3KLIB

Crystal structure of unliganded azt-resistant hiv-1 reverse transcriptase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 103
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kliB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB03
4K4VA 3LAMA 4RNMA 4J9MA 5F8MA 4XPEA 1SH0A 1UWBB 4B3OA 4R8UA 2R2TA 3KLVA 2FJVA 3T5JA 1S6QA 5D3GA 4WFXA 1R0AA 5KFYA 2CJQA 2FLLA 1SUQB 2EC0A 4XO0A 2RDJA 3CO9A 5L1IA 4IH5A 3EPGA 3T5LA 5KFLA 3KLHA 5DG7A 2VG6A 4OL8A 1K1SA 5KFIA 3Q8PB 1RDRA 1KHVA 1RT7A 3FFIB 5KFQA 3QGIA 2OPPA 1Z4UA 5KFJA 3NGDA 3MR3A 1NHVA 3CJ4A 3CVKA 4YMEA 5HBMA 4K4WA 1JLQB 2WTFA 4Q8FA 3MEGA 3NBPA 1N5YA 2O5DA 4TYAA 5EUHA 2OPSB 5J2MA 5DG9A 3E51A 3H2LA 2W9CB 1HMVA 3MEEB 5J2NA 4TN2A 4ID5A 5KFEA 4YP3A 3GV7B 4HYKA 4KHRA 1LW0A 2IM2A 2C28A 2F8EX 2XCPA 1FKPB 1RT5B 4R5PA 5HP1B 4KV8B 4TQSA 1TKXA 3PR4A 4Y2CA 5L1LA 4EBDA 1S9EA 3M8QB 5FDLB 5KT7A 1RT4B 4PQUB 4URGA 2W7OA 3OLBA 3LANA 3V6HA 3MR6A 3PW0A 4WXWA 3BJYA 1SH2A 1S1VB 4KKOA 2IJFA 2ILZA 4G1QA 3NMAA 4IH6A 3V81A 1TL3A 1RTJA 3DI6B 5EWGA 1RTIB 4MFBB 1SV5A 4ZVGA 3QIPB 2YKMB 4QWEA 3LP1B 5KFRA 4IG3A 4DG1B 1S49A 5JUMA 5K14A 2AGPA 2VG7A 5C25A 3IGVA 2FVPA 4J9LA 1S0MA 4WZQA 4NLDA 2C2EA 4ED6A 1HQEB 4RUCA 1TV6B 1MU2B 1EP4A 1RT1B 1S0OA 2BQRA 3BR9A 2R2UA 3PW7A 5KFWA 3OSNA 4TXSA 3CJ2A 1RYSA 2HMIA 4RW8B 2YNGA 1ZTTA 1YVFA 2E9ZA 4LSNA 3KMQA 1FKOB 3DLKA 1S4FA 2V9WA 1S9GB 2W9AA 1XR6A 4KAIA 3H98A 1IKYB 1RT3A 4QWBA 4F50A 1S97A 3I0SB 4WZMA 4NLQA 4ECTA 2W8KA 4J9OA 1HNVA 1D1UA 5C24B 1S1TB 3BREA 2ZE2A 4NCGB 4ZVFA 4ZHRA 4NZ0A 3SFGA 3H5SA 4ED3A 5C42A 3MF5A 1HPZB 4RNHA 1SH3A 1TQLA 4G3IA 4H54A 3RBEA 1GX5A 1REVB 1C0TA 3DLGB 1IKVB 4IH7A 3GIMA 4DL3A 1DTQB 3JSMB 1S1WB 2R8KA 3I0RB 4KFBA 1LWFA 3KLFA 1ZETA 2W9BA 3NAIA 3T5HA 1S1XA 3QO9B 4F4WA 1QAJA 3Q8QB 5F8LA 3KK1A 3IN5A 2WONA 4IR9A 2R2RA 4H4OA 4KE5A 2AX1A 2FVCA 4RU9A 3PR5B 2OPRA 5F8JA 2QE5A 3HHKA 4JUZA 4ED7A 1ZTWA 1JX4A 3CDWA 1JLFB 1TL1B 3C6TA 2XGPA 3CJ5A 1DTTB 1S48A 3KLGB 4Q0BA 4Y3CA 1IKXB 2R8HA 3DOKA 5J2QB 1C2PA 3GQCA 4J9PA 3MEDB 4PWDA 3KK3B 4Q8EA 1N6QA 2IBKA 2R2SA 1LWEA 3QYYA 1JLGB 1JLCB 5DQGA 2IJNA 2YNIB 3LP0A 2B43A 3G86A 4MKBA 3C6UA 5KFZA 5KG3A 5DGBA 5DLFA 4JV2A 2QV6A 4WFYA 4ZPBA 5KFNA 2R8IA 5F8NA 4MK8A 1JKHB 2C22A 3IS9B 5KFXA 4F4XA 3Q8RB 4NLXA 4EO6A 3T5KA 2OPQB 4EBEA 1HQUA 2IC3B 1C1BA 3ITHA 3V4IB 4RW4B 5KT5A 3DRSB 4KO0A 1T03A 2IAJB 3DMJA 1T3NA 1S6PB 3N6LA 4QW8A 1T05A 1VRUB 4NLUA 3ISND 3KHHA 2J6UA 2I5JB 2VA3A 1WNEA 3IG1A 3QLHA 3MR5A 1KHWA 5KT3A 1JLAA 4QWCA 1R0AB 3BSNA 2R8JA 4DL2A 2VG5B 3IRXB 3KLEA 3RBDA 1VRTA 2XGQA 2ZD1A 2RKIA 1LW2A 2RF2B 3GV5B 1RTHB 3GYNA 4WE1A 1RTDB 2FVQA 3MECA 4K4SA 4H4MA 2XWYA 3V6DA 2WCXA 3I5AA 2CKWA 3H5YA 4PUOA 4Y34A 3KJVA 3BSCA 4ED1A 4RW9A 5J1EA 1DLOA 1RT2A 4I2PB 3QGHA 4O3PA 4TY8A 2BE2A 1HMVB 3T1AA 1C0UB 4I2QB 4ID5B 3H4BA 4DL5A 5CYQB 4IFYA 1XR5A 1EETA 2YNFA 2BQUA 1HARA 1NHUA 3KLIB 3EPIA 4ECUA 3DRRB 4URQU 4IRDA 5HLFB 1IM4A 1TKXB 1S9EB 1UWBA 4F4YA 3NAHA 2W7PA 3KHLA 1SUQA 1S0NA 1QUVA 5KT4A 5L1JA 2FJXA 3G6VA 3QIDA 3FFIA 4DL7A 1JLBA 3V81B 1RTJB 3N6MA 4M95A 5L9XA 1JLQA 4Q43A 3V6JA 3OL9A 3DYAA 4ZP9A 3T19A 2OPSA 1D0EA 1W25A 2ATLA 4TLRA 3OL8A 5K14B 5C25B 2W9CA 1GX6A 3MEEA 2ASJA 5KG4A 2JEFA 4K4UA 2R8GA 2JEIA 3LP2A 1EP4B 4IFVA 2WK4A 3I5BA 3SFUA 3GIIA 1TKZB 1FKPA 1RT5A 3ICLA 3QGGA 5HP1A 4KV8A 4J9KA 2YNGB 4NLGA 5FDLA 5KFKA 5DQHA 1RT4A 4PQUA 4URSA 3DRPB 2RDIA 4IKAA 3DLEB 4NRTA 3TVKA 5KG7A 3RAXA 2HAIA 5KFCA 3DM2B 4GC7A 1QE1B 1S1VA 4KHMA 4R0EA 5KG5A 4IG0B 1N48A 2JEJA 1HNVB 5KFVA 4ZMMA 2ZE2B 1K1QA 1N56A 3DI6A 1C1CB 1RTIA 4O3NA 4MFBA 2WB4A 5KG6A 2UVVA 1S1UB 2HNZB 3GIJA 1KLMB 2YKMA 4ICLA 3LP1A 2GIRA 4DG1A 4O44B 2W8LA 3OL7A 3E01B 4J9QA 1RT6B 4NLWA 4IDKB 3UQSA 2BANA 2XCAA 4KFBB 1TV6A 1MU2A 1RT1A 5HROB 3FSIA 4O4GB 5I42A 3QZ7A 4EYHB 4YR0A 2UUWA 2W9BB 1FK9B 2AWZA 1RYRA 2XI3A 3Q8SB 4FS2A 3SI8A 1S1XB 4RW8A 1J5OA 2WONB 4RW6B 4YR2A 4MK9A 1BQNB 2E9RX 1T94A 1S9GA 3RAQA 2AX0A 4RZRA 2C2RA 1IKYA 4O3OA 3LAKA 4IR1A 3PW2A 3H5XA 2B6AB 1MMLA 3C6TB 3PJWA 4Q44A 3G6YA 1QAIA 4K4YA 4FBUA 3GIKA 2JC1A 2HNDB 1S1TA 4NCGA 4J9NA 2AU0A 4WXOA 4QPXA 4ECZA 2ASDA 4NLOA 2JEGA 3KK2B 3QZ8A 1BQMB 4PWDB 2B5JB 2YKNB 3DOLB 4LSLB 4EEYA 4RNFA 1REVA 1N6QB 5DG8A 2IMWP 4NRUA 1IKVA 4EBCA 3LP0B 1DTQA 2WOMB 3JSMA 3I0RA 3BGRA 3BQ0A 3KOAA 1HNIB 3MFIA 5F9LA 5DQIA 2FVRA 4RNNA 1U09A 3JYTB 1IKWB 3QO9A 4ED2A 2WRMA 3HVAA 2JC0A 4XPCA 1S10A 1C1BB 4ZPDA 3EZUA 4RW7B 3TAMA 4I7FB 5EDWA 4KO0B 1T03B 4ZPCA 5KFHA 1LWCB 5KFBA 3DMJB 3GILA 4O3QA 1JLFA 3HVTB 1JXLA 2J6SA 2I1RA 1HYSA 2BRKA 3UR0A 5CYMB 2OH2A 4MH8A 2HNYB 1OS5A 3KLGA 2YNHA 1RA6A 2HWHA 3HKWA 1TKTB 2DPIA 1IKXA 4NYZA 4J9RA 5J2QA 4IQXA 1JLAB 3I5CA 4FS1A 3MEDA 5I3UA 1RA7A 4R8UB 2UVWA 4B3OB 3M8PA 2JLEA 1S6QB 5D3GB 2ZD1B 4K4XA 3PZPA 1S9FA 4ED8A 1JLCA 2WHOA 1JLEA 4LQ3A 3KLHB 2HWIA 3MTKA 2VG6B 4K4TA 1CSJA 4NLSA 5DLGA 3PHEA 1RT7B 4DL6A 1JKHA 2OPPB 3V6DB 2OPQA 5HBMB 1TP7A 4NLPA 5J1EB 2BR0A 3UDLA 5KFMA 3MEGB 2IC3A 4TY8B 5C5JA 3NBPB 1N5YB 2IA6A 2ZKUA 5J2MB 3V4IA 4RW4A 4RUAA 4IFYB 2BRLA 5KFTA 1S6PA 5J2NB 4U6PA 2YNFB 4KB7A 1LW0B 1VRUA 2FVSA 3IGNA 4WYWA 5EWFA 3BQ1A 5J2PA 5KFAA 2I5JA 4TQRA 4R5PB 3H59A 3RB3A 4HKQA 1TVRA 3DDKA 2VG5A 3IRXA 2D3ZA 3OSPA 1JIHA 3FQLA 3CJ0A 4NLYA 2FJWA 4X2BA 2RF2A 1RTHA 4ECYA 3UPFA 1RTDA 4WFZA 3RB4A 4KKOB 2UVUA 1JLBB 3NL0A 4G1QB 4IOBA 3DYAB 1TL3B 2V4RA 4I2PA 1SV5B 3M9MB 4ZVHA 4K4ZA 5JXSA 5KFOA 4KSEB 3TQ1A 1C0UA 4I2QA 4IG3B 3PW4A 4RNOA 3LP2B 2VG7B 4IFVB 5CYQA 4WYLA 3CJ3A 3KHRA 3KLIA 3DRRA 5HLFA 5F9NA 4YR3A 4ECSA 2XI2A 3CWJA 5L1KA 4IRKA 4LQ9A 2HMIB 3KHGA 4QWAA 3M8QA 4LSNB 4DL4A 3FDSA 4K50A 3DLKB 2C2DA 4JV1A 3M9NB 2ILYA 3H40A 1RT3B 3CDUA 2IM1A 3LALA 4Q45A 3MR2A 4ZHRB 4ICLB 4O3RA 5C42B 4F4ZA 4NLVA 3QIPA 2D41A 3NKYA 3OHBA 1I6JA 2BANB 1C0TB 5I42B 2ALZA 2IM0A 4ECRA 1TKZA 2UUTA 2D3UA 3BQ2A 2DPJA 1HQEA 4ZP6A 1LWFB 3KLFB 3RB6A 2AQ4A 4O4RA 1J5OB 3G6XA 5KT2A 4M94A 4YQWA 2VA2A 2D7SA 5KG1A 4GC6A 4O3SA 3DRPA 3KK1B 4EO8A 2XC9A 3MFHA 3DLEA 4ECVA 4H4OB 1FKOA 3DM2A 2OPRB 5KFUA 1QE1A 4KBIA 2FLNA 5KFDA 3V6KA 3GV8B 4IG0A 4MIAA 4DEZA 5F8GA 3I0SA 3CDEA 1RAJA 3CIZA 5DGAA 5KFSA 1C1CA 3M9OB 5C24A 3KMSA 1S1UA 2HNZA 4Q0BB 1KLMA 3N6NA 5F8HA 1N4LA 3DOKB 4O44A 1HPZA 2AGQA 4ECWA 2E9TA 5KFPA 3E01A 5F8IA 1RT6A 4QWDA 4IDKA 2V0NA 4NLTA 1LWEB 5HROA 3BGRB 5KFGA 3DLGA 4ECXA 4O4GA 1FK9A 1S1WA 3C6UB 2FLPA 3D28A 3D5MA 3PW5A 3ISNC 4RW6A 2IM3A 4J9SA 1BQNA 5T14A 3TAMB 1HQUB 5KT6A 4FBTA 4MKAA 2AGOA 3ITHB 4U7CA 2B6AA 3RB0A 1HYSB 4JV0A 2ASLA 3OLAA 2HNDA 2V4QA 2YNHB 1TL1A 1T05B 1XR7A 4EYIB 5EWEA 1DTTA 3KNAA 3IG1B 5I3UB 1BQMA 3QLHB 2B5JA 2YKNA 3DOLA 4LSLA 3M8PB 3KK2A 4MK7A 2BQ3A 3OHAA 2GC8A 3PVXA 3KLEB 3OL6A 1JLEB 3KK3A 1VRTB 2WOMA 4ZP7A 2RKIB 1JLGA 1LW2B 3BSOA 2YNIA 1HNIA 4WE1B 2GIQA 4ECQA 4MIBA 3JYTA 4TY9A 4IRCA 1IKWA 3MECB 3H5UA 4H4MB 4QW9A 3IS9A 3H4DA 4ZPAA 3FQKA 4ED0A 4PUOB 4NLRA 3KJVB 4RW7A 4RW9B 1DLOB 1RT2B 4I7FA 3FRZA 3HVWA 1NNDA 1LWCA 5KG2A 5KFFA 2BE2B 4ZP8A 5KG0A 3HVTA 2UVRA 3DRSA 3PJXA 2IAJA 3BSAA 3VQSA 5CYMA 5J2PB 2HNYA 1EETB 4Y2AA 1TKTA 2J6TA 4TYBA 1TVRB 4ZVEA
chains in the Genus database with same CATH superfamily
4DFJA 4RNMA 2F4VF 1RB0A 2W4PA 2R2TA 2FJVA 2MPUA 4WFXA 3MMAA 1SKRA 1J5EJ 2OPPA 4KR0B 4WFAQ 4HLBA 5LMNJ 1JLQB 5DG9A 2B8QA 4YP3A 4TN2A 4HYKA 2MY7A 3D6HB 2AHOB 3JSRA 3M8QB 2BM0A 3CJRA 4ES1A 3MCSA 2MLZA 1JNZB 3LANA 3G9CA 2XYPB 5G0RB 2IJFA 5LT5A 1TAUA 1R31A 1RHRB 1SV5A 2NLWA 1OWXA 3LP1B 2Y1RI 2XMTA 1S0OA 2CG8A 4CTAB 1FTRA 2W9AA 1X7VA 1ZS6A 4ZVPB 5C24B 4ZHRA 5B0DA 3BM7A 3HK2A 1TQLA 1C0TA 5D0HA 1ZETA 2M9KA 4MYTA 1QAJA 2YWHA 4PXDA 3PR5B 4PR6A 2RQKA 4ES2A 1RWMB 3C6TA 2AT1B 3QWUA 4HTJA 4NASA 3MEDB 2YXLA 2IBKA 1N54B 2R2SA 3RRHA 3CIMA 4MKBA 1Y9OA 3LGHA 4PQAA 1SL2A 5KFXA 3M2VB 2JLFA 2AJ1A 4XIUA 1S6PB 1PKUA 4AT1B 3CUNA 2D3O1 1X60A 1LW2A 5GAHU 1WKLA 2WBRA 1I5OB 4ED1A 2HK3A 2GVZB 4PWWA 4CWBA 2HIQA 4M5IA 4KGXB 1KR4A 1N33F 4HI2A 5IQ6A 3UN3A 4RWXA 3B4MA 4X4NA 2B9XA 3HP6A 2M8HA 5E7OB 1RWKB 4UW2A 2EK1A 5ETOA 1RT5A 2HIYA 3QGGA 5DQHA 3GYXB 1M1GA 2RQCA 4R0EA 1U4BA 1RP5A 3Q22A 2EEYA 3GFYA 2WB4A 4TKTA 3GIJA 2LVWA 1ZAXA 3PO4A 5D0RA 3SCLE 5I42A 3QZ7A 1VQ9S 1DHMA 1VHIA 3L09A 1V3ZA 4HI1A 1NDLA 3M1VA 4NA2A 3G96A 2IMOA 4O3OA 3H5XA 2JC1A 1FF2A 2AEJA 4WXOA 4RNFA 2MSSA 3CW2C 4CO2A 3I0RA 5AT1B 1HNIB 2E7VA 1YJUA 3GR1A 1JK9B 1BHNA 1LK5A 1NK9A 4MYUA 3ILLA 4USWA 2R7WA 4KO0B 1HNWF 3N4WA 1KLNA 1JLFA 5E41A 3GIRA 3ET6A 1TAQA 3LQVA 3VV2B 1U1LA 3ILIA 3M6VA 4CH1A 3P96A 2VU5A 2HVDA 3K5MA 4YB1P 4NLPA 1VOMA 4X64J 4OMFG 2YPYA 1VRUA 2WW4A 2EI5A 4R5PB 1N32J 1IWGA 2CQ0A 3JAMY 2BJ8A 3HHLD 3VR1A 4CQ1A 3HVRA 1WKJA 3OSPA 1JIHA 4DSIA 4C9DA 4OZLA 1CLFA 2ROPA 1VGYA 4I56A 1PYOB 1NKCA 1L3UA 2F9JA 4JI6J 3MGJA 4YY3J 4K50A 3I87A 4LVOP 1VQKS 2IPOB 4NA1A 5H9FK 2N3OA 2ADBA 5IM0A 3R5BA 2OLWA 2X1FA 2ALZA 1Y10A 2GS8A 2DH7A 4X84A 2CPHA 4YQWA 2C2MB 3AQPA 1XMOJ 2VKZG 1U6BA 4IG0A 4F67A 3CDEA 5DGAA 3P49B 3SCIE 3M9OB 3IR6B 3KMSA 3ZZYA 2ROGA 1HPZA 3ONQA 4PYAA 4QWDA 1QLNA 2A2DA 2DBBA 2LA4A 2DVIA 3PV8A 3EICA 2RQ4A 5CZVA 2IM3A 4PG8A 1TUGB 2ZBIA 3BB5A 2CQBA 2HZCA 3OLAA 2EFNA 1T9TA 3A8EA 5MLCV 2LQ8A 4RUBA 2ZJRQ 2GC8A 1Y5IB 4Q5VA 2OELA 2VB6A 4HACB 2XY6A 2CJBA 1IKWA 4X4QA 5HVGA 5IS2A 3UDCA 2WW8A 4C0HA 1W26A 4J37A 3WQPA 3EDQB 3VQSA 3FVYA 1YTYA 4P71A 2ZH3A 2K1RB 4R8UA 1SH0A 2COLA 3R3TA 2PE8A 3KLHA 4OL8A 2B9YA 2QTWA 3TA2A 1Q79A 2J9DE 3E51A 3GV7B 4U67Q 3LF0A 1R8AA 3TEHB 2VQEF 1S9EA 1P6TA 1D8ZA 2UXBF 3WDOA 3MR6A 4BCAA 4HL9A 2CIMA 3MCNA 2LECA 4CLWA 3IR5B 3LUYA 2GX8A 2AGPA 4AE5A 4N76A 1H72C 3BYPA 1RYSA 2VH7A 1ZTTA 3QT7A 3MMBB 1XR6A 4WZMA 1F6TA 3MURP 3CMAS 2A2CA 4ECTA 4X66F 1NK0A 1YJTA 1PG5B 4U8VA 3JQJA 3MF5A 3Q2SC 4ENOA 2CDQA 3RBEA 3Q0AA 3TZWA 2W9BA 3FCVA 1RAIB 5IZHA 2XHWA 4OYXA 2GHWA 1FJGJ 3DDIA 3JTPA 2HHSA 4DR4F 4CO0A 1XBWA 2CNOB 4USMA 4TU8A 3PIPQ 3G86A 3OT9A 3C66A 2XLJA 2MEWA 4ZPBA 4CT8A 2FUG9 4UF4A 3BKTA 3Q8RB 4N8OA 2VC1A 3NNHA 3ITHA 1X9SA 3V4IB 2VV5A 3DCAA 4DMZA 3CCJS 3EM1A 1XK8A 4QYZJ 1WI8A 1VS3A 2R4FA 3GV5B 1S59A 2XG8A 2PI5A 3QPIA 1QAYA 2L3MA 1BXNA 4ZLNA 2QLXA 3NCRA 3TX8A 2B7CB 2P9GA 1S4EA 4OHZA 2BQUA 5A8KB 3W9JA 3GB0A 1IM4A 2ZKTA 2KVQE 4B9LA 2W7PA 4X65J 1AZSB 3MPVA 3DXBA 5BYSA 4I68A 2FJXA 2H51B 4AXJA 1JLQA 1EARA 3NS6A 3F73A 1L5UA 1S7HA 4ZN3A 4F0HA 2QA4G 4Y65A 4NLGA 4URSA 2E5LJ 5KTQA 5GADU 4NRTA 1LFPA 5G0RA 2FC9A 1VYAA 1FEEA 4P7VA 4DV4J 4ZJLA 5BXIA 4ICLA 3LP1A 1HBUA 1FRKA 3AODA 2XI3A 4CTAA 3VAKA 4PXCA 4RW6B 5KOXA 2HBQB 2HNDB 2CQ4A 4ECZA 2CZ9A 4YEAA 1BQMB 2BYCA 5KAKA 4LF7F 3P5BP 5DG8A 2WOMB 4OZ3A 1UVNA 2UXDF 3JYTB 3CCRS 4DV3J 1S12A 1VMBA 4B9VA 3FNNA 2YWKA 1K44A 2DH8A 1VQ7S 2PEHA 2MQ8A 2HYIB 3MM8B 4HHJA 2AYEA 2DR8A 3MEDA 1YJNS 5B0GA 1MROB 5E5NA 1FCAA 2PMWA 2EG1A 3CO0P 3CJSA 5J1EB 2JFKA 2D69A 4YB7A 4UZCA 2KM8B 5D4OA 1S6PA 4M63A 2I38A 5SUHA 3R5JB 4OZ5A 3ILJA 3SSRA 1Q8BA 8AT1B 3S7RA 4IOBA 2F4VJ 4G6VB 2ERRA 2GVZA 3NOGA 1H2TZ 4OJ1A 4CIOA 1GFWB 4LBPA 1OSDA 5F9NA 3LGNA 2QMXA 2HMIB 4OI1A 4L75A 3H0PA 2ILYA 3ZO7A 2DITA 2WVDA 3PKMA 2DHXA 1NDCA 2D41A 4PG6A 1SQFA 1UEKA 3OXFA 2D3UA 1T9VA 1RHMB 1SIWB 4M94A 2J76E 1SJFA 4EO8A 1PBAA 2LLZA 4GO5X 2MGZB 3HI9A 4W92B 2PDAA 4DUZF 3WHIA 2FLOA 1LWEB 5AXNA 4L73A 1D3WA 3D5MA 3GJQB 4J9UE 3VAGA 4P7TA 3F56A 1URRA 5ETKA 2HEKA 2V4QA 2YNHB 2D74B 5IXUA 3M8PB 3VZHA 4CLFA 3M32A 3NY0A 1Q5VA 2ZDPA 1U1NA 1HNIA 1KWMA 2B9EA 4M8LA 4UOFA 2P8IA 4QW9A 3H5UA 1I94F 5F0UA 2V2VA 1UJ4A 1RT2B 2VIHA 3DRSA 2A0FB 3UR3C 5IT4A 5K8PA 1GMUA 1IQZA 4JB8B 1YRTA 3OD2A 3O3LA 1YDLA 3CO9A 4IH5A 5KFLA 2GMLA 1VC6A 5KFQA 3OJUA 3RZAA 3CCVS 3G2XA 4R5PA 2HKEA 5HP1B 4KV8B 3M8RA 3PO5A 3OLBA 1RAAB 1UETA 1RZMA 2ZC4A 4LRDA 1XJWB 1N33J 5DDOC 2BDPA 2RU3A 1F9EB 1HQEB 1TV6B 5FD1A 2RJZA 1JQGA 2YNGA 1FKOB 3HT3A 3GMGA 2N7YA 3I0SB 5D4LA 3I4PA 3BREA 3MM6B 2DCUB 5JJBA 3CPWR 4QQBA 4UZBA 4FKXA 3ENVA 3JSMB 1XNQF 3OFFA 3QO9B 2DGWA 3Q8QB 5F8LA 2N7CA 1TK0A 4OHYA 4ZIWA 2WBMA 4F8RA 2CYYA 5LXRA 3ZC4A 3FJ2A 2PIIA 4A8KA 3PY8A 2XO6A 2ZBRA 4F4XA 4ZCLA 3CCES 3S6EA 2Y8WA 4Q2MA 2QA4S 2VKRA 3KHHA 1T7PA 1IBLF 4EWTA 2HZVA 3FBCA 1HNWJ 2VG5B 1RTHB 4HACA 5DDQC 1VQMS 4LF8F 3TI0A 3I5AA 3H5YA 2RNEA 5CCLA 3ZZTA 2YKOA 3SDEA 4LIRA 2B4PA 4Z2XA 2XYHB 5D4PA 2GCFA 2DYAA 2C3MA 3V81B 4A8QA 1RE1B 3QQCD 2CPDA 4G65A 1AT1B 4USVA 3W8PA 3H25A 3HPOA 4WK1A 3DM2B 4AXIA 5KG5A 3NWGA 4M5KA 4DLGA 1N56A 1KLMB 2GIRA 4O44B 5AXKA 2FDNA 3EGZA 3VALA 3WC2A 2DGQA 4JYAJ 3MD1A 1DQAA 2GAHC 3N5FA 3EJMA 1Y5NB 3PJWA 3KNGA 3NGRA 1KC8T 2EVZA 5F3ZA 2CJYB 2QA2A 4ANEA 4JV5F 4I69A 2KH9A 2FJDB 2WRMA 4ZPDA 4A48A 1CQMA 1ZZNA 3LPEA 2MQPA 2OH2A 1KTQA 3T41A 1SL1A 1RHQB 3I5CA 4FS1A 1T02A 1EJ7L 2E29A 1SPBP 2CUYA 3V4IA 4RUAA 1FXRA 2NXUA 3C16B 3WX8A 4HDHA 3AT1B 2Y0SD 2XM3A 3MXHP 2EBEA 3FRYA 3K8VA 2UVUA 2VBXA 1ZM3A 2VONA 1D9DA 1OY9A 1CG2A 4KSEB 3W65A 2MY8A 5A8KA 2LCWA 1R8HA 3CWJA 1AZSA 3FKBA 3SSQA 3T1YF 2VPWB 3CDUA 4DFMA 2VQEJ 4F02A 4WFNQ 2UUBF 3T3FA 3DOMA 1OY8A 4ECRA 2DGSA 4WP9A 3CCTA 2CNNB 3G6XA 3FBFA 3KDNA 5L46A 1RAFB 2JZ5A 3SQGB 3B82A 2GQ2A 2QLFB 3BZQA 4IOAQ 4X66J 4DQSA 4WTYA 2BMBA 2IBOA 3I82A 4RW6A 3W62A 1HQUB 2FHJD 4JV0A 1FJEB 2HNDA 5EWEA 4NOHA 1BQMA 3QLHB 4UUXA 3IWLA 1KQGB 2WOMA 2RKIB 1LFWA 4RBTA 4P74A 3JSBA 3JYTA 4IRCA 3H4DA 1FFSB 1UVLA 3MD3A 3FRZA 3PFEA 1EETB 3WZ0A 4K4VA 2E5GA 3KLVA 1MROA 2BM1A 2XS5A 1K1SA 3Q8PB 2QL7B 2CZVC 3SEOA 3MEKA 4Q8FA 4HT5A 3D6TB 2W9CB 1U1PA 4DR1F 4X62F 2LEBA 2VPXB 5ADZA 3IFEA 1BQXA 4HH1A 4OHXA 4R25A 1NKEA 3D1HA 1RQ0A 4RX6A 1RTJA 1RXOB 1Y3KA 3FMBA 2H48B 1NM2A 1S0MA 3QWPA 1Q7LB 2KFNA 2ZHOA 3BKFA 4L6V3 2HMIA 2DHHA 1GTEA 1I51B 1S9GB 2G0CA 4DBQA 1VDHA 2PO4A 3GCWP 2ZNYA 2LU1A 1HNVA 1FVSA 2V2QA 4FZVA 1ZPWX 4M5NA 4KJIA 1B0PA 1HWUA 4FKYA 2VFRA 3G71S 2FVCA 4ED7A 2Z58B 1F2GA 4Q2LA 4C8MA 1YZ6A 4X4SA 2MGZA 1XEZA 4Q8EA 4JI4J 1LWEA 2QFIA 2IJNA 4A8MP 1SJQA 4XTTA 2JSXA 3AB2B 2FHMA 4J5OA 1VJQA 4LF7J 4NLXA 2Z30B 3T9NA 1HA1A 5KT5A 4RW4B 2RIJA 3UD5A 3N6LA 2CNKB 2UXDJ 1T0TV 3AH6A 3CDBA 1OQ3A 3IXQA 1WDTA 4G1IA 5A8WB 3GYNA 3H20A 3MM5A 1RT2A 4TY8A 2MZSA 4ID5B 4I2QB 3H4BA 4C2MA 3VQTA 2W1BA 4DLEA 1RABB 1P8GA 3NAHA 1N34F 2DGTA 2H5IB 4C97A 1D0EA 3L3CA 4TLRA 4CH7A 2CJAA 2JEFA 2JEIA 4PYDA 3M2UB 4IFVA 3I5BA 3HZGA 3Q89A 2LQJA 5HP1A 4KV8A 2MSTA 1PILA 4X4OA 3UDEA 2RB7A 5KFCA 2KI2A 3NRBA 1A6LA 3KJFB 1J2VA 2UVVA 1S1UB 4OQJA 4ZCMA 3QRRA 5D78A 2XB2D 4CLSA 4KFBB 1TV6A 4YR0A 3IBWA 2IVMA 4M5MA 1BQNB 5M2RA 1Q7YT 1KTVA 2NZCA 1WEXA 4J9NA 2QO3A 2E1RA 4OZ1A 2JEGA 2B5JB 2WVFA 3LP0B 3JSMA 3BN4A 4JI5F 3ZTSA 3KOAA 4B3MF 2DCLA 4O0NA 4NWBA 3QO9A 4DUZJ 1XNRJ 4DUTA 4BWMA 2OMLA 2BOPA 2DGOA 1QTMA 2HNYB 1CULB 1U24A 4J9RA 4BC7A 2RD5C 4JI1F 2RHQB 4B3OB 2HHPA 5M2UA 4NYOA 2H5EA 3Q86A 4MMOA 3EUNA 1KOOA 4ER8A 3M6WA 3B54A 3UDLA 3GFHA 2FD2A 1R8CA 3WBZA 2BJ7A 4X4TA 3IGNA 1I94J 1NSPA 3MOZA 2XTJP 2VG5A 1RTHA 1JLBB 2RDDA 2KO1A 2AZ3A 2DK2A 1E6VB 2AYBA 1VR6A 1D09B 1RT3B 4KQZA 4MJKA 2O3DA 5C42B 2LQ9A 1AROP 1H7WA 2BANB 1RWNB 2MZJA 4UQGA 3RB6A 1CC8A 1BLUA 3MHYA 2OO4A 2B4UA 4OYMA 3IRWP 2RSQA 2DISA 3DM2A 1TL4A 2DNZA 4KBIA 3D66A 4PWUA 1KP6A 4OX9F 3DU6A 1W7WA 1KLMA 3EGVA 5F8HA 3PX0A 4O44A 3CD5A 1SBRA 5F0WA 4DV2J 3MUMP 2CXEA 2LDIA 3U1LA 1V5VA 3WIUA 3ISNC 4C8LA 5CYJA 1TUWA 1XNQJ 1TL1A 1X8DA 1CC7A 5ETQA 2DR5A 2RQMA 2MKIA 2KVIA 3EZ5A 5FIIA 5HMZA 5SZTA 2AJQA 2OSRA 5J1PA 1EB0A 1UA1A 2HHWA 1DY3A 5J2PB 2F5GA 1O5JA 1KOHA 3FC9A 3CF5Q 4ZVEA 5E0OA 1F1BB 1RWOB 3GWCA 4YOEA 1X5TA 2RS2A 3NGDA 1RSCA 2CPEA 1BD6A 2Z2YB 2V67A 4LF8J 4FYWB 3C16A 1FKPB 3HHEA 3J80Y 2MTLA 1NSAA 2U1AA 1SH2A 3HHLA 1N88A 2KFZA 2MKKA 1NMEB 1U1QA 2Y1IA 4A8FA 2A3JA 2Y0BB 1EP4A 3OVAA 3BR9A 5A8RA 4ZN1A 3AJ1A 3G8QA 1IKYB 4FNIA 3KUHA 4J9OA 2ZE2A 3H5SA 2HVZA 3E8OA 1FT8A 2IVFB 1U49A 2XLIA 5IT9Y 3O44A 1TU0B 1E6YB 2RUSA 2VFSA 4Z7CA 1K9MT 1N36F 1S1XA 2UZAA 5F8JA 3QMQA 1P1TA 2OUGA 2R8HA 1WTBA 1QSYA 1Q78A 3GFZA 3KWMA 4DSEA 5JVHQ 1S76D 3D0HE 3P8BB 2Y1LB 1HQUA 2IC3B 3D4JA 4PAAA 2IAJB 4USKA 2IHR1 4CLUA 1Y7PA 2DNLA 2MQOA 2A1BA 4WFBQ 3OR1B 3QLHA 2B9WA 1VJWA 3KUGA 2XGQA 3DHXA 2RKIA 4DQPA 2RF2B 1R89A 4V19X 4K4SA 2YWFA 1SKWA 1IR1A 2YX1A 1D9AA 2ZITA 4O3PA 1SI9A 2MLYA 3A3NB 3EXCX 3T1AA 2PFDA 1C0UB 4IFYA 1RI7A 1EETA 2QFJA 1HARA 2KHCA 2M88A 5HK4A 1AW0A 1TKXB 2E5JA 2CJXB 5ETRA 1YQHA 2K7JA 3HFKA 2GJIA 2DKOB 3X1LB 3OL9A 5C25B 1K73T 1G7CB 2W9CA 4ZJOA 2H1YA 2JLGA 4ATNA 1UMJA 2V63A 4BS2A 3W64A 2J7UA 2DR7A 2OIHA 2KZZA 3DRPB 3DLEB 5KG7A 1QSSA 1IR0A 1QE1B 2Z0GA 1OPZA 4MT1A 4P6QA 5DM7Q 1SXLA 4XAKA 1F5BA 4K0KF 3T1YJ 4CO3A 3E01B 1S5ZA 3BO4A 1FESA 4ITSA 3KJQB 4FS2A 3NGSA 1O8BA 1S9GA 3FEYB 1JJ4A 2H3EB 3C46A 3G4SS 1HW8A 4EBCA 1WHWA 8ATCB 1U09A 1B3TA 4ED2A 1IQTA 1VLOA 2DRDA 3SZ2A 3DXSX 4RBVA 3NCQA 1OY6A 1HYSA 1TKTB 2V9KA 1NPRA 4ED8A 1M5VC 2NXCA 1Q16B 3PEHA 4I6WA 5HI7A 2Q1LA 4DL6A 3V6DB 5HBMB 2IVYA 4RW4A 3OPKA 5J2NB 4U8YA 2DT9A 3OQ2A 4KB7A 2B0GA 3TOQA 4EU0A 1YKWA 3DDKA 3MM9A 1FXLA 5A8WA 1ZM2A 3KKFA 1H3DA 3AJDA 3GPAA 4ZPTR 2MKJA 1UCNA 3X3UA 3M6UA 5KFOA 2UV8A 4I2QA 4S0MA 2DEIA 3LP2B 2KXNB 2C2ZB 4YDXA 4FF1A 4LR8A 4OYIA 4P2SA 4QWAA 3IO1A 4DR6F 2W2PP 3MPWA 1YZ7A 4X62J 1WOOA 2IM1A 2VD3A 5IT0A 4CLZA 3NKYA 3OHBA 4KC5A 3M2UA 1VLYA 3BQ2A 4B02A 4NMXA 4M1KA 1U1MA 3IAS9 1BY9A 3KK1B 5A2QU 2XS2A 3V6KA 2APOA 4CNYA 2V94A 3C3LA 1S1UA 2EPIA 2XMMA 3DOKB 1ITPA 2D9PA 4NLTA 2Q6CA 5KFGA 1U2CA 3JB9k 2R7XA 4WU3A 4I6YA 2F4FA 1BQNA 2AGOA 4FN5A 4U7CA 3CMQA 1H73A 1T05B 2CQGA 3EGWB 1S6UA 2R8JA 2B5JA 2BQ3A 2GHPA 3JSYA 3O8WA 2OGUA 1JLGA 1YRXA 4WE1B 2DTJA 3ZZ0A 1NUEA 3C19A 1OIAA 3PJXA 1RU2A 1J5EF 2HNYA 3R1LA 1CULA 4K4XA 2OFGX 4K8RA 4OX6A 5LMNF 5GVQA 4B3OA 1SIZA 1R0AA 1BE4A 3H2UB 2MMYA 2PN6A 1RLCL 2ZWOA 1UPMB 1WUUA 1U1KA 2IM2A 2C28A 4QU7A 3J7ZT 3EZOA 4P10A 4DI6A 4LR7A 2BJ3A 2MKSA 1PYTA 2CDRB 1RHJB 2I0XA 4DG1B 2XMWA 1E6VA 3RR8A 4J9LA 3BGOP 4ED6A 3QFWA 4W4MA 2BACA 1R0BG 3CJ2A 2XSJB 3MTJA 3PEJA 4F3MA 1RT3A 5CZXA 4V19J 1PSDA 2JL9A 1S1TB 2DNQA 5C42A 2X3DA 1H2UX 4F04B 1FX2A 3IM8A 3RYLA 3D3CJ 2HHTA 4LFAF 3NNAA 2YQ3A 5IC6B 3HHKA 1U2RA 3MMCB 5J2QB 2EKNA 4LBIA 1JLCB 1EZZB 5IQQA 5KG3A 5DGBA 3M05A 4DCJB 5HJXA 4C3MA 3A1YG 1ZA2B 2OEMA 2Z2ZA 3D68A 2QL5B 3SCJE 1NJYA 4JI5J 1T3NA 4B3MJ 5GMKa 3MAAB 2ZOGA 1WNEA 3MMAB 4F0MA 1T9YA 2C2KB 4RLEA 5AJ3F 2ZH1A 4JI1J 4FXVA 4DPTA 3KLIB 4ECUA 3AQOA 1PAUB 5E3PA 3P4UB 3L7UA 2Z2LA 4ALZA 3EVOA 4OI6A 4QIEA 3N6MA 4GVLA 1WKKA 1W25A 1XMBA 4QJVA 4DZ6A 1FKPA 3R7SB 1S0VA 3R6LB 5JVGQ 3KXDA 1TUVA 4BHQA 1KEKA 3HKZD 4KHMA 5DDRC 3ZZPA 4ZMMA 3BO2A 1IVZA 2NUUG 5KG6A 3MI7X 1MG7A 1TL7B 2V8VA 2HK2A 1IUJA 4IDKB 3SYZA 1NKBA 2EC2A 2LEPA 2M70A 3Q8SB 4ED4A 4LF5J 2E9RX 1P27B 4OZNA 2ZEJA 2AX0A 1IKYA 3PW2A 1MMLA 3C6TB 3VVUA 3UCGA 3QZ8A 2F7VA 2IMWP 2W4DA 1E6YA 2BE9B 5B0BA 4OX9J 5GMDA 3DDNA 2EFQA 4PPZA 3FSYA 3QRPA 4ZPCA 2UXCJ 2IIHA 1EX8A 3P6YC 4WKRA 4KYZA 1LXNA 4X64F 3AAWB 1R43A 3VGUA 4UY8T 1KS2A 3K5LA 4ETZA 1X4DA 2MZQA 2V69A 4OLOA 4UY85 1XERA 2IC3A 2FYXA 2XHCA 2BJ9A 4WYWA 4WK3A 4NCAA 4PG5A 3ZTQA 4FDFA 4Y2KA 1OPIA 5AE3A 2JJ4D 1P9QC 2U2FA 2RF2A 1YHQS 2XYGB 4ECYA 4FNHA 3CGIA 2CQ3A 3PYGA 2G0IA 4WBFA 3DHWC 4YY3F 2RAQA 1C0UA 2YH0A 4KHPJ 4ECSA 1BWEA 5L1KA 3M6XA 2XY5A 3CCLS 2XO7A 1ICEB 1HQ2A 4B9TA 1UPPA 3H42A 3U1NA 3A3OB 2VJVA 4NLVA 1I6JA 1HW9A 5H1SV 5I42B 4CH0S 3MCMA 4GC6A 3DRPA 3DLEA 1QE1A 3GV8B 3MCOA 4KH0B 4ZOSA 4E8UA 3D67A 3CD0A 4KPYA 3R2CJ 1T8EA 1LQ9A 2V8HA 3E01A 5F8IA 2V8PA 3D9BA 3D1OA 5H9FJ 4DPWA 1KNZA 2XMKA 3ENAA 3QGPA 2FQQB 3KJNB 1EKRA 3ZFVA 2FJAB 3K58A 1N36J 4LF6F 3IG1B 4PABA 3OHAA 1NJZA 3PX6A 2YNIA 1W2BR 4DHVA 3JXOA 4LIWA 2ZZMA 3KJVB 3M30B 4ZP8A 3O6QA 1TKTA 2DGVA 4AUKA 3LAMA 4XPEA 3R97A 5L1IA 3MR3A 1FRJA 3CJ4A 5HBMA 1ZYQA 4WKYA 5J2NA 4ZLJA 3PR4A 1M1KT 5ETVA 1RT4B 3DKDA 4URGA 4DX5A 1RGVA 4I6AA 4ILRA 4DV6F 1WG5A 5IM0B 1WF2A 1UJ6A 1RBLA 4P75A 5K14A 5HQMA 3I9V9 5I4MA 2NSCA 2WZ1A 2ZH6A 4RW8B 4RR5A 2HLTA 3PXGa 5IT9U 2F3JA 4CYUB 4NZ0A 4C7QA 1HPZB 3VAJA 4G3IA 3V4MA 1REVB 3K89A 1QUPA 2A6MA 2Z8QA 4NMLA 1S72S 3NAIA 4LFCJ 2XNRA 3KK1A 2WONA 4IR9A 2AX1A 2FGOA 3GZ7A 4Y00A 2QE5A 5ETSA 3UD3P 1F9FA 2WSCC 3DOKA 4TU9A 3J7YI 3D6FB 2VZ9A 3KDOA 3CC2S 1RBAA 5DLFA 1FJ7A 1MN7A 4PEOA 1T03A 3DMJA 1T05A 4L76A 2DRAA 4I0WA 4DWIA 3H2VE 4WE1A 4EK2A 1TFYA 5E33A 2WAQD 4P2XA 4X65F 4LF9J 3LWMA 2YNFA 4V1Ak 1NHUA 3KG1A 2AJ0A 1S9EB 1NK7A 1X4FA 3G6VA 4DX7A 2ASYA 2IY5B 4K4UA 2R8GA 3CCUS 3SFUA 1O51A 1VHFA 2B56A 2XZWA 1SKSA 1O6XA 2L9NA 2GJFA 4DG1A 3EWGA 3P3DA 4NXMJ 2W9BB 5K9FA 2AWZA 4CLKA 4B9MA 1A9NB 2AJFE 2XSJA 2ZZTA 5GAEI 2ZJPQ 4MAKA 3Q2TC 1S1TA 4HH0A 4BDPA 3M8WA 3BGRA 5J1NA 3OFHA 4DS5A 3PYDA 2JC0A 4C0BA 3OTBA 5KFHA 2Z57B 1GNKA 2E44A 3MMCA 2BRKA 3K59A 2KTQA 1PJ6A 5J2QA 2ZUAA 2UVWA 4X4VA 2JLEA 5D3GB 3PZPA 2ZM6F 1JLCA 2AW0A 2XY7A 3MAHA 2N4CA 2VG6B 4AD6A 3PHEA 1RT7B 2W24A 1WC5A 1TP7A 1DURA 3TA1A 2CQPA 1NH7A 2I9SA 1FWLA 1B0TA 2JH3A 3MAAA 1GTHA 3UDVA 4TQRA 1VBKA 3UO0A 4DN0A 5DETA 2WVBA 1GAOA 4IUFA 2I6WA 4I4BA 3ELHA 1VBXA 3S8SA 3TQ1A 2HBRB 3TZXA 3KLIA 2MLXA 5LJ5Y 3R5GA 1Q81T 4LSNB 4ZLPA 2C2DA 2RE1A 3CD7A 2HVIA 1ZZFA 4C8KA 5AXMA 4KGZB 2DRBA 4ICLB 1HBUB 3VHQA 4ERDA 4J9VA 4EGLA 3NGUA 2F1FA 4CLPA 2CWXA 5KFDA 4LRCA 3CIZA 4LFBF 5KFSA 1YJ7A 2NREA 2KL8A 4LR9A 1N4LA 1TL7A 4QCLA 5U47A 2AGQA 4IDKA 2MZ1A 1XMQF 1S1WA 1NDPA 4LRAA 4Y2IA 1RCXB 1WHXA 3AA9A 1WD6A 5A6PA 2QMUB 4LFAJ 3OV7A 5GAGI 1M1HA 4IQMA 4MK7A 1NPPA 3KK3A 4ZP7A 1UAWA 1AYEA 1EIYB 1PGZA 4H4MB 1Y3JA 1X0PA 4I1TA 3THVA 4J90A 2YQ0A 1ZPVA 3NL0A 4U9RA 2FLLA 2YBVA 1WC1A 3TVZA 1F3VA 1Z4UA 1HBNB 2XZDB 5ETPA 3BPSP 5E3QA 1WTFA 4K2XA 5AJ3J 2HURA 4UOGA 1TMJA 5FDLB 3V6HA 3PW0A 4GKJJ 1S1VB 1KKHA 2K06A 2BZ2A 4DUYF 5EWGA 1RTIB 1QJHA 1MU2B 3BPDA 3PW7A 1GQEA 5C7PA 3UWTA 2E9ZA 1GEHA 3H98A 4CM0A 1TZ0A 1PC4A 4NCGB 2OP5A 1IXKA 4ZVRB 1MWYA 2HQIA 4LT6A 4DV0F 5D4NA 3W66A 4DL3A 2VBZA 3HJVA 4UT4A 1KN6A 1WHYA 4MKYA 2NQPA 1H2VZ 1MN9A 3OUYA 1JX4A 3CDWA 1FRLA 1TELA 1S48A 4USUA 2ZH8A 2LU2A 1YBAA 1ZBTA 3M32B 2JVRA 4OYOA 4BLGA 2DNPA 4WFYA 3C15B 5KFNA 5F8NA 4MK8A 3GYGA 2AV5A 2ZH9A 4ANDA 3DRSB 4OIXA 3ISND 1IM6A 3IG1A 5E3RA 2NS1B 2Q43A 5D0GA 2HHUA 3HZEA 1KFSA 1RWXB 2OKQA 4X4UA 2CKWA 1WEYA 3KJVA 1KSPA 5D8HB 3M30A 4FVCA 1URNA 5CYQB 2VC0A 2QGFB 1FDAA 2HQ3A 3DRRB 2V34A 4KT0C 1V9OA 1NCLA 4QOTA 4P2MA 4HTIA 1FA0A 4ILLA 3QIDA 2NPIA 1IBMF 1NXIA 3T19A 2NXNA 3RW6A 3VGSA 2J5AA 1VIOA 1R7IA 3M4XA 4DX6A 2YNGB 4KGKA 3CB4A 1RT4A 3ZZRA 3RAMA 3EMTA 5LJ3Y 4JYAF 5BR8F 2CQ1A 3K57A 4O23A 1NZAA 3EVMA 4O4GB 4L74A 3KYLA 4DS4A 4RW8A 2P9EA 5AE1A 1T94A 2M8DB 4M5LA 4FBUA 4CYUA 2KFYA 1XC9A 3KK2B 2YKNB 1LOUA 1REVA 4OYBA 2LMIA 1PJ5A 3MFIA 4RNNA 4DZDA 2CPFA 4RW7B 4WIQA 2X1GA 5EDWA 4D3HA 4FPIA 2NR0A 1R0CB 3GP9A 1W2IA 3GSIA 2JWNA 5IWAF 1HBMB 2BJ1A 2QN6B 1B7FA 1JLEA 4LF6J 2P2CB 2YTCA 2VBYA 2W2MP 1JMTA 3SDEB 3SIPB 4RBUA 1FJCA 5DZ6A 3DC2A 2D3ZA 1UVMA 2VFVA 2GZOA 1VQ4S 2EKYA 3MZIA 1N5QA 2V4RA 4ZVHA 2MQMA 3LA0A 3W2VB 4IG3B 4DPYA 4C8OA 2VOOA 3KFWX 3J81j 1ZA1B 4DL4A 1PAEX 4CT9A 5B0EA 4JV1A 3RG6A 4FF4A 3N9UC 1SQGA 4WWSA 2R9LA 3UVJB 4O3RA 3HM9A 2JFDA 3TUJC 5B0AA 2LFVA 4DV6J 2UUTA 4GVBB 3BBFA 4JI3F 2HHHF 4R0JA 4ECVA 2ALYB 2YY3A 2AF6A 1SJ1A 2V8GA 1KRPA 2YX7A 1ULRA 5L39A 5EGYA 2G2OA 2Z56B 3RU0A 2B3TB 3PG9A 1PJ7A 2ASLA 2GVDB 2ZH5A 1K0VA 2ZNZA 2W2NP 1PYSB 1RACB 4ZPAA 1NNDA 4DF8A 2C2NA 2CA9A 1KONA 2IRUA 2ZJQQ 3CJ3A 4FYVB 5F8MA 2DNMA 5D3GA 2CJQA 1YGYA 2VG6A 1RT7A 2D1CA 2WTFA 2O5DA 4DV7J 4Q7AA 2ROEA 4N8NA 1D9FA 3RBXA 5KFEA 3HFZB 2F8EX 4YS2A 1T11A 3B6BA 1FRIA 4PQUB 7AT1B 3R9LA 2M3DA 3CULA 2VODA 4QR0A 4WIIA 1U45A 1S49A 5JUMA 3DOMB 4QIFA 4NLDA 2C2EA 1QM9A 4DPUA 3NNCA 5KFWA 4OV6A 4LSNA 1XIQA 2ZZNA 1TL5A 3CNQP 3HSZA 4H4KC 3UE2A 3SFGA 1WG4A 1MSWD 2DB1A 3R5CA 3G82B 2UUCF 2M7SA 3EGNA 5FLXU 4JI4F 2HVEA 1FFWB 2DNOA 1CEZA 3PRVA 2PEBA 4PWDA 3T1HF 1N6QA 1AB8A 3QYYA 3HX9A 2AEFA 2HWTA 3BGFA 4KPCA 1G4CA 3H7HB 4NI2B 4QBUA 1HNZF 2IA0A 2VQFJ 3DNCA 4PXEA 3VGVA 1KHWA 1X4GA 1JLAA 2ZD1A 1NB2A 2HRUA 3CC4S 3I31A 4EUVA 1FRXA 2ADCA 4H4MA 1U26A 2ZM6J 1WSRA 1NSKL 2L41A 4TNOA 3CSKA 5HLFB 1QVGR 2EWHA 5EHHA 2CWKA 2MXYA 4K7QA 1HBNA 1UL3A 1RTJB 3FBEA 2IYGA 1IR2A 1JWWA 1U0HB 1KVKA 4J7CA 2F9DA 1NRKA 2IDLA 4LF1A 5CHCB 4JI0F 5FDLA 1BMQB 3E3XA 5B7WA 2D3OR 3RAXA 2HAIA 1S1VA 4E0DA 1HNVB 1K1QA 4FYXB 3TVYA 1RTIA 2B7BB 1I3OB 3S1TA 4G1PA 1MU2A 2MDAA 2OJ3A 1CJTB 2XMAA 1SJ4P 1FVQA 2DIVA 3MMJA 4NCGA 3V2UC 4QPXA 1X4CA 4NLOA 1XNRF 4LFBJ 3RUBL 3BQ0A 3JS9A 2OI2A 3GJTB 2YKAA 2YX4A 4DR3F 1K0TA 4XPCA 4DV5F 2XULA 3TAMA 3D54A 1XMQJ 3MUTP 3AJ2A 3HVTB 2I1RA 2VASA 1ZH5A 1OS5A 1DBDA 4NYZA 4P52A 5D6GA 5C2CA 2Y8YA 3NS7B 3UFCX 3PRDA 3MM5B 4K4TA 3OR2B 5HL7Q 3C15A 3R7BB 2HFSA 4OX7A 2BR0A 4TY8B 2ZKUA 5J2MB 2FZCB 5KFTA 2YWEA 3C2PA 4NZ6A 1G1XA 1X5OA 1F3FA 3W63A 4USTA 3QRQA 3CJ0A 1Q82T 5CXTA 2ZHAA 2AJ4A 4B3RF 2BOAA 1LKZA 4DPXA 3WC0A 3LOUA 1VQYA 4IFVB 2VG7B 5CYQA 3VWSA 3KHRA 2DGXA 3DRRA 3UN5A 1KQFB 1A7GE 1NU4A 4Y28C 3WX4A 5EX3A 4M5DB 3QIPA 1YJRA 2UU9F 5HMYA 4ZP6A 4DUYJ 5LOQA 1Z2LA 5KG1A 3I4HX 3U02A 4DV2F 2OPRB 3D6MB 4USHA 4Q0BB 1LV5A 1UA0A 2IFXA 3HT0A 3IP0A 3DLGA 4O4GA 3C6UB 2FLPA 1X31C 4DV0J 4MKAA 3OBIA 1Q53A 1XR7A 1DTTA 3KK2A 3UNYA 1NZ8A 2YKNA 2DO4A 4LF2A 3KLEB 2IRXA 5E3CA 5C2GA 4ECQA 4MIBA 3QT6A 3BBBA 4RW7A 5KFFA 2KJVA 3QAEA 4OYPA 1F5CA 5T41A 1HBMA 3TAPA 1CJUB 2P5VA 4FF2A 2XNQA 1NHVA 1FTCA 1BUXA 1FI4A 4RKUC 3GLJA 2XCPA 1FDDA 4Y2CA 1QD1A 1V6HA 2W7OA 4ZVSB 1YIJS 1S7IA 5GAHI 4FP9A 2KRBA 2CQIA 4MFBB 2MKHA 4QWEA 3W2VA 4IG3A 2FVPA 2LQ5A 3BBCA 1KQKA 2R2UA 1IBMJ 1C4CA 2BKOA 1RLDA 2ZVSA 3KMQA 1S4FA 2XMJA 1WACA 2HFVA 2V2KA 2E1CA 3UVJA 1AFJA 2ACYA 1FNMA 1VI7A 1EAYC 4RPFA 4H54A 2FGCA 4C98A 5E2QA 2R8KA 1H98A 5BR8J 1V5IB 1Y00A 4GVBA 1U25A 1NJIT 1FE4A 4F4KA 2ZBQA 2MKCA 2EFPA 3ETMA 2J9CA 3DLBA 1TL1B 1RWWB 1K8AT 4ZIVA 4Y3CA 1IKXB 2PA3A 1KFDA 4DSFA 2CPZA 3GU0A 4JV2A 2C22A 5AXLA 1RWPB 3IC1A 2GVDA 2HRYA 5A6WA 2XS7A 3AFGA 1R6YA 3HSJA 2WVEA 3AB4B 4NPOA 4EZ6A 3LH2S 5CQGA 5IWAJ 5BYQA 2KXFA 2LQBA 3BSCA 3G87A 1F5AA 2QMWA 4P73A 4ZS6A 2KKHA 1NLKL 1XR5A 3QJPA 1OQ6A 5HMXA 2X1BA 4IYQA 4URQU 4IO1A 4OJHA 3CJ8A 1X4EA 2CQ2A 1QUVA 5KT4A 2BW7A 3HHLB 2KB2A 2HRTA 2HHQA 3M2RB 1Q86T 2HS0A 2EBGA 1EP4B 3BEGB 3ZZUA 2ATCB 5A8RB 3LPYA 3CJTA 1QTNB 4OX8A 1UFKA 4PQUA 2RDIA 3PHTA 4K59A 2H9ZA 4GC7A 2ZE2B 4N7TA 1C1CB 2W8LA 4CO4A 1LEOA 3HMJG 2EFGA 3UQSA 2XCAA 3PDNA 2DXEA 4A8WA 1S1XB 1J5OA 4YR2A 2HBYB 4IR1A 2B6AB 2O01C 4Q44A 1BC6A 4JI3J 5A2QY 2HHHJ 2ZDOA 1HBOB 2AP6A 4EEYA 2DO0A 1A0OB 3G82A 1GMWA 5DQIA 4OHWA 3HVAA 5D0EA 4YB6A 3VVTA 1VQLS 2PSZA 2KG1A 3UR0A 3LWLA 4YN3B 5RUBA 3HD1A 4QR1A 4PRFA 4EFAC 1GXLA 2ZUGA 1CSJA 3NP5A 5DLGA 5EX0A 4NI2A 4Y0FA 4F7VA 3MEGB 1XWLA 3NBPB 1VBYA 3D7SB 1L3KA 4IFYB 2BRLA 3HLUA 1LW0B 3BQ1A 3GJSB 3RB3A 4HKQA 1AFIA 4NLYA 3K7RA 4DV1F 3RB4A 5CH7B 2X51A 1VBZA 2E1PA 2DHAA 2PGCA 4K4ZA 4QR2A 5AE2A 4GO7X 1CJKB 1WI6A 1SC3B 1FD8A 5HLFA 2LEAA 3L7OA 4LQ9A 2ZH2A 1Q1KA 3L4BC 3QFHA 3W5XA 2AD9A 4C11B 3J7AN 1FE0A 2F63A 5IV4A 1NH8A 1U0HA 4GRSA 1JNRB 2OTJS 2PFFB 2DPJA 3MOJB 2AQ4A 4OZ0A 5KT2A 4PG4A 4PG7A 1WJ9A 2D7SA 3TX0A 3MFHA 4CZCA 4F3QA 1RJJA 5DM6Q 4DX8H 5CABA 3W61A 4JI2F 3I6PA 4OLPA 2VDHA 4KGVB 3MDFA 5A0YB 4YHHF 4B9NA 3D3BJ 1CJTA 1NDKA 5T14A 3FUYA 3QNWB 1HYSB 4AYBD 1B64A 2UUCJ 4UTGA 2XMVA 3AXKA 2HS3A 2C3YA 3MECB 3IS9A 3T1HJ 2BE2B 1FWPA 3TJAA 3HVTA 1NJWA 3CMES 2XEXA 2H4YB 3SXLA 3MM9B 1UWBB 1HNZJ 5KFYA 3EPGA 3QJJA 3OR2A 3NGTA 3QGIA 3CVKA 3BGLA 2R3VA 5J2MA 1HWLA 1HMVA 4LRFA 4AL7A 2V4JB 1NO8A 3VAHA 2RHSB 2HGMA 3K5PA 3R1HA 3CE8A 4OI3A 1NJXA 1VISA 1Q8KA 2GQQA 2VG7A 2NPFA 3PKYA 4WZQA 4C4WA 5D15A 3OSNA 2HS4A 4I67A 1J27A 3JQMA 1RAGB 2M52A 2W2QP 4QWBA 2RT3A 2CPJA 1X4BA 4JI0J 4NLQA 1QVFR 4M5DA 5LL6d 2KXHA 2QX0A 3GCXP 3FMWA 3GIMA 2HFOA 1UFWA 2KYZA 1NK6A 4F4WA 1KD1T 3IN5A 4RU9A 4NCBA 1OSCA 2OPRA 3R6GB 5GADI 3ZTOA 5LMUF 2QIFA 2W01A 2J7KA 1VK3A 2QEXS 1ZM9A 3SCKE 4Q0BA 4B17A 5BJRA 2MZRA 3B78A 3GQCA 3W9IA 3AY0A 1JLGB 3A3PB 3C6UA 3JTNA 3SSSA 4QIVA 2YKPA 3ZTPA 1C1BA 4UOHA 5LM7E 4DR3J 1FX4A 3QT5A 2MJUA 4NLUA 4ZVUB 2VA3A 4DV5J 3MR5A 1L3SA 4QWCA 1R0AB 3KLEA 5K5MA 1JJHA 2BBEA 4F36A 4U95A 2FVQA 1U8SA 2Y1JA 3CTRA 3QGHA 1SC1B 1N5VA 4IOCQ 3Q23A 2DD8S 3KG0A 2MB0B 1CJUA 4QZVB 1O0PA 2GJ2A 2F8MA 2CZ4A 3A4TA 4N41A 2ZH7A 1VQPS 4M95A 1KBRA 2XMUA 2VF3A 5H9EK 3DYAA 2HZAA 2LP4A 2AJ2A 4B3RJ 5HO4A 4O0IA 5L9NA 2DNHA 3M8ZA 4C3KA 3T9ZA 4CNZA 3FGVA 2NCKL 3B4DA 4ELUA 1NB7A 4ZK7M 1AA1B 4O3NA 4B9UA 4MFBA 2OEJA 4ED5A 4LF5F 1S99A 3FSXA 3FSIA 2UUWA 4C3LA 2W4CA 4MK9A 2UU9J 4RZRA 4HHHA 4K4YA 2R42A 1MMDA 4PXBA 5L8RC 1U1RA 4MKVA 2J0QD 2L9WA 2UXCF 3AOAA 4L3NA 3MAQA 2MHNA 2MQNA 3EZUA 3AD8C 3GILA 4LMZA 2W7AA 1ROFA 1IKXA 3NLCA 5I3UA 1RISA 4DR5F 2DEJA 1S9FA 3G6ES 2ZHBA 4Z37A 2FIUA 2KRRA 2H4WB 2Q6BA 1TVRA 1VQ6S 2K3IA 3CCZA 2FJWA 1G3OA 3A12A 4KHPF 3SV3A 2AZ1A 3UCZP 3OTOF 3WIVA 1N8RT 4F2SA 2QJ3A 2B4OA 3KHGA 3M8QA 2PA8D 3MPUB 3FDSA 4WTOB 4DQIA 2CJKA 3JTOA 2AIRB 2O1PA 5ETNA 3M2RA 4F4ZA 3RTVA 1UZDA 2V50A 1VQNS 1PO6A 2XC9A 3IR7B 5KFUA 1ACMB 1C1CA 2N3LA 5C24A 2DNYA 3W2WB 2CPXA 2FB0A 2FPHX 1WORA 3FZBA 3D28A 1HR0F 2F40A 4J9SA 1DZ5A 1HWIA 2V2ZA 3VGTA 2B6AA 2JNJA 1HI8A 1HBOA 3G8SA 2FJEB 4FVMA 3UW1A 3W8GA 1TTHB 3B8HA 3P5TL 1WDDA 3ZZZA 4ZDNA 4PUOB 2O66A 2ZBCA 3M2VA 1DLOB 4ELTA 3HO1A 1FNOA 2VOPA 3BSAA 2EFOA 3PIOQ 5CAAA 1GH8A 1SUQB 3PM9A 2X7IA 3N79A 1B7YB 3T5LA 2NZ4A 1QSLA 2J9EA 4YMEA 1PBUA 3MEGA 3NBPA 2OPSB 3DGPB 3THPA 1WSVA 1LW0A 5ETLA 2BJDA 1FDBA 1JXVA 1PIEA 4WXWA 3BJYA 4OZ2A 4IH6A 3DI6B 4ID8A 5LSOA 2I8EA 2XZTB 1CJKA 3PTWA 1GK8A 5T7LB 4RUCA 4LREA 4GKKF 1R8PA 5HMWA 4P2FA 2PT0A 2POKA 5CD4A 1UVJA 1H38A 2QSWA 4C11A 1FERA 4LFCF 4XDDA 2ZOFA 1SC4B 1DTQB 2GQCA 4HDGA 4YFUA 1RHKB 2R7QA 3AD9C 3CD6S 1BWVA 2MJNA 4JUZA 1ZTWA 3TQEA 5K8MA 4A8OA 3KLGB 2BVZA 4J9PA 3R8YA 2YPZA 5A0YA 5DQGA 2YNIB 4NEYA 3EVWA 5I3PA 2F8HA 2WB1D 4A8YA 4EBEA 1QDUB 4KO0A 3MUVP 2J9DA 3J81Y 4KGMA 4LF9F 2I2YA 1CJVB 3MECA 5HN0A 2WCXA 4TU7A 4Y34A 1FHTA 1NK4A 2BE2A 4EMDA 1ZAWA 3GG0A 4ZA1A 2E7XA 4NYPA 3HXMA 1B70B 3CCSS 1UWBA 1IWAA 1UZHA 6FD1A 1T3OA 5L9XA 5IOLA 3V5RA 5K14B 1EHWA 2ASJA 3KTQA 4DV1J 2V4JA 1X4HA 2JHEA 2HW3A 3ICLA 3W9HA 2RRAA 4ZCKA 1M5HA 5DO2A 3TRGA 2MYFA 4NXMF 5THWA 3ZNJ1 3NGKA 3EPIA 4IRDA 4EYIB 3VAMA 3LO3A 3SI8A 2IRYA 3CXCR 6AT1B 2WONB 3FEZA 4NA3A 2DNKA 4N77A 5D77A 1Z1ZA 3GIKA 2DH9A 4DR7F 4BC9A 4AQYF 3TZZA 4YB5A 1ZOTA 2FVRA 4JI2J 3CJKB 1V3SA 1T03B 3PJ9A 3DMJB 1WC4A 4YHHJ 2FHKA 5CYMB 1YBUA 1RWVB 1LK7A 3HKWA 2HWHA 3OVSA 5ETMA 2HLUA 2R7SA 1RK8A 4EI2A 1RA7A 4QIGA 4PPDA 4GMKA 5ITHA 1UP1A 4DFKA 3MTKA 5CD4H 3AXMA 2GAGC 1NPKA 5F41A 3FBBA 2YNFB 2HQGA 5KFAA 3ZNUA 5HSPA 4DXLA 2XSFA 2FTRA 2K1RA 3W5YA 3FQLA 1WWHA 1R27B 1DFDA 4G1QB 3GG1A 1HNXF 3Q8VA 1WC6A 1KQSR 2M4MA 3PW4A 2G9OA 4LSZB 2CADA 2V6AA 4A4JA 2FHOB 3SQOP 5IC4B 4OZJA 2KT2A 3R2DJ 2NXJA 3MR2A 4NZ7A 2K3KA 4TLQA 2H54B 3L7PA 1UTAA 2CVIA 1RADB 1FKAF 3Q8YA 1C4AA 4O4RA 1HKAA 1WHVA 3BH6B 4X4RA 4F2RA 3DGVA 3MMBA 3E2EA 2OEKA 1R3NA 4CCHA 5F8GA 5IFMA 3AOCA 3F0NA 2P9CA 2QZ8A 2CPIA 3H90A 3BGRB 4N5SA 1JJCB 3HCXA 3W7BA 1P9YA 3I9ZA 5KT6A 3HHNB 4UQTA 2VDIA 2L08A 3VAFA 2FZKB 3K5NA 3K0JA 3IM9A 4A8XA 1Q5YA 5LMUJ 1N5TA 1HD0A 1OYEA 4ED0A 2G13A 1FO1A 5KG0A 3JAMU 2Z2MA 4A47A 1JXEA 3FCHA 2MQQA 3FFIB 2K2PA 5ETTA 3EE3A 4TYAA 5EUHA 1TR0A 3H2LA 4GKJF 3F44A 1IJEB 1HFEL 4EBDA 1UJ5A 4QIWD 1BGXT 1SCJB 3HJFA 2ILZA 3NEKA 2VJUA 2JX2A 5DJBA 2YKMB 4ZCIA 2WVCA 2P6SA 2UXBJ 1T9WA 4DPOA 3PCOB 1CS4B 1RT1B 2E5HA 1Y0HA 5HQLA 1OO0B 4DR2F 3W3SA 5K8OA 5A76A 1VIXA 1EQ0A 4KAIA 4C6AA 3THTA 4BBYA 3UCUP 1M90T 1IKVB 1S1WB 1U0SA 3UNGC 2CQHA 2WSFC 4QYZK 3QATA 2UP1A 3IAM9 1HL6A 2ZWPA 2KM8C 2DR9A 2KU7A 2G1DA 2YVSA 1SVDA 3RBZA 4ZITA 3W2WA 3I32A 3KK3B 7FD1A 1YJWS 3PYEA 5DDPC 4DR4J 1FRHA 1M0SA 5LSLA 2BE7D 4QW8A 1S6OA 2OFHX 4RU2A 1EQMA 2BEFA 3MM8A 3VZIA 3BSNA 4DL2A 3IRXB 3HULA 1WC3A 1VFJA 4WPAA 1DQ9A 3K17A 4DR5J 4PUOA 5J1EA 1DLOA 4I2PB 3NG8A 3P45B 3EDRB 2D9OA 3KHLA 1SUQA 1S0NA 2E66A 3BH7B 1N0UA 4DL7A 2GGPB 4YUDA 4FF3A 2BKPA 1FD2A 2E7WA 4ZP9A 2OPSA 3DGPA 5LXYA 1GX6A 2M0GB 5KG4A 1H7XA 2M2BA 1CQNA 2WK4A 3TJ9A 4W90B 3OTOJ 3EXYA 5KFKA 3TVKA 1EKSA 4KIAA 4JI8F 3M7VA 3DI6A 1Z2ZA 4FYDA 1DARA 2UUAF 4RWWA 2VICA 2CRLA 5T7LA 1FK9B 3GSDA 5CA5A 2R7TA 2BX6A 1F0XA 1FWKA 3OUYB 2R7RA 1IN0A 2KN4A 3G6YA 3TR5A 3IBCB 2H65B 3TJ8A 1HHQA 1VQ8S 1B4SA 2ASDA 3DOLB 1DTQA 1Q8LA 2W25A 3HSGA 1VQOS 1G6BA 4E98A 1QAXA 4OFZA 2GV1A 1HR0J 3KLGA 2YNHA 2NYHA 1APSA 4IQXA 1UVKA 3M8PA 5K20B 5M2PA 3VCDA 2WHOA 2J7WA 3RGIA 4CP5A 1WELA 4UUWA 2OSQA 1DJ0A 1XN9A 2C3UA 1R6VA 3IWXA 4DN9A 5C5JA 2IA6A 5HVFA 2CFXA 4PKDB 2KDOA 3UD4P 2Y9HA 3HDSA 4PZVA 2YKQA 3GTYX 5BYRA 4AFFA 4USIA 4OI2A 3UPFA 1YJ9S 1CJVA 2HFZA 8RUCA 3FEXB 4CI0B 1TL3B 2IDEA 4OYAA 4RNOA 4W98A 1I1GA 4RJVA 4YR3A 2XI2A 3DLKB 3HF5A 3IMQJ 4LF4F 1MNEA 1AUSL 4DSKA 3MWBA 4Z7YA 3PX4A 1HQEA 1SJRA 1LWFB 3KLFB 2PMHA 4OYZA 2VA2A 4DU7A 4H4OB 1FKOA 3QT8A 4GKKJ 2UV8G 3I0SA 1RAJA 2DY1A 3MM6A 3N6NA 2J8AA 3TWZA 4ECWA 1WOSA 4ECXA 2MQLA 1N52B 3OW2R 2RRNA 3PW5A 3CDAA 4ILMA 2RU9A 5EN1A 3RB0A 1Q0NA 5FLXY 4DJBA 1G2EA 1FDNA 1S77D 3IWNC 3PVXA 1U2FA 1JLEB 1VRTB 3BSOA 1YSJA 2E1MC 2KHDA 4TY9A 3CJKA 2V8DA 1PC5A 3S01A 2UVRA 4B08A 2FHJA 5CYMA 2GNKA 2J6TA 2VFTA 4J9MA 4DV7F 2EC0A 1S79A 1RDRA 3L9ZA 5KFJA 4ZPWR 1YWXA 4KHRA 1V3RA 1OJ4A 3Q8UA 3HHDA 2OD6A 4E2FB 2KT5A 5I3QA 5L1LA 3C8YA 3BF4A 1YG0A 4PCQA 2QLWA 4NEZA 4G1QA 3NMAA 3V81A 3O5TB 2O67A 3ZZOA 3DN9A 2C3OA 3IGVA 4U96A 2L9DA 3AHPA 3GONA 2BQRA 4FXWA 2BJEA 3NXZA 2CVEA 2QG9B 4KRWA 2DHGA 3D0IE 3RJMB 2DR6A 4F50A 2IYIA 4DQRA 3ETOA 4RNHA 1U02A 1HI1A 3OTDA 1GX5A 4NX9A 2XLKA 1RHUB 2P6TA 3T5HA 4KE5A 3VAIA 2BV3A 1TK5A 2ZH4A 3CJ5A 3TW0A 5MAOA 1C2PA 2LDYA 2RUGA 4ZVQB 2SXLA 4DR7J 2VQFF 3DLHA 4AQYJ 1UEUA 3PYFA 2R8IA 3BKUA 1U48A 3J81U 2MKYA 1UWAA 3HHLC 1HD1A 3BYRA 4A46A 4B3TF 2J6UA 2CNLB 5KT3A 2BA9A 1REGX 2QSFA 3CEDA 3O2IA 3AD7C 3C14B 3ENQA 1U1OA 1L3VA 1IBLJ 1PCAA 4K5SA 1UEVA 2EG2A 1NHKL 4DL5A 3RRKA 3SBMA 4F4YA 4ZVTB 1RWUA 5L1JA 2G0JA 4HT7A 3FFIA 4DOZA 2CAJA 2DJWA 3DRYA 2ZBPA 3CCMS 4DF4A 1AUDA 1TKZB 4ZPVR 1HNXJ 2E5IA 4FPRA 4DSLA 3QJLA 4IKAA 1RBOB 1YJVA 3J7YU 2YKMA 4USJC 4XK8C 4J9QA 1RCOB 2HFUA 5HROB 1CS4A 1RT1A 4EYHB 2W2OP 4OV1A 2YH1A 4HVZA 2K8GA 3ENWA 2GO8A 3RAQA 3CJQA 2FY8A 5KOWA 4BWJA 4NL5A 4PWDB 4LSLB 3SQGA 1N6QB 1IKVA 2JVOA 3QSIA 4F0KA 2AMCB 1ZAVA 3LGMA 3K5OA 3R5DA 2G2YA 2GO9A 3CT9A 5G4DA 3SV4A 1L3TA 5HAOA 4ZJQA 2BW2A 4JV5J 2KJWA 4O3QA 3BR8A 3A13A 2HQDA 4EZ9A 1H6KX 2DPIA 1MLAA 1JLAB 3OVBA 3BN7A 1S6QB 2ZD1B 4LQ3A 4NLSA 1MW7A 1S57A 5B0FA 1YK9A 4NE9C 3DLLQ 1N5YB 2L48A 3A8KA 5DS7A 1F60B 4B3SF 4U6PA 2NXEA 4OJGA 1X5SA 3H59A 2RRBA 3IRXA 1RAOA 5HQ8A 1KVIA 4KKOB 4WJBA 1RAEB 4I2PA 1HHTP 2EXUA 4WYLA 1IBKF 2RILA 3K2YA 3GFXA 4ZLLA 5GAEU 1FFGB 4CO5A 5HJYA 4WU2A 3M9NB 4JP8A 2AEMA 3HD2A 2GGPA 4OJ3A 1YX2A 4CLYA 4Q45A 4JBCA 3MM7B 3TARA 1HI0P 3U7JA 1TMMA 3TZYA 2CJ9A 1IJFB 3BO3A 1UW9A 2XBPA 2HBZB 2UUBJ 4C8NA 4OHVA 2FLNA 3DU5A 4F25A 1UVIA 3FCWA 2AKWB 2J0XA 3OTEA 2LXIA 4DR2J 2J0WA 3NS5A 2E9TA 1X9WA 2V0NA 1XQIA 1FK9A 1T9XA 3PACA 4ZVOB 3TAMB 1H74A 4JOUA 3D2WA 4KY3A 3TP2A 1GMVA 3DOLA 2VUGA 4Y6IA 7FDRA 2DXFA 4RW9B 5KG2A 3HVWA 3SMZA 3TAQA 2FJBB 1P1LA 4XO0A 2RDJA 1TKDA 2VPZB 1RKIA 5KFIA 1KHVA 4K4WA 2PMZD 3HSDA 1ZM4A 2HGNA 2QYGA 3MEEB 4ID5A 2M5YA 3I96A 2ABYA 1X9MA 3BGUA 4TQSA 4F26A 3MR7A 1NAQA 1TFWA 4OI4A 3BS9A 3AOBA 2LKZA 3L95X 4DR1J 4UOCA 2A10A 1TL3A 4ZVGA 3QIPB 4D3GA 1SJ3P 5KFRA 2OTLS 4JI7F 2HVHA 4OI0A 4TXSA 1RTZA 1YVFA 3IBFB 3Q24A 3DLKA 1GT8A 2V9WA 1LNQA 4NXNF 2J0SD 5GAGU 1D1UA 1HWKA 1FXDA 3TUPA 4ED3A 4DSJA 2KG0A 2B51A 1B0VA 2LXUA 4JI8J 3DRXA 1YBTA 3VF0B 3DLGB 3D1QA 4IH7A 2HAFA 4KFBA 1GXTA 2F65A 1LWFA 3KLFA 2LA6A 4LRBA 2UUAJ 4H4OA 3FZ2A 2XGPA 1VQSA 1DTTB 3UI3A 4L72B 4QYRA 3EYZA 3LP0A 5KFZA 3D0GE 2QV6A 3NMRA 1JKHB 1SL0A 4C8ZA 4EO6A 3T5KA 2OPQB 1YLXA 2NYIA 5HVHA 1RKJA 2YWWA 1FEHA 4M5HA 2GIFA 2I5JB 1F9HA 3QSYB 1M5OC 3RBDA 1VRTA 1RUSA 2AYGA 1WF1A 1IBCB 3G8TA 2JDJA 1RTDB 2GW8A 2BUNA 2XWYA 2QRRA 4DL0C 2QLJB 1CBKA 1U47A 3BDPA 2RVJA 3TUZC 1WC0A 3MPDA 2IJRA 1N5SA 3OXGA 1HWJA 1T9UA 3N28A 3QBCA 3BV8A 3J7Z5 1F2HA 2BXJA 1Q8IA 1JLBA 4Q43A 3V6JA 3POTB 1N34J 1OMSA 3ULHA 2GMJA 1VRQC 5K8NA 4J9KA 2HQCA 2H5JB 2N4DA 3M8SA 1N48A 5B08A 5KFVA 3UN2A 5HANA 2HNZB 1RAHB 4LF4J 1RT6B 2BANA 4ETXA 1SC6A 2VL1A 4C0OC 3LAKA 1QAIA 3ISZA 1D8YA 4MIWA 2AU0A 2LYVA 2QT7A 4AL5A 1S10A 4I7FB 1LWCB 3ZTRA 4MH8A 1NSQA 1WG1A 2GMHA 1X5PA 4HHUA 2Q79A 3F41A 2RS8A 3K8WA 3M8YA 4RO0A 2HWIA 1M5SA 2OPPB 3OFGA 4P9SA 2JRSA 1K47A 5KFMA 1GXUA 4WP8A 5EWFA 5J2PA 2DIUA 2CG4A 4N56A 2EK6A 3KG4A 2FY1A 4X2BA 1CPZA 1U7LA 4I64A 2QL9B 3C14A 2BKNA 2DGUA 4ANCA 3M9MB 1SV5B 2C3PA 1JB0C 2JOQA 1LWXA 2OHDA 3LTOA 4IRKA 2K7KA 2BABA 3LW5C 2DXDA 2Z4PA 1X0FA 3BDEA 1Q4RA 3CCQS 2R7UA 4F3OA 1DQ8A 4ZHRB 3R5AA 2YQ1A 4K2JA 1C0TB 2IM0A 4LUBA 1DRZA 1TKZA 3TEGA 1DAXA 2CPYA 1J5OB 1N0VC 4O3SA 5B0CA 1YI2S 1TK8A 3A8JA 1M5PC 1CVJA 1FRMA 1H0HB 3ZXWA 1AXQA 1Y4ZB 5HROA 4CO1A 1NK5A 4LJMA 4LBHA 3RW7A 3OXLA 3RR7A 2OD4A 3QAUA 4LSLA 2GA7A 2KYXA 1NK8A 3I56S 1LW2B 2GIQA 3FK4A 4CLTA 4H4KA 1N32F 5LSRA 4NLRA 4DU8A 1SKUB 3A8IA 2HG4A 4XDCA 3DLJA 2IAJA 4Y2AA 4CM2A 4TYBA 3OR1A 1U6FA 2EFVA 3O1LA 3T5JA 1S6QA 4ES3A 4L3KA 3TA0A 2R7OA 4B3TJ 5DG7A 3VTIA 1KVJA 1JXLA 2G4BA 4C8YA 1WEZA 1N5YA 4JI6F 4J91A 2G1HA 2A18A 2A6OA 1RT5B 1TKXA 4WP3A 5KT7A 2WSEC 4DDFA 4KKOA 3W1YC 4DCPB 5DRKA 5HATA 1VC5A 1XMOF 5C25A 4RL1A 1U8WA 3KUEA 2MZTA 2MHEA 3M1VB 1S97A 3GE9A 4FXDA 2NSBA 2W8KA 4WF9Q 2FZGB 3N5BA 4ZVFA 3MM7A 3PRBA 1SH3A 2B4VA 5FJ4A 1T95A 6FDRA 1FNXH 1MWZA 3I0RB 1XTZA 4M5GA 2V5HG 1NBEB 2HHXA 2R2RA 2C2OB 3N0VA 2FC8A 1JLFB 4TVAB 1UKUA 3MPYA 2ZFHA 2PI4A 3ET6B 1UW4A 4B9SA 3NOCA 3U27A 2XWXA 1UFLA 2B43A 2X3GA 3TYTA 3W60A 1VC0A 3IS9B 3HFVA 3RRGA 2CQDA 4OYWA 1Q95G 2QYCA 2HGLA 2V68A 3OJSA 1VRUB 2QLBB 2R7VA 1HHSA 3OTCA 3TUIC 3ILOA 5E3AA 4DQQA 3ADAC 4YDDB 4HEA9 3N01A 4ELVA 1Y5LB 3V6DA 4RUHA 4RW9A 3H8YA 1VQ5S 1HMVB 4HR2A 3J80U 9RUBA 3T6BA 2QA1A 1SB6A 1WF0A 4B3SJ 1YRUA 2DY9A 4KH1B 4X4PA 1X4AA 3PFOA 3US5A 2GFFA 2ATLA 3OL8A 3MEEA 3LP2A 3GIIA 4IO9Q 1U6ZA 4A8SA 2GHVC 1MWQA 5DZ7A 4ZKAA 5GMEA 4CRJA 1IBKJ 2RMLA 2JEJA 4IG0B 1KDNA 4U7UD 3OL7A 2Q66A 1GMWD 4NLWA 1QY7A 2EW9A 1RYRA 5L38A 2ZOMA 2DNNA 1FJGF 5H9EJ 2DNRA 4K0KJ 3R27A 2C2RA 3PNIA 2E1AA 4C48A 3U1MA 3GR0A 3TO8A 2YWGA 4NRUA 1VCTA 5F9LA 3TANA 3TNVA 1LXJA 1IKWB 2KZMA 1C1BB 5CCMA 2HPUA 5KFBA 2J6SA 1RA6A 4R8UB 3NWRA 3KLHB 4DFPA 2NUHA 1JKHA 4AL6A 2OPQA 2KT3A 2FVSA 2I5JA 4M5JA 2CQCA 2HHVA 4KTQA 1Y11A 4N47A 2VFUA 2B8PA 1RTDA 4WFZA 4K5RA 2RH3A 2LXFA 4WCEQ 3NCPA 3DYAB 1MMNA 4P72A 5JXSA 3CC7S 1VK8A 2ZC3A 2E5LF 2VBWA 1WOPA 2HFNA 3W5ZA 2G2ZA 2QC3A 4DV4F 2N82B 3CCWA 2VPYB 4FYYB 2PD1A 3H40A 3EX7B 2PC6A 5JMNA 2C42A 3T6JA 4QPTA 3LALA 5F3TA 2X1AA 1ELOA 3POTA 4MTPA 4CLLA 4DR6J 2HSEB 2Q3PA 3IA0A 1B99A 4CDIA 2DNGA 4JI7J 3J7A1 4MIAA 4DEZA 2C1EB 3AA8A 2VHGA 2HNZA 1YITS 2OMOA 3JQKA 4DV3F 3DFEA 5KFPA 1RT6A 4NXNJ 1RU1A 2DHSA 2ZVIA 1HIYA 2AYMA 3OFEA 4QU6A 4FBTA 2OAUA 1OYDA 3ITHB 4DCOB 1NEEA 3R7NB 1R8BA 1HLWA 3GJRB 4F4AA 3KNAA 5I3UB 9ATCB 4Y2MA 1M5KC 3I55S 4LVNP 2XQCA 3OL6A 2ACMA 2J8SA 1SQEA 1JJ2R 4U7UK 3FQKA 5B09A 2HQFA 4I7FA 1LWCA 2Y3YA 5IV3A 3Q83A 1TVRB
chains in the Genus database with same CATH topology
4DFJA 4RNMA 2F4VF 5F8MA 2DNMA 2W4PA 2R2TA 2FJVA 2MPUA 5E0OA 5D3GA 4WFXA 4A47A 1JXEA 2CJQA 3MMAA 1YGYA 3GWCA 1SKRA 4YOEA 3FCHA 1X5TA 2MQQA 2RS2A 2VG6A 1RT7A 3FFIB 2K2PA 3NGDA 2OPPA 2CPEA 2D1CA 4KR0B 4WFAQ 4HLBA 1JLQB 2WTFA 1BD6A 2O5DA 4TYAA 5DG9A 5EUHA 1TR0A 4Q7AA 2ROEA 4N8NA 3H2LA 1D9FA 4GKJF 3F44A 4YP3A 4TN2A 5KFEA 4HYKA 2MY7A 2F8EX 1FKPB 3JSRA 3HHEA 1IJEB 1HFEL 4EBDA 3M8QB 3J80Y 2BM0A 1FRIA 1UJ5A 4PQUB 1BGXT 4QIWD 4ES1A 3MCSA 1JNZB 3LANA 3G9CA 2M3DA 2U1AA 1SH2A 5G0RB 3HJFA 2IJFA 3HHLA 5LT5A 2ILZA 3CULA 1TAUA 2VODA 1R31A 1N88A 2KFZA 4QR0A 1SV5A 2NLWA 2JX2A 5DJBA 1OWXA 4WIIA 2MKKA 2YKMB 4ZCIA 3LP1B 1U1QA 2Y1IA 1S49A 1U45A 2P6SA 4A8FA 5JUMA 2Y1RI 4DPOA 4QIFA 4NLDA 2XMTA 2C2EA 1QM9A 2A3JA 1S0OA 3NNCA 1EP4A 1RT1B 2E5HA 3OVAA 3BR9A 1Y0HA 5A8RA 5KFWA 4CTAB 3AJ1A 1OO0B 4DR2F 4LSNA 3W3SA 1FTRA 5K8OA 2ZZNA 1VIXA 3G8QA 2W9AA 1X7VA 4KAIA 1IKYB 1TL5A 3THTA 4FNIA 4H4KC 3UE2A 4J9OA 5C24B 2ZE2A 4BBYA 4ZHRA 5B0DA 3SFGA 3H5SA 2HVZA 3E8OA 3BM7A 1FT8A 2IVFB 3HK2A 1WG4A 1TQLA 3UCUP 1U49A 1MSWD 2DB1A 2XLIA 1M90T 3O44A 5IT9Y 1C0TA 1IKVB 3R5CA 1S1WB 1E6YB 2VFSA 1ZETA 1K9MT 3UNGC 2M9KA 1N36F 2UUCF 4MYTA 2CQHA 1S1XA 1QAJA 2WSFC 2YWHA 2M7SA 3EGNA 4PXDA 2UZAA 3PR5B 5F8JA 4JI4F 4PR6A 3QMQA 2UP1A 3IAM9 1P1TA 2RQKA 1HL6A 4ES2A 3C6TA 2DNOA 1CEZA 3QWUA 2KM8C 2R8HA 4HTJA 2DR9A 2KU7A 2G1DA 2YVSA 3MEDB 1WTBA 1QSYA 4PWDA 1Q78A 3W2WA 3I32A 3KK3B 3T1HF 1N6QA 1N54B 2IBKA 2R2SA 3GFZA 3QYYA 3CIMA 7FD1A 3RRHA 3HX9A 3KWMA 4MKBA 4DSEA 5JVHQ 1S76D 2HWTA 3D0HE 1Y9OA 3BGFA 4PQAA 1YJWS 1SL2A 5DDPC 5KFXA 3M2VB 1HQUA 1FRHA 1M0SA 2JLFA 2IC3B 5LSLA 2AJ1A 4QBUA 1HNZF 4XIUA 2IAJB 2IHR1 1S6PB 4QW8A 1Y7PA 2IA0A 2DNLA 1S6OA 3DNCA 2A1BA 4PXEA 2MQOA 4WFBQ 2OFHX 3OR1B 4RU2A 3QLHA 1KHWA 2B9WA 3MM8A 3VZIA 1X4GA 1JLAA 3CUNA 1VJWA 3BSNA 4DL2A 3IRXB 2XGQA 2ZD1A 2RKIA 3DHXA 4DQPA 2HRUA 1LW2A 2RF2B 1R89A 1VFJA