3NNCA

Crystal structure of cugbp1 rrm1/2-rna complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
175
structure length
175
Chain Sequence
SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords CUGBP Elav-like family member 1
publication title Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nncA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nncA02
2OSRA 2RNEA 2ERRA 2DNLA 3P6YC 1VBXA 3FEYB 3UE2A 3CPWR 2CQHA 2MZ1A 2QFJA 5GVQA 2JX2A 1VC5A 2YH0A 2MKCA 5IM0A 5DDPC 1H2UX 3CMAS 4WFNQ 2KXHA 3VAHA 2DNNA 1KQSR 3BO2A 4F26A 1KOHA 1DZ5A 1ZH5A 2DNGA 1Q86T 5DM7Q 1VQ8S 4CQ1A 3DLLQ 3MOJB 1KD1T 2ADCA 1SJQA 4LJMA 3TYTA 2CPXA 2KI2A 2XSFA 2N7CA 1OO0B 2DB1A 1YJNS 2MJNA 4FXWA 2HGMA 3CCRS 3EGZA 3U1LA 3HI9A 1VQ9S 3CC4S 2PEHA 3TP2A 2LA6A 1UP1A 1FJEB 5D77A 3R1HA 5GMKa 1VQ6S 3CCSS 5LXRA 2ZJPQ 5LSLA 1X4GA 2CQDA 2JRSA 3UD4P 3US5A 2M4MA 2DO4A 3VF0B 1VC0A 1URNA 1QM9A 1VQNS 2XNRA 5LJ5Y 1X4CA 2OTJS 2KYXA 1U1RA 1FO1A 3S8SA 2G1DA 3B4DA 1KC8T 3K0JA 2LKZA 2CPDA 2X1BA 2KN4A 3CXCR 3CCMS 2RS2A 2CQ3A 2A3JA 5IFMA 4P6QA 1PGZA 3JB9k 2G4BA 2DNQA 3S6EA 1FT8A 5DM6Q 2RRBA 1WEYA 2MGZB 2JVRA 2D9OA 2LEBA 3H2VE 5DDRC 1YHQS 3IRWP 2OTLS 2MSSA 3P49B 1X4FA 2MHNA 1FHTA 1U1PA 3BEGB 1HD0A 2RU3A 2MKIA 1U1QA 3EX7B 3ULHA 2LCWA 1OIAA 2HGLA 2DGOA 2MZTA 2Q79A 2EVZA 2CPHA 5GADU 3CF5Q 2DGSA 2VODA 1U1KA 2JVOA 3V4MA 1M5PC 2E5IA 2CQ4A 2MKKA 2F3JA 3MURP 2MJUA 3U1MA 1NJIT 1NU4A 1WG1A 2MY7A 3UCZP 3UWTA 1U1OA 5GAHU 2RS8A 1FXLA 2MSTA 2BZ2A 4M5DB 4CIOA 3UD3P 4Y0FA 2L9WA 2KRRA 3H2UB 2DHGA 1WG5A 4J5OA 1HD1A 2DO0A 3OW2R 1X4HA 2KXFA 5LJ3Y 2DH7A 4YB1P 2MB0B 2KXNB 4IOCQ 3MUVP 1N52B 3S7RA 3Q2TC 1QVFR 2OSQA 1KOOA 2RT3A 2AD9A 3CULA 2XS5A 1IQTA 1ZZFA 2LYVA 2FC9A 2L08A 4QU7A 2DNMA 3G4SS 2MQQA 2X1AA 2CQGA 1G2EA 2OJ3A 2CPYA 2FPHX 2CQ1A 1SXLA 2KHCA 2MGZA 3CCJS 2FC8A 3G6ES 3CUNA 2MQMA 1X5OA 1DBDA 1VQ7S 1BY9A 1PO6A 1WI6A 1SJFA 1WHWA 2KG1A 4WFBQ 1U1NA 2DIUA 1M5OC 2DH8A 4F02A 5EN1A 2YH1A 4UQTA 1VC6A 1X5PA 1VQPS 1N88A 2YTCA 2CPJA 2MY8A 2MMYA 1AUDA 2DNOA 3CMES 1DHMA 2U1AA 5JVGQ 3VAIA 5H1SV 1F9FA 2OIHA 4QPTA 2M7SA 2ZJQQ 2XB2D 4YUDA 1H2TZ 5CA5A 1A9NB 2M0GB 4IUFA 3CC7S 3P5TL 2N3LA 1U1LA 1WHVA 3ZZYA 4C7QA 2NZ4A 2RQ4A 1H6KX 4W90B 4LIRA 2MZJA 1OPIA 2M52A 2I2YA 3CCLS 1UW4A 4RU2A 4PRFA 3PIOQ 3I56S 2AYGA 1JJ4A 1L3KA 1P27B 2MQLA 1UFWA 2DNYA 3THPA 2DIVA 3R1LA 4YOEA 4TLQA 1VQLS 2MQOA 1HA1A 4Y00A 3CCES 1VQKS 2O3DA 3BO4A 3L3CA 2MXYA 2KH9A 3VAKA 2D3OR 3J7YU 2KFYA 1K8AT 2X1GA 4WIIA 5CXTA 3SXLA 2M88A 3R27A 2E5JA 1X0FA 2J0SD 4WF9Q 4A8XA 5HL7Q 2XS7A 1B7FA 1M5VC 2CQ0A 3NNCA 1WEXA 2HVZA 1YWXA 3CCUS 2J76E 1NO8A 2CQIA 2LECA 3PIPQ 2LEAA 1FJ7A 1M5KC 1SJ4P 1M1KT 2MQNA 3I55S 2DHAA 3CC2S 2RVJA 4IOAQ 1R8PA 4ED5A 2M70A 2EK1A 3UCGA 2LQ5A 3D2WA 3UCUP 1U6BA 2YWKA 2DNKA 1WTBA 2DISA 5HO4A 1YIJS 1U1MA 1HL6A 3G9CA 1M90T 2E5HA 2LXIA 2DHSA 1R8HA 2MKJA 5MLCV 4PKDB 3SMZA 2M8DB 3VALA 2YKAA 4UY8T 2E44A 4U67Q 4Z2XA 2QEXS 1WI8A 3RW7A 3B4MA 1WF0A 2DGTA 2DITA 1K9MT 1VQ4S 4CH0S 2G0CA 1D8ZA 5FJ4A 2RUGA 2MZRA 3CCVS 3BO3A 1YJWS 3NS5A 4OZ0A 5ITHA 2KM8B 4F25A 4C0OC 1YITS 2N82B 1Q7YT 3MUMP 4TU7A 2CQPA 2EK6A 2NLWA 2U2FA 2BOPA 2JWNA 1X5SA 4ZKAA 1VBZA 1FNXH 1RKJA 1A7GE 1WG4A 2AYMA 2CPEA 2LMIA 2DGWA 2GO9A 3LQVA 4W92B 1OWXA 1CVJA 1JJHA 1S72S 2CPFA 1S79A 4EGLA 2DGUA 2LXUA 2F9JA 1WHYA 2I38A 1Q81T 2PE8A 5GAEU 3N9UC 4PR6A 1VBYA 4TU9A 2D9PA 1Q82T 1K73T 3VAGA 1XN9A 2MQPA 3VAJA 3VAMA 3Q2SC 1JJ2R 2V94A 2DGXA 1N8RT 5LXYA 1SJ3P 3DXBA 1O0PA 2VONA 3G71S 1YTYA 2MKSA 3SDEB 2ZJRQ 2MPUA 4WCEQ 2DNPA 4CH1A 4C4WA 2HZCA 2CQCA 2DGQA 1X5TA 1WF1A 1ZZNA 2FHOB 2M8HA 3S01A 1WEZA 2DK2A 1VQ5S 2ADBA 3MXHP 1U6FA 3RW6A 3MDFA 3MD1A 2N3OA 4V19X 2DGVA 3MD3A 1VQOS 2CQ2A 2LA4A 4QQBA 2SXLA 2CJKA 1RK8A 2E5GA 5IM0B 1P1TA 1H2VZ 2AYEA 5BJRA 3LPYA 1YI2S 3TO8A 1X4BA 2RQCA 2CQBA 5IQQA 4WFAQ 2DNRA 3G96A 5D78A 2RRAA 3NMRA 4OZ1A 2KG0A 1N54B 1U2FA 3THTA 4FXVA 2KM8C 2MKHA 2VOPA 3FEXB 3HHNB 4ERDA 2X1FA 2CPIA 2K3KA 5DETA 3IWNC 1SJRA 1FJCA 5CYJA 4QU6A 2M9KA 1WF2A 3CTRA 1D9AA 3ZZZA 2AYBA 2HYIB 3VAFA 1DRZA 4BS2A 2VOOA 5DDOC 2DHXA 1W2BR 5JVHQ 2MYFA 2QA4S 1YJ9S 2DNHA 5DDQC 3G8TA 3NNAA 2L41A 4IO9Q 2B0GA 3G8SA 1JMTA 3CD6S 4TU8A 2J8AA 1WWHA 3MUTP 1UAWA 3CCQS 3NNHA 1X4DA 1VQMS 2K8GA 2FY1A 2UP1A 1WELA 2KU7A 3MI7X 2J0QD 2XS2A 2KT5A 2F9DA 5LSOA 3P3DA 2M2BA 2CPZA 3J7ZT 2XNQA 3SDEA 1X4EA 2MZQA 2HGNA 2DH9A 2MZSA 2WBRA 3BS9A 1X4AA 2KRBA 1WHXA 2GHPA 4WKRA 3NS6A 2DNZA 1QVGR 3EGNA 4LMZA 2KVIA 5GAGU
chains in the Genus database with same CATH superfamily
1T03A 2ZKUA 1HW9A 2YH0A 3CMAS 1YJVA 3BDEA 3I9ZA 2FJDB 2E9TA 5DG7A 2J6UA 3MCMA 2CNOB 1OO0B 4KFBB 1VFJA 3RG6A 1S1XB 2ZJPQ 4NXNF 2COLA 1IBLJ 5KT6A 3PXGa 2C3PA 2VFTA 2E7WA 3T1AA 3I0RA 1N0UA 1AFJA 2XLIA 2X3GA 3NXZA 4OX7A 1FWKA 4MH8A 1U6ZA 2AZ3A 1NZAA 3ZNJ1 4RNHA 5J2QA 3P49B 4ZJOA 3EVOA 3OR2A 2AZ1A 1IBMJ 3HHLA 3PX6A 3BEGB 1HD0A 4A8MP 3EX7B 2LCWA 1OIAA 4J9PA 4RUHA 1SKSA 1S9EA 1B99A 3D0HE 1C4AA 4ZCKA 2E5IA 1FKOB 4DF4A 4AD6A 2VBYA 1RGVA 1NU4A 2MY7A 3A12A 3M2VA 3IRXA 4P2SA 2KL8A 2XY7A 1LW0B 4DQSA 4K4VA 1RWKB 1J2VA 3GILA 2POKA 2JNJA 1U0SA 2V4JA 3MAAB 4EEYA 3Q2TC 2F40A 4DV7F 3IBCB 2B4VA 2UXBF 3N5FA 4JV1A 3CDWA 2J6SA 3Q8SB 1HR0F 5EX0A 2ZWOA 1IWGA 4TYAA 4Y28C 3TARA 1X5OA 3MZIA 4Y6IA 4DV5J 3KK1A 3PKMA 1MG7A 1HWLA 2W25A 3AQPA 1UEKA 2P9CA 2G2OA 3V6JA 1HWIA 4O3QA 5KG2A 1WSVA 5J2NB 4IR9A 2GQCA 3ZZYA 1QTMA 1RHMB 2HS3A 3HVWA 3M8QB 5IZHA 3NGRA 3H4DA 2JFKA 3HLUA 3PO5A 4M1KA 1WKKA 2C2KB 5LMUJ 3CCES 3L3CA 3IS9B 5THWA 4P71A 3W61A 2RDDA 4ECSA 5KFZA 1K8AT 4U96A 2CAJA 4RNFA 5HROA 2HPUA 2BYCA 5E3AA 5CZXA 4QWDA 2WK4A 1KVJA 2MLXA 3MM7B 1SJ4P 4FF1A 2JSXA 3DOMA 1RWWB 4ZVSB 1B3TA 1T9XA 4OYXA 2RSQA 3BGFA 3KXDA 1XC9A 3PZPA 1Z4UA 3R5DA 3LP0A 3UCUP 3HHDA 4P74A 1W7WA 2UZAA 2ZZMA 3CDEA 4LF6F 2DPJA 3TWZA 1U1MA 5G0RB 4RPFA 3KUEA 3IN5A 5CHCB 2ATCB 2H51B 3BSCA 2QMWA 2W4PA 4KB7A 1H7WA 3KUHA 3R3TA 2H1YA 3DXSX 4HI2A 1LEOA 1UJ5A 3T5JA 4F0MA 4K0KJ 3HVAA 2DGWA 2VQFF 1U26A 1OWXA 4CNYA 3C46A 4F4YA 1U48A 3TJ9A 1YBUA 4JI4F 4G65A 5M2PA 5L9XA 3PR5B 4DPOA 2IM0A 1OMSA 4XPEA 3KMQA 2O01C 4CYUA 3N01A 1QE1B 1HKAA 1N32F 4DG1A 2MKSA 4X66F 3MEEB 4ICLB 4HHUA 3GIMA 4GVBB 2ZITA 1BC6A 1FKAF 3K17A 1RT6A 4KV8A 2PEBA 2F8MA 2QSWA 4KH0B 4DV4J 3MEDA 1PJ6A 3CJ4A 4Q2LA 5HQMA 2H9ZA 2EFVA 5AT1B 3KLEA 3EICA 5KFNA 3FDSA 4TYBA 3DRYA 3HX9A 4YB7A 2BQ3A 2XEXA 4RW8A 4IH6A 3NNAA 3G8SA 3CD6S 3A4TA 1CS4B 4KKOA 4J9RA 1I5OB 2HHQA 2HNZA 4CM2A 2AJFE 2OSRA 4K4WA 5A2QY 4B3TJ 1NSQA 5C42B 5IM0A 3CT9A 4KY3A 2RUSA 1T9UA 2HQFA 1KOHA 4USTA 1HNWJ 1TU0B 5ETNA 4ILMA 3UPFA 2B9YA 3CCRS 4P2MA 4X62J 5HQLA 1HQUB 2E1MC 4P2XA 5K8MA 3R1HA 2CQDA 1T3NA 4G1QA 4WP9A 3LGNA 4KAIA 1FDBA 4O44A 3U27A 1DTQB 1I1GA 3H42A 2RRBA 4K4TA 2E5LJ 4USUA 1FRHA 4DX6A 1IKYA 2DXEA 2OTLS 2GJFA 3H5UA 4KYZA 4TNOA 2BX6A 5IWAJ 3ULHA 2ZH3A 4BDPA 4F4AA 3QJLA 2Q79A 1RYSA 1OJ4A 2DGSA 3CW2C 1EKRA 2VZ9A 4OHYA 5SUHA 3LWMA 1NKBA 3A8JA 3CJ0A 3GFHA 4ZN1A 3VR1A 5ETPA 2FY8A 3R5AA 3NP5A 1AZSA 4ZHRA 3FK4A 1CLFA 2QYCA 2VC1A 5LJ3Y 3P5BP 5F8GA 1FRJA 4WU3A 3UDCA 5DQIA 3O6QA 1TQLA 3E8OA 2FZKB 3TVYA 3D6TB 4EYIB 4NXNJ 1DQ8A 5A8KB 1R0AB 3WBZA 4KHRA 3HVRA 4PCQA 3PJWA 1NPKA 3GIJA 4KR0B 2KZMA 1X5PA 4NXMF 3VAIA 3EGWB 2W8LA 3M05A 5IT9U 5DLGA 1FRLA 4NE9C 2BKNA 4IG0A 4BLGA 1R8BA 4OMFG 2FGOA 4PG6A 2HS4A 4JI1F 1S9GA 4HTJA 4F0HA 1TMMA 3H5XA 1RT2B 2IM1A 5AE3A 3QGIA 3J81j 4P7VA 4Y00A 1VQKS 1XBWA 2JL9A 2MXYA 1S6PA 4L74A 4DOZA 3D1QA 3VQTA 4N41A 1FTCA 2XI2A 4DV7J 2GZOA 4HLBA 2UXBJ 3HDSA 4ZPVR 2YKNA 1NK9A 4JOUA 2IVYA 1HR0J 4N47A 1YBAA 1W2IA 2BANB 2IBOA 2M70A 4ED4A 3ZZUA 4FNHA 5KFAA 2AEFA 1WOPA 2LQBA 2IVFB 2FVSA 5H9FK 1R8HA 3D68A 2QTWA 1C0TB 2WB4A 2CFXA 4URGA 1O6XA 2W8KA 3D4JA 4NLXA 2P8IA 2V8HA 4PWUA 4ZVOB 2FHMA 3BH6B 3KHRA 4I6YA 1YITS 4TU7A 2CQPA 4ZPCA 1VBZA 3CJQA 2C42A 3DRPB 4NLVA 1Q78A 1YRXA 5A0YA 2XMKA 5KFUA 1VJWA 1KSPA 5HLFB 4FNIA 2LXUA 1O8BA 1S1WB 1HW8A 4RUBA 2V68A 4BHQA 2XO6A 3QJJA 1SJ3P 3ZZPA 2ZJRQ 1NH8A 5BYRA 3TAMA 1Z2LA 4NLTA 1VQ5S 1RSCA 2ADBA 2LEPA 4ILLA 4LF6J 2QMUB 1RK8A 2E5GA 1H2VZ 5LT5A 1U7LA 4J9VA 1SQGA 3C14B 4USIA 1S57A 3IFEA 3G96A 3M8PB 4FXVA 3HVTB 1FNOA 2BRKA 3IWNC 2C3OA 4QIGA 3P8BB 1EKSA 3LANA 1WC4A 2RJZA 4EZ6A 5EX3A 3ZTSA 1UWBB 2K1RA 3X3UA 2L41A 2VQFJ 1UWAA 3KNGA 3NEKA 3MUTP 5D3GB 1HBOA 3NNHA 2V8DA 4O4GB 2K8GA 2G0JA 1WELA 4C6AA 3PFOA 4PG4A 3M8YA 2IJRA 2CVIA 3G6XA 5B0CA 2HGNA 2A0FB 1LWFB 3H4BA 4ZVEA 2E7XA 3AT1B 1RXOB 1RHRB 4X4SA 3V81B 4OYOA 1S4FA 1CC8A 1N32J 2QFJA 3GCXP 1IBKF 1U45A 1KQSR 2HHPA 4X66J 4KHPF 1Q1KA 4PYAA 2NSBA 3HF5A 1KD1T 1FVQA 1GNKA 2XMTA 3CIZA 2FIUA 2VHGA 4B3OA 2HFOA 1JNRB 2PEHA 1SCJB 3ENWA 1YJ7A 1YSJA 1JLAA 5D77A 4YFUA 4IG3B 4ZCLA 2OD6A 2VG6B 5AXMA 3HSDA 1IR0A 2PD1A 4F2SA 3J7A1 1U4BA 4F4WA 3KLFB 5E2QA 1D0EA 4B9UA 2RS2A 2R7TA 3FMWA 1SPBP 1U2CA 4DR3F 2ZHAA 4HKQA 1KEKA 5KFXA 1KN6A 3GR1A 2HAIA 2LEBA 3NMAA 2DD8S 2FVCA 1ZYQA 1FRXA 2VF3A 2C2RA 1SB6A 3WZ0A 3CF5Q 3W9IA 1NUEA 3N6NA 3M30A 3GLJA 4Q0BA 3T5LA 2KTQA 1VBKA 1PSDA 3HM9A 2O67A 2BZ2A 1EETB 3TZWA 5D4PA 3UD3P 3MMJA 1WG5A 3HZEA 4Z7YA 2GHVC 3S7RA 2VFRA 3A3NB 1NPRA 2FC9A 3FGVA 1L3TA 4EBDA 1QSLA 1X0PA 3BH7B 3K8VA 2RHSB 3GCWP 2UXCF 1BY9A 3QIPB 1WHWA 1LWCA 2CJAA 2W2OP 3SFUA 4YS2A 3I0SB 5CZVA 4UQTA 2ACMA 1LWEA 4NA2A 1F9FA 3DDNA 1A9NB 1X7VA 2QJ3A 1KQKA 4U7UD 3QO9A 2ZH1A 3BPSP 1BWVA 5F8LA 2ILZA 3TA1A 4FF3A 1KR4A 4CLSA 1TVRA 3ZO7A 1F3FA 2RKIA 1G3OA 3A8IA 1FD8A 3CJKB 5CXTA 2HWTA 4PZVA 3M8ZA 2ZDPA 4X4RA 4WF9Q 2XS7A 2Y9HA 1AUSL 4K4XA 2HVZA 3SQGA 3PIPQ 4HHJA 2MQNA 3I55S 2R7RA 3KLHA 2FJEB 2LQ5A 3R97A 4QIWD 5H9EK 5CCMA 2IVMA 4NXMJ 4JI8F 4DR6F 2HVHA 1M90T 2E5HA 1TK8A 1CJKB 3FFIA 3ICLA 3HSZA 5SZTA 4I7FB 5KT2A 5FJ4A 3NS5A 1U8SA 4OZ0A 4JI1J 2BDPA 4LRBA 3KMSA 2AKWB 1D3WA 4CO4A 3R7BB 4H4KC 2HHXA 2DVIA 2HG4A 4EO6A 1HPZA 1K1QA 1LW2B 3UR0A 4RLEA 3MEKA 4IR1A 3GIKA 1S79A 5C24A 2IHR1 1Q4RA 5F9LA 3NGSA 2FHJA 2Y1JA 3EMTA 3GYGA 1KHVA 1XIQA 1RT7B 2Z30B 1OYEA 4NI2A 4E8UA 2GMJA 3VAMA 4PQUB 1NK5A 3FRYA 2BM1A 3L7OA 3HFKA 1KRPA 1X5TA 2FHOB 4R5PA 2BKOA 1WEZA 4I6AA 2CJ9A 2XULA 3ITHA 5HMYA 1UL3A 4V19X 2IAJB 2D3UA 1BQNA 3CB4A 4WZQA 4IYQA 5F8JA 5KG1A 6FD1A 5LMNJ 2PN6A 5U47A 4DJBA 2J9DE 3MR5A 3HHKA 3K89A 4U8VA 2J8SA 4DV0F 2HYIB 4LBIA 2R7OA 2QL5B 4OYMA 1OY9A 3PG9A 3UNYA 5F8HA 3PVXA 3UNGC 2HIYA 2PMZD 3PV8A 4RL1A 5ETSA 2ZBCA 3CCQS 2L48A 5F8IA 3GZ7A 4OI1A 2XZWA 5F0UA 2F9DA 1KQGB 2I9SA 2QMXA 4DPWA 4ZVUB 5ADZA 4WKRA 1NSKL 3LAMA 5KAKA 2BR0A 2BABA 1S76D 5KFCA 2JJ4D 2CNKB 4LF7F 5DM7Q 3H20A 3DLLQ 4X84A 3WQPA 2EBEA 2YQ0A 3M4XA 1X31C 2QN6B 2MJNA 2DR7A 3A8KA 5B0AA 3AOBA 3PDNA 4DSJA 1JLBA 4PUOA 1U0HA 3ZZTA 3OTCA 2JRSA 2Z2YB 4DI6A 3NAIA 1SC3B 3VF0B 4P52A 1HWUA 2KT3A 2G1DA 2LU1A 4R0EA 4WXWA 3PM9A 3CVKA 3ET6B 1REVA 3DGPB 3OHBA 1RA6A 2NXUA 4B9SA 4KO0B 4NLUA 1TKZB 3W3SA 1FT8A 5DM6Q 2HBZB 1NHKL 2D9OA 2DCUB 5C7PA 4I6WA 3WIUA 4UF4A 1ZOTA 2GVDA 4TY8A 4OI3A 1IKWA 2WAQD 2CPHA 2LLZA 3UN2A 1S7IA 3D1HA 4OHZA 1IBKJ 2CQ4A 2HQ3A 3SCLE 4XPCA 3KNAA 2J9CA 2PC6A 3HPOA 2ZFHA 1FXLA 2OPRB 2IA0A 3JQKA 2G2YA 1HBUA 4LREA 3R5BA 4LUBA 2FLNA 3SBMA 4HACA 1RTDB 1TFWA 1RWUA 3KUGA 1CJVB 3GG1A 3QATA 1PAUB 1O5JA 4QWBA 3MR7A 1Y0HA 3W2WB 2BRLA 2WOMB 1WKLA 3BKTA 5LL6d 4Z7CA 1SJFA 2XHWA 5CQGA 3FSXA 2QL7B 3NL0A 2YTCA 3CJ2A 5KG0A 4DR3J 1PCAA 4QW8A 3QZ8A 2R7WA 2OIHA 3C15B 2XB2D 4X4NA 2NUHA 1S49A 2M0GB 2XHCA 4XDDA 3POTA 2JDJA 2VFUA 2GAGC 4UUXA 4IQXA 4M94A 2M52A 3BN7A 1UEVA 3FBFA 3CCLS 4DR2F 4DCOB 3PIOQ 2IPOB 4N5SA 1KLMB 1UFWA 4ZN3A 5KTQA 2AQ4A 5E3CA 4NZ0A 5EWFA 1X60A 1DTTA 2ZNZA 2LP4A 4LF4F 3KG1A 4Y2KA 4CZCA 1KVKA 1RHJB 2NXCA 3OXFA 2QGFB 4WXOA 1BUXA 5CYQB 3MFHA 2CQ0A 1WEXA 1RABB 4RUCA 1FXDA 3FVYA 1FJ7A 3QT8A 2LFVA 3IM9A 1TL5A 1HNVA 2G13A 4HI1A 2VICA 5JXSA 3X1LB 4HYKA 2OPPB 3FEZA 2XC9A 3W60A 2E44A 4F3MA 3AY0A 2YKMB 2DITA 4CH0S 2DEIA 3C6TB 4O3PA 2ZHOA 1FFWB 4ED2A 2EK6A 2VBWA 3DU6A 4C0HA 3HP6A 4Q7AA 3ONQA 4DX5A 2G0IA 2H4YB 2BV3A 1RKJA 4IFYB 4CT9A 4ID5B 5C25A 1TKXA 1NK4A 1Q82T 3TQEA 4RKUC 3V5RA 2KO1A 1Q8IA 4J7CA 4F4KA 3HD2A 4FDFA 3H5YA 1O0PA 2IRYA 2R7UA 1HARA 4F4ZA 1N6QA 1WC6A 2ILYA 4DCJB 3TA0A 5DZ6A 3MDFA 2PIIA 2AJ4A 5EUHA 1JJCB 1R6YA 1QAXA 1WACA 5HSPA 1RUSA 4DR6J 2FHKA 3NBPB 4ES3A 3KJVA 1ZS6A 5F8NA 1KBRA 3EE3A 5ETVA 5IT0A 3FEXB 3VCDA 4PG7A 2CG8A 1HBMA 2LVWA 2HHSA 2JC0A 5CYJA 1S7HA 2XZDB 4LSLB 1UJ4A 3M8SA 1RT5B 5J2MA 1DRZA 1UMJA 2HNDA 5DDOC 2ZNYA 5JVHQ 3TNVA 5IT9Y 1RAHB 2JFDA 2W4CA 3IC1A 3MMAA 3MMCA 5KFKA 3MI7X 1RI7A 3VGTA 2VDIA 4BWJA 2OEMA 2KRBA 1S1TB 3RB3A 3IMQJ 1WOSA 3DI6A 1SVDA 1PYTA 2OMOA 1ZPVA 3VHQA 2HZVA 4ETZA 4Q2MA 3A3PB 2OAUA 2XBPA 2FJXA 3TYTA 2XSFA 4YDDB 2DB1A 1WJ9A 2HW3A 4NRTA 2HZAA 1ZETA 4XO0A 2GV1A 3CC4S 1AA1B 2B9XA 2W9CA 1SKRA 4DU8A 3C2PA 3CCSS 2R7SA 4OI2A 1JLEB 1LWXA 2Y1IA 1TELA 4AE5A 1VQNS 1S0MA 1FX2A 4DV0J 3F0NA 3N6MA 2YWGA 3PW0A 4A8KA 4RBUA 5FD1A 2NPFA 1T94A 4UT4A 3IBWA 2G4BA 2DNQA 3DLBA 2ALYB 1CEZA 3RTVA 1DFDA 3NWRA 1PIEA 3F44A 1WC1A 1IJFB 1HQEB 2W2MP 1Y5IB 1WUUA 2HGLA 5GADU 2K3IA 2GS8A 3IG1B 2KKHA 1RT3B 4BC9A 3UCZP 2IDEA 1NEEA 2R7VA 5CABA 4DQIA 2EPIA 4LFBF 4QR1A 1TL7B 4LF7J 3J80U 2CRLA 1FNMA 3CJSA 4YB1P 2ZH4A 3AD7C 3WHIA 2M5YA 4YR2A 4FN5A 3OXLA 2GA7A 3MR2A 1QTNB 4CP5A 2J6TA 4ZVFA 1VQYA 2ZC4A 4QU7A 3KTQA 5A8RB 1G2EA 1U24A 2MHEA 1SUQA 2BVZA 3C16B 2FC8A 3G6ES 2MQMA 4DPUA 4ECZA 1P1LA 4RR5A 2L3MA 1N88A 1JLFB 3OLBA 1MMNA 2APOA 2VA3A 3JTOA 1VRUB 2M7SA 4GKKF 4PWDB 4NCBA 4C3MA 5ETMA 5BR8F 3P5TL 4KQZA 1RU2A 3MM9B 1NHVA 1P8GA 1UW4A 2B43A 3IGVA 3GQCA 5KG4A 1FEEA 1YX2A 1R43A 3OR1A 3R1LA 4LRAA 4ZP9A 4XIUA 1NMEB 4CO2A 4HEA9 2YNHB 1SV5B 4I2QA 5KFOA 4OZNA 2HMIB 1CC7A 2XSJA 1R89A 3IR6B 1WTFA 3KK3B 2I5JB 5IS2A 4YB5A 4BC7A 2R9LA 1H3DA 3CC2S 1EIYB 3GV7B 2EFNA 2PA3A 1PYOB 3BM7A 3UI3A 4Q8FA 1R8AA 3VVTA 2HSEB 3D2WA 1G1XA 5HMZA 4C8ZA 3W2VB 4ZDNA 1TKTA 4OYIA 5E5NA 4C8NA 3I5BA 4UZBA 4B02A 2MKJA 3GFZA 3CJ3A 2QEXS 2P9GA 4RW6A 5DO2A 3CNQP 1ZA2B 3B4MA 4F04B 4DR2J 5J1EB 3DMJA 1RAGB 1WNEA 2PDAA 1EX8A 5ETRA 5B08A 1EJ7L 3W5XA 2QLXA 2RAQA 3WX8A 2YNIA 4YB6A 1YGYA 2AYMA 3NAHA 4PPZA 2K2PA 1T05B 3M9OB 4LF4J 1BQMB 4DR5F 4DL3A 3T6BA 1W25A 1S6QB 2DBBA 3MM8A 2WBMA 1N5YB 1C4CA 3F73A 2GIFA 4QWCA 4ECRA 2OPQB 2IBKA 5AE1A 4IOBA 1N4LA 5A8WB 3TZYA 3M6UA 3DYAB 1JXVA 4L3NA 5JMNA 3W5ZA 1G7CB 1S1VA 4ZOSA 1R27B 1L5UA 2AYEA 2MDAA 1YI2S 5EDWA 2CKWA 4DL2A 3OVSA 4N56A 5D78A 4Y3CA 4DSIA 3EVWA 1DJ0A 1H73A 1T7PA 2E66A 4OZLA 3CTRA 4N7TA 4JV5J 4BS2A 1S77D 3SV4A 2GJ2A 1F5AA 2VIHA 4IO9Q 5B0GA 3QGHA 4TU8A 3EUNA 1UAWA 1NDLA 3I87A 2J0QD 2HLTA 5LSOA 2M2BA 1WC0A 2EBGA 3M1VB 2ROPA 1CJUA 2LDYA 1E6YB 2DNZA 3GV8B 4K4ZA 1B0TA 1RWVB 3FEYB 3M2UB 5LSRA 4C0BA 2AW0A 4ZMMA 2UV8G 7FDRA 2GGPA 1CJTA 3K58A 3MM5B 2BE2B 2N4CA 2DNGA 4USWA 1OQ6A 2IM2A 4YHHF 2ADCA 2DPIA 2YNGB 1XK8A 3MEGB 2RIJA 2W2PP 4CO3A 3UDEA 3NCQA 4KRWA 2ZE2B 3DM2B 1IM6A 2GMHA 4EMDA 2WSCC 5KOXA 1Y11A 4WK3A 2PFFB 1URNA 5LJ5Y 4F4XA 2X7IA 2LKZA 2OD4A 2CXEA 2RF2B 3W63A 3G87A 3CCMS 2R8HA 4FYDA 1IM4A 4JI3F 2WONB 3N0VA 3OVAA 2PI5A 1X4FA 1JXLA 3TUPA 1U1PA 3KJNB 2MKIA 1D9DA 5B0FA 2EVZA 3DDIA 2W01A 1U1KA 3GE9A 3MCSA 4ZVQB 3U1MA 2A2CA 3MECB 5EWGA 1HBNB 4USVA 1HIYA 3ZTPA 2R8GA 4KFBA 3DHWC 1IR1A 4WIQA 2BJ9A 1RBOB 2RU9A 4DPYA 4M5DB 2KJWA 1S1XA 4C2MA 5C5JA 3IBFB 3CCZA 2KXFA 2JC1A 4N8OA 2XS5A 3OUYB 4DUTA 4DN0A 4ELVA 2VD3A 2A6OA 2JOQA 2ZBQA 1GQEA 1NM2A 3TUZC 5T7LB 2HHHF 4ZLNA 2F63A 5F41A 1PO6A 4NMLA 1U1NA 1BGXT 3KJFB 2DNOA 1GMWD 1KS2A 2JLGA 4OJ1A 2MLZA 4O0NA 2ZBRA 4FS1A 1FKOA 2R2UA 1NJZA 3VGVA 2BW2A 2N3LA 3PACA 2EFPA 1OPZA 2NZ4A 2RQ4A 1LW0A 2UVUA 4CTAB 2QO3A 3GG0A 1SC6A 1NKCA 2J9EA 3MM6B 4CCHA 2AYGA 1L3KA 4NLQA 5HMWA 3MAAA 1QJHA 7AT1B 5KFJA 1XR6A 2WZ1A 2VJVA 4LFBJ 2QLFB 1HA1A 2B56A 3VAKA 1TR0A 2FLLA 3R27A 4MKAA 1HWKA 4FYVB 1T0TV 1JLQB 1F5CA 1N56A 3PRBA 1IN0A 3M8RA 3FKBA 3CCUS 4TQSA 2LEAA 3IO1A 4OFZA 3ISND 3WX4A 1QAIA 2JH3A 3QRRA 4G1IA 4MTPA 2PI4A 1X8DA 5J2NA 4JI0F 5KG3A 3ZTRA 2FZCB 2ZBIA 4MIWA 1YRTA 2OPSB 2Y1LB 3CGIA 3M8QA 4GKKJ 5DGAA 2YKAA 5BR8J 1WF0A 4FBTA 4PYDA 2UVVA 2DHHA 3KHLA 3QJPA 5HBMB 3B82A 3IS9A 1FRKA 2N82B 3BGOP 3W65A 2X3DA 5GADI 3GIIA 4XK8C 1PAEX 2WVEA 3SSSA 3MM7A 2VBXA 3AB4B 3R5CA 1Q8LA 2ZKTA 2F65A 4N76A 2RDIA 4URSA 4TLRA 4U9RA 1A6LA 4YN3B 4TN2A 3JSMB 1WOOA 1N8RT 2VPWB 3MPWA 1M5HA 3G71S 4HH1A 5G0RA 8AT1B 2HFNA 3S01A 2XMVA 3CDBA 1MU2B 1LFWA 4DV5F 3SYZA 2DRBA 2CQ2A 2LA4A 3CIMA 2H65B 3FSYA 4OLPA 5KFSA 4UTGA 1C0UB 1LNQA 4ZCMA 1FERA 4DX7A 3A3OB 3CO0P 4E2FB 2DYAA 1I94F 3RAMA 2BA9A 3PW5A 2YNFB 3J7Z5 2K7JA 4M5IA 4LVNP 4DR5J 1WWHA 1UCNA 1QE1A 3SCKE 4GO5X 3M32B 1WHXA 2GHPA 3MEEA 2KVIA 4ICLA 1S4EA 4GVBA 3SSQA 3D6FB 4IH7A 4D3HA 1E6VB 3OPKA 2F4FA 1PBUA 4B9LA 4EK2A 5ETKA 1Q95G 2AGQA 2VG7B 1SJQA 1WC3A 4X4UA 4M5MA 2QRRA 1APSA 4Y34A 4I2PB 1VQ9S 3TP2A 4J9UE 4TKTA 3UN5A 2FQQB 4AL6A 1ELOA 2YKPA 1Q53A 3UD4P 5DS7A 4DR7F 3BJYA 1CS4A 2XNRA 4YQWA 5ETLA 4NLRA 4KHMA 1U1RA 1KC8T 3MOZA 3JYTB 2UU9F 3MR3A 2RB7A 3S6EA 3KG0A 2Z8QA 2V4QA 4KC5A 1SH3A 4J9OA 2A18A 1W26A 3IM8A 3H2VE 1VIXA 3M8WA 4DQRA 4ECVA 1YK9A 5C42A 4O3OA 1YJRA 1ZM2A 1CULB 2DGOA 1FA0A 3I31A 1OY6A 1R6VA 3HCXA 2UUAF 2F4VF 5KFVA 2W7PA 2RS8A 4B3MF 1JXEA 1HQUA 1RWMB 4YHHJ 4A8FA 3OTEA 4J5OA 4O3RA 3TUIC 4GVLA 4B3RF 1FWPA 3M6WA 2BJ7A 4DSLA 2CQGA 2CQ1A 1DTQA 4FXDA 2WRMA 4R0JA 3CCJS 4DR4J 1M5SA 3PX0A 3H5SA 4IDKB 3AB2B 1FD2A 1Y3JA 4K5RA 2YH1A 2RH3A 2CPJA 4JI3J 3TA2A 3HT3A 2KHDA 1UVKA 3RRGA 3NGKA 2F7VA 3A8EA 4DLEA 4OZ2A 1IXKA 5AXKA 4DZ6A 1KQFB 4OYAA 3OV7A 2UUBF 3LALA 3WDOA 4DV3F 4RU2A 2NSCA 2VA2A 4KT0C 3OTOJ 2E1PA 2ZWPA 3N6LA 2D41A 3E01B 3HT0A 1RE1B 2MQOA 2BE9B 4RW7B 4C48A 3C19A 5KFRA 3J7YU 5A8KA 1R0AA 2E5JA 2P9EA 1KLNA 3FMBA 1M1HA 4O23A 4A8XA 3ISNC 4JP8A 1LV5A 4NCAA 4M95A 1YWXA 1T9WA 3R7SB 2B5JB 2QLBB 4JV0A 2HHHJ 1K47A 1TUVA 1T02A 1Q5VA 4K50A 2ZUGA 1U6BA 4PG5A 2YWKA 2ZC3A 1MW7A 4B9VA 3TEGA 5ETTA 2ROGA 4RWXA 2V63A 4KH1B 4QYRA 2KDOA 1RT2A 4U67Q 1Y00A 4OX6A 5HP1B 3T3FA 1GXTA 4ZP6A 1YJWS 4ELTA 4MT1A 4PAAA 3I4PA 3QAUA 1XMOF 1VRTB 1A7GE 3LGHA 1ZTTA 4DU7A 3KLHB 1FJGF 4A8OA 4U8YA 2QG9B 2EG2A 1NSAA 1NJXA 1FVSA 3C3LA 4UOFA 2BANA 2PE8A 1N5VA 3N9UC 1AFIA 3PCOB 4H4OB 3I4HX 3QFHA 1IJEB 3A1YG 2HRTA 1F5BA 2V94A 3RR8A 4A47A 4WP8A 2BEFA 3AODA 5GAGI 3J80Y 2GW8A 4OL8A 2HK2A 2AV5A 1F3VA 3M2RB 3I5AA 4ID8A 1C0TA 4F50A 3MFIA 4JI0J 5IC6B 5D6GA 2KFZA 2ZH8A 1R8CA 2RDJA 5E7OB 2RRAA 1WDDA 1U2FA 4LSNB 3DRPA 3RZAA 3Q0AA 3HHNB 3Q8VA 5K8NA 2VOPA 1NK7A 1HNIB 5J1PA 3KWMA 3M6XA 4CLPA 1D8YA 2HBQB 3N5BA 7FD1A 5HLFA 3N4WA 3HKWA 4K4UA 2QZ8A 1S1WA 3ADAC 5HQ8A 4WFZA 1KKHA 4ITSA 1TKDA 2IDLA 2J8AA 4TVAB 1B0PA 2HKEA 2UVRA 4ETXA 1SL1A 3S1TA 1X4EA 5I4MA 2ABYA 1BQNB 2B7CB 2C2NA 2I8EA 4USKA 1H2UX 4J37A 3K5MA 5H9FJ 4F26A 3K5NA 3C14A 2ZH5A 2UVWA 3GPAA 1QSSA 2W1BA 1VQ8S 2D69A 2IRUA 3M8PA 4ZLJA 3HVTA 2ZOGA 4QYZK 2MTLA 3KJQB 4O3NA 5AJ3J 3EGZA 2LDIA 3Q83A 4QOTA 4CLYA 1UP1A 1LK5A 4Y2MA 4X4OA 5AXLA 1UWBA 2RD5C 1X4GA 3IGNA 1QM9A 5D3GA 4C8MA 4O4GA 4OX8A 3VWSA 1I94J 4HL9A 2FVPA 5E41A 5A76A 1LWFA 1PGZA 1HMVB 1N5SA 2W2QP 1FE4A 3V81A 2B8PA 4E98A 1LK7A 1WEYA 2RHQB 1Y7PA 2JVRA 4NX9A 2Y3YA 3RAQA 2J5AA 3CMQA 4L6V3 3QWUA 4ES2A 4F2RA 1MMLA 1RT1B 1RTHB 1RAFB 5ETQA 1XTZA 2C3UA 2QLJB 2I1RA 4ECWA 1N48A 1RT4A 3BV8A 2W4DA 3W64A 1UZDA 4J90A 2MSTA 1RB0A 4IG3A 4WZMA 4CIOA 4Y0FA 2NQPA 2BXJA 2L9WA 2VG6A 4DF8A 4CRJA 3SCJE 3BBCA 5G4DA 2QE5A 3BDPA 3KLFA 1QVFR 3QRQA 4O0IA 3CULA 5KT3A 2LQ9A 2QIFA 4QCLA 2F1FA 3W7BA 2FPHX 4DR7J 2FGCA 3EDRB 2GO8A 4DQPA 1S99A 2B9EA 1A0OB 6FDRA 2UU9J 5EN1A 1DY3A 3CMES 2BOAA 3M6VA 5JVGQ 1XMQF 1HQ2A 3IWLA 1U1LA 1PG5B 4FKYA 1SQFA 2BBEA 3TQ1A 3IP0A 2UXDJ 3THVA 4DFPA 1NSPA 2RQMA 4D3GA 1EETA 1VJQA 2UUAJ 2F4VJ 1U8WA 3THPA 3KLGB 4B3MJ 4ZCIA 2XI3A 4RNMA 2KH9A 4J9KA 3SSRA 3FCHA 3SXLA 2M88A 5KG5A 3BKUA 1EHWA 3VQSA 3RB4A 3RBEA 1M5VC 2VB6A 4B3RJ 2Q3PA 3QIPA 2J76E 1NO8A 2LECA 4PPDA 3I0SA 4MIBA 4DUZF 3HKZD 3D54A 3NGDA 1VMBA 2NXEA 1HYSB 2FB0A 4NA1A 5KFEA 4UY85 1Y5NB 1EP4B 4NLOA 3QWPA 5J2PB 4CH7A 3VGUA 4ED8A 2ATLA 3EDQB 2UUBJ 3O2IA 2MZRA 3E51A 3BO3A 4DV3J 3MUMP 4USJC 1KFSA 1Y10A 3CJKA 4P73A 2W2NP 3CDUA 3D3BJ 2LMIA 2YWEA 3ENQA 1FI4A 2DRAA 1XEZA 4CT8A 2Y8YA 1U25A 4P9SA 1N36F 1MN9A 3DLEB 3G6YA 2I38A 2P5VA 2HHVA 4FPRA 3QNWB 1IKVB 4NYZA 3VTIA 3LP1B 5KFQA 5LXYA 4B08A 2E29A 1RTJB 3Q86A 3MR6A 1CJKA 4CH1A 1WF1A 2EEYA 2DK2A 4I7FA 3OT9A 3RW6A 3NG8A 2NXNA 2O5DA 1FF2A 3O44A 1WD6A 2FD2A 3RBDA 1UVJA 4U95A 4LSZB 4OZ1A 1ZA1B 4KBIA 5C2GA 1YJUA 2KJVA 1PJ5A 1LW2A 5HAOA 4QU6A 2M9KA 5EGYA 1D9AA 1FK9B 3OTBA 3D67A 3BYRA 2GHWA 1XMOJ 5I3QA 2JEIA 3G8TA 2PO4A 3HK2A 1RT7A 1ZM4A 1FJGJ 3TJAA 4Y65A 4PQUA 4RW9B 2FUG9 4WFYA 3T1HF 4MKVA 4Q44A 1YLXA 3BS9A 2B4PA 1OSDA 4C97A 2DCLA 1YBTA 1K0VA 4LMZA 3J7YI 3GR0A 2GFFA 2C3YA 1SIWB 2IAJA 2XYHB 2MZ1A 5H9EJ 3MAQA 4Q43A 2J9DA 3SQOP 1ZH5A 2HNYB 1DQAA 3MOJB 1K0TA 3IWXA 3LH2S 3ILLA 3G6VA 3HULA 2ASYA 1FKPB 3K5OA 5F3TA 2XMMA 4URQU 3HI9A 2J0WA 4FYXB 3MMBB 3AOCA 1XERA 2XCAA 4NOHA 1X4CA 3QMQA 3K8WA 1I51B 1KWMA 4C3LA 1J5EF 4DFKA 2AWZA 3B8HA 2KN4A 3CXCR 3VGSA 2CQ3A 1F60B 2XWXA 4WU2A 1WKJA 4MKBA 4OQJA 2MGZB 2WW4A 4JB8B 2MSSA 2VJUA 2RU3A 3LGMA 3H0PA 4B3SJ 2YWHA 3J7AN 5A6WA 3V4MA 2EFQA 4KIAA 2F3JA 3OL7A 2ZH2A 1T95A 1OY8A 1PKUA 2VFSA 2QYGA 2KRRA 1T9YA 3H2UB 1XMBA 3OW2R 2DH7A 3MUVP 1RTIB 2LYVA 5L1IA 3ET6A 3Q8UA 3G4SS 5LMNF 3JSBA 2X1AA 1K1SA 3DGPA 4DWIA 4WP3A 4KO0A 3BB5A 1TKZA 4M5NA 3AXKA 5KT5A 4F67A 2H5IB 3TW0A 3TEHB 2HHWA 2KG1A 2DH8A 5IV4A 1VC6A 3DRRB 2CDQA 3FCWA 3B6BA 3UVJB 2ZJQQ 2JLEA 1T3OA 2AX0A 2RE1A 1SL2A 2XGPA 4M63A 2P6SA 3JTNA 1QY7A 4C7QA 1ZBTA 2OPRA 4LIRA 3KLVA 5KT4A 3PHEA 5D0EA 4PRFA 1Z1ZA 1MWQA 4FS2A 1JKHB 1I3OB 2NXJA 4CLKA 4DSFA 2B51A 2IRXA 2AGOA 3W62A 1X9WA 3OL8A 1CJVA 3BO4A 2NREA 4PXEA 1VGYA 1S6OA 5AXNA 1DLOB 3W2WA 5D0GA 3F41A 3PKYA 2WOMA 1GEHA 4M5GA 4ECUA 3HMJG 1PJ7A 4EBCA 1TUGB 1KTQA 1JB0C 2RVJA 2C22A 3QGGA 3NWGA 4CO5A 3C15A 3V4IB 2V2QA 4KGVB 5CCLA 1ZPWX 4MKYA 3DHXA 4YP3A 2PFDA 1VLYA 2ZOFA 3D9BA 5HO4A 2YXLA 3BR9A 4HDGA 3G9CA 2IYGA 2W9BB 1S1UB 4NASA 1XMQJ 4MK9A 3FZ2A 1KLMA 1VQ4S 2QA1A 5D15A 3CCVS 2ZH6A 5KFDA 2VG5B 2BM0A 1Q79A 2U2FA 2FJBB 2IC3B 2JWNA 1IKXB 1VHFA 3DRXA 3D28A 4ZKAA 4L73A 4I68A 1JLGB 3OL6A 5CYQA 2CNNB 1WG4A 1F9HA 2QT7A 3OL9A 1B70B 3W8GA 1Q0NA 4C11B 1JWWA 2YY3A 4YEAA 3TVZA 4LQ3A 3IAM9 3QLHB 5F0WA 3PRDA 3GTYX 5GAEU 1VBYA 3OLAA 2HFUA 5L1KA 2DGXA 4DUZJ 2OPPA 3SDEB 3BGUA 1PILA 1KTVA 2CJXB 2YKMA 1V5VA 2AEMA 1VQOS 3PYFA 3C6TA 4QQBA 2CJKA 1IWAA 3LPYA 2E1CA 2RQCA 3N28A 2Y0SD 1SI9A 3HZGA 1HHQA 4X4TA 4NYPA 1FRMA 4IFYA 1WF2A 4ID5A 1TL1B 2GNKA 4I56A 2AYBA 2IY5B 3VAFA 1NDPA 2DHXA 3MPDA 1B7YB 3JS9A 1QD1A 2YX1A 1N36J 2XLJA 3LTOA 1EB0A 5DQGA 1T9TA 1RAJA 2MQPA 2DNLA 2OO4A 2C1EB 3CPWR 2W7AA 4UUWA 5IOLA 2ZH9A 1FE0A 1NPPA 1VC5A 3NBPA 4HH0A 2Y8WA 3OD2A 3UR3C 1Q86T 2OH2A 3FQLA 3KHGA 4NZ6A 1YG0A 2B6AB 2QLWA 2YWWA 2QC3A 2YWFA 3IR7B 2QV6A 3U1LA 4LSLA 1RT5A 4WWSA 4Z37A 4OI6A 1VQ6S 5LSLA 5KFLA 1V3ZA 2AJ2A 2HURA 1VC0A 2OTJS 2D7SA 1RZMA 2I6WA 4NLYA 4DS4A 1EAYC 1JLCB 1MROB 4ZIWA 2CJYB 4K5SA 1RU1A 2A3JA 1EARA 1S1TA 1RCXB 4FVMA 3GWCA 1JIHA 3HFZB 3CJ5A 3LO3A 3HJVA 4Y2AA 3T1HJ 3BN4A 2MHNA 2GC8A 4PG8A 3PRVA 1Q8BA 1NJWA 3V6HA 1SL0A 3UWTA 3MCNA 3H98A 2IA6A 2H3EB 2MKYA 4ALZA 3Q8QB 4RBTA 2QA2A 4GO7X 1JLEA 1HNZJ 1Y4ZB 1N33F 4M5JA 1C2PA 3HFVA 2RT3A 3BSOA 4U7UK 4WE1B 4K2XA 4CLZA 2MQQA 5HANA 4C9DA 1VIOA 4GC7A 4PABA 4ZITA 4ZS6A 2V34A 1J5EJ 4CWBA 3Q23A 4IKAA 3RR7A 2G9OA 1HQEA 2HLUA 1AUDA 3CO9A 1DHMA 3HXMA 3IG1A 1RT3A 2XWYA 4QBUA 1WHVA 1C1BB 2AIRB 4C8KA 5KFIA 1U02A 5E33A 1RQ0A 2GMLA 3AD9C 1OPIA 1TL7A 2R8JA 3R5GA 3PYEA 1JJ4A 4KJIA 1RTZA 5B7WA 3J81Y 5KOWA 3TX0A 3DOKB 2ZD1B 2DR9A 3CE8A 2AF6A 4YOEA 4NPOA 3Q24A 3MGJA 4L75A 1R0BG 5A8RA 3RU0A 5L39A 4NLSA 5HL7Q 3C16A 1FFSB 4DPXA 2ZEJA 4HVZA 3TANA 1IVZA 4EO8A 1M5KC 1J27A 4I69A 1JLFA 2F8HA 2ROEA 5I42B 1S0VA 4IOAQ 1VRUA 3KK2B 4PWDA 3DDKA 4A8WA 4WK1A 2DXDA 3EPGA 4G3IA 1Y3KA 2DNKA 3MM9A 4LR8A 4ECTA 1OSCA 4P2FA 2LXIA 1H38A 1LOUA 4J9SA 3SMZA 5L8RC 3D5MA 1IUJA 2C2EA 1RHUB 3ENAA 3OBIA 2R42A 2YNHA 1SV5A 3FBCA 5ITHA 3CD7A 2R2TA 4ECQA 2IM3A 1Q7YT 2DJWA 2HMIA 3MWBA 2BOPA 3MPUB 3KK3A 3TI0A 1TTHB 2I5JA 1JX4A 1UJ6A 4B9TA 2D1CA 2MQ8A 3PR4A 3DRSB 4WKYA 2VH7A 1GT8A 5DQHA 4PR6A 1KDNA 4TU9A 4B9NA 3DU5A 3T5KA 3W2VA 4DHVA 3O5TB 2ZDOA 3JAMU 3DLGB 2MPUA 4WCEQ 2HZCA 3H2LA 5L1LA 2HQDA 3IA0A 3NCRA 4NCGB 4FZVA 1RWOB 3TRGA 3MD3A 2AMCB 2BQRA 3T5HA 2GIQA 3EPIA 2VL1A 5BJRA 5J1EA 3UD5A 2EFOA 2VUGA 4ZPAA 3DC2A 3R7NB 1QLNA 4TY9A 2CPIA 3QBCA 3D3CJ 1H72C 2CJQA 2Q66A 1KONA 4WYWA 1FDDA 2QX0A 1T05A 4FYYB 1BQMA 4K8RA 4ZPTR 2Q1LA 4JI6F 4A8YA 1S6QA 2MYFA 4EYHB 3GFYA 1N5YA 3I96A 4OI0A 2RILA 1VRQC 1VQMS 2OPQA 1H0HB 5A8WA 1RDRA 2MZQA 1X4AA 1RYRA 3DYAA 1ZAXA 3DN9A 3NS6A 2OFHX 4ED1A 2XMUA 2DEJA 3EGNA 2CWKA 3NY0A 4ZK7M 3CD5A 2H5EA 2UUCF 2Z2LA 2DTJA 3VAHA 3OVBA 1RLCL 3GJRB 1DZ5A 4ANCA 2FDNA 1RACB 4CQ1A 3SEOA 4ZVTB 1SKUB 4LJMA 1ROFA 4HHHA 5FDLB 5I3UB 5EHHA 3CCTA 3BR8A 4FXWA 4ED6A 4RW4B 3V6DB 1TL3B 1PBAA 4RWWA 4HDHA 5GMKa 1RWNB 4R8UB 1UVIA 1VISA 2O66A 3L7UA 3US5A 2DO4A 1DARA 5M2UA 4DR1J 2YBVA 2KYXA 4W98A 1UVMA 2F8EX 1SKWA 4KPCA 3RYLA 3M1VA 5IFMA 4P6QA 1E6YA 2BMBA 3QIDA 3UO0A 4LT6A 1CSJA 3M2UA 3IRWP 2D74B 2XLKA 4IFVB 1WSRA 1FHTA 3TZZA 3QZ7A 3DOLB 3QT6A 1NDCA 3MM5A 2BE2A 4K59A 4PXDA 2MZTA 4J9QA 2GVZB 3RBXA 3C8YA 3G86A 3LP2B 2R7XA 4FVCA 4DX8H 2YNGA 3OSPA 2QL9B 3MEGA 1QUPA 4QIVA 5GAEI 2MKKA 3F56A 5CYMB 5JJBA 4NLDA 4JI5F 3HHLD 1YQHA 2ASJA 2ZE2A 5DRKA 3DM2A 3OHAA 2DO0A 4KTQA 5KFGA 1WDTA 4I1TA 1F9EB 5CD4A 2E9RX 1IQTA 1U47A 2OI2A 5L46A 4RJVA 2RF2A 4NZ7A 4QR2A 1GAOA 3UDVA 2OJ3A 4DV6J 2WONA 2EC0A 1F2HA 1J5OB 1L3SA 1VQ7S 4OJ3A 2HIQA 4M5LA 1BXNA 4JV5F 2XGQA 4OLOA 4H4MB 3BKFA 1H2TZ 3BBBA 4X4VA 1S6UA 3MECA 2ZM6F 1HBNA 1H6KX 5K14B 2CDRB 2GJIA 1QSYA 3C6UB 1XQIA 4M5DA 3KLIB 3PEHA 4DV2F 2X51A 3DNCA 1NB7A 4TLQA 3LAKA 3OUYA 3ZZRA 5FLXU 2JEFA 2KVQE 3AD8C 2V9KA 1RAAB 3K57A 1N33J 3AH6A 2HBYB 4J91A 5T7LA 1GXUA 1HNXF 4ZVRB 2OHDA 2GIRA 4JUZA 1C1CB 2L9NA 2R2SA 1M1KT 3GYNA 4CI0B 3BGRB 4JI2F 4WTYA 3ENVA 2XCPA 3H8YA 4YR0A 5JUMA 1GX6A 4CNZA 2WTFA 4MYUA 1WTBA 1R0CB 3KOAA 2RRNA 4CTAA 3MM6A 3NGUA 4PKDB 1Z2ZA 1SH0A 5RUBA 1Y5LB 1LFPA 3PEJA 1D8ZA 3EJMA 4F25A 4RU9A 2XY5A 4LFAF 2YX4A 2IFXA 3MCOA 1IR2A 3DCAA 1X5SA 1JLQA 3MPVA 2CPEA 2HFVA 4C8YA 2GO9A 4DL5A 3LQVA 3NKYA 3KDOA 2CPFA 2WCXA 3ZXWA 4EGLA 5T41A 2IMWP 2W24A 2D9PA 3FCVA 3G82B 4MFBB 1XN9A 1FDNA 2OKQA 3Q2SC 2EW9A 3QSYB 4OX9F 2NYIA 3TVKA 1YTYA 2XZTB 5DGBA 4KGKA 2OPSA 5KFTA 4A46A 1T03B 1B0VA 3PW7A 3DGVA 5HBMA 2LXFA 4I0WA 2I0XA 5B0EA 3AAWB 3BPDA 4PEOA 4X4PA 1N54B 4LIWA 1RLDA 4CLWA 1CBKA 4UOGA 2GQQA 1U09A 1FJCA 1NKEA 2J7WA 2Z0GA 3PJXA 2CZVC 1DURA 1NK6A 1RBLA 3H25A 3GFXA 3K2YA 1VI7A 5K9FA 1NCLA 1JMTA 3JSMA 4DDFA 3I0RB 2HWHA 3TAPA 2KU7A 3LUYA 2RMLA 2XO7A 2CPZA 2XNQA 2DH9A 2WBRA 4B17A 4KSEB 4GRSA 2BJ8A 3JQMA 1QVGR 1MU2A 2KB2A 3UE2A 1UZHA 4NYOA 4OJGA 5J2QB 3OR2B 3HHLB 2KXHA 5L1JA 3PNIA 3BO2A 3FQKA 1C0UA 3SIPB 2PA8D 4ZP7A 1S9EB 2Z58B 1EQMA 3HHEA 2FJAB 2EG1A 2ZVIA 5HI7A 1Q7LB 2GX8A 1X9MA 3M2VB 2OMLA 3IRXB 3FBBA 2E7VA 2V2ZA 3QSIA 4ZLPA 1M1GA 2YNFA 2V4JB 3EZUA 3ZZ0A 3PYGA 2UUWA 4TXSA 5F3ZA 4ED3A 4RZRA 3I6PA 3N79A 2HAFA 4JI6J 4AUKA 5HJYA 3M32A 5HVGA 2JHEA 1T11A 1E6VA 3I82A 4IRDA 1VYAA 1ZM9A 4RUAA 3KK1B 3AXMA 1VS3A 4I67A 1V3SA 2RQKA 4N77A 2VG7A 2HQCA 3MF5A 5DJBA 3HHLC 2GCFA 2DRDA 2UUCJ 2LQ8A 3MURP 3UDLA 4IRKA 1NJIT 4I2PA 1WG1A 1BWEA 4ZLLA 3H40A 4DEZA 4B9MA 1PC4A 2EWHA 2JZ5A 3LW5C 5F8MA 4HR2A 4QWEA 3ZFVA 1HD1A 1X4HA 1R3NA 4JI4J 1ZAVA 1N52B 1XNRF 4NLGA 1YVFA 4DMZA 2DY1A 2L08A 3JYTA 1GMWA 4NEYA 5KG7A 3GV5B 2CA9A 5HROB 2KHCA 3NOGA 2WVCA 3RJMB 2Y0BB 2ZZNA 3PW2A 1RT4B 4AFFA 2XMJA 3DOMB 2MY8A 1CULA 5B09A 2CYYA 4QIEA 1TV6A 3D6HB 3LP0B 1Q5YA 4IUFA 2HFZA 2I2YA 1FEHA 3GSIA 4OV1A 2F5GA 3EXCX 3O8WA 3U1NA 4LVOP 2C28A 2DNYA 1X9SA 1G6BA 3H90A 3RRHA 5A6PA 4JI5J 2O3DA 4CLUA 1D09B 3NGTA 5K8PA 3NCPA 3U02A 3HJFA 4ZJLA 4FKXA 1B7FA 4IDKA 1TK0A 1KP6A 4KPYA 3AJ2A 2W9AA 4IQMA 5FIIA 2O1PA 4DL7A 1XJWB 2B9WA 2V50A 3BF4A 4ED5A 2B3TB 2WB1D 4ELUA 1RA7A 4QWAA 4PXCA 3TR5A 1UTAA 4CYUB 2DKOB 3DLKA 1YIJS 4QZVB 4DG1B 3RAXA 3EM1A 1AXQA 3SZ2A 1SJ1A 1WI8A 1HI8A 2ZM6J 2FVRA 2V4RA 1U49A 3ZNUA 3E01A 1NXIA 3T1YF 1ICEB 4RW7A 1RT6B 1NB2A 1BLUA 4DCPB 2V8VA 1F6TA 1N0VC 4KV8B 4V1Ak 4DV2J 3MEDB 2EC2A 4F36A 2QSFA 9ATCB 5IQ6A 1CVJA 1DQ9A 3EVMA 4OYZA 2B5JA 3KLEB 3M9MB 5D8HB 2DT9A 1ZAWA 4RW8B 1HNXJ 2HVDA 4MIAA 2ZVSA 4KKOB 1BHNA 4MYTA 1JJ2R 4JI2J 2HNZB 1FWLA 1S0NA 1UETA 4DR4F 3KDNA 2V2KA 1FXRA 5HP1A 5MAOA 2JEGA 2WVDA 3GJQB 2VKZG 5IM0B 5KFMA 4LR7A 3TO8A 2VASA 1GMUA 1VK3A 4ZJQA 2GQ2A 2KG0A 5KFWA 3P4UB 4WFXA 3THTA 1VRTA 1UA1A 4ERDA 4FPIA 5DETA 4RO0A 4UQGA 4P10A 4LFAJ 2NR0A 3I32A 4YDXA 2VOOA 5DDQC 3OTOF 4OZ5A 4TQRA 4H4OA 2EKNA 4G1QB 4NL5A 2Z2ZA 3NRBA 4QPXA 1X4DA 2K7KA 2FY1A 3P3DA 4O44B 3J7ZT 2IJFA 3FJ2A 1D9FA 4ENOA 3M2RA 1SH2A 5GAGU 1UW9A 2RNEA 4ZVPB 1VBXA 2CQHA 1IKYB 5L9NA 4OX9J 5GVQA 1BQXA 4WFNQ 5AE2A 2DY9A 5IXUA 2CUYA 3CJTA 1B4SA 2BW7A 2LU2A 2XYPB 1L3UA 4LSNA 4RNNA 1UVLA 3JSYA 1TMJA 1HNIA 2HGMA 4ILRA 5DG9A 2P2CB 1UA0A 1R7IA 2LA6A 5I3PA 1AZSB 4ZHRB 3DKDA 3CJRA 3TX8A 3GIRA 4P72A 1BD6A 3K0JA 3OFHA 3O1LA 4G6VB 3UQSA 4EU0A 2CIMA 4X2BA 1MLAA 4ANEA 2YKQA 3R6LB 1ZM3A 1XR5A 3U7JA 3KYLA 5LOQA 2ASLA 2WW8A 2PMHA 3G8QA 2CADA 2ZBPA 1PC5A 2MJUA 4IG0B 2OEKA 2EXUA 2C2ZB 2DXFA 1S9GB 3MTJA 3FUYA 3ISZA 3JTPA 2NCKL 3RBZA 2KXNB 2FJWA 1YZ7A 1SIZA 2OSQA 4GKJF 6AT1B 3DFEA 3JAMY 3EZOA 1S6PB 5D0RA 4NWBA 4K2JA 5HK4A 4X65F 1VHIA 1HMVA 3CJ8A 2UUTA 4NMXA 1NBEB 3GP9A 3UW1A 4CLTA 2HFSA 2V69A 2VV5A 4EWTA 2YKNB 1RJJA 3BQ0A 1M5OC 3JQJA 5KFYA 3MAHA 1RT1A 1RTHA 2V0NA 3BQ2A 1UFKA 1SQEA 4YUDA 3CWJA 3CC7S 1V6HA 3P45B 1YZ6A 4EBEA 1FX4A 2AJQA 4W90B 4F3OA 2FYXA 2ZHBA 1P27B 1GFWB 2MQLA 3H59A 4QYZJ 1MN7A 1YKWA 2FJVA 3OFEA 1ULRA 2R3VA 5KFPA 5HVFA 4USHA 4WIIA 2V8GA 2DR6A 1X0FA 1XNRJ 4HTIA 2A10A 5AJ3F 3OFGA 1T9VA 5A0YB 4LBHA 4C8LA 2HVIA 2CQIA 3EWGA 3SV3A 3Q8PB 3BBFA 1WORA 2YQ3A 1R8PA 2W7OA 4K4YA 4KHPJ 3ILIA 2FLPA 3FC9A 4AL7A 1HL6A 2WVBA 4CM0A 2CJBA 2DHSA 4OZ3A 5E3PA 1XNQF 3TAMB 1TK5A 1S5ZA 3SCIE 1JNZB 3L09A 3K7RA 3K59A 1K9MT 4ATNA 3KLGA 2G0CA 3R5JB 2CG4A 2V67A 5T14A 3L7PA 1KHWA 3EYZA 1NH7A 2VFVA 2FLOA 1XR7A 1TL4A 4OYPA 4W92B 2DGUA 4UOHA 2K1RB 2ZOMA 1HYSA 5HATA 3VV2B 2EFGA 3VAGA 1O51A 1VQSA 1HBOB 4CLFA 1EP4A 2ASDA 2R2RA 3GONA 2VONA 4RBVA 4J9LA 3W9HA 5J2PA 5BYSA 1LXNA 2OUGA 3MTKA 2AJ1A 4F3QA 1RHQB 1U6FA 2FHJD 4DXLA 2Q6BA 4MK8A 5D4LA 2DGVA 1AT1B 4LFCF 4QIFA 1P1TA 4NLWA 3GB0A 1N5TA 2HRYA 2J7UA 1OQ3A 5IQQA 2X1FA 3T1YJ 1F2GA 4B3OB 4YR3A 2UXDF 1MWYA 2UXCJ 3CCWA 1MWZA 3ZZZA 1JLAB 4AT1B 1V9OA 3DLEA 4DN9A 2C2OB 4ZVHA 2QA4S 2BACA 3Q8YA 1URRA 1IKVA 2NS1B 2G1HA 1JQGA 3CSKA 3LP1A 2UP1A 1S9FA 1RTJA 3LA0A 2AGPA 2OFGX 2MZSA 1HFEL 2A6MA 4OV6A 4F7VA 4OHWA 2V8PA 1UPMB 5K8OA 2ERRA 3T41A 4E0DA 1HI0P 3QYYA 4PXBA 5DDPC 5FLXY 2DNNA 2YX7A 4ZPDA 4P75A 4AL5A 2R8KA 1RAIB 3M30B 3R9LA 2KI2A 4Q0BB 4OJHA 2XMWA 3T19A 1AROP 3B78A 1HHTP 4DV1F 1FK9A 5LXRA 1F1BB 4JV2A 1AYEA 4RW9A 3GJSB 3S8SA 3B4DA 2CNLB 2BJ3A 4MMOA 4A4JA 4JI8J 2NZCA 1XWLA 3QGPA 2NPIA 2B8QA 1LQ9A 2YPZA 5DDRC 5DZ7A 2VPZB 1LWCB 1FESA 4K4SA 4EZ9A 1LWEB 5GMDA 2HNYA 4OHVA 3TAQA 2JVOA 1M5PC 1AB8A 2HQIA 2WHOA 1FKPA 3AFGA 1U1OA 5GAHU 2HHUA 3QO9B 1GTEA 3R2DJ 3MMBA 5IC4B 5HJXA 5BYQA 4UW2A 4X4QA 4MAKA 2DR5A 2MB0B 3PX4A 4IOCQ 1TVRB 2B4UA 1LKZA 1ZZFA 2RKIB 2XG8A 2CVEA 2DNMA 1BE4A 1NJYA 1MSWD 1YDLA 3JXOA 3OTDA 4C3KA 2MGZA 1TZ0A 1MNEA 3SQGB 2CZ4A 3W9JA 3GU0A 1Q8KA 2U1AA 5H1SV 2Q43A 2HEKA 3AA9A 3RRKA 2Z2MA 4JI7F 2R4FA 3H7HB 3AHPA 4KGXB 3TOQA 2MZJA 2B4OA 2XYGB 4XTTA 3QRPA 3FFIB 4W4MA 8RUCA 2XQCA 1RTIA 2VDHA 4V19J 4A8SA 4L72B 2YKOA 1BMQB 1GMVA 2G2ZA 1ACMB 5CD4H 2VKRA 4ZPBA 1HPZB 4GKJJ 3D0GE 4X65J 5C24B 4DZDA 3DRRA 1FRIA 4DPTA 5HMXA 3UVJA 3UCGA 4BBYA 1MMDA 4NI2B 3UN3A 4NLPA 5CH7B 4ZA1A 2Q6CA 2BKPA 3HO1A 3J81U 3BZQA 4R5PB 4UY8T 1JKHA 3E2EA 3ITHB 1F0XA 4I64A 4LQ9A 3IAS9 2KM8B 1NK0A 4B3SF 3ZTOA 1DLOA 3PW4A 4ED0A 4PWWA 1GK8A 5KFHA 4RNOA 2C2MB 3G2XA 4ER8A 5CAAA 4HT7A 4AYBD 2ZUAA 1HHSA 1RCOB 3JSRA 2KFNA 4ECYA 2F9JA 4CDIA 2XMAA 3V4IA 1K73T 4XAKA 4L3KA 1NK8A 2PMWA 3L9ZA 3DXBA 1RP5A 2W9BA 1S1UA 2DNPA 4C4WA 4J9MA 5GMEA 5E3RA 3MXHP 2BJDA 1RWPB 1VOMA 3MD1A 2VG5A 3BYPA 3FZBA 3RB0A 1X4BA 3VZHA 1TP7A 1XNQJ 5J1NA 3PHTA 5BXIA 2IC3A 1IKXA 3NMRA 4YMEA 4DUYF 3L95X 2AP6A 1JLGA 4ZP8A 2MKHA 3BREA 4IO1A 2KM8C 5EWEA 4Q5VA 2K3KA 1K44A 1REGX 5KFFA 5B0DA 2IYIA 1RAEB 9RUBA 4C11A 1JLBB 1W2BR 4PUOB 3QLHA 1U0HB 1YJ9S 2DNHA 4UOCA 2ALZA 1KNZA 2OELA 3EGVA 2B0GA 2H5JB 3DLJA 3KHHA 2XS2A 4AQYF 1REVB 3SDEA 4WPAA 1B64A 5B0BA 4OYWA 3ETMA 3P6YC 4DFJA 5HVHA 4DSKA 4OIXA 3BSNA 2BQUA 5K20B 5DLFA 3AOAA 2MKCA 1IKWB 2GVDB 1Q16B 3AJDA 4TY8B 4FF2A 1SC4B 2CPXA 3VVUA 4QR0A 4LFCJ 1YJNS 1TL1A 4DBQA 4DFMA 4MJKA 2Z56B 1HBUB 1TAQA 2M4MA 4LF9F 4HACB 2VC0A 3EZ5A 2ZH7A 4JYAF 2PT0A 2X1BA 4DS5A 2ZZTA 4RX6A 3JB9k 4PQAA 4IRCA 3QPIA 4CO0A 1YHQS 3W8PA 1HWJA 1SBRA 3W1YC 3Q8RB 4YY3F 3ILOA 3Q22A 1V5IB 3PTWA 3RGIA 5KG6A 2B6AA 1DAXA 3POTB 3GSDA 2HHTA 5LM7E 1UVNA 3ZTQA 3D0IE 2OP5A 2H48B 2WVFA 3TUJC 3KG4A 4P7TA 3BSAA 1QDUB 4DV1J 2AD9A 2V6AA 1DTTB 1CPZA 1JLCA 1MROA 2CPYA 4QJVA 3BGLA 3QQCD 4LRCA 2V5HG 3CUNA 4H4KA 1QAJA 1DBDA 3EXYA 3WC0A 2IMOA 4WFBQ 1ITPA 2DIUA 4F02A 1VQPS 1P6TA 4G1PA 3T6JA 1HNVB 2YPYA 3HSJA 2DR8A 5E3QA 4WJBA 3FSIA 4EI2A 5CA5A 4J9NA 1UPPA 2FVQA 2A1BA 3NOCA 3OJUA 4LRDA 4O4RA 3I56S 3TZXA 2VPXB 5A2QU 1V3RA 2VQEF 1VQLS 4WE1A 1GX5A 2D3OR 3RUBL 2KFYA 3ELHA 3CDAA 3ETOA 1VLOA 2J7KA 1PYSB 1GH8A 2XM3A 1NRKA 2LQJA 4ANDA 4I4BA 3WC2A 1YJTA 1RAOA 2DHAA 2Z4PA 4LF5F 1IBCB 5C25B 4ES1A 1TKXB 2AHOB 3RB6A 2AT1B 3A13A 5C2CA 1C1BA 4XDCA 3W66A 2DISA 4LF8F 4H54A 1N6QB 1LXJA 2C3MA 2P6TA 5MLCV 4Z2XA 4JI7J 1HLWA 3RW7A 2QFIA 3DOKA 2ZD1A 3MPYA 3FNNA 2RUGA 3QAEA 2VBZA 1NNDA 1N34F 1T8EA 2UV8A 4KGMA 4C0OC 2A2DA 3KJVB 2VPYB 2Z57B 2NLWA 1H7XA 3PO4A 4Q45A 1FNXH 5E0OA 1OYDA 4X64F 3ZC4A 3SI8A 1HBMB 4HT5A 2R7QA 1JJHA 3IR5B 1S72S 5J2MB 1KFDA 3M7VA 2HNDB 4AXIA 5GAHI 1WHYA 5I42A 2YQ1A 1HNZF 3KK2A 1CQMA 1QAYA 1N5QA 1RWXB 1OS5A 3MMAB 3MMCB 4JBCA 2MLYA 3QT5A 2EI5A 2BJEA 2CQCA 1ZZNA 2J0XA 1RKIA 2OEJA 2E9ZA 2N3OA 3DI6B 4DSEA 4N8NA 2SXLA 1P9QC 4C98A 2CQBA 4WFAQ 2DNRA 1GTHA 4LRFA 4ED7A 3OJSA 3W5YA 1IBLF 4Y2CA 3LWLA 3BQ1A 2Y1RI 3T9ZA 2XTJP 3M9NB 2W9CB 3DRSA 4BCAA 3KKFA 5DG8A 4FP9A 1FFGB 2CWXA 1RBAA 3DLGA 1IBMF 2K06A 1I6JA 1UKUA 3AA8A 3VZIA 1S48A 2HS0A 2H4WB 4NCGA 3L4BC 4DLGA 4F0KA 1EZZB 2JX2A 4NRUA 3E3XA 1GXLA 3LF0A 2AU0A 2N7CA 1WC5A 2BJ1A 3AQOA 1RHKB 4DL6A 3Q89A 1FJEB 2AX1A 2EKYA 1Y9OA 1NLKL 1VDHA 4DUYJ 1H74A 2N4DA 3PYDA 4NEZA 8ATCB 4OI4A 1FO1A 2KT2A 4C8OA 1QUVA 1NDKA 2CPDA 3FBEA 2V2VA 3KFWX 5HN0A 5KT7A 2GAHC 3OSNA 1RTDA 2JLFA 1SUQB 1FDAA 2BE7D 2AJ0A 2FZGB 3PJ9A 4AQYJ 1L3VA 5F9NA 2HBRB 2JEJA 2OGUA 1U1QA 4DL0C 4LF2A 3GYXB 3GMGA 4FBUA 2VODA 1M0SA 4R25A 1R31A 5D4NA 1S10A 2E1AA 5FDLA 5I3UA 3T9NA 4MK7A 4RW4A 4M5KA 3V6DA 1TL3A 1S59A 3K5LA 4WTOB 5K5MA 5LMUF 4DQQA 3LPEA 4R8UA 3V2UC 2DHGA 4UZCA 1EQ0A 4ECXA 3OR1B 3TJ8A 1KOOA 2H54B 4LR9A 4USMA 4I2QB 4GMKA 1AW0A 5KFBA 4F8RA 3I5CA 2XSJB 3D1OA 1SXLA 4LF9J 2L9DA 1UFLA 1U2RA 3V6KA 1NZ8A 1WI6A 4JYAJ 4IFVA 4S0MA 2WSFC 5D4OA 1FTRA 3R6GB 3DOLA 2MMYA 1JK9B 1NAQA 2GVZA 4QPTA 3P96A 3LP2A 4EFAC 3GJTB 5L38A 4OZJA 5CYMA 4YY3J 1TUWA 4CO1A 1TKTB 1G4CA 5IV3A 2NUUG 4M8LA 4IH5A 1IQZA 1RISA 4RW6B 3D6MB 4AXJA 2DIVA 3R2CJ 3CD0A 4K0KF 1VCTA 4KGZB 3SFGA 3DMJB 2V9WA 4L76A 5ETOA 2X1GA 4LF1A 4QW9A 2YNIB 4WYLA 4A8QA 2J0SD 2KYZA 2NYHA 4ZIVA 2ACYA 1ZTWA 1J5OA 3NNCA 2MEWA 3NS7B 2HRUA 4BWMA 4CLLA 2PGCA 4Y2IA 1TV6B 4GC6A 1S0OA 3HD1A 2HVEA 3NLCA 3MM8B 5M2RA 3PY8A 4H4MA 4OYBA 2EK1A 5IT4A 4DR1F 2PSZA 1YRUA 1NHUA 2AEJA 2QA4G 4O3SA 1S97A 2WSEC 5K14A 2HWIA 3C6UA 1TFYA 1VK8A 2M8DB 3VALA 3KLIA 4ZPWR 2DGTA 4NA3A 4DV4F 1P9YA 3IXQA 1CQNA 1S1VB 1CG2A 1VR6A 3OFFA 4DL4A 1TAUA 3D66A 2KZZA 4A48A 4K7QA 3OQ2A 4ZVGA 3ILJA 2VQEJ 2OLWA 2C2DA 2R8IA 1C1CA 1HI1A 3BGRA 4FF4A 1D1UA 3AJ1A 2VU5A 3ZZOA 1Q81T 3DLKB 2E1RA 4U7CA 3OXGA 3K5PA 3C66A 3VAJA 4B3TF 2YVSA 4WBFA 4LF5J 4KE5A 3CEDA 4DV6F 3HSGA 3DLHA 2DGQA 1CJUB 2M8HA 3FRZA 1HNWF 5D0HA 4EUVA 2N7YA 4LF8J 2XY6A 3WIVA 3LOUA 1UEUA 2GGPB 1CJTB 1KVIA 3MHYA 2M3DA 4X62F 3D7SB 1SC1B 1FCAA 3O3LA 1N34J 3QFWA 1SJRA 3R8YA 1S12A 4U6PA 4FYWB 1RADB 2FTRA 4Q8EA 4OHXA 4LBPA 2CZ9A 2HK3A 2B7BB 4M5HA 4X64J 3G82A 3I9V9 4MFBA 3B54A 2BUNA 1H98A 2E5LF 2IIHA 3QT7A 2IJNA 2KT5A 2D3ZA 2D3O1 2HQGA 5IWAF 3UFCX 3PFEA
chains in the Genus database with same CATH topology
2RNEA 3GR0A 1T03A 1VBXA 2GFFA 2CQHA 2ZKUA 2C3YA 1IKYB 1SIWB 5L9NA 3DI6A 2IAJA 2MZ1A 5H9EJ 1HW9A 5GVQA 1BQXA 3MAQA 2YH0A 4Q43A 2OMOA 2J9DA 1ZPVA 4WFNQ 3CMAS 5AE2A 1YJVA 3BDEA 4ETZA 5IXUA 4Q2MA 1ZH5A 2OAUA 3I9ZA 2FJDB 2XBPA 2HNYB 2LU2A 1DQAA 1L3UA 2E9TA 3MOJB 2FJXA 1K0TA 5DG7A 3IWXA 2J6UA 3LH2S 4LSNA 4RNNA 1UVLA 3TYTA 2XSFA 3G6VA 4YDDB 1OO0B 2DB1A 3JSYA 2HW3A 2ASYA 4NRTA 1HNIA 1FKPB 3K5OA 2HGMA 1ZETA 4ILRA 5F3TA 5DG9A 2XMMA 4URQU 4XO0A 2GV1A 3HI9A 3CC4S 1UA0A 1R7IA 4KFBB 2LA6A 2J0WA 5I3PA 2B9XA 2W9CA 1SKRA 1VFJA 4ZHRB 3C2PA 3CCSS 2R7SA 3MMBB 4OI2A 3TX8A 1S1XB 2ZJPQ 1JLEB 4NXNF 2Y1IA 1XERA 2COLA 2XCAA 4NOHA 5KT6A 4AE5A 1VQNS 3PXGa 1S0MA 1X4CA 3QMQA 2C3PA 3K8WA 2VFTA 2E7WA 3T1AA 3I0RA 1N0UA 4C3LA 1AFJA 1J5EF 1BD6A 3K0JA 4DFKA 2AWZA 3B8HA 2XLIA 3N6MA 2X3GA 2KN4A 2YWGA 3CXCR 3OFHA 4OX7A 3PW0A 4A8KA 4RBUA 2CQ3A 5FD1A 1T94A 4MH8A 2NPFA 3IBWA 1F60B 1U6ZA 2XWXA 3O1LA 4G6VB 4WU2A 2G4BA 2DNQA 3UQSA 3DLBA 1CEZA 4EU0A 4MKBA 2CIMA 4OQJA 4X2BA 2MGZB 1NZAA 5FJ4A 3RTVA 2YKQA 1DFDA 4RNHA 5J2QA 2MSSA 3P49B 1ZM3A 3OR2A 1XR5A 3U7JA 3HHLA 3KYLA 3F44A 3PX6A 3BEGB 1HD0A 2RU3A 4A8MP 1IJFB 1HQEB 3EX7B 1Y5IB 2LCWA 1OIAA 2HGLA 3LGMA 4J9PA 4RUHA 5GADU 2YWHA 2ASLA 2K3IA 1SKSA 1S9EA 2WW8A 5A6WA 3IG1B 2PMHA 3D0HE 3G8QA 3V4MA 1C4AA 4ZCKA 2E5IA 2KKHA 1FKOB 2EFQA 1RT3B 4BC9A 4KIAA 4DF4A 2F3JA 1PC5A 2MJUA 2VBYA 4IG0B 3OL7A 1RGVA 1NU4A 2MY7A 3UCZP 1NEEA 3M2VA 2ZH2A 3IRXA 4P2SA 2XY7A 1LW0B 1T95A 4DQSA 4K4VA 2R7VA 4DQIA 2EPIA 4LFBF 4QR1A 1J2VA 2VFSA 3GILA 1S9GB 2CRLA 2POKA 3MTJA 1FNMA 2KRRA 3ISZA 3H2UB 3JTPA 1XMBA 3OW2R 2V4JA 2DH7A 4YB1P 2KXNB 2ZH4A 2FJWA 1SIZA 3MUVP 1RTIB 4EEYA 3Q2TC 2F40A 4DV7F 2OSQA 2M5YA 2B4VA 4YR2A 4FN5A 3OXLA 2GA7A 2LYVA 3MR2A 2UXBF 2J6TA 4ZVFA 5L1IA 1VQYA 3N5FA 2ZC4A 4JV1A 3CDWA 3G4SS 3DFEA 3JAMY 4GKJF 5LMNF 4QU7A 3KTQA 3JSBA 1S6PB 2J6SA 2X1AA 1K1SA 3DGPA 4NWBA 5A8RB 3Q8SB 1G2EA 4X65F 1U24A 4DWIA 1HMVA 2MHEA 1HR0F 4KO0A 1SUQA 3BB5A 1TKZA 2BVZA 5EX0A 4TYAA 5KT5A 4Y28C 2FC8A 4F67A 3TARA 2UUTA 3G6ES 3TW0A 2MQMA 1X5OA 3UW1A 2HHWA 3MZIA 4Y6IA 2VV5A 4EWTA 2KG1A 4ECZA 1P1LA 2YKNB 1RJJA 3BQ0A 1M5OC 2DH8A 5KFYA 3KK1A 2L3MA 1VC6A 3PKMA 1N88A 3MAHA 1JLFB 1RT1A 1RTHA 2CDQA 2V0NA 1MMNA 2APOA 3DRRB 3OLBA 3BQ2A 2VA3A 3JTOA 1VRUB 1HWLA 2W25A 3AQPA 2M7SA 2ZJQQ 2P9CA 1SQEA 1T3OA 2JLEA 4YUDA 4PWDB 2AX0A 4GKKF 3V6JA 1HWIA 4O3QA 2RE1A 4C3MA 5KG2A 3CWJA 1SL2A 4NCBA 3CC7S 5BR8F 5J2NB 3P5TL 4IR9A 2GQCA 2XGPA 4M63A 2P6SA 1V6HA 3JTNA 1QY7A 4KQZA 3ZZYA 4C7QA 3MM9B 1QTMA 4EBEA 2AJQA 1ZBTA 2HS3A 2OPRA 4LIRA 4F3OA 3KLVA 4W90B 1NHVA 5KT4A 3PHEA 1P8GA 1UW4A 3HVWA 4PRFA 2B43A 1Z1ZA 3M8QB 2ZHBA 5IZHA 3H4DA 4FS2A 3IGVA 2JFKA 1P27B 1JKHB 3HLUA 3PO5A 2MQLA 3GQCA 5KG4A 1FEEA 3H59A 4DSFA 1R43A 4M1KA 3OR1A 3R1LA 4QYZJ 2B51A 2FJVA 2IRXA 4ZP9A 3OFEA 4XIUA 1ULRA 4HEA9 4CO2A 2AGOA 2YNHB 1SV5B 4I2QA 1X9WA 3OL8A 5KFPA 3CCES 5KFOA 3BO4A 3L3CA 3IS9B 2NREA 5THWA 4PXEA 1VGYA 4ECSA 1S6OA 4OZNA 4USHA 2HMIB 5KFZA 1K8AT 5AXNA 4WIIA 2V8GA 1CC7A 1DLOB 2XSJA 4RNFA 3W2WA 1R89A 3IR6B 1WTFA 3KK3B 5HROA 1X0FA 2HPUA 2BYCA 3F41A 2I5JB 4HTIA 2A10A 3PKYA 5IS2A 5E3AA 5CZXA 4YB5A 5AJ3F 2WK4A 4QWDA 1KVJA 2WOMA 3OFGA 5A0YB 4C8LA 3MM7B 4ECUA 4BC7A 2CQIA 3HMJG 2HVIA 2R9LA 3SV3A 4EBCA 3Q8PB 1SJ4P 1KTQA 4FF1A 2JSXA 3DOMA 1H3DA 2YQ3A 3CC2S 1JB0C 2RVJA 2C22A 3GV7B 2EFNA 2PA3A 3QGGA 3NWGA 1R8PA 4CO5A 2W7OA 4K4YA 3BM7A 3UI3A 3V4IB 1R8AA 4Q8FA 2RSQA 3BGFA 5CCLA 2FLPA 1XC9A 3PZPA 1Z4UA 3R5DA 3LP0A 3D2WA 1G1XA 1ZPWX 3UCUP 3HHDA 4MKYA 3DHXA 4YP3A 5HMZA 1VLYA 4C8ZA 2ZOFA 3W2VB 2UZAA 2ZZMA 4ZDNA 3CDEA 5HO4A 4LF6F 3BR9A 1TKTA 4HDGA 2DPJA 4AL7A 1U1MA 1HL6A 5E5NA 4C8NA 3G9CA 2CJBA 2IYGA 2W9BB 2DHSA 1S1UB 3I5BA 5G0RB 4B02A 2MKJA 3GFZA 4MK9A 5E3PA 3IN5A 5CHCB 3TAMB 1XNQF 1TK5A 3CJ3A 3FZ2A 3SCIE 1JNZB 2QEXS 2P9GA 3L09A 1KLMA 4RW6A 5DO2A 3K7RA 3B4MA 3K59A 1K9MT 4ATNA 1VQ4S 2QA1A 3KLGA 2G0CA 3CCVS 2ZH6A 5KFDA 2VG5B 3BSCA 2QMWA 2W4PA 2BM0A 5J1EB 3DMJA 1WNEA 2PDAA 2CG4A 4KB7A 5B08A 5T14A 3L7PA 1H7WA 2QLXA 3R3TA 1KHWA 1Q79A 2U2FA 2FJBB 3DXSX 2IC3B 2JWNA 4HI2A 1IKXB 1VHFA 3DRXA 3EYZA 2YNIA 1NH7A 2VFVA 3D28A 4YB6A 1UJ5A 2FLOA 4I68A 1JLGB 4ZKAA 3OL6A 3T5JA 1YGYA 1XR7A 5CYQA 1WG4A 2AYMA 3NAHA 4PPZA 1TL4A 2QT7A 2K2PA 3HVAA 2DGWA 2VQFF 1T05B 3M9OB 4W92B 3OL9A 1U26A 1OWXA 4CNYA 1BQMB 4DR5F 4DL3A 4C11B 3C46A 1JWWA 2YY3A 4YEAA 3TVZA 3T6BA 4F4YA 2DGUA 1U48A 4LQ3A 3IAM9 1W25A 1S6QB 2DBBA 3MM8A 3QLHB 5F0WA 2WBMA 2K1RB 3PRDA 2ZOMA 1N5YB 4JI4F 5GAEU 1VBYA 1HYSA 5M2PA 5L9XA 3PR5B 2EFGA 4DPOA 2IM0A 1C4CA 3OLAA 3VAGA 3F73A 4XPEA 3KMQA 1O51A 4QWCA 4ECRA 1VQSA 5L1KA 1HBOB 2O01C 1EP4A 2DGXA 3N01A 2OPPA 1QE1B 2OPQB 2ASDA 2IBKA 1N32F 5AE1A 4IOBA 2R2RA 1N4LA 2VONA 4RBVA 2MKSA <