1WI8A

Solution structure of the rna binding domain of eukaryotic initiation factor 4b
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSSGSSGSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNKRIRVDVADQAQDKDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 4B
publication title Solution structure of the RNA binding domain of eukaryotic initiation factor 4B
rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
total genus 12
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wi8A01
2LYVA 1G2EA 3P6YC 1WELA 2XB2D 2D3OR 3VAIA 2DH9A 1SJ3P 3VALA 2M88A 2AYGA 3CUNA 5CA5A 3CC4S 1UP1A 1R8PA 1U1OA 4P6QA 2LMIA 5IQQA 4F25A 2KHCA 4BS2A 1VQLS 3IRWP 1VQOS 3THPA 3RW7A 3CCVS 1WI6A 1YIJS 1U6FA 2QA4S 3HI9A 2NLWA 2VOPA 2LKZA 2KXFA 2CQGA 3THTA 4ZKAA 3R1LA 3PIOQ 1ZZNA 2HGNA 2MZRA 4J5OA 2CQ1A 1WI8A 2MJNA 2FPHX 1VQNS 2MKCA 2DNQA 2XS2A 1VBYA 5FJ4A 2KRRA 2DK2A 1XN9A 3CCES 2DH8A 3S01A 3SDEB 1SJRA 1X0FA 2KU7A 3CC2S 1U1QA 4QU7A 1F9FA 2MKHA 2E5GA 1SJFA 4TU9A 2OTLS 2CPHA 3CD6S 3SMZA 5DM7Q 3NNCA 2E44A 4W90B 3S7RA 1O0PA 3J7ZT 3G96A 4WIIA 1FT8A 3CCUS 1WEXA 2NZ4A 2MKKA 4V19X 1WTBA 4Y00A 4OZ0A 3P3DA 4WCEQ 2ZJQQ 2CQBA 5DDPC 4M5DB 2KG0A 1S79A 3US5A 3VAJA 4ED5A 3UE2A 2RRAA 1VQKS 3FEXB 2O3DA 2DNHA 2RQCA 2CPJA 3VAMA 5H1SV 3D2WA 1YTYA 1M90T 2K3KA 3S8SA 3G71S 4IOCQ 2MZJA 3DXBA 4PRFA 2LQ5A 3CULA 1WG1A 2ZJPQ 2QFJA 1X5SA 3EX7B 1QVFR 2EK1A 1WWHA 2KXNB 2MKIA 3BO2A 2M52A 3I56S 2AYEA 1VQMS 1X4FA 4WKRA 2L08A 2MY7A 3NS5A 2JVRA 2MQLA 1H2TZ 5BJRA 3SDEA 2DNMA 1X5PA 2HVZA 1N52B 2K8GA 2X1GA 1YWXA 1WHWA 2CPZA 2X1BA 1WF2A 5DDOC 4WF9Q 2CQHA 1JJHA 1KOOA 1M5PC 2ERRA 1RK8A 2HGMA 2DISA 3VAHA 3K0JA 3H2UB 1U1PA 5CYJA 1M5KC 2RT3A 2CPIA 5LXRA 2CQIA 4UY8T 2M7SA 1YJNS 2LA6A 4A8XA 3TP2A 3TYTA 1NO8A 2M8DB 2DO4A 3V4MA 1WG4A 1Q7YT 3UCUP 3N9UC 5DDQC 2OIHA 3BS9A 3MUVP 1YHQS 3G8TA 2MHNA 1VC6A 1X5OA 3MD3A 2KRBA 5GMKa 1VQ5S 2DNPA 3LPYA 2RVJA 1X4DA 1X4GA 2EVZA 2KYXA 4WFAQ 5LSOA 5HO4A 5GAHU 2MGZB 3MUTP 3BO4A 3UD4P 1U6BA 2YH1A 4TU7A 2DHXA 4PR6A 1K8AT 2E5IA 4QQBA 2V94A 1WG5A 4ERDA 2X1AA 3CPWR 1H2UX 2SXLA 2M4MA 2LEBA 1X4AA 4QPTA 3CTRA 3I55S 3LQVA 4C7QA 1U1LA 3NMRA 2MB0B 2KI2A 1U1KA 1K9MT 2F9JA 2E5HA 3UD3P 3CCQS 5IM0B 2RU3A 3L3CA 5HL7Q 1QM9A 4QU6A 2FC8A 3UCZP 1FNXH 2M70A 2DGQA 2MY8A 5D77A 2XNRA 2M2BA 2MQPA 2UP1A 2MZSA 3J7YU 2F3JA 2CQ3A 4YB1P 3MOJB 2OSQA 2DNZA 5IFMA 1X5TA 4CQ1A 5GAGU 2HZCA 1Q81T 2JX2A 2DH7A 1NU4A 1H2VZ 2CPYA 1X4CA 2YTCA 1SXLA 2MSTA 2MZ1A 2MGZA 3VAFA 1DHMA 2X1FA 3DLLQ 2KM8C 4LIRA 1VQ4S 3U1LA 2J0SD 2DNRA 2MXYA 4EGLA 2AYMA 1NJIT 3R27A 2DGWA 4CH1A 4W92B 2G4BA 1VQ8S 3ZZZA 3TO8A 3CC7S 3JB9k 2MQNA 2JRSA 4CIOA 1VQ6S 2CQDA 3CCSS 2CQ0A 2MPUA 3CF5Q 1M5OC 3FEYB 1M1KT 2DNGA 5IM0A 2RRBA 1IQTA 3BEGB 5LJ3Y 2U1AA 1P1TA 2DNLA 1VBXA 1RKJA 1K73T 1VQ9S 2KFYA 2DB1A 2RS8A 4FXWA 1FJEB 1UW4A 5CXTA 5DM6Q 1SJQA 5GVQA 5EN1A 2OJ3A 4PKDB 4C4WA 2KN4A 4RU2A 1KQSR 2DGOA 2DHSA 4TLQA 5LSLA 3NNAA 2KH9A 2G0CA 2BZ2A 3S6EA 1ZH5A 1FHTA 1WHXA 3RW6A 2GO9A 3G8SA 2DO0A 4TU8A 1JJ2R 1FXLA 1SJ4P 1PGZA 5D78A 2FC9A 2DHGA 3CCLS 2XSFA 2DIUA 1M5VC 4IUFA 2CQCA 4LMZA 2YWKA 2MJUA 1FO1A 4CH0S 3MDFA 2B0GA 2KT5A 2MZTA 2J0QD 2FY1A 1OWXA 1OO0B 1WHYA 3CCJS 1A9NB 5GAEU 2RQ4A 1WF0A 2N82B 1WEYA 1DZ5A 5GADU 2F9DA 3SXLA 5MLCV 5JVGQ 1OPIA 2MKJA 2YH0A 1KD1T 3UCGA 3CMAS 3PIPQ 1KOHA 2AD9A 2YKAA 2CQPA 3B4DA 2RNEA 1X4HA 1U1NA 2CPFA 1VC5A 3U1MA 2G1DA 3HHNB 2MQQA 4YOEA 2XS7A 3NNHA 2CJKA 1WEZA 4F26A 3B4MA 3EGNA 3ULHA 4Z2XA 2XS5A 3P49B 2QEXS 2KXHA 2A3JA 3MD1A 1X4BA 3H2VE 3NS6A 2DGVA 2DHAA 2ADBA 2M0GB 3G9CA 3ZZYA 4C0OC 1Q86T 1HD1A 2WBRA 2MSSA 3Q2SC 2M9KA 4Y0FA 1W2BR 2LECA 1VC0A 2MQOA 2LA4A 3MURP 2KM8B 3CMES 1JMTA 5LXYA 1B7FA 2JVOA 2MQMA 1HA1A 2DITA 1HD0A 2DGSA 3MI7X 1Q82T 2CPDA 1DRZA 1U1MA 2LXUA 2N7CA 2D9PA 5JVHQ 2VOOA 1HL6A 2PEHA 1R8HA 5DETA 1YI2S 2LEAA 4WFNQ 4UQTA 1DBDA 1N54B 2DIVA 3MUMP 1YJ9S 5ITHA 2VODA 1VQ7S 1U2FA 2MMYA 1U1RA 1BY9A 2KVIA 1H6KX 1FJCA 3G6ES 1L3KA 4IO9Q 4IOAQ 1JJ4A 2J76E 3OW2R 2DGXA 2RUGA 1VBZA 1WHVA 5DDRC 2FHOB 2CQ4A 2ADCA 3IWNC 2OTJS 4OZ1A 3R1HA 2EK6A 1X4EA 2LXIA 2CQ2A 2GHPA 2N3LA 1KC8T 1UFWA 3BO3A 1YJWS 1A7GE 2CPXA 4WFBQ 1AUDA 1PO6A 1D8ZA 2DNKA 2I38A 2LCWA 4U67Q 1CVJA 2VONA 3MXHP 1N88A 3CCRS 2Q79A 2DGTA 1N8RT 5LJ5Y 2JWNA 2OSRA 2J8AA 2D9OA 3VAGA 2N3OA 2RS2A 1QVGR 1VQPS 1FJ7A 1P27B 2L41A 3CCMS 2PE8A 2AYBA 1UAWA 2DNOA 3G4SS 2XNQA 2DNYA 2MYFA 2M8HA 3P5TL 3UWTA 2MZQA 2DNNA 2HGLA 1ZZFA 2U2FA 2ZJRQ 4FXVA 2KG1A 2MKSA 2I2YA 2CPEA 1WF1A 1OIAA 1YITS 1URNA 2DGUA 4YUDA 4LJMA 2BOPA 2HYIB 2L9WA 2E5JA 1S72S 4F02A 1D9AA 3VAKA 3CXCR 3VF0B 3EGZA 3Q2TC
chains in the Genus database with same CATH superfamily
1R3NA 3DNCA 1MN7A 1WTFA 1FD8A 2ALYB 2RE1A 2CWKA 4QWAA 1NPKA 4WPAA 2AYGA 2YVSA 4PYAA 2VJVA 5GMEA 1WUUA 3KHGA 1TVRB 4K8RA 4L3NA 3G2XA 3THPA 1T7PA 3N6NA 4B9NA 5DGAA 1KP6A 2VOPA 3QIPA 5DQIA 1KDNA 1ZZNA 3SEOA 3CJKB 2HG4A 3B8HA 3QAEA 4WU3A 4X2BA 1KTVA 3MMAA 3M8YA 3C2PA 1XN9A 3AODA 4B3RJ 4DN9A 1S9GB 3F0NA 2KU7A 3M6XA 1B70B 3KLGB 4LT6A 2K7JA 2FZKB 3NNCA 2ZNZA 3FRYA 3FSXA 3KLHB 3HHKA 4RNMA 2XCAA 4JI8F 1HNIB 5FLXY 2ZJQQ 1HYSB 1QSLA 1C1CB 5F0UA 2DR6A 3HZEA 2CPJA 2I1RA 1S97A 4CDIA 4LR7A 3G71S 1IKVB 5THWA 3JYTA 3EMTA 3SCLE 1U4BA 2ZBPA 1L5UA 1FEEA 2H5JB 3W64A 1WHWA 3WDOA 1GMWA 4ZHRA 1JJHA 2XBPA 2O1PA 4YP3A 2XZWA 2D41A 4C48A 4L3KA 1FCAA 4DX8H 2M7SA 1RKIA 3PEJA 3KMQA 1FVQA 1O5JA 1T9YA 2KTQA 2K1RA 3OL6A 2GVDA 1S9FA 2ASLA 2KYXA 1WACA 1ACMB 5AXMA 3BO4A 3UD4P 3GJRB 1UPPA 4TU7A 4RUHA 4MKBA 4DV4F 2LEBA 1X4AA 3J81U 1TKXA 1U1LA 3ZTSA 4ED6A 1K9MT 4OZ5A 1KN6A 4LF5F 3RUBL 5IM0B 5KFQA 5JJBA 2CDRB 3CD7A 7AT1B 1S1VA 3GIKA 2VL1A 4R8UA 1B4SA 2X3DA 1HMVB 4YR3A 1GQEA 2KB2A 2VFSA 3MOJB 4AQYF 2FJDB 1KNZA 3NBPB 5ETPA 2DH7A 3DLJA 4O4RA 1T02A 2C22A 3GJTB 3E8OA 3MOZA 2GC8A 4M5MA 5IS2A 2CKWA 3ZTPA 4KYZA 4A47A 4IDKA 1RBAA 2DNLA 3IGVA 5CYQB 3D66A 1DQAA 4TLRA 4NCBA 4RW8B 1XMQF 4OJ3A 5L9XA 3UN3A 1KS2A 3DGPB 4NYZA 3AB2B 4HHUA 4Y2CA 5LSLA 4X64J 1ZH5A 3QRPA 4YB6A 2EKNA 1FXLA 2P5VA 1TKTB 1YSJA 4NWBA 3W2VB 4J9KA 2WSFC 2HW3A 1TL7A 2G13A 5CCLA 3LGMA 4QWCA 4MYTA 2HQFA 5KFDA 5GAEU 4KHPF 3T5JA 4ZVTB 2AJ1A 2KT3A 2MKJA 1S0OA 3CMAS 4OYOA 1X31C 2DVIA 2AHOB 3U1MA 4MFBB 2R8GA 3SV3A 1UA0A 4YOEA 4J91A 1LEOA 1RT3A 2FJXA 4LF4F 2DGVA 3W1YC 2HWIA 1NH7A 2J0WA 2KL8A 2FIUA 4F04B 4Y0FA 5GAHI 4BDPA 1NJZA 1BGXT 1IJEB 1DRZA 5LMUF 3FZ2A 3LP2A 3J81Y 5T41A 1C1BA 1SH3A 2ZBRA 3GIJA 3Q8YA 1S6UA 1AFJA 4KT0C 1U1RA 2DR9A 4DQIA 4ES2A 3D7SB 4KKOB 2FHOB 1RACB 3R1HA 2ASYA 3CO0P 1X4EA 1APSA 3KK3A 3OPKA 3TUZC 4USHA 1YJVA 1AUDA 3OTDA 3OUYB 3KLFB 1XC9A 3MXHP 1N8RT 4JI0J 4CYUA 2JEIA 4Q45A 3IO1A 2RS2A 4EUVA 4USJC 4NLTA 4HH0A 5E3QA 4LFBJ 3C46A 3Q24A 3KUHA 2J7UA 2V9WA 4OLPA 3W8PA 1WF1A 2DGUA 1T95A 2EFPA 2XO6A 3RG6A 1D9AA 3CXCR 4C6AA 1FE0A 3AD9C 3VF0B 1W7WA 4ZITA 2PMHA 1V5VA 4YFUA 6AT1B 1VQYA 3MMBA 4HHJA 3ZZUA 3KG4A 2H48B 4YB5A 3LW5C 2Z58B 1V9OA 4CH7A 4OYPA 2DPJA 3A4TA 5B0CA 2KT2A 1K0VA 4FYDA 2QV6A 2M5YA 4ETXA 3MMCB 1NSKL 1VQNS 3QWUA 1VBYA 1C0TA 3CCES 3TUPA 4DPUA 2GVZB 3UVJB 3GIRA 1U09A 3HZGA 1HBUB 4HDHA 1JB0C 2IM3A 5BYQA 3C19A 2EFQA 4CLKA 3ZTQA 4FYXB 1RHUB 3GYGA 1NHKL 2XMMA 3LANA 2HHVA 4Q8FA 2BJEA 2HIQA 4CNZA 1NM2A 1B3TA 1VOMA 3I56S 1U0HB 5L1JA 4RW7A 3K59A 4LVNP 1Q8LA 1FVSA 4NLSA 1RU2A 3QAUA 3BN7A 5CYMB 2ZE2B 3GCXP 3ZO7A 1M5PC 3NMAA 1TK0A 4KV8A 2ZC3A 4MH8A 4X4PA 4CLWA 1NLKL 4ATNA 4BBYA 3HLUA 4LR8A 3TYTA 2V63A 2R8KA 3IAS9 3H5XA 1YBUA 3G8TA 2RVJA 2RB7A 4ILMA 4PWUA 4UT4A 5KFXA 3MM6A 2D7SA 1FD2A 3VTIA 2BABA 2DBBA 1OY6A 2H54B 2Y0BB 1BQMB 3E2EA 3Q8SB 4Q7AA 1R0CB 2RF2A 3A8EA 1KLMA 1HNXF 5HP1A 1RTJA 4M1KA 5LSRA 1BC6A 4DDFA 3D3BJ 2A6OA 4AL5A 3J7YU 2DNZA 4LSZB 1F3VA 4PG7A 1I94J 2WOMA 4OHZA 2WB4A 4CQ1A 5ETVA 5GMDA 2Y9HA 2IYGA 3CWJA 3OLBA 1FWKA 2Z2ZA 5HROA 4LF8J 5KFOA 3FFIA 2DR7A 1U2RA 4HACA 1VQ8S 5CHCB 4ANDA 1Y4ZB 3JB9k 3TZYA 1CSJA 4DCOB 1JLAA 3CCSS 4WFZA 4G1QB 2Q1LA 5E7OB 2VG5B 1RT1B 5HVHA 4RO0A 5D4PA 5KFEA 1FJEB 5CXTA 8ATCB 5K8PA 3MEGA 1QE1B 1TFYA 4QWEA 9ATCB 4U6PA 4AL7A 2B9WA 1FHTA 2ZDOA 3G8SA 5KFIA 4BWMA 1VDHA 5DG9A 5D78A 1HI8A 2MZTA 1F60B 4LF6J 3E01A 1UKUA 1LOUA 5K14A 4XPEA 5KG7A 4N8OA 1F2HA 3CMQA 4LSLA 2UXBJ 2RNEA 4IG3B 1E6YB 1TR0A 5KFGA 2J9DA 2GO8A 1KHWA 3BGOP 3G6YA 2DHAA 1FEHA 3EVOA 5KFFA 5D4LA 2PD1A 3M2UA 2J6TA 4BLGA 1AW0A 4J9UE 2DXEA 2LA4A 1TKZB 2DD8S 2B9XA 1GMVA 2MQMA 5A8RA 4RPFA 4ALZA 3MM8A 3I5AA 1LNQA 4H4KA 2Z0GA 3QATA 2LEAA 4WFNQ 2BA9A 4ZVOB 3M32A 2POKA 3PRVA 2FLOA 3CJSA 3TWZA 2HK2A 2XM3A 1UVIA 4DUYJ 4CT9A 2OTJS 4LRAA 1U25A 1TAQA 1PCAA 3OXGA 4P73A 1D9FA 1FRIA 1TL3B 2VC1A 4O3NA 3DRPA 2BOAA 3KK2A 3RU0A 3QGHA 4U67Q 1HWJA 4YY3J 3FSYA 1E6VA 3T1AA 3V6JA 3M8PA 2BKOA 2NSCA 3MCNA 3HKWA 2W2PP 4WE1B 4C11A 1JLCA 2B5JA 3WHIA 2H5IB 1CJTA 2LU1A 4FXVA 3SV4A 2E1AA 1S7HA 2FD2A 3SFGA 2Q6BA 1S0NA 1YITS 5B0FA 5B0AA 2LYVA 1G2EA 2BDPA 2D3OR 1HHSA 2OP5A 4P2MA 2IMOA 4BS2A 3RBXA 2AWZA 1LW2B 4F8RA 2BACA 1YLXA 3OR2B 3L7UA 4ZIWA 3HK2A 1NK0A 2RUSA 3OFEA 3OT9A 1UVLA 2CNOB 3CEDA 2WVEA 3MM5A 4DG1A 5D6GA 2XWXA 2E9ZA 1OY9A 1JLGB 5FJ4A 3ILJA 3H40A 2DK2A 1IKXB 1RTHB 4NI2B 3DFEA 3CC2S 4DCPB 1SIZA 3PO5A 1EQMA 4DSFA 1VLOA 2E44A 3G96A 1XERA 1G6BA 3ITHB 3C66A 2BUNA 3PHTA 1PJ5A 5DDPC 1S79A 4JV5F 3HX9A 5E3RA 4RWWA 2ZJPQ 4ED2A 3DOMA 3HM9A 1BMQB 2LLZA 2GCFA 4LF1A 3K5LA 4DU7A 3KDNA 2BRLA 1N4LA 4C8MA 3W2WB 2CAJA 4X4UA 2K2PA 4JUZA 1XNQF 2YWWA 5LXRA 2CQIA 4KFBB 5C42B 2FYXA 4TY8B 1RAJA 2B8QA 2C3MA 4F3MA 1NO8A 1Q78A 4DS4A 5ETSA 2XSJB 1FKOB 1IR1A 3DOKB 3OQ2A 3MCOA 7FDRA 5T14A 1U6ZA 1HI1A 4LSNA 4DPTA 4YDDB 2MGZB 1C0UA 3JSMB 4YB7A 1IN0A 2YY3A 2CUYA 1F5CA 1VFJA 5JMNA 3NS7B 3CTRA 3GV5B 3H4DA 4Y2KA 2NREA 2VICA 2E5HA 3L3CA 2JEFA 5AXKA 3UCZP 3OLAA 2JSXA 2XMVA 5D77A 4O44A 4RW4A 3N0VA 1K47A 1FXDA 4JI1J 2PA3A 3HT3A 3HULA 3MCMA 4TVAB 1PYTA 5GAGU 4ID5A 4ZLPA 1JLBA 3B6BA 1VQ4S 1QD1A 1NJWA 1J5OB 1HBOB 2J0SD 4ES3A 1KFDA 1YJTA 1RWNB 5HQLA 3FC9A 3R5DA 3ZZZA 4CI0B 1ROFA 1BXNA 2ZZMA 3QRRA 3M30B 4OJHA 4NLPA 4JV0A 1YJRA 1RU1A 2DB1A 1REVA 2E5LJ 3RB6A 2GQ2A 3GIMA 1N6QA 4K4UA 1CJVA 1IXKA 3GB0A 5KFNA 3DI6A 1EZZB 4RU2A 2G0CA 4MMOA 1S4FA 1WHXA 3M8WA 2R7RA 3AD7C 4OHVA 3Q8VA 2HHPA 3GFXA 2V0NA 2P9EA 3MMJA 4ECXA 1GH8A 3T5LA 5IT9Y 4AD6A 5ETTA 2QL5B 1YBAA 1WF0A 1MWQA 4DV6J 4UUWA 8AT1B 3ZZRA 3PFOA 2ILYA 4FN5A 3OJSA 4N56A 2YNIB 1RGVA 4CLPA 3P49B 1WD6A 5IWAF 1IBKJ 2ALZA 3Q2SC 1QY7A 1DLOA 1J27A 3BZQA 1JLQA 4ECQA 2HWHA 4IRDA 4RJVA 3BKFA 3UFCX 2FZGB 3KLEB 3ETMA 4I7FA 1D0EA 4B3TJ 2I5JA 2CRLA 1D8YA 2ZOGA 5IQ6A 4X64F 2HQIA 2W7PA 2OFGX 1YI2S 4B9MA 4WFYA 1MROA 2CWXA 2KVIA 2DXDA 3G6ES 2QLXA 3RB4A 2H9ZA 3TR5A 4DSEA 5EUHA 4JBCA 1OSDA 2AGPA 3VWSA 2ZWPA 1I1GA 1BQNB 2HHWA 3QFHA 5J2MB 4K0KJ 4IRKA 4B3SF 3GSIA 2YNGA 4PAAA 5CZVA 4ECYA 2C2EA 4Q43A 4X62J 4P7VA 3QIPB 2OPRA 3CCMS 1U02A 1NHVA 2M8HA 2L48A 1F9HA 1JLFA 4RUAA 1CQMA 1OIAA 3NAHA 1XMOF 2BOPA 4XPCA 2H5EA 2V8DA 1FFGB 1QSYA 3BGUA 2ZUAA 4MIWA 1HWIA 3BPSP 4Q5VA 2VBWA 4ICLA 4CZCA 1CJUA 3OVBA 4DZDA 1LV5A 1WI6A 4RZRA 5GAEI 4NMXA 5KFJA 1LWCA 2GQCA 2R7VA 3JYTB 2AEMA 3MPUB 4ZA1A 4DR5J 4HI1A 4JI0F 4B9TA 1DURA 2BVZA 3G86A 3ZZ0A 5F3ZA 4IH6A 2E5GA 4LFBF 4ZHRB 2OTLS 4IH7A 2VF3A 3D3CJ 2R2RA 2ZZTA 1FT8A 3M1VA 2NZ4A 2Z2YB 3TEHB 4KAIA 3NGDA 2KG0A 2E1MC 3DMJA 1EJ7L 1DTTA 4AE5A 3FJ2A 2N4DA 2WVBA 4IOCQ 2LQ5A 3D4JA 3V5RA 4NLGA 4MTPA 4N47A 3QQCD 3L9ZA 4DOZA 2H65B 3BO2A 1RI7A 1FDNA 5J1EA 3D1HA 3RBDA 3QT6A 5KG0A 3OVAA 2GVDB 1EAYC 2JVRA 2QG9B 4X4TA 1H2TZ 3QLHA 2B9YA 2HVZA 4NCGB 5DLGA 4NLQA 3I87A 1KOOA 1ICEB 5I3QA 3SBMA 4O3OA 2DKOB 1CG2A 1TKXB 1TUVA 4XK8C 1M5KC 1EP4A 3ISNC 4I68A 2R7XA 4F0HA 1WG4A 2ZBIA 1X9SA 4ECWA 3TJ8A 2IBKA 1X5OA 3LPYA 1RABB 1X4DA 4LRDA 2EPIA 4O3SA 4M5HA 1WC0A 4CM0A 2X1AA 3BR9A 2JFKA 2CJYB 3BBBA 1HW9A 2BX6A 4J9OA 3RR7A 3MECA 1X8DA 4IDKB 3FRZA 3UQSA 4NLOA 4NXNJ 5B0DA 3M4XA 1M0SA 5BYSA 3W9HA 1RWPB 2XNRA 4IQMA 2MQPA 2UP1A 2CQ3A 1SC1B 4J7CA 2P8IA 3AJDA 4ZOSA 2XG8A 1TL5A 2YNHA 3MAQA 2MZ1A 4O3QA 2X1FA 3FK4A 2HK3A 3KJVA 3TRGA 1TL7B 4JYAF 4RX6A 2AYMA 3KUEA 1H38A 4CH1A 1HNWF 1U45A 2CJAA 2WRMA 4J9NA 2UUAJ 4USIA 2FJEB 1SKWA 3GSDA 3DRSA 2CQ0A 2MPUA 2DCLA 5EHHA 2MLZA 3OR1B 4XO0A 2VA3A 1HQEA 4KRWA 4FXWA 2R9LA 5AXNA 4IQXA 3LF0A 1JIHA 1N5YA 1RT3B 1NDKA 1PG5B 4PKDB 2C2MB 1ZTWA 4TU8A 4ZLLA 1QAJA 1H74A 2CJ9A 2FC9A 4ED0A 2AX0A 4LMZA 3MDFA 3UPFA 3DRRB 1J5EF 1N56A 5A6PA 2N82B 1C1BB 2P9GA 3PW5A 1RWWB 4ZVQB 4ELUA 4DSJA 1GMUA 5D0RA 4RNHA 1FERA 2RRNA 4F4AA 4LF8F 3I96A 3KFWX 3EM1A 2HBQB 2QN6B 4DZ6A 3LH2S 2ADBA 3KK3B 4MKVA 1AXQA 2JC1A 1XBWA 3EE3A 3BR8A 3G82A 3RAMA 3MURP 3ZZTA 1JMTA 5A76A 2G0IA 4OX8A 2V69A 1HD0A 3MI7X 2CIMA 2GIRA 1NDCA 6FDRA 4CLUA 5KG2A 3POTA 3T6BA 1DBDA 2DIVA 1RE1B 3K5MA 1U2FA 2HRUA 1H6KX 2I8EA 3B82A 4ZN1A 4PYDA 3QJJA 1MMDA 3MPVA 2RSQA 1JXVA 3IWNC 1ZM4A 3R5GA 4LF6F 3BM7A 1RTDA 4WP8A 3UI3A 1DJ0A 3A8JA 4DR7J 3MMBB 2UXBF 2CPXA 1PO6A 1VYAA 3I9V9 3MCSA 1U0SA 1UA1A 4JI6J 1VLYA 1QVGR 2NYIA 4ED4A 1NK8A 1FJ7A 2VKRA 2OO4A 3MZIA 5F0WA 2YKMB 1XMBA 2NUHA 3GR0A 4S0MA 4ZPCA 2KYZA 1BUXA 2HAIA 3EICA 3P5TL 2ZH6A 3MFHA 4DR6F 1ZPWX 2XMWA 1NK6A 2L9NA 2Z8QA 1C0TB 2UXCJ 4WU2A 2HYIB 4NEYA 5AJ3F 1U24A 3HP6A 1VK3A 3C6UA 2XB2D 3CT9A 1U1OA 4BC9A 1VQLS 1DTQA 5ETMA 3UR0A 1U6FA 4PG6A 3CJ0A 1GXUA 3HI9A 1O8BA 2DY1A 1S77D 2CQGA 3R1LA 1RLCL 2CQ1A 5A8KB 4DV7J 5I4MA 2E7WA 4FYVB 2GJ2A 3T1HJ 4PG4A 3RTVA 2L9DA 5ADZA 1F9FA 1CULA 5H9FK 4LBIA 3CD6S 3RBEA 3AY0A 2ZOFA 4X66J 1O0PA 3BREA 4KV8B 2DRBA 1Q16B 2V34A 5F8HA 4K7QA 1ZETA 3VAMA 1RZMA 4PRFA 2HVIA 3MPYA 2OGUA 3LA0A 3V81A 1FKPB 3LO3A 2AGQA 3PRDA 4PQUA 3MM6B 5LMNF 4KPCA 1TQLA 3EXYA 1FE4A 2FJWA 3GP9A 1NJXA 1CBKA 2Q43A 1S6PA 4ZP6A 1M5SA 1BWEA 4B17A 2RF2B 1KLMB 2EFVA 4RUCA 5HP1B 4QWDA 3TEGA 1RTJB 3UCUP 1RHJB 1TK8A 3DLGA 5GMKa 5K20B 3Q8RB 3HSGA 2IJRA 2P9CA 3C15A 2B8PA 3C14B 4ENOA 4F50A 2R3VA 5HROB 2GX8A 3FFIB 3I31A 4BWJA 1P1LA 4QPTA 2OEMA 3O2IA 4KGKA 5E41A 1GXLA 1H7XA 3NGTA 1JLAB 2I0XA 1VJWA 4WKYA 3OFHA 1F0XA 4DUZJ 2FC8A 4JV2A 2PA8D 1Q8IA 4ZVEA 4PPDA 1MU2A 4AUKA 2M2BA 4FVCA 2MZSA 4YB1P 3OL9A 5IFMA 5H9FJ 1G3OA 1P6TA 3VAFA 4LF9J 4KH0B 1GFWB 1RWVB 5SUHA 5HN0A 1S10A 4EI2A 2DGWA 2G4BA 3E01B 2HWTA 2FVCA 2MQNA 4RKUC 5K8OA 3KKFA 3TA2A 1CEZA 3CDEA 4EFAC 2OAUA 4LSLB 3J81j 2U1AA 1UJ5A 2OPQA 5FIIA 1IWGA 4DX7A 4OHWA 4X84A 4JI2J 1X7VA 4EK2A 2CNKB 4DF8A 2E1RA 4Q8EA 3G87A 4JOUA 3KJQB 4X65F 3CCLS 3NY0A 2CQCA 1TFWA 4HTIA 2OHDA 3ISZA 2D74B 2K7KA 1OSCA 1G1XA 4JI1F 2HMIA 2E1CA 1WHYA 2OUGA 1MMLA 1FRHA 1B7YB 1QLNA 2EFNA 3QBCA 2HNYA 1SKUB 4ANEA 4DL3A 3TAMA 3W62A 1H0HB 3FMBA 3P8BB 2WSEC 4C0OC 4Z7YA 4ZPDA 1HWKA 5I42A 2WBRA 3DRPB 2HAFA 2R2UA 3KK2B 3FGVA 2LECA 3GJSB 4KH1B 1E6VB 2CDQA 2PGCA 1RAIB 2D9PA 1R8HA 4LRCA 3MR7A 4O3RA 4DL4A 1JLCB 2HRTA 3ILOA 1U48A 2OEKA 5KOXA 4NYPA 2PC6A 2VFUA 5JUMA 1GMWD 1WSVA 1IR2A 1RAFB 1Q79A 4GO7X 5GAGI 1Q53A 4L76A 2QA1A 4IFVA 4DV4J 4P2XA 4GRSA 2ZH4A 2ZBQA 3O44A 2C28A 2DPIA 4LF5J 3QJLA 4QYZK 2Y1LB 2B56A 4MK7A 3AJ1A 2MZQA 2QZ8A 3MM5B 2DNNA 2HGLA 2ZJRQ 5KT4A 5IV4A 3RRHA 4LJMA 3L95X 2R42A 3KHRA 4D3HA 4AQYJ 3SCIE 3UR3C 3OBIA 4R5PB 3MR2A 1VRTA 2FDNA 3EZOA 5IOLA 1WELA 1SQGA 3VAIA 2DH9A 1QDUB 1ZA1B 3JSRA 2NUUG 2WW8A 3HF5A 3M9OB 2OFHX 4QR0A 4I2PA 3UN5A 1XTZA 3T9ZA 4WP9A 4F0KA 2HGNA 5AE3A 3N5FA 4MJKA 3DOMB 1WI8A 3KNAA 3MEEA 2XC9A 2R8JA 4OMFG 4X62F 1L3TA 2VH7A 1YZ6A 3R8YA 5KFVA 3PM9A 2XEXA 3SMZA 2F7VA 1WEXA 1HR0J 2BW2A 3H25A 4XTTA 4GMKA 4DU8A 5C25A 5L46A 1VHIA 2D3O1 2XWYA 3TA0A 2K3KA 3S8SA 1PIEA 1WG1A 3AXKA 1X5SA 1NXIA 3X3UA 3KUGA 2AYEA 3D6TB 1Z2ZA 2MLXA 5KFLA 5DRKA 3NS5A 4LF4J 1UEUA 4DWIA 4FXDA 3IRXB 4LSNB 3T3FA 1VGYA 5HSPA 1C0UB 3ILLA 3H5UA 3FCVA 1V3SA 1YBTA 4DR5F 4QPXA 2IVFB 4K4YA 4MAKA 1C4AA 5C2GA 3JQKA 3R2CJ 2WK4A 5LMUJ 1SC4B 2ZM6F 2RT3A 4QYZJ 5DGBA 1FTCA 3SSRA 3LP1A 4A8XA 5HJXA 2M8DB 2AGOA 3DU5A 1KR4A 3PJXA 2OIHA 3NL0A 4O44B 3K7RA 1YHQS 2CZ9A 4N76A 3F44A 5KFAA 1UWBA 2FZCB 5K9FA 1FESA 4ID5B 2DHXA 4PR6A 2E5IA 3HT0A 1NSPA 1WG5A 2VC0A 1Q7LB 5C7PA 4ZPWR 4OYXA 5KFTA 1GX6A 5F3TA 2HURA 1V3RA 3CJ8A 1MN9A 1Y0HA 3H90A 3EDRB 2M70A 3LAMA 1REVB 4LRBA 3V2UC 3RB3A 3JSBA 1N6QB 1CJVB 2CJQA 3DI6B 4DV5J 3BH7B 1RA6A 5F41A 2JEJA 3GWCA 1QTNB 1OYDA 2PN6A 1VK8A 5ETNA 5L1KA 1GK8A 5A2QU 2HHTA 1L3SA 2ZHOA 3TO8A 3CC7S 1NZAA 2CQDA 3FKBA 3CF5Q 4AFFA 2Q6CA 2CYYA 1VBXA 1RKJA 1Y7PA 5DM6Q 4KGXB 2FQQB 5EN1A 4NZ6A 2E9TA 3M05A 3RGIA 2XMKA 1VMBA 4KE5A 1KQSR 3NNAA 2HZVA 4DLGA 1DLOB 4GVBA 2UV8A 5U47A 2NXJA 3NOCA 1PGZA 4I7FB 5HANA 4IFYA 4CH0S 2HS4A 2I5JB 4M5IA 3PKYA 1WOOA 4A8YA 1OWXA 1DFDA 1HWUA 1DARA 2FHJA 3IXQA 2FJVA 1DQ9A 1MROB 3CIMA 2W2MP 3QO9B 3HVTA 1C4CA 1TL1A 5A8WA 5AE2A 2CPFA 2XMJA 2BJDA 1CS4B 3D5MA 2KXHA 3QWPA 3MD1A 2UUAF 5ETLA 3BKUA 2XLJA 4EO6A 1HHQA 4QBUA 1W2BR 1AROP 1ZOTA 1NSAA 3TNVA 3O1LA 4UZCA 2DGSA 2YNGB 5FDLA 1SB6A 3ELHA 2QMWA 3PW7A 3M6WA 1RHQB 4LREA 5DETA 1HBNA 3D6HB 3HSZA 5BR8F 5ITHA 2VODA 4AXJA 2V2KA 2HPUA 3DLKA 3DDNA 1JJ4A 1JLFB 5EX3A 1G4CA 2RKIA 1S12A 3C3LA 2V9KA 1WC6A 3CW2C 3BV8A 5IT0A 2LXIA 2Y8YA 4URSA 1YG0A 3D6MB 2W4DA 5C24A 2N3LA 4ZPBA 4C98A 1UEVA 1Z4UA 4DR2J 1YJWS 4IYQA 1A7GE 4J9SA 3BGLA 5D3GA 4YS2A 2HNZA 4ICLB 2I38A 1CJUB 5A2QY 2JWNA 2UUBF 3VAGA 2GA7A 1HNZF 2VBXA 1WC1A 2R2SA 2RU9A 1N33J 2BQRA 1ZZFA 3SQOP 2AZ3A 2KHDA 1URNA 2EC2A 4CLLA 2L9WA 4DSIA 4JI7F 2HHUA 3K57A 3Q2TC 2V68A 3KLIA 4ECTA 3SZ2A 2M88A 3MR3A 3M1VB 4XDDA 1FX4A 4DL2A 4P6QA 3DMJB 1LWEA 1DTTB 4OYMA 2B6AB 2W2NP 4O4GA 2IFXA 3PX4A 1UFKA 4FBTA 4ZCIA 2H3EB 1R8AA 4CNYA 3M6VA 2MKYA 2AF6A 2ZVSA 5J1EB 1X9WA 4PPZA 1OPZA 2LU2A 1S6QB 2B43A 4JI6F 3QLHB 4FNHA 4QR2A 4ED3A 3V6DA 3W66A 1SJRA 1LFPA 1HQUA 2MKHA 4QIEA 3TX8A 4W90B 4OV1A 2R2TA 2LDIA 3BSAA 4ELTA 2UXCF 4FF3A 4OYAA 1EP4B 4MT1A 2IBOA 4KIAA 2BKPA 2C2OB 4M5JA 3K5PA 3CJQA 2MZJA 2GFFA 1PJ7A 3UDCA 4HKQA 4I6AA 1WWHA 2AEJA 2RJZA 4FYYB 1NK5A 3SQGA 3ENVA 2JLFA 4WKRA 2DHHA 4CM2A 3ET6A 2XGPA 4NRTA 4L75A 2HGMA 3T19A 3K0JA 2ATLA 1BWVA 3I4HX 3MECB 3T1HF 2CPIA 1H73A 1RT5A 1ZAVA 3H5SA 2VDIA 4X66F 4PQAA 3A3PB 4NLXA 3M2VA 1NPRA 1XQIA 1VC6A 1S9EB 2DNPA 3D54A 3J80U 2YNHB 1FNOA 4HL9A 4Q2MA 4LRFA 3KJVB 3OSPA 5HATA 1IBLF 3LP0A 2A6MA 1PC4A 1HPZA 1JKHA 3TVYA 3Q8UA 1Y11A 2R8IA 2EWHA 1SI9A 1UJ4A 2VG6A 1N5YB 3O8WA 1YZ7A 2C3OA 3IC1A 3BJYA 3PDNA 2ROEA 1X60A 2G9OA 1Q81T 4I2QA 1UZHA 3K5OA 1ZTTA 4MIAA 1UCNA 2HFUA 2MXYA 2V8HA 1XR5A 2B4UA 4OJGA 3VR1A 2JHEA 2XHCA 1IVZA 2IRYA 4UY85 4YN3B 3FEYB 2VG7A 3SCKE 2IRXA 1TV6A 3KLHA 2XGQA 2HFVA 4NYOA 1HNIA 4HT5A 3FZBA 4DX6A 2J0XA 2VASA 3G82B 1JJ2R 2AT1B 4DUZF 1WJ9A 5KT5A 2GZOA 3EJMA 3GV8B 4C0HA 1M1HA 2KT5A 2XHWA 2XMAA 1P9QC 4GC6A 1S76D 2FY1A 1OO0B 3POTB 4M8LA 4MYUA 1OPIA 3DU6A 2AD9A 4LF9F 3OTCA 4EZ6A 4DEZA 1U1NA 4WFXA 3SYZA 5C2CA 2CJKA 4ID8A 4I69A 3PYFA 1R8BA 3PHEA 3ZC4A 4Y2MA 3J80Y 1KWMA 4WIQA 3HSJA 1F6TA 2Z56B 1QUVA 1EETA 4JI2F 4JI5J 1XNQJ 3OVSA 5DZ6A 4U7CA 2V8PA 3HJFA 1T94A 5K8MA 4J9RA 3GR1A 5I3UA 1UL3A 4C3MA 1X0PA 1L3KA 3U02A 4IR1A 4E98A 2GHWA 1JXLA 1MNEA 2Y3YA 1TELA 2DTJA 1TKDA 1SBRA 3D9BA 2IC3A 3OFFA 1UFWA 2H4WB 1RUSA 3C6UB 1VISA 3D68A 1VS3A 4F3OA 4ED1A 5K5MA 1D8ZA 4P75A 1EQ0A 2DNKA 2LCWA 1K1QA 1T9UA 1DTQB 2F5GA 2YWHA 5B7WA 1TP7A 3TQ1A 5C5JA 1T05A 4A8WA 3FQLA 3NBPA 3MM9B 5EWFA 3G8QA 2EFOA 1XWLA 2MKSA 5KOWA 1IBMF 3HVWA 2IM0A 4EBDA 1EB0A 3IP0A 1CULB 1S59A 1HBMA 5KG5A 1D9DA 3CJTA 2H1YA 2KHCA 2ZH7A 3IRWP 3HCXA 3A8IA 1FJGJ 5J2QB 1N0VC 5M2PA 3WBZA 4DHVA 4K4SA 1T9TA 1TKTA 4NLDA 4PUOB 2OMLA 4C2MA 2ZFHA 3Q86A 2DH8A 3S01A 1U8WA 3OHBA 1O51A 1RT2A 1LWXA 4OLOA 4XDCA 2ZITA 5DM7Q 3OL8A 1JK9B 2UV8G 2MKKA 4MFBA 1MSWD 4Y00A 4OZ0A 4HT7A 2CQBA 1S1WB 1S6PB 3VV2B 3UE2A 4PWDA 1PKUA 1VRQC 5H1SV 3W7BA 1RBOB 2DEIA 2HZAA 3DLGB 4USWA 1HLWA 1IR0A 1G7CB 3C15B 5IWAJ 2HKEA 1SJ1A 2GAGC 3M8ZA 1FRMA 4EO8A 4C97A 3D0GE 5DDOC 4OHYA 3KNGA 5J2NA 1KONA 4KKOA 1QTMA 2V2QA 2GV1A 4IG0A 3BQ0A 3PZPA 1AB8A 5IT4A 1VIOA 2LA6A 5J2PA 3TP2A 5HVGA 1SUQA 1MU2B 1HR0F 1FFSB 4C8NA 3M2RA 3LGHA 2BJ8A 3MD3A 2KRBA 1FA0A 1AFIA 2OMOA 3KG1A 5HO4A 5KFCA 4XIUA 4DL5A 1IKYA 4B3SJ 5A0YA 4FKXA 3LALA 3CCQS 3TANA 1T0TV 5AE1A 5F8LA 2OPQB 5D8HB 2DGQA 4KSEB 1CC7A 3GG0A 2B3TB 4HLBA 2HQDA 1XMOJ 1S1UA 3GYXB 5HLFA 1VR6A 3LWMA 1FKAF 1TAUA 2KFZA 4OX7A 3AAWB 3Q8PB 1Q8BA 4NL5A 3QT7A 3UNGC 3U1LA 5F9LA 3MMCA 4EGLA 1UEKA 1MG7A 4QW8A 4DV1J 1H98A 2LQ9A 3UVJA 4LF7J 4CLSA 1IQTA 4NZ7A 3BEGB 2EG1A 3TARA 4NA1A 2RS8A 8RUCA 4FBUA 4M95A 2R8HA 3TZWA 2XYGB 2O66A 4KR0B 5I42B 4AXIA 3QRQA 3NWRA 1NMEB 1GT8A 4U7UD 1RAHB 1WC5A 1RHKB 2MJUA 1ELOA 1FO1A 2W9CB 2B0GA 3HFVA 1U0HA 4DV5F 2IYIA 3CCJS 3W8GA 2RQ4A 2Y8WA 3W5YA 1DQ8A 1KD1T 3PJWA 4EU0A 3KJFB 3FEZA 3W5XA 2YQ0A 1UWAA 1NBEB 1OQ6A 4USKA 1OMSA 4DV0J 3ULHA 2JZ5A 5IC4B 5EWEA 3EPIA 4H4MA 2PT0A 2KJWA 3PX0A 3A8KA 2R7UA 4IFVB 5L1IA 3EPGA 4QIVA 3NGSA 4K59A 5EGYA 2DITA 2IHR1 1Q82T 5HBMA 1U1MA 2ZD1B 5JVHQ 3AB4B 2D69A 2V2VA 4DR1F 2YX4A 3V4IA 2MMYA 4RW9B 1UZDA 4B08A 5KFHA 4IO9Q 4ZJQA 4ZP9A 2QYCA 3KG0A 1XIQA 1BQMA 2BANB 3OD2A 1N5TA 1M5HA 1TU0B 3HVAA 3TUIC 1VRTB 3BN4A 3HHLB 4OV6A 3F73A 1JXEA 3RB0A 3NKYA 5CCMA 4I2PB 1RA7A 1PJ6A 2MYFA 4LF2A 3N01A 1Y5NB 5HMZA 1LKZA 1R27B 3MEEB 3RYLA 4J37A 4C8KA 4URGA 3IWLA 1HARA 3CDBA 2FVPA 4HYKA 2R7TA 1D1UA 4DJBA 3GMGA 3AJ2A 4B9UA 1RT1A 4B3MJ 4JYAJ 4KY3A 2LMIA 3JTNA 4F25A 1HNWJ 1OY8A 3RW7A 2ZHAA 4ZLNA 5C25B 4ZN3A 2PSZA 2QA4S 2JL9A 4DR2F 3ICLA 4ZVSB 4ZKAA 3R7SB 3LOUA 4ZPTR 5DG7A 1RT7A 1IBCB 4CT8A 3LAKA 4L73A 3DDIA 3DKDA 1CQNA 3PYGA 2RQKA 1X0FA 1SJFA 4TU9A 1N33F 4OI6A 3S7RA 4ED7A 2UVRA 1J5EJ 2V5HG 2XQCA 3VAJA 4IOBA 1Q5VA 1KTQA 3LP1B 1M90T 2QFJA 1RT6A 3I6PA 4PZVA 2HS3A 2JOQA 2HNDA 1UWBB 1L3UA 1OS5A 3I0RA 5BJRA 4K50A 3JSYA 2K8GA 1R8CA 4KPYA 2X1BA 5CABA 4URQU 2CQHA 4DV3J 4DR4F 1NKEA 3QGIA 1BE4A 2P6TA 3CJ2A 3H2UB 4DUTA 3KK1A 2ZDPA 3OFGA 2OLWA 2ZH1A 4RWXA 1R7IA 4UY8T 1LWFB 3HFZB 3JTPA 4OHXA 2VIHA 3THVA 3SSSA 1HWLA 3EWGA 2ZH3A 4WXOA 1RHRB 1PBUA 2EVZA 3CNQP 3HMJG 4WE1A 3CPWR 1H2UX 4JV1A 3HJVA 3PG9A 2I6WA 2W1BA 3NMRA 1SCJB 3TW0A 1MW7A 2BRKA 1B0VA 2RIJA 3IA0A 3MEDB 3M8QB 2RU3A 3A1YG 3UO0A 4DR6J 1YRUA 3KJNB 5BXIA 4F4WA 1LW2A 1YK9A 2LEPA 3MM7B 3GQCA 5AJ3J 2WONA 3WX4A 4GVBB 2F65A 3JXOA 2ZEJA 3EGWB 4IFYB 4WP3A 2HLTA 4B3OB 3P4UB 1CPZA 3A3NB 4UOHA 4QYRA 3MTJA 2UVVA 3JAMY 1SL2A 3MR5A 1IKXA 3HVTB 1TL1B 3TX0A 4TKTA 5A8WB 4DFJA 3BGRA 2HVEA 2F40A 4OX6A 3RAXA 4DPWA 4TLQA 3LGNA 3RW6A 4DMZA 2H4YB 4TYAA 2IAJA 3DYAA 2DHGA 2PO4A 3NLCA 2C3PA 1RAEB 1D09B 2IPOB 5FDLB 1H3DA 1Q0NA 1SPBP 1YJ7A 1EX8A 3NEKA 1HBNB 1S7IA 3TZXA 3D6FB 2YH0A 1FDAA 4A8FA 3DLKB 3K8VA 1X4HA 3W2WA 1VC5A 2RKIB 5KFPA 3ZTRA 1PC5A 1F9EB 2VPZB 4CO1A 4F26A 3B4MA 3ZXWA 3Q8QB 4CO0A 2Y0SD 5C24B 4DV2F 4CLTA 1Q5YA 5LMNJ 1FK9A 4KFBA 3MPWA 7FD1A 4DPYA 3UN2A 1OJ4A 2OPPB 4RW6A 3TAQA 5D3GB 1VC0A 1MMNA 2HNZB 3BB5A 2XSJA 4PXBA 1KVKA 3DOKA 3PYEA 1HL6A 2J9EA 3ZZPA 1YJ9S 3R9LA 2FLPA 3K58A 1FX2A 3JSMA 4FP9A 1GXTA 2RUGA 4HTJA 2VKZG 5L39A 4EWTA 1RSCA 2GHPA 2YWFA 4TXSA 1S1XA 2AEFA 2F8EX 1N5VA 3GV7B 2V8VA 2V2ZA 1LWEB 1I3OB 1K1SA 4O4GB 3EZ5A 3AA8A 5KG6A 3VCDA 2V6AA 3Q89A 2W24A 1B0PA 3QSYB 5CD4H 3ZTOA 4Q0BB 2UUTA 2IJNA 5IT9U 2UUWA 2I2YA 2C2DA 3MTKA 4JI5F 4YUDA 5CH7B 2ZH5A 3V6DB 3EVWA 3M30A 1HQUB 1TUGB 1AUSL 1S6OA 4K4XA 2XY5A 5IXUA 4KGMA 1FWPA 1H7WA 1TMJA 2FJAB 5H9EK 1JJCB 4G1PA 1RJJA 2KXFA 3CSKA 2QO3A 5DZ7A 4J5OA 4EYIB 5L1LA 2MKCA 2AV5A 3SQGB 5CQGA 4ZP8A 3DRYA 2ACYA 4CCHA 2ZNYA 5F8IA 1NJYA 2AKWB 4OYBA 3ET6B 2HQ3A 4X65J 1UETA 1N32F 5HI7A 2YKPA 4NX9A 1EHWA 2UXDJ 2K06A 4ED5A 2YQ1A 3CJ3A 3CCZA 2GQQA 1RT5B 5G0RB 2UUCJ 2WBMA 3M2VB 4YHHF 3KLEA 3MEKA 1FJGF 3G6VA 2DNMA 2X1GA 4BC7A 5D0GA 2NXEA 3K2YA 3HKZD 3HHDA 5AT1B 1NZ8A 1JKHB 1S4EA 1LK5A 2GIFA 1NPPA 3I82A 1BQNA 4PABA 2V4QA 5J2MA 2VG6B 1IM6A 5F8MA 1F5BA 3PV8A 4G6VB 1U7LA 3CO9A 3MUVP 4EBEA 3GLJA 1RLDA 2ZUGA 4I2QB 3KHHA 4YEAA 2XMUA 3RBZA 3J7Z5 1K8AT 2FUG9 5E2QA 3OV7A 4A8QA 3SIPB 1TMMA 4RR5A 4O0IA 2W9BA 5H9EJ 3HFKA 1SQEA 4LFAJ 3KYLA 5E5NA 2VG7B 1EKSA 3KMSA 1JQGA 2VBYA 2G2OA 3FBEA 4WYWA 4B9LA 4P52A 1TV6B 3AT1B 4NA2A 4N77A 2B4OA 3CJRA 1KQGB 4A4JA 3DLLQ 1RT4A 5I3PA 3ETOA 4A8KA 4OZNA 4W4MA 3LUYA 3R27A 1T3OA 3GU0A 4CWBA 1FRJA 1ITPA 4WTOB 2VPYB 3DLHA 5D4NA 3DLEA 3R6GB 2B4VA 4MK8A 5EWGA 4CTAA 2NZCA 4KHMA 3OTOF 2DGOA 2DHSA 2BZ2A 3HHLD 2DO0A 3AOBA 3BBCA 3W60A 1XR6A 3MMAB 3PR5B 1EETB 4ED8A 2E7VA 3ONQA 1T11A 3K89A 1VIXA 2W01A 1CJKA 1P8GA 5I3UB 4ILLA 1V5IB 4NLRA 4NCGA 1I51B 3MGJA 2G1DA 4K4WA 3HHNB 5LT5A 3CIZA 5B08A 2V67A 2QEXS 2IC3B 4DF4A 4Q2LA 4DV1F 3ZZYA 1HD1A 4O23A 4LF7F 2CA9A 4NPOA 3AH6A 2MQOA 3DM2A 1XEZA 3NOGA 2WSCC 1HA1A 3U1NA 5F8JA 2W7OA 4DFMA 2XULA 2MHEA 2ZM6J 1RAAB 2BXJA 1T05B 4NXMF 4DBQA 3P5BP 2LXFA 1R0AA 1BY9A 2FB0A 3BSOA 2LQ8A 2VUGA 3PEHA 3UD5A 4ZVPB 4DN0A 4F7VA 3E3XA 1NK7A 1NK9A 5D0HA 2QSFA 2FGOA 5HMYA 3W9IA 3RAQA 4ZIVA 1HBMB 2NQPA 3NXZA 2Z2MA 4WFBQ 2K1RB 5LL6d 4DV0F 2DGTA 5G4DA 3PJ9A 4NLVA 4G3IA 1XNRJ 2GGPA 5D0EA 1NEEA 4OYZA 2ROPA 2U2FA 3FBFA 1RXOB 4L72B 4FKYA 5ETRA 1RT2B 3PNIA 3H2LA 1VBKA 1RWMB 2VV5A 3IR5B 4GKJF 3QT8A 4JP8A 3OR1A 1S1VB 4OI2A 2IVYA 1SJ3P 1URRA 3MR6A 4R8UB 1QUPA 4RBUA 3CC4S 1UP1A 3PW2A 1OQ3A 3GYNA 5HJYA 1ZM2A 3CCVS 4PWDB 2WVFA 2NLWA 2KKHA 1S48A 2AIRB 1VHFA 2QLWA 1YGYA 3L7OA 2VJUA 4DSKA 2DNQA 3H5YA 3V6KA 3DRRA 4NEZA 2YKNA 5SZTA 2YPZA 1FF2A 3BPDA 4M5KA 2EEYA 3LTOA 3QIDA 2QLFB 5J2NB 3L09A 1WTBA 4MIBA 2NPIA 4PEOA 2VQFJ 2JLEA 4IG0B 4RBTA 1QJHA 2DNHA 2J7KA 4NLWA 5J2PB 1T9WA 3MWBA 2WB1D 3OTEA 4RBVA 2W2OP 2C42A 1SUQB 4B3MF 3N4WA 2VDHA 2KXNB 2HVHA 2N4CA 3M2RB 2DCUB 2PI4A 3KOAA 2MQLA 2JC0A 3SDEA 3IBFB 1KHVA 2YNFA 2AQ4A 2CPZA 2HHHF 2EG2A 4TYBA 2YKQA 1IKYB 5A0YB 2DISA 5IZHA 3ENQA 3W9JA 2FHJD 4DQRA 3KDOA 4M5DA 3ISND 1WDDA 5BR8J 3DC2A 4J9PA 2BJ3A 1UVNA 2CG8A 1S1UB 3LP2B 3PXGa 5HLFB 1V6HA 2EW9A 2IRUA 3T9NA 1X4GA 2GNKA 1HW8A 2MQ8A 2YKMA 4ZCKA 4K4ZA 2KJVA 3DHWC 2NXUA 2M4MA 4Y6IA 2QC3A 3IG1A 1YKWA 2UUBJ 2LDYA 2W4CA 3PR4A 1HNZJ 4Y2IA 4LFCJ 3VGVA 3HHEA 4DV3F 2MY8A 3QFWA 2QFIA 4CYUB 1Y9OA 2GMJA 4FF1A 1YVFA 4JI7J 4C9DA 1NRKA 1WNEA 1R6YA 4EBCA 5KFUA 2O5DA 2FHMA 2VPWB 4K5RA 3WIUA 1RYSA 5KT3A 3QZ8A 3RRKA 2KM8C 4QW9A 5M2RA 2VZ9A 1NJIT 5A8KA 5ETKA 2BQ3A 4ZCLA 4QJVA 3CVKA 1NB2A 3FVYA 1VQ6S 4GKKF 2RRBA 4ZPAA 5LJ3Y 4OZJA 2CVIA 3QZ7A 4DR3F 3VZHA 4CLFA 1IKWA 2F63A 4ECZA 4H4MB 3IS9A 1HNVA 3H8YA 4V19J 4I67A 5EDWA 2GO9A 5E3PA 4HEA9 3FUYA 5HBMB 1WKKA 1YDLA 2XLIA 1FKPA 5JVGQ 2HBYB 2BJ7A 3V4IB 1KOHA 2HFOA 1GNKA 2E29A 2C3YA 3PX6A 2O01C 1TTHB 1WEZA 4NLYA 3S1TA 1NDPA 2MLYA 3H2VE 3TJ9A 2M0GB 2HHSA 1Q86T 4K5SA 2NR0A 3L7PA 2CXEA 1FDBA 3HD2A 2GMLA 1NH8A 4OYWA 2F8MA 1RCXB 2EXUA 4RW7B 4DFKA 1EARA 2LXUA 1S57A 1Z2LA 4X4NA 4DQSA 4CLZA 1VQ7S 1FJCA 2ACMA 3C14A 3TVZA 4IOAQ 3GTYX 1VBZA 1OYEA 4ZLJA 1WHVA 5DDRC 4E2FB 2ADCA 6FD1A 2FLLA 3VQSA 1S1TA 5HQMA 4FDFA 5DQGA 4O0NA 2RH3A 2G2ZA 3P45B 4C8LA 2NS1B 1VCTA 2ASDA 2VONA 1IBLJ 1RTZA 3EZUA 1N36F 3T1YJ 5HMXA 2XY7A 1U49A 1P27B 5ETOA 3AOCA 3PACA 4JI4F 2PE8A 4E8UA 3H98A 3T5HA 1RT7B 1Q95G 1UW9A 2EKYA 4I56A 3KHLA 4WJBA 2AJ4A 1LXNA 3QGGA 2E5JA 1RYRA 2ZH2A 5EX0A 5KG3A 1S5ZA 2GHVC 4Y34A 1KQKA 2IJFA 2ZH9A 1IJFB 1D3WA 4A46A 2BQUA 4FYWB 5CA5A 2IDLA 4ZK7M 5KG4A 3QPIA 2WOMB 4HHHA 2FHKA 1PAUB 2VQEF 2RHSB 3AD8C 2HQCA 1RT6B 4USMA 1F1BB 3D0HE 2FPHX 4ZMMA 4HACB 3C6TA 1J2VA 1ULRA 2HNDB 2KRRA 3I0RB 4RNNA 4LBPA 4FVMA 4QU7A 1U47A 1T9VA 4Q44A 3BSNA 1LW0A 4U8VA 3J7ZT 3MEGB 4CLYA 3KK1B 4IRCA 5KTQA 2R7SA 1RTIA 5RUBA 2NCKL 4P9SA 1T3NA 2XZDB 2EK1A 4F3QA 3CD5A 1U26A 5DS7A 1VQMS 5E0OA 4UTGA 5K14B 1SH2A 4DQPA 3SSQA 2UVWA 3R7BB 3DHXA 1V3ZA 3VGUA 3LPEA 4Z7CA 1U1PA 2LQJA 3M2UB 2HLUA 1I6JA 3R5JB 4QOTA 1YJNS 2QL7B 5KFBA 2J8SA 1LFWA 3AQOA 2ZHBA 3KXDA 5A8RB 1HI0P 2UXDF 2Z2LA 3MM8B 2GMHA 3VGTA 3IR7B 2OH2A 2WONB 3M32B 2HBRB 1KBRA 2KZZA 1S49A 4OX9J 2YH1A 4JI3J 3PCOB 4QQBA 2UUCF 3K5NA 2UU9F 2G2YA 3LQVA 5B0BA 3H4BA 5KFZA 3CDUA 3MF5A 2VPXB 2RHQB 2DR5A 4R5PA 4U9RA 3TOQA 4H4OA 3BGRB 2KFNA 2A2CA 1IBMJ 4YDXA 1GX5A 2B7CB 3M8PB 3GG1A 1KEKA 2N7YA 2F3JA 3R2DJ 5E3AA 1KKHA 1WKJA 5JXSA 4F2RA 1HQ2A 2NXCA 3FCWA 2R4FA 4C11B 3BDPA 2B5JB 2XYPB 3HPOA 4OFZA 2XI3A 3JQJA 1NU4A 1CJTB 2CPYA 2IAJB 3DYAB 1SXLA 2YPYA 2EFGA 2Z57B 3CJ4A 3FBBA 2QIFA 4HI2A 4CIOA 4PG5A 2DNGA 2YWGA 3TAPA 1UVJA 2ZZNA 3QSIA 1FRKA 5HMWA 4USVA 4UW2A 2BM0A 3T6JA 2FJBB 5E33A 4B3RF 2W2QP 4LFAF 1FK9B 1SKRA 3H20A 4RW6B 5LOQA 4DG1B 4QWBA 3GFZA 4F67A 2QT7A 3MAHA 4DX5A 2WVCA 1JLEA 2Q66A 2IM2A 4ZS6A 2WHOA 3QJPA 2QMXA 5GADU 3CE8A 3IRXA 3BYPA 2W4PA 3PIPQ 4NMLA 1H72C 2JNJA 2JLGA 1PAEX 1KLNA 4U8YA 2CZ4A 4FF2A 3FNNA 4FF4A 4QIFA 3HDSA 4KGVB 4QCLA 1S1XB 4PXCA 2NPFA 3UDLA 2V4JA 5DJBA 3GZ7A 2YX1A 4DPOA 3FQKA 3EUNA 3BF4A 2B9EA 3BDEA 2QMUB 2PMZD 1KQFB 2N7CA 1R0BG 4OZ3A 1ZS6A 5B09A 4I64A 3AFGA 2CQ4A 1KVJA 2AJQA 1KC8T 1AZSA 1MLAA 5M2UA 4HDGA 1T03A 1HKAA 2Z4PA 2PMWA 1HHTP 3CCRS 2F1FA 5DQHA 4FPIA 5L9NA 5LJ5Y 3WC2A 2AJFE 2J5AA 4H54A 2N3OA 1VQPS 2L41A 4IH5A 2BMBA 3OJUA 2AYBA 1UAWA 3G4SS 3HO1A 3UWTA 3HHLC 2CADA 2CPEA 2HVDA 4CRJA 4K4TA 1NB7A 2HIYA 2CFXA 3C16A 4EMDA 5BYRA 3PRBA 3CDAA 4YR0A 4JB8B 3CUNA 4RW4B 1UJ6A 2HFSA 3BYRA 1Y10A 1JLBB 1WC3A 1YX2A 3O3LA 2MZRA 2PDAA 3DOLA 4D3GA 3WC0A 3ZFVA 1Z1ZA 2MJNA 1F5AA 4O3PA 2XS2A 1XJWB 2C1EB 4HVZA 2C2NA 1XNRF 2HSEB 2DEJA 2C2KB 2ZWOA 2HS0A 3QO9A 2J6UA 4WIIA 2QJ3A 4RLEA 1FDDA 2J7WA 4ECVA 1B0TA 4OI0A 1CS4A 3TJAA 3US5A 4X4QA 1VQKS 4I6YA 3DXBA 3CULA 4IO1A 2BE2A 2E7XA 2AMCB 4UF4A 5E3CA 4UQGA 4KQZA 3NCQA 2B4PA 1WF2A 3U7JA 4NASA 3GE9A 3GCWP 2BYCA 3ZZOA 2AJ2A 1NSQA 2W9BB 4W98A 3W61A 2VU5A 3KTQA 4DR1J 1JLQB 9RUBA 2DRAA 3E51A 2DO4A 3OL7A 2FLNA 3N9UC 3V6HA 1PSDA 1T9XA 4Y2AA 2VQFF 5F8GA 1PYSB 1VRUA 3VVUA 3A3OB 2O67A 1RQ0A 3R3TA 2L3MA 3MUTP 1U6BA 3JTOA 1RT4B 2SXLA 1RDRA 2NSBA 4KO0A 4R0JA 2C2ZB 4C7QA 2MB0B 3F41A 3ADAC 1WDTA 2PIIA 2OKQA 2RDIA 4QU6A 3DLEB 3NCPA 3AA9A 3R5CA 1TZ0A 3A13A 1SV5A 4CTAB 2AW0A 5KT7A 3HXMA 4KBIA 2OSQA 4RNOA 3J7A1 2OPRB 2B6AA 2RAQA 3RZAA 1H2VZ 2JDJA 4U95A 2DNRA 4F0MA 3O5TB 4RL1A 1UPMB 1R31A 2V8GA 1NK4A 1UMJA 4HR2A 1XK8A 2HFNA 1S6QA 4QIGA 3M7VA 2QE5A 4DL7A 1CJKB 3I0SA 4ER8A 2FTRA 1PILA 2OEJA 4DCJB 3NGUA 2RQMA 1F3FA 5F8NA 4P7TA 2DXFA 4B02A 3PFEA 3EVMA 5J1PA 1FFWB 2KDOA 2KH9A 4LFCF 4K2JA 1QAIA 1LWCB 1SL1A 2LQBA 2P6SA 3DM2B 2XSFA 4PXDA 3NGKA 4MKYA 2RDDA 2OPSA 4WYLA 4CO2A 3NAIA 4ZP7A 1N34J 1WEYA 2A10A 3SXLA 3UCGA 2QA4G 1R0AB 3B4DA 2FVQA 2MQQA 1VQSA 2OD4A 2H51B 3WZ0A 2XS5A 3D0IE 3DN9A 3ENAA 2IM1A 4DPXA 2PEBA 2ZH8A 1W25A 3Q0AA 3CMES 4DR4J 2VA2A 4HH1A 3I4PA 1FRXA 1Q4RA 4F36A 1S9EA 4J9VA 2PEHA 1MWZA 1O6XA 2XMTA 2GGPB 1AT1B 1SC6A 4MK9A 4C8OA 1Y3KA 2HQGA 2J76E 2DGXA 2J9DE 4ILRA 4NOHA 1RCOB 1CC8A 2QLJB 1MWYA 1KRPA 4YQWA 4KB7A 2GJFA 2MEWA 1PBAA 2UZAA 3B54A 2OSRA 4KHRA 2Y1JA 2M3DA 4P10A 3MAAA 3EDQB 2DNOA 2A0FB 3W5ZA 1ZAXA 3HD1A 4FS2A 5KFRA 4Y28C 1RHMB 2YKNB 5B0GA 2CJXB 3H0PA 1I94F 3EGZA 4G1IA 5T7LA 3IWXA 3FCHA 1Y3JA 4PXEA 2BKNA 3VALA 1Q1KA 4X4RA 1PYOB 4J9QA 2A18A 3QGPA 1R8PA 1R89A 1Y5IB 1AA1B 5IQQA 1M1GA 1VQOS 1YIJS 3T41A 2Y1IA 2ROGA 2YWEA 4Z37A 3TA1A 3PIOQ 1LK7A 5KAKA 4OL8A 2J6SA 2WW4A 3PW4A 4ZJLA 4ZCMA 4DXLA 3T1YF 5KFYA 2XO7A 3DRSB 4I4BA 4M5LA 3SDEB 3Q23A 1U1QA 2YNFB 1RWKB 1HQEB 1W26A 3R5AA 3DRXA 3P3DA 4M5DB 1TVRA 3FEXB 3J7YI 2QYGA 2A2DA 4ANCA 1A0OB 2VD3A 2DR8A 2GJIA 3CJKA 4ECUA 1WOPA 5CAAA 2V50A 2M52A 4EEYA 4NLUA 4TNOA 2L08A 2MY7A 4DV2J 1ZA2B 4CP5A 1X5PA 1S9GA 1YWXA 3KLGA 3C8YA 4WF9Q 1DY3A 3VVTA 2ERRA 4Y65A 5B0EA 3IG1B 3U27A 2C2RA 1HYSA 2Q3PA 1C1CA 1QAYA 2D3UA 1Y5LB 1IKVA 4G65A 1RWOB 4ES1A 1Q7YT 4ZVRB 4DUYF 3BS9A 4OQJA 2ZC4A 1GTEA 3SFUA 5LSOA 2QL9B 2V94A 3MM9A 5IC6B 2VFRA 3AXMA 2KVQE 3GPAA 2YQ3A 4YY3F 4M5NA 1RTDB 5HK4A 2KI2A 2F4VJ 1SKSA 3RR8A 1XR7A 2BW7A 1UVKA 1B99A 3UD3P 1K0TA 5HL7Q 4AL6A 1FNXH 3I32A 1IKWB 2XCPA 2EC0A 5DO2A 2IA0A 1NKCA 2HHQA 3FMWA 3IS9B 1S0VA 4N5SA 1HNVB 1R43A 3AQPA 2X3GA 2HZCA 5J2QA 2JX2A 1KFSA 1EKRA 2AU0A 3KWMA 2MSTA 4LIRA 3GONA 4DLEA 1GAOA 4PUOA 3RJMB 2GW8A 3SI8A 1NUEA 3MHYA 1YJUA 2NXNA 4KJIA 3DCAA 4OX9F 4TQRA 3GILA 1YQHA 5IM0A 4JI3F 4BHQA 3CD0A 1P9YA 3R97A 1P1TA 1K73T 4ZVHA 2KFYA 4OZ2A 1SJQA 4EZ9A 1HMVA 2OJ3A 4C4WA 2XZTB 2VFTA 1S1WA 1ZAWA 5D15A 3ZNJ1 2D3ZA 4DL6A 1N32J 4F4ZA 4IUFA 4RNFA 4X4VA 2A1BA 1A9NB 3W65A 5MLCV 1NAQA 5D4OA 1JNZB 4ZVGA 2IY5B 4FZVA 3RRGA 1AYEA 3JQMA 3M8RA 2CQPA 1NCLA 3IFEA 5CYQA 1X9MA 1L3VA 3ENWA 2FVSA 1IUJA 4YHHJ 2XS7A 4RW8A 4Z2XA 1YRXA 4KTQA 1S1TB 4WBFA 3DGPA 1X4BA 2OI2A 3NS6A 1RAOA 3CJ5A 1C2PA 3DXSX 1RWUA 3W2VA 1B7FA 2JVOA 3V81B 4DQQA 4CO4A 4USUA 2CPDA 4ZVUB 4I1TA 3F56A 2P2CB 1NNDA 3WX8A 4PQUB 1JWWA 1N54B 3MUMP 2E66A 4FPRA 1S0MA 4UOGA 2XI2A 4WZMA 3IMQJ 1RP5A 2EK6A 5CZXA 3EXCX 1JX4A 3X1LB 1UVMA 3A12A 3EGVA 1W2IA 4PG8A 2BJ9A 1SIWB 1CVJA 3UW1A 2D9OA 4FS1A 2DNYA 1JNRB 4N41A 3IGNA 3GFYA 3B78A 5KG1A 3C6TB 3JS9A 2PFDA 4NCAA 4B9VA 2ZBCA 4JI8J 3DDKA 1S72S 4C0BA 4L74A 4ZPVR 3P6YC 1UFLA 1LW0B 4UUXA 3NGRA 3OUYA 3KLFA 1RTIB 1Q8KA 5KFMA 1S99A 1BD6A 3N6MA 2FVRA 4TQSA 4P74A 5KT2A 5KFWA 2LKZA 5GADI 2DY9A 3THTA 1TK5A 2E5LF 2COLA 3D67A 5L38A 2W9CA 1HFEL 4OZLA 3OTOJ 2MDAA 2CJBA 3UDVA 3HVRA 1FNMA 1U2CA 4PWWA 2IIHA 4U7UK 1KSPA 4WCEQ 2ZKUA 4DV6F 3D1OA 2CNLB 2WAQD 2O3DA 2WTFA 1YTYA 2MTLA 3OSNA 1EIYB 5KT6A 2JJ4D 2AJ0A 2QA2A 2HMIB 3NG8A 2KO1A 2Y1RI 1GTHA 1NHUA 1X4FA 2ZD1A 2JH3A 3BGFA 1IBKF 1WKLA 5L8RC 1ZPVA 2GVZA 2HNYB 3W3SA 1HBUA 4A8SA 4RW9A 3R7NB 1RK8A 4B3TF 3VAHA 3TAMB 1RAGB 2BANA 4NXMJ 3CCTA 3W63A 4H4OB 3ILIA 3V4MA 3HHLA 4A48A 2B51A 5DDQC 2CG4A 2MHNA 1N5SA 1VQ5S 3NCRA 2IMWP 3Q22A 2VFVA 2XYHB 3OXLA 4ZJOA 1QAXA 3DGVA 3M9NB 4F4XA 2LFVA 4WFAQ 2HRYA 5GAHU 5CYMA 2ZE2A 4K0KF 1N48A 2OELA 3KLVA 3I55S 1XMQJ 4U96A 2ILZA 2FY8A 3D1QA 5HVFA 4GO5X 3MFIA 1FTRA 3PY8A 5LM7E 2GAHC 4R25A 1QM9A 3EYZA 3UNYA 3GFHA 4DS5A 4PCQA 4K2XA 2X7IA 3PYDA 4UZBA 3DLBA 4R0EA 3ZNUA 4KHPJ 1WSRA 4A8OA 2YTCA 1X4CA 4GKJJ 3LWLA 1DHMA 3TZZA 4GC7A 1JLEB 1WOSA 1RB0A 1A6LA 4F2SA 2JRSA 4TY9A 2W7AA 4TN2A 1M5OC 3CDWA 4C3KA 1T8EA 2BE9B 2K3IA 1VQ9S 4NE9C 2IVMA 1ZM9A 5K8NA 2HEKA 3IAM9 5GVQA 4CO5A 4M94A 4K4VA 2KN4A 3VGSA 2IDEA 2VBZA 3S6EA 2JEGA 1SJ4P 3FDSA 2V4JB 3AHPA 2ABYA 4UOFA 1M5VC 1SC3B 1BQXA 4P2SA 2BM1A 2AP6A 2KZMA 3WIVA 2CZVC 2FGCA 4OI3A 3CCWA 4G1QA 1FRLA 2QLBB 2VG5A 2QX0A 3QNWB 3Q83A 4DFPA 4DL0C 3QYYA 1QE1A 3EGNA 4WK3A 3FBCA 2A3JA 2ZKTA 3G9CA 1AZSB 2MSSA 3BQ2A 2HHHJ 2APOA 1T03B 1LWFA 5MAOA 3OHAA 4I6WA 2I9SA 5LXYA 4P72A 3BQ1A 1RWXB 3CGIA 3AOAA 3G6XA 4UQTA 2BE7D 3VQTA 5KFKA 1FI4A 4B9SA 1R6VA 4IG3A 3OW2R 4IR9A 1E6YA 4C8ZA 2RMLA 3JAMU 1NKBA 1N34F 3C16B 2CNNB 2OD6A 4NA3A 3TI0A 3MEDA 3M8QA 3N28A 4N7TA 3I5BA 3QT5A 1TKZA 5DG8A 2BJ1A 4OIXA 2DJWA 3MM7A 1SQFA 1NDLA 3UDEA 3DOLB 4NXNF 1LQ9A 3BH6B 2DYAA 4QZVB 3M6UA 2KG1A 4C3LA 4B3OA 2BBEA 4WZQA 4F02A 2D1CA 4LIWA 4YMEA 1TL3A 1FWLA 2BR0A 3I5CA 2CVEA 3T5KA 4ITSA 1DAXA 2YKOA 4ELVA 3O6QA 3GIIA 2RDJA 5F9NA 3GJQB 1Y00A 4GKKJ 2BE2B 4NRUA 5FD1A 2QGFB 1K44A 4DR3J 2W8LA 1RADB 2QTWA 4LUBA 4XAKA 3CB4A 2CPHA 1BHNA 1N0UA 1IM4A 3M9MB 3CCUS 3IM9A 4V19X 3VZIA 4RUBA 5A6WA 4ECRA 2RRAA 1SH0A 3OR2A 3PVXA 2ASJA 2RQCA 3D2WA 2IA6A 3FSIA 4LR9A 4DSLA 3EX7B 2OPPA 2RILA 1QVFR 4IKAA 2MKIA 2F4FA 2W25A 1BLUA 1JLGA 1VRUB 1YRTA 3N79A 4X4SA 1CLFA 3NRBA 4C8YA 2G1HA 1IQZA 1RTHA 4NI2A 1N52B 3J7AN 1HNXJ 2EBGA 4Y3CA 4KO0B 3R6LB 2C3UA 4ETZA 3ITHA 4QR1A 5CYJA 4OYIA 2W8KA 3K17A 2Z30B 2YXLA 2E9RX 1ZM3A 1I5OB 4LQ3A 4KGZB 1ZYQA 3NWGA 1SV5B 3L4BC 3IBWA 4OI1A 2WZ1A 4AYBD 3PTWA 4ZVFA 2ZOMA 3HSDA 1VI7A 3PKMA 1B64A 4X4OA 1GEHA 4DR7F 2HHXA 4ERDA 4Q0BA 1N36J 3MPDA 4H4KC 1U1KA 2QSWA 2F9JA 1RISA 3I0SB 3OTBA 2W9AA 4JI4J 5C42A 2WCXA 4TY8A 2R7OA 2J9CA 4WTYA 4WWSA 5KFSA 4KC5A 2VHGA 3H42A 2R7WA 1FKOA 4E0DA 4A8MP 2AZ1A 4I0WA 1LXJA 1X5TA 3IM8A 2XTJP 3P96A 1REGX 2MGZA 4GVLA 1WORA 1TUWA 3D28A 2PI5A 3PO4A 5AXLA 4AT1B 2GIQA 4LQ9A 4P71A 2OPSB 4J90A 4W92B 3BSCA 4N8NA 3KLIB 4L6V3 1M1KT 2VQEJ 3PW0A 5CD4A 4OJ1A 2G0JA 4ZDNA 3TVKA 1UW4A 1QSSA 3K8WA 4DV7F 2HFZA 1VJQA 2F4VF 4OI4A 1RBLA 3I9ZA 3SCJE 4RU9A 1FXRA 2GS8A 1SVDA 5ETQA 2HBZB 5HQ8A 4FNIA 4BCAA 2DIUA 1J5OA 1HBOA 3TUJC 5G0RA 2YWKA 1IWAA 2J0QD 1SL0A 3OXFA 2EBEA 1DZ5A 3QMQA 4LBHA 2F9DA 3BBFA 4ECSA 3IN5A 2B7BB 2X51A 2YKAA 3N6LA 2V4RA 3NNHA 2RD5C 4DI6A 4NZ0A 3R5BA 1HIYA 2LVWA 3VHQA 2R7QA 2WVDA 2ZVIA 2YX7A 4USTA 4YR2A 5DLFA 2UVUA 2M9KA 3TQEA 2XLKA 3M8SA 2BV3A 2PFFB 2KM8B 4WXWA 4EYHB 4F4YA 2VB6A 3IR6B 5FLXU 4V1Ak 4M5GA 2VOOA 3BKTA 2NYHA 3MAAB 4QIWD 2F8HA 3N5BA 5IV3A 2ATCB 1UTAA 2YNIA 2DRDA 4OZ1A 4LVOP 1N5QA 2XY6A 3WQPA 2CQ2A 5J1NA 2JFDA 3BO3A 5T7LB 4WK1A 1ZBTA 2DT9A 5HAOA 4F4KA 4MKAA 2EI5A 3H59A 2UU9J 1N88A 2Q79A 4P2FA 2AX1A 2LP4A 2J8AA 2QRRA 1WC4A 4UOCA 3NP5A 2E1PA 1KVIA 1F2GA 3H7HB 4J9LA 2XNQA 4CO3A 4M63A 3IBCB 3LP0B 4J9MA 2BEFA 1U8SA 2YBVA 1HPZB 3VAKA 1TL4A 4JV5J
chains in the Genus database with same CATH topology
2R7TA 1R3NA 1D1UA 3DNCA 5BYRA 1WTFA 3PRBA 3C6UA 1FD8A 4DJBA 2XB2D 3CT9A 3GMGA 3AJ2A 2RE1A 3CDAA 4QWAA 4B9UA 4YR0A 2AYGA 1RT1A 3CUNA 4RW4B 2YVSA 3KHGA 1U1OA 4BC9A 2LMIA 3JTNA 4F25A 1VQLS 1TVRB 1DTQA 1UJ6A 4L3NA 3THPA 3RW7A 1T7PA 2ZHAA 3N6NA 5C25B 3UR0A 4B9NA 1U6FA 5DGAA 2PSZA 2QA4S 1JLBB 2JL9A 1GXUA 3CJ0A 3HI9A 4PG6A 4DR2F 2VOPA 3ICLA 1O8BA 3QIPA 1S77D 2CQGA 5DQIA 4ZKAA 3R1LA 1ZZNA 3O3LA 2MZRA 3SEOA 2PDAA 2CQ1A 3DOLA 3CJKB 2HG4A 3LOUA 4ZPTR 3B8HA 3WC0A 4D3GA 5DG7A 3ZFVA 1RT7A 1Z1ZA 2MJNA 5A8KB 3QAEA 1F5AA 3LAKA 4WU3A 4CT8A 4O3PA 4X2BA 1KTVA 2XS2A 3MMAA 3C2PA 5I4MA 1CQNA 1XN9A 2E7WA 2RQKA 4HVZA 2GJ2A 4DN9A 4PG4A 1XNRF 1S9GB 3RTVA 1X0FA 2KU7A 3M6XA 2L9DA 5ADZA 1F9FA 3KLGB 2HS0A 1SJFA 4TU9A 4LT6A 1N33F 3CD6S 2K7JA 4OI6A 3QO9A 3NNCA 3RBEA 2ZNZA 3FRYA 2J6UA 3AY0A 2ZOFA 3FSXA 3S7RA 3KLHB 1O0PA 3BREA 4ED7A 4WIIA 3HHKA 4KV8B 2UVRA 2DRBA 4RLEA 1Q16B 1FDDA 2J7WA 4ECVA 4RNMA 1B0TA 2XCAA 4JI8F 1HNIB 4OI0A 5FLXY 2V5HG 5F8HA 2ZJQQ 3US5A 3VAJA 4X4QA 1HYSB 1QSLA 1VQKS 1C1CB 5F0UA 4IOBA 3HZEA 2CPJA 2I1RA 3VAMA 1ZETA 1KTQA 3LP1B 1S97A 1M90T 3G71S 4I6YA 1IKVB 3DXBA 3CULA 4PRFA 4IO1A 2QFJA 2BE2A 2E7XA 2HVIA 1RT6A 3I6PA 5THWA 3JYTA 3MPYA 5E3CA 3V81A 2HS3A 2JOQA 4UQGA 1FKPB 3LO3A 4KQZA 3SCLE 2HNDA 1UWBB 1U4BA 1L3UA 2AGQA 1OS5A 3PRDA 1L5UA 3I0RA 5BJRA 4K50A 1FEEA 3JSYA 4PQUA 2K8GA 1R8CA 3NCQA 3MM6B 1WHWA 5LMNF 1TQLA 3WDOA 2X1BA 2B4PA 4KPYA 1WF2A 4URQU 4ZHRA 3EXYA 1FE4A 2CQHA 3U7JA 1JJHA 4DR4F 3GE9A 2FJWA 2BYCA 2XBPA 1NKEA 3ZZOA 3QGIA 2P6TA 3CJ2A 2O1PA 1NJXA 4YP3A 2Q43A 2W9BB 3H2UB 3KK1A 2XZWA 2ZDPA 2D41A 3OFGA 3KTQA 2OLWA 2ZH1A 1S6PA 1FCAA 4DX8H 4RWXA 1R7IA 4ZP6A 4UY8T 1M5SA 2M7SA 1BWEA 4B17A 1RKIA 1LWFB 1JLQB 2RF2B 1WNEA 2DRAA 1KLMB 3PEJA 3E51A 2EFVA 4RUCA 5HP1B 4QWDA 2DO4A 1FVQA 1O5JA 3JTPA 3KMQA 4OHXA 1RTJB 3OL7A 3UCUP 2FLNA 3N9UC 2KTQA 2K1RA 3SSSA 3THVA 3V6HA 1PSDA 3OL6A 1TK8A 1HWLA 4Y2AA 3DLGA 2VQFF 5F8GA 5GMKa 2ZH3A 4WXOA 3Q8RB 1VRUA 1S9FA 2ASLA 2O67A 2EVZA 2KYXA 1RQ0A 2P9CA 1WACA 3R3TA 2L3MA 3HMJG 3MUTP 1U6BA 5AXMA 3BO4A 3UD4P 4TU7A 3JTOA 4RUHA 4WE1A 1RT4B 4F50A 5HROB 4MKBA 3CPWR 1H2UX 4DV4F 2SXLA 4JV1A 2GX8A 3FFIB 3I31A 2LEBA 1X4AA 4BWJA 1P1LA 1RDRA 4QPTA 2NSBA 4KO0A 3O2IA 4R0JA 4KGKA 4C7QA 1TKXA 1U1LA 3NMRA 2MB0B 3F41A 3TW0A 4ED6A 1K9MT 5E41A 4OZ5A 1MW7A 1KN6A 1GXLA 2BRKA 1H7XA 4LF5F 1JLAB 1B0VA 2I0XA 2RIJA 1VJWA 3IA0A 4WKYA 2PIIA 3MEDB 5IM0B 2OKQA 5KFQA 3M8QB 3OFHA 2RU3A 1F0XA 2RDIA 4QU6A 3DLEB 2FC8A 5JJBA 4JV2A 2PA8D 3CD7A 1S1VA 1Q8IA 3NCPA 3GIKA 2VL1A 3A1YG 4ZVEA 4PPDA 1MU2A 4AUKA 4R8UA 3AA9A 3R5CA 2M2BA 4FVCA 1TZ0A 1YRUA 1SV5A 2MZSA 4CTAB 1HMVB 4YR3A 1GQEA 2AW0A 4YB1P 2KB2A 5KT7A 3HXMA 2VFSA 3MOJB 4F4WA 4KBIA 2OSQA 1LW2A 2LEPA 3MM7B 3GQCA 4RNOA 3OL9A 4AQYF 5IFMA 2FJDB 3J7A1 2OPRB 2WONA 3WX4A 1KNZA 3NBPB 2B6AA 5H9FJ 1G3OA 2DH7A 3RZAA 1P6TA 3VAFA 1H2VZ 2JDJA 3DLJA 4O4RA 3EGWB 1T02A 2DNRA 2HLTA 4IFYB 3O5TB 5SUHA 4B3OB 5HN0A 2C22A 1S10A 1CPZA 3E8OA 3MOZA 1R31A 2V8GA 2DGWA 1NK4A 2G4BA 2GC8A 1UMJA 4QYRA 3E01B 2HWTA 3MTJA 2FVCA 1XK8A 2MQNA 4RKUC 5K8OA 2CKWA 3KKFA 5IS2A 2UVVA 2HFNA 1S6QA 4QIGA 3TA2A 3JAMY 1CEZA 4A47A 1SL2A 3CDEA 2QE5A 3MR5A 4DL7A 1IKXA 3I0SA 4IDKA 4EFAC 2FTRA 3HVTB 2OAUA 1TL1B 4LSLB 4TKTA 1PILA 5A8WB 4DFJA 2U1AA 2DNLA 3IGVA 5CYQB 1UJ5A 3BGRA 2OPQA 2RQMA 1DQAA 4TLRA 5FIIA 5F8NA 4P7TA 4B02A 4OHWA 4X84A 2F40A 4NCBA 4RW8B 1XMQF 3PFEA 4OJ3A 4OX6A 5L9XA 1KS2A 4NYZA 3AB2B 5J1PA 1X7VA 3RAXA 4Y2CA 2KDOA 5LSLA 4TLQA 2KH9A 4LFCF 3LGNA 1ZH5A 4DF8A 2E1RA 1QAIA 1LWCB 4Q8EA 4JOUA 3RW6A 4YB6A 4DMZA 1SL1A 2LQBA 2P5VA 1TKTB 2P6SA 4TYAA 1FXLA 4X65F 2IAJA 1YSJA 3DM2B 3DYAA 4NWBA 2DHGA 3W2VB 2PO4A 2WSFC 2XSFA 2C3PA 3NLCA 3NGKA 4PXDA 3CCLS 4J9KA 4MKYA 2CQCA 1TFWA 4HTIA 2G13A 5FDLB 3ISZA 5CCLA 2D74B 3LGMA 1H3DA 2K7KA 4QWCA 1OSCA 1G1XA 2OPSA 4WYLA 4JI1F 4MYTA 4CO2A 2HMIA 3NAIA 2E1CA 4ZP7A 1WHYA 5KFDA 1HBNB 5GAEU 4KHPF 1WEYA 1MMLA 2A10A 1FRHA 3SXLA 3T5JA 2AJ1A 1QLNA 2KT3A 2MKJA 2YH0A 2EFNA 3UCGA 2QA4G 1R0AB 1S0OA 3CMAS 1FDAA 4A8FA 2HNYA 3DLKB 3B4DA 3K8VA 2DVIA 1X4HA 3W2WA 2FVQA 1VC5A 3U1MA 4MFBB 2R8GA 2RKIB 5KFPA 3SV3A 1UA0A 2MQQA 4YOEA 1VQSA 1PC5A 2OD4A 2VPZB 4CO1A 4F26A 3B4MA 3WZ0A 2XS5A 1RT3A 4DL3A 3Q8QB 2FJXA 3TAMA 4CO0A 1H0HB 2Y0SD 3FMBA 5C24B 2DGVA 3D0IE 4LF4F 3DN9A 2WSEC 4DV2F 2IM1A 2HWIA 1NH7A 4C0OC 2J0WA 4ZPDA 1HWKA 1FK9A 2WBRA 5I42A 4KFBA 3DRPB 2FIUA 3MPWA 7FD1A 2R2UA 2ZH8A 3KK2B 2OPPB 4Y0FA 4RW6A 3FGVA 3TAQA 2LECA 1W25A 5D3GB 1VC0A 1MMNA 5GAHI 3Q0AA 3CMES 2HNZB 2VA2A 4BDPA 4HH1A 1NJZA 1E6VB 2CDQA 1BGXT 3BB5A 2PGCA 3I4PA 2XSJA 4PXBA 1IJEB 1DRZA 1FRXA 5LMUF 3FZ2A 3DOKA 1Q4RA 1S9EA 2D9PA 3LP2A 1HL6A 2PEHA 3J81Y 1R8HA 2J9EA 1MWZA 5T41A 1C1BA 1SH3A 3ZZPA 2XMTA 2GGPB 3GIJA 1YJ9S 1S6UA 1AFJA 4KT0C 4O3RA 4DL4A