3KLIB

Crystal structure of unliganded azt-resistant hiv-1 reverse transcriptase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 103
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kliB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB03
4Q43A 1HNIB 3OSPA 4WYLA 1SH3A 3CJ0A 5EWGA 4K4YA 1J5OB 3LP1B 2YNGB 5I42A 2R2UA 3RB6A 5JUMA 3NAIA 2DPIA 2RKIA 3TAMA 1XR5A 4RUCA 3H2LA 3M9MB 4RW9B 5DLGA 3PW5A 5DG8A 3T5LA 2D3ZA 4QWBA 3HVTB 4RW8A 2CJQA 4TXSA 4ED1A 3BSNA 4DL7A 2OPSB 4K4WA 4KFBB 3N6LA 4TQRA 5KT7A 4ED6A 3DRRB 3CDEA 2WB4A 4H4MA 3BSAA 1IM4A 2JC1A 4NLVA 3QYYA 4R0EA 2E9RX 4DG1B 2OPRB 1T05B 3E51A 1EP4A 1HQEA 1QUVA 1Z4UA 3QGHA 2YKNA 3RB0A 2IJFA 2JLEA 1C2PA 4QPXA 2BANA 4ICLB 5KFEA 2WONA 3QO9A 2W8LA 4M94A 5DG9A 2HNDB 4IR1A 3GQCA 3PW2A 1RT5A 4I2QA 3KMSA 5KFVA 5J1EA 3DOLA 4IH7A 1JX4A 3QGIA 4KAIA 2YKMB 1RT2B 4MIBA 3I5CA 2BRKA 4WFXA 4ZPDA 1S0MA 2XI3A 3PJXA 4QW8A 1UWBA 2FLPA 3GV5B 1JLEA 1IKXA 1DTQB 3QIPA 2C22A 4KE5A 4IFVA 1HNVA 5F8GA 5CYMA 2HWIA 4IRDA 5DQGA 1FKOB 2B6AB 4ZVEA 4TY8A 3MECA 4WE1A 2B5JA 5KFUA 3RBDA 3KK3B 4EBEA 3FRZA 1LW2B 4O3PA 1XR6A 1MMLA 1S6PA 1REVA 4J9OA 3HVAA 4PUOA 2J6TA 2VG7B 2AX1A 4DEZA 4KO0B 1BQMA 2ZKUA 4YMEA 5F8HA 5KFCA 3M9NB 3G6XA 4J9SA 4ED2A 1DLOB 3V81A 5C42A 4ECRA 3DI6B 4M95A 2GIQA 4TYBA 5L1KA 4O4GA 3DLKA 1CSJA 2R8IA 2XC9A 4ED3A 3MEDB 5KG3A 3I0SA 5KFDA 4QW9A 2XI2A 1N6QB 3N6NA 1LWEB 4LSNA 5K14B 4ID5A 1RTHA 2YNFB 3QLHB 2W7PA 4R8UA 1RTDB 3KLEA 2WRMA 3QIDA 1JLBB 1S1TB 2GIRA 4ECVA 2FVQA 3EPIA 1TL3B 3ISND 2JC0A 3H5SA 4EBDA 3T19A 3CVKA 4Q0BB 4O3NA 2FVSA 2VG6B 1U09A 1RTIB 5L9XA 2IAJB 4KSEB 4NLYA 1SUQB 2WHOA 3TVKA 3PHEA 3E01A 2VG5B 1RTJA 3EPGA 5C24A 1JKHB 2WOMB 4XO0A 4RNOA 3HHKA 1IKVA 3KLVA 2BE2B 4I2PB 5CYQB 2W9BB 5F8IA 3Q8SB 4MFBA 1JLAA 3IG1B 3KJVA 1KLMB 3VQSA 2EC0A 4KKOB 1QE1A 1S1VA 3G6VA 2UVRA 2FJWA 4WYWA 5KFSA 3MEGA 3MEEA 1C0TB 1TKTB 5HP1B 2UVWA 2OH2A 4EYIB 3M8QA 4G3IA 3ICLA 2AX0A 3DLEB 2XCAA 1TL1B 5J2MB 2FVCA 2XCPA 2W7OA 2R2SA 4I7FB 2FJVA 3BQ2A 3GILA 3ITHB 4ECYA 3JSMA 4MKAA 3LAKA 3BR9A 3PW4A 4RW4B 4J9KA 5DLFA 3OL6A 4GC6A 1S0NA 3PJWA 2O5DA 4FS1A 3V6DA 4PQUA 2BQRA 1S0OA 2UVUA 5J2QB 1JLFA 4RNNA 1FKPA 1LWCA 1TKZB 4TN2A 1T94A 1S9EB 1JLQB 4G1QB 5D3GB 3NBPB 4IFYB 4RW7A 2WCXA 4F4XA 2OPPB 4URQU 3MR3A 4FBUA 3CDWA 3H98A 3FQKA 1EETA 3N6MA 3C6UA 5KFJA 2FVRA 3DOKA 2HMIA 3UR0A 5KG1A 2W9AA 2E9TA 3HVWA 3MR5A 4F4YA 4LQ3A 3DYAA 4DL5A 3TAMB 3RB4A 3DLGA 2D3UA 4ZHRB 4TQSA 4RW6B 2ASDA 4FBTA 3DRPB 3KLGB 1HQUA 3FFIA 5HLFB 3UQSA 3LP2A 1VRTB 3GIJA 2YNIB 3IRXA 5FDLB 4LSLA 5JXSA 5KG6A 1FK9A 4EO8A 5KT3A 5I3UA 4J9QA 3KK1B 2ZD1B 1S9FA 1TP7A 2OPQB 2V4RA 3JYTA 5KT6A 1JLCB 3DDKA 2ASJA 5KG7A 4IG0A 2GC8A 3PW7A 3KK2A 3IS9B 1W25A 3KLIA 2E9ZA 2UUTA 4RU9A 3PR4A 3GIKA 3T1AA 3FQLA 4QWCA 3LANA 5DQIA 3KLFA 2BQUA 1C0UA 2FLNA 1HYSB 1DTTB 1N5YB 3BQ1A 1LWFB 3I0RA 2UVVA 4WZQA 5KFZA 1HNIA 2JEGA 4JV0A 3LP0B 4IQXA 3V4IB 5L1JA 1J5OA 3LP1A 3LALA 2YNGA 4K4VA 4NLWA 5KT2A 2XWYA 2IBKA 3G86A 4H4OB 5HBMB 1C1BB 1IKXB 3QIPB 4RW9A 3KLHA 4NCGB 4XPCA 1S9GB 4URSA 4Y2AA 4Y3CA 1IKWB 1VRUA 2HNZB 2DPJA 4ECSA 2JEIA 3HVTA 5J2NB 2XGQA 4K50A 1S1UA 1S49A 3BSCA 2OPSA 3FSIA 4IG3B 4KFBA 3MTKA 4TY8B 1RT4B 4X2BA 3KHRA 3DRRA 1YVFA 2QE5A 1SH0A 2I5JB 2IM2A 3GIIA 2W9CB 4O44B 1TKXB 4RNHA 1JLGB 4DG1A 2OPRA 1T05A 4IKAA 5DGBA 1TV6B 4NLGA 4TYAA 4Q8EA 1N48A 2C2EA 4ICLA 4RZRA 2AWZA 2ZE2B 4MIAA 4ECTA 3OL9A 3H59A 4MK7A 3NKYA 2HNDA 4K4SA 1S1XB 4O4RA 3RAXA 3C6TB 1S10A 1RT1B 3DRSB 2YKMA 1RT2A 1KHWA 1R0AB 4R8UB 4EYHB 3BREA 1DTQA 4WXOA 4NLPA 1SV5B 3IGVA 1RT6B 3DMJB 5C25B 1RT7B 2HNYB 4ZP6A 3GV8B 1BQNB 4KHMA 4ZPBA 5DG7A 4WZMA 1FKOA 1S6QB 2B6AA 2WTFA 3CJ2A 1RA6A 3PR5B 2C2DA 1LW0A 3M8PB 3KK3A 2AGQA 1LW2A 4J9NA 2I1RA 4KV8B 4MH8A 4HKQA 3UPFA 5KFBA 3OSNA 2XGPA 3V6KA 2VG7A 2V4QA 5KFYA 4KO0A 5KFWA 3UDLA 2ILYA 4Q45A 2RF2B 4R5PB 1RT3B 1DLOA 1JLAB 4LQ9A 3DI6A 4Q44A 3OHAA 5HROA 2IMWP 1OS5A 5EUHA 3IGNA 4NYZA 4WFYA 4ECXA 4DL4A 2R8JA 1IKYB 4KBIA 5KFIA 4NLXA 1N6QA 3V6HA 1LWEA 4PWDA 5K14A 1JIHA 5KFMA 4ECQA 1D1UA 5F8NA 4IH6A 2YNFA 3QLHA 5KFGA 3BSOA 1RTDA 3BQ0A 3NL0A 4KHRA 1JLBA 5DQHA 1S1TA 1T03B 3IN5A 4F4WA 3H5XA 4ZP8A 4JV2A 4YP3A 1C1CB 1TL3A 3KNAA 2CKWA 2FLLA 4Q0BA 4Y34A 2VG6A 1QAJA 1RTIA 2IC3B 2IAJA 3GV7B 4J9PA 1RYSA 3H4BA 1S1WB 4RNMA 3RBEA 1SUQA 4PQUB 3Q8RB 3GYNA 4ZMMA 4U7CA 4B3OB 4NLUA 2VG5A 1I6JA 4NZ0A 1TVRB 3OL8A 4K4XA 4RW7B 2IM3A 4ECUA 2WOMA 1ZTTA 3CDUA 2RDIA 2BE2A 4I2PA 5CYQA 1N4LA 2V0NA 1HMVB 2D7SA 4NLQA 2YNHB 3KHGA 2W9BA 3IG1A 4F4ZA 2R8GA 1MU2A 1KLMA 5J2PB 5C5JA 4IDKB 2IM0A 1C0TA 1TKTA 5HP1A 4YQWA 1HPZA 3BGRA 3CJ4A 4NLOA 3OHBA 3DLEA 1K1SA 5I42B 4TLRA 1TL1A 5J2MA 4I7FA 2RKIB 4LSLB 3H5YA 4IRCA 3H5UA 1FK9B 4ZP9A 3LAMA 2FVPA 4RW4A 4RW8B 5KT5A 3DM2A 3MR6A 2WK4A 4ZP7A 4ZPAA 5J2QA 3T5JA 4H4MB 1TKZA 2IA6A 1RA7A 1S9EA 1JLQA 5D3GA 3NBPA 4IFYA 3CJ5A 2AGPA 1EP4B 1HQEB 2OPPA 2C28A 2YKNB 3I0RB 4DL2A 3M9OB 2BANB 5EDWA 2WONB 3QO9B 5KFQA 3T5KA 1RT5B 3D5MA 4I2QB 4NLSA 3MR2A 3PW0A 5J1EB 1NHUA 1GX5A 3DOLB 4OL8A 4ZHRA 4RW6A 3DRPA 3KLGA 3KLHB 5HLFA 4J9LA 4MK8A 2VA2A 5KFNA 1VRTA 1VRUB 4JV1A 1UWBB 1D0EA 2YNIA 1JLEB 5FDLA 1S1UB 2F8EX 4IH5A 3RAQA 4IFVB 2FJXA 1HNVB 2B43A 3T5HA 3SFUA 5CYMB 4MKBA 2ALZA 2JEFA 3KK1A 2ZD1A 2OPQA 1JXLA 4FS2A 1JLCA 3MECB 2B5JB 4WE1B 2ILZA 5EWEA 3SFGA 3IS9A 2AGOA 1S6PB 1KHVA 1REVB 2IM1A 4Y2CA 4PUOB 5F9NA 5KFXA 4ZVGA 2IJNA 2R2TA 5KT4A 1BQMB 4F50A 1HYSA 1DTTA 1N5YA 4EEYA 1LWFA 5C42B 2R2RA 3V81B 4O4GB 3D28A 3DLKB 5KFAA 3LP0A 3V4IA 5KG2A 3I0SB 5KFRA 3BJYA 4XPEA 1S48A 4H4OA 4LSNB 5HBMA 3MFIA 1C1BA 1RTHB 4ID5B 3EZUA 4U6PA 3CO9A 1WNEA 4NCGA 1S9GA 3KLEB 2RDJA 1IKWA 3NAHA 3OLBA 2HNZA 4YR0A 4EBCA 4URGA 5J2NA 1T3NA 2AQ4A 2HWHA 4IG3A 4ZVHA 2W8KA 1RT4A 1LW0B 4KB7A 4IR9A 2C2RA 4J9RA 2I5JA 3RB3A 2W9CA 5KFPA 5L1IA 4O44A 1TKXA 3PVXA 1RDRA 1JLGA 3E01B 5KFLA 3KHHA 3KMQA 1TV6A 1RTJB 3I5BA 3NMAA 3HKWA 1S97A 4WXWA 5C24B 5HROB 3G6YA 4GC7A 4RNFA 1IKVB 2ZE2A 2AU0A 5F9LA 3H40A 4MFBB 4TY9A 3KJVB 1S1XA 4PWDB 1NHVA 1QE1B 1S1VB 3C6TA 1RT1A 3OL7A 4YR2A 3MEGB 3MEEB 3DRSA 3MEDA 1XR7A 4NRUA 1R0AA 3Q8QB 4NRTA 3M8QB 3I5AA 3H4DA 4YR3A 1ZTWA 1SV5A 1RT6A 3DMJA 5C25A 1RT7A 2HNYA 3FDSA 4NLDA 5KFHA 5KFTA 3PZPA 3TQ1A 1BQNA 1TQLA 4ED0A 1S6QA 4K4ZA 3JSMB 2UUWA 4QWEA 4Q8FA 3M8PA 3CJ3A 1NNDA 2BRLA 5EWFA 4RUAA 3QZ8A 3KOAA 1ZETA 2QV6A 4KV8A 3V6DB 3Q8PB 1HARA 2J6UA 3CWJA 1JLFB 3ISNC 4O3OA 1FKPB 1LWCB 5KG0A 4QWDA 3NGDA 3KHLA 2RF2A 4R5PA 5T14A 1RT3A 3MFHA 2J6SA 4J9MA 1MU2B 3QZ7A 5L1LA 1JKHA 5F8LA 3OLAA 2D41A 2ATLA 1IKYA 4JUZA 1K1QA 3CIZA 1EETB 5F8MA 1HPZB 3BGRB 3C6UB 3DOKB 4ZPCA 4KKOA 2HMIB 4K4TA 4HYKA 4ECZA 5KFKA 2R8KA 1N56A 3QGGA 5KG4A 3DYAB 1T03A 2ASLA 4WFZA 3DLGB 1QAIA 3GIMA 1C1CA 4NLRA 4O3RA 1HQUB 3FFIB 1RAJA 3LP2B 3V6JA 4ED8A 4IOBA 3IRXB 3DM2B 4ED7A 2BQ3A 2IC3A 3ITHA 4K4UA 2R8HA 1S1WA 4ECWA 5KG5A 4O3SA 4QWAA 4ZVFA 5I3UB 2V9WA 4B3OA 3SI8A 1S4FA 4DL3A 1TVRA 5F8JA 3JYTB 4NLTA 5KFFA 4IG0B 5DGAA 1GX6A 4O3QA 4DL6A 3KK2B 2VA3A 2HAIA 2BR0A 3KLIB 1HMVA 2JEJA 2YNHA 4G1QA 4EO6A 1SH2A 3MF5A 5J2PA 4MK9A 5KFOA 3KLFB 1RYRA 4IRKA 1C0UB 4H54A 4IDKA
chains in the Genus database with same CATH superfamily
1HNIB 4WYLA 2ZJQQ 2JSXA 2RQ4A 1XR5A 4RUCA 5DLGA 3W2WB 1QTMA 4C8NA 1BWVA 4DMZA 1T9YA 1XNRJ 4G6VB 3CUNA 2GJFA 1XJWB 2IJFA 2V94A 4PCQA 1ZM4A 2YXLA 4CYUA 1S6OA 1BHNA 2VQFJ 5A8RA 2B6AB 1KOHA 2C2ZB 4FXWA 2MHNA 1NHKL 4I0WA 4QYZK 3LWMA 5F8HA 2ZH3A 5C42A 2MKYA 3DI6B 1FD2A 1R89A 4TYBA 3VAGA 2CQ4A 2IRXA 3SQOP 4LSNA 1PC5A 2BZ2A 5B0DA 3BYRA 3DKDA 1IJEB 1LFPA 2FB0A 3TVKA 2HLUA 2IDEA 1N5SA 1D8YA 1KDNA 4F4AA 4DR7J 1VI7A 1R8CA 1TKTB 4G3IA 1M5SA 1RISA 1D9DA 2V9KA 4BC7A 4B17A 4K5RA 2AEFA 4CO0A 1LWCA 1HHSA 4DUTA 3VAJA 2JWNA 2UUBF 1RAGB 5AE1A 3UR0A 5KG1A 5LOQA 4FBTA 2AV5A 3DRPB 3TUIC 4MIWA 4AFFA 1RSCA 4UF4A 3IRXA 4N76A 1FK9A 1X4GA 1YHQS 1L3KA 4PG8A 1VDHA 1PGZA 5KT6A 2XSJB 3N01A 2BJ7A 3DHXA 1PAEX 1N5YB 1D09B 4I6WA 2AZ3A 2JVOA 4OJ1A 1DZ5A 3V4IB 1J5OA 3VGUA 3SCLE 4DSFA 4Y3CA 2XGQA 2VKRA 4KFBA 4A8WA 1SIWB 3ENVA 2CQ2A 4I4BA 1JLGB 3UCGA 2P5VA 2M9KA 3OFHA 1X4FA 2PEBA 2RSQA 1TZ0A 2ZM6F 1NJYA 3DMJB 1VJQA 4DR1J 4DSKA 1XMOF 3D66A 5LSLA 1SC6A 1RA6A 1S12A 2RDDA 4OJHA 1HWKA 3C14A 1RADB 3S8SA 5A8WB 1V3ZA 4AUKA 4CTAA 1YRXA 5K14A 1KWMA 4IH6A 3QLHA 1C1CB 3KFWX 2ZHAA 4KT0C 4V19X 2M0GB 3Q8RB 1I6JA 1JJCB 5CA5A 3OL8A 1J5EJ 2HZCA 4TKTA 3KHGA 2HHPA 2GHWA 1HNZF 3W8GA 2RRNA 2DEIA 1JJHA 4KIAA 1NEEA 4L75A 2CPYA 3SMZA 1WC5A 3BN4A 1DAXA 2W4CA 3RRGA 4OYAA 3ZNUA 4ERDA 2HQDA 3J80U 3OTCA 3QATA 1BD6A 1NSPA 1UEVA 1VRUB 2F8EX 1FRKA 3R2DJ 2LXFA 1RUSA 2J5AA 5A8RB 1ZAXA 1CJUB 3R6LB 2RE1A 2FC8A 5HL7Q 2EKYA 1XMQF 3IS9A 5B0EA 3Q83A 1GTEA 5SUHA 2R9LA 5C42B 3M4XA 3D28A 5KFAA 3BJYA 4Y2IA 4LSNB 1SPBP 3QAUA 2J8AA 3MFIA 4P72A 4OYXA 4DQIA 4RR5A 4IG3A 4FVCA 2RQMA 2C2RA 4CH7A 5L1IA 4KY3A 3KMQA 4OQJA 3RRHA 5HROB 4BBYA 5DDRC 2XSFA 2P8IA 2AU0A 3UWTA 3X1LB 2XM3A 4U95A 4YR3A 2VOPA 3QAEA 1PSDA 2B56A 4PABA 1S6QA 1S99A 4A4JA 2Q1LA 2MJNA 1RWVB 4X4PA 1LWCB 3R8YA 5KG0A 1FTRA 2P9CA 1RLDA 4K0KJ 1WC6A 2J8SA 2DBBA 5K20B 1S7HA 2GMLA 2Z4PA 3CJ8A 1QAIA 3CCTA 1BMQB 1HFEL 3IRXB 4LFCF 4O3SA 1URNA 2WSEC 3W8PA 3MD1A 4IUFA 4P74A 2GO9A 4DL6A 4A8SA 5HJYA 2VZ9A 5J2PA 3AY0A 5KOWA 1B0VA 5A76A 1U0SA 1J5OB 2BDPA 2B51A 4QU6A 3M9MB 4HHHA 1IBMF 3FC9A 3GSIA 4ATNA 4KFBB 3BSAA 1LEOA 2M8HA 4QPXA 3D6TB 3CEDA 3QJPA 3QGIA 3HO1A 2BRKA 3PJXA 1DRZA 3GV5B 2C22A 4AYBD 1UJ4A 4OHWA 2JLGA 2ZWPA 2CPHA 1YJNS 1N88A 1NU4A 7FDRA 2KJWA 3C14B 1BQMA 1G3OA 3W60A 3PDNA 4NZ7A 2CDRB 5L1KA 4ED3A 3MEDB 1NJXA 5K14B 4ID5A 3QLHB 5B0BA 4ECVA 1EAYC 4EBDA 2IFXA 2MY8A 4G1IA 4FYYB 3MD3A 4NE9C 5IWAJ 2DR5A 5F8IA 3K5LA 2XYPB 3G6VA 2MMYA 1ZS6A 3M8QA 1F3FA 5L8RC 2XCAA 2W7OA 4OJ3A 1UVNA 4DV7J 4J9KA 1UWAA 1P9YA 1S0OA 2MGZA 3ZTQA 2VIHA 4ZPTR 3SQGA 1Q0NA 4DCJB 2CQDA 2W9AA 1J2VA 4ES2A 3ZNJ1 3U7JA 4TQSA 1EX8A 4C98A 1VCTA 2G4BA 2L41A 3IS9B 3Q22A 3W63A 3M8RA 2BJ3A 3BQ1A 2UVVA 1NSQA 1WORA 2DIVA 1KFDA 5HI7A 1TUGB 4LF6F 1DJ0A 1F9EB 3MMCA 2YNGA 3FRYA 3TP2A 1IKXB 2KVQE 2JOQA 2ZITA 4YY3F 3NP5A 2OPSA 1EB0A 4IG3B 2VASA 3HLUA 5IQ6A 2EK1A 3GIIA 1KQSR 4P6QA 5HJXA 4NCAA 2AWZA 2DHXA 5F0WA 4ECTA 3LGHA 1NKBA 2B0GA 4YB7A 2YKMA 3H2UB 4CLSA 4EYHB 3O1LA 1FT8A 2KH9A 1FKOA 1S6QB 3BBFA 2LDYA 3EUNA 4HR2A 2J0SD 1EQMA 2ZDPA 2CADA 2A6MA 2QA4G 4AE5A 1BLUA 1NH8A 1OO0B 3PFOA 1U1QA 2FYXA 4NLXA 1KN6A 1VGYA 1KTQA 2ZNZA 1Q7YT 2GQCA 1HWUA 2DR6A 5DQHA 1RTZA 4USKA 2CQ0A 2KRRA 3PM9A 3MUTP 4NLUA 4NZ0A 2SXLA 4N41A 1N4LA 1S0VA 1HBNA 2DY9A 3IG1A 4OI1A 5E41A 5J2PB 2FJEB 1X5SA 4DLGA 5GAHU 2ROGA 3PNIA 4DQRA 2V2KA 3MR6A 2CPXA 2IA6A 5GADI 4PG4A 5LMNF 2R7SA 3QQCD 4NLSA 3FBEA 1VQ7S 5D15A 4OZ0A 1NZAA 4NI2B 3KK1A 4K2JA 2DO4A 2BJ8A 2ABYA 5KT4A 4F8RA 1BQMB 3CCJS 1H72C 1DTTA 2R2RA 2HGLA 4B9VA 1DY3A 4I6AA 2YX4A 4FPIA 1HBUA 2MLXA 1W2BR 4ID5B 3K8VA 2ZH2A 1TFYA 2XMKA 2X1AA 2W8KA 1LW0B 1WC0A 2XZWA 2VFVA 1YIJS 1HI8A 1IWAA 1CPZA 2MB0B 1TK5A 3I56S 3M8QB 3H4DA 3ETMA 2XNRA 4JYAJ 4X4QA 1BQNA 3P6YC 4ER8A 3I9V9 3VAIA 3A3NB 3RR8A 1FE4A 4ZPVR 2BRLA 4FYDA 4KV8A 2MGZB 2I38A 2IIHA 4MJKA 2PGCA 2VBWA 3HZEA 2ATLA 3GIRA 1H2UX 3R27A 2PA3A 3QGGA 1HBMA 5J1PA 3T1YJ 4MT1A 2B7CB 5KG5A 4DL3A 2FLOA 4KHPJ 2MKIA 2ZC4A 1NK4A 1UPPA 3MF5A 1T0TV 4LF5F 1DQ9A 3MMCB 2YNGB 3U02A 1H2TZ 1H38A 2H5JB 5DG8A 4ED1A 4Z7CA 1GEHA 2OPSB 2XO7A 1NDLA 3NOGA 2IMOA 5HQMA 1DQAA 3O3LA 4CM0A 1FD8A 1U47A 3M8ZA 5DG9A 4F0MA 4IR1A 3GQCA 1IBKJ 2YKMB 4MIBA 1GMVA 1QJHA 1UL3A 4X4NA 2YX7A 4DSJA 3VGTA 5F8GA 1SCJB 2XMUA 1NUEA 2DCUB 1FKOB 1Y5NB 5IFMA 4KPCA 3J7YU 1AFIA 3PO5A 4DXLA 5G0RA 2QN6B 1XMBA 4OYOA 2FD2A 1GXUA 2VV5A 1VISA 2RS2A 4FZVA 2DXFA 3TUZC 4YHHJ 4PWWA 1ZPWX 1OPIA 3QWPA 1RWPB 2KU7A 1HBNB 3Q8SB 3IG1B 4EYIB 2CNNB 1UFKA 2E7VA 3CCSS 4ALZA 3CCZA 3CW2C 4FXDA 1N5TA 2DNRA 1Q4RA 1YBAA 1PO6A 4ZLNA 2GQQA 1AA1B 1U7LA 3DC2A 1W7WA 2DCLA 4X66J 3GIJA 1DQ8A 2X1GA 5BJRA 3KK1B 1E6VA 4RO0A 4TLQA 2CQBA 2KFZA 2M7SA 1W25A 4LIRA 2GVDA 1PYTA 2UUTA 2F8MA 1X9WA 4I1TA 1DTTB 2LQBA 3ZZRA 1V5VA 7FD1A 2JNJA 1HBUB 4URSA 1X31C 2ZVSA 2W2NP 2ADBA 2CYYA 1CJKA 2QGFB 3Q2TC 4QBUA 1FX4A 2Z57B 2JZ5A 2ZHOA 2X3DA 2FTRA 2N3OA 2RU3A 3LTOA 2VH7A 2RS8A 4PYDA 4ZP6A 2PE8A 1BQNB 2GAGC 3D0GE 2DXDA 4WKRA 4KV8B 3V6KA 4L76A 3W5ZA 2UXCJ 2EG1A 2D1CA 1Q1KA 2YNFA 3POTA 1HBMB 1WHXA 4P73A 4N8OA 4YOEA 2M4MA 4LF4F 2IAJA 3HD1A 3US5A 1KSPA 2HHHJ 2QJ3A 4RW7B 2DHGA 5D0HA 1HW8A 1XERA 3EZ5A 4EZ9A 2HK2A 3F56A 1V3RA 1RWNB 2F63A 4X4OA 1PG5B 1M90T 2OIHA 1SKRA 3S1TA 4HHJA 1AW0A 4ZPAA 4F2RA 2B3TB 1MLAA 2HFSA 4NL5A 4ES1A 1NPPA 2KT2A 2H5IB 2DB1A 1VOMA 4YFUA 5HVGA 2UZAA 3NXZA 1D0EA 4GKKJ 3HK2A 1S1UB 3RAQA 3WHIA 1F60B 3FKBA 1EHWA 3BYPA 3IFEA 1UVKA 3Q8UA 3A8EA 2ZH5A 5F9NA 2YKAA 2VF3A 1FDNA 4F50A 3OW2R 2JL9A 4FKYA 5KFRA 2CZVC 4U6PA 5G0RB 2R4FA 5LMUJ 4USVA 4Y6IA 3FVYA 1FRXA 4KB7A 1FWKA 3IP0A 1Q5VA 4NXNF 2XS7A 4GMKA 1R6YA 3PCOB 3WZ0A 4EZ6A 1MN7A 2J9EA 2PMHA 2QMXA 3WC0A 2ZE2A 2VQEF 1X60A 1RT1A 4TU9A 3OL7A 4DX7A 2G0JA 3EGNA 3PO4A 1HNZJ 5GMEA 3CF5Q 1NMEB 2FPHX 1TR0A 2KM8B 3OQ2A 2RF2A 2W2PP 2PT0A 1MU2B 3PX6A 2CJAA 3RJMB 2HQ3A 2LECA 4W4MA 2GNKA 3DM2B 2RJZA 2BQ3A 3ITHA 2EFNA 4DF8A 4B3OA 1NK0A 1TVRA 1E6VB 4H4KA 4O3QA 2E7WA 1KVJA 2GVDB 4P7VA 1YRUA 3D7SB 4NWBA 3C15A 4P52A 3Q23A 3CMAS 3MCOA 1WDTA 4JI6J 1Z2ZA 2ZH4A 1CJKB 2FHKA 2QL9B 1U1NA 1WI6A 3BZQA 2IYGA 2Z8QA 5ETTA 3GJTB 1EP4A 1Z4UA 4H4KC 2JLEA 5KFEA 3QO9A 3EVOA 4M94A 3HDSA 2PFFB 2G9OA 2DNLA 3PHTA 5C2GA 4YDDB 2WVFA 3NGRA 1SI9A 4U96A 1MMLA 4WTOB 1S6PA 3P8BB 8RUCA 5H9EJ 5KFCA 1KOOA 2HSEB 1RHRB 1EQ0A 4DX6A 2XZTB 3Q8YA 3N6NA 2K7JA 3M2VA 2YNFB 3POTB 1VQYA 3CXCR 3CJKA 4O3NA 4UY8T 4CRJA 1U09A 2IAJB 2KJVA 4ZVRB 4UTGA 4ZLLA 3AD9C 2G2YA 3KLVA 2C3YA 1JLAA 1QE1A 3MEGA 1RHJB 5BYRA 3O8WA 4A8YA 1IR1A 4UOCA 3PW4A 3KJQB 4GC6A 2CG4A 4USTA 2E44A 1RGVA 2BKPA 3MZIA 4G1QB 1ITPA 1EETA 1F3VA 5B0GA 3D54A 3DYAA 1WUUA 2ZH6A 1XK8A 5JXSA 5JJBA 3CCES 3HSGA 1S9FA 2V4RA 4DOZA 1RBAA 3FGVA 1AB8A 4WZQA 4X4SA 2JEGA 2IDLA 2CXEA 3LPEA 2IBKA 3PTWA 1X4AA 4XPCA 3NGKA 3W62A 2LU2A 3PKYA 3CJQA 1T05A 4NLGA 1HNXF 3FBFA 2VDIA 2ZE2B 2OD6A 5DDOC 1RT1B 2XWXA 2IJRA 1KC8T 1T7PA 4WXOA 2A18A 1K73T 2J9DA 2G0CA 1ZZFA 2PI5A 3FCVA 4Y2MA 2RF2B 4DV6F 1FNXH 1LNQA 3GJQB 1N6QA 3DN9A 4RKUC 2AZ1A 2KZZA 2HVDA 1VHIA 1XNQF 4Q0BA 2VOOA 1RTIA 1MG7A 4RNMA 4B3OB 4XK8C 1TVRB 3DRYA 4K4XA 3CDUA 5CYQA 2D7SA 3X3UA 4CDIA 4FXVA 3C15B 4NLOA 3AAWB 3M6WA 1YI2S 1FXRA 1X5PA 4YY3J 4AL7A 3QRRA 4PQAA 5IV4A 5J2QA 2LVWA 1HL6A 1EP4B 3I0RB 5B7WA 3CD7A 3QO9B 1VQ8S 2C2NA 2BEFA 3O44A 2VA2A 1VS3A 3GB0A 1UVMA 2EPIA 3ONQA 4LT6A 4QPTA 4MKBA 5D8HB 2AGOA 2MY7A 1S6PB 2HVZA 4UW2A 3MWBA 1FJGJ 2B9EA 5CCLA 3NS5A 1V6HA 3QMQA 3M2VB 2BVZA 3OXLA 5BR8J 1RK8A 3VF0B 4J9RA 2DNKA 5KTQA 2RU9A 3KHHA 2X1FA 2HGNA 2ADCA 4F3OA 3HX9A 2Y1RI 4DX8H 4TY9A 1QE1B 3MEGB 1FFWB 1R0AA 5M2UA 1R27B 3I55S 2LYVA 1RT6A 4ED0A 2IHR1 3L09A 3UE2A 2W7AA 5K8MA 3NGDA 4R5PA 1QD1A 4OX7A 3HHNB 1EETB 3NOCA 4X64J 2W4DA 2MLZA 3DYAB 4I6YA 1NDPA 4NLRA 1TFWA 3CNQP 2B4PA 1FJEB 2YKPA 1P6TA 2CPZA 4LF1A 3D0IE 5DGAA 3DXSX 3CIMA 2HAIA 2VA3A 4J90A 2ZHBA 3OJUA 4IDKA 1ICEB 3RBXA 1M5KC 3MPUB 2COLA 1O5JA 3D0HE 4C11A 4KJIA 4QIGA 4OHYA 3F44A 4N47A 4K4WA 3M05A 2P2CB 4I68A 3K57A 2JC1A 3B78A 1T05B 4X62F 3W64A 4Q5VA 1C2PA 2AD9A 3QIPA 1Q8LA 2ZH1A 4IFVA 2ZOFA 1U6BA 1XEZA 4W90B 2HHTA 3K2YA 3KG0A 4X65F 5D77A 5E2QA 4KGMA 3TARA 1HNWF 4UY85 3GSDA 2HRTA 5KFDA 1V3SA 1N6QB 2Z2LA 1RTHA 1S57A 3PACA 1CC7A 2ZH8A 3KLEA 5DZ7A 1OY9A 1U6FA 2GIRA 2JC0A 2ZUAA 4Q0BB 3BGLA 4USJC 1RTIB 2WSCC 3GG0A 2VL1A 3E01A 3I4PA 3EPGA 4RNOA 5CYQB 1UCNA 1XWLA 1X4DA 4M5LA 5A8KA 4OX9F 1ELOA 4DN0A 2R2SA 4FKXA 3VV2B 3LGMA 3EVWA 4JI4F 3UI3A 2K7KA 4C8MA 3V6DA 2UVUA 4QCLA 5J2QB 2LCWA 5HMYA 3HI9A 1LXNA 1SQEA 4FBUA 3C6UA 2A3JA 2DEJA 3QSYB 1EZZB 3W2VB 3W5XA 5EGYA 3DCAA 3HVWA 3MR5A 3CGIA 2RQKA 4QJVA 4KGKA 3BO4A 4LIWA 3KKFA 2AYMA 4J9QA 2F4VJ 4KGXB 3JYTA 1GTHA 3GZ7A 2EWHA 3BPDA 4QWCA 2VJVA 4B3RJ 1C0UA 3R2CJ 2O67A 3P5TL 4DR5F 3E8OA 2ZH7A 3TANA 2KYXA 1S49A 3FSIA 4AT1B 4TY8B 1YVFA 2QE5A 5GMDA 1Q82T 1Q7LB 4OI2A 2WVBA 4FVMA 4CLKA 4TYAA 3GYXB 1BC6A 2HVHA 3TWZA 4TNOA 2HURA 1ZM3A 3GCXP 1R0AB 2LLZA 2Q3PA 1RBOB 2DXEA 1RT6B 5LJ5Y 2B4OA 3GV8B 5SZTA 3R1LA 2MZSA 1LW2A 4WK3A 3I82A 2U2FA 2BW7A 4HKQA 5HMXA 2XGPA 3HHLD 3DHWC 1SBRA 4Q45A 4R5PB 4WFYA 5JVGQ 1C4CA 1JIHA 4ECQA 1BY9A 1S1TA 3M6UA 3RU0A 2CKWA 4DR3J 1QAJA 3H4BA 4DR6F 1LV5A 2IM3A 3ILIA 2WOMA 1MNEA 3CJRA 4NLQA 4N56A 5LXYA 3RZAA 2CAJA 5AJ3F 4IDKB 1U6ZA 1R8HA 3DLEA 4IRCA 4LSLB 2YWFA 4OZLA 4C11B 1UA1A 4OZNA 2C1EB 4UT4A 1HBOA 5D3GA 2R7TA 1OQ6A 4M63A 1PJ7A 1I94F 5EDWA 4RW6A 5AE2A 1AT1B 4DR4F 2QA4S 4IFVB 2V69A 4PAAA 4OI4A 3JQMA 3VHQA 3HHDA 1TL5A 4ZVGA 4Q7AA 2BOPA 2KFYA 2FHJA 1RTHB 4LRAA 5JVHQ 3CMES 3OJSA 3KLEB 3CSKA 1Y3KA 4LF4J 4LUBA 1VK8A 3E01B 1D9FA 4DV5J 4Z37A 1VBXA 4JI0F 1XR7A 5A8KB 1R43A 1SV5A 5KFTA 2VJUA 3W9IA 2KKHA 2MKJA 4QIVA 1NNDA 2RMLA 5EWFA 5GAGU 3V6DB 2D3O1 3A8KA 1SKUB 3T5JA 1Y0HA 3T3FA 1FRLA 2H4WB 3TZYA 3CULA 1TMJA 3AA9A 4CH0S 2V6AA 3C6UB 4JI5F 2DRBA 2RNEA 1V5IB 1HQ2A 2EW9A 2N4DA 2LU1A 5KG4A 5MAOA 2ASLA 2MLYA 4LR9A 2VHGA 1UZHA 4E0DA 4G1PA 3JYTB 4HVZA 4O0IA 2C3PA 4JI1F 2FDNA 1HMVA 2ZBRA 4EO6A 1RKIA 1RYRA 1C0UB 4P75A 1YRTA 1T02A 2XMAA 1VR6A 5E3CA 4NA3A 5I42A 3RB6A 2R2UA 2CUYA 5JUMA 2RKIA 3PW5A 4NMLA 3BSNA 1HW9A 1DBDA 2CVEA 5KT7A 3TJ8A 4DUYJ 3QYYA 3WBZA 2ERRA 4QQBA 3TA0A 3OBIA 3SV4A 1JNRB 1UJ5A 2XI3A 5GADU 4CO2A 2UUAF 5HK4A 1FNOA 5C2CA 3VVUA 2NS1B 1F9HA 1R8AA 1RAAB 2N82B 1LW2B 3HFVA 1OYDA 4I64A 2KXHA 3V81A 2CPDA 4M95A 1G4CA 4O4GA 3RW7A 3NGUA 2LMIA 2XI2A 3MUVP 2E1AA 1S1TB 2VPXB 2V50A 2X3GA 3JSRA 1U1PA 2P9GA 2Z2YB 5H9FJ 3FBCA 1N5QA 2MPUA 1RTJA 2I6WA 1MMNA 4LRCA 3I96A 1VQ4S 2WOMB 4KYZA 3FMWA 1FHTA 1MWZA 4CO5A 2BE9B 3EVMA 3J7Z5 4WPAA 3PV8A 5ETRA 1IBLJ 3DLEB 4MKAA 4RU2A 2NXEA 3M6XA 4OYPA 1P27B 4PQUA 4CI0B 2CQHA 3A13A 1HBOB 5D3GB 5DM6Q 4URQU 5E3AA 2ZZMA 3TEGA 3NCPA 3JSBA 3RTVA 4LQ3A 2ASDA 4RW6B 1GMUA 5AXNA 2HG4A 3M2RA 5GVQA 5THWA 2OSQA 1NDKA 3FQLA 1LOUA 3CDAA 3UNYA 3BPSP 1M1GA 2NPFA 5L1JA 2OEKA 4W98A 2QG9B 1MMDA 1S5ZA 2DNHA 1SJRA 1PJ6A 2CPIA 2J9CA 3MTKA 3KHRA 3DRRA 5L39A 1H2VZ 2KXFA 1VK3A 2HZAA 3T41A 4DG1A 3UFCX 3D6FB 1U2FA 1HI0P 1NK6A 2PEHA 1TL4A 1S10A 4HHUA 1RT2A 2WSFC 1SV5B 1YSJA 3MCNA 5DG7A 1H0HB 2ZC3A 2WTFA 3LPYA 4DV3F 2FGOA 3TA2A 4B3TF 1K44A 2I1RA 2PA8D 3R5DA 3ENQA 2OSRA 2VG7A 1JK9B 1Y7PA 1DLOA 3OHAA 1RLCL 2R7WA 2M88A 2UP1A 1M5PC 3BSOA 1JLBA 4RUBA 2E5LF 3H25A 3OFEA 5L9NA 2VBZA 3TJ9A 5IS2A 3Q2SC 1DURA 2BE2A 1HMVB 2WZ1A 2E7XA 2UU9F 2XO6A 2ROPA 1NSAA 3UDVA 4CP5A 5I42B 4JI7F 1TKDA 5K8NA 2RKIB 1Q8KA 4ZP9A 5KT5A 3NNCA 4KGVB 3OUYA 2EXUA 1V9OA 4QZVB 4DQSA 1VQ5S 5HQLA 4OL8A 1W2IA 3MR7A 2DY1A 1B3TA 4DCPB 4FS2A 3LOUA 2CQ1A 2DRDA 5CD4H 2FY1A 4ETZA 4PXCA 2MQOA 4DV2F 3BN7A 2OTLS 1Z2LA 3V81B 3TRGA 4O4GB 1SJFA 2MQNA 4NXMF 4XPEA 4AL6A 3NAHA 4W92B 4GKJJ 4AQYF 3PYEA 1S77D 2XHWA 2GAHC 2I2YA 1XTZA 3LA0A 3VAKA 1RTJB 3CMQA 3NG8A 3WX4A 3DDNA 1N52B 1SC4B 4PWDB 2G0IA 3SSQA 1RT7A 2CG8A 3PZPA 1N36F 4QWEA 2ZZTA 4ZLPA 2YWEA 4J91A 4P9SA 3KHLA 1FVQA 4RBUA 4CCHA 3G96A 2OEMA 2D74B 2J7UA 4ZPCA 4KKOA 3SBMA 3GFZA 1T03A 4TVAB 5IV3A 5LXRA 1NB7A 2GMJA 1O8BA 3NMRA 3JAMY 3GFXA 4RUHA 3M2RB 2BABA 5U47A 2F8HA 3CC2S 2V8PA 4UUWA 2YNHA 5ETSA 3UD5A 3MAQA 1OWXA 3HSZA 3O6QA 3PIPQ 4CLUA 1Q8BA 1BUXA 4MKYA 4DFJA 3DRRB 2AKWB 2PD1A 2Q79A 4R0EA 4DG1B 4B3MF 4IO9Q 3TVZA 1RT2B 4A47A 4CNYA 3W61A 3UCUP 3I6PA 4M5JA 2XEXA 2LXIA 2B5JA 3HVAA 3TZWA 1B70B 4JOUA 2FZCB 2VG7B 4J5OA 3TAPA 2LP4A 1IR2A 4ED2A 1DLOB 3AD8C 3GE9A 1NK5A 1T9XA 4WBFA 2DITA 1JLBB 3UD4P 1HI1A 1FEHA 2F40A 3M7VA 5L9XA 2NZCA 4NLYA 4C4WA 2BJ1A 2DNQA 3ILLA 1UPMB 4LFAF 1YJRA 2BE2B 3J80Y 2R7OA 2AJ0A 3THPA 1WC1A 1LFWA 3BR9A 4P2MA 1S0NA 4DR2J 3OUYB 4F4XA 1S6UA 1KR4A 2W4PA 3G2XA 3N6MA 2MKHA 2XNQA 3GJSB 3OTOJ 4DS4A 1FWLA 4JBCA 2DGUA 3OVAA 2HHVA 4DX5A 5HANA 1ZOTA 3MM8B 2ZBPA 3T1AA 4ZDNA 2DNYA 3R7BB 1RQ0A 4K5SA 3LP1A 4M1KA 1S72S 4RW9A 1O51A 1DARA 2UXBJ 3HVTA 5GMKa 4RWWA 1WG5A 1WOOA 2XY6A 4X2BA 1AZSB 1FXDA 1HLWA 5DGBA 2JX2A 4Q8EA 4JP8A 4C9DA 5L46A 5GAEI 4P10A 2PMWA 3ENWA 2HNDA 1QSYA 4O4RA 4ENOA 1RT7B 2BV3A 4ZPBA 2JH3A 3K58A 2DNZA 4YUDA 1UW9A 5DDPC 5KFYA 2V4QA 4IYQA 3VWSA 2UXDF 2YWKA 4DHVA 5D6GA 5HVHA 1GXTA 3BQ0A 4KHRA 2H3EB 1T03B 1UFLA 4ZP8A 3MUMP 1NAQA 1TUVA 4KC5A 4OYZA 6FD1A 2ALYB 3GV7B 4OZ2A 3OV7A 3MMJA 1A9NB 4OZJA 1OY8A 1A6LA 2YNHB 5C5JA 2NLWA 1FJ7A 4DV4F 4DN9A 3BGRA 4TLRA 4YN3B 4ZJQA 1OSDA 2HHQA 3BDEA 4L6V3 2WK4A 4IFYA 3EE3A 3KG4A 4DL2A 1ROFA 3M9OB 2WVDA 2VBXA 4QIWD 2QA2A 5FD1A 1LXJA 2YX1A 4M5KA 4JV1A 1VBKA 3D2WA 2V67A 4WU2A 4ZIVA 2RUSA 5AT1B 2NXCA 1NPKA 4C8OA 2B5JB 5EWEA 4OLPA 2MXYA 1B0PA 4ANCA 4EEYA 1NBEB 1Q5YA 2ASYA 3L3CA 4F3QA 3EZUA 2WBMA 4NCGA 1S9GA 1UFWA 2AQ4A 4HH0A 1FRIA 4IR9A 2ZDOA 5KFLA 3DGVA 4XTTA 3OTEA 3H40A 3UW1A 5AJ3J 4C8YA 1VQKS 1IN0A 1M1KT 4IO1A 3K5NA 2QO3A 4WF9Q 1TAUA 4R25A 3OXFA 1KP6A 4JI2J 1CG2A 4MAKA 3OD2A 3GR0A 4DV1J 3G71S 4OX6A 1RT3A 2EK6A 1JKHA 1JB0C 2OGUA 3CIZA 4A46A 3ADAC 2WW8A 4ZKAA 3PRBA 4K4TA 4DJBA 4BWJA 3GIMA 2IYIA 3ZZYA 2XULA 4Y28C 3KUGA 2IPOB 4F2SA 2AJ1A 1GX6A 2QSFA 4NA2A 1WKJA 4K4YA 3LP1B 2ZWOA 2HQGA 4PWUA 2F1FA 2DPIA 3TAMA 3AH6A 3SYZA 4RW9B 5CHCB 3HVTB 2VD3A 3N6LA 4DWIA 1FF2A 5HN0A 3AHPA 3RB0A 1RAIB 1G2EA 3NCRA 2HNDB 1WF1A 3R1HA 4JI0J 3DOLA 2QL7B 1CBKA 2DIUA 2HAFA 1JNZB 3BBBA 1WC4A 3M8WA 1N0UA 1T8EA 3JAMU 2E1RA 3TI0A 1Q8IA 1XNRF 2O3DA 1BXNA 2VONA 4X4TA 4ZJLA 4QYRA 2GIQA 2HGMA 2R8IA 3I0SA 1TMMA 2EC2A 2ZOMA 2XMMA 5IT0A 2BJEA 2VQFF 1RU2A 3QFHA 3V2UC 2N4CA 2WHOA 2VPWB 3PHEA 2FJBB 1SQFA 3HHKA 3HZGA 4BWMA 4C8KA 1AROP 1XC9A 2FJWA 4CLPA 1U8SA 3M6VA 2AEJA 2VDHA 2HK3A 2FVCA 4LR7A 1N32J 1AFJA 4RNNA 4IFYB 1QSLA 5DETA 3CDWA 3ZTSA 4DR7F 3CO0P 3K5MA 4WK1A 4K8RA 3VCDA 3OFGA 4HDGA 1WHVA 5E0OA 4CM2A 2QX0A 5KG6A 3D1QA 4BS2A 1TP7A 3V4MA 2OHDA 2F65A 3KLIA 1TAQA 5DDQC 5F3TA 4HT7A 3KDOA 1N8RT 4CYUB 4NLWA 5KT2A 3G86A 2ROEA 8ATCB 3IMQJ 3KLHA 4NCGB 1S9GB 2DPJA 4A8KA 3MM5A 1BE4A 4DCOB 2IM2A 3OTBA 1I5OB 4FF2A 3EGWB 2YQ3A 4MIAA 1WKKA 3NKYA 4DFMA 1F5CA 2NUHA 3LH2S 4USUA 4FYXB 3QRPA 2YWGA 2HZVA 2YPZA 3KK3A 1XIQA 2XMJA 2NXUA 4K7QA 5GAHI 1Q78A 2J9DE 1BQXA 3UDLA 1RT3B 2BM0A 2R42A 4Q44A 2BACA 3AQPA 3IGNA 4NYZA 1U02A 3GWCA 4V19J 4JV5J 3RBZA 4OHXA 3N28A 3NL0A 1RTDA 1YBUA 1H3DA 4DR1F 1OSCA 5CH7B 8AT1B 4ZMMA 3IXQA 2VG5A 1NK7A 4RJVA 4WWSA 1KQGB 1T3OA 3PYGA 4F4ZA 2GVZA 1ZH5A 4DSIA 3FUYA 1FRJA 3TYTA 4ZLJA 2CQPA 2QYGA 2VODA 3H5UA 1FK9B 3LAMA 2FVPA 3RW6A 3N9UC 2IRUA 4C7QA 1U4BA 2BKNA 2EI5A 2QMUB 1K0TA 3DOLB 3CCMS 5I4MA 3BGFA 4NYOA 3TUPA 4LRBA 4ILMA 2ALZA 2ZD1A 3JB9k 4DV3J 1XN9A 1P1LA 2RQCA 1HYSA 2NCKL 3W65A 3QT7A 5KG2A 3I0SB 2F3JA 3G8SA 4R0JA 3TX0A 4U7UD 5JMNA 3A4TA 3FK4A 3TOQA 4RPFA 2B4UA 4OYIA 1H73A 4ZVHA 1WEZA 2PN6A 2W9CA 2O66A 4O44A 3MGJA 1RDRA 5E3QA 4CTAB 1NHVA 3MDFA 2UU9J 3NRBA 4NRTA 3I5AA 2V8VA 2DK2A 1YG0A 1SL2A 3T6BA 4Q8FA 1APSA 3R5GA 1ZM2A 1D8ZA 1ZETA 2QV6A 1XBWA 4C48A 3C2PA 3SCIE 3H20A 1WSVA 3D6HB 4DPUA 2R8KA 3MEKA 4DUZF 2G2ZA 4LMZA 4F02A 2CDQA 2H54B 3KLIB 2GQ2A 1RXOB 3BKFA 3NEKA 4K0KF 1UZDA 5EWGA 4YS2A 1UEKA 2DGWA 2Y1IA 3J7AN 3ISZA 2DNMA 3KJFB 3W9HA 4ZCKA 4QWBA 3MM5B 2V68A 3J7YI 2CRLA 2XLKA 3E51A 1QUVA 1HQEA 5H1SV 2MYFA 2UUCJ 1F2GA 1EJ7L 1JMTA 3VGVA 2UV8G 3CB4A 4NOHA 2MQ8A 3IWXA 5CYMA 2HWIA 1N36J 2XYHB 5D4LA 3RBDA 3KK3B 5DJBA 4PUOA 4M8LA 5C7PA 2ZEJA 2KG1A 2XC9A 3AXKA 4R8UA 1RTDB 1WEXA 4C0HA 3EPIA 3T19A 5D4NA 2J7WA 2QRRA 3R6GB 1DHMA 4U9RA 1OIAA 5T41A 3OR2A 2VG5B 3D4JA 3G8TA 3N79A 2J0WA 1IKVA 2EBGA 3R7SB 2GVZB 3KJVA 1KS2A 2UVRA 2UVWA 3MEEA 2XCPA 2FJVA 2C3OA 1WF0A 3VVTA 2KYZA 1WHYA 5IWAF 3EWGA 3FQKA 5KFJA 2NREA 4B3MJ 1B64A 4F4YA 1HQUA 1SKWA 3C19A 2C3MA 4LFBF 2O01C 4DV7F 4X4RA 3GG1A 2ZD1B 3PY8A 3DDKA 4EU0A 1U1RA 4RU9A 3IR5B 3LANA 2GS8A 5DQIA 4E2FB 1UEUA 1HYSB 2GGPA 2VFRA 2J0QD 3EGVA 2XMTA 3HSJA 4DPYA 2RB7A 1FO1A 2EVZA 1L5UA 2DHSA 5EN1A 2W9CB 4O44B 5KAKA 3J81Y 3BH6B 3NGSA 2M2BA 4X4VA 3CCLS 1X8DA 1HIYA 3T1HF 2XHCA 4C8LA 3IO1A 4ED5A 1HR0J 4KO0A 5KFWA 1Q95G 2A2DA 3EXCX 2NR0A 3KJNB 1NRKA 4WP3A 2AIRB 1X9SA 2HFOA 3ZO7A 3IM9A 1TL3A 1JJ2R 2G2OA 2VG6A 2H65B 1YJWS 4U7CA 1J27A 3SZ2A 3K8WA 3SQGB 2V0NA 1NLKL 2RAQA 3W7BA 1HPZA 3OHBA 2WW4A 1K1SA 3IWLA 1ZA2B 1G1XA 2VFTA 3PYFA 4E98A 4ELTA 3RAMA 4B3SJ 4ZP7A 4KRWA 3P96A 1S9EA 3NBPA 1WTFA 1HQEB 1S79A 2WVEA 1WELA 2A1BA 2K2PA 3A8IA 1SJQA 4OI0A 4LF7J 1PILA 1OQ3A 3I87A 3Q86A 3ZZPA 5CYMB 2L9WA 1RHMB 2F7VA 4PUOB 5KFXA 2VFUA 5HQ8A 2AYGA 2LFVA 5F0UA 3N4WA 1CJTA 2OFHX 3BO3A 1RHKB 4BLGA 4NMXA 2CNOB 1QVGR 1TKXA 3PVXA 1PBUA 1FERA 4CLYA 3L7PA 1S97A 1IKVB 1TTHB 3CCRS 3ETOA 3KJVB 3UR3C 5ETLA 3C6TA 4JI3J 3MEEB 3DRSA 4NRUA 3Q8QB 3MCMA 4GO5X 3J7A1 1ZTWA 5HO4A 3FDSA 2HNYA 2CPFA 4FYVB 1WKLA 4MYTA 3EZOA 1FXLA 1KNZA 3KOAA 5BXIA 3MM6A 2J6UA 3A3PB 5IM0A 3MFHA 4WJBA 2ZUGA 5E3PA 3U27A 1IKYA 4PXDA 3CCQS 4CLLA 4N77A 1WI8A 1N56A 6AT1B 3R5CA 1HQUB 4YB1P 4JYAF 1YWXA 1GMWD 1RWUA 2LQ8A 2V63A 1X9MA 4ZVFA 1VBYA 4CT9A 4FF3A 3LQVA 3FJ2A 1RAEB 5D4PA 1HWLA 1X4CA 3PX4A 1Q16B 4CZCA 5KFOA 4IRKA 4ECYA 5LSRA 2KB2A 2GGPB 1EKSA 3CJ0A 1VQPS 4YB5A 1LK5A 2VKZG 4ZN3A 1CEZA 1U0HA 3QGPA 2CJQA 2Q6CA 1N5VA 5E7OB 1IM4A 1RI7A 4WP8A 4LBIA 2MQMA 2YKNA 3BBCA 4TU7A 4M5IA 3PW2A 1RT5A 5J1EA 3GTYX 1S0MA 2GHVC 2AJ2A 4O0NA 1X4HA 1JLEA 2W2QP 3UD3P 5A2QY 1FX2A 2BJDA 2AX1A 2BOAA 4KO0B 4DEZA 4J9SA 2XYGB 2CPJA 2HVEA 3ZZ0A 1IBKF 3CCUS 2R7QA 2WRMA 2FVQA 3KUHA 1TL3B 1U49A 2BA9A 2VG6B 3H2VE 1RCXB 4ZIWA 4L3KA 3A1YG 2GV1A 2ZJRQ 2MTLA 2NZ4A 4DSEA 5C24A 1PAUB 3M32A 2UUBJ 1SKSA 4ANDA 1F1BB 1YQHA 2KXNB 1KTVA 4I56A 1U26A 1IR0A 4FNIA 5ETOA 2W25A 2ATCB 4FS1A 1LK7A 2BQRA 4XAKA 1FKPA 1FESA 1S9EB 3NBPB 2OD4A 5M2RA 3MR3A 2HFUA 3H42A 1IWGA 2HMIA 4GRSA 2E9TA 1R0BG 3I9ZA 2ZNYA 2E5IA 4FF1A 2HHSA 3M1VA 1VRQC 3FFIA 2AJFE 2HWTA 2G1DA 3BH7B 3OPKA 3HMJG 2QL5B 3AFGA 1OJ4A 1R3NA 4CLZA 2BJ9A 5D0RA 3PW7A 1QSSA 1NJZA 3PR4A 3G8QA 2FLNA 2ZM6J 1HD0A 3PIOQ 4KTQA 1CJTB 2PFDA 1HA1A 4X66F 1VRUA 4DL0C 1XMOJ 5E5NA 1CJUA 1TKXB 4RNHA 4L74A 3CD0A 4ICLA 4DU7A 2EBEA 3C6TB 3ZXWA 1B4SA 3DRSB 4I69A 3PRVA 3EDQB 1VIXA 2HNYB 3AJDA 4Y0FA 3M8SA 2HRYA 5D0GA 3MM6B 2DGTA 4PXBA 3HD2A 5IM0B 2LEAA 4FYWB 5HROA 1L3UA 1WTBA 4DL4A 1IKYB 2HFZA 3PX0A 1LWEA 5KFMA 5KFGA 4UQTA 2OO4A 3OFFA 3HSDA 4M5DA 2B9YA 4L3NA 3KG1A 1U2RA 4Z7YA 3J81U 1R0CB 2NYIA 2XBPA 2HKEA 2UXCF 3PYDA 2HVIA 1FE0A 4ZVPB 2E5JA 1HHQA 3SCJE 2BKOA 1U0HB 3ZZZA 3PXGa 2E1PA 3QJLA 4ZA1A 1WG4A 1XMQJ 2EKNA 3AOCA 2HHHF 3G82A 4A8FA 2AGPA 2OPPA 2YKNB 2YWHA 2Y0SD 4X4UA 3SSRA 5DM7Q 1QAXA 1SVDA 5KFQA 1RT5B 5LJ3Y 5J1EB 4ZHRA 2V8HA 5CZXA 2ZZNA 1JLEB 3BS9A 2IVFB 4ELVA 2AYBA 3T5HA 3S7RA 4HL9A 2M8DB 4NEYA 3F0NA 2FQQB 2E5HA 3OT9A 1LWFA 5IT4A 5BYSA 3EDRB 4CLTA 5B0AA 5AXKA 2C2KB 5ITHA 4F36A 2RDJA 4HACA 4URGA 4GKKF 3HCXA 4GVLA 3M8YA 4PEOA 1R8PA 3E3XA 1FDBA 5C24B 3KWMA 1HD1A 4TU8A 3M32B 4LREA 2YKQA 1YK9A 1RABB 3MEDA 5AXLA 1G7CB 3D9BA 2V5HG 3BM7A 2JJ4D 4NLDA 5LMUF 3SIPB 4LFCJ 4K4ZA 5GAEU 1G6BA 3M8PA 2KFNA 4O3OA 1LQ9A 1FKPB 3P5BP 5HMZA 4DDFA 2CIMA 3WC2A 4XDCA 2HMIB 5FLXY 5HMWA 2NQPA 1T11A 3M1VB 3FFIB 1IBMJ 4ZVTB 2IC3A 1S1WA 4QWAA 3TUJC 5ETPA 3N0VA 4UUXA 1S4FA 3MM7A 4N7TA 2E1MC 1SH2A 2FJAB 4H54A 4Q43A 2G13A 1U48A 3AQOA 3CJSA 4BHQA 2DVIA 3FSYA 4RW8A 4PYAA 4LF2A 4X84A 5EX0A 4KQZA 4ICLB 2W8LA 5KFVA 1JXEA 2NSBA 4DF4A 2CNLB 1IKXA 4JI6F 2W24A 4KE5A 1NH7A 3UNGC 4ES3A 3CPWR 3HKZD 3MECA 4M5GA 1E6YA 4C3MA 2JDJA 1XR6A 3JQJA 1REVA 4C0BA 2ZKUA 4J9VA 1CSJA 1LWEB 2VC0A 2W7PA 3QBCA 2F5GA 3AJ2A 4DUZJ 4FPRA 4M5DB 1YJ7A 4YDXA 2PMZD 1KLNA 3PRDA 2N7CA 2C2MB 1X5OA 1I1GA 3TQEA 1YLXA 2OH2A 1CC8A 1PKUA 5DZ6A 3ITHB 2M3DA 4NA1A 2N7YA 2ZVIA 5A2QU 4IOCQ 3R5BA 1JLFA 2DGXA 3FMBA 3EMTA 4ZCMA 3G82B 3DU5A 2OPPB 3UVJA 3DOKA 4LF6J 3D67A 2WB1D 2VICA 3R5JB 1VQMS 3AJ1A 4ZHRB 2Z2ZA 4WKYA 2HBRB 1P1TA 4BDPA 3TEHB 1F9FA 3DLLQ 5ETVA 3WIUA 3Q89A 2ASJA 3TX8A 3HT3A 1T9VA 5IOLA 1B7FA 1LWFB 4EGLA 1VQSA 4KR0B 3QJJA 4QU7A 3UDEA 3AT1B 3F41A 4HACB 4ZJOA 1HWJA 3BSCA 1UW4A 4NI2A 4OZ1A 4NX9A 1WD6A 4IKAA 1X0PA 3JQKA 3FZ2A 5CAAA 3OL9A 3H59A 1FTCA 3HJFA 3OVSA 2HQFA 4CLFA 1VYAA 2YY3A 4PPZA 3CJKB 1RWOB 3BREA 4QYZJ 3GU0A 1WOSA 4KGZB 4KHMA 4WZMA 1YGYA 1SXLA 2C2DA 1LW0A 3M8PB 2AGQA 4DZDA 1F2HA 3B6BA 5F41A 3K5OA 1JLAB 2AJQA 2BYCA 3CE8A 3M2UA 4DPWA 4PPDA 2QIFA 4JV2A 4LRFA 3W3SA 3NY0A 3EM1A 2IC3B 1S1WB 4LFBJ 1OPZA 1RU1A 4USIA 3MM7B 1S4EA 5LMNJ 1PYSB 5HP1A 3AXMA 2MZRA 3B4MA 2R3VA 5J2MA 2B4VA 2M5YA 3QFWA 3UCZP 3MOJB 1T95A 4RW4A 4RW8B 1M5OC 4OHZA 1TKZA 3FSXA 2KG0A 1JLQA 1CVJA 2PC6A 3HHEA 4HTJA 2RRBA 1WDDA 5KFNA 1VRTA 2Z2MA 4L72B 2XQCA 2QFIA 2B43A 1GQEA 3T1HJ 3GPAA 3MECB 2F4FA 1E6YB 4DPTA 1REVB 2W01A 2KI2A 1WF2A 1VC0A 3BB5A 5CQGA 2BMBA 2EG2A 2XMVA 1CLFA 4H4OA 5GAGI 1C1BA 1X0FA 4QR2A 2VU5A 2HWHA 1RT4A 2J7KA 3Q0AA 1ACMB 3HT0A 2APOA 1TV6A 2EFQA 1PC4A 3VALA 3HHLA 4F25A 2EEYA 4B08A 2LEBA 1FJGF 5H9FK 2XB2D 4J7CA 4CIOA 4DBQA 4ID8A 2ZJPQ 5C25A 3TQ1A 2MKSA 5BR8F 3BF4A 3H90A 4O23A 4RX6A 3Q8PB 1JLFB 2NSCA 3ISNC 4OHVA 5F8LA 3OLAA 3UVJB 3LW5C 1K1QA 3HHLC 4LF5J 3DOKB 2P6SA 3TJAA 1FWPA 3D68A 4K4UA 3BDPA 2R8HA 2VFSA 3J7ZT 3NWGA 2QEXS 2KVIA 3MTJA 5F8JA 2XMWA 1REGX 3HPOA 2E1CA 4XDDA 2POKA 4MK9A 4WTYA 4UOHA 1VHFA 2DISA 3LWLA 3THVA 3OSPA 4X64F 4HI2A 3JS9A 5D4OA 3L7OA 1ZAVA 4TXSA 4OYMA 1D9AA 2R7RA 3OVBA 3IC1A 2C42A 3CDBA 2NYHA 2MJUA 3QGHA 2BANA 4Y2KA 4DPXA 2ZFHA 1VQLS 3NNHA 5FLXU 3I5CA 4NPOA 2FLPA 3KNGA 2I9SA 1QM9A 2IVMA 4P2XA 1JJ4A 1RAOA 4DQPA 4USWA 3M9NB 3TNVA 2LA6A 1TUWA 2KO1A 2UV8A 3IAS9 2I8EA 5ETKA 3M2UB 1UA0A 2VPYB 1H98A 3ISND 1T9WA 2FVSA 4HEA9 2MSTA 1WACA 1NPRA 4WFNQ 4EWTA 4ANEA 2H9ZA 2H5EA 5HVFA 9RUBA 1U1OA 4MFBA 1Q53A 3VQSA 2V4JA 5IT9Y 2LDIA 4WYWA 5HP1B 4F67A 2DNPA 5HATA 5J2MB 3BKTA 2CVIA 4FNHA 4RW4B 3W9JA 1TKZB 1T94A 1JLQB 4RW7A 3MXHP 1SC3B 1H7XA 3QRQA 2FVRA 1VC5A 4NCBA 4C0OC 3WX8A 3UQSA 1VRTB 3ILOA 3D3CJ 1GNKA 3R3TA 3TA1A 3UDCA 4IG0A 2E9ZA 3NCQA 1U45A 2BQUA 2Y9HA 5KFZA 2AJ4A 4IQXA 1QTNB 2FHOB 1RBLA 2XWYA 4H4OB 3WIVA 1C1BB 3QIPB 2HIYA 4P71A 4ECSA 1S1UA 3NLCA 2P6TA 4ETXA 1RT4B 2F4VF 2KN4A 3MPYA 1TV6B 1ZYQA 4CNZA 3SV3A 3HHLB 4B3RF 2MSSA 1AUSL 2CJYB 2YH0A 4WIIA 5HAOA 2P9EA 2ZH9A 2IBOA 2CWXA 4NLPA 5IZHA 3IGVA 2QLJB 5C25B 3GMGA 3VAFA 2DO0A 3CCWA 3CJ2A 3VZIA 1F6TA 4MH8A 4ZITA 4BC9A 4QOTA 5KFIA 3M30A 5T7LA 3KDNA 5CD4A 4CH1A 1NCLA 4J9PA 4EMDA 2Y1JA 4IOAQ 3P49B 1SUQA 3GYNA 3TZZA 1QVFR 5FIIA 1NJWA 3EICA 2L3MA 2W9BA 4ELUA 1MU2A 2YH1A 2Z30B 1C0TA 2V2ZA 1MW7A 2XZDB 1FNMA 1SL1A 2KHCA 4DR3F 3FCWA 3DM2A 1N34F 4U8VA 3ZTPA 2JHEA 3K89A 2BXJA 1JQGA 3NWRA 3G4SS 2X1BA 3L4BC 2FC9A 2BANB 2KM8C 2BE7D 4WU3A 3T5KA 2DGSA 3IA0A 1FRMA 1VBZA 4J9LA 4MK8A 3I31A 1X4BA 2M52A 2X7IA 1N33F 1IBCB 3PFEA 4NXNJ 3SFGA 1QAYA 3ZC4A 3VAMA 3O2IA 1ZA1B 2VQEJ 1WHWA 2BX6A 1S48A 2DH8A 4B9SA 5FJ4A 3CO9A 2L9NA 5E3RA 4EBCA 5J2NA 2RUGA 4MMOA 1ZM9A 2DRAA 3MM9A 1KVKA 3JTOA 3ZTOA 3I5BA 3NMAA 1VMBA 3BEGB 1AXQA 4GC7A 4FF4A 1UETA 2MZJA 4MFBB 1S1XA 2V4JB 4LF9F 3D3BJ 1H6KX 5KFHA 3ZZUA 3A8JA 1TQLA 3H7HB 1PJ5A 3CJ3A 3QZ8A 1RZMA 4DV5F 4MKVA 1QUPA 3QT8A 4AXJA 1RWMB 3FEYB 3UN2A 2HFVA 2MEWA 2HIQA 3GP9A 4O3RA 4IOBA 4S0MA 2CJKA 4ECWA 2V9WA 1Y00A 5EHHA 2FY8A 5KFFA 4UOFA 4IG0B 2H48B 4G1QA 2XY5A 2MQQA 1IUJA 2BBEA 3GR1A 3NS6A 2GMHA 1FFSB 2RVJA 2AP6A 1B7YB 2DD8S 1A0OB 3CDEA 2WB4A 1Y4ZB 5IC4B 2PO4A 5I3PA 3KXDA 3OR1A 2Y8WA 2WONA 2XY7A 3QSIA 1B0TA 3KMSA 1JX4A 2HS3A 4WFXA 1URRA 1MWQA 1HNVA 1EARA 4IRDA 5DQGA 1K0VA 5DS7A 4OIXA 5A6PA 4LBPA 4DUYF 2QLBB 4J9OA 4EUVA 2M70A 3G9CA 2HPUA 3VZHA 3DLKA 4QW9A 4G65A 1WWHA 3M30B 5T7LB 2HHUA 2W2OP 1YJTA 1NKCA 1SUQB 7AT1B 1PBAA 1GXLA 2DKOB 3IM8A 2ZBIA 2OJ3A 2W9BB 2HS4A 3D6MB 1S1VA 1C0TB 3QNWB 3ICLA 4HDHA 3BQ2A 3Q24A 3MI7X 3LAKA 1WC3A 4OFZA 5DLFA 2DHAA 2O5DA 2E66A 3MPWA 3HXMA 2LA4A 4DI6A 2HQIA 3H98A 3D1HA 1K47A 3PKMA 4DL5A 3RB4A 3DLGA 2D3UA 1IBLF 3ULHA 1H7WA 4OV1A 1JWWA 9ATCB 5KT3A 2XLJA 5I3UA 1SQGA 1PYOB 3CTRA 4D3GA 1HNXJ 1IJFB 4N8NA 3I0RA 5IT9U 1IVZA 1B99A 3A12A 1ZBTA 3IWNC 4MTPA 2B8PA 2CJBA 5J2NB 3BKUA 1U2CA 4LSZB 2V8GA 3HP6A 3MM9B 2QC3A 3T9NA 2OPRA 5CCMA 2VUGA 4LVOP 2C2EA 4DV6J 4XIUA 2CPEA 2Q66A 1S1XB 4CWBA 4F3MA 1FVSA 1FJCA 1PIEA 1DTQA 1UVIA 1ZAWA 3MAHA 1XNQJ 4CT8A 3JSYA 3PR5B 1U1LA 2IRYA 3OSNA 2ACYA 1UKUA 4LQ9A 4PG6A 4ECXA 3SCKE 1TU0B 4KBIA 4B9MA 3V6HA 3G6ES 2ZBQA 4ZPWR 4K2XA 2QSWA 2WBRA 4YP3A 1CQMA 5KOXA 3KNAA 2FLLA 1IQTA 1N54B 4ITSA 4PQUB 2OKQA 4JI8F 4ECUA 2RDIA 2YBVA 1GT8A 3HULA 1KLMA 3ENAA 3CJ4A 3MURP 1TL1A 3MMBA 3L95X 2NPIA 4DV0F 2EFVA 1VLYA 1TK8A 2RD5C 2AYEA 2XS5A 2C28A 4B9NA 5G4DA 2CZ4A 3OR1B 2FHMA 2WONB 1VQ9S 1GX5A 5AE3A 3ET6A 3FBBA 1RJJA 1HNVB 3SFUA 2A2CA 2B8QA 1JLCA 2ILZA 2PDAA 2KRBA 4E8UA 2RRAA 4I67A 2ZKTA 4Y2CA 3IAM9 1P9QC 2VBYA 3DLKB 3UN5A 3K17A 5B0CA 5HBMA 3ZZOA 4ZVSB 3K59A 3BGOP 1N0VC 3AODA 4OYWA 5ETMA 2I5JA 3RB3A 1TK0A 4M5HA 3HVRA 3DNCA 4DQQA 2OELA 4RNFA 3CJTA 1WOPA 3TW0A 1S1VB 2OLWA 4A48A 1UMJA 2CJ9A 4F0HA 2KDOA 3ZZTA 5A6WA 1JXLA 5ETNA 1SJ1A 4GKJF 1RB0A 4C97A 2BUNA 3HJVA 1KFSA 3DGPA 5L1LA 2BM1A 1RAHB 1Q81T 2EFOA 4ILLA 4LRDA 3PG9A 1L3VA 2CNKB 4K59A 3DLGB 3K0JA 4ED8A 1L3TA 3GCWP 5I3UB 2HLTA 3SI8A 1NK8A 3DFEA 4X62J 4WFBQ 3TAQA 1OY6A 2BR0A 3K7RA 2RH3A 2OUGA 4C8ZA 3W66A 3W2VA 4UZCA 1I51B 2D3OR 1KVIA 2V8DA 1D3WA 2GJIA 4TQRA 3B8HA 2OP5A 4H4MA 1IXKA 4X65J 2VPZB 2OPRB 1HNWJ 2HFNA 4P2SA 4I2QA 3LUYA 4QW8A 1UWBA 1DTQB 2GIFA 4J37A 1YJ9S 5BYQA 1M1HA 2Y0BB 4ZVEA 1ZPVA 4TY8A 4WE1A 5AXMA 1VQOS 1VJWA 1LKZA 4HLBA 2CA9A 4OX9J 3TZXA 4AXIA 4F26A 2J76E 4OI6A 1RKJA 2KTQA 3CVKA 4HH1A 1VLOA 4JI4J 4DZ6A 4KSEB 1F5AA 2R7UA 4ZOSA 3UN3A 1KEKA 1NXIA 1KKHA 3IR7B 4FP9A 4ZN1A 4KPYA 1KLMB 4KKOB 2H4YB 5KFSA 4WP9A 4PRFA 4RLEA 2JVRA 1TL1B 3MMBB 2DNOA 2YTCA 3JSMA 3HM9A 1QDUB 2K1RA 2L08A 2Q43A 4KH0B 4OI3A 2OMLA 4DS5A 3F73A 4DR5J 4EK2A 2HQCA 2NXNA 3ET6B 5L38A 4LSLA 2AF6A 4EO8A 4DR2F 4DU8A 1U25A 1JLCB 3GIKA 3TVYA 3KLFA 2AW0A 2JRSA 2HHXA 2LQJA 3LALA 2CWKA 3QT6A 3OTOF 5HBMB 1UAWA 2RHQB 1CQNA 4K50A 2KZMA 4YEAA 2XTJP 2I5JB 2O1PA 2DYAA 2EFGA 4RZRA 3DU6A 1F5BA 4MK7A 2IY5B 1KHWA 4M5MA 4U67Q 4WCEQ 2CQ3A 1HWIA 1EIYB 5K5MA 2UXBF 4DR6J 1JXVA 3SDEA 2Z58B 3HF5A 4DLEA 4ZVQB 3AB4B 4QR0A 3NS7B 3DGPB 1OS5A 5EUHA 1KQKA 1FDDA 2H51B 1R31A 4USHA 1D1UA 5F8NA 1TL7A 5CXTA 3WDOA 3NGTA 3IN5A 4F4WA 3H5XA 1MROA 5ETQA 3THTA 2YPYA 3P3DA 3RBEA 1YTYA 1R6VA 3EJMA 4ZK7M 2X51A 4I2PA 4U8YA 1GAOA 1I94J 4LF8F 2KT5A 2OTJS 2LQ5A 4DR4J 2NXJA 4I7FA 3RG6A 2GJ2A 1OYEA 2DNGA 2V2QA 1IM6A 3FNNA 3GONA 3MPDA 4H4MB 1ZZNA 2GZOA 3RR7A 1Y3JA 4B02A 1NDCA 4I2QB 3KLGA 1X5TA 5HLFA 3B54A 1UWBB 2E29A 5J1NA 1K8AT 5RUBA 2JEFA 4OV6A 2K8GA 4WE1B 3HFKA 1KHVA 2AT1B 2LXUA 2R2TA 1K9MT 2RHSB 4LR8A 2L48A 3LP0A 2CQGA 1SC1B 4HT5A 1RWWB 1T3NA 3EX7B 2V2VA 5D78A 2L9DA 2KL8A 4HI1A 5KFPA 1SJ3P 4JB8B 1YX2A 3RRKA 1OMSA 4WXWA 1Y5LB 3HFZB 5MLCV 1RHQB 4EI2A 2MZTA 4JI5J 3DLJA 3V5RA 2D9OA 3JSMB 2UUWA 1C4AA 1N34J 4RUAA 2K1RB 3S6EA 4JI1J 4ED4A 2J6SA 3QZ7A 3TR5A 2CFXA 5EX3A 4ZVUB 4JUZA 3BGRB 3DXBA 2Y8YA 3BO2A 2MKCA 5KFKA 2VB6A 2VC1A 3V6JA 4B9UA 1RHUB 3FEZA 5F3ZA 1VQ6S 2OI2A 4JI2F 1YITS 1N33J 4PG7A 2MZQA 2I0XA 4C6AA 4DV1F 1DFDA 3SSSA 4NLTA 5A0YA 2FUG9 4DPOA 3LGNA 3KLFB 1SB6A 2RIJA 4KH1B 3CD5A 2DJWA 3BGUA 3P4UB 3H2LA 2UUAJ 2D3ZA 1ULRA 4DL7A 2H1YA 3Q8VA 4F7VA 4ED6A 1NM2A 2E9RX 3FCHA 1RE1B 1UP1A 2Z0GA 4RL1A 3L9ZA 4IH7A 4KAIA 4LF9J 4ZPDA 2KHDA 2HBQB 2CJXB 4B9TA 3KYLA 3SDEB 4OX8A 4EBEA 3FRZA 4O3PA 3A3OB 2U1AA 2J6TA 4YMEA 3G6XA 1GK8A 3KTQA 5KG3A 3GFYA 3SEOA 1TL7B 3LF0A 1MROB 3H5SA 2OFGX 1JKHB 2RILA 1KRPA 4I2PB 3QT5A 5B09A 4L73A 2EC0A 3GJRB 2AX0A 2QT7A 2DTJA 3VGSA 4I7FB 2AMCB 2ACMA 4DFKA 1FRHA 4WIQA 3OL6A 3PJWA 4F04B 2MQLA 4TN2A 4C3LA 5K8OA 2WCXA 3I4HX 1YJUA 2E5GA 5B08A 2QLWA 2DH7A 1XQIA 1H74A 2FZGB 2DGQA 3FZBA 2KT3A 2OEJA 4V1Ak 2GA7A 3TAMB 3AA8A 3DOMA 3KLGB 5HLFB 2EFPA 2A0FB 4PZVA 1Y11A 1N32F 4D3HA 1O0PA 2AEMA 2DNNA 2YQ0A 4USMA 4AD6A 5KG7A 3KK2A 1J5EF 4ZS6A 1FCAA 3ZTRA 3MCSA 2YVSA 4QIFA 4JV0A 3LP0B 1YKWA 1Z1ZA 4K4VA 4AL5A 1FFGB 4Y2AA 2JEIA 1WSRA 3MMAA 1FI4A 2Q6BA 4B3TJ 2GX8A 4RBTA 4LJMA 1N48A 1VQNS 5E33A 2PI4A 2GO8A 4BCAA 2FHJD 3RAXA 1IQZA 2RT3A 2HW3A 2LKZA 2E5LJ 3MOZA 1BWEA 2V34A 1KD1T 3IRWP 4J9NA 5KFBA 2XG8A 3PEHA 2ILYA 1FA0A 1M0SA 4QIEA 4NYPA 4F0KA 3C16A 2R8JA 3LO3A 3TO8A 4PWDA 1Q79A 1Q86T 2DR8A 4JI7J 1HHTP 4A8QA 1FKAF 2F9DA 1KQFB 3RGIA 2HS0A 3RYLA 4FDFA 1VC6A 4NZ6A 2QMWA 2DGOA 1ZTTA 5A0YB 2R8GA 2WVCA 2IM0A 5CYJA 2QLFB 4YQWA 2GW8A 3C46A 4JV5F 3EYZA 3DRXA 1WG1A 1YBTA 3I32A 3PJ9A 3N5FA 1RA7A 4DV2J 3CJ5A 1P8GA 2J0XA 3JTPA 3PEJA 4NXMJ 3PW0A 4K4SA 1NHUA 5I3QA 5LL6d 3KLHB 1CS4A 4CO3A 2YNIA 5FDLA 4N5SA 1U24A 4AQYJ 1MWYA 1RP5A 2OPQA 4M5NA 4P7TA 2IM1A 3R5AA 2IJNA 1WEYA 3UO0A 1CJVA 2PSZA 3QWUA 3EXYA 1CULA 2QYCA 1PCAA 1YZ7A 1A7GE 3AOBA 2JFKA 1W26A 4GO7X 1WNEA 1U1MA 1IKWA 2HNZA 4YR0A 4C2MA 1U1KA 1VIOA 1UTAA 3JXOA 3W5YA 3DLHA 1YDLA 1T9TA 3IBWA 4JI8J 4PR6A 2D9PA 1BGXT 3S01A 4YR2A 6FDRA 1NZ8A 3C66A 4OZ3A 3ZFVA 1YZ6A 4DV0J 2YQ1A 2B7BB 2A6OA 3T9ZA 1HARA 2HYIB 4RWXA 3D1OA 1RCOB 4B9LA 3E2EA 4UQGA 2IVYA 1WJ9A 1SIZA 3T6JA 4HYKA 1MN9A 4ZCLA 3DOMB 4WFZA 3J81j 2DH9A 4Y65A 2QLXA 4OZ5A 4ZVOB 3JTNA 3KK2B 5CZVA 2JEJA 5IC6B 2B9WA 1HKAA 4OMFG 2A10A 2CQIA 1SH3A 2DHHA 3G87A 3NAIA 2C2OB 3T5LA 3CCVS 2FZKB 3CC4S 4GVBA 3MMAB 4DSLA 4CO4A 4CQ1A 4PXEA 2HRUA 2PIIA 4NLVA 4EFAC 2Y3YA 3MM8A 2K06A 3VR1A 4F4KA 5LM7E 3C8YA 1F0XA 5IXUA 1MSWD 2BW2A 4HTIA 5KFUA 1Y10A 1AZSA 3AD7C 4LFAJ 1YJVA 2UUCF 4ECRA 1FDAA 4U7UK 3C16B 1M5HA 3QIDA 3C3LA 1AUDA 4LVNP 3O5TB 1UVLA 4ZCIA 3MHYA 4WFAQ 4QR1A 2NUUG 5DO2A 3U1MA 1RAFB 4XO0A 2IA0A 2W2MP 3MAAA 3IBFB 2W1BA 3U1LA 2MKKA 1S7IA 3GILA 2ZOGA 1GMWA 2JLFA 2MHEA 1X7VA 3GLJA 5M2PA 2HBZB 3CT9A 1RWKB 3H0PA 4A8OA 3DLBA 2C3UA 5K9FA 5CABA 4DFPA 2LEPA 4ILRA 1M5VC 3LP2A 1CS4B 2OAUA 2YNIB 5FDLB 1X4EA 3GYGA 1RWXB 3R97A 2D69A 2OPQB 3P45B 2GC8A 2OMOA 5D0EA 3K5PA 2GCFA 1CJVB 1HNIA 2R7XA 1CULB 2QTWA 2CQCA 2QA1A 3IBCB 2DGVA 3R7NB 1IKWB 5LSOA 3W2WA 2HNZB 3MPVA 1UJ6A 1S76D 4NASA 3GFHA 1SH0A 2FGCA 2Z56B 1NO8A 3L7UA 3R9LA 1KONA 1QY7A 4Q2LA 1GFWB 3B4DA 4PG5A 2UXDJ 3SXLA 2MDAA 4R8UB 5H9EK 3NNAA 2JFDA 1R8BA 3OTDA 1QLNA 3WQPA 2R7VA 1NB2A 3QPIA 4IQMA 3B82A 1T9UA 2B6AA 1NJIT 3OR2B 3EGZA 4C3KA 3UPFA 3W1YC 3DI6A 4Z2XA 2IMWP 1VFJA 1TELA 1AYEA 4DV4J 1I3OB 1NK9A 4UZBA 1Y9OA 4CO1A 2G1HA 3CD6S 3OXGA 4Y34A 2HEKA 1RYSA 1UVJA 3VTIA 3BR8A 2B9XA 1U8WA 1LWXA 1HR0F 4YB6A 1Y5IB 3AOAA 1TKTA 2FIUA 4OLOA 4LBHA 2WAQD 1RACB 3KUEA 3H5YA 4GVBB 4FN5A 3IR6B 3BV8A 5K8PA 3VQTA 4P2FA 2DR9A 4OYBA 5LT5A 2LQ9A 2QFJA 3D5MA 3MR2A 5DRKA 2QZ8A 3DRPA 3T1YF 1GH8A 4IH5A 3RUBL 4CLWA 2AHOB 3DDIA 2FJXA 1NKEA 4B3SF 4A8MP 1NSKL 4PKDB 2XSJA 4KHPF 2DR7A 2XLIA 4OJGA 1N5YA 2HHWA 3V4IA 2K3KA 4LF7F 3OLBA 3H8YA 2K3IA 2CZ9A 2N3LA 3N5BA 1R7IA 3U1NA 2MQPA 1JLGA 3HKWA 4UOGA 3G6YA 5F9LA 3ILJA 4LF8J 3MAAB 1L3SA 1O6XA 3DMJA 1KBRA 2DT9A 1EKRA 4J9UE 1FEEA 2HBYB 2Y1LB 2GFFA 4Q2MA 3AB2B 3CWJA 3FEXB 5HSPA 4QWDA 3CC7S 5T14A 4J9MA 5A8WA 2D41A 1S59A 2MZ1A 2YWWA 5F8MA 1HPZB 4ECZA 4JI3F 4A8XA 2YKOA 1C1CA 1RAJA 3LP2B 2F9JA 4ED7A 2GHPA 2FJDB 1SL0A 1SJ4P 4NEZA 2ZBCA 3VAHA 4YHHF 5B0FA 3ELHA 4Y00A 2XS2A 5IQQA 5ADZA 4RBVA 4MYUA
chains in the Genus database with same CATH topology
2BBEA 3GR1A 1M5KC 1HNIB 4WYLA 2ZJQQ 5EWGA 2COLA 2JSXA 1O5JA 2DGWA 2Y1IA 3NS6A 2GMHA 2RQ4A 3D0HE 1XR5A 4RUCA 3ISZA 2DNMA 5DLGA 4C11A 3W2WB 4ZCKA 4QWBA 1QTMA 4C8NA 4KJIA 2RVJA 3MM5B 4QIGA 2AP6A 4DMZA 2CRLA 3J7YI 2XLKA 3F44A 4N47A 4K4WA 4OHYA 3M05A 4I68A 3K57A 2DD8S 3CDEA 2WB4A 2JC1A 4G6VB 3B78A 1T05B 3E51A 4X62F 1Y4ZB 3CUNA 1QUVA 1HQEA 4Q5VA 5H1SV 2PO4A 2MYFA 2IJFA 5I3PA 1F2GA 3OR1A 1C2PA 2V94A 4PCQA 1ZM4A 2WONA 2XY7A 1JMTA 2AD9A 1B0TA 3KMSA 1JX4A 2UV8G 1S6OA 2HS3A 4WFXA 3CB4A 1URRA 4NOHA 3QIPA 1Q8LA 2ZH1A 4IFVA 2ZOFA 1HNVA 1U6BA 3IWXA 1XEZA 5CYMA 2HWIA 4IRDA 5A8RA 5DQGA 2B6AB 3K2YA 2HHTA 5DS7A 4W90B 1KOHA 3KG0A 4FXWA 4OIXA 1K0VA 5A6PA 5D4LA 3RBDA 3KK3B 5DJBA 4DUYF 2MHNA 4I0WA 4X65F 5D77A 5E2QA 4J9OA 4PUOA 4KGMA 2M70A 4EUVA 3TARA 3LWMA 3G9CA 5F8HA 4M8LA 1HNWF 2HPUA 2ZH3A 4UY85 5C42A 3DI6B 3GSDA 1FD2A 1R89A 4TYBA 3VZHA 2KG1A 3VAGA 3DLKA 2XC9A 2CQ4A 2IRXA 5KFDA 4QW9A 1V3SA 1WWHA 3M30B 1N6QB 5T7LB 4LSNA 2Z2LA 1RTHA 1PC5A 2BZ2A 2HHUA 3PACA 1CC7A 4R8UA 1RTDB 3KLEA 2ZH8A 1U6FA 2GIRA 1WEXA 4C0HA 5B0DA 3EPIA 2JC0A 3T19A 5D4NA 4Q0BB 2J7WA 3BGLA 4USJC 1YJTA 2QRRA 1RTIB 1NKCA 2WSCC 1DHMA 1IJEB 1LFPA 1SUQB 2FB0A 4U9RA 3TVKA 3GG0A 2VL1A 3E01A 2HLUA 1OIAA 1GXLA 3OR2A 5T41A 2VG5B 1N5SA 1D8YA 2ZBIA 3G8TA 3I4PA 3EPGA 3N79A 4RNOA 2OJ3A 2J0WA 1IKVA 2EBGA 5CYQB 2W9BB 1XWLA 3KJVA 2HS4A 1KS2A 1VI7A 1S1VA 2UVRA 2UVWA 1X4DA 3MEEA 1C0TB 1TKTB 1R8CA 5A8KA 4OX9F 4G3IA 3ICLA 1ELOA 4DN0A 2XCPA 1M5SA 1RISA 4HDHA 1D9DA 2R2SA 2FJVA 3BQ2A 2V9KA 2C3OA 3Q24A 3LGMA 4BC7A 3MI7X 3LAKA 4OFZA 4B17A 4JI4F 5DLFA 3UI3A 2DHAA 2O5DA 2K7KA 4C8MA 4K5RA 3V6DA 2E66A 3MPWA 2UVUA 1WF0A 5J2QB 2LCWA 4QCLA 4CO0A 2KYZA 1LWCA 5HMYA 3HXMA 1WHYA 2LA4A 3HI9A 1LXNA 5IWAF 1HHSA 1SQEA 2HQIA 2JWNA 3VAJA 4FBUA 3H98A 3FQKA 5KFJA 2UUBF 3C6UA 2A3JA 3D1HA 2NREA 5AE1A 3W2VB 3UR0A 5KG1A 5EGYA 3PKMA 3DCAA 1B64A 3HVWA