3KLIB

Crystal structure of unliganded azt-resistant hiv-1 reverse transcriptase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 103
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kliB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB03
2HAIA 3MR2A 4ED8A 1ZETA 5F8HA 1RTHB 2J6UA 3NMAA 2HNZB 3V6DA 4DL3A 1RT5B 1S1TB 2WRMA 4WFYA 4EYIB 2OPQA 3SFUA 4TQRA 4RW7A 3OHAA 5KT5A 3C6UA 3IG1A 5DQIA 2IA6A 4QW9A 2W9BB 1GX5A 5KG4A 1C1CB 2E9TA 2AGPA 1RT7A 2R2RA 4RNHA 2BQUA 1RTDA 2EC0A 5KFUA 3BGRA 4FS2A 3OLBA 4K4ZA 2JEGA 4ZP7A 3N6NA 5HLFB 5L1KA 4XPEA 4TN2A 1W25A 5EWFA 1ZTWA 2ATLA 4J9PA 3QLHA 2YNGB 3LP2A 4PWDB 4ZPAA 2HMIA 3CO9A 2XI2A 3V6JA 4ZMMA 1LW2A 3KHLA 3GV8B 3KLIB 4ECUA 4O3PA 5KFNA 2UVRA 4ED6A 4IFYB 4IRKA 3SI8A 1RT2A 1S0NA 5I42B 1U09A 2W9AA 3E51A 5KFRA 4QW8A 4ZP8A 4LQ3A 1VRTB 2FVSA 2R8GA 2B5JA 4RZRA 4WE1B 2V4QA 1QE1B 1SV5A 1EETA 4ID5B 3FSIA 1RAJA 2BE2B 1FKPB 3KOAA 1J5OA 3KMQA 1N4LA 4NLPA 3G6VA 3MEEA 5C25A 3CJ3A 2HWHA 1K1SA 1NHVA 4KO0A 3KHRA 3PVXA 3H5XA 1JKHB 1N56A 4NLSA 1JX4A 4NLUA 3D5MA 2R8KA 1IKWA 3M8PA 1S6QB 5KFWA 4MFBA 3CWJA 4IKAA 3GIIA 4KFBB 2IM3A 5KFPA 4O3NA 2OPRB 5J2MA 2IJFA 5L1LA 2XCAA 5DG9A 5L1JA 4K4WA 4I2QB 4Q8EA 3OHBA 1S0MA 3TVKA 3LP1A 1C0UB 3GIMA 4FBUA 4RW4A 1S1WA 2UUWA 3DRSA 5HP1B 2BQRA 1RYRA 4H4MA 1RT4A 4R0EA 1HQEA 1RA7A 4IFVA 2XC9A 2XGPA 1RA6A 3Q8SB 3CVKA 1T05B 1EP4A 4NLTA 3DLEB 2R2SA 1FK9A 4PQUA 4Q0BB 3D28A 1S10A 2O5DA 5KFLA 4I2PA 3DRRB 3M8QB 4ZHRA 4TXSA 3KK1B 5KG2A 5KFFA 2VG7B 3T1AA 4QWAA 4R5PB 3QZ8A 1S9FA 4YR0A 2D3ZA 4MIAA 4YR2A 3V6HA 3TQ1A 3KHGA 4J9KA 3NGDA 4J9RA 5KG7A 5EWGA 1TV6A 1KHVA 5J1EB 2WK4A 3HVTB 3MEDB 4NLXA 5F8MA 2R2UA 3KHHA 2ILZA 1RTHA 4WZMA 5EDWA 4NCGB 1JLAB 1S1TA 2HNDB 4Q8FA 2R8HA 3PHEA 3DYAB 4O3RA 3UDLA 4O3OA 4GC7A 3PJXA 5KFKA 1C1CA 4RU9A 4KE5A 4IQXA 1MMLA 4J9NA 3JSMB 4ZVEA 3OSNA 4ECQA 1IKYB 4ZPBA 5K14B 5HLFA 3BREA 1RT1B 4KV8A 4H4OB 1N6QB 1HNVA 3BQ0A 2ASDA 3V6KA 5DQGA 5CYMB 4NRUA 4EBCA 2FLNA 3DLKB 4ZVGA 1SUQA 2I5JB 2FJXA 3GIKA 4PUOB 2OPPA 3FRZA 2GC8A 2ZE2B 1TL1B 1TKTA 1LWFB 4MK7A 2ASLA 3FQLA 2VG5A 3MFHA 3KLHB 5I42A 3QIDA 2FVCA 4NLWA 4WYLA 1VRTA 4EO8A 1HQUA 3DOLB 4WE1A 3RB4A 1QE1A 4LSLB 4DEZA 4ECSA 4O44B 1TKXA 2BE2A 4IRDA 3EPGA 1FKPA 2FLLA 3MEGB 1T03B 4WFXA 1JLCB 1S6PA 5C24B 3LALA 5F9NA 3MTKA 4WXWA 4IOBA 2IM1A 3CDWA 5KFAA 5KT3A 1JKHA 1DTQA 5DLFA 1Z4UA 5F8JA 5KFGA 1HMVA 4EO6A 3RAXA 1S6QA 3QO9A 2YKNB 1IM4A 3DMJB 4KFBA 1IKXB 3QGGA 5J2PB 4J9QA 2DPJA 5DG8A 2OPRA 1DTTA 3PW2A 5KFSA 2XGQA 4ECWA 4IDKA 3FQKA 4TY9A 3QIPB 4U7CA 3TAMA 2FJVA 3RBEA 2YKMB 1SH0A 4IH7A 3OLAA 3PW4A 4YR3A 4TYAA 5HBMA 1LWCB 3LAKA 3NL0A 4IG3B 1T05A 3KK3B 1BQMA 2AX0A 2GIRA 4ZVFA 2YNHB 4IH5A 3KNAA 3M8QA 3DM2A 1NHUA 5KFZA 2WONB 3I0RA 3DI6A 1S48A 1KLMB 1REVB 1RTIB 3CDUA 3BSOA 1TL3A 4URQU 3NBPA 3DDKA 4ICLB 3T5KA 5J1EA 3CDEA 3HVTA 3MR6A 1DLOA 4R8UB 3QYYA 1R0AA 3LP0B 4H54A 4Q43A 3QGIA 1IKVB 3KLGB 4NCGA 1JLAA 4RNOA 2UUTA 1S9EB 2HNDA 1S4FA 4RUCA 1VRUB 3G6YA 3SFGA 1KHWA 2WOMA 1S49A 4TY8B 4ECRA 1LWEB 3ITHB 2FVQA 1S1VA 1N5YB 5F8IA 1XR6A 2HWIA 1UWBB 5J2QB 4JUZA 2B43A 2W9CB 1RYSA 5CYQB 3CJ5A 4JV1A 1TKZA 3KJVB 2HNYB 1JXLA 4RW6B 1IKYA 1C0TA 3H59A 3OSPA 5K14A 3PW0A 1RT1A 4B3OA 5D3GA 5JUMA 4H4OA 5KFEA 2BANB 4OL8A 1RT6B 2JC0A 5CYMA 5EWEA 4LSNA 4WFZA 2AGOA 5KG3A 2C28A 3IGVA 2I5JA 3DRPB 2YNIB 4PUOA 3Q8QB 4J9LA 1TL1A 3RAQA 1LWFA 4Q45A 2IC3B 5KFTA 3DOKA 5KFDA 3PZPA 2ALZA 2ASJA 4K4UA 1JLEB 1S1UB 4NLOA 4I7FA 3MECA 4DG1B 3H5SA 4G1QA 5I3UB 1GX6A 5KG0A 2UVWA 3DOLA 2FLPA 4O3SA 4O44A 4IH6A 3BQ1A 3GV7B 1S1XA 2RDIA 4ECZA 1T03A 2AWZA 1TVRA 2CJQA 4EBEA 1JLCA 4FBTA 2ZD1A 2JC1A 2QE5A 5KFVA 2UVVA 5T14A 2I1RA 4KHRA 4F4WA 3I5BA 4IRCA 4Q44A 2OPQB 4MIBA 1FKOB 1HARA 5JXSA 4KBIA 4K4XA 2FJWA 1HPZA 2YKNA 3KK2B 3IN5A 3PW7A 1N48A 3DMJA 1IKXA 2D41A 1BQNB 2HNZA 5J2PA 1TQLA 4U6PA 1RT7B 5F8NA 3FFIB 4KKOB 1RT5A 2CKWA 4LQ9A 1CSJA 2JLEA 3BGRB 2WCXA 5DQHA 4K4VA 3T19A 4ZP6A 2VG6B 3QIPA 2RF2B 3T5JA 2BRLA 1JLQB 1JLGB 2W9BA 5L9XA 4WXOA 3QLHB 3LP2B 2FVPA 4JV2A 1QAJA 4RW8B 3NKYA 4URGA 4KAIA 4MK9A 5F9LA 3BSNA 3V81B 1RTJB 4FS1A 4ED7A 4MH8A 3M9MB 3IS9B 2OH2A 2BRKA 1S97A 3MFIA 1RT2B 3H40A 2YNGA 4IG0B 5J2NB 4PWDA 2BR0A 5KFXA 1S9GB 4F4YA 1REVA 3KLIA 3UR0A 1SV5B 1JLBB 4ICLA 5FDLB 2VA3A 4IFYA 4JV0A 2YNFB 2D3UA 4R8UA 1JLFB 3LP0A 3CIZA 2OPSB 4NLDA 4Y2AA 3GQCA 1LW0B 1IKVA 3G6XA 3HKWA 2RKIB 2IBKA 2AU0A 1S9EA 3RB6A 1VRUA 4ID5A 3FDSA 4TY8A 3RB0A 4MKBA 3ITHA 4MFBB 1N5YA 5EUHA 4K4YA 1UWBA 5J2QA 2IJNA 3BSAA 5DLGA 4YMEA 2W9CA 1I6JA 3QZ7A 2BQ3A 4QWBA 3KJVA 3KLEB 2HNYA 4RW6A 1RT3B 2F8EX 2R2TA 5KT4A 2W7OA 4DL7A 1WNEA 4NZ0A 4X2BA 1C1BB 1RT6A 4H4MB 1RT4B 4DL4A 4IFVB 4Y34A 3M9OB 4XO0A 3BQ2A 3N6MA 3DLGB 4J9SA 2YNIA 3OL6A 4PQUB 1FK9B 4I2QA 5KG5A 4ZP9A 2E9RX 4TQSA 1C0UA 4I2PB 3H98A 4ZHRB 3OL9A 5HP1A 2IC3A 2C22A 3ISND 5C5JA 4NLYA 1JLEA 1S1UA 4DL6A 4DG1A 5KFOA 3GIJA 5I3UA 1ZTTA 3DLEA 2IAJB 4Q0BA 5F8LA 2V4RA 4F4ZA 1TV6B 2WHOA 3G86A 4ZPDA 5KFHA 4ED1A 3MR3A 3DRRA 3H4DA 3KK1A 2V9WA 1XR7A 2VG7A 4R5PA 5L1IA 4KHMA 3JYTB 2WTFA 3KLFB 3H5YA 4URSA 5KT6A 3T5HA 1FKOA 3E01B 1K1QA 4YQWA 3MEDA 3KK2A 4EBDA 4ED3A 4O4GB 1C2PA 2J6SA 5DG7A 1BQNA 3HHKA 3UPFA 1MU2B 3FFIA 4KKOA 4GC6A 4K4SA 5DGAA 3KLVA 3DYAA 2JEJA 1QAIA 2UVUA 2VG6A 2C2DA 2RF2A 4KV8B 2ILYA 1JLQA 1JLGA 1HNVB 1D0EA 4Y2CA 3H2LA 3MR5A 3CJ0A 3ICLA 2AQ4A 2B6AB 5KFYA 4RW8A 3JSMA 1QUVA 4DL5A 1SUQB 5KFCA 1HNIB 3I0SB 1RTJA 3V81A 4ZPCA 5KFMA 2OPPB 3M9NB 3IS9A 3IRXB 1TKTB 1N6QA 3EPIA 4J9OA 2VG5B 3RB3A 2J6TA 4IG0A 2ZKUA 5J2NA 5HROB 3MF5A 4ECXA 1S9GA 3DLKA 4DL2A 4XPCA 3CJ4A 4MK8A 1HQUB 2IM0A 1JLBA 5FDLA 2ZE2A 1TKXB 4KB7A 1TP7A 3BSCA 2YNFA 3V4IB 1JLFA 3C6TB 1XR5A 2OPSA 4Y3CA 3KLHA 2IM2A 1LW0A 1S6PB 2V0NA 4ZVHA 2RKIA 2AX1A 4K4TA 4J9MA 5C42B 4RW9B 1OS5A 1DTQB 4KSEB 4LSLA 3N6LA 1HMVB 1HYSB 1SH2A 3QGHA 1T94A 3H5UA 4IR9A 3QO9B 4YP3A 3MEGA 1NNDA 4NLVA 5C24A 3V6DB 4ECVA 1DTTB 3BR9A 5KFIA 3KLEA 1RT3A 4RW7B 2IMWP 4IDKB 3RBDA 5F8GA 3I5CA 3C6UB 3IG1B 3TAMB 2W7PA 1C1BA 3NAIA 3VQSA 5HBMB 2W8KA 1RTDB 1SH3A 4TYBA 3I5AA 3DLGA 2D7SA 4RUAA 4F50A 4K50A 4TLRA 4NRTA 3HVWA 4WYWA 1BQMB 2E9ZA 4RNFA 2YKMA 3DM2B 5KFJA 4EEYA 2WB4A 3Q8PB 1LWCA 2C2RA 3I0RB 2HMIB 4IG3A 3DI6B 3OL8A 4WZQA 2XWYA 3LAMA 3KK3A 2R8JA 1RDRA 1LW2B 2IAJA 2JEFA 1TL3B 3NBPB 3PJWA 2YNHA 4QWEA 5KT2A 3PR4A 3CJ2A 4NLRA 1DLOB 1R0AB 2WONA 3JYTA 3KMSA 3KLFA 4IR1A 2FVRA 2C2EA 1KLMA 1RTIA 4ED2A 4QWCA 3NAHA 2B5JB 2VA2A 4ED0A 4F4XA 3LANA 4QPXA 1EETB 3E01A 4NLGA 2WOMB 3ISNC 3PW5A 3HVAA 5KG1A 1S1VB 1J5OB 4O4GA 2GIQA 3BJYA 3MEEB 5C25B 3KLGA 1MU2A 3GV5B 4G3IA 4KO0B 4M94A 3IGNA 4NLQA 4O4RA 5KFBA 1TKZB 4ECTA 1T3NA 4HYKA 3T5LA 4RNNA 1C0TB 1IKWB 3M8PB 1LWEA 4B3OB 5D3GB 1S0OA 2XCPA 3Q8RB 5J2MB 3H4BA 4LSNB 3OL7A 2B6AA 5CYQA 3EZUA 2RDJA 1HNIA 3GYNA 3I0SA 4ECYA 3LP1B 2R8IA 3IRXA 2BANA 4RW4B 1S1WB 4HKQA 1YVFA 5KT7A 3DRSB 4MKAA 2QV6A 3DOKB 2JEIA 1HQEB 5KFQA 5HROA 3GILA 4I7FB 3MECB 1EP4B 3DRPA 4G1QB 2W8LA 3PR5B 2XI3A 4NYZA 5DGBA 4O3QA 3V4IA 1S1XB 4EYHB 2AGQA 3C6TA 1TVRB 2ZD1B 3UQSA 5C42A 4RW9A 4QWDA 4M95A 2DPIA 5KG6A 4RNMA 1HYSA 1JIHA 1D1UA 1HPZB
chains in the Genus database with same CATH superfamily
2NXNA 1T02A 1VR6A 2ZJQQ 3EGZA 3IG1A 4C0HA 5I3PA 3PNIA 2E5LJ 2JEGA 4HI2A 1S7HA 3LWMA 3OW2R 1HD1A 3W2WB 4ECUA 4P10A 4BBYA 1SVDA 3W8PA 1NK0A 3QSYB 3KOAA 1RKIA 2PMZD 1FFGB 3PVXA 3VAMA 1JKHB 2CWXA 4LF5F 4C8YA 1V3ZA 1UA1A 4AT1B 4ZCIA 2AF6A 1DURA 1PYOB 2F63A 3MCNA 3WZ0A 1EB0A 2D69A 1M5PC 1T05B 1CS4A 1X4BA 3DRRB 4MT1A 2D3O1 5GMEA 4OZ1A 2GHPA 3GG1A 3IR5B 5IV3A 3MOZA 2YPZA 1SIWB 1JJCB 1XN9A 1CVJA 5C2CA 2NQPA 5KFKA 1C1CA 3BGLA 2ZWOA 2BMBA 5LJ5Y 3BQ0A 1YRUA 3T41A 4EBCA 2BM0A 2I5JB 3HHEA 3OXFA 2AJ1A 4NCAA 2VG5A 3MFHA 1VC6A 3C16B 1D9FA 1G7CB 3UFCX 3TEGA 3TAPA 2YKQA 4MYTA 5D0RA 2YKNB 5CA5A 2CQ3A 4JI6F 3X1LB 1ZA1B 3CMAS 1UW4A 4N8OA 1FWPA 1QDUB 3U1LA 5EX0A 3MZIA 2ZH2A 5J1PA 3SCLE 3SSSA 5CXTA 2K7KA 4QQBA 4DX5A 4CH0S 3CJSA 3ENVA 4H54A 2DNLA 1U6FA 4RNOA 1LXNA 1HHQA 3KKFA 1N5YB 3QAEA 3B8HA 3AQOA 3CGIA 5J2QB 4K5RA 1RWXB 4PRFA 3KJVB 3OV7A 2IIHA 4JV5F 5KG3A 4DR2J 4JI0F 4B9MA 5KFDA 1DBDA 1A7GE 5I3UB 3Q83A 1P27B 4FBTA 1FDBA 5LOQA 2HEKA 4F67A 4KBIA 1S12A 3A3PB 5IXUA 4PKDB 2HZAA 4DV0J 2JZ5A 2Q3PA 1TL7A 3M05A 5L9XA 2DY9A 3D6TB 2CPXA 4DV1J 4YOEA 1YJUA 2V9KA 5IM0A 2OMLA 3Q89A 2AYBA 1E6VB 3KG1A 1JLFB 2RT3A 4TY8A 1FDDA 1XNQJ 3EVOA 3ZTOA 2IJNA 1XBWA 2JSXA 2DR6A 4P2XA 3FSXA 4Y34A 3BQ2A 3N6MA 1U2FA 2Q6CA 4TQSA 2ZBPA 3DDNA 1FCAA 3O8WA 5F8LA 2V4RA 4L75A 2GZOA 1S99A 3C19A 4LR9A 4OHXA 1KN6A 1G6BA 3VV2B 2UXDJ 2WBMA 5BR8J 2VQEJ 1A6LA 4ED3A 1TAQA 2XSJB 2J6SA 1RAHB 1S7IA 2AV5A 1QM9A 2RF2A 4Y65A 1HNVB 3T1YJ 1QSSA 3MPYA 5KFYA 3BM7A 1WC5A 1RTJA 4ZPCA 2OPPB 4PXCA 2LECA 1TKTB 5LXRA 2EI5A 4NXMF 2K2PA 1UPMB 3FC9A 2KHCA 3ELHA 5M2PA 2CQHA 2DR8A 3ILOA 4ED4A 3GWCA 1FNXH 3BF4A 1WEZA 2VFTA 2JJ4D 3MMCB 5HBMB 1NPKA 1UFKA 1TMJA 1Y11A 1HLWA 3WHIA 3FCHA 4ERDA 4LVNP 3KDOA 1KONA 2ZH4A 5D4NA 1TL3B 5A8RA 2W7AA 1ICEB 1DLOB 3KXDA 2V67A 1U1PA 4IR1A 1FEEA 1EQMA 1JK9B 1EETB 2DTJA 4USMA 3L7OA 4M94A 2QGFB 4I56A 1W2BR 1IKWB 1VYAA 4CLPA 5J2MB 4LSNB 2YVSA 3NEKA 2VOPA 4U9RA 1WOPA 3U02A 3BGOP 2QV6A 3MECB 1BQXA 3V4IA 4L76A 1SJ1A 1FESA 2G2OA 2CQ0A 1IBKJ 3SDEA 4CI0B 3OTBA 2J6UA 2HNZB 2W2NP 2FC9A 1RT5B 4WFYA 2OPQA 3I6PA 3WIVA 1G3OA 2W2MP 1JJ2R 3EVWA 2AGPA 4ZCMA 2EK6A 4M5IA 2F8HA 3I55S 3N6NA 4YB5A 5HLFB 5L1KA 1R6VA 3AODA 1H0HB 3QRPA 4UQGA 4FVMA 2K1RB 2MQOA 3KHLA 4ENOA 4O3PA 1RT2A 3NS7B 1KD1T 4DV6J 1SPBP 3B54A 3HSGA 4USHA 4DUZJ 4W4MA 3FSIA 1WI6A 1ZPWX 3ZZRA 3K8VA 4LBHA 4DV2J 1HFEL 3KJQB 2RAQA 2MKJA 3MCSA 2OPRB 2V2ZA 2X1GA 5DG9A 1HI0P 5A6PA 3TI0A 3IR6B 3KDNA 1KS2A 2O5DA 1GXUA 5KG2A 3GFXA 3RRKA 3R27A 4M5DB 4B3TF 1UW9A 8AT1B 4NEZA 4LRFA 1F9HA 4C8LA 4GC7A 1EHWA 2ZZNA 3NGSA 2DR7A 2YXLA 2W25A 4H4OB 1VS3A 5DDPC 4MK7A 3OD2A 3R6GB 3QIDA 1X5PA 3HFVA 3OXGA 3LALA 3MMJA 2YWKA 1N34J 5CAAA 4ZN1A 4AQYJ 4YB6A 2E1MC 4U7CA 2FJVA 3HFZB 1SH0A 1N33J 4YR3A 2ZFHA 1RISA 4OJ3A 3M8QA 2GMLA 2L9NA 1WC6A 1NAQA 3R7BB 3MEKA 5A2QY 1UA0A 2RUSA 4QOTA 1FRMA 3EZOA 2F4VF 3HHLC 2B7BB 3LP0B 1CULA 1E6YB 1HWIA 8ATCB 3CB4A 2DNGA 3NY0A 1RCXB 1Q79A 2HNYB 2Z56B 5K14A 3MAAB 1PC5A 2E1RA 1VBKA 4ILRA 5FLXU 1X5OA 1FX4A 2O01C 2MQNA 4DG1B 2KTQA 3CDAA 1S1XA 4IOCQ 2M70A 1WELA 1R0BG 5ITHA 2HFUA 2DHHA 9RUBA 2HQ3A 1IKXA 2D41A 4X65F 1SQFA 2JLEA 3G2XA 2LU2A 3CCES 3NKYA 4UQTA 3IXQA 4P73A 2WVBA 3HSDA 5GAEU 3F41A 3K58A 4OHZA 1WHYA 2VDHA 1TKDA 3W2WA 1CJVB 1X4FA 2ZBCA 2V8DA 2VIHA 2VB6A 1I1GA 4RJVA 4I6YA 1MNEA 2LQBA 2YQ0A 1U49A 4LREA 1V9OA 4NASA 1NLKL 2B56A 4AL7A 2LKZA 4DR4F 2EW9A 1NJIT 2QLXA 4ZPWR 1TUWA 3DRRA 2HVZA 1OY9A 2CYYA 3PYGA 4YQWA 3DLLQ 5CH7B 5B08A 1CJUB 3F73A 1VQKS 3GTYX 1QAIA 2BJ1A 4BLGA 3W60A 1HNIB 3R1LA 2ZBRA 2I6WA 2ZKUA 2RRNA 2ZOMA 3ETOA 7FDRA 1KQKA 1M90T 3SQGA 3C16A 2XSFA 1U1OA 2IBOA 3UCGA 3M8RA 1DTTB 3I5CA 2XG8A 2DNNA 3A8JA 3BKUA 2Z2MA 4X66J 4RUAA 1JNRB 1VISA 2ROGA 2JLFA 3PO4A 3FEXB 3O5TB 1UVNA 2R8JA 1HNXF 3NBPB 3O3LA 4LRAA 2BE9B 4ED2A 2HHTA 5HSPA 3HVAA 4QPTA 1Q53A 3PRVA 2QLBB 2FY1A 1U1MA 2FD2A 4ATNA 2ZZTA 2OUGA 3L95X 3BYRA 3KNGA 3AXKA 3E3XA 1ZBTA 2WB1D 2F9DA 2OEMA 3PXGa 5GAEI 3R1HA 1EP4B 1VQYA 3DLJA 4RW9A 2MHEA 3O2IA 4YEAA 4DWIA 2XLKA 2IDLA 2HAIA 5CHCB 4DL3A 3JAMY 1RP5A 3W3SA 1SJRA 5DQIA 1NJZA 2MLXA 1R43A 3D54A 1XMQJ 1W25A 1HWJA 3N01A 1JXVA 1GEHA 5KFNA 2KG1A 1S59A 2W9AA 2FVSA 2V4QA 2ZHBA 1M5SA 4U8VA 2GJ2A 1YX2A 1N4LA 1R8HA 4N76A 1NHVA 4A4JA 4X4QA 1F3FA 1F9EB 2DGSA 1RHMB 3UCUP 1X4AA 1T9YA 2WVFA 1BC6A 1K8AT 1M5VC 5F3ZA 4Q8EA 1S0MA 4TU8A 4HHHA 3LGHA 2R2SA 3AXMA 3DGVA 1T9UA 1RWNB 4YR0A 2MKYA 3CCTA 2BV3A 4USKA 3ZZUA 2DGVA 2AJQA 4FDFA 5HJYA 4UZCA 4NA1A 1FHTA 4GO7X 1GNKA 1FRLA 3R9LA 2HNDB 3DYAB 4DV4J 4ZVEA 4ECQA 3P5TL 1HNVA 2ASDA 1H7XA 4ZVGA 2ADCA 2OPPA 4KPCA 4OMFG 1TAUA 1TKTA 2DNZA 4F25A 4ELTA 3BS9A 5GMKa 2IM1A 1RU1A 2DHGA 2Y1RI 3MMCA 3C3LA 3DHWC 3M2VA 1IXKA 5HBMA 4ZVRB 3BKFA 2MGZB 4IH5A 4UT4A 1AUDA 1REVB 1WG1A 1TL3A 4A47A 4DR1J 1DLOA 4ETZA 4LFAJ 2OEKA 5CQGA 1VRUB 2F8MA 3LH2S 2FVQA 2AP6A 4C7QA 2W9CB 3F44A 3D1OA 5CYMA 4LSNA 2VFVA 2M2BA 3D7SB 2MJUA 4DUYF 4NLOA 3MECA 3DOLA 2E5JA 4O44A 3GV7B 3VTIA 2RNEA 4GVBB 4C3LA 1VJQA 4Q44A 3MM7A 4I4BA 1HARA 5AXMA 4CO2A 4UY8T 2HNZA 1R6YA 5JVHQ 1RT5A 1WJ9A 1G2EA 3M6UA 2VG6B 1RQ0A 3T5JA 3UE2A 5K8MA 3L09A 5F9LA 3BSNA 4PPZA 1NKBA 1X7VA 5B0BA 3IS9B 3MFIA 3UDVA 4DU7A 1QAXA 2JHEA 2VA3A 3TX0A 3G6XA 5RUBA 3H20A 1JXEA 2DNMA 5BYQA 1SKWA 2CPDA 4DL7A 4JI6J 1RT4B 4IFVB 3M9OB 4XO0A 2M88A 5KG5A 2J8AA 2E9RX 4OZLA 3BR8A 1FD2A 3GIJA 4JI7F 4HHJA 3G86A 4ZPDA 5A8WB 4DR7F 3BBFA 3H4DA 4WU2A 5DZ7A 4KGZB 4RU2A 4LF2A 3KK2A 4O23A 5DGAA 4F2SA 2ILYA 3HMJG 5E2QA 3CJ0A 1QUVA 2OLWA 3N0VA 2XZWA 5K5MA 3RB3A 1AZSB 5I4MA 2HWTA 5L38A 4FPIA 4JI0J 3CJ8A 2PD1A 3HCXA 4ED8A 4A8SA 3FSYA 1WHWA 3V6DB 1TFWA 4V1Ak 3TAMB 4B3RJ 3J7A1 3BPDA 2W8KA 1FJGF 2RRBA 1FXRA 5MLCV 1O0PA 4OYPA 3J80Y 1UVIA 2QLWA 1YG0A 1LW2B 4K5SA 1R0AB 2XB2D 2DNOA 2B5JB 1Q16B 3CTRA 3LANA 1NH8A 2MZTA 5DJBA 3FEZA 3CT9A 3E8OA 1U7LA 2Y0BB 1T3NA 3M8PB 3LA0A 1PGZA 1WF0A 1N8RT 5D6GA 1IJEB 3MAAA 1V3SA 4RW4B 1S1WB 1KEKA 4CO4A 5M2RA 3FZ2A 3PR5B 1M5OC 3MI7X 1DZ5A 1AFIA 5DDRC 2HZCA 4DS4A 3UN3A 1S1TB 1NK8A 3TZWA 3P49B 3H2UB 3CD0A 3D1HA 4DF8A 3VGSA 3CUNA 1NHKL 2YH1A 4P7VA 1HR0J 3AOCA 3L4BC 3CJRA 1LWXA 2QYCA 1BUXA 1CJVA 5HMZA 4LQ3A 1M1KT 5K8OA 1HHSA 4LF6F 3KMQA 1VQSA 1FFWB 3H5XA 1OYEA 3KUHA 3CWJA 4HHUA 4IKAA 3MMBA 2B9WA 5LMUF 1RWOB 4CDIA 1RA7A 3SV3A 2XC9A 2QL9B 2FHOB 4Q0BB 2X1BA 3PCOB 4MIAA 3TQ1A 3VVTA 3KUEA 1UJ4A 4NLXA 3MURP 2ILZA 1N5TA 5EDWA 1RU2A 3UDLA 1VI7A 2DBBA 1SL2A 4J9NA 4FKXA 1YBTA 1OY8A 3BDEA 1GMVA 5B0GA 2CQCA 3V6KA 3FCWA 1RBLA 3DLKB 3HHLB 4DXLA 1IWGA 1Q1KA 3D1QA 3NS5A 2ZE2B 3OPKA 2EC2A 1H3DA 1DY3A 1X31C 4DEZA 3HD1A 1N36J 1T03B 2J0WA 1MWQA 2RVJA 1YBAA 3FBEA 1RBOB 3PV8A 1DTTA 3PW2A 4J91A 1H73A 3GPAA 2NR0A 3PEHA 1N32F 1WG4A 1A9NB 1FVSA 5AXNA 4X84A 3R2DJ 1FE4A 2YQ3A 3NBPA 5J1EA 2BW7A 4DSKA 3GR0A 1BWVA 2JLGA 3ENWA 3O6QA 2R7WA 4JUZA 3T1HJ 2MYFA 1MN7A 1WI8A 2PN6A 4L3NA 1U2RA 2D3OR 1TL5A 3PKMA 1TL1A 2R7XA 1AXQA 2GMHA 2VICA 2FQQB 1GX6A 2YWEA 2OFHX 4XDCA 3B6BA 2QE5A 2LEBA 3O1LA 2LEPA 5JXSA 4FF1A 1F5AA 2EFQA 3VGVA 5LSOA 2KM8C 2G0JA 1GFWB 4F0HA 2DY1A 1K73T 2UXBF 4ED7A 1LKZA 1S97A 4CH7A 1NPRA 2RD5C 3NP5A 3OR1A 2CPYA 5FDLB 4Y2AA 1S9EA 4Z37A 2D9OA 4HDHA 2XMWA 2R7OA 4DSIA 2H5JB 3MUTP 2BQ3A 3J81Y 4QYZJ 2W2PP 4RW6A 1RT3B 2NCKL 1NK7A 3FCVA 3TUPA 3E2EA 1IQTA 1RT6A 4DL4A 2J0XA 4CT8A 2OD4A 2GA7A 4PQUB 2H51B 3CCMS 2MTLA 2GNKA 4G6VB 1S1UA 4DL6A 3HLUA 4OZJA 1XR7A 4PR6A 3C66A 5D4PA 4EZ9A 1C2PA 5ETMA 4KKOA 2AYMA 1EZZB 2BM1A 3DYAA 1JLQA 2HIQA 3ZZ0A 2B6AB 5KFCA 1CEZA 3V81A 1NDCA 2DHXA 5ETOA 4M5KA 1VIXA 2C2NA 3C6TB 1HNWF 5C42B 1OS5A 3BBBA 2QFIA 2C3YA 2KO1A 1WC3A 1QTNB 2HHSA 2Y1IA 3BN7A 3HP6A 3KLEA 3MOJB 1U8SA 1VHIA 3I82A 4X65J 3GCWP 1RTDB 2VKZG 4F50A 2L48A 4EEYA 1N54B 2P5VA 4ZPVR 5KT2A 3MM5A 2XO7A 1XMBA 3PX6A 4ER8A 2LCWA 2UUCF 3NAHA 4QPXA 3E01A 2Z0GA 2GHVC 2DR5A 2HQCA 2FUG9 5DM7Q 3OTOF 2N82B 1C0TB 1S0OA 4Y0FA 2V2VA 3Q8RB 2O3DA 3DCAA 4M5NA 2J9DA 3IBWA 5GVQA 4I7FB 3D2WA 1HKAA 1H98A 2FIUA 4DDFA 4DR4J 2ZD1B 2XMJA 5ETQA 2DPIA 1HPZB 4QU7A 3SZ2A 5A0YB 4GKJJ 1A0OB 3K89A 3J7Z5 2C2MB 2APOA 5E3QA 2R2RA 2BQUA 3CIMA 1YZ7A 1TU0B 2LDIA 3MM9A 2ZC4A 2HMIA 1X4DA 2UVRA 4IFYB 5THWA 1FXLA 1UJ6A 2N3LA 2E1AA 3GFZA 3N4WA 1VRTB 4R25A 1FKPB 2H54B 4F3QA 2HURA 4NWBA 2JFKA 1H2UX 2AT1B 2GCFA 2MLZA 4K4WA 2ZOGA 1RAOA 1RT4A 4IFVA 3Q8SB 4WFNQ 3I9ZA 1HBNB 2IA0A 5KFFA 2CQDA 7FD1A 2F1FA 2NUUG 1OSCA 4A46A 2DXFA 3IP0A 1R7IA 2AHOB 3R5GA 2V2QA 1RTHA 5AE1A 5FJ4A 4DR3J 4WIQA 2R8HA 2VBYA 1WDTA 3EDQB 3PY8A 1RAFB 1Y0HA 2OD6A 3BREA 2LQ8A 3GCXP 3B82A 4DI6A 5DDQC 3ZTSA 2B4PA 3GFHA 5L39A 1Y7PA 4C8KA 1RWUA 2W01A 1QE1A 4ECSA 3H2VE 4C3KA 2GGPB 4WFXA 4JI8F 3CDWA 5KFGA 5FIIA 3ULHA 2PFFB 1IJFB 1LXJA 2CQIA 4F8RA 4ECWA 2R4FA 1YJ9S 3QIPB 3M8ZA 3TAMA 3R3TA 4NI2A 4BC9A 1KVIA 4ZVTB 2HAFA 2GIRA 1NZAA 1BE4A 3CDEA 5IWAJ 1HW8A 1G4CA 4DJBA 1R0AA 1FNOA 1CLFA 2PA3A 2ZZMA 4C0BA 2HLTA 3IFEA 3R8YA 3PYDA 2BANB 2CRLA 4MAKA 2KVIA 1B70B 1HIYA 3VGUA 4QR1A 3I96A 2H4WB 2KT3A 3RAQA 1FRIA 3QRRA 2PFDA 1HBOB 2RDIA 2RU3A 1YJWS 1Q8LA 3N9UC 4F4WA 1PBAA 2GIFA 1BQNB 2MSTA 3FFIB 1JLGB 2GMJA 1BLUA 1J27A 4IG0B 5G0RB 3F56A 1JLBB 1LW0B 1IKVA 2DITA 1FVQA 1PO6A 3ITHA 4YMEA 5KT4A 3P3DA 3CCVS 2EFVA 2AJ2A 4DCOB 4Q5VA 3RW6A 3A4TA 5ETKA 3W63A 1FK9B 5HQMA 3PJ9A 4YB7A 1ZTTA 4Q0BA 2U2FA 4ED1A 3MR3A 3IAS9 2V9WA 5L1IA 4JBCA 2ZJRQ 4LRBA 1QTMA 2DIVA 2LEAA 4EBDA 5AJ3F 3CF5Q 3K5MA 3C14B 4GC6A 5LT5A 2FZGB 4DR6F 3G8QA 1IM6A 2FJAB 1QJHA 4CO5A 4PABA 2GVZB 2Z30B 3VWSA 4ECXA 3DLKA 1UMJA 4XPCA 3HHLA 2R7RA 5SZTA 2ZE2A 1X60A 3QJLA 2YNFA 2V0NA 4DUYJ 3MM8B 5E0OA 2CPJA 1U1NA 2QL7B 2DNKA 3UW1A 4IR9A 4NLVA 2L9WA 4EU0A 3A13A 1AA1B 2IMWP 4MTPA 3OFGA 4USVA 2JWNA 2JFDA 3CJTA 1C1BA 1SH3A 3DLGA 2A3JA 2OSRA 3FVYA 4DOZA 3JTNA 4WZQA 2NPIA 3PJWA 5A2QU 4FN5A 4ANDA 4YHHF 1Q78A 4RBTA 5EGYA 4CLKA 1KQFB 3DKDA 3WC0A 3BV8A 3I0SA 3LP1B 3KUGA 3K5PA 1S4EA 4MKAA 2OTLS 5E3AA 2HHVA 4NYZA 5F3TA 2MZRA 4QWDA 4RPFA 4M95A 1HYSA 3MR2A 1ZETA 3NMAA 1KFDA 2ADBA 2XY5A 3CCUS 5KG4A 1UVKA 4FXWA 4PZVA 3OLBA 4XPEA 5EWFA 4OHVA 2AIRB 2O66A 2IMOA 1YI2S 1KLNA 2KRRA 5JMNA 3HXMA 3VAKA 3L7PA 5BXIA 1PG5B 4F4AA 3K7RA 2ZVIA 2HWHA 4C11B 1JX4A 4QBUA 3IA0A 1S6QB 2NYHA 2Y8WA 2HS4A 2N3OA 4AD6A 2XCAA 1WTBA 4I2QB 2UUWA 5IZHA 3DRSA 2HGMA 2Z4PA 2KB2A 4PQUA 5GMDA 3T1AA 5KG7A 2WK4A 1SBRA 2YWHA 4NCGB 2WVCA 3CJKA 3TUIC 2K3KA 2GAGC 1D09B 4YY3J 2D1CA 4EMDA 4QU6A 4IYQA 4OV6A 3FUYA 4OHWA 2BJ7A 4HT7A 2ERRA 6FDRA 2NXJA 3KLHB 5I42A 3R7SB 2YWFA 4WE1A 2KVQE 2DRDA 4DFJA 3EPGA 4YB1P 1S6UA 2JDJA 3LWLA 3THPA 3QGPA 4CM0A 1UTAA 2LU1A 3OFFA 5J2PB 4TU9A 1B7YB 1BD6A 4M1KA 1LWCB 3Q8UA 2AX0A 3KNAA 3AD8C 1FTRA 3HF5A 2WONB 4RO0A 5IT4A 9ATCB 2QEXS 4NPOA 4URQU 3MR6A 2G13A 3QGIA 4LF8F 5KOWA 3EICA 2KM8B 4ECRA 2J5AA 5L46A 4H4KC 1R27B 1C0TA 3SYZA 1VGYA 4LRCA 4HR2A 2AZ3A 3D68A 1MMNA 5LMUJ 5CCLA 4C8ZA 2CJ9A 4I6AA 4ZOSA 4I7FA 2D74B 1NDKA 2HRTA 2M3DA 4OZ3A 2ZD1A 3DXBA 4KHRA 2FJBB 2FJWA 1HPZA 4WJBA 3AJ2A 1RT7B 1CSJA 3K59A 1U6ZA 3GIRA 3LP2B 5CD4A 4ZITA 5IC6B 1RBAA 1R8CA 1UKUA 3H40A 2FHMA 2RE1A 5F0WA 2BR0A 3DU6A 2GS8A 4ICLA 4IFYA 4JV0A 2JVRA 3HKWA 5B7WA 2OIHA 3UD5A 1T7PA 4LBPA 1UWBA 1I6JA 3QZ7A 4X62F 5HQLA 4NZ0A 4H4MB 4K2JA 4J9SA 1B0VA 4I2PB 3SQOP 2C22A 4B08A 1AYEA 2EPIA 3JS9A 1HBNA 2C3PA 1P8GA 3MMAB 1FKOA 1MU2B 4FYVB 3DRXA 1IBCB 2UVUA 3M30A 1D0EA 4M5MA 3FEYB 1U8WA 2AQ4A 2HBYB 3PDNA 1DJ0A 3B4MA 3M9NB 2AJFE 4HACB 4J9OA 4FKYA 1OMSA 5M2UA 4KB7A 3ILIA 4B02A 2ZH8A 2KI2A 4ZIWA 4Y3CA 1TFYA 4TLQA 1SH2A 2NXEA 1KRPA 4PQAA 1MWZA 4YN3B 4I68A 1SJ3P 2HQGA 2HIYA 1X8DA 4DUTA 1Q7YT 1BQMB 5E33A 3DI6B 2IAJA 2UUBF 1Q8BA 2IFXA 4HDGA 4OYMA 4LF7J 2OTJS 3KMSA 1BGXT 1HBUB 5DS7A 1BWEA 3TJ9A 3BKTA 1LFPA 4L6V3 1NDLA 4RNNA 3DFEA 4U67Q 4FXDA 3EE3A 3H4BA 3NMRA 2UUAJ 1RWMB 3UCZP 2BANA 1CJTB 3DOKB 3ET6B 2QA2A 4G1QB 2W4DA 2DCUB 4EYHB 5IT9Y 2VBXA 1XWLA 2DH8A 5IC4B 2CUYA 3ILJA 5AXLA 4P2MA 2DXDA 2V34A 3EWGA 4FYDA 1VC0A 4KHPJ 4CIOA 2GVDA 5DRKA 4NYOA 5D0HA 2CA9A 1U6BA 3PHTA 4DR5J 2V8GA 4USTA 2XMUA 2EBEA 5KFRA 3CEDA 1KTQA 1TUVA 1J5OA 1K44A 3OTEA 4PWUA 1HNWJ 5D4OA 3MPVA 4NA2A 1B0TA 4O3NA 4DMZA 4Q7AA 5L1JA 2AD9A 2KT5A 3U1NA 4FBUA 3M1VB 2BQRA 1JNZB 1RHRB 5E3CA 2DNHA 1FK9A 4KH1B 3ZZOA 3HM9A 3KK1B 4TU7A 1PJ6A 4GO5X 5D15A 3HPOA 3RAMA 1YBUA 3HVTB 2JX2A 2YKOA 2UUCJ 1U2CA 2DKOB 3NNCA 1FRHA 1YQHA 3HHNB 3A3OB 3OTDA 2OP5A 3OTOJ 2XMKA 1IKYB 1N6QB 3CD6S 3AHPA 2QG9B 4AUKA 4DPTA 2FLNA 3TA1A 2XHCA 5LL6d 1LWFB 4RWWA 4DQPA 2KFZA 2LA6A 2LLZA 5GAHU 2X1FA 1X0FA 5J1NA 4W92B 3A3NB 1EARA 3CC4S 4KFBA 1MROB 4JI4F 5KFSA 3MAHA 2VQFJ 2Q79A 3OLAA 3DRYA 4IH7A 3TA0A 3IMQJ 3NL0A 4IG3B 3J80U 2E1PA 2ZBIA 1R8BA 4HTJA 4ZJOA 1RZMA 3TW0A 4R8UB 5D4LA 3T6JA 3PIOQ 1JLAA 1CJKB 3CCSS 2ZWPA 3D3CJ 3O44A 3CJ5A 1FWKA 4K59A 4JV1A 4K0KF 4RX6A 5LMNF 1RT1A 4OZNA 2B8QA 4DFPA 5EHHA 1S57A 3CCRS 5ADZA 1VLYA 2V8PA 2BA9A 2H48B 2UVWA 2DR9A 1S79A 2YY3A 4YDDB 3DOMB 3G8SA 3DMJA 2J9DE 1WG5A 1R31A 3FNNA 2XS5A 2GO9A 1ZAXA 2ZH3A 4RBVA 2YKPA 4NXNF 5D77A 2MY8A 1NM2A 5KFXA 4F4YA 3UR0A 4HLBA 4ZJLA 5L1LA 2ABYA 5C2GA 3W8GA 3G4SS 1JJHA 3BSAA 2E7VA 4B9VA 3P96A 4WWSA 1FTCA 3VALA 1WNEA 3K5OA 2YX7A 1ZPVA 1K47A 4AYBD 4I2QA 4ZP9A 1T0TV 1RJJA 2IC3A 3LGNA 3VHQA 5BYSA 2C3UA 7AT1B 1X9SA 3DLBA 2XEXA 2OFGX 4DPWA 1DRZA 5GAHI 2FZCB 3M4XA 1LK5A 2CVEA 2G1DA 3D6HB 4UZBA 4OV1A 4O4GB 4JP8A 1LV5A 3UPFA 2ZDPA 4XIUA 1L3SA 2JEJA 3Q23A 3TJAA 4ZVUB 2AKWB 2KT2A 2BBEA 1PILA 5J2NA 2E44A 1TKXB 1LEOA 3KLHA 3A8IA 4BC7A 1S5ZA 2GX8A 2FC8A 2NZ4A 3N6LA 3QO9B 4U95A 2HHWA 4LR8A 4LF4J 3H42A 5ETVA 3RBDA 4FF3A 1AT1B 4TLRA 2J76E 4WYWA 4RNFA 1NSKL 3HZEA 1LWCA 2C2RA 2VU5A 2XWYA 5HK4A 1KOOA 2BYCA 1IR2A 3PR4A 3CJ2A 2WONA 3JYTA 2LVWA 5AE3A 1BMQB 3PW5A 3BJYA 4FYYB 4OI3A 4M63A 5SUHA 2M9KA 2HHQA 4WF9Q 1FFSB 4ECYA 2IYGA 1HQEB 3SCJE 3BGFA 2XI3A 5BJRA 3GJRB 4O3QA 4PG6A 1FNMA 4PXEA 2DXEA 4X4NA 1Y9OA 5IS2A 2B4VA 1TL4A 4RW7A 1HBMA 2COLA 2CNKB 2MPUA 2IA6A 4X4VA 4F02A 4EFAC 4PEOA 1RT7A 2CZ4A 2G2YA 4WP9A 2OAUA 4ZP7A 1ZTWA 2X51A 4HI1A 4HTIA 2H1YA 3LP2A 1RACB 4X4SA 1FJ7A 4ED6A 3KG4A 2VD3A 4RZRA 2BE2B 2PC6A 1PC4A 2HHUA 1Y3JA 3MEEA 1W7WA 2R42A 2AEJA 3W66A 2CVIA 2OO4A 3SCKE 4DN9A 4NLUA 3J81U 3ZZYA 1L3UA 1S6OA 2BABA 3N28A 4LUBA 3W64A 3QJPA 1C0UB 1XNRJ 4H4MA 3RG6A 5KFLA 4I2PA 1TMMA 4KR0B 3V6HA 3KHGA 5HVGA 4CO0A 1WOOA 1DQ9A 1KNZA 2V6AA 4N5SA 3HSJA 2F3JA 2ZH9A 4UY85 2AW0A 3UR3C 3CCZA 1WC1A 4G1PA 4ZLNA 2RS8A 2DH7A 3BO3A 1FJEB 4PUOB 1QAYA 1VDHA 4CZCA 1UZDA 3M2UA 4CWBA 2HS3A 3G71S 3M6WA 5B0CA 3KG0A 1NRKA 1J5EJ 3PG9A 3SSQA 1RADB 1QVFR 1VQNS 5DLFA 2V2KA 3TNVA 4RKUC 3CO0P 1VBYA 1QSLA 5DG8A 2B9EA 3M8WA 4KT0C 4KH0B 4U96A 1RAIB 2CJAA 3TYTA 1BQMA 1ACMB 2Z8QA 2Y0SD 3QRQA 3DI6A 2IJRA 3BSOA 2DEJA 1Q95G 1RTZA 1EKRA 3GG0A 3SFGA 2NSBA 3GJSB 4M5HA 3OTCA 4WIIA 1ULRA 1KR4A 4X64F 1WKJA 2CIMA 5DDOC 2HFSA 3WC2A 2M5YA 3Q8QB 1R8PA 2ASJA 3DOKA 3H90A 1JLEB 5A8KB 4G1QA 2P2CB 4OZ2A 4O3SA 2HGLA 2VH7A 2CJQA 1JLCA 2I1RA 2B4OA 4CLLA 3I5BA 3QT5A 4MIBA 1L3VA 2LP4A 4K4XA 2Q43A 1U24A 2XYGB 4Z7YA 2WCXA 3BGRB 4DPOA 4DV0F 5E41A 3AY0A 4WXOA 4C97A 3BYPA 4NEYA 4DV1F 4NCBA 3TR5A 1S9GB 2FTRA 2RKIB 2OELA 3FDSA 4MKBA 4DSEA 2DRAA 3R5DA 1XNQF 1ZZNA 3LQVA 2IVFB 1F2HA 3SMZA 4A8YA 2W7OA 2J9CA 1YGYA 3K0JA 2EXUA 2DH9A 2YNIA 2E29A 3G6ES 3DGPB 3Q8YA 3MXHP 1ZM4A 5HVHA 2DNPA 1MW7A 1TV6B 2BEFA 3KK1A 3KLFB 1X9WA 1RXOB 2MQLA 1B7FA 4XDDA 2CJKA 1ZAVA 2UXDF 5H9FJ 5BR8F 2VQEF 5LXYA 1N52B 5DG7A 2EKYA 2UXCJ 5AXKA 1X5SA 2CQ1A 3LPYA 3KLVA 1OJ4A 3GU0A 3T1YF 1IR1A 4RW8A 4LIWA 4A8KA 6FD1A 3J7AN 3IRXB 1N6QA 5HANA 3MF5A 2DGXA 4DV5F 3IRWP 2RMLA 2LQ9A 3BSCA 1L3TA 3M2RA 1SI9A 2OPSA 1NEEA 1F5BA 1I3OB 2DB1A 2CQPA 2B4UA 1T94A 4CP5A 4ECVA 3TEHB 1KTVA 3KYLA 3IG1B 2P9CA 3SIPB 2HSEB 2KL8A 2VF3A 4IG3A 2DEIA 4B3MJ 2DGWA 4PAAA 4F4XA 1WC4A 1YJRA 2BJDA 5KFBA 4N7TA 2BJ9A 4KJIA 3OQ2A 3CC7S 1NXIA 3H8YA 2RDJA 3GYNA 4X62J 1URRA 4HKQA 5HROA 4DS5A 2AYGA 1TR0A 4HT5A 2BVZA 2MB0B 4HVZA 4G1IA 4ANEA 3OFHA 2ZHOA 2WRMA 2QX0A 2VFUA 3C6UA 3Q8VA 3L3CA 1GX5A 2W9BB 1C1CB 1FXDA 3TZYA 1MMDA 4FPRA 1NH7A 1AUSL 3S01A 3PO5A 2HYIB 4Y2MA 4KGMA 1C4CA 3W5YA 4IRKA 1S0NA 4DV6F 2ZVSA 4QW8A 4CTAA 2B8PA 4ES3A 1RHQB 3OUYA 5L9NA 3C8YA 3G6VA 5JVGQ 5C25A 3A1YG 1K1SA 4KO0A 4DV2F 1N56A 1AW0A 3GJTB 1UEUA 3TVKA 1Q8IA 2LXIA 2C42A 1RYRA 2I0XA 2XGPA 1DARA 2C2OB 2OGUA 4TXSA 4QWAA 2F7VA 4A48A 2A18A 2N4CA 4J9KA 1KHVA 2UUBJ 2BZ2A 5KOXA 4IO9Q 4Z2XA 1YK9A 1YJNS 4O3RA 2VBZA 3POTB 5H1SV 2E7XA 4PCQA 5T7LB 4ZLLA 2GQCA 3FRYA 3TWZA 2EK1A 2WW4A 3QFHA 2MSSA 4DCJB 2QMXA 1NCLA 2V50A 2DCLA 2DHSA 3W7BA 2KHDA 3NXZA 5JJBA 5CD4H 4OI0A 3QPIA 4NLWA 3JB9k 4DQRA 1TKXA 2FLLA 3Q2TC 3A8KA 1X0PA 2DNYA 1JKHA 4MKYA 1N34F 3NNHA 3QT6A 1L3KA 3QO9A 3UD4P 5CZXA 1WD6A 4AQYF 3CD7A 1D9AA 3PEJA 1XMOJ 1N33F 4X4PA 1TL7B 4NMLA 1M0SA 1WOSA 3LAKA 4LF1A 1T05A 3TP2A 3TVZA 5IM0B 2H9ZA 1RE1B 4OHYA 1KQGB 3G9CA 5ETPA 3I9V9 1FRKA 4TY8B 3OR2B 3JSBA 1WEYA 2Y9HA 3J81j 4N41A 2LXUA 3EXCX 5KFEA 5JUMA 4B3SJ 1FJCA 3WX4A 1T9XA 5DZ6A 4OL8A 1FKAF 4DZ6A 2I5JA 5E3PA 1UFLA 2IY5B 4K4UA 3L9ZA 2AEMA 4OQJA 4JI5J 1HI1A 3NGUA 1VQLS 2JC1A 2PMHA 2CQBA 2KJVA 4JYAJ 1RAEB 2XMVA 3EMTA 2YKNA 3ONQA 2I38A 4K4VA 4P71A 2RF2B 1B99A 2YX4A 3D0IE 4JV2A 2L41A 3GFYA 1RTJB 4FS1A 5AT1B 1GTHA 3I4HX 3L7UA 3NWGA 3TJ8A 1VHFA 1KQSR 3TQEA 4NLDA 1VBZA 2IPOB 3SSRA 1M5KC 2G4BA 4ES1A 1N5YA 2Y3YA 5J2QA 3GB0A 5F41A 1NSQA 2MMYA 3KJVA 2PDAA 2Z2LA 1NZ8A 4OYXA 2ZNYA 1WSVA 1SXLA 4DV3F 2N7CA 3CNQP 1C0UA 4ZHRB 3ISND 2ROPA 4HL9A 3UNYA 5I3UA 3K17A 3HK2A 5A8RB 1PKUA 2A0FB 1YHQS 1B4SA 1RHKB 1P9QC 3OVSA 2QL5B 1Z1ZA 2FGCA 2VPXB 1GXTA 3MR5A 4PG4A 1FX2A 2MY7A 2EFPA 4ALZA 2HVDA 3CJ4A 4USJC 5B0DA 1E6VA 1XEZA 3V4IB 1JLFA 4A8XA 1VC5A 4H4KA 4QJVA 2A10A 3GP9A 2L08A 3QQCD 2DT9A 3BR9A 3PX4A 5F8GA 3MAQA 2W7PA 3CMQA 2BKPA 3CDBA 3S7RA 4TYBA 3I5AA 1IBLJ 5KFJA 4M5GA 2ZJPQ 1RWKB 3OL8A 3LAMA 4LFCJ 1QSYA 4JI3F 3QJJA 4M5LA 3W9JA 5IQ6A 4GKKJ 2F40A 4N77A 2CFXA 3ETMA 4FF2A 2R7SA 2ZDOA 2QO3A 1S1VB 2XSJA 3D6MB 2AMCB 5D0EA 4E2FB 1TKZB 4ECTA 4HYKA 4JOUA 1ZM2A 3UDEA 4OJ1A 2RHQB 4RBUA 3BEGB 2MEWA 1M1HA 2QLFB 2FDNA 4ZJQA 5D0GA 2IVMA 1H74A 3HT0A 1XQIA 4RNMA 3D67A 3OJUA 3CSKA 3BGUA 4PWWA 4V19J 1KFSA 3IC1A 5A76A 2E5HA 4QW9A 3BGRA 2XLIA 1XMQF 3VGTA 3MWBA 3X3UA 1ZZFA 4BS2A 2B9XA 2C2KB 5B0AA 2PI4A 1KBRA 4A8MP 3E51A 4ZP8A 3HDSA 1WC0A 1EETA 2NZCA 4F26A 4NLPA 2HGNA 3K5LA 4DQIA 3HJVA 4LF5J 1IKWA 3GIIA 5KFPA 5J2MA 2CQGA 4CNZA 5D8HB 3M8SA 4EI2A 3M8QB 2VG7B 4R5PB 3MM6B 4AL5A 1TV6A 1ZOTA 3BBCA 2DJWA 4WZMA 1CULB 2W2OP 5K8PA 1NB2A 1UEVA 2VFSA 2XMMA 2NSCA 2QSWA 2QMUB 4DV4F 4NZ7A 3M6XA 3NG8A 2QFJA 1U47A 3I31A 4ZS6A 5K14B 5HLFA 1LQ9A 2ZOFA 1SB6A 2K1RA 1T9VA 1RAAB 4QR2A 2DD8S 2I2YA 1H6KX 4LSLB 1WKLA 1FRJA 3MTKA 3OBIA 3W65A 4C8MA 4P6QA 4EO6A 4F04B 2HHPA 2LQ5A 1XIQA 4N8NA 1IKXB 2OPRA 2AEFA 1Y5LB 4J7CA 1Y10A 2ATCB 3TOQA 3Q86A 4WCEQ 3CDUA 1K0VA 2QLJB 4M5DA 4DR1F 1FE0A 2VPZB 4LFAF 1H72C 3C15B 3WDOA 1PAEX 2VC1A 2MZ1A 2M52A 3QBCA 5H9EJ 1JXLA 1NSAA 3LPEA 4H4OA 3SBMA 4JV5J 2WBRA 5D78A 2F4FA 2HKEA 3PZPA 3M8YA 5IT9U 1FEHA 3H5SA 4OX8A 2OSQA 2UVVA 2HW3A 4KTQA 1FD8A 1KVKA 2SXLA 1CQNA 4F2RA 1TUGB 4DL0C 4LT6A 1I94F 4LFBF 1YIJS 2BRLA 3EGVA 2W9BA 3JQJA 2Z2ZA 3EJMA 1FA0A 1HNZF 3R6LB 2HRUA 2WSFC 3LP0A 2XY6A 1NB7A 3SQGB 4WK3A 2IBKA 1E6YA 1UFWA 1RAGB 4MFBB 1YSJA 2DISA 2HNYA 4J9VA 2F8EX 4HH1A 5I3QA 1TTHB 3W5ZA 2DHAA 2ZH7A 1PCAA 4YFUA 3VAFA 4DG1A 5KFOA 5KFHA 4WFBQ 3HKZD 1NK4A 2VDIA 4URSA 3PX0A 5KT6A 1NU4A 1NK6A 1K1QA 2GJIA 1V6HA 2AJ0A 2JVOA 2CJYB 1UP1A 3U27A 3POTA 5T7LA 1SUQB 4X64J 4OLPA 1IWAA 4LSZB 2EVZA 4LIRA 4NXMJ 1EJ7L 1WF2A 1TP7A 3IM8A 4ZVHA 2BX6A 2X7IA 2V68A 2XZTB 4RW9B 3I32A 4YP3A 4F4KA 1VJWA 2DO0A 4B3RF 4ZLJA 2MZJA 1PSDA 2RS2A 2CQ2A 3AQPA 1RWWB 4CM2A 2VHGA 1S0VA 2VA2A 3FGVA 1VOMA 2LXFA 2XMTA 1GTEA 2AJ4A 3C2PA 1CJUA 2EBGA 3FBBA 4DPYA 4P9SA 3BO2A 4B3OB 3OR2A 2BXJA 4WBFA 2XMAA 1HNIA 4OX9F 2VJUA 4F0KA 2R8IA 4QIVA 2DIUA 2RQ4A 1N5VA 3PACA 2DGOA 5CZVA 1HWUA 3JSRA 2R7UA 5KG6A 3RBZA 1QVGR 2G0IA 4EYIB 4TQRA 4FS2A 3T3FA 1HR0F 2M8DB 4FVCA 1PJ7A 3MPUB 4FZVA 4ZMMA 4EK2A 3GV8B 3G8TA 2MKIA 3PRBA 1SL1A 4DV5J 1V3RA 4ID5B 1RAJA 2CDRB 2IRUA 3CJ3A 2LDYA 4NLSA 1PBUA 3D5MA 1WUUA 2KFYA 2BJEA 3H7HB 1GXLA 3GIMA 2VC0A 3M2VB 5ETLA 2DGQA 4F36A 1EP4A 2FY8A 4ZHRA 2CPEA 4ED5A 3W9HA 4J9RA 2KYXA 3SXLA 2OI2A 3GYXB 4B3TJ 3MEDB 5F8MA 2HFZA 4DLEA 2B0GA 4Q8FA 1H38A 1NMEB 3PJXA 3GZ7A 1VCTA 3P4UB 4IQXA 1U45A 5B09A 2VFRA 1RHJB 2EFOA 2NUHA 5DQGA 2BDPA 5CYMB 4C8NA 2GC8A 5CABA 1SC6A 3FQLA 2XNQA 4I6WA 3DOLB 5H9FK 4O44B 1LOUA 1N36F 1YZ6A 2CADA 5IT0A 1N88A 3RW7A 3CCJS 3MM7B 5KTQA 1HWLA 4DV7F 3QGGA 2A2CA 1WTFA 4CO1A 4ELVA 1O6XA 4CLUA 4TYAA 2A6MA 2YNHB 3R5AA 2Y8YA 1NHUA 3PRDA 2OJ3A 2VJVA 3AD7C 4UOCA 2POKA 2F4VJ 1VLOA 2RDDA 3DN9A 2FLOA 2MHNA 2HNDA 4RUCA 2K06A 1S1VA 3T1HF 1RYSA 1TKZA 1RHUB 4P72A 5AE2A 1VMBA 3JXOA 4BCAA 2AGOA 4LBIA 3DRPB 5K9FA 2XBPA 5CCMA 5KFTA 2HRYA 1JB0C 1V5VA 3QWPA 2FZKB 2C1EB 2QC3A 2JOQA 4PG8A 3UI3A 3ZNUA 4IRCA 4M5JA 2KDOA 4UOGA 3IWLA 1Q86T 3IN5A 3KK2B 3PW7A 3VQTA 1PIEA 4LQ9A 4FXVA 3D0HE 2YQ1A 2P6TA 5DQHA 4M8LA 3U7JA 3CD5A 2MKCA 4URGA 3FKBA 3T9ZA 3M9MB 1O51A 2MGZA 3PKYA 1U4BA 4KPYA 3JTPA 1REVA 3QT8A 2EFGA 3PTWA 2X3GA 3RTVA 5IOLA 4WK1A 4DU8A 1ZH5A 4OI6A 2ZH6A 3BH7B 1VRUA 4ZLPA 2IDEA 2KG0A 2W9CA 4UUXA 4QWBA 5A6WA 1KOHA 2H5IB 3ILLA 3OL6A 1VK8A 4UUWA 5HL7Q 4AL6A 2M4MA 4ZPTR 3VAJA 4PG5A 2PMWA 2WSEC 4FF4A 1APSA 2VG7A 4R5PA 2WTFA 4GVBA 3HI9A 3MM6A 2C3MA 1EQ0A 3TA2A 1SC1B 2E66A 5EX3A 4WKYA 3GSIA 3T6BA 2VG6A 2NXUA 2KXNB 3ICLA 4JB8B 2NREA 1TELA 3IS9A 3NS6A 1OO0B 3Q24A 2MJNA 4MK8A 3DDIA 1XR5A 4K4TA 4ITSA 1R3NA 4DQQA 1ELOA 4LSLA 3QGHA 3KJFB 2PSZA 3MCMA 4TNOA 4IDKB 3R97A 4ZDNA 2H4YB 4L72B 5B0FA 3SEOA 4DFMA 4K50A 4NRTA 3DM2B 3S6EA 2W4CA 3ZXWA 3QAUA 1HNXJ 5A8WA 5HATA 2ZHAA 4W98A 4P75A 2CAJA 2ZITA 3W9IA 4QZVB 4UOFA 4NLQA 4O4RA 3C15A 2BE7D 2XS7A 5D3GB 3MMBB 3GR1A 1YJVA 1KVJA 2PEHA 2MKSA 1X5TA 4N47A 1AZSA 4DV3J 4DPUA 3R5BA 2A6OA 2HK3A 3UN2A 1CC7A 1TVRB 1VQMS 1DQAA 5EN1A 4TKTA 3V6DA 4F0MA 4GKJF 4PYDA 3DXSX 1D8ZA 5ETSA 3K8WA 4JI1F 3NCRA 3R5JB 4KGKA 1IBMF 4J9PA 1EAYC 4B17A 2V8HA 4EWTA 1LW2A 5GAGU 2R7TA 1RCOB 5E7OB 4ELUA 5HMXA 3ZTQA 1K9MT 4NOHA 2B5JA 3UVJB 3P6YC 2ZH5A 4R0JA 3D3BJ 3DLHA 2KU7A 2UZAA 2QT7A 3M8PA 4MFBA 1RB0A 2Q66A 2VKRA 4CRJA 4OYWA 2NYIA 2YTCA 2GFFA 4RW4A 1S1WA 3HHLD 3NGTA 3B4DA 4MJKA 2JL9A 4NLTA 3IWNC 3KTQA 2DVIA 3NGDA 4JI3J 5J1EB 3G96A 3TRGA 4RR5A 4DR3F 1S1TA 3PHEA 1N5QA 4O3OA 2L9DA 4KE5A 4YUDA 1KC8T 2EG1A 1Z2ZA 2BW2A 1WDDA 1SUQA 4U7UK 1TL1B 3BPSP 3CULA 4DZDA 1ITPA 3Q22A 2ZUGA 2J0SD 2HHXA 3NCQA 3AD9C 2CPHA 3MEGB 1F9FA 4WXWA 3Q0AA 5F8JA 3IO1A 1U0HB 2VODA 1VQ4S 3D4JA 2XGQA 2RU9A 3D66A 1PYSB 2EFNA 2YKMB 4NMXA 1VQ7S 2V4JB 2QA4S 3UNGC 4XK8C 1S48A 1RTIB 3OR1B 1DFDA 3OXLA 1H7WA 2HPUA 1I5OB 3NOCA 5IWAF 4E8UA 2OMOA 4HEA9 1S9EB 3G6YA 3CCQS 1LWEB 4J9UE 2H5EA 5C7PA 1SC3B 2B43A 5CYQB 2QRRA 4RW6B 4P74A 1SCJB 3TUZC 4X4RA 3PW0A 4B3OA 1RT6B 3U1MA 3Q2SC 3HD2A 5GAGI 1VQ6S 1S1UB 5KG0A 2RIJA 3VZHA 3BQ1A 1OPIA 3HHDA 1T03A 4LVOP 4C48A 1B0PA 2LQJA 1REGX 2G2ZA 4KKOB 2QIFA 3AFGA 3WQPA 2CNLB 4UOHA 1JLQB 3AA9A 2XWXA 3QLHB 1QAJA 1DAXA 3G87A 4KAIA 3V81B 5IFMA 3LTOA 1SQGA 2B9YA 4CLTA 1D9DA 4FP9A 1XC9A 8RUCA 3JQKA 2KH9A 3GQCA 2K3IA 2GQQA 2XYHB 4ID5A 5EUHA 4WP3A 4B9SA 4YDXA 3KLEB 2XO6A 4CLFA 1MLAA 2G9OA 3EGWB 3H98A 4Q2LA 4NA3A 5E3RA 1WKKA 2BKNA 4JI7J 2CNNB 2O67A 4DR7J 3MM5B 2HHHF 3E01B 3MEDA 4U8YA 3EM1A 4PYAA 3FBCA 5DO2A 4DL5A 3JTOA 4BWJA 1UWAA 3P5BP 4CT9A 1Q81T 5FDLA 4USIA 3HJFA 4ILLA 4J9MA 2PI5A 1FI4A 3VF0B 4P52A 1B3TA 3N5BA 1RT3A 1GMUA 1U1KA 2KJWA 1U48A 3DHXA 3VQSA 1U1RA 4EGLA 1KKHA 1I94J 1FJGJ 4LFBJ 2ASYA 2D7SA 2KXFA 1VQ5S 3LO3A 2F9JA 3MM9B 2FHJD 2WB4A 2BOAA 4ZN3A 2GW8A 2HMIB 2CJXB 2PT0A 2YNHA 4QWEA 1HNZJ 1R8AA 2C2EA 4ED0A 4NLGA 1WWHA 3RBXA 3IGNA 4KGVB 2ROEA 2XCPA 3PYEA 2KZZA 3ZZZA 2B6AA 4C98A 4NZ6A 3S8SA 4OLOA 2QSFA 4P2SA 3ENQA 4DHVA 1RWVB 3GILA 3DRPA 2HFOA 3C6TA 2UV8A 2ZM6F 3UQSA 1NK5A 5C42A 1U0SA 5F8HA 1RTHB 5H9EK 3SFUA 2QA1A 5KT5A 3M6VA 3A8EA 1RTDA 5KFUA 2BKOA 2DNQA 2RHSB 1NPPA 4L74A 2YNGB 3BO4A 4LR7A 3CO9A 4OJGA 4PXBA 1I51B 3AT1B 2GJFA 2R8GA 3D0GE 1QE1B 1QD1A 1WHVA 4I0WA 4LF6J 4USWA 3VVUA 1EIYB 3B78A 3KHRA 2ZC3A 4RUHA 2E1CA 2I8EA 3OHBA 1KSPA 4NI2B 3PIPQ 1FERA 4U7UD 4DQSA 3W2VB 2JH3A 2IRYA 1HD0A 3DLEB 2FHJA 1S10A 1X9MA 1K0TA 3MGJA 3CC2S 3SCIE 5EWGA 1VQPS 3MDFA 1R0CB 2P8IA 4LRDA 3JAMU 5G4DA 4A8WA 2VOOA 5A0YA 1LK7A 1HW9A 2ZKTA 2J7KA 2M7SA 4YY3F 1NDPA 3OSNA 1YRXA 1RUSA 3D9BA 3ZTPA 2DRBA 3LF0A 2FJXA 2EEYA 2VPWB 4QCLA 4OX9J 2BJ8A 1Q5YA 1U25A 2RSQA 3KJNB 3QNWB 3PFOA 4DFKA 1VRTA 4EO8A 3RB4A 4DX7A 2RQCA 1FKPA 4LF9F 1AROP 5F9NA 4IOBA 2B3TB 1Z4UA 2IVYA 4J9QA 3QMQA 4USUA 2QJ3A 3NGRA 4IDKA 1SKSA 3QATA 3CJQA 4CYUB 2P6SA 2YWWA 1N32J 3K2YA 3DM2A 2R9LA 3W62A 3ENAA 1KLMB 2NS1B 2HFVA 1RI7A 3S1TA 5HMYA 4Q43A 1IKVB 3KLGB 1T3OA 1S49A 4LJMA 3ITHB 5F8IA 1WHXA 2UV8G 3OSPA 4XAKA 5D3GA 5EWEA 1NJWA 4CH1A 4Q45A 2ALZA 2DGTA 2LYVA 2HQDA 1NBEB 3LOUA 5T41A 2GGPA 1TVRA 1KWMA 1SKRA 2HG4A 1CC8A 3RRHA 2Q1LA 3QIPA 3HZGA 4QR0A 1S77D 1P1LA 3R2CJ 1RLCL 3AB4B 1WORA 2UXBJ 2E5GA 2YH0A 4MH8A 2BRKA 1IQZA 1AB8A 2G1HA 4UF4A 5BYRA 1NK9A 1SV5B 3MD1A 3RU0A 1GK8A 2YNFB 2C3OA 3CIZA 4RUBA 2AU0A 3UVJA 3CCWA 4K4YA 4KGXB 2KKHA 2FGOA 4BWMA 3D6FB 4EZ6A 4DV7J 1SJQA 4F3MA 2I9SA 1C1BB 3PYFA 4K7QA 3WBZA 4OX6A 3DLGB 4IUFA 4OYBA 3GJQB 1ZAWA 3OL9A 2OEJA 2FB0A 2PO4A 4JI2F 1URNA 4OJHA 1HBOA 4FNIA 1XK8A 2MLYA 4XTTA 4WU3A 3V4MA 1BQNA 3FFIA 1OYDA 4I64A 2RQMA 4Y28C 2C2DA 1JLGA 2KZMA 4DLGA 2GO8A 3I0SB 4NX9A 1ZM3A 2W1BA 2J6TA 4IG0A 5G0RA 1C4AA 4DL2A 3NGKA 1VQ9S 1HQUB 4FYXB 2IM0A 1JLBA 3GLJA 1LW0A 1S6PB 3AH6A 1HMVB 2CDQA 1HYSB 3H5UA 3VAHA 1PYTA 3MEGA 1NNDA 2Z58B 1WF1A 1Y3KA 1U0HA 2P9EA 2GV1A 3NAIA 1FDAA 4X4TA 2YKMA 1VRQC 4B9UA 3Q8PB 2LFVA 2VL1A 2V4JA 4CQ1A 4LF7F 3EX7B 4OIXA 1VIOA 1RTIA 4QYZK 4QWCA 4O0IA 2WOMB 2CWKA 3C14A 1LWEA 2UU9F 2EWHA 3MPDA 5CYQA 4QIGA 2UUAF 2GVZA 2L3MA 2WZ1A 3DRSB 4Y6IA 4C0OC 4ZK7M 2W8LA 2H3EB 2NLWA 1AFJA 3MM8A 5DETA 2VONA 3TX8A 3CJKB 3FJ2A 3OHAA 3THTA 1TK8A 4KHPF 1Q0NA 3RR7A 2EC0A 1VFJA 4TN2A 4DR5F 2ATLA 3QLHA 4ZPAA 1H2VZ 5HQ8A 3FK4A 1Q5VA 5I42B 4P2FA 4WE1B 4OX7A 4MYUA 3AJDA 3ZTRA 2FJDB 5KFWA 1GH8A 3GE9A 2XY7A 5B0EA 4ZVPB 3MPWA 1WSRA 4DSLA 3LP1A 4ANCA 1RA6A 3EYZA 1XTZA 3RGIA 1YJTA 4P7TA 2D3ZA 3VCDA 2OKQA 3W1YC 5LJ3Y 2HZVA 2R2UA 3KHHA 4WP8A 3NNAA 4J5OA 3ZZTA 2VZ9A 3JSMB 2MQMA 1ZM9A 3LUYA 3TANA 1YJ7A 2MZSA 4X4UA 2IHR1 1M1GA 1GQEA 2ASLA 4ZCKA 3N79A 2FVCA 2JRSA 4WYLA 2MQPA 3ZNJ1 4BDPA 4IRDA 4B9TA 4JI8J 5C24B 2VV5A 4C11A 3CCLS 2KYZA 1S6QA 4MKVA 1IM4A 4IQMA 1SL0A 2CXEA 2V5HG 2VQFF 3FQKA 2ZUAA 3GSDA 4E98A 3CW2C 4JI1J 3KK3B 1GMWD 1IBMJ 4ETXA 1OPZA 1G1XA 2C2ZB 2KXHA 4ICLB 1JWWA 4NCGA 2MQ8A 1BY9A 3TZZA 1B64A 3K5NA 1W26A 2XZDB 4K8RA 1KHWA 4KQZA 1UWBB 4J90A 4GMKA 2D9PA 4CO3A 3PM9A 1LFWA 1NO8A 4WFZA 2C28A 2CPZA 4ZVQB 3R5CA 1F60B 2PE8A 4E0DA 2QMWA 3GMGA 4D3GA 2FLPA 2KN4A 5L8RC 1T9TA 4IH6A 2XLJA 4AXIA 2AWZA 2EG2A 2V94A 3WIUA 1UPPA 4LMZA 2WVDA 2RB7A 1FKOB 2DO4A 5J2PA 3R7NB 4U6PA 4CCHA 5HJXA 4ZP6A 3VAIA 3DU5A 3M30B 4I69A 5IV4A 1UEKA 3P45B 3CMES 2YNGA 2IYIA 2J7UA 1Z2LA 3GONA 2F65A 1FF2A 2XHWA 4W90B 1F3VA 4C6AA 2B51A 3RJMB 2ACYA 1N0VC 1NSPA 2R2TA 1NJYA 1QUPA 4X2BA 4F7VA 1OQ6A 1OWXA 3P8BB 2QTWA 3W2VA 3AOAA 1GMWA 3DLEA 2IAJB 3BB5A 4F4ZA 3TARA 2WHOA 3LW5C 4MMOA 3H5YA 1WEXA 4N56A 2J0QD 3WX8A 1RKJA 5AJ3J 1M5HA 2HBQB 1RGVA 3HHKA 2E5LF 1DQ8A 4KV8B 2HFNA 4DR6J 4Y2CA 4WTOB 3M32B 2NXCA 6AT1B 5LM7E 3NRBA 3QT7A 1OIAA 2CZ9A 3ZZPA 4G65A 3EPIA 5KAKA 2GAHC 5HN0A 3CXCR 2HVIA 3C46A 4C2MA 4Y2KA 3IBFB 5HMWA 3EXYA 1DTQB 3VR1A 4KSEB 3MR7A 1BHNA 1FDNA 1F6TA 2KFNA 4LF4F 1HWKA 2GVDB 2QZ8A 1OQ3A 3PFEA 3I0RB 4CYUA 2K8GA 1SIZA 2W24A 3MMAA 1KLMA 1YITS 1Y5IB 4YHHJ 1L5UA 2DGUA 2KRBA 1J5OB 1X4CA 3RRGA 1UCNA 3KLGA 1MU2A 1X4HA 2YX1A 2J8SA 1SJFA 2CG8A 1VBXA 1MSWD 3EZUA 2MKKA 4HACA 1YVFA 5KT7A 1V5IB 1O8BA 4ES2A 5FLXY 1UVJA 2AGQA 1OY6A 4KYZA 2H65B 3RUBL 2HS0A 2HHHJ 1YTYA 4ID8A 4OYZA 2HK2A 3ISZA 1P9YA 2E9TA 2N7YA 4RNHA 1TZ0A 3CPWR 2K7JA 1X4EA 3NWRA 4PWDB 2MZQA 2XI2A 3V6JA 3KLIB 2WAQD 3HT3A 3EUNA 3MCOA 1TK0A 1HBUA 4DX6A 1SV5A 3I87A 3OFEA 2XM3A 1GAOA 4KFBB 1O5JA 3EZ5A 2IJFA 3A12A 4RLEA 4DR2F 2Z2YB 1CJTA 5HP1B 1XNRF 1N0UA 3ET6A 1F5CA 4R0EA 3UN5A 3RZAA 4ZVSB 2EKNA 2M8HA 3CVKA 4NYPA 3D28A 4OYOA 1FT8A 3VAGA 1S9FA 4YR2A 2RILA 1NKEA 3OT9A 2J7WA 1JLAB 3TVYA 2LA4A 5LSRA 4RU9A 4B9LA 1MMLA 5CYJA 1WACA 5IQQA 2RJZA 1CBKA 4ZPBA 1RT1B 4OFZA 4NRUA 1T9WA 3IAM9 3NOGA 5GADU 1NUEA 1T95A 2X1AA 3THVA 1HQUA 1J5EF 1JMTA 3MUMP 3H0PA 2X3DA 1S6PA 2ZM6J 1RWPB 2MDAA 1HMVA 3RAXA 3V2UC 2XULA 2CZVC 4OYIA 4X4OA 3DMJB 2PIIA 1MWYA 4OI4A 4TY9A 3RBEA 1JQGA 1FWLA 3BZQA 3M1VA 3M7VA 4GRSA 3ZFVA 4I1TA 4AFFA 3FMBA 4ZVFA 1KDNA 1IVZA 5KFZA 3OJSA 1MG7A 1XJWB 3DDKA 1HHTP 3HVTA 5E5NA 4LF8J 3G82B 1DHMA 2WOMA 1XR6A 2HWIA 2QA4G 1IKYA 2QN6B 2FYXA 3H59A 4KY3A 1XERA 2HLUA 2JC0A 2B7CB 3IM9A 3IGVA 3UO0A 4J9LA 2DK2A 1RABB 1LWFA 3T9NA 2IC3B 2XTJP 4KIAA 2R3VA 4BHQA 2E5IA 3IR7B 2OHDA 2CNOB 4Z7CA 4ECZA 2Y1LB 5HI7A 3AOBA 1U1LA 3BN4A 4K2XA 3N5FA 1MROA 2CKWA 4KC5A 3T19A 4MK9A 2OH2A 4C9DA 5J2NB 4CLZA 3HO1A 2G0CA 1UZHA 1SC4B 4ZKAA 4R8UA 2R7QA 4B9NA 4DCPB 1CJKA 2MKHA 3JQMA 3RB6A 1NJXA 4UW2A 4LF9J 3NCPA 5DLGA 5DM6Q 2BOPA 4V19X 4OYAA 3HVRA 1VQOS 1FO1A 1CS4B 1ZYQA 4CNYA 4NLYA 4RL1A 5GADI 4DF4A 4RWXA 1IBKF 2Y1JA 1F2GA 3TZXA 3JYTB 1RSCA 3DOMA 1X4GA 4J37A 3AB2B 2J9EA 1VQ8S 2UXCF 2YKAA 2P9GA 4K4SA 4ILMA 4PXDA 1QY7A 2HVHA 2V8VA 3JSMA 2E7WA 5KFMA 3RR8A 2AZ1A 2VG5B 1HQ2A 2CG4A 4DUZF 4S0MA 3F0NA 5ETRA 2AX1A 2NPFA 1Y5NB 3DC2A 1RLDA 2BACA 1Q8KA 4UTGA 2XQCA 4OI1A 5C24A 2HQFA 1SKUB 4RW7B 1HBMB 1SQEA 3HFKA 4DPXA 2E9ZA 4WKRA 2PGCA 3KK3A 4MIWA 2JEFA 4B3MF 2O1PA 4O0NA 2CPFA 3HSZA 3W5XA 2FVRA 2ZBQA 4F3OA 3ISNC 2LMIA 2DYAA 4O4GA 3MEEB 2HBZB 4Y2IA 3T5LA 1UAWA 4TVAB 1KP6A 2CQ4A 3OL7A 1F0XA 2JEIA 4HH0A 4OZ0A 3UDCA 2WVEA 2VASA 4AXJA 5DGBA 1UL3A 2HQIA 1QLNA 4JI2J 3AJ1A 3H25A 1FRXA 2PEBA 1MN9A 1T11A 4K4ZA 1HL6A 5LSLA 1F1BB 1T8EA 4A8FA 5K8NA 3SI8A 5HO4A 3M2UB 1U09A 5HAOA 1D8YA 2V63A 2M0GB 2R8KA 2FPHX 3W61A 2IM3A 2BUNA 2R7VA 1S72S 4CLSA 1YDLA 1YWXA 4NL5A 1HQEA 1PJ5A 1N5SA 3QZ8A 1IR0A 3MTJA 4CLYA 1CQMA 1RK8A 1U1QA 4OI2A 4DBQA 1VK3A 3NLCA 1Q4RA 1W2IA 3QWUA 2QYGA 4KV8A 2UU9J 3M32A 4DN0A 3LGMA 1GT8A 5MAOA 3AA8A 3GIKA 3FMWA 3MHYA 2V69A 3FRZA 4FYWB 1PAUB 2ZH1A 1Y00A 2RQKA 4FNHA 2BE2A 1YLXA 2HBRB 1JLCB 4L73A 3J7ZT 5KFAA 5KT3A 1DTQA 4PPDA 1CG2A 1Q7LB 2DPJA 1Y4ZB 4JI4J 3ZO7A 3TAQA 2GHWA 5ETTA 2RUGA 1XMOF 1J2VA 3PW4A 3KWMA 3TO8A 2YWGA 4WFAQ 3QSIA 1EX8A 1LNQA 5FD1A 3I0RA 1UVMA 4CLWA 2YPYA 3T5KA 4I67A 3UD3P 2VUGA 2XNRA 3QYYA 3EGNA 3KFWX 2UUTA 3J7YU 1S4FA 1ZA2B 4C4WA 3IBCB 3ADAC 1H2TZ 4ZVOB 3MUVP 3VZIA 1JJ4A 4K0KJ 5LMNJ 4B3SF 3OVAA 4L3KA 4WTYA 4D3HA 2N4DA 2YNIB 4PUOA 1SJ4P 1U02A 2CPIA 2VPYB 3SV4A 3EVMA 3SDEB 4JI5F 4EBEA 1NKCA 4YS2A 5KFVA 5T14A 4JYAF 2OPQB 3GYGA 1N48A 2U1AA 4IO1A 1TQLA 4QIEA 5ETNA 2ALYB 5F8NA 5K20B 1CPZA 1UVLA 4X66F 1YRTA 4Q2MA 4QIWD 2FVPA 4RW8B 3EDRB 4NXNJ 1RT2B 4PWDA 4DSFA 2GQ2A 3KLIA 2A1BA 3M2RB 4QIFA 2D3UA 2OPSB 2RRAA 2W4PA 3RB0A 3V5RA 3HULA 4ZCLA 4DX8H 4KRWA 2XYPB 3CE8A 3BH6B 2PA8D 1IUJA 3I56S 2ACMA 4ZIVA 5HP1A 5C5JA 1D3WA 1JLEA 5A8KA 4NE9C 4OZ5A 2UP1A 3HX9A 1UETA 4KHMA 2MXYA 4DSJA 1ZS6A 3T5HA 2VBWA 2CJBA 3H2LA 1ROFA 3US5A 2ZEJA 2WW8A 4C3MA 2WSCC 3JSYA 4WPAA 5HROB 1S9GA 2Z57B 2DNRA 2FHKA 3K57A 2AYEA 3AAWB 1HI8A 2IM2A 2FJEB 2RKIA 2A2DA 1TK5A 2RH3A 3J7YI 3RYLA 1OSDA 5KFIA 1Q82T 4C8OA 3C6UB 4IOAQ 1IN0A 3BDPA 4QYRA 2IRXA 4EUVA 2BJ3A 3HVWA 5U47A 4Y00A 1IBLF 3DGPA 2JNJA 1EKSA 1RDRA 3DNCA 4LFCF 4NLRA 4GKKF 1HA1A 3KLFA 4CTAB 4GVLA 3OUYB 5F0UA 3FZBA 5KG1A 2GIQA 2W2QP 4PG7A 3ZC4A 3IWXA 5C25B 1BXNA 3GV5B 3G82A 4G3IA 4KO0B 2MQQA 3FBFA 4ZA1A 2F5GA 1P1TA 1YKWA 1UJ5A 3MD3A 3IRXA 1U26A 2HVEA 3TUJC 5KFQA 5HVFA 3OVBA 1S1XB 2Q6BA 3QFWA 2YBVA 3UWTA 4AE5A 4A8QA 2XS2A 4A8OA 3I4PA 1R89A 1P6TA 1S76D 1JIHA 1D1UA 2ZNZA
chains in the Genus database with same CATH topology
4QU7A 4G1IA 3SZ2A 3OFHA 5F8HA 1RTHB 5A0YB 1T02A 2ZHOA 2WRMA 2ZJQQ 3EGZA 3SFUA 2QA1A 3J7Z5 5KT5A 2VFUA 2APOA 3C6UA 3IG1A 4C0HA 3L3CA 1GX5A 2W9BB 1C1CB 3M6VA 5E3QA 2R2RA 5I3PA 2BQUA 3A8EA 3CIMA 1RTDA 1FXDA 3PNIA 5KFUA 2JEGA 2DNQA 1MMDA 4HI2A 1S7HA 2LDIA 1NH7A 4FPRA 3LWMA 3S01A 3MM9A 3OW2R 3PO5A 2YNGB 2ZC4A 3BO4A 1HD1A 3W2WB 2HMIA 2HYIB 3CO9A 4OJGA 4ECUA 1X4DA 4Y2MA 4KGMA 4BBYA 2UVRA 4PXBA 4IFYB 1C4CA 4IRKA 1S0NA 5THWA 4DV6F 1FXLA 1UJ6A 2N3LA 2E1AA 3GFZA 1NK0A 2ZVSA 4QW8A 4CTAA 3N4WA 1VRTB 2R8GA 3D0GE 1QE1B 4ES3A 3OUYA 4R25A 1WHVA 5L9NA 3C8YA 1FKPB 4I0WA 3KOAA 1RKIA 2PMZD 3G6VA 5JVGQ 5C25A 3A1YG 1K1SA 4F3QA 4KO0A 3B78A 3KHRA 3VAMA 1JKHB 4DV2F 3PVXA 1N56A 1AW0A 4NWBA 2JFKA 4LF5F 2ZC3A 4C8YA 1V3ZA 1UA1A 1H2UX 1UEUA 4RUHA 4ZCIA 2AF6A 2E1CA 2I8EA 1DURA 2GCFA 4K4WA 2ZOGA 3OHBA 3TVKA 1KSPA 1Q8IA 2LXIA 1FERA 3PIPQ 4DQSA 3W2VB 2C42A 1RYRA 2JH3A 1RT4A 3WZ0A 4IFVA 2IRYA 2I0XA 2XGPA 1M5PC 3Q8SB 1HD0A 1DARA 1T05B 4WFNQ 3DLEB 2FHJA 1S10A 3I9ZA 1X9MA 1K0TA 3MGJA 1X4BA 1HBNB 2IA0A 3DRRB 4TXSA 5KFFA 4QWAA 2CQDA 3CC2S 3SCIE 2F7VA 4A48A 2A18A 7FD1A 2F1FA 2N4CA 4OZ1A 4J9KA 2GHPA 3GG1A 2NUUG 1OSCA 5EWGA 1KHVA 1VQPS 4A46A 3IR5B 3MDFA 2BZ2A 1R7IA 5KOXA 5G4DA 4A8WA 4IO9Q 4Z2XA 1RTHA 2VOOA 5AE1A 5A0YA 3MOZA 5FJ4A 1LK7A 1SIWB 1HW9A 1XN9A 2R8HA 2ZKTA 2J7KA 1YJNS 1CVJA 2VBYA 4O3RA 2M7SA 2VBZA 3PY8A 2NQPA 3POTB 5KFKA 1C1CA 3BGLA 5H1SV 2E7XA 4PCQA 5T7LB 4YY3F 1Y0HA 2GQCA 2OD6A 3FRYA 3OSNA 1YRXA 2EK1A 3BREA 5LJ5Y 2MSSA 3BQ0A 2DRBA 1YRUA 2QMXA 4EBCA 2BM0A 3LF0A 3B82A 2I5JB 2FJXA 2DCLA 2DHSA 2VPWB 3HHEA 3OXFA 5DDQC 4QCLA 2AJ1A 2B4PA 3W7BA 2KHDA 4NCAA 3GFHA 1U25A 5L39A 2VG5A 5JJBA 3MFHA 1VC6A 5CD4H 1Y7PA 2RSQA 4C8KA 4OI0A 3QPIA 4NLWA 3PFOA 4DFKA 1VRTA 4EO8A 1RWUA 3JB9k 1D9FA 3RB4A 1QE1A 4ECSA 3H2VE 1G7CB 3UFCX 2RQCA 4DQRA 1TKXA 1FKPA 2FLLA 4C3KA 1AROP 2GGPB 4LF9F 3Q2TC 4WFXA 4JI8F