4OJHA

The crystal structure of truncated, y86e mutant of s. solfataricus acylphosphatase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDESFSEYKGEFEDFETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acylphosphatase
publication title Edge strand engineering prevents native-like aggregation in Sulfolobus solfataricus acylphosphatase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 22
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ojhA00
1X0PA 5B08A 1OQ6A 3I9ZA 4YDXA 4A48A 1AW0A 1YJUA 1TL5A 1WD6A 1Y3JA 2GCFA 2KYZA 2BBEA 3BB5A 3BN7A 3IWXA 5F0WA 1CPZA 1XBWA 1YG0A 4Y2IA 2K7KA 3HDSA 1FEEA 1R6YA 3VTIA 1FD8A 2ASYA 2BJDA 5B0DA 3KG0A 1N5VA 2K1RB 1Y3KA 2BYCA 4ZA1A 3BGUA 1N5TA 1P8GA 2HFNA 2RMLA 1K0VA 1VQSA 2OFGX 3HFKA 5B0AA 4OJGA 4FNHA 3LGNA 1FE4A 2QLXA 3T9NA 3HHLD 1APSA 3BF4A 5B0CA 2LXFA 2OD6A 3BM7A 2FIUA 3TNVA 3UDCA 2QYCA 2XMTA 1FESA 1CC8A 3K7RA 1Q53A 1CC7A 1X7VA 3KKFA 1RJJA 1GXTA 5IXUA 1U7LA 4NL5A 2OP5A 4A4JA 2W4CA 3HX9A 1P6TA 2XMKA 1W2IA 1OQ3A 2JDJA 1URRA 5A6PA 2OMOA 3WDOA 1S6UA 2LQ9A 4OJ1A 1N5QA 3HHLB 5A6WA 2AJ1A 1OPZA 3QGPA 4HH1A 1ULRA 2XMWA 2N4CA 2XMMA 3HHLA 4Y2KA 2GGPA 5B0BA 2IFXA 2N4DA 2HFOA 1MWZA 2PGCA 3MZIA 1AFJA 1FVQA 3KNGA 2GV1A 2XMUA 1Q8LA 2FTRA 1GXUA 4QOTA 3FRYA 1YRXA 3BR8A 2N7YA 2RSQA 1YJVA 2G9OA 2W4DA 4HL9A 4OJ3A 4U9RA 2ROEA 2IYGA 5B0FA 4HI1A 2OAUA 1FVSA 2Q3PA 2RU9A 2HIQA 1OSDA 5F0UA 2BUNA 1TZ0A 4YEAA 4A46A 1YJRA 2FB0A 3HF5A 2HQIA 1SB6A 3FGVA 1V3ZA 2RILA 3TOQA 2GGPB 2KT2A 1SQEA 2VH7A 4F67A 3CJKB 2LDIA 1LQ9A 2QLWA 2KT3A 3DCAA 3LO3A 1IUJA 2BJEA 5T7LB 1QUPA 1JK9B 3QMQA 3GZ7A 4FNIA 4Y2MA 3CJKA 2L3MA 1FE0A 1TL4A 2FHMA 5T7LA 5B09A 2PD1A 5B0EA 3E8OA 1X8DA 3F44A 3BDEA 3HHLC 1KQKA 2AJ0A 2GA7A 4A47A 5K9FA 2K7JA 2OKQA 1TUVA 1Y0HA 1Y9OA 2EW9A 2ACYA 2GFFA 3DXSX 1S6OA 2ZDOA 4Q2MA 5B0GA 1N5SA 4EFAC 1VQYA 3MCSA 3LGMA 2GO8A 4OJHA 1JWWA 3FMBA 2IYIA 1Q8BA 2HLTA 2ZDPA 1YJTA 2K1RA 1TR0A 2CRLA 2HLUA 4OIXA 1KVJA 2AW0A 4DN9A 2OD4A 2VV5A 2AP6A 2LQBA 2XMJA 1Q4RA 2ROPA 2XMVA 4HH0A 4Q2LA 2ROGA 4DL0C 4HI2A 4DPOA 1AFIA 3KG1A 2QIFA 4NPOA 4ZOSA 1KVIA 2KKHA 5KAKA 3TRGA 2K2PA 3IWLA 1SI9A 2OFHX 1MWYA 2W4PA
chains in the Genus database with same CATH superfamily
5G0RB 2PC6A 1F0XA 2VA2A 1RTJA 1WORA 3VVTA 4O3QA 5K8MA 3DI6B 4XPEA 4Y34A 3CJ3A 2CNLB 1UW9A 4W92B 4OYZA 2Z30B 1RT1A 4ELVA 2FJDB 4DXLA 4DX5A 1C0TB 2MQQA 4DR7F 3NP5A 4ZLNA 3TZWA 3PDNA 2FHJA 4B3TJ 1FNMA 2NXEA 2R7QA 4ZVRB 3FCWA 2DXFA 5IS2A 1H2UX 3SFGA 1QLNA 4S0MA 3IRWP 3Q89A 2HIQA 3I5BA 1B3TA 2KM8C 5HN0A 3X1LB 1FDNA 1G6BA 2UUBF 3G87A 1Q1KA 3WC0A 4LVOP 4KHMA 4DPXA 4K4XA 4IO1A 4TY9A 2RD5C 1ZAXA 3GONA 2VA3A 1N6QA 1T9TA 4JI7J 3JSMB 5IQ6A 4CLYA 1CJUA 1TUGB 3HJFA 1PJ7A 4M8LA 1Q86T 4C48A 2P6SA 2CAJA 1R31A 2NREA 4DR3J 3BKUA 4USUA 4KO0A 2E66A 2NYIA 1RWMB 1WF1A 4ZIWA 2FJAB 2LVWA 4A8OA 2VIHA 1RTIA 4DR4J 4TYBA 2JHEA 2EC2A 2ZJPQ 2WCXA 4LVNP 2YQ3A 1GFWB 1N32J 1WKJA 2WB1D 1HNZF 5F0UA 2WOMB 2P8IA 2MB0B 5D4LA 4UQTA 1VQNS 3WX4A 4YR2A 2CWKA 3VR1A 4OZLA 2OKQA 3N6MA 2ZD1B 3M2VB 1V3SA 5ETTA 1VI7A 1IM6A 2K3KA 1TKZA 3R27A 5CCLA 2DITA 1X4DA 2D1CA 1U0SA 3KUEA 3ONQA 3DHXA 4NLYA 3I5CA 4C3KA 1CJTA 3Q8QB 4ILMA 3H25A 3KG0A 4OL8A 1XNQF 4WXOA 3VAFA 3RG6A 5C7PA 3JYTA 1FRXA 4DV7J 2I38A 4UUWA 2B9WA 3MEEA 4ETXA 3NOGA 2PE8A 1SH2A 3ITHA 1EQMA 4ITSA 3ET6A 4NZ6A 4OYMA 1RA7A 1RGVA 1TL7A 4O3RA 1OO0B 2ROEA 3GFYA 1HBOA 1WHYA 1UWAA 3E01A 1ZH5A 2IM1A 1CJVA 2QZ8A 1YTYA 1X4AA 2ASDA 4UY8T 4E0DA 3H2VE 2RKIA 1C4AA 2HVHA 3KK3A 3CCSS 4I56A 4Y2AA 3OL6A 1FWPA 1SKSA 1QDUB 3CJ8A 3M2RB 1R27B 2YQ0A 3BR9A 5BJRA 2MPUA 5AE1A 3SDEA 1VBZA 3CCQS 3BQ0A 3OT9A 3IWXA 5HQLA 5AXNA 5HMWA 2NR0A 2JLEA 1HWLA 3HHEA 5KFJA 4DFKA 4FF4A 4WXWA 4KH1B 1N0VC 3CC2S 1ZYQA 3JTPA 5L1LA 5D0RA 1A7GE 2GVDB 2BA9A 1E6YB 1S7IA 1HPZA 1R8HA 1AT1B 2UXCJ 3HMJG 4ZPBA 2XC9A 3M9MB 3GFHA 4GO5X 2BANB 4MKBA 1JLFB 2KHDA 2DEJA 5F3TA 5AE2A 1Q95G 3JXOA 4ZIVA 3SSRA 1N5YB 1M1KT 2EFNA 3RR8A 2MHNA 3NS6A 2YNGA 2HLTA 1ZTWA 2XMJA 4N7TA 2MHEA 1PGZA 4YFUA 4DL5A 3FFIB 1B0VA 3JSYA 1WKKA 5G0RA 2J7KA 2QMXA 2IC3B 3BYPA 3DI6A 4ED1A 1IKVB 4TKTA 2VG6B 1RWOB 1VK8A 3ZFVA 2UV8A 3OFEA 3U02A 2ALYB 1BQMB 1C0TA 3IGNA 3JSBA 2CQ2A 2XMMA 5LT5A 4CH7A 1VIXA 1MWZA 2XYPB 5EN1A 2HVDA 1TK8A 3KLEB 1SJQA 5GAGI 2UU9F 3QRQA 2WHOA 2BUNA 4FXDA 2LA6A 4K4UA 3KK2B 3GYGA 7FDRA 4YR3A 2FPHX 1X8DA 1VQPS 2NUUG 3EMTA 4RU9A 4CCHA 2R7XA 2EVZA 5I3QA 3CUNA 4ECTA 2G0JA 3DDNA 4LIRA 4AYBD 4OHXA 3MHYA 1SBRA 2HHHJ 2ROPA 3W9JA 2E5JA 2BKNA 5KAKA 3EYZA 1RT7B 3OVSA 4CO5A 1FXLA 1F60B 4N47A 1P1LA 3GIRA 3AB4B 3Q2TC 3JSMA 2ZH5A 3I4HX 2ZZMA 3TW0A 4AL5A 3U27A 5J2MB 3CMAS 1B64A 1VJQA 3G2XA 2PSZA 4DR7J 3VAMA 5KFEA 2XEXA 2G4BA 2DY9A 3GE9A 4P75A 1UJ6A 4RWXA 1UCNA 4QYRA 1KHWA 3BR8A 1M5VC 1RHQB 1RTHB 4HTIA 1GT8A 3H90A 3CIZA 3RB0A 4BWJA 3VZIA 2WOMA 4ZKAA 3LP1B 3SV4A 1QAIA 2XLIA 2UUBJ 2AJ0A 2D9PA 4IR9A 2ZD1A 1CLFA 1YJWS 2RRNA 3NXZA 1Q0NA 3DU5A 4U7CA 2HHUA 1WACA 2VL1A 3DKDA 3L4BC 4X4UA 3GYXB 1YBTA 2OJ3A 4H4OB 4RUHA 2V9WA 3WC2A 1YJUA 4PQUA 2DGXA 4N8NA 4O44B 3CJSA 1EETB 3BGUA 3HJVA 3QATA 2NCKL 4PKDB 1TL3B 3TAMB 1REVB 4CLZA 2E1RA 2ZC3A 5L39A 2AMCB 2WVFA 2CJBA 4X84A 1OS5A 1FVQA 2COLA 4GVBB 2BE7D 4ALZA 1WC3A 1HNZJ 3OXFA 3KHLA 2QLFB 3AODA 2C3PA 5H9FJ 3HHDA 3R9LA 3G86A 3QMQA 3G8QA 1TQLA 1AB8A 2KRRA 5F8IA 3ZO7A 1R0BG 3M2RA 5GAHI 2Y8WA 1CS4B 3IWLA 3GJSB 2XG8A 4DSKA 2YWGA 3MTKA 3OLBA 1R89A 2HVEA 1KN6A 4CNZA 4YS2A 2FVCA 4F2SA 4N56A 4PWDB 2DR7A 2LXFA 1I1GA 3H5SA 4KH0B 4HEA9 2GVDA 1E6YA 1FX4A 3TEHB 2DBBA 2ZKUA 4URQU 1VMBA 4DPTA 1CEZA 1FJCA 3C2PA 3AAWB 4WIIA 4CT8A 3EX7B 4U9RA 5KFFA 2HSEB 2B4OA 2BANA 2RU9A 4DV2J 1RLDA 2V67A 4ED4A 2J6UA 1JLFA 4OYOA 1HW8A 2LP4A 4FYWB 3LPYA 3DU6A 2RUSA 4OV6A 2V8GA 2AYMA 2UUWA 1N5YA 1D8ZA 2GX8A 1HQEA 4ECVA 2VODA 4ECZA 5IV3A 3QWPA 1ELOA 5CD4A 1R0CB 3KHHA 2OI2A 5L9XA 5CD4H 4LF8F 1ZPWX 2W9AA 4URGA 1TFYA 2HS0A 2MZJA 2QIFA 2YKNB 1X4HA 1Q81T 3W1YC 1TTHB 3D7SB 3FFIA 3BB5A 1YG0A 3QJPA 4PYDA 2IC3A 2JL9A 3M32B 2HHSA 1SL1A 3IRXB 4NA1A 4YDDB 1IKVA 2EK1A 1F3FA 2QYCA 4LR8A 1EP4B 3S8SA 4J9VA 3PYDA 3BBCA 1R43A 3G6ES 3OFHA 1HHTP 1ZTTA 1S6QB 2CQBA 1YZ6A 4QWBA 1QSYA 3AD8C 4ID5B 4ZPDA 2BJEA 2C3OA 4TVAB 3KK2A 4OFZA 4DCJB 2UVUA 4DOZA 2RJZA 3MCSA 4OJHA 1ZA2B 3A8KA 2VC1A 2PFFB 2RHQB 3DDIA 3W8GA 3O1LA 2KT5A 1XMOF 2XZTB 4P72A 3R1HA 2J8SA 2CPZA 1RT7A 5CYQB 4IH6A 4Q43A 4NZ7A 5ETQA 1QVGR 1UFKA 1ZETA 4ZJOA 1FJEB 1XERA 1WKLA 1NJYA 1VCTA 3QLHB 3CJTA 3K5PA 3TA0A 3RBEA 3K7RA 4C2MA 3VF0B 5KFXA 3AT1B 5J2MA 1BUXA 3QAEA 4ZVGA 5KG2A 3BH7B 4PPZA 4TXSA 3C3LA 1FNOA 2XY5A 2KG0A 2JEGA 2JX2A 3ZC4A 5LOQA 1RTHA 4ZPVR 2UU9J 4V19J 3OR2B 2V2KA 1YJNS 2BR0A 3KDOA 3H5UA 4NCAA 1NSQA 1HQ2A 3AHPA 4ANCA 3LP1A 1RAEB 3NBPB 4ELUA 4LF1A 1ZM2A 1YBUA 2HGNA 4B9UA 2WZ1A 3ISND 3BYRA 1GX5A 1I5OB 9ATCB 4JI3F 5B08A 2VBZA 4H4OA 3HHKA 4X62F 4I1TA 3SV3A 2B7CB 3PZPA 1RYSA 4O44A 4B3OB 2HS4A 2BEFA 1TL3A 2XI3A 3TAMA 3TNVA 5LJ3Y 3B82A 4ECYA 4CO0A 2C2ZB 1REVA 5IXUA 4PCQA 3TO8A 3UD3P 1Q7YT 2J76E 1Z4UA 2GGPA 3H4BA 3SZ2A 3QBCA 4P2XA 4IH5A 4GVBA 2W4DA 2HMIB 4DSIA 3PX6A 3EGZA 2M8HA 2KT3A 4BDPA 2YY3A 2CPEA 4C0BA 3DLJA 2MGZA 5LJ5Y 1RBOB 3W65A 2YKPA 2GJFA 1S1UB 4NLPA 2MQNA 1OYEA 1GMVA 1CS4A 2M5YA 4CLLA 2PN6A 1AW0A 2EFQA 1VC6A 4R5PA 2DXEA 1VGYA 3R2CJ 3T6BA 3FEYB 4WU2A 3T1HF 4PWDA 1PAUB 4IDKB 5A76A 4GRSA 3BM7A 3MDFA 4JBCA 4F50A 2VKRA 1C4CA 2VOOA 4LREA 4U96A 3I6PA 3MM8B 5FDLB 2J0SD 4IRKA 2OUGA 2K06A 4OV1A 2KTQA 3JQJA 2GO9A 3IGVA 4DQSA 4CLSA 2YQ1A 3BEGB 1AA1B 1FEHA 3S01A 4P10A 1RWUA 1JLGB 4QU6A 1RQ0A 3Q22A 1NHUA 3D6MB 3QT7A 2XCPA 5CCMA 4TU7A 1Z1ZA 1DBDA 2XHCA 2OEJA 2RF2A 4OI1A 2MKKA 5ETVA 4C98A 1EB0A 4ZLJA 3WIVA 2AP6A 2C28A 2F8EX 4WFXA 4NPOA 2HBRB 2I6WA 1N34J 1HWUA 4RBVA 3EZUA 1EIYB 3MAAB 4IO9Q 2MJUA 1JLBB 1QAXA 3M32A 3I55S 2G0IA 1Y5NB 3LP2B 3DFEA 4PWUA 3BO4A 1EP4A 1N33F 1JLAB 2GQ2A 4DL4A 4DR2F 2FJVA 1AFJA 4ED3A 4CO4A 5KT5A 1JNZB 4LF2A 2H5EA 2EK6A 3MPUB 3THVA 1BQXA 4RWWA 2AGOA 2ZEJA 1KLNA 4F67A 2QLWA 4ID5A 3ZTPA 1U6BA 1RT3B 1KQKA 4F4ZA 3QPIA 1ZAVA 1XJWB 3I96A 1B7YB 4GVLA 3ILIA 3ULHA 3AOBA 2F8HA 3H59A 1T9XA 2ZDPA 3UQSA 3SSSA 4LF8J 3M8SA 3ZXWA 4DPOA 4DL0C 4LF6F 4ED2A 5CYQA 4L75A 1UJ4A 4JYAF 2MKSA 2BQRA 3O8WA 4PXCA 3J80Y 4DX7A 5K5MA 2HHVA 4P7TA 3QLHA 3K58A 1F3VA 3KKFA 4C8LA 1NU4A 2KYXA 1W2IA 3GCXP 4UTGA 1PYTA 1FRMA 3H2UB 2RDJA 4USKA 4IH7A 2V6AA 2NUHA 2A2CA 1S1TB 4K4SA 3SFUA 4FDFA 2IVFB 1N56A 3CGIA 3M8PB 2CDRB 2YH1A 5LL6d 2RHSB 2FB0A 1H7XA 1T11A 4MT1A 2ZH1A 3CJKB 1U8SA 3E51A 4NWBA 2ZUAA 5T7LB 2IHR1 4FKXA 1DARA 1TAQA 5T14A 2HZCA 1JLEB 2XHWA 1NHVA 3T19A 1TMMA 3MF5A 3NBPA 5CAAA 2HHXA 2DEIA 1N5SA 2QYGA 1VQYA 5AE3A 1SIWB 3HZGA 3W5ZA 4ZN3A 2QA4G 4QQBA 5DM6Q 4PYAA 4FXVA 3H0PA 2HVZA 3ETMA 2ZVSA 3G6XA 1XMOJ 2DNQA 2YXLA 2HFSA 2CPHA 1SC6A 2ASYA 1Y3KA 3N6NA 4OX6A 2HFNA 4RUCA 3V4MA 5K8PA 4B3OA 2HPUA 4UW2A 2ZHAA 1H0HB 4Y00A 3IM8A 5GADI 2AEJA 1PSDA 1V9OA 4CM0A 3PYEA 4JI1F 1RBLA 4ED5A 5KFRA 3EXYA 3GP9A 5DDQC 1AUDA 1KONA 5L8RC 2HNZB 3SCLE 4CWBA 2FTRA 1KRPA 4IUFA 1YJVA 1JKHB 4DZDA 1XQIA 2AHOB 4BHQA 2WONB 2HMIA 4ZPTR 1ICEB 4KC5A 2YWHA 5HMZA 3CO0P 3W5YA 4K4YA 4I67A 5A8KB 3HLUA 4DCPB 2XLKA 3GIIA 1UAWA 2MLZA 2P9CA 1U1LA 4KE5A 2A1BA 3BGRA 4PABA 4DL7A 2CQDA 2HZAA 5DGBA 4O23A 2YKAA 1S1UA 4WFNQ 4KY3A 2HBYB 1KC8T 4WTYA 2YKMB 5LMUF 3L3CA 1UJ5A 4JI3J 2PIIA 1ACMB 4X62J 2E1MC 1TK0A 3ILLA 2OFGX 1WHXA 3BPDA 1DRZA 3HP6A 3HHLD 4MKAA 2DNKA 2HW3A 4IDKA 2BOAA 1M5SA 4ZMMA 2VG5B 3DLLQ 2XLJA 2DHXA 2ZBQA 4EBEA 1HWJA 3MM8A 3RU0A 5J2NB 5FDLA 2CJAA 1C1BA 3UFCX 4K50A 5H9EJ 1FFWB 1Q8IA 4YOEA 3UDEA 2P9GA 2ZJRQ 4P2MA 2H48B 3SCKE 1JLGA 2LMIA 3RUBL 3GV5B 3IP0A 1VQ7S 4DU7A 2V0NA 3DOKB 1VR6A 4KSEB 1NZAA 2IA6A 5GAEI 2WK4A 4ZOSA 3GTYX 1PYSB 3T5HA 4FPRA 1YX2A 3TI0A 4YUDA 2L9DA 1K8AT 4CH0S 3KXDA 2PEHA 1K44A 1NPPA 1CBKA 2M52A 3MAAA 2FHJD 1UZHA 1JLBA 1H6KX 1RAJA 1HD0A 2F9JA 9RUBA 2DH9A 4JI4F 2GAHC 3T1YF 3LP2A 3HFVA 3VGTA 2F3JA 1JLAA 3EWGA 1N8RT 3HPOA 2MY7A 3TP2A 5DZ6A 1T0TV 4M5JA 3H8YA 1IWAA 4I6WA 5KT3A 4NYZA 5J1NA 4DUTA 5KFGA 4QYZJ 4F36A 2PMZD 2C2NA 2AEFA 5KFWA 1TKTB 3MURP 2MZ1A 3V4IB 4P2FA 3OFGA 5BR8F 2UXDF 2OAUA 5CABA 3LAMA 4RL1A 1M1GA 5KFMA 3K8WA 4PUOB 1JK9B 2MTLA 1HBUB 2RQ4A 3PV8A 4LRCA 1KFSA 5LSOA 4QCLA 1RT3A 4ZLLA 4MYUA 4GKKF 3D6HB 1S9EB 1KOOA 1X4GA 4NYOA 2Y0SD 5E41A 3C6UA 3EGNA 1U6FA 2R2RA 3O2IA 3CULA 1UFLA 3TYTA 4OI4A 1SC3B 4U8VA 2R4FA 3IO1A 4C4WA 1P1TA 1OY6A 3KFWX 1RHKB 3CXCR 1ZPVA 4NLRA 2MKIA 5DETA 2FC8A 4NYPA 5JVHQ 3O6QA 2HFUA 2M7SA 2Z0GA 4EO8A 1N33J 2DKOB 4NMXA 3GIKA 3KG4A 1YK9A 1Q7LB 2B43A 1EQ0A 3BBFA 1UWBA 4DR2J 5LM7E 2GV1A 2Q66A 3O5TB 1S1TA 2G9OA 1GTHA 3OV7A 2PDAA 3M8PA 2ZKTA 4DR6F 2YNHB 3Q8VA 2LDIA 4CIOA 5D4NA 2VPXB 4Y2MA 3CJKA 5IT9Y 5T7LA 4OZ5A 2RQKA 3QGIA 4JI6F 1NRKA 3E8OA 1JLEA 2AGPA 3IC1A 2RU3A 3A8JA 2DJWA 1R6VA 3O3LA 4O0IA 1TAUA 2NQPA 4RKUC 1Y7PA 3HO1A 4LF6J 2CA9A 1H2VZ 3OTEA 5ETPA 2BJ8A 2DNOA 2LU2A 4RW7B 3KYLA 2VC0A 2BDPA 4JYAJ 3B4DA 2RIJA 4KB7A 1RBAA 4KFBB 2R8IA 1O6XA 1X9WA 3UVJB 2QC3A 4A4JA 4DV0F 3R6GB 1SVDA 2F40A 3ILOA 1OPZA 2FY8A 1NLKL 2RS2A 1XEZA 4R0EA 2HNZA 3KNGA 2EG2A 4IFYB 4F4YA 4F4WA 4MTPA 3TWZA 5DDRC 2QA4S 2QX0A 4KPYA 3ZNUA 2WONA 2BVZA 2KB2A 2YWWA 2EFVA 4K8RA 1QE1B 2E5HA 2XSJB 3SCJE 4DPUA 4IYQA 1RE1B 2Z57B 2MZSA 3GFXA 2QLBB 5ETSA 2IJFA 2ZC4A 3CNQP 4N41A 4NXNF 3A3NB 4Q2LA 4TQRA 2CVEA 2K2PA 4HACB 4HL9A 2AF6A 2BW2A 1HL6A 2CJQA 3PRDA 4Q8EA 2VG7B 3U1NA 2QMUB 2QSWA 3C66A 4QWDA 2NXCA 3DNCA 3QT8A 2PA3A 4KBIA 4N77A 5JUMA 3EDRB 4QIVA 5T41A 4CP5A 3OJSA 2VG5A 3QQCD 1PJ6A 1F9EB 4JI1J 3OVAA 3NRBA 5J2NA 3IA0A 5D0GA 2LQJA 4HYKA 2IRXA 1FRLA 2BV3A 4KTQA 2QEXS 4RR5A 1SC1B 1DHMA 5AXKA 3OTDA 2ILZA 3ZZYA 3JQMA 1YJRA 4DLGA 3MD3A 3OSPA 1VISA 2AJQA 3DRSB 1XN9A 2QA1A 2J0WA 2DNPA 4DR1F 4O3SA 2DR8A 2IVMA 4G1IA 1S9GB 3DXSX 3DOKA 3PHTA 2RRAA 3BH6B 1Y5LB 3IG1B 1FRJA 2WBRA 3AD7C 5LMUJ 4PG6A 3A8EA 4J91A 3DOLA 3HVTB 4WJBA 4IR1A 4B9SA 1UA0A 1TMJA 5GAGU 2XYHB 5HJXA 2ILYA 1JMTA 1QSSA 1NDPA 2VPYB 2QG9B 1NSKL 3PEJA 2HS3A 4E8UA 4KHPF 3FQLA 1B0TA 5I42B 4DV3J 3IR7B 2QFIA 3CDAA 4DF8A 1VBXA 2F7VA 2FVSA 4OYAA 1TKTA 3V4IA 4DEZA 1TL1A 3F56A 3CD5A 2RILA 1BLUA 1I3OB 2BRKA 2E5GA 1IXKA 1M0SA 4LMZA 4EI2A 3UN5A 4PUOA 3HD2A 2UUAF 4KKOB 1HBUA 3F44A 1VRQC 4OHVA 1S9EA 4KHRA 1FWLA 3T5LA 1T05B 4W98A 4QW8A 2OD4A 2HHTA 3AJDA 4PG5A 4FXWA 1UVKA 2HQIA 5H9EK 3MCOA 4WZQA 3W5XA 2VQFF 1ROFA 4BCAA 5J2PB 2GC8A 1FE4A 4Y65A 4DV4F 1WF0A 1X7VA 3CC7S 3OBIA 5HAOA 3QSIA 3QT5A 4EWTA 3BO3A 4JI4J 1LFWA 1O51A 3QGPA 3MCNA 1HYSB 3MTJA 2G13A 1FI4A 4LSZB 3BSCA 4PG4A 1U48A 2CJKA 4FBUA 3QIPB 3SCIE 1D0EA 2J8AA 3NL0A 1R7IA 5BR8J 1IWGA 3DLBA 3I32A 4OYIA 4K2JA 5HBMB 1TZ0A 1FXRA 3KJNB 2OTLS 1U4BA 2YNHA 1L3VA 5U47A 4RPFA 5IWAF 1YRUA 2PT0A 3H5XA 2J7UA 3BV8A 2B8QA 1DY3A 4GKKJ 2KN4A 3BGOP 2FVQA 1JWWA 2F4VF 4KGXB 3DRRA 4J90A 2ADBA 2A6MA 5HJYA 1VLOA 2GW8A 2BJ9A 3PG9A 1TU0B 1VBYA 4P2SA 4H4KC 4J9SA 4QYZK 2NZ4A 2V68A 3NGKA 1YDLA 4RW7A 3TX8A 2WW8A 1S0VA 4DFPA 1B70B 4HDGA 1SQFA 1TV6B 2Z4PA 2FIUA 3UDCA 5JJBA 4KFBA 1CC7A 3ZZ0A 1ZOTA 3UVJA 2M9KA 5L1JA 4ECQA 2XWXA 2XMWA 3T41A 2N7CA 4F8RA 3MI7X 4DMZA 2ZHBA 4B02A 3RW7A 5CH7B 2ZH8A 3HSJA 2QA2A 4EU0A 2N3OA 4EGLA 2GVZB 3BZQA 5CHCB 4DR6J 4ENOA 1LXJA 1QE1A 2XSJA 3CCUS 2R7RA 2R42A 5MLCV 1KTVA 2YPZA 4JI7F 1T03B 4JI6J 4A47A 2Y1JA 1Y00A 3CJ0A 4YB6A 2W8LA 2C3UA 2V8PA 2BE9B 3Q2SC 1CJKB 3LWLA 2P5VA 1K0TA 5DJBA 4R8UB 1NB7A 1P9YA 3JTNA 2VG7A 2DNRA 3I56S 2H4WB 2OHDA 4DV5F 2I1RA 4QWCA 4DR4F 2OPQB 1XWLA 4ZVUB 4XO0A 1WDDA 4MMOA 2V2ZA 2HZVA 4USVA 3NWGA 2GHPA 4DV0J 4M5NA 1MLAA 2C2KB 1HWKA 4O3NA 1HA1A 4AL6A 5LMNF 2E5LF 2MEWA 3IBCB 1WNEA 1S97A 3ETOA 2V9KA 3I0SB 3I5AA 3PO5A 3OXLA 4L6V3 3KLVA 1SV5B 4O3OA 3RYLA 3UCZP 3OHBA 1N0UA 1FA0A 2ZUGA 4H4KA 3DRSA 2O5DA 5AJ3J 5KFKA 1L3TA 3J81U 1S9GA 1SKUB 3OLAA 1LW2B 5K8NA 4X4OA 4OYWA 1FRHA 1HNIB 3ELHA 4HH0A 4NXNJ 4MAKA 1AYEA 3HT0A 2KFZA 1OYDA 4MK9A 2LQ5A 1M5OC 1S10A 3HVTA 1CQMA 8AT1B 4ZVPB 3PYGA 2Y9HA 5J1PA 1WTFA 3LGNA 3TVZA 3CSKA 3V6DB 2F8MA 3MAHA 4PXBA 1NUEA 1T3NA 4X66F 1WDTA 2HQGA 3HKZD 2BZ2A 3OSNA 1VHFA 5I42A 2Y1IA 1OIAA 1R8PA 2F1FA 4C8KA 2CUYA 2VB6A 2DNNA 2H3EB 4OJ3A 2H54B 4J9PA 3W7BA 2Q3PA 1KQFB 1FHTA 3FGVA 1RA6A 1KQSR 2LEPA 2VJVA 4WWSA 5KFBA 3GILA 1QUPA 4USJC 5D78A 4C8YA 3O44A 4DR1J 1F5AA 4KKOA 2R8GA 3CO9A 4DU8A 2NLWA 4HTJA 2AQ4A 2HQFA 1T05A 3K8VA 5HK4A 1RACB 5C42B 1RT4B 3FSIA 2W2QP 3CMES 5HVGA 3HSZA 1KVIA 5ETLA 1X4BA 4KGZB 1U26A 4B08A 3K59A 3PRVA 2BOPA 2LCWA 3AA8A 4ECUA 3D68A 3MGJA 5D77A 2CQIA 3PFEA 3C15B 3PRBA 3PVXA 2FLLA 2XI2A 1RLCL 5HANA 4BC7A 4DUZF 3FCVA 2OMLA 3GIMA 4KHPJ 2HQCA 5F3ZA 1H38A 1MROB 1NPKA 2HEKA 1L3UA 2PGCA 2CQCA 1HYSA 2E9ZA 1IJFB 1YRXA 2C2MB 2G2OA 3QIPA 5G4DA 1JLCB 2D41A 4YB7A 4Y6IA 2XS5A 5HBMA 3CF5Q 4YR0A 2JOQA 2AU0A 2WW4A 4LF9J 1KWMA 1AROP 1ZZFA 2UUAJ 4C3LA 2W24A 2CZ4A 4RBUA 3VAHA 3D3BJ 4UZBA 5DQHA 2WB4A 3D9BA 3JAMU 4LFCF 4KQZA 2V63A 3KLFB 5GMKa 4JI5F 3C6TB 4IQXA 3DLEB 2GCFA 3SQOP 1CPZA 5DG8A 2EPIA 3W9HA 4ER8A 2DK2A 2VQFJ 3VTIA 5HMYA 3W8PA 3QGHA 3MM9B 3G6VA 1FJ7A 5HATA 1FD2A 2HIYA 1IR1A 2XYGB 4DFJA 1U0HB 3HSGA 1DTTB 3THTA 4IRDA 1HLWA 1RWNB 3HX9A 3M9OB 5KFLA 4CLWA 2OPSB 1RDRA 1TKDA 4WIQA 2FLPA 2XY7A 4F4KA 2A3JA 5DO2A 4F02A 1GQEA 2Y3YA 4Q7AA 3Q8YA 5CYJA 3MM6B 3R5AA 3HM9A 1VFJA 2GVZA 4K4TA 2CWXA 2E9RX 1L3KA 1W2BR 1NK8A 4I4BA 1U1MA 2XO6A 4B3SF 1UVJA 1UVNA 2Y8YA 5IWAJ 1LEOA 1T03A 4I2QB 3M6UA 3IBFB 4MKVA 4NA3A 4ZVEA 4NOHA 2OTJS 4DWIA 3DGPA 4W4MA 5E3CA 2Z58B 2F4VJ 1CJKA 3N4WA 5DDPC 3U1LA 3MM7B 3ZZRA 5F8JA 2GMLA 1SH0A 2RNEA 2F63A 5I3UB 1RI7A 4R8UA 5E3AA 2CFXA 4IOCQ 3FNNA 1MWQA 4J9UE 4RW8B 3LANA 2OPQA 4RUBA 2QV6A 1SQGA 2XMAA 3CDWA 2FD2A 4XTTA 2W4CA 2CQPA 3M8YA 2IVYA 4OI0A 2FJWA 1QAYA 4P74A 2ZH4A 1OWXA 1DLOB 5DLGA 3G4SS 3SYZA 2IMWP 1S48A 1BD6A 2ALZA 3I0SA 1T8EA 4USMA 4QIEA 4JP8A 1SV5A 1B4SA 5L46A 5EDWA 4Y3CA 5IC4B 5FIIA 5B0EA 5FD1A 1WF2A 2YNIB 4NRUA 3NGRA 3PACA 1Q16B 1U25A 2L9NA 2DHAA 3HD1A 1LW2A 1WG1A 2SXLA 7FD1A 1HNIA 2DCLA 1S1VB 2XCAA 2D9OA 2CQHA 1LWCB 2OFHX 2HRYA 1E6VB 4X4TA 4F04B 2HGLA 4FYYB 5EWGA 3HDSA 3ZZPA 4QR2A 3CDBA 4DV5J 3J7A1 2CQGA 3R8YA 1RYRA 4DS5A 2CJ9A 1H72C 1C2PA 1RB0A 3V6DA 3MWBA 1QTNB 3PHEA 4LIWA 1PO6A 3V6HA 5KG0A 5J1EB 3PKYA 4ZVSB 3TJAA 5L9NA 1OQ3A 4DPWA 3QFHA 3OD2A 4OX9F 2AJ1A 5HI7A 1PBAA 1NBEB 5LMNJ 2E5LJ 1K1SA 3VVUA 2FHOB 2V8VA 4HLBA 1VQ9S 2XNRA 1RT2B 5KG7A 4RZRA 2L41A 4FZVA 2JEFA 1NK9A 3QJJA 1EHWA 2GZOA 2F65A 1PIEA 1IKYB 2ADCA 3I87A 4ZK7M 2F4FA 3OJUA 1A0OB 2K1RA 1FCAA 2NXUA 4M95A 2VFRA 3MEDB 3GMGA 3PR5B 5HMXA 5C42A 1SJ4P 4IRCA 1RT4A 3PCOB 2OPRB 4RBTA 5C2GA 1JLQB 3PIPQ 4C8OA 3P4UB 1K0VA 5KT2A 3K89A 4OJGA 1NO8A 1N36F 1QVFR 3M30B 2ZE2B 1CQNA 1NK5A 2PEBA 3PNIA 2HFZA 4OLPA 2AZ3A 4DV2F 4TU9A 2ZH9A 2B4VA 2D7SA 4X66J 2C22A 1Y10A 2FLOA 2FJEB 2LQ9A 2E9TA 3NMRA 1MROA 4UF4A 1NJXA 4KYZA 2JZ5A 2Z2MA 3AXKA 2RSQA 4UOGA 2DNYA 1GNKA 1JLCA 5LXRA 3OXGA 2B6AB 2HNDB 2W2OP 1IBKF 1VBKA 4KT0C 1S0MA 5LSLA 5GADU 4F3MA 4DSFA 3CWJA 4A8KA 2X1GA 4J9MA 1S12A 3DLKB 2AGQA 3KLFA 3C6TA 4LR7A 2CVIA 4NXMF 1CVJA 2BMBA 1YLXA 1U8WA 3MM9A 5FJ4A 1VQ4S 2DY1A 4FF3A 4NLTA 3LAKA 5KFDA 3PO4A 1U0HA 1LK5A 4DUZJ 1DTTA 2JDJA 2HHQA 3TJ8A 2DNLA 3QAUA 1N5QA 2OPSA 2W1BA 1SH3A 4FVCA 4WBFA 3LP0B 3OL7A 3CCVS 2POKA 4J37A 5F8HA 2HHWA 2DPIA 2OPPA 2R2TA 2PI4A 1IQZA 2CG4A 1FDBA 3DHWC 4YHHF 1NZ8A 3MM6A 3OFFA 3TQEA 3TR5A 4TY8B 2JH3A 1MG7A 2QL5B 2V4QA 1U09A 5D4OA 1V5IB 4YB1P 4I2QA 4PQAA 1WHWA 3IS9B 1I94F 4R0JA 4AE5A 3KLHB 2DNHA 1IKWB 2J6TA 1JJ4A 1TR0A 3P5TL 1ZM3A 3NKYA 4CNYA 2XY6A 4LFCJ 1WOOA 2UUTA 4JI5J 4GC7A 3MM7A 1A6LA 4ERDA 5I3UA 1H73A 3QNWB 1UEKA 2VFTA 2B9XA 4I2PB 3BSAA 2YVSA 3D28A 2AWZA 2JRSA 1XR7A 4RW8A 2CPDA 3DC2A 3OW2R 4I68A 3IAS9 1HI1A 3ZTQA 1RHJB 4OJ1A 2YX7A 1DFDA 3TAQA 3L95X 3RAQA 5SZTA 1Q8LA 5GAEU 4QPTA 5K14B 3HK2A 1DLOA 3EVWA 4USTA 2BX6A 4HKQA 2A10A 2C2RA 3PW0A 4FYDA 1RU1A 3PW4A 3DOMB 1KVKA 4AL7A 2DHGA 1O8BA 4NRTA 1SQEA 2IM0A 4CLKA 3BQ2A 4B3SJ 1UMJA 3MEGB 4ECSA 2NYHA 5E3RA 2A6OA 2YNIA 2NS1B 3FDSA 4A8FA 2XWYA 4EO6A 4M5LA 1YI2S 1DTQB 2AW0A 2ZBPA 2H5IB 1MMNA 5CA5A 1S1VA 3EVOA 1LWCA 1E6VA 3GFZA 5L1KA 3Q23A 1GK8A 2ZFHA 1SIZA 3W60A 2OGUA 1S72S 3SQGB 1G1XA 1LXNA 3GJTB 1RTDB 3GJQB 3S7RA 4JOUA 3LTOA 2AJ4A 5J1EA 2VBXA 4X4RA 4F26A 2XMUA 2DGSA 4ANDA 4MK8A 4QBUA 1AXQA 3M2VA 4A46A 1RT2A 3PR4A 1XR6A 4FYVB 4DBQA 3VV2B 3M8RA 2VASA 4JI2J 2KG1A 1EKRA 1NNDA 3B54A 1FKOB 1SJRA 2RS8A 1WEYA 4E98A 3W63A 2FVPA 2CPFA 4P7VA 1FJGF 1ZBTA 3P96A 2BJ1A 3D67A 3BQ1A 3I82A 3L7UA 4RW6B 3LALA 2OPRA 2VPWB 4DX8H 5B0AA 4FF1A 3ICLA 1OSCA 3M30A 4GC6A 2G1HA 2ZE2A 3AQPA 2MKYA 3WZ0A 2B4UA 5A2QY 4DL2A 4NX9A 1QJHA 1FTRA 5D3GB 5C24B 4OZ3A 3Q86A 2D69A 3ENQA 4OX9J 2WRMA 4U67Q 1YGYA 3MZIA 3TA1A 3PJWA 3FRYA 5SUHA 4M63A 3FMWA 1BC6A 3N9UC 5KFSA 3E3XA 2HNYB 2XZDB 4PAAA 1VK3A 4WYWA 2HQDA 2VH7A 2B6AA 1C0UB 1WG4A 1IUJA 2HNDA 4F25A 4LBIA 1N34F 1SKRA 3AJ2A 3FBFA 1NMEB 2EKNA 2KRBA 3IMQJ 2VKZG 1HNWF 4B3MF 1V6HA 4NLXA 4FKYA 1FNXH 1I51B 1ZS6A 1U1NA 3DLKA 4K2XA 3TRGA 3BBBA 2DIVA 4XPCA 1NDCA 3A8IA 1R3NA 1U1RA 2WVCA 4UY85 4G1QB 2EKYA 4JV1A 5BYSA 2Y0BB 5GMDA 4FNHA 3NAIA 1VQMS 5EUHA 1N36J 3OTCA 3KTQA 1VC5A 1NH8A 2XMTA 4B9TA 4CO2A 3NWRA 1X4CA 4CH1A 3TVYA 3D0GE 2DRDA 4RW9B 1ZA1B 2NPIA 2XS7A 3PJXA 3LP0A 4LF4F 3GYNA 2EFOA 4ED6A 1U24A 3IBWA 2AEMA 3VAKA 1NKEA 1UPPA 4ZPAA 3T1AA 3MECB 1IN0A 1UEVA 3M6WA 3OQ2A 3T3FA 4TY8A 2FHMA 1R8CA 1BHNA 4JI0F 3MUTP 1IBKJ 2C2EA 4AT1B 2VUGA 4IOBA 1FDAA 3SMZA 2B7BB 3IS9A 3FMBA 3KLHA 3CTRA 3DDKA 1IKWA 4PZVA 4XK8C 2QLJB 1QTMA 5DQIA 1B99A 2MKHA 1NSAA 5KFZA 4N5SA 3NOCA 5HSPA 3ZZTA 2VG6A 1W7WA 5IM0B 2ERRA 4NXMJ 2W7AA 2DRBA 4LFBJ 3CJ2A 2IDLA 1BQMA 4I2PA 2DVIA 8ATCB 3RRKA 5FLXU 3IR5B 4WK3A 1IR0A 3W64A 4BLGA 3H42A 4RUAA 5C5JA 1H3DA 2HWHA 1CJTB 5HROB 2GIQA 2R7WA 4QIFA 3D1HA 5HO4A 1X4EA 3KLEA 2E7VA 3V81B 2HAIA 4PG8A 1G2EA 4PRFA 1S1XB 4K4WA 3OVBA 2VOPA 3FSYA 4OYXA 2EEYA 4C6AA 3M1VB 2IY5B 4YHHJ 1RADB 2R8HA 2KT2A 4FNIA 2Z2ZA 1NKCA 2GJIA 1TL4A 4ID8A 2B9EA 4LF5F 2LEBA 2AIRB 3MEGA 3QYYA 4USHA 4U7UK 2R9LA 4MK7A 1LOUA 1I94J 3POTB 3PTWA 2IBKA 4K7QA 2B3TB 1DTQA 4P9SA 2IMOA 4JI8F 1T94A 2DIUA 1NK6A 4V19X 2XBPA 4B3RF 1HQUB 2XNQA 1VRUB 5BXIA 2GS8A 2YWFA 5M2RA 2MJNA 4I6YA 3DRXA 3SQGA 1RTDA 2Q6CA 2ZZTA 2R8KA 1GXLA 2DPJA 3EXCX 3W2VB 2V69A 3UR3C 1HARA 2KXHA 2PMWA 4ZVOB 4CI0B 2QL7B 4CDIA 1QUVA 2PA8D 3RAMA 3LWMA 3HVRA 4WP8A 2F9DA 5C2CA 2H4YB 1X5OA 3W66A 1O5JA 1NK4A 2BKOA 4PXEA 1DZ5A 4KIAA 2MQOA 1Q79A 1T9YA 3LOUA 2NXNA 1J27A 2WSEC 3MMJA 4DFMA 1X5SA 4WZMA 2O01C 1R0AB 1EETA 1RABB 3UWTA 1FKOA 2IA0A 5IOLA 1GX6A 2X7IA 1I6JA 3MOZA 3RR7A 4EZ9A 2C3MA 1UZDA 3R1LA 4RX6A 1J5EJ 2UVVA 3KMQA 4I69A 4ECRA 1XR5A 4RW6A 1D1UA 1N5VA 1ZZNA 2DXDA 3BS9A 2OD6A 2B51A 2JFDA 3AA9A 4UT4A 2DHSA 3HFZB 2VFUA 3LF0A 3DM2B 3UCGA 5A6WA 5D3GA 4BWMA 3NNHA 5F8GA 4HT7A 4MIAA 5C24A 1AZSB 1FRIA 1FTCA 3MMBB 2LLZA 3R7NB 4DS4A 5CXTA 2HGMA 2HNYA 1S4EA 1IVZA 3FK4A 2Z56B 1R8BA 1Y4ZB 4ATNA 4QJVA 3OR1B 2UVRA 3DCAA 3MFHA 1C0UA 5KFYA 3AXMA 4NLVA 3RRHA 2KI2A 3TANA 2KL8A 4ZVTB 5E0OA 3A3PB 2ROGA 4NLGA 3GG0A 1FJGJ 1GMWA 2MQPA 2EG1A 2I5JB 1H98A 3RBZA 5ETOA 3M2UB 4Y2IA 2HFVA 4FS2A 2L08A 4G1QA 1P8GA 1GH8A 3BN4A 1HI0P 1TKXB 1Q78A 3K5MA 4OHZA 1VJWA 4O4GB 4ZDNA 2QE5A 3BGFA 4K4VA 3F41A 1WC1A 3WX8A 3QIDA 2AKWB 4RW9A 2H65B 5DG7A 4ZCIA 2U2FA 4ELTA 2J0QD 2GIFA 2E7XA 2A2DA 4P52A 4GKJF 2RH3A 3MECA 2X3GA 4OZ2A 5KT6A 1BE4A 4C0OC 3NMAA 4OI2A 2QN6B 4L74A 2YKNA 3VHQA 5K9FA 1NDLA 1Y0HA 1MU2B 2M2BA 2HAFA 2NXJA 5F41A 3TZZA 1HNWJ 4B3MJ 5C25B 2OLWA 2MDAA 4EBCA 2ZH7A 1YITS 3CCRS 2I2YA 3IRXA 4P71A 4C97A 2OIHA 4XDCA 5DG9A 4YMEA 4DV6F 4BS2A 1Z2ZA 4JUZA 1RT5B 5IM0A 1RCOB 5GMEA 1NJWA 4YN3B 4ZA1A 2JLGA 4ZP8A 3HHNB 2XTJP 1M5PC 1S5ZA 1FKPB 2DD8S 2MQLA 1XNRJ 4PQUB 1S6QA 3MM5B 4NA2A 5HROA 3DXBA 2WVDA 4IFVB 4KPCA 4QWAA 1W25A 3ILJA 4HH1A 3V81A 3MOJB 1F1BB 5B0BA 1LV5A 2EBEA 1S1XA 4ZLPA 4RLEA 4LF4J 1FERA 5B0FA 2A0FB 1T9VA 5HVFA 4NI2B 3CCES 4OI3A 4CLTA 3KNAA 3M1VA 2BJ7A 4HHJA 2UVWA 2L3MA 2M0GB 2LFVA 4JI0J 4WFZA 1SCJB 2YKQA 2MLYA 4LRAA 1TK5A 2I8EA 1KKHA 1RAOA 4H4MB 2ZWPA 1D9FA 3IR6B 5HQMA 2ABYA 2WVBA 3POTA 3W9IA 1SUQB 3D4JA 2GIRA 4NCGB 3KUHA 2W2MP 3MMAB 2BQ3A 1WD6A 4UUXA 3W3SA 1S9FA 1U1PA 1LWEB 1HQUA 1HKAA 2EFGA 4Y28C 1VRUA 2BM1A 2W2NP 1GMUA 3RJMB 1C1CB 1KHVA 4WYLA 2AD9A 1FESA 1RWPB 3M6XA 2CPIA 3W2VA 1KQGB 1SC4B 1URRA 5A6PA 3WDOA 3OR2A 3TZYA 3MPVA 4B17A 2W7OA 2UUCF 3W62A 2ZM6F 4NLQA 5A8RB 1WC0A 4YY3F 1OSDA 6FDRA 3F0NA 1NHKL 1BWEA 2CQ3A 4DL6A 2O66A 2IJNA 3CD0A 5M2UA 2M3DA 2FJXA 2DGOA 1QD1A 4LF5J 3HXMA 3P6YC 1WEXA 3TARA 4X65F 1D3WA 2CXEA 1IM4A 2R7TA 3LGMA 4RNFA 4KGMA 1R0AA 1IKXB 4WFYA 4X64F 4DN9A 2YWEA 2KXNB 3J81j 1FX2A 4JI8J 5K20B 1JXLA 2B5JB 5M2PA 4F4XA 2K7KA 4B3RJ 1HQEB 1S6PB 3T9ZA 2CG8A 3HFKA 3BSNA 3ZTRA 3V5RA 5DLFA 3BF4A 1MMLA 5DM7Q 3FQKA 1S4FA 3JQKA 2XM3A 2MKJA 3RRGA 1N52B 4DX6A 3NCPA 5KT4A 4DN0A 4NE9C 2DCUB 2XMKA 2ATLA 4WPAA 1UW4A 4NLDA 3R3TA 3DM2A 2R2UA 2PFDA 1NAQA 1AZSA 3FCHA 4NEZA 2ZWOA 4LFAJ 3MMBA 5JMNA 4CM2A 4WP3A 2MYFA 5KG1A 2DGVA 5CYMB 3D0HE 3LPEA 3W2WB 2M70A 3D2WA 3PW2A 3TOQA 2KZZA 1RAHB 4FBTA 3OR1A 3MEKA 2QFJA 1UL3A 3UNYA 5D6GA 1T7PA 4F0KA 4DR5F 4OZ0A 1DQ8A 1UKUA 3UDLA 2B0GA 2GO8A 1UVIA 3SI8A 3H4DA 4F3QA 3P49B 4U6PA 2ZHOA 1Q5VA 2I5JA 2XO7A 4DV3F 3M2UA 2GAGC 3WIUA 3RZAA 3H5YA 3CJ5A 4RNHA 5B0CA 4J9KA 1HBNB 5ETNA 1TKXA 3NEKA 5HL7Q 1IJEB 4O4GA 1XC9A 3BREA 3H20A 1HFEL 5ADZA 2UXBF 2X1AA 3GB0A 1MSWD 4G65A 3SBMA 1VQ5S 2MXYA 5FLXY 3GU0A 1T3OA 3TJ9A 4QPXA 1JIHA 3F73A 2KVIA 2J0XA 4ZITA 3RTVA 4I7FB 3NGUA 2OH2A 2M8DB 1S79A 1Q82T 1ZM4A 3C19A 2GHWA 3Q8RB 2DNMA 1MU2A 3G82B 4O4RA 1T9WA 1KOHA 3H7HB 2WVEA 5C25A 2G2ZA 4ILLA 1RAFB 4IG3B 1FO1A 3LA0A 3MR2A 3J80U 1RT5A 2ZVIA 3KWMA 2BJDA 3L7PA 3ZNJ1 3GCWP 1GEHA 3T9NA 4IG0B 3G6YA 2MLXA 4URSA 2JVOA 1FKPA 1HI8A 3UD4P 2RUGA 2D3OR 3MM5A 3P8BB 2D3ZA 2G1DA 3D66A 3EJMA 2JFKA 2HBQB 4IFVA 3QT6A 5F8NA 4ZN1A 3CD7A 3TEGA 2VFVA 1N48A 2N4DA 3C8YA 1NPRA 2FC9A 3HKWA 2OEMA 2MQMA 1MN9A 3KJQB 3ENAA 3GIJA 4LQ3A 4H54A 4DQIA 1PYOB 2DB1A 1LFPA 4GKJJ 3IAM9 4NI2A 2GGPB 1D09B 3J7Z5 4M5DB 2W7PA 2JC1A 2ZITA 4C11B 3CMQA 5DGAA 3MUVP 3C14B 3B8HA 3THPA 3UO0A 4H4MA 3CIMA 1SUQA 3EPIA 2CYYA 2MGZB 3M4XA 1X0PA 4NCGA 2RVJA 4IKAA 5AXLA 3MMAA 4DV6J 1N88A 3UPFA 4NLUA 4OI6A 1EJ7L 2HKEA 3T5JA 2C1EB 1LWEA 2RMLA 1Y5IB 2BE2B 3A1YG 2Z2YB 2AJFE 4B9NA 2E29A 1C1CA 3UNGC 1FXDA 4EZ6A 4R5PB 4XDDA 3QZ7A 3C46A 2EI5A 4L76A 2YNFB 2VICA 1S6UA 2E44A 3PKMA 2D3O1 2OSQA 1NM2A 4LRBA 1XNQJ 2UP1A 1ZM9A 5E7OB 3N0VA 2R7OA 1FVSA 5A8RA 1PC4A 2X51A 3US5A 1RKJA 1LWFB 4X4QA 3OTBA 4XAKA 3VAIA 3KOAA 4KGVB 1EKSA 4Q0BB 4LBPA 2Q79A 1TELA 1IKXA 1QY7A 5BYRA 5KFUA 2XMVA 2DO4A 4J9QA 2IAJB 2DO0A 2RF2B 2B5JA 1V5VA 5HVHA 2WSFC 4LRDA 2VDHA 1S6PA 3OUYB 2K8GA 4OLOA 2HYIB 3CB4A 1JKHA 1KBRA 1Q53A 3RB6A 1UTAA 4EYIB 3DN9A 3TX0A 2QGFB 1HNXF 2X1BA 3GQCA 5A8KA 5ETMA 2UUCJ 3TUZC 5AJ3F 2ZM6J 1N4LA 3FEZA 1A9NB 2V5HG 4YY3J 1UP1A 5CYMA 1JB0C 3W2WA 5KFAA 5HQ8A 3G71S 5DQGA 2LYVA 2HK3A 2KO1A 4EUVA 1S77D 1TVRB 3EZ5A 1M5HA 3V6JA 2M4MA 1PG5B 2NPFA 1HD1A 2YKMA 2K7JA 4RW4B 1NXIA 2E1AA 1VC0A 2EW9A 3PJ9A 2CJYB 2MY8A 4X65J 2VFSA 4FVMA 3R2DJ 4X64J 5KG4A 1BMQB 3LQVA 4MJKA 1PC5A 2P2CB 3MFIA 4DQRA 1WC6A 3GG1A 2ZBIA 4Z2XA 3J7YI 3KJVB 3HI9A 5BYQA 3GV8B 4B9LA 2CQ1A 1X0FA 1KD1T 2BACA 4MFBB 4TU8A 4F2RA 2WSCC 2YPYA 2MKCA 3ZTOA 1HBNA 4I64A 4K0KF 4DJBA 1FKAF 2E7WA 4EYHB 4AD6A 2AV5A 1SJ1A 5E5NA 3B78A 3EGWB 3TAPA 2YX4A 3A12A 4BC9A 4ICLB 5L1IA 1LWXA 1XMQF 3PIOQ 3P45B 4TN2A 3IM9A 4B9MA 1RCXB 2IM2A 4KV8B 3M6VA 2ASJA 2PD1A 4I7FA 1RXOB 2M88A 4ED8A 2RDDA 4DR5J 3LUYA 4HR2A 1UVMA 3CCMS 4M5GA 4NASA 3NNCA 2IPOB 2BRLA 1WI8A 3PW7A 1YJTA 2HWTA 3D0IE 3G82A 4A8MP 2VBYA 3GV7B 4DUYF 3CE8A 3PEHA 1RAGB 2J9DE 2CPYA 1KP6A 3CW2C 4QIGA 5IT0A 2ZJQQ 4IG3A 1UVLA 1WWHA 2NSBA 1BQNB 3N5BA 1FEEA 1FD8A 1RHRB 2QO3A 3PXGa 2ZOMA 1PCAA 1HWIA 4FPIA 3MPDA 4LQ9A 2V4RA 1HBMB 4IG0A 4WKYA 3K57A 3G9CA 3R5BA 4OZ1A 2R7VA 3MR5A 4LJMA 4K5SA 3ZZUA 2L48A 1HW9A 2YBVA 4EK2A 2UXBJ 4WP9A 2XULA 4PG7A 1YQHA 2N4CA 4LF9F 3N79A 3MCMA 2RT3A 3EVMA 4NLWA 2J6SA 1G3OA 1YRTA 4JV2A 4CO3A 4AUKA 2KFYA 1F2GA 3NS7B 2LQ8A 1BGXT 1FT8A 4V1Ak 5IT9U 2DGUA 1Z2LA 2Q43A 4ECWA 4P73A 2VF3A 4M5DA 2KZMA 3DRYA 4X4VA 3RBDA 3GLJA 4A8SA 4OZJA 4C11A 3C14A 5I4MA 1SXLA 3CPWR 4LSNB 4NMLA 3EZOA 4DV1F 1Q4RA 2DH8A 4YP3A 3D6TB 4ZVQB 1B0PA 2BBEA 3BGRB 4ECXA 4NCBA 5B0DA 2AT1B 3SXLA 4DL3A 1APSA 1MN7A 3EUNA 2BE2A 2RE1A 3R7BB 4PEOA 4Q8FA 4IOAQ 4WF9Q 3AY0A 1JNRB 4M5MA 3FBBA 4L73A 2CQ0A 2YNFA 1ULRA 1EAYC 2HVIA 2W8KA 1F5CA 8RUCA 2WTFA 2VDIA 4RJVA 3KHRA 3A4TA 1YZ7A 2HK2A 4CLPA 2X3DA 1C1BB 4YEAA 2EBGA 1S0NA 1YJ9S 4PR6A 2HRTA 1LWFA 1SL2A 3S6EA 5D0HA 3JS9A 1PJ5A 4M5HA 3RB4A 1NSPA 5JXSA 2W25A 1RK8A 5IC6B 2IYIA 3FZ2A 3NGTA 1DJ0A 3NG8A 4Q0BA 3LH2S 4Z37A 5E3PA 4K5RA 2ATCB 3QO9B 4KRWA 3BSOA 3AD9C 3ZZZA 1SI9A 2IAJA 1UPMB 3IN5A 1S59A 1XBWA 2W9CB 1FF2A 4ZHRB 5A0YB 2G2YA 1KFDA 5KT7A 1UFWA 5EX0A 4OZNA 5IFMA 2P6TA 3BJYA 3L7OA 2DR5A 3OUYA 3A3OB 4IFYA 3DGVA 2FGCA 3BO2A 1NK7A 1CULB 2RDIA 5B7WA 3PW5A 2NSCA 5H9FK 2RAQA 1HNVB 3M9NB 3M8QB 4MYTA 3J7ZT 1GAOA 2W9BB 3AB2B 2O3DA 2DGWA 1WC4A 1YIJS 1EARA 4G1PA 3DLGB 1TVRA 1XTZA 4OYBA 4WFBQ 2AJ2A 4HACA 4O0NA 5KFOA 4OYPA 3DMJB 4RW4A 2ZH6A 2FQQB 1RWVB 4LUBA 2E5IA 3R5JB 4J9LA 3VQSA 3ADAC 2IIHA 2P9EA 2W4PA 3N6LA 2KYZA 3MR7A 3KJVA 3OL9A 2BKPA 2DH7A 3C6UB 2BXJA 4ZPWR 2QJ3A 1N5TA 5EGYA 4MFBA 1TUWA 1U1OA 3RBXA 2PO4A 3QRRA 1YSJA 4IQMA 1D9AA 2V4JB 4LR9A 2IJRA 2Q6BA 1DQAA 4KGKA 3QJLA 1RJJA 5H1SV 4X4PA 1REGX 1G4CA 4DZ6A 3VQTA 4JV5F 1NB2A 1HIYA 3TUPA 4K4ZA 2ZZNA 4NZ0A 1HNXJ 3KLIB 3MAQA 1KNZA 4W90B 2LKZA 3G8SA 4A8XA 2LECA 2KU7A 4ICLA 2HRUA 3CCLS 2DT9A 3SEOA 3OTOF 4A8WA 5EWEA 3IG1A 4UQGA 3KJFB 1UWBB 4KV8A 4ES1A 1HHQA 3ENWA 4CT9A 2QRRA 2L9WA 3U1MA 2JEIA 3D5MA 3BPSP 4DSLA 1RWWB 2Z2LA 2E1PA 3KG1A 2KKHA 4FF2A 2O67A 3PX4A 1RAIB 2W01A 4QIWD 2V94A 5E3QA 3GSIA 2Z8QA 1BQNA 2BYCA 1OPIA 4DLEA 2MZRA 3PYFA 2AYBA 2ZH3A 5DS7A 2PI5A 2V8HA 1RAAB 2N82B 3V2UC 1HBMA 1RP5A 3I31A 3AH6A 1P6TA 4K0KJ 1U45A 2VPZB 2GNKA 4L3NA 3T5KA 4HDHA 1WSVA 4O3PA 1Q5YA 2WBMA 1KS2A 4AXIA 2IM3A 3RAXA 3HZEA 2RQCA 1XMQJ 3I0RB 4MIBA 1D9DA 3FC9A 1L3SA 2UZAA 3WQPA 4CZCA 2PMHA 3BDEA 2A18A 1VDHA 1KEKA 3M7VA 2H51B 1MMDA 1K47A 3VWSA 2B8PA 3UI3A 3CJ4A 2R8JA 4LSNA 5KFQA 5F9LA 1VRTB 1SKWA 5J2PA 4DUYJ 1NDKA 1JJHA 3NCRA 4FYXB 4F0HA 4WKRA 1W26A 2MQ8A 1SJFA 3D1OA 3OPKA 3QGGA 5JVGQ 4J9OA 3M8ZA 3HVWA 3K5OA 2C42A 4ZVHA 2YX1A 3BKTA 7AT1B 2VZ9A 5CQGA 4AQYF 5F8LA 1JJCB 2R2SA 3CDEA 3MUMP 1WSRA 3KK1B 2JWNA 2CZVC 3R5GA 2EXUA 4AFFA 3GR0A 1WHVA 4B9VA 3A13A 4NL5A 2BM0A 5ITHA 5CZVA 2Y1LB 3CT9A 3FVYA 3WHIA 5KFVA 1MW7A 5A8WB 4LF7F 2HFOA 1WOSA 5EHHA 1K1QA 3D54A 2C3YA 4GMKA 6FD1A 3JSRA 4HHUA 2LXUA 1PILA 3HVAA 1S1WB 3FBEA 3NGDA 1IBLF 2DNZA 3UN3A 1FE0A 3VGUA 1IBMF 3NY0A 4DSEA 2FZKB 2EC0A 2V34A 2BW7A 4M94A 2ZBCA 3G8TA 4OIXA 2HLUA 4P6QA 2DNGA 1U1QA 1OMSA 1DURA 4DV1J 1YWXA 1HR0F 4F0MA 3QO9A 1TV6A 4J9NA 2HHPA 4CYUB 1RWKB 2W9CA 4ZHRA 4Q44A 2GQCA 5A0YA 1X60A 1VLYA 4RO0A 4ILRA 3AFGA 4DG1B 3AQOA 1RT6B 2QMWA 3TA2A 1H74A 1RISA 3E2EA 4K59A 3DOLB 4WU3A 4C9DA 1NJIT 1CULA 1FRKA 1ZAWA 1S49A 2VJUA 3MPYA 3EGVA 2VU5A 3T1HJ 1XMBA 1RZMA 4ANEA 2IRYA 1HNVA 2ASLA 3M8QA 2DGTA 2MSSA 2HG4A 2CPJA 2W9BA 1Y11A 2DGQA 1RHUB 2CQ4A 5DZ7A 2XSFA 2V2QA 3DLGA 2GMJA 3HCXA 1GMWD 4L3KA 4C3MA 4ETZA 1TL1B 1S6OA 3DMJA 4J7CA 3PY8A 4ZS6A 3K0JA 1O0PA 2JJ4D 3NLCA 3BGLA 2KJVA 5HP1B 3M8WA 2GQQA 2LXIA 3I9ZA 2V50A 3C16B 5F0WA 3SIPB 3I4PA 1H2TZ 1KR4A 1QSLA 2I9SA 3GSDA 5LXYA 1XIQA 1HHSA 1RKIA 2V4JA 1X5TA 3ZZOA 4WK1A 5AT1B 4C7QA 4ZJLA 4MIWA 3EM1A 3GJRB 3T6JA 3VGSA 1RUSA 2DTJA 5KFPA 2XZWA 1JXEA 5E33A 1HMVB 3D3CJ 1VQOS 2GJ2A 2IDEA 2QL9B 1U2RA 3NNAA 4JI2F 3FEXB 1SPBP 4QOTA 3KLIA 3MR6A 3GR1A 5KOXA 4WE1B 1LW0B 5KFCA 3ZTSA 2CDQA 1U49A 4UZCA 2KXFA 3CCZA 1FK9B 2HURA 4ZVFA 4Q5VA 1WELA 2XQCA 1XK8A 3ISZA 2ACYA 5B0GA 4F7VA 2B56A 3GPAA 2RRBA 2VQEF 1X31C 4A8YA 3CCWA 5KG3A 4A48A 4NEYA 1Y3JA 2QT7A 4OHYA 1NEEA 3DRRB 2HQ3A 3VAGA 5IQQA 1U7LA 2AYGA 2O1PA 3K5LA 5DRKA 4JV5J 4XIUA 1IBCB 1RWXB 4F4AA 1GXUA 4X4NA 3QZ8A 4WTOB 2N7YA 3CDUA 4DPYA 4QR0A 2IYGA 2H9ZA 4HI1A 5IT4A 5KG5A 4EBDA 3UW1A 3I9V9 3OTOJ 4QW9A 3I0RA 1PBUA 1JJ2R 5EWFA 3IWNC 4UOCA 5KG6A 1S0OA 3PM9A 3CCTA 3UR0A 1NJZA 4PPDA 1OY8A 3TUJC 1X9MA 1S7HA 1H7WA 3DYAB 1VRTA 4CTAB 2LQBA 3FJ2A 3H2LA 1U2FA 1AFIA 3C15A 4GO7X 4KAIA 1QM9A 1YKWA 4F3OA 1JXVA 2HBZB 4RU2A 1M90T 2WAQD 1VQLS 4HVZA 4L72B 3KK1A 3Q8PB 1F2HA 2IRUA 3UN2A 4M5KA 2VBWA 4C8ZA 2KFNA 5A8WA 2J9DA 3ISNC 3DRPB 2R7SA 4I0WA 4J9RA 2MMYA 3N28A 1OJ4A 1S1WA 3Q0AA 4LRFA 2MZTA 1V3ZA 1M1HA 3MMCB 2J5AA 2AYEA 3QSYB 2HWIA 2DR6A 4TYAA 1KTQA 1FFGB 3DLEA 2H5JB 4RNMA 4LFBF 2CADA 1YVFA 4TLRA 5RUBA 4G3IA 5HLFB 1VQ8S 2BJ3A 4DQQA 4OX8A 2K3IA 4CLUA 4D3GA 1P27B 3NS5A 1UETA 1MNEA 4CYUA 4ZP9A 5K8OA 2UV8G 6AT1B 3J7AN 4MH8A 3GWCA 1U2CA 2KDOA 4AQYJ 2FJBB 2J9EA 4DG1A 3TQ1A 1RT6A 5IV4A 3KLGB 3WBZA 1S76D 1YJ7A 2GHVC 1PKUA 1BY9A 2JNJA 2XGPA 2JLFA 4EMDA 2Y1RI 1F6TA 1FDDA 4Y2KA 2ZNZA 2LEAA 4LF7J 2BQUA 5KTQA 3N5FA 3R6LB 1Q8KA 3CCJS 1IBLJ 1LQ9A 2ACMA 3M05A 4ES3A 4QWEA 3CD6S 2FZCB 4N8OA 2MZQA 1IBMJ 1WI6A 2CKWA 4Z7YA 2GFFA 4UOHA 2OELA 1N54B 3JB9k 4WFAQ 3TZXA 1VOMA 1X9SA 3J81Y 3OHAA 1HR0J 1UEUA 4M1KA 5HP1A 1F5BA 1OQ6A 3KHGA 1S57A 4QR1A 3C16A 2CNNB 5J2QB 5L38A 3W61A 2RQMA 4PWWA 4DF4A 2XS2A 1EX8A 3VALA 4DHVA 2LU1A 3VCDA 3Q24A 2DRAA 1CC8A 2G0CA 4OX7A 2Q1LA 4Y2CA 1J5OB 3S1TA 2I0XA 1HMVA 3MXHP 2FGOA 2AX1A 1T9UA 4G6VB 4NLOA 1KLMB 4YQWA 3CEDA 4WE1A 1LW0A 2EWHA 1KSPA 3T1YJ 3CVKA 1IR2A 3X3UA 3IXQA 1FK9A 1WEZA 1J5EF 2KH9A 3NGSA 1VYAA 2CPXA 3NAHA 4NLSA 3KMSA 3FUYA 3EICA 2AX0A 2FUG9 2APOA 2ZDOA 2UXDJ 1DQ9A 4OMFG 4AXJA 5D0EA 5ETKA 1J2VA 5MAOA 2R3VA 2ZNYA 4LSLB 1KDNA 1R6YA 1VHIA 1TP7A 3DLHA 2CZ9A 4ZP6A 3FSXA 5D15A 4CLFA 4Z7CA 3RGIA 3MPWA 2XGQA 3EE3A 4X2BA 2OP5A 5KFTA 2DISA 2OMOA 2D74B 4LT6A 3HHLB 3OL8A 1BWVA 1P9QC 4B3TF 2XB2D 3Q8SB 2ZBRA 2CIMA 2JSXA 2N3LA 4BBYA 2YTCA 4J5OA 2JVRA 4UOFA 3SSQA 4CO1A 2OEKA 1IKYA 3CJQA 4D3HA 4LBHA 1TFWA 3HULA 3UD5A 5ETRA 1CG2A 3MEDA 5AXMA 2QTWA 3TVKA 1YHQS 2FHKA 2V8DA 1EZZB 1T95A 5GAHU 4A8QA 3HSDA 4TNOA 1JLQA 5KFHA 5GVQA 4R25A 2VQEJ 3DYAA 3L09A 4CTAA 3JAMY 3BDPA 4U8YA 1MWYA 3LW5C 4YDXA 3BKFA 1RTJB 2F5GA 1F9HA 1FFSB 1WUUA 2MSTA 3DGPB 1D8YA 4I6AA 1R8AA 3QWUA 4FN5A 4DR3F 1RT1B 2RB7A 5D8HB 1X4FA 2C2DA 4JB8B 4QU7A 3AOCA 2VD3A 1URNA 4CRJA 4KR0B 1FWKA 4YB5A 3RW6A 4TLQA 3DRPA 3TUIC 1N32F 4M5IA 1IQTA 3FBCA 1M5KC 4CQ1A 4TQSA 2ZOGA 1WTBA 3R7SB 3HF5A 1SB6A 1LKZA 1NCLA 3N01A 3KUGA 3MMCA 4C8MA 1RTZA 1Y9OA 4WCEQ 3Q8UA 3EPGA 1L5UA 5CZXA 5HLFA 4DDFA 1N6QB 3AJ1A 1XNRF 1ITPA 4MKYA 2J9CA 3MD1A 3PFOA 2FLNA 4USWA 3VGVA 4ZPCA 1CJUB 1PAEX 4FS1A 5DDOC 1WJ9A 4DI6A 2NZCA 3R5DA 2DHHA 3R5CA 2VHGA 2QLXA 2H1YA 2CNKB 4KO0B 2ZOFA 1RHMB 4DV7F 3KLGA 3L9ZA 3EDQB 5KFIA 2JC0A 1UA1A 5LSRA 1RTIB 5D4PA 3D1QA 1VS3A 2IBOA 4DCOB 2QSFA 4ZCLA 3VZHA 1VQ6S 1DAXA 3QFWA 2JEJA 2YWKA 3J7YU 3R97A 3UCUP 4DQPA 3NCQA 2CNOB 3MR3A 1V3RA 2D3UA 3FRZA 2KHCA 2W2PP 3CJRA 1VIOA 2KJWA 3RB3A 3Q83A 3HHLC 1TUVA 5F8MA 3B4MA 3FKBA 2OSRA 4Q2MA 1TKZB 3AOAA 1X5PA 3UE2A 2LDYA 1NKBA 4HHHA 2CRLA 4OQJA 5EX3A 1BXNA 2LA4A 2KVQE 5F9NA 3HT3A 1OY9A 3H40A 4U7UD 3UDVA 3G96A 2CJXB 4ZCKA 2VONA 4U95A 5J2QA 2K1RB 4PXDA 1VQSA 4OHWA 3JTOA 3IFEA 4ZCMA 3P5BP 4EEYA 3JYTB 4RNNA 5I3PA 2C2OB 3ENVA 2J7WA 5K14A 2KM8B 3K17A 3MEEB 4E2FB 4Y0FA 1K9MT 1J5OA 3DOMA 3ITHB 2UXCF 3H98A 1GTEA 2IFXA 3ET6B 1WOPA 3V6KA 1TL7B 4USIA 4C8NA 1HBOB 4X4SA 1VQKS 3E01B 2YKOA 1KLMA 3QRPA 5IZHA 1CJVB 4C0HA 4N76A 3LO3A 3KDNA 2RKIB 1NH7A 1WC5A 2R7UA 3KK3B 1U02A 4RNOA 1SL0A 2FZGB 3K5NA 3D6FB 4EFAC 2GMHA 1JQGA 2YH0A 1Q8BA 5E2QA 2EFPA 4ZP7A 1CSJA 4Q45A 3SDEB 4ES2A 4LSLA 2E1CA 1TL5A 1YBAA 3BN7A 5THWA 1T02A 4JV0A 4ZJQA 1RU2A 5A2QU 4LFAF 4ED0A 1K73T 2FDNA 1LK7A 2B9YA 5KFNA 1JX4A 1GXTA 1SJ3P 3P3DA 1HPZB 4QZVB 3CC4S 1RSCA 2FYXA 4KJIA 4FP9A 1WG5A 3HHLA 3PX0A 4DSJA 2OO4A 3FZBA 1G7CB 1AUSL 4DV4J 1QAJA 1S99A 3VAJA 3U7JA 3K2YA 4HT5A 1U6ZA 2DYAA 1LNQA 1F9FA 3GZ7A 1U1KA 2ZH2A 5B09A 2V2VA 3B6BA 2GA7A 2DR9A 1B7FA 2OPPB 2B4PA 2YNGB 2U1AA 1U47A 1NK0A 3LGHA 2AZ1A 1KVJA 2HHHF 2VV5A 2X1FA 4ED7A 5KOWA 2FVRA 2BABA 4HI2A 2FY1A
chains in the Genus database with same CATH topology
1S1VA 3TI0A 5G0RB 1B0PA 1LWCA 4YUDA 2BBEA 1E6VA 2L9DA 1K8AT 2PC6A 4CH0S 3GFZA 5L1KA 1F0XA 2VA2A 1RTJA 3BGRB 4O3QA 2PEHA 4ECXA 4NCBA 5B0DA 3Q23A 2ZFHA 1SIZA 5K8MA 3DI6B 4XPEA 4Y34A 3SXLA 2M52A 3CJ3A 2FHJD 4DL3A 1S72S 1APSA 1JLBA 3SQGB 4W92B 1G1XA 1LXNA 1H6KX 3EUNA 1RTDB 1RAJA 2BE2A 1HD0A 1RT1A 2F9JA 2RE1A 4Q8FA 3S7RA 4ELVA 4IOAQ 4WF9Q 2FJDB 4JOUA 2DH9A 3AY0A 2AJ4A 5J1EA 2VBXA 1JNRB 4JI4F 1C0TB 3T1YF 3LP2A 2MQQA 4X4RA 4DR7F 3NP5A 2F3JA 1JLAA 2CQ0A 2YNFA 3PDNA 2FHJA 1N8RT 3HPOA 2MY7A 3TP2A 1ULRA 1FNMA 2R7QA 4F26A 2HVIA 2W8KA 5IS2A 2XMUA 1H2UX 3H8YA 4I6WA 5KT3A 4NYZA 5J1NA 1F5CA 2DGSA 5KFGA 2WTFA 4QYZJ 2PMZD 3SFGA 1QLNA 3KHRA 5KFWA 1TKTB 3MURP 2MZ1A 3V4IB 3OFGA 5BR8F 2UXDF 4MK8A 2OAUA 4QBUA 1AXQA 3M2VA 3IRWP 3LAMA 2HIQA 4A46A 1C1BB 4YEAA 5KFMA 1RT2A 3K8WA 3PR4A 2EBGA 3I5BA 1S0NA 2KM8C 1XR6A 1YJ9S 4PUOB 4PR6A 5HN0A 1JK9B 1LWFA 4DBQA 1SL2A 1HBUB 3X1LB 1FDNA 3M8RA 1G6BA 2VASA 3S6EA 2RQ4A 3PV8A 2KG1A 1KFSA 2UUBF 5LSOA 4QCLA 1RT3A 3RB4A 4MYUA 5JXSA 1Q1KA 1NNDA 2W25A 3WC0A 4GKKF 4LVOP 1S9EB 1KOOA 1X4GA 4KHMA 1RK8A 4NYOA 4K4XA 2Y0SD 5E41A 2IYIA 3C6UA 3EGNA 3FZ2A 4IO1A 1U6FA 1DJ0A 1FKOB 1SJRA 3NG8A 2R2RA 2RS8A 4Q0BA 3O2IA 1WEYA 3LH2S 4TY9A 3CULA 1UFLA 3TYTA 4Z37A 5E3PA 4K5RA 4OI4A 4E98A 2RD5C 2FVPA 2R4FA 3IO1A 3QO9B 2CPFA 4C4WA 1ZAXA 4P7VA 4KRWA 3BSOA 2VA3A 1FJGF 1N6QA 3ZZZA 1ZBTA 1SI9A 3P96A 1P1TA 2IAJA 3KFWX 3IN5A 3BQ1A 3JSMB 5IQ6A 3I82A 1XBWA 4RW6B 2W9CB 1FF2A 3HJFA 4M8LA 4ZHRB 3CXCR 1ZPVA 4NLRA 3LALA 2OPRA 5A0YB 2VPWB 1KFDA 2MKIA 5KT7A 4DX8H 1Q86T 1UFWA 5B0AA 2P6SA 5EX0A 4OZNA 5IFMA 4FF1A 2P6TA 5DETA 3BJYA 2FC8A 3ICLA 1OSCA 1R31A 3L7OA 2DR5A 2NREA 3OUYA 3M30A 4GC6A 4NYPA 4KO0A 4IFYA 5JVHQ 2E66A 2ZE2A 3O6QA 3AQPA 2M7SA 3WZ0A 2NYIA 2B4UA 2FGCA 5A2QY 4DL2A 3BO2A 4NX9A 1NK7A 2Z0GA 1WF1A 1QJHA 1FTRA 4EO8A 5D3GB 3GIKA 3KG4A 5C24B 2FJAB 1Q7LB 2LVWA 2B43A 4A8OA 3ENQA 2RDIA 2WRMA 4U67Q 1YGYA 1RTIA 1UWBA 3MZIA 5B7WA 4TYBA 3PW5A 2GV1A 2NSCA 3TA1A 3PJWA 2JHEA 2Q66A 3FRYA 5SUHA 3O5TB 3FMWA 4M63A 2ZJPQ 2WCXA 1HNVB 1BC6A 1S1TA 3M9NB 4LVNP 2G9OA 1GTHA 2YQ3A 3N9UC 3M8QB 4MYTA 3E3XA 5KFSA 3OV7A 2HNYB 3J7ZT 2WB1D 1GAOA 2W9BB 1HNZF 2PDAA 1VK3A 3M8PA 3AB2B 5F0UA 2O3DA 4WYWA 2DGWA 2ZKTA 4DR6F 2WOMB 2YNHB 1YIJS 2VH7A 2LDIA 2B6AA 1C0UB 1WG4A 1IUJA 2HNDA 4F25A 5D4NA 4CIOA 2VPXB 4Y2MA 2MB0B 3CJKA 5D4LA 5IT9Y 4UQTA 1VQNS 5T7LA 4G1PA 3DLGB 1TVRA 4OZ5A 2RQKA 1N34F 3QGIA 1XTZA 4JI6F 1NRKA 3WX4A 4WFBQ 1SKRA 3E8OA 4YR2A 3VR1A 1JLEA 4OZLA 3AJ2A 5KFOA 2AGPA 2OKQA 3IC1A 3N6MA 2RU3A 2ZD1B 3DMJB 3M2VB 1V3SA 4RW4A 2ZH6A 2KRBA 2DJWA 2VKZG 1VI7A 1HNWF 4B3MF 3O3LA 1V6HA 2K3KA 1TKZA 4LUBA 4NLXA 4O0IA 3R27A 5CCLA 2E5IA 1TAUA 2NQPA 1FNXH 2DITA 1X4DA 2D1CA 4J9LA 4RKUC 1Y7PA 3HO1A 3ONQA 1U1NA 3DLKA 3DHXA 3VQSA 4K2XA 1H2VZ 3TRGA 3OTEA 3I5CA 4NLYA 2DIVA 4C3KA 4XPCA 2P9EA 2W4PA 3N6LA 2KYZA 1R3NA 3Q8QB 1U1RA 3KJVA 4ILMA 2DNOA 3OL9A 2LU2A 4UY85 4G1QB 2DH7A 3C6UB 3H25A 4RW7B 2BXJA 2EKYA 2VC0A 3KYLA 3KG0A 2BDPA 4ZPWR 4JV1A 1N5TA 3B4DA 4OL8A 5BYSA 5EGYA 2RIJA 4KB7A 4MFBA 1XNQF 4FNHA 1U1OA 2PO4A 3NAIA 1YSJA 4IQMA 1VQMS 1D9AA 2V4JB 4WXOA 5EUHA 3OTCA 2Q6BA 3KTQA 3VAFA 1VC5A 4KFBB 1DQAA 3JYTA 2R8IA 1NH8A 4KGKA 2XMTA 3QJLA 4B9TA 4CO2A 1X9WA 1FRXA 1RJJA 1X4CA 4CH1A 4A4JA 2I38A 5H1SV 4UUWA 2B9WA 4X4PA 3MEEA 4DV0F 4ETXA 3VQTA 4JV5F 3TVYA 3D0GE 2F40A 1OPZA 4K4ZA 4RW9B 2PE8A 1SH2A 3ITHA 2ZZNA 2NPIA 4NZ0A 2RS2A 1XEZA 4R0EA 2HNZA 4ITSA 3KNGA 3KLIB 2XS7A 3MAQA 4NZ6A 2EG2A 4IFYB 1RA7A 3PJXA 4F4YA 3LP0A 1KNZA 4F4WA 4LF4F 1RGVA 3GYNA 4O3RA 2EFOA 4ED6A 1U24A 4MTPA 4W90B 2LKZA 3IBWA 1OO0B 2ROEA 3GFYA 1HBOA 4A8XA 3G8SA 2KU7A 2LECA 5DDRC 3VAKA 1NKEA 2QA4S 4KPYA 4ICLA 4ZPAA 2HRUA 1WHYA 3CCLS 2DT9A 2WONA 3E01A 3MECB 3SEOA 2BVZA 3T1AA 3OTOF 2IM1A 4A8WA 1ZH5A 2KB2A 2QZ8A 2EFVA 5EWEA 1IN0A 1QE1B 2E5HA 2XSJB 3IG1A 1UEVA 3SCJE 4UQGA 1UWBB 3M6WA 1YTYA 1X4AA 3OQ2A 2ASDA 4IYQA 3T3FA 4UY8T 4TY8A 4KV8A 2FHMA 4E0DA 1R8CA 3H2VE 4JI0F 2RKIA 1C4AA 4ES1A 3MUTP 2C2EA 3ENWA 4CT9A 2QRRA 2L9WA 2HVHA 2MZSA 3KK3A 3CCSS 3U1MA 3GFXA 2VUGA 4I56A 4IOBA 1FDAA 4Y2AA 3SMZA 2IJFA 3OL6A 2JEIA 2B7BB 3D5MA 3IS9A 2ZC4A 3FMBA 3KLHA 3CTRA 1SKSA 3M2RB 3DDKA 1IKWA 1R27B 4DSLA 3BR9A 4XK8C 4N41A 1QTMA 5DQIA 4NXNF 4Q2LA 2Z2LA 2MKHA 2MPUA 3KG1A 5KFZA 5AE1A 5BJRA 3SDEA 2CVEA 2KKHA 4TQRA 4N5SA 1VBZA 4FF2A 3ZZTA 3CCQS 2K2PA 2O67A 3BQ0A 2VG6A 3PX4A 4HL9A 2AF6A 2BW2A 1HL6A 5IM0B 2ERRA 2CJQA 3IWXA 3PRDA 4QIWD 4Q8EA 2V94A 2VG7B 5E3QA 2W7AA 5AXNA 2DRBA 3U1NA 2Z8QA 5HMWA 1BQNA 2QSWA 2NR0A 2JLEA 1HWLA 3C66A 3CJ2A 4QWDA 2BYCA 1BQMA 4I2PA 2DVIA 3DNCA 1OPIA 3RRKA 4DLEA 3HHEA 2MZRA 2AYBA 5KFJA 3IR5B 2PA3A 4KBIA 4N77A 4WK3A 5DS7A 1IR0A 5JUMA 2ZH3A 4QIVA 2PI5A 2V8HA 4DFKA 4FF4A 4WXWA 2N82B 3V2UC 4RUAA 5C5JA 1N0VC 1H3DA 3CC2S 5T41A 2HWHA 1HBMA 1ZYQA 1RP5A 3OJSA 3JTPA 5HROB 2GIQA 2R7WA 4QIFA 2VG5A 3D1HA 5HO4A 5L1LA 1X4EA 3I31A 3KLEA 1A7GE 3AH6A 1P6TA 2BA9A 3OVAA 1E6YB 3NRBA 1U45A 1HPZA 3V81B 5J2NA 2HAIA 4PG8A 1R8HA 1G2EA 3IA0A 2VPZB 2LQJA 4HYKA 2IRXA 4PRFA 1FRLA 1S1XB 2BV3A 2GNKA 4K4WA 3HMJG 4L3NA 4KTQA 4ZPBA 2QEXS 3T5KA 4HDHA 3OVBA 2XC9A 4O3PA 2WBMA 3M9MB 2VOPA 3FSYA 3GFHA 1KS2A 1DHMA 2BANB 4GO5X 4AXIA 2IM3A 5AXKA 3RAXA 3OTDA 3HZEA 2ILZA 4MKBA 3ZZYA 2RQCA 3I0RB 1JLFB 1YJRA 3M1VB 2R8HA 2KHDA 2KT2A 4MIBA 1D9DA 5F3TA 5AE2A 1L3SA 4DLGA 3MD3A 3OSPA 2AJQA 4FNIA 3DRSB 1XN9A 2UZAA 2GJIA 1TL4A 1NKCA 2QA1A 4ID8A 2J0WA 2DNPA 4CZCA 2PMHA 4DR1F 2DR8A 4LF5F 4O3SA 2IVMA 2LEBA 3BDEA 2A18A 3MEGA 3QYYA 3SSRA 4USHA 1N5YB 4G1IA 1M1KT 1KEKA 2EFNA 3RR8A 1S9GB 3DXSX 1MMDA 2MHNA 3DOKA 4U7UK 3VWSA 2R9LA 4MK7A 1LOUA 2RRAA 3UI3A 3CJ4A 2R8JA 1Y5LB 3NS6A 3POTB 4LSNA 2YNGA 2HLTA 5KFQA 3IG1B 2IBKA 5F9LA 1VRTB 2B3TB 1SKWA 5J2PA 1FRJA 1DTQA 1ZTWA 2XMJA 2IMOA 4JI8F 1T94A 2MHEA 2DIUA 2WBRA 1NK6A 1PGZA 1JJHA 3NCRA 4V19X 4YFUA 4WKRA 4DL5A 3FFIB 2XBPA 1B0VA 1SJFA 3D1OA 3OPKA 3QGGA 3JSYA 5JVGQ 4J9OA 5G0RA 4B3RF 1HQUB 3HVWA 3K5OA 4PG6A 3A8EA 2J7KA 2QMXA 3DOLA 2XNQA 3HVTB 4WJBA 2C42A 4IR1A 4B9SA 1VRUB 2IC3B 4ZVHA 2YX1A 1UA0A 5GAGU 2YWFA 2VZ9A 5CQGA 4AQYF 5F8LA 3DI6A 2R2SA 5M2RA 2MJNA 4ED1A 1IKVB 3CDEA 4I6YA 2ILYA 3MUMP 3DRXA 2VG6B 4TKTA 3SQGA 3KK1B 1JMTA 2JWNA 2CZVC 1QSSA 1VK8A 1RTDA 2Q6CA 2VPYB 3ZFVA 2UV8A 2R8KA 1GXLA 2DPJA 4AFFA 3EXCX 3GR0A 3W2VB 1WHVA 4B9VA 3OFEA 4NL5A 3PEJA 2HS3A 4E8UA 2BM0A 3U02A 5ITHA 4KHPF 3UR3C 1HARA 2KXHA 3FQLA 5CZVA 1BQMB 1B0TA 1C0TA 3CT9A 3IGNA 4CI0B 5I42B 3JSBA 3FVYA 1QUVA 2PA8D 3RAMA 2CQ2A 3IR7B 3LWMA 2XMMA 5KFVA 1MW7A 4CH7A 5A8WB 1VIXA 5LT5A 3HVRA 4LF7F 2HFOA 1MWZA 2F9DA 3CDAA 4DF8A 5EN1A 5EHHA 1K1QA 3D54A 1VBXA 2F7VA 2C3YA 4GMKA 6FD1A 1X5OA 3JSRA 1O5JA 1TK8A 2LXUA 1PILA 3HVAA 1S1WB 2FVSA 1NK4A 4PXEA 3KLEB 1SJQA 1TKTA 5GAGI 1DZ5A 3V4IA 2UU9F 4DEZA 2WHOA 1TL1A 3F56A 4KIAA 3CD5A 3NGDA 1IBLF 2BUNA 4FXDA 2LA6A 4K4UA 2DNZA 2RILA 1BLUA 2MQOA 2BRKA 1Q79A 1IXKA 1M0SA 2E5GA 3KK2B 3LOUA 4LMZA 4PUOA 7FDRA 1FE0A 4YR3A 2FPHX 2UUAF 4KKOB 1HBUA 3F44A 1X8DA 2WSEC 1IBMF 1VQPS 2NUUG 3MMJA 4RU9A 4DFMA 4CCHA 2R7XA 1X5SA 4DSEA 2EVZA 5I3QA 4WZMA 2O01C 2EC0A 3CUNA 4ECTA 1R0AB 4OHVA 1S9EA 3DDNA 4LIRA 4KHRA