3NNCA

Crystal structure of cugbp1 rrm1/2-rna complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
175
structure length
175
Chain Sequence
b'SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUGBP Elav-like family member 1
publication title Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 46
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nncA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nncA02
3Q2SC 3R1HA 2PE8A 1N8RT 1IQTA 1VQ4S 3CC2S 4Z2XA 1X4FA 3FEXB 3LQVA 2PEHA 3P5TL 2DH7A 2VOPA 1WHYA 1K9MT 3PIOQ 4QU7A 3FEYB 2D9OA 1ZZNA 3P49B 2DNRA 3RW6A 3OW2R 2KU7A 5D78A 3SXLA 3VAGA 2DGWA 1A7GE 2RS2A 4TU7A 1X5PA 1JJ4A 5DDQC 2KXFA 3R27A 2J0QD 5CXTA 2KN4A 2XB2D 1WG1A 2DGOA 1YHQS 3BS9A 3P3DA 4WCEQ 1N88A 2JX2A 1Q86T 3NMRA 1U6FA 1X4HA 2DGXA 2LMIA 5FJ4A 5DDRC 1U1PA 2UP1A 3ZZYA 4P6QA 1CVJA 2M52A 3B4MA 2FPHX 1NO8A 2DB1A 3NS6A 3G4SS 2MKKA 4IOAQ 1X5TA 4J5OA 1HD1A 1FT8A 2RUGA 2MB0B 4TLQA 2B0GA 1VQMS 1H2TZ 5GADU 2DNKA 3BEGB 3BO4A 3P6YC 5IFMA 1FHTA 1FO1A 1NU4A 2CQPA 1FJ7A 3CTRA 2MKIA 3UCZP 2ZJQQ 2CPJA 2XNQA 3S7RA 1D8ZA 1YJ9S 2JWNA 2RQCA 4CH0S 2QA4S 2G0CA 1X4EA 1KOHA 1U1OA 1SJFA 1X5OA 4F02A 4QQBA 1VBYA 1QVFR 1VBZA 3G6ES 3EX7B 2KM8C 1JMTA 3G96A 3B4DA 2MJUA 2KG1A 2KXHA 3CCES 2CQ4A 2YWKA 5DM7Q 1QVGR 3THTA 1YITS 2OJ3A 1HD0A 1WEZA 2M9KA 3CPWR 2A3JA 2I38A 2DHGA 2F9DA 4W90B 2MQQA 2XNRA 2DHXA 3NS5A 2CPXA 2L9WA 2MKJA 2DHAA 1U6BA 4U67Q 3CCUS 3ZZZA 3DLLQ 1S79A 3HI9A 1VC0A 1PO6A 4IUFA 4ERDA 2LKZA 3VAFA 2G4BA 5HL7Q 4F25A 2MMYA 3VAMA 5JVGQ 2ZJRQ 2M2BA 2KRRA 1OPIA 2MGZA 1VC6A 1X4DA 3THPA 1K8AT 1A9NB 3VAIA 2N3LA 3S8SA 4TU8A 5JVHQ 5GAHU 4WFAQ 2N82B 2CPIA 2SXLA 3MURP 2DHSA 5BJRA 1AUDA 1OIAA 2LQ5A 1WG4A 2MSSA 2O3DA 2OTLS 4TU9A 1YIJS 1SJ3P 2F9JA 2NLWA 2D3OR 1W2BR 1M90T 3CCRS 2FC9A 3K0JA 4V19X 3CCVS 2KH9A 3CC7S 2E5JA 5EN1A 5ITHA 2CQ1A 5LXYA 1X5SA 2WBRA 2ADBA 3VAKA 2AYEA 5CYJA 3CUNA 2DGVA 2KFYA 2K8GA 2ERRA 2CQHA 5MLCV 2DNQA 4YUDA 2HZCA 2DGUA 4ZKAA 2RT3A 4A8XA 1JJ2R 2CPHA 3TP2A 2E5IA 1WHWA 1YJWS 3I55S 2KHCA 2RRBA 1DBDA 1WHVA 4Y00A 2YH0A 2J8AA 3D2WA 5CA5A 3IWNC 2KYXA 5LSOA 4ED5A 2MKSA 2MZJA 4FXWA 2MQLA 2MJNA 1KQSR 5DM6Q 2CQCA 3BO2A 1URNA 3UD4P 1WWHA 1WELA 3N9UC 1U1QA 2RQ4A 2LA4A 2M8DB 1Q7YT 2CQ3A 2MQNA 1HL6A 1DZ5A 3I56S 1VQ5S 2XS2A 5LSLA 4M5DB 1SJRA 2MKCA 4FXVA 1OO0B 2MQOA 2JRSA 1O0PA 3CF5Q 1YI2S 1M5PC 1H6KX 2E44A 1WF0A 3UCUP 1U1RA 4C7QA 1WEXA 2DNHA 2I2YA 5GMKa 1KD1T 3MUMP 2DNOA 3MUTP 3CCJS 1FXLA 1DRZA 1WEYA 2U2FA 3VAHA 2V94A 4LJMA 3CULA 2E5GA 1N52B 3H2VE 4OZ0A 1R8HA 2LXIA 1Q82T 2AYMA 2DGSA 3S01A 5GVQA 2X1AA 2XSFA 2CQGA 2DK2A 2KT5A 2CPZA 2XS7A 2OIHA 2LYVA 2N3OA 1VQOS 2CQ0A 2NZ4A 2YKAA 5H1SV 2DH8A 5LJ3Y 2MKHA 1Q81T 2HGMA 4BS2A 3G9CA 3PIPQ 2MZQA 4RU2A 3G8TA 1UFWA 2CQDA 1X4AA 1WTBA 2RS8A 4OZ1A 3CCMS 2OSRA 3V4MA 2MY8A 1OWXA 3VALA 1VQNS 3U1LA 5D77A 1F9FA 2GHPA 2YTCA 1X4CA 1G2EA 2MZ1A 2DNNA 1SJ4P 2CQBA 1D9AA 2K3KA 2YH1A 2KXNB 4WKRA 4PR6A 2LEBA 2DGTA 1VQLS 4WFNQ 1WF1A 2CPEA 3LPYA 2LCWA 2N7CA 2DISA 1H2VZ 4W92B 3SMZA 3NNAA 3UWTA 2DO0A 5DDPC 5LJ5Y 1B7FA 5DETA 1R8PA 2D9PA 4UY8T 1KC8T 3UD3P 1U1LA 1M5VC 2MZSA 1SXLA 4UQTA 2CPFA 1ZH5A 2E5HA 1HA1A 3TO8A 3CXCR 3MOJB 1YTYA 3CC4S 1WHXA 2FC8A 2FHOB 2M8HA 4C0OC 3JB9k 2U1AA 2MQMA 1M5KC 2LXUA 2XS5A 3CMAS 4CQ1A 2M70A 2X1BA 1UW4A 5IM0B 3MD1A 1KOOA 2RRAA 2L08A 3TYTA 5HO4A 3L3CA 3IRWP 4Y0FA 2M88A 5IM0A 1VQ8S 2DGQA 1NJIT 3CCQS 3MXHP 3EGNA 3VF0B 2JVOA 2L41A 4IOCQ 2X1GA 3MI7X 4WF9Q 1FJCA 4IO9Q 4PRFA 2KG0A 1WI8A 2CJKA 2DNGA 1XN9A 1S72S 3CCSS 1FJEB 2DNZA 2AD9A 2MSTA 1U1MA 2DO4A 3MUVP 2M7SA 1WI6A 2J76E 2MZRA 4WIIA 3J7ZT 1P27B 2OSQA 2DITA 3G8SA 1VBXA 2MZTA 1H2UX 3U1MA 3CCLS 1WF2A 2F3JA 3S6EA 1M5OC 2GO9A 5IQQA 1K73T 2HGLA 5DDOC 2KVIA 1UAWA 3R1LA 1X0FA 2HVZA 3DXBA 1VQPS 2KI2A 2RVJA 5GAEU 3RW7A 1P1TA 4QU6A 3UE2A 2QFJA 3MDFA 1VQ9S 2BZ2A 1SJQA 2JVRA 1QM9A 3G71S 2MQPA 3CMES 1JJHA 2ZJPQ 3SDEB 4YOEA 4YB1P 1FNXH 2M4MA 1YWXA 2CPDA 5GAGU 2BOPA 1X4GA 1BY9A 2CPYA 2X1FA 2MPUA 1U2FA 4EGLA 4QPTA 2DNLA 2KRBA 3SDEA 1L3KA 1ZZFA 3NNHA 2MY7A 2ADCA 1RKJA 4C4WA 3ULHA 3BO3A 2EVZA 2EK6A 2OTJS 2RU3A 4PKDB 1X4BA 1M1KT 2MHNA 2CQIA 2VOOA 1RK8A 3CD6S 2Q79A 3NNCA 1YJNS 2QEXS 2DIUA 2J0SD 5LXRA 2KM8B 1DHMA 2AYBA 2RNEA 3US5A 2VODA 2CQ2A 1U1NA 1VC5A 2LEAA 2LECA 1WG5A 2MXYA 2M0GB 2LA6A 2AYGA 3Q2TC 4CIOA 4F26A 2MYFA 2FY1A 4LMZA 2DNMA 2DNPA 3VAJA 3HHNB 3MD3A 2G1DA 2EK1A 1VQKS 2VONA 1UP1A 1PGZA 4CH1A 4LIRA 3UCGA 1VQ7S 3EGZA 3H2UB 2HGNA 3J7YU 4WFBQ 2DH9A 1VQ6S 2DIVA 2HYIB 1U1KA 1N54B 2DNYA 2MGZB
chains in the Genus database with same CATH superfamily
2PE8A 5A8KB 5EDWA 1QD1A 2V8DA 2FJEB 3LQVA 1Q8KA 2PEHA 1M5SA 3EVWA 1RT7A 4F2SA 2IAJA 4X64J 1KHVA 2QLJB 4A46A 3DRSB 2FVRA 1JJ4A 3NAHA 3MEEA 1V9OA 4B3RF 3HD1A 3MF5A 1N5YB 3M6VA 2P9GA 4KYZA 4FS2A 3KUEA 2C2EA 2ZH4A 4PWDA 5DDRC 5KFMA 4MK8A 4P6QA 2DB1A 2EI5A 1AZSA 4IQMA 2IC3A 1PCAA 3W5YA 1JLQA 3TAMB 4DR3F 2B0GA 1VQMS 2XMWA 1EP4B 1FO1A 1IWGA 2PN6A 4ELTA 9RUBA 3J81Y 1TFWA 3IXQA 4DDFA 2EFGA 4Z37A 1D8ZA 2AGQA 1YJ7A 2V8PA 2CAJA 2QA4S 1UKUA 1KOHA 2FVCA 2WBMA 5E33A 4GC7A 2VBWA 4OYIA 1VBYA 2VG5B 5IOLA 4NZ0A 4ECUA 5HLFB 4L76A 3KK1A 3GWCA 2D41A 3R9LA 4X65F 1F9EB 2CZ9A 5JJBA 3CPWR 4I6YA 4JI0F 1NEEA 5KFNA 1Q4RA 1FKAF 4YR2A 4Q43A 2FIUA 2ZDOA 1RT3A 3CCUS 1U26A 3RB3A 3M8ZA 3FMBA 4DLEA 5CQGA 3W8GA 3QFHA 2WW4A 3DKDA 5I3UA 3VAIA 3OBIA 1DTQB 2F65A 1G7CB 2L9NA 5T7LA 1W2BR 2BE9B 2V4JA 3KMSA 1SUQA 4O44B 2FVSA 2J6TA 4OX9F 3DRSA 4OYOA 4NZ6A 1SKWA 1D8YA 3MM9A 2PO4A 4RNFA 1JJ2R 3T41A 2FDNA 3OFEA 2GIQA 4Q7AA 4J9VA 2HIYA 2L9DA 2VUGA 3AH6A 2RMLA 3GIMA 3MZIA 3F0NA 1WELA 3NG8A 3W66A 1OO0B 4FYVB 2JRSA 3IA0A 3KLHB 3JQJA 4C3KA 5DLFA 4IO1A 4M5DA 1VQSA 4WFXA 3IS9B 1YRTA 1XNQF 3VVTA 1C4AA 4RW6B 4EK2A 5AXNA 2H1YA 1SV5A 3QGPA 1QSSA 3I4HX 3N6LA 3T5KA 1EIYB 4UUWA 5KG0A 2ZE2A 1GTEA 1TFYA 3CSKA 4NRUA 4DR1F 2XG8A 3GU0A 3VQTA 1X4CA 2H4YB 2CQBA 3HKZD 3GIRA 1ZTWA 6FDRA 2CPEA 1TKXB 2PMZD 1ZPWX 2N7CA 1WOOA 3UDEA 3OXFA 3CJ3A 1NHVA 4NRTA 1NZAA 4FVMA 5HANA 1DTQA 1PAEX 2GVDA 1P1LA 1EAYC 1WHXA 2EFOA 3KFWX 4C0OC 4P2XA 1RT6B 2U1AA 2MQMA 5KG7A 3CMAS 5ETSA 1Z1ZA 2ATCB 1KFSA 2KT3A 1VQ8S 3C16A 5KAKA 5IV4A 2EC2A 1RGVA 5A8WA 1JLEB 1RBLA 3ETMA 3POTB 4ED6A 3LA0A 3OVSA 4B3MJ 1TQLA 4DJBA 3M8QB 3R97A 1UJ6A 2HGLA 2KVQE 1FNOA 2X3DA 2J0WA 4KPYA 4MK7A 4MTPA 4RNOA 2VASA 5D4OA 4CTAA 3A8JA 3KLHA 3CJ5A 2JC0A 3K7RA 2VV5A 4USWA 1HBOA 5C5JA 4HYKA 2RDIA 4C4WA 3G86A 4UZCA 1EJ7L 2IJFA 3D6MB 5J1PA 3M2VA 2AKWB 2YX1A 3AQPA 4ZHRA 3GTYX 2AYBA 5DQHA 3ENWA 3OLBA 1TL3B 5A8RB 3EZ5A 2CJYB 1HR0F 2LXFA 3RG6A 4KKOB 1UCNA 2DPJA 5J2NB 2GIFA 1T9YA 4ZN1A 4GVBB 1VGYA 4PABA 4D3HA 1JLGB 4CLTA 4ZPCA 1B99A 4IG3B 3CJKB 2NREA 5B0DA 1CJVB 4X84A 3TARA 3FZBA 1RT1A 2MDAA 2CADA 4DR6J 2ZHAA 4OHYA 5CXTA 5ETTA 2KN4A 2CVEA 1EKSA 5D4PA 2QZ8A 4ED3A 2WAQD 1UVJA 1IBKF 2P6SA 1SC1B 1B70B 4DV0J 3BZQA 1FT8A 2VU5A 4M8LA 4NASA 1HBUB 3VGSA 4TLQA 1H2TZ 3CW2C 5F8NA 3D0IE 2V9WA 3EVMA 3OQ2A 4JI1F 3UN2A 3WZ0A 5J2QB 2PEBA 4FN5A 5E5NA 4MKAA 1YJ9S 1WDTA 4CH0S 1NK7A 3WIVA 4CI0B 4UY85 2LU1A 2JEIA 4QYZJ 3I5BA 4I2PB 4QBUA 5E2QA 1PJ6A 2Z2MA 4DN9A 2R7VA 4RO0A 1JMTA 2CQ4A 4LRBA 2OI2A 3SSRA 2BE7D 2A3JA 1XQIA 3CIMA 2IM1A 4DL2A 3FJ2A 1KDNA 3GYXB 2ZFHA 2CPXA 1QLNA 4NYPA 2L9WA 5THWA 4PZVA 4NLSA 3EXCX 3OTBA 4B3OB 1VC0A 3NCQA 4IUFA 4R0EA 3QJLA 1FDDA 2M2BA 3EYZA 4GVBA 1OPIA 1K8AT 3ZO7A 5IQ6A 1JLGA 1NK0A 2BKPA 2WVFA 4DPTA 2DHSA 3PYEA 1C4CA 2ADBA 4DV7F 1ELOA 2XY7A 2KFYA 1D9FA 4OYBA 3ZTOA 4R5PA 1T95A 4O3NA 2XTJP 3GMGA 5AXKA 4B3SF 3IWNC 4K4UA 2WB4A 5HP1A 4KRWA 1FERA 2C1EB 4LRAA 3QZ7A 3MCNA 1KVKA 4JP8A 4FXDA 4Y28C 2LA4A 5K20B 2MKCA 3H7HB 3CF5Q 2QL5B 1TUGB 3W2VA 3MUMP 1Y4ZB 3CCJS 4CO3A 3QBCA 3GCXP 2PSZA 3VQSA 2DCUB 1N0VC 2RF2A 3OL8A 3OLAA 4FDFA 3BDEA 3K5OA 4U95A 1PG5B 2AQ4A 3ISZA 1FKPB 1ZBTA 1VQNS 2P2CB 2DNNA 3DLBA 4ES2A 4X66F 1WF1A 3DDNA 2LCWA 3UFCX 4DV5F 4PYDA 3ZZUA 1NHKL 4F4KA 4U8YA 2XI3A 2FHOB 3J81U 4FYDA 1A0OB 5C7PA 2L08A 5HJYA 4JYAF 2M88A 5L38A 4Y2MA 1KNZA 3T5JA 4CRJA 4LF7J 3D5MA 5LM7E 4ZVEA 5DGBA 1ROFA 2H4WB 4OLPA 2ASDA 4ZVFA 5DZ6A 2MSTA 1WI6A 4BLGA 1VDHA 4RW7B 1IJFB 4DG1B 4WU2A 2ZNYA 1M1HA 3HKWA 4U6PA 1N36J 5CD4H 2DR7A 3UQSA 4JI6J 5B0CA 3UW1A 1FDBA 3MDFA 1SJQA 2MQPA 1TKZA 1JJHA 1KQFB 4I4BA 4DUZF 4FF2A 3SDEA 1VS3A 8AT1B 1EX8A 2Q6CA 4ZVPB 4KHRA 2ZD1A 2ZWPA 2C3MA 2OMLA 4MJKA 1XMOF 2UUWA 2Q79A 2XGQA 2J0SD 2Y1RI 2J7KA 3AJ2A 3OTEA 1IBLJ 3IMQJ 4Y6IA 2FZCB 3QATA 1Y3KA 1SI9A 2BJEA 1Q0NA 1FKPA 4E0DA 4J9UE 4LBHA 2EK1A 2W8KA 3QAUA 2HFSA 4KE5A 4U7UD 3CJSA 4C3MA 1FXDA 1HYSA 4WP9A 3E51A 2BE2B 3CD0A 2HHHJ 2FLPA 3D6HB 2ZOMA 3WDOA 2H54B 1N0UA 4HACA 2XWXA 5E41A 1S1TA 4HHUA 4X62J 3P5TL 4DV1F 2VOPA 1T03B 1IBCB 3H98A 2GQQA 2DNRA 2Q1LA 5FD1A 3LPEA 2J0XA 4OI4A 1RB0A 4YHHF 3BS9A 3NEKA 4RNHA 4Y2AA 1N32F 3C14B 4LF8J 4IOBA 2J7UA 1XWLA 4IH5A 4ZVRB 4NMXA 4R0JA 1U1PA 5IWAJ 2W2QP 5CABA 2V5HG 3N0VA 1FE0A 3Q22A 1JLCB 3OL9A 1FXRA 1GTHA 2EFQA 1RP5A 3IRXB 2FHMA 3DI6A 4DQPA 3M30A 2CXEA 2A2DA 1F5AA 4CDIA 5KFRA 4ECVA 3NBPA 2VQFF 3BGRB 2BACA 3LP2B 5KG6A 4U96A 4C48A 3G6ES 3Q8UA 1RTHA 1H73A 1FWKA 4DUYJ 2KHDA 3B4DA 4NMLA 1NZ8A 2AGPA 3WX8A 1DAXA 2QFIA 1HD0A 1E6VB 2I38A 1Y5IB 3I9ZA 2XC9A 2Q3PA 3GG0A 1FA0A 3FSYA 2OPPB 5C24A 1S76D 3HI9A 5E3RA 2LKZA 1F5BA 4L75A 2BE2A 4GKKJ 4M5KA 2WONB 4OI6A 3ITHA 2DHHA 4C2MA 3ZNJ1 4LFAF 2PMWA 1C1CA 5JVHQ 2NZCA 2CPIA 1AUDA 1RTJB 2MSSA 3HVTA 3TANA 4OHVA 4HDHA 4PQUB 1M90T 2B5JA 4V19X 3EDQB 4C11A 2GV1A 1VYAA 5CYJA 2YPYA 1BWVA 2R7UA 2VG6A 4CYUA 1LQ9A 2HRTA 4A8XA 1E6YB 1YJWS 1H7WA 3W8PA 3NLCA 2EXUA 2HFVA 3SFGA 2CKWA 4FXWA 3KJVA 3EXYA 1QUPA 3TWZA 3DLGB 3N5BA 3IRXA 1O0PA 4LRCA 5J2MB 1AA1B 3AOCA 3HHKA 2DNOA 3H25A 1DRZA 2V94A 1UA0A 3H2VE 2XMJA 2FJWA 2XSFA 3HMJG 4DPUA 1BQNA 3DLKB 1I94F 3OJUA 4DL3A 2MKHA 4YDDB 2C2MB 4TQRA 1RA7A 1UWAA 5LT5A 1FD2A 3OL6A 4A8MP 1U4BA 4DV6F 1SJ4P 4JI4F 4CT8A 1D9AA 4ZJQA 2YH1A 4QIVA 3O8WA 2HLUA 3IAM9 4B9TA 2QMWA 4W92B 2GJFA 1IUJA 2JL9A 2FGCA 5AJ3F 1WDDA 1DTTB 1U0SA 5MAOA 4UQTA 3KHHA 1RTJA 1HNXJ 2XMVA 2HBRB 5B08A 4DZ6A 1KOOA 3LP1B 1S0NA 2DGQA 1NJIT 2WVEA 5HVGA 5HN0A 1RJJA 2HS4A 4X2BA 4OYMA 3CCSS 2BJ9A 1S9FA 2O1PA 1NDKA 3RAQA 1NPRA 3DLEB 3KLFA 3KG4A 1P27B 2HHXA 1SC6A 4DPYA 3UNYA 5KFAA 2NXJA 2KI2A 3PJXA 4X4SA 4LFBF 3M9MB 2RKIB 4OFZA 1JLFB 5DQIA 4IRCA 5D0RA 4DPXA 3MMCA 2XY6A 1BUXA 1KLNA 1X4BA 1QJHA 2E9RX 2HHQA 4FKXA 2BRLA 2DIUA 4O3QA 5DG8A 4FBUA 3TUIC 1RWXB 2RNEA 2IRUA 4M5GA 1NK9A 3QT5A 1P6TA 3FK4A 1S6QB 3MEKA 4MFBB 5KFOA 1UJ5A 5ETLA 1GK8A 2MLXA 1PBUA 3FCVA 3EGZA 2EPIA 1C1BB 3J7YU 5G4DA 1EQ0A 1CBKA 1R0AA 3BBCA 4XO0A 3SCJE 2FHJA 1T3OA 4KAIA 3UD5A 4IH7A 1JLBA 3RRGA 1U24A 4OZLA 2IY5B 2QL7B 1EARA 1A7GE 4TU7A 4MAKA 4BCAA 2C2OB 1IR2A 2ROEA 2FTRA 1W7WA 3JYTB 3W62A 2V2QA 2XYPB 3ZXWA 3HDSA 3D1OA 4C8NA 4UT4A 5B0AA 4JV0A 3QFWA 1Q7LB 4Y2CA 1F6TA 2RSQA 1R89A 5DQGA 4LBIA 4MK9A 1FESA 5GADU 1TUWA 1CS4A 1HI8A 4K2JA 2GGPB 2MKIA 5BR8F 3D66A 1TZ0A 3S7RA 1LWFB 1WC3A 4NLVA 3BQ0A 4WK1A 2AZ3A 3PO4A 1X4EA 3FCHA 3TNVA 5KFVA 3SCIE 3CB4A 1S99A 1CC7A 1S12A 4I67A 2QA2A 3I0RA 4ZPDA 1FRKA 2KG1A 4OX9J 3M4XA 3NXZA 3TAQA 1GXTA 3AJDA 3F44A 2H51B 3QIPA 3LTOA 2HK3A 5HROB 3TQEA 2HZVA 1YJTA 5CYMB 5T14A 2GMLA 2QA4G 3IBFB 5ETOA 1T94A 3QQCD 2I5JB 1QAIA 2I6WA 4ZN3A 3L7UA 1FRLA 3SQOP 1X4DA 1A9NB 4PG6A 1BC6A 2HHVA 4ZJLA 4ZIWA 3AT1B 3ENVA 4ANCA 2E66A 3K0JA 3R2CJ 3OFFA 2KH9A 4CLSA 3HHLA 2YQ0A 5K8NA 3M2RA 1KVIA 1GNKA 4ENOA 2RQMA 2YNFA 1MMNA 5AT1B 3UDVA 2BMBA 2RT3A 4I7FB 3VHQA 4ED7A 3T19A 2RRBA 4H54A 2V67A 4Y00A 2ZH8A 2EKYA 4ALZA 3AA8A 2VJUA 1WKJA 3WQPA 3BO2A 1VCTA 2UZAA 1HQUB 4H4MA 3GYNA 1I51B 2GGPA 3PZPA 1RHUB 5LSLA 1M5PC 4F3OA 3CULA 4CLWA 4NLWA 1R8HA 2KT5A 5HBMB 3SV4A 1U2RA 2N3OA 2XHWA 2FUG9 2A2CA 1UVKA 4IR9A 1S7IA 4OJHA 4LF5F 3KDNA 3CCMS 3H40A 5HROA 4WWSA 2HNDA 3PNIA 3RBDA 1F9FA 4B17A 1J5EJ 2VD3A 3AY0A 1L3SA 3UWTA 1R8PA 2DRDA 2G2YA 4M5JA 4Y2IA 3MECA 5D0GA 3CC4S 4OZ5A 1S4EA 2OEKA 1Y0HA 1V3RA 2B6AB 1UMJA 2OEMA 4S0MA 5HO4A 5D8HB 2VBYA 1S9GA 1UVLA 4K4SA 3OL7A 1H38A 3NGTA 4G1PA 1WI8A 2UVRA 1HNZJ 2NCKL 5F0WA 1FJEB 2KT2A 2J76E 2UXCF 4O3SA 3KJQB 3BH6B 4B9SA 2HHWA 3DXBA 3MCMA 3QLHA 3L9ZA 1T05B 1RAGB 4HT5A 2K7KA 3D1QA 8ATCB 4YB1P 1G3OA 2CPYA 2ASLA 1VIOA 2KRBA 4M5IA 5EWFA 3E3XA 4X64F 1RKJA 4EEYA 2VDIA 1CJTB 2EVZA 4F4XA 4OV1A 4M5HA 2HLTA 1FRIA 1YJNS 2V0NA 1HQEA 1X8DA 1YQHA 1X0PA 1U0HB 2M0GB 5KT5A 2J6SA 1P9YA 1HQ2A 1MMLA 3VAJA 4YB6A 1RTIB 1SCJB 2XY5A 3SZ2A 1RHJB 2HK2A 1EZZB 1IBKJ 2Q66A 3B78A 3PACA 4G1QA 4WFBQ 4FYYB 2AIRB 2IMWP 4QWDA 2H9ZA 4P2FA 3ILJA 2DH7A 3HFKA 4KFBA 1RT4B 4KGKA 3GIJA 1K9MT 3PIOQ 2ZEJA 2B6AA 1NJWA 3BQ1A 4OYZA 4USTA 3LP0A 4NA3A 4O3RA 1X5PA 3TA2A 1R6VA 3RR7A 4O3OA 2AHOB 4EYHB 2I9SA 2PFFB 1Y9OA 4PXCA 4NLXA 4WTOB 5FJ4A 4J9PA 3HSJA 5EUHA 5IXUA 3TQ1A 4LQ9A 4IOAQ 1WOSA 2ZH9A 3ENAA 2R2SA 1LWCB 3CTRA 5K9FA 3AXKA 2OELA 3H4DA 1RWNB 1T0TV 1U1OA 1UETA 4N76A 1JLAB 2EBGA 1CJTA 2AJ4A 3ZTRA 3ICLA 3G96A 4YFUA 3OFHA 3PRVA 3BQ2A 2ZH5A 4FP9A 3KMQA 4HEA9 2C42A 4O3PA 1VRUA 3BSAA 1QSYA 2FVQA 3IR5B 2K7JA 3QRRA 5K14B 1TV6B 4WE1A 3J7Z5 3GSIA 5FDLB 4QWCA 4YN3B 4DU7A 3M32B 4LBPA 2DEJA 4XAKA 4RW4A 3MCOA 1FD8A 3D3BJ 2V2VA 3M2UB 4OYAA 2VFUA 1TL1B 3TZXA 3HF5A 2C22A 2G13A 3HVRA 4WXOA 4AD6A 3E01B 4DSLA 2R7XA 2HVDA 3DDIA 2E5JA 1RE1B 2WBRA 4PXBA 1OSDA 4DL5A 4NL5A 2RHQB 1S6PA 4N5SA 3SV3A 1U8WA 4ECSA 5L1KA 3NGRA 9ATCB 4ED5A 3NAIA 1S9EA 2CQCA 2IHR1 3VGTA 2XMKA 5ETMA 2NUHA 2CQ3A 3DC2A 2CJBA 3QMQA 2LFVA 3WIUA 4HR2A 3D9BA 4MT1A 4IH6A 4AQYJ 2BJ3A 2IPOB 4Z7YA 1L3UA 4PCQA 1VRTB 3THVA 3NGUA 2ZBIA 1RA6A 2XZWA 2X1AA 5B0FA 2ABYA 3CT9A 1RTDB 1Q8LA 3ET6B 4EBEA 2NZ4A 3LUYA 1NB7A 1JXEA 3RAXA 1GMVA 3W60A 2W9BB 4KB7A 1UFWA 5L1LA 3R6GB 4B3MF 3KK3B 5KFDA 3QT7A 3KK2B 5M2UA 4HKQA 2UV8G 1O8BA 2YTCA 5KTQA 3QWPA 1ZM4A 3RR8A 2ZH3A 4RW9A 4F50A 1H2VZ 1F9HA 5DDPC 1IQZA 1REVA 4HDGA 3B54A 2QN6B 1DFDA 2QYGA 2M8HA 4OJ1A 2BUNA 4NZ7A 3DOMA 4LSLA 3QJPA 3TZZA 1N4LA 3A8EA 5IM0A 2EFNA 1Y00A 2GHWA 3N5FA 2B56A 1HNWJ 2JVOA 5EX0A 4TY8B 4IOCQ 1XMOJ 3TA1A 1S72S 2XGPA 4LSZB 4J37A 2AD9A 3D0HE 1RWVB 1JXLA 1RBOB 2HFNA 5IZHA 2WSFC 4ECTA 1H2UX 3OXLA 4ZP6A 2K1RB 2DR5A 3BN7A 3PR4A 3U1NA 3BV8A 3HZGA 1KP6A 4TNOA 3WBZA 2YQ3A 3GJSB 2ZJPQ 5EWEA 5C42A 2XLJA 3KXDA 4O4GB 1UPPA 2ZH1A 4OX7A 2HFUA 2C3UA 3ULHA 3FRZA 4DR6F 3BO3A 1LOUA 2OTJS 2RU3A 3CD6S 3MM7B 2C3PA 7AT1B 3GYGA 5DRKA 4UZBA 1XEZA 2W9BA 4YHHJ 2KYZA 4LF4J 3RAMA 3FZ2A 4RLEA 4IQXA 2LA6A 3RB6A 4ZVUB 2UUCJ 1VK8A 3IAS9 1X9WA 4DV0F 4Q8FA 3MPDA 4BBYA 3UCGA 1L3VA 2WCXA 3M6XA 2HGNA 4LSNB 2ZOGA 1WOPA 4I6AA 2GIRA 2MEWA 4NCAA 1VI7A 1HARA 1RSCA 3DM2B 2IDEA 1VQ4S 3G82A 1PYTA 4KC5A 1B3TA 1G1XA 4QU7A 3TEHB 2JFKA 3BPSP 1JX4A 4MIAA 3BBBA 4ECQA 4PAAA 2XHCA 2FYXA 3M8WA 3V4IA 3A12A 4O0NA 4IFVB 2XCPA 2A1BA 3D68A 3OUYA 2F4VJ 1CQNA 2W4DA 5GMDA 4X4OA 1Q86T 3BR9A 4Q0BB 3VGUA 1EQMA 2L48A 3C6TB 1IKXA 4DHVA 2BR0A 2HNYB 2BW7A 3QRPA 3ZZYA 2GX8A 3J7A1 2FPHX 3GLJA 5HQLA 5E0OA 3LW5C 1T11A 2VA3A 2HFOA 4FYWB 1AB8A 1FHTA 2NSCA 2EC0A 3V6JA 3UCZP 4K4ZA 1S10A 2ZC4A 5D3GB 3FQLA 4O4GA 1Q5VA 3CO9A 2IFXA 5L1JA 1H3DA 3V6DB 4K4WA 1ZM3A 3GONA 4GMKA 4DX7A 5A0YB 1QVGR 2ZZNA 1SL0A 1BGXT 3UDCA 3UPFA 1WKLA 3NMAA 3MEDB 2XNRA 2FQQB 3M9OB 5IS2A 3H59A 1MMDA 4USJC 3PYGA 3BGOP 3KG0A 5SZTA 3FBEA 5J1EB 5F9LA 3DRPB 5JVGQ 5DS7A 4NXMJ 3SI8A 4RWWA 1IR0A 3QNWB 1TVRB 3MURP 2WRMA 2W7OA 4Y3CA 1F0XA 3K5NA 4LQ3A 5I42B 3TX8A 4RUAA 5KOXA 3HVWA 1TELA 1KBRA 3A3NB 2YKMB 5MLCV 2Z57B 1LW2B 4YUDA 4HHJA 1GXLA 3C6TA 2KHCA 1DLOB 2FJBB 2PD1A 3K17A 1LW0A 3TEGA 1UZHA 1T7PA 3G6VA 1LFPA 3UVJA 4V19J 3I32A 1WC6A 5GAEI 3N9UC 3OHAA 2XS2A 3RRHA 5CH7B 1WF0A 3ZZOA 4ES1A 1KD1T 1MU2B 3OV7A 4WBFA 4B3TJ 4A8YA 2BJ8A 3V6DA 1SPBP 4NYZA 4E8UA 3PDNA 1S1UB 4LIWA 4DSFA 3MM8B 4LR9A 1VQOS 2XYHB 5H1SV 3CCTA 4DBQA 4NA1A 3K5LA 1WTBA 4OZ1A 1HMVA 2RIJA 2OSRA 3W9JA 1BMQB 2XCAA 1RAFB 1SIZA 2GVZA 4HT7A 1J5OB 3C6UB 3R6LB 2FB0A 3C8YA 1N36F 3DRPA 2HBYB 2JOQA 5LJ5Y 3CGIA 4QR1A 4JI6F 3GSDA 1LXJA 1IBMJ 3SEOA 2CG8A 3I87A 4CH7A 1NAQA 1RDRA 2VKRA 3TI0A 4FVCA 3JB9k 2Y1JA 2O66A 1A6LA 4LF9J 2V6AA 5EGYA 4WKYA 3TYTA 5F9NA 2HMIA 1VJWA 2G2OA 1KRPA 2YKMA 3BPDA 2X1GA 2V8HA 2OPRB 1WC5A 4DOZA 3DGPA 4NX9A 1DLOA 2Y3YA 5F8HA 3DOKA 1U1MA 2OFGX 5K8OA 2OGUA 3Q8QB 3OR2B 1YG0A 1N6QB 4QIEA 3HPOA 4XPCA 4R8UA 2HHHF 3JTNA 2GQCA 2W4PA 3UE2A 3KLEB 3M1VB 2BZ2A 1NUEA 4X62F 2CPDA 3H20A 4EGLA 1FRHA 3P5BP 4P2MA 1FKOB 1HPZB 2D3UA 4N7TA 3DRRA 2YNIA 4H4OA 1SC4B 5EHHA 2VG7A 1RKIA 1VBKA 2P5VA 4F3QA 1N5VA 1NK4A 4LF8F 3US5A 5U47A 4USIA 1M5HA 1OY9A 3NS7B 2B4PA 2DNMA 5IWAF 4OI3A 4HHHA 4C8KA 1NDLA 1Q16B 4E2FB 1FRMA 1VQ7S 4USMA 3CE8A 1DY3A 4DFMA 1Z2ZA 1BWEA 3NCRA 3TJAA 4CCHA 1IKYA 4HLBA 2ALYB 3EUNA 2GAGC 2VKZG 5KFUA 1T3NA 1C0UB 1U25A 3D4JA 5CHCB 1FDNA 1B7YB 4JBCA 2X51A 4DUYF 4RW8A 3Q8SB 1TR0A 1WG1A 2IVYA 3TX0A 3P3DA 1PILA 1N88A 4L72B 3PHEA 5BXIA 1ZETA 4JB8B 4DPOA 2VZ9A 2UP1A 4ECWA 3O2IA 1CVJA 3D0GE 3PX4A 1HBNA 3G4SS 3PJ9A 1X5TA 1T9UA 4FS1A 2VBXA 1PJ7A 5KFCA 5FLXU 4LRFA 1OY8A 2DNKA 1CJUA 4GKKF 3CJ0A 1C0TA 3H5XA 4ZPVR 2J9DA 1LFWA 4KJIA 4C0HA 1MWQA 3VR1A 1QVFR 3RB0A 4TLRA 1BQMB 3OFGA 4ZITA 2IVMA 2KXHA 1Y5NB 2ACMA 4X4RA 1PBAA 4ED0A 1LWEA 5KFFA 4YB7A 3EMTA 1Q95G 1YITS 2M9KA 2ZZMA 3WHIA 1FEHA 5K8PA 1S1WB 1VFJA 4EFAC 1U6BA 4WJBA 4ZLPA 2VPWB 1EKRA 3E8OA 1WKKA 4LF2A 1W26A 1NH7A 3C15A 2N82B 1VQYA 4JI5J 2O3DA 3MTKA 4ZVSB 3W5XA 1MROB 1HFEL 2V63A 4TXSA 5AE2A 1HHTP 4M95A 2FC9A 2YNHB 3CC7S 5M2RA 5LXYA 1X5SA 1KLMA 4XDCA 3ZTPA 4AFFA 3PW7A 4N56A 2DNQA 2WOMA 2CPHA 2Y8YA 1S0OA 2YH0A 4OQJA 2WB1D 2ZM6J 3FGVA 3RBXA 4IRDA 1HW9A 2EG2A 2GJ2A 3H90A 3Q8PB 4A47A 1DZ5A 4PPDA 1WSVA 4IDKB 3UCUP 2E29A 1HWUA 2R8HA 2J9EA 1HNXF 2ZVIA 2CIMA 3T6BA 3NOGA 1WEYA 2U2FA 1QTNB 4DCOB 1N52B 4IFYB 4LT6A 1N33J 3LANA 2LYVA 2DYAA 3Q23A 4DV3J 5KFGA 1CJKA 3DOLA 1Q81T 4ZA1A 2HGMA 3O5TB 4K59A 1T9TA 1FDAA 1NK8A 1ZA2B 5IT4A 4M1KA 3RTVA 4YS2A 1HNIA 3ENQA 1VQLS 2F8EX 4DX6A 1IKWB 3CVKA 1HBMA 4K8RA 3SQGB 1QAJA 4NPOA 2ZWOA 3MEGA 1KC8T 3JSMB 1GX5A 2QO3A 1Q8IA 3CXCR 2FC8A 1HNVA 1B0PA 3GV5B 2DR9A 1M5KC 1UW4A 4ANDA 2RRAA 2H3EB 2B9EA 5C25B 3VF0B 5D0EA 3SCLE 3MAAA 3HCXA 1YJRA 1YSJA 2ZBPA 1UA1A 1DJ0A 2F3JA 3KLGA 1VQPS 1NDPA 3ILIA 2HQCA 2AW0A 2GMHA 5JXSA 4KV8B 3KUGA 3CMES 2R3VA 5CYQA 1YWXA 5L1IA 2MPUA 3SSSA 4ECYA 3MAQA 3TZWA 2UXBJ 2BXJA 3FRYA 3PY8A 1UVNA 2Z30B 1JJCB 4EMDA 2GAHC 1RAOA 5K5MA 2AT1B 3HHEA 2FJAB 4ETZA 3QRQA 2BM1A 2N4CA 1FK9A 1G4CA 5KG4A 2UXDJ 4HTIA 2DPIA 3MD3A 4FYXB 1S6OA 2VONA 3D6TB 1SVDA 1PGZA 3V2UC 4PXDA 4PWUA 1NK6A 1IKWA 1EETA 4L74A 2PA8D 2DH9A 1VQ6S 2IM0A 3ZZRA 2WTFA 3Q2SC 5HMWA 5GAHI 1H0HB 4NLQA 3FEXB 2FLNA 2X7IA 5A8KA 4DS5A 4UW2A 3W64A 4WTYA 5E3CA 2VICA 3L7PA 2VHGA 1FVSA 2Q6BA 3JSRA 2XO6A 2KKHA 4TYBA 1V5IB 3BJYA 5DG7A 1Y3JA 3FNNA 1N5YA 1FEEA 2YWFA 3NRBA 2CRLA 4O4RA 3IGVA 2Z8QA 3DHWC 3CJTA 2R8JA 1UEUA 4DSEA 3TAMA 3IR7B 3H2LA 1FJ7A 1NH8A 2XNQA 1EP4A 5EX3A 2BANB 2QJ3A 1SJFA 4ZVHA 4QQBA 5F8GA 4P52A 2VG5A 2NSBA 5CCLA 1NJYA 4USKA 3JAMU 5HLFA 1DQ9A 4NWBA 4ATNA 5I4MA 2XSJB 2OJ3A 4OV6A 1VOMA 5H9FK 2BM0A 1S1XB 1Z2LA 4PUOB 2MQQA 4U67Q 3FQKA 4UOFA 4ERDA 1CULB 3W65A 1KFDA 3MPYA 2ZJRQ 3W9IA 2J7WA 2DY9A 3I4PA 1VC6A 2N3LA 2C2KB 4LREA 4NLPA 4X4PA 2YWWA 2LQ5A 4RBUA 1BD6A 1DARA 2OTLS 1SJ3P 4ER8A 4I2QB 1SH2A 1BE4A 1WTFA 2HAFA 3X1LB 3EICA 2CQ1A 5ITHA 2AYEA 4O44A 5B0EA 4OYXA 3R5DA 3K89A 4NI2B 2LDIA 1QAXA 3M9NB 1U49A 3IBWA 2XZDB 1F3FA 5LSOA 1RT2B 4TKTA 4CT9A 1R31A 2DR6A 4J9OA 2YNGB 1J5EF 2MHEA 4YEAA 1FCAA 3UD4P 2ZZTA 1XR7A 4RWXA 2M8DB 1RHRB 4M94A 1YI2S 4FF4A 2LQJA 2NPIA 2B9XA 2BANA 3UN3A 1NM2A 2RDJA 2F40A 2HURA 4LJMA 2NYHA 2E5GA 3IS9A 3MOZA 3T5HA 4B9NA 1PKUA 5G0RB 2DK2A 2A10A 2DEIA 4DV4J 4RW6A 2OD6A 2R7SA 1PYOB 2XSJA 4OHZA 4I56A 1HNZF 1WSRA 1AFJA 3BR8A 2RS8A 2Y9HA 2AJ2A 4PUOA 3I9V9 2P9CA 4Y34A 4P74A 4OMFG 4KH0B 2K3KA 1NSAA 3PJWA 2CNKB 2ROPA 4DX8H 2DGTA 4WFNQ 3R5JB 3M05A 3M8SA 1PIEA 1V3ZA 1TKXA 1QE1B 1ZH5A 2QLXA 1HA1A 1YGYA 3MOJB 1RACB 4PYAA 3N4WA 2C28A 1MN9A 1ZM9A 3EJMA 1RT6A 2HZAA 4Q5VA 4A8FA 1R8AA 1NPPA 2OPSB 2AX0A 3CJQA 1RADB 4JI7J 3WX4A 3PRBA 4A8KA 3R7SB 4IO9Q 4PRFA 4TQSA 1RISA 3DU5A 1JLEA 1WC1A 2DNZA 3POTA 1S1VB 2M7SA 1RT5B 5HSPA 3G8SA 3ZZTA 2MZTA 1KQKA 3DLJA 3M8QA 4ECXA 5IT0A 3CJRA 2V2KA 4P75A 3T9NA 3T1YJ 1R0BG 1NB2A 2JEJA 4X4UA 2DNLA 5BYRA 4CZCA 1M0SA 2OLWA 2MY7A 3TUJC 4P9SA 4PKDB 2PFDA 4F4YA 2JSXA 1RAHB 3L09A 4EI2A 3CNQP 2F63A 2UU9J 2R2RA 1J2VA 5L9XA 3TA0A 3QJJA 3LWMA 2AYGA 3Q2TC 1RWKB 4XTTA 2ZHBA 3Q89A 1OJ4A 1JQGA 1TL3A 5A8RA 3BREA 5KFEA 1S0VA 3Q8YA 2E7WA 3IO1A 3W2WB 4KKOA 1RWUA 1F2GA 1UZDA 5J2NA 2B9YA 3AAWB 4W4MA 4JOUA 2CZVC 3C3LA 1QE1A 4QPXA 4DSJA 3CC2S 2H5JB 1JIHA 1SC3B 4WP3A 4IG3A 1GFWB 3P49B 2VFTA 3CJKA 1CJVA 2EFPA 2OPSA 3VAGA 2DGWA 2RS2A 2QSFA 2QV6A 5DDQC 4TVAB 3G6XA 4ILMA 1XC9A 2XB2D 1YDLA 2G9OA 4QYRA 2P9EA 4R25A 1H98A 1S97A 2JJ4D 1ZAVA 2Z58B 2BV3A 1S1VA 2DGXA 3TW0A 3DLHA 4MKVA 2MKKA 4K4VA 4J5OA 2RUGA 2YKPA 2OFHX 4KH1B 1HBUA 1Y7PA 3PW2A 2YKNB 2LQBA 2JZ5A 4FZVA 5KG1A 4F4AA 2D7SA 5J2QA 1FWPA 3MPVA 2W9CB 2C2DA 4RUBA 3FKBA 1H74A 1RWMB 4FBTA 2QLFB 4I2PA 2DRBA 2JH3A 1APSA 3W5ZA 2ILYA 3LH2S 1RLCL 2HNZB 1FFSB 4AL7A 2VBZA 2HPUA 1WUUA 3HXMA 4OYPA 4CLLA 2PT0A 3OTOJ 5RUBA 3ZZZA 2KFNA 1ZA1B 5HL7Q 2G2ZA 4B3OA 1U02A 2JHEA 2ZITA 3HLUA 4HVZA 2AEFA 5E3AA 3W3SA 2WZ1A 4TU8A 4AQYF 3I0SB 4ZP8A 4P72A 2FZKB 4DL0C 1TK8A 4TU9A 2F9JA 3CD5A 4ED2A 4XDDA 1OQ6A 3GV7B 4ID5B 2E7VA 1QDUB 1RHKB 4B02A 1F60B 4B9LA 2QTWA 3I96A 3DYAB 3FSIA 3N28A 2B4VA 2IRYA 2F4FA 2HHSA 2CWXA 1NKEA 3D2WA 4NLYA 1K44A 2MKSA 1P9QC 4ZCIA 3W1YC 1URNA 5BYSA 2UUBJ 4KO0B 1V6HA 4B9MA 1U1QA 3MCSA 3N79A 2EKNA 1U1RA 4K4YA 5GMKa 1TK5A 5GAGI 3GZ7A 4ED1A 2NPFA 4RX6A 4KY3A 6FD1A 3VAHA 1VK3A 4NOHA 2BJ1A 1Q5YA 2QA1A 2CQ0A 1HNWF 2DH8A 3KUHA 3PHTA 4KSEB 2G1HA 2OPQB 1FRXA 1LK7A 1OWXA 2GQ2A 2BJDA 3HZEA 4MIWA 1LNQA 1WC4A 4WPAA 5HAOA 1TMMA 2XULA 3OHBA 1UTAA 2FLOA 3O1LA 4X4NA 3A8IA 3LPYA 3PYFA 2HRYA 3NNAA 2DXFA 3P8BB 1UJ4A 3LGHA 2OO4A 3EPGA 3NOCA 1SXLA 3I0SA 4JUZA 4Q2MA 2KJWA 4JV5J 3TUPA 5HQ8A 2BDPA 3MMAB 1YZ6A 2VF3A 1XK8A 4CQ1A 4ILRA 4ID5A 4QW8A 4KIAA 3J81j 4Y65A 1NDCA 3O3LA 4Y0FA 3EGNA 2JC1A 4WFZA 2L41A 1JWWA 4LR8A 4QWEA 2KG0A 2KB2A 4LF4F 3DN9A 1YBAA 3IG1B 2Y1LB 3MUVP 2UUCF 4LUBA 4WIIA 4C8OA 2OSQA 2NYIA 3U1MA 3Q8VA 4RW7A 2KVIA 4DI6A 2KZZA 4DG1A 3HFVA 5GAEU 1U6ZA 4X4TA 3MMBB 3DNCA 3IBCB 4YOEA 4RBVA 2W7PA 1X4GA 4DV2J 2HWTA 4QPTA 4DQRA 1ZZFA 1F3VA 4EZ9A 4DZDA 4ZVOB 1M1KT 4F0KA 1XMQJ 5J2PB 2ALZA 1RCXB 2F4VF 4AXJA 1UW9A 1UVIA 2LECA 5KFTA 4CIOA 2FY1A 1SQFA 5KFSA 3MTJA 3ELHA 3KLIB 4PWWA 3W63A 3J7YI 3GB0A 4NCGB 3BKUA 1YZ7A 3R3TA 2DIVA 1RT7B 3RUBL 1OMSA 1X4FA 1HI0P 3KHLA 3CDBA 4EBCA 2CJXB 3GJRB 5A6WA 5D78A 1T03A 3SXLA 3MEEB 3T1HJ 4JI2J 2KXFA 5DGAA 4E98A 1K47A 5KG3A 3K8VA 2QGFB 2RUSA 4PWDB 4O23A 1U6FA 3C14A 1X7VA 5KOWA 1GMUA 2OEJA 3G2XA 2HWIA 2IC3B 2R7WA 3OVAA 2A0FB 5GADI 1MWYA 5ETKA 1Y10A 5ETRA 2QL9B 3BEGB 2HS3A 3H0PA 4NXMF 5DO2A 4RPFA 1JLCA 5KFPA 2CQPA 3MMBA 1XTZA 4CO2A 2DT9A 2CPJA 4L73A 2GO8A 2RQCA 4DR4J 2XWYA 4F02A 1XMBA 3KK1B 2LU2A 5IV3A 2XMUA 1FVQA 3BGRA 3LP2A 3FDSA 4ZCKA 3AOAA 2YKQA 3KJNB 3ILOA 4LFCJ 2HVEA 3PG9A 3GE9A 5JMNA 1RT3B 1E6VA 2DHXA 2ZKUA 2HHUA 1NRKA 3JS9A 3FBFA 3EZUA 1S79A 2OPPA 4A8OA 2P8IA 1PO6A 2KJVA 1RYSA 5I3UB 4RKUC 3MPUB 2XMTA 3S1TA 2BQRA 2WONA 2HW3A 1FF2A 5T7LB 1BLUA 4WFAQ 1Z4UA 4RZRA 1U09A 3UR0A 4C97A 4B3TF 2V4JB 3GFXA 1SUQB 5F41A 2NLWA 2D3OR 1NSPA 3DCAA 4PQUA 3VTIA 3MM9B 3VAKA 1RABB 3CUNA 4I64A 3TP2A 3R5CA 1E6YA 2HQDA 4MIBA 3TVZA 3DHXA 4PG7A 1WD6A 1UFLA 1D9DA 4KTQA 3HSDA 2MZJA 3BDPA 1KQSR 1H7XA 5F8IA 2BA9A 1RU2A 2BQ3A 2YPZA 1HL6A 2XZTB 1IBMF 4KQZA 4M5DB 1T02A 5L8RC 1ULRA 3DLGA 1L3TA 3L95X 3MUTP 2C2NA 2HFZA 5J2MA 1YLXA 1WNEA 3AXMA 4LF9F 4OZ0A 4UUXA 1Q82T 1SV5B 2CPZA 4NXNF 1NKCA 2YKAA 3DLKA 3BSOA 1GMWD 2ZE2B 2ZVSA 3IWXA 2H48B 2D1CA 2ZH2A 4A4JA 4C0BA 4G1IA 2MZ1A 3O6QA 3V5RA 1NKBA 2DISA 4ANEA 2NR0A 2C3YA 2GVDB 4XPEA 3PO5A 3UD3P 1M5VC 4NLUA 2CPFA 1BHNA 4C8ZA 3KWMA 1UPMB 1DTTA 1YRXA 1YTYA 5F3ZA 1QAYA 3DXSX 2M70A 2VFVA 3C16B 3PKYA 5A6PA 5A8WB 4U7UK 3LP1A 3OSPA 4F7VA 5KFKA 2YX4A 3X3UA 3OD2A 2FY8A 2VPZB 2L3MA 4U9RA 3BB5A 1TL7B 3D28A 3DLEA 4URGA 2HHPA 4L3KA 1X0FA 1LKZA 3UR3C 4CTAB 2NUUG 5LOQA 4GKJJ 4OJ3A 1XR5A 1SL2A 2XI2A 2H5IB 1HBOB 2OKQA 2RKIA 3J80Y 3QZ8A 1YJUA 2PI4A 1JLFA 3M2VB 4ZHRB 4Q44A 3HSGA 1ZTTA 5KT3A 2QEXS 1OQ3A 2A18A 4MKYA 1KQGB 1HIYA 4DN0A 3DU6A 2HQFA 2VODA 1VC5A 2UVWA 2MXYA 3QT8A 4F26A 1UWBB 4LMZA 5KFJA 4CLKA 2JNJA 2W2MP 1S6QA 4JV2A 4MFBA 4YR3A 4ZIVA 2JEFA 4GO5X 1MSWD 1C1BA 3GV8B 3LGMA 1ZAWA 3N6NA 1R43A 2RILA 4V1Ak 2EBEA 2XYGB 1RT1B 2PDAA 4GO7X 2WVCA 2BYCA 3CDUA 3ONQA 2R7OA 3H5UA 1B4SA 1HWLA 4OHWA 2DGOA 4QWAA 1YHQS 2XEXA 1HWIA 3ZTSA 3M8RA 2VQEJ 3JYTA 1MNEA 1NXIA 2W2OP 3W61A 3D54A 3LWLA 2VFSA 1TL7A 1HLWA 4ECRA 1D3WA 1NO8A 3RB4A 1OYEA 5DJBA 1XR6A 3NL0A 5D15A 1RYRA 1WACA 4FKYA 2XLIA 2FVPA 2V8GA 2ZJQQ 1JNZB 3MM5B 5KT6A 4JI5F 2B8PA 1LWFA 1X5OA 1Y11A 4Q45A 4M5MA 1CPZA 1REGX 1Q79A 2MLZA 1RZMA 3LAMA 2YVSA 2ZUGA 4FPIA 4C98A 1WEZA 2LP4A 5CD4A 1UWBA 3B6BA 2ZM6F 1HI1A 3NS5A 1V3SA 3DMJB 4I1TA 5LMUJ 2IDLA 4ZOSA 3ZFVA 4ZVGA 4U8VA 2IBOA 5CYMA 3LAKA 5ETPA 2RU9A 2FD2A 4NA2A 1B0TA 2YBVA 2I5JA 2KRRA 3GFYA 5KFIA 3S8SA 1RWOB 5GAHU 1HHSA 5BJRA 1OIAA 1YIJS 4ZP7A 3U7JA 2E9TA 2WSCC 4B08A 1N33F 3MHYA 2Q43A 2E1CA 4R5PB 2K8GA 5DG9A 3RBEA 4A8SA 2XLKA 4DV3F 1FFGB 3HD2A 5C2CA 2IJRA 2AJ1A 2V34A 1AYEA 2BABA 4DU8A 4I7FA 4MKBA 3W7BA 5HP1B 2DJWA 5HK4A 3FFIB 2B8QA 2DTJA 4F04B 4HTJA 4CO4A 2MJNA 3QGHA 3CWJA 1T9XA 2MQNA 3M6UA 4JI8J 1HQUA 5H9EK 3W2VB 3CD7A 1KVJA 3MM5A 2G0JA 4EZ6A 4DR5J 4WU3A 1RAAB 2YY3A 3IN5A 4DFJA 2LXIA 2RF2B 5KFBA 2LLZA 2JLEA 3P45B 4ZPAA 5HBMA 2AEJA 2DVIA 4F8RA 2CQDA 4WZQA 1NJXA 3R5BA 4LF6J 3V4MA 1FX2A 3DMJA 2AJFE 1G2EA 2VDHA 1PSDA 3OJSA 5M2PA 4PR6A 3TVKA 1SJ1A 3C66A 3QSIA 3I5CA 3AOBA 3QT6A 2DO0A 2P6TA 6AT1B 2ZBQA 4UY8T 1VIXA 3DGVA 2CWKA 4C8YA 4OZNA 1MLAA 1FI4A 3AJ1A 2UXBF 2XS5A 3LOUA 3TJ9A 2CFXA 4CWBA 3L3CA 4DCPB 3IRWP 2RQKA 4LF1A 1S49A 1TKDA 4QIWD 3JSBA 4JI3J 1KS2A 2A6OA 3OR1B 5HATA 1F5CA 1TUVA 2HRUA 2IIHA 2ZKTA 2UXDF 4P71A 1VBXA 3FFIA 3CCLS 3FEZA 1FJGJ 2IYGA 2F8HA 3CDEA 4DCJB 3MGJA 4DR7J 2W2NP 1MW7A 3FVYA 1VR6A 1TKZB 1SIWB 5F8LA 2LEPA 3AHPA 4QWBA 1QM9A 2XBPA 2R7QA 2AGOA 3SDEB 1T05A 2M4MA 3K57A 2J9DE 2ZD1B 1T8EA 2E1MC 4RNNA 2K2PA 2AZ1A 5LXRA 3CIZA 4CLZA 1GXUA 4CM2A 5HMZA 1YVFA 1XERA 5AE3A 1U1NA 2CJQA 3TAPA 4KR0B 4NLRA 4AXIA 3PVXA 3C46A 3VGVA 1U0HA 5KG2A 2DY1A 1HYSB 1P8GA 1RTIA 1GEHA 1YX2A 3OSNA 1IXKA 4HACB 4J91A 2BKOA 1S1TB 1CQMA 1N8RT 2D3O1 2OUGA 1HWKA 3J7AN 3W9HA 3R7BB 5KG5A 3FSXA 5KFLA 2W24A 1RT4A 2GFFA 4RUHA 3GCWP 2D3ZA 4NEYA 2E7XA 3OR1A 3GR0A 4WCEQ 2JFDA 3MWBA 1RLDA 4KGMA 5HJXA 4HI2A 4ZCMA 3R7NB 5K8MA 5B7WA 3R2DJ 1OPZA 3KDOA 5AXLA 3FC9A 2MB0B 1N5QA 4CO5A 1V5VA 3BO4A 2V9KA 4YDXA 3DI6B 3M30B 1KTVA 4BC7A 3C2PA 3Q8RB 3H8YA 2VFRA 1LWCA 3NBPB 1O6XA 3T5LA 1X31C 2G0CA 1IWAA 2PA3A 2CZ4A 2KDOA 2IMOA 1RTHB 5LMNF 1VBZA 2VC1A 3EX7B 1JLAA 4K50A 2KM8C 5DM7Q 2YWKA 2QLWA 2KZMA 1N34F 2GA7A 2OP5A 2QG9B 2ZBRA 2W1BA 5C24B 3CEDA 3BM7A 3CMQA 4OJGA 4F3MA 2DHAA 5KFHA 5FLXY 4HH0A 3VAFA 2G4BA 3ITHB 5K14A 1TV6A 3BSCA 1SBRA 1B64A 1C1CB 4F0HA 5FDLA 3GP9A 2EFVA 4P7VA 4UF4A 3HVTB 3M32A 1TL5A 1DQ8A 4OLOA 4WK3A 3ZZ0A 2B5JB 1S59A 2LQ9A 1RQ0A 3D67A 2XMMA 3M2UA 4C11B 2PGCA 2W9AA 2HAIA 1TL1A 1YJVA 5EN1A 3J80U 3E01A 3ETOA 2V8VA 3EGWB 4DV4F 3AB2B 4UTGA 4YY3J 2VG6B 2G0IA 4PG4A 4CYUB 5HVFA 2DGUA 3BYPA 2DBBA 3SFUA 3I55S 4AL5A 4NLGA 1WHVA 5IC6B 4TY9A 5CA5A 3KJVB 4NCBA 1LXNA 5HVHA 2RQ4A 2N4DA 2WK4A 3GFHA 5A2QY 3PCOB 4C3LA 1U47A 1OYDA 1H6KX 4DFKA 4C7QA 2CNNB 1MWZA 2NXCA 4KHPF 2BEFA 4ICLB 1VRTA 1BQNB 3JQMA 1MG7A 4LVOP 4JI7F 4OZ2A 3M8YA 1RTDA 4J9LA 3HFZB 3ET6A 4HI1A 4BS2A 3PIPQ 2W4CA 3G8TA 3K5PA 1VLOA 3WC0A 1TL4A 1BXNA 2IA0A 4RU9A 2ZBCA 2MY8A 3KK3A 2GHPA 3KK2A 1Y5LB 3H4BA 4L3NA 4ZDNA 2RDDA 3AODA 2XM3A 1URRA 3G8QA 3T1YF 4WZMA 5DETA 4AT1B 1UVMA 1U1LA 2DXDA 2E5HA 1HWJA 2LQ8A 7FD1A 5F3TA 1VHFA 1YRUA 3HHLC 3MR3A 2HHTA 2AEMA 2VIHA 3CDAA 5KT4A 1ICEB 4USHA 4QJVA 4OI2A 2CJAA 2QMUB 2BOAA 2YWHA 2IVFB 1PYSB 4A8QA 4DQQA 4DQSA 2UVVA 2UU9F 4TY8A 2CJKA 3KLFB 3VV2B 1VMBA 2DKOB 2O67A 1TAQA 2EW9A 5I3QA 4ED4A 4NLDA 1O51A 2MKYA 4PEOA 4ITSA 3RU0A 3CJ4A 1LWXA 2RVJA 3VZIA 3RW7A 2K1RA 4WYWA 3PKMA 1X60A 1P1TA 2ZHOA 4QYZK 1VQ9S 1S5ZA 3G71S 1NCLA 2KL8A 2QYCA 1S57A 2BOPA 5GAGU 3MMCB 2X1FA 1BY9A 1RAIB 4ICLA 1NBEB 4OZJA 4P7TA 3NNHA 2UUAJ 3D3CJ 2CQIA 1FRJA 2H5EA 2KM8B 4KGVB 2M3DA 3MM7A 2C3OA 4DR2J 3P4UB 3V6HA 2E5LJ 5E3QA 2WVDA 2ZNZA 1S4FA 1KR4A 8RUCA 1R0AB 4EYIB 2GNKA 2QLBB 2O01C 1XNRJ 1N54B 4LSNA 5DLGA 2CG4A 1JLBB 2ZUAA 5L46A 2KFZA 3EZOA 3DM2A 4DF8A 3V6KA 3OVBA 1BQXA 1WHYA 2D9OA 1C2PA 2IRXA 1T9WA 1ZPVA 3QGGA 2B51A 2KU7A 4N41A 1U48A 2GS8A 5ETNA 4WP8A 2XMAA 4KBIA 3G6YA 1JNRB 1HKAA 2B43A 4DSIA 5AXMA 2J0QD 4ID8A 1LV5A 2RB7A 4IFVA 3NMRA 2VA2A 5GMEA 4ZVTB 2OHDA 2LMIA 4Q0BA 3OTOF 3JTPA 1WJ9A 2H65B 2HNYA 2UUTA 3PRDA 5AE1A 1CS4B 2OD4A 1GT8A 4TN2A 5KFWA 3N01A 2GZOA 3L4BC 2JWNA 2W2PP 2V4QA 3BF4A 5D3GA 2RAQA 3EM1A 3EGVA 3K58A 2OMOA 1SKRA 4JV1A 1QY7A 3I0RB 4AUKA 1IJEB 2YWEA 3RBZA 4B3RJ 3QIPB 1RTZA 2W01A 5IC4B 3BKFA 2GW8A 4I69A 4IKAA 5A0YA 2RHSB 2BX6A 4CLFA 1OY6A 4K7QA 3OTCA 4W90B 4N77A 2GCFA 3MEDA 2AWZA 4OI0A 4ES3A 4DR3J 2UUBF 1TAUA 2AJQA 1NJZA 5J1EA 2YQ1A 4QIGA 2XO7A 1U45A 3THPA 3NY0A 3GJTB 3MPWA 4UOGA 2SXLA 1TVRA 2QX0A 4K4XA 3HHLB 3M6WA 3M2RB 1F2HA 3JAMY 5L9NA 2QSWA 2I0XA 3GFZA 2YNFB 5I42A 2ERRA 3MFIA 4NXNJ 2AJ0A 4DX5A 4X65J 4PG8A 2E5IA 1LW2A 4JI0J 1DBDA 5I3PA 4N47A 5BYQA 4ZLNA 2FJDB 4LRDA 2KYXA 2GHVC 4H4MB 4A8WA 3CCZA 2WHOA 3NWGA 4I0WA 2MQOA 3JXOA 1R0CB 5L39A 4JV5F 4ZS6A 4FF1A 4DPWA 5KFYA 1MU2A 3T3FA 3HJVA 1S1UA 1ZAXA 4YP3A 3MM8A 4UOHA 4YMEA 2AX1A 2MZQA 3R5GA 4B9VA 1AT1B 2HNDB 2F7VA 2Z2LA 3VALA 2CNLB 5KFQA 5H9FJ 3KHRA 1KN6A 4WKRA 1RXOB 1CC8A 4OX8A 1PJ5A 2K06A 1RAEB 1J5OA 3C6UA 3MECB 2MZSA 2BBEA 4H4KA 2BVZA 4FPRA 4DV2F 3HULA 3IM9A 4WIQA 5HI7A 1XNQJ 1S9GB 3BH7B 2HQ3A 5B0BA 3PFOA 1NHUA 3DFEA 2AV5A 1XMQF 3CCQS 3MXHP 2NXNA 1TP7A 2HBQB 4FF3A 3A13A 4WF9Q 1FJCA 1GAOA 4RBTA 2OPRA 3ZZPA 4DS4A 2HVHA 3RRKA 2V50A 2Z2ZA 3RZAA 4DR1J 2DITA 1WF2A 1M5OC 5IQQA 2FHJD 5DDOC 2O5DA 3QLHB 1FNMA 1R8CA 3OR2A 1FFWB 1N6QA 2E1RA 2UV8A 3EPIA 4BHQA 4RNMA 2CYYA 3KLEA 3M1VA 4DSKA 3BGLA 1FE4A 4F4ZA 2A6MA 2APOA 4K0KF 1M1GA 1EHWA 2ADCA 4A48A 4M5NA 1FKOA 1HPZA 4MH8A 3T1HF 3KOAA 2MHNA 3IM8A 4JI2F 1HQEB 4ZVQB 3F41A 5LSRA 1NLKL 4EO8A 2CQ2A 2K3IA 2PMHA 1Q1KA 1NNDA 1RAJA 3CCWA 2AP6A 3CJ2A 3QWUA 1IKVB 2FJVA 5FIIA 4G1QB 4LIRA 3R8YA 2QT7A 3M7VA 5D4NA 4OIXA 2NXUA 2JDJA 3ILLA 4L6V3 4K2XA 2HYIB 4KFBB 1I5OB 4DR4F 1ZM2A 4M63A 3K8WA 5A2QU 3LP0B 2VJVA 1PC4A 4RUCA 5KFXA 3RW6A 5CZXA 4ZCLA 1C0UA 3R5AA 1S77D 5JUMA 3GPAA 3FUYA 1IM4A 3LALA 4LFCF 1ZOTA 2B4UA 3NCPA 2QC3A 2ACYA 3BKTA 1HR0J 2NQPA 1LK5A 4EU0A 2M52A 3B4MA 2HEKA 5F0UA 2Z4PA 3NS6A 1K0VA 1HD1A 2YWGA 2PC6A 4P2SA 3F73A 1VHIA 1W2IA 4EO6A 4K5RA 5HQMA 2POKA 1I6JA 1RHQB 3HHLD 4TYAA 4F0MA 1AUSL 4FNHA 2Z2YB 3NKYA 1YBTA 5F8JA 2IBKA 3GJQB 5E3PA 2R7TA 4AYBD 1BQMA 2MJUA 3CCES 3BGFA 1VRUB 1VRQC 1GX6A 1PC5A 3D6FB 3EE3A 5IT9Y 4WXWA 1S1WA 1X9SA 4WE1B 1IKVA 3PEJA 1U8SA 2CDRB 3AD8C 1D09B 1VISA 4RW4B 4JI1J 4F4WA 3NGDA 3VWSA 5T41A 2LVWA 1T9VA 1WG4A 4J7CA 3EVOA 1QTMA 2V68A 3HK2A 2W25A 4G65A 2VL1A 3CCVS 1MROA 2BJ7A 4IRKA 4B9UA 2YNHA 3PW0A 1S6PB 1SQGA 1VLYA 2RE1A 4CNZA 2HZCA 4ZKAA 3VZHA 4DUTA 2ZDPA 2RJZA 1WHWA 3FBBA 3RGIA 4Z7CA 3VCDA 2FGOA 1S9EB 1GH8A 4RL1A 1N48A 1SH0A 2MQLA 3AFGA 3PX0A 1WWHA 1FTCA 2XQCA 1SJRA 4FXVA 2COLA 2V2ZA 5D6GA 2E44A 4AL6A 2I2YA 2I8EA 4ZK7M 1R3NA 2W7AA 2HQGA 4IDKA 1JB0C 1FXLA 2BW2A 3UI3A 2AYMA 1FTRA 2DGSA 4ELVA 5GVQA 4IFYA 2IM2A 1UFKA 1I3OB 2AU0A 1KTQA 3MR5A 5KT2A 2XS7A 2OIHA 5EWGA 4DV7J 7FDRA 4UOCA 1I1GA 3ADAC 1X4AA 2AMCB 4M5LA 3HVAA 1W25A 4B3SJ 3TOQA 1UEKA 4RW9B 2LEBA 3QO9B 2DD8S 3TZYA 2B3TB 1REVB 1NMEB 3SMZA 4DL4A 2D9PA 4GKJF 3SQGA 3F56A 2V69A 4RJVA 2RD5C 3TVYA 3JSMA 3DOMB 4KGXB 4LSLB 4ZPTR 1G6BA 2LXUA 4NE9C 3I31A 5F8MA 3H42A 1SQEA 2X1BA 3L7OA 5IM0B 1B0VA 2Y0SD 3CO0P 4K5SA 4PG5A 2R8IA 4QR2A 3SCKE 4BDPA 3HT0A 5C25A 1SKUB 3MI7X 4URSA 2VPYB 1HHQA 4ZLJA 2V4RA 4X4QA 1Q53A 2LDYA 3DRXA 2VPXB 2DO4A 2ZH7A 2MZRA 3FCWA 3J7ZT 4X4VA 3S6EA 4CNYA 4X66J 2GO9A 1K73T 2DCLA 4DV5J 3AA9A 4IR1A 3I6PA 1H72C 4QU6A 3KG1A 2QFJA 4BC9A 5C42B 4C9DA 1AFIA 4KV8A 2ZOFA 2B9WA 2GJIA 1L3KA 3AB4B 4CLYA 1KKHA 3MR2A 3AD9C 1KSPA 4OX6A 2Y8WA 4QW9A 3B8HA 2EK6A 3A8KA 1R7IA 2VOOA 1RK8A 4JYAJ 4G3IA 4I68A 2NXEA 4P10A 1NPKA 1DHMA 1ACMB 1XJWB 3A3OB 3BN4A 2ZH6A 4QOTA 3KNGA 2VQEF 4ZP9A 2WW8A 3GIKA 2QRRA 2MYFA 1Q8BA 2M5YA 1N56A 3EDRB 1VQKS 4ELUA 4W98A 4DQIA 2MTLA 2E1PA 4KHMA 3QO9A 4G6VB 3H2UB 2YKOA 3KLVA 3T9ZA 1NK5A 3MR7A 4O0IA 1JK9B 3KJFB 3BGUA 3G82B 5SUHA 1U2CA 3R1HA 4EBDA 3V81B 4DUZJ 3BYRA 1ZYQA 2GC8A 2I1RA 3GIIA 4ZJOA 1SKSA 4GC6A 3V4IB 5LMNJ 2YX7A 2R8GA 3OUYB 3R27A 2D69A 1RWWB 1IKXB 2JX2A 2Z0GA 1X4HA 1N34J 2R2UA 2E1AA 3BBFA 3IWLA 2CDQA 5LMUF 1L5UA 3PEHA 4NLTA 3Q24A 3HT3A 1LEOA 3HM9A 3P6YC 5CCMA 1NU4A 2QE5A 2ASJA 1SL1A 3IC1A 4DV1J 4AE5A 2IM3A 1NSKL 2EG1A 4NEZA 1TTHB 2QIFA 3THTA 1N32J 1RHMB 3PW4A 4HH1A 3NP5A 2F9DA 4DMZA 2B4OA 2IA6A 2J6UA 2ILZA 1S7HA 1S1XA 2MKJA 2UVUA 4QIFA 3Q83A 3PW5A 4H4KC 3I82A 3NGKA 2MMYA 3VAMA 1CULA 3A1YG 4JI8F 4IYQA 1FX4A 4PPZA 1UEVA 4KT0C 3RJMB 3GG1A 3K59A 3V81A 2CA9A 4DR5F 3HO1A 2VQFJ 1Q78A 2FHKA 1NSQA 4KHPJ 2CVIA 3CCRS 1XBWA 2HQIA 1TMJA 4I2QA 2IJNA 3EWGA 2DGVA 3AD7C 2CQHA 5KT7A 1LW0B 4C6AA 4NI2A 4LF6F 4D3GA 4WYLA 2QMXA 2IYIA 1PAUB 3UVJB 4GVLA 1JKHB 2DXEA 1DURA 3VVUA 3QSYB 1RT2A 5DM6Q 2YNGA 1S48A 3I56S 1VQ5S 3ISNC 1SB6A 4LFAJ 1WEXA 2YXLA 1QUVA 3LF0A 2J8SA 3JSYA 3PYDA 4LR7A 2ASYA 1CSJA 2Y1IA 4P73A 2C2ZB 1XIQA 2FLLA 5G0RA 1CEZA 4JI3F 4ZLLA 5LJ3Y 1IN0A 1HMVB 3KHGA 5D0HA 4OYWA 2J9CA 2GVZB 3PV8A 3C19A 5D77A 4OL8A 1RBAA 1FJGF 2KXNB 5E7OB 2F1FA 4KPCA 5HMXA 2ATLA 3MMJA 4DR7F 4BWJA 4N8NA 1S0MA 2HIQA 3GILA 3LO3A 2DRAA 3TJ8A 3E2EA 1CLFA 2RRNA 4DL7A 4BWMA 3HHDA 2R2TA 2HMIB 3BSNA 2JLFA 1ITPA 1I94J 3AQOA 3DGPB 4WFYA 3DOKB 3PFEA 1K0TA 1YK9A 3TRGA 1D1UA 1JKHA 4FNIA 2B7BB 4DV6J 3HX9A 4JI4J 1RT5A 4R8UB 2CUYA 3SIPB 3R1LA 2HVZA 5ADZA 5IT9U 4HL9A 3PXGa 1D0EA 1AROP 4F36A 4MYTA 2CNOB 5AJ3J 3Q86A 2JVRA 2N7YA 4OZ3A 4CLPA 3B82A 1RUSA 4QCLA 3UO0A 1U2FA 2E9ZA 3DRRB 2YNIB 4H4OB 2VG7B 3ZTQA 4KGZB 4EWTA 2HS0A 3NNCA 3OT9A 4LF7F 1HW8A 1EB0A 3KNAA 3DRYA 3I5AA 4J90A 2R7RA 1SH3A 4MYUA 5CAAA 4DL6A 2F5GA 2DNPA 3DDKA 5LL6d 1DQAA 2HWHA 3GQCA 3H5YA 4CH1A 5B0GA 3OXGA 1IR1A 1KWMA 3N6MA 4DFPA 1RCOB 4J9RA 1IKYB 1AW0A 4Q2LA 4K4TA 3IGNA 3W2WA 4LFBJ 2MGZB 1J27A 3SYZA 1IQTA 4Z2XA 3QYYA 3SBMA 4ZMMA 3IR6B 2OAUA 3FEYB 2WSEC 1ZZNA 3OW2R 3MM6B 3CDWA 4IG0B 4RW8B 3RYLA 1IBLF 1N5TA 2EEYA 3QPIA 3PX6A 2AF6A 1HBNB 4NYOA 3WC2A 4OHXA 3UN5A 1MN7A 3Q0AA 3FBCA 2GMJA 1CJUB 3U02A 1JXVA 2D74B 5IFMA 1C0TB 4YB5A 3QAEA 4U7CA 2YKNA 2ROGA 1YBUA 2BQUA 3HJFA 4DLGA 2R42A 2W9CA 1TKTB 3QGIA 2KO1A 1LWEB 4YY3F 1AXQA 2NS1B 1KONA 3GR1A 1O5JA 3KTQA 2DHGA 2HNZA 3NWRA 2C2RA 3DLLQ 1KHWA 2JEGA 3ZNUA 4F25A 2PIIA 4ZPWR 4YQWA 3HP6A 2ZC3A 1RU1A 4MMOA 5BR8J 3UNGC 3MR6A 2MGZA 2X3GA 5ETQA 3C15B 2RH3A 1ZS6A 4DEZA 5KFZA 2PI5A 2VH7A 5DZ7A 4CP5A 3D1HA 2WVBA 2HVIA 1N5SA 1WORA 3MM6A 1K1SA 3SSQA 1KLMB 3M8PB 3K2YA 4IG0A 4ILLA 3P96A 4RR5A 1UL3A 4CLUA 1IVZA 2WOMB 2B7CB 4CM0A 3A4TA 2CJ9A 4J9QA 3DYAA 4XIUA 2MLYA 2J8AA 5HMYA 3KYLA 1OS5A 4CO1A 4URQU 3OPKA 1RI7A 2F8MA 2HSEB 1Q7YT 1RWPB 4PXEA 4KO0A 2MQ8A 4QZVB 1TK0A 1YKWA 4J9NA 2BRKA 2DNHA 3KKFA 4ECZA 4Q8EA 2BKNA 4ZPBA 3T6JA 3S01A 1TKTA 1CG2A 3PTWA 3T1AA 2CQGA 1R8BA 1R27B 4XK8C 1CJKB 3DOLB 5CZVA 2KTQA 3G9CA 4DF4A 4RU2A 5A76A 1HNIB 2HG4A 3O44A 4DWIA 2OPQA 1S6UA 3U1LA 3IP0A 1VJQA 4C8MA 4F2RA 1HBMB 2VC0A 5ETVA 3D7SB 3G87A 3CJ8A 1WC0A 4ETXA 3PR5B 2JLGA 3MEGB 4DXLA 1B7FA 3MAHA 3U27A 4C8LA 1HNVB 2W8LA 1OSCA 3NGSA 3TO8A 4EUVA 3MFHA 4LVNP 3JQKA 3ZC4A 2IAJB 2FJXA 3M8PA 3MD1A 3MMAA 4J9KA 2UUAF 2Z56B 4K0KJ 1QSLA 3MAAB 1F1BB 5D4LA 1X9MA 3PM9A 4LF5J 4DR2F 2DNGA 1XN9A 4J9SA 3JTOA 2HKEA 4OI1A 2E5LF 4CO0A 1U7LA 3TR5A 3IG1A 1GMWA 5J1NA 2HBZB 1GQEA 1AZSB 3KLGB 1JLQB 1UAWA 2J5AA 4USUA 4N8OA 3OTDA 3K5MA 3QIDA 1XNRF 3IFEA 5CYQB 1K1QA 4NLOA 1FNXH 1TU0B 4USVA 5H9EJ 1FWLA 3LGNA 3FMWA 3HSZA 2R9LA 3UDLA 2R4FA 5J2PA 1FK9B 4I6WA 2LEAA 1WG5A 4QR0A 4PQAA 4F67A 3A3PB 5B09A 2UXCJ 3HHNB 1IM6A 4J9MA 2DR8A 2EWHA 2G1DA 1KEKA 4Y2KA 4UQGA 1UP1A 1EETB 4YR0A 4ED8A 4GRSA 3KLIA 5C2GA 2VB6A 2FZGB 3H5SA 3ISND 2Y0BB 4NCGA 2R8KA 3TUZC 2OH2A 1R6YA 1U1KA 2DNYA
chains in the Genus database with same CATH topology
4QPXA 1JLBB 2PE8A 2IMWP 5A8KB 5EDWA 4QWDA 2V8DA 2FJEB 4DSJA 2KFZA 3CC2S 2H9ZA 3DM2A 3LQVA 4DF8A 1JIHA 3V6KA 2PEHA 1M5SA 2DH7A 3HFKA 4KFBA 1RT4B 3OVBA 1BQXA 1RT7A 4F2SA 4KGKA 1WHYA 4IG3A 3GIJA 1K9MT 3PIOQ 2IAJA 2D9OA 1C2PA 2B6AA 2IRXA 1NJWA 2VFTA 1ZPVA 3CJKA 3QGGA 3BQ1A 3P49B 2B51A 2KU7A 4N41A 3LP0A 4NA3A 2EFPA 1U48A 2OPSA 3VAGA 1KHVA 2DGWA 4A46A 2RS2A 4O3RA 3DRSB 1X5PA 2FVRA 4KBIA 1JJ4A 3G6YA 1JNRB 2QSFA 3NAHA 2QV6A 3MEEA 2B43A 3TA2A 5DDQC 4DSIA 3G6XA 3RR7A 4ILMA 5AXMA 2J0QD 1V9OA 1XC9A 4B3RF 4O3OA 2XB2D 2G9OA 4QYRA 2P9EA 4R25A 4EYHB 3MF5A 1N5YB 3M6VA 1H98A 4ID8A 1S97A 2I9SA 2RB7A 1LV5A 2JJ4D 2P9GA 2PFFB 1ZAVA 1Y9OA 4PXCA 4IFVA 3NMRA 2VA2A 2BV3A 4FS2A 4NLXA 1S1VA 2DGXA 2LMIA 4J9PA 3TW0A 2ZH4A 2C2EA 5FJ4A 4PWDA 5DDRC 4Q0BA 3OTOF 5KFMA 3JTPA 4MK8A 4P6QA 5EUHA 5IXUA 2DB1A 3TQ1A 3DLHA 4LQ9A 2EI5A 2HNYA 2MKKA 2UUTA 4IOAQ 4IQMA 4K4VA 2IC3A 4J5OA 3PRDA 2RUGA 1JLQA 2ZH9A 3TAMB 5AE1A 2YKPA 2OFHX 2OD4A 4DR3F 2B0GA 1VQMS 1GT8A 2XMWA 1HBUA 1EP4B 1FO1A 2PN6A 2R2SA 1Y7PA 3PW2A 4ELTA 1LWCB 3CTRA 3J81Y 4TN2A 5K9FA 1TFWA 5KFWA 3IXQA 4DDFA 3N01A 2YKNB 2LQBA 2EFGA 4Z37A 2JZ5A 1D8ZA 2AGQA 4FZVA 5KG1A 2JWNA 3H4DA 2D7SA 2QA4S 2V4QA 5J2QA 1UKUA 1KOHA 2FVCA 2WBMA 5E33A 1U1OA 4GC7A 2VBWA 2AU0A 1UETA 3BF4A 5D3GA 1VBYA 3MPVA 2W9CB 2VG5B 4N76A 2C2DA 1JLAB 2EBGA 4NZ0A 3K58A 2OMOA 4ECUA 1SKRA 4JV1A 4FBTA 4I2PA 5HLFB 5IFMA 1QY7A 3I0RB 4AUKA 1IJEB 2DRBA 2AJ4A 3KK1A 3GWCA 2JH3A 2YWEA 3ICLA 2D41A 1APSA 3G96A 4YFUA 3OFHA 4X65F 3QIPB 2ILYA 3BQ2A 5JJBA 3LH2S 4I69A 2GW8A 4IKAA 2HNZB 2ZH5A 5A0YA 4AL7A 3CPWR 4I6YA 2VBZA 4FP9A 1NEEA 4JI0F 3KMQA 2HPUA 3HXMA 4HEA9 2C42A 4O3PA 1VRUA 3OTCA 5KFNA 4W90B 3BSAA 1Q4RA 1FKAF 4YR2A 2PT0A 4N77A 4Q43A 1QSYA 2FVQA 3IR5B 2FIUA 2GCFA 2ZDOA 1RT3A 3ZZZA 3CCUS 2K7JA 3MEDA 1U26A 3RB3A 2KFNA 2AWZA 5K14B 4OI0A 1TV6B 4WE1A 3J7Z5 4ES3A 5HL7Q 2UUBF 3FMBA 1TAUA 5FDLB 4B3OA 4DLEA 2JHEA 4QWCA 2AJQA 2ZITA 5CQGA 1NJZA 3HLUA 4HVZA 5E3AA 5J1EA 3W3SA 4QIGA 2XO7A 3M32B 5I3UA 1U45A 3THPA 3VAIA 4XAKA 3OBIA 4RW4A 4TU8A 1DTQB 4AQYF 3I0SB 4ZP8A 1FD8A 3MPWA 2SXLA 2L9NA 1G7CB 1TVRA 3M2UB 5T7LA 4DL0C 1TK8A 2VFUA 4TU9A 4K4XA 1TL1B 3HHLB 2F9JA 3CD5A 3HF5A 3M6WA 4XDDA 4ED2A 2C22A 2G13A 3HVRA 4WXOA 3M2RB 1OQ6A 3GV7B 1W2BR 3E01B 4DSLA 2V4JA 2R7XA 3KMSA 1SUQA 4ID5B 3JAMY 4O44B 2FVSA 5L9NA 2E5JA 2J6TA 4OX9F 2QSWA 2WBRA 3DRSA 2I0XA 3GFZA 2YNFB 4PXBA 5I42A 4B02A 1F60B 4B9LA 4NZ6A 1SKWA 1D8YA 1OSDA 3MM9A 4DL5A 2ERRA 3I96A 3MFIA 4NL5A 2AJ0A 2PO4A 3DYAB 4RNFA 1S6PA 4PG8A 1JJ2R 2E5IA 3FSIA 2FDNA 4N5SA 1LW2A 3OFEA 1DBDA 5I3PA 3N28A 2GIQA 2B4VA 4N47A 2IRYA 5BYQA 3SV3A 2HHSA 4ECSA 1NKEA 5L1KA 2FJDB 3D2WA 4Q7AA 2KYXA 2L9DA 2VUGA 2GHVC 3AH6A 4NLYA 4ED5A 3NAIA 2MKSA 2RMLA 1S9EA 4H4MB 4A8WA 1P9QC 3GIMA 3CCZA 2CQCA 2IHR1 4ZCIA 2WHOA 1URNA 5BYSA 3MZIA 2XMKA 4KO0B 3NWGA 1WELA 1V6HA 4B9MA 3NG8A 2NUHA 1U1QA 2CQ3A 4I0WA 3MCSA 2MQOA 1OO0B 2JRSA 3DC2A 3N79A 2CJBA 3IA0A 3QMQA 3KLHB 4C3KA 5DLFA 1U1RA 4IO1A 4K4YA 4M5DA 4IH6A 5GMKa 1VQSA 1TK5A 1L3UA 5L39A 5GAGI 3GZ7A 4JV5F 4PCQA 4ED1A 1VRTB 2NPFA 4RX6A 6FD1A 3THVA 3VAHA 4WFXA 3IS9B 2ZBIA 4ZS6A 4FF1A 5KFYA 1YRTA 1VK3A 1XNQF 1MU2A 1C4AA 1RA6A 4NOHA 2XZWA 4RW6B 2X1AA 5B0FA 3T3FA 2ABYA 3CT9A 1RTDB 1Q8LA 5AXNA 2QA1A 4EBEA 1SV5A 2CQ0A 1HNWF 2NZ4A 3QGPA 1S1UA 1ZAXA 3LUYA 4YP3A 1JXEA 1NB7A 3MM8A 3RAXA 2DH8A 3I4HX 3N6LA 3T5KA 1QSSA 4YMEA 2AX1A 2MZQA 4KSEB 2W9BB 4B9VA 4KB7A 4UUWA 2OPQB 5KG0A 2HNDB 1UFWA 2ZE2A 1FRXA 5L1LA 1LK7A 1GTEA 2F7VA 1TFYA 4B3MF 3KK3B 3CSKA 2Z2LA 5KFDA 1OWXA 4NRUA 3VALA 3KK2B 4DR1F 2GQ2A 2XG8A 2BJDA 5M2UA 4HKQA 3HZEA 5KFQA 2UV8G 4MIWA 3VQTA 1O8BA 5H9FJ 2YTCA 5KTQA 1X4CA 3QWPA 2XULA 3OHBA 3KHRA 2CQBA 1KN6A 1ZM4A 2FLOA 3HKZD 3O1LA 1ZTWA 3RR8A 4WKRA 1CC8A 6FDRA 4X4NA 4OX8A 2ZH3A 2CPEA 3LPYA 1TKXB 2PMZD 1ZPWX 4RW9A 2N7CA 4F50A 2HRYA 1H2VZ 1J5OA 3NNAA 5DDPC 1IQZA 3C6UA 3OXFA 3MECB 1REVA 1UJ4A 3CJ3A 1NHVA 2OO4A 4NRTA 3EPGA 1NZAA 4FVMA 2MZSA 1SXLA 2BBEA 1DTQA 4H4KA 4HDGA 3I0SA 4JUZA 1DFDA 1P1LA 4Q2MA 2BVZA 2KJWA 4FPRA 4DV2F 1WHXA 2EFOA 3KFWX 5HQ8A 2BDPA 2M8HA 4C0OC 1RT6B 2U1AA 2MQMA 4OJ1A 3MMAB 2BUNA 5KG7A 4NZ7A 5HI7A 3DOMA 3CMAS 1XK8A 4CQ1A 4ILRA 4LSLA 1S9GB 1Z1ZA 4ID5A 3QJPA 4QW8A 4KIAA 4Y65A 2HQ3A 5B0BA 3PFOA 1NHUA 1KFSA 3DFEA 2AV5A 2KT3A 3O3LA 4Y0FA 1N4LA 3A8EA 5IM0A 1VQ8S 2EFNA 1Y00A 1XMQF 2GHWA 3CCQS 3MXHP 3EGNA 2JC1A 2B56A 3N5FA 4WFZA 1TP7A 2JVOA 5KAKA 5EX0A 4TY8B 2L41A 4IOCQ 4FF3A 1RGVA 1JWWA 4WF9Q 5A8WA 1JLEB 1FJCA 3TA1A 4QWEA 2KG0A 2KB2A 4LF4F 1GAOA 4RBTA 3POTB 1S72S 2OPRA 4ED6A 3DN9A 2XGPA 3ZZPA 1YBAA 3IG1B 4DS4A 4J37A 2AD9A 3D0HE 3OVSA 3MUVP 2UUCF 1TQLA 1JXLA 4DJBA 2HVHA 4LUBA 3RRKA 4WIIA 4C8OA 2HFNA 3RZAA 2OSQA 2DITA 2WSFC 3M8QB 5IZHA 2NYIA 4E