3KLIB

Crystal structure of unliganded azt-resistant hiv-1 reverse transcriptase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
molecule tags Transferase
source organism Human immunodeficiency virus type 1
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
total genus 103
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kliB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliB03
4QWAA 1TV6B 3DDKA 3CJ0A 4H4MB 2I5JB 4EO8A 4QW8A 4QPXA 5F8MA 1HQUA 1RYRA 1HQUB 4NLVA 1VRUA 5HROB 3I0SA 1S1UA 1S9EA 1TV6A 4Y2AA 4R8UB 3BQ1A 1TL1A 3LAKA 4EYIB 3BQ2A 3DRRA 4MH8A 5DQGA 1JLEA 3M9OB 4K50A 5DG9A 4IG3A 5J2PB 1J5OB 4B3OB 4FBUA 1TKXB 4J9RA 2YNHA 3FRZA 1BQNB 3C6TA 3CJ2A 3OL9A 1REVA 3RBEA 5KT7A 5C42B 4ED7A 1RA7A 5KFJA 3T5JA 4PWDA 4RW9B 1DLOA 1K1SA 4KHRA 4PUOA 2OPSB 5T14A 5F8NA 4IH7A 1RDRA 1N5YA 5J2NA 4PQUA 3ICLA 2QV6A 2GIQA 1JLAA 3BQ0A 4RW8B 3RB6A 3C6UA 1RT7A 4IFYA 5KFVA 3RAQA 1FKOB 3BJYA 1HPZB 1JLCB 4Q8EA 3MR2A 2OPQB 5HP1A 2WK4A 2OPRA 4XO0A 3G6VA 1RTIA 5DLGA 1C0UB 4F50A 1IKVA 2B5JA 4DL4A 5KG1A 3IGVA 5KFXA 1JKHB 4RW6A 1DTQB 1RTDB 1Z4UA 1RT1B 1DTTB 2HAIA 3QGHA 4TQSA 1S9GB 3MR6A 2WRMA 2XGQA 1RT3A 2D3UA 5I42A 3MF5A 1D0EA 5KFWA 4RNOA 3NBPA 2ZE2B 3DLKA 1I6JA 3RBDA 2VA3A 3V4IB 2XI2A 4MKBA 1CSJA 4ECSA 3BREA 4QWEA 1IKWB 2BRKA 4O3PA 4J9PA 2I1RA 3NKYA 1KLMB 3LP1A 1WNEA 2GIRA 1N56A 4MKAA 2ATLA 5KFAA 5FDLA 2IAJA 1RT4B 2FVSA 4RNFA 1JLGA 4WYWA 1S0OA 3QGGA 5KFMA 3RAXA 3ISNC 2FLNA 3T5HA 3MFHA 3I0RA 5F8GA 3DOLA 1RA6A 4GC7A 3QIPB 1HQEA 1SH3A 2BRLA 5J2QA 4URSA 4HKQA 3V81B 4K4YA 4ZHRA 1HYSA 2XCAA 3OL6A 5C25B 4I2QA 4TN2A 4FS1A 2IAJB 1S48A 3HVAA 1YVFA 3KOAA 4ZP7A 2VG5B 1S6PA 3ITHA 3M9MB 5C24B 2UUWA 3E51A 2QE5A 3Q8RB 3NGDA 4LSLA 1EP4B 1S1XB 4KV8B 1JIHA 2IM0A 3NMAA 2HNYA 1S97A 3TVKA 1JX4A 4TXSA 2ZE2A 3NBPB 2ILYA 4ZMMA 2ASJA 1HMVA 2YNGB 3KLEB 1XR7A 3PW0A 1ZETA 1KHVA 2J6TA 1DTQA 5HLFB 2RDJA 1S1TB 3MFIA 5J2MB 2FJVA 4KBIA 3DRSB 4Q45A 1KHWA 4ED2A 1RTIB 4J9KA 1U09A 5J1EA 4Y3CA 4ZP8A 3V6JA 1RT7B 1ZTWA 1T94A 3LP0A 4I2PB 1TKZB 3PJWA 3G86A 4J9MA 3I5CA 1QUVA 4RUAA 3MEGA 3E01B 1RT5A 5F8HA 1QE1A 5KT6A 3MR3A 3KLHA 4MK8A 1SH2A 1LWCA 3IN5A 4J9QA 2AGQA 4XPCA 3TAMB 3DMJB 4ED8A 3GQCA 1SH0A 4ZPDA 5KFUA 3C6TB 4TYAA 5KFBA 4YR2A 2JC0A 3KHHA 1S1WB 3DLGA 3KJVA 4B3OA 3PJXA 4TLRA 3MR5A 2AGPA 3HVTB 4YMEA 5KFOA 4DEZA 2HNDA 4M95A 1RT6A 2EC0A 3DRRB 3N6MA 3PR4A 2F8EX 4ZP6A 1TL1B 3D5MA 2FJWA 4R8UA 1FKPB 1S9EB 4NLYA 3KLIB 3I0SB 4U7CA 4R5PB 3DMJA 4ZPBA 4H4MA 1LWFA 1T03A 3OL8A 2XCPA 1LWEB 3PZPA 1C2PA 3E01A 3MEGB 3H59A 4IDKA 3DLEA 3CDEA 4NLOA 5KT3A 4ECYA 4I2PA 2IM3A 5CYMA 2UVRA 3MEDA 5KFGA 1HNVB 1TKTA 2WOMB 4DL3A 3PW7A 1S0MA 1S9FA 4FBTA 1SUQB 4K4XA 3DI6A 4ICLB 1IKYA 5J1EB 4IG0A 3RB4A 4K4TA 2BQ3A 3IS9B 3H5UA 2C22A 3GYNA 2VG7B 3JSMB 5HLFA 2FVCA 5EUHA 1HARA 1GX6A 3M8PA 5DGBA 4IKAA 1TL3B 5CYQB 1QAJA 4YQWA 1RT2A 3H2LA 3FSIA 5D3GB 3G6YA 3DOKA 2UVVA 3MECB 4NCGB 2B6AA 5KG6A 4DG1A 1LW2A 4KV8A 5KT2A 5EWFA 4LSLB 3Q8QB 2YKNB 1SV5A 2YNIA 4RW7B 4MK7A 2FLLA 2AWZA 1EETB 2VG6B 4RZRA 2VG5A 1LW2B 4DG1B 5KFRA 4WE1B 4QWBA 2FLPA 1R0AB 4NCGA 3FDSA 3GILA 3QLHB 2HWHA 1D1UA 3EZUA 1HYSB 4ZHRB 3DOKB 1XR5A 2W8LA 4ECTA 2JEFA 1RT2B 3QIPA 3FFIA 4XPEA 4Q0BB 5KG0A 4RU9A 4KKOA 2R2SA 4K4UA 4TQRA 3M8PB 2UVWA 2IJNA 4IH6A 3IG1B 3M8QB 3KHRA 4WXWA 3UDLA 2E9ZA 1JLGB 3RB0A 3V6DB 3IS9A 2RKIA 1GX5A 3GV8B 4ED3A 2RF2B 3DRPA 4IRKA 2IA6A 1IKYB 5KFPA 3G6XA 1QAIA 2AX0A 4J9LA 4MIAA 1SUQA 3T5KA 3QIDA 3MEDB 5CYMB 4Y2CA 3KLVA 1JLFA 3DLKB 3DLEB 1IKXA 2FVPA 3SFGA 1RAJA 2O5DA 1LWEA 4G1QB 4LQ3A 1RTJB 2AX1A 4NLDA 4ZP9A 4IRDA 5L1LA 3BSOA 4O4GB 1DTTA 1RT1A 3DM2B 2ILZA 1JKHA 4RW6B 1RTDA 3EPGA 1JLBB 2CKWA 4R5PA 2OPPA 4H4OB 3PR5B 4RW4B 2HNZB 2OPRB 5HP1B 1HPZA 4KAIA 2W7OA 1JXLA 2XC9A 3OHBA 3FQLA 4NLWA 2V4QA 2W9BB 5L1IA 3HVTA 4WZQA 2R8GA 1N5YB 2W8KA 2E9RX 3LP2B 2OPSA 3UQSA 2JC1A 3N6LA 1DLOB 4RW9A 3TAMA 3HHKA 1N48A 4HYKA 2J6SA 3KK3B 3Q8SB 4RUCA 4URGA 3LANA 4WXOA 3KLHB 2D41A 3M9NB 5DG8A 1REVB 1QE1B 3T1AA 1RT5B 3QO9B 2YNHB 2W9CA 1VRTB 2WONA 4NLSA 5KFZA 1N4LA 2W9BA 4GC6A 3PW4A 1MU2A 2WTFA 1JLEB 4O3QA 4TYBA 2JEIA 5DGAA 5I3UA 4NLTA 1C1BA 4R0EA 2HNZA 4RW4A 2WB4A 3DRSA 1S1UB 4JUZA 4EYHB 1XR6A 1S1TA 1K1QA 1VRUB 1S49A 3UPFA 3CDUA 3NAIA 3H40A 3IRXA 2I5JA 4O4GA 4ID5A 2WCXA 5KFQA 4NLGA 4MK9A 3KLEA 1RTJA 5KFHA 4G1QA 1HMVB 2YNGA 4ZPCA 5C5JA 3KHLA 4ECZA 2IM2A 1JLFB 5F8LA 4ED6A 4ECVA 3OLBA 1TVRB 4NLXA 4MFBB 3CJ3A 5KFDA 4K4WA 4KB7A 1LW0A 2YNFA 4ECQA 3OLAA 4KO0B 4J9NA 2RF2A 3BR9A 3HKWA 2YKMA 4NZ0A 3V6DA 4KFBB 4JV0A 3EPIA 4F4XA 2V9WA 2HMIB 4IFVA 4YR0A 5C25A 3DYAB 5L9XA 3H4DA 4DL2A 5HBMA 3IGNA 4EBCA 3I5BA 3H5YA 1HQEB 2C28A 3DOLB 4IRCA 3FFIB 3H5SA 3KK2B 3BSAA 5KFTA 4RNHA 4F4WA 2BANA 3BSNA 3BGRA 3QLHA 1RT4A 5FDLB 2R2UA 1R0AA 4ZVHA 4WE1A 5F8IA 2VG6A 4YR3A 1SV5B 4O3NA 2RDIA 3CJ5A 4NLPA 4ED0A 2B6AB 3V4IA 3MECA 2IMWP 2OH2A 2ZKUA 2R8IA 3QZ7A 1JLQA 4I7FA 3SI8A 2D3ZA 1RT3B 3H98A 1TL3A 5CYQA 1S9GA 3QGIA 1N6QA 4I7FB 1JLQB 5KT4A 3H4BA 5K14A 5KFLA 5L1JA 2BR0A 4K4VA 2R8HA 3MEEB 4IR9A 5KFCA 1IKVB 3LALA 1W25A 2B43A 4WYLA 4URQU 5EDWA 4IG0B 4Q44A 1RYSA 2OPQA 2E9TA 4ECWA 3DI6B 3TQ1A 1NNDA 1HNVA 1TKTB 2WOMA 4O44B 4RW8A 1JLAB 3CVKA 4O4RA 4J9SA 3BGRB 1IM4A 3GIIA 2BANB 4IOBA 4EBDA 5KFSA 3V6KA 2C2DA 3KK2A 3H5XA 5DLFA 5KFNA 1LWFB 1T03B 3KK1B 2XWYA 4WFXA 2C2EA 4PWDB 1BQMB 3DYAA 1TQLA 4EBEA 5KG2A 3KLIA 4ECXA 2YKMB 3RB3A 1FKPA 4QW9A 1BQNA 3FQKA 2IM1A 1TKXA 1T05A 2WHOA 4MIBA 1LW0B 2YNFB 1NHUA 3Q8PB 1RT6B 3OHAA 4TY9A 2HNDB 3KMSA 4Y34A 1TVRA 2UUTA 1S1WA 1C1CA 3DLGB 3KJVB 3CO9A 1S1VA 4ZPAA 4ZVGA 5KG5A 2V4RA 4IR1A 4EEYA 2AGOA 4IQXA 4YP3A 2V0NA 4O3RA 5HROA 2CJQA 4ID5B 4NLUA 4M94A 3IRXB 3T19A 3ISND 3KLFB 1LWCB 5JUMA 1MMLA 1C1BB 3MTKA 2IBKA 5I3UB 1FK9A 4RNMA 1TKZA 3LP0B 1MU2B 4JV1A 1S4FA 5DG7A 1RTHB 4LSNB 2D7SA 5KFKA 3PHEA 4DL6A 2BQUA 2WONB 4K4SA 1FK9B 1VRTA 2W9CB 5L1KA 2XGPA 3QO9A 3GIKA 2DPJA 2XI3A 3CIZA 3I5AA 3QYYA 5J2MA 5F9NA 4KSEB 3KLFA 5KT5A 4LQ9A 3KK3A 3SFUA 5KG7A 2ZD1B 5KFEA 3KNAA 4NLQA 4WZMA 3PW2A 3VQSA 5KFFA 2FJXA 3LP2A 1UWBB 4OL8A 1S1VB 4F4YA 3KLGB 3KMQA 1C1CB 5DQHA 4O3SA 5F9LA 2HNYB 3NL0A 4TY8A 1EP4A 1S1XA 1T05B 5KFYA 4QWDA 5C24A 3CWJA 1C0TB 3ITHB 1S6PB 5F8JA 4ZVFA 3JYTA 2OPPB 4H4OA 1HNIA 3NAHA 4I2QB 1JLBA 4RNNA 1BQMA 2BQRA 3DM2A 2R8JA 2JLEA 3V81A 3PVXA 5J2QB 2JEJA 4G3IA 3KK1A 4O3OA 3GIMA 3I0RB 2BE2A 4FS2A 4WFZA 1IKXB 1S6QA 2J6UA 4ECUA 4O44A 3GV5B 2ALZA 3LAMA 1KLMA 3LP1B 2IC3A 4DL7A 4K4ZA 2W7PA 2IC3B 3DRPB 1IKWA 4NRTA 2RKIB 5JXSA 3GV7B 3MEEA 4ED1A 5K14B 2JEGA 1S6QB 3IG1A 3M8QA 1NHVA 1N6QB 2HWIA 4WFYA 3V6HA 2BE2B 4KE5A 5I42B 4QWCA 4KKOB 3QZ8A 4KHMA 4Q0BA 4X2BA 1T3NA 2R8KA 2W9AA 3PW5A 3D28A 4NLRA 3OSNA 5KG4A 2B5JB 1HNIB 2ASLA 3JYTB 1C0UA 2UVUA 1C0TA 1EETA 4RW7A 1JLCA 1FKOA 2YKNA 2YNIB 2IJFA 3HVWA 4IFYB 4TY8B 4EO6A 3C6UB 2FVRA 4F4ZA 2C2RA 2GC8A 2R2TA 3OSPA 2DPIA 1TP7A 5J2NB 4PQUB 5KFIA 3KLGA 5D3GA 4ZVEA 1UWBA 1ZTTA 5EWGA 4IH5A 4PUOB 4Q8FA 2ZD1A 4J9OA 5HBMB 3N6NA 5EWEA 1S10A 3JSMA 4DL5A 2VG7A 4IFVB 2HMIA 5DQIA 3T5LA 4KFBA 5C42A 3UR0A 2FVQA 1OS5A 2ASDA 4KO0A 4H54A 5KG3A 4ICLA 1S0NA 4NRUA 3BSCA 1J5OA 4IG3B 5J2PA 1RTHA 4LSNA 4ECRA 3OL7A 4MFBA 2AQ4A 3GIJA 4NYZA 3CDWA 2VA2A 4U6PA 2AU0A 2R2RA 4Q43A 4IDKB 4JV2A 3CJ4A 3KHGA
chains in the Genus database with same CATH superfamily
3C14B 3T3FA 3CJ0A 3FBEA 1F60B 3MMJA 5DDQC 4U95A 2WVBA 3RBXA 4EO8A 1V5VA 5HQMA 4FF1A 1HQUB 1U24A 3R5JB 1KFSA 1B0TA 3JXOA 3M32B 2HQFA 2VKRA 3CGIA 3R5CA 2ZHBA 1S9EA 1TV6A 4I68A 4Y2AA 1IM6A 3LAKA 1Y00A 1ZAXA 3W62A 1GNKA 4A47A 4YDDB 3DRRA 2GO9A 1RAFB 3TEGA 5DQGA 5FLXY 4TU8A 1X8DA 2JFKA 1QVFR 3BKFA 5DO2A 4B3OB 2XO6A 5B0EA 5HJYA 1CBKA 1GMUA 3FZBA 5B0CA 3BGUA 3FRZA 4ZJLA 3TP2A 4USWA 4JI2J 5KT7A 1SCJB 1UJ4A 2E7VA 2QA2A 4ED7A 1YITS 2XYGB 5T7LB 5KFJA 2J0WA 2XULA 3GFYA 3T5JA 4RW9B 1DLOA 2V8HA 2Y0SD 4KHRA 4ETXA 5A2QU 4I67A 2DO4A 3CCQS 4HLBA 3PYDA 1SKWA 3OXGA 4DV3J 2LECA 2CXEA 3AOBA 4P2FA 4KY3A 4DPWA 5F8NA 5JMNA 2WSFC 1N5YA 4OX7A 4JI8J 2QV6A 1JLAA 5LMNJ 4FP9A 4RW8B 3MHYA 1LK7A 3KNGA 1VQYA 5IT9Y 4TU9A 6AT1B 2NPFA 3UVJA 2RRAA 3SBMA 3MR2A 3Q24A 4DF4A 4HACB 3J7ZT 4DV3F 2B4OA 3QT8A 1NKEA 2CJYB 2OI2A 2QL5B 4I69A 2J9CA 2V8PA 5DDOC 1IBMF 3PFOA 4DL4A 1MN9A 2CZ9A 3IGVA 4BHQA 2HAIA 1R8CA 1Z4UA 2QLBB 3MCNA 1WC4A 3C19A 1S9GB 1SJ4P 1YQHA 3HSZA 1RT3A 2UUBJ 2AP6A 2ROGA 2MQMA 1G7CB 4AT1B 3DLKA 5HL7Q 3PEJA 4OYIA 1CSJA 4ECSA 2LCWA 1UW4A 2NXNA 9RUBA 1TELA 1CLFA 1IBKF 2W2OP 4DR6J 4M1KA 3LP1A 1X5PA 1FVSA 2EI5A 2GIRA 4DV4F 2ATLA 3CJ8A 4RNFA 2ZJPQ 3FCHA 2IFXA 3IP0A 1SJ1A 2HHWA 3OR1A 1BLUA 2P9CA 2CPZA 2E66A 5KFMA 5ETQA 2HG4A 2FLNA 1AROP 3L7PA 5F8GA 2NXCA 3DOLA 2BJ9A 3R8YA 4DV7F 4DR6F 1MWYA 5D15A 3CD7A 2KFNA 3PDNA 1HYSA 3OL6A 2IYGA 4FS1A 3KUGA 1S48A 3K5NA 3HVAA 3KOAA 4ZCIA 4ZP7A 1S6PA 3ITHA 3O44A 2UV8A 2UUWA 5A2QY 3KDNA 2EBEA 1S1XB 2Z4PA 2HNYA 1S97A 3QBCA 5DS7A 4GKKJ 1JX4A 2DNNA 2BEFA 2Y1LB 2ZBRA 5F0UA 4C8MA 2ZE2A 2ILYA 3K8VA 4PPZA 4Y2IA 3M2UA 1EZZB 1V6HA 1RABB 1YGYA 1NSAA 3PW0A 1ZETA 3GFHA 4OZNA 1VQSA 4ZPTR 2P9EA 2RDJA 3PYGA 4M5JA 5A8RB 5J2MB 3ENAA 2AT1B 4ZPVR 1NJZA 6FD1A 4HACA 4J9KA 5HMWA 2DY1A 1B64A 1TUGB 1CC8A 3JQMA 3Q8UA 5DETA 2HZVA 4A8KA 2XSJA 3CD6S 2J9DE 1F2HA 3V6JA 1RHRB 4DFKA 4ZITA 3P3DA 5CXTA 4F2SA 3U1MA 4LF6J 3BN4A 4PPDA 1NBEB 5AXLA 4PKDB 4N76A 3WDOA 5JVHQ 3I5CA 2HHTA 3MEGA 3E01B 2H9ZA 4ZN3A 1CC7A 5F8HA 4USJC 4EI2A 1O5JA 2QSFA 2EFVA 4MK8A 3TQEA 1N8RT 2AZ1A 4FPIA 2QO3A 4USIA 4XPCA 3TAMB 3GWCA 2CZVC 2ZC4A 1SH0A 1RI7A 4FYXB 1B0PA 4OFZA 5IC6B 1YJUA 4OYPA 4DSJA 1UEKA 2M2BA 2VONA 3C6TB 1S7IA 1X60A 2W01A 1RJJA 5KFBA 4HI1A 2DR8A 1N34J 1S1WB 3CJSA 1HIYA 2MMYA 1FKAF 4CLTA 2HNDA 4PWWA 5A6WA 5IXUA 2NXUA 3DRRB 2MB0B 3EYZA 2F8EX 3D5MA 3CC4S 3A4TA 2HZAA 4R8UA 5CQGA 4OHXA 5ETKA 3VV2B 1KD1T 1S9EB 4FZVA 1AB8A 2L9WA 5H1SV 1A9NB 2FPHX 1K9MT 3R3TA 2PEBA 1UFWA 2VBWA 4G6VB 2NSCA 1U1QA 2UU9F 1BUXA 4CI0B 3PZPA 1C2PA 3AQPA 4PZVA 3CDEA 2AJ2A 2UZAA 3C66A 4Y2KA 5LL6d 2HQGA 4KT0C 1TKTA 4DL3A 2ZHAA 4FBTA 2XG8A 1ZA2B 2CWXA 3MCOA 5B0DA 1RCOB 1WF1A 3RB4A 5RUBA 2NUHA 2XS5A 1ROFA 1T9TA 1D09B 2VG7B 4P75A 3MMCB 2F3JA 2E44A 2DRDA 3MUMP 1VMBA 2FY8A 4IKAA 5DGBA 3NS7B 4P10A 1RAEB 2BW7A 2JL9A 3QATA 1F6TA 1RT2A 4DLEA 4CWBA 1VBZA 4FBUA 2UVVA 2AHOB 1FE0A 1KVJA 3JSRA 2CDRB 2XSFA 3MECB 5GAGI 2KH9A 1Y11A 1SC6A 4KV8A 1WOSA 1RKIA 3HKZD 2YKNB 4RW7B 2GQQA 3M30A 3D6FB 2KZMA 1EETB 4X65J 2HQIA 2NS1B 3IAM9 4RZRA 4X4OA 2FLPA 4B3MF 1GTHA 3FDSA 3GILA 1EHWA 2GS8A 2VD3A 4CTAA 2B4VA 1HYSB 1NEEA 3ZZTA 5M2PA 4ECTA 3NS6A 2KXNB 1RT2B 1HI0P 3QIPA 3NOCA 3MUTP 2WVDA 4EK2A 1X9MA 1HBOA 1UZDA 4U8VA 4LF9J 4K4UA 3M8PB 4CO0A 1F3VA 2UUAF 2Y1IA 2H1YA 5B0FA 2E9ZA 3DC2A 1JLGB 1H7XA 4P52A 1T9YA 1VK8A 4L3KA 4ZDNA 4ED3A 2F1FA 4LRCA 2RF2B 2B56A 2A2CA 4ELTA 2OUGA 2F7VA 1QDUB 2FYXA 1SJQA 2HBQB 4MIAA 1SUQA 3H2VE 3T5KA 4WFBQ 4XK8C 5GMEA 4BLGA 5ETVA 2R7WA 1JLFA 3SV3A 3DLEB 2FVPA 3TYTA 2YWWA 1RAJA 2O5DA 2RMLA 4G1QB 8RUCA 4L3NA 3THVA 4DV1J 2MQNA 3FEZA 5IFMA 2QLXA 2M4MA 2CKWA 2XMVA 3D3BJ 5F0WA 2OPPA 1V3ZA 4DN9A 3K5MA 2IBOA 5LJ3Y 1U1MA 4Z7YA 2WW4A 1FRKA 3D6MB 3HFVA 3VQTA 3QJLA 2RUSA 1EJ7L 2XLJA 4KAIA 1DQ9A 2W7OA 1JXLA 1UFKA 2LQ5A 2M7SA 2V4QA 2DXEA 3OPKA 2U1AA 2LQ9A 1KEKA 1NK9A 3W63A 1H98A 3ENWA 3LP2B 3IR7B 2ZWPA 4F67A 2C3OA 4A8YA 1IWGA 1VC0A 4MYTA 3NOGA 1UL3A 4QBUA 3B4MA 5T7LA 5K20B 1CULA 5LXYA 2DISA 4RUCA 3A8IA 3OVSA 3F73A 1X4EA 2CQGA 2D41A 2BA9A 3D1QA 1QE1B 3G87A 1OQ3A 1U47A 2W9CA 3VVTA 2MKYA 2AQ4A 2WONA 3OFFA 2COLA 2VZ9A 3IBWA 3HHLD 3KTQA 2W9BA 4GC6A 1VI7A 3FNNA 3ZC4A 4OLPA 3LF0A 5DGAA 2CQIA 3QAUA 4IYQA 5L46A 4XDDA 4RW4A 2GVZA 1M90T 4EYHB 5A8RA 4AXJA 4LRBA 3KYLA 1KOOA 2HYIB 3NAIA 2L08A 3PCOB 1OQ6A 4K2JA 4LRFA 4O4GA 2G0IA 1OSDA 5ETSA 5F41A 2R7TA 1FO1A 4WFAQ 1C4CA 2MLZA 2EFNA 3D1HA 4ZKAA 2B9XA 4G1QA 1HMVB 3M8WA 1P1LA 3QAEA 2KFYA 3KHLA 1NK8A 2KO1A 5F8LA 4RKUC 2PC6A 1TVRB 1X4GA 4MFBB 4YB7A 1HNXJ 2GMJA 5KFDA 2X7IA 3ENVA 1VLYA 3H20A 4KB7A 1NXIA 3RAMA 4DWIA 1VLOA 1G2EA 3R7NB 4J9NA 2LVWA 1U1LA 1KWMA 3BR9A 3V6DA 1U7LA 3BN7A 2ZM6J 1HFEL 4MIWA 4F4XA 2RE1A 2QGFB 5C25A 1WJ9A 4YR0A 3OJSA 3CULA 3ZZZA 2EK1A 3LOUA 1N36F 3C15B 1OMSA 5A6PA 3DOLB 1D8ZA 1KLNA 3WBZA 4CLWA 1N52B 3JQJA 1XMQJ 4RNHA 2P9GA 3HT3A 1AUDA 2QX0A 5D77A 5E3CA 4ZVPB 2V68A 1RT4A 3QT7A 4DBQA 1R0AA 2ZH8A 4ZVHA 3R1HA 3DKDA 5F8IA 4GRSA 2E1AA 2Q6CA 1S72S 4DV7J 1H2UX 1JQGA 5E3PA 4WFNQ 4DR5J 2UXDJ 2KFZA 4O3NA 3R97A 1R27B 3CJ5A 5T41A 3CC2S 4RBVA 2B6AB 1XNQF 4LUBA 1F9EB 3W5YA 2IMWP 4ILMA 2ZKUA 6FDRA 2B0GA 3GJQB 1JLQA 4ANDA 3QZ7A 2WAQD 2NLWA 2YBVA 2DNPA 5IT0A 4RUHA 4AL7A 3NY0A 1TL3A 5CYQA 3KG1A 4F26A 1ICEB 4DLGA 2AV5A 1N6QA 2H65B 2I9SA 1JLQB 2RVJA 4MMOA 4YB5A 3S6EA 3OJUA 5L1JA 4K4VA 3PYFA 1X4HA 3LALA 3MAQA 1PYTA 4LFAF 1ZAVA 3K58A 1W25A 2B43A 3GFXA 4URQU 4DX6A 4N56A 1VBXA 2HQCA 2Z30B 2HFSA 3DI6B 2NZ4A 3BM7A 5AE2A 2FD2A 1FFGB 2XMTA 2DK2A 2L9NA 3JAMY 3TQ1A 1B7FA 2WOMA 1B4SA 4O4RA 1KSPA 1IM4A 4X4RA 2BANB 4IOBA 1LWXA 4OHZA 5KFSA 1TK8A 1W26A 1FDNA 5C2CA 2FC8A 4QYRA 5L39A 1VQ9S 4UTGA 2C2EA 2SXLA 1T03B 4JI5J 3KK1B 5HQLA 2MSTA 1MMDA 1A6LA 4JI0F 5CCMA 3HHDA 4LF5F 2WVFA 2CQ1A 3AB4B 5KG2A 4OI6A 1X4AA 2B4PA 4FYWB 3W60A 4CDIA 3R6LB 4WP8A 1BQNA 2EPIA 2HPUA 4CNZA 4QW9A 4B3RJ 1CJKB 4EZ6A 3CNQP 4MIBA 5KOXA 1W2BR 2KI2A 3SXLA 5B7WA 2HNDB 2QC3A 4Y34A 1TVRA 2VL1A 4OI1A 3TUIC 1GT8A 1KDNA 3PKMA 1C1CA 2N82B 2Z2YB 3QWUA 4AQYF 4NXNF 1WWHA 2DNZA 2RHSB 3M6XA 3H2UB 4BBYA 4YP3A 3QFHA 1U6FA 4RLEA 2DBBA 4DFPA 1M5OC 3NNAA 3KLFB 3A8EA 2K7JA 4CO4A 1LWCB 1X7VA 2FB0A 2FJEB 3GIRA 4FNIA 4NA1A 2Y1JA 4OI4A 1WHWA 1U0HA 1FK9A 4DSIA 3LP0B 3UDEA 1Q5VA 4WKYA 7AT1B 3POTB 4JV1A 2CJBA 4LSNB 3EE3A 3PHEA 3MTJA 2WONB 4CH1A 2OTJS 1FK9B 2UXCF 1DQAA 2CJ9A 2QMWA 2J9EA 2MPUA 2XI3A 3HHLB 3FUYA 1RWPB 3I5AA 3DXSX 5J2MA 1M5SA 2KT2A 2ZUGA 3DCAA 5EX3A 1OIAA 3KLFA 4I56A 3SFUA 3KK3A 3SIPB 3VGUA 3VAKA 4CLSA 2AJQA 2LXFA 4UQGA 2H5EA 3KNAA 1JNZB 3PW2A 1YJRA 3AH6A 3AD8C 2FHJA 5KFFA 2POKA 3BBFA 4XIUA 3KLGB 4F4YA 1C1CB 1PO6A 4X4NA 1DFDA 5EX0A 5J1PA 1CQMA 3CCES 1NJYA 2VFUA 2OEMA 2V69A 2UUCJ 3OFGA 1QTNB 1S1XA 4TY8A 3ILLA 4B9TA 4LF9F 3NL0A 1KN6A 1T05B 5KTQA 2CVEA 1K44A 1NKBA 5C24A 1C0TB 2HSEB 4EMDA 2VPXB 4ENOA 3UDCA 2RIJA 4FPRA 4OYXA 2OPPB 1X0FA 4LBHA 1L3SA 2CPJA 2BW2A 1JLBA 2JDJA 2OGUA 3KJQB 5IV3A 3TZXA 2R8JA 3ONQA 4IR9A 2C2NA 3I31A 1UA1A 3M2VB 3KK1A 2A6OA 4G3IA 2Z2LA 1PBUA 1FRXA 2ZZMA 2YX1A 3EJMA 4RUBA 4W4MA 3K7RA 4CT8A 4WFZA 3OTOJ 1IKXB 4FS2A 2XZTB 3GJRB 3ZTOA 3FCVA 3TUPA 4QIGA 3PJ9A 3W1YC 1T7PA 1WKLA 3D66A 4ILRA 4K4ZA 2W7PA 2IC3B 4OHWA 1YZ7A 1X4BA 4NRTA 3RYLA 4ED4A 1URRA 2QJ3A 1KQFB 1RBAA 2FZKB 4X62J 2X1AA 3IG1A 5D6GA 4PWUA 2ZZTA 1HBOB 2YXLA 4KHMA 3Q23A 4X2BA 3FCWA 2EG2A 2W9AA 2HHQA 1YRXA 3MM9B 1UPMB 3Q8VA 3CMQA 1WEZA 2AEMA 1HQ2A 2GV1A 2HQ3A 1C0TA 2CJAA 1JJ4A 3FBCA 3MMBB 4CO5A 1EKRA 2YNIB 2JLFA 1Y5NB 4IFYB 2DGXA 2MZRA 2ZNYA 4TY8B 5K8PA 2FVRA 3GYGA 4WP9A 5IM0A 2GC8A 2XLIA 4F4ZA 4UUXA 2XY7A 2DPIA 1KP6A 1SKRA 3ILJA 4OHYA 3VZIA 4ERDA 4ZVEA 1ZTTA 1G4CA 4FXVA 5EWGA 2R7UA 3GSDA 1HW9A 2JHEA 3L7OA 2XZDB 2ZD1A 1HHSA 4R25A 2MLYA 1FEEA 4DL5A 1N0VC 3D4JA 4KYZA 1P6TA 4JBCA 3WIVA 2DRBA 2AJ0A 5C42A 1YSJA 2ZBIA 2R42A 1YBAA 2ZH5A 2ASDA 5FJ4A 1VDHA 2WBMA 3S7RA 3R2DJ 4NRUA 1FWPA 1WDDA 4HH0A 4ECRA 3FMWA 4MFBA 2HHVA 4X64F 4K0KJ 3V5RA 2FJBB 3LTOA 2R2RA 2DCUB 2MEWA 1MWQA 1HD0A 3CJ4A 4NYOA 4ZOSA 5A76A 4OYMA 3J7YI 1WTBA 2CFXA 3DDKA 3EXCX 3UFCX 1S99A 2VPWB 2PMHA 2G4BA 3I4HX 5CHCB 5ETTA 4NLVA 1VRUA 2FHKA 1Q81T 1XBWA 3I0SA 2D3OR 2ZUAA 1S1UA 4LF5J 4DR1J 2OIHA 2JZ5A 2CNKB 2ZBCA 3BQ2A 3MCSA 3W3SA 2F8HA 2OELA 4L72B 3M9OB 1JLEA 4ZLJA 2F63A 2CQ4A 3GSIA 1RWWB 5GMKa 3BGFA 5C2GA 1FFSB 5J2PB 1J5OB 3DDIA 4H4KA 3BKTA 1T9WA 5E2QA 1FFWB 1TKXB 5GAEU 1RP5A 1XQIA 1KONA 3BZQA 1KQGB 3C6TA 3PTWA 1TTHB 4OV1A 4AQYJ 3RBEA 3OL9A 5C42B 4F0KA 4UT4A 2NZCA 4DZ6A 2W2QP 4KC5A 2HHUA 3H8YA 1HI1A 2CYYA 3SSSA 3R2CJ 4PWDA 1K1SA 4PUOA 2BE9B 1DRZA 3O5TB 1NPRA 2M8DB 3ICLA 2GIQA 3BR8A 3CCSS 1ACMB 2ZNZA 4KTQA 3RB6A 4MKYA 2GQCA 1RT7A 3ZTPA 1HNWJ 1PG5B 2GHVC 1PBAA 3RAQA 4F4AA 5A8WA 4M5LA 2A18A 2WK4A 2OPRA 4XO0A 1X31C 1MMNA 3ZO7A 1C4AA 2MZQA 2ZOGA 2K1RB 2LLZA 4OYAA 2HHHJ 1IVZA 2GZOA 2Y1RI 4RW6A 3AD7C 3QGHA 3VR1A 1FRMA 5G4DA 4D3HA 1RK8A 2IRYA 3O8WA 1TFYA 2HVDA 2D1CA 2D3UA 1MWZA 3MF5A 3NGSA 4JI2F 1XEZA 4CH7A 5KFWA 2MQPA 3NBPA 2ZE2B 3HD1A 1I6JA 1H74A 3GTYX 3TW0A 3G4SS 3IA0A 4DQSA 3RBDA 2BMBA 1DHMA 2DNGA 1WDTA 2VBYA 4OZ2A 3G6YA 2OO4A 2ZH3A 1NLKL 2XMMA 3QGPA 1IJEB 4BC9A 1X9SA 4M63A 1NDLA 2B7BB 2C2KB 1KLMB 2H5JB 3AOAA 3E3XA 3GP9A 4MKAA 1N56A 2QLWA 5FDLA 2IAJA 2FVSA 1FDAA 4DCOB 1JLGA 5FIIA 4P6QA 1S0OA 3CJRA 1PJ7A 1LFWA 1YKWA 3NGKA 3QGGA 4RPFA 4DV6J 2Z57B 1NB2A 3T5HA 3RAXA 3MFHA 4KGZB 2MQLA 1NUEA 3D0GE 2EG1A 4CLYA 1X9WA 3QIPB 1HQEA 3LPYA 4ZLLA 4LF8J 4HKQA 4NXNJ 2HEKA 3IM9A 3NWRA 5D0GA 2ADCA 3O3LA 5HQ8A 3MOZA 2VG5B 4QIWD 1KTQA 1X4FA 1Y0HA 4WK3A 3M9MB 4DPYA 3E51A 3OXLA 2QE5A 3Q8RB 4DSFA 4LF8F 1JIHA 2E7WA 2YVSA 4O23A 4QR0A 4NEYA 2PFFB 4A4JA 1GAOA 1EARA 2AYEA 4OI3A 3SSQA 1FDBA 2YPZA 3L9ZA 1PCAA 4LREA 2YNGB 4JOUA 4ZVQB 3KLEB 3FEXB 1KHVA 3Q2SC 3SCJE 4ZVRB 1GMWD 2J6TA 3DLBA 2CPHA 1HKAA 1FXRA 1VR6A 2NYIA 2L41A 1S1TB 2VB6A 2HHHF 2APOA 2FJVA 3W2WB 5G0RA 2GVZB 2IA0A 1KHWA 3CDAA 1ZPWX 3F0NA 4ED2A 2DHGA 2QA4S 5J1EA 1JK9B 1UZHA 3UW1A 1CJTB 4ZP8A 3ZZOA 4KH0B 2HFVA 5A8WB 3CMAS 2FY1A 4HHHA 4LF2A 3D68A 4ZN1A 1KKHA 4AL5A 2J0SD 3LUYA 4B3TJ 3WIUA 5C7PA 4ILLA 1XN9A 4PYAA 1QUVA 1HL6A 3MR3A 2M5YA 1QE1A 3KLHA 3R5DA 1Q78A 1O0PA 1SH2A 1Y4ZB 2FJAB 5IWAJ 3IN5A 2AGQA 3PW7A 4NI2A 3GQCA 1S59A 2CQDA 1PGZA 4KGXB 5CYJA 4ZPDA 4WIIA 4YR2A 2WZ1A 3CXCR 3KJVA 3ET6A 2HFOA 4B3OA 4LF7F 2EW9A 1NO8A 2EEYA 3UN5A 1VQKS 4I4BA 4DEZA 3L4BC 4B3SJ 4ZP6A 1HWKA 3HO1A 2FJWA 1YTYA 1KR4A 2C3MA 2I2YA 4NLYA 2PIIA 4F7VA 3AD9C 4M8LA 4XTTA 4U7CA 3G8TA 1Q53A 2LQ8A 4NI2B 3G8SA 5HVFA 4CO1A 3Q22A 1FEHA 1H0HB 1BC6A 4ZPBA 4X84A 1HD1A 4B3SF 4N7TA 2D9PA 5EHHA 1RZMA 1SL0A 3EMTA 3MPWA 1E6VB 4NLOA 5CZVA 3DLEA 1Q1KA 4OQJA 4KPYA 3EVWA 1WD6A 4ECYA 1VQ6S 4AD6A 2IM3A 2ZH6A 1HNVB 3SCLE 2DGQA 2GMLA 1Y10A 3S8SA 4V19J 1BQXA 1CJTA 3DI6A 1EAYC 2PA8D 1IKYA 2H5IB 4IG0A 4I6WA 2IY5B 2BQ3A 2ZHOA 5M2RA 2ZOFA 3IBCB 1U45A 4JI3J 5HO4A 3H5UA 4JP8A 3GYNA 2B7CB 3UR3C 2C22A 3BDPA 4HDGA 4KQZA 1JJHA 4DR5F 3SCKE 3X1LB 1U2FA 1XWLA 3M8PA 3MD1A 3U1LA 1TL3B 5CYQB 4JI7F 1JXVA 4HDHA 1RSCA 3SCIE 3UDVA 4YQWA 1OPIA 3H2LA 3FSIA 5D3GB 2MHNA 3DOKA 1VGYA 1ELOA 2QMUB 2W1BA 1VYAA 1WG4A 2XYHB 3DXBA 3GPAA 1Y5LB 5AT1B 4F3MA 5IS2A 2MQQA 5FLXU 3BH6B 3HJFA 1LW2A 4NWBA 1DZ5A 1XC9A 1MNEA 2G1DA 3ILIA 3MMBA 2CPIA 4MK7A 4J37A 4AE5A 5CA5A 4AL6A 4DFMA 1RQ0A 2DGVA 2VG5A 5M2UA 3OTDA 4NCGA 2ZJQQ 3NWGA 3QLHB 1VQLS 3ZXWA 2HWHA 4LJMA 2I6WA 2MTLA 5CD4H 4ZHRB 3DOKB 1XR5A 2CQCA 3IR6B 4DOZA 1PILA 2MZ1A 1FDDA 3FFIA 2PSZA 5KG0A 4KKOA 2ZDPA 1CG2A 2IVFB 3UI3A 4TQRA 2DR7A 1TUWA 2OP5A 3KHRA 3TWZA 2AKWB 4WXWA 3UDLA 3UCUP 3RB0A 1UJ5A 1T0TV 2MKKA 2VJVA 3V6DB 4CLZA 2RKIA 1GX5A 1SIWB 3GV8B 3J81U 1XERA 3GJTB 1XMOF 1FXDA 5KFPA 4DUTA 5ETMA 1QAIA 2DHXA 4LFCF 3CD5A 4DQQA 2HRUA 5ETRA 4L73A 3HJVA 2BOPA 2GAHC 1VFJA 3P5BP 5DDRC 1MW7A 1XMBA 2F8MA 3T9ZA 1IKXA 3W65A 3SFGA 3ZZPA 5GAEI 4J90A 5CD4A 3BS9A 4LQ3A 4GKJJ 4C8OA 4NLDA 1I94J 3MM7A 5L1LA 4PCQA 5E41A 2MKHA 3K17A 1TFWA 1CJUB 2HFUA 4R5PA 1F9FA 2OD6A 1D8YA 2HBRB 2VFVA 4Q2MA 4PG6A 3OTEA 1FF2A 3L7UA 1HPZA 4DPUA 1BGXT 1PSDA 4EGLA 2BACA 3FQLA 5L1IA 4ANCA 2GJIA 2E9RX 1UWAA 2CPDA 1PAEX 2DCLA 2CDQA 2W8KA 3UQSA 2AJFE 4DS4A 4PRFA 1SQGA 5KT2A 4DCJB 3N6LA 2YKAA 2E7XA 3M05A 2J6SA 3OTCA 1FT8A 4URGA 3TVZA 3V6HA 3EVMA 2JLGA 3HHEA 4B3MJ 2YH0A 1RT5B 2DD8S 3AJ2A 4IOAQ 1JWWA 2DHHA 3KJFB 1YRUA 2X1GA 5D78A 4FYYB 4OJ1A 4UF4A 1WC6A 3PW4A 3W5ZA 4NZ6A 3CO0P 1JLEB 1CS4B 3LGNA 2FC9A 4TYBA 3OXFA 3ILOA 2JEIA 2KDOA 3CPWR 1C1BA 5JJBA 2HNZA 1U4BA 3U27A 4JUZA 2P8IA 1S1TA 3N28A 1CJUA 4BCAA 3J7Z5 2GGPB 1LQ9A 3RR7A 2WCXA 4ID5A 2HS4A 2X1BA 2Z0GA 4NLGA 5CH7B 1U6BA 1N5QA 4LBPA 5C5JA 1MROA 1WF2A 3M2UB 4NXMF 4F02A 1G1XA 1UP1A 3I32A 1ZZNA 4USHA 1VHFA 1FWKA 1AT1B 4OZLA 2PDAA 4NLXA 1PJ5A 5K5MA 1RB0A 3TO8A 2I38A 3CDBA 1HWLA 4G1PA 1TKDA 1NJIT 5CZXA 4K4WA 2YNFA 4ECQA 2ZVIA 3ZFVA 1NRKA 2WVCA 3NGTA 2NR0A 1FRIA 4DR4F 2RF2A 3HKWA 4AUKA 3N9UC 2OEKA 1GMWA 5D8HB 1F0XA 4QR1A 5HBMA 3D54A 3I5BA 4OZJA 3V4MA 4Z7CA 3H5YA 4B9SA 2C28A 3FFIB 1YWXA 4W92B 2QZ8A 4P2SA 4PXBA 4J9RA 1UTAA 1KQKA 3VGVA 4A8SA 2DR9A 5FDLB 2R7XA 3J81Y 1GEHA 2YPYA 3CSKA 4CZCA 2VQFJ 1NCLA 4A8WA 1U2CA 2HK2A 2ZH2A 1U48A 3PRBA 5CAAA 3IXQA 3M1VB 4JI3F 2XMAA 2OH2A 2BM0A 5K8MA 1U6ZA 1KQSR 1WTFA 2WSEC 3SI8A 1N88A 3D0HE 4CLUA 2DGUA 1ZM2A 1S9GA 3QGIA 1REGX 4OV6A 5KT4A 1TL4A 3DGPB 3MMCA 4MT1A 3MEEB 2J0XA 3QT5A 1JJCB 4F2RA 2PEHA 4BDPA 4WYLA 2YKQA 4C8KA 4NASA 3DLHA 2E9TA 1DJ0A 2YX4A 5DDPC 3M4XA 3R5BA 2HVIA 3EGNA 4ZVSB 1SJ3P 3WC2A 1TKTB 4O44B 4J9SA 1H6KX 2OAUA 1JLAB 2KL8A 2WB1D 3GONA 3BGRB 4ZVOB 3VAHA 1NK0A 1ITPA 1YJ7A 4DX8H 4PG5A 1E6VA 3AY0A 2MQOA 5IQ6A 4Y65A 4DV6F 4B02A 3J80U 2RU9A 1LWFB 2G0JA 2ROPA 3A8KA 2FHJD 4LF7J 3MR7A 1BQMB 4DV4J 4USMA 4EBEA 5HMXA 2JRSA 2O66A 3FC9A 1SC4B 2YKMB 3FK4A 5J1NA 5MAOA 4ECXA 3NNCA 4B17A 2QTWA 3FQKA 2UXBF 2CQ0A 1UAWA 3LW5C 1T05A 2WHOA 3EDQB 1LW0B 1RCXB 2L48A 2KXHA 3AA9A 3AJDA 5IWAF 3Q8PB 3KMSA 4JI4J 1KTVA 3EZ5A 2YTCA 2UUTA 3DLGB 4X66F 5KG5A 1LXNA 4K0KF 1GXTA 4LFBJ 3TJ9A 2WSCC 2RRNA 2Y0BB 2Z58B 2QA1A 4DPTA 1WACA 1ZM3A 2V0NA 4NX9A 4PG8A 5GVQA 2KRRA 3BYPA 1SI9A 4M94A 3IRXB 2DYAA 4NLUA 2GGPA 1P9QC 2BDPA 2DNOA 4DHVA 3OVBA 2ZWOA 3PACA 2HW3A 1PC5A 4DPOA 5JUMA 2BJ8A 2KHDA 1MMLA 2BJEA 3VZHA 3PX0A 2F5GA 4LR8A 3ZTRA 2K3KA 3ENQA 3TAQA 2IBKA 3BKUA 2Q66A 4YFUA 4ZA1A 4JI8F 4NA2A 4RNMA 1MU2B 3POTA 2D7SA 1WSRA 2LDIA 4WK1A 1VJWA 1VRTA 3GR0A 5HVGA 1VC5A 4CLPA 2XGPA 1JXEA 2K06A 3CIZA 4YHHJ 1HW8A 5F9NA 3W2WA 2X1FA 4KSEB 2JX2A 2PE8A 2YQ1A 4LQ9A 1U49A 1S12A 2KG0A 2DHAA 2W4DA 2XYPB 1TAQA 5KG7A 5KFEA 4NLQA 3X3UA 2AYGA 3SMZA 4E0DA 5BYQA 2DXDA 4M5NA 3VQSA 1FJEB 1UWBB 2DH9A 1QSYA 5DQHA 2UXBJ 2DGSA 1HHTP 2KJVA 3K2YA 5KAKA 4PG4A 5F9LA 5AXNA 4DQPA 4O3SA 1RBLA 2YWGA 2VFSA 1YRTA 2F65A 1B3TA 2QL9B 1LKZA 2DNQA 2KHCA 3CWJA 2CAJA 3BGOP 1E6YA 4ZVFA 2Q6BA 4P73A 5GAGU 3ZNUA 4IO9Q 1WC0A 3GB0A 2OTLS 1BQMA 2BQRA 3DM2A 2JLEA 5J2QB 2C3PA 1SQFA 4O3OA 3OTBA 3L3CA 3CIMA 1BWVA 2MKJA 1NDKA 2VDIA 3B82A 3HI9A 4ZCMA 3LAMA 1UA0A 2J7UA 2IC3A 1WOPA 4DL7A 2PD1A 2AYBA 4DR2J 2AD9A 3P4UB 1IKWA 2VUGA 3K89A 4Q7AA 1RWOB 2HS0A 4QR2A 3RR8A 2HIYA 2F4VF 4DR4J 1N0UA 2IDEA 4ED1A 4JI5F 2XQCA 3W8GA 3DGPA 2JEGA 2HWIA 5DZ7A 1N6QB 2UUCF 1KS2A 4N8NA 1RISA 2ASYA 3SQGA 5I42B 3HM9A 4KKOB 3K5PA 5HMZA 4Q0BA 4EWTA 1HNWF 2Q3PA 2QYCA 4PABA 3ETMA 3I55S 3PW5A 3EGVA 3DLLQ 3K8WA 4FXDA 1N5SA 1KRPA 2XO7A 1HNIB 1TL7A 3M1VA 1GQEA 4USKA 4CCHA 1HLWA 2MXYA 1JB0C 2UVUA 1EETA 3W2VB 1U25A 2KB2A 4OZ3A 2UUAJ 2YKNA 1VBKA 2EVZA 3HVWA 2XMWA 5LSOA 3C6UB 1FCAA 1SXLA 2B8QA 4DU8A 2VQEF 2C2RA 2L3MA 4MAKA 2EKNA 3GFZA 4U7UK 3U1NA 5D3GA 3MPVA 4USVA 3G9CA 1UWBA 1KC8T 3WC0A 4WF9Q 4IH5A 4PUOB 1H38A 4C9DA 1HI8A 2X51A 7FDRA 2BX6A 2QL7B 3OD2A 1VQ5S 3JSMA 2HVZA 2VG7A 4IFVB 3VAJA 1OY6A 3PO4A 2CIMA 3NG8A 4C0OC 1RHKB 3ZZ0A 1SB6A 1WI8A 1BE4A 2ATCB 4HVZA 4ICLA 2QLFB 3BSCA 1J5OA 5J2PA 3A8JA 1PIEA 3HZGA 4ER8A 2XY6A 1M5PC 4NYZA 3CDWA 2HBYB 4BC7A 1HBUB 4Q43A 4IDKB 1VQ8S 2MZTA 4F3QA 2C1EB 1H73A 1HBNB 2I8EA 1TV6B 5BYSA 1GXLA 1NJXA 1FJGF 2Y3YA 1HNZF 1I3OB 4H4MB 4B3RF 2I5JB 2VASA 4M5DA 4QPXA 5F8MA 2PI5A 2AMCB 4ZLPA 2RSQA 3QNWB 1S0MA 1L3KA 4ZIWA 2V2KA 1UVKA 2GQ2A 3TARA 2J8AA 1Q16B 4R8UB 4F0HA 1TL1A 1RWXB 3AQOA 4XAKA 1HBUA 3W9HA 4MH8A 2LA4A 4K50A 4DSKA 4M5MA 1BWEA 1KVIA 2FJDB 5DG9A 2LXIA 5I3QA 4IG3A 1KNZA 1OPZA 2HK3A 3G71S 2BKNA 1ZOTA 1U1PA 2YNHA 4C11A 3R1LA 1VBYA 1IBCB 2GFFA 2AW0A 2FZGB 1IR0A 2BE7D 2PFDA 4J5OA 1RA7A 3A3NB 3M6UA 3CF5Q 3EXYA 5THWA 4RJVA 2OJ3A 3JS9A 4ES1A 1AXQA 4DUZJ 2OPSB 2RD5C 5FD1A 3TEHB 4JV5J 1OSCA 2EBGA 4PQUA 2GIFA 1H7WA 4OI2A 5BJRA 1N33J 1Q7LB 3LH2S 2N4DA 1WUUA 2H4YB 1AZSB 2E5GA 4DQRA 2DGOA 2DIVA 3HFZB 3GZ7A 3BJYA 4U9RA 1JLCB 3RRGA 4Q8EA 1SL1A 5HP1A 2C3UA 2DNKA 5E3QA 4GO7X 3TANA 1RTIA 4JV5F 2BJDA 3SYZA 3MM5B 4X65F 3GLJA 3BBBA 3MEKA 4F50A 3TA1A 2B5JA 1EB0A 1M0SA 4L6V3 2PN6A 1AW0A 1JKHB 1RTDB 3MM8A 5U47A 4TQSA 3EDRB 1O51A 3ISZA 1RAOA 4RBTA 3W9IA 3PIOQ 3MR6A 2LP4A 2W24A 2WRMA 3ELHA 2VOOA 1AA1B 5I42A 1FX2A 1D0EA 3N01A 4P2MA 3K0JA 2LEPA 1WHXA 1U02A 2P6SA 4RNOA 4LRDA 5LT5A 2XNRA 2V6AA 4P7VA 1LOUA 3AXMA 3RTVA 5H9EK 4HTIA 1EKSA 1TL5A 2XI2A 4MKBA 2VFRA 2OLWA 2J7KA 3FBBA 5B0GA 2H51B 4QWEA 2QFJA 1SIZA 4O3PA 3PRDA 4J9PA 1GTEA 2HLUA 3NKYA 1T11A 4B9VA 4X4VA 2XNQA 1O6XA 5KFAA 1RACB 2MKIA 1S6OA 2DKOB 5E33A 3QRQA 4F25A 1VS3A 4CT9A 4JI1J 4DR7F 3I82A 2CG4A 3I0RA 4J9VA 5JVGQ 4TNOA 3TNVA 4GC7A 4FKYA 2BRLA 1F3FA 1V3RA 4URSA 3BGLA 4K4YA 4ZHRA 3NXZA 4IQMA 2XCAA 4I2QA 2MZSA 4LF4F 2RAQA 4DQIA 1FTRA 3I96A 2WBRA 1ZM4A 5ETLA 1SL2A 2B3TB 2F4FA 2RHQB 1YJVA 1F5CA 5A0YB 4OX8A 4LSLA 3NGDA 1EP4B 4KV8B 2IM0A 3O1LA 3BB5A 1OO0B 3WHIA 2IHR1 3TVKA 1FVQA 3MPYA 1WEYA 3PYEA 3TZWA 3J7A1 3J80Y 3GCWP 2ASJA 1HMVA 5LMUF 1P27B 4L76A 1UVLA 2VC1A 2J5AA 1DTQA 3ZNJ1 5HLFB 3I4PA 4UZCA 4RWWA 2G0CA 2K1RA 4J91A 4OJGA 4Q45A 2KVQE 5EN1A 1RTIB 1FD2A 1U09A 2R4FA 4U96A 2CPFA 1S76D 1AZSA 3DN9A 2VQEJ 2W2PP 3JSBA 1ZTWA 1FX4A 4C98A 2BKOA 3LP0A 4I2PB 2ZBQA 3J81j 1TMMA 1NDCA 2LEAA 4J9MA 3OT9A 3TZZA 2VH7A 5KT6A 1YBUA 4GMKA 2MJNA 4ZVTB 2CQ2A 1QAXA 1LWCA 3AOCA 4Z2XA 3HSJA 2CG8A 2LU2A 1ZZFA 3S1TA 3FBFA 4LRAA 5LM7E 3DMJB 2HGNA 1OYDA 2JSXA 5B0AA 2ZDOA 3B8HA 3IFEA 3KHHA 2AYMA 3FMBA 2KM8C 3UD4P 3PJXA 4TLRA 3MR5A 3K57A 3HULA 1V5IB 3HVTB 3C16B 1RAGB 4OJ3A 2V2VA 2EC0A 1NPPA 2OSRA 3PR4A 3ET6B 1BY9A 3MPUB 1WG1A 2CVIA 4FN5A 5CABA 3IAS9 2GW8A 1M5KC 3I0SB 3GR1A 4FYVB 1L5UA 3A1YG 3DMJA 1O8BA 1RLDA 2G2YA 4TLQA 3KXDA 3T1HJ 3TAPA 2O3DA 1YK9A 1R8AA 3GU0A 8ATCB 5F3ZA 2UV8G 1T03A 3W66A 2NUUG 2XCPA 3OR2A 2CADA 3M8SA 1Z2ZA 4TVAB 3KG4A 3HHNB 2PT0A 3E01A 3MEGB 3H59A 4IDKA 4Y2MA 3GG1A 4J7CA 4H4KC 1W7WA 4I2PA 4HL9A 2UVRA 1H72C 4WTYA 3MEDA 2VBZA 1MLAA 2UUBF 2XSJB 1SUQB 4YB6A 4DV2F 2VPZB 5J1EB 4L75A 4CO2A 3VAFA 5IZHA 4K4TA 3MAAA 3PY8A 4W90B 3RZAA 1NH7A 4RU2A 4NPOA 2M52A 2KU7A 4C97A 3N0VA 4Y0FA 4CM2A 2AF6A 5KOWA 2JNJA 1GX6A 1RE1B 1WHYA 1WOOA 2OKQA 5LOQA 2GHWA 4DUZF 3FEYB 4LIWA 2DJWA 4DJBA 3QSIA 4C0HA 2IIHA 3EUNA 4C6AA 2IMOA 1PYSB 3OFHA 5EWFA 3VGSA 3Q8QB 4I0WA 3MMAA 3W7BA 1N36J 2YKOA 3W2VA 3CCLS 3A13A 2R7QA 2FLLA 3AT1B 2VG6B 2C42A 3HHLC 1LW2B 4UOFA 2E29A 5LSRA 2LMIA 2IVMA 4B9LA 1D1UA 4USUA 2W8LA 1YZ6A 4KHPF 4FKXA 3SDEB 2UXDF 4XPEA 4Q0BB 3HF5A 3HX9A 3WQPA 4RU9A 2UVWA 3SQGB 2IJNA 3H90A 3M8QB 2N7CA 3C2PA 4X66J 4DSEA 2OFHX 4GKJF 2D69A 4P7TA 2IYIA 3IO1A 1D9DA 4MKVA 3DRPA 4IRKA 2HVEA 1R3NA 1YLXA 4PAAA 1HR0F 2C2ZB 3G6XA 3CMES 5IT9U 2ZJRQ 1PAUB 4X64J 3HK2A 1UEUA 5D4LA 4ZJOA 3RU0A 2DNHA 3NCRA 3CEDA 4NMLA 3THTA 3UD5A 1FESA 1HWIA 5MLCV 2KTQA 1LWEA 2YQ0A 1RTJB 4N8OA 4B9NA 3NNHA 5ITHA 2QEXS 4IRDA 3WX8A 5SZTA 4O4GB 5D0HA 1RT1A 1SJFA 3GCXP 3CC7S 2PO4A 4RW6B 2AJ4A 2KXFA 1PC4A 2G13A 2V5HG 4HHJA 4DR1F 3RRHA 2DIUA 3PR5B 3BDEA 1RAHB 4TU7A 4CLFA 4ZVUB 5HP1B 1RAIB 2AEFA 2A1BA 4DZDA 3UVJB 1Q79A 1IQTA 2Q1LA 3OHBA 4NLWA 1TZ0A 2W9BB 2DEIA 3HVTA 4WZQA 2KJWA 1APSA 3D67A 1VOMA 4JYAJ 3KWMA 2WVEA 1VK3A 1N5YB 2VV5A 5IV4A 1V9OA 3KG0A 4C7QA 3OV7A 5L38A 2D3O1 1K73T 3QT6A 2HAFA 2KVIA 4LT6A 1ZA1B 2DNYA 3HHKA 4RW9A 4C3MA 3G6ES 1N48A 4HYKA 1NSPA 3KK3B 3Q8SB 1YBTA 2HHPA 5E5NA 4WXOA 3ZTQA 4HEA9 3D1OA 3M9NB 2B51A 1REVB 5DG8A 4DPXA 1H2VZ 2V8DA 1CJVB 2A3JA 3MWBA 4GO5X 4I64A 3P6YC 2CPEA 4K59A 3UNYA 4NLSA 5IQQA 1FWLA 1MU2A 2WTFA 5I3UA 3TA0A 3P5TL 3FVYA 4NLTA 3SQOP 1F5AA 1S77D 3IWNC 2DR6A 2WB4A 3DRSA 2GHPA 1S1UB 2BKPA 4K5SA 1YHQS 1XR6A 4LFBF 4AXIA 4RR5A 1S49A 2P6TA 3M7VA 4F36A 3UPFA 1M1KT 2LU1A 2YX7A 1T9XA 3IRXA 3CJQA 1R8BA 2I5JA 4M5DB 4EZ9A 1S4EA 5KFQA 2V4JB 1WHVA 3RG6A 3KLEA 2V63A 2MKSA 5BYRA 3C14A 5KFHA 1HWUA 4ZPCA 3IWLA 1VISA 1WKJA 1RADB 2FTRA 1Y3KA 4DUYJ 4ED6A 4I6AA 1ULRA 2J9DA 4LF1A 3LGMA 2ZZNA 1CPZA 4ES3A 2VIHA 1YJNS 4P9SA 1I94F 4KO0B 4WWSA 5B09A 1UFLA 1NKCA 4NEZA 4JV0A 3CCRS 2YKMA 1WC3A 2MGZA 2V9WA 4E8UA 4F04B 3WX4A 2HMIB 2ZOMA 4DUYF 3DYAB 3IGNA 1RLCL 4X4SA 3TZYA 3T1HF 1DQ8A 4N5SA 4QCLA 4X4PA 2M88A 3BO4A 3J7YU 3PEHA 3PXGa 3UNGC 2DB1A 5HATA 3BGRA 2O1PA 2W4CA 4ZPWR 4WE1A 4RWXA 1KVKA 4YEAA 4JI0J 2DNMA 3FKBA 4GVBB 1SV5B 5HSPA 2UXCJ 4ITSA 2RDIA 3AXKA 2B9WA 3DOMB 4PXDA 3V4IA 2CPXA 2HGLA 2CQBA 2AEJA 3MECA 3QQCD 4WBFA 3Q0AA 1OYEA 2R8IA 1M1HA 3MM9A 1UVIA 1DARA 4I7FA 3AJ1A 3EX7B 1P9YA 2D3ZA 3AAWB 4U7UD 2CJKA 2E5JA 2BOAA 2A6MA 2BR0A 2H54B 1HBMB 4PXEA 2R8HA 3T6JA 5KFCA 3KKFA 3MM5A 5SUHA 3UD3P 4HT7A 1N5TA 3MAAB 5EDWA 4ANEA 2IPOB 4OX9F 2OPQA 4K5RA 3UN3A 1RYSA 4RBUA 2J7WA 5HJXA 3CCUS 2DGTA 1NNDA 1HNVA 3UO0A 3QJJA 3LQVA 4ZK7M 3TX8A 4M5GA 3GIIA 1CQNA 4QPTA 2C2DA 1KOHA 2OD4A 2X3GA 3H5XA 3GE9A 1WKKA 3OR2B 3OHAA 3BO3A 5DLFA 5KFNA 3F41A 2XWYA 1UVNA 3D2WA 4PWDB 1YX2A 1GK8A 7FD1A 2QG9B 1N32J 1TQLA 2XBPA 2Y8WA 4NMXA 3QWPA 3HFKA 3KLIA 1SVDA 1FKPA 2JWNA 4KGMA 1S7HA 2IM1A 2MLXA 1HR0J 1VCTA 1NHUA 3KUEA 1RT6B 2HHXA 3DDNA 3N5BA 5BXIA 3CCWA 4RX6A 4R0JA 2CJXB 1S1WA 3CO9A 4ZVGA 1S1VA 2J8SA 1QD1A 2QN6B 2V4RA 1VQMS 2ZM6F 2AGOA 2F9JA 3IR5B 1K8AT 5HROA 1RHJB 4ID5B 2CJQA 2DHSA 3M32A 3Q89A 3QMQA 4D3GA 3VALA 4KHPJ 2XMKA 3ISND 1XIQA 3GG0A 2HIQA 3GMGA 3EGZA 4QYZK 2NXEA 2BBEA 3HHLA 3BBCA 3D9BA 1DAXA 4LR9A 1RXOB 3MTKA 5I3UB 3BV8A 2DT9A 4DR2F 3T1YF 1CS4A 1TKZA 2M70A 4NZ7A 4YUDA 1S4FA 3MM6B 2RU3A 3TUZC 5DG7A 3DNCA 5KFKA 3U02A 2I0XA 1YJ9S 4K4SA 3QPIA 1IJFB 2HS3A 3H42A 3TR5A 3OBIA 4I1TA 4ZCKA 2W9CB 3QO9A 2GNKA 1IBLJ 3NCQA 4C3KA 3QYYA 5G0RB 5IT4A 1CULB 2N7YA 1S0VA 4JI4F 1U1NA 2ZD1B 1D9AA 2EFQA 1HHQA 1QSSA 4WZMA 4OYWA 1VIOA 2RQMA 2FJXA 3LP2A 4OL8A 3VAGA 2HWTA 4Y28C 2XZWA 2XS7A 1SKUB 5K8NA 2V8GA 2HNYB 1EP4A 1RGVA 1FE4A 2CQHA 2CRLA 3RW7A 4ES2A 3NEKA 4Y00A 4EUVA 1LV5A 1RBOB 2IVYA 1CEZA 1R31A 5K8OA 2XHCA 3EM1A 1WELA 3IWXA 2DXFA 3JYTA 3I87A 1HNIA 3NAHA 4OYBA 5AE3A 4RNNA 1NAQA 1U26A 4ELUA 4K2XA 2E1CA 1YJTA 3Q8YA 2BE2A 1M1GA 2A2DA 2RJZA 4IO1A 4WU3A 1R0BG 2KRBA 2W7AA 1S6QA 2W2MP 3IM8A 3OUYB 2QMXA 1VQNS 2C2MB 1AFJA 2KM8B 3CTRA 2J6UA 1SQEA 3CE8A 4O44A 3W5XA 5DM7Q 2ALZA 3LP1B 4W98A 5D4OA 2E5HA 1Y9OA 4CM0A 3CJKB 5BR8F 4JI6J 1RU2A 4HT5A 4B9MA 2CA9A 4DV1F 3DRPB 8AT1B 1QLNA 1IBMJ 5JXSA 3GV7B 4DCPB 1F2GA 5L8RC 2RILA 3US5A 3EICA 1S6QB 4WFYA 3HP6A 3H25A 2BE2B 2KKHA 4I6YA 4KE5A 4UW2A 5E3RA 3QZ8A 3C8YA 4N41A 3SDEA 4CNYA 1T3NA 2ABYA 2O01C 3B54A 3D28A 3OSNA 2D74B 3MI7X 5KG4A 3W9JA 2B5JB 2OMLA 2ASLA 3OQ2A 4NCBA 2LYVA 4LBIA 2HZCA 3B4DA 2V9KA 1IWAA 3DOMA 1XNRJ 4C3LA 1NZ8A 4FXWA 3MDFA 3PNIA 1ZAWA 1FKOA 3AHPA 4X4QA 3TJAA 4EO6A 2R7SA 2R2TA 3KJNB 3OSPA 1Q7YT 5D0RA 4PQUB 1QTMA 5KFIA 4P71A 3AODA 4IOCQ 3RW6A 5IOLA 3PO5A 5LMUJ 4Q8FA 3G8QA 1GH8A 4ALZA 2V94A 5HBMB 1IXKA 3F56A 5EWEA 4J9OA 2G2ZA 5DQIA 2FDNA 4DR3J 4KFBA 3T5LA 3M2RA 3UR0A 2EK6A 2IRUA 2FVQA 1P1TA 1OS5A 3DRYA 4E2FB 4O0IA 4H54A 2GAGC 2OEJA 1QVGR 4IG3B 3NRBA 1RTHA 1NSQA 4LIRA 3CUNA 3OL7A 4DF8A 3MM6A 2DH7A 2EC2A 2EKYA 3AB2B 3GIJA 3OW2R 2QRRA 3UCGA 2RNEA 5ETNA 4YS2A 4JV2A 3DLJA 2HVHA 3KHGA 3Q83A 4QWAA 3K59A 1U0SA 1RYRA 4QW8A 1K0VA 1HQUA 2DITA 2ACMA 1BHNA 2U2FA 3DHXA 3ZTSA 3S01A 4HH1A 2R9LA 3I6PA 1UVJA 5HROB 1OY9A 1VRQC 2F4VJ 1HBNA 1UJ6A 2EFOA 3R7BB 3DU6A 3BQ1A 4EYIB 2YWKA 3JTOA 2MHEA 2GCFA 1VQ7S 3D6TB 4WU2A 1JMTA 2ACYA 3MD3A 3C16A 1WG5A 4CYUB 3HMJG 4WTOB 3W8PA 2B9YA 2K2PA 4YOEA 3OFEA 1BQNB 2GMHA 3CJ2A 3P49B 1REVA 5AE1A 4OJHA 4U67Q 3CCMS 3P8BB 1NB7A 1R43A 3J7AN 2DH8A 4OX9J 2FLOA 3M6WA 3CCZA 2VFTA 2O67A 3PG9A 1GXUA 2VODA 5DRKA 2VU5A 1H2TZ 2CUYA 4JB8B 3D7SB 3NMRA 4JI7J 1RU1A 5T14A 3ADAC 4IH7A 1RDRA 1ZS6A 4USTA 5H9EJ 2ERRA 5J2NA 4DI6A 1I51B 2N3LA 4PXCA 4UUWA 3QRPA 3BQ0A 1VJQA 1VHIA 3C6UA 2PMWA 1OWXA 2AZ3A 3O2IA 4PYDA 4IFYA 4G65A 5KFVA 1QM9A 1FKOB 4JI1F 1HPZB 4UY85 2CPYA 4DR7J 2OPQB 3G6VA 4PEOA 2Z2MA 3RJMB 2F40A 5DLGA 5DJBA 3ETOA 2BVZA 1C0UB 5E3AA 3TRGA 4E98A 1AFIA 1IKVA 5B08A 2DNLA 3VAMA 2RQCA 3C46A 2LFVA 5KG1A 2YWEA 5KFXA 1DTQB 3B78A 3R7SB 1RT1B 1DTTB 4QZVB 3RUBL 1FRLA 5GADU 2KG1A 2XGQA 1Q82T 1NK6A 1OY8A 2NXJA 2J76E 2ROEA 3MGJA 4C8LA 1RUSA 1RWMB 2VA3A 3V4IB 4OZ1A 1UMJA 3BREA 5DM6Q 1IKWB 3HDSA 2BRKA 5A0YA 2DTJA 4K7QA 3QRRA 2OSQA 2VPYB 2ZBPA 3EWGA 3MXHP 1KFDA 4U8YA 2I1RA 5B0BA 3PIPQ 1L3VA 2DVIA 4Q5VA 1WNEA 3E2EA 1N32F 1S9FA 1RT4B 1HWJA 1X5TA 2G2OA 4WYWA 3MPDA 3JQKA 5F3TA 3TX0A 3ISNC 2HQDA 2N3OA 1NPKA 1FNMA 1RA6A 4QYZJ 2HLTA 1QAYA 4ETZA 1SH3A 3CJTA 5J2QA 1NK4A 3V81B 1S79A 2BJ3A 1IQZA 1RKJA 1NH8A 2XS2A 2ZITA 3KDOA 5C25B 3NCPA 2UU9J 4TN2A 2KZZA 2IAJB 3TOQA 2QFIA 1YVFA 2LEBA 2QSWA 4EFAC 1FJGJ 4P74A 4QU6A 1IR1A 1X5SA 3VWSA 4CIOA 1T8EA 5C24B 1N54B 2OHDA 3RBZA 2B8PA 1Z2LA 2KT3A 2HURA 2QT7A 3FSYA 4B3TF 3NMAA 4QIFA 4ED8A 3HXMA 2B9EA 2GA7A 2FGOA 4TXSA 1IBLF 2BABA 3M6VA 3N79A 3NBPB 4ZMMA 3TI0A 1MROB 1XR7A 3VF0B 1N34F 1FI4A 1EQMA 2V34A 2M9KA 5ADZA 1ZYQA 2BXJA 2ZKTA 4QIVA 5GAHI 3RRKA 2FUG9 2H4WB 4C8ZA 3MFIA 5A8KB 3PRVA 2AJ1A 3R27A 3DRSB 4KBIA 4QIEA 4XDCA 2VICA 4FF4A 2XTJP 1URNA 2OFGX 4CRJA 1SKSA 2DR5A 3IMQJ 2R3VA 3FSXA 3TUJC 3VHQA 4KRWA 4Y3CA 3I56S 4C8YA 1X4CA 2V50A 5H9FJ 9ATCB 1RT7B 2PGCA 3HPOA 1T94A 3I9ZA 1TKZB 2BJ7A 3PJWA 1IN0A 1W2IA 1U0HB 3G86A 4DFJA 2C2OB 5AXKA 4RUAA 3G2XA 1RT5A 1B99A 4DV0J 2E5LJ 3Q86A 4J9QA 2EFGA 1U2RA 1X0PA 4MJKA 5GADI 2HGMA 2MZJA 5KFUA 3MUVP 4UOHA 1B70B 4TYAA 2JC0A 3DLGA 1G6BA 4NL5A 4ZCLA 2AGPA 1YJWS 3SSRA 4YMEA 4TKTA 4OMFG 5KFOA 3P96A 4B08A 4M95A 1RT6A 3N6MA 1T9UA 2HBZB 3NGUA 5L9NA 1MSWD 1TL1B 2IRXA 4KGVB 4AFFA 4CQ1A 1FKPB 1ZM9A 3JTPA 3IBFB 3KLIB 2P5VA 4R5PB 1LEOA 3IC1A 3FGVA 2DGWA 3MURP 1WC1A 5HI7A 4H4MA 2HFZA 3MM7B 4EU0A 1LWFA 1F1BB 3OL8A 4IQXA 1LWEB 4Y6IA 3QSYB 2J0QD 3AFGA 5KT3A 3H0PA 2FHMA 4V1Ak 5CYMA 1VQ4S 1F5BA 5D4NA 4PR6A 2WOMB 5KFGA 2XM3A 4HI2A 1D3WA 2EWHA 3W64A 3PKYA 2PA3A 3CW2C 1A7GE 2GVDA 2L9DA 1YDLA 3H7HB 1RHUB 4K4XA 4ICLB 2Z56B 4F8RA 3N5FA 2ZH4A 2Q79A 3DGVA 3IS9B 4C2MA 4NYPA 3VCDA 3JSMB 2E5LF 1FA0A 5HLFA 2FVCA 5AJ3F 4LFCJ 5EUHA 1HARA 3V2UC 1Q95G 4JI6F 5BR8J 1QAJA 4C8NA 2XY5A 3ZZYA 2GX8A 4G1IA 1K0TA 1QY7A 3LPEA 4LFAJ 2RQ4A 1NHKL 2K8GA 2RDDA 3F44A 3K5OA 2ZH7A 3SEOA 4NCGB 2B6AA 2LQJA 5KG6A 1VQPS 1IBKJ 4DG1A 4YHHF 1PJ6A 2KYXA 4LSLB 3B6BA 3G82A 2YNIA 1SV5A 1SPBP 1SC3B 2F9DA 2JOQA 3NLCA 3R6GB 4DL0C 4UOGA 2AWZA 5HN0A 2VHGA 1X4DA 5KFRA 1Q86T 4DG1B 4A8OA 4WE1B 2M3DA 4QWBA 1R0AB 4O0NA 1Q8LA 5AXMA 3K5LA 1XNQJ 1RHMB 4OX6A 1U1KA 3EZUA 3IRWP 1TU0B 3SV4A 4X4UA 2JEFA 2RS2A 4ZS6A 1N5VA 2R2SA 4QQBA 2BJ1A 4DU7A 2DEJA 4OYOA 4B9UA 3BF4A 4IH6A 3IG1B 3THPA 2HFNA 3BPSP 4CO3A 4JYAF 4WCEQ 4FNHA 4GVLA 3R5GA 2PMZD 3IS9A 2MGZB 1Z1ZA 1TK0A 4M5IA 4L74A 2IA6A 1IKYB 3BYRA 1R6YA 2AX0A 4J9LA 5ETOA 3JSYA 2QYGA 3R5AA 4OLOA 3QIDA 3DRXA 5E7OB 3MEDB 1J2VA 1DY3A 5CYMB 1MN7A 4YN3B 4ED5A 4Y2CA 2A0FB 3KLVA 3DLKB 4WP3A 3ULHA 2JFDA 2RUGA 2AX1A 2BM1A 2V4JA 4ZP9A 3UCZP 1FERA 2AIRB 2BV3A 5ETPA 1DTTA 3BSOA 3PX4A 3RGIA 3DM2B 1RWKB 1JKHA 1RTDA 1EX8A 2ILZA 1JLBB 3DHWC 3L95X 3MM8B 3EPGA 1Y3JA 2HRTA 3FZ2A 4H4OB 5GMDA 3LWMA 1D9FA 3PFEA 4RW4B 3HT0A 2HNZB 2NPIA 2RH3A 2W25A 1WI6A 2OPRB 3LGHA 3NS5A 3HVRA 2MDAA 4ATNA 2XB2D 2R7OA 4OI0A 2XC9A 4KIAA 2CWKA 5D0EA 4DN0A 2R8GA 3LWLA 1T9VA 3HZEA 4OHVA 2VOPA 2JH3A 2MYFA 2OPSA 2KN4A 4BWJA 3G96A 4BS2A 2JC1A 3R9LA 2LKZA 4C48A 3M8RA 4A8FA 1DLOB 3NP5A 3TAMA 1LK5A 1FRJA 1T95A 4A8QA 4FF2A 1R0CB 1V3SA 1R8PA 2CNOB 1HNXF 2YWFA 3LANA 3ZZUA 3KLHB 2M8HA 2V67A 4ELVA 3Q2TC 1M5HA 3T1AA 3QO9B 2YNHB 2QLJB 1U1RA 3HCXA 4KPCA 1VRTB 2FZCB 5LMNF 3FRYA 5LSLA 1NK7A 1TAUA 5KFZA 1N4LA 1LXJA 2D9OA 4DSLA 2ZEJA 4V19X 2NQPA 2XMUA 2K3IA 2BUNA 3L09A 4O3QA 3OVAA 1R8HA 1T3OA 4DV5J 1UW9A 4R0EA 4N77A 4M5HA 1UPPA 4RL1A 4A8XA 2MJUA 1QJHA 1K1QA 1QUPA 1VRUB 2JVRA 2RT3A 4Q2LA 3CDUA 1FD8A 4KGKA 3D0IE 3H40A 4DV5F 3OTOF 4NCAA 4HHUA 4MK9A 1B0VA 1RTZA 4NA3A 1U1OA 2DRAA 1RTJA 4ECZA 1Q8BA 2YNGA 2BZ2A 1R6VA 4P2XA 3T1YJ 2IM2A 1NJWA 1WC5A 2HKEA 1JLFB 2C3YA 2XMJA 4LR7A 1UETA 2Z8QA 2GO8A 1BD6A 4ECVA 3OLBA 3MAHA 4KR0B 2QIFA 3PX6A 4ZIVA 3CJ3A 2ZH9A 3EVOA 4FDFA 1DBDA 1LW0A 2YWHA 3M8YA 1FJCA 1WF0A 1I5OB 1BMQB 1CJKA 1HA1A 1Q4RA 3T9NA 3D3CJ 2LA6A 1FNOA 3OLAA 4NXMJ 2CQ3A 1FXLA 4NZ0A 3EPIA 2A10A 4KFBB 1UKUA 3A3PB 4IFVA 1MG7A 3D6HB 5L9XA 4DL2A 3H4DA 2XEXA 4CLKA 4DV0F 4UY8T 4EBCA 1SBRA 2VQFF 1HQEB 1ZPVA 2OMOA 1LNQA 1S5ZA 1UCNA 5EGYA 4IRCA 3C3LA 3H5SA 3KK2B 3BSAA 4IUFA 1I1GA 5KFTA 4F4WA 2BANA 3OR1B 3BSNA 1YIJS 3QLHA 1LFPA 1TMJA 2R2UA 2IJRA 1NSKL 2YKPA 3HD2A 4M5KA 5IM0B 1CVJA 1FTCA 2VG6A 3CCTA 1Y7PA 3T41A 4YR3A 1IR2A 1Y5IB 2E1PA 3ZZRA 1TUVA 3JB9k 1JJ2R 3G82B 4WJBA 4NLPA 4BWMA 4DX5A 4ED0A 3N4WA 5HVHA 1J5EF 3CT9A 1BXNA 4X62F 3KUHA 4P72A 1NZAA 2H3EB 4FVCA 4PQAA 3CCVS 2GJ2A 1DURA 2M0GB 4LVNP 4DS5A 1N33F 4OIXA 1RT3B 3H98A 1M5VC 2HHSA 2ADBA 1RWVB 1TK5A 4I7FB 2HRYA 3H4BA 5K14A 5KFLA 2RB7A 1IKVB 1GMVA 1RWUA 2FGCA 2JVOA 2VF3A 2WW8A 3BPDA 3KFWX 3MZIA 3MOJB 2MY8A 4MTPA 4DMZA 1XNRF 3PM9A 4IG0B 4Q44A 2QA4G 4F0MA 4ECWA 2JJ4D 3CJKA 2VC0A 5K9FA 1FHTA 3HSGA 1R89A 4RW8A 4CLLA 3CVKA 1T02A 2E5IA 2FHOB 2LQBA 2H48B 4EBDA 3OUYA 4DDFA 1J5EJ 1GFWB 4K8RA 3V6KA 3KK2A 2Z2ZA 4NE9C 4YY3F 4DXLA 2P2CB 2MQ8A 4WFXA 5H9FK 1RAAB 5CCLA 4FF3A 3DYAA 3O6QA 1VQOS 1J27A 4DX7A 1ZBTA 3CCJS 3RB3A 3M8ZA 4YY3J 4C11B 1PYOB 1TKXA 1K47A 1XMOJ 1XTZA 2MY7A 4WKRA 2YNFB 4YB1P 1FNXH 1X5OA 4TY9A 4KH1B 2LDYA 4HR2A 1NM2A 4QJVA 1QSLA 3JTNA 4OZ5A 3KJVB 1AYEA 4ZPAA 1H3DA 3CB4A 4J9UE 4IR1A 1Q5YA 4EEYA 2E1MC 3A3OB 5E0OA 1KBRA 1B7YB 4O3RA 4LVOP 3SZ2A 3T19A 2ZVSA 2DO0A 1RHQB 2DY9A 4DR3F 4FYDA 1S6UA 2YH1A 2VJUA 1WSVA 1C1BB 3LA0A 3EGWB 1NMEB 1Q8IA 1RTHB 2BQUA 4DL6A 5LXRA 3P45B 1CJVA 4MYUA 4NOHA 4QOTA 4YDXA 5L1KA 2N4CA 3GIKA 4UOCA 2DPJA 3GYXB 3M2RB 4CP5A 1L3UA 5A8KA 5KT5A 5D4PA 1VC6A 1EQ0A 2FIUA 1OJ4A 1XMQF 2IDLA 3BH7B 3HSDA 3UN2A 2Y8YA 2BYCA 1EIYB 5IC4B 4LF4J 4FVMA 1S57A 2DNRA 1S1VB 3KMQA 1U8SA 2V2ZA 3TJ8A 2Y9HA 2XLKA 3AA8A 1XK8A 3QFWA 2NSBA 3I9V9 4ID8A 1UEVA 2ZH1A 5KFYA 4QWDA 3DU5A 5HK4A 2W4PA 3ITHB 1S6PB 5F8JA 3T6BA 4GKKF 4H4OA 1TL7B 2NYHA 4UZBA 4I2QB 4QU7A 2PI4A 2CQPA 3UWTA 4UQTA 3V81A 2MSSA 2Q43A 3PVXA 2JEJA 3BEGB 2FQQB 1A0OB 4ZLNA 3GIMA 4LF6F 4WPAA 3I0RB 2KT5A 4CH0S 3PHTA 1WORA 4WIQA 1L3TA 1SC1B 3W61A 2B4UA 3DFEA 3TVYA 4ECUA 4A8MP 3FJ2A 1PKUA 3GV5B 1FJ7A 3UE2A 1KLMA 2ALYB 3VTIA 5AJ3J 5I4MA 2RRBA 1XJWB 2K7KA 4C4WA 1YI2S 1JNRB 2NCKL 2YY3A 4F4KA 3EZOA 4S0MA 4LMZA 2RKIB 5DZ6A 1P8GA 2G9OA 3MEEA 1HNZJ 1HBMA 2CNNB 5K14B 3JAMU 5GAHU 3M8QA 1NHVA 1VIXA 1Q8KA 2YQ3A 3GJSB 5I3PA 1F9HA 4DV2J 2RS8A 4OYZA 4QWCA 3MCMA 3TA2A 2R7RA 3VVUA 2XHWA 3BO2A 2KYZA 3M2VA 2GJFA 2R8KA 2ZC3A 4NLRA 5HANA 2CZ4A 5HMYA 1SJRA 4C0BA 4CTAB 2NREA 3WZ0A 3JYTB 1YG0A 1RWNB 1C0UA 4N47A 1AUSL 1TR0A 1E6YB 2V2QA 4AYBD 5LJ5Y 4F3OA 3U7JA 4HTJA 4GVBA 4A48A 3M30B 4RW7A 1JLCA 3PV8A 1U8WA 2LXUA 3MMAB 2IJFA 3NGRA 1UVMA 2RQKA 3LO3A 1ZH5A 4Z37A 1WEXA 3E8OA 2EFPA 2UP1A 4ZJQA 2VKZG 1FRHA 2VBXA 1TP7A 4PG7A 3QJPA 5J2NB 3KLGA 3HLUA 1NDPA 1G3OA 2ZFHA 3A12A 4X4TA 3C15A 4LSZB 4RO0A 2V8VA 3N6NA 2EXUA 2VDHA 1S10A 2HMIA 4KJIA 3CD0A 2X3DA 1R7IA 1IUJA 4A46A 2XWXA 4KO0A 5KG3A 2MKCA 3VGTA 1S0NA 1NU4A 2GVDB 4CYUA 4LSNA 5HAOA 2W2NP 2R7VA 1Q0NA 2VA2A 4U6PA 2E1RA 3VAIA 2G1HA 2AU0A 4OZ0A 1NK5A 2CNLB
chains in the Genus database with same CATH topology
3T3FA 3CJ0A 3MMJA 1F60B 5DDQC 4FF1A 4EO8A 1HQUB 1U24A 1KFSA 1B0TA 3M32B 3CGIA 2VKRA 3R5CA 2ZHBA 1S9EA 1TV6A 4I68A 4Y2AA 3LAKA 1Y00A 1ZAXA 4A47A 1GNKA 4YDDB 5FLXY 3DRRA 2GO9A 5DQGA 4TU8A 1X8DA 2JFKA 1QVFR 5DO2A 4B3OB 5B0EA 5B0CA 3FZBA 3BGUA 3FRZA 3TP2A 5KT7A 2QA2A 1UJ4A 4ED7A 1YITS 5T7LB 5KFJA 2J0WA 2XULA 3GFYA 3T5JA 4RW9B 1DLOA 2V8HA 2Y0SD 4KHRA 4ETXA 4I67A 2DO4A 3CCQS 4HLBA 1SKWA 3OXGA 2LECA 5F8NA 2WSFC 1N5YA 4OX7A 2QV6A 1JLAA 4FP9A 4RW8B 3MHYA 1LK7A 3KNGA 1VQYA 4TU9A 2NPFA 2RRAA 3MR2A 3Q24A 4DF4A 3J7ZT 4DV3F 2B4OA 1NKEA 4I69A 2J9CA 1IBMF 5DDOC 3PFOA 4DL4A 3IGVA 4BHQA 2HAIA 1R8CA 1Z4UA 1S9GB 1SJ4P 1YQHA 1RT3A 2AP6A 2ROGA 2MQMA 1G7CB 3DLKA 5HL7Q 3PEJA 1CSJA 4ECSA 2LCWA 1UW4A 1CLFA 1IBKF 4M1KA 3LP1A 1X5PA 1FVSA 2EI5A 2GIRA 4DV4F 2ATLA 4RNFA 2ZJPQ 3FCHA 2IFXA 1SJ1A 2HHWA 3OR1A 1BLUA 2P9CA 2CPZA 2E66A 5KFMA 2FLNA 2HG4A 1AROP 3L7PA 5F8GA 3DOLA 4DV7F 4DR6F 1MWYA 3CD7A 2KFNA 3PDNA 1HYSA 3OL6A 2IYGA 4FS1A 1S48A 3K5NA 3HVAA 3KOAA 4ZCIA 4ZP7A 1S6PA 3ITHA 3O44A 2UV8A 2UUWA 5A2QY 2EBEA 1S1XB 2Z4PA 2HNYA 1S97A 5DS7A 1JX4A 2DNNA 4C8MA 3TUIC 5F0UA 2ZE2A 2ILYA 3K8VA 4PPZA 4Y2IA 3M2UA 1V6HA 1YGYA 3PW0A 1ZETA 3GFHA 4OZNA 1VQSA 4ZPTR 2P9EA 2RDJA 5A8RB 5J2MB 4ZPVR 1NJZA 6FD1A 4J9KA 5HMWA 1B64A 1CC8A 5DETA 4A8KA 2XSJA 3CD6S 2J9DE 3V6JA 4DFKA 5CXTA 4F2SA 3P3DA 3U1MA 3BN4A 4PPDA 5AXLA 4PKDB 4N76A 3WDOA 5JVHQ 3I5CA 2HHTA 3MEGA 3E01B 2H9ZA 5F8HA 1CC7A 4USJC 1O5JA 2QSFA 2EFVA 4MK8A 1N8RT 2QO3A 4USIA 4XPCA 3TAMB 3GWCA 2CZVC 2ZC4A 1SH0A 1RI7A 4OFZA 1B0PA 4ED8A 4DSJA 1YJUA 2M2BA 2VONA 3C6TB 1RJJA 5KFBA 4HI1A 2DR8A 1S1WB 2MMYA 1FKAF 5IXUA 2HNDA 5A6WA 2NXUA 3DRRB 2MB0B 3EYZA 2F8EX 3D5MA 3CC4S 4R8UA 4OHXA 5CQGA 1KD1T 1S9EB 4FZVA 2L9WA 5H1SV 1A9NB 2FPHX 1K9MT 3R3TA 1UFWA 2VBWA 4G6VB 2NSCA 1U1QA 2UU9F 3PZPA 4CI0B 1C2PA 3AQPA 3CDEA 2UZAA 3C66A 4Y2KA 5LL6d 4KT0C 1TKTA 4DL3A 2ZHAA