3NNCA

Crystal structure of cugbp1 rrm1/2-rna complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
175
structure length
175
Chain Sequence
SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords CUGBP Elav-like family member 1
total genus 46
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nncA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nncA02
3NNCA 2FC8A 2LQ5A 2M2BA 2LEAA 3Q2TC 2CQBA 1FHTA 5H1SV 1O0PA 1U1NA 3ZZYA 1X4AA 2MXYA 1WEXA 3UCUP 2ERRA 2CQPA 1S72S 4EGLA 2MJNA 3CCLS 1ZZNA 2L9WA 2HGLA 4TLQA 3G71S 3CPWR 1QVGR 2G0CA 3MUVP 2GO9A 3PIOQ 3NNAA 2KVIA 2RS8A 2GHPA 1UW4A 3SDEB 3CMAS 1DHMA 2DNRA 2LA6A 4C7QA 2MPUA 5GVQA 2I2YA 3CC7S 1H2UX 3N9UC 1IQTA 1VQOS 2M4MA 2KM8B 3CCRS 3THTA 3EGZA 2L08A 1X4CA 3CCVS 2LKZA 2M88A 3LQVA 1Q86T 3S6EA 2CPIA 4BS2A 2MY7A 2MJUA 3LPYA 2M8HA 3S7RA 1X4FA 2MGZB 1U1LA 1HD0A 4V19X 3UD3P 2MQNA 1YWXA 2KFYA 5MLCV 3G6ES 2DNYA 2RNEA 1P27B 2J8AA 3MXHP 4CIOA 3BO3A 2CPFA 2MZ1A 1VQ6S 5DDPC 3CCJS 1P1TA 2MZQA 2FC9A 2JRSA 5IFMA 2YH0A 2MYFA 4FXVA 1M5VC 3CC2S 2DNMA 5DETA 2MKIA 1SJ3P 3CCUS 1M90T 2DNZA 2X1AA 2FY1A 4TU8A 3G4SS 2HGNA 2MSTA 2N82B 2RU3A 2MKCA 2KXFA 2B0GA 3RW6A 3BEGB 2LMIA 2J0QD 3JB9k 3SMZA 3THPA 1W2BR 4W90B 4CQ1A 3UD4P 2L41A 1DBDA 3MUMP 3NS6A 2DHSA 2RQCA 2PE8A 1SJRA 2MZRA 1JJHA 4IOAQ 5GAEU 1WI8A 2MKKA 3IWNC 4M5DB 1Q82T 1H6KX 1X4GA 2OSRA 2DHXA 1UAWA 3J7ZT 5D78A 2CQ4A 2Q79A 4J5OA 3R27A 4OZ0A 2M7SA 3B4MA 1KOOA 1X5OA 1VBZA 1WHYA 3UCGA 1U1QA 1S79A 3I56S 1U1OA 1WEZA 3P6YC 3VAKA 1FXLA 3OW2R 1D9AA 1RK8A 2MZTA 2LXIA 2RRAA 4IUFA 4F26A 2X1GA 5GAHU 1X4DA 3G9CA 2E5JA 3CULA 1WWHA 1XN9A 4WCEQ 1M1KT 4OZ1A 1U6FA 3TP2A 1L3KA 1Q81T 3MD1A 2QA4S 2YTCA 1VQ8S 4C4WA 4UY8T 2DGWA 1H2VZ 1BY9A 1N52B 3FEYB 3L3CA 2F3JA 5DM7Q 2XS5A 1YIJS 2DNPA 3I55S 4RU2A 3TYTA 2MQMA 5DM6Q 1WF0A 2CQ3A 2N3OA 2JX2A 2DO0A 2YH1A 3SDEA 2QFJA 2DB1A 1PGZA 3MDFA 5JVHQ 2KYXA 3CCQS 1SXLA 1X0FA 4CH0S 2EK1A 4Z2XA 4WFNQ 3H2VE 3ZZZA 2DGVA 3R1HA 2OIHA 1X5TA 2EK6A 2J0SD 1PO6A 2E5HA 5FJ4A 1Q7YT 2X1FA 2MKHA 2AYEA 1VC6A 2N3LA 1YJNS 2MZJA 2DH9A 3BS9A 4F25A 2AYBA 2A3JA 2MQOA 2DH7A 2KU7A 3H2UB 2CQIA 2MHNA 2J76E 3NS5A 2CPHA 2BOPA 1WG1A 2CQHA 1FJCA 3DLLQ 2AD9A 2JWNA 3S8SA 4U67Q 5IM0A 3V4MA 3BO4A 3K0JA 2VODA 1R8HA 5LXYA 4CH1A 2LECA 1M5OC 1SJ4P 3VAMA 2BZ2A 1QM9A 1ZZFA 2AYMA 5IQQA 3U1MA 2KXNB 2RUGA 2ZJPQ 1K73T 2ZJRQ 2HVZA 2RS2A 2XS2A 2CQ1A 4QPTA 2DNQA 2MB0B 1NU4A 2DHGA 2DO4A 2M8DB 2M70A 5LXRA 2UP1A 1VQ5S 1X5SA 5DDOC 1YITS 2G4BA 1H2TZ 3MUTP 1FJ7A 1ZH5A 5CA5A 2VOOA 2DNNA 2K8GA 4PRFA 3J7YU 4YUDA 2XNRA 1SJQA 5GADU 2KG0A 1U6BA 4WF9Q 1UP1A 2JVRA 4UQTA 1YJWS 3MURP 1DZ5A 1YTYA 2E5IA 3R1LA 2CQDA 4LIRA 2U1AA 5LSOA 2CQGA 1U1PA 1KD1T 1X5PA 2DISA 2ADBA 2D9PA 2DITA 1KQSR 2HZCA 5GAGU 1KOHA 4PKDB 3P5TL 5IM0B 1B7FA 2YWKA 4ERDA 2KT5A 4IO9Q 1CVJA 4QU6A 4QU7A 3B4DA 2KG1A 4WKRA 3NMRA 4ZKAA 1U1RA 1N88A 2KI2A 2DGXA 2KRBA 4PR6A 3US5A 2XB2D 2JVOA 2CQ0A 4A8XA 3CC4S 5ITHA 2F9DA 1VQPS 3BO2A 3CMES 2KH9A 1FO1A 2DIVA 2DGUA 2E5GA 2ADCA 1OIAA 1WHVA 1WEYA 1K8AT 5GMKa 1N54B 3VAGA 2CPZA 3SXLA 5LJ3Y 2MMYA 1HD1A 2EVZA 3G96A 2DNOA 3CTRA 5HO4A 5CYJA 4C0OC 3P3DA 1OPIA 1OWXA 2WBRA 4LJMA 1JMTA 2MGZA 2DIUA 2DK2A 3VALA 3RW7A 4TU7A 1OO0B 2HGMA 3G8TA 1VQKS 4QQBA 2ZJQQ 2MQQA 1WHWA 1YHQS 1HA1A 1WI6A 1VQLS 1SJFA 2K3KA 2KHCA 5LJ5Y 2LYVA 2DGTA 2CPYA 5LSLA 1FJEB 1NJIT 2M0GB 4WFBQ 2RQ4A 4TU9A 2SXLA 3EX7B 1HL6A 2I38A 1U1MA 1VQ9S 3Q2SC 1JJ4A 1YJ9S 2AYGA 2DNKA 2KM8C 3UCZP 1WG4A 2V94A 2CQ2A 2G1DA 1U2FA 1X4EA 3MD3A 1VC5A 1QVFR 3D2WA 5BJRA 2RRBA 3VAFA 1WF1A 3FEXB 2PEHA 2HYIB 2FPHX 2X1BA 5DDQC 2CQCA 3PIPQ 2DNHA 2DH8A 1X4HA 3DXBA 3VF0B 3CCES 2E44A 2DGOA 2F9JA 2DGSA 2MKJA 5DDRC 5EN1A 2D3OR 2LA4A 5HL7Q 4WFAQ 2DNGA 4W92B 2MY8A 1G2EA 1X4BA 5CXTA 1FNXH 2RVJA 4YOEA 2VONA 4Y00A 2KRRA 1VBYA 2DHAA 2XS7A 2MQPA 1FT8A 5JVGQ 2LEBA 1VQMS 2OSQA 1M5PC 1A7GE 2XNQA 4ED5A 1WG5A 2VOPA 2FHOB 2M9KA 4Y0FA 2LXUA 3CCSS 2LCWA 2M52A 2QEXS 1A9NB 3MOJB 1M5KC 2KN4A 2OJ3A 2MKSA 1U1KA 2MZSA 4LMZA 3EGNA 2OTLS 3VAHA 1R8PA 5D77A 3U1LA 2OTJS 1WHXA 2KXHA 2CPEA 1KC8T 1WELA 2MSSA 3IRWP 2CPJA 2CPXA 3UE2A 2N7CA 2DGQA 1NO8A 1N8RT 1DRZA 1VQ7S 2D9OA 4IOCQ 2YKAA 3CUNA 1URNA 1AUDA 1RKJA 1D8ZA 1VQNS 2CPDA 2U2FA 2MQLA 3G8SA 2CJKA 3MI7X 3CXCR 2DNLA 1UFWA 4YB1P 1WTBA 2NZ4A 3NNHA 1VQ4S 3P49B 3CF5Q 1WF2A 1K9MT 4F02A 2XSFA 1F9FA 2RT3A 3ULHA 4WIIA 3CCMS 3VAJA 3HHNB 4FXWA 2NLWA 3CD6S 3UWTA 1VC0A 2O3DA 3VAIA 1JJ2R 3HI9A 3S01A 1YI2S 1VBXA 3TO8A 4P6QA
chains in the Genus database with same CATH superfamily
2OEJA 4HI1A 1F60B 1FKAF 3L7UA 2V2KA 3QFHA 2HHHF 3Q2TC 5E5NA 4X62J 2F4VJ 4B3TJ 5H1SV 4RW8B 3FVYA 3D28A 3MEGB 1HR0J 4MK9A 1U24A 2Q66A 2KZMA 3I87A 2K3IA 3HHLA 2ATCB 2LP4A 4OX6A 3GIRA 4CO0A 4DFMA 2EKYA 4OHXA 2QO3A 1Q8IA 3IM9A 4K4UA 3O5TB 5C24A 4CM0A 3OTDA 2WONB 5B0EA 1YRTA 5B0GA 2IJRA 2GHWA 4OI4A 4TY8B 2FJAB 5JMNA 4NYPA 1SQFA 1HWLA 2HGLA 2OGUA 1HQEA 2C3UA 3G71S 2J6TA 4YR0A 2IRUA 3PX4A 3BKTA 3LP0A 5F8HA 4IOBA 1S57A 3V2UC 4ELUA 3KK3A 1IWGA 1B0PA 4X4SA 1TAUA 4USWA 1TV6A 3T5KA 4RWXA 2GHPA 5IC6B 5RUBA 1UW4A 2PGCA 3NBPA 2R8GA 2V2ZA 4UY85 2ALYB 2DR8A 1IBLJ 4DR3F 4ES2A 1RT5A 1H2UX 2AEMA 1Y5IB 3DU5A 2WAQD 3N9UC 2RF2A 2EC2A 3I31A 4LF1A 4PYAA 5K5MA 2XCPA 1VQOS 4Z37A 4U6PA 2KM8B 3RR7A 3GB0A 3AD8C 3MPYA 3THTA 3GZ7A 1UPMB 4UOHA 4F4WA 2Y0BB 3THVA 4KTQA 3ENVA 4YS2A 3CCVS 4QIWD 3ENQA 1UJ4A 3T19A 4LFAF 3QT7A 3R5GA 1HQUB 4EBCA 3GSIA 2XWXA 3HVTB 2MY7A 2MJUA 1IM4A 1CSJA 4I1TA 4USKA 1WC4A 4ZPCA 4F2RA 3K5LA 1TKXA 1HD0A 4KQZA 3I6PA 4K5RA 2HFUA 4Y6IA 1NJYA 2H5EA 2EFQA 1CS4A 3UD3P 4IFYA 1YWXA 5F3ZA 4OZ2A 1RZMA 3H59A 1NK4A 3UDVA 2HNYA 3G6ES 1P27B 4TXSA 4CIOA 3L4BC 3Q89A 2DPIA 4LBHA 5LOQA 3BH7B 1BC6A 3DKDA 1HWIA 3KLIB 2UUCF 3V6KA 5DDPC 2YX4A 1XMQF 2NUHA 1RTIA 1HPZA 4LT6A 2YKMA 3M2VA 7AT1B 1P1TA 2JEFA 2VBWA 5L9XA 3OFHA 4KHMA 1T03A 4X66J 2YWFA 4RNMA 1O51A 3AD9C 2EXUA 3QAUA 1IKYA 1JLFB 1F5AA 4ZIWA 1VQYA 5M2PA 4B3OB 1VGYA 4NA2A 2J9DE 1RT1A 4OI1A 1BUXA 1JLAB 1UZDA 4USVA 1FXDA 4UOFA 2MKIA 1PCAA 3OHBA 3CCUS 2RDIA 1SJ3P 3M8QA 1H98A 3FBEA 1DTQB 1M90T 2V8GA 4GVBA 2JLFA 5AXMA 5F0WA 4V1Ak 4AL5A 3W63A 4LQ3A 3LAKA 3QSIA 1FCAA 3D66A 3FEZA 1YZ7A 1DARA 4HT7A 2YKOA 3K5OA 3VVTA 3KLHB 3G4SS 4DF8A 5KAKA 4DL0C 3RB3A 4ZCMA 2UXBF 3B6BA 4ANDA 4CI0B 3PFEA 3PRVA 2RU3A 3EDRB 3DHXA 4GO7X 2KFZA 3G87A 2PO4A 3CDEA 4CTAB 2QFIA 1W2BR 4W90B 4LIWA 3UD4P 3M30B 4IDKB 3SFUA 5KFRA 2PC6A 5G0RA 4FBTA 3I5BA 2PE8A 2DVIA 3DLEB 3LA0A 4X4OA 4OHZA 1T7PA 2DRAA 1WI8A 1EAYC 2ACMA 2VH7A 1DLOB 4DV3F 1UWBA 5K14B 3R9LA 5J2NA 1E6YB 2HURA 1U7LA 1T11A 4DQQA 3FZ2A 4N56A 4OZLA 4LSLA 2W4CA 3PO5A 5D78A 1JWWA 4HTJA 2CQ4A 1RB0A 4WU3A 4X2BA 2PFFB 4HHJA 3HHLB 4TNOA 4ENOA 1FFWB 2M7SA 2C42A 3D3CJ 1OQ6A 3B54A 5FDLA 4QWAA 1XMOF 1TL7B 1X5OA 3I9ZA 1VBZA 1S1XA 1QD1A 1WHYA 2F8HA 1ZM3A 2UUTA 4ID8A 1RHKB 3HF5A 3UCGA 3FSIA 1U1QA 4GKKF 2KZZA 1CLFA 3ADAC 3GFZA 3VZHA 3MMBA 1YJTA 3KLIA 4DR7J 1U1OA 1IBMJ 1WEZA 2HRYA 2KJVA 5CABA 1T94A 2R8HA 4JI5J 3OW2R 2AJFE 3NEKA 4X4PA 3QRPA 5ADZA 2JOQA 1F2GA 2LXIA 1Y10A 2XMJA 3QGPA 3OVSA 1KRPA 3G9CA 2EBGA 4USTA 3ILOA 2E5JA 2IM0A 3CO0P 3QWUA 3V6JA 2R2SA 2IRYA 4DQPA 2RH3A 2NR0A 1NNDA 4M63A 2LDYA 3CB4A 4MH8A 5I3PA 3VGVA 1G1XA 4G1QB 3HPOA 1APSA 3TQ1A 2QA2A 3Q8SB 3TX8A 1FVQA 2HNZB 4X65F 2QG9B 1N0VC 3MD1A 3PRBA 5D4LA 3H5UA 4RL1A 2QA4S 2NQPA 3FCHA 4ZVFA 1N34J 1BY9A 4DV1F 3M2RA 1SL1A 4F0MA 5DM7Q 4FYWB 4UF4A 2B5JA 2BE9B 3MM7A 3O6QA 3TYTA 4EUVA 3W9IA 1HHTP 1YG0A 2BJ9A 1WF0A 4N47A 5K8OA 2ZE2B 3FCWA 2AX0A 4RW6B 3M2UA 2UU9J 1VLOA 2QFJA 1FX2A 4PXCA 1IUJA 3PHEA 2GW8A 1FKOA 4I2PA 5A6WA 1TV6B 1U0HA 1YKWA 2BM1A 2GGPB 2YX1A 4LF9J 4ECXA 1QUPA 1HNZJ 3GMGA 4MK7A 4OJHA 2E5LJ 4B17A 4J9PA 2BRLA 4J9OA 5KOWA 2OIHA 2V0NA 4J9KA 2CJXB 1S48A 1ZYQA 1RBAA 1NJXA 2EK6A 3KXDA 2V6AA 4DSEA 3UNYA 3IG1A 3ZZ0A 2IM1A 4RNHA 2K1RB 3CJKA 3DRYA 3ILLA 2V9KA 4N8OA 4A8KA 4HVZA 4PG7A 5IOLA 1REGX 4YDXA 5ETRA 3QQCD 4NYOA 1QSYA 3WC2A 3FFIA 1VC6A 2QT7A 2OEMA 1TUWA 2MZJA 2DH9A 2ZEJA 4F25A 3W5ZA 2BOAA 2YNFA 2AYBA 3MMAA 1OYEA 2QRRA 2XYPB 2Z0GA 2MQOA 3VGTA 2DH7A 3OLAA 4Y2IA 2W9AA 4EO8A 2K2PA 3PEJA 4HR2A 2J76E 3NS5A 2CPHA 5A8KA 2HVDA 1WG1A 5CD4H 3M8SA 2CQHA 1FKOB 4I2PB 2RMLA 4DV4F 1NKCA 2IIHA 3DOMB 3GIKA 1U8SA 2VU5A 3DLLQ 4QYZJ 1VQSA 4EI2A 4RW6A 1S1WA 5KFOA 2COLA 3BGLA 2KO1A 2DHHA 3V4MA 3S8SA 5IM0A 1CPZA 5IWAJ 2BXJA 3OLBA 2A1BA 3BSCA 3JTNA 4DR2F 1K0VA 1AFIA 4DL6A 4HT5A 3WBZA 2AZ1A 3JQJA 2E1CA 1FVSA 4Q45A 3A13A 4JB8B 4CH1A 1M5OC 3KK2B 3EM1A 3CJQA 4NLUA 4DUTA 2CXEA 3K59A 4LVOP 3HK2A 3HO1A 3QJPA 1FD8A 1M1GA 1SI9A 4I6WA 3W5YA 4DV5J 2KXNB 1K73T 1BWVA 2X51A 2I6WA 4O3PA 3U1MA 1UVMA 4LFCJ 2H51B 2QYGA 2HVZA 2RS2A 2LQJA 1YJUA 3ZTSA 4O4GB 4PG4A 4QPTA 3RRHA 1NU4A 3T5JA 4U7UD 2DHGA 3K7RA 5E3CA 1LOUA 3KMSA 2HMIB 4ELVA 4IR9A 1K1QA 4V19J 1A6LA 1VQ5S 1X5SA 4LRAA 5BXIA 1H2TZ 2FJBB 4EBDA 5C42A 5A8RB 2QL7B 3DYAA 2Y1IA 3M4XA 4KPYA 1HKAA 4C98A 4PRFA 1RT6A 2P6SA 4YUDA 3MZIA 1HBMA 5GADU 2DCLA 1U6BA 1NPPA 3BH6B 4J9RA 3JXOA 5HI7A 1P9QC 4WF9Q 2ROEA 2RJZA 3MECA 3OPKA 1YJWS 1URRA 2W4PA 3M9OB 2D74B 1NPKA 3PCOB 2RAQA 1D3WA 2R8KA 1NDCA 3M8PA 3E01A 2E5IA 5D6GA 1GX6A 2CQDA 2HVIA 4Q43A 1RHJB 5LSOA 2CQGA 4DUYJ 2X3GA 3HCXA 1PC4A 3Q24A 1PJ7A 4NRTA 2YQ0A 4ID5B 5GAHI 1MNEA 3JQMA 4OMFG 3PKMA 5KFFA 2GQ2A 2ADBA 1N5VA 3QRRA 1FK9B 2HQCA 1IM6A 2JNJA 2HZCA 4LF4F 3GILA 4HYKA 2HK2A 1SKSA 4PKDB 5KT2A 2UXCF 3QRQA 5IM0B 2DXFA 2FIUA 2HSEB 3UN2A 4GKJF 1S1WB 2QMXA 4ERDA 4FYXB 5HBMA 2GJ2A 3VZIA 4IO9Q 3GYXB 4QU6A 4NCAA 5EWFA 4A4JA 4M8LA 4WKRA 2FJEB 3GTYX 4URGA 3HJFA 1N33J 2VJUA 2ZH9A 2KI2A 2DGXA 2KRBA 4CLKA 1X9WA 5ETQA 3US5A 2E7XA 2AGPA 5AXKA 2R7SA 3UD5A 2ILYA 3CNQP 2M5YA 2ZOGA 1KN6A 5IWAF 5ITHA 3KLHA 1JKHA 3U1NA 1JLGB 1N0UA 2UVWA 2F9DA 3KMQA 1WD6A 2Z2ZA 4RKUC 5T7LA 1TKTA 4NLTA 3BO2A 2A2CA 2ZD1A 2KH9A 3BSAA 2OPQB 3OT9A 4LBIA 2DGUA 5CCMA 2VPYB 2IRXA 4LRBA 5CYMB 1TK5A 1RT2A 2VQEF 3EVMA 2Z4PA 3QT5A 3K5NA 2RDJA 1GXTA 2Z30B 1FESA 8ATCB 1FDAA 2GVDA 1V3RA 4KFBB 5LMUF 1GTHA 4LR9A 4U9RA 4PWDB 4X4VA 2VG7A 3A8JA 4E2FB 1HNVA 1RHMB 2YNHB 5IT4A 5LJ3Y 1HD1A 1RT7A 2JC0A 2E1PA 5AJ3J 3NXZA 4K4YA 2EVZA 2IHR1 3TUJC 4DPTA 3SCIE 3U7JA 4EO6A 4KY3A 2ZE2A 3B8HA 3FUYA 5KFEA 3TAPA 4C9DA 3O3LA 5CYJA 2R7XA 1NHVA 2P8IA 4RUCA 4WE1A 5E33A 4LF5J 2GJFA 2MEWA 2WBRA 2VZ9A 4LSNB 4UZBA 4LJMA 1Q16B 5GAGI 1P9YA 1Y9OA 3M2RB 3O44A 4NLOA 1CJTB 1M1HA 4P2XA 5AJ3F 2DIUA 2DK2A 2OFGX 3RW7A 3VALA 1DY3A 2DEIA 3KG1A 4TU7A 2R7WA 1H73A 1CJVA 4DV7J 4OJ1A 2QSFA 1RTHB 2ZVSA 4USMA 4G6VB 1SIZA 2XSJB 1DQ8A 1PILA 1TU0B 3DC2A 3TEGA 4ECYA 1UVNA 1YJ7A 4C0BA 4M5JA 5KFBA 1RT1B 2ZJQQ 4AQYF 1IBKF 1VHFA 2CNNB 4FDFA 2AGQA 4ECRA 2WVFA 3D3BJ 3ZXWA 1ICEB 1Q8BA 4FS1A 2V63A 1V3ZA 2ZH7A 4C0HA 2RF2B 1RTIB 1RYSA 4OI3A 5JXSA 2DY9A 3QJLA 3IAM9 1EKRA 5KT6A 4LBPA 3DM2B 2CPYA 5LSLA 1Z2LA 4B9TA 3G8QA 1MU2A 3NAIA 2M0GB 3NBPB 1OYDA 3D6TB 3GR0A 2AJ1A 3P45B 2RQ4A 4KFBA 2DXDA 4WFBQ 2VFSA 3W2WB 3D6FB 3DDKA 4TU9A 2I38A 2W9CB 4UOCA 3V6HA 2BKOA 5CYQB 3LP0B 3SSQA 1TKXB 3MF5A 3PVXA 1B64A 4FNHA 4FVCA 5KFXA 2VICA 5CYMA 3FJ2A 3ZTRA 1HBUA 1RWXB 2G1DA 2FD2A 2I9SA 2QSWA 4JP8A 1W25A 4QR1A 3BV8A 1S6OA 3EXCX 2IM2A 5ETVA 4ZVSB 2GAHC 1VC5A 4YB7A 2XZDB 4C11B 3VAFA 4EZ9A 1IR0A 3T1AA 4LF7F 5K20B 1IQZA 2YKPA 3MAAA 4NA3A 3PJ9A 5KFDA 2CQCA 3KDOA 4CH7A 1U2CA 3ET6B 2W9BA 4KGMA 1X4HA 3DXBA 3B78A 3HD2A 3VF0B 1HNZF 4O3SA 3CCES 1U09A 2EW9A 5IV3A 2DGOA 1R8BA 1UVLA 4DS5A 4B3RJ 4HHUA 3GP9A 5CAAA 4C48A 3JTOA 5IT0A 2HFNA 2MY8A 4OX9F 3D68A 3WQPA 1RKIA 5CXTA 3DU6A 2H4WB 1IKWB 1C0TB 1EB0A 1U6ZA 2ZBRA 1XR7A 3C6UA 2B43A 4TY9A 4Y2KA 3RRKA 4Y00A 4LR8A 2KRRA 1DQ9A 2HQDA 5EUHA 3SEOA 3WIUA 5HBMB 1VBYA 1X8DA 5DLGA 3PW5A 1FT8A 2OH2A 2XS7A 2OMOA 3GJSB 3KJQB 3DGPA 4MAKA 5B0DA 2DR7A 3FRYA 2UZAA 1N48A 4BC7A 4IQXA 3BZQA 3SV3A 5FLXU 5DZ6A 1UVJA 2VD3A 2XNQA 2UUWA 2LU1A 5GAEI 1W7WA 1WG5A 1U0SA 2IVFB 4DR1F 2VOPA 3A4TA 2M9KA 4FYYB 2FLOA 4PPZA 4Y0FA 3Q8PB 2UUBJ 3E01B 2AEJA 3T1HJ 2BQRA 4DCPB 1H38A 4OZ5A 2F4FA 3N5BA 4NL5A 3EPIA 2ZH5A 2Z58B 1N8RT 3NKYA 3BYPA 1KQGB 1U1KA 2YXLA 3AJ1A 4NASA 4TLRA 3OTEA 3CCTA 5KFYA 2YKMB 3M2VB 4ZN3A 1FNMA 2OTLS 5KTQA 1B0TA 5CZXA 1HBMB 2HHUA 1R8PA 4RUHA 4AQYJ 4FNIA 4A8WA 5CHCB 3TNVA 4USHA 5HP1A 1WHXA 4U8YA 3T5LA 2CPEA 3W3SA 2ILZA 1MW7A 1NH7A 2H1YA 2BANB 1WELA 3Q0AA 2MSSA 1YJRA 3VQSA 4CO3A 2BM0A 2CPXA 5B0BA 1PYOB 2R7UA 3UE2A 1DRZA 2DGQA 1NO8A 3LANA 2B4PA 1YSJA 3GJRB 4K5SA 2W2QP 3UDLA 4MT1A 5IT9U 1R6YA 3DRPB 2FJVA 2NXEA 2MLZA 2YNGA 2RSQA 2CNKB 3BR9A 4ILRA 4JI3J 1TR0A 4OI6A 3CD5A 1KWMA 1AUDA 3V4IB 1CEZA 1AYEA 1U26A 3AB2B 1CQNA 2CPDA 2U2FA 4N7TA 2J0XA 1L3VA 1B4SA 2FHKA 3NGUA 3MI7X 1CJVB 4Q2LA 2HRUA 3T5HA 3HVAA 3CXCR 4NZ0A 3TW0A 5H9FK 4KGZB 2XYGB 3CDAA 3MM9B 1CJTA 1C0UB 3HSGA 5I42B 1J5OB 4ZN1A 4YB1P 2NZ4A 3IBFB 4ZLPA 1RQ0A 4WE1B 1RT5B 4DR2J 3JS9A 2C2OB 1RT6B 3PZPA 3WX4A 4WIIA 3CCMS 2E9RX 3AXMA 3GIJA 1WSVA 3A8KA 4Y65A 4R8UB 1QUVA 4ED8A 4OI0A 3OL9A 2NLWA 1PYSB 3TVKA 1VC0A 3PR4A 2VG7B 3TQEA 4ZJQA 1FJGJ 4CZCA 2DR9A 4Q8FA 3GG0A 2V8PA 4QWEA 4ZITA 3G6YA 3DDIA 2M2BA 3DOKA 1YX2A 4PZVA 2LEAA 3VGUA 4ED7A 3MMAB 4DSKA 1FHTA 9ATCB 2RDDA 3MHYA 1R89A 3RBZA 3HMJG 1N5TA 3FFIB 5L1JA 1N36F 2QA1A 1KFSA 1X4AA 2VOOA 4LF7J 4WXWA 4X64F 2MXYA 2YWEA 4FYVB 2XI2A 4YEAA 4RBUA 2CWXA 4QYRA 2CQPA 4ED6A 2HHVA 1S72S 4R5PA 2KVQE 2XMVA 3HKZD 4C8KA 2L9WA 2B51A 4H4OA 4Y2AA 1Y3JA 2OPSB 6AT1B 4Q0BA 5AE3A 1HMVA 2Y1LB 2JLGA 2IJFA 2XI3A 4NZ6A 4JV1A 1WDDA 4KGKA 4J7CA 3TRGA 5SZTA 2KT2A 1HNXJ 1J2VA 3NRBA 4KE5A 4LF5F 3H0PA 4LR7A 4FF3A 1EQMA 2C2ZB 2OI2A 2FVRA 5CH7B 1S0MA 5HROA 1S77D 2ABYA 2LA6A 5GVQA 2PSZA 4HH0A 2I2YA 1NK0A 2UUCJ 2W2NP 1S6PB 1U25A 5J2MB 4C3LA 3LGMA 2DEJA 5A2QU 4ZVPB 2L08A 1C2PA 4C6AA 1R31A 2LKZA 4KC5A 5KFHA 1TTHB 3E51A 4QWCA 3KJVB 3G86A 4G1QA 2F8EX 2H5IB 2YPZA 1JB0C 4USIA 2R8IA 3A12A 3BQ2A 3PW7A 2WVCA 2M8HA 3ILIA 4DFJA 2ZKUA 2MGZB 3KLEA 5L1KA 4JOUA 3GE9A 1IR2A 1GXUA 1TUGB 4DEZA 4DQSA 2E7WA 4P75A 5KFLA 5J2PB 2MQNA 2J0WA 3K2YA 4W4MA 1AZSB 1LW0B 4KKOA 4DI6A 2KFYA 4Q2MA 2UXDJ 3MEDB 2J8AA 3MXHP 2YKNB 4PXDA 4QR2A 4P9SA 1TL1B 1CQMA 4DXLA 4FBUA 2MZ1A 2XHCA 1VQ6S 3K58A 3D7SB 5CCLA 5KG7A 2MZQA 3D9BA 2WZ1A 3JYTA 2JRSA 4PAAA 3WZ0A 4K4WA 2XNRA 1YRXA 5BYRA 1JLQB 1Y11A 4ED4A 1UEUA 3EMTA 1NK9A 2CVIA 1VK8A 1EETA 3SQOP 1LEOA 4LSLB 3I5CA 5AE2A 1YDLA 2CIMA 1NDLA 4K2XA 3HT0A 1QSSA 4CDIA 3NMAA 2IYIA 3BPSP 1HR0F 3RBEA 4B9UA 1RBLA 3CJ5A 1UEKA 5LT5A 4DS4A 3GV7B 3DNCA 1B0VA 2YQ3A 3ISND 3W9JA 4RUAA 4CCHA 4DSIA 3N79A 2KXFA 4KO0A 5BYQA 3BEGB 1ZM9A 4QWDA 4OYWA 4A8QA 1VLYA 2ZWOA 2HKEA 2I1RA 3JB9k 4WZMA 2XY5A 4I64A 3THPA 4YHHF 2B7CB 2J9CA 3BGFA 4JI6F 4CQ1A 2GNKA 2E1AA 1DBDA 4D3HA 1NK8A 1R7IA 3RR8A 1L3UA 2RQCA 1CULB 4NLWA 1SJRA 2MZRA 2BOPA 4BDPA 3V5RA 3NCPA 2EFPA 2CUYA 5M2RA 4DQIA 2FLLA 1N5YB 3ETMA 1BWEA 3PX0A 4ZVEA 2R7VA 3QZ7A 2GZOA 2KB2A 5HQLA 1Q82T 1TAQA 2XC9A 1X4GA 1ZAWA 3I96A 1DTQA 2ZWPA 1FFSB 1B7YB 4XDCA 3X3UA 2XO6A 4M5DA 2PDAA 3R27A 3OFGA 4OZ0A 3B4MA 1NCLA 4DDFA 3H5XA 3HHLD 2Y3YA 1U02A 4OIXA 1VJQA 2QYCA 4F4XA 1G3OA 4QWBA 5AE1A 4N5SA 2BKNA 1KSPA 4JI8J 1F1BB 2CJYB 1FE4A 4ZPWR 1S79A 2IDEA 1SV5A 3T41A 3M30A 4IDKA 1I1GA 4QIFA 1AFJA 1MG7A 5H9EK 1D9AA 2H3EB 1S9EA 4HKQA 5HATA 2WCXA 2YNIA 1G4CA 2J7WA 2RRAA 1UVIA 4JI3F 1I3OB 2IC3A 4IUFA 3UN5A 3CWJA 2UUAF 4U96A 5GAHU 2RE1A 3MR2A 1X4DA 1Y0HA 4OLPA 1KKHA 4YDDB 2VDIA 2UUBF 1Q53A 2NUUG 4PPDA 2CZVC 2RU9A 2VA2A 2VFVA 2W25A 3SSRA 1R27B 2AHOB 4MTPA 1U6FA 2NYIA 5KFAA 3TP2A 4DU8A 2BV3A 5A2QY 5L1IA 2C2DA 3R2DJ 2QV6A 1FWKA 1NH8A 4EYHB 1VMBA 1LXNA 1OY8A 2YTCA 3OBIA 4ZPVR 3NLCA 2HWHA 3ITHA 4X84A 2DGWA 4WTOB 1H2VZ 1QTNB 3BPDA 3FEYB 5KFPA 1IBLF 3HHLC 1HI1A 1YIJS 3SFGA 3EWGA 2KL8A 4RU2A 3OHAA 1BQMA 2ZHBA 1C1CB 2UXCJ 3M8YA 2N3OA 1WKJA 2VFRA 2DO0A 3T1YF 2VJVA 3R5AA 2WB1D 3OXLA 1T05A 3RTVA 1UEVA 1S9EB 3AT1B 1NSKL 4AUKA 1TL4A 2ZDPA 3PFOA 2DB1A 5KT4A 2R2TA 9RUBA 1K44A 3KUEA 4J9VA 3VR1A 3OTOF 1XMBA 1IVZA 3W61A 1X0FA 4H4MA 3DRXA 3PYGA 4DLGA 2ZZNA 3KG0A 4X4NA 2V2QA 4QZVB 3MCOA 4WFNQ 4DN0A 1RT2B 3BBCA 4OZJA 1N6QB 2HFOA 4D3GA 1HWKA 3GFXA 3CDUA 2P5VA 4CT8A 4EWTA 5K9FA 1X7VA 4NPOA 1PO6A 4BLGA 2E5HA 5C24B 5FJ4A 3LAMA 1NMEB 1TKTB 3TA0A 2I8EA 4ALZA 4PQAA 3M32A 1JLCA 1HI8A 4O44A 3JSMA 2Z2MA 2B6AA 4IO1A 5K14A 1FXRA 2N3LA 2VC0A 1YJNS 2FYXA 3QATA 4MIWA 4WU2A 4K4SA 4NX9A 3TUIC 3HM9A 2ZZTA 3WDOA 3AJDA 3C46A 4NEYA 2KU7A 3IN5A 1XMOJ 3KUGA 4DWIA 3KNGA 1RGVA 1VBKA 3T6JA 1H7XA 1EP4A 1F3FA 2GQQA 3FMBA 3QBCA 3DI6A 2BEFA 2V8HA 4NZ7A 4MFBB 1RHRB 3WC0A 3ZZRA 1G7CB 1R8CA 4KO0B 4WFZA 2FY1A 5F8LA 3ISZA 3PKYA 2NREA 2BACA 3O2IA 1TUVA 5D3GA 3R2CJ 3OR2A 1FK9A 3T6BA 3RU0A 3WX8A 1LK7A 4RR5A 4WZQA 1C4AA 1JLEA 2IVMA 4LQ9A 5LXYA 2WONA 4HDGA 4L3NA 1SJ4P 5D0RA 1RWVB 4DR5F 4O3NA 1Z4UA 3RYLA 1QM9A 2CJAA 1NB7A 1FJGF 4QIEA 3Q22A 2MTLA 2CADA 4WK1A 2UUAJ 1OSCA 1NK6A 2ZJPQ 2KKHA 1JLFA 1IKYB 1VFJA 5IC4B 3PRDA 3MFIA 1IKVB 2DNQA 3MECB 2OD6A 3OD2A 3RZAA 1V3SA 2MB0B 2R3VA 4DSLA 4WFXA 3ZNJ1 1SL2A 3OVBA 1K0TA 2M70A 2DY1A 2D69A 4RBTA 4O3QA 2UVVA 1FEHA 2IAJB 4JV5F 2CNOB 1TMMA 3MUTP 2BBEA 1NDKA 2AP6A 5A8RA 2YKNA 2EFVA 2BVZA 2LQBA 2DNNA 2OPPB 2YWWA 3ZZTA 2Q1LA 1AZSA 1CS4B 5HQ8A 4X4QA 4QIGA 1UP1A 3OJUA 2D1CA 2HAFA 2JVRA 4ZPAA 5A0YB 4TQSA 1LW2A 1JLBA 3BN4A 4NMLA 1W2IA 5HVHA 3AD7C 5C2GA 4DX6A 4ZP9A 2KHDA 5FD1A 1Q5YA 3H42A 1TVRA 3MM5B 1HQUA 1DZ5A 1LXJA 1HIYA 2CG8A 1YTYA 1RAIB 2OHDA 5FLXY 3R1LA 4LIRA 2WRMA 3HSZA 2U1AA 2H4YB 3LTOA 3SCLE 2G2OA 3H98A 3MOZA 4C97A 4F04B 3C14B 1T9UA 4AT1B 1U1PA 2HBRB 3OVAA 2VQFF 2V8VA 3J80Y 1CC8A 2WW8A 3OFFA 5IXUA 3IXQA 4C8OA 1MMDA 2D9PA 2DITA 1LK5A 3AFGA 4CLTA 4CYUA 4DU7A 5F9LA 3MMCB 1N33F 3KUHA 4FF2A 3GYNA 3P5TL 3PR5B 1S6PA 3EGWB 5HROB 2RRNA 3BN7A 2KT5A 2WSEC 4C3MA 3W1YC 1WKKA 1TZ0A 4YB6A 4QU7A 5DQIA 2BE2A 4ZKAA 4ZLLA 1RT4A 2C2MB 2H5JB 2RB7A 3PTWA 1PYTA 3ZTOA 5C5JA 4DV5F 4DX5A 4ZIVA 2V5HG 3LGHA 3C15A 3MCSA 4PUOB 4I56A 3CULA 5KFIA 1OQ3A 4CLYA 3EZOA 3J7YI 3H40A 3UFCX 2G2ZA 1SQEA 3BKUA 2C3MA 3N5FA 1HMVB 4O3OA 2L48A 4A8XA 1SQGA 2OPSA 3CC4S 4NLGA 1Y00A 3OR1A 1RAGB 1VIXA 3FC9A 3VWSA 1RWNB 1Q0NA 2APOA 5L9NA 1GMWA 3FQLA 4ELTA 3CMES 3CCWA 1OJ4A 1NZAA 5ETSA 2MKYA 4DV6F 2N4CA 3H90A 2OD4A 1AUSL 2DIVA 3OR1B 5KFVA 3TJAA 2B7BB 4LFBJ 1GX5A 2NXJA 3K89A 3BF4A 5CD4A 1WHVA 3DOKB 4QJVA 2UXDF 1KQFB 1K8AT 4F4ZA 5GMKa 4O0IA 4R0EA 4PUOA 3VHQA 1N54B 3PACA 4F0KA 3KK1B 3NAHA 1RTDA 3Q8VA 4P71A 5JJBA 1S1VB 2JHEA 1E6VA 2I0XA 2JH3A 2OMLA 4U8VA 4LFBF 5L38A 1U48A 4ICLB 2V68A 4JBCA 4F7VA 2VIHA 1YBUA 2OPRA 2PA8D 2R2UA 4OJGA 4C0OC 3P3DA 4DCOB 4FS2A 3UVJB 3DRSA 2H54B 5GADI 2EKNA 3TAMA 4TYAA 1KEKA 3IRXB 2V4JB 2E5LF 1B3TA 4TN2A 5ETLA 4X4TA 2PMWA 1PAEX 2VFTA 3D1HA 2G2YA 2HGMA 2WK4A 1D8YA 1SC4B 4A47A 2ROPA 4GO5X 1WHWA 2KJWA 1SKUB 4DBQA 4J91A 1UMJA 2GMJA 2VG5B 2FUG9 1RLDA 2FZGB 4K0KF 2GS8A 4WP8A 1BLUA 2KHCA 3TA2A 2K7KA 3TJ8A 3DRPA 2LYVA 3VCDA 3GIMA 1HYSB 2PN6A 3L95X 3BDPA 2RD5C 4ZVQB 1FX4A 1NKBA 2J7UA 1N56A 2MDAA 2BANA 3P8BB 3G82A 2GCFA 2IA0A 3SCKE 2XMTA 4DV3J 4B9SA 4M1KA 1T3OA 2SXLA 4JI2J 1VQ9S 3J81j 1YJ9S 3UO0A 1Y3KA 1R6VA 1IKXA 4WP3A 4C3KA 3T1YJ 2V94A 3AA9A 2ZH2A 1FF2A 1PJ6A 2CQ2A 1N36J 1U2FA 4QW9A 5HJXA 1S12A 4A8MP 3D2WA 5BJRA 3M1VA 3FEXB 1UTAA 3DOLB 2FTRA 1HBOB 4NI2A 2AT1B 3RAMA 1BMQB 1V9OA 3TVZA 3NOCA 4KIAA 3D0GE 2EPIA 2CYYA 2C2RA 2B4VA 3VGSA 4Y3CA 3C66A 2QA4G 1UPPA 1JJCB 1GTEA 3UN3A 1T9WA 2MKJA 2V2VA 4ZVOB 5DDRC 2AEFA 1S4EA 6FDRA 1L3SA 1RWMB 4LF8F 4W92B 2DNGA 1KONA 1XQIA 2W1BA 2Y1JA 4HDHA 2AWZA 1FFGB 1DQAA 2RQMA 1GT8A 5ETPA 5EWGA 1Z2ZA 2QMWA 1HNIA 3N01A 2R9LA 4WIQA 4M5IA 2NPIA 5K8MA 1JIHA 2KYZA 3FSXA 2OSQA 4L76A 1S1TA 2BUNA 1A7GE 3I0RA 1VI7A 3N6NA 3KLFB 5A8WB 2HZVA 3OTBA 1S97A 3MAAB 2KTQA 2FHOB 1NRKA 4Y28C 5F8IA 2BQUA 4C11A 4ZPTR 4ETXA 3ZZOA 5KFNA 2LCWA 2M52A 3PO4A 1A9NB 2QLXA 4NRUA 3DMJA 2W9CA 2MZSA 1CBKA 2VBXA 4Q7AA 3QJJA 4IFVB 2IPOB 4H4MB 3VAHA 1VOMA 2P9EA 3TAQA 1MWZA 1SH2A 3IBCB 2PI5A 1VJWA 4NWBA 3HHDA 3U1LA 2GA7A 3JAMY 3PJXA 2WW4A 3ZFVA 2ZHAA 3DFEA 2NXUA 2AGOA 1MU2B 1B99A 3L7PA 1KC8T 1RAAB 1SC3B 2V34A 3PDNA 3IRWP 2IYGA 2B9EA 2VC1A 3DM2A 2HHTA 5BR8J 3GFHA 2EFOA 4XO0A 2BW2A 3LH2S 2R7TA 5HVFA 3ZZUA 3I0SB 3MWBA 4LRDA 1QY7A 3W7BA 2AF6A 4IOCQ 2LVWA 3CEDA 5ETOA 4DF4A 4ZOSA 5LMUJ 1EHWA 1S1UB 1VISA 1Q8KA 4PEOA 5F9NA 2OO4A 4FP9A 1S59A 4I2QA 2R7OA 3I32A 4A8SA 1QAIA 2F8MA 3D5MA 2BDPA 4PG6A 4QOTA 2QMUB 4C2MA 1VQ4S 4DFKA 4PYDA 5DLFA 3CF5Q 1JK9B 2D3O1 4RW9A 4F02A 2XSFA 1F9FA 3ULHA 5EDWA 1MN9A 4GMKA 3GLJA 1FDDA 5IZHA 2B3TB 1RTJB 3OUYA 2ATLA 2R7QA 1KNZA 4FPRA 2IM3A 1NKEA 2PI4A 3CD6S 3X1LB 3QSYB 2WOMA 2NSBA 3M8ZA 4PG5A 1S9GB 1ZA2B 2J5AA 2J9DA 2ZH8A 1JJ2R 4LF8J 1I5OB 4CO4A 4WWSA 3KK1A 3K8WA 1RTDB 5E3PA 1DFDA 2LQ5A 1FKPB 3IO1A 2GVDB 4WK3A 2ZNYA 4DPOA 1TKZA 1DAXA 2UVRA 1O0PA 3L7OA 5J2QB 2B4OA 1U45A 4HHHA 5HQMA 2HVHA 1YJVA 2ZOMA 3RGIA 2AU0A 2B9WA 4ZJLA 2ACYA 2ERRA 3HHKA 3CMQA 1PBAA 4LF2A 2WBMA 3QMQA 3IGVA 1ZM2A 1R8AA 3SSSA 4EGLA 1J5EF 4JI0J 1ZZNA 2WB4A 3CSKA 2W8LA 4UT4A 3CPWR 4K8RA 4QW8A 2R8JA 2GO9A 4P7TA 4PWWA 1UA0A 1X31C 1S6QB 4KR0B 3TJ9A 1NK7A 1BQNA 3OXGA 4ZVGA 2EG2A 1Q4RA 4LF6J 2GVZB 2RS8A 1FI4A 1TL5A 1Y7PA 2L9DA 3SV4A 2E29A 4HLBA 1NSAA 3NL0A 1XNRF 3W2VA 3CMAS 3QT8A 2XO7A 2UXBJ 3KHLA 2HBQB 4K2JA 4WP9A 4C7QA 1X9SA 3G6XA 3LUYA 5IQ6A 3POTA 3CC7S 3MPUB 1V5IB 4OYBA 4X66F 1GXLA 2EG1A 4C8LA 2EC0A 2M4MA 3CCRS 4PCQA 2VG5A 4AXJA 3EGZA 1X4CA 4C8MA 3MEKA 5I3UB 1L3TA 1SC1B 2V50A 1NDPA 3LQVA 4OYMA 2BABA 3AA8A 1GFWB 3HJVA 3HULA 4H4KA 4ID5A 1FDBA 3S6EA 4C8ZA 2UV8G 4ZMMA 1EETB 2CPIA 4BS2A 3BGRA 4N41A 3LPYA 2HVEA 3ZO7A 4F4AA 1TL3B 4IRKA 3H5SA 3KHGA 3EPGA 5U47A 2FY8A 2AKWB 3S7RA 1WNEA 4GVLA 2E7VA 4KRWA 3R8YA 4V19X 1J27A 3FBCA 4B3MF 3B82A 4M5GA 4DV2F 3AQPA 4MYUA 3Q8UA 2NXNA 5MLCV 2DNYA 1NHUA 1TL1A 2CNLB 3CJ2A 5D0GA 2HHWA 1IWAA 2JL9A 3MEDA 2GIRA 4YY3J 1RA6A 2GIQA 2IAJA 2JFDA 3MPDA 1RBOB 3CCJS 1BQXA 2A0FB 5J2PA 1R0AA 4NLPA 2FB0A 3GJQB 4CLLA 3J7A1 2FC9A 1OY6A 1TP7A 1F3VA 2CA9A 4KT0C 2VQEJ 1IKVA 1YBTA 1T0TV 1M5VC 4E8UA 1TL3A 3HX9A 1YQHA 2DNMA 3CGIA 3CIZA 3CC2S 3W8PA 3O1LA 1H0HB 1NB2A 1Q95G 2EFNA 5J1NA 4NLSA 4CLZA 4RW4B 5H9EJ 3KKFA 2WSCC 2DNZA 2N7YA 4ZHRA 2X1AA 2HGNA 4CLFA 2JC1A 3FGVA 2N82B 3GV5B 3JSBA 2DT9A 1UZHA 1H7WA 1Q86T 2RHSB 2B0GA 3OSPA 3RW6A 3POTB 4ILMA 2J0QD 1PAUB 1MROB 1KLMB 3C19A 3MM6B 3NS7B 4U95A 3V81A 1ZETA 1FJCA 1TK0A 4G65A 4YR2A 1FTCA 1RUSA 3QO9A 1S1VA 3MUMP 2DHSA 4KV8B 2BE2B 2XGQA 4LFCF 1ZTTA 3K8VA 1BQNB 4IOAQ 5GAEU 2Q43A 4DUYF 1LWEA 4CO5A 2D3ZA 3DXSX 2MKKA 5KFWA 1JNRB 3HZGA 4ES1A 3D6HB 3WHIA 1OPZA 2L3MA 4Z7CA 1HW8A 3D0IE 2YKQA 2IMOA 3BB5A 3DN9A 4PXEA 5HAOA 3RBDA 2OSRA 2DHXA 1UAWA 3M32B 4OYOA 2CJBA 3J7ZT 4KH1B 4ZK7M 2OP5A 3QFWA 4J5OA 1WC0A 3OSNA 4XDDA 2JZ5A 2G1HA 1CJUA 1AT1B 4R0JA 4MKBA 3DCAA 5J2QA 1QAXA 1KQKA 1I94F 3M7VA 1S4FA 3C15B 2GGPA 1U0HB 2HFVA 4B3TF 2FVSA 2A10A 3M6XA 2Y0SD 4KV8A 4L74A 3I56S 4KYZA 1I51B 3HSJA 3VAKA 2IJNA 3IWXA 1SCJB 4HI2A 1KHWA 4ED1A 3LP1B 1KLMA 1FRJA 1UFKA 4B3MJ 1S49A 1NSPA 3CO9A 2VUGA 3PYDA 1RACB 4DL5A 2X1GA 4M5LA 2X3DA 5A76A 1RWWB 4QR0A 5KFMA 4ZVTB 4GKJJ 3KHRA 3IR6B 2DR6A 4ZHRB 1WWHA 3Q86A 4UQGA 2HNZA 2QIFA 1C1BA 3CD0A 4ZA1A 3PXGa 1HNXF 3MGJA 4OZ1A 2A6OA 4CT9A 1L3KA 2AJ2A 1Q81T 1NSQA 1Y5LB 2R4FA 1KBRA 3HKWA 4P7VA 4CO2A 8AT1B 2FVQA 2BJ3A 2XULA 1VQ8S 4C4WA 4UY8T 2FHJD 3W8GA 1D0EA 3L3CA 2F3JA 3R6LB 3LWLA 2ZH3A 3F56A 1LW2B 1YVFA 3VTIA 4TVAB 2DNPA 3TZYA 3I55S 1R0AB 1SL0A 1X9MA 2NPFA 2MQMA 5DM6Q 2CQ3A 5D4OA 3CD7A 2JX2A 3RBXA 3MR6A 1SPBP 5KG5A 4M5MA 1WOSA 2YH1A 1VRUA 3SDEA 2D7SA 4DQRA 1RCOB 2HQFA 4LUBA 3HLUA 1QE1A 3BM7A 3K57A 3GR1A 3R97A 2J6UA 2KYXA 2VA3A 1SXLA 2RILA 1WC3A 1IJFB 3HHEA 3MEEB 3M6VA 5D4NA 3FKBA 4CH0S 4ECWA 1S6UA 2EK1A 2F40A 5C25A 3NGDA 3KTQA 4Z2XA 2NCKL 3M05A 1RHUB 2QLWA 2VKZG 2GC8A 1LWFB 2DGVA 3SQGB 1X60A 3R1HA 5FDLB 1X5TA 4RW7B 2CAJA 2HHQA 2V4QA 3H8YA 4IG3B 3AB4B 2X1FA 4I6YA 1QAJA 2OUGA 4CLSA 2C3PA 4JI4J 2EEYA 3MMJA 1DTTB 3VVUA 3V6DA 2ZZMA 1HHSA 2BJ8A 3CDWA 3HFZB 3WIVA 1N6QA 3A3NB 3IS9A 4LFAJ 3KYLA 1JXVA 4N8NA 1K47A 3DLEA 4DV7F 2CQIA 1N5QA 2MHNA 4UTGA 3DGVA 5A6PA 2LEPA 2ZNZA 1QE1B 4DUZF 1NBEB 4BCAA 1IKWA 1C0TA 1NPRA 2YBVA 5FIIA 1AXQA 1ZOTA 3CJRA 2GVZA 4ITSA 4CTAA 4F3QA 3M9NB 1RTJA 2JWNA 2PMZD 3OUYB 1VHIA 3SBMA 3D4JA 4H4KC 3QLHA 4OFZA 2OELA 2ZH4A 2LDIA 2C28A 1FDNA 1HARA 2HWIA 2BJDA 3K0JA 5HVGA 3A8EA 2CJ9A 4G1PA 2VODA 4OV1A 2VL1A 1RI7A 2AIRB 1KTVA 2JEIA 3N6LA 4OI2A 3QZ8A 3KLGB 2BZ2A 5AT1B 3KLVA 5F41A 1FD2A 4M94A 3M1VB 4JI6J 1WTFA 1FRXA 1OSDA 5IQQA 4C8NA 3UDEA 1C1BB 1JLAA 3CJTA 3ZZPA 1HBUB 5B7WA 3AAWB 1REVB 1UFLA 4CM2A 5KFZA 5F8GA 1RT3B 1GAOA 1HPZB 5B08A 3JYTB 2DO4A 4ED0A 4ECSA 1T03B 4RZRA 2V69A 3W2WA 2IDLA 3N0VA 4M5NA 5IV4A 3I4HX 3L09A 3C3LA 4ILLA 1M5SA 3AODA 3A3PB 1IXKA 4N76A 3ZNUA 4OYIA 2ZM6F 1F6TA 1UL3A 2K8GA 2HNYB 3ELHA 5KG3A 3OJSA 4J9QA 2HWTA 1MMNA 2W4DA 3QIPA 5KFCA 4UQTA 1P8GA 3JTPA 4CLUA 3J81U 3TZWA 1VIOA 2HBYB 3QIDA 4P2FA 3MPVA 3HVRA 3E2EA 1HWUA 1SIWB 1RWUA 2DRBA 1U47A 1CJUB 3PX6A 4CP5A 3HFKA 3MCMA 1UVKA 5E3RA 3GU0A 4ECTA 2OLWA 4DUZJ 3GG1A 4KGXB 2QN6B 1BHNA 4OHWA 4OQJA 1S76D 1LQ9A 4DR4F 2Q3PA 1X5PA 2DISA 2GMLA 2W2PP 4RO0A 5KFSA 4B08A 4KHPF 1KTQA 3BJYA 3IAS9 4AL7A 5GAGU 1EZZB 1H3DA 1KOHA 2VDHA 3UVJA 3Q8YA 3QLHB 2YWKA 2B8QA 3N28A 2BRKA 3AJ2A 2J8SA 1CVJA 3C16A 4WKYA 3B4DA 4LREA 4W98A 3JAMU 2KG1A 4U7UK 1E6VB 2ZKTA 3IA0A 3NMRA 1N88A 2F63A 2GIFA 3JSRA 1HNWF 1RCXB 2AJQA 3MM6A 3DLJA 3J7Z5 4FXDA 4JI5F 1SUQA 1FTRA 4RBVA 1RU2A 1R3NA 3H4DA 1PC5A 1AB8A 1RLCL 2GFFA 3DMJB 4O4RA 5ETMA 4B9NA 2BJEA 4DR7F 4ANEA 4KGVB 1WDTA 1ZA1B 1GK8A 4F3MA 2IBKA 1HQEB 3I9V9 4LSZB 4NLRA 1ZM4A 4ZDNA 3UR3C 2OPQA 3MM8B 3W66A 4J9MA 4Q8EA 1S0OA 2FJWA 4F50A 3QT6A 4FPIA 2DD8S 3M8RA 4CO1A 1GQEA 1F9EB 1U2RA 3R7NB 1XEZA 2GO8A 3ONQA 1LWFA 3QGIA 3SQGA 2GHVC 4ER8A 1PIEA 2PMHA 2ADCA 4NXNF 1D09B 4LF9F 1OIAA 3Q83A 1WEYA 5HK4A 5LM7E 1RDRA 2DJWA 2EFGA 3KFWX 4Q44A 5LMNF 3RRGA 1AA1B 3CE8A 1N34F 4NXMJ 3DLGA 1N32F 3D67A 4B3SF 3FSYA 5MAOA 4DR6J 4ED2A 1WJ9A 4I68A 2ASYA 3PHTA 3VQTA 1SJ1A 3GWCA 4DZ6A 4DX7A 1U49A 5IT9Y 5KFGA 3G96A 1ZTWA 1HLWA 4X64J 2X7IA 4IYQA 4DPWA 5HO4A 1ZPWX 1VR6A 2P9CA 2IVYA 2XBPA 3DLKA 3L9ZA 3NP5A 4FKYA 5T41A 3TVYA 3G2XA 4OYPA 4OJ3A 4CYUB 2B8PA 4FVMA 3E3XA 1XTZA 2YWHA 3MTKA 4Z7YA 1HHQA 3R5BA 3DOLA 4A48A 5KOXA 2C3OA 3FRZA 2YY3A 4NE9C 3ZTPA 2ZVIA 4A8YA 4Q5VA 1VQKS 4QQBA 2MQQA 3TUZC 3CCZA 1GMVA 4DJBA 2O67A 3ILJA 1HA1A 4O23A 1XJWB 4XAKA 5G4DA 1WI6A 4IG0B 4GC6A 1JLBB 1SJFA 3DRSB 2K3KA 1RE1B 4DV0F 2V8DA 3KJFB 3TUPA 1B70B 4WTYA 2F5GA 4IH5A 5KT3A 3MR5A 2VQFJ 3TARA 2Y8YA 4B3RF 2DTJA 4C8YA 4KHPJ 2DGTA 4HACA 4CNZA 2I5JA 5BYSA 1FJEB 2QLFB 1NJIT 4BC9A 4HTIA 1XK8A 5C42B 4JI7F 4EMDA 2Y1RI 2NYHA 3C6TB 3GIIA 2XG8A 3DLGB 2MLYA 1AROP 1YRUA 5AXNA 3SIPB 1BD6A 1CJKA 1HL6A 4RNFA 3EX7B 2XY7A 2QLJB 2W8KA 4NLQA 3D1QA 1HNWJ 3I82A 2DNKA 1I6JA 2WVDA 5E7OB 3Q8QB 4QCLA 1NZ8A 4K4TA 4NEZA 3MPWA 2FGCA 4ATNA 1X4EA 1XWLA 3MD3A 3BBBA 3F44A 2BX6A 5E0OA 4R5PB 2XGPA 1MLAA 1RWPB 4O3RA 1QVFR 1WF1A 4AXIA 2PEHA 3SCJE 1ZBTA 2AQ4A 2FPHX 2X1BA 3FDSA 3KK2A 3BBFA 3T9NA 2DH8A 3E8OA 3TAMB 5F8JA 3SZ2A 3Q23A 2E44A 2F9JA 2Z2LA 1M5HA 1YZ6A 3OR2B 1QDUB 2DGSA 4LRCA 1FKPA 3EUNA 4F4YA 3EZUA 2LA4A 3PW4A 2D3OR 1D9FA 4WFAQ 1G2EA 3SI8A 1RT4B 1ULRA 1JXEA 4XK8C 1FNXH 2RVJA 4YMEA 4ECVA 2WOMB 4ZP8A 2B9XA 4KAIA 2HAIA 1XR6A 3C16B 1MROA 1XNRJ 5A8KB 3DLHA 4J37A 5AXLA 5JVGQ 2LEBA 4RWWA 5C7PA 1VQMS 1QTMA 4RW9B 1JXLA 1WC1A 2N4DA 2QL9B 3FBBA 3GCWP 4WYWA 4PWUA 3C2PA 2O5DA 1C0UA 2GJIA 2OEKA 5I42A 1J5OA 2G13A 4O44B 3HVWA 5EGYA 3ICLA 1XNQF 1QLNA 3BQ1A 2IA6A 4X4UA 3CJKB 4NCBA 5LL6d 1ZPVA 1MSWD 1ITPA 5CZVA 3CCSS 4RU9A 1K1SA 4KB7A 5HLFA 2Y9HA 2QEXS 4KPCA 1M5KC 1LKZA 2KN4A 3GCXP 4RNOA 3V4IA 2MKSA 3TR5A 2OJ3A 2RHQB 1GMWD 3R5CA 2ZUGA 4YHHJ 4LMZA 4PWDA 4XPCA 2ZUAA 2PFDA 3K5MA 1X0PA 2C3YA 2AZ3A 3G6VA 4DR6F 1L5UA 1KS2A 2F7VA 2OPPA 2RKIA 3NGTA 1OY9A 3UR0A 5EWEA 4ED3A 4OL8A 4EYIB 1IBMF 2NSCA 3W62A 1WUUA 2CPJA 4DSJA 1RTZA 4Y34A 1S0VA 2N7CA 1T05B 2BW7A 4MK8A 2YWGA 4EFAC 5HP1B 1Q7YT 3MMCA 1T9TA 1BQMB 1VQ7S 2B5JB 3MM7B 3PEHA 2CWKA 2YKAA 1UW9A 3M8WA 5D8HB 1URNA 2LXFA 3FBFA 3MM9A 2MHEA 4M5KA 2ALZA 1D8ZA 1RKJA 1BGXT 2W01A 3NWGA 3NGSA 5KG6A 4PQUA 1KVIA 1FEEA 2HNDB 2MQLA 4DL7A 4TYBA 4DR4J 4JI2F 2CJKA 3HXMA 1S1UA 4K4VA 4BWJA 2FZKB 1O5JA 2W7OA 4QPXA 1RTHA 2QLBB 1Q8LA 1UFWA 3H7HB 4ZCKA 3OL8A 1XIQA 2HFSA 2L9NA 1WTBA 1FRHA 2A18A 3ENAA 4DV0J 4RJVA 4DV6J 3NNHA 3I0SA 1PBUA 1WF2A 3NY0A 3QIPB 3PV8A 1K9MT 4LSNA 1P6TA 1LWCA 4B9LA 2V67A 4NCGB 4I7FB 4IRCA 4FXWA 3D0HE 3DI6B 3EJMA 3QAEA 3UWTA 2O3DA 2HW3A 3N4WA 3VAIA 4XIUA 3HI9A 3S01A 5KG4A 4PXBA 1SB6A 4DPXA 1RWKB 1D1UA 1TELA 2ASLA 1UJ5A 4JI4F 4IFVA 3UQSA 2FC8A 3NNCA 2G9OA 1ELOA 1VCTA 2CQBA 3IS9B 2W7PA 1NJZA 1REVA 2JJ4D 1J5EJ 1S0NA 2Y8WA 1TL7A 2DCUB 1U1NA 4OHYA 5KT5A 4KSEB 2C2NA 3JQKA 3ZZYA 3AOCA 3RG6A 2AX1A 1WEXA 2QZ8A 3UCUP 1HBOA 3QGGA 3PYFA 4B02A 5A8WA 2CVEA 3LO3A 1N4LA 2W7AA 2E9TA 1JLEB 2RUSA 4ZPBA 1JLGA 1EJ7L 2MJNA 2ROGA 3IR7B 3CCLS 5F8NA 2R42A 4P74A 4R25A 4TLQA 1UCNA 1IKXB 2RQKA 3P4UB 4UW2A 2G0CA 4XTTA 4P2SA 3PIOQ 3UPFA 3MUVP 1QVGR 3OTOJ 1SUQB 3HDSA 2CZ4A 1XNQJ 4MKYA 2E1MC 2AV5A 2KVIA 4MFBA 3MTJA 3K17A 4I67A 3W5XA 2C2KB 3A3OB 3SDEB 4K0KJ 3NNAA 4NCGA 3H4BA 1DHMA 4B9VA 2DNRA 1FRKA 4MKAA 1LWCB 2MPUA 5C2CA 2VPZB 4WJBA 4PG8A 3RJMB 3KG4A 5D0HA 2PA3A 1IQTA 3UW1A 5HJYA 4IH6A 2ZOFA 4NOHA 1FNOA 5K8NA 1DTTA 3V6DB 1N32J 1T9YA 1JLCB 1H74A 3EVWA 1T95A 2EBEA 2M88A 1S7HA 4WXOA 1TMJA 4ZPDA 4YQWA 2CDRB 2P9GA 2Z56B 2XQCA 3TANA 3RUBL 1QSLA 2XLIA 4NLVA 2KFNA 1LV5A 3W9HA 4GKKJ 1O6XA 4MMOA 4N77A 4DOZA 4RPFA 2VPXB 1XERA 1JLQA 4P2MA 1X4FA 4MKVA 4L73A 3MAQA 1V5VA 1U1LA 1F0XA 1NJWA 1U4BA 2XMKA 4A8OA 1XBWA 3MEEA 1WACA 3CJ3A 3CVKA 4E98A 5ETTA 1FE0A 3F41A 3NCQA 4K50A 4DHVA 3LP1A 2RNEA 3AH6A 4M95A 4Y2MA 3BO3A 1V6HA 2CPFA 2VF3A 4KKOB 5B09A 1HNVB 1SV5B 1C1CA 4IQMA 4URSA 2Q6BA 5DO2A 3HSDA 2BJ7A 3LF0A 4BBYA 4P73A 3HT3A 1HYSA 1RT3A 2K7JA 4MJKA 4KHRA 4RX6A 1WORA 1KVKA 5I3QA 4JI0F 2HLUA 5IFMA 5HLFB 2P6TA 2YH0A 2CG4A 2MYFA 4FXVA 2R2RA 4DCJB 5DETA 2GQCA 4IRDA 3TEHB 2XTJP 2QL5B 3O8WA 6FD1A 3EICA 2HQ3A 4J90A 3KLGA 4I6AA 2LU2A 1KHVA 1DURA 1RHQB 3GJTB 4CNYA 1S1TB 3I0RB 3CIMA 3LALA 2VG6A 1FRIA 2LFVA 5DJBA 3U02A 4TU8A 2MSTA 2V4RA 1KR4A 3PM9A 4JV5J 2AMCB 2MKCA 3LP2B 4JI8F 2JSXA 1NHKL 4OZNA 2LMIA 3A1YG 3SMZA 1VRTA 2QTWA 3CJ8A 5DS7A 5CQGA 1UJ6A 5KFTA 2L41A 1RAEB 3NS6A 3HP6A 2WVBA 4MYTA 2PEBA 1HI0P 3GV8B 2HHHJ 4J9UE 5E41A 1JJHA 3ISNC 3LOUA 1XMQJ 1P1LA 3H25A 5KFKA 3AQOA 3IWNC 4Y2CA 5KG0A 4K4XA 1WKLA 4B3SJ 1KP6A 2B4UA 4M5DB 4NXMF 1H6KX 3DRRA 2HQGA 4IG3A 3R6GB 2NS1B 2WSFC 4OZ3A 1AW0A 3EXYA 5T7LB 4RW7A 2K1RA 5DGBA 2Q79A 1NAQA 2HS4A 1JKHB 2GAGC 2E66A 3HZEA 3CW2C 3M8PB 2BJ1A 4YY3F 1KOOA 4K59A 2HQIA 5D15A 3MR3A 4ECQA 5B0AA 2Q6CA 2W2MP 1RAJA 2WTFA 3M9MB 5DRKA 4F36A 4NLYA 1CULA 2AJ4A 4L72B 1SH0A 1T9XA 2F65A 3C6TA 3EYZA 3BQ0A 3G82B 1EIYB 5D4PA 3FMWA 1RA7A 1NUEA 3QO9B 4ZLJA 3P6YC 1WC5A 1FXLA 1RJJA 1CC7A 3V81B 3AXKA 2JEJA 2DKOB 3K5PA 1Z1ZA 2CJQA 4LVNP 5HN0A 4J9LA 5LSRA 1RK8A 4XPEA 2MZTA 1NXIA 4OX9J 5L1LA 1YGYA 1Q7LB 4JI1F 4YN3B 4F26A 3EZ5A 2YQ1A 3KJNB 2LQ9A 5HMYA 4RNNA 1SC6A 1H72C 2O1PA 3IMQJ 2IBOA 3PY8A 3J80U 1XN9A 3C14A 1IR1A 4WCEQ 1M1KT 2HHPA 4LF6F 1S10A 2XEXA 4I69A 5DQGA 4AE5A 3DHWC 4UUXA 3IRXA 2G0JA 4JI7J 3PJWA 3OXFA 2ZBQA 1N52B 5EX0A 2EI5A 2PIIA 2ZFHA 2CKWA 2R7RA 2XS5A 3BDEA 4F0HA 1KLNA 3NG8A 4A46A 2D3UA 2J9EA 5J2MA 4ZVUB 3DLKB 5L46A 5DG8A 2D41A 2XLKA 5E2QA 3W60A 3NGKA 1RWOB 1S7IA 4OYXA 2XMMA 3IC1A 3W2VB 3F0NA 3TA1A 5JUMA 3I4PA 4X4RA 4LF4J 1PGZA 1JNZB 2VBYA 2YX7A 3AOAA 3MDFA 1EP4B 2BE7D 5JVHQ 2HRTA 2J7KA 5ETNA 4X62F 1SH3A 3CCQS 2ZH6A 1XC9A 2BR0A 2F4VF 2P2CB 5K8PA 1S6QA 1TFYA 3QWPA 2YNFB 4EZ6A 1S1XB 3H2VE 2B56A 3ZZZA 2B6AB 2QJ3A 2FVCA 2HK3A 2FHMA 3BGUA 5T14A 2J0SD 3GSDA 2GX8A 4F3OA 1D9DA 1WSRA 4TKTA 5DQHA 5HANA 4JV2A 4G3IA 4KJIA 2OAUA 4IH7A 3MM8A 1WC6A 4KH0B 4QBUA 3KDNA 5F8MA 5H9FJ 1O8BA 1XR5A 1Y5NB 2MKHA 3DRRB 3ENWA 2ZBIA 3BYRA 2AYEA 1OS5A 3FK4A 4X65J 3M6WA 3HFVA 2XMAA 1E6YA 3ETOA 3BS9A 1LWEB 3KWMA 2VFUA 4A8FA 1DLOA 1WOOA 2A3JA 3UDCA 3FQKA 1TKDA 1SBRA 1M0SA 3H2UB 5KT7A 5LMNJ 3A8IA 4ETZA 1ACMB 3NWRA 2HS0A 1S9GA 3H5YA 4DV2J 1R0BG 1U8WA 1VRTB 2XLJA 2G0IA 3TX0A 1GNKA 4R8UA 4DL2A 2AD9A 3LP2A 4U67Q 3BO4A 4H54A 4FF1A 3J7AN 2VG6B 1R8HA 4H4OB 1IN0A 1PG5B 4EK2A 1S99A 2VV5A 1EQ0A 2O66A 3D1OA 2IY5B 2MQ8A 1C4CA 4RW4A 5ETKA 2LECA 3KNAA 1RXOB 4I2QB 3BGOP 1VS3A 4YFUA 3VAMA 2H9ZA 4F8RA 1NM2A 2JDJA 3QGHA 1ZZFA 1T9VA 3IG1B 1UETA 1GH8A 2AYMA 4ZVHA 3R7SB 4DL4A 2RUGA 1TVRB 2ZJRQ 1TK8A 2NXCA 2XS2A 3D54A 3W64A 4DR3J 4NA1A 2CQ1A 1F5CA 2HZAA 1LFPA 2QX0A 4K7QA 2VHGA 2POKA 4G1IA 2HG4A 2A2DA 5IS2A 2M8DB 5KG2A 5DG9A 4M5HA 2J6SA 5LXRA 3SYZA 4B9MA 2UP1A 4F4KA 4UZCA 5DDOC 4EBEA 1YITS 4K4ZA 2G4BA 4TQRA 3VV2B 1MWYA 4OLOA 3OV7A 3LGNA 4GRSA 1FJ7A 3LPEA 7FDRA 1FA0A 1R43A 2XYHB 2ZC3A 3M2UB 1ZAXA 4JV0A 1G6BA 5CA5A 1UA1A 2E1RA 1ZH5A 3J7YU 2XB2D 2O01C 4AYBD 1SJQA 2KG0A 3OTCA 2NZCA 1YLXA 2DBBA 3J81Y 2EWHA 2BYCA 2LLZA 4YR3A 4IFYB 3I5AA 3OL7A 1T3NA 1PKUA 4USUA 3MURP 5M2UA 3U27A 2HEKA 3ITHB 1ZS6A 1HBNB 5B0FA 2Z57B 2OFHX 4PABA 2GV1A 5THWA 3IBWA 2DYAA 2CRLA 1FERA 2XSJA 4MIBA 3GFYA 1KD1T 3AY0A 4DV1J 3OFEA 3BR8A 1FWPA 3ZC4A 2K06A 2YNGB 4WYLA 4ZP6A 2FZCB 2MLXA 3QYYA 5J2NB 3AHPA 1KQSR 4NXNJ 4FN5A 1SVDA 2IC3B 5EX3A 1JX4A 1B7FA 4OHVA 1HNIB 2YNIB 2WVEA 5J1EB 1EX8A 2FHJA 4DMZA 3LWMA 3BSOA 1YK9A 4ANCA 2V9WA 2FGOA 1OMSA 2XHWA 2VASA 5G0RB 3T1HF 4AD6A 2W2OP 4FKXA 2F1FA 4ZS6A 1U1RA 1RYRA 1DJ0A 1MMLA 4MIAA 5KG1A 1ROFA 3QNWB 4WFYA 5GMEA 5HMXA 4DR5J 1HFEL 2ASDA 4PR6A 1Y4ZB 3TZXA 3C8YA 2HFZA 1A0OB 2CDQA 5F0UA 4ZCLA 3NCRA 2JVOA 5HSPA 1NLKL 2UVUA 3GQCA 2CQ0A 3R3TA 2HIQA 4YP3A 2C1EB 3JSMB 2XWYA 1VQPS 1BXNA 3UNGC 4RUBA 4GVBB 1Q78A 2HLTA 3DLBA 1FO1A 1VDHA 2VBZA 1I94J 1FWLA 4ZCIA 2DPJA 1RP5A 2E5GA 3CJSA 1TKZB 4OV6A 4OX7A 4F67A 2XCAA 1UWBB 2E9ZA 3MEGA 5C25B 1PSDA 3RB0A 4HH1A 2Z2YB 1FRMA 2RIJA 2Z8QA 4EU0A 1FRLA 4WPAA 2UV8A 3VAGA 2CPZA 4ECZA 3FNNA 2BQ3A 3C6UB 3SXLA 1JQGA 3TWZA 2FJXA 2FLNA 2MMYA 1VRUB 5DZ7A 4I7FA 1HW9A 4IR1A 2DNOA 3NGRA 1T8EA 2IMWP 4L6V3 1LW0A 3CTRA 3GONA 3EGVA 1SKRA 5J1EA 3MAHA 1OPIA 3BSNA 3F73A 1OWXA 4NLXA 1VK3A 4NYZA 5KFUA 4AFFA 4FYDA 2C22A 2AJ0A 3ET6A 2W9BB 1JMTA 2XM3A 4F2SA 2AW0A 2MGZA 1VRQC 2ZBCA 2ZM6J 1S5ZA 3Q8RB 3RAQA 4ZP7A 2C2EA 3M8QB 1OO0B 2HNDA 4O0NA 4CRJA 3H20A 4ES3A 3RB4A 4PQUB 2FJDB 3P96A 3G8TA 4QIVA 2FDNA 2H65B 3MR7A 1MWQA 2YVSA 4U7CA 1YHQS 1HBNA 2KT3A 5B0CA 4JI1J 4B3OA 4FZVA 4CLWA 5CYQA 2HHSA 1RSCA 1VQLS 3W65A 3T3FA 1NK5A 2UU9F 4DL3A 4DSFA 5LJ5Y 4DR1J 2CZ9A 2ZHOA 2XZWA 3MMBB 2OPRB 2DXEA 1LFWA 2CFXA 5L39A 4ICLA 3RAXA 1SKWA 2DR5A 2W24A 3MCNA 2JFKA 2RKIB 2YNHA 2ZITA 3CDBA 2VKRA 2YPYA 2IFXA 1MN7A 3EDQB 3R5DA 1RABB 2XMWA 2FQQB 4HEA9 4P52A 1IJEB 1U1MA 8RUCA 2HMIA 4WBFA 3KK3B 3Q2SC 1JJ4A 3RB6A 4JYAJ 2AYGA 1EKSA 2HPUA 3KLEB 2KM8C 1GMUA 3IP0A 1EARA 5D0EA 3UCZP 2BKPA 4CLPA 1WG4A 3BREA 4ECUA 3PW2A 4Q0BB 3HVTA 4BHQA 2LQ8A 4DX8H 5BR8F 1Q5VA 4EEYA 2RRBA 2ZD1B 4BWMA 3KJVA 3PG9A 1TQLA 3IWLA 3IR5B 3KLFA 2HYIB 4JYAF 5DDQC 3PIPQ 2DNHA 2H48B 2ZH1A 2HIYA 1T02A 1IBKJ 4ZLNA 1QJHA 3ZTQA 1N5YA 4RW8A 4DFPA 4ZVRB 4FF4A 2JLEA 3S1TA 2ZC4A 5EN1A 2M3DA 5HL7Q 4NLDA 2ZBPA 4NMXA 5I4MA 1F2HA 5KFQA 1RT7B 3P5BP 1X4BA 2QE5A 1W26A 4IKAA 4OYZA 3KOAA 3OL6A 1F9HA 4YOEA 2VONA 4L3KA 1Q79A 2PT0A 3IFEA 3CJ4A 2DHAA 5DG7A 4DN9A 3MFHA 2XZTB 2MQPA 3TI0A 2FLPA 3CJ0A 3AOBA 1RADB 2XY6A 2DRDA 1VYAA 2HS3A 4USJC 1TFWA 2OKQA 4ZJOA 5HMZA 1M5PC 3JSYA 4UOGA 4TY8A 4NI2B 3HD1A 4AL6A 1KDNA 2QC3A 3EVOA 4P72A 5J1PA 4ED5A 5L8RC 3PW0A 3CT9A 2ASJA 5E3AA 4OX8A 4DV4J 2LXUA 4J9NA 1R0CB 3IGNA 1LWXA 2PD1A 3H2LA 3MOJB 2BMBA 4L75A 5E3QA 1RAFB 5GMDA 1CJKB 1QAYA 1HWJA 3EGNA 3QPIA 1NEEA 5A0YA 4DPUA 1HQ2A 2VB6A 5D77A 2OTJS 3N6MA 1PJ5A 3IM8A 1LNQA 2GMHA 1UKUA 2I5JB 2KXHA 1Q1KA 1KFDA 2VPWB 2ZDOA 4P10A 4RLEA 2JEGA 4KBIA 1RU1A 4DG1B 4HACB 2B9YA 4OYAA 1N5SA 1BE4A 3R7BB 3UI3A 1S9FA 3M6UA 3GPAA 1RAHB 3PNIA 2A6MA 4IG0A 2D9OA 4GC7A 5EHHA 5DGAA 4DPYA 3CUNA 1RAOA 4O4GA 4JUZA 1YBAA 1F5BA 4I4BA 4HL9A 4QYZK 3BGRB 1VQNS 3OQ2A 2HHXA 4URQU 1RISA 5HMWA 3G8SA 3TZZA 5KFJA 4J9SA 4E0DA 3FZBA 2FVPA 3LW5C 3TOQA 4LRFA 2DNLA 2V4JA 4DLEA 3MM5A 3FCVA 5I3UA 3EE3A 3NOGA 2QGFB 3DDNA 4CWBA 3KHHA 3BKFA 3P49B 7FD1A 4S0MA 5D3GB 3DGPB 2RT3A 3PYEA 1CG2A 3GYGA 2BA9A 2WHOA 4I0WA 3VAJA 4DZDA 3D6MB 3HHNB 4DG1A 2KDOA 1WOPA 3DYAB 3R5JB 3T9ZA 4YB5A 3DOMA 1GEHA 4UUWA 1UWAA 5F3TA 1KVJA 2XMUA 1YI2S 1VBXA 1ZAVA 5SUHA 3TO8A 2HBZB 4P6QA 1IBCB
chains in the Genus database with same CATH topology
4HI1A 1F60B 1FKAF 2HHHF 2V2KA 3Q2TC 5E5NA 5H1SV 4RW8B 3FVYA 3D28A 3MEGB 2Q66A 4MK9A 1U24A 2KZMA 5D8HB 3I87A 2K3IA 3HHLA 4CO0A 4OX6A 4DFMA 2EKYA 4OHXA 2QO3A 1Q8IA 4K4UA 3O5TB 5C24A 3OTDA 2WONB 5B0EA 1YRTA 5B0GA 2GHWA 4OI4A 4TY8B 2FJAB 2J6TA 4NYPA 1HWLA 2HGLA 3G71S 1HQEA 2C3UA 4YR0A 2IRUA 3PX4A 3LP0A 5F8HA 4IOBA 3V2UC 4ELUA 3KK3A 1B0PA 4X4SA 1TAUA 3T5KA 1TV6A 4RWXA 2GHPA 1UW4A 2PGCA 3NBPA 2R8GA 4UY85 2DR8A 4DR3F 4ES2A 1RT5A 1H2UX 3N9UC 1Y5IB 3DU5A 2WAQD 4QCLA 2RF2A 3I31A 3RR7A 2XCPA 5K5MA 1VQOS 4Z37A 4U6PA 2KM8B 3GB0A 3MPYA 3THTA 3GZ7A 3THVA 4KTQA 4F4WA 3ENVA 3CCVS 4QIWD 3ENQA 1UJ4A 3T19A 4LFAF 1HQUB 4EBCA 2XWXA 3HVTB 2MY7A 2MJUA 1IM4A 1CSJA 4I1TA 4ZPCA 4F2RA 3K5LA 1TKXA 1HD0A 4KQZA 3I6PA 4K5RA 4Y6IA 1NJYA 2H5EA 2EFQA 3UD3P 4IFYA 1YWXA 5F3ZA 3H59A 1NK4A 2HNYA 3G6ES 1P27B 4TXSA 4CIOA 2DPIA 1BC6A 2UUCF 1HWIA 3KLIB 1UVJA 3V6KA 5DDPC 2YX4A 1XMQF 2NUHA 1RTIA 1HPZA 4LT6A 2YKMA 3M2VA 4N76A 1P1TA 2JEFA 2VBWA 5L9XA 3OFHA 4KHMA 1T03A 2YWFA 4RNMA 1O51A 3QAUA 5M2PA 4B3OB 1IKYA 1JLFB 1F5AA 1VQYA 1VGYA 4NA2A 2J9DE 1RT1A 4OI1A 1JLAB 2MKIA 1FXDA 3OHBA 1SJ3P 3CCUS 2RDIA 3M8QA 1H98A 1DTQB 1M90T 2V8GA 2JLFA 5AXMA 5F0WA 4AL5A 4LQ3A 3LAKA 4HT7A 1FCAA 3OL6A 3FEZA 3KLHB 1DARA 3G4SS 2YKOA 3K5OA 4EYHB 4DF8A 5KAKA 4DL0C 3RB3A 4ZCMA 2UXBF 4CI0B 3PFEA 2RU3A 2KFZA 3DHXA 4GO7X 2PO4A 3CDEA 4CTAB 1W2BR 4W90B 4LIWA 3UD4P 3M30B 4IDKB 3SFUA 5KFRA 2PC6A 5G0RA 4FBTA 3I5BA 2PE8A 2DVIA 3DLEB 4X4OA 4OHZA 1T7PA 2DRAA 1WI8A 4DV3F 2VH7A 1DLOB 1UWBA 5K14B 5J2NA 1E6YB 1U7LA 4DQQA 3FZ2A 4N56A 4OZLA 4LSLA 2W4CA 3PO5A 5D78A 1JWWA 4HTJA 2CQ4A 2PFFB 4WU3A 4X2BA 4HHJA 3HHLB 4TNOA 2M7SA 2C42A 1OQ6A 5FDLA 4QWAA 1XMOF 1X5OA 3I9ZA 1VBZA 1S1XA 1WHYA 2F8HA 2UUTA 1ZM3A 4ID8A 3UCGA 3HF5A 3FSIA 4GKKF 1U1QA 2KZZA 1CLFA 3GFZA 3VZHA 3MMBA 1YJTA 3KLIA 1U1OA 1WEZA 2HRYA 2KJVA 2R8HA 1T94A 3OW2R 2AJFE 4X4PA 5ADZA 2JOQA 1F2GA 2LXIA 2XMJA 3QGPA 3OVSA 1KRPA 3G9CA 2EBGA 2E5JA 2IM0A 3V6JA 4DQPA 3CULA 2R2SA 2IRYA 2NR0A 2RH3A 1NNDA 4M63A 2LDYA 3CB4A 4MH8A 5I3PA 1G1XA 4G1QB 3HPOA 1APSA 3TQ1A 2QA2A 3Q8SB 3TX8A 1FVQA 2HNZB 4X65F 3PRBA 1N0VC 3MD1A 5D4LA 2QA4S 3H5UA 2NQPA 3FCHA 4ZVFA 1BY9A 4DV1F 3M2RA 1SL1A 5DM7Q 2B5JA 3MM7A 3O6QA 4EUVA 3TYTA 1HHTP 1YG0A 5K8OA 1WF0A 4N47A 2ZE2B 2AX0A 4RW6B 3M2UA 2QFJA 4PXCA 1IUJA 3PHEA 2GW8A 1FKOA 4I2PA 5A6WA 1TV6B 2GGPB 2BM1A 2YX1A 4ECXA 1QUPA 3GMGA 4MK7A 4OJHA 4B17A 4J9PA 2BRLA 4J9OA 5KOWA 2OIHA 2V0NA 4J9KA 1S48A 1ZYQA 1NJXA 2EK6A 4DSEA 3IG1A 3ZZ0A 2IM1A 4RNHA 2K1RB 3CJKA 3DRYA 2V9KA 4N8OA 4A8KA 4HVZA 4PG7A 4YDXA 4NYOA 1QSYA 3FFIA 1VC6A 2QT7A 2MZJA 2DH9A 4F25A 2YNFA 2AYBA 3MMAA 2QRRA 2MQOA 2Z0GA 2W9AA 3OLAA 2DH7A 4Y2IA 4EO8A 2K2PA 3PEJA 2J76E 3NS5A 2CPHA 5A8KA 3M8SA 1WG1A 5CD4H 2BOPA 2CQHA 1FKOB 4I2PB 2RMLA 4DV4F 1NKCA 3GIKA 1U8SA 3DLLQ 4QYZJ 1VQSA 4RW6A 1S1WA 5KFOA 2COLA 3BGLA 2KO1A 3S8SA 3V4MA 5IM0A 1CPZA 2BXJA 3OLBA 2A1BA 3BSCA 3JTNA 4DR2F 1K0VA 1AFIA 4DL6A 4HT5A 3WBZA 2E1CA 1FVSA 4Q45A 4CH1A 1M5OC 3KK2B 4NLUA 3K59A 4LVOP 3HK2A 3HO1A 3QJPA 1FD8A 1SI9A 4I6WA 2KXNB 1K73T 3U1MA 2X51A 4O3PA 1UVMA 2HVZA 2RS2A 2LQJA 1YJUA 4O4GB 4PG4A 4QPTA 3RRHA 1NU4A 3T5JA 2DHGA 3K7RA 5E3CA 1LOUA 3KMSA 2HMIB 4ELVA 4IR9A 1K1QA 4V19J 1A6LA 1VQ5S 1X5SA 1H2TZ 2FJBB 4EBDA 5C42A 5A8RB 3DYAA 2Y1IA 3M4XA 4KPYA 4C98A 4PRFA 1RT6A 2P6SA 4YUDA 3MZIA 1HBMA 5GADU 2DCLA 1U6BA 4J9RA 4WF9Q 5HI7A 1P9QC 2ROEA 2RJZA 3MECA 3OPKA 1YJWS 1URRA 2W4PA 3M9OB 2D74B 1D3WA 2R8KA 3M8PA 3E01A 2E5IA 5D6GA 1GX6A 2CQDA 2HVIA 4Q43A 5LSOA 2CQGA 2X3GA 1PC4A 4NRTA 4ID5B 5GAHI 1MNEA 4OMFG 5KFFA 2GQ2A 2ADBA 1N5VA 1FK9B 2HZCA 3GILA 4HYKA 1SKSA 2UXCF 4PKDB 5IM0B 2FIUA 4GKJF 1S1WB 2QMXA 4ERDA 5HBMA 2GJ2A 3VZIA 4IO9Q 3GYXB 4QU6A 4NCAA 5EWFA 4A4JA 4M8LA 4WKRA 2FJEB 4URGA 3HJFA 2ZH9A 2KI2A 2DGXA 2KRBA 1X9WA 3US5A 2E7XA 2AGPA 5AXKA 2R7SA 2ILYA 2M5YA 2ZOGA 1KN6A 5IWAF 5ITHA 3KLHA 1JKHA 3U1NA 1JLGB 1N0UA 2UVWA 2F9DA 3KMQA 1WD6A 5T7LA 4RKUC 1TKTA 4NLTA 3BO2A 2A2CA 2ZD1A 2KH9A 3BSAA 2OPQB 2DGUA 5CCMA 2VPYB 2IRXA 5CYMB 1TK5A 1RT2A 2Z4PA 3K5NA 2RDJA 1GXTA 1FESA 1FDAA 1V3RA 4KFBB 5LMUF 1GTHA 4U9RA 4X4VA 2VG7A 1HNVA 2YNHB 5LJ3Y 5IT4A 1HD1A 1RT7A 2JC0A 2EVZA 2IHR1 3TUJC 5KFEA 3SCIE 3U7JA 4EO6A 3TAPA 2ZE2A 3B8HA 4C9DA 2R7XA 3O3LA 5CYJA 1NHVA 4RUCA 4WE1A 5E33A 2WBRA 2VZ9A 4LSNB 4LJMA 1Q16B 5GAGI 1Y9OA 3M2RB 4NLOA 3O44A 4GC7A 5AJ3F 2DIUA 2DK2A 2OFGX 3RW7A 3VALA 3KG1A 4TU7A 2R7WA 4OJ1A 2QSFA 1RTHB 2ZVSA 4G6VB 1SIZA 3DC2A 1DQ8A 1PILA 2XSJB 4ECYA 1UVNA 4C0BA 5KFBA 1RT1B 2ZJQQ 4AQYF 1IBKF 1VHFA 2AGQA 4ECRA 1Q8BA 4FS1A 1V3ZA 2ZH7A 4C0HA 2RF2B 1RTIB 1RYSA 4OI3A 5JXSA 3QJLA 3IAM9 5KT6A 3DM2B 2CPYA 5LSLA 1Z2LA 4B9TA 3G8QA 1MU2A 3NAIA 2M0GB 3NBPB 3GR0A 2AJ1A 4WFBQ 2RQ4A 4KFBA 4TU9A