1K0TA

Nmr solution structure of unbound, oxidized photosystem i subunit psac, containing [4fe-4s] clusters fa and fb
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
80
structure length
80
Chain Sequence
SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PSAC SUBUNIT OF PHOTOSYSTEM I
publication title Solution structure of the unbound, oxidized Photosystem I subunit PsaC, containing [4Fe-4S] clusters F(A) and F(B): a conformational change occurs upon binding to photosystem I.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 1
structure length 80
sequence length 80
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2001-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1k0tA00
1D3WA 2FJDB 2PA8D 1FRKA 2WSCC 2UZAA 1F5CA 2XSJA 2O01C 5BYRA 2C3UA 1FCAA 5E7OB 4CI0B 1JB0C 3MM7B 1GAOA 2C42A 2WAQD 3GYXB 2GMHA 3MMBA 1FRMA 1DURA 1Q16B 1JNZB 1R27B 3EUNA 1FF2A 1CLFA 4ID8A 3MM5B 1K0TA 2C3MA 2WSEC 2C3OA 5CHCB 6FDRA 3IR7B 4L6V3 1BC6A 3MMCB 1WTFA 3MMAA 1SIWB 1B0PA 2V4JA 1FDAA 1FDNA 1Y5LB 5FD1A 1GTEA 1XERA 2VPYB 2Y0SD 1DAXA 7FD1A 3IR5B 3MM8B 2FJAB 3LW5C 1A6LA 1Y5IB 1JNRB 1FRJA 1FD2A 1H7XA 1KQGB 3MM7A 1BWEA 3OR1B 3MM9A 2C3PA 2PMZD 3EXYA 3MM6B 3OR2A 2Z8QA 5L8RC 2PDAA 1FDDA 1SIZA 1IR0A 4OV1A 1BD6A 1FEHA 1GTHA 3MM5A 1FXRA 4OMFG 4YDDB 1ROFA 5CH7B 2FDNA 1KQFB 1H98A 2FD2A 2IVFB 2V2KA 1FDBA 3C8YA 4XDCA 1FERA 1C4AA 1RGVA 1C4CA 1HFEL 1DFDA 1H0HB 1FRXA 4Y28C 1PC4A 2VPWB 4AYBD 5BYQA 3EGWB 2VPXB 3MMAB 3MM8A 2VKRA 1G6BA 1B0TA 4DHVA 2C3YA 6FD1A 4RKUC 2XSJB 1FRHA 1G3OA 3OR1A 1F2GA 1FRLA 3PNIA 2WB1D 4KT0C 2FGOA 3MM6A 1AXQA 1H7WA 2GMJA 2ZVSA 5BYSA 3MMCA 3IR6B 3MMBB 1BLUA 3MM9B 4XK8C 1B0VA 1Y4ZB 1F5BA 1PC5A 2FJEB 2VPZB 3OR2B 1FXDA 7FDRA 1KEKA 1FTCA 1VJWA 1BQXA 1GT8A 3HKZD 1SJ1A 1Y5NB 4XDDA 2FJBB 2V4JB 1FRIA 1IQZA 2WSFC
chains in the Genus database with same CATH superfamily
2CAJA 1OPZA 2DT9A 2GS8A 4ER8A 1U8WA 3G8SA 2KRRA 2VU5A 3RAQA 4YHHF 4I2QB 4PXCA 3CJ5A 3W65A 1JLCA 2H65B 1TKDA 3MGJA 2EFGA 3FGVA 3D1OA 1NHUA 3AY0A 1KONA 2O3DA 3BSCA 3KTQA 3FRYA 2RS2A 4OL8A 4B02A 3J7ZT 3HSZA 4QIFA 3DOLA 2LEPA 4FKXA 3ZO7A 4FS1A 2VONA 2MQMA 2CQ0A 2W8LA 3B78A 5L8RC 3UN3A 4ZHRB 4ID5A 4ANCA 2F1FA 2D3ZA 4MKBA 3UO0A 1C0UB 1ZA1B 1QAYA 2FVSA 4HACA 2QMWA 2NXCA 3I31A 2QLJB 3MAAA 5L1KA 3DOKB 4Y2AA 5DZ6A 5J1EA 3W9JA 3MEDB 3NNAA 3FC9A 1MMLA 3ENWA 3M8QB 4O3RA 2GVDA 3HFZB 3VAJA 4QPTA 1SJ1A 4ED0A 5D3GB 3WZ0A 4PPDA 4ATNA 2AJ4A 4NCGA 1NZAA 4WP3A 2CYYA 4OX7A 3W61A 1J2VA 2JX2A 4FF2A 5G4DA 3EZOA 5FLXU 4R0EA 3FEYB 1WOPA 3EXYA 1WD6A 4K2JA 2ROPA 4CTAA 3GIJA 1UZDA 2OJ3A 3NMAA 1RT3B 2IC3A 1T05B 3MAQA 1M5OC 1R8AA 3NAHA 4KYZA 5AXNA 4ZJLA 4O44A 3UCUP 4JI0F 3QPIA 3TYTA 1H7WA 4ENOA 4IKAA 3GTYX 2UUBJ 3V81B 2HZAA 3I87A 3JTNA 4M5DA 2VPZB 3MEKA 4OYOA 4NLRA 4LQ9A 3HVAA 5CXTA 1HQ2A 4KGVB 2J7UA 3G8QA 1RT6A 1U47A 1DTQB 1GAOA 3J7AN 3UR3C 2R4FA 4EFAC 2QYCA 2HURA 2ZWPA 1U45A 1URNA 3P4UB 1OJ4A 2VQFF 4CO0A 3ILIA 1RWNB 2QLBB 5G0RA 1NEEA 4DF4A 4X4OA 3CDUA 3T5JA 2F9JA 1U49A 4LF9F 2QSFA 1N33J 1X5PA 4YMEA 4UQGA 3VGVA 2K06A 4O4GB 3OFGA 2YVSA 2PE8A 5D15A 3P49B 1RGVA 4OLPA 5ETSA 4ZLNA 2HHSA 2FB0A 2VOPA 3AJ1A 3LP0A 3F56A 1HWKA 4V19J 5KFOA 3ILJA 2ILZA 3K0JA 1NK0A 1RT4A 2VJUA 2Y0BB 3PDNA 3WQPA 4MK8A 1N4LA 2ACMA 3I4HX 1JLAB 5A8WA 1WDDA 1VJQA 4OV6A 2FJDB 3DLGB 3CCMS 2ATCB 2Y3YA 5F3ZA 4RWWA 4QWEA 3IS9A 2BACA 1HHTP 5HVGA 2Q43A 2JEFA 2Q6BA 4DPWA 4B3MF 2GIRA 3FBBA 4YR2A 1TFYA 1CJVB 3I0RB 5KFHA 1S1VB 3MMJA 4R5PA 1XERA 3HI9A 2DO0A 4K4TA 1NBEB 4C11A 3CW2C 3DLEB 4HEA9 5ETRA 3MEEB 3GR1A 2ZNYA 3C16A 4DQQA 3D6MB 4RLEA 3F41A 4DPYA 4MT1A 1AROP 3SDEB 4DJBA 1WDTA 1ZAWA 2ZITA 2RIJA 4OI4A 3IN5A 3I0SB 3JTPA 4ECWA 3CD6S 2CVEA 3A3NB 3R6LB 8RUCA 3KLEA 2YWFA 1U6ZA 2ATLA 5IT9Y 1FTCA 1X0FA 2GHWA 3W8PA 3WC2A 2YWHA 1FRIA 1NPPA 5F8HA 4ED1A 2BABA 4KHPF 1VYAA 1NLKL 3PR4A 2ACYA 1WC0A 4F4XA 1XMOF 2BKPA 3MD1A 1V3RA 3W7BA 3GFZA 4USVA 1KNZA 1R0AA 1U1KA 2AIRB 2BV3A 1FKPA 4M5NA 1TVRB 5IQ6A 3W9IA 1NB2A 2R8IA 4GC7A 4KGMA 4RL1A 2BJ3A 1CC7A 1U02A 3H98A 5I4MA 3UNYA 1FDDA 4I7FB 3FCVA 1N5YB 2KRBA 5KFAA 1KQFB 3T1YF 4ECYA 1VQ4S 1B7YB 1FERA 3EYZA 1DFDA 2P8IA 1EQ0A 2R2RA 4J9UE 5HATA 2B56A 1HWIA 1HBOA 5F8LA 2IYGA 3DGPA 2DGVA 3R5JB 3J7Z5 2ALYB 2GQQA 1WJ9A 4H4OA 4A48A 2DY1A 4ZK7M 3GPAA 1WKKA 2KXHA 4JI6J 3PJ9A 1IJEB 3R97A 4Q43A 2CQGA 5L1LA 2Q1LA 5KFNA 4A8XA 2ZE2B 2Z58B 2UUWA 3RRHA 1T02A 1H2TZ 1FF2A 2GX8A 2IJNA 3TO8A 4WFXA 4AQYF 2YX4A 3EGVA 2CZ9A 5ETKA 3V6HA 5A0YB 2G1HA 3QAUA 2XBPA 4O3QA 2PD1A 4C7QA 5KFCA 1JKHB 3L4BC 2KN4A 1M5HA 2XS2A 5EN1A 2UV8G 4WE1A 3R7SB 3GP9A 4Q45A 4P6QA 4QIGA 3T19A 2XCPA 5IXUA 3D9BA 3POTB 1GMWD 2JLEA 1ZOTA 3NS5A 4R8UB 3M8YA 3ZNUA 1HBUB 1YJVA 3OPKA 1NRKA 2GAGC 5B0GA 1S59A 2CQDA 2HBQB 1L3VA 1BE4A 1HQUA 3Q24A 5IV4A 2E5LJ 2NZ4A 4UOHA 4KTQA 3PJWA 3LPYA 4DL3A 1WKLA 4C97A 4ZLPA 1HNZF 1S6UA 2CG8A 2N4DA 2ZHOA 3MCOA 1UEUA 3I56S 1JXEA 4BLGA 1WORA 4DSIA 3J81U 3MHYA 2BRLA 4LF8F 2NYHA 1BUXA 1GMVA 2IBOA 2AX0A 2KHDA 3QT7A 4UTGA 1CS4A 5K5MA 3PW7A 4ZVOB 5K8NA 4NEYA 3UN5A 3SV4A 1PAEX 4A46A 3OTDA 3J7A1 5L39A 5F0WA 1CJTA 4O0NA 3LF0A 2M3DA 4HHHA 2QL5B 2B4UA 1RAHB 2D74B 4V1Ak 1IBMF 1WF0A 2HKEA 2KVQE 1Z1ZA 2DRBA 4B3RF 1UEKA 1U0HA 1Z2ZA 3R2DJ 1VI7A 4B3TJ 2AJ1A 2LA6A 3T1AA 5DQHA 4XTTA 1QAIA 4ZVGA 2HNDA 5DQGA 4WK3A 3LWLA 3BEGB 1Q78A 3BO4A 2KJVA 1WNEA 3R5CA 4OZ5A 1E6VA 1UFWA 2BYCA 3FMBA 1JWWA 1M5VC 2BM0A 3QZ8A 4AXIA 3DLBA 2RRBA 1VQOS 2MYFA 4PWWA 5E5NA 4Y6IA 2XG8A 4QWBA 5KG6A 3PHTA 2IAJA 1VC0A 1CJUA 1FK9A 2I8EA 3VAGA 2EI5A 4DL2A 5IT0A 2DXFA 2Z8QA 2AZ3A 4ES2A 4OV1A 4KFBB 1XNRF 2UXDF 2ZDOA 2LU2A 1IBLJ 3KUEA 5D0HA 4JI3F 5M2RA 3H5YA 2H54B 2CPEA 4ECQA 2NQPA 1QD1A 3K5MA 4TN2A 2ERRA 5IS2A 2DGOA 3MD3A 2AD9A 3GYGA 3BYPA 4NYPA 1S9EA 1DTTA 3MMCA 1MW7A 3QSIA 5GAGU 2B6AA 2WVEA 2LKZA 3MM9B 2YKAA 1S0MA 2JVOA 1DLOB 2V8HA 1ZM9A 2BQ3A 3T5HA 1BQXA 4RZRA 5GAEI 1ZM2A 3KLGB 2CQHA 5E7OB 1TELA 2AX1A 1VQNS 3I9ZA 3PZPA 1URRA 3N6LA 4CLFA 1R8CA 5HP1A 2C3MA 3MOJB 5HBMB 4NA1A 1YIJS 1SIWB 2KJWA 2XWXA 2CFXA 2EFNA 4PKDB 4OYZA 2F7VA 3VTIA 4QQBA 3BGRA 2VG6B 1PYSB 3CSKA 1RT5B 5HAOA 3GLJA 3PXGa 5HROA 3C6UB 1U1MA 2X3GA 1PO6A 4OHXA 3MF5A 2V50A 2VASA 1SQGA 2I1RA 4YY3J 1PC4A 3KUGA 1RTIA 4S0MA 2AJ2A 4EYHB 4KE5A 3CE8A 1RCOB 1U1PA 2VIHA 2XYHB 2E1RA 2XMJA 1J5OA 1TR0A 3PYDA 2QC3A 4MIBA 2GVZB 1S4FA 2VH7A 4A8FA 2ZKUA 2KFZA 3QIPA 1VGYA 2MZ1A 2IBKA 2RQKA 5C2GA 4A8KA 3KLIA 4KH0B 1I94F 5F41A 4WFAQ 1KRPA 4NA3A 3FJ2A 5J2QA 3CMES 2YPZA 4QIEA 4H54A 5T41A 1R0BG 2FLNA 3NKYA 2G0CA 2RKIB 5KFZA 1JLGB 1S12A 1CJKA 3GSDA 3ISZA 3N5BA 2HMIB 2G0IA 4FXDA 5GAGI 2R8GA 2MQQA 4ZLLA 2EFVA 3DU6A 5KTQA 2DEJA 2XTJP 2YKMA 3BKFA 4LFCF 3KXDA 3Q8UA 3KK2A 4P7VA 1HYSA 1C1BA 2V8DA 3G96A 2HVZA 2Q6CA 2HPUA 4YUDA 3KHLA 1NDLA 1TL1A 5B09A 3DDIA 3S01A 3NS6A 1CPZA 4ELVA 3JQJA 4TKTA 9RUBA 4Q7AA 1IBKF 4IR1A 3Q0AA 3AA9A 3EPGA 3JSYA 1D9AA 1KS2A 4P74A 2VC1A 2JLGA 1P9YA 3VGTA 1ZPVA 3KUHA 4G1PA 5FJ4A 2B9YA 1Q5YA 3IRXB 4J9NA 1CSJA 2V67A 2GMHA 4UOGA 4HI1A 3NEKA 3N6MA 1SXLA 4J91A 3RAXA 3TR5A 4DS5A 2XMWA 5M2PA 1HIYA 3MAHA 3M8WA 3DM2A 5AXMA 3ET6A 1S48A 2EVZA 3P96A 1M0SA 2C2MB 3DLJA 2PFFB 2DNHA 2H5EA 1SC3B 4LF2A 2XYGB 2BRKA 3EDQB 3HF5A 4KQZA 4TQSA 4PG5A 3ZC4A 1RAGB 3DI6B 4PG6A 2FVPA 3QAEA 5CCLA 4FVMA 5B0DA 3JB9k 4N5SA 4F3OA 2HNZA 2GJFA 4WTYA 2YNIA 2A2DA 1RQ0A 3V6KA 1Y3JA 4ERDA 5RUBA 1I5OB 5F8GA 4I0WA 2AQ4A 1KN6A 3M9OB 2M8HA 3OLBA 5KFKA 5DLFA 5KT2A 3OFFA 4I64A 4H4KC 3CJKA 2OPRB 4CLZA 1U09A 4JI0J 2P2CB 3Q2SC 2CG4A 4L72B 4BWJA 2NUUG 4OX9F 2GV1A 1R7IA 1QSYA 1HBMB 2E1CA 1QM9A 4NLWA 4G3IA 4WP9A 2KO1A 3O6QA 1DY3A 1PAUB 2K3KA 5D77A 2AT1B 3H20A 3CB4A 2LECA 3PCOB 1RTDB 3ZNJ1 1WC6A 1QVFR 4I67A 3PKMA 2HK2A 4ZLJA 4F02A 4OJ3A 2MB0B 1A6LA 4F0HA 1YVFA 3C15A 5C42A 2PSZA 1NMEB 2VQFJ 2R2TA 2MZTA 3H4DA 3UN2A 1UWBB 5B0BA 1FRXA 1SL0A 1VRUA 4LF9J 4FPIA 6FD1A 2ZJRQ 4FS2A 1WSRA 1KWMA 2Y1RI 2BR0A 2EBGA 1J27A 1TL7A 4MKYA 4G1QA 2LEBA 1UVJA 3VGSA 1HHQA 1NPRA 1Z4UA 4QU6A 1JLBB 3FSXA 4QR1A 1FFSB 3THPA 3K5LA 5KFUA 2BE2A 4LF4F 1LWFB 2VFTA 1RWKB 2E29A 3QBCA 3JXOA 1R27B 2LCWA 4MK7A 2VBXA 4N47A 4JV5F 1SC6A 1R6YA 1DJ0A 2DNGA 3HSDA 4Q2LA 1Y5LB 5EX3A 2DNPA 4JP8A 1RT2A 4ELTA 5CYQB 1KOOA 1HBNA 2P9EA 2R7RA 3GU0A 3M2VB 2LQBA 3OBIA 1NSKL 4A4JA 4B3MJ 3QGIA 2PC6A 4RO0A 1SVDA 2DO4A 1L3KA 3LPEA 2FY1A 2YNGA 4UY8T 4FYXB 4MFBA 2NPFA 1TUVA 2PFDA 4DHVA 4A47A 3UVJA 2DXDA 2B8QA 3OUYA 4OX8A 4DX6A 3CCES 4C8LA 1TKXA 4QPXA 4RW8B 2ZC4A 2CNOB 4DQPA 2MHNA 1RA6A 2ZBPA 2IJFA 4C3KA 4JI4F 3J7YU 2JEIA 3D0IE 3IG1A 3IC1A 2DGXA 3OSPA 2O01C 4EO6A 3DMJB 1N32F 1R8BA 1HI8A 5EWEA 2OHDA 3T9ZA 3TJ9A 1G2EA 4OYIA 3MMAA 3W2WB 2C2RA 3BBBA 5A2QU 3D5MA 4IOAQ 4O4RA 3EZ5A 4KHPJ 1VFJA 1U1RA 4WU3A 1RAFB 4RBUA 3TZWA 3UW1A 2X1BA 4Z7CA 4DSFA 2IHR1 4YEAA 2VQEF 3AD7C 1FXLA 1XMOJ 1JLEA 2XNQA 1GTHA 3H5SA 2VG5A 1LW2A 4G1IA 3ZZUA 2OD6A 4XO0A 3MXHP 3LWMA 1U4BA 2UU9F 2VPWB 2YPYA 1KSPA 3D2WA 1O0PA 4ZIWA 1B0TA 3QO9A 2QZ8A 2EG2A 1FFWB 3TAPA 1T3NA 4C4WA 3DRSA 4FF4A 4GO5X 3TANA 2XI3A 3T1YJ 1JLCB 2BKOA 1U26A 2LMIA 4HLBA 1JQGA 1FO1A 2HQDA 3IO1A 4CLUA 3PW0A 3DOLB 2MY7A 5BYRA 1WC4A 5AE1A 3BGUA 4NRTA 2XY5A 1KVIA 3SCIE 5IT9U 1WSVA 1VIXA 1J5EF 3OL9A 4IO1A 3CJ8A 4ID5B 3EVWA 3W1YC 4Q5VA 2J76E 3N4WA 2QX0A 3AB4B 1K73T 3O8WA 4C6AA 1WEZA 4HACB 1RLCL 3MAAB 4DX5A 2VV5A 5B0EA 1NHVA 2AJ0A 1ULRA 4ZPBA 4JI8F 2ASLA 5ETOA 3R3TA 3KDOA 5J1EB 2XNRA 2FLOA 4AQYJ 2HGMA 3NS7B 3SZ2A 2OTJS 1RKIA 2RVJA 5ITHA 5AE3A 1RTHB 5D0RA 4KJIA 2GVDB 2ZD1A 1RT7A 1VHFA 2FZGB 4WU2A 4GRSA 5F3TA 4B9MA 3W5YA 1X60A 2M7SA 4ZA1A 2XYPB 4C0OC 3MCSA 3LUYA 4M5JA 4ECSA 1R43A 3GYNA 1B99A 3WHIA 3V6DB 2RAQA 3HD1A 4J9LA 2CJ9A 4NASA 3BZQA 2RHSB 2RJZA 2HVIA 3IGNA 1NUEA 5IM0A 5IOLA 4HR2A 1DURA 2BW2A 2NR0A 4CTAB 4LBHA 2AYMA 1WTFA 3WX4A 2VC0A 3BF4A 2D3O1 2CQ4A 1HNZJ 4LFBJ 2G0JA 3AA8A 4K4XA 2ZH5A 1QSLA 5D4NA 1H7XA 4O44B 2B0GA 1F9HA 4NZ7A 2HK3A 4AFFA 4LF8J 3VALA 1WTBA 2B5JB 1VBXA 1IR0A 1RAAB 3VZHA 3NP5A 2ZH7A 1FXRA 3NLCA 3OTBA 5J1PA 4M5DB 3O3LA 1DQ9A 1VLOA 4DSLA 5LT5A 1WG4A 3MWBA 2IMWP 5E41A 2IJRA 3CVKA 4X4TA 1I1GA 3WIUA 2JSXA 1RT6B 3ICLA 1VBYA 5CQGA 4GC6A 3CIMA 2O66A 4J9VA 3T9NA 3P6YC 1IWAA 4NLTA 1EETA 4BC7A 2NSBA 4TY8B 1IBMJ 1TKTA 2OI2A 5G0RB 3OW2R 3M6VA 1XIQA 2FIUA 4B3RJ 2YKPA 1KP6A 1T7PA 5I42A 1NKBA 2DR7A 2F8MA 1EX8A 1CLFA 1QSSA 3VQTA 4JUZA 4JI5F 5DGAA 2RH3A 1D9FA 2GO8A 4JBCA 3MR7A 2F9DA 1FRJA 4DSKA 2UXBF 1OYDA 5L9XA 2R7TA 2CWXA 4YB5A 4LBPA 4G65A 4ES3A 1BY9A 1RT4B 4U7UK 2NUHA 2OIHA 5D4LA 2HHUA 4NA2A 1K9MT 3MCNA 5A8WB 2BM1A 3PIOQ 2QLXA 4TU9A 4J9PA 2DVIA 1BMQB 3MUTP 3G8TA 2IDLA 1XNRJ 2UXDJ 4JI3J 2HFNA 1SC4B 1MROA 3AHPA 4NLOA 1M1KT 1FNOA 5H9EK 4LF7F 2V8GA 4R5PB 1ZM3A 4OYPA 1WEXA 2LQ5A 4Y2KA 3ZFVA 3E01A 4C11B 4UY85 3ONQA 2HZVA 4DR6F 2BEFA 2M52A 3C16B 4NYZA 4K4UA 1RWMB 1Y0HA 3HULA 4DU8A 4ITSA 1T9YA 1S0NA 1U0SA 1SL2A 5J2PA 3J80U 2FHJA 1L3SA 2QRRA 1U6FA 1WUUA 4WYLA 2KXNB 2A6OA 1EP4A 4HT5A 1ROFA 4PG8A 3KLHA 4DSEA 4O3SA 5KG1A 2CPIA 2FHMA 1M1GA 2Y1LB 4P73A 3DLLQ 1YJUA 3HHNB 1XBWA 3PG9A 3ZTQA 3KMQA 1HMVA 1KVKA 2E1PA 1R0AB 1TUWA 1D0EA 4O3NA 1RHQB 5FLXY 4DDFA 1XNQF 2B43A 2BXJA 5KT5A 4CLKA 2IFXA 1XEZA 1S6QA 3BQ1A 3CUNA 1TZ0A 4YB7A 5HJYA 1VMBA 3TJAA 1JB0C 2LDIA 4K4SA 2GW8A 3KJNB 1GQEA 2WVDA 2VDHA 1YX2A 3CJ0A 3C14A 4DR4J 4ILRA 3E2EA 4WK1A 4UUXA 1HBOB 3EWGA 3DGPB 1I94J 4ZP6A 2HEKA 2FY8A 4B9LA 3D67A 3HLUA 3W2VB 3N28A 4H4OB 4DCJB 4X4RA 1RAIB 1RAEB 1UPMB 3D28A 5KT7A 2H1YA 4LVNP 1TK8A 1N5VA 1D1UA 1UVNA 4MK9A 1RJJA 3A8JA 3MM8A 2CQBA 1RADB 4USMA 3IXQA 1FJGF 3IBFB 4OYXA 4D3HA 3S8SA 4LFCJ 1N6QA 3QGPA 3G9CA 4X84A 3EGZA 2Z57B 1WHVA 1SV5A 1PYTA 1ZTTA 4OZ1A 2Q79A 1WG1A 2B4OA 2VBZA 2RDDA 4F2RA 3CJQA 1IBKJ 1NKCA 4M1KA 4IR9A 3BKTA 2UUBF 4F26A 2BKNA 2PMWA 3LP1B 4NXNF 3Q8PB 1YLXA 5THWA 3A8IA 1X31C 3BQ2A 5FDLB 2JHEA 3RUBL 2OPPA 2W7OA 1IWGA 1YDLA 2LXIA 5JVHQ 4DV3F 3RYLA 4WCEQ 1X9MA 2FDNA 2MQ8A 5J2MA 2OFGX 1HNXF 1OMSA 1QUPA 2XLIA 4FF3A 4L76A 3QT8A 2ZHAA 3T6BA 3CO9A 4F3QA 1HR0F 2ZJQQ 2ZUGA 2ZVSA 2EKNA 2BJ8A 3PW4A 1Q8LA 3CT9A 2NSCA 4KPCA 2OKQA 1N33F 2E5JA 3ZZ0A 1SBRA 4I2PB 1CS4B 2PA8D 1SJFA 3DXSX 2I5JA 3SBMA 3SSSA 4I56A 2JOQA 4RNMA 4RNFA 1VRQC 4GO7X 2DR5A 2F63A 4WWSA 4B08A 4IYQA 4ZN1A 1ZBTA 3VF0B 5KFRA 4OX9J 1LWCB 4U95A 1VC5A 2IM3A 2Z2YB 2YX7A 2WBMA 2NXNA 3DXBA 1HKAA 4Z7YA 3R9LA 1UVKA 1AB8A 3MR3A 2YH0A 3MCMA 2HNDB 2O5DA 1IN0A 4LUBA 3TVYA 3EGWB 1RBAA 5DO2A 5T14A 1E6VB 1BQMA 2E9TA 3CTRA 2MGZA 4RW9A 1QLNA 4F50A 3BO3A 3UDCA 2HHXA 4WKRA 1VQYA 3DHWC 1YTYA 2BANA 4LR8A 3SCKE 4J9KA 4DZDA 1FCAA 2KZMA 2DK2A 2IAJB 4ALZA 4DV6F 2ADBA 3TZYA 2A3JA 2C2OB 4URGA 1G4CA 2OMOA 1NJWA 1NNDA 1TK0A 3BDEA 5C25A 4DN9A 4GKKF 1P9QC 4LF4J 5LXYA 4F4YA 2JRSA 4ED6A 2GAHC 1U1OA 1K8AT 2AU0A 3Q8SB 1QAJA 1S9EB 4L3NA 1DARA 3QYYA 4WXOA 2B6AB 2XQCA 4JV5J 2V8PA 2OMLA 1SH0A 1IJFB 1VQPS 3LGNA 1F2HA 1U1NA 4DMZA 4F67A 1TAUA 2VPXB 4QYRA 2VUGA 3NWGA 1LW0A 4MMOA 3O1LA 2MSTA 1FJ7A 2W8KA 3FQKA 4F0KA 5KFQA 3P8BB 5HP1B 1RYSA 5DQIA 4OI6A 2L9WA 3LGHA 1S9FA 4RW7B 2DYAA 4LRCA 5C7PA 2BE7D 2P6TA 3R7NB 5T7LA 3BGRB 5KFYA 2ZFHA 3IGVA 1W25A 2DITA 2Y1IA 3EUNA 4JV2A 3TAQA 5HROB 4Y0FA 5K14A 2JLFA 4ZCIA 2CJAA 2CPHA 4JI4J 4M63A 3K59A 2UP1A 1O8BA 3BM7A 5H9EJ 3TQ1A 5FD1A 2BOAA 1GH8A 1RTIB 4FYDA 2HFZA 1PJ7A 1N32J 2QIFA 1PBAA 2J6SA 3CCLS 1J5OB 3HHKA 5I3UA 2JVRA 3L7UA 4YDDB 4WFBQ 4P7TA 5KFLA 2IA0A 2DEIA 2OSQA 1CQMA 3ITHA 3QIPB 4NWBA 5CAAA 3CMAS 2NS1B 1FI4A 3T1HF 4QWCA 2R2SA 1CBKA 2GMJA 1CG2A 1SKUB 2J7KA 1Q95G 3EPIA 4DQIA 1U7LA 3TI0A 5J2QB 2UU9J 2RQCA 1S5ZA 2WRMA 5JUMA 4WIQA 2ZZMA 4MIWA 4DN0A 2EXUA 1Y9OA 4M5MA 1HD0A 1Q1KA 3FNNA 4AXJA 3DYAA 5I3PA 2HHWA 2JL9A 2WW4A 3M32A 2C3OA 2YKMB 2MQPA 1HYSB 1C1BB 1VCTA 2VBYA 5IT4A 1XN9A 2NXEA 1DAXA 4NLGA 2WCXA 4QYZJ 1S9GA 1TL1B 3Q8VA 1S1XB 4P2XA 3QWUA 1J5EJ 4MJKA 1F3FA 2OAUA 2ZKTA 4B3SF 3U7JA 2DNQA 2W7AA 5KFFA 3HDSA 5K20B 4ANEA 3D66A 3DU5A 3LQVA 3LO3A 4R0JA 4JI8J 1S1TA 2E1MC 3DRYA 1Y7PA 3MM6A 2A18A 4CLYA 4PQUA 2XMAA 3LP2B 4BCAA 1NB7A 3OR2B 2VA3A 2HHQA 5LJ3Y 1NZ8A 1VQ5S 4LRFA 3O2IA 4AL6A 2ZH4A 1ZH5A 2WSCC 2G2OA 3DM2B 2HRUA 1S72S 5ETPA 3D0GE 4QWDA 5E3AA 3ELHA 4HTJA 1X8DA 3TNVA 3IR7B 4QIVA 3BGFA 5GAHU 1FDAA 4QW8A 5F8IA 4PR6A 4JI1F 3DRPA 1R6VA 3TA1A 3GV7B 2M70A 4URQU 3F73A 3CNQP 2JZ5A 2HNZB 4F4AA 3M8QA 3I5CA 2CPYA 3S7RA 1F6TA 1IBCB 3MUMP 4K0KF 1S79A 4X4SA 3SQGB 1IKWA 4C0BA 1UW9A 3C8YA 3BBFA 3FVYA 4H4KA 4ZCLA 1P8GA 3NL0A 2G2YA 2GIQA 2XSFA 4ED4A 3R2CJ 2MKSA 2G4BA 4AYBD 3GB0A 1JMTA 2DD8S 2W4CA 2AHOB 1KQSR 1TMJA 4ECRA 2EC0A 5E2QA 3QT5A 1GX5A 1FVSA 4L74A 3W66A 5HJXA 1N0UA 7FDRA 4KHMA 1W26A 1HD1A 3KHHA 5K8PA 3IBWA 2XMUA 2J9CA 4CLSA 3W64A 3HVTA 2VICA 2FZKB 3SXLA 1T05A 3IAM9 2CQCA 3KHRA 2KDOA 4B3OA 1T03B 3KJQB 5F0UA 1S76D 4YB6A 1VRUB 1H2VZ 3NGDA 1S6PB 4Q0BA 3V81A 1TK5A 3ZZRA 2W9CA 1VQ7S 1R31A 4URSA 4RW6A 4USIA 4EWTA 4JI5J 1RHKB 3T5KA 4G1QB 1H3DA 3CDWA 5C5JA 1RU1A 1U48A 5JXSA 1RWOB 3PX0A 1H6KX 3IM8A 3U1NA 1MWZA 2MQNA 1KC8T 5EHHA 2UXBJ 2HYIB 2WB4A 1R8HA 3C66A 1NDPA 2WB1D 3TQEA 3TW0A 4OZNA 2DR8A 3O5TB 4KHRA 5KG2A 2XO7A 5LL6d 2YKQA 4QJVA 1AYEA 5SUHA 2W7PA 3H90A 2L48A 1JJCB 1KR4A 4DCOB 1FNXH 1RT2B 2A2CA 4DG1A 2DHSA 1O5JA 2P5VA 1HBNB 5IV3A 4W92B 2CPXA 3FFIA 4O4GA 4MKAA 3HMJG 1S77D 2ZBIA 2FQQB 5B0AA 2DNNA 4D3GA 3NOGA 4LREA 4F8RA 2DH9A 3A4TA 5DG9A 2CQ1A 4LF7J 2FC8A 4OI1A 5J2NB 3OJUA 1FDNA 1IKXB 2BQRA 2YNGB 3TA0A 1W2IA 4TQRA 4MFBB 3EJMA 1VQSA 5DS7A 5GMKa 4DR6J 5H1SV 1MG7A 3NGSA 4K59A 2BA9A 4V19X 1RDRA 1TL5A 4WIIA 1TKXB 2B7BB 5KT4A 1JLAA 3TA2A 5D0GA 4QR0A 1H74A 4H4MA 1RTJA 4EBCA 4X4NA 1OS5A 3W5XA 1WELA 2EG1A 1N0VC 1WF1A 4OHYA 9ATCB 2IRYA 1H2UX 2L9NA 3M2RA 2C2ZB 4EUVA 2R3VA 2KM8C 3DLEA 2CPFA 2HQGA 5CD4H 2W2OP 2HRYA 3PFEA 2O1PA 2FUG9 4TYAA 2B51A 1CEZA 3G2XA 2EK6A 1E6YB 3KG4A 4ID8A 5HO4A 2F8HA 5E3CA 1VLYA 2VG5B 1LW2B 5DETA 4AL7A 1PBUA 3SDEA 1XNQJ 4CH7A 3L9ZA 2M4MA 2MMYA 1XWLA 4P2SA 3PTWA 1HQEB 3CJTA 4ZVTB 3NNHA 4LIWA 1Y5IB 4NLDA 2V2QA 2H4YB 3HVRA 2QA1A 2C2NA 3DRSB 3NCRA 1ZS6A 2XGQA 2YBVA 2MEWA 4OI3A 4X4QA 1JLFB 1RB0A 4IOCQ 2FJXA 4CM0A 4ETXA 1D9DA 1WHYA 3CIZA 2J6UA 4N8OA 4Y3CA 2HS4A 1YBUA 3MI7X 4CRJA 2J7WA 3VAKA 2HWTA 2PO4A 1LK5A 2JDJA 2M5YA 2V69A 1TV6A 3QZ7A 1O51A 3HHLD 3RBZA 1BQNA 4XIUA 2F4VF 3GMGA 4C8NA 4OZJA 1KEKA 1VJWA 4CZCA 1BGXT 1UA0A 1DRZA 4PWDA 2AWZA 1FJGJ 4I7FA 1FJEB 1IUJA 1N5YA 1TTHB 4I1TA 4JV0A 3I32A 1N5QA 3OL8A 1KLNA 1K0TA 3G4SS 3BDPA 1X9SA 3K17A 2LLZA 3PO4A 2LDYA 1JJ2R 3OHBA 1OIAA 4YB1P 2ZD1B 1Q4RA 1RT7B 2PEHA 3W63A 4IOBA 5D78A 4K4ZA 1NSQA 2DNLA 3N9UC 2RQMA 2IRUA 1TKZB 4Y2CA 3C6TA 3MUVP 1KTQA 4EZ9A 2MSSA 5DLGA 1MWQA 2H4WB 1MN9A 4WFZA 4USKA 1OSDA 3S1TA 4DR2F 4NXNJ 3DOMA 5BYQA 3OV7A 3W62A 2Z2MA 1EARA 1FRHA 5IM0B 3PM9A 3CO0P 4U9RA 4DV3J 3H5XA 4QU7A 5L9NA 3KKFA 3RBEA 3B6BA 1F5BA 5LMUF 1TFWA 1HNXJ 2IA6A 3H59A 4NI2A 5A8RA 1JKHA 2J8SA 2V94A 2Y8WA 5KOWA 3RB3A 4MIAA 1RU2A 3KOAA 2DR9A 4CYUA 2C3UA 1GK8A 3ADAC 4PEOA 1HR0J 2RUSA 2XGPA 1QTMA 3EX7B 2D3UA 2E9ZA 3H2UB 4U7UD 2SXLA 1Q5VA 3WC0A 4DWIA 1HBUA 1FA0A 3NWRA 3IR5B 3KLFA 2N82B 1T9UA 4ZP7A 2LYVA 2V2ZA 3V4IB 1DZ5A 2HWIA 3FSIA 5HVFA 1KDNA 1UW4A 4X62F 2U2FA 2IDEA 4KAIA 5B08A 4IH6A 1EETB 4MYTA 1R0CB 3AXKA 3PRBA 1TKTB 1NO8A 1SJQA 3BPDA 5ETLA 5I42B 4CM2A 5A2QY 4F36A 3LA0A 5DJBA 2H5IB 1Y4ZB 1UZHA 3ILLA 1NCLA 1XMBA 4MTPA 3GV8B 3ETOA 4P52A 3HHDA 2VOOA 3UFCX 1HWJA 1HNVB 1P6TA 1GEHA 2BQUA 2CJYB 3H2VE 1YWXA 2DRAA 2POKA 3ENQA 3G71S 1BC6A 1OWXA 4ZPAA 3RB4A 2ZWOA 3HJFA 1SI9A 3PACA 4F2SA 1VHIA 3PRDA 3RGIA 2QL9B 2ZBCA 3BR9A 3HD2A 1UJ4A 2RF2A 3PR5B 4DV6J 5K9FA 4YR3A 1X5SA 2BBEA 3H42A 3D6FB 3DGVA 2FVRA 4USUA 2AYGA 1VBZA 4GKKJ 3V6JA 2BJEA 3JQKA 4L75A 2GGPB 1WACA 4U8YA 2V68A 3E01B 1VOMA 3FCHA 2MKHA 3RRGA 2CQPA 2E7XA 3RB0A 1PILA 3BO2A 4X2BA 1YITS 2H5JB 3CCRS 2MTLA 3H25A 3QSYB 5EGYA 1SB6A 2KU7A 2DBBA 3SCLE 3Q8QB 2AEJA 3N5FA 2AKWB 3E8OA 1EP4B 1SUQA 2OFHX 2HW3A 3PEJA 5GVQA 1ZA2B 4NZ0A 4CH1A 3UDVA 1K44A 5CHCB 2KVIA 2FZCB 6AT1B 2ROGA 2R7UA 2OPQA 3VVUA 4DPTA 2HQCA 3Q83A 3QLHB 3HKWA 4OI2A 4NX9A 2Y0SD 1AZSA 1V6HA 2UUCF 1VC6A 1UWAA 1UFLA 3MM9A 2E66A 2PMZD 2GNKA 4N76A 2RRAA 3GR0A 1NSAA 3EZUA 4CDIA 5ADZA 2OH2A 4NLVA 1X4CA 2X1AA 1HMVB 2IVFB 3KLGA 1N34F 4Z37A 5D0EA 3L09A 3GZ7A 1P27B 1KLMA 3PRVA 1H72C 3OVAA 4PZVA 4XPCA 5E33A 2J6TA 4HHUA 2LQJA 5HBMA 2IY5B 4IDKA 3M8PA 3UNGC 4K4VA 1LV5A 2QTWA 2VFSA 3C14B 3RB6A 3MTKA 2ASDA 3ENVA 1KHWA 4F4WA 3V2UC 2XSJA 3D1HA 4KIAA 3T1HJ 2HAFA 1ZPWX 3GYXB 5D4OA 1CVJA 4DCPB 3NRBA 2D41A 4OZLA 2R8JA 4NLSA 2V4RA 1UMJA 2R7SA 4UT4A 4IO9Q 4PXEA 3L7OA 2IM0A 2D69A 2E1AA 1YZ6A 2RRNA 3GIRA 3MM8B 4R25A 2OPSA 5SZTA 5E3QA 1FNMA 3SSQA 3AB2B 2R9LA 5HMYA 2V2KA 2V34A 1RYRA 1X4BA 4OLOA 4USHA 4WYWA 1EKRA 4TYBA 2FVQA 2XLJA 4L3KA 4OX6A 2ZZTA 3OFHA 1Q8BA 1H38A 4LFBF 2CZ4A 4ZCMA 3HZEA 2LVWA 2CJQA 1CC8A 4B3SJ 2J8AA 1YGYA 4KGXB 3Q86A 2CNNB 1L3TA 3X1LB 2EK1A 5GAEU 2CJKA 4LF5F 2HHTA 2CIMA 1S99A 3G86A 1JXVA 5AXKA 4DOZA 2HFOA 2PN6A 4LIRA 4OHZA 3BKUA 5J2MB 4DFMA 3FEZA 4NOHA 4FZVA 1RHMB 1TQLA 1UKUA 4ZN3A 2Q3PA 2RDJA 1WOSA 1QY7A 3JS9A 1HWUA 2H9ZA 4IFYA 3BS9A 5D8HB 4K4YA 4OMFG 4ED2A 5GMEA 4A8OA 4FF1A 5L1IA 1S97A 4Y28C 4JI1J 2YKNA 3K5PA 2HFSA 3K7RA 2I5JB 3D1QA 5KFTA 2DCUB 3PNIA 3AODA 4PUOA 3J80Y 4K0KJ 2CWKA 4DF8A 2C28A 2AGQA 2RDIA 4A8SA 1IXKA 3IRWP 2DNMA 2R7XA 1XK8A 2ADCA 5HK4A 3K8WA 4FYWB 3HK2A 3G6YA 1S1UA 3UPFA 3DI6A 4WP8A 4F0MA 1SJRA 4DPXA 4U7CA 3LOUA 2EC2A 3W60A 1UJ6A 3KNAA 3HSGA 3HJVA 3DLKB 3EMTA 3KJVA 2WVFA 4OHVA 1BQMB 2DPIA 2MGZB 4RW9B 2K7JA 1TU0B 1MLAA 1WI6A 3MM5A 5K8MA 4HH0A 2D9OA 2Y1JA 1ZETA 5KFSA 1PJ6A 2BANB 3R27A 3PW2A 1LOUA 4EGLA 1YJ9S 1ZAVA 2PI5A 3BGOP 2LU1A 5ETVA 3M6UA 4XAKA 4X4UA 3Q8YA 1S1WA 4CO2A 4P2FA 5C25B 1YJTA 1EAYC 1RHJB 2QL7B 3NBPA 2ZUAA 2KT3A 1LK7A 3MECA 1NJXA 3ZZTA 2L3MA 2KH9A 1WOOA 1JNZB 4GMKA 2NREA 2AP6A 4FBTA 4ZVFA 3TZXA 4OHWA 4KV8A 2WK4A 3OTCA 4PYDA 3B4MA 4WPAA 4KGZB 4O3OA 2LQ9A 1O6XA 1LW0B 4F4KA 1HHSA 3JSBA 4N77A 1PG5B 1BD6A 2A10A 2HHVA 5KT3A 1RUSA 1HNIA 2VD3A 2BJ9A 2R8HA 3GFXA 3I4PA 4J90A 5GMDA 1OO0B 4DR4F 2FTRA 2C3YA 4DX7A 3QRRA 5T7LB 5HN0A 2FGOA 5KG5A 2DNYA 2DB1A 3OFEA 4LF6F 4RNOA 4ZCKA 4UOFA 4ILMA 3M9MB 4XPEA 3I6PA 3JYTB 5DM7Q 1VRTA 5K14B 2ZOFA 3SFUA 2H3EB 3PJXA 3CGIA 3M2VA 2KHCA 5DRKA 2W2QP 2I6WA 1WHWA 2HHHF 1Z2LA 2DHGA 4M5LA 5I3UB 3OJSA 2YWKA 4NLPA 1RXOB 4FN5A 4FDFA 1T3OA 1G1XA 2C2KB 3ITHB 5BR8F 4MKVA 4F3MA 2RB7A 1N5SA 4RPFA 2WONA 3F44A 4RW8A 4X64F 4MYUA 2NYIA 1K1QA 2EKYA 1OSCA 4PPZA 3IWNC 1NJZA 3A3PB 2J0QD 3VCDA 3M2UA 4IFVA 3DMJA 4IH7A 1CULB 1Q86T 3GIKA 4DPUA 4X4PA 4J9MA 3KDNA 3FRZA 5ETNA 4G6VB 3UWTA 3DYAB 2XY6A 2CPZA 5ETTA 3M32B 4CT8A 4PXDA 2A0FB 4KO0A 1FHTA 1D3WA 2AGPA 2CQ3A 2QJ3A 3VQSA 2GHVC 1S9GB 2EFPA 5LSLA 2CJBA 5KFVA 4U67Q 1FKOA 1RTZA 2HQFA 4BHQA 4GKJF 3BH6B 4IG3A 1D8ZA 2L08A 2F4VJ 1SC1B 4FYVB 2HWHA 2C22A 3QJJA 2YTCA 4DFPA 3HT3A 3W9HA 3SIPB 2QG9B 4C9DA 4TVAB 2ZDPA 2HBRB 3CULA 3L7PA 3TWZA 1X5TA 1SKWA 2DH8A 2OO4A 4TU7A 4DLEA 1S1TB 2FGCA 1DBDA 1UCNA 5F8NA 2FYXA 3MM6B 2F4FA 3KK1A 3CJ3A 4PQUB 1KFSA 2VJVA 2V9WA 1RSCA 3DDNA 4ED5A 4DV5F 4DR3F 3QRQA 5A8KA 1B70B 2OEKA 3HT0A 2HAIA 3FKBA 1YZ7A 4N41A 2X3DA 1UVMA 3PW5A 1TL3A 5C24A 2ALZA 3F0NA 1PSDA 4TXSA 2MKKA 1NJIT 1EB0A 4DR2J 3HP6A 4PABA 2G2ZA 1S0VA 4PAAA 1RWUA 3HHLB 2HRTA 5A76A 3DRPB 2YNHB 1Y3KA 3UD4P 1HPZB 2ZH8A 2KZZA 1RTHA 5LMUJ 3C3LA 4RUCA 1ACMB 3HO1A 4TU8A 1IKWB 3A1YG 5EDWA 3UQSA 1Y11A 4LR9A 3US5A 2DHHA 2MLXA 3JSMB 5KG7A 2GIFA 2ZBQA 4X4VA 1FD2A 2MQOA 3V6DA 2XI2A 3T5LA 2DNKA 2X1FA 1BXNA 1NH7A 4LSLA 2I38A 1JJ4A 2GHPA 5CZVA 5F9LA 5CA5A 2VODA 4CNZA 1NPKA 2WTFA 1U2RA 2VKRA 4OYBA 4CCHA 3PYEA 2ZH9A 1S6OA 4DX8H 4X62J 4U8VA 3HVTB 1X4GA 2XHWA 4B3OB 2LQ8A 4QCLA 1VQ6S 1D09B 4WKYA 1DQAA 4DQSA 2KYXA 2B5JA 3PV8A 2N7YA 4Q0BB 2DJWA 2W9CB 2ZC3A 3R5DA 3L3CA 2ZJPQ 3I96A 1NXIA 4RW6B 4DU7A 3TP2A 4ZVQB 3TAMA 1MU2A 3TOQA 3RR7A 4NE9C 3GONA 4YFUA 1GMWA 4NPOA 5U47A 2XZDB 1IKVA 4TY8A 2HIQA 1MNEA 3BJYA 2YNFA 1B7FA 1RHUB 1HARA 4J9RA 4RUAA 1Y10A 4UOCA 4Z2XA 2HBYB 4DG1B 2JNJA 3PX4A 2JC0A 2GFFA 1S7HA 2QEXS 3FFIB 3DLHA 5CYJA 2EW9A 4LVOP 4M5IA 1F0XA 1PC5A 4YDXA 3VAMA 2B9WA 3KYLA 2OEMA 4DZ6A 2M88A 1R3NA 4HDHA 5CYMA 3CJSA 4C0HA 2FC9A 2ZOGA 4NLYA 3HFVA 1LFPA 2IVMA 2CNKB 5IFMA 1D8YA 4X66F 4F4ZA 2XLKA 1Q8KA 2OD4A 2ZH6A 3FCWA 4DR7F 4AT1B 1RT1B 4H4MB 1YJRA 1RTJB 3JQMA 2XMKA 2MJUA 4JYAF 3GCXP 3VZIA 4ECXA 1VQLS 3MEGA 3LGMA 3THVA 2ZHBA 5DGBA 4DFKA 5A6WA 4DL0C 3M2RB 2KFYA 4A8MP 4P2MA 5L38A 3I55S 3EXCX 3OTEA 2JFDA 2UUCJ 1REVA 2AEMA 4ZIVA 2DKOB 2QA2A 3IP0A 2VHGA 3KK3A 1N34J 3MPYA 4NXMF 3TVZA 2KFNA 3TVKA 1FT8A 3PX6A 2YQ3A 2V8VA 3HPOA 5E3RA 1OY8A 2HGLA 1WHXA 3EM1A 4U96A 4RJVA 3RU0A 5KG0A 1H73A 3BPSP 2UXCF 2HSEB 4ZVUB 2V4QA 1NDKA 2NXUA 3A13A 2V4JA 3GIIA 3MPDA 1JLQA 2IM1A 1PJ5A 4DUZF 4K8RA 1GXLA 4W90B 2E44A 1TV6B 5B0FA 1BQNB 4NCGB 2YWWA 1Q79A 2MPUA 3QRPA 1F60B 1V9OA 3MZIA 3VAIA 4WF9Q 1QAXA 4NL5A 4PWDB 2RT3A 2HGNA 4DV0F 4RW4A 3ISND 3OR1A 3GILA 2M2BA 3IMQJ 5IC4B 2P9CA 4EU0A 3UCGA 1XQIA 1IVZA 2PA3A 4LSZB 3M6WA 2VZ9A 3EDRB 4FYYB 5IC6B 7AT1B 2N4CA 4KC5A 2YY3A 2VFRA 3TARA 4LQ3A 3BBCA 2IC3B 3AOCA 1WC3A 3W2VA 2YH1A 3MR2A 5HQLA 3H5UA 3C6TB 4CIOA 4FNHA 1S4EA 1FX2A 3SEOA 1S0OA 2WSEC 4L6V3 3DOMB 3A8KA 2W25A 2GZOA 4NYOA 5KFDA 1YQHA 1KQKA 3W8GA 1U6BA 5L46A 2AW0A 4RNNA 4LF5J 1IQTA 1KQGB 1RZMA 3B54A 2BJ7A 2K1RA 1K47A 2AYBA 4W4MA 5H9FJ 4AUKA 4MH8A 4IRKA 2VBWA 4NI2B 2HLUA 2BZ2A 2Z2LA 5A8RB 2OP5A 3MPUB 4EMDA 1ZTWA 4NLXA 4CYUB 4K50A 2VDIA 1FWKA 2IIHA 3ZXWA 4I4BA 4ZVHA 4KY3A 5LSRA 4B9NA 2WZ1A 4A8YA 3LP1A 2QO3A 2DHAA 1UPPA 4I68A 4I69A 2CQ2A 3BSNA 1LEOA 2MLYA 5FDLA 3D3CJ 3HKZD 2FJBB 4EI2A 3SYZA 2IM2A 3KLFB 4DR5F 2IPOB 3I5BA 1GFWB 3LP0B 4ZPTR 2XEXA 1SQEA 2MLZA 2E7WA 1JJHA 2KT2A 1CQNA 5D4PA 1L5UA 1ICEB 2YWEA 2BJDA 4PXBA 3GWCA 2RQ4A 1YRTA 1U2CA 3R1LA 1IM4A 1BWEA 4UW2A 2AF6A 3MFIA 3D6HB 1SIZA 3IS9B 4DV2F 3Q23A 5AT1B 4I2PA 3SI8A 3KJFB 3S6EA 2XC9A 1QE1A 4C8ZA 4JOUA 2JWNA 2B8PA 1G6BA 3OXGA 1DQ8A 1AA1B 3VV2B 2DCLA 3VAHA 3PIPQ 4DV4F 3R5BA 3NGKA 4C8KA 1LWEA 2W01A 1LWCA 3PYGA 3KMSA 1B4SA 2RHQB 4CH0S 2RF2B 4FKYA 3SQOP 2QYGA 3MMBA 1W7WA 2ZM6F 4LBIA 6FDRA 1MMNA 3R5AA 3ZZYA 3KLEB 5DM6Q 3C19A 2J0WA 2HZCA 2M9KA 1UP1A 2CJXB 4DQRA 4ZPDA 2X7IA 4ELUA 2YQ0A 1R89A 2AZ1A 2C3PA 3VWSA 2V2VA 2GC8A 4LRDA 2RMLA 3RRKA 5CH7B 3UR0A 3Q89A 3I5AA 2I9SA 2GA7A 3RBDA 3KNGA 2V6AA 4IUFA 5C2CA 1WC1A 1EJ7L 3DNCA 1YHQS 2BVZA 2ZOMA 1FKPB 2W4PA 4QYZK 4DL4A 1SUQB 2O67A 4I6AA 2CDQA 1Q8IA 3AOBA 1I3OB 1BLUA 4ED8A 1B0VA 4ILLA 4WTOB 1UAWA 2OPQB 2EPIA 1GT8A 3FSYA 1YRXA 5E0OA 2HFVA 1V3ZA 2MKJA 1AZSB 4J37A 3W3SA 4LF6J 5KG3A 4IQMA 2VKZG 3TEGA 1C1CA 4YOEA 3EGNA 2WW8A 3BQ0A 1SH2A 3OSNA 4PYAA 3G82A 1GTEA 5BJRA 2VG7A 2VPYB 2NPIA 2E7VA 4UZCA 3M30A 1NK6A 2HHHJ 1KLMB 3MM7A 4DBQA 1YK9A 2NCKL 4WFNQ 2XMVA 4IRCA 4IDKB 4F04B 1B64A 3DRRA 3M8PB 2RILA 1SKRA 3HX9A 2KYZA 5A6PA 4RW7A 2UV8A 3M6XA 4EBEA 5BR8J 3TEHB 4BWMA 4C3MA 5HLFA 2XSJB 1FE4A 3KWMA 2HNYA 2DGWA 4X64J 1AXQA 2OLWA 2BDPA 2R42A 3R6GB 2EFOA 5MLCV 1P1LA 4WE1B 2ILYA 2KB2A 1N8RT 1FD8A 2RE1A 1C2PA 3V5RA 3ZTPA 2XB2D 4PG4A 1U2FA 3D54A 1LFWA 1FJCA 2W2PP 2KTQA 4ZMMA 2OPSB 4C98A 3FEXB 1F9FA 4C8YA 3N0VA 1IR2A 1NK5A 1F1BB 1UTAA 5M2UA 1HQUB 4LJMA 3QWPA 2MKCA 5FIIA 1YBTA 3NAIA 1OYEA 2PT0A 2J9DA 3DN9A 3GV5B 1VQMS 5LSOA 1A0OB 3ZTRA 4GKJJ 3ETMA 5HI7A 1YSJA 2QN6B 1EHWA 1X4DA 3L95X 1KD1T 3DKDA 2VL1A 1VISA 2ASJA 5LMNF 3M1VA 4OZ3A 2D1CA 1VQ9S 3U02A 1VIOA 4OJHA 4IG0A 5KFIA 4JV1A 3EVOA 2CUYA 1WI8A 2EWHA 4CLTA 4YHHJ 4M95A 5HL7Q 4KKOA 2N3OA 3EICA 4DV5J 4DR3J 4E0DA 4ANDA 1U1QA 2I0XA 1CJTB 4OQJA 1RAOA 4F7VA 1S1XA 4JI2F 4E98A 1PYOB 5CCMA 1EIYB 2PI4A 4QOTA 4IFYB 1U0HB 4ICLA 1PKUA 5IZHA 2D3OR 2CNLB 4M5KA 1PCAA 3UCZP 4PG7A 4CO4A 3DDKA 4FNIA 2MKIA 2Z56B 2Z30B 2YKNB 1F9EB 4QBUA 7FD1A 3RW7A 3MFHA 2JJ4D 4K5RA 3LP2A 4DSJA 2MZRA 4E8UA 4DEZA 2ZH1A 4PUOB 5CZXA 3OR2A 3IWXA 3R7BB 2MXYA 5K8OA 1WG5A 2FHJD 1UVLA 1TL4A 1A9NB 3H7HB 3TUJC 1HFEL 3GFHA 1X4AA 4ZPCA 3MOZA 4NMLA 3M4XA 3MR6A 2HS0A 1RBLA 4RU9A 4AL5A 5IQQA 1LXJA 2QLFB 3I9V9 4FPRA 2FVCA 3CCQS 1S1UB 1C0TA 2DPJA 2MHEA 2U1AA 1CJUB 3E51A 1FK9B 5F8JA 5EUHA 3NXZA 3HHLC 3CCZA 3CCUS 3KJVB 3LAKA 3SQGA 3X3UA 1KVJA 4EZ6A 1FX4A 2JH3A 3MM5B 1BWVA 4PQAA 5F9NA 3MMCB 1DTTB 4KH1B 3CPWR 5L1JA 4X65F 3Q22A 1UL3A 2MQLA 1RA7A 2QFIA 4GVBA 1G7CB 3RAMA 2QSWA 1M90T 2W9BA 4HKQA 2MZSA 4OIXA 1HI0P 1RBOB 2ZVIA 3OL7A 3TUZC 2CPDA 4DV7F 3KFWX 1S1WB 4FXVA 4ZPWR 4DUTA 4RWXA 4J9OA 1IKYA 2DRDA 2AJQA 3TX0A 3NBPB 3MECB 1LNQA 2ROEA 5BXIA 4C48A 1T03A 2KG0A 4OFZA 4KV8B 1Y5NB 1S6PA 2HLTA 1UFKA 1Q81T 2A6MA 4OYWA 4JI7F 4Q2MA 1AUSL 5KFPA 4M8LA 4YN3B 1GXTA 1SJ4P 4ZP9A 3A12A 2HIYA 5ETQA 3GG1A 3ZTSA 3KLVA 1KTVA 3T3FA 2X51A 3FDSA 3PY8A 1HNIB 3FMWA 3K5OA 2Z0GA 2QMUB 2DHXA 3CC7S 2W4DA 1R8PA 3CDBA 2DIUA 1ZM4A 4C8OA 4DS4A 3BN7A 1XR5A 3TX8A 4X66J 2R2UA 2GJ2A 2PDAA 2YQ1A 4LFAF 2R8KA 3RBXA 1GMUA 2F65A 1VBKA 3QIDA 3U1LA 4N56A 4TNOA 3KLIB 2P6SA 4DR7J 3EE3A 1F5AA 1VRTB 2OTLS 2KXFA 2NLWA 4JYAJ 5AE2A 3QGGA 1K1SA 4ZDNA 3JAMY 1CJKB 3AD9C 1N5TA 4WZMA 3Q8RB 5KT6A 5J2NA 1T9WA 1IKXA 2WOMA 4LF1A 1YBAA 2XULA 4DUYF 1NK9A 3VR1A 5J1NA 4ED7A 3PYFA 1OPIA 2UVRA 3KK2B 4B9UA 5HMZA 1OQ3A 4FBUA 1NU4A 2WONB 3HM9A 4LSNA 3LAMA 2VB6A 4HH1A 2FHKA 2W2NP 4NXMJ 3K8VA 2I2YA 3CCJS 1SKSA 5DZ7A 5KFEA 3LANA 3M2UB 2JC1A 4IFVB 5E3PA 4HL9A 2H48B 3G6VA 3SV3A 3OL6A 3B8HA 4K5SA 1VQKS 3CJ2A 2XZTB 1Q82T 1T9TA 4I2QA 2BW7A 3RZAA 4ZVSB 2UXCJ 3UI3A 3T41A 3BN4A 4KR0B 1W2BR 3PVXA 3R5GA 4DFJA 4ETZA 4UZBA 3FBEA 2W2MP 4KO0B 3TJ8A 1TUGB 3CD7A 2BOPA 4F25A 1E6YA 2K8GA 4RKUC 4DUZJ 4EK2A 5LXRA 4ZP8A 1FKOB 1V5IB 3ET6B 3NGRA 4IG3B 4ZHRA 1NK4A 3WIVA 2FJEB 5LOQA 1UETA 2CQIA 3Q2TC 1HQEA 3NCQA 1C0UA 2XMTA 4DL5A 2HQ3A 4DV0J 2FJWA 3DOKA 1WC5A 3K2YA 1HA1A 2K7KA 1JLFA 4ZJQA 5KFWA 4P10A 3MEDA 3KK1B 2DGTA 1S57A 4EBDA 3QFWA 2YNIB 4CT9A 1XMQF 1ZYQA 2Y9HA 3K57A 1RWPB 4WZQA 3KG0A 5A8KB 5D3GA 4DR1F 4NLUA 4Q8EA 2N3LA 3CJKB 1TL3B 4L73A 5C24B 3MDFA 2DR6A 5KG4A 3FUYA 4IQXA 1H98A 1FDBA 4W98A 3FBCA 3NG8A 1IM6A 2XZWA 1KBRA 4Q8FA 3AH6A 2E5GA 4NRUA 1Q53A 1I6JA 1YI2S 1SL1A 1F2GA 3OXLA 3GIMA 4M94A 3C15B 5C42B 3HHEA 3SCJE 1NK8A 2LXUA 3J7YI 3K5NA 4LT6A 2UUAF 1RT3A 4UUWA 1RKJA 2DISA 2HVEA 2R7OA 1TKZA 3GJSB 4M5HA 1AW0A 1XC9A 3U27A 5EWFA 5DDOC 2CDRB 4HVZA 3OD2A 2UUTA 4LSLB 2R7QA 3C2PA 2NZCA 1RACB 1TL7B 3PFOA 5IWAF 3LALA 1N52B 4P72A 4DR5J 1GX6A 1DTQA 3OHAA 3A8EA 5HVHA 4IH5A 2BE2B 4BDPA 1KHVA 2M8DB 1N88A 5KFXA 4UF4A 2V63A 4M5GA 2CXEA 1YJNS 1NSPA 3D7SB 2OELA 2PGCA 1RLDA 1MN7A 1U1LA 5DDRC 3CCVS 5HQMA 1RHRB 2DGSA 2WBRA 1APSA 2WHOA 3IR6B 4DV2J 5HSPA 5KOXA 2HHPA 2OGUA 2QE5A 2HS3A 3TAMB 1HLWA 1MU2B 4DV1F 1V5VA 3M7VA 4K2XA 3V4IA 2MDAA 4J9QA 1ELOA 3CCWA 1AFJA 1U24A 4ECVA 4ZJOA 2XS7A 1IKVB 1UA1A 1HI1A 3UVJB 3AOAA 2J0SD 1GNKA 4DV4J 3OUYB 2J9DE 4WJBA 4EO8A 2YNFB 2ABYA 3QMQA 2RU3A 1T95A 3DLGA 2Q66A 1WKJA 4RNHA 1EKSA 2XHCA 2APOA 3IG1B 1T9XA 2ZM6J 3OTOF 2UVUA 5JJBA 3CEDA 5CABA 1QUVA 2V5HG 2B9XA 1CJVA 3I0RA 1Q7LB 4OJGA 1JXLA 4KBIA 1S1VA 2VFVA 1HNVA 3MMAB 2UVVA 4DL7A 5CYMB 3WX8A 3MEEA 1U8SA 2NXJA 3QT6A 4O23A 3DRXA 3D68A 5BYSA 2C2DA 1N36F 2G9OA 1JLEB 2ASYA 2E5IA 3PKYA 5HMXA 5KFBA 3HZGA 4K7QA 1FE0A 4NEZA 1X7VA 3D3BJ 4CLPA 5AJ3F 2UZAA 5F8MA 3OT9A 3I0SA 4OYAA 2DNRA 3QO9B 1UVIA 3HCXA 2RNEA 2JEJA 1FRMA 3UE2A 4CQ1A 3MEGB 1HNWF 3ILOA 3MTJA 1UJ5A 4AD6A 3FZ2A 5JMNA 2KM8B 2GGPA 1B0PA 1M1HA 3OVBA 2KT5A 2AJFE 2F5GA 2L41A 4EEYA 5MAOA 1FESA 4P71A 5HMWA 1REVB 1VQ8S 4Q44A 2HQIA 2WVBA 4QIWD 2QFJA 3KK3B 4E2FB 3DHXA 3GJTB 3ZZPA 3M05A 3M8ZA 2PMHA 3GE9A 3VGUA 2B4VA 1TVRA 2KKHA 1RK8A 2IMOA 4USWA 2HG4A 1TP7A 3LH2S 1I51B 3RTVA 3N79A 2FLLA 3QFHA 1FKAF 1F3VA 3QLHA 3QATA 3P45B 1FXDA 1WEYA 2V4JB 4PWUA 2WSFC 2X1GA 2IRXA 2D9PA 8ATCB 2Z2ZA 1LWXA 1JLQB 4ZITA 2DTJA 3DCAA 1X0PA 4OZ0A 4IRDA 1EZZB 3TZZA 3D4JA 1XTZA 3NGUA 1N54B 1Y00A 2LP4A 3CDEA 1SH3A 4YP3A 1Q7YT 4K4WA 2ZE2A 3OR1B 4RW4B 1T94A 2MZQA 4O3PA 2C2EA 2XM3A 1LXNA 3P5TL 3RW6A 4NCBA 5A0YA 1NK7A 3QJLA 2LFVA 4C8MA 4DPOA 4USJC 3AJDA 4CLLA 5LMNJ 2DXEA 2K3IA 3EVMA 1HL6A 3M9NB 3POTA 4NCAA 1X4EA 2M0GB 3M8SA 4XDDA 2GQCA 3GG0A 3CD0A 4R8UA 3K58A 4HTIA 2AYEA 3P5BP 2C42A 4ECUA 4KRWA 2WVCA 2GMLA 3KHGA 4Y65A 4A8WA 2K1RB 3AJ2A 5EWGA 3IBCB 1NHKL 3C46A 1HW9A 3GFYA 4WXWA 2RD5C 4HHJA 4OZ2A 1MSWD 1AT1B 1S49A 4Y34A 4ZVEA 1B3TA 5DDQC 3NNCA 4JI2J 1U25A 3W5ZA 3LW5C 4ZS6A 1YKWA 1KKHA 4DI6A 3H4BA 4RU2A 1Q0NA 2B3TB 2ZBRA 3AD8C 3AAWB 3UD5A 1XR6A 2QT7A 3SFGA 2FPHX 1FWLA 4BC9A 2UVWA 1AUDA 1JK9B 2HVHA 1VR6A 2HBZB 4PRFA 1VK8A 4LRAA 3JTOA 1G3OA 2QV6A 1FRLA 3KG1A 3R8YA 1N56A 1RWWB 3BSAA 1WF2A 4KB7A 3CF5Q 3RG6A 4CWBA 1OY9A 4Y2MA 2DNZA 3A3OB 2F40A 2KL8A 2F8EX 4A8QA 4Y2IA 2XY7A 1YG0A 1Q16B 3BH7B 3NGTA 4ED3A 5LM7E 4ZOSA 1VS3A 4QWAA 3VVTA 1MROB 1QE1B 3BB5A 1TMMA 2AEFA 1T11A 2QA4G 3PHEA 4HI2A 4B17A 2P9GA 1MMDA 2E9RX 2YKOA 2CADA 1RE1B 1LWEB 4X65J 1C4CA 4CLWA 4C3LA 3ZTOA 3U1MA 5J2PB 2VA2A 4C2MA 2QLWA 1M5PC 4I6WA 3G6ES 3D0HE 4KFBA 1T9VA 3MMBB 3MURP 2A1BA 1JIHA 2XS5A 3B4DA 2BMBA 4XK8C 4DV7J 4MAKA 1K0VA 2MKYA 3QJPA 1T8EA 3BREA 3DLKA 3G6XA 3KLHB 3HXMA 5HQ8A 3CD5A 3OLAA 1F5CA 2BJ1A 2D7SA 1QTNB 1GXUA 2R7WA 3DFEA 1DLOA 4J9SA 4TLRA 5DDPC 1JX4A 3IM9A 4JI7J 3JSRA 4BS2A 4DL6A 3GCWP 1S6QB 2AGOA 2KG1A 3N6NA 4RBVA 2OEJA 3CC4S 2RU9A 3QGHA 3UDLA 4FP9A 1TAQA 3CXCR 2H51B 5I3QA 2VG6A 2FJVA 3HSJA 3K89A 4Y00A 3BGLA 2J5AA 2BE9B 2JEGA 4LFAJ 4CP5A 1RT5A 4J7CA 1C1CB 3C6UA 3MPVA 3VHQA 3NY0A 1FFGB 1QDUB 3HVWA 3G82B 3FZBA 2L9DA 1OY6A 2LA4A 1REGX 2VG7B 1FRKA 3SMZA 2QA4S 3M30B 2JFKA 5GADU 4NLQA 3MR5A 3MM7B 1LQ9A 2GO9A 5KFGA 4AE5A 2XO6A 2R7VA 2WAQD 1WWHA 3E3XA 5ETMA 3DRRB 2BX6A 1PIEA 2GVZA 4DUYJ 3UDEA 1PGZA 4O0IA 1N6QB 1KOHA 1XJWB 1A7GE 1SV5B 1ZAXA 1NJYA 4OYMA 5HLFB 2HNYB 3BYRA 3JYTA 2CZVC 2XCAA 2ZEJA 4KPYA 2MZJA 4N7TA 2RSQA 2G13A 1H0HB 3NOCA 4B9VA 1M5SA 4JI6F 3QQCD 2RKIA 3GQCA 1JLGA 1NKEA 2CA9A 1HWLA 2AV5A 2HMIA 4YS2A 3FBFA 4CO3A 1P1TA 2OPPB 4YR0A 1S7IA 3J81Y 2B7CB 3J81j 2VQEJ 3ZZZA 1EQMA 3JAMU 1N48A 2OUGA 2VFUA 1OQ6A 3AXMA 3FQLA 5LJ5Y 1HW8A 2ZH2A 1FTRA 4FXWA 2RS8A 5B0CA 3M8RA 4QR2A 3H2LA 3M1VB 3BSOA 1YJWS 2PEBA 1CULA 3WBZA 4NZ6A 4IG0B 2YWGA 1XR7A 1X4HA 3BR8A 3IA0A 3H8YA 2FJAB 4EYIB 2B9EA 5AXLA 2V0NA 3IRXA 4KKOB 4WFYA 1AFIA 3I82A 3OVSA 3AQPA 1XMQJ 1NDCA 1SJ3P 1UEVA 4DR1J 2E5LF 2DNOA 4PCQA 1IR1A 3RR8A 2CKWA 1SQFA 5GADI 2YXLA 3UD3P 4OI0A 2CRLA 3GJRB 1ZZNA 2HVDA 3CCSS 1SCJB 3TRGA 3IFEA 3RJMB 1X4FA 4ZKAA 3H0PA 4HT7A 3D6TB 4ICLB 4DLGA 1RISA 3PO5A 2V9KA 3TUIC 4RX6A 3CCTA 5HANA 4ECZA 1QVGR 4LR7A 1RABB 4LRBA 2Z4PA 3AFGA 2XWYA 3R1HA 5JVGQ 2N7CA 4TY9A 3TUPA 4USTA 1MWYA 2UUAJ 2DGQA 4ECTA 2W9AA 4CO5A 2OPRA 2KI2A 4ZVPB 1JNRB 5DG8A 1HBMA 8AT1B 3IAS9 3CWJA 2YX1A 2G1DA 1C0TB 4B3TF 3WDOA 2IVYA 1QJHA 2FD2A 5IWAJ 4B9SA 4XDCA 5KFJA 4RR5A 1C4AA 2GCFA 1RTDA 3HHLA 2YNHA 1RWVB 1HPZA 3GSIA 2GQ2A 5KAKA 3O44A 4DXLA 4JB8B 2AMCB 3OQ2A 2MJNA 4OJ1A 1FVQA 3ISNC 1UWBA 2IYIA 4BBYA 3FK4A 3JSMA 3CDAA 3THTA 1IQZA 2J0XA 1VK3A 4GVBB 4TLQA 3NCPA 3H40A 4LMZA 2W9BB 2QMXA 2DGUA 2DH7A 4DV1J 2MY8A 1IBLF 3VAFA 1JLBA 3LTOA 4RUHA 1T0TV 2C1EB 1IKYB 3T6JA 4RBTA 2ZNZA 2OSRA 1LWFA 5EX0A 2E5HA 1ZZFA 2CPJA 3GJQB 1BHNA 1FEHA 5D6GA 2ZH3A 2GJIA 2VF3A 1V3SA 4YQWA 2HFUA 1FEEA 3CJRA 2Y8YA 2QGFB 2FLPA 4N8NA 1NM2A 3NMRA 5B7WA 2DY9A 5CYQA 4J5OA 3ENAA 4FVCA 3OTOJ 5CD4A 2EFQA 4GVLA 4HYKA 4HDGA 3AT1B 1SPBP 3CC2S 1YJ7A 1X5OA 3HFKA 3PEHA 4CNYA 2DIVA 3ULHA 4KGKA 4QZVB 1RAJA 4CI0B 3N01A 1N36J 3CJ4A 1RP5A 2CVIA 2PIIA 5GAHI 1KFDA 3P3DA 3BV8A 4ZVRB 3B82A 3IWLA 1X9WA 5AJ3J 4KSEB 3OXFA 1M5KC 4YY3F 3AQOA 3MPWA 4UQTA 4P9SA 2W24A 2EEYA 1RWXB 4ZPVR 1NAQA 4WBFA 2BUNA 3QNWB 1S10A 1HNWJ 3V4MA 1VDHA 4QW9A 2B4PA 2COLA 2J9EA 3G87A 3W2WA 3DC2A 5KFMA 2WOMB 4ES1A 1NH8A 4RUBA 1DHMA 4P75A 4CO1A 1ITPA 4B9TA 5DG7A 4I6YA 2F3JA 1FWPA 2LXFA 4KT0C 4LSNB 1YRUA 2K2PA 3SSRA 3CMQA 4NMXA 1RT1A 3ZZOA 2XMMA 2LEAA 1RI7A 2W1BA 1LKZA 2FHOB 2RUGA 2ZZNA 5H9FK 4U6PA 2EBEA 1L3UA 1RCXB
chains in the Genus database with same CATH topology
4F4WA 3V2UC 1OPZA 2DT9A 2FIUA 2XSJA 2YKPA 3D1HA 4KIAA 1T7PA 3CCZA 5I42A 1NKBA 3CCUS 3G8SA 2KRRA 3LAKA 3KJVB 2DR7A 3SQGA 3X3UA 1ZPWX 1KVJA 3RAQA 3GYXB 5D4OA 4YHHF 4EZ6A 1CVJA 2F8MA 4I2QB 3NRBA 1CLFA 4PXCA 2D41A 2JH3A 3CJ5A 3MM5B 4OZLA 1JLCA 1TKDA 1QSSA 2R8JA 4PQAA 3MGJA 4NLSA 5F9NA 3VQTA 2EFGA 3MMCB 1DTTB 4JUZA 2V4RA 4JI5F 1UMJA 3FGVA 2R7SA 3D1OA 1NHUA 3CPWR 4PXEA 4IO9Q 3AY0A 3L7OA 5DGAA 1KONA 5L1JA 2IM0A 2O3DA 2RH3A 2E1AA 3BSCA 4X65F 3KTQA 3Q22A 3FRYA 2RS2A 1D9FA 2RRNA 1UL3A 2MQLA 1RA7A 4OL8A 2GO8A 4B02A 3J7ZT 4JBCA 4QIFA 3DOLA 3MM8B 2F9DA 1G7CB 2LEPA 1FRJA 4R25A 2OPSA 3RAMA 2QSWA 2MQMA 4FS1A 2CQ0A 4DSKA 2VONA 2UXBF 2W8LA 3B78A 5SZTA 5L9XA 1M90T 5L8RC 2R7TA 5E3QA 2W9BA 4YB5A 4HKQA 2MZSA 4OIXA 1HI0P 1FNMA 4ZHRB 3SSQA 4ES3A 1BY9A 4ID5A 1RT4B 3AB2B 4U7UK 3OL7A 3TUZC 2R9LA 5HMYA 2V2KA 2CPDA 4DV7F 2NUHA 2OIHA 2F1FA 2D3ZA 3KFWX 1S1WB 4FXVA 4MKBA 5D4LA 4ZPWR 4RWXA 1RYRA 1X4BA 4OLOA 4NA2A 1IKYA 4USHA 4J9OA 1K9MT 2HHUA 1C0UB 4WYWA 5A8WB 2AJQA 1QAYA 2BM1A 3PIOQ 4TYBA 2FVSA 2QLXA 4TU9A 2FVQA 2QMWA 4J9PA 2XLJA 2DVIA 3I31A 5L1KA 3DOKB 3NBPB 4Y2AA 3MUTP 4OX6A 3G8TA 3OFHA 1Q8BA 1H38A 4LFBF 3MECB 5J1EA 2CZ4A 4ZCMA 2ROEA 3HZEA 2LVWA 2CJQA 1CC8A 3MEDB 3NNAA 1MMLA 2J8AA 1T03A 1YGYA 2HFNA 3ENWA 1MROA 3M8QB 3AHPA 4NLOA 2KG0A 4O3RA 1M1KT 4OFZA 4KV8B 1FNOA 3VAJA 4QPTA 1SJ1A 1Y5NB 4ED0A 1S6PA 5D3GB 1L3TA 4LF7F 3X1LB 2HLTA 2V8GA 4R5PB 1ZM3A 2EK1A 1Q81T 3WZ0A 1WEXA 2LQ5A 4Y2KA 3ZFVA 3E01A 4PPDA 4ATNA 4C11B 4UY85 5GAEU 4JI7F 2AJ4A 4Q2MA 2CJKA 5KFPA 4M8LA 4LF5F 3ONQA 2HHTA 4NCGA 1GXTA 4DR6F 1SJ4P 1NZAA 2M52A 4NYZA 4ZP9A 4K4UA 2CIMA 2CYYA 1Y0HA 3GG1A 1S99A 3G86A 3KLVA 4ITSA 1KTVA 3T3FA 1S0NA 2X51A 5AXKA 1SL2A 4DOZA 3FDSA 2HFOA 2PN6A 4LIRA 3PY8A 4OHZA 5J2PA 1HNIB 3FMWA 4OX7A 2FHJA 5J2MB 3K5OA 2Z0GA 2DHXA 1L3SA 2QRRA 1U6FA 3CC7S 2W4DA 1R8PA 1J2VA 4DFMA 3CDBA 2JX2A 3FEZA 2DIUA 1ZM4A 4FZVA 4NOHA 4WYLA 4FF2A 4C8OA 5G4DA 4DS4A 3BN7A 1TQLA 1UKUA 2Q3PA 2KXNB 2RDJA 1XR5A 1EP4A 4R0EA 3TX8A 2R2UA 1QY7A 3FEYB 2GJ2A 1HWUA 3EXYA 2H9ZA 1WD6A 2PDAA 4HT5A 4IFYA 2ROPA 4LFAF 2R8KA 3BS9A 3QIDA 3U1LA 4N56A 4CTAA 4OMFG 3GIJA 4K4YA 4TNOA 4ED2A 5D8HB 3KLIB 1ROFA 2P6SA 4A8OA 4FF1A 4PG8A 5L1IA 3KLHA 1S97A 2OJ3A 1F5AA 4DSEA 4O3SA 3NMAA 1RT3B 1VRTB 5KG1A 2CPIA 2IC3A 1T05B 3MAQA 1M5OC 4Y28C 2YKNA 2FHMA 2OTLS 1R8AA 3NAHA 5AXNA 2KXFA 2NLWA 5AE2A 3K5PA 3K7RA 4O44A 2I5JB 3D1QA 3QGGA 5KFTA 3DLLQ 1YJUA 2DCUB 4JI0F 3UCUP 3PNIA 1K1SA 3QPIA 4PUOA 3TYTA 1H7WA 4ZDNA 3JAMY 3J80Y 4IKAA 3V81B 1N5TA 4DF8A 3HHNB 4WZMA 3Q8RB 1XBWA 2C28A 5KT6A 3I87A 3JTNA 3KMQA 4M5DA 5J2NA 2VPZB 2AGQA 2RDIA 1HMVA 1R0AB 1IKXA 1D0EA 3MEKA 4O3NA 2WOMA 4A8SA 5FLXY 1YBAA 4NLRA 4DDFA 2XULA 1IXKA 4DUYF 1XNQF 3IRWP 2B43A 1NK9A 2BXJA 3VR1A 4LQ9A 2DNMA 5J1NA 3HVAA 5KT5A 4ED7A 5CXTA 1OPIA 1XEZA 2IFXA 1S6QA 2UVRA 3BQ1A 3CUNA 1TZ0A 2J7UA 3G8QA 2R7XA 1XK8A 3KK2B 4B9UA 2ADCA 1RT6A 1U47A 1DTQB 4YB7A 1VMBA 5HMZA 3K8WA 1JB0C 1OQ3A 2LDIA 1GAOA 4K4SA 2GW8A 4FBUA 1NU4A 2WONB 3HK2A 3G6YA 1GQEA 3HM9A 4LSNA 3UR3C 2R4FA 4EFAC 1S1UA 2QYCA 3LAMA 2VB6A 3UPFA 1U45A 1URNA 3DI6A 4HH1A 2FHKA 2VQFF 3CJ0A 4CO0A 3K8VA 2I2YA 4ILRA 3E2EA 4WK1A 3CCJS 1SJRA 1SKSA 5G0RA 4U7CA 1NEEA 3LOUA 5KFEA 3LANA 4UUXA 3M2UB 2JC1A 4IFVB 4DF4A 4X4OA 5E3PA 1UJ6A 4HL9A 3KNAA 3DLKB 1HBOB 3G6VA 3CDUA 3OL6A 3SV3A 3B8HA 3T5JA 2F9JA 3KJVA 1U49A 4ZP6A 4LF9F 4OHVA 1BQMB 4K5SA 1VQKS 2DPIA 2QSFA 3CJ2A 4B9LA 2MGZB 3HLUA 2K7JA 4RW9B 3W2VB 1Q82T 4I2QA 3N28A 1WI6A 4H4OB 4X4RA 3MM5A 1X5PA 3RZAA 4YMEA 3D28A 5K8MA 3UI3A 3BN4A 4HH0A 4KR0B 5KT7A 4UQGA 4O4GB 4LVNP 3OFGA 2YVSA 1W2BR 2D9OA 2PE8A 2Y1JA 3PVXA 3P49B 1RGVA 4OLPA 1TK8A 1N5VA 1ZETA 4DFJA 5KFSA 1D1UA 1UVNA 4MK9A 4ETZA 2HHSA 2FB0A 4KO0B 1RJJA 2VOPA 3AJ1A 2BANB 3LP0A 3MM8A 2CQBA 3CD7A 2BOPA 4F25A 1E6YA 2K8GA 4RKUC 3R27A 3IXQA 3F56A 1FJGF 5LXRA 1HWKA 4ZP8A 3PW2A 1LOUA 4EGLA 4V19J 4D3HA 5KFOA 1YJ9S 1FKOB 1ZAVA 3S8SA 2PI5A 2LU1A 2ILZA 4IG3B 3K0JA 4ZHRA 1NK4A 3M6UA 1NK0A 1N6QA 1RT4A 2FJEB 3QGPA 4XAKA 3G9CA 4X4UA 4X84A 3EGZA 1UETA 1S1WA 1WHVA 3PDNA 2CQIA 1SV5A 3Q2TC 4CO2A 1HQEA 3NCQA 1C0UA 4MK8A 2XMTA 1N4LA 5A8WA 3I4HX 1JLAB 5C25B 1YJTA 1ZTTA 4OZ1A 2FJDB 3DLGB 2Q79A 2HQ3A 4DL5A 1WG1A 2B4OA 2FJWA 2VBZA 3CCMS 3DOKA 3NBPA 5F3ZA 4RWWA 2KT3A 3K2YA 4QWEA 1HA1A 1LK7A 3MECA 3IS9A 1NJXA 2BACA 2K7KA 1JLFA 1HHTP 3ZZTA 2L3MA 5KFWA 3MEDA 2KH9A 3KK1B 4F2RA 2DGTA 2Q43A 1JNZB 1NKCA 4GMKA 4M1KA 4EBDA 2JEFA 2NREA 2YNIB 2Q6BA 4CT9A 4B3MF 2GIRA 4YR2A 2AP6A 1XMQF 1ZYQA 1TFYA 4IR9A 4ZVFA 4FBTA 4OHWA 2UUBF 3K57A 4F26A 3I0RB 4KV8A 5KFHA 4WZQA 3KG0A 3LP1B 5A8KB 2WK4A 4NXNF 4DR1F 4NLUA 1S1VB 5D3GA 3Q8PB 3OTCA 4Q8EA 3MMJA 4R5PA 1XERA 3HI9A 3B4MA 2DO0A 5THWA 4K4TA 2N3LA 3BQ2A 4C11A 5FDLB 4O3OA 2LQ9A 3DLEB 1LW0B 2JHEA 4HEA9 2OPPA 4F4KA 3MEEB 1HHSA 2W7OA 3CJKB 1TL3B 5C24B 3JSBA 3MDFA 2LXIA 4N77A 5JVHQ 3GR1A 2ZNYA 4DQQA 4DV3F 1BD6A 3RYLA 5KG4A 4RLEA 3F41A 4IQXA 2A10A 4WCEQ 1X9MA 2HHVA 2FDNA 5KT3A 1AROP 1H98A 1HNIA 1FDBA 2VD3A 5J2MA 2OFGX 3NG8A 1HNXF 2R8HA 1QUPA 3GFXA 3SDEB 2XLIA 4DJBA 4FF3A 2XZWA 3I4PA 4Q8FA 1ZAWA 2ZITA 2RIJA 1OO0B 2ZHAA 3T6BA 2FTRA 3AH6A 4DR4F 2E5GA 4NRUA 4OI4A 1Q53A 1I6JA 2C3YA 3CO9A 4F3QA 3IN5A 5T7LB 1YI2S 5HN0A 1SL1A 3OXLA 3I0SB 3JTPA 1F2GA 4ECWA 2FGOA 5KG5A 3GIMA 2DNYA 3CD6S 2DB1A 1HR0F 3OFEA 2ZUGA 2ZJQQ 4LF6F 2ZVSA 4RNOA 4ZCKA 3PW4A 4M94A 1Q8LA 2CVEA 5C42B 4ILMA 3KLEA 2YWFA 3CT9A 3M9MB 1U6ZA 3HHEA 3SCJE 2NSCA 1NK8A 2LXUA 3J7YI 4XPEA 3K5NA 2ATLA 5IT9Y 4LT6A 3I6PA 3JYTB 2UUAF 5DM7Q 2OKQA 1RT3A 1VRTA 5K14B 1N33F 1FTCA 2E5JA 4UUWA 3ZZ0A 1X0FA 2GHWA 2ZOFA 3WC2A 1RKJA 1SBRA 3SFUA 2DISA 2YWHA 3PJXA 4I2PB 3CGIA 1FRIA 2R7OA 5F8HA 1TKZA 3M2VA 2KHCA 2BABA 2PA8D 4ED1A 4KHPF 1SJFA 5DRKA 3DXSX 2I5JA 3PR4A 3SSSA 1AW0A 1XC9A 4I56A 1WHWA 3U27A 2JOQA 5EWFA 4RNMA 2HHHF 2ACYA 4F4XA 1Z2LA 5DDOC 4HVZA 2DHGA 1XMOF 4RNFA 3MD1A 2UUTA 4GO7X 1V3RA 3W7BA 3GFZA 2DR5A 5I3UB 3OJSA 4LSLB 2R7QA 1KNZA 1R0AA 1U1KA 3C2PA 2YWKA 4NLPA 4B08A 4FN5A 4IYQA 1T3OA 3PFOA 1G1XA 5IWAF 1ZBTA 3LALA 2BV3A 3VF0B 1FKPA 5KFRA 1N52B 1TVRB 3ITHB 5IQ6A 5BR8F 1GX6A 4F3MA 1LWCB 1DTQA 2RB7A 1VC5A 2IM3A 1N5SA 2R8IA 3OHAA 4GC7A 3A8EA 4KGMA 2YX7A 2WONA 1CC7A 2WBMA 4IH5A 3F44A 3H98A 3DXBA 4RW8A 2BE2B 5I4MA 4X64F 4BDPA 1FDDA 1KHVA 2M8DB 4I7FB 1N88A 4MYUA 5KFXA 2NYIA 1N5YB 1K1QA 2KRBA 2EKYA 1OSCA 5KFAA 1KQFB 4PPZA 1UVKA 3T1YF 4ECYA 3IWNC 1VQ4S 1NJZA 3MR3A 1YJNS 2YH0A 1FERA 3EYZA 2HNDB 1DFDA 2O5DA 1IN0A 2R2RA 4LUBA 2J0QD 3VCDA 2PGCA 3M2UA 4IFVA 3DMJA 3EGWB 2B56A 3TVYA 1HWIA 4IH7A 1HBOA 5DO2A 5F8LA 2IYGA 1U1LA 5T14A 5DDRC 1Q86T 3DGPA 3GIKA 1E6VB 2DGVA 4X4PA 1BQMA 4J9MA 3J7Z5 2E9TA 3CTRA 3CCVS 2GQQA 2MGZA 4RW9A 1QLNA 3FRZA 2DGSA 2WBRA 4G6VB 3UWTA 4F50A 1APSA 2WHOA 4H4OA 3BO3A 3IR6B 3DYAB 4A48A 3UDCA 5KOXA 2XY6A 2CPZA 4ZK7M 2HHPA 2QE5A 3M32B 4CT8A 2HS3A 3TAMB 1MU2B 2KXHA 2HHXA 4WKRA 4PXDA 1VQYA 4DV1F 3DHWC 1IJEB 4K2XA 4KO0A 1YTYA 2BANA 1FHTA 3SCKE 4J9KA 1D3WA 3V4IA 2AGPA 2CQ3A 2MDAA 2GHVC 3VQSA 4J9QA 1ELOA 3CCWA 4Q43A 2CQGA 5L1LA 1FCAA 1S9GB 2Q1LA 5KFNA 2KZMA 4A8XA 2DK2A 2EFPA 5LSLA 1AFJA 1U24A 2IAJB 4ALZA 2CJBA 5KFVA 4U67Q 1FKOA 2ZE2B 4GKJF 4BHQA 4ECVA 2UUWA 3RRHA 2XS7A 1T02A 1IKVB 4DV6F 1H2TZ 1UA1A 1HI1A 2ADBA 4IG3A 1D8ZA 2L08A 1GNKA 2J0SD 1FF2A 2A3JA 2GX8A 2HWHA 2IJNA 3TO8A 4URGA 3OUYB 2J9DE 4WJBA 4WFXA 4AQYF 2OMOA 2C22A 3QJJA 2YTCA 1NJWA 2YX4A 4EO8A 2YNFB 4DFPA 2ABYA 3HT3A 1NNDA 3QMQA 2RU3A 3V6HA 1TK0A 5A0YB 3BDEA 3QAUA 5C25A 4DN9A 4C9DA 1T95A 2XBPA 4O3QA 2ZDPA 3CULA 4GKKF 3L7PA 3DLGA 1P9QC 1X5TA 2Q66A 1SKWA 2PD1A 2DH8A 4RNHA 5LXYA 4C7QA 2OO4A 5KFCA 1JKHB 4F4YA 4TU7A 4DLEA 2JRSA 1S1TB 2FGCA 2KN4A 1M5HA 4ED6A 1U1OA 1K8AT 2APOA 3IG1B 1DBDA 2XS2A 5EN1A 5F8NA 2UV8G 3MM6B