3NNCA

Crystal structure of cugbp1 rrm1/2-rna complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
175
structure length
175
Chain Sequence
SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUGBP Elav-like family member 1
publication title Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 46
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nncA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nncA02
3CUNA 2MJNA 1X5SA 2DGXA 3SDEA 1VQLS 2M8HA 2DITA 2L9WA 1UW4A 5IM0B 4QU6A 1VQOS 2OTJS 2RQ4A 1U1NA 1H2TZ 2GHPA 3L3CA 2N3OA 2LEAA 1G2EA 1JJ4A 2J0QD 2CQGA 3V4MA 1JJ2R 1YWXA 3VAFA 2XNRA 2LMIA 2MQMA 4LIRA 1YI2S 3EGZA 2N82B 2NZ4A 2MKKA 2HVZA 1M5VC 2RRAA 4IOAQ 1WI6A 2CQHA 1L3KA 3I55S 1HD1A 2M8DB 3UE2A 1DZ5A 1X4HA 4Y00A 2CJKA 3ULHA 2RQCA 3SXLA 2DHGA 5H1SV 3FEXB 4F26A 2N7CA 1UP1A 2DB1A 2DGSA 2CPJA 2FC8A 3VAMA 2CPIA 4UQTA 1M1KT 1P1TA 2J76E 1N8RT 4BS2A 2DHAA 5HL7Q 1ZH5A 2AYMA 3G4SS 1HA1A 2ADCA 4FXWA 1VQNS 2CPHA 1R8PA 3H2UB 3CC4S 1SJQA 1WEZA 2DNQA 2MGZA 1QVGR 2DO0A 3G6ES 3MUMP 1WG5A 2DO4A 5DDRC 3MD3A 2YH0A 2VOPA 1VQMS 2DGOA 2I38A 4UY8T 1M90T 4IUFA 1UAWA 1JMTA 2MKSA 1VC5A 3I56S 3P3DA 3TP2A 2DISA 1N52B 3SMZA 3Q2TC 2OTLS 1VQKS 3MD1A 1SJ3P 3N9UC 2D3OR 2ZJQQ 4W90B 1WG1A 3RW7A 2JWNA 2RRBA 4YB1P 2KHCA 2X1GA 5DETA 5IM0A 2M7SA 4ERDA 3MDFA 5JVGQ 2CPEA 3RW6A 1SJFA 3B4MA 2DH9A 3VF0B 4J5OA 1CVJA 1D9AA 3VALA 1WTBA 2X1AA 2OJ3A 1UFWA 2AYEA 4A8XA 1X5TA 4C4WA 1FJEB 4PRFA 3UCGA 5DDPC 3NMRA 3NNCA 3CCVS 3CMAS 2XS5A 2KU7A 5HO4A 5GAEU 1X5OA 3S7RA 3CXCR 3CCLS 1WI8A 3CC7S 1S72S 3CMES 3ZZZA 2MJUA 2E5IA 2LKZA 2DNGA 4ED5A 3MUVP 3CCSS 1X4AA 5GADU 2I2YA 2AYBA 2DNLA 3US5A 4WIIA 1FJCA 2M70A 1S79A 2XS2A 5LXRA 1WEYA 3U1LA 3NNHA 3HI9A 1M5PC 1U6FA 2YTCA 1VQ5S 2MZSA 3CCMS 3DXBA 1U6BA 3R27A 3BS9A 2JRSA 2MQPA 2QA4S 3EGNA 4TLQA 2DH7A 3MOJB 1YIJS 1AUDA 4M5DB 2DHSA 4EGLA 2JVRA 2L08A 3IWNC 2A3JA 1DBDA 2DGQA 2KI2A 1RKJA 5DDQC 1WHVA 3S01A 3THTA 2XNQA 2FY1A 1A9NB 2DNPA 3IRWP 2MYFA 1FO1A 4WKRA 1WHYA 1BY9A 1WG4A 2CQ3A 2DNKA 5DDOC 3CCRS 2LA4A 2JVOA 2DIVA 2EVZA 4CQ1A 2RT3A 3CF5Q 3BO3A 4Z2XA 2CPDA 4CH0S 4CIOA 3BO4A 3CCQS 1M5KC 2KXFA 2MQQA 4TU9A 2KH9A 4OZ1A 2CQCA 1U1LA 1PGZA 3K0JA 5GMKa 1ZZNA 2BZ2A 1Q81T 1FT8A 2G1DA 5CA5A 1KQSR 2XS7A 2QFJA 3H2VE 5LSLA 4P6QA 2CQ0A 3ZZYA 3CC2S 1U1OA 2MKCA 2D9OA 2ERRA 3SDEB 1O0PA 1VC0A 2YH1A 2U1AA 2EK6A 2B0GA 3BEGB 2XSFA 2MPUA 2KXNB 1YITS 3UD4P 3B4DA 2KXHA 2LYVA 1XN9A 4WFBQ 2ZJRQ 2DNOA 2RNEA 2E5JA 5JVHQ 2RVJA 2F3JA 3UD3P 2KN4A 5IQQA 2MY8A 3VAJA 2LXIA 4WFAQ 2HYIB 3NS5A 3S8SA 2CQPA 2MSTA 1X5PA 5BJRA 3CPWR 2JX2A 2DGTA 2CQ2A 1K9MT 4ZKAA 3CCES 3BO2A 4LJMA 1RK8A 2E5HA 5DM7Q 3JB9k 4PKDB 3Q2SC 2OIHA 3G8TA 1U1PA 2UP1A 1IQTA 4YUDA 1YJNS 4QPTA 4TU7A 2F9JA 5GAGU 2O3DA 3CTRA 3UWTA 2DNYA 2MZRA 1FJ7A 2HGMA 2DGVA 3VAGA 4FXVA 3PIPQ 2KG1A 2MB0B 1F9FA 1U1QA 2U2FA 1OPIA 2RUGA 4TU8A 3PIOQ 3UCUP 1SJRA 2D9PA 2MZTA 4IO9Q 1X4DA 1HD0A 3J7ZT 1R8HA 2M4MA 2KM8C 1YTYA 2LXUA 1K73T 4WFNQ 2KM8B 4C0OC 2LECA 2MXYA 3VAIA 3CULA 1ZZFA 1X4BA 2VONA 3HHNB 1VQ6S 2DGWA 2DNHA 2FC9A 1H6KX 5EN1A 2CPZA 2QEXS 1FXLA 2DIUA 2L41A 3P6YC 3D2WA 2GO9A 2M9KA 1YJ9S 2MY7A 2MZJA 3MXHP 2KYXA 2ADBA 2X1BA 2J8AA 1NU4A 2FHOB 1U1RA 2Q79A 3P5TL 2ZJPQ 2VOOA 1URNA 2KRBA 4PR6A 4C7QA 2KVIA 2CPXA 2RS2A 1M5OC 1D8ZA 1KOOA 2DNZA 2MQOA 1Q82T 3MUTP 5CYJA 3UCZP 1KD1T 1X4CA 1H2UX 2CPFA 1N88A 2CQIA 2MKJA 1DHMA 2CPYA 1PO6A 2X1FA 1VBZA 2MKHA 5LJ3Y 5DM6Q 1U2FA 3LPYA 3MURP 1VQ8S 1WEXA 2SXLA 3G8SA 3U1MA 2FPHX 2DHXA 1WHWA 3G71S 1DRZA 4LMZA 1N54B 2CQBA 1WWHA 2VODA 2MZ1A 1K8AT 1Q86T 2DK2A 2DH8A 1OIAA 1KC8T 2MKIA 5IFMA 2DNMA 2LCWA 2LA6A 2V94A 2NLWA 2G0CA 2HZCA 2RS8A 1WELA 2YWKA 2HGNA 4U67Q 2J0SD 1OO0B 1U1KA 1X4FA 2AYGA 1VQPS 1OWXA 4F25A 1HL6A 1VC6A 5D77A 1VBYA 3CD6S 1X0FA 1A7GE 3VAKA 4WF9Q 3G9CA 2M2BA 2E44A 1WHXA 3S6EA 3OW2R 2AD9A 2E5GA 1X4GA 1B7FA 2KT5A 2CQDA 3R1LA 3P49B 2XB2D 4RU2A 1KOHA 2OSQA 2M88A 1FHTA 3FEYB 5LXYA 4IOCQ 2BOPA 2N3LA 4WCEQ 3TO8A 5LJ5Y 4CH1A 5GVQA 1WF2A 2KRRA 1VQ7S 2WBRA 2EK1A 4QQBA 2DNNA 2MZQA 5ITHA 4YOEA 2DGUA 2KFYA 2LQ5A 3EX7B 5GAHU 3CCJS 1SJ4P 2YKAA 2KG0A 1YJWS 2MMYA 3NNAA 2G4BA 1NJIT 1QVFR 1WF1A 2MSSA 3THPA 4F02A 2MQNA 1FNXH 1VQ4S 3VAHA 2OSRA 2M52A 2DNRA 2CQ4A 5MLCV 3G96A 2PEHA 2MGZB 5CXTA 4Y0FA 5D78A 5FJ4A 1NO8A 3TYTA 2M0GB 2PE8A 3NS6A 1U1MA 3MI7X 1W2BR 3CCUS 4OZ0A 5LSOA 1H2VZ 1P27B 2MQLA 1VBXA 3DLLQ 3J7YU 4V19X 1WF0A 3LQVA 2CQ1A 2F9DA 2K3KA 2MHNA 4QU7A 1SXLA 2LEBA 1VQ9S 1Q7YT 1YHQS 1JJHA 1X4EA 3R1HA 2K8GA 4W92B 2RU3A 2HGLA 1QM9A
chains in the Genus database with same CATH superfamily
3NGKA 3MM8A 3SV3A 2RJZA 3M8YA 2E9TA 2OTJS 2GHPA 2LEAA 3BDEA 2RF2A 3IRXB 4Q0BA 2LMIA 1G1XA 3TX8A 6AT1B 1FWPA 1N36J 2B9WA 1ACMB 5K8NA 2ZZMA 1HNXJ 4DX7A 3GIKA 3T5LA 4ZIWA 2WCXA 3MCMA 4UQTA 4KKOA 2DHAA 3Q8QB 1ITPA 5HL7Q 2XY6A 3OR1B 3GJTB 1S97A 1CC8A 3QLHA 4URGA 3DOMB 3O44A 1S1TA 1B64A 2RQMA 1QVGR 5J2PB 1XERA 3K89A 3RB6A 1NSAA 1OQ3A 1RT4B 2GIFA 4CLZA 1V3SA 5G0RB 5LMNF 4GKJJ 4W90B 3HSZA 4WJBA 5CYMA 2X1GA 5IM0A 1D0EA 2P6TA 2MDAA 3QGPA 2KFZA 4ED3A 4WK3A 4RLEA 2ZZNA 5DQHA 3KJVB 1LQ9A 1RWXB 1U7LA 3UCGA 4FS2A 3CCVS 2AF6A 1F1BB 1GNKA 1X5OA 4I2QB 3DYAA 4I6AA 3PW5A 4DSIA 2HZVA 3CDUA 1FKOB 1C0TB 5F8HA 4PG6A 2QO3A 3FQLA 4OMFG 3EXCX 1JLFB 1NSKL 2G2OA 1JLAB 3PJWA 4DFJA 1XMOF 2BE2B 2DXDA 4TLQA 4U7UK 1IJEB 2A3JA 1N33J 1J2VA 4DR6F 1C1BA 1TUWA 1A9NB 3MMAB 1IKWA 2F5GA 3M7VA 2BACA 2DRAA 4GMKA 2FHJD 1KR4A 1TKZA 1NDPA 2Z0GA 2QYGA 4AD6A 4KJIA 3OXGA 3NY0A 3I5CA 4ICLB 3H7HB 1HWIA 3OFEA 2HHVA 3K8VA 4L72B 4JI1J 1ZZNA 1Q81T 5GMDA 3G82A 3H5XA 5DQGA 2Y0BB 4KGKA 2GO8A 2RIJA 2RDJA 3AD9C 4X4OA 2EBGA 1N5QA 1NKBA 3BSAA 2DCUB 1EKSA 2G13A 3G6YA 3NBPB 3ENQA 1UWAA 3D0GE 1H0HB 4DSLA 4DBQA 4LFCF 3VZIA 3TVKA 2YNHB 5F8LA 1SKRA 5J1PA 3Q2SC 3NL0A 3DFEA 3ZO7A 2EI5A 1RT1B 4QPTA 3FFIA 2O3DA 1U47A 2I8EA 3EXYA 3GFYA 1KNZA 1B0PA 4ECQA 1UVMA 4B3SF 3NCRA 4CNYA 3SEOA 3RRHA 1BHNA 1P9QC 3JTNA 1T94A 4MK7A 4TU8A 4A8YA 2LQ9A 1HD0A 1R8HA 4C8OA 1YTYA 1GMUA 1QTNB 1RWKB 3EVOA 1VRTB 1ZZFA 5KFKA 1HBMB 4O3RA 2HWHA 1YZ6A 1LFPA 5J2MA 4AFFA 3MR2A 2KYXA 2AV5A 2VOOA 3DM2B 5HBMB 4RW8B 3GJRB 1D8ZA 2BYCA 2MQOA 5CAAA 2M5YA 1UEKA 1XEZA 2UXCJ 1JLCA 1U45A 4WYLA 2IAJB 1VQ8S 1Q8IA 2FPHX 4JI5J 3IA0A 3TAPA 3VV2B 4Q8FA 3Q83A 4DPWA 2AT1B 2WVEA 4DR5F 3V6DA 5GADI 1L3VA 3RBDA 2GV1A 1VBYA 3AOBA 2E5GA 1B7FA 4DV4F 2OSQA 4IG0A 2V8VA 1W7WA 4CO0A 4DV5F 3ZTPA 2UV8G 5HMXA 3JS9A 4TY8B 1MMDA 1T9WA 4OHVA 1HPZB 1JB0C 5J2NB 3EPGA 1UVJA 4KHRA 4QQBA 4ZS6A 4GKKF 2G4BA 3CD0A 4B9SA 3QGGA 2B9EA 3TEGA 1ZETA 4RU9A 1RHUB 4WP8A 1F9EB 1REVB 3G96A 1VQSA 5FJ4A 2OP5A 5EDWA 5DG9A 5KTQA 2C3PA 4OZ0A 3TJAA 1VBXA 4ZOSA 3MPVA 1VJQA 2GVZB 2XMJA 2FB0A 3KMSA 1JJHA 4G1IA 3RJMB 2BJ8A 3J80Y 5A8KA 1U1NA 5K14B 1RCXB 1H2TZ 2W2MP 2QX0A 4LF8J 2J0QD 1TV6B 1TP7A 4A8FA 4XPEA 1T8EA 5T7LB 3ULHA 3EICA 4B3MJ 4OIXA 2XGQA 2VG6B 4F26A 4QIWD 4C8LA 2CPIA 1N8RT 2J76E 5RUBA 2CJQA 2E66A 4Q43A 3E01A 1IBLJ 1NHVA 3I0RB 2OGUA 3IGVA 1D8YA 5IXUA 2HLUA 4PG5A 3G6ES 3W8GA 2DRBA 3F0NA 2GQ2A 2HS0A 1M0SA 3QGHA 2W4PA 3CW2C 1NKEA 1HNIA 3ILOA 3NG8A 5B08A 2R8GA 1LKZA 2ZJQQ 4WZQA 4ECYA 2HHTA 4K2XA 2IY5B 3JSMB 2RD5C 2VDIA 3HHDA 3N79A 2OPPB 3TQEA 4WKYA 1D1UA 1KHVA 3H90A 1LW2A 1RKIA 3MCNA 2KU7A 3PM9A 2E9ZA 4IOBA 1Y5NB 1S1UB 5LL6d 4IFYB 2BABA 5HANA 3U7JA 2VDHA 1HI0P 2CDRB 2MLYA 5LXRA 3PRBA 3MR5A 1U6FA 1VQ5S 4K7QA 3BS9A 4X4RA 2ZHAA 3EVMA 3H4DA 1EETB 3GCXP 3C14B 5F9LA 3BGRA 3MEGB 3AT1B 2DNPA 4ES1A 3TR5A 3MPUB 2ASLA 3IBWA 2LA4A 4B9UA 2DIVA 1RHQB 1D09B 1JLEB 4Z2XA 4RBTA 2JHEA 2BXJA 3MTKA 2FJXA 3J7YI 2OH2A 2ZDPA 7FD1A 3K0JA 1MROB 4I7FB 3MFIA 1FDAA 3CJKA 2FJDB 5LOQA 2XSFA 1KLNA 1SC1B 3AFGA 2RF2B 2FY8A 1PG5B 2MY8A 1A0OB 3NCPA 2OLWA 2CQ2A 4ZKAA 3CCES 1UA0A 3GG1A 3NMAA 3C66A 4CZCA 1T9UA 4TYBA 4EBCA 1PYOB 1OY6A 1HWLA 4KKOB 1RWOB 2HGMA 3JAMY 5M2PA 1S99A 2WVBA 3QLHB 1U49A 1S1TB 5B09A 3ICLA 1OS5A 3BV8A 3M2RA 1BD6A 5HSPA 2HLTA 4RW7B 4DR1F 4X64F 3D2WA 4PWWA 2IYGA 1HI1A 4H4OB 3LAMA 2HMIA 1K1QA 4TY9A 2QV6A 5SZTA 2CPFA 4A8WA 1Y0HA 4DQQA 3PXGa 1SQEA 1U2FA 3EM1A 2HHQA 2RMLA 3G8SA 4J91A 4J9VA 3UDCA 4LMZA 3R7SB 8ATCB 1OIAA 4RUCA 1MN9A 2ZITA 1WELA 2YWKA 2EG2A 1MMNA 2X3GA 3FBBA 3OFFA 1UCNA 5HATA 2QFIA 3QT5A 3HFZB 3S6EA 4CDIA 1OSCA 1AROP 4CLPA 1S9EA 5LXYA 4RX6A 2BOAA 4ED4A 4WCEQ 3OTBA 3DGPA 4O3PA 4CH1A 1X60A 4YY3J 4KGXB 5KFMA 1CG2A 4M5DA 2WBRA 2E9RX 1Y5LB 2FJVA 3EX7B 1RAOA 3TJ8A 2VF3A 3THPA 2MSSA 3POTA 2ZH8A 5HVGA 4WU3A 1DQAA 4LFBJ 4GO5X 3LUYA 3KUHA 2GAHC 2XY7A 3N5FA 1NBEB 1CS4A 2K3KA 1NHUA 5D4LA 2KB2A 1KQKA 5KFPA 2ROGA 1X4EA 3FQKA 1JJCB 4QPXA 3M6UA 2WOMB 1GFWB 1R27B 1G2EA 3R2DJ 4LIRA 3DLJA 2HHHF 1XIQA 4RW9A 2OPSA 4OQJA 4LFAJ 1W25A 2ZVSA 4RW4A 1S6QB 3KXDA 3GFZA 1P1TA 2GQCA 5EGYA 7AT1B 1O51A 2CDQA 3OFGA 1R8PA 5KFTA 3M6VA 2DR5A 1S57A 2XLJA 2DNQA 3MEDB 3A13A 3W2WA 2ZH2A 3K57A 3CIMA 2I38A 2OMOA 3ITHB 1UFLA 3Q89A 1S0MA 4IQXA 1M90T 4AE5A 1QE1B 4I64A 2XULA 2DISA 1RBOB 3GJSB 2J9CA 4BBYA 2YNFA 5KOWA 3L09A 1SJ3P 3RYLA 2NYHA 4H54A 4YB1P 3D6MB 5DETA 4P2XA 1CJTB 2B3TB 2XSJA 2LEPA 5ETPA 2VBZA 1CVJA 1WTBA 3W8PA 5BR8J 1HQUA 3T9ZA 2WB1D 2NR0A 4ILRA 3ILLA 3NMRA 3V6DB 4F0HA 4JI7F 3DI6A 2IJFA 4F4KA 2I2YA 1IR2A 2AYBA 3I9V9 1WD6A 1CJUB 2OFGX 2I6WA 3BH6B 5BYQA 4LQ3A 2FJBB 2JRSA 3RU0A 2MQPA 4DU7A 1YIJS 4NLOA 1N34F 2VG5A 2KO1A 2GJ2A 1G4CA 3DRPA 4ZIVA 3E3XA 3CT9A 4F67A 2DNKA 1QTMA 3CCRS 2PDAA 3EDQB 3R5DA 3EZOA 1RT6B 3DOLA 2CPDA 4CH0S 1PC4A 4OI3A 2VG7A 2G0IA 2XI3A 1RADB 4FF2A 2CXEA 1X9WA 3DOKA 4ID5A 1FT8A 3N6LA 4K4YA 4DG1B 4MFBA 1NRKA 3TAMB 4I69A 4O3NA 5DZ6A 1PJ6A 1T9VA 4QR0A 2GAGC 5JVHQ 2R2TA 2APOA 3QFHA 5IQQA 2Q66A 3MM7A 2MSTA 4B08A 1TKDA 1RK8A 4CYUA 4PG7A 3ZZPA 1TK5A 3G8TA 2IIHA 4C98A 1S0OA 2UP1A 2FHJA 1OY8A 2CFXA 3NGTA 1R3NA 1ELOA 1NDLA 2C42A 1FRKA 4X4VA 3E01B 1YZ7A 4KO0B 4EEYA 4KPCA 1JLBB 4CRJA 1JLGB 4EBEA 2BMBA 5KFNA 3DLGB 5K8OA 4ATNA 2ZH5A 3NAIA 4PQAA 4HTJA 4O3QA 2LECA 3ZTQA 4U8YA 3PW0A 3RR7A 2RSQA 4OV6A 4LRAA 4ZVOB 4PABA 3RBEA 3OTCA 1GX6A 1AZSA 2GQQA 3AOCA 4IR9A 3UDVA 1VBKA 2HWIA 3MR3A 4AQYJ 1Z2ZA 5DGBA 1VCTA 2W2OP 2JSXA 2D3O1 2IM0A 1TL3B 3P96A 4IRKA 1RT7A 4FYYB 1RSCA 4M95A 5EWEA 4KV8B 1IBMJ 3UO0A 1FRLA 2VPZB 5KFAA 1NK6A 1S6OA 4F4AA 4NWBA 4YHHJ 3UFCX 2H54B 1D3WA 4JUZA 2CJYB 1F3FA 2HGNA 2DKOB 3SBMA 1U0SA 1SV5A 2VIHA 5F0UA 1VQPS 4F25A 1KN6A 4OL8A 1S10A 4PXEA 3PX6A 4NYPA 2LDYA 3PEHA 1S4FA 2LP4A 1VRUA 4RU2A 2N4DA 5HQ8A 4XAKA 2M88A 4ZK7M 3SFGA 1N48A 4K8RA 1YLXA 5GVQA 3M8RA 3QRRA 5ITHA 5DLFA 2KDOA 1WC3A 3NNAA 4YEAA 2Y3YA 3HZEA 4F7VA 3CD5A 4G6VB 2CQ4A 2J6TA 4ITSA 3Q8UA 1U2RA 1V6HA 4YR0A 5A8RB 5K20B 4V19X 1EX8A 4DU8A 2P9GA 1N36F 1ROFA 4RNNA 1E6VA 4HTIA 3KJFB 4QU6A 4IRDA 2DPIA 4FYVB 4MH8A 3LP0B 3PR4A 4OJ3A 3NGRA 2I0XA 1CULB 3GILA 3PYEA 3FSIA 3TUPA 1BMQB 5KFXA 2ZH1A 4C9DA 1X8DA 3CJ0A 3LW5C 2AQ4A 1MU2A 4DV0F 3DDKA 2BM1A 4DXLA 4NLWA 3KLHB 4UUWA 4QR1A 1M1KT 1S77D 4BS2A 4ZVTB 3KK3A 1KFSA 4PPZA 2ADCA 3UPFA 3B8HA 3OTDA 3BKTA 4ZP6A 2NXUA 2OKQA 3HP6A 4GKJF 3I82A 1FKPA 3T5JA 2FDNA 3Q24A 3KHRA 2GZOA 2ABYA 2OPQB 2BQ3A 3IR5B 4IUFA 1TL1B 1JMTA 2HMIB 1RACB 3FCHA 2OTLS 2RKIB 3MEEA 2BE9B 2J7UA 2IJRA 2CPEA 5KFDA 2Q1LA 3W65A 5DS7A 1XNQF 4Y2KA 1BWVA 4HDHA 3E8OA 4KGMA 2QSWA 4U6PA 4A8XA 2YKNB 5F8GA 4MK8A 4FXDA 2XS5A 4YP3A 2C3OA 2E1AA 5IWAJ 4X66F 3GFHA 2JL9A 4YN3B 4NL5A 2CAJA 1C1CA 1WEYA 1S9EB 3CSKA 1HWKA 5EX3A 1ZA1B 2BV3A 3HSGA 3DGPB 4OYZA 2P2CB 3THVA 3MOJB 2MLXA 3TUZC 1ULRA 3DKDA 4M5DB 3IAM9 1QUPA 2QL7B 1S1XA 1BY9A 3J81U 3POTB 3KHHA 1PAUB 4PG8A 4C11B 4ER8A 3QWPA 4CQ1A 4ZVEA 5CYQB 1TKXB 5HN0A 1HNVA 2QA4G 2WK4A 3FZBA 3QATA 4KGVB 4ELUA 1FRMA 4QWCA 1CS4B 2BZ2A 2GA7A 3NKYA 1J5OA 1NAQA 1Q78A 2CQ0A 1HWJA 1H38A 2Z8QA 3ONQA 2MKCA 3O3LA 2I5JB 1HKAA 4L74A 4NXNJ 3TOQA 3UD4P 4M5HA 2YKMB 4NE9C 4C3KA 3C19A 2LU2A 3K5LA 4JI2J 3BO2A 1FK9B 1VK8A 4USJC 4J7CA 4DZ6A 5A8WB 3EYZA 4RW4B 5IV4A 2C2DA 2QT7A 2VPWB 4EMDA 2HNYB 4IDKB 5GAGU 4AXIA 3A3OB 1MNEA 4WYWA 1SJRA 2QJ3A 3W2WB 3J7ZT 2LXUA 1RAHB 3B82A 2OO4A 2KYZA 2W2QP 2XO7A 3QRPA 2QEXS 1FXLA 2M9KA 1YJ9S 5DLGA 4HT7A 2XEXA 2ROEA 3GIJA 2ZJPQ 2NS1B 4AL6A 1SUQA 3MAAB 2PGCA 2DNZA 1NK5A 4LF5F 2H48B 4DF8A 2MKJA 3EZUA 1DAXA 2AJ4A 4DPTA 3R5BA 4ZVUB 4ZLLA 2XLIA 2DRDA 3DRRB 5HLFB 3HT0A 3DI6B 4NEYA 4DFKA 2DNMA 2W8LA 5L8RC 3A3NB 5C24A 2LQ8A 4IH7A 3T1HF 3NWGA 2C2NA 3JYTA 3ZZRA 3OLBA 3GR0A 1YJTA 5I42B 5KFLA 3DRPB 3A1YG 4TKTA 2DCLA 3CJ4A 2GMHA 2OEJA 1NK4A 3DOLB 3BKUA 1WOSA 2DGUA 3OVAA 5CHCB 3M32B 5IC4B 5D0RA 5A0YB 2XMWA 4PEOA 4ZLPA 1TUVA 4ID5B 5F8IA 1ZM9A 2KJVA 2GGPA 4FKYA 5L1IA 1U1MA 3M8SA 4WP3A 3M05A 2GW8A 4TVAB 1NJXA 4LF8F 3HLUA 2UUCF 3EZ5A 2Z4PA 3OUYB 2VPYB 1VIOA 3UNGC 4F3MA 3OHAA 4Y3CA 3SDEA 2M8HA 3FCWA 4OI4A 4NASA 4V19J 1H73A 3W60A 5D0GA 1OYDA 2DR8A 1WOOA 1JJ2R 1NJWA 1IWAA 2FLPA 1YI2S 3EGZA 3BQ2A 1RWWB 4Q44A 2AGOA 1QDUB 3KKFA 4F3QA 4ECXA 1RU2A 4NZ6A 5GAHI 2NYIA 2HRUA 2XZDB 3M30A 3M2VA 2F65A 3SXLA 3W9HA 4GC6A 1RUSA 1XMOJ 2YXLA 3KK2A 1Q5VA 3E2EA 3G4SS 4OYOA 3UN3A 1N5YB 4DR6J 4ANDA 3HKZD 3PYGA 5AXMA 1JXLA 2DO4A 1ZTTA 2XTJP 3C3LA 1S0VA 1UAWA 1RAAB 3P3DA 3GONA 2ZH9A 2ZBPA 1RBAA 5CABA 1RT7B 3LWMA 2HQCA 3LANA 2HNDA 1H74A 1KDNA 2WSFC 4XDDA 2V4JA 3VGVA 2Y8YA 2ZC3A 4F0KA 1WKLA 1QLNA 2AYEA 3CO0P 2IRYA 4B3TF 2LLZA 3I32A 1QSLA 1S1VA 2BJ7A 2R8IA 5GMEA 4LFCJ 1SKUB 3QNWB 1P1LA 2IRUA 3M9MB 1S72S 4WK1A 1YBAA 4F4XA 5IQ6A 4U7CA 3V6HA 2C1EB 1R89A 3MUVP 2JFDA 2QRRA 5ETOA 1T02A 1IKXA 4F2SA 2R42A 3MMBB 4Y28C 1YG0A 4QJVA 2EFVA 4LRFA 3P4UB 1M5PC 1VR6A 4QYRA 4B3SJ 4DJBA 1IM4A 1N4LA 5B0BA 2DH7A 1S0NA 2ZNZA 2C28A 3T6JA 2DTJA 3V81A 4AXJA 1YVFA 5DDOC 1FESA 3Q8RB 2Y8WA 1WKKA 1WSRA 3AY0A 2YQ1A 2R8JA 2DEJA 1NCLA 2KH9A 2O5DA 1KKHA 3C16A 4KR0B 3PO5A 5JJBA 1IBKF 2QFJA 1SC4B 3BKFA 3BF4A 1VMBA 4YB6A 4FBTA 1T7PA 3B4DA 2ZJRQ 2YNGB 3S8SA 4N8OA 3AD7C 3KLVA 4DR5J 1YBUA 2AEMA 1U1PA 3DLKA 4Z7CA 2XYGB 1YRUA 3SI8A 3PHEA 4FVCA 3BPDA 4NLSA 5E3CA 4DV4J 2PI4A 1TQLA 3H40A 4N41A 2KG1A 3MR6A 1LWEB 3H98A 1L3SA 1FKPB 1I6JA 4LF9F 1Q95G 4M1KA 3K2YA 2JH3A 2ALZA 1IWGA 4NA3A 5KG1A 2AJFE 2B51A 2L41A 1K1SA 3AODA 4DN0A 2E1RA 2WZ1A 1U1RA 4LUBA 1GXLA 4M5JA 4B3RF 3OVSA 4UY85 1N56A 4IH5A 2Y1LB 2C22A 5HK4A 3T19A 1NUEA 2YKPA 4QYZK 2ASDA 1GMVA 4OZ5A 5IT4A 1NM2A 2MKHA 2IBKA 1EP4A 1HBUA 4P52A 3MM6A 2FVCA 3BH7B 2ZKTA 1NMEB 1S6PA 2DR6A 3T9NA 1SH2A 3R5GA 2UXDF 3ZNUA 3TANA 4ZDNA 3I9ZA 4YY3F 1X0FA 2RAQA 3ZZOA 5E33A 2DPJA 2H1YA 3R1LA 1S9GA 3LP2A 3R5AA 5HVFA 2P8IA 5AT1B 3FEYB 1RT5B 2VPXB 1S1XB 3OTEA 4LFBF 2EC0A 4MIWA 3TO8A 1GMWA 4I67A 1T05A 2CWKA 2AJ0A 3LA0A 1FX4A 3HVTA 1TMJA 4PQUB 1VDHA 4ZVSB 5MAOA 1YRXA 3TYTA 2ZWOA 5L1KA 3CVKA 1MWQA 2QLFB 2JDJA 2OEMA 5KT2A 1FRHA 4NMXA 2RU3A 1YGYA 1RI7A 2PI5A 3N01A 2BUNA 4NRUA 2CQGA 2VFTA 3LP1B 3BYRA 4X4QA 2BJ9A 3KMQA 1BXNA 1S76D 5F3ZA 2C3UA 3I5BA 4G1QB 4J9OA 2CJKA 1FDNA 2FC8A 1RYRA 2JEJA 5E3RA 2YNIA 5HROB 4CO5A 4GC7A 1CBKA 3Q8SB 1VQNS 3TVYA 2WSCC 2MGZA 4JYAF 1G7CB 5I3UB 1FI4A 1SIWB 1NLKL 3JXOA 2A2DA 5EUHA 2B9YA 1Q16B 2GC8A 2BANB 4ES3A 1VQKS 4FVMA 3KLEA 2XCAA 4YDDB 4ERDA 3IR6B 3DN9A 1HNZJ 1UZHA 3LF0A 3BGOP 4TQRA 2IFXA 1D9AA 3IRXA 1UMJA 3SCJE 3AJ1A 4ZPBA 3SCLE 4Q7AA 3X3UA 4B02A 2WW8A 4I2PB 3GU0A 4ENOA 3S7RA 3HFKA 3KWMA 4OX8A 4I68A 1FNOA 4CTAB 3WIVA 3OL6A 4ED5A 4NLDA 3W63A 5HMWA 3OXLA 1NK8A 3R27A 5KFQA 1KVKA 5J2PA 3TZXA 3HHEA 3S01A 5KFCA 2XNQA 1VRQC 4X4UA 2V68A 3J81Y 1RT4A 5ETRA 3GSIA 2CQ3A 4PCQA 2FZCB 5C7PA 3F44A 5G0RA 1WJ9A 1TU0B 5E2QA 2GGPB 4DR1J 2B43A 4YMEA 4QW8A 4GO7X 4LF6F 2D1CA 1SCJB 2CQCA 1U1LA 3BN7A 3KG1A 1Q7LB 2XMMA 1Y3JA 2G1DA 3D1QA 3NRBA 5CA5A 3KJVA 2R7VA 5ETNA 1WNEA 3H2VE 3IC1A 3SDEB 1HNWF 4EWTA 1VC0A 1HMVB 4I2QA 3CJQA 2ZUGA 1XN9A 4DQRA 2E5JA 4LF7F 4HT5A 1FKOA 1C0TA 2JX2A 1JLFA 2DHHA 2VB6A 1XJWB 1JLAA 5J1EB 2BE2A 3M2VB 3QYYA 3HX9A 3CJ2A 1SKWA 2HFNA 4XDCA 1S59A 3MEKA 4EUVA 1WC1A 2EFGA 3KK2B 3MMAA 2I1RA 5D6GA 2A2CA 2DGVA 4USWA 1PSDA 1YSJA 3ZZ0A 5CZXA 3T3FA 4KY3A 3RZAA 1NB7A 3VAIA 2EWHA 2RILA 4A47A 2AX0A 3D66A 3ET6B 2R7WA 2MZJA 4ECUA 4IH6A 5DG7A 3RBZA 1NJYA 4USUA 1URNA 2HNDB 2XMKA 3NBPA 1GXUA 4PR6A 2AJ2A 3BQ0A 1AUSL 4AL7A 1HHQA 2GS8A 3MUTP 3UCZP 1IR0A 3W5YA 2J9EA 2ZM6F 1PO6A 1H7XA 2K7KA 3PYFA 4YR3A 2YNHA 1KLMB 2O67A 2VICA 2K1RA 4MTPA 4DSJA 1RWPB 5FD1A 4DUYF 2LU1A 2DBBA 4LRCA 4AUKA 2PN6A 2Y1JA 2NLWA 4LF1A 2HZCA 3ISZA 5F8NA 2NUHA 1IKXB 5KFSA 2UXBJ 4UOGA 1C2PA 4OYXA 2C3YA 1F9HA 3R3TA 1WHXA 3Q23A 5A76A 1VRTA 1BE4A 3V81B 1HBMA 3RUBL 2N3LA 3LWLA 3UDLA 4NLTA 2HK2A 3ILIA 3TZZA 4LVOP 2C2EA 3DM2A 5HBMA 2ZHOA 3EGWB 1NJIT 2HIYA 1M1HA 1IKVB 2PEHA 3KHLA 4MIBA 2M0GB 2WONB 2IAJA 3AA8A 2X3DA 4ZJLA 3W2VB 1KHWA 3W64A 3AQOA 1RT2A 4RWWA 2OMLA 1QM9A 3D68A 4ZVQB 3CUNA 1X5SA 4RO0A 2MKYA 1MN7A 4NZ7A 1QJHA 1RAIB 2N3OA 4RNMA 2RDIA 2AEJA 3CGIA 3VAFA 1CJKA 3DLKB 4CLTA 2XNRA 2AWZA 1S6UA 4P7VA 3UR3C 2V9WA 1V9OA 3BPSP 4OHYA 2CQHA 1TL7B 4IYQA 1LXNA 1FF2A 5J2NA 1RA7A 4LRBA 3GV5B 2CPJA 3VAMA 9RUBA 3CJ8A 3FMWA 4W98A 4ZJOA 1N34J 4QW9A 1JQGA 1ZTWA 1NXIA 4U96A 5EWFA 3TQ1A 1YX2A 3CC4S 3GTYX 3KOAA 4A4JA 1REVA 4USKA 3TARA 4DV1J 4ZN1A 4K4VA 1XMBA 3L9ZA 2G0JA 2VBWA 2HBQB 4UF4A 4OZNA 4H4MB 4DCPB 1VQMS 4FYDA 1AFJA 2GVZA 3KK1B 1PCAA 1N52B 1KP6A 3MD1A 3N9UC 5CCMA 2YQ0A 4PZVA 1KSPA 5K14A 4USTA 4KH0B 1FD8A 1HBUB 3B4MA 3MM6B 4CO3A 2OJ3A 5EX0A 2CNLB 4C4WA 2XCPA 1HYSB 3LAKA 3V6KA 5T7LA 4OYWA 2YKOA 5HO4A 2ZDOA 1LXJA 3BQ1A 3CJ5A 4HKQA 4L76A 3CC7S 2VG6A 3GV8B 4ED8A 4NLPA 5HQMA 4LR9A 5C2GA 3US5A 3LP2B 1S1WB 3H5YA 2ZH7A 3U1LA 1F2HA 3HI9A 3I0RA 2HW3A 3I0SA 2BW2A 2HHPA 2VUGA 2DGQA 1RU1A 3MOZA 1IVZA 2ILZA 4A8KA 2H9ZA 2MEWA 4OV1A 2W7PA 1YRTA 3VZHA 2MQ8A 3SCKE 4CP5A 3I31A 3IP0A 3T1YJ 3FKBA 3I5AA 3HVWA 2C2MB 4J9UE 3JSMA 3N28A 4G3IA 2OPPA 2VQFF 4YQWA 1S48A 5IOLA 3CCWA 1ZBTA 4N77A 4JI2F 2NPFA 2V2VA 1U1OA 2PA8D 2Z2YB 3D4JA 4AL5A 2JEIA 3JSYA 2VBXA 2YH1A 2ZE2B 2MPUA 2NREA 2LYVA 4IFYA 4P75A 1W26A 2HAFA 2RVJA 1RWNB 1N5SA 1Y00A 4F50A 4LR7A 2A0FB 1PAEX 1T0TV 3NS5A 2CYYA 3CWJA 2POKA 4N56A 1EETA 4E98A 4YUDA 1RISA 2FQQB 3C14A 5C42B 3I96A 4HH0A 4M63A 2GCFA 4RZRA 2DNYA 2B9XA 2YNIB 3VVUA 2UUTA 2FZKB 4DF4A 2FHMA 1U1QA 2U2FA 1U24A 2BQUA 1U02A 1B99A 3MAQA 4OYBA 4WFNQ 4JV0A 4L73A 3TW0A 4O44B 1H6KX 2WSEC 1MROA 4Y34A 4I7FA 3HD2A 4ZN3A 1MLAA 3HHKA 1Y3KA 3KLEB 4JI6F 5KG6A 3RB3A 4CO2A 4B3OA 1CJVA 4E2FB 1Q82T 4WFYA 3ENVA 1KD1T 3CCZA 4Y2IA 3A3PB 4DLEA 2X1FA 1R0AB 1RAEB 4EO8A 4BWJA 3QT6A 4DX8H 4WFXA 4EU0A 2MZ1A 1WKJA 2AX1A 3W5ZA 2DH8A 4DDFA 2AHOB 2LA6A 4ZVPB 1B0VA 3V4IB 2IA0A 3A4TA 2F4VF 2Q6BA 2R7TA 4A8QA 4NLXA 2M2BA 1I1GA 2AD9A 1VIXA 4DV0J 2L48A 3NGUA 4JOUA 4NRTA 3CDWA 1XR7A 3K8WA 3WX4A 4EI2A 1VLOA 2RB7A 4RW7A 4N8NA 3TJ9A 4H4OA 4F4YA 2KG0A 5F9NA 1V5VA 2F63A 3KLFB 5CH7B 2VQEF 2DNRA 4EFAC 4HH1A 1RDRA 4BC9A 1U25A 5LSOA 3M4XA 4MT1A 2UZAA 3W5XA 2FVPA 3K17A 1ZAXA 4UOHA 3ZFVA 5KT6A 3FVYA 1XNQJ 1U0HB 1SXLA 3OTOF 1YHQS 1S12A 5L39A 2VKRA 1JLQB 4NCGB 1GTHA 2V8PA 2ZNYA 1WC6A 1YWXA 4X66J 1NDCA 4J37A 4WE1A 3QBCA 4M5GA 1DLOB 2NPIA 4OJHA 4K50A 3ILJA 2QTWA 2PMZD 5AXNA 2HQDA 3V2UC 3SSRA 1S7HA 4FS1A 5HJXA 3C15A 3IS9B 4NYOA 1UVKA 4TXSA 1OQ6A 3OBIA 5KFVA 1DARA 3PJ9A 2P6SA 1BWEA 1K44A 3LH2S 4WPAA 2J6UA 2BJDA 2CNNB 2HBZB 2V4QA 2XZWA 3ETOA 3FBEA 4DUTA 4JI0J 4IRCA 1WG1A 1NPKA 4EZ6A 3LGNA 4R25A 2WOMA 2E1CA 3L7UA 4NI2B 5KFWA 4A8MP 4PXBA 4DQPA 2K1RB 1EAYC 2V50A 4X4TA 2V34A 2AIRB 3FGVA 2B7CB 2PFDA 2ROPA 3GR1A 1AT1B 3LO3A 2IDLA 4DS4A 4J9PA 2D3UA 1IKYA 1S6QA 2XG8A 2XHWA 3CCSS 2V9KA 3VHQA 2IM2A 4A8SA 2HSEB 2CZ9A 2WB4A 3QO9B 3UNYA 4LVNP 1EKRA 3PR5B 3MEDA 2V8DA 2QA4S 2OEKA 2ACMA 2H5JB 3ITHA 3THTA 1CSJA 4KQZA 2IMOA 1QE1A 1OYEA 4NZ0A 2FGCA 5B0EA 1SC3B 5DGAA 4DSKA 3QAEA 3HJVA 3CF5Q 4DSEA 2H4WB 1WUUA 3TZYA 2AMCB 1CJTA 3NP5A 3WX8A 2MQQA 1SC6A 3OSPA 4MYUA 3TA2A 3N4WA 4LF5J 4QCLA 2VD3A 4FPIA 1RT2B 2ERRA 3GZ7A 5LMUJ 2AGPA 2EK6A 2XMVA 3AB2B 5F3TA 3FNNA 1CJKB 5ETQA 4B9LA 2CQPA 1CJUA 4LJMA 1RBLA 5DM7Q 3T1HJ 4OZ3A 1VS3A 1NHKL 1LOUA 4TU7A 3FBFA 4OFZA 4ZPTR 3UWTA 2MZRA 4ZLNA 2FUG9 4LIWA 2W2NP 4USIA 1EIYB 1R43A 4FXVA 2YWGA 4LT6A 1F9FA 4H4KA 3OQ2A 1RT6A 4Y2MA 3ISNC 2MZTA 4Q2LA 2KM8C 3M9OB 4X4NA 4C0OC 2WVCA 4DV3F 1UJ6A 3BSOA 1R0CB 4ZVRB 4DHVA 2JLGA 5JMNA 3DRSA 4DG1A 1ZOTA 3TAMA 4ZCMA 4B9VA 2GFFA 3CIZA 3KJQB 1KOOA 2HNZA 5CYJA 2UUCJ 1H2UX 3PACA 5CZVA 4ZP9A 3IM9A 4XK8C 1CQMA 2VFUA 2P9EA 2ASJA 2MKIA 4W4MA 4RUAA 1CQNA 5KFBA 4YDXA 4KO0A 1X4FA 3MF5A 1LWCA 1JNRB 4DFMA 4ZHRA 1VC6A 1JLBA 5AE2A 1JLGA 3CD6S 3GYXB 4ZVFA 1P9YA 3DLGA 3I0SB 4ZCLA 3G9CA 2G2ZA 3BGFA 3PFOA 1NJZA 4KSEB 2XB2D 2CUYA 5J1NA 2R7RA 1IBCB 3MAHA 2EFPA 1C0UB 1NDKA 1RA6A 2YX1A 1IR1A 5H9EJ 5KG7A 4I4BA 1PBAA 1VJWA 3HSJA 2QE5A 2B4OA 4FPRA 4WIQA 2HHSA 3DHWC 1VQ4S 2R2SA 1SKSA 1TL3A 4DV7F 2BJ1A 3KUEA 2H51B 3CD7A 2M52A 4UUXA 2X7IA 3D6FB 5CXTA 3H4BA 4DR4F 3QGIA 4CI0B 1UPPA 2W8KA 1YDLA 2PE8A 4KV8A 4ZPVR 2PD1A 5KOXA 3WBZA 4P2SA 3B54A 2ZZTA 3KUGA 2RHSB 3C6TB 3O8WA 4QIVA 4B3TJ 4JB8B 3TVZA 2HZAA 4ZA1A 8AT1B 3L3CA 4C8ZA 4PUOB 4ECWA 2FLLA 3DLEB 7FDRA 3FSXA 1T3OA 2RRAA 3M8ZA 3HSDA 4DPUA 1O8BA 1B70B 1HD1A 2M8DB 3KLIB 4DZDA 2K7JA 1VFJA 3BJYA 3U27A 1DTQB 3HMJG 4X62J 2DHGA 3SIPB 1ZH5A 3W66A 1WSVA 4FBUA 3R97A 3SQOP 2HEKA 2FJAB 4ECSA 2H5EA 4CLWA 2JC0A 1L3UA 1H7WA 1KQGB 2DJWA 1HNZF 2YY3A 4JV5J 2DGOA 2KKHA 5A8RA 4B3OB 4CLFA 2MKSA 4J90A 2IC3B 1CJVB 2RUSA 3M1VB 1IBKJ 4D3HA 3MWBA 4NOHA 5A6PA 1I51B 3LP0A 4N47A 5M2UA 3PV8A 2FTRA 1CULA 3IFEA 3W62A 1UFWA 3MPWA 1UPMB 2JEGA 1GH8A 3FK4A 1LWFB 4OI1A 1RABB 1RTIA 4PRFA 2V69A 3ZNJ1 2B8PA 2CIMA 5K8PA 3VWSA 4M5LA 2VZ9A 3M2UB 3DLHA 3CMES 2X51A 3KLHA 1S9FA 2H3EB 1S79A 4K2JA 1N6QA 3D6HB 1DQ8A 3H5UA 2CWXA 1V3ZA 5HAOA 3NXZA 1XWLA 3EGNA 1VHFA 2DHSA 4DUZF 1GK8A 2W9CB 2OPQA 3HULA 2PMWA 3MFHA 4LF9J 1FDBA 1TL1A 4DR7F 3M8PA 4KIAA 1NPPA 4MJKA 4HHJA 4U7UD 3N6NA 2RKIA 4YFUA 1XNRF 2W7OA 4CIOA 4O3OA 2G2YA 2XY5A 1FE0A 4LSNB 2JLFA 4OZ1A 3VQTA 4B3RJ 4D3GA 4DX6A 2YKNA 1UVIA 4NLRA 3MECB 2XYHB 4NCBA 1N5TA 1O0PA 2VA3A 3HPOA 3PX0A 2B0GA 1KS2A 3I6PA 3MMJA 4RBUA 2HQGA 1NEEA 1HI8A 4TYAA 1Q0NA 3UN5A 1UJ5A 4WE1B 3TUIC 4ES2A 4Q45A 1TR0A 5KFZA 1VQYA 1GT8A 2UXDJ 3J7A1 1JXEA 2OIHA 3H20A 4E8UA 1NSPA 3QSIA 3GIIA 1BQMA 3OVBA 1TUGB 2P9CA 3V6JA 2HHXA 2D74B 4WBFA 3U02A 3C15B 4FNHA 2E5LJ 5AJ3F 2MB0B 2A10A 4LSLB 4C11A 4C2MA 1OPIA 2RUGA 3UCUP 2R2UA 5CYQA 1TKXA 2M4MA 2ZVIA 3WC0A 2E7WA 3HK2A 1X4BA 4KPYA 2ZH6A 4DL2A 5L1LA 4ZITA 1XQIA 5EHHA 1FJGF 4P73A 4ED0A 4CT9A 1KFDA 2MY7A 1U48A 3MXHP 2I5JA 3MCSA 1TL5A 2FHOB 3N6MA 1VYAA 2KRBA 2Y1RI 1H98A 3DCAA 2E29A 2BJ3A 4MMOA 2YKMA 4RJVA 4K0KF 1LWXA 5IT0A 3BB5A 2WVDA 2UXBF 4PWDA 1FK9A 3PW7A 2R7SA 1ICEB 3D3BJ 2DHXA 1DRZA 5A8WA 5KAKA 4DV2J 3D28A 2NCKL 1IKYB 4OI2A 1KC8T 2AKWB 2G9OA 2HNYA 4IDKA 4MKAA 4P7TA 2RS8A 4DR2F 3SSQA 1G6BA 3HCXA 4Q5VA 1WC5A 1XC9A 2BA9A 4KE5A 2YPYA 4XTTA 4HR2A 1BLUA 2C2RA 3SV4A 3CJTA 2FLNA 3QZ8A 1J5EF 4ECVA 2V67A 4JYAJ 3ADAC 4YOEA 1R6YA 5D0EA 1U2CA 2XM3A 5F8JA 3MAAA 3NWRA 5KG2A 1UZDA 4NA2A 3PRVA 3MMCB 3IM8A 4CO4A 1YKWA 2OFHX 3DLLQ 1HFEL 1YJVA 4Z7YA 2MHNA 3ISND 2V5HG 3DRRA 5HLFA 5HJYA 4IG3B 4PAAA 4XPCA 3OR2B 4AYBD 2HGLA 2L9NA 2MJNA 1VQLS 2DGXA 2UVWA 3AOAA 3NOCA 1T9XA 4OZLA 1ZPVA 4GVLA 1FTCA 4BDPA 5FLXU 3PW2A 2B5JB 4BCAA 3SQGA 4FP9A 5I42A 1GTEA 2R4FA 3H8YA 3UE2A 4DV1F 2RDDA 4ECZA 1IN0A 1KVIA 1FD2A 3M32A 5A0YA 1QAYA 3BBCA 3M9NB 1NSQA 2LXFA 3TRGA 2KTQA 3DRSB 4OYAA 1Y10A 3CJRA 4LF6J 5IC6B 3OUYA 3MM9A 3ENAA 2HNZB 2ALYB 2RRBA 3IWLA 4ILLA 3VGUA 4BWMA 4OJGA 2Y1IA 1HNWJ 1H72C 2DYAA 2GX8A 1BQNB 3FRYA 4LF7J 3FRZA 5DG8A 3NNCA 1YQHA 2NXEA 3GE9A 3MGJA 3QWUA 2VJUA 2JC1A 2W1BA 1B4SA 1LWCB 4ZHRB 2KT2A 1H3DA 5BYSA 3QJLA 2PEBA 2MJUA 4HI2A 2HVEA 3WHIA 3ZTSA 4KB7A 4WIIA 1N5YA 2RQKA 2V8HA 2W24A 1RHJB 5E7OB 5KFHA 2IMWP 4O3SA 1HQEA 4O4GB 3HVRA 3T1YF 2L08A 3IWNC 1RKJA 4TLRA 3IBFB 2CJXB 1WC4A 3PKYA 1HBOB 1WG4A 2Z2LA 2NXJA 2RT3A 2DR9A 2O01C 4QR2A 1PBUA 4CLKA 2KXFA 4JBCA 4TU9A 3VTIA 4B9NA 3ZZTA 1T03B 1F5AA 4RL1A 8RUCA 2ZM6J 4RUHA 2V4RA 3RG6A 4P2MA 2KXNB 4JI4F 2KXHA 4OHWA 2PT0A 2RNEA 3FUYA 5KT4A 4DUYJ 4LF2A 2HYIB 5J2QB 4OX9J 2MHEA 5BJRA 3LGMA 3JTOA 5E3AA 4ZVGA 3MMBA 5ETSA 5JUMA 1NZ8A 2FJEB 2E5HA 3JB9k 1HWUA 2VFRA 1T95A 4C97A 4WTOB 1IUJA 4A46A 3SSSA 2F1FA 1SPBP 1UWBA 2GJIA 2ACYA 2XI2A 4ECTA 3PIPQ 2UU9F 5B0FA 4DWIA 1K0TA 2ZKUA 4ETXA 3H0PA 1X4DA 3M8QB 4DQSA 4NLYA 1FFSB 2VONA 3D0HE 2CZVC 4FZVA 4KYZA 2DGWA 2HQIA 1YJ7A 5CD4A 1RWUA 3W61A 1N0VC 2X1BA 5ETTA 3W7BA 3BBFA 4ZP8A 2HBRB 3B78A 1M5OC 3Q8VA 3HD1A 2D41A 2AEFA 2HS4A 3L95X 2YNGA 2QLBB 4UZCA 1RTIB 4CWBA 2QMWA 3VVTA 1AW0A 1RHRB 3OJSA 3TA0A 1R6VA 2EFOA 4OI6A 3AXMA 3KG0A 1WWHA 3UR0A 1E6YB 3AA9A 5IFMA 2VHGA 2V94A 1TAQA 4JI3F 2CA9A 1N6QB 4R8UB 2FVRA 4F0MA 3QIDA 1LWEA 4QWDA 4WF9Q 1RTJB 3GFXA 4HI1A 3OW2R 5ETVA 3K59A 3GPAA 3GV7B 3M8PB 2VBYA 5LJ5Y 2EG1A 4X4SA 3MTJA 1RE1B 2EK1A 1KWMA 1TVRB 2R8HA 4MIAA 2CJAA 3O1LA 5D4PA 4LBIA 4ED1A 1L5UA 5MLCV 1DQ9A 3G2XA 3BM7A 1DTTB 3DRYA 2XZTB 3DGVA 1TAUA 5KFRA 1O6XA 1RHMB 2CQ1A 2AJ1A 2HG4A 2BBEA 3H59A 2EKNA 3WZ0A 3PG9A 1RXOB 2J9DA 2DITA 1UW4A 3D3CJ 2GMLA 1RTZA 5ETKA 3AXKA 3G6VA 1JJ4A 2YKQA 3EE3A 2ILYA 4DL0C 2WAQD 3BZQA 3R5CA 4LSZB 1BQMB 2N82B 2MKKA 1FA0A 1FXDA 1WI6A 2EKYA 5DZ7A 5L46A 1RT5A 5F0WA 3W3SA 4Y00A 4YS2A 2QZ8A 1HW8A 2RQCA 2N7CA 1UP1A 4K4SA 2HRTA 2XC9A 2F8HA 5KT7A 5K5MA 1LEOA 4PQUA 4JI0F 1BC6A 4A48A 1GAOA 1I94F 3J7Z5 2UVUA 3F56A 3BYPA 3MM5B 1VC5A 3TP2A 1TFWA 1FDDA 3SMZA 3Q2TC 3RB0A 2VQFJ 2D3OR 4GRSA 5HP1B 1Z4UA 1SJFA 4PWDB 4J5OA 4CLUA 3LP1A 3VALA 3RR8A 5E0OA 1CEZA 4IKAA 4PPDA 4R0JA 4G1QA 4RNOA 3HM9A 3NS7B 1WC0A 1MMLA 2NUUG 5K8MA 2DNGA 3R6LB 3QSYB 4FDFA 2A1BA 5HROA 2DT9A 4JI8F 2K3IA 2ZD1B 4DPYA 3FJ2A 2QL5B 5I3UA 3WQPA 2JVRA 4JV1A 5CCLA 3PEJA 4WKRA 1TTHB 2BANA 2JVOA 4I1TA 1LW0B 3DNCA 3AAWB 3BO4A 5LMUF 3CCQS 4USHA 4RPFA 2VFVA 1UTAA 4JI6J 3AQPA 2CG8A 4RKUC 4LF4F 2HHWA 4P6QA 1VHIA 4I2PA 2QG9B 2L3MA 2W25A 2U1AA 3EPIA 2GVDA 4HHUA 4L3KA 3RBXA 3SCIE 3GCWP 2Q3PA 4CTAA 4P71A 2KN4A 1HBNB 4I6YA 2LQBA 3SQGB 1TZ0A 2ZBIA 5E41A 2DGTA 2O66A 1K9MT 4L6V3 1T11A 1QUVA 4J9NA 2F4VJ 4DPXA 4ED7A 3HO1A 1YJNS 4CM0A 3MHYA 3AH6A 1Q53A 4DX5A 2BW7A 2K06A 2BJEA 4NEZA 1FJ7A 5D0HA 4IFVB 4Y65A 1MSWD 3PHTA 2FIUA 1HARA 1NPRA 3K5MA 1K73T 3EUNA 3BN4A 2B7BB 2W7AA 2DY1A 5KG4A 3DC2A 4Q8EA 2ZOGA 1UVLA 3NGDA 3MM9B 3P6YC 2VQEJ 3I87A 4XIUA 2B56A 3QMQA 1DURA 4DN9A 5B0GA 3P5TL 1HMVA 1N0UA 2BE7D 2QSFA 2EC2A 1X4CA 2FZGB 4ELTA 3OHBA 3OTOJ 4R5PA 1KRPA 4QWAA 3LPYA 3MURP 1WEXA 5J1EA 1Q86T 4AT1B 2KZMA 4DV6F 2ATCB 3MM8B 3ZTRA 4DOZA 2D69A 1OO0B 3JQKA 4USVA 3ZZUA 1OWXA 3X1LB 4BLGA 3CCTA 1HQEB 2I9SA 4Q0BB 3HHLC 4TQSA 1X4GA 3NOGA 2HPUA 2WTFA 3D6TB 4MYTA 4DSFA 4C3LA 3ET6A 1NNDA 2MZQA 2OAUA 1JKHA 4PYDA 1SJ4P 3P8BB 3D67A 4OYIA 4Y0FA 3J7AN 4C6AA 2IDEA 3IBCB 3CCUS 1X9SA 4DEZA 1KLMA 4TNOA 2W4DA 2XBPA 4L3NA 1HR0F 4O4RA 2E1PA 5E5NA 2HVHA 1N5VA 4LRDA 4I56A 5CYMB 1Q4RA 2XMUA 5IM0B 2B6AA 3ZC4A 1SQGA 5I4MA 4X62F 1F60B 2A6MA 5KT3A 5FLXY 1KEKA 2HFVA 1UWBB 1LFWA 1FEEA 1L3KA 4NLQA 3A8KA 4ZCKA 5E3PA 4FKXA 5M2RA 3DYAB 3M6WA 1XMQF 1ZPWX 4JV5F 1Y5IB 1UETA 1MG7A 4YB5A 1VISA 2HAIA 1IKVA 4QBUA 4X65J 1HHSA 4U9RA 4CNZA 3V5RA 2XGPA 3QJPA 2WONA 1R8BA 3MD3A 3C2PA 2YH0A 1EHWA 1C1BB 3W2VA 1IKWB 3NEKA 3LGHA 4O0IA 3I56S 4F2RA 2ZH4A 1PILA 1TKZB 2RRNA 1FVSA 4DPOA 2Z58B 4CLSA 2YWHA 1XR5A 3I4HX 2JFKA 4HDGA 3TEHB 3N5BA 1IXKA 4DQIA 1P6TA 1FE4A 3G82B 5KG5A 3DHXA 1KTVA 1TL7A 4MKYA 2OUGA 1KVJA 2E5IA 2LKZA 2QMUB 1AYEA 1K47A 2DNLA 1FJCA 4KHPJ 2UUAJ 2HQFA 4F3OA 2N7YA 3D7SB 4H4MA 4G1PA 2LQJA 5IT9U 1IQZA 3FFIB 4DR3F 3KK1A 1FO1A 1ZM4A 4DV3J 4RWXA 5ETLA 3BR9A 3FCVA 2R7UA 3TNVA 3K5OA 4KT0C 1RYSA 3QT8A 1SBRA 3GQCA 2BR0A 4OX7A 2B8QA 5D15A 3WIUA 5GMKa 2EXUA 4P10A 4OLPA 4DL3A 5J2MB 3PFEA 4M5KA 1HYSA 2IVFB 3RAQA 2O1PA 1UL3A 1PC5A 2IPOB 2IBOA 4RNHA 5KFEA 3RAXA 2F3JA 4P74A 2E1MC 2LXIA 2WVFA 2E7XA 1JLCB 1S1WA 2E5LF 2Z2ZA 3VCDA 3ENWA 3B6BA 1C4CA 3M6XA 1FFWB 3MPDA 2HFZA 2VC0A 2UUBF 2VU5A 3R2CJ 3VAGA 1B7YB 3IMQJ 2W4CA 4N76A 2Z56B 3GIMA 3AJ2A 4IG0B 1T3NA 3TAQA 2CKWA 3J81j 3CNQP 4KGZB 3RGIA 4ZVHA 4DV7J 1PIEA 1LV5A 4DL4A 1JX4A 2YPZA 2GO9A 4DR4J 2J8AA 2QA1A 2VH7A 2ZE2A 4ANEA 4OHZA 2KJWA 4DV2F 3C46A 2ZWPA 5BXIA 3D9BA 3G87A 2GMJA 2CQIA 5I3QA 4NYZA 4OX6A 3BSCA 4A8OA 4KTQA 5DM6Q 3GSDA 5GAGI 2KL8A 1SB6A 1Q5YA 1WHWA 3A12A 3KFWX 4BHQA 1K8AT 2DXEA 5C42A 3IN5A 2C3MA 2LCWA 3GMGA 4EYHB 4NLUA 5AXLA 5A8KB 2CVEA 2C2OB 2QLJB 3KNGA 3BSNA 2V2ZA 3BGUA 1N32J 1CC7A 2HBYB 1SL0A 1T9YA 5D3GA 4B9MA 1ZS6A 2VC1A 4O44A 5AE1A 6FDRA 4K5RA 3UW1A 3CDBA 2JLEA 4OI0A 3VR1A 2J0XA 2CJBA 5GAHU 4C8NA 2MMYA 5B0CA 3U1NA 1FNXH 3IWXA 3MCOA 2FVSA 4NXMF 2ZH3A 5D78A 1R0AA 3FC9A 1W2BR 1TK8A 1H2VZ 3CO9A 3H42A 2H65B 5B7WA 2GVDB 3UVJA 2AGQA 2COLA 3QQCD 3AD8C 1YBTA 1HNIB 2LEBA 3R1HA 2NQPA 2XHCA 1NZAA 2JZ5A 1ZAVA 4OJ1A 1NB2A 2HFOA 1C4AA 3ETMA 3V4IA 4MK9A 1NH7A 2J7KA 1GMWD 3L7OA 4ELVA 2QL9B 1JWWA 5B0DA 3BDPA 1U8SA 1RAFB 2H5IB 4RUBA 1LW2B 2HFUA 3ZTOA 1FFGB 2YX7A 3GG0A 2J7WA 2D7SA 5H1SV 2R8KA 4PG4A 1SVDA 4DUZJ 2AYMA 4J9RA 2VFSA 3KLFA 2R7OA 3UD5A 5HMYA 4DR7J 4FF3A 1F5CA 1Q8LA 5DDRC 1XNRJ 2VOPA 3BGRB 4JV2A 4K4UA 3NAHA 1U0HA 3HHLD 2E7VA 1Q8BA 3TUJC 3PDNA 3AB4B 1SH3A 1JK9B 4R5PB 1JLQA 3PO4A 4NCGA 3Q8PB 5KG0A 4DLGA 4C8YA 4F36A 3IO1A 2IM1A 3G8QA 3Q22A 2R9LA 1YJUA 3EGVA 4EBDA 3CJKB 1J27A 1RT3A 1DLOA 1FJEB 1M5HA 5DDPC 3GYGA 3OL7A 4DI6A 5GAEU 2V8GA 4QOTA 1SL1A 3K5NA 1YJRA 3IS9A 2F40A 4FN5A 1HIYA 1HNXF 1UJ4A 1UVNA 3NNHA 4P2FA 1RJJA 3SFUA 1U6BA 5L1JA 2BQRA 2UVRA 5AJ3J 2XMAA 1AUDA 1X7VA 3QPIA 5H9FJ 4X4PA 1DBDA 3T1AA 5DDQC 1JKHB 1SL2A 2ZBCA 2FY1A 5AXKA 2MLZA 3IGNA 1BUXA 1I3OB 3BO3A 1FJGJ 3DRXA 5EWGA 4NI2A 2QN6B 3M2RB 1HHTP 1PGZA 1K0VA 4ANCA 1KQSR 1S4EA 4OX9F 2RE1A 5U47A 4K0KJ 3BR8A 3CB4A 2D9OA 3EDRB 2B6AB 1AFIA 3C8YA 2YWFA 4IR1A 5IZHA 3UD3P 2BEFA 3T6BA 3CDAA 2NXCA 4WFAQ 5LM7E 2PA3A 1WDTA 4LQ9A 4UOFA 1F3VA 3QO9A 3FMBA 3Q8YA 1URRA 4QWEA 1QAJA 2RHQB 4DR2J 2CRLA 4ZJQA 5KFOA 2XMTA 4F8RA 4FF4A 2XQCA 2Q43A 4RR5A 2H4YB 4ZPDA 4NA1A 4UW2A 2UVVA 4N5SA 1N33F 1NK9A 2D9PA 1RWMB 2OELA 5AE3A 3OV7A 4FNIA 2KM8B 1J5EJ 2OPRA 3PW4A 2GIQA 3PX4A 3CULA 3QFWA 2FC9A 3KDOA 2J6SA 3A8EA 2DIUA 4U95A 3EVWA 1RP5A 1X0PA 1F0XA 1QAXA 3KNAA 2Q79A 4JI1F 2NXNA 2RH3A 4YR2A 2IHR1 1XTZA 2Z2MA 2F8EX 1DHMA 2IM3A 1APSA 3OJUA 4Y2CA 3UI3A 2HURA 4ETZA 5HVHA 5C25A 3PRDA 1MWYA 3IG1A 2FVQA 1PKUA 3S1TA 4U67Q 2AU0A 3VAKA 2E44A 5KFIA 2ZBRA 1TK0A 2CQDA 3KG4A 4RW9B 3P49B 2DEIA 1KOHA 2OPSB 3R7NB 4F4WA 1FHTA 4ID8A 1U4BA 4ED2A 3KHGA 4MAKA 1VQ7S 2KHDA 2KZZA 2KFYA 2PSZA 2YKAA 2AP6A 3GB0A 1NK0A 2GHWA 3IAS9 1WF1A 2VJVA 1EB0A 4QYZJ 1OJ4A 4KH1B 4M8LA 5D4OA 1BQXA 2YQ3A 4RW6A 3MI7X 3RB4A 4C8MA 5A2QU 3O5TB 2NSBA 3VQSA 1V5IB 1B3TA 2UXCF 4HVZA 1ZA2B 1EARA 2BKOA 4PYAA 2YNFB 2V63A 3GWCA 4F4ZA 3W9IA 5L9NA 4I0WA 5D4NA 2RQ4A 4JI5F 2R3VA 2XSJB 3TWZA 3D54A 1WACA 1HQUB 1X9MA 2DY9A 3C6UA 3LALA 3KJNB 4K4ZA 1C0UA 4R0EA 2YWEA 2XWXA 1HQ2A 1RGVA 2R2RA 2IVMA 3HT3A 1FERA 3FEXB 2EEYA 2DB1A 1GXTA 4HEA9 1HA1A 4KFBA 2L9DA 2WBMA 3O2IA 1QAIA 1Z1ZA 1RZMA 1WEZA 3DMJA 1VGYA 4PXDA 2VG5B 2OI2A 2GHVC 2VASA 3LTOA 1P8GA 4J9LA 1FVQA 3N0VA 2CNOB 2J0WA 3C6TA 2KHCA 3PJXA 4ECRA 2J8SA 2QGFB 4UQGA 2HS3A 5JVGQ 1F5BA 2VG7B 3DXSX 1CLFA 5KFUA 1AXQA 1PYTA 5KFYA 3DOKB 2BDPA 4PUOA 3BGLA 3DLEA 1RWVB 4JI4J 2GJFA 5LMNJ 3D1HA 4NLVA 4MFBB 2UUWA 2QLXA 3CMAS 4BC7A 3KLIA 3CCLS 1DTQA 4WP9A 1IJFB 1WI8A 5D3GB 1X4AA 3MM7B 2V2QA 5A6WA 4N7TA 2XS2A 4B3MF 4CYUB 2MZSA 4HYKA 4K4XA 2UU9J 3F41A 1I5OB 4EGLA 4NMLA 3UN2A 2WHOA 2KI2A 4HL9A 5IT9Y 2GIRA 1IBLF 4B17A 2IC3A 1JNZB 4H4KC 3M1VA 2BM0A 2EVZA 4O23A 5KFGA 4ZCIA 4KAIA 1M5KC 3PZPA 3DU6A 4Y2AA 1RTDA 4KHMA 1B0TA 3UVJB 2B4UA 1CPZA 2XS7A 1LWFA 5FIIA 3CC2S 1RLDA 2DXFA 1AZSB 5H9FK 1HW9A 3BEGB 3M2UA 4K5SA 3WDOA 5L38A 5KFJA 3VAJA 2BVZA 2IRXA 1X5PA 4WXOA 5D8HB 3GJQB 4JI3J 2V2KA 1IM6A 2Z30B 3R8YA 2HIQA 3NLCA 2CJ9A 2W9CA 3A8IA 3QAUA 1RCOB 1WDDA 1FNMA 1EQMA 4TN2A 6FD1A 3EMTA 2HK3A 1SV5B 3RAMA 3PIOQ 4LBHA 4XO0A 4CM2A 4J9SA 1VRUB 4LSNA 1GX5A 4P72A 2V0NA 3FBCA 2QLWA 3NGSA 4FYXB 4DL7A 3K7RA 4NX9A 1SQFA 2FGOA 3HFVA 3MECA 1EQ0A 4OLOA 3OFHA 5BYRA 3HXMA 1XR6A 4M5MA 1LK5A 4IO1A 4C7QA 2BRLA 1FKAF 3E51A 5G4DA 1Y11A 1FRIA 4LR8A 4EO6A 2D3ZA 5T41A 3LOUA 1RT3B 3QZ7A 3KYLA 3PKMA 3TA1A 3VGTA 3CEDA 1OSDA 3U1MA 3G71S 2QC3A 5GAEI 1S7IA 2VODA 2DK2A 2W9BA 1U09A 3D0IE 1QSSA 1E6VB 2CG4A 1Q1KA 4WFZA 4PWUA 4QIEA 1OY9A 2AYGA 3KDNA 2HQ3A 2B4VA 1HL6A 4LSLA 4K4WA 4DCOB 4LBPA 4RBVA 1TELA 2KT5A 4UZBA 4J9KA 2FD2A 3Q0AA 1BGXT 4URQU 3GIRA 5HI7A 4DCJB 4IOCQ 5K9FA 1MU2B 2KRRA 2HVIA 3WC2A 1EJ7L 2DNNA 1XK8A 1ZM3A 1YJWS 3KK3B 5I3PA 1I94J 4C8KA 1QVFR 4DV5J 4FYWB 2OSRA 2DVIA 1KQFB 5SUHA 1NO8A 3NS6A 1FTRA 2MQLA 3H5SA 3UDEA 3LQVA 4GKKJ 2N4CA 2K8GA 4W92B 2VV5A 3MEEB 1REGX 4JP8A 1QY7A 1W2IA 3AHPA 1VQOS 2ZFHA 2A18A 3M8WA 3OL8A 4ALZA 1O5JA 2CVIA 4OYPA 2MQMA 3OPKA 1RTHA 3JQJA 2ZHBA 2NZ4A 1VOMA 1U26A 4IOAQ 4EK2A 4X65F 5C5JA 1DZ5A 4JI8J 4I6WA 4C3MA 1X4HA 3QIPA 2R7QA 5DRKA 3A8JA 4OYMA 2K2PA 1R0BG 3CE8A 2YVSA 3HZGA 3VGSA 1C1CB 2LVWA 2OPRB 2HRYA 2CPHA 3H2UB 4QWBA 2C2ZB 3MMCA 2PFFB 4GVBA 3MUMP 4DMZA 3D1OA 2EW9A 3FDSA 5F41A 2JEFA 4UY8T 1UA1A 2QYCA 2Y0SD 4IG3A 4MKBA 3OR2A 5DO2A 3PYDA 2WW4A 1Y4ZB 3CDEA 4LF4J 2FYXA 1HNVB 3H25A 2M7SA 5LT5A 3RW6A 3KLGA 3VF0B 2QA2A 5HQLA 5FDLA 4ZP7A 3HKWA 5C25B 4M5IA 4P9SA 5DQIA 1J5OB 3BBBA 2B5JA 1X5TA 4CLLA 3GP9A 5L9XA 4KHPF 3IG1B 2UUAF 4URSA 1DFDA 1D9FA 3EJMA 4L75A 4C0BA 4S0MA 1JIHA 3SZ2A 1FXRA 1JXVA 3ZZZA 4LREA 1KONA 1T9TA 3HJFA 4LFAF 2FLOA 1TKTA 1F2GA 4OHXA 2YTCA 3W1YC 4K4TA 3CCMS 3DXBA 1NKCA 3I4PA 1NH8A 3HDSA 1ZM2A 3HHLA 3DU5A 1WHVA 2ASYA 2KVQE 4HLBA 3P5BP 4PXCA 3IRWP 2MYFA 1WHYA 2JNJA 2NZCA 4RW6B 4HACA 5JXSA 2ZC4A 2M3DA 3QRQA 4HHHA 1R8CA 1BQNA 3D5MA 2IYIA 3CJ3A 2Z57B 4ZPAA 3ZZYA 2F8MA 5LSRA 2J9DE 2C2KB 1QSYA 1PJ5A 2PIIA 5BR8F 1SUQB 4WFBQ 3PY8A 2DNOA 4M5NA 1AA1B 1WORA 1UEVA 3L7PA 3IR7B 3CPWR 3OSNA 3C6UB 4DV6J 2ZEJA 2F4FA 4PKDB 4O4GA 1SJ1A 5DJBA 3NCQA 1U8WA 2HVDA 1OPZA 2Y9HA 1UKUA 3CTRA 2MTLA 5C24B 1FRXA 1HBOA 4KFBB 2W9AA 1R8AA 1WTFA 3JYTB 1OMSA 1RAJA 1GQEA 2XYPB 1LNQA 3OD2A 3DMJB 5HMZA 2LFVA 3OR1A 2MXYA 3HHNB 3DOMA 2DNHA 1EZZB 3GYNA 2UV8A 1T03A 5EN1A 3Q86A 4E0DA 4DL5A 2ADBA 1NU4A 2IJNA 5C2CA 1Y9OA 2OD6A 2KVIA 3OXFA 3MPYA 1HR0J 3DDNA 1N88A 5J2QA 3UQSA 4X64J 1VBZA 3T41A 2PC6A 1Z2LA 2SXLA 1KBRA 3CMQA 1N32F 3PTWA 3FSYA 4MKVA 3BREA 2AZ3A 2G0CA 2HHUA 1UEUA 2FHKA 2J0SD 4B9TA 4O0NA 1R31A 1U1KA 3R7BB 5T14A 1A7GE 3T5KA 1XMQJ 3M8QA 1R7IA 1Q8KA 1G3OA 4NLGA 2OD4A 3M30B 4WU2A 4QZVB 2ZOMA 2XWYA 3AJDA 2LQ5A 3CCJS 3PVXA 1RHKB 1FEHA 2YWWA 4F02A 1RTDB 4CLYA 1DJ0A 1SIZA 1M5SA 5IS2A 2EFQA 3JTPA 4ICLA 4ILMA 4AQYF 5A2QY 1P27B 4CT8A 2PMHA 1WF0A 3GLJA 4DFPA 1L3TA 4QU7A 1VQ9S 1E6YA 1Q7YT 2KT3A 2A6OA 1IBMF 1S49A 2R7XA 2L9WA 3J80U 3QJJA 4R8UA 2G1HA 4QIFA 4UOCA 4CO1A 2V4JB 4QIGA 2ZOFA 4WXWA 2HFSA 3HF5A 3V4MA 1RTJA 4YHHF 3K5PA 3H2LA 1QD1A 4DL6A 2HVZA 1M5VC 2AJQA 1U6ZA 3T5HA 1S1VB 2PO4A 2BRKA 3O6QA 3I55S 1PJ7A 1X31C 1TFYA 3SYZA 1RT1A 4CCHA 2DGSA 4EYIB 1TVRA 2HHHJ 5KT5A 1Q79A 5KFFA 4F04B 1S5ZA 3ELHA 4FXWA 4DR3J 1SJQA 3MR7A 1DTTA 2DO0A 1WG5A 2F7VA 3EWGA 2LDIA 1MWZA 2V6AA 4NPOA 2BKNA 3L4BC 2HWTA 1VLYA 2QIFA 3RW7A 2JWNA 1PYSB 3MDFA 4Y6IA 3DDIA 4RW8A 2DH9A 2X1AA 4Z37A 3C16B 2W9BB 2BX6A 2AZ1A 2VKZG 4IQMA 3MZIA 3IXQA 2ZBQA 2Q6CA 2XO6A 1WOPA 1NK7A 9ATCB 4EZ9A 3CXCR 3LPEA 4M94A 2EBEA 3DLBA 3TZWA 3ZXWA 4YB7A 4ZPCA 4G65A 5F8MA 5GADU 2XLKA 4J9QA 2M70A 2OHDA 2VA2A 2BKPA 2YBVA 2UUBJ 3R5JB 4JI7J 1FWLA 3R9LA 2NSCA 5ETMA 4WWSA 4TY8A 5CD4H 1YK9A 2WRMA 3MM5A 1FX2A 1HPZA 4FF1A 3OL9A 1GEHA 1HLWA 5B0AA 4CH7A 5HP1A 4U8VA 1FRJA 4UTGA 4K59A 5LSLA 1UFKA 3FZ2A 4WZMA 1V3RA 4OZJA 1ZAWA 1YITS 1MW7A 1D9DA 4RNFA 3OLAA 4NCAA 1RTHB 1SH0A 1EP4B 2ZD1A 5IWAF 2KFNA 2CNKB 3P45B 3QIPB 2GNKA 1TV6A 3RRGA 1IQTA 1DY3A 1S6PB 2J5AA 2B4PA 2F9JA 2JJ4D 5IV3A 1RLCL 5E3QA 4ZMMA 4ZPWR 1F6TA 2P5VA 3JAMU 2CADA 1M1GA 3OT9A 1LW0A 4IO9Q 3TI0A 4GVBB 1Y7PA 2AW0A 3PCOB 1TMMA 2RU9A 1S9GB 4J9MA 1UW9A 3RTVA 1VQ6S 3K58A 2DR7A 3RRKA 2CPZA 2ZUAA 5THWA 2VL1A 4NXMJ 1RAGB 4ZLJA 3JSRA 4USMA 5H9EK 1T05B 3JQMA 3JSBA 3F73A 2CPXA 3KLGB 2RS2A 3HVTB 4OZ2A 4C0HA 3QT7A 5FDLB 1LK7A 1HBNA 5ADZA 3CJSA 2CPYA 2HKEA 1KTQA 3TX0A 5LJ3Y 5KG3A 1FCAA 3G86A 4X84A 4NXNF 2FJWA 4ED6A 1N54B 2CZ4A 2CQBA 1RB0A 4X2BA 1VI7A 1XBWA 4IFVA 1TKTB 2IVYA 5D77A 1S1UA 2DD8S 1TL4A 1VK3A 3HHLB 2W01A 2IA6A 4KRWA 2ATLA 3KTQA 2BOPA 1FWKA 1A6LA 3PNIA 1WF2A 4C48A 3W9JA 2EPIA 3MEGA 4UT4A 4WTYA 2EFNA 3G6XA 4HACB 2QMXA 4Q2MA 2MQNA 4V1Ak 3HVAA 3VAHA 1JLEA 2MGZB 2JOQA 4KC5A 1ZYQA 4DS5A 3R6GB 1SI9A 3J7YU 2YX4A 2F9DA 5CQGA 1RQ0A 3FEZA 1AB8A 4KBIA 2W2PP
chains in the Genus database with same CATH topology
1NZAA 2JZ5A 1ZAVA 3NGKA 4QIVA 4Y3CA 4OJ1A 3SDEA 3MM8A 2M8HA 3SV3A 2HFOA 1C4AA 4OI4A 3V4IA 2RJZA 4MK9A 2E9TA 2OTJS 3TVZA 4V19J 1NH7A 4ZA1A 2GHPA 3L3CA 2J7KA 2LEAA 3BDEA 3L7OA 2DR8A 4ELVA 1JJ2R 1JWWA 4C8ZA 1NJWA 4PUOB 2RF2A 3IRXB 4Q0BA 4ECWA 2FLLA 3DLEB 2LMIA 7FDRA 5B0DA 3FSXA 2FLPA 1G1XA 1YI2S 3EGZA 1T3OA 3TX8A 3BQ2A 4Q44A 3BDPA 2RRAA 1U8SA 2AGOA 3KKFA 4F3QA 1LW2B 4ECXA 2B9WA 5GAHI 4NZ6A 1O8BA 5K8NA 2NYIA 1HD1A 2ZZMA 2HRUA 2YX7A 2M8DB 3KLIB 3M30A 2K7JA 1VFJA 3M2VA 3BJYA 3GG0A 3U27A 1DTQB 2J7WA 3SXLA 3HMJG 2D7SA 2DHGA 3GIKA 5H1SV 4GC6A 2R8KA 4PG4A 3T5LA 2WCXA 3KK2A 4UQTA 4KKOA 2DHAA 3Q8QB 3E2EA 5HL7Q 1ZH5A 2AYMA 3G4SS 4J9RA 4FBUA 2XY6A 1N5YB 3OR1B 2VFSA 1S97A 1CC8A 3KLFA 3QLHA 2R7OA 2FJAB 5HMYA 4URGA 4ECSA 3O44A 1S1TA 2H5EA 3HKZD 4FF3A 1B64A 1F5CA 1Q8LA 2RQMA 2JC0A 5AXMA 1L3UA 1JXLA 1H7WA 1QVGR 5J2PB 1KQGB 2DO4A 1ZTTA 5DDRC 2DJWA 1HNZF 2VOPA 2YY3A 3C3LA 3BGRB 2DGOA 2KKHA 1S0VA 5A8RA 4JV2A 1XERA 3RB6A 4K4UA 4B3OB 1UAWA 2MKSA 1OQ3A 2IC3B 3NAHA 1RT4B 3P3DA 3HHLD 2ZH9A 1Q8BA 1V3SA 3TUJC 3M1VB 3PDNA 3AB4B 5G0RB 5LMNF 1SH3A 4W90B 1JK9B 1RT7B 3LWMA 4WJBA 4R5PB 5CYMA 2X1GA 3LANA 4D3HA 3MWBA 5IM0A 1D0EA 2P6TA 1JLQA 2MDAA 3PO4A 4NCGA 4NOHA 3Q8PB 5A6PA 5KG0A 4DLGA 2HNDA 3QGPA 4C8YA 2KFZA 4ED3A 4WK3A 2WSFC 4XDDA 2V4JA 3LP0A 3IO1A 2IM1A 4RLEA 4N47A 2ZZNA 2ZC3A 3G8QA 3Q22A 5M2UA 3PV8A 2FTRA 3IFEA 2R9LA 1UFWA 3MPWA 2JEGA 1GH8A 5DQHA 1YJUA 4EBDA 3KJVB 1QLNA 1LWFB 2AYEA 3CJKB 4OI1A 1RTIA 1LQ9A 1RT3A 2IRYA 4B3TF 1U7LA 1DLOA 2LLZA 1FJEB 3UCGA 4PRFA 1M5HA 3I32A 5DDPC 1S1VA 2R8IA 4FS2A 1QSLA 3CCVS 2AF6A 3OL7A 2CIMA 1GNKA 5GAEU 1X5OA 5K8PA 3VWSA 4I2QB 3DYAA 2VZ9A 3M2UB 2V8GA 1P1LA 2IRUA 3M9MB 3DLHA 1S72S 4WK1A 4QOTA 1SL1A 1YBAA 3CMES 2X51A 4I6AA 5IQ6A 4U7CA 4F4XA 3K5NA 3PW5A 4DSIA 3KLHA 3V6HA 3CDUA 1FKOB 1R89A 3MUVP 1C0TB 2JFDA 1YJRA 5F8HA 3IS9A 1S9FA 2QRRA 1T02A 2F40A 4PG6A 4FN5A 2QO3A 1IKXA 3FQLA 4F2SA 1S79A 1HNXF 1UJ4A 1UVNA 1N6QA 3MMBB 4Y28C 1YG0A 4QJVA 4OMFG 3NNHA 3EXCX 1JLFB 2EFVA 1DQ8A 1M5PC 3H5UA 1RJJA 1V3ZA 3SFUA 1U6BA 4QYRA 5L1JA 1JLAB 3PJWA 4DJBA 1XWLA 4DFJA 1IM4A 1XMOF 2BE2B 3EGNA 4TLQA 4U7UK 5B0BA 2BQRA 1N4LA 2UVRA 2DH7A 1VHFA 1S0NA 1AUDA 1X7VA 2DHSA 4DUZF 3QPIA 5H9FJ 2ZNZA 2C28A 1IJEB 2W9CB 2A3JA 1DBDA 2OPQA 1J2VA 3T1AA 3T6JA 4X4PA 2DTJA 5DDQC 4DR6F 1C1BA 3MFHA 1JKHB 1SL2A 3V81A 2ZBCA 1FDBA 2FY1A 1A9NB 3MMAB 1IKWA 1TL1A 5AXKA 3IGNA 4DR7F 3M8PA 2BACA 4KIAA 4AXJA 2DRAA 1YVFA 4MJKA 5DDOC 4HHJA 4GMKA 2FHJD 1FESA 1KR4A 1TKZA 2RKIA 3N6NA 2Z0GA 4YFUA 3Q8RB 3BO3A 4KJIA 3OXGA 3I5CA 1XNRF 3AY0A 2W7OA 4ICLB 3DRXA 4O3OA 4CIOA 2R8JA 2XY5A 1FE0A 1HWIA 3OFEA 4LSNB 5EWGA 2KH9A 2JLFA 4OZ1A 2HHVA 3M2RB 3K8VA 1HHTP 2O5DA 4L72B 1PGZA 1K0VA 3VQTA 1ZZNA 1Q81T 4KR0B 3PO5A 4D3GA 5JJBA 3H5XA 5DQGA 1KQSR 1IBKF 2YKNA 4OX9F 2QFJA 2RE1A 4KGKA 2GO8A 2RIJA 5U47A 2RDJA 4X4OA 4NLRA 3BF4A 1UVIA 2EBGA 3MECB 1N5QA 1VMBA 2D9OA 3BR8A 3CB4A 4YB6A 1NKBA 3BSAA 4FBTA 4NCBA 1N5TA 1O0PA 2DCUB 3G6YA 2G13A 2VA3A 3HPOA 2B6AB 3PX0A 3NBPB 2B0GA 1T7PA 1KS2A 1AFIA 3C8YA 3I6PA 3B4DA 3MMJA 3ENQA 2ZJRQ 4RBUA 2YWFA 4IR1A 3D0GE 5IZHA 1NEEA 1HI8A 3UD3P 4TYAA 3T6BA 1H0HB 4DSLA 3CDAA 1UJ5A 4WFAQ 4WE1B 2PA3A 3TUIC 4ES2A 4DBQA 2YNGB 4LFCF 3S8SA 4N8OA 3VZIA 4LQ9A 4Q45A 1TR0A 3TVKA 3QO9A 3KLVA 5KFZA 2YNHB 1VQYA 1GT8A 5F8LA 1SKRA 3FMBA 1URRA 5J1PA 4QWEA 3J7A1 1JXEA 1QAJA 2OIHA 3Q2SC 3H20A 1U1PA 2CRLA 3DLKA 4E8UA 3NL0A 3DFEA 3GIIA 1YRUA 1BQMA 2EI5A 3SI8A 5KFOA 2XMTA 3OVBA 1RT1B 4F8RA 3PHEA 2P9CA 4QPTA 3V6JA 4FF4A 2HHXA 2Q43A 2D74B 3FFIA 4FVCA 4NLSA 2O3DA 3U02A 1U47A 2I8EA 3EXYA 5E3CA 4FNHA 3GFYA 1KNZA 1B0PA 4ECQA 1UVMA 2PI4A 4B3SF 1TQLA 4ZPDA 3NCRA 4CNYA 3H40A 4N41A 3SEOA 3RRHA 4NA1A 5AJ3F 2KG1A 3MR6A 1LWEB 3H98A 4UW2A 2A10A 4LSLB 4C11A 1P9QC 3JTNA 1T94A 4C2MA 1OPIA 2RUGA 4MK7A 4TU8A 3UCUP 1L3SA 2UVVA 2R2UA 4N5SA 5CYQA 1TKXA 1N33F 4A8YA 1NK9A 2D9PA 1FKPB 2LQ9A 1I6JA 1HD0A 1R8HA 2M4MA 4C8OA 4LF9F 1YTYA 5AE3A 3OV7A 4FNIA 4M1KA 2KM8B 3K2YA 2JH3A 2ALZA 2OPRA 3WC0A 2E7WA 2GIQA 1VRTB 1ZZFA 3PW4A 3PX4A 5KFKA 3CULA 4NA3A 3HK2A 1X4BA 1HBMB 5KG1A 4KPYA 2ZH6A 4O3RA 2HWHA 2FC9A 4DL2A 5L1LA 2J6SA 1LFPA 5J2MA 2AJFE 3A8EA 5EHHA 1FJGF 2B51A 2DIUA 2L41A 4ED0A 1K1SA 4CT9A 4AFFA 1KFDA 3MR2A 1RP5A 2MY7A 1U48A 3MXHP 1X0PA 2I5JA 2KYXA 1F0XA 1QAXA 2E1RA 1TL5A 2FHOB 3MCSA 4DN0A 1U1RA 3KNAA 4LUBA 1GXLA 2Q79A 3N6MA 2AV5A 4JI1F 3DM2B 2VOOA 4B3RF 2KRBA 5HBMB 2RH3A 1H98A 2Y1RI 3DCAA 4RW8B 4YR2A 3OVSA 4UY85 1N56A 2IHR1 1D8ZA 2E29A 4IH5A 2BYCA 2C22A 2MQOA 1XTZA 4MMOA 3T19A 2YKMA 2M5YA 2Z2MA 2YKPA 2F8EX 1XEZA 4K0KF 1DHMA 2ASDA 1JLCA 4OZ5A 5IT4A 1U45A 5IT0A 3BB5A 2IM3A 2MKHA 1APSA 2IBKA 2UXBF 4WYLA 2IAJB 3OJUA 1EP4A 4PWDA 1FK9A 4Y2CA 1HBUA 3PW7A 3UI3A 2R7SA<