRHA 5GADI 2CJAA 1UA0A 2YNGB 3R5AA 3NNHA 3QJPA 4CDIA 3DMJA 3L09A 2B4VA 1Y5LB 3VF0B 1KEKA
chains in the Genus database with same CATH topology
3ZZZA 1L3UA 2AQ4A 2MZTA 3K5OA 4WFBQ 2EFNA 3N5FA 3VAMA 4NCGB 1DQ9A 3W3SA 4ZHRB 4I1TA 3G8SA 2O5DA 3T3FA 2LYVA 1U1RA 1KFSA 1UVIA 4ECTA 3OVAA 5A8KB 1S6PA 1VQMS 3SSQA 4EBEA 1RT7B 4TY8A 5I3UB 4ZPDA 1K1QA 5AJ3F 4H4MA 2CFXA 1BY9A 2ZH7A 5J2QA 2UVVA 5THWA 3TANA 3MMCB 2HGNA 2VBYA 2BE2A 4I0WA 1A7GE 5T7LB 4DMZA 5EDWA 4KR0B 1K9MT 1XN9A 2KJVA 3LP1A 2CPEA 2EG2A 2M9KA 4KKOA 4NOHA 1X4GA 1SXLA 3BGRB 4EU0A 4E98A 1VC5A 1BC6A 2C42A 4DN0A 1Y5NB 5IM0B 1VQNS 1LXJA 1T05B 4FXWA 5LMUF 1RT1B 1TV6B 2CPXA 4CIOA 2QMXA 2VA2A 2M2BA 3NP5A 1YJUA 1JLBB 3UR0A 4ILMA 3NCPA 4A4JA 3HVAA 2ZC3A 1IM4A 1FEEA 1JMTA 2H5EA 5KFCA 4Y2AA 4YOEA 4ZP6A 3OTOF 2HRUA 4N8NA 2R8HA 3T5JA 2DITA 2RVJA 1CQNA 3CJ3A 3PHEA 1SL1A 3US5A 3EPIA 2JFDA 4FS2A 1RTDB 3NWGA 3OJUA 4EBDA 3G96A 1VK8A 2DB1A 4ZPTR 3U27A 2KN4A 1ZTWA 3CVKA 4OZ1A 3CDBA 2AYEA 3ZZOA 1BWEA 2EBGA 3AJ1A 1J5EF 4HI2A 4BWJA 1HBNA 5I42A 1MROB 2FJVA 3ENQA 3CUNA 3G8TA 1IKVA 4DQSA 4JV5F 5KFJA 2Q66A 2K1RB 3AQOA 1QUVA 4WZQA 1J2VA 2CQDA 1W2IA 4HEA9 3K8VA 4X4RA 1WELA 3CJ4A 4K4WA 1FESA 2DBBA 4A8KA 2R8JA 2ZHBA 1N6QB 2CQ3A 1HBUA 3KLFB 3TOQA 2HHHF 4LSLA 4FYDA 2CJ9A 5E3RA 1LQ9A 3K8WA 4KGKA 4B02A 1IKWA 4CO1A 3KLIB 4IOBA 2ACYA 2YKNA 2BXJA 2HQ3A 5LSRA 3DGPA 5LXYA 2DRAA 1MWZA 5CCMA 3Q8RB 3F56A 3KJVA 4PQUB 3HHEA 3MTKA 2YQ3A 1RAJA 3MM6A 4LSLB 4CNZA 5KFHA 5FLXY 2AJ4A 2FDNA 1SKSA 1H2TZ 1XR7A 2NUUG 4KE5A 3TA0A 3FRYA 2JLGA 2XMVA 1SJ3P 1U48A 3AA8A 1FRIA 1A9NB 2YKNB 3VAFA 2C3PA 4PXEA 5HLFA 2BJEA 2EBEA 4M5DB 3UI3A 5F9NA 5C5JA 3MMAA 2A2CA 5A0YB 2MYFA 3H2VE 4MIAA 1KR4A 3GR0A 2LLZA 1VBYA 1ROFA 3G71S 1VBXA 3Q22A 4NLXA 2ZUGA 2VZ9A 2W8LA 1IJEB 4DFKA 4ZA1A 4RNHA 4OI4A 1PSDA 1Y5IB 5KT2A 1XR5A 3GV5B 3HLUA 3M05A 1VQPS 1VQ6S 5CA5A 1G7CB 1W25A 5IFMA 3TVYA 1FE0A 1Z2ZA 3O2IA 4B3MF 3FCHA 1FVSA 3N6LA 1YVFA 1RT6B 1EP4A 1KHVA 2RQMA 5B0EA 3CCMS 3EUNA 1LWFA 1WF0A 3TVKA 3LOUA 2L48A 2O01C 5KFZA 1U4BA 4HKQA 2IAJB 3N6MA 4IDKA 5F8IA 3EXYA 1HW8A 2PIIA 1JLGB 1Z1ZA 2XGQA 1NEEA 2DHAA 2CQ2A 4I6YA 4KHPF 3OBIA 4KV8A 1RGVA 4EO8A 3M8QB 5M2UA 2BW2A 3GMGA 5KOXA 5AXLA 2YKMA 4PWUA 4OX6A 1RTHB 1L3TA 4RNFA 1XEZA 2J9CA 3NGKA 4F25A 2YKOA 2WCXA 1QSYA 1TUVA 3LQVA 4EFAC 4NZ0A 1LV5A 2XMKA 3CEDA 2DHGA 5KFEA 2AYGA 1FXDA 3OUYA 2U1AA 1H2VZ 1C4AA 4KV8B 4DL6A 4B9UA 2OO4A 1QAXA 4OX8A 3UW1A 2DT9A 2FJDB 5M2PA 3VAHA 1VQKS 2CPIA 4USIA 2VFRA 3U1LA 4A8QA 1ZAXA 3JB9k 5G4DA 1ZZNA 2MGZB 5KFPA 3MR5A 1IXKA 1TQLA 4RW9A 4E0DA 2QIFA 4NLPA 4QW9A 3BO3A 4J9RA 4KHRA 2ZKTA 3TO8A 4DR6F 2N82B 2HNDB 1KOOA 2MKCA 5DRKA 1BLUA 3MECA 4YQWA 3QIDA 5KG5A 3AY0A 1UJ5A 1WD6A 5J2PA 3PKYA 1PO6A 1R43A 4OI3A 4AXJA 5JVHQ 1S9FA 1VRTA 2UUCF 5J1PA 5K8PA 1ZPWX 5LSLA 3NGDA 1S7HA 3P96A 4ECXA 2OPSA 2UP1A 1DARA 2YNIB 5KT3A 1TK5A 3FEZA 2C3UA 2XCAA 4YR0A 1Y4ZB 2W4DA 4X2BA 2XS2A 2V0NA 3H4BA 2MPUA 5KFGA 4U6PA 1S0VA 2E9TA 3IS9B 4O0IA 2IYIA 3EZ5A 2I1RA 1SL0A 1RT5A 1HBOB 4HYKA 2DGUA 1MW7A 4IR1A 1SV5A 2DH7A 2CPZA 3LUYA 1CLFA 2GO8A 2P9GA 3M8PB 3IFEA 2ZDPA 3AJ2A 3M9NB 3CCRS 3SV4A 3J7A1 1N32F 1LK7A 2DPIA 2DNRA 4HH1A 4DR2F 2PDAA 4ECRA 3QWUA 4HLBA 3VWSA 2KXHA 3DI6B 4KHMA 4TLRA 4Y2IA 3BGUA 1KEKA 2RIJA 1SBRA 2FHKA 1SJFA 3JAMY 2IM1A 3O5TB 3RZAA 3VAIA 3RB0A 2BDPA 3G4SS 3HK2A 3J7ZT 3NKYA 5K8NA 3Q0AA 1MWYA 4YHHF 3OSPA 2EFPA 4LFAF 3J7Z5 4ZKAA 1AROP 4NMLA 1Q8BA 1S1WB 1VJWA 1O8BA 2RU3A 1HNWF 3HHLA 2EW9A 4YR3A 1FA0A 1JNRB 2GMLA 2N4CA 5HMWA 2AW0A 1FK9A 4U7UK 1LW2A 3LAKA 2D7SA 2CRLA 4RWXA 3M8SA 3SEOA 1J5OA 4LSNA 2LU1A 2E5HA 3V6HA 2B5JB 2VFUA 3MD1A 4Q44A 1GAOA 3BS9A 1VQOS 1KNZA 2XHWA 2DISA 4RZRA 5HMXA 2LEPA 4QWDA 5L8RC 5C25A 1REVB 4A8SA 2DNYA 4G6VB 1R8PA 2RRBA 4N5SA 3X1LB 1PILA 1T3NA 3DOKB 2X1AA 3SDEB 4YB1P 4RW6A 1RDRA 4HDHA 5A8WA 4HTIA 3E51A 4Y65A 2YNFB 2J0QD 1UA1A 3MR2A 4I56A 1YGYA 4KO0A 2RU9A 5CZXA 3RRKA 1NO8A 1IQZA 1KQGB 3IR5B 4O4GB 5EX3A 1IKYA 5AXMA 4ETZA 4ZMMA 4WCEQ 4C11A 1TL3A 4WFZA 3JYTB 3LO3A 3K5LA 4RW6B 2JHEA 3ETOA 1FRLA 1P1TA 2GO9A 5C42B 3RW6A 3TA1A 2Z4PA 2V9KA 4CH7A 4LFCF 3FEXB 3V2UC 3GYNA 3HHLD 1N8RT 1M5HA 2IRUA 2BM1A 3E01A 3MXHP 5KFNA 2DVIA 3IO1A 5KTQA 2W8KA 2Q3PA 1NZAA 1ZETA 1HBMB 1VQSA 5T41A 3FQKA 5E3CA 2FLLA 2FUG9 3D0GE 1FRMA 3A8EA 4DG1B 1U2RA 2QV6A 2WK4A 1X9WA 2OPQB 1N48A 3KLGB 4IYQA 2VFSA 5J1NA 1NK7A 1K8AT 2BA9A 2ASJA 1NNDA 1R8CA 2FLPA 4TY9A 4DUYF 2EPIA 2HHTA 3E3XA 4MTPA 2GIQA 1X9MA 4PG6A 3GZ7A 3OW2R 5AXKA 2JX2A 2Z2MA 1D9AA 3FSYA 1WNEA 2AWZA 3T1YF 1BQMA 1NK9A 5F8MA 3IWLA 5C24B 1GXLA 2WOMA 2KU7A 4RW8B 1KVIA 1ZBTA 3DM2A 2BM0A 4B3SF 3OL9A 2J9EA 4I2QA 4WK1A 4NX9A 2UV8G 5DDPC 3J80Y 3CC7S 2NXUA 2ILZA 4EUVA 2QEXS 1X5SA 2L9DA 2PA8D 5CYMB 4ZP9A 1UJ4A 1NHVA 2KRRA 2KKHA 3HXMA 4RBVA 1ZAWA 1K1SA 1G1XA 2IC3B 5GAEU 1UVKA 1MMDA 1FNXH 3BN7A 1N5QA 3QJLA 5D3GA 1LW0A 2ASYA 2B6AA 2FTRA 2ZH8A 5HP1A 1TKTB 1X5PA 2HRYA 1H98A 4H4OB 1M5SA 3CGIA 3B4MA 3TAMA 4NZ6A 4URSA 1H7XA 5H1SV 3HHNB 3PM9A 2I5JA 4YMEA 3E2EA 3THTA 3CDWA 3OVSA 3JSRA 1ZAVA 1Z2LA 3DLKA 4ICLB 2HS4A 2ZOFA 1T03A 2J5AA 4QIEA 3TNVA 3RBEA 2BANA 2F9DA 3I4PA 5KG6A 3KK2B 2HFOA 1FXRA 2ZDOA 3I5CA 3GIKA 3TAPA 1JLEB 1IBMF 2XS5A 4RX6A 1WG1A 2IM3A 3MEGA 1U6ZA 1TL4A 2DH8A 3J81Y 1A6LA 3S01A 1TKZB 4B9MA 2OMOA 4I7FA 4IRCA 1N5VA 2VD3A 3UCGA 1QLNA 2YWKA 3BZQA 3MEEB 1UFLA 2KFNA 3DLEA 4O3QA 5KOWA 1JKHB 1R8HA 1S1XB 4N56A 4LF5F 5EWFA 4IR9A 4ES1A 2ZVSA 1R0AB 3IG1B 1VC0A 3C6UA 3ZC4A 2UVUA 5JUMA 4I4BA 2DD8S 4GO5X 2NZ4A 4OJ3A 2XMWA 2I8EA 5L1KA 2XMUA 4DX8H 1JIHA 1YJNS 2Y0SD 2J0WA 1SUQA 3IGNA 3TUJC 3MF5A 2PI4A 1ZPVA 2HNYA 2QMWA 2RE1A 2GA7A 1JLCB 4Y0FA 3BQ2A 4IG3A 4ED3A 4EZ6A 4TU7A 2KFYA 1O5JA 3I0RA 4IKAA 2WHOA 4U7CA 3RBDA 5AXNA 4A8XA 3VAJA 2BOPA 2R2UA 5E41A 1K0VA 3KFWX 1S6QA 1HMVB 1H2UX 2BVZA 3L3CA 2DNPA 4XIUA 1N54B 2ABYA 4JBCA 1E6YA 3QO9B 5KG7A 4J37A 1S0OA 3D0IE 1N5SA 1TFWA 2HFNA 1FXLA 2J6TA 3I4HX 2ROEA 3MMBB 3KLVA 3TR5A 1TR0A 2YX4A 3PFEA 4FF1A 2PFFB 2FC9A 3NMAA 2W9CA 3ITHA 4LUBA 4QWCA 1JJHA 1YRXA 2VKRA 4DHVA 1I1GA 1N34F 5HL7Q 4TYAA 5F8LA 5IXUA 3AAWB 1SH2A 2N4DA 5GAGU 4LT6A 3T1HF 3OVBA 2F40A 3LP0A 3QGHA 2VPXB 5IS2A 5KT7A 4GC7A 4QBUA 3DC2A 4DPOA 2EK1A 4MYTA 2J7KA 2CJKA 1HNIA 2XCPA 3P5TL 2QA4G 3LP2B 4NCBA 4MYUA 4X65F 2L9WA 1MMNA 5J2MA 4M95A 5AE2A 4IFYB 1LWCB 3RB4A 2CZ4A 4K4VA 3LGNA 4Q2MA 5F0UA 5KAKA 3HVWA 2IJFA 2XGPA 3NS5A 4DSJA 4QU7A 2CKWA 1FKOA 3AHPA 1S9EB 2E5IA 4YY3F 4IH7A 2UXCF 2B9YA 4OHZA 1KONA 1B0VA 5CD4H 4X64F 1L3SA 1M1KT 2VOPA 4Q5VA 5B0FA 2J0SD 3M1VB 1QE1A 2VKZG 3SQGA 3CULA 2KZMA 2Y1JA 4MIBA 3THVA 4YB7A 4R0JA 1S97A 3OXLA 1Q78A 3NL0A 1H3DA 2CQ1A 1YIJS 3BDEA 2JEIA 2WONB 2CQBA 4KAIA 4OHVA 5HBMA 4CTAA 2JVOA 1DZ5A 1JLAA 4JI7F 1S1UB 1Y0HA 4DS4A 1Z4UA 1JXLA 5J2NB 1FJGF 2GJ2A 2WSFC 3B78A 4IFVA 1JLFA 4K0KF 3C46A 1S4FA 3CPWR 5GAEI 1S79A 1NKEA 4NXMF 3HX9A 4KFBA 2V8VA 4CTAB 2MSSA 4IG0A 3RTVA 4I2PB 2XI3A 1WTFA 3KLEA 2PA3A 3MM5B 1KLMA 3NRBA 1YBAA 2LCWA 2XLIA 4C8KA 4LF7F 2HYIB 2VFVA 2AJFE 4M94A 4BC9A 4F4ZA 2WB1D 1TK0A 5E3AA 2R7WA 4MK8A 2Q6CA 4AE5A 4CH1A 3KG0A 4QWBA 2YWEA 3MUVP 1X4FA 1YRUA 5SUHA 1VK3A 3WDOA 2IM0A 5J1EA 1R6YA 3JSMA 3M2VA 1VI7A 1X5OA 2R4FA 1SC6A 5D4PA 1CEZA 2A2DA 4N76A 3PNIA 4OZ5A 3KMSA 4F4YA 1U1QA 2BACA 2AF6A 3L7PA 3M30B 3Q24A 3HVTB 4NLYA 4QQBA 4YDXA 2LXUA