4OJHA

The crystal structure of truncated, y86e mutant of s. solfataricus acylphosphatase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
b'MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDESFSEYKGEFEDFETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
molecule tags Hydrolase
source organism Sulfolobus solfataricus
publication title Edge strand engineering prevents native-like aggregation in Sulfolobus solfataricus acylphosphatase.
pubmed doi rcsb
total genus 22
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ojhA00
2L3MA 2K1RB 2N4DA 1TR0A 3HHLD 4A47A 2EW9A 1X0PA 1N5SA 3FMBA 4Q2LA 1AFJA 3HHLC 1MWZA 2ZDOA 2GO8A 3QMQA 3VTIA 1IUJA 1JWWA 4FNHA 3HHLB 1P6TA 2BJDA 3BN7A 4Y2KA 1KVIA 3E8OA 2FIUA 2RU9A 1Q8BA 2GA7A 2W4PA 3CJKB 5IXUA 1CC8A 1KVJA 1MWYA 2CRLA 1YG0A 3KKFA 3UDCA 1APSA 2FTRA 3TRGA 2XMJA 2OD6A 2W4CA 1U7LA 1P8GA 3DXSX 1CPZA 2XMVA 3BB5A 2JDJA 2ROGA 2N7YA 1Q8LA 2XMMA 1LQ9A 4A46A 2OD4A 2OMOA 5K9FA 5T7LB 2VH7A 1Y3JA 2KT2A 3LO3A 4A4JA 1GXUA 2Q3PA 1TL4A 2BBEA 2LDIA 1YRXA 3BF4A 4A48A 1ULRA 2IYGA 2PD1A 3LGMA 1JK9B 3QGPA 1R6YA 1Y0HA 2KT3A 2ROEA 2GFFA 3HX9A 2RSQA 3I9ZA 2BYCA 1OQ3A 2QIFA 3HHLA 1OSDA 2ZDPA 2HQIA 4OJGA 2HLUA 5KAKA 3MZIA 1TL5A 1SB6A 3F44A 4DL0C 1W2IA 2RILA 4ZA1A 5A6WA 1WD6A 2XMWA 4NL5A 5B0BA 2AP6A 1N5VA 1X8DA 2GV1A 2GGPA 2KKHA 3IWXA 1VQYA 2HFNA 1XBWA 1YJVA 5F0UA 1X7VA 4YDXA 3TOQA 3IWLA 3HFKA 2LQ9A 2KYZA 1Y9OA 2AW0A 4HI2A 2K7KA 1N5TA 5A6PA 3FGVA 2OFGX 2G9OA 2ROPA 4EFAC 5B0EA 4Y2MA 4YEAA 1AFIA 2XMKA 1TUVA 2OP5A 1SQEA 4OIXA 3LGNA 2AJ0A 5T7LA 2BJEA 2GCFA 1FESA 2VV5A 4Y2IA 5B09A 1FE4A 1K0VA 4HL9A 1Q53A 2LXFA 2N4CA 1URRA 1YJTA 4HH0A 2HIQA 2QLWA 4U9RA 4QOTA 2GGPB 5B0DA 4OJ3A 1Y3KA 2FB0A 5B0GA 4NPOA 1FVQA 1FE0A 3T9NA 1OPZA 4OJ1A 3MCSA 1V3ZA 2HFOA 2AJ1A 3BM7A 3FRYA 4HH1A 3CJKA 2QLXA 2IYIA 2K2PA 3K7RA 2FHMA 1FEEA 3WDOA 4ZOSA 3HDSA 2RMLA 2LQBA 5B0AA 2XMTA 4DPOA 5B0CA 2IFXA 3DCAA 1SI9A 1CC7A 3BGUA 3GZ7A 1YJUA 2XMUA 3HF5A 2K7JA 1S6UA 3BR8A 5B0FA 3TNVA 2K1RA 1N5QA 2ACYA 4OJHA 1FVSA 2HLTA 1QUPA 2OAUA 4F67A 4HI1A 1YJRA 5B08A 1OQ6A 1Q4RA 1GXTA 2PGCA 4FNIA 1FD8A 4DN9A 2W4DA 4Q2MA 3KG1A 1KQKA 1TZ0A 3BDEA 1VQSA 2OFHX 1S6OA 2OKQA 2QYCA 1AW0A 2BUNA 5F0WA 3KNGA 2ASYA 1RJJA 3KG0A
chains in the Genus database with same CATH superfamily
4V19J 3PIPQ 1HBNB 1NK5A 1RISA 2A6MA 1FERA 4KE5A 2J0SD 2D3ZA 3FMBA 3V6DA 2JWNA 2RF2B 3RBXA 5DM6Q 1LKZA 2B43A 3IR6B 3PJWA 3MECA 4H4MA 4IH5A 5HVFA 4DV7F 2ZZNA 2XEXA 2BE9B 3CE8A 2XLKA 4QCLA 1UVKA 2UUAJ 5GAGU 2VJVA 2MJNA 2HHQA 3AOBA 5B7WA 3UCGA 4CO0A 4DQPA 2NXJA 1FA0A 2ZWOA 3QBCA 4DF4A 4K8RA 1BE4A 2GAGC 4NOHA 1X4DA 1K47A 2GJFA 3DHXA 3R5BA 1ZA2B 1JLGA 2B0GA 1QAIA 3OTOF 4NX9A 3G8QA 2WOMB 3I5CA 2HZCA 5FDLB 2K3IA 5KT4A 2J8AA 5BR8J 2XQCA 2R2TA 1ZTWA 2ZH1A 2ZOMA 2FY8A 5KFMA 4YHHF 2IRUA 3TA2A 3GFXA 4TLQA 3VGVA 4CH1A 4K4UA 4PG8A 3M8QB 3VAIA 3KJFB 2OH2A 4GKKF 3P6YC 4X4PA 4LJMA 1OPIA 3H20A 1TL3A 2FHKA 3CJ4A 3IGNA 3PEHA 3RRKA 2VPWB 2H1YA 2VQEF 4RU2A 2LEAA 3K5NA 2QGFB 2M0GB 3CCQS 3AAWB 5D0GA 4RU9A 1F2GA 3CCRS 2RILA 3HZEA 5IQ6A 1RUSA 5KFZA 1TUGB 2DEIA 1D9DA 2AP6A 4Y2AA 4ZCIA 5K8OA 3SSSA 4PXCA 4BLGA 4A8KA 2FPHX 4JV1A 4K0KF 1UVNA 4OV1A 2Z8QA 4LRCA 5IC6B 5A8KB 4X66J 3ZC4A 2H4YB 4HDHA 4Y6IA 3GV8B 1Q8KA 3TR5A 3CDWA 5ETMA 1XNRF 3K8WA 1J5OB 3DN9A 1VC6A 3M8SA 1NJYA 4CLUA 1H2VZ 1TL1A 3SQOP 4ED3A 4ETXA 3IS9A 5T7LA 3N4WA 5L38A 1FK9B 1UWAA 3JSRA 4O4GA 1ZTTA 3MMAA 4LFBJ 4X4UA 3G8SA 1HNVB 4FKXA 4KAIA 1SKSA 5EN1A 4NLSA 2V6AA 3NEKA 2FQQB 2WK4A 3KK3A 4IOCQ 1CJKA 4DL3A 4JI6F 3RB6A 3ISZA 2DY1A 4OZNA 1V9OA 1ITPA 2PN6A 3LOUA 2A1BA 1PJ7A 2LLZA 3BPDA 2F8EX 2CJXB 3DOKB 2QL7B 1V3ZA 3OTDA 4I0WA 2YKMA 1OJ4A 3MPUB 1TKZB 2JVRA 3HFVA 4RBVA 2V4JA 3NL0A 3GFYA 3DRYA 1TK5A 1KP6A 3WDOA 4YOEA 2VHGA 2H4WB 3M2UB 4ES2A 2R7WA 4PABA 5E7OB 1CC7A 4DPUA 4DFKA 1WG4A 3W63A 4NLGA 3T3FA 2V4RA 1NPPA 2AEFA 1X5TA 2HLTA 2I6WA 4RUAA 2GZOA 3TJ9A 2Q6CA 3ZO7A 1CS4B 1YBAA 3D1OA 4NRUA 2BV3A 1KWMA 1WJ9A 1KQFB 1HBUB 1XR7A 2DNRA 4DJBA 1WWHA 4R0EA 9RUBA 4ED8A 1VJWA 3DU5A 3CC7S 1U0HB 2O01C 3LANA 3MMCA 2QYCA 2YVSA 1SL1A 4D3HA 1H0HB 3D7SB 2G13A 2YQ0A 1U1PA 1M5VC 2HHTA 2CQDA 1TKTA 2KM8C 1S7HA 3CO9A 1EQMA 1D09B 2K1RB 3IBCB 4I1TA 3ZXWA 5GMKa 5J2QB 1NZ8A 2HHXA 1ACMB 2I5JA 3PCOB 4DCOB 5HN0A 4X4QA 1R0AA 3UN2A 1R8HA 4C3LA 1KLNA 1CEZA 4JI5F 3OR1A 2B6AA 2EFPA 4HTJA 3HHLC 2YKOA 3K2YA 3IFEA 3G87A 3W5XA 1B70B 2MZ1A 5AJ3F 1EZZB 1JLQA 3ILIA 3IR5B 1KRPA 3C46A 1XK8A 4ZVHA 2CQ3A 2E66A 5DDOC 2WBRA 3PJ9A 4RW4A 1VQPS 3E01A 3MGJA 3GJQB 2R9LA 4OYAA 3H5YA 2LECA 2JOQA 3M8PA 1F5CA 3VQSA 5THWA 1IVZA 4FZVA 2IVFB 4NEYA 4JI4J 4DCPB 2B5JA 3NRBA 5K14B 2MKKA 1Z4UA 2QA1A 5D77A 4O3QA 3H7HB 2OD4A 6FD1A 3KLGA 1XJWB 3K57A 3DXBA 3K0JA 5H9FK 1GXUA 2N7CA 1TMMA 2BBEA 3E01B 1CG2A 2BVZA 2JH3A 2XBPA 4P52A 8RUCA 3C3LA 5CD4A 3QIPB 1ULRA 2PI4A 2KJVA 3PHTA 1LK5A 1Q5VA 1W26A 4B9SA 3QJLA 3QWUA 3I9ZA 3K8VA 3P45B 4CTAB 3JYTB 2AYMA 2J0WA 4WBFA 2XGPA 3PW0A 3PYGA 1EP4A 2BEFA 2FHJD 1BQMA 4O0NA 4U6PA 2EKYA 3D6MB 2IRYA 3DOMB 3OR1B 5F8GA 3US5A 4QWEA 3D2WA 1BD6A 1R8BA 2DNPA 3V81A 2JJ4D 2VASA 3N79A 1JJ4A 4FXDA 2LEPA 1RK8A 3HJVA 4KO0A 3SI8A 4PUOA 2CNOB 4DFMA 1U1KA 3DOMA 1JLEB 1FKAF 1UEKA 4WFNQ 3A3OB 5E33A 1Y9OA 4J9SA 2WHOA 4CLKA 2GMJA 3OL6A 2AX0A 2HS4A 4FKYA 4DV5F 4IYQA 4FF4A 2G9OA 2XCAA 3KHHA 2UUWA 2AIRB 2N3LA 2V63A 4Y2MA 3OFFA 4Y00A 1RT5A 5K8PA 3EX7B 2W9CB 4P7TA 2D3OR 3HM9A 2FVCA 1APSA 2DY9A 3CGIA 4OI2A 3KLGB 1HBMB 3M6UA 2B5JB 3WIUA 1WKJA 1Q0NA 3MUVP 1Q53A 1VYAA 2DT9A 2DXEA 5B0DA 3ENQA 1WI6A 2FVPA 4QIVA 4DG1A 5D78A 2ZC4A 1JMTA 1RWWB 4R5PA 4RNMA 4F0HA 4DUYF 2OEMA 3DOLA 2BANB 4JYAF 1RYSA 4JI3F 2AZ1A 1LFWA 1JLQB 3AB4B 2DHXA 3IWNC 4CO2A 1TK8A 1FKOB 1BQNA 1KOHA 1RT7B 2WSCC 2EG1A 3GU0A 3V4IB 1MNEA 4WFZA 4DSFA 1QM9A 3KK3B 2FJDB 4DPOA 1UZDA 3JQJA 4K7QA 4F4KA 2QMWA 5J1NA 4LFCF 1KOOA 2COLA 1SI9A 3GZ7A 2J76E 3EGWB 3HF5A 2V68A 3MF5A 2EI5A 4MH8A 5LMNF 1VBYA 2JEFA 5ETNA 5CXTA 3BGOP 4O4GB 2K1RA 3OT9A 4OX6A 2EK6A 2HNZB 2YPZA 4NMLA 2DH7A 3QT5A 4OJHA 2ZHOA 3EVOA 4QR0A 4O3PA 3OQ2A 2ZOGA 2VQEJ 4FS1A 3L7PA 5AXMA 3CCUS 2I8EA 2Q6BA 4F3OA 4YR0A 4JI1J 2WSFC 4USHA 2B9WA 4EMDA 1VC0A 5H9EK 4LFAJ 4G1PA 3TA1A 1NSPA 2ZITA 1B64A 1S6OA 2KJWA 3FSYA 2LFVA 4WFXA 1HNZF 2LVWA 5HQLA 4AQYF 1L3SA 3L3CA 1K8AT 1C1CA 2XTJP 2KXNB 1WNEA 4H4OA 3MTKA 3O8WA 4HT5A 1NSAA 3DRSB 4LF6F 3ZNJ1 2JSXA 4N8OA 3RBEA 2WW8A 3M2VB 4AE5A 4WU2A 5DZ6A 1TTHB 4BHQA 5L8RC 3NG8A 3UW1A 3EGNA 1BWVA 3J81Y 1U6FA 1BHNA 1C0TA 4I7FA 5G0RB 2BJDA 4WK1A 4WP3A 3UQSA 3V2UC 4YMEA 1CLFA 2HWHA 3MCOA 1R6VA 3BBFA 1NJWA 2A10A 4DPTA 5IXUA 5LXYA 3BJYA 4IQXA 4YY3F 3M8QA 1Q81T 2CPFA 3PR5B 1RP5A 4ECYA 1RWUA 1Y5NB 3QRQA 4ZLNA 1VBZA 1CJKB 4U67Q 4P72A 3I56S 1S1WA 2DVIA 3C15A 2XHCA 1CVJA 1EETA 3CCMS 3AH6A 5A0YA 5KG2A 1RHKB 2P8IA 3DU6A 3WX8A 2DNLA 2IA6A 1AZSB 2QSWA 2RQ4A 2WONB 3DLJA 2PMZD 4GMKA 4YS2A 5L1IA 4FYWB 5AE1A 5DGAA 2EK1A 1G2EA 1MMLA 3ET6B 2PT0A 3A8KA 3LALA 4QIGA 4ZVEA 5KFOA 2DNOA 1FWLA 2QLJB 2QX0A 1S1TB 1S1UA 1WOSA 2DYAA 3CIMA 3MM8A 1B4SA 2DCLA 1YBTA 2H48B 2QJ3A 4FN5A 4UF4A 3HX9A 5KFXA 4CP5A 3J7YU 4DF8A 1D1UA 2ABYA 1TQLA 1S6QA 2V34A 5A8KA 4OJGA 1HD1A 4U8YA 1JJCB 2CPJA 2JFDA 4DFPA 4ZA1A 2CJBA 1WC6A 2LQ5A 7AT1B 2D41A 2HAFA 2Z2MA 3HLUA 4EWTA 3DNCA 2KZZA 1U09A 3RR7A 1R8AA 3GV7B 2PE8A 1RWNB 1F3FA 1E6VA 4K59A 4DPYA 4ALZA 3QQCD 1LWFB 3CPWR 4YDXA 3TOQA 5I3UA 1GMUA 5HROB 4ATNA 3GQCA 5J1PA 2AW0A 2PDAA 3GFHA 3C2PA 3CD6S 4EZ6A 5AE3A 1RCOB 1RQ0A 2ROPA 1N48A 1FJGJ 3SCKE 4ED4A 4LF9J 1UL3A 3S6EA 1QLNA 1VISA 1LW2A 5D3GA 1B7FA 3PYFA 4M5HA 3TZWA 1KQGB 3N5BA 3T41A 1YJTA 2B56A 1PJ5A 1Z2ZA 1RT1A 3CCWA 5C24A 4P73A 2ASJA 4NYPA 1I94J 2ZKUA 3O1LA 2ZE2A 1VMBA 3LP1B 1DTQB 4A8FA 4UY85 5GVQA 4H54A 4KTQA 1BUXA 4B3MJ 1HQUA 3OBIA 5KFUA 4MFBB 3V6JA 4OI4A 2HVDA 1L3TA 4ZVSB 2WBMA 5IFMA 4ZJQA 2E9ZA 2AGOA 4I69A 4OYXA 3T9ZA 5CYQB 2VDIA 1Y4ZB 4LR9A 4U8VA 1FFWB 2M52A 5B0CA 2YWGA 3EZ5A 2MQQA 4ZN3A 5HANA 2G0JA 3I55S 2NREA 2V9WA 5DJBA 1S6UA 2OSRA 4RNOA 3LWLA 4UUWA 4CO3A 4N56A 4GVBA 3VGTA 5GAHU 2PGCA 2AGPA 2L9WA 3BZQA 4LSLB 2A2DA 2ZD1B 2EFNA 2W2MP 3G6ES 2MGZB 3NMRA 3M6XA 1EX8A 3MM6B 4QIFA 4X65F 4B9VA 4ZIWA 4LF5J 4PYAA 3MR3A 1Q8IA 2M7SA 2MSTA 5CYMA 5AJ3J 1NB7A 1OSCA 1GNKA 3GR1A 4UZBA 1LV5A 2OJ3A 4B9TA 5EGYA 3DLGB 1T05A 3PO5A 3GFZA 3O44A 3R3TA 1NSQA 3AT1B 4KPCA 3NNCA 4FBTA 1RTJB 2WTFA 3CB4A 4KPYA 3ZZTA 2ZDOA 1TAQA 3DDKA 1GX5A 2HRYA 1HA1A 2GIQA 2RHSB 1U2FA 2Z4PA 1PC4A 4K5RA 1RTDB 2V94A 1H98A 2AYBA 1SC3B 1RI7A 3T6JA 4LR8A 4F7VA 2CPHA 1SXLA 2EXUA 2ZD1A 4PKDB 1JNRB 4LSLA 3PZPA 3HHNB 1HQEA 1T0TV 1X4BA 4EGLA 5F3ZA 3H5SA 3L4BC 1KKHA 4I4BA 1XMOJ 2VOPA 2J6TA 1HI8A 3MMBB 2IBKA 3G86A 3FZ2A 4LVNP 5K5MA 4L72B 5K9FA 1FXDA 2VH7A 4DI6A 2JNJA 2BA9A 3HMJG 3W1YC 4JI0J 5IOLA 2C22A 1RLCL 2ZUAA 1YRXA 2EBGA 4DMZA 4JBCA 1NK7A 2ZC3A 1HD0A 2HGLA 3R7NB 3UR0A 1Y0HA 5HP1B 2HYIB 4OYMA 1YK9A 4PYDA 3BN4A 1S6PA 4RNFA 5JUMA 1RYRA 1NB2A 2MY7A 3HHLA 2ZDPA 2UP1A 4Y3CA 2KFYA 5KFWA 3BS9A 2OPRB 3D3CJ 2DITA 3G96A 3VZHA 3OD2A 1NDLA 3QIDA 3SCJE 1S5ZA 4ETZA 2P9EA 2QYGA 2YY3A 2GGPA 2V2KA 3QT7A 4F25A 3HP6A 3IN5A 1UKUA 4IFYA 4NXMF 3MM7A 3FSXA 3GJSB 2K7KA 2UU9F 2GVZB 4OL8A 3CCJS 3AY0A 2XY5A 3IGVA 3KLFA 4JI8F 3LAKA 4DL5A 1T9UA 5HROA 5LMNJ 3N5FA 5L1LA 1FNMA 2M5YA 4FYXB 2X1AA 3RBDA 2C28A 2KDOA 4IG0B 4JP8A 2K8GA 5HJYA 3RB4A 1QD1A 4W92B 4EO6A 2CQ2A 4OLOA 2V50A 3VGSA 3Q8UA 2WAQD 4QQBA 4BBYA 4A8MP 3L95X 2AU0A 1XQIA 1AUDA 4LF1A 1FRIA 3RUBL 1X5PA 4AL5A 2FHJA 4DLEA 3K5MA 4EEYA 4OX9F 2FDNA 1JX4A 1MLAA 2BJ7A 4C8MA 3W61A 1NRKA 1S12A 4ZCLA 2JEJA 1IJEB 5H9FJ 4DV2J 2XCPA 4NLPA 2CG4A 3M32A 2VOOA 1FEEA 2DRDA 2YH1A 4DU8A 3GLJA 4DZ6A 2Y1RI 2MZQA 1NJXA 5B0AA 1ZA1B 1X4FA 3DCAA 1T02A 1WF0A 2GC8A 2VG7B 1X4GA 4XPCA 2IM0A 1YJNS 4NI2B 2ASDA 3IG1B 2PEBA 1OMSA 3CW2C 1GK8A 1U8SA 3NOGA 3H4DA 4JI0F 3ISNC 2MKCA 2FYXA 5D6GA 3WC2A 3AODA 1RKJA 3BH6B 1S1WB 1KVKA 4KJIA 2LA6A 4CO4A 2E1PA 3IP0A 4C0OC 4DN9A 1RT4B 2W7OA 2OEJA 3KG1A 3T1YJ 5GMDA 2AJFE 3A3NB 4ZPDA 2L08A 5LOQA 2BUNA 2CQ0A 3ZTOA 4DLGA 2N3OA 2R2RA 1RABB 2CJYB 1TUWA 2E7WA 4M5GA 4OZ5A 4USKA 4DFJA 3BO3A 4NLQA 5HQMA 2UUTA 3D68A 2L9NA 1F9EB 2WZ1A 1K44A 3LP2B 3M2VA 2HG4A 3PRVA 3TZZA 5IM0B 3DRSA 3MR5A 2EW9A 7FD1A 1IBMJ 3M30B 4XDDA 1WOPA 3WX4A 1A6LA 1RAHB 3KK2B 1U47A 4RL1A 1NK0A 3GIRA 2QO3A 2OPSA 1YZ6A 3HULA 4IQMA 2VIHA 1IKVA 1FX2A 4NLUA 4EO8A 1C1BA 2PA8D 4DV1J 4W4MA 4UOFA 3H98A 2G1HA 2J9EA 2UV8G 2VFTA 3D0IE 5E3RA 3J80Y 2XMJA 3FBCA 1WSVA 1M5SA 1EKRA 3EGVA 3TA0A 1U7LA 4F3QA 2RS8A 3M8WA 1KBRA 4M5MA 3HSZA 1EQ0A 4C8ZA 2MKYA 4MIWA 1VQNS 3OJSA 5KT7A 3C19A 3T5LA 4WE1A 4GKJF 3TAPA 1D8ZA 1NH8A 2GMHA 3GONA 4J5OA 3CCLS 1XMQJ 3KK1A 3QAUA 1CSJA 1WHYA 2FUG9 3CD0A 3BKUA 4CH0S 2PD1A 2F4VJ 5KG5A 2ACMA 4RW6B 3V4IA 4X62J 3LTOA 5GMEA 4C6AA 4E8UA 1ZZNA 2NQPA 1C1BB 1FHTA 2RSQA 1BQNB 2BYCA 3LAMA 2E5HA 2QIFA 5LXRA 4ED5A 2J0QD 1T11A 2GQCA 1KONA 1N4LA 1GQEA 1RTIB 1IQZA 1J2VA 3CJQA 3S1TA 2J7WA 3LW5C 1LWXA 1RAFB 4WK3A 3GG1A 3TX8A 5L1KA 2GV1A 3M2RB 4LMZA 3TUIC 1RLDA 3QRRA 3V4MA 3Q2SC 4ZLJA 1LFPA 1F6TA 5I42B 3RU0A 5KFEA 3OV7A 2JEGA 4B3RF 2Y9HA 4PRFA 2OO4A 1WG1A 5MAOA 4BCAA 1NKCA 2J7KA 2I9SA 2JX2A 2CYYA 4P7VA 1RT2B 5T14A 4X66F 3NP5A 4GC6A 1QJHA 2XLJA 4PR6A 1M90T 4EBDA 1ZAWA 3FFIB 1R8CA 1JJ2R 4OHZA 1JLCB 1VDHA 3G82A 2WVBA 5GADI 3QFHA 4YEAA 5E3AA 4AXIA 4Q45A 2ZKTA 1AFIA 4DV3J 4XDCA 5EX0A 3MEEA 3C14B 1GAOA 3EICA 4NCGB 2GCFA 1VQ9S 4LFBF 2QSFA 3JQKA 2BJ8A 5I42A 2ZFHA 4B3TJ 2W2NP 4IR1A 1PCAA 3MEEB 4YR3A 3EVWA 4CIOA 2ZH8A 1FWPA 2GHVC 3M1VB 4IRKA 4IUFA 1U25A 2RNEA 2P6SA 3H40A 3RTVA 4DUZF 1FVQA 2CJAA 3W2WB 1FE0A 1B7YB 3T9NA 2F4VF 2VODA 3HJFA 2D69A 2G4BA 1T9XA 4CM0A 4CTAA 3HHEA 3PFOA 5M2PA 5KOXA 5FJ4A 2J6UA 2C3PA 2HBRB 1BGXT 2KN4A 3SMZA 3U1LA 1N32J 2BJ9A 4K2JA 4TN2A 4YDDB 1FRMA 1P1LA 4FS2A 3AFGA 4J9MA 1YJUA 1SJQA 3AD9C 2K7JA 3GP9A 1DY3A 3KXDA 2MQOA 2C2DA 2UVRA 3HK2A 3PIOQ 4L73A 4DSKA 2OAUA 3QATA 1X9SA 4IH7A 2VC1A 3M8PB 4N47A 3KLFB 2ZJPQ 1Q4RA 3PKYA 1UVMA 2C2OB 2GHWA 4TQSA 4B9NA 2KU7A 2B3TB 4Q2MA 5G4DA 4PWDB 3MWBA 4I56A 3ZZYA 5KFVA 1BXNA 4MIBA 3E3XA 3MM7B 2YWHA 5J1EA 3HD1A 4E98A 1OS5A 3GYXB 3CDAA 5JJBA 5BR8F 4BS2A 3I31A 2HIYA 2L3MA 3BGRA 4J7CA 4RJVA 1VBKA 2UXBJ 3C8YA 1HBOB 5C2GA 4DQQA 1JLAA 3K59A 1HW9A 4G6VB 2QTWA 3H2VE 2D74B 2IVMA 3UR3C 1FRHA 2OPQB 1SCJB 1Q7YT 4X4OA 2UUAF 5ETVA 3ILOA 4KC5A 5LMUF 1ZETA 4Y2KA 1SJ3P 5KFAA 1KVIA 2VONA 1UWBB 4DUZJ 3W64A 3LH2S 4Q0BA 1U0HA 2F9JA 1G3OA 3M9MB 1XMBA 3HCXA 5CCMA 3KK2A 2AEJA 4LUBA 3QJPA 4OI0A 2XSFA 4JI1F 1UFKA 2JEIA 2RUGA 2DCUB 4MMOA 2MSSA 4QYZK 2YKQA 2VUGA 1TV6B 2KYXA 4PXBA 4QW8A 2V67A 4K4SA 4TU7A 5EWFA 2DGWA 3FDSA 4Q5VA 1SIWB 2A6OA 1GTHA 3VGUA 3A3PB 3G71S 4A4JA 1BMQB 2QE5A 2I2YA 2YTCA 2J9DE 4PWUA 3CCES 2AD9A 4JI5J 1WUUA 2XB2D 1IBKJ 4Q43A 4JI2J 3GWCA 1XC9A 2QRRA 2GHPA 5KT2A 1RAGB 4DQSA 1TKZA 1N56A 1FJEB 3CJ2A 1WC5A 3J7ZT 2MKHA 3W3SA 4ZCMA 4ED0A 1RTDA 3H4BA 2LDYA 3DRXA 2PO4A 1TL5A 1YRTA 1OY9A 2IC3B 3GTYX 2CQPA 3MZIA 4G65A 4RBTA 1WD6A 2DR6A 3FVYA 4P75A 2QC3A 4ZIVA 1T3OA 2B7CB 5BXIA 4RNNA 2FZKB 4DR5J 1UVIA 4NZ0A 5DLFA 2UXCJ 4C11A 3IWXA 1HNVA 3MD3A 4R8UA 5ETKA 3KFWX 1KC8T 2B8QA 3P3DA 5CAAA 4U7CA 2B51A 4N76A 1C4CA 1EJ7L 1XR5A 9ATCB 2V8HA 4Z2XA 4NXNF 2K06A 2E44A 2KO1A 1FD2A 5CCLA 1I94F 1ZM4A 2E5JA 3DLKA 1S48A 1VQ6S 2OFGX 5C42B 1M5OC 4M5NA 1HWIA 4QZVB 4ELUA 3BO2A 3QGIA 3CSKA 3GJTB 2EFVA 5BYQA 4BC7A 4JV5J 2W9BB 3BKFA 4OZ3A 2MZRA 2O3DA 1SJFA 1I3OB 3AJ2A 2Q66A 1K9MT 1U4BA 1MN7A 2BM0A 1KFSA 2DNNA 2QFJA 2YQ1A 1SQGA 2HIQA 1V3SA 4HH0A 4QOTA 4URQU 5E5NA 3UN5A 5RUBA 2O67A 3D3BJ 5CYQA 1IM6A 5SUHA 4QIEA 4USIA 3R8YA 2F8HA 4XPEA 2IY5B 4ECVA 3PV8A 1AB8A 2DGOA 3PJXA 2NR0A 1SVDA 1WDTA 4AFFA 5I3QA 4M1KA 1HFEL 2U1AA 1VQKS 3ZZOA 4HACA 1P9YA 3D5MA 3HDSA 3G2XA 2FLLA 3TVZA 3JB9k 1NHKL 2IJNA 3Q24A 2MB0B 4HVZA 2YKNB 2B9XA 2HNYA 5BJRA 1ROFA 1TVRB 1UPMB 4LF9F 3BPSP 4DV4J 1JLBA 1J27A 1NKBA 1CJVA 1FVSA 1VRQC 1FFSB 4B08A 4EBEA 1ZZFA 3R7BB 4DR7F 2JC0A 4NE9C 2VBXA 1WEXA 3TEHB 4KQZA 1DBDA 4OYPA 3GIMA 1U2CA 1VRTA 1NO8A 4YQWA 4ES1A 4KIAA 4LF8F 3SCLE 4J37A 2M2BA 3DRPA 2X51A 4LSNA 4WTOB 1SQFA 3PDNA 1LWFA 1RJJA 5IT4A 4X64F 2VQFF 3BDPA 2DEJA 1FDBA 4RPFA 3MMBA 1E6VB 1AROP 3MAHA 1MN9A 2RF2A 2NUUG 3PVXA 4ZK7M 1RWKB 3KDNA 2NCKL 4OZ1A 4A47A 3KUGA 4WIQA 3OL8A 1ZM9A 2Z2YB 1X0PA 4HLBA 1XIQA 4CZCA 4USVA 5DDQC 1SC4B 4QW9A 2DR8A 1MWZA 2EPIA 3FJ2A 1RBAA 2DD8S 3I0SA 1PIEA 5A8WB 5AXKA 4LSNB 1TFYA 2E1AA 1WF2A 2W4PA 2A18A 2GJ2A 2YNFA 2ZH4A 2HHVA 3LP0B 4PG4A 4EYHB 5F8NA 4E0DA 1PSDA 3VVUA 3BSNA 2OD6A 5DM7Q 4OLPA 2C42A 2M9KA 2Y1JA 2BDPA 1RTHA 3AD7C 3AXMA 1GFWB 3DXSX 3GSIA 3NGKA 5HLFB 2XG8A 4ZDNA 4C8YA 5M2RA 3HD2A 2LEBA 3E51A 4KSEB 4ZN1A 3WZ0A 1ZPWX 1EETB 1KLMB 2R8KA 1HLWA 2CPEA 4A48A 2Z30B 4P9SA 1S79A 1SH0A 3AQPA 4OV6A 4ZPAA 4ECSA 3F56A 3DLHA 4A8SA 3LPYA 1KD1T 3KNAA 2ZUGA 5G0RA 1OSDA 4P2XA 1W2BR 2QA4S 4F8RA 4HYKA 1FCAA 1UVLA 3TZXA 5A6WA 2F63A 2M8DB 3R5JB 5B0BA 2UUCJ 2YPYA 2H5JB 4CLLA 3I5BA 4F3MA 2P2CB 2RH3A 3W9JA 5LSRA 4N77A 4RBUA 5ETRA 5DDRC 1ZH5A 1QY7A 2V0NA 1DAXA 3RGIA 5DO2A 1LWCB 2I38A 3HFZB 2FJXA 3FBFA 1L3KA 1N5YB 2ZZTA 3R9LA 3H90A 4ZVUB 1DRZA 2FC8A 2HVHA 2KYZA 4FYVB 4CLYA 1I1GA 1Q78A 5A6PA 3QT6A 4O4RA 5CQGA 3A12A 2QMXA 4LRBA 1LK7A 2NLWA 1FI4A 4DQRA 3D1QA 2XMKA 1FT8A 4YUDA 1RT3B 1SL0A 4KGMA 1BQXA 1KLMA 4HT7A 5E3QA 5ETTA 3KJVB 4ZVRB 3QLHA 2HBZB 2IVYA 4L3NA 1QAXA 2G1DA 4R8UB 2LXIA 5KFKA 5HLFA 1D0EA 1PC5A 4ELVA 2VA2A 3J7A1 2W8LA 3ETMA 5CZXA 3P5TL 1P27B 4F4YA 1X4EA 5ITHA 2IC3A 1SKUB 2F9DA 1RWPB 3ZFVA 4J9QA 4DPXA 4M5LA 2CWKA 1Y7PA 5LSLA 3NOCA 4YFUA 2GAHC 3BM7A 2E1CA 5IV3A 2KL8A 2QLXA 3RRHA 4Y34A 3SQGA 2DRAA 1CJTB 2CG8A 2BANA 4DR5F 1NH7A 2ZBQA 4WFBQ 2UU9J 3TVKA 1FRJA 3R2DJ 4YP3A 1Y5IB 4FPIA 1VRUB 4LQ9A 4DS5A 1T3NA 1NZAA 1U24A 3MAAA 3G4SS 2DNHA 5KFJA 5L46A 2BJ1A 2W7AA 3BKTA 4PQUB 3FEYB 2ACYA 2IJRA 2J5AA 4CNZA 2B8PA 2WB1D 3HVAA 1S6QB 4F67A 2DGQA 2ZM6F 4LRAA 3NNAA 1KS2A 1RWMB 4I6AA 2DO4A 1VQ4S 3K5LA 2FJBB 2ZBIA 1QE1A 3RAMA 3JSMA 3BDEA 4DR2J 3ET6A 4LBIA 1UJ5A 3VV2B 5GADU 3VAMA 1U2RA 1JLEA 2G0CA 3TO8A 3HPOA 1REVA 1X4HA 1KHWA 3R5CA 4J9RA 2KT5A 2EFGA 1Q16B 1U1OA 5HQ8A 1FRKA 4H4KC 3F0NA 3IBFB 4ECRA 2HNYB 1RBLA 1RHRB 2C3OA 4F02A 1AYEA 3LA0A 3KMQA 2VBYA 3U1NA 3VTIA 3JTPA 4UQTA 1KQSR 3CXCR 4OI3A 4DSLA 2DHAA 4K5SA 4TQRA 1CULA 2HFSA 5ETQA 1BY9A 1S99A 4F50A 2AYGA 3QFWA 1WG5A 1QTNB 3QIPA 2KB2A 2V9KA 3OW2R 1SC6A 2PEHA 2F4FA 3BQ1A 2VPXB 2W4CA 1P8GA 2HQFA 2POKA 3FUYA 2H3EB 4TXSA 1X5SA 2XMVA 3VQTA 3MAQA 1XMOF 2C2KB 5K14A 5HL7Q 5IV4A 1SKRA 1S4FA 2ZZMA 2C3UA 3CD5A 3FBBA 1VCTA 3DKDA 1HNZJ 3FNNA 1ZAXA 2LDIA 4DCJB 4RW4B 4CT9A 3PW4A 5HBMB 4DR2F 1VS3A 4FYDA 1Y5LB 5FLXU 1GXLA 2GQ2A 2RRBA 3KWMA 4J9LA 2ZM6J 2KXHA 2GFFA 4X64J 4JV5F 4M5DA 3WC0A 3N01A 1U6BA 3SFGA 5D4LA 1GEHA 3D54A 4ZMMA 1TK0A 2MMYA 2WVDA 4A8QA 2HLUA 1HNWF 3W2WA 1ELOA 2O5DA 2RHQB 3N28A 2OTLS 2BJ3A 4ID5B 1HWLA 3SV3A 1U8WA 1LWEB 3BSCA 1BLUA 4P10A 2W7PA 3UCZP 2XMAA 3W65A 1VQYA 5AXLA 3PRBA 3NXZA 1G1XA 4M5JA 5F9NA 4WU3A 4CLWA 1RT7A 2LQ9A 3FBEA 2FZGB 4OI6A 4LFCJ 2JLEA 2E9RX 4J9PA 1JXEA 4OZ2A 4OYZA 4C0HA 3DOLB 1JLCA 2DK2A 2NPIA 2BXJA 3G82B 3ZZUA 1T8EA 1N34F 1N36F 1S76D 3BYRA 1XN9A 3DYAA 4JUZA 3Q8PB 3TEGA 1GX6A 1SQEA 2HGMA 2BABA 4OIXA 4JI2F 2AGQA 4DV3F 3FEZA 3R1LA 4QU7A 2HQ3A 3HKZD 2HHPA 5DRKA 1EKSA 3IBWA 3RZAA 2QLWA 1RT5B 2HPUA 2ZH9A 3M2UA 4WZQA 2C3MA 2RT3A 1HHQA 3GPAA 1U1MA 5HJXA 1S77D 5B0GA 4OX9J 4V1Ak 2V4JB 4G1QA 3M7VA 4GVLA 1KN6A 4USWA 4WWSA 5KFIA 1PBAA 2HFOA 2AJ1A 1Q79A 2R7XA 3VWSA 1GH8A 2IJFA 3N0VA 4QBUA 4RW6A 3SBMA 2R2SA 4ZCKA 4Y0FA 3CJRA 1ZS6A 3BGLA 3JTNA 2CWXA 2CDRB 3GB0A 2CNLB 1S0NA 5HVGA 2P9CA 3FSIA 1N0VC 5KG3A 3CIZA 3ISND 1U6ZA 4LF2A 2XO6A 2CDQA 2HKEA 4F04B 2HHHJ 2B9YA 1HBOA 4RUBA 4JI7J 4FXVA 2CVIA 3W8PA 1JLFB 1TL1B 4NASA 1VGYA 3JYTA 4GRSA 5J1EB 4FNIA 1QVFR 2KRBA 4M63A 1S72S 5EHHA 4I2QB 2CFXA 5T41A 2FY1A 2BE7D 1TZ0A 3H2UB 3PW5A 1VQSA 1J5OA 4PWDA 3VAJA 2OGUA 1FNXH 4ED2A 3BGFA 2HURA 2V8GA 1OY6A 2M8HA 3L7OA 5ETPA 2GO9A 4B02A 4OHVA 4ANDA 2OLWA 1VQMS 4WF9Q 2XY6A 3VVTA 1WF1A 1HPZB 5IWAF 1Y11A 4ZP6A 3UDLA 5J2MA 3KDOA 1XMQF 3I32A 1N5SA 3MOZA 4Z7YA 3I6PA 4WFAQ 1PYOB 2GO8A 3NWRA 1IR2A 3UPFA 4NRTA 1ZM2A 4OYOA 1JWWA 3FKBA 3J81U 4MIAA 2AJ2A 1TL3B 1CULB 3I9V9 2V4QA 4AQYJ 4KHPF 3MTJA 3PNIA 2CVEA 4AYBD 2R7TA 3MFHA 4NCAA 2LXUA 2YNGA 3W5YA 4DPWA 3H0PA 4RZRA 2FTRA 1RT4A 3OSNA 1VC5A 4LFAF 4OZLA 3M1VA 4I68A 5LL6d 1RHQB 4CT8A 3AJDA 3KYLA 4UUXA 3OVSA 3BYPA 1O5JA 4KKOB 3VZIA 1V5IB 3B78A 1REVB 1Q8LA 3MR2A 1K1SA 3NGDA 5AXNA 1UP1A 2Q3PA 5C7PA 3O3LA 4WTYA 4HTIA 2Z57B 2OMLA 3V5RA 1WKLA 3MMCB 2RQMA 4OQJA 3EGZA 4ECUA 1B99A 2ZH2A 3QJJA 1F60B 2LP4A 2HS0A 3MPVA 3FFIA 4ZLLA 1TKDA 1CS4A 3D6HB 3IMQJ 1O6XA 3DFEA 1OQ3A 3NS5A 2DH9A 2I0XA 5KFYA 4RUCA 1IKWA 1VQ5S 4U95A 4MK8A 2RE1A 2GS8A 5DS7A 1S9EB 1U49A 4P74A 3H59A 2YNIB 2QV6A 1TMJA 3EDRB 4KY3A 4QYRA 4JV0A 3Q89A 1YQHA 2NPFA 4NYZA 2BQRA 3I87A 4B9UA 2PSZA 4NEZA 2XZDB 3ONQA 1RAEB 4LF5F 1XBWA 1HBNA 4IG0A 4P2MA 4LF8J 2B4PA 2DB1A 3EJMA 2HHWA 1SH3A 1MWQA 1X7VA 1UEUA 3W8GA 1O8BA 3I82A 2MY8A 2YKMB 3BREA 3MR7A 3Q0AA 1NJZA 2OIHA 4K50A 2AV5A 3P96A 2W1BA 4O3OA 1N5TA 2X7IA 3M6WA 3KLEA 3W9HA 2FVRA 2DNKA 2MYFA 1HHSA 2E7XA 3G6XA 2KZMA 3TUZC 4AT1B 3TQ1A 4YB5A 2ZJQQ 4URSA 4AD6A 2ATLA 3RB3A 3I96A 3SYZA 2MZSA 4ZPWR 3SCIE 2AJ0A 4IFYB 1U26A 1X4CA 4LREA 4OYWA 4WE1B 2VL1A 2R2UA 3KJVA 4JI3J 2FVQA 2V2QA 4ID8A 5KG0A 5B09A 4X4NA 4DDFA 1DQAA 3IM8A 5SZTA 4XO0A 1PO6A 2GGPB 3FK4A 3J80U 3CMES 3A8EA 1IBCB 3SIPB 4M95A 1HQ2A 2C2EA 5K20B 4L75A 2NZ4A 1KTQA 2JC1A 2LKZA 5IS2A 2KVIA 3D67A 5KFTA 2HHSA 1AA1B 2EG2A 4LIRA 2FZCB 2U2FA 3KUHA 4FXWA 3CF5Q 2CQCA 3UVJA 2FHMA 1FFGB 1UCNA 3ADAC 3IAS9 2LQBA 2Y8WA 4KBIA 3CCSS 3M30A 2DGVA 3B8HA 1ZM3A 3OR2B 1EAYC 5IT0A 2NSCA 5J2PB 5IM0A 4CLSA 7FDRA 2Y1LB 2LQJA 1TKXB 3ZTRA 5ETOA 3PYEA 4DL2A 4JI4F 1WC1A 1VK3A 4LQ3A 4ZLPA 3CMQA 3HKWA 3M05A 2XULA 1PAEX 5U47A 3GE9A 4XIUA 1SUQA 1FD8A 1Y10A 4ZVTB 4GO5X 1BC6A 2CAJA 1IBLF 3EUNA 4MT1A 4EZ9A 1WELA 4C0BA 5C25B 2FGCA 4GC7A 3NAIA 2JDJA 4O3SA 4DV6J 5BYRA 3OSPA 1L5UA 5KFBA 3RB0A 3TZYA 2HBQB 3TAMB 2A2CA 4DR3J 4IG3A 4O44A 3ZZZA 1RTHB 1XERA 4ECQA 4ZJOA 5KFGA 3T6BA 1U1QA 1B0TA 2XHWA 3PHEA 4ICLB 4DR6J 2DNMA 3ULHA 2XGQA 3DHWC 4NA2A 3E2EA 3BV8A 1DTTA 1WACA 1RE1B 2YNFB 2QL5B 3CJ0A 1GTEA 2OELA 2NXCA 5D0EA 4UTGA 1FRLA 4CO1A 2MTLA 4WP8A 3MPDA 3D66A 3MECB 4LSZB 2HWIA 2Y0SD 5L39A 3TRGA 1VLOA 3V6DB 4IFVA 4MKYA 1FDDA 1HNIB 2IRXA 2X1GA 3A1YG 4C3MA 1S57A 4IRDA 4K4ZA 3M8YA 3BB5A 4ZPCA 2ROGA 2DIVA 2MXYA 2YQ3A 4PXDA 2OPPB 2AKWB 2KT2A 1NHVA 1Q95G 1HNIA 4F0KA 1NK4A 1IBLJ 4WFYA 1T9TA 4USUA 2QG9B 3J7YI 2BE2A 1QDUB 4G3IA 2CPDA 1H7WA 3NCRA 2OUGA 4MFBA 1C0UB 1HQUB 2DR9A 4NXMJ 2RB7A 4JI7F 1CJVB 2Q79A 1JLBB 1IR1A 5KAKA 3PR4A 2BQUA 4KH1B 5CYJA 4HHHA 4ICLA 3BQ2A 4PEOA 3T1YF 4K4XA 2E29A 2RIJA 2CPIA 1W7WA 3HSGA 1N5VA 1X8DA 2QN6B 2YKNA 4Z37A 5ADZA 4DV0F 4IG3B 4O44B 1D9FA 1FJGF 1OYDA 1N88A 3LF0A 3LQVA 2DPIA 1YJVA 1VQ7S 3DDIA 4J9KA 4QWCA 4NLRA 4CI0B 2VKRA 3S8SA 4KT0C 4K2XA 1IN0A 4UOCA 4QWAA 2CZ4A 3Q8RB 2JZ5A 4NLOA 5JVHQ 4EFAC 2XS7A 2L48A 5IZHA 4QU6A 1SUQB 4CO5A 2CQ1A 2DXDA 1YLXA 2WW4A 3FEXB 3OHAA 3JQMA 1DARA 1R43A 2E1MC 3R27A 3TUPA 4KGXB 3DLEA 3BBCA 1N6QA 4KRWA 2J9DA 1J5EJ 1MMDA 3UE2A 4QWDA 5H1SV 1HR0F 3PEJA 4YHHJ 3MR6A 2ZVIA 4U9RA 3FC9A 1I51B 3HT3A 2EFQA 3CJSA 3QSYB 5E41A 4BDPA 5HATA 2DR7A 5K8MA 1DZ5A 5C42A 2NXUA 4A8OA 3PO4A 3P8BB 2GVDA 1GMWA 1OPZA 3MCSA 4ZP8A 1KSPA 5KT3A 4HH1A 2HMIB 1FTCA 1XEZA 4RO0A 3H25A 2M4MA 3MEGA 2R7VA 2PFFB 4ZVGA 4U7UK 2E5GA 3MEDA 3MCMA 1DTTB 4ZOSA 2IM3A 3MPYA 4F0MA 2VICA 2CIMA 3VAGA 4C11B 3BEGB 1RTJA 2IPOB 4XTTA 3GJRB 3MM5A 2RU3A 1G6BA 1H74A 3AD8C 2MQMA 3MM9B 2KM8B 1CQNA 2YKAA 3NAHA 4DX8H 3TNVA 1QAJA 1DJ0A 1RU1A 1Z1ZA 3AOAA 3ENVA 1V5VA 3JSBA 4L6V3 4ZVOB 5GAEI 5A0YB 4B9MA 5CYMB 2XWYA 2HVIA 5E2QA 2UXDF 2ZJRQ 3MM6A 2CQHA 2WB4A 3KLEB 5KT6A 1YTYA 1WKKA 5GAGI 2OEKA 1XNQF 5F8JA 4O0IA 1UMJA 3EE3A 5F0WA 1WEYA 4TY9A 3POTB 4WYLA 4CLZA 3KG0A 3ENAA 3LWMA 2YWWA 1PAUB 1N8RT 2OSQA 2WVFA 1RGVA 1NUEA 1TL7B 3KUEA 3PYDA 4MK9A 4CNYA 2W8KA 3TWZA 4HEA9 2HNDA 3KHRA 4WXOA 1JXLA 3I4PA 2F8MA 3WIVA 3CT9A 3QO9A 1H2TZ 4UQGA 5LMUJ 5EUHA 3OTOJ 4GKKJ 2VA3A 4OYIA 3W9IA 4MKBA 1F0XA 1UWBA 3CJTA 3NGTA 4JV2A 3KTQA 4ANCA 3BQ0A 1NDCA 1CC8A 3GMGA 3HHKA 4KHMA 3UDCA 4I67A 4KGKA 3DC2A 1HARA 1UPPA 3EZUA 3NGRA 1BWEA 3LP1A 1VQ8S 2UXBF 3C6UB 4IKAA 5K8NA 4IH6A 3S01A 4V19X 1UFWA 1RT1B 4PXEA 5C24B 1R27B 2BZ2A 4RWWA 2CPXA 2X1BA 4JI6J 2N7YA 4ED1A 3T1HF 3J7Z5 1NHUA 4Y28C 4KKOA 4OX8A 1LW2B 4ZP9A 5GAHI 3JSYA 1S0VA 1B3TA 1I5OB 2DBBA 4PCQA 2ZEJA 1TL4A 2IBOA 1KNZA 2NXNA 2EKNA 2QL9B 2XSJB 2X1FA 1N52B 4O23A 4ED7A 3DRRA 2HEKA 2XI2A 1DFDA 5KFCA 3SZ2A 2P6TA 4CLTA 3HVRA 5KT5A 1VK8A 2C3YA 2EWHA 3N6MA 2ZHAA 1SIZA 4PPZA 5A8RB 5KFQA 5C2CA 2BRKA 4BWJA 2AX1A 4QPTA 2JL9A 2UXCF 2HSEB 3TVYA 4F4WA 2LMIA 1JNZB 1RT6B 1HW8A 2QA4G 2HFNA 2AYEA 3TYTA 2HW3A 2HFVA 4M8LA 1IJFB 1HBMA 1OO0B 1RAIB 4ZPBA 1PGZA 4DSIA 3A8JA 2J9CA 2CQ4A 2IAJA 3D0HE 3KHGA 3GIJA 5HAOA 1U0SA 3SV4A 3MUMP 2CPYA 3EM1A 4UY8T 4OZJA 3G6VA 3IO1A 2BQ3A 5DLGA 2W24A 3NS6A 4M5KA 4FBUA 3ZTSA 1YI2S 1R3NA 1S1UB 5KOWA 3TAQA 1PKUA 1RCXB 5F9LA 4LT6A 2MJUA 4Y2CA 1YJ7A 1UAWA 2XYGB 2VBZA 3LGNA 2MZTA 1RAAB 2CNNB 4FYYB 5M2UA 4ECTA 4P2FA 3K5PA 4TYAA 1IWAA 2VV5A 5DZ7A 5HI7A 5HVHA 1LOUA 3T1AA 4ANEA 2YBVA 2DH8A 3N6NA 4OX7A 3C14A 2LXFA 4NCGA 2VF3A 4KO0B 3SEOA 3QGGA 2R8JA 3V81B 4MKVA 1P9QC 2ADBA 2DJWA 1P1TA 1T94A 4CRJA 1R0CB 4NA1A 2A0FB 2YNGB 5DQGA 1S0OA 1HI0P 4ZKAA 2HVZA 4QYZJ 3L9ZA 1V6HA 2F65A 3MURP 1WC4A 3QRPA 2Y3YA 1RA6A 3VR1A 5HMZA 3W2VA 4X4RA 1QSYA 2E5LJ 1W25A 4G1QB 5I4MA 1C0TB 4I7FB 2HS3A 1HYSA 1O0PA 1IKYA 1HWJA 1JB0C 4C8OA 4WZMA 1RKIA 3HVTB 1K1QA 1IBKF 5KG7A 2ADCA 2ATCB 3DMJA 5AE2A 3Q8SB 2CQBA 3UD4P 2M70A 4RNHA 4G1IA 1JKHB 1WTFA 4UW2A 2J6SA 3MDFA 5J2MB 1CBKA 1RU2A 1SV5B 3NS7B 4ECWA 4KR0B 4CQ1A 1FNOA 1E6YA 3Q22A 3TANA 1YJRA 3A13A 4KV8B 5LSOA 1DQ8A 4ECZA 2JHEA 2KFZA 1MU2B 1S1VA 2APOA 2RDIA 4YN3B 5CD4H 1WDDA 5DQIA 2Y8YA 2QT7A 3FQLA 2HQGA 1IKXB 3DM2B 2BKOA 3A8IA 4E2FB 3B54A 4MYTA 3KJQB 5LJ3Y 3R5AA 2Z2ZA 1SKWA 3BSAA 1UW9A 3CNQP 4Q8FA 2HNZA 3M6VA 3EDQB 1LXJA 3QZ7A 3F73A 2N4DA 3HHLD 1SJRA 2CJ9A 3R5GA 3PW2A 1UVJA 1R7IA 4LBPA 2FLNA 1R0AB 4Q2LA 2QZ8A 1RTZA 1TP7A 2G2OA 3QMQA 1TKTB 1G4CA 5F41A 3QPIA 2XM3A 3NMAA 3BN7A 3OFEA 2MEWA 4M5DB 4DR3F 2GA7A 1JQGA 3FZBA 1TFWA 1NMEB 1QTMA 1MWYA 2CRLA 3RW6A 2O1PA 3EVMA 1A9NB 4RLEA 5J2NB 4R5PB 2R7QA 3MHYA 3IRWP 2QMUB 3H42A 3IC1A 4DX7A 3K58A 1WORA 4KV8A 3NGUA 3ZNUA 3NKYA 3CCVS 2PC6A 1E6YB 1Q7LB 3TJ8A 4JOUA 4PG7A 2E5IA 2IHR1 2BOAA 4ER8A 1Q82T 1H38A 4A46A 2DO0A 1F1BB 2MLXA 2VC0A 3O6QA 1I6JA 4WPAA 4F2SA 1JKHA 4B3TF 2W9CA 3DMJB 4NLVA 3UDVA 4B9LA 4BC9A 3BF4A 1XNQJ 2FJAB 2IYGA 1JK9B 3C16A 3AB2B 4DU7A 2KT3A 1RACB 1ZBTA 2GIFA 2V8VA 3CDBA 4DZDA 3LPEA 4DV4F 2I1RA 3DI6B 2V8DA 3RYLA 5JMNA 5KFFA 3IRXB 1VI7A 4IR9A 1AT1B 1U45A 1S97A 3AHPA 2W2OP 2DHSA 2JVOA 4XAKA 2XY7A 4U7UD 1HR0J 2AQ4A 3L7UA 1F3VA 4QIWD 4CCHA 1W2IA 4D3GA 3IG1A 5DGBA 4ZPTR 1CQMA 3CUNA 4IOAQ 5D4PA 2X3GA 4NI2A 3M9OB 1RAJA 2LYVA 1ZYQA 4CWBA 3BH7B 4OHWA 2H51B 4ID5A 3GR0A 3MMAB 2F3JA 4IOBA 4DS4A 1TU0B 5FD1A 1BQMB 1NSKL 2G2ZA 1SPBP 2H54B 2PMWA 3IS9B 3R97A 2V69A 2DNQA 3PG9A 2UVUA 4BWMA 1C4AA 1U02A 2EC2A 2LU2A 4P2SA 4W98A 1YJWS 1WOOA 3HI9A 5HSPA 3IR7B 4O3RA 5KFSA 2DGUA 3QZ8A 3CCZA 4TLRA 2NYHA 3KMSA 1N34J 2DNGA 3UNGC 2GIRA 1TELA 1VQLS 1SBRA 1RXOB 2C2NA 5GAEU 4F4XA 2IAJB 3GIIA 2BJEA 4PQUA 3TJAA 1AUSL 2Q43A 2HZVA 1FTRA 3ICLA 2BW2A 4IRCA 1IR0A 4USJC 3SXLA 3RG6A 1RT6A 2Z2LA 1CJUA 2FGOA 4AL7A 3D9BA 4KFBB 5E3CA 1DQ9A 2DGTA 3H5XA 4NMXA 3OLBA 4DWIA 1CJTA 4DL7A 4LF7J 1FKPA 2CNKB 2MLZA 3W60A 2MDAA 3T19A 2CZ9A 1NU4A 4USMA 2HQCA 2RDJA 4CDIA 3QWPA 2OI2A 4DV1F 4X4VA 2BM1A 3M8RA 4NLDA 5FLXY 1WI8A 2A3JA 2EVZA 2X3DA 2XMUA 2YX1A 3CVKA 1NEEA 3D6FB 4CLFA 2R8IA 3OXLA 1DURA 3BR8A 2OPRA 3MFIA 2CPZA 2WOMA 2W01A 5KG6A 2ASLA 4WKRA 1X60A 3QNWB 1LW0B 1ICEB 1RT3A 3EXCX 1UTAA 5B08A 3GIKA 2LU1A 3VCDA 5D0RA 4MAKA 3GYNA 2ZBRA 3RBZA 3C6UA 4ES3A 2XC9A 3NGSA 4UT4A 1QE1B 3JSMB 1YHQS 1Q5YA 2ALZA 3ITHB 1Z2LA 1NNDA 3OLAA 3W7BA 1UEVA 3CMAS 1T03B 4RW7B 3H5UA 2PI5A 2ASYA 1S1XB 1EARA 2NYIA 3FMWA 3HHDA 4H4MB 2ZOFA 2D3O1 4S0MA 4CLPA 1RDRA 2GJIA 2RQKA 4N7TA 4DV6F 3Q2TC 1MSWD 1FF2A 1YKWA 3UDEA 4TKTA 1DLOA 1VLYA 4C8NA 4EI2A 4C4WA 4CYUB 5HK4A 3PY8A 4MJKA 2XS2A 5IT9U 1JJHA 3AA8A 2ZH5A 2LA4A 4FNHA 2AHOB 3T1HJ 4DV7J 3AA9A 4NA3A 3EMTA 3SQGB 3KLVA 2XO7A 3HSJA 5LM7E 3KLHA 1IWGA 4NLTA 3Q83A 4OI1A 4LF6J 2NUHA 2XYHB 3KKFA 1YG0A 4F26A 4NZ6A 4HKQA 1VHFA 2FJWA 1UJ4A 2P5VA 3OL7A 3NBPB 1X31C 1NAQA 4R25A 4KH0B 4U96A 2VQFJ 3OVBA 4A8WA 1NPKA 1VOMA 3DLGA 5MLCV 2RQCA 3X1LB 4PG6A 4J91A 2R8GA 1S9GB 2YH0A 4TU8A 2KXFA 4NLXA 5T7LB 4IDKA 1Y3JA 4B3MF 1PYSB 5IT9Y 3V6HA 3PX0A 2XS5A 3H8YA 5KFDA 1FDNA 1RADB 2GNKA 3LGMA 3LP0A 3QGPA 3MEDB 2RKIB 3D6TB 1JXVA 3HSDA 3I0RA 2AWZA 3CO0P 4WXWA 4ZHRA 1YIJS 2CKWA 2HMIA 3U7JA 3ZTQA 3U02A 1R31A 3UD5A 3OL9A 2GVDB 4DV5J 4NZ7A 1T7PA 3F44A 4RW9B 2IM1A 2QA2A 2R42A 2VU5A 4NL5A 1DLOB 3MUTP 3VAHA 1X4AA 2XZWA 2XZTB 4FF1A 1R89A 1ZAVA 3IA0A 1OYEA 2UUBF 1S1XA 1C2PA 2D9PA 5CABA 4RW7A 2DGXA 3DLEB 3NCQA 4MYUA 1UA0A 2F40A 1N6QB 3EXYA 3SSRA 2P9GA 4ENOA 4YB1P 2G0IA 4DR4F 1M0SA 1MROB 2DHHA 3FGVA 5E3PA 1M5PC 1VRTB 2R7UA 1DTQA 4I64A 2ZE2B 1S4EA 4I6WA 4LRDA 2HBYB 2AEMA 2WRMA 1EHWA 1HI1A 1TUVA 1UJ6A 2R7SA 3FCHA 4ZVPB 1PYTA 1WEZA 1R8PA 3UWTA 3OPKA 3J81j 3ILLA 4I6YA 5FDLA 3KLIB 5KFLA 2F5GA 5D3GB 1QSLA 3NY0A 1JLGB 2MKSA 1TVRA 1YJ9S 2GQQA 4W90B 2HZAA 3SFUA 2KG1A 3UN3A 4HR2A 4LF4J 4M5IA 1X9WA 1NXIA 4K0KJ 4F36A 2FC9A 5F8LA 3CC2S 2MQLA 1MROA 2Z56B 3ETOA 3P5BP 4FVMA 1LXNA 4KHRA 5EWGA 3T5HA 1NDKA 3RAXA 2ZH6A 2O66A 4USTA 5I3UB 4KGVB 3W66A 2RAQA 1U1RA 1L3VA 3TARA 2BE2B 3FCVA 2VB6A 4MKAA 1NK6A 4K4VA 4IO1A 3RW7A 4KFBA 5KFRA 1URNA 3OFHA 2DRBA 3BGUA 4NLWA 2VFUA 4XK8C 4DR1J 3AOCA 2OPPA 3WQPA 4RW9A 1HWUA 3RRGA 5LT5A 3QYYA 1T9VA 4FPRA 4J9UE 4YB6A 1KFDA 2UUBJ 4UZCA 2PFDA 4CM2A 2W9BA 4PQAA 1YVFA 2MQPA 2PIIA 1B0PA 3DRPB 5KG1A 1YDLA 5DG9A 1M5HA 2RKIA 3MM8B 4ZHRB 4TNOA 1S1TA 3Q8VA 4OHXA 4B3SF 2R3VA 1F5AA 1OIAA 2XYPB 1V3RA 4N41A 1AW0A 3TP2A 1KDNA 3JTOA 3KNGA 4AL6A 3B4MA 1AZSA 2WONA 2Z58B 3ENWA 5KTQA 2ERRA 4WJBA 4MTPA 2FJVA 2YNHB 1WC3A 4PZVA 2H5EA 2V2VA 1KEKA 3PTWA 2WVEA 4TVAB 4ZVFA 3T5JA 4C8LA 3L09A 2E7VA 4B17A 3C15B 2MQ8A 1H6KX 1EB0A 3LUYA 1S0MA 4NCBA 4B3OA 2ZBPA 2OTJS 1S59A 1HIYA 1NCLA 3D1HA 3TAMA 4PAAA 4C3KA 4HACB 4ECXA 1RHMB 1FX4A 2V5HG 3QAEA 4KHPJ 4P6QA 4RW8B 5F8IA 3IRXA 1P6TA 4Z7CA 3M9NB 1FRXA 5C25A 2CXEA 1IXKA 2FIUA 1KVJA 1MW7A 4ZVQB 2K3KA 4CYUA 3OTCA 2MKJA 1REGX 5EX3A 5IC4B 3S7RA 1F5BA 3N6LA 5C5JA 5IWAJ 2C2ZB 4H4OB 3DLLQ 1QVGR 1TKXA 2DNYA 1C1CB 2WCXA 1FO1A 2OMOA 3QGHA 5JXSA 3PW7A 2E5LF 1T03A 3OR2A 2IMOA 3SDEA 5J2NA 3ITHA 1NK8A 1M1KT 3JAMU 1LNQA 4DN0A 4C7QA 1R6YA 3R6GB 1Q1KA 4Q0BB 2ROEA 2YWEA 3DLKB 3PFEA 4EBCA 3CJ3A 2DKOB 4FVCA 3MEKA 2ZHBA 2YKPA 2XLIA 3OUYB 2HQIA 1LW0A 3EZOA 4PG5A 4EUVA 2AT1B 1EIYB 3PKMA 4FDFA 5IQQA 2OPQA 4DL0C 1FJCA 3GCWP 4YB7A 2WSEC 2UVVA 5BYSA 4QWBA 4FF3A 2IDLA 3ZZ0A 4DOZA 2L41A 1HNXJ 2B4OA 2HK2A 2ZNYA 3N9UC 2H5IB 3BGRB 3MXHP 1KTVA 2DIUA 1RAOA 5D4NA 1GMVA 3HVWA 3JS9A 3VAFA 4JYAJ 1NM2A 1F9FA 1FKOA 1WHWA 2YWFA 1VHIA 3HFKA 3IWLA 1IKXA 3DM2A 2MHEA 2OHDA 2Z0GA 2DTJA 1FKPB 4TY8B 2VBWA 5KG4A 3WHIA 3RAQA 1NKEA 2EC0A 2MLYA 1XR6A 2C2MB 1Y00A 3THTA 2R7RA 1VIOA 2HRTA 3UO0A 4DX6A 3DGPB 1FEHA 4DG1B 2ZWPA 1N33F 1CJUB 2KHDA 2M3DA 5F8MA 2BMBA 3B4DA 3UI3A 1FESA 1HWKA 1HNWJ 4DR4J 1YITS 2R8HA 2MKIA 1HKAA 2N4CA 3ELHA 2ILYA 2YXLA 1TV6A 2KFNA 5D0HA 4OJ3A 1R0BG 2KHCA 2IIHA 2YNIA 3VAKA 3HVTA 1N36J 2FB0A 1X9MA 1HYSB 1S9EA 1X0FA 1XTZA 2RVJA 4LVOP 1U1LA 2MQNA 1IKWB 4OJ1A 3CJKA 4LR7A 1NJIT 2FLPA 2JFKA 2IYIA 2DISA 4KGZB 5D4OA 3HO1A 5LJ5Y 4TU9A 4J9NA 2BOPA 1VR6A 1QSSA 1H7XA 1UFLA 4PUOB 4LIWA 3CJ5A 3Q8YA 1YGYA 1WTBA 1HNXF 2IFXA 3R7SB 2JLGA 1FJ7A 1RWXB 4X4SA 1FXLA 1D3WA 4ITSA 2VG6A 1JLAB 3KG4A 3W5ZA 1SH2A 2CA9A 2V2ZA 3RJMB 1N5QA 3GYGA 3TW0A 1EP4B 2KI2A 2RDDA 2VD3A 3KHLA 1WSRA 2BRLA 3DI6A 4AXJA 2VPZB 2B4VA 2HAIA 2MHNA 1Q86T 4ZPVR 3C16B 1KQKA 3HT0A 1VQOS 3A4TA 1VJQA 1NDPA 2OKQA 3UCUP 1HMVB 1KR4A 1RT2A 3HXMA 2E9TA 3I0SB 3EPGA 2AZ3A 1KHVA 3VHQA 2FJEB 3NCPA 3V6KA 2VG5A 4UOHA 1TR0A 3CTRA 3O2IA 2F7VA 3ZZRA 3UD3P 2V8PA 1RSCA 4OZ0A 1HPZA 2IA0A 2R4FA 5EWEA 3T5KA 1F2HA 1IUJA 4LBHA 4WIIA 1RHJB 2UXDJ 1K73T 4AUKA 2RU9A 4ZJLA 3BR9A 4ED6A 2XSJA 4N5SA 2BKPA 2G2YA 4I2PB 4RWXA 2HFUA 3CEDA 3F41A 4I2QA 4YY3J 2B6AB 1RWVB 5A2QY 3KK1B 3OVAA 2VZ9A 2W2QP 2C2RA 3B82A 3MOJB 2D7SA 1CPZA 5DG8A 2I5JB 3MI7X 3UFCX 1JLFA 3VF0B 2EBEA 1H3DA 2GMLA 2J8SA 2RRNA 3CDEA 1RZMA 4X65J 2KH9A 2XMMA 8AT1B 5J2QA 4DR7J 1S7IA 5CA5A 4DV2F 2DPJA 2D9OA 3K89A 2FVSA 1H2UX 5HMYA 4B3SJ 1B0VA 3FRZA 1T95A 3QT8A 3G6YA 6FDRA 2CQGA 3IAM9 4J9VA 1HBUA 3C66A 3I5AA 5HO4A 2RRAA 1U1NA 2UVWA 1MU2A 1S1VB 1UETA 4WKYA 1PG5B 2B9EA 2KVQE 4L3KA 5D15A 1SJ1A 3OTEA 3C6TB 1HL6A 1PILA 2UZAA 4RX6A 1NK9A 3CDUA 5DQHA 1SV5A 1T9YA 4YR2A 3GV5B 1X5OA 2HNDB 5KFHA 4A8YA 4QPXA 3M2RA 2KKHA 1U48A 4LRFA 4RUHA 4ILLA 3Q86A 1TAUA 3Q8QB 1RA7A 4KYZA 1IKYB 2PMHA 5F0UA 3C6TA 3POTA 1RWOB 1RTIA 2HHHF 3W2VB 3FQKA 2MPUA 4HHJA 1OY8A 2BACA 2F1FA 5D8HB 2XNQA 3DOKA 3DYAB 4HI2A 2PA3A 2QLBB 2DGSA 3TUJC 2AJQA 3H2LA 5B0EA 2KTQA 2W2PP 3HZGA 1QAYA 1H73A 1O51A 1M1GA 4TY8A 3X3UA 3MD1A 4ZP7A 1RB0A 3JXOA 4X2BA 1HHTP 2CQIA 2N82B 1FK9A 4DL4A 2HRUA 3MM9A 1FE4A 4Y2IA 4HL9A 4K4WA 1K0VA 1URRA 3AJ1A 1QUVA 2FD2A 2VJUA 3GG0A 4H4KA 1XNRJ 1LWEA 3J7AN 2FHOB 3D28A 4N8NA 2BX6A 3CJ8A 4RKUC 1Y3KA 3BSOA 4F4ZA 4DSJA 2VFVA 4I2PA 2ZVSA 3M32B 4UOGA 2CJKA 4C8KA 2XWXA 4QR1A 5CHCB 5JVGQ 3VALA 2XNRA 2LCWA 3FRYA 3CULA 3THVA 1VFJA 2AMCB 4NLYA 3K7RA 4Q44A 3G8TA 4LF4F 1IKVB 4JB8B 2ZH3A 4DL6A 3CWJA 2OPSB 3RR8A 3R1HA 2YX4A 2JRSA 2QLFB 2XMTA 3DGVA 4TYBA 2B4UA 3IM9A 5HBMA 2RS2A 3G9CA 5CH7B 2UUCF 2VFRA 1A0OB 1NLKL 2B7BB 3D4JA 4X4TA 1ZPVA 2H9ZA 2YWKA 3LP2A 5A8RA 1S9FA 4EYIB 2VG5B 3M8ZA 5E0OA 2Y1IA 4HI1A 1PJ6A 3DRRB 4RR5A 3THPA 4ERDA 2JLFA 1HMVA 1SL2A 2DXFA 4K4YA 1SJ4P 5HMWA 4Y65A 3O5TB 5A2QU 4OMFG 4HHUA 2CADA 4DR6F 2KG0A 2BR0A 3P49B 1WC0A 1XWLA 4QJVA 5DG7A 3PX6A 2UV8A 1G7CB 2FLOA 2QEXS 2L9DA 2H65B 2BW7A 1LEOA 2RJZA 3PXGa 2VG6B 4DQIA 1F9HA 2D1CA 3CC4S 2ZNZA 2M88A 4DUTA 2VG7A 3PX4A 4PWWA 1AFJA 2HWTA 3ILJA 4F4AA 1ZOTA 4WYWA 4FF2A 1IBMF 2Y0BB 2E1RA 5I3PA 2IMWP 1IQTA 3FCWA 3PM9A 2NSBA 3HHLB 4KB7A 2RD5C 4DHVA 3E8OA 1Q8BA 1MG7A 1S6PB 1WHVA 3OXFA 4OFZA 3CJKB 4DX5A 3MMJA 4L76A 2HGNA 3R6LB 5KFNA 2CJQA 1RBOB 3QO9B 5FIIA 5F3TA 3ZZPA 2NS1B 3BBBA 4DXLA 3R2CJ 4HDGA 1T9WA 5CZVA 1TL7A 4C2MA 1NBEB 2CZVC 2CUYA 2ZH7A 4IO9Q 1S10A 1JIHA 1NPRA 1UA1A 5DDPC 2RUSA 2EFOA 1LQ9A 5DETA 1N0UA 4NWBA 3I4HX 2NZCA 3IXQA 3LO3A 1VRUA 3M4XA 1YRUA 2DHGA 3MAAB 2VKZG 3LGHA 1IM4A 1N54B 1YWXA 4IFVB 4EK2A 3BO4A 4ELTA 3DGPA 3OHBA 3OJUA 2HVEA 3EYZA 2WVCA 1YSJA 1YX2A 2GVZA 2LQ8A 3K17A 3KJNB 1D9AA 3AXKA 1H72C 3WBZA 4C97A 5L9NA 1N33J 4DR1F 2D3UA 1VBXA 3OXGA 2NXEA 3CD7A 1L3UA 3K5OA 1SB6A 4GKJJ 2HFZA 2XMWA 4DUYJ 2W9AA 4R0JA 3MM5B 4Q8EA 4GO7X 3PACA 3QLHB 3GILA 5L1JA 1T05B 3U1MA 2AF6A 3CCTA 3TX0A 5H9EJ 2J0XA 2DNZA 2HQDA 1FWKA 4DBQA 5A76A 2ILZA 3KLIA 4P71A 6AT1B 5KFPA 3MEGB 1D8YA 1UW4A 1OWXA 3D0GE 2XI3A 3OUYA 4NYOA 4MK7A 1RHUB 3PRDA 1J5EF 3P4UB 1SC1B 2VFSA 3UNYA 4ZITA 3KOAA 4C98A 3MCNA 4J90A 5HP1A 2YX7A 4OHYA 4JI8J 3GCXP 3JAMY 3W62A 2OP5A 3SDEB 4GVBB 4X62F 3TQEA 3QSIA 4B3RJ 1N5YA 4F2RA 2HK3A 1LWCA 5ETSA 2GX8A 2DR5A 1N32F 5J2PA 1GT8A 4NXNJ 3NWGA 4M94A 1AXQA 5ETLA 1FXRA 1UZHA 1VIXA 2AJ4A 1A7GE 1M1HA 1HQEB 3MPWA 5L9XA 4K4TA 4QR2A 5F8HA 4C9DA 4CH7A 4NPOA 3B6BA 8ATCB 4LF7F 3UVJB 4DEZA 5AT1B 1YZ7A 2BKNA 4A8XA 4EU0A 2K2PA 3Q23A 5EDWA 1GMWD 2QFIA 2EEYA 3I0RB 4RW8A 4Q7AA 4ILMA 3EPIA 2W25A 2GW8A 4FP9A 2SXLA 3OTBA 1FDAA 2MZJA 2J7UA 2RMLA 3U27A 4J9OA 3TI0A 1M5KC 4B3OB 4WCEQ 4WP9A 3OFGA 4O3NA 4IDKB 2VPYB 2KRRA 1S9GA 2R7OA 4L74A 5HMXA 4ILRA 2IM2A 2YNHA 5B0FA 3AQOA 4X84A 3DDNA 4DSEA 4PPDA 1QUPA 2C1EB 2ZBCA 2IDEA 3NLCA 1C0UA 3NBPA 1OQ6A 2VDHA 4DV0J 1GXTA 4URGA 3NNHA 3EWGA 1DHMA 2W4DA 3SSQA 1MMNA 1S49A 2MGZA 3DLBA 3R5DA 1PBUA 2ALYB 4OYBA 1WHXA 4ZS6A 2OFHX 3GSDA 1K0TA 4C48A 3KLHB 2Q1LA 5A8WA 2HHUA 1YBUA 3ZTPA
chains in the Genus database with same CATH topology
4V19J 3PIPQ 1HBNB 1NK5A 1RISA 1FERA 4KE5A 2J0SD 2D3ZA 3FMBA 3V6DA 2JWNA 2RF2B 5DM6Q 1LKZA 2B43A 3IR6B 3PJWA 3MECA 4H4MA 4IH5A 4DV7F 2ZZNA 2XEXA 3CE8A 2XLKA 4QCLA 1UVKA 5GAGU 2MJNA 2HHQA 5B7WA 3UCGA 4CO0A 4DQPA 1HD1A 1FA0A 4DF4A 4NOHA 1X4DA 3DHXA 3R5BA 1JLGA 2B0GA 1QAIA 3OTOF 4NX9A 3G8QA 2WOMB 3I5CA 2HZCA 5FDLB 2K3IA 5KT4A 2J8AA 2R2TA 1ZTWA 2ZH1A 2ZOMA 5KFMA 4YHHF 2IRUA 3TA2A 3GFXA 4TLQA 4CH1A 4K4UA 4PG8A 3M8QB 3VAIA 2OH2A 4GKKF 3P6YC 4X4PA 4LJMA 1OPIA 3H20A 1TL3A 2FHKA 3CJ4A 3IGNA 3PEHA 3RRKA 2VPWB 2VQEF 4RU2A 2LEAA 3K5NA 2M0GB 3CCQS 3AAWB 1F2GA 4RU9A 3CCRS 2RILA 3HZEA 5IQ6A 5KFZA 1D9DA 2AP6A 4Y2AA 4ZCIA 5K8OA 3SSSA 4PXCA 4A8KA 2FPHX 4JV1A 4K0KF 1UVNA 4OV1A 2Z8QA 5A8KB 3ZC4A 4HDHA 4Y6IA 3GV8B 3TR5A 3CDWA 1XNRF 3K8WA 1J5OB 3DN9A 1VC6A 3M8SA 1NJYA 1H2VZ 1TL1A 4ED3A 4ETXA 3IS9A 5T7LA 3N4WA 5L38A 1FK9B 3JSRA 4O4GA 1ZTTA 3MMAA 4X4UA 3G8SA 1HNVB 4KAIA 1SKSA 5EN1A 4NLSA 2WK4A 3KK3A 4IOCQ 4DL3A 4JI6F 3RB6A 3ISZA 4OZNA 1V9OA 2PN6A 3LOUA 2A1BA 2LLZA 3OTDA 3DOKB 2F8EX 4I0WA 1V3ZA 2YKMA 1TKZB 2JVRA 4RBVA 2V4JA 3NL0A 3GFYA 3DRYA 1TK5A 4YOEA 3WDOA 3M2UB 4ES2A 2R7WA 5E7OB 1CC7A 4DFKA 1WG4A 3T3FA 2V4RA 1X5TA 2HLTA 4RUAA 2Q6CA 1YBAA 3D1OA 4NRUA 2BV3A 1KQFB 1HBUB 1XR7A 2DNRA 4DJBA 1WWHA 4R0EA 4ED8A 3CC7S 1VJWA 3DU5A 2O01C 3LANA 3MMCA 1SL1A 2QYCA 2YVSA 4D3HA 1H0HB 2G13A 1U1PA 2HHTA 1M5VC 2CQDA 1TKTA 2KM8C 1S7HA 3CO9A 5GMKa 2K1RB 4I1TA 5J2QB 2HHXA 2I5JA 5HN0A 4X4QA 1KLNA 1R0AA 1CEZA 1R8HA 4C3LA 4JI5F 3OR1A 2B6AA 2EFPA 4HTJA 3HHLC 2YKOA 3K2YA 3IFEA 2MZ1A 5AJ3F 1JLQA 3IR5B 1KRPA 3C46A 1XK8A 4ZVHA 2CQ3A 2E66A 5DDOC 2WBRA 4RW4A 1VQPS 1SL2A 3E01A 3MGJA 2R9LA 2LECA 3H5YA 2JOQA 3M8PA 1F5CA 3VQSA 5THWA 4FZVA 2IVFB 2B5JA 3NRBA 5K14B 2MKKA 1Z4UA 2QA1A 5D77A 4O3QA 6FD1A 2OD4A 3KLGA 3K57A 3K0JA 3DXBA 1GXUA 2N7CA 2BBEA 3E01B 1CG2A 2BVZA 2JH3A 2XBPA 3C3LA 3QIPB 1ULRA 2PI4A 2KJVA 1LK5A 4B9SA 3QJLA 3QWUA 3I9ZA 3K8VA 4CTAB 3JYTB 3PW0A 2AYMA 2J0WA 2XGPA 1EP4A 2FHJD 4U6PA 1BQMA 2EKYA 2IRYA 3OR1B 5F8GA 3US5A 4QWEA 3D2WA 1BD6A 1R8BA 2DNPA 3V81A 2JJ4D 2VASA 3N79A 4FXDA 2LEPA 1RK8A 4KO0A 3SI8A 4PUOA 4DFMA 1U1KA 3DOMA 1JLEB 1FKAF 4WFNQ 5E33A 1Y9OA 4J9SA 2WHOA 2GMJA 3OL6A 2AX0A 2HS4A 4DV5F 4FF4A 4IYQA 2HHSA 2G9OA 2XCAA 3KHHA 2UUWA 4Y2MA 2N3LA 4Y00A 3PKMA 3OFFA 5K8PA 1RT5A 3EX7B 2W9CB 4P7TA 2D3OR 3HM9A 2FVCA 3CGIA 3KLGB 4OI2A 1HBMB 3M6UA 2B5JB 3MUVP 1Q53A 2DT9A 5B0DA 3ENQA 1WI6A 2FVPA 4QIVA 4DG1A 5D78A 2ZC4A 1JMTA 4R5PA 4RNMA 4DUYF 3DOLA 2BANB 4JYAF 1RYSA 4JI3F 1LFWA 1JLQB 3AB4B 2DHXA 3IWNC 4CO2A 1TK8A 1FKOB 1BQNA 1KOHA 1RT7B 2WSCC 2EG1A 3V4IB 1MNEA 4WFZA 4DSFA 1QM9A 3KK3B 2FJDB 4DPOA 4F4KA 4LFCF 2QMWA 5J1NA 1KOOA 2COLA 1SI9A 3GZ7A 2J76E 3EGWB 3HF5A 3MF5A 5LMNF 2EI5A 4MH8A 1VBYA 2JEFA 5CXTA 4O4GB 2K1RA 4OX6A 2EK6A 2HNZB 4NMLA 4OJHA 2DH7A 4QR0A 4O3PA 2ZHOA 4CO4A 4Q8EA 3OQ2A 2ZOGA 4FS1A 3L7PA 5AXMA 3CCUS 2I8EA 2Q6BA 4F3OA 4YR0A 2WSFC 4USHA 2B9WA 1VC0A 4V19X 1S77D 3TA1A 4G1PA 1B64A 2ZITA 1S6OA 2KJWA 3FSYA 4WFXA 1HNZF 2LVWA 4AQYF 1L3SA 3L3CA 1K8AT 1C1CA 2KXNB 1WNEA 4H4OA 3MTKA 3O8WA 4HT5A 3DRSB 4LF6F 2JSXA 4N8OA 3RBEA 2WW8A 3M2VB 4AE5A 4WU2A 4BHQA 5L8RC 3NG8A 3UW1A 3EGNA 3J81Y 1U6FA 1C0TA 4I7FA 5G0RB 4YMEA 2BJDA 4WK1A 3UQSA 3V2UC 4F2RA 1CLFA 2HWHA 1NJWA 2A10A 5IXUA 5LXYA 3BJYA 4IQXA 4YY3F 3M8QA 1Q81T 2CPFA 3PR5B 1RP5A 4ECYA 1RWUA 1Y5NB 1VBZA 4U67Q 3I56S 1S1WA 2DVIA 1CVJA 1EETA 3CCMS 3AH6A 5A0YA 5KG2A 3DU6A 2DNLA 2IA6A 2WONB 2QSWA 2RQ4A 3DLJA 2PMZD 4GMKA 5L1IA 5AE1A 5DGAA 2EK1A 1G2EA 1MMLA 4QIGA 2PT0A 4ZVEA 3LALA 5KFOA 1IQTA 2DNOA 5KG0A 2KG1A 1S1TB 1S1UA 3CIMA 3MM8A 3ZFVA 2DCLA 4FN5A 5KFXA 1D1UA 4DF8A 3HX9A 3J7YU 2ABYA 1TQLA 1S6QA 5A8KA 4OJGA 4DFPA 2CPJA 2JFDA 4ZA1A 2CJBA 2LQ5A 2D41A 2Z2MA 3HLUA 4EWTA 3DNCA 2KZZA 1U09A 3RR7A 1R8AA 3GV7B 2PE8A 4K59A 1E6VA 4ALZA 1LWFB 5I3UA 4YDXA 3TOQA 5HROB 4ATNA 3GQCA 5J1PA 2AW0A 2PDAA 3GFHA 3C2PA 3CD6S 5AE3A 1RQ0A 2ROPA 1N48A 3SCKE 1UL3A 3S6EA 1QLNA 5D3GA 1LW2A 1B7FA 1KQGB 3N5BA 1YJTA 2B56A 1Z2ZA 1RT1A 3CCWA 5C24A 2ASJA 4NYPA 2ZKUA 3O1LA 2ZE2A 1VMBA 3LP1B 1DTQB 4A8FA 4UY85 5GVQA 4H54A 4KTQA 1HQUA 3OBIA 5KFUA 4MFBB 3V6JA 4OI4A 1L3TA 5IFMA 2WBMA 2E9ZA 2AGOA 4I69A 3T9ZA 5CYQB 1Y4ZB 5B0CA 2M52A 3EZ5A 2YWGA 2MQQA 3I55S 2NREA 2V9WA 5DJBA 1S6UA 2OSRA 4RNOA 3LWLA 4UUWA 4CO3A 4N56A 5GAHU 2PGCA 2AGPA 2L9WA 3BZQA 4LSLB 2A2DA 2ZD1B 2EFNA 3G6ES 2MGZB 3NMRA 3M6XA 4QIFA 3MM6B 4X65F 4B9VA 1NB7A 3MR3A 1Q8IA 2M7SA 2MSTA 5CYMA 1OSCA 1GNKA 3GR1A 1LV5A 2OJ3A 4B9TA 5EGYA 3DLGB 1T05A 3PO5A 3GFZA 3O44A 3R3TA 3NNCA 4FBTA 1RTJB 2WTFA 3CB4A 4KPYA 3ZZTA 2ZDOA 1TAQA 3DDKA 1GX5A 2HRYA 1HA1A 2GIQA 2Z4PA 1U2FA 1PC4A 4K5RA 1RTDB 2V94A 1H98A 2AYBA 1RI7A 3T6JA 2CPHA 1SXLA 2ZD1A 4PKDB 3PZPA 1JNRB 4LSLA 3HHNB 1HQEA 1X4BA 4EGLA 5F3ZA 3H5SA 4I4BA 2J6TA 1HI8A 3MMBB 2IBKA 3G86A 3FZ2A 4LVNP 5K5MA 4L72B 5K9FA 1FXDA 2VH7A 3HMJG 2BA9A 2C22A 1YRXA 2EBGA 4DMZA 4JBCA 1NK7A 2ZC3A 1HD0A 2HGLA 3UR0A 5HP1B 1Y0HA 2HYIB 3BN4A 1S6PA 4RNFA 5JUMA 1RYRA 2MY7A 3HHLA 2ZDPA 2UP1A 4Y3CA 2KFYA 5KFWA 3BS9A 2OPRB 2DITA 3G96A 3VZHA 3QIDA 3SCJE 4ETZA 2P9EA 2YY3A 4F25A 2GGPA 2V2KA 3HP6A 3IN5A 1UKUA 4IFYA 4NXMF 3MM7A 3FSXA 2K7KA 2UU9F 4OL8A 3CCJS 3AY0A 2XY5A 3IGVA 3KLFA 4JI8F 3LAKA 4DL5A 5HROA 5L1LA 3N5FA 1FNMA 2M5YA 2X1AA 3RBDA 2C28A 2KDOA 4IG0B 2K8GA 3RB4A 4W92B 4EO6A 2CQ2A 4OLOA 2AU0A 4NXNF 2WAQD 4QQBA 4BBYA 4A8MP 3L95X 1AUDA 4AL5A 1FRIA 1X5PA 2FHJA 4DLEA 3K5MA 4EEYA 4OX9F 2FDNA 1JX4A 4C8MA 1NRKA 4ZCLA 2JEJA 1IJEB 5H9FJ 2XCPA 4NLPA 2CG4A 3M32A 2VOOA 1FEEA 2YH1A 2Y1RI 2MZQA 1NJXA 5B0AA 1X4FA 3DCAA 2VG7B 1T02A 1WF0A 2GC8A 1X4GA 4XPCA 2IM0A 1YJNS 2ASDA 3IG1B 1U8SA 3H4DA 4JI0F 3ISNC 2MKCA 5D6GA 3WC2A 1RKJA 1S1WB 4KJIA 2LA6A 4C0OC 4DN9A 2W7OA 1RT4B 3KG1A 2AJFE 4ZPDA 2L08A 2BUNA 2CQ0A 4DLGA 2N3OA 2R2RA 2E7WA 4OZ5A 4DFJA 3BO3A 4NLQA 2UUTA 2L9NA 3LP2B 3M2VA 5IM0B 2HG4A 3DRSA 3MR5A 2EW9A 7FD1A 3M30B 4XDDA 3WX4A 1A6LA 3KK2B 1U47A 1NK0A 2QO3A 2OPSA 4IQMA 1IKVA 4NLUA 4EO8A 1C1BA 2PA8D 3H98A 2J9EA 2UV8G 2VFTA 3D0IE 5E3RA 3J80Y 2XMJA 1M5SA 3TA0A 4F3QA 1U7LA 2RS8A 4C8ZA 4MIWA 1VQNS 3OJSA 5KT7A 3T5LA 4WE1A 4GKJF 3TAPA 1D8ZA 1NH8A 2GMHA 4J5OA 3CCLS 3KK1A 3QAUA 1CSJA 1WHYA 2FUG9 3CD0A 4CH0S 2PD1A 5KG5A 4RW6B 3V4IA 2NQPA 4E8UA 1ZZNA 1FHTA 1C1BB 2RSQA 1BQNB 2BYCA 3LAMA 2E5HA 2QIFA 5LXRA 2J0QD 2GQCA 1KONA 1N4LA 1GQEA 1RTIB 1IQZA 1J2VA 3S1TA 2J7WA 3LW5C 4WK3A 3TX8A 5L1KA 3GG1A 2GV1A 3M2RB 4LMZA 3TUIC 3V4MA 3Q2SC 2JEGA 1LFPA 4B3RF 3OV7A 3RU0A 5KFEA 4PRFA 2OO4A 1WG1A 5MAOA 4BCAA 1NKCA 2J7KA 2I9SA 2JX2A 2CYYA 4P7VA 1RT2B 5T14A 4X66F 3NP5A 4GC6A 1QJHA 2XLJA 4PR6A 1M90T 4EBDA 1ZAWA 3FFIB 1R8CA 1JJ2R 4OHZA 1JLCB 5GADI 4YEAA 5E3AA 4AXIA 4Q45A 2ZKTA 1AFIA 4XDCA 5EX0A 3MEEA 4NCGB 1GAOA 2GCFA 1VQ9S 4LFBF 2QSFA 5I42A 2ZFHA 4IR1A 3MEEB 4YR3A 4CIOA 2ZH8A 2GHVC 3M1VB 4IRKA 4IUFA 1U25A 2RNEA 2P6SA 3H40A 3RTVA 4DUZF 1FVQA 2CJAA 3W2WB 1FE0A 3T9NA 2F4VF 2VODA 3HJFA 2G4BA 4CTAA 3HHEA 3PFOA 5M2PA 5KOXA 2J6UA 2C3PA 1BGXT 2KN4A 3SMZA 3U1LA 4TN2A 4YDDB 1FRMA 1P1LA 4FS2A 4J9MA 1YJUA 1SJQA 2K7JA 2UVRA 2MQOA 3HK2A 3PIOQ 4DSKA 2OAUA 1X9SA 4IH7A 2VC1A 3M8PB 4N47A