1K0TA

Nmr solution structure of unbound, oxidized photosystem i subunit psac, containing [4fe-4s] clusters fa and fb
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
80
structure length
80
Chain Sequence
SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSAC SUBUNIT OF PHOTOSYSTEM I
publication title Solution structure of the unbound, oxidized Photosystem I subunit PsaC, containing [4Fe-4S] clusters F(A) and F(B): a conformational change occurs upon binding to photosystem I.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Electron transport
total genus 1
structure length 80
sequence length 80
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2001-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1k0tA00
1HFEL 1BLUA 2XSJA 1Y5NB 1C4AA 1Y5IB 3MM6B 2PDAA 1K0TA 2FGOA 3MM5B 1SIZA 1VJWA 3MMCB 1XERA 1JNRB 1H7XA 1CLFA 1G6BA 3MM9A 1FRIA 2ZVSA 7FDRA 1KQFB 2C3MA 2FJAB 1ROFA 3IR7B 4ID8A 1GT8A 3MMBA 1A6LA 1IR0A 2C42A 1FDBA 1JB0C 1SIWB 1SJ1A 1Y4ZB 2Z8QA 6FDRA 3OR2B 5BYQA 1G3OA 1FD2A 1FTCA 1D3WA 3C8YA 1AXQA 1DFDA 1F2GA 2VPWB 1FERA 1FDNA 2V2KA 3MMAA 2XSJB 2V4JA 2VPZB 3GYXB 1F5BA 4KT0C 1Y5LB 2GMHA 3MM8A 1H0HB 1RGVA 1B0TA 4Y28C 1FDAA 4XDCA 3MM9B 2WSEC 3IR5B 5CH7B 2PA8D 3EUNA 1FRHA 2VKRA 2WAQD 3LW5C 2C3PA 1BD6A 1GTEA 2FJDB 1DAXA 3MMBB 1FDDA 2WSFC 2WSCC 2PMZD 3MM7B 2FDNA 5E7OB 1KQGB 5CHCB 3OR1A 2IVFB 3IR6B 4OMFG 3MMAB 1PC5A 2GMJA 2V4JB 1H7WA 1FRJA 2Y0SD 2C3UA 4YDDB 2WB1D 2FJEB 3MM8B 1KEKA 3MM6A 3MM5A 3MMCA 3HKZD 3PNIA 1JNZB 1H98A 1F5CA 4OV1A 1BWEA 1WTFA 1B0VA 2VPXB 4RKUC 4XK8C 1B0PA 4AYBD 5L8RC 5BYSA 2UZAA 5FD1A 4DHVA 1GAOA 1FRXA 1R27B 1FCAA 3EGWB 4XDDA 1FF2A 1GTHA 1PC4A 1FRLA 1IQZA 5BYRA 3OR1B 7FD1A 1FXRA 2VPYB 1FRMA 4CI0B 1Q16B 3EXYA 3OR2A 1FRKA 1C4CA 4L6V3 1FXDA 2C3YA 2FD2A 3MM7A 2O01C 1BQXA 2FJBB 2C3OA 1DURA 1BC6A 6FD1A 1FEHA
chains in the Genus database with same CATH superfamily
4ZCMA 4X2BA 3KWMA 4PXBA 4LMZA 1WHWA 3G6ES 5A2QY 5L9XA 3T19A 4ZLNA 1MROB 1XK8A 1HI8A 3US5A 3CD0A 2CPDA 4NRTA 4P2FA 3QSIA 2Y9HA 5ITHA 1H2VZ 4CDIA 1Y4ZB 4LSNB 4WU3A 2QMUB 3D7SB 5GAGI 2CQIA 1UJ6A 4I0WA 3SV3A 2I5JB 4Q8FA 4AL7A 4EZ9A 3MEGB 2VQFJ 3HM9A 2OTJS 1RYSA 2AW0A 2E5HA 3VGSA 4NL5A 4UQTA 2Y1LB 1VRUA 3HDSA 3TZWA 2UXDJ 4DQIA 3EMTA 3NGUA 2XMMA 2IYGA 3VALA 4DV2J 3FMWA 3SQGA 1R43A 3EWGA 1FWKA 2ZH6A 5F3ZA 2B4PA 4R25A 2MHNA 2WONA 4MMOA 1VI7A 5HJXA 1FRMA 4RW7A 1KKHA 4JI5J 1IKXB 1Z1ZA 1JLBB 2MGZA 1NK4A 4F4AA 4QWCA 4LF5J 4UQGA 2VHGA 5B0CA 3TJ9A 4NE9C 4LFAJ 1WSRA 4ETZA 2H4YB 1KQKA 2EPIA 4ZKAA 2VONA 4PZVA 2AEFA 5KFWA 2YNFB 1FWPA 1U26A 1CJUB 1S97A 5F8NA 2C2KB 4YB7A 4I56A 2MKIA 2GA7A 2KFNA 4KV8B 4BCAA 1I94F 1LK7A 5D0EA 2BEFA 3VHQA 4F26A 2JH3A 2ZH5A 4KPCA 5J2NA 3MAAA 3K89A 4QWDA 2ZJQQ 2GS8A 4URQU 1X9SA 4WP9A 4GKJF 3A8IA 1HBNA 4EBEA 4GKKF 4EBCA 2E9RX 1RHRB 3HHEA 3IBWA 4B9MA 1UJ4A 2HW3A 1F9FA 1LW0B 4QR1A 4U67Q 1TZ0A 4ZPCA 1GAOA 2KYZA 4CH1A 4KJIA 4FYYB 2O1PA 4ETXA 3DLEA 3R9LA 1SH2A 3NMAA 3R27A 3C15B 1OSCA 3HSDA 4RW6A 3EVMA 3ZTPA 1JK9B 1T03A 1WC3A 3ZZZA 3OXLA 2G9OA 2MDAA 3RR7A 1D3WA 1U0HA 3KMQA 2MYFA 2VQFF 3DRSA 5KG6A 2E1PA 1LK5A 4C3KA 2HNYA 2IMWP 1TFYA 1YJVA 2Q1LA 2R7UA 2UXDF 2HGMA 1ELOA 4XPEA 3MD1A 3KK1B 2YNIB 3W1YC 4NZ6A 1U1MA 3NY0A 1CULB 5C5JA 3I9ZA 4KHMA 4FVMA 1S1XA 2DGWA 3KLHA 1KEKA 2DT9A 4F3OA 5ETTA 1TUWA 3PFEA 5LSOA 2BYCA 4DR1J 3K5NA 4MIWA 1DZ5A 4TXSA 4K59A 4NMLA 4JI5F 4NCBA 2O5DA 1S57A 2B6AB 2HHVA 4LF5F 4DF8A 1VBYA 1UL3A 5IM0A 1UETA 2QV6A 3W5YA 4LFAF 4IH5A 1YBUA 2BJ8A 3S1TA 3WX4A 5I42B 2DNLA 7FDRA 1XR7A 1UEUA 5KFMA 3GONA 1X7VA 3BO3A 4ED2A 1X5OA 2K3KA 4USUA 3IO1A 2RDIA 1FKAF 2G13A 3JSYA 3HSGA 4LQ9A 2KN4A 1VK8A 1NJIT 2XSJB 4E8UA 2R42A 2VASA 4U8VA 3JTPA 2MQMA 4I2PA 4ECVA 5EHHA 3OD2A 5CAAA 4ECQA 3OFHA 4PWWA 1UZDA 1C2PA 4FF1A 3AOCA 3M2VB 4JV2A 3HKWA 3AXKA 3GCWP 2CDRB 3PDNA 3KJNB 2Q43A 5E3QA 2CFXA 3M8SA 2EFOA 3JQJA 1FJCA 3R7BB 4C11B 3TVKA 1TKXB 3TP2A 3MURP 2PDAA 2CQDA 1VJWA 4IQXA 3ETMA 4CO1A 5F8HA 1N5VA 2B7BB 4YUDA 3FFIB 3LA0A 4ID8A 1IR0A 3S8SA 1KTVA 3HT0A 4UOCA 1SKSA 3DRYA 4AUKA 3TRGA 4AXJA 1K8AT 1T9YA 2M9KA 3TUPA 2AJQA 2XZTB 2EW9A 1DARA 4P71A 4NLXA 4KYZA 1HBMA 3KK3A 3MM7B 2X3DA 4P72A 5KFXA 1VQ6S 2HFVA 4DR1F 1NDKA 4YR0A 1U2FA 3FUYA 1RKIA 2BW2A 3JS9A 1G1XA 3VV2B 3OPKA 4WFAQ 3PYDA 5DZ6A 3D54A 3MOZA 5B7WA 1QJHA 5IT9Y 4XDDA 1YHQS 4K7QA 1NBEB 4J9RA 5D6GA 3EXYA 5F0UA 2WZ1A 2DEJA 4OHZA 3CGIA 1JLAB 5KG1A 4AL5A 3I4HX 3S6EA 3BDPA 5HVHA 1KLMA 5L39A 4JI6F 5JVHQ 2AGOA 4P74A 2NYIA 4N77A 2OMOA 2V8HA 3PJ9A 2DTJA 1EAYC 3DOKA 5F3TA 1ZM9A 1Q82T 4LRFA 4ITSA 3TUJC 2VODA 2QFJA 5F8GA 4LBPA 4CZCA 3H90A 2W2PP 2D3O1 3KG4A 1JLEB 2BDPA 1RAJA 4IDKB 5T7LA 1S1TB 4QR0A 4ZVHA 3UCUP 2OEJA 3FJ2A 3TUZC 3MFHA 1B0VA 4RKUC 3M8WA 1OS5A 3W5XA 4CTAA 4DX8H 2ZE2A 4C8KA 2UU9J 4OI1A 3I5AA 2IM0A 4WFYA 4CIOA 1C1BA 2L41A 5M2UA 4OIXA 2Y8WA 3D3BJ 3CMQA 4FKYA 1LQ9A 4KKOB 4O3SA 4CCHA 2R2UA 3BBBA 2VJUA 2P8IA 1W7WA 1CJTA 1CS4B 1HBOB 3I0RB 4P6QA 1TVRB 3PRVA 2R7XA 4K5RA 2OMLA 3FDSA 2WOMB 1JXLA 1UWBB 3K0JA 2HRUA 1JJCB 1RAGB 4KE5A 4B3OA 3ELHA 1YRTA 4IG0B 4V19J 4K50A 2M8DB 2P9EA 4YB6A 2FHOB 1FRJA 3KNGA 2ZOMA 2QA4G 3IM9A 4LIRA 5KG5A 1WTBA 4O44A 1UFWA 4B9SA 2UV8A 4LF2A 5RUBA 4IOBA 2ZKTA 5ADZA 2EK1A 2CPXA 1HQEB 3KHLA 1FXDA 4RBTA 5D8HB 5KFIA 1NZ8A 1EARA 4FYVB 2B4OA 1AFJA 2A3JA 2E5LJ 2BA9A 3TZXA 1F60B 2JEGA 5KG3A 2JFDA 3IM8A 1YLXA 2QA1A 1J5EJ 3BPSP 1RTIB 1UEKA 2YWFA 3TVZA 4NI2B 3UCGA 3ZZYA 1RT7B 1FDAA 2NXCA 4Y2IA 2V2QA 3M05A 1M1GA 1U6ZA 3M2UB 4ZP8A 3M9MB 1C0TA 4DEZA 2PFFB 1Q8IA 4PXEA 3BO2A 4FNHA 1WTFA 3LP2A 2BX6A 3JSMA 3ET6B 5L8RC 2AEMA 2YWWA 3PM9A 2QGFB 4WP8A 1UJ5A 2OEKA 2QMWA 5E5NA 3N4WA 2RQCA 1SIZA 3SCIE 4R0EA 2HS4A 4J5OA 3QT6A 3THVA 4NXMF 5A2QU 4C0HA 3VGTA 2CXEA 2HZVA 3Q8YA 2ZEJA 3K5LA 1GQEA 4YDXA 2B3TB 1NJZA 3CCRS 5KFYA 4FXWA 1WG5A 2RS8A 5KFAA 3HJFA 1J5OB 4USMA 2WVEA 2AZ3A 4KQZA 1VQ7S 4BS2A 1RI7A 5C25B 4PYDA 2J0QD 1WG4A 2GAGC 3J7A1 3CDBA 3C19A 1DTTA 1KQSR 4ES3A 2DH8A 4DL3A 5C2GA 4DV6J 1RWNB 5CYJA 3PR4A 4EO8A 1YRXA 2E7XA 1KOOA 4CYUB 5E3PA 2LYVA 4PABA 3DC2A 3DI6A 3OFFA 2E5LF 3MWBA 1X5TA 1Z2LA 2L3MA 2UP1A 4EUVA 5F8MA 5ETRA 1S9EA 2UXBJ 1ZPVA 2MQOA 2W9AA 3CO0P 1J5EF 1KOHA 4O23A 3LP1B 2HQDA 3DM2B 2YX7A 1URRA 1GH8A 1HI1A 3H7HB 3GJRB 4QIGA 3RW6A 1F3FA 4F25A 2J0XA 1Q0NA 4RU9A 1VDHA 3JTOA 3BB5A 5IXUA 1UVMA 5CXTA 4P2MA 1E6VB 3PV8A 2F9DA 3UCZP 2FZGB 1RTJA 3K2YA 3TJAA 2ZFHA 1Y00A 3QT5A 2HQGA 1P27B 3M8PA 2O3DA 1ZH5A 1I6JA 4J9LA 2IDEA 3NP5A 1NMEB 1U8SA 1S6PA 3ILLA 1C4CA 4DL7A 5K5MA 3MGJA 1RT3B 1EKRA 1YSJA 2QSWA 5C42A 2DNHA 2MZSA 2VBYA 3G6VA 4F4YA 3EPIA 2CKWA 2XNRA 2RAQA 5ETPA 1FRIA 1JJ4A 2GVDA 1S1WA 2FVPA 3B8HA 1MNEA 3CNQP 3IRWP 4I69A 4C98A 2V8DA 2Z57B 2ZBQA 4Z2XA 3AD8C 1FXLA 3SI8A 2ASDA 5FJ4A 2X7IA 2L9NA 4ZVQB 1RHQB 2BKPA 1RGVA 4G1PA 4XPCA 1O0PA 4DSKA 3CW2C 4KFBA 4TNOA 3W2VB 2XMJA 4DV6F 1SKRA 3HPOA 4B17A 1HHSA 2B43A 3L9ZA 2JOQA 4C3LA 4J7CA 2DNOA 2NPIA 2QRRA 4WPAA 3ISZA 4DR5J 1D8YA 2ZOFA 3IFEA 3D6MB 1BQNB 2XMUA 3IRXB 3BV8A 4RZRA 2POKA 4RJVA 1MROA 2DNKA 3JAMY 1RWKB 3ZZRA 2UXBF 4W92B 2AJ4A 4LSNA 3A3OB 1QVFR 4XTTA 2ZJRQ 2I5JA 1GEHA 2HLTA 4UOFA 2DR5A 1FE4A 4OYXA 2Z30B 1VOMA 3MEGA 4OYMA 4FDFA 1SJ4P 2X51A 1WEZA 2WW4A 5A8WB 2XC9A 3J7YU 1UVLA 4XAKA 1NH7A 1YRUA 1QUPA 4X4QA 1NKEA 1XR5A 1KHVA 2U2FA 2XCAA 3EGZA 2UVRA 5DG8A 3D6HB 2Z56B 4KHRA 3UQSA 1TK5A 3KUEA 3OJUA 1Q78A 4NOHA 3BSNA 3MXHP 2U1AA 4QQBA 1VRQC 3TWZA 2I0XA 4O4GB 3VAJA 3SXLA 3LO3A 1IKXA 2K7KA 1JLBA 4C0OC 4FYWB 2CZ4A 5MLCV 5KFCA 2XNQA 5CA5A 2AX1A 4HI1A 3W8PA 3V6HA 4OJGA 3BEGB 2CQ1A 1FRXA 3DU6A 3CC2S 2MZJA 3GLJA 2YKOA 2HVDA 1ZA2B 2YNFA 3KJQB 1CJUA 3H25A 4A8SA 3Q23A 1PBUA 1VQMS 1HIYA 2R7QA 5M2RA 2DB1A 4J9NA 3AXMA 4KGZB 3UR0A 2W7OA 4EYIB 4KV8A 4IYQA 1RWXB 4O3PA 4G3IA 2HZAA 4NA2A 2UUCJ 2XY6A 2OPPB 1TL1B 4JI8F 1UKUA 1NJXA 4GVLA 2ILZA 4OX7A 2UUBF 2XM3A 1VBKA 1YBTA 3H5YA 4U95A 3PRBA 3VAFA 2E1MC 1LW0A 2QA2A 2OPQB 5J1PA 5KT5A 3TNVA 5KOWA 4NXNJ 1T94A 1IKVB 2DXDA 1Y3JA 5GADI 1IBLJ 3NGTA 4G1IA 5F9NA 1TK8A 2RVJA 4CT8A 4IG3B 3MPVA 3C15A 1MG7A 3W61A 4LF7J 2GMLA 2UUAF 2GIQA 1X4CA 1PJ5A 2X1AA 4K4TA 2YVSA 4ZVFA 3DKDA 5BYSA 4V19X 1R27B 3PW0A 2W9CB 1URNA 1UAWA 2D3UA 2CJAA 1FF2A 2DIVA 2IVMA 2KXHA 1F9EB 1ZZNA 5IT9U 3GU0A 3ONQA 2RQKA 1U24A 3OVSA 4L74A 2R8IA 1QY7A 5DM7Q 3BQ2A 1RT5B 3RB0A 3FEXB 1WKJA 1VIOA 2ZOGA 1AUSL 1A9NB 2D3OR 1RUSA 2YNIA 3HZEA 4WP3A 4QPTA 2IYIA 3C16B 2V8GA 1CULA 3CJTA 2HFSA 3GIIA 4ICLB 4DL6A 4ZPDA 3W63A 1IWAA 3RTVA 4WCEQ 2J9EA 4TY8B 1R0AB 5JMNA 1NXIA 1H38A 1EB0A 2ZJPQ 4ZVSB 4OZ0A 3JQKA 5DETA 2AU0A 2JFKA 1SJFA 4OI4A 1L5UA 3QFWA 4GC7A 5LMNJ 2ATLA 3I0SA 3HHLC 3OLBA 2XULA 2B6AA 3PRDA 4X4UA 4JV0A 2CDQA 1RWVB 3QQCD 1KSPA 3DLBA 3T5JA 5G0RB 2RRBA 3R5JB 5I42A 4DCOB 4JI7F 1VISA 2FHMA 2AD9A 3BYRA 2CJQA 3ISNC 3D68A 1Y11A 1HNVB 2E66A 2Z0GA 3SFUA 4TLRA 2XSJA 3HF5A 2FIUA 1N5QA 2UUCF 4G6VB 4ZVUB 4UOHA 2RILA 3M1VB 2UXCJ 3RB4A 3D28A 2XMKA 2RB7A 4UTGA 5HROB 2HLUA 3ILIA 1Q79A 5SUHA 4TN2A 3NNAA 1F5BA 2DGUA 4A48A 2L48A 3M2VA 3LTOA 2OIHA 3DDNA 4IUFA 4JOUA 3CDWA 4ED3A 2PA8D 4DX6A 1ACMB 3KLVA 4AXIA 1IBLF 2V6AA 4BLGA 4NX9A 4C3MA 2AKWB 2OPRB 1IXKA 4C11A 2DY1A 5LJ5Y 3OVBA 1TKXA 3CJ8A 1JLFB 3RZAA 5JJBA 1WOSA 4CLSA 3R2CJ 4A8QA 3P4UB 3SCJE 3FFIA 3BQ0A 4B3SJ 1PGZA 3GG1A 2KKHA 5CCMA 1U45A 2DHAA 3OTBA 2VUGA 2GQCA 2VZ9A 2HK2A 1CBKA 4EYHB 2VA3A 4HH0A 3TR5A 2DIUA 5KAKA 5J1EB 4DV3J 3NGKA 4MKVA 2DGTA 1X4BA 2A6OA 2BRLA 2C42A 2PN6A 2JX2A 2JC0A 3TW0A 1FERA 5AE2A 1FVQA 4M8LA 1PBAA 3NGRA 4DL2A 3A1YG 1JX4A 1W26A 2CQ2A 4Q43A 4L73A 4J9PA 4QR2A 4F4WA 3HSZA 2PMZD 3HFKA 1FESA 3G8QA 2GO8A 4C6AA 2OD4A 3G82B 2DNNA 4LRCA 4O3NA 4FS2A 4OMFG 5U47A 3AY0A 3CJ5A 4UUWA 1JLAA 1F5CA 2K3IA 2OPSB 3ZO7A 2R9LA 3H59A 1RABB 2Q66A 3DLHA 2CZ9A 1IBMJ 3AOAA 5A6PA 3V6KA 4LRBA 1H72C 4OZNA 1H7XA 2UXCF 2GJ2A 2HVZA 3G86A 5LXYA 2CPEA 1FVSA 1WORA 3DOMB 1NPPA 3G2XA 3C46A 2W1BA 3GSIA 5D4LA 4CLZA 2QLXA 1JB0C 2RHQB 1Q8LA 4DQPA 1HARA 1JLEA 4RO0A 3GYXB 4YOEA 4IDKA 1S1TA 4Q44A 2GW8A 1PAUB 4ELTA 2JZ5A 4LQ3A 2G4BA 2PEBA 4Q5VA 1NJYA 2H1YA 1LWCB 3I9V9 2EEYA 2FVSA 3IBFB 3K7RA 4B3SF 2ZKUA 4FZVA 2FLNA 4Z7CA 1SKUB 4G65A 4KKOA 4R5PB 2M4MA 4FS1A 2XLKA 3QJJA 1FCAA 5KTQA 4JYAJ 3QRPA 3LALA 3M9NB 1CS4A 1HBOA 2WK4A 3B6BA 3I0RA 1TVRA 1P9QC 4OL8A 2PI5A 4OJHA 2WOMA 3BN4A 3BR8A 2J9CA 1TL4A 4OHXA 2A2CA 2ZHOA 3ZTRA 2OI2A 2GZOA 4IG0A 4P52A 1F2GA 2VJVA 3ITHB 1W25A 4ZHRB 1Y5LB 2XZWA 5HN0A 2DCLA 2ZNZA 3PKMA 5KFVA 3HHDA 2HAIA 2YQ0A 4YR2A 2QG9B 2BE2B 1V5VA 3MMBB 1REVB 1FKPB 1SC4B 2FJXA 3H5SA 3KDNA 2CPHA 1FFGB 4F0HA 4F0KA 2VH7A 1OY6A 2Y0SD 2XGPA 3G4SS 5F8IA 1PCAA 4KC5A 5KG4A 3MDFA 1IBMF 2RJZA 4TU8A 2XY5A 2B0GA 2HFUA 5A6WA 4F4KA 1N0VC 1VC5A 2R2TA 1RTIA 4PRFA 1S48A 4MK9A 3CF5Q 5KFBA 2AF6A 6FD1A 3EZ5A 3MR7A 1FKOB 4DFMA 4RBVA 4NI2A 5K20B 2R8GA 4JUZA 1UVIA 1RT7A 5KFTA 3WC2A 3BJYA 4X64J 4USWA 3SQOP 1J2VA 1F5AA 2J7WA 4B3MJ 5BXIA 3KUHA 3M2UA 4OFZA 5LXRA 4DL5A 2WRMA 5M2PA 1SL1A 2RHSB 3PVXA 1LEOA 2YWGA 1CC7A 3G8TA 3RJMB 3X3UA 1HI0P 2EFVA 1T02A 1WUUA 2CNKB 5GAHU 4WXOA 2J76E 4KRWA 1NPKA 3ET6A 4WWSA 3CULA 1WHXA 4ECRA 4TYAA 4RWWA 4HI2A 5E7OB 1WKLA 1M5OC 4OQJA 1H3DA 3N6NA 3TYTA 1IKWB 3WIUA 4N76A 1Y3KA 3J7ZT 3EZUA 2HQCA 5KT6A 2P6SA 3FRZA 2MEWA 3RRKA 4JYAF 1I5OB 2A0FB 2W7AA 3H98A 1R31A 2RMLA 3JAMU 1L3UA 2EFPA 3M7VA 4MH8A 1TUVA 4WU2A 2DD8S 1VC6A 4OYOA 4DFJA 3TA0A 5F0WA 3SZ2A 1MLAA 2VG6A 4OYPA 5BR8J 4JV1A 4CM2A 1SVDA 1ICEB 2XHWA 2B8QA 2W8KA 1N52B 1JNRB 1TMJA 4ELUA 2G2OA 2RU3A 1FHTA 1J5OA 1SCJB 3AFGA 1HD1A 5C25A 2YBVA 5KFNA 3NGSA 4DL4A 4K5SA 2WBMA 3A3NB 3BREA 3D9BA 2IMOA 4I68A 1WJ9A 1H74A 3V6JA 1DLOB 1FK9B 3QJPA 4R8UB 4CYUA 5CYMB 3UN5A 5AJ3J 1SQGA 4OX8A 4DPYA 4FBTA 2FPHX 2FDNA 4QW8A 5KOXA 4RW9B 4CP5A 3MEKA 1YJTA 2AIRB 3F44A 2KFYA 3B4DA 4F0MA 3RB6A 5L1IA 4QOTA 3HT3A 1H6KX 4W4MA 1W2BR 2H65B 1RADB 2CVIA 3LP1A 1U47A 3H2UB 4ED6A 1M5HA 3DGPA 2KFZA 1HNXF 3DM2A 2W01A 3AJ1A 4LF1A 3OTEA 1U09A 1DURA 1YJNS 2M3DA 3K5PA 2W2OP 5E3RA 3QZ8A 3C6UB 3GR1A 2R2RA 5A8KA 2VL1A 3QJLA 3TAMB 2J6SA 2K06A 1U49A 5T14A 4X4NA 5FIIA 4KO0B 5HBMB 3MUTP 1OPZA 2ZVIA 3IR7B 2HBRB 1TQLA 1WACA 1SKWA 3SEOA 2V4QA 5ETKA 4P7TA 1RHJB 2HQFA 5B08A 2W2MP 1E6VA 4EMDA 3KG1A 1RT2B 2DHGA 3O5TB 4LF8J 5AXKA 2JEIA 2J7KA 3QSYB 1U2CA 2VBXA 1X5SA 2YKMB 3IAM9 3P8BB 1NK0A 1RT3A 4I1TA 1Z2ZA 3TEGA 5D78A 3MPUB 2CQGA 3LOUA 4MKAA 1SJRA 1H98A 3W64A 4DQQA 3PFOA 2W9BB 1XMOF 2RQMA 3JXOA 3KDOA 5BR8F 1NK5A 4K0KJ 3WDOA 4USVA 1R0CB 2FYXA 2CUYA 5IC4B 2BE9B 1WI8A 5K8OA 4E2FB 4OLOA 2ADCA 1PILA 4Y2CA 4V1Ak 4OX9J 3W2VA 1I51B 1VBZA 3KHHA 1WF2A 2KM8C 5HQ8A 1EP4B 2VICA 3FBFA 1KS2A 3FVYA 4C8YA 2AJFE 5AJ3F 4B3RJ 1WSVA 2H48B 5J2PB 4Y28C 3V81B 3Q8RB 2LQ9A 2HKEA 1BQNA 3IRXA 4CH0S 3DRPB 5ETVA 1D9AA 5ETMA 2DPIA 3DHXA 1G4CA 1H7WA 1D9FA 4A8WA 2LVWA 1RAOA 1F0XA 2YXLA 1HNZJ 1RAEB 3H20A 1KTQA 3PKYA 1KD1T 1X0PA 4DBQA 5A8WA 4MKYA 3QIPB 2EFGA 1FRLA 1UTAA 1AFIA 4F4XA 5I3PA 2DNRA 1GMWA 3O1LA 5ETQA 1Y5NB 4LFBJ 4K2JA 3EPGA 3R8YA 1LKZA 3N01A 3NBPB 1FJEB 3MAHA 4NLSA 4UUXA 4QW9A 3LP0B 5IC6B 1XWLA 5DM6Q 4ED0A 4O4GA 4CO3A 3RBDA 3CDAA 3OTCA 1HMVB 1RHUB 4KPYA 1WD6A 3CCUS 4LF8F 1T9UA 2E29A 2XS7A 3R6LB 2BQUA 5D15A 3PR5B 1N6QB 3U02A 2Q3PA 3CIZA 3EXCX 3JSBA 2ZZNA 1F6TA 1Q8BA 2MQPA 4DV5J 2D41A 3BKFA 3A13A 3E51A 3UD4P 2BVZA 4ZN1A 2KU7A 1NSPA 4K0KF 2QE5A 1T05B 5AXMA 4DR3J 2OGUA 3NLCA 2IDLA 3NL0A 1F2HA 3MCSA 1VK3A 2DGOA 4L3NA 1UA1A 2Y1JA 2DNQA 4LSZB 1MMLA 3I31A 2OPPA 2O01C 4J9OA 1TL1A 3NNHA 2KG1A 4OX9F 4FBUA 1WNEA 1RACB 5EX0A 1CG2A 2BJEA 3NWRA 5HQLA 4PUOB 2C2NA 1NLKL 1ZAWA 2BZ2A 2OPQA 1YQHA 5KFHA 3RRHA 1IKVA 4ZPTR 4TYBA 4B3RF 2A2DA 2HS0A 2BE7D 4YR3A 3POTB 3E2EA 4IG3A 4I2QB 2BKOA 5HATA 4LREA 2XYGB 3OJSA 2VFSA 4LSLB 1HPZB 3PCOB 3PIPQ 5D3GB 2CA9A 1D8ZA 2W9CA 4DR6J 3GB0A 1U1PA 3MTKA 1UMJA 2YQ3A 3HULA 1RAHB 1SBRA 1RT5A 1RTHB 2PO4A 3N28A 3M2RB 4Y2AA 3D6FB 5KFSA 4LFBF 3C16A 2A10A 1B3TA 2C28A 4ICLA 1RHMB 2KYXA 4UZCA 3S01A 3OUYB 4X62J 3KLFB 4Y6IA 3P5BP 2MQ8A 4TY8A 1R0AA 1Q86T 4E0DA 2LXIA 2C2DA 1RJJA 2IJNA 4NLTA 4NA1A 1NHVA 3HVAA 3W9JA 2WVDA 1WOOA 3SSQA 4IH7A 1HL6A 3Q89A 3LWLA 4USTA 1NJWA 4C8LA 4DV5F 2VKRA 5KFKA 1SC1B 3VWSA 3LANA 3IBCB 5KG0A 3ZZPA 1HNVA 4C8ZA 1AZSB 4NYOA 4YDDB 3W2WB 2VC1A 3AQOA 2KH9A 3HVWA 2WB4A 1U02A 1LWXA 4WXWA 5B0DA 4MT1A 3PEJA 2FUG9 2HGLA 3M1VA 3Q2SC 1VHFA 5GMEA 5BYRA 4Q0BB 2OELA 1Z4UA 3HVRA 3CJ3A 4QWAA 5LSRA 1S1VB 5HROA 4PR6A 5FLXU 5GAGU 5H9FJ 3MHYA 4B02A 1UVNA 2XMAA 1JLQB 4OJ1A 1UWAA 1U1NA 3DDIA 4DR2F 2CQHA 4NA3A 4Q2LA 2IC3B 3DU5A 4KR0B 4GO5X 3CJ2A 2JRSA 4M95A 2OPRA 1GX6A 2BUNA 1NNDA 4F4ZA 3P6YC 3NS5A 2A18A 4A8FA 2FVCA 1JLFA 2F8MA 2RF2B 3QT8A 3ENVA 3UE2A 3I32A 4DR6F 1OPIA 4OYZA 3ENWA 4X4TA 1X9MA 4WFNQ 5K8MA 3GFXA 1BY9A 4YB5A 3A3PB 1RK8A 2BABA 2A6MA 2Y3YA 5AE1A 3P45B 5J1EA 2EG2A 1TAQA 3UN3A 3NOCA 3CDEA 4I6AA 2RKIB 4ZJOA 3IWNC 1S4EA 3PX4A 4X62F 2DH9A 3C66A 2V9WA 1BQXA 3RYLA 3ZZ0A 2XWYA 2HSEB 3RGIA 3Q8SB 2AX0A 3V4IB 3OL7A 2P6TA 2QIFA 1RB0A 1LXJA 3FCHA 1FX4A 2MJUA 1RKJA 1SIWB 2CG8A 5KFEA 3G82A 2EI5A 4X4OA 4Q8EA 3GFHA 5IT4A 1AW0A 1RU1A 3DLLQ 2OPSA 1Q7LB 4GKJJ 1CQNA 3C14B 4TU7A 4UW2A 3FCVA 3M6XA 2B5JB 2ERRA 4LF4J 1JMTA 5GAEI 3RW7A 4X4PA 2ZH4A 1XMQJ 4R0JA 3NG8A 3M9OB 3R1LA 1HHTP 1KP6A 3AOBA 3DOMA 5FDLB 3ZZTA 4ECWA 3CD7A 1TTHB 4OHVA 4IOCQ 2ZH9A 4DCJB 1Q16B 2KVIA 2VFUA 5DQGA 4CO4A 2CRLA 4B3TJ 3SMZA 2JJ4D 2IM2A 4K4WA 3UNYA 4NLOA 4C7QA 1GXTA 3HLUA 4F04B 2O67A 3MPDA 3FSXA 1RA6A 5LL6d 4X4SA 1U48A 4NZ7A 5EGYA 2ZBRA 4WKYA 3ENQA 5JUMA 2E9TA 3GV7B 3G71S 1DAXA 2HNZB 4R5PA 2ZHBA 3RG6A 1D09B 2M2BA 3RAQA 1YVFA 1LFPA 4USHA 2FHKA 1WWHA 4KGMA 2J6TA 4NLVA 4ENOA 1EETB 2VG5B 2F4FA 4GO7X 1QDUB 1QAJA 4KB7A 2ZM6J 4ILRA 5K14B 2CZVC 2WVBA 2B56A 2E5IA 2GJIA 1JLCB 4FPRA 2QLWA 3GIMA 4RWXA 1RSCA 3ITHA 1XN9A 3UN2A 1C4AA 3M6WA 4ZHRA 1NEEA 1R89A 1AA1B 4AL6A 3H4BA 2BE2A 2KJWA 3MMBA 1REVA 1FKPA 2YH0A 2XLJA 2KRRA 1FD2A 3M8RA 3VAGA 1RT1B 1P9YA 3TJ8A 3EJMA 3DLKB 2YWEA 2ZH7A 1QLNA 1T9WA 2R8JA 4LF4F 2DYAA 5H9FK 3BH6B 4OYIA 1XMQF 2NSBA 2KXNB 1T95A 4RR5A 3L09A 2BRKA 3GSDA 3ZTOA 1WC6A 1CQMA 3J7Z5 1FKOA 3H5UA 2UUTA 4HTIA 4YY3J 1SUQB 1IWGA 3DLGB 3DHWC 3N9UC 5KFZA 2ZNYA 4AYBD 1PJ6A 4ED4A 2DJWA 4DHVA 3I5CA 4ZCKA 4I7FB 4QIFA 2HNYB 3GPAA 2BW7A 4B3TF 3AAWB 1PYTA 4ZPAA 2Z2YB 2QL9B 3BZQA 3S7RA 4ZVPB 1MN7A 4ANDA 3CEDA 2KXFA 1N8RT 2WTFA 3GIJA 3PYFA 1VLOA 3KOAA 3D1OA 3FCWA 5L1LA 1VFJA 4D3HA 3OR2B 4QWBA 1HWJA 4CO0A 1NK8A 1NRKA 4M5NA 4F2RA 4BHQA 2A1BA 3GILA 1IKWA 3UPFA 1F1BB 3LF0A 2HGNA 2RDJA 4M5HA 1L3TA 3CT9A 2HHPA 4H4MB 4DMZA 2XS2A 1S0NA 2V94A 2DR8A 4ID5B 1B7FA 4NLYA 1IBKJ 2CQPA 2ZM6F 3Q0AA 4USJC 5ETSA 4JI3J 1QAIA 4MAKA 2Y0BB 4NCGB 5DRKA 2W4CA 2Z2LA 3OFGA 2PGCA 3G6YA 2OD6A 3PYEA 5E33A 3TX0A 3D1HA 1SV5B 4O4RA 2PE8A 5DDOC 3FBBA 1CLFA 1DLOA 5B0EA 4JI6J 4R8UA 4MK7A 4RUBA 1T3NA 4ZIWA 3O2IA 4DU7A 2Z58B 2D3ZA 5CYMA 2WCXA 5K8NA 4DJBA 4P2XA 4Y0FA 2B7CB 2CJ9A 3G8SA 4RW9A 4RW4B 3IA0A 2VFTA 3MCNA 2NSCA 4S0MA 3HX9A 2UUWA 9RUBA 4PPZA 4J37A 3SFGA 4NEZA 2IBKA 2WSCC 2L9WA 1M90T 5B09A 2DRAA 3NRBA 2B9XA 1JKHB 4YY3F 4NYPA 1DRZA 4KSEB 3ILOA 4C4WA 3C6UA 3GJQB 1RLCL 2AYMA 3KJVB 3TAMA 1YX2A 3PHTA 3CCVS 1FE0A 4KO0A 5HBMA 2BANB 4ECYA 1P1TA 1NKBA 1MW7A 1YJRA 2QX0A 3VVUA 3MUVP 4XO0A 2BOPA 2XI3A 4TKTA 4ZK7M 2HHSA 2JC1A 1VJQA 3KHRA 4KTQA 3SV4A 1E6YB 2ZDPA 4OI0A 2FVRA 1BGXT 2X1GA 2X3GA 2AHOB 1G2EA 3CIMA 5J1NA 4U7CA 5KG2A 3JTNA 3TOQA 2H5JB 1V3ZA 2XLIA 5LM7E 3BH7B 2YKMA 2YTCA 4WYLA 1FDNA 2X1FA 2NXUA 3H5XA 1NU4A 5DQHA 3OLAA 2NUHA 2V9KA 4DG1B 2W9BA 1TU0B 4WK3A 3VZIA 1IBKF 1X4FA 1P1LA 2ILYA 3M8ZA 3VGUA 2QT7A 4JI3F 3CCZA 2DVIA 4ERDA 5IT0A 5LSLA 2D9PA 4DQSA 4KBIA 3HKZD 1CSJA 3OL6A 1GXLA 2LLZA 3B82A 5IV4A 4WZMA 2QLFB 4JV5J 3LGHA 4ZS6A 5F8LA 3PX6A 1EP4A 3NAHA 4D3GA 2HPUA 1HNIB 3I6PA 2KB2A 3MM6B 3MM5B 4C48A 5J2PA 3V81A 2HG4A 2H5EA 5I3QA 4M5DB 4IR9A 3DRPA 1EQMA 4KGKA 3R5DA 2KT2A 5IQQA 3GIRA 3BM7A 2CYYA 2R2SA 3RB3A 1X4HA 2DR9A 5C7PA 3K58A 1UPMB 2RU9A 3MM9B 4A8KA 3O3LA 2HVHA 1XIQA 1S7IA 2R7SA 3I56S 3QIPA 4PCQA 4PG8A 9ATCB 1QAYA 2GMJA 4F36A 4AE5A 3UD3P 3ZZUA 4MYTA 5B0BA 3T5LA 1U6BA 3LH2S 3ZFVA 3MPYA 2DNMA 3NNCA 3NBPA 3C3LA 3RU0A 2E44A 5CD4A 3MEEB 2FJWA 1CJTB 5DS7A 2JL9A 3LP0A 5ETNA 1CEZA 4O0IA 4JI1J 4FN5A 1A7GE 4NEYA 4NXMJ 1NM2A 1HMVA 1UW9A 3D0HE 3VR1A 1K73T 1DY3A 5AT1B 2EC0A 2CJKA 4CLLA 1R8BA 3WQPA 1N6QA 2DNYA 2YKPA 4QJVA 2HAFA 1HA1A 3DRRB 4LRDA 1IR2A 3RBZA 3G6XA 4M94A 2C2MB 4P73A 5KG7A 3NS7B 4WIQA 1T05A 2ACMA 2WAQD 3HD1A 2ZH8A 2PMWA 4M5KA 2H5IB 4O0NA 1M5SA 4GVBB 1VS3A 3JQMA 4F3MA 2J5AA 4QYRA 2VA2A 4UZBA 2OUGA 4HVZA 4JV5F 1LXNA 4OV1A 4LR8A 3H40A 4OYBA 2IRUA 1YJWS 3KYLA 3KTQA 4PUOA 5FD1A 4A8OA 3KMSA 3EGWB 4GC6A 3C6TB 1BC6A 4N56A 3CE8A 3POTA 1XERA 4ZA1A 1N0UA 1X4AA 4I2QA 2MKYA 1OJ4A 5HI7A 4LSLA 4MKBA 1HPZA 2V50A 2JHEA 5D3GA 4ECTA 3N5BA 2H51B 1T3OA 1VIXA 1BUXA 1WEYA 2F7VA 1QSYA 4RLEA 2HIQA 3IN5A 2XO6A 1RTHA 4PWDB 4DX7A 1KR4A 3LPEA 4FF3A 3HSJA 3M2RA 2R7VA 3EGNA 2KHDA 1M5VC 3ILJA 2P5VA 2LA4A 3FBEA 1ZM3A 2ZH1A 1DQAA 2RD5C 3OUYA 2P9GA 3KLFA 1VQ4S 4JI1F 1VQ5S 4C8MA 2V8VA 5B0AA 8ATCB 2CQ0A 3VGVA 4P7VA 3B54A 2HNDB 2J6UA 1NK7A 2R7WA 4Y34A 4ILMA 1HYSB 2QZ8A 2I8EA 3KLIB 1C1CB 3GWCA 4QYZJ 3OTOJ 3TI0A 2VBZA 4NLPA 1VRTA 3Q86A 4C2MA 2FJAB 4DWIA 4BDPA 3MZIA 1S1UB 2JSXA 3GMGA 4E98A 4FYXB 4MJKA 1RT6B 1T0TV 1AZSA 4K4YA 3U1LA 3W2WA 2QA4S 2GMHA 4WBFA 4ES1A 3VAHA 1HBUB 1TL5A 3ZNJ1 2QJ3A 3DI6B 1ZPWX 5HLFB 2M5YA 3D5MA 3MAQA 3EVOA 3EVWA 2FLOA 5LOQA 5HMYA 2OSQA 4Q0BA 1O8BA 2MPUA 4F02A 1VQ9S 2AJ0A 2R7RA 1S1VA 2EFQA 1KRPA 3QYYA 2JDJA 2HRYA 4CRJA 1N4LA 1VQPS 4F50A 1UPPA 2EXUA 2VU5A 2XHCA 3HJVA 4PYAA 1JLQA 1IKYB 3W9HA 1K1SA 2RS2A 5HL7Q 2RUSA 2MY7A 4NCAA 1QM9A 2KT3A 2IC3A 4NLWA 4DN0A 2MKKA 7FD1A 5EWFA 3SSSA 2YKNB 2RF2A 5D0RA 1XR6A 4HDGA 2LCWA 1BQMB 4Q45A 4B9LA 3QLHB 3T1AA 2NXEA 4HACB 3NCQA 1YZ6A 3K8WA 3FK4A 2IVYA 5C24B 4IRCA 2XSFA 5HVFA 5IFMA 4HLBA 1QAXA 2V2VA 5L1JA 2QFIA 1KFDA 4ZJQA 5CH7B 5HSPA 1DJ0A 4ED8A 4DV7J 2KZMA 2R7TA 2CPYA 2RKIA 3CJ4A 3RBEA 2NPFA 1W2IA 3CMES 5GMDA 1ZYQA 3VF0B 3A8KA 4ECZA 3A8JA 1X4DA 3PHEA 2HS3A 3V4IA 5A8RB 1XNQJ 4ATNA 2BJ7A 4PG6A 2DGQA 3NAIA 1EQ0A 3GG0A 3UVJA 2BJ1A 4PXDA 2VPYB 4CI0B 4X84A 3OTOF 2C3OA 4DPOA 3GIKA 4J9MA 3FMBA 3K59A 3A12A 3T1YJ 2NZCA 1ZTTA 4RNNA 3LAMA 4JI8J 4C97A 4ZOSA 3N5FA 4PAAA 4O3QA 3KG0A 3N6LA 5DQIA 2UUBJ 3C14A 4X65J 1S6UA 4ZJLA 1AXQA 2B5JA 5KFRA 4ZCIA 5GADU 3BO4A 2OEMA 1J27A 1RWWB 2AYGA 1N5SA 4I6WA 4JI4F 2YWKA 3W9IA 5K9FA 4DUYJ 1REGX 2I2YA 4NASA 3HXMA 3DXSX 1VGYA 2FJDB 5D4NA 5FDLA 2F3JA 2BQRA 4FYDA 2DCUB 4OHYA 2LEAA 1M1HA 2UUAJ 1U1RA 5EX3A 3V4MA 2UV8G 4ZP6A 2BMBA 1TV6B 1NUEA 3M8YA 3L4BC 3DGVA 2J9DA 1IQZA 4CM0A 2N82B 3KUGA 3Q22A 1XNRJ 3EZOA 1RAIB 3D4JA 3ZTQA 4W90B 2LP4A 3MR2A 5KFFA 3IG1B 3NCPA 4ZLJA 2AWZA 4K4UA 3R2DJ 3GYGA 2M8HA 1GK8A 2HNZA 3G87A 4LRAA 1MU2B 2CJXB 3OBIA 2ZBCA 3AODA 5HMXA 4LBHA 1BWVA 3PJWA 4FF4A 3E8OA 1DQ9A 1C0UB 2M7SA 3LGNA 4DV7F 2YQ1A 1RWOB 4LVOP 3CD5A 1EETA 4XDCA 2VG5A 1VQNS 3TX8A 1GTEA 1T9VA 3I55S 5K14A 5CQGA 2HEKA 4RNMA 3J81Y 2HHWA 1U25A 1JLCA 4LFCF 2AQ4A 3TZZA 4QYZK 1PC5A 3MR5A 1XNQF 3OV7A 4JI7J 3QO9B 2XMVA 1RXOB 3PNIA 1U2RA 3Q83A 2HHQA 1RISA 5CYQB 4KHPJ 1V3RA 2HHXA 1OMSA 2G2YA 2OHDA 4EK2A 3UR3C 2ZZTA 2C2RA 5IWAJ 3T1YF 1RT1A 5IS2A 3TQ1A 3TARA 2GV1A 4K2XA 3DLKA 5LJ3Y 2W25A 3AA8A 4HKQA 1HWUA 4X65F 1B7YB 4DCPB 1B99A 4X66J 1S6QB 4H4KA 2ALZA 4FPIA 1PKUA 4OZ2A 1RWMB 4DUYF 2GNKA 1RQ0A 3SDEB 4MIBA 1T7PA 1TR0A 1U1KA 1PSDA 4PQUB 4HR2A 3KLEB 1SUQA 4M1KA 3DLGA 2IPOB 2ZH3A 1VQLS 2VQEJ 3CB4A 2GHVC 4M5MA 1PJ7A 1KHWA 4I7FA 2F8EX 3M6UA 4ED1A 1NCLA 2AGPA 5J2MB 1FX2A 3GV5B 2MZRA 1CPZA 3D66A 4DV2F 1BWEA 2B9EA 2Z2ZA 1YKWA 1VQYA 2E9ZA 2PA3A 1V9OA 4HT5A 1XNRF 2QC3A 2FHJA 5EUHA 3KK1A 2EG1A 3OR2A 1NH8A 4U9RA 4ANEA 5EN1A 3CCWA 4N8OA 4B9VA 1HFEL 2E1AA 3KLGB 4EZ6A 4YS2A 1TL3B 3TO8A 1G7CB 3HO1A 2YX4A 4URGA 1ROFA 3JSRA 4H4MA 3I0SB 4DFPA 1WC1A 2HFOA 2R8KA 4ID5A 3QRRA 3QRQA 3M4XA 2V68A 5MAOA 2V2KA 1GMVA 2MKCA 1R8HA 1S59A 1KVKA 3Q8UA 5HMWA 2MZ1A 2LEPA 3EUNA 3OW2R 4NCGA 1FDDA 1R8CA 1AYEA 1YTYA 1QVGR 4DSJA 1ZTWA 4DPTA 2AMCB 5L38A 3DMJB 4C9DA 1U1LA 2GHWA 2LKZA 1OY9A 1Q4RA 4NZ0A 5GMKa 2C2OB 3PW2A 1SV5A 4KHPF 1RLDA 3HK2A 1RWUA 1B0PA 1Y7PA 2FC9A 1VHIA 1KONA 5IWAF 2PMHA 3CPWR 1D9DA 2ZDOA 3D2WA 1TP7A 5DZ7A 2J9DE 2RRNA 2IJRA 1SQEA 1N5YB 1HNWJ 2EFNA 4RW4A 3JYTB 2HFNA 2W8LA 4X66F 1GMWD 3LAKA 4AT1B 1FJ7A 4ZLLA 5KT4A 1WC0A 4EWTA 1S7HA 3R5AA 4LJMA 3OHAA 5ETLA 3VQTA 1FFWB 3R1HA 1O5JA 1CC8A 4LF6J 3NXZA 5HQMA 2D9OA 1JKHA 2RUGA 3FZBA 3UDCA 3KXDA 2QMXA 2VQEF 2Y8YA 2DXFA 3AJ2A 4YEAA 2RT3A 3BSAA 4IFYB 1Y0HA 4TU9A 3KJVA 3KHGA 4USKA 2F40A 3AA9A 3FQLA 2BANA 3BN7A 3P5TL 4F67A 1SC6A 1L3KA 3CJKB 5EWGA 2OSRA 2E5GA 4CNYA 4M5IA 4K4XA 2GAHC 1Q7YT 1JQGA 1U7LA 3AT1B 1E6YA 1R3NA 4G1QB 4I6YA 5F41A 1HW9A 2MSTA 2RDDA 1LW2B 4EBDA 2V69A 2N7CA 4CLFA 2DR7A 1WEXA 1D0EA 3MM7A 2CADA 4LT6A 1K0TA 1VQ8S 5DG9A 3VZHA 2KVQE 4DLEA 5IQ6A 3QGGA 2KL8A 3O6QA 1X9WA 4DG1A 1X8DA 2KO1A 1GT8A 2XEXA 3T5KA 4J90A 1FDBA 2V67A 1NDLA 3F56A 3T9ZA 3DN9A 3WC0A 1KNZA 2MB0B 1XJWB 4DV4J 2JLFA 3CMAS 3LWMA 5H9EJ 2ZZMA 4O3OA 1S49A 1U0SA 4DI6A 3AB4B 4NLUA 3T9NA 5F9LA 3AB2B 3IXQA 3PW5A 3L3CA 3OL9A 4DDFA 2ZH2A 3OXFA 1VC0A 2WB1D 1HNIA 3ICLA 3MM6A 4M5LA 1TKTB 3MM5A 1QUVA 2IRYA 2PFDA 3R7SB 2HWHA 3DRXA 4B9UA 2PT0A 2BM1A 2I38A 1KFSA 1RAAB 2KDOA 4M5DA 1HNWF 3M8QB 3K5OA 4OI6A 1SJ3P 4IFVB 3QT7A 1KLNA 1UFKA 3O44A 3OHBA 4LF6F 3K57A 3I82A 1R0BG 1BMQB 3MM9A 2ZVSA 4LR7A 4IOAQ 2CPZA 1VYAA 2KJVA 3L7OA 2YPZA 4PQAA 1X0FA 2JEJA 4B9NA 1WKKA 2FLLA 2XZDB 2QL7B 4Y00A 1N36J 1MWQA 2MKSA 2OFGX 2VPZB 2ZD1B 5DJBA 2HQIA 1U8WA 1B0TA 2XYPB 2ATCB 4QCLA 3AD7C 3MEEA 2DNPA 4WF9Q 1BXNA 5J2QB 1NHKL 1JLGB 4NRUA 2GC8A 2JLEA 4HT7A 1RP5A 2ASLA 4DS5A 2HHTA 5FLXY 5AXNA 2HYIB 4DV1J 2Y1IA 1K44A 3OT9A 2VPXB 4XK8C 1M1KT 1UWBA 4EFAC 3P96A 3CC4S 3NWGA 3DRRA 2XY7A 2EK6A 2FD2A 3E3XA 2KG0A 3LGMA 1BLUA 2E5JA 3PZPA 2HRTA 2VKZG 4IH6A 3MOJB 5A76A 1FFSB 2COLA 1S6OA 1O6XA 1KQFB 2C3MA 3D3CJ 4C8NA 3RAMA 2EBEA 5SZTA 1X60A 2LQJA 4DV4F 4DPUA 4GVBA 3W60A 2J8SA 2VB6A 3PX0A 2LEBA 1HQEA 1WC4A 4HTJA 3RAXA 2LDIA 5HVGA 4WYWA 3EICA 2WSEC 4IO9Q 3UFCX 1T11A 2G0CA 1WF0A 2OP5A 2XGQA 1JXVA 1S10A 3VAIA 4HEA9 4KGVB 3C6TA 4F8RA 3PJXA 1TKZB 4CLPA 6AT1B 2OKQA 2VD3A 4ZPVR 2K7JA 4PG4A 2BKNA 2HK3A 1HNXJ 3HVTB 4UY8T 2XS5A 2B4UA 3BGUA 1YJ7A 3ZC4A 1U4BA 2FY8A 3OFEA 5E3CA 3GR0A 8AT1B 2BJ3A 4M63A 3PO4A 4K4ZA 2F9JA 1FNXH 3V6DB 3CWJA 4WFXA 2ZHAA 2J0SD 1FNMA 4FF2A 2ZC3A 3IC1A 2VG7B 4MFBB 1IJFB 1PIEA 2UU9F 3KK2B 4WTYA 4WKRA 4RW8B 4PWUA 2ROEA 4PWDA 1N36F 1YJUA 3IS9B 3GTYX 4U8YA 4YN3B 3AQPA 3BGRB 1TL7B 3DCAA 3OSPA 4DZDA 1IBCB 1JJ2R 4IR1A 4KT0C 5D0HA 3FQKA 4QPXA 1EHWA 1WI6A 1OYEA 3VCDA 3M30B 2RIJA 3U7JA 2DGVA 1NPRA 2VG6B 3SIPB 2FZCB 2YWHA 3MCOA 4DV1F 2HNDA 3I4PA 1XQIA 1HYSA 2FTRA 2V4JB 1XMOJ 3UO0A 2CG4A 3KLIA 1C1CA 2DITA 1MMDA 3MCMA 2BJ9A 2QSFA 2KI2A 2LXUA 1DBDA 1S1UA 2EVZA 2FY1A 1BHNA 3GCXP 4LUBA 5GVQA 1RT6A 3NCRA 5H9EK 2OLWA 3PYGA 3T6BA 4PG7A 2D69A 2B51A 1CJVB 1APSA 1HBUA 1HQ2A 1QE1B 1N34J 2QL5B 4DXLA 5HLFA 4U6PA 1I1GA 4OI3A 3CXCR 4MTPA 5BYQA 1PG5B 4ZIVA 4H54A 2APOA 1NSQA 3CJSA 3QATA 3DLJA 4FP9A 5LT5A 2PD1A 2DHSA 2OH2A 4CNZA 2OTLS 4CLYA 3SYZA 2BXJA 5HP1B 3DGPB 2LU1A 1IKYA 1WF1A 3Q24A 3VAMA 4MYUA 2LU2A 3W7BA 2J8AA 4WJBA 4QBUA 1GXUA 1ULRA 3J81U 1NK9A 3MMAB 5A8KB 5CZVA 4YMEA 1N88A 4EI2A 2IHR1 2YKNA 4DLGA 1P6TA 1RYRA 3R3TA 1F9HA 2WVFA 4DS4A 1K1QA 4WFBQ 1WG1A 3EX7B 1BQMA 2V4RA 1AB8A 3QLHA 3H42A 1VBXA 1PC4A 4HACA 3GP9A 1B64A 2NYHA 4ALZA 2R8HA 5L46A 3BKUA 3DYAB 1YITS 3THPA 4KH1B 5C24A 2E7VA 3IP0A 1RCXB 4YQWA 4I67A 4DFKA 3T41A 4JI0J 1EX8A 4EU0A 3A8EA 1S4FA 2F1FA 1SH3A 3L95X 1FNOA 4EEYA 1UA0A 2B4VA 2H54B 2BOAA 5A8RA 3NS6A 2X1BA 1V6HA 4RUCA 3VVTA 2WSFC 4Y2MA 3AHPA 3ADAC 1ZM2A 2QN6B 2XQCA 4BC9A 2E1CA 3H0PA 3IR6B 4CH7A 2W4PA 4DL0C 3W62A 2MKJA 2HVIA 2C2ZB 3LPYA 4IO1A 3MR6A 4QIVA 4HH1A 4OJ3A 4OX6A 1VR6A 3KNAA 3R5GA 4AQYJ 2FZKB 4QU7A 2C1EB 2G0IA 2C3YA 2MLZA 4ZN3A 1N34F 4IRKA 1SB6A 3MECB 1NB7A 1SPBP 3NMRA 4JBCA 1R7IA 3V2UC 2MZQA 4BWJA 1LWFB 4WZQA 2LA6A 2ZUAA 1DFDA 2VF3A 3DOLB 2M52A 1IR1A 3I96A 2G1HA 5AE3A 1ZOTA 1KVJA 1A0OB 3UWTA 1TV6A 3DFEA 3R5BA 3FZ2A 1FRHA 3IWXA 1VMBA 1X4EA 4OV6A 1PYOB 2N7YA 4TQRA 5E2QA 2DEIA 3UDVA 5IV3A 1ZAXA 2Q6BA 4KH0B 4P10A 3HMJG 4J9SA 1CJKB 3GZ7A 3E01B 3MM8B 1FA0A 3IG1A 2CJYB 5L9NA 2MMYA 3PXGa 2AJ2A 3M32B 1WOPA 4BC7A 1MU2A 2OJ3A 3R6GB 2Y1RI 4A4JA 2OO4A 1HQUB 4OYAA 2YNHB 4JI0F 1C0UA 1TMMA 2EC2A 2DNGA 3QAEA 5A0YB 1TFWA 4L75A 4ZVRB 2WW8A 3MEDB 4ZVGA 1FI4A 1S99A 2AZ1A 3U1NA 2N4DA 3OTDA 2CNLB 4RX6A 1HWIA 3TA2A 4PPDA 2GVZB 4A47A 2F5GA 4P2SA 2LQ5A 4DUZJ 1RTZA 4YP3A 4PKDB 1ZAVA 2V0NA 3QO9A 2MQNA 1MWZA 3FNNA 2GHPA 1RDRA 5CYQA 4RUAA 2JNJA 1Q53A 2GGPB 3NEKA 4H4OB 3H2VE 1KDNA 4ZDNA 3J80Y 3BGFA 1S9GB 4HL9A 1JNZB 3R7NB 4AQYF 4ZVEA 2CWKA 2YX1A 5JXSA 4YHHJ 4DR5F 1LWEB 2EKNA 3ZXWA 1S6QA 3RUBL 1OQ3A 4F2SA 2V34A 2F4VJ 1EJ7L 2HWIA 3SDEA 4Y3CA 2V63A 4DR2J 1NZAA 2DR6A 4DUTA 1SI9A 4PQUA 1RE1B 4CLWA 3KLEA 1N56A 2L08A 2MQQA 1N48A 3N6MA 3TAPA 2G2ZA 2YNGB 2IBOA 1S72S 3T1HJ 5D4PA 3MR3A 4J91A 2VPWB 3NOGA 2LMIA 4J9VA 5J2MA 3UDEA 5KFOA 4HYKA 4WK1A 3EDQB 3ZTSA 5KT7A 3DXBA 2LQ8A 4ZMMA 5HAOA 4Q2MA 1RTDB 5L1KA 1XEZA 3ZNUA 2KZZA 3J7YI 3C2PA 3R5CA 4WE1B 4ZVTB 3DDKA 3EE3A 5DLFA 2JWNA 4FVCA 1S0VA 3K8VA 4GMKA 2DY9A 3BGOP 3HI9A 4ECUA 3F0NA 2KHCA 1KVIA 2I1RA 3KLGA 3JB9k 2P2CB 2KRBA 1TL3A 1TK0A 2MLXA 2UVVA 5KFPA 5I4MA 3K5MA 3CCSS 4ZVOB 2IAJB 1TUGB 4LF9J 2N3OA 4CO2A 1T9XA 3MPWA 3D6TB 5CCLA 1T9TA 4N5SA 2QTWA 3UNGC 4DPXA 3I5BA 2GIRA 3MMCB 1Q5VA 3IAS9 3HFZB 3MF5A 2DKOB 3GE9A 1HW8A 2CPIA 4NPOA 2PEHA 5G0RA 4RPFA 2FJVA 3RR8A 2DHHA 4LBIA 6FDRA 4DUZF 4DU8A 3FC9A 2JVOA 1NAQA 5GAEU 4DF4A 3DMJA 1PAEX 2HBYB 4OHWA 5DDRC 4MK8A 4OYWA 2PIIA 1KWMA 4A8MP 1S0MA 3CD6S 1S76D 1M0SA 2LQBA 3V5RA 2IVFB 2N4CA 4OZ5A 2NR0A 4YHHF 4NXNF 2NZ4A 1YIJS 1N5YA 4QIEA 3JYTA 2M88A 4CT9A 3HHLB 1WHVA 1SQFA 3NKYA 2F4VF 1FTRA 3RBXA 4NWBA 4QU6A 4LF7F 3OR1B 4L76A 1XMBA 2RH3A 4B08A 4A46A 2VDIA 1RT4B 3N0VA 3L7UA 2D1CA 3VTIA 3W66A 4GRSA 2JEFA 3LQVA 2D7SA 4ED7A 4RNOA 3T1HF 1AUDA 4IFYA 4YB1P 5KFDA 1FJGJ 4N7TA 1HHQA 1OWXA 1SJ1A 2H4WB 3G9CA 4NLQA 3C8YA 2IM1A 2ACYA 3CJKA 2IFXA 3LUYA 1S79A 2K1RB 2ROPA 5KFQA 1DTQB 1H0HB 3KKFA 3KJFB 4G1QA 3SCLE 5I3UB 1LW2A 2C3PA 3B78A 4M5JA 2MY8A 1NDCA 3SCKE 1OY8A 5C2CA 3CJ0A 7AT1B 2VFVA 1IN0A 2E1RA 3TEHB 4LR9A 3M6VA 3PY8A 5LMNF 1K47A 2OFHX 4LF9F 1FWLA 4NLDA 2DGSA 2HURA 2FB0A 4N41A 3FGVA 2UZAA 2K2PA 1WC5A 2I9SA 2HMIB 5IOLA 4MIAA 2NXJA 2DK2A 1OO0B 2IY5B 1FEHA 1GNKA 3CCLS 4DZ6A 2HFZA 2MXYA 1HKAA 5B0GA 4OI2A 1L3SA 1UVJA 1B70B 2VFRA 1MWYA 3Q8QB 3EDRB 2XBPA 5KFJA 3WBZA 1O51A 2RQ4A 2C22A 2M0GB 2YKQA 1Q1KA 1TKTA 2FC8A 2VIHA 1N5TA 1EZZB 2FGCA 3N79A 2W4DA 3IGNA 1BE4A 4XIUA 3M8QA 3FBCA 3I87A 1VQSA 4U7UD 1WHYA 3BQ1A 3WHIA 2K8GA 4HDHA 1XC9A 4IFVA 4DR7J 2B9WA 2AYBA 3AH6A 3BSCA 1RA7A 2GIFA 1VRUB 4KIAA 2BJDA 4ECXA 3TQEA 1KBRA 4P75A 4UF4A 3FEYB 1FRKA 2DGXA 3SQGB 3J81j 1LWCA 5HMZA 2ZD1A 1FJGF 2ADBA 4PXCA 1P8GA 1NDPA 3QAUA 2WONB 2BM0A 1X5PA 3PEHA 2EWHA 1QSSA 4CWBA 4DV3F 3QGHA 4ZP7A 5J2QA 1JLGA 1S12A 4RW7B 5HJYA 1EKSA 1RZMA 3MMJA 4ZCLA 3HP6A 2MHEA 3BKTA 4ZITA 2MGZB 4H4KC 4IQMA 3CUNA 2AJ1A 1UZHA 5EDWA 3CCJS 4RL1A 2YH1A 2BR0A 3HCXA 3GJTB 1UFLA 1X4GA 1NO8A 3IWLA 3Q8VA 4K4SA 3EGVA 4NYZA 4HHHA 3Q8PB 1XBWA 4I4BA 3BBFA 1FD8A 3MFIA 4URSA 2LFVA 2LXFA 4UY85 3HHLD 4WTOB 1JIHA 5J2NB 3MAAB 4L3KA 3FEZA 4NLRA 3NGDA 1HBNB 5DGBA 1IVZA 2RRAA 2DH7A 2JLGA 2FGOA 2CWXA 1RCOB 2ZITA 5BJRA 1K9MT 2CQCA 1N32J 1QTNB 3P3DA 3ISND 2O66A 4DQRA 2VDHA 4BWMA 1GX5A 1IUJA 2FVQA 1KC8T 2H9ZA 3VAKA 1TKZA 1LV5A 3DLEB 3W5ZA 4DSFA 3QBCA 4RW6B 2W2QP 2BV3A 3ULHA 2F65A 1LOUA 3HVTA 2MQLA 1S9FA 1UVKA 1T03B 4F7VA 3ETOA 4DX5A 2V8PA 1U0HB 3V6DA 4DR7F 3HHNB 3CSKA 1U1OA 2HVEA 3DRSB 2GCFA 2Q79A 2VG7A 2GFFA 3MI7X 4MFBA 3KK2A 1X31C 3R97A 1DHMA 4RW8A 4PG5A 2XTJP 2ABYA 3IS9A 1KN6A 1WDTA 2XWXA 3PACA 3RRGA 2AP6A 1YJ9S 4RNFA 3OSNA 1HWLA 3BGRA 1TL7A 1S1XB 5KFGA 3TZYA 3KLHB 1UP1A 5DO2A 1TAUA 2KT5A 3OL8A 4TY9A 4ELVA 1NHUA 3M30A 3QWPA 4DSEA 1A6LA 3F73A 3CJRA 1HR0J 1R6YA 1FTCA 2ZUGA 5KFLA 5IM0B 2PSZA 2VBWA 1YI2S 2V4JA 4RUHA 1H2UX 1U6FA 1FT8A 2ASYA 3CCES 4I64A 1OSDA 1WDDA 2R4FA 1QTMA 4A8XA 3PO5A 1RAFB 1HLWA 5B0FA 4U96A 2XYHB 1RBLA 1WELA 2BACA 5G4DA 2DO4A 1YGYA 2RNEA 1Q81T 4QWEA 2GQ2A 4UT4A 4NLGA 2ZWOA 4DR4J 1CJVA 4HHJA 4I2PB 3CCQS 4CLTA 1Y9OA 4NMXA 1FK9A 1QE1A 4M5GA 2QO3A 5IZHA 3HFVA 2W24A 4OZ1A 3WX8A 1GTHA 4JB8B 4L6V3 3P49B 1ZS6A 3WZ0A 2DISA 2CVEA 4WFZA 1N32F 3EYZA 4JI2J 3VQSA 3K17A 2ROGA 2I6WA 5HP1A 2Z2MA 3PG9A 3A4TA 1NK6A 5E0OA 2HBZB 4KGXB 2HQ3A 2VV5A 3BBCA 5DLGA 1R6VA 4X64F 2XB2D 1V3SA 3CJQA 3H2LA 3MMAA 1MSWD 2QEXS 2Q6CA 3GV8B 4B3MF 1IQTA 3QWUA 2V2ZA 3B4MA 2NCKL 1CVJA 2G1DA 3TANA 2DRDA 5KT3A 4ZPWR 4ZP9A 3BR9A 1RBOB 1ZM4A 1IJEB 1DQ8A 4BBYA 3DYAA 2HHHJ 1N54B 4OLPA 3J80U 5GAHI 1YWXA 3CC7S 3CCMS 3KK3B 1HBMB 1B4SA 4CQ1A 3D1QA 4RU2A 2HZCA 1RT2A 2OAUA 2IJFA 3H4DA 3DNCA 2HWTA 3QFHA 1M5PC 4J9UE 1JJHA 4KY3A 5AXLA 2CPJA 1RHKB 3W8GA 3TVYA 1HR0F 3T5HA 3KFWX 1UCNA 2E7WA 4Y65A 3D0GE 4OZLA 2QYCA 5K8PA 2V5HG 3CDUA 2IM3A 3FSIA 2MLYA 2FQQB 1QSLA 4FKXA 3GYNA 5LMUJ 4QZVB 2ZC4A 2D74B 3F41A 4TVAB 4KAIA 4FXVA 1KLMB 1SJQA 4Q7AA 2QYGA 3AJDA 2IA6A 2SXLA 1VCTA 3CO9A 3CTRA 4DR4F 1F3VA 2B8PA 2WHOA 2HBQB 3DOKB 4USIA 1V5IB 2DHXA 3IMQJ 2G0JA 4ANCA 3J7AN 4C0BA 3BDEA 1S0OA 4AFFA 1QD1A 3MECA 3QIDA 2MSSA 3GFYA 3TA1A 2L9DA 3TAQA 4JI2F 2NXNA 5CZXA 1FXRA 1LWFA 3PTWA 2CNOB 2FHJD 3DOLA 3FRYA 5T7LB 1RU2A 3G96A 1VQKS 1N33J 3BPDA 1MN9A 5E3AA 1HD0A 2XG8A 4CTAB 2ZE2B 2Z8QA 4W98A 3D67A 2NUUG 2AV5A 3FSYA 2R3VA 5D4OA 1C1BB 2DRBA 3PW4A 1SXLA 4ECSA 1CJKA 3E01A 3MM8A 2AGQA 4HHUA 2KM8B 2J7UA 4DSIA 4U7UK 1BD6A 1D1UA 2XI2A 4CLUA 3M32A 3IGVA 2CIMA 2GQQA 3X1LB 2HHHF 5CHCB 4J9QA 1H2TZ 4A8YA 2XO7A 2MTLA 2ALYB 2XMWA 1HQUA 2YNHA 3QNWB 1AROP 3QZ7A 5DGAA 2UVUA 3CCTA 1UEVA 1Y10A 5H1SV 5A0YA 1SC3B 2ZBPA 4B3OB 2P9CA 1GMUA 4FXDA 1NB2A 3MEDA 2F63A 2LDYA 2AEJA 2FJBB 4CLKA 2VOOA 3OVAA 1R8AA 2R7OA 1LNQA 2GVZA 1OQ6A 2GX8A 4O44B 1RWPB 1S5ZA 3OXGA 5THWA 3PW7A 2ZBIA 2GO9A 4J9KA 5LMUF 4X4RA 4P9SA 5KFUA 2GGPA 4H4OA 1ZETA 2ASJA 4ZPBA 4WIIA 3BGLA 2M70A 3ENAA 3BF4A 3FKBA 2J0WA 2WBRA 2UVWA 1S9GA 2VOPA 2MKHA 3IR5B 3LW5C 4LVNP 3UD5A 2DXEA 4Z7YA 2CNNB 4IKAA 1LWEA 4RNHA 2YY3A 4EGLA 4O3RA 3EM1A 5CD4H 2MJNA 3T6JA 1XTZA 1VQOS 3MUMP 3H8YA 3SBMA 3QGIA 5DDQC 4OZJA 1NKCA 1ZA1B 2AT1B 2N3LA 1UW4A 2CQ3A 3TUIC 3UI3A 4DV0J 3PIOQ 1YDLA 4ILLA 1TELA 2CJBA 2HHUA 1HNZF 3MD3A 2YNGA 3BYPA 5D0GA 2AYEA 1N33F 1EIYB 2CQ4A 2Z4PA 1C0TB 4ES2A 1YZ7A 2CPFA 4N47A 2HIYA 2PC6A 3LP2B 1SL2A 1G6BA 3JSMB 2EBGA 1RTDA 3W3SA 1HWKA 3UW1A 4B9TA 3GFZA 4WE1A 1VLYA 2QLJB 2XMTA 2DNZA 1TKDA 2BBEA 3QGPA 4TLQA 4N8NA 3HZGA 5KT2A 4RBUA 4PEOA 1YG0A 4DOZA 2PI4A 2QLBB 2IAJA 2YKAA 1PO6A 3GJSB 1MMNA 4K8RA 1S77D 1RBAA 4IRDA 3WIVA 4K4VA 4DSLA 1Q8KA 1VRTB 3MMCA 4QIWD 4Y2KA 3O8WA 2F8HA 2W7PA 4AD6A 1Q95G 1T8EA 1R8PA 2IIHA 2NREA 4F3QA 3QPIA 1NSAA 4DR3F 1DTTB 2DO0A 1OIAA 2H3EB 5F8JA 1Y5IB 5EWEA 1JXEA 1ITPA 2LECA 3SSRA 2NS1B 1IM6A 3AD9C 1YK9A 2DBBA 4JI4J 2ZWPA 1G3OA 3L7PA 1K0VA 1ZZFA 5HK4A 3D0IE 3MTJA 4L72B 1S9EB 1YBAA 2NQPA 4C8OA 2RE1A 8RUCA 1SL0A 3Q2TC 4LIWA 3HHLA 2DPJA 3BS9A 2WVCA 1KQGB 3U1MA 3OR1A 3HD2A 4DV0F 5JVGQ 1PYSB 5ETOA 2BQ3A 1GFWB 1LFWA 2FJEB 4EO6A 1RT4A 4YFUA 3OQ2A 1FO1A 2C2EA 1JWWA 2VC0A 5T41A 2W2NP 4UOGA 4DPWA 2EKYA 4Z37A 4ED5A 5HANA 4CO5A 2K1RA 4OZ3A 5E41A 2KTQA 3HHKA 1RTJB 1DTQA 1NSKL 5I3UA 3M8PB 2CQBA 1SH0A 4FNIA 4DN9A 3CVKA 1S6PB 4ER8A 1H73A 2MZTA 2GJFA 4X4VA 1I3OB 2YPYA 5C42B 1M5KC 2FLPA 3ZZOA 1FEEA 2GVDB 1S1WB 5DDPC 3UVJB 4LFCJ 1OYDA 5CABA 2HMIA 4TQSA 1IM4A 5DG7A 1I94J 3T3FA 2C3UA 1U1QA 2RSQA 2IRXA 3BSOA 2NLWA 5D77A 4ZLPA 2IA0A 4JP8A 1Q5YA 4KFBB 2CAJA 3THTA 3U27A 4GKKJ 1L3VA 3GQCA 1AT1B 5HO4A 1ZBTA 2JVRA 3UDLA 3W65A 3QMQA 2B9YA 2XCPA
chains in the Genus database with same CATH topology
4ZCMA 1N34F 4X2BA 3KWMA 1HNIB 5A6PA 4PXBA 3I6PA 3V6KA 2KB2A 3MM6B 3MM5B 4IRKA 4OZNA 4LMZA 1H7XA 1SB6A 1WHWA 2UXCF 3G6ES 2GJ2A 2HVZA 3G86A 5A2QY 5L9XA 5LXYA 3T19A 3MECB 1NB7A 5J2PA 3V81A 2CPEA 1MROB 1FVSA 2HG4A 2H5EA 3NMRA 1XK8A 4JBCA 1HI8A 3US5A 3CD0A 5I3QA 1R7IA 2CPDA 4NRTA 3C46A 3V2UC 5D4LA 2MZQA 4M5DB 4IR9A 5ITHA 2QLXA 1H2VZ 3DRPA 1JB0C 1LWFB 4BWJA 4WZQA 1Y4ZB 2LA6A 4LSNB 4KGKA 1Q8LA 4DQPA 3R5DA 4WU3A 2KT2A 5IQQA 1HARA 1DFDA 3DOLB 3BM7A 2M52A 2CQIA 1UJ6A 4I0WA 5GAGI 1JLEA 2CYYA 3I96A 3SV3A 2I5JB 3GYXB 4Q8FA 2R2SA 4AL7A 3RB3A 4YOEA 1X4HA 5AE3A 4EZ9A 4IDKA 1ZOTA 2DR9A 1KVJA 1S1TA 3MEGB 3K58A 3UWTA 4Q44A 3HM9A 2OTJS 2RU9A 1RYSA 2AW0A 2E5HA 3MM9B 4A8KA 4NL5A 1TV6A 3DFEA 3O3LA 3R5BA 2GW8A 3FZ2A 4UQTA 1FRHA 2HVHA 3IWXA 1VMBA 1X4EA 1VRUA 4ELTA 3HDSA 2JZ5A 4LQ3A 2G4BA 4DQIA 2R7SA 3I56S 3QIPA 4PCQA 4Q5VA 1NJYA 2XMMA 2IYGA 4PG8A 3I9V9 1LWCB 2N7YA 4TQRA 5E2QA 3VALA 1ZAXA 2Q6BA 1QAYA 2FVSA 2GMJA 3HMJG 4AE5A 3UD3P 3FMWA 3K7RA 3ZZUA 4J9SA 4MYTA 3SQGA 3GZ7A 1R43A 3E01B 4B3SF 3MM8B 5B0BA 3T5LA 2ZKUA 1U6BA 4FZVA 2FLNA 3LH2S 3ZFVA 3MPYA 2DNMA 1FA0A 2ZH6A 3NBPA 3NNCA 3C3LA 5F3ZA 2B4PA 3RU0A 3IG1A 2E44A 5L9NA 2MMYA 3MEEB 4KKOA 2FJWA 4R25A 5DS7A 3PXGa 2M4MA 2MHNA 2WONA 4R5PB 3M32B 2JL9A 4FS1A 3LP0A 4MMOA 4BC7A 2XLKA 3QJJA 1FCAA 1CEZA 5KTQA 1MU2A 1VI7A 2OJ3A 3LALA 4O0IA 3M9NB 1FRMA 4RW7A 4FN5A 1A7GE 1HBOA 2WK4A 2Y1RI 4A4JA 2OO4A 3I0RA 1IKXB 1HQUB 1HMVA 1Z1ZA 1JLBB 1TVRA 2YNHB 2MGZA 3D0HE 3VR1A 4JI0F 1C0UA 1P9QC 1NK4A 4OL8A 2PI5A 1K73T 4OJHA 2WOMA 3BN4A 3BR8A 4QWCA 2J9CA 1TL4A 3QAEA 2DNGA 4OHXA 2A2CA 5A0YB 4UQGA 2EC0A 5B0CA 2CJKA 2ZHOA 1TFWA 1R8BA 4ETZA 2WW8A 2DNYA 3MEDB 2EPIA 4ZVGA 1KQKA 2YKPA 4QJVA 4ZKAA 1N6QA 2VONA 1HA1A 4IG0A 3DRRB 1S99A 5KFWA 3U1NA 2YNFB 1F2GA 2N4DA 3ITHB 3OTDA 1U26A 3G6XA 4RX6A 1HWIA 4M94A 3TA2A 4PPDA 1S97A 1W25A 4A47A 5KG7A 5F8NA 4P2SA 4ZHRB 1Y5LB 2XZWA 5HN0A 2DCLA 2LQ5A 4YB7A 4YP3A 4I56A 4PKDB 2ZNZA 3PKMA 2MKIA 1ZAVA 2GA7A 2V0NA 3QO9A 1T05A 5KFVA 3HHDA 2HAIA 2KFNA 2MQNA 4KV8B 2WAQD 2ZH8A 4BCAA 4YR2A 1MWZA 3FNNA 1I94F 1LK7A 2BE2B 2GHPA 3MMBB 1REVB 1RDRA 1FKPB 4F26A 5CYQA 2JH3A 4RUAA 3H5SA 2FJXA 2ZH5A 5J2NA 2ZJQQ 4QWDA 2CPHA 1M5SA 4URQU 1X9SA 1Q53A 2GGPB 4H4OB 1VS3A 2VH7A 4GKJF 4F3MA 1HBNA 2Y0SD 3H2VE 4EBEA 2XGPA 2J5AA 4QYRA 2VA2A 4GKKF 4ZDNA 4EBCA 4HVZA 3G4SS 5F8IA 2E9RX 3J80Y 3BGFA 1S9GB 3HHEA 4JV5F 3IBWA 4HL9A 4B9MA 1UJ4A 1JNZB 1LXNA 1F9FA 4KC5A 4OV1A 4ZVEA 5KG4A 4AQYF 2HW3A 2YX1A 3MDFA 5JXSA 3H40A 1IBMF 2RJZA 4TU8A 2XY5A 2IRUA 1YJWS 1LW0B 4QR1A 3KYLA 4U67Q 4DR5F 2B0GA 1TZ0A 3KTQA 4PUOA 5FD1A 5A6WA 4ZPCA 4F4KA 1GAOA 1LWEB 4A8OA 3KMSA 3EGWB 4GC6A 1S6QA 3C6TB 2KYZA 1N0VC 4CH1A 1VC5A 4KJIA 2R2TA 1OQ3A 1RTIA 4F2SA 4PRFA 2O1PA 1S48A 4MK9A 4ETXA 5KFBA 3CF5Q 3DLEA 1BC6A 2AF6A 4N56A 6FD1A 2HWIA 3SDEA 3EZ5A 1SH2A 3NMAA 2C2RA 3R27A 1FKOB 1OSCA 4Y3CA 3CE8A 4DFMA 4RBVA 3POTA 4RW6A 1NZAA 1SI9A 1XERA 4PQUA 2R8GA 4ZA1A 1N0UA 1X4AA 3KLEA 4JUZA 1N56A 1UVIA 1RT7A 2L08A 4I2QA 5KFTA 3WC2A 1JK9B 3BJYA 5HI7A 1T03A 2MQQA 1N48A 4LSLA 3N6MA 4MKBA 1HPZA 2YNGB 3OXLA 3ZZZA 3TAPA 1J2VA 2G9OA 2JHEA 5D3GA 1F5AA 2J7WA 2IBOA 2MDAA 4ECTA 1S72S 3RR7A 3N5BA 1D3WA 3M2UA 5D4PA 3KMQA 3MR3A 4OFZA 1T3OA 1VIXA 2MYFA 2VPWB 5LXRA 2VQFF 2LMIA 2WRMA 3DRSA 5M2PA 4DL5A 5J2MA 5KG6A 1WEYA 1SL1A 3PVXA 5KFOA 1LK5A 4C3KA 2F7VA 2HNYA 2YWGA 2IMWP 4HYKA 1TFYA 1CC7A 4WK1A 1YJVA 1QSYA 3G8TA 4RLEA 2Q1LA 3X3UA 5KT7A 2R7UA 1HI0P 2HIQA 2EFVA 1T02A 3DXBA 3IN5A 2UXDF 1RTHA 4ZMMA 5GAHU 4PWDB 2HGMA 4WXOA 1ELOA 2J76E 4XPEA 4KRWA 4Q2MA 1RTDB 3MD1A 1KR4A 3KK1B 2YNIB 5L1KA 1XEZA 3CULA 1WHXA 4FF3A 4NZ6A 4ECRA 4TYAA 4RWWA 2KZZA 1U1MA 3J7YI 3C2PA 4HI2A 3M2RA 3R5CA 4WE1B 5E7OB 2R7VA 5C5JA 3DDKA 3EGNA 1M5OC 4OQJA 2KHDA 1H3DA 5DLFA 3N6NA 1M5VC 2JWNA 4FVCA 1S0VA 3I9ZA 4KHMA 3K8VA 4FVMA 4GMKA 2P5VA 1IKWB 3TYTA 3HI9A 2LA4A 1S1XA 4N76A 4ECUA 2DGWA 1Y3KA 3J7ZT 3EZUA 2KHCA 1KVIA 2I1RA 1ZM3A 5KT6A 1KEKA 3KLHA 2P6SA 3FRZA 1DQAA 2ZH1A 2DT9A 3KLGA 3JB9k 4F3OA 2KRBA 1TL3A 2RD5C 3OUYA 2P9GA 3RRKA 3PFEA 3KLFA 1TK0A 4JYAF 2UVVA 5LSOA 2BYCA 1VQ4S 4JI1F 2W7AA 5KFPA 3K5NA 1VQ5S 4C8MA 2V8VA 4MIWA 5B0AA 5I4MA 3K5MA 4TXSA 2CQ0A 3CCSS 2IAJB 1DZ5A 3H98A 1R31A 4K59A 4NMLA 4JI5F 4P7VA 2RMLA 4NCBA 1L3UA 2O5DA 2EFPA 4MH8A 1TUVA 2HNDB 2J6UA 4WU2A 1NK7A 2DD8S 1VC6A 2R7WA 4Y34A 4DFJA 2N3OA 3TA0A 4ILMA 5F0WA 2B6AB 1HYSB 2HHVA 4CO2A 3MPWA 4LF5F 3SZ2A 2VG6A 2QZ8A 5CCLA 4N5SA 4JV1A 4DF8A 1VBYA 1UL3A 2I8EA 5IM0A 3UNGC 1UETA 3KLIB 2QV6A 1C1CB 2XHWA 3I5BA 2GIRA 4LFAF 2W8KA 4IH5A 1N52B 3GWCA 3MMCB 1JNRB 3S1TA 3WX4A 3IAS9 3MF5A 4ELUA 4QYZJ 3TI0A 2VBZA 4NLPA 2RU3A 1FHTA 3GE9A 1VRTA 1J5OA 4C2MA 5I42B 2DNLA 7FDRA 1HW8A 2FJAB 2CPIA 4DWIA 1XR7A 1UEUA 4NPOA 5KFMA 4BDPA 2PEHA 3MZIA 5G0RA 1X7VA 1S1UB 2FJVA 1HD1A 3BO3A 4ED2A 1X5OA 2K3KA 3RR8A 2JSXA 3IO1A 5C25A 2RDIA 3GMGA 6FDRA 1FKAF 2G13A 4E98A 5KFNA 3JSYA 4LQ9A 4DUZF 4DL4A 2KN4A 2WBMA 4K5SA 2JVOA 4MJKA 1NAQA 1RT6B 3BREA 5GAEU 4DF4A 1VK8A 3DMJA 2IMOA 1NJIT 2XSJB 4I68A 4K4YA 3U1LA 3W2WA 3V6JA 2QA4S 2GMHA 4E8UA 4OHWA 2VASA 4ES1A 1DLOB 1FK9B 5DDRC 3QJPA 3VAHA 4MK8A 4R8UB 1HBUB 2PIIA 3JTPA 1TL5A 4A8MP 2MQMA 1S0MA 4I2PA 3CD6S 1S76D 5CYMB 4ECVA 3DI6B 1ZPWX 5HLFB 4OX8A 2M5YA 3D5MA 5EHHA 4FBTA 1M0SA 2FPHX 2FDNA 3MAQA 2FLOA 4ECQA 5HMYA 4QW8A 2OSQA 3OFHA 5KOXA 4RW9B 2LQBA 4Q0BA 1O8BA 3MEKA 3V5RA 2MPUA 4F02A 2IVFB 1VQ9S 1YJTA 2AJ0A 1C2PA 2N4CA 4OZ5A 2R7RA 2NR0A 1S1VA 2EFQA 3F44A 4YHHF 4FF1A 2KFYA 4NXNF 3B4DA 1KRPA 3QYYA 2JDJA 2NZ4A 3M2VB 1YIJS 4QIEA 1N5YA 2HRYA 3RB6A 5L1IA 1N4LA 1VQPS 4JV2A 3JYTA 4F50A 4QOTA 2M88A 3HT3A 1H6KX 4CT9A 3HKWA 1JLQA 1IKYB 1W2BR 3HHLB 1K1SA 3PDNA 2RS2A 1WHVA 5HL7Q 2CVIA 1FTRA 2Q43A 3NKYA 4NWBA 2F4VF 4QU6A 2MY7A 3LP1A 1U47A 5E3QA 3H2UB 4ED6A 4NCAA 1M5HA 3DGPA 4LF7F 2KFZA 1HNXF 1QM9A 2CFXA 3DM2A 2KT3A 3M8SA 2IC3A 4NLWA 2EFOA 4DN0A 2MKKA 3OR1B 7FD1A 1FJCA 4C11B 3TVKA 3AJ1A 3OTEA 1U09A 1XMBA 5EWFA 1DURA 3SSSA 1TKXB 2RH3A 1YJNS 4B08A 4A46A 2M3DA 3K5PA 3TP2A 5E3RA 3QZ8A 1RT4B 3C6UB 2YKNB 3MURP 2PDAA 3GR1A 3N0VA 2CQDA 2D1CA 3VTIA 1VJWA 2R2RA 2RF2A 2JEFA 5A8KA 3LQVA 4IQXA 4CO1A 2D7SA 5F8HA 4ED7A 1N5VA 2VL1A 2B7BB 4YUDA 4RNOA 3T1HF 3QJLA 1XR6A 4HDGA 3FFIB 3TAMB 1AUDA 4IFYA 2J6SA 2LCWA 1U49A 5T14A 4X4NA 1BQMB 5FIIA 4KO0B 4Q45A 4YB1P 5HBMB 3MUTP 1OPZA 5KFDA 3IR7B 4ID8A 3QLHB 4B9LA 3T1AA 1IR0A 1TQLA 1OWXA 3NCQA 1SJ1A 1WACA 3S8SA 3G9CA 1KTVA 4UOCA 4NLQA 1SKSA 3C8YA 1SKWA 2IM1A 3SEOA 3K8WA 2V4QA 3DRYA 2ACYA 4P7TA 4AUKA 3TRGA 3CJKA 2IVYA 2IFXA 3LUYA 4AXJA 1S79A 5B08A 5C24B 4IRCA 1K8AT 2K1RB 2XSFA 1E6VA 2ROPA 5IFMA 4HLBA 5KFQA 1DTQB 1QAXA 1H0HB 3KKFA 5L1JA 2M9KA 1KFDA 4G1QA 3SCLE 5CH7B 2AJQA 3KG1A 1RT2B 5I3UB 2DHGA 1LW2A 2C3PA 1DJ0A 3O5TB 2EW9A 3B78A 4ED8A 1DARA 2MY8A 2KZMA 2R7TA 2CPYA 4NLXA 1HBMA 3SCKE 3KK3A 2RKIA 3MM7B 3CJ4A 5AXKA 3RBEA 2NPFA 2JEIA 3CJ0A 1W2IA 2J7KA 3CMES 2VBXA 5KFXA 1VQ6S 1X5SA 2YKMB 3IAM9 1ZYQA 3VF0B 4ECZA 2VFVA 1IN0A 1NK0A 4DR1F 1RT3A 4I1TA 2E1RA 4YR0A 1Z2ZA 1U2FA 1X4DA 5D78A 1RKIA 3M6VA 2CQGA 3PY8A 3LOUA 5LMNF 2BW2A 2OFHX 3PHEA 4MKAA 4LF9F 2HS3A 3V4IA 1SJRA 1H98A 1G1XA 5A8RB 4DQQA 3PFOA 3OPKA 2W9BB 4NLDA 4ATNA 1XMOF 2DGSA 2RQMA 2FB0A 4N41A 4WFAQ 3FGVA 3D54A 2UZAA 5BR8F 2K2PA 4PG6A 3MOZA 5B7WA 1NK5A 1QJHA 2DGQA 3NAIA 2I9SA 2HMIB 3WDOA 5IT9Y 4XDDA 3GG0A 1YHQS 4MIAA 2DK2A 1OO0B 4J9RA 4PXDA 2VPYB 4CI0B 5D6GA 3EXYA 5F0UA 4X84A 3OTOF 4OHZA 2C3OA 4DPOA 3GIKA 3CGIA 1FEHA 4J9MA 1GNKA 3CCLS 1JLAB 3FMBA 2HFZA 2MXYA 5KG1A 3K59A 5B0GA 4AL5A 1WI8A 3I4HX 5K8OA 4OLOA 2ADCA 4OI2A 3S6EA 1PILA 1ZTTA 1L3SA 4Y2CA 4RNNA 3BDPA 3LAMA 4C97A 1KLMA 4ZOSA 3W2VA 1UVJA 3N5FA 4O3QA 2VFRA 5L39A 1VBZA 3KG0A 3N6LA 4JI6F 5DQIA 5JVHQ 1MWYA 3KHHA 1WF2A 2KM8C