1Q86T

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1q86T00
2X1BA 2L9WA 2RS2A 1VQ8S 4U67Q 3DXBA 2QEXS 4M5DB 4LMZA 2LYVA 3G8SA 1HL6A 4QPTA 1X4HA 1VQ7S 3Q2TC 1YJ9S 3VAFA 4ERDA 4P6QA 3OW2R 1YIJS 3UD3P 1X4AA 2DITA 3BO4A 3UE2A 3CMES 1DBDA 5DETA 2MZSA 1F9FA 3CCJS 2MZTA 3H2UB 5JVGQ 4C4WA 2KN4A 3P3DA 3TYTA 1K73T 5D78A 4Y0FA 1WF0A 1FHTA 3CCMS 3BEGB 1YWXA 2N7CA 4TU9A 2ZJQQ 3H2VE 2YH1A 5DM7Q 2OSRA 2QA4S 2MKHA 3UCZP 2DGTA 5GAEU 2HYIB 2MKIA 5DDQC 1QM9A 1WF2A 1Q82T 1YTYA 2F9JA 2E44A 2X1FA 1UFWA 2CPEA 2LKZA 2MB0B 4W92B 2G0CA 1JJHA 2M2BA 4WF9Q 4J5OA 1ZZFA 2DK2A 2JVOA 1NJIT 2DH9A 4IO9Q 2DGSA 2KU7A 4CH0S 2LEAA 2ADCA 2MQMA 3V4MA 2MQPA 1YJWS 3UCGA 3G96A 2RNEA 3CMAS 2XSFA 2F9DA 1FT8A 2E5IA 2DNZA 2FY1A 1H2UX 2FHOB 1H2VZ 3EGNA 2MXYA 2KVIA 4WKRA 5GADU 1W2BR 1UAWA 3CPWR 3LPYA 2I38A 1X5SA 2MYFA 1P27B 5CYJA 3NS5A 3G8TA 2LECA 1X4EA 2QFJA 3UWTA 1VBYA 3MUVP 3MUMP 2OTJS 2M52A 1CVJA 2MZQA 1A7GE 2NLWA 2LXIA 1X4GA 1HD0A 3VAGA 3VAJA 1VQKS 1WHWA 5EN1A 1L3KA 5GAGU 2MQLA 2U2FA 1VQLS 2CQDA 2G4BA 3J7ZT 2PEHA 3I55S 1D8ZA 1KD1T 2XS5A 1ZH5A 1VC5A 2DO0A 1VQ4S 2RUGA 2N3LA 1U6FA 5IFMA 2CQBA 1P1TA 2HGLA 2DNMA 2J0SD 3EGZA 5DDRC 2CQ3A 2CQIA 3S7RA 2E5GA 5GMKa 1WEXA 3CCLS 1VBZA 2E5JA 4YB1P 3PIPQ 2RS8A 1WEZA 1U6BA 2L41A 2KM8B 5CA5A 2XS7A 2GO9A 2BOPA 2MZRA 1U2FA 2HGMA 1K8AT 1U1QA 2O3DA 1N88A 3CULA 3CTRA 3G4SS 2M7SA 1Q86T 2DNHA 2MKSA 2KG0A 2M9KA 2HVZA 1BY9A 3S01A 2ZJPQ 3CCVS 3CXCR 2KRRA 3CC2S 3CCRS 1SXLA 5CXTA 4WCEQ 1X5PA 1N8RT 1PO6A 2FPHX 2CQ0A 2NZ4A 2KRBA 3VAKA 3CCES 1FO1A 2LA6A 3G6ES 2RVJA 4OZ0A 1M5OC 2OTLS 4QU7A 2KM8C 2M4MA 3SMZA 2D9PA 4ZKAA 3P49B 1FJCA 1X0FA 5IQQA 2EK1A 2MKJA 1R8HA 5DM6Q 2DGOA 3CF5Q 2VOPA 1WG1A 2DNQA 3B4DA 5HO4A 2AD9A 1N54B 4QQBA 2MPUA 2B0GA 2CPXA 3R27A 4PR6A 4CIOA 3HI9A 1M5PC 4TU7A 3RW6A 3D2WA 1WEYA 2K3KA 2MY8A 3EX7B 2JX2A 2LCWA 4Y00A 2I2YA 3PIOQ 1X4CA 2CPDA 2MQNA 3ZZZA 1U1KA 2DO4A 1DZ5A 2VOOA 2DHXA 2LA4A 2Q79A 2M0GB 1RKJA 1X4DA 2DNYA 1VQMS 2DB1A 2MZ1A 4BS2A 2U1AA 2FC8A 4RU2A 2G1DA 3VALA 1U1RA 5LJ3Y 3MD1A 3R1LA 2EVZA 2KT5A 3CUNA 4QU6A 3ZZYA 1ZZNA 1FNXH 2CQPA 3FEYB 3U1LA 3MUTP 3NS6A 3VAHA 4IOAQ 5JVHQ 2DH7A 2MGZA 2LXUA 2MQOA 2RQ4A 1WHVA 3FEXB 2XNQA 2YH0A 1M5KC 5DDOC 4PRFA 2MKCA 5LXYA 1DRZA 1IQTA 2CPIA 1JJ2R 1SJRA 2E5HA 1KQSR 2CQ2A 1UP1A 2DNLA 4TU8A 2EK6A 3S8SA 1WWHA 2JRSA 1X5TA 1OO0B 2VODA 5IM0A 2KXNB 4IUFA 3THTA 2DGXA 4F25A 1VC0A 4TLQA 5MLCV 1QVFR 2JWNA 1YJNS 1VQ5S 2HGNA 3MD3A 1VQNS 2N82B 3HHNB 2K8GA 2M70A 2KG1A 1RK8A 2RRAA 4FXVA 2CPJA 4WIIA 1YHQS 2ADBA 1WI6A 1VQ6S 4EGLA 2J8AA 1WELA 2CQGA 1UW4A 2M88A 2J0QD 4WFNQ 3MOJB 2DGWA 4F02A 3J7YU 1D9AA 2WBRA 2KHCA 2YKAA 3MURP 1M5VC 2VONA 2DGQA 2MJUA 2CJKA 2JVRA 4OZ1A 2A3JA 2GHPA 4YUDA 3L3CA 2AYMA 3CCQS 2DH8A 1X4FA 2SXLA 5GAHU 2CPHA 3NNAA 3VF0B 1PGZA 1U1OA 3SXLA 2DNKA 2KFYA 2CPYA 2MGZB 1WHYA 4V19X 2MJNA 1O0PA 1SJQA 1X4BA 1SJ3P 2LMIA 3NNCA 2DNNA 2V94A 3ULHA 1S72S 1A9NB 2DNRA 1U1NA 4F26A 3SDEA 1KC8T 1NU4A 1U1PA 3CD6S 1KOOA 2DISA 2MQQA 2DNOA 5D77A 1QVGR 3S6EA 1WHXA 3UD4P 5HL7Q 2LEBA 1M1KT 2DGVA 5IM0B 1YITS 1N52B 3N9UC 3G9CA 1B7FA 2DIUA 3UCUP 2KXHA 4YOEA 4FXWA 2D9OA 1U1LA 1JJ4A 3BO3A 3CCSS 2RRBA 2AYEA 1OPIA 1YI2S 1WG5A 2F3JA 2LQ5A 4WFBQ 2DGUA 2UP1A 1URNA 3Q2SC 1G2EA 2MY7A 5DDPC 2ERRA 3DLLQ 2CQ4A 3B4MA 2KXFA 4Z2XA 2CPFA 5GVQA 1U1MA 5BJRA 2OJ3A 3NNHA 2L08A 1FXLA 2AYBA 3US5A 3BO2A 1VBXA 2KI2A 4PKDB 2OSQA 3K0JA 2DNGA 1K9MT 4ED5A 3IWNC 3U1MA 1OIAA 2KYXA 3NMRA 1OWXA 1DHMA 1WI8A 1X5OA 2HZCA 4C7QA 3IRWP 2YWKA 2CQCA 3THPA 3P5TL 2ZJRQ 4UY8T 1VQ9S 5LJ5Y 1FJEB 3TO8A 3I56S 2J76E 2MZJA 1M90T 2MSTA 2MHNA 2AYGA 1H6KX 2DHGA 3MDFA 2OIHA 3CC4S 2PE8A 1NO8A 2CQ1A 2MKKA 5H1SV 4C0OC 2XS2A 3VAIA 2YTCA 4A8XA 1WTBA 1Q7YT 2RU3A 4CQ1A 3P6YC 2N3OA 2BZ2A 2KH9A 3LQVA 1SJFA 1JMTA 1Q81T 3SDEB 1HA1A 1WG4A 5LSLA 5LXRA 2MSSA 4LJMA 1VQPS 3RW7A 5FJ4A 1H2TZ 2DHAA 4LIRA 5ITHA 1VQOS 1VC6A 3R1HA 2XNRA 1HD1A 2DIVA 1KOHA 3G71S 2DHSA 2RT3A 1R8PA 1AUDA 4W90B 1WF1A 1SJ4P 1XN9A 2M8DB 1S79A 3JB9k 1FJ7A 2MMYA 3CC7S 2RQCA 4WFAQ 2XB2D 3MXHP 3TP2A 2DNPA 3VAMA 2X1GA 3CCUS 4UQTA 2M8HA 4IOCQ 2X1AA 2FC9A 4CH1A 2CPZA 5LSOA 2D3OR 2CQHA 3BS9A 3MI7X
chains in the Genus database with same CATH superfamily
4YR0A 2W01A 5B0AA 1N5TA 4LMZA 1RT6B 1HL6A 1T02A 3B82A 3OW2R 1LOUA 3CMES 2YVSA 1K1SA 1F9FA 2VG5A 4ICLB 3M05A 5D78A 3L4BC 3RRKA 5DM7Q 3E01B 5GAEU 3D0HE 2FTRA 5DDQC 5DG8A 1HNVB 1RDRA 3L09A 3QO9B 3QT6A 2BDPA 2UVRA 4DL6A 1JLCB 2XYPB 4ZPAA 1BE4A 3UDCA 1ZM2A 5KFJA 1WDDA 3CJ3A 1PC5A 2ALYB 2FY1A 1H2VZ 4PAAA 1T9TA 1XNRF 3NKYA 4PXEA 4C3LA 2V67A 2AW0A 1WOOA 4H4MA 3M9NB 3IRXB 3DM2B 2NLWA 4G65A 2KZZA 2IAJA 2B9WA 4B9LA 2IYIA 2W9CA 3LWMA 3SV3A 4LRDA 3I9V9 1U6ZA 3ZO7A 3LANA 1HBNB 4FS2A 3NY0A 3IP0A 5KFBA 1B70B 1H0HB 1X7VA 2VKRA 2BX6A 4ECYA 3N6MA 2W2QP 2UVVA 1BGXT 1RT2A 2XO6A 1WDTA 1IM4A 1R0AB 5AE3A 2K7JA 4NLSA 3H8YA 4KE5A 4DPYA 4CWBA 2OD6A 4B9TA 1LWCB 1OYDA 4KO0B 4I2PA 4QR2A 1H38A 3HHLB 1RTHA 5D8HB 2XZWA 3BBCA 2Y9HA 1Z1ZA 2ZE2A 4A4JA 2DVIA 2P2CB 2Y1IA 1YRTA 5IQQA 5CQGA 5DM6Q 3NEKA 1IBCB 1UFLA 3R27A 2D69A 3L95X 4MMOA 2XM3A 4RBVA 1S1XA 4F4WA 1E6VA 4ZJQA 1HYSB 4JI3J 2MZ1A 3IR6B 1QD1A 4B3SF 1F5BA 1JLFA 5LJ3Y 3CJSA 3QFHA 4IRKA 1YBAA 3BQ0A 3HULA 1Q16B 1QUVA 3I0SA 2YNGB 3KLFA 3D28A 2DH7A 2ZKTA 1B4SA 1A0OB 4ZLPA 3DRRB 4D3GA 3QNWB 4DV1F 3NGRA 4MIBA 3M2VB 1Z2LA 3GJQB 1X5TA 2H9ZA 4O4GA 3GIMA 3TZXA 1F0XA 2BE7D 1TVRB 1T9XA 2J8AA 4KQZA 3EJMA 2J0QD 3TQEA 4B9UA 1S6OA 3HXMA 1S4EA 2G2ZA 2FVCA 2FIUA 2X3GA 5LT5A 2LLZA 2R9LA 4ECZA 1NK5A 1OMSA 1S6QA 3QQCD 4M5KA 2HAIA 1ZA1B 2AJQA 4N8OA 4MYUA 5J2PA 2APOA 2FHMA 1D8YA 5L46A 1KKHA 3NLCA 1AB8A 4JUZA 1SJ3P 1MWQA 4OHYA 3D9BA 3R7BB 2WBMA 3CD6S 2HURA 1TV6A 5J1PA 1NDCA 1LXJA 3TZZA 1FRLA 4U7UK 5KFVA 2OPQA 3ETMA 4C0BA 5L1IA 2RRBA 3TWZA 1RYRA 1OPIA 4NLYA 4NZ7A 1SKWA 3IWXA 3KLEB 4L6V3 2FDNA 3MEEB 1FXDA 4E0DA 2KI2A 2ZH1A 3FDSA 2JC0A 4CH7A 4ZP6A 3D67A 5D4OA 1OWXA 3HHDA 3OT9A 3FCHA 4RWXA 2X7IA 3PCOB 1VOMA 2BE2A 3AA9A 4RUBA 5GMEA 3PX0A 1JMTA 3D6HB 1U02A 3FCWA 3FQLA 4DV5F 1C0TB 4PCQA 3MAQA 2M8DB 1N5QA 1S79A 3FSYA 4IG0A 3QJLA 4J91A 1SKRA 2MLZA 2DNPA 2ROEA 1RT1A 3DI6A 1TFWA 3OSPA 2UUAJ 2FC9A 4K5SA 4QYRA 1NB7A 4A46A 4NYOA 1TK8A 5J1NA 1VQ8S 3DXBA 4AXIA 3PNIA 2LYVA 2DY1A 3U7JA 1UA1A 2I6WA 4LF1A 3N01A 2B9EA 3CNQP 1FKOB 4NA1A 3ITHB 2W9AA 3KOAA 1GMWD 4DX5A 3TYTA 1HMVA 3R5DA 4EZ9A 1Q8IA 3JAMY 3DKDA 3LAKA 2XSJA 4QIWD 3UCZP 4C11B 4BC9A 3GIIA 1Q82T 5B0GA 4FXDA 1RUSA 4J5OA 4OYPA 2HIYA 5HATA 1VRQC 2G2OA 2MQPA 1YJWS 3T1YF 2FJVA 2C2NA 3PJXA 3EGNA 3HHLC 4CLTA 1ZTWA 5GADU 2AJFE 4ECUA 2BYCA 2YWWA 2YQ3A 2F8HA 2OTJS 1K0VA 1DQ8A 3AJ2A 2EWHA 5K8NA 1RHQB 3NG8A 4USVA 3H0PA 4G1PA 2CQDA 1AZSA 1P1LA 4GO7X 1CQNA 1JIHA 4C6AA 4RJVA 3UN3A 3GTYX 5GAGI 2UU9J 3TQ1A 2HS0A 3DLEB 4I6AA 4O0IA 4USTA 4ED8A 1FRHA 2AMCB 1SH0A 2QL9B 4LQ3A 2AGOA 2N7YA 3DU5A 3AD8C 1XNQJ 1L3SA 4UTGA 3POTA 4ZOSA 3FCVA 4DPUA 5K8PA 4P75A 2J9EA 4PZVA 1QDUB 4DXLA 1BWEA 2B6AA 3UFCX 2KTQA 4KY3A 1CJTA 2VOPA 2KO1A 3QT5A 2B9YA 4X4PA 1YGYA 2J0WA 4ZCIA 4YQWA 2Q43A 2BV3A 2K1RA 2M0GB 5DG9A 2QC3A 2W2MP 3EYZA 1UWBB 2ZZTA 3X1LB 4F7VA 3R1LA 2JH3A 3KHLA 4LF9F 4LF8J 2OGUA 1W25A 2RU9A 3ELHA 1Q8BA 1U8WA 3MTJA 1CULB 4NASA 1LV5A 2ZOFA 3PW4A 1GXTA 5KG6A 2GMJA 4OYOA 4U96A 3OTOF 4M5HA 3QIPB 1S4FA 1Q95G 2GA7A 4DSJA 2DGXA 1VR6A 2QLFB 2BVZA 4Q0BB 3GFXA 5MLCV 2HGNA 4LREA 3HLUA 1QAYA 1O6XA 3HZGA 4EGLA 4G6VB 3TZWA 1V9OA 2HNYA 2XULA 4DR3J 4L76A 1HQUB 1Y00A 4M5GA 3GV8B 2Z2LA 3LGNA 5D0GA 3DFEA 4FYXB 2DNKA 2ATLA 4V19X 1YVFA 2YKMB 2DXFA 3LGMA 1I6JA 2CJ9A 1UEVA 4A8WA 2VD3A 2E1MC 1M1KT 1RHRB 1T95A 1JLEA 4F0MA 2RUSA 1EX8A 2AYEA 5DQHA 1DTQB 1I51B 2A1BA 3TA0A 2WVCA 5DDPC 1PAEX 2IYGA 4ZVTB 2HHVA 1JLQA 3MEGB 4HDHA 1DURA 4DL2A 3GIRA 4PWWA 5KFEA 4DUZF 3CT9A 1IJFB 4X65F 4YY3F 4BWMA 1M1HA 4PG7A 2AZ1A 1OSCA 1WSVA 4JI7J 1AA1B 1LFPA 3DDKA 1OPZA 1LWEA 3SDEB 3UN5A 4Z37A 1R7IA 4MK8A 2QYCA 3BGRA 1H2TZ 2HW3A 1TAUA 4FVMA 1H7XA 4MAKA 4RLEA 1RE1B 3D1HA 1T05B 2ZWOA 1FXRA 3ENAA 1BMQB 2VQEF 4IDKA 2XMVA 2X1GA 2AQ4A 2VBWA 2CPZA 4A48A 3WBZA 3G8SA 2B4OA 4RW6B 1C1BB 3HZEA 4ERDA 4P6QA 4JI0J 2V50A 3UE2A 2HS4A 2A0FB 2VDHA 4ECQA 1FDAA 3CCJS 4RPFA 2ZM6F 4JBCA 4CT9A 2RF2B 3P3DA 5AT1B 4YHHF 1R31A 2J6SA 2N7CA 4TU9A 2BMBA 4ZA1A 2IPOB 3W65A 2W7PA 1QSYA 1RT3A 3TARA 1KSPA 5B08A 2I8EA 3C14B 2QJ3A 4M5LA 1QTMA 2E1AA 3HT0A 3FMWA 5KTQA 2R8IA 3KFWX 1NKCA 5J2NA 1G7CB 3T19A 2FHOB 2RKIB 2W2OP 2FVPA 1XR5A 2B7CB 4YP3A 3PHEA 8ATCB 1N5VA 2FHJD 3TAMA 4HDGA 4EUVA 1X4GA 3MGJA 2K7KA 3D3CJ 3LA0A 1RSCA 1ZH5A 4AQYF 2V9WA 4U7UD 2WSEC 1T9UA 4MK9A 2E5JA 5A8KB 3A4TA 1E6YB 2IDLA 2OEMA 4NLWA 5A6WA 2HGMA 4K0KF 2JEGA 4LBPA 1T7PA 3CTRA 1U2RA 2BW2A 4FDFA 3CXCR 3LP0A 4HH0A 4WCEQ 4KRWA 5M2PA 3CCES 4PUOB 4KPCA 1DTTB 4ED6A 4B3TF 2RJZA 3IC1A 4B3RF 5CZVA 2KM8C 5IXUA 4OMFG 5A76A 4Q8FA 2VBXA 2C3MA 2V4JA 3M30B 4YB7A 5KFLA 4OI3A 1R8HA 4J9UE 4KR0B 3B4DA 5KFYA 2ZH3A 1B0PA 3MM9B 4CT8A 2WRMA 3HSJA 1GAOA 5F9LA 3KLIB 2OHDA 4G1QB 1RLCL 2V0NA 4RNHA 4USIA 1T3NA 2NXCA 3PIOQ 2GAGC 1JNZB 3W9HA 3I32A 4RU2A 2FZGB 2BJ9A 2IA0A 2F40A 4RW7A 2B43A 3KMQA 1RHJB 2F4FA 3VAHA 1ZAXA 2YH0A 2QMXA 4HHJA 1PYSB 4LF4J 5F8JA 1CJKA 2GHVC 4RL1A 1NRKA 4DEZA 2QA4G 4MTPA 3GYXB 1ZAWA 4WYLA 2RRAA 2M70A 2ASLA 2CFXA 5ETOA 1ZM9A 3DCAA 4J9KA 4XPCA 2ZUGA 3HVRA 2UUBJ 2RIJA 2CVIA 3E3XA 3Q89A 2A2CA 3C6UA 2YKAA 1M5VC 4ECWA 5HQMA 1TKTA 2VG6A 2VG7B 5HQLA 2DGQA 2YNHB 2ZWPA 5D3GA 3TUPA 2C3YA 2AYMA 4LFAJ 3DOMB 3CD5A 1NEEA 4FBTA 3M1VA 3QJPA 4OI1A 1QE1B 5KOXA 4URQU 2DNRA 2YNFA 3W2VB 5F41A 2BUNA 1MW7A 2ZUAA 1FX2A 4B3OA 3PRDA 1WHXA 2XLJA 4ED0A 2DIUA 3DLGB 4F3OA 4YOEA 1WORA 3C66A 1BC6A 5A8RA 3ZTRA 1RYSA 4PXDA 3ZZ0A 1R0CB 1FK9B 3DGPB 2CPFA 3EVOA 2HHSA 5CH7B 1JB0C 5IV4A 3CSKA 1Y3JA 3BM7A 3K0JA 3KLHB 3NMRA 2HZCA 4C7QA 3FZ2A 1GMUA 1ZPVA 1OY9A 5IS2A 1FJEB 1GNKA 2NXEA 4DHVA 4P73A 4IQXA 4QWEA 2XMUA 2HSEB 4B3MJ 3O3LA 2ZZNA 4EMDA 5CCMA 3P6YC 4EBDA 2OP5A 1F60B 3JSRA 1IUJA 5CAAA 1SH3A 2M3DA 4K4XA 1IKWB 4ECVA 4OJ1A 3JYTB 1WF1A 2BR0A 5F3ZA 4IFYB 1F2HA 5F0UA 3A8JA 4DR6F 5HBMB 3FRYA 5IT0A 1EARA 4CO2A 5I3PA 4O0NA 3IM8A 4DR2F 1N5YB 2ZD1B 3T9NA 1KFDA 3RBZA 2P9EA 3ET6B 1X4AA 4OZ5A 3I96A 1QAIA 3QYYA 3C16A 3R2DJ 1S6PB 3IM9A 1VCTA 4OYZA 4NLGA 4P7VA 5HI7A 4RNFA 2C1EB 2IJFA 3QZ7A 5HMYA 3M32A 3A3NB 4LF7F 2QO3A 3G6XA 3T5LA 2JEIA 4RW4A 3P45B 4U8YA 4FNIA 4CH0S 3V4MA 1SC6A 4DR7F 2RNEA 3V81B 2FYXA 4K2JA 4ZCMA 2QA1A 2IC3A 3RZAA 2MXYA 2KVIA 3CPWR 3KNAA 4AE5A 1UEKA 4F4AA 3DRPA 2MYFA 4K4VA 3M6XA 2COLA 1HWJA 2YX4A 1D9DA 2VA2A 2IA6A 4CTAA 3J7Z5 2E5LJ 2GW8A 5DZ6A 3OTBA 4CLWA 5C25A 2VQFJ 2VPXB 4E8UA 1WC5A 3QSIA 3SCIE 4KKOA 3MCNA 1DY3A 4OHWA 1IM6A 4UQGA 4LR9A 2RS8A 1HNXJ 5E2QA 2H54B 2NYIA 4M5IA 1DJ0A 3UVJA 2IM0A 4PWDA 3UI3A 3CIZA 4WPAA 2IJRA 5FIIA 2RSQA 1ACMB 3S01A 3C46A 2IM1A 4DBQA 5HVHA 1U4BA 1Q7LB 3C2PA 2GIQA 4E98A 3VAKA 3CDEA 1KDNA 4FKYA 2EXUA 5F8NA 4OZ0A 1SV5B 2ILZA 1Q79A 3ENWA 1X0FA 3VTIA 1YSJA 4LFBF 4NLTA 2MKJA 4ELTA 3CF5Q 4FS1A 3A1YG 4QQBA 4WK1A 5KG5A 2IVFB 3DOLB 4X4QA 5ETMA 5EWGA 2GGPA 3ZZZA 2VOOA 1N4LA 3OFFA 1U48A 2PI5A 3VALA 1URRA 1GFWB 4CP5A 4DV7J 1WC0A 1F3FA 2I5JA 3UW1A 1M5KC 2J6TA 3IFEA 4QIVA 1S97A 1B0TA 1XBWA 4KC5A 5I3QA 5IM0A 2VH7A 4FPRA 3R7NB 2NXUA 1REVB 5KOWA 4TKTA 3WIVA 5J2QA 4WZMA 4DSIA 3J7AN 2ZHOA 2KHCA 2KJWA 3AD9C 3TEGA 5L38A 1VDHA 2CJKA 4OZ1A 4JI1F 3IS9A 4F4ZA 3GV5B 4JYAJ 3ZFVA 3Q83A 5GAHU 4KGXB 1U1OA 2IBOA 2DNNA 2O66A 3WZ0A 1KC8T 1RT5A 3BPDA 2CJYB 1AT1B 4OX9J 5D77A 2E7XA 1ZETA 2OMOA 3KJVA 1TMMA 4ED1A 3K57A 2V8HA 2XMAA 3QIDA 3MMCA 1LWFB 2HRUA 5C24A 4MH8A 4LRBA 3K5OA 1RWOB 3V2UC 4NMXA 2CQ4A 1LFWA 2H5JB 1RTIB 1HBUB 4DV0F 4WBFA 3UR3C 4DG1A 3PXGa 4TYAA 2FJEB 3GJSB 2ZJRQ 1KVIA 1W2IA 1LW2A 2ROPA 3QT8A 1N6QB 2PE8A 2CQ1A 3NBPB 3MAAA 4USWA 3C6TB 4ATNA 2KH9A 5HMWA 1HA1A 1RB0A 1HBMB 1DAXA 5IOLA 5L9XA 5AE2A 4WXWA 3D1OA 1KTQA 2XNRA 2XBPA 2MQ8A 2F1FA 1HWKA 1NDKA 1AUDA 2MLYA 1TU0B 2LVWA 1JLGB 5HAOA 2FZCB 3IMQJ 1CC7A 2KDOA 2IY5B 4JI5F 4N77A 2R8HA 2C22A 4TY8B 2QEXS 3JSYA 2HMIA 3MAHA 1S9GA 3UQSA 1UVJA 2V4QA 4KPYA 2QZ8A 5LSRA 3I87A 2DEJA 1OSDA 2VFSA 3LAMA 4XAKA 1JLBB 2Z8QA 2ZH4A 1TL1A 4L73A 5ETLA 3H2VE 2XZTB 2I1RA 1HR0J 4Y2KA 3K58A 5FD1A 2QMWA 4HACA 3MMAA 1J5OA 1G3OA 2LKZA 4AL5A 1JKHB 4DN0A 2EG1A 4ILMA 1MMDA 4EK2A 1VMBA 4USJC 2GQ2A 4O44A 1PILA 1VFJA 1NK4A 5B09A 2YWHA 4DN9A 4ZVEA 1A7GE 1MLAA 2VG5B 1Q4RA 4FYDA 1XWLA 4TNOA 1RT7A 2UVUA 2NPFA 2FD2A 2PEHA 3GYNA 4EU0A 2CJXB 3NCQA 5B0EA 4EI2A 4ILLA 3K5LA 1U09A 4BC7A 5KG4A 3Q0AA 1VIOA 1WEXA 3PY8A 4B9NA 2G9OA 4NA3A 1RTDA 5DO2A 2F7VA 3MCMA 3PEHA 3CDAA 2O3DA 3HFZB 3OHAA 2DTJA 4RUHA 2M7SA 1Q86T 3CJ8A 2AWZA 3FZBA 5KT6A 5EGYA 1Q5VA 2JEJA 2CWXA 1N36J 3W66A 3NMAA 4H4MB 5IC6B 3SZ2A 1RLDA 3BSOA 2E9TA 1ITPA 3NWGA 1M5OC 3FBFA 3GU0A 1JJCB 1PJ7A 4DL3A 2IAJB 1WC6A 1U49A 2CG8A 4ALZA 2W9CB 4Y28C 4DPTA 1WG1A 2BRKA 2IFXA 5L1JA 1MU2A 2AKWB 2R7VA 1RTZA 1OY6A 5D0EA 2B51A 2AJ4A 2XI3A 2CPDA 5LMUF 1R27B 4I2QA 2RQMA 4X66J 2PFDA 1RT2B 1X0PA 4J9MA 3CDBA 3W60A 4ES1A 3T5JA 2LU2A 3CCWA 4BLGA 1YJVA 3GE9A 1D1UA 3AQPA 1EIYB 5D4PA 4N41A 2XZDB 4DUYF 2QSWA 3HVTA 1HQ2A 4I2PB 3V4IA 1S9FA 1RTHB 3IG1A 4TU8A 5EDWA 4AT1B 3BDPA 2ZE2B 3QGPA 1SL0A 1KLNA 5T7LA 1OY8A 4A8YA 9RUBA 2CDRB 4X84A 1VQNS 2H4YB 2N82B 1DLOA 3MM8A 4KGZB 2CJAA 2VL1A 2XHCA 3V5RA 4WFNQ 2DGWA 2HAFA 1S1XB 3OSNA 1E6VB 1K0TA 3G8QA 4LRAA 4ES2A 2GO8A 2DPJA 4NYPA 5U47A 4YUDA 1JLFB 3AHPA 4YEAA 4HI2A 3I0SB 1PG5B 1IKYA 2VPYB 5HJYA 3KLFB 3TAQA 1O0PA 3L7OA 4ENOA 1PAUB 5ADZA 1NUEA 1YZ6A 2QLWA 2EC2A 3S6EA 3HO1A 2GVZA 1IBMJ 1UCNA 2HNZA 4O4GB 2JNJA 3FEZA 3PACA 2ZH6A 3H2LA 4ZHRA 1LWXA 4ID8A 4GVBA 2RDJA 1VLOA 2B56A 2ERRA 4FNHA 1EQ0A 1U1MA 3K59A 1F3VA 4ZDNA 3QGHA 1FXLA 3KG0A 3FVYA 3MPVA 3E51A 2XMTA 3FBCA 5J2PB 1M90T 1HBOA 1U7LA 4DV4J 1RAFB 3DXSX 5H1SV 3VAIA 2WAQD 4JP8A 2KB2A 1Y5NB 1SIWB 1TV6B 3W2WA 3KYLA 1HPZA 4XTTA 4L72B 2OPQB 4OI2A 4UT4A 1XN9A 1A6LA 2MMYA 4NCAA 4DV6J 3GR0A 4Y3CA 1V3SA 3TUIC 3BS9A 1T9YA 2XWYA 3IWLA 2BJ1A 1X4HA 8AT1B 1YJ9S 2R3VA 3EDQB 1Q53A 3HJFA 3BO4A 1NSQA 1PBUA 4URSA 3Q23A 3H2UB 3P96A 4DFJA 4P9SA 1RCOB 5DQGA 1HNZJ 2BE2B 2MKHA 1KR4A 3HT3A 2KT3A 2GJFA 2CZ9A 1U26A 1WUUA 4WTYA 4A8KA 4AL7A 3OVBA 3WX8A 1JJHA 1KHWA 1ZZFA 3V6JA 4IG0B 3MECA 4ZK7M 3G96A 5E33A 1RT1B 3DI6B 4CLPA 3I4HX 2CYYA 5EX3A 5HVFA 2AEJA 1P27B 3G8TA 2UUAF 3BGOP 2X3DA 3GFZA 3UWTA 1WJ9A 2M52A 4GRSA 3AA8A 4DV2J 1WOPA 5M2UA 5CABA 4HEA9 1HMVB 3C15A 4ETXA 5EN1A 4QCLA 2XSJB 1TUVA 3SSSA 3SFUA 4EFAC 1CPZA 2P6SA 4OYIA 1XNRJ 3S7RA 3CJQA 1MG7A 1UZHA 1OYEA 4QYZK 5CA5A 3MCSA 4K4SA 2XS7A 3JS9A 2HEKA 1JQGA 3CW2C 3G82A 4ZVQB 4ZLLA 3FBBA 3H40A 2H5EA 2W2NP 1SQEA 2HVZA 4JI4J 4DQQA 4YR2A 3CCRS 4J9NA 3PEJA 2CQ0A 2J9DE 4QWAA 2B3TB 1RBAA 2VPWB 1D09B 2GV1A 1XIQA 4P2XA 2VFRA 3K5NA 4OX8A 2LDYA 2JC1A 1OS5A 3OL8A 2QV6A 1JLAA 3KK3A 2AU0A 1AZSB 2Y0SD 1QSSA 3CCTA 2J7UA 2XHWA 5HO4A 3DYAA 4GKKJ 1DARA 4DR4F 2FVSA 3Q24A 3GZ7A 1NZ8A 2OO4A 5KFZA 2FLLA 1KNZA 3PW0A 2UU9F 1U1RA 4LBHA 2BQ3A 4ZPTR 4CO5A 4QU6A 2DR9A 3TVKA 4DFMA 4X62J 3NS6A 3POTB 4YS2A 1C1CA 5DDOC 2J5AA 3GIJA 2WCXA 4OYBA 3JXOA 3IN5A 3PTWA 3A3PB 1IKXA 4LRFA 4K4YA 2KXNB 2B6AB 4NMLA 1CJTB 5THWA 4OQJA 3FNNA 1YJNS 4OLOA 2ZH5A 3HHNB 4AYBD 2VZ9A 1M1GA 5KG7A 1VBKA 2HHPA 2OPPA 4IOBA 2UUCJ 3PM9A 2XMWA 2K1RB 3HHLD 4ZVPB 5KFWA 1N48A 2FLPA 3TR5A 1FERA 2MJUA 2C42A 3DLKA 3L3CA 4LSNA 4HI1A 1YBTA 1Y9OA 3D66A 1WKLA 3CVKA 4ZP9A 3AH6A 2LMIA 3EMTA 4LF8F 1A9NB 1HNWJ 1SPBP 3CE8A 5KFCA 4ZVOB 1IWGA 2LEBA 3W9JA 1VYAA 4WFBQ 1LKZA 1LEOA 3OVSA 3PFOA 1YLXA 2UP1A 1F2GA 5SUHA 4C0HA 5K8MA 3PG9A 4M5DA 3OTEA 4EO8A 2HNYB 4MKAA 4TQRA 4PXBA 4ED5A 2KYXA 1NSAA 3AXMA 3GWCA 3OUYA 1VQ9S 1FDDA 1XC9A 3CWJA 2MSTA 2AYGA 1QUPA 4FN5A 4NXMJ 4A8XA 3K5MA 1YRUA 3UN2A 3UDLA 2UUWA 3C8YA 2DYAA 1VQOS 3R1HA 1JLEB 4GMKA 4C8KA 3JB9k 1Y7PA 3EICA 2K06A 3CC7S 4YB6A 1VHIA 2LQ8A 4CH1A 3NCPA 5DJBA 3R6LB 1P8GA 2XCAA 1S0OA 1JLQB 3MMBA 1IWAA 2F8EX 1V5IB 5I42A 2IMWP 2GIFA 4LSLA 3GSIA 2CADA 2AZ3A 1WF0A 3BEGB 2OSRA 2HYIB 1LWEB 3KNGA 3QWUA 4JI7F 2J9CA 1OJ4A 2X1FA 3BGRB 2FQQB 1T03A 4HTIA 3H20A 2DT9A 1FFWB 3MM7A 2JVOA 2A6MA 2J7KA 2LEAA 2PI4A 1RAJA 1KTVA 3JTOA 3W1YC 2AX0A 4A8QA 4IDKB 2HNDA 5G4DA 1GTEA 4ECSA 1RJJA 3SCJE 3MPWA 3GIKA 3TJ9A 3LO3A 3LPYA 4LQ9A 2UXDJ 2VB6A 3NGTA 2D7SA 4E2FB 4JI0F 4J9RA 4XK8C 2W4CA 3K17A 1UA0A 2HHWA 1S1VA 4ZN1A 3LTOA 4MKBA 4CO0A 4QWDA 1XMOF 1KD1T 4NLUA 1GXLA 3DN9A 1RT3B 3H5UA 4NA2A 1HWIA 3N6LA 1M5SA 3TVYA 1TK5A 2ZZMA 1S0MA 1FWKA 4DZDA 1TL4A 1KQFB 2HZAA 5D0HA 2BKNA 1U2FA 1YG0A 2R7OA 5J2NB 2IM2A 3ISND 1S1TA 2F8MA 4OHXA 3W64A 4LFCJ 2FPHX 3M6WA 2B8PA 4Q45A 5HP1A 2NZ4A 2W7OA 3LP1A 5AJ3J 3TAMB 5ETKA 3TZYA 4PG5A 4Y65A 3UPFA 2Z30B 3BGLA 1TAQA 5KG2A 4WP9A 1H3DA 4CLSA 1HARA 2EK1A 3H98A 2XCPA 4PR6A 2C2DA 1QJHA 2N4DA 4DSFA 2QL7B 4HYKA 2DB1A 3KUHA 1AFIA 3HSDA 2YWGA 5HQ8A 1UMJA 5KFHA 3W3SA 4EBCA 1BQMA 1W26A 3A3OB 4KAIA 4CCHA 2ZOMA 3LP0B 4JV0A 4Z7CA 5L39A 1ZTTA 3RR8A 3DRSA 4DR1F 2RD5C 5KFRA 4HL9A 1WD6A 2VASA 3OFEA 3FSXA 1VC0A 5CYMA 2V4JB 2OEKA 3M9OB 3H59A 2GCFA 4JV2A 3FQKA 4C48A 4WYWA 1HQEA 1WELA 4C8MA 1NK0A 2NSBA 3KTQA 3MPYA 1EHWA 3HMJG 2V8DA 2HHHJ 2IDEA 1R43A 4N5SA 2WB1D 5I3UA 1Y5IB 5CZXA 4MIAA 5D6GA 3OTOJ 2R8JA 2XGPA 4RW7B 2L9DA 5F8HA 1FFGB 2RE1A 2DCUB 3VF0B 4K4UA 1RT4A 3PR5B 3Q22A 3MR3A 4CM0A 1MROA 3JTPA 4B08A 2J9DA 3OD2A 3ICLA 1CJKB 2OMLA 4PWUA 2QL5B 2DGVA 3UDVA 3WX4A 4LF4F 4AL6A 1YKWA 5EUHA 1NPPA 2F3JA 1EP4A 1RHKB 2KL8A 2JHEA 2G0JA 2RRNA 4ZCKA 3C6UB 3QWPA 2AYBA 3WC2A 1TKTB 1Q1KA 2VG6B 2DCLA 3PZPA 5D3GB 3RAXA 1K9MT 1OIAA 4ED3A 1XMQJ 2E66A 3M8RA 1MN7A 5LJ5Y 2J76E 2CA9A 1KVJA 3M1VB 2OIHA 3NOCA 1NO8A 5IT9U 4BBYA 4DOZA 3OL6A 4LFAF 3SCLE 1N34F 1O8BA 2RAQA 2YNFB 7AT1B 3HVAA 5LSLA 3LW5C 1NH7A 3M4XA 4ZLNA 3SSQA 4W98A 3ZNUA 4ZCLA 2WHOA 1GXUA 4B3OB 4Q7AA 5ITHA 4X4NA 2UXCF 4K2XA 2K2PA 1HD1A 1CJUA 3RTVA 5BYQA 5A8RB 4W90B 1SJ4P 5H9FJ 4DUZJ 3VV2B 4WFAQ 3TP2A 1XQIA 3MPDA 2CUYA 2R2RA 4IRDA 2KHDA 4IG3A 1UWAA 4MT1A 2CQHA 1F5CA 3MI7X 2RS2A 3Q8VA 4U67Q 2HFNA 4B17A 2LP4A 4J9PA 5B0BA 2DITA 3AQOA 3HHKA 1RCXB 2YNIA 3QZ8A 4KV8A 1OQ3A 4NWBA 1J2VA 1D9FA 4DPOA 3O8WA 1EB0A 4TVAB 1CLFA 4IRCA 3PX4A 2BKPA 2F9JA 4B3MF 2VV5A 3MWBA 4W92B 3ILLA 3PYGA 1KWMA 4OZNA 3T6JA 4OYXA 2ADCA 2MQMA 3QRQA 5C2GA 4O3QA 1I94F 3CD7A 1PKUA 2XSFA 2F9DA 1FT8A 1APSA 3PRVA 4H4KA 4WKRA 1B99A 4ES3A 1FEHA 2XC9A 4H4OA 2LECA 3MUVP 4FVCA 5B7WA 2PSZA 4NI2A 2LXIA 2Q1LA 1SC1B 2Z2ZA 2ACMA 3HF5A 3AT1B 3C16B 4CLLA 5DGBA 1JK9B 5GAGU 1VQLS 2GJIA 2R7QA 3O5TB 1YRXA 7FDRA 2RUGA 3M32B 3AOAA 4CZCA 3IBCB 1K1QA 4ZP7A 4QW9A 3PIPQ 3HCXA 4RW4B 3UO0A 1GH8A 3OLAA 2FGCA 5E3PA 3QSYB 5FLXU 1JXEA 2MKSA 2YX1A 2IC3B 2CDQA 2KRRA 5KT4A 3GCWP 2UVWA 3DRPB 5HMXA 4C8OA 3CDWA 2R7WA 2HBYB 1FO1A 1TMJA 1JWWA 4F3MA 1TR0A 2OPSA 4CTAB 3NGUA 3ILJA 4QYZJ 2R7XA 2G13A 2V2VA 5C25B 2L3MA 5KFQA 1J5EF 2E5LF 3MTKA 3BKFA 2HLTA 2HHUA 2VQFF 2UXBF 3RRGA 2RHSB 4KKOB 2ZBPA 2LCWA 2V8PA 4M1KA 3NGKA 1X4CA 1FDNA 2MQNA 4NXNJ 1X4DA 1CEZA 1BWVA 1UTAA 2G1DA 2ZH7A 4B3TJ 2UV8G 2HWIA 3UVJB 4B3RJ 1C2PA 1S49A 4GVLA 1P9YA 4PWDB 5F8MA 3FEYB 3HM9A 5JVHQ 3CMQA 5KFNA 2RQ4A 4WFXA 1MNEA 3EZUA 2FB0A 4DUTA 4NRTA 2EK6A 2HWHA 1WWHA 4WU3A 3EUNA 3KK2A 4OJGA 1GMWA 1W7WA 2EW9A 1WI6A 3O1LA 3TRGA 1VQ6S 4LF2A 4ZVFA 4QIFA 2GGPB 3MR7A 2EPIA 1NNDA 3ZZPA 1RA7A 1Q5YA 3HD1A 4J9OA 2DR5A 4QBUA 1S77D 3UNYA 4OX6A 4NL5A 1WOSA 2EEYA 2EI5A 4Y2CA 1U45A 2I5JB 2SXLA 2ZH9A 4DV7F 1WHYA 2YX7A 2AX1A 5I4MA 3WHIA 1U1NA 3QATA 3B8HA 1OQ6A 1ZYQA 1N33J 2HQGA 1VRUA 5IM0B 1FNOA 1ZM3A 3H4BA 2D9OA 2VU5A 5E5NA 1SKUB 1NJYA 2HHTA 1FJGJ 3GP9A 5C7PA 5J2QB 1Z4UA 1RWUA 3BQ1A 4P7TA 4DX6A 2KXFA 5GVQA 5KFSA 2ZVSA 4QPXA 4P52A 3GLJA 3MEDA 2QTWA 3ZNJ1 3IS9B 2EKNA 2G2YA 4UY8T 4NPOA 2F4VJ 3W63A 1T3OA 3SYZA 4X4OA 4C0OC 4B02A 4JYAF 4NZ0A 4C8NA 5A0YA 2EKYA 1RAHB 2DD8S 3AJDA 2MSSA 1VQPS 4TY9A 3ENVA 1RT5B 1HWUA 3KJVB 1KLMA 2V9KA 2HFSA 3K2YA 4OX9F 3MMCB 3TA1A 2ZOGA 5C24B 3VAMA 2DRBA 3BSAA 2AGPA 4F0KA 2L9WA 1FD2A 4DG1B 3VCDA 4MIWA 1F9EB 2JOQA 2AV5A 1LW2B 2AEFA 5BYSA 5BYRA 4NX9A 1GEHA 4ZPVR 5E3AA 3R2CJ 3CCMS 3MAAB 4DR6J 1RTJA 2HHXA 2VBYA 2OUGA 2HBRB 3F56A 3EGWB 3HSGA 1IKVA 1PCAA 2W9BA 5KFGA 1ZPWX 2FJXA 2P8IA 2VIHA 4WF9Q 2DK2A 3K89A 1SUQA 3PYEA 5KG3A 2QN6B 2Y8YA 3NOGA 3HJVA 2NUHA 3UCGA 4CO4A 4ZVHA 2FJWA 3WIUA 3FBEA 2D74B 5KFPA 4OYWA 4K8RA 4UOHA 2P5VA 1R8BA 2HMIB 1VBYA 1S9GB 1FCAA 1U0HA 8RUCA 1FFSB 4LF7J 3VAJA 1VGYA 1L3KA 4NEZA 4HVZA 2HKEA 4DR7J 2YWFA 1VC5A 4HACB 4JI2J 3MMAB 2D3O1 1J5OB 2N3LA 1VRTA 1UETA 1P1TA 2DNMA 2GFFA 2AT1B 3VHQA 4MKYA 1FA0A 2PA3A 3MM6A 2KM8B 9ATCB 3QT7A 2HFZA 4G1IA 1L5UA 3KJNB 4X4RA 2QA2A 5G0RA 4OL8A 1S1WA 4QR0A 4O44B 5E3QA 2HQIA 1Y10A 1X31C 2LA6A 3G6ES 2P9CA 1UVLA 1YZ7A 4C97A 3OBIA 1NDPA 3PW5A 4Y6IA 2H3EB 3P49B 3I0RA 1FJCA 1RT7B 4JB8B 2R7SA 4CYUA 4FKXA 3RRHA 1NSKL 1T8EA 4ITSA 3WQPA 1NH8A 1TK0A 1FVQA 4CIOA 3ADAC 3HI9A 1HNIA 1O51A 3C19A 5A2QU 4DQRA 4ZVRB 1TL7A 2R2UA 2W4PA 4FF3A 4X64J 4R5PA 2DHXA 3M7VA 3LGHA 4KYZA 1VQMS 2FC8A 4LBIA 4NOHA 1D0EA 3IBWA 3NRBA 2XLIA 4KHMA 5E3CA 5IT9Y 3VGSA 3F0NA 4ANEA 1F9HA 3MM5A 1Q0NA 3OXGA 2MGZA 2XNQA 2KT2A 3T3FA 2JJ4D 5LXYA 2CPIA 1SJRA 4B9SA 2DXEA 4ED4A 2YKQA 2Y1RI 2X51A 4TLRA 4IUFA 4OJHA 2JFKA 4TYBA 1RK8A 5J1EA 2J8SA 1S0VA 4WIIA 1MU2B 2XTJP 2HFOA 4I0WA 2NCKL 3MFHA 1KFSA 3QAEA 7FD1A 4I2QB 2VONA 3ZZOA 1N56A 1IVZA 4OV6A 3L9ZA 3D7SB 2DH8A 4X66F 1U8SA 3J7YI 2FZKB 1I3OB 1ZAVA 3RR7A 5KAKA 1H98A 3FJ2A 1SL1A 1R6YA 4LR7A 4KJIA 1NZAA 3ULHA 3HVTB 4B9MA 4M94A 3LPEA 2A6OA 1IR1A 3V4IB 3OXLA 3IG1B 2JZ5A 2FHJA 1HHQA 3N9UC 3ZZTA 1Q78A 1B7FA 1XR6A 5T7LB 4WJBA 1JJ4A 2LDIA 2BM0A 2BQRA 1DLOB 3MM8B 3W8PA 4UZBA 4GKJJ 5JJBA 2BRLA 2HK2A 1S7HA 3GPAA 2L08A 4ZIWA 2GNKA 3R5BA 3TVZA 3U1MA 1GK8A 3OVAA 2XYHB 1NCLA 2CQCA 3G87A 5E3RA 1S10A 4Q44A 2W8KA 3BZQA 1IKYB 3CC4S 1LQ9A 1XJWB 1C0UA 3OJSA 5CD4H 2CXEA 1CQMA 2ZKUA 1CSJA 3ETOA 3GG0A 2PMHA 5LXRA 3KDNA 2V8VA 3RW7A 2ZVIA 2QYGA 2E9RX 2GVZB 1SJ1A 3X3UA 5KT2A 2HPUA 2HNZB 3CJKA 2DIVA 5A8WA 2PIIA 4DPWA 4ZHRB 5FLXY 3BGUA 1I1GA 2CNNB 4GVBB 4KGMA 5ETTA 2WOMA 1WTFA 4LF6J 2BJ8A 4CO1A 3M6UA 5D4LA 3BN7A 1X9MA 2WW4A 2CIMA 3IBFB 3Q2TC 4ZIVA 3VAFA 2V5HG 5L1KA 2R42A 2ABYA 3HPOA 5DLFA 3NBPA 3LWLA 5DETA 2YXLA 1F5AA 4WP8A 2IIHA 2CNLB 3AOBA 1HBOB 4M63A 4KHRA 5CCLA 4ID5A 2YKOA 3M6VA 4DV4F 1BXNA 2Q66A 3N5FA 3W2WB 4F4KA 4RUCA 1HPZB 2H4WB 2DR6A 1FRJA 2DGSA 3W62A 2ZBIA 1NK7A 3PV8A 2BE9B 3PVXA 3GB0A 1UVMA 1QLNA 4RNOA 1V6HA 4DV6F 5ETNA 2P9GA 3EVMA 2QFJA 3W5ZA 2XO7A 3MHYA 2MZQA 2RH3A 2E7WA 2OPRA 1Y11A 4OZ2A 4YDDB 3KWMA 3QBCA 2AIRB 2YKNA 5H9EK 1MSWD 3RB4A 1CC8A 1TZ0A 2M5YA 1LW0A 1D8ZA 3R97A 1TP7A 4AD6A 1HNZF 1TL3A 5KFOA 5LM7E 1T11A 3EGZA 2W2PP 2CQIA 2WW8A 4RW9A 3R5CA 3CCLS 4PXCA 4USUA 4OZJA 4OHZA 3R5AA 2MZRA 2NQPA 3MECB 1U1QA 3HK2A 3KXDA 4R0EA 1EQMA 4NZ6A 4C3KA 2EBEA 2DNHA 1YQHA 2GQQA 2PA8D 1BD6A 2BANA 1SXLA 3ENQA 1S1UA 1SL2A 3F44A 3U1NA 2W25A 2XI2A 2C2EA 2RVJA 3LUYA 1FDBA 1RWVB 4NLXA 5L9NA 1NHKL 3C15B 1IBKF 3K8WA 5HJXA 4DV2F 1S48A 3NP5A 2QRRA 4QOTA 1Q8LA 1NPKA 2JX2A 2A10A 2H48B 3N5BA 1UW9A 3CIMA 3P5BP 1YJ7A 5HVGA 5AE1A 2VFTA 2NXNA 1RI7A 4PQUA 3G82B 4FYYB 2OLWA 3IR7B 4PABA 2BEFA 2C3PA 1IJEB 5DZ7A 5HROA 3NGSA 4KB7A 5CHCB 4JI4F 4HT7A 1DRZA 1EKSA 5KFMA 2JRSA 1OO0B 5LMUJ 1RBOB 2HBZB 2VJUA 3VVUA 4KHPJ 4MJKA 4F3QA 4F25A 4NLQA 1JLAB 3KK3B 3SV4A 4DSKA 1NKBA 1VQ5S 4RW8A 2K8GA 2KG1A 3DYAB 2AP6A 4CLUA 2PT0A 3I9ZA 2W8LA 2CQGA 2GAHC 4PG4A 4F04B 2M88A 5FDLA 4F02A 4DX8H 4GKKF 1D9AA 1XMBA 4I7FA 4DUYJ 2WONA 2HVHA 5K14A 3GV7B 1RXOB 2YY3A 3OR2A 1LK5A 1NAQA 1FRXA 1BUXA 3J81j 4DF8A 1C1CB 3BH6B 1AW0A 3NNCA 2V94A 1TKXA 4X62F 1NU4A 2OAUA 4LIWA 4NCGA 1IKXB 3G9CA 3UCUP 2B4UA 2LQJA 1HFEL 2JLGA 1WACA 3BPSP 1RAOA 2V2QA 4ZJOA 2BABA 1URNA 1K47A 3W7BA 2LQBA 2OPPB 1O5JA 4IFVA 3ZXWA 1IR2A 3BBFA 6AT1B 1LXNA 5CD4A 1TTHB 3DDIA 3PX6A 2UUCF 5C2CA 2F63A 3DLKB 4F4YA 1X5OA 5AXLA 4DWIA 3PRBA 4F2SA 3P5TL 4LSNB 2N4CA 4I68A 1RABB 4Q43A 2MHNA 4JI6J 4BCAA 2Y0BB 3M8QA 1Q7YT 3MEKA 1P9QC 4X4SA 2BZ2A 5E41A 4EYIB 3W5XA 1SIZA 4M5NA 3RBDA 1NHVA 2AJ2A 1EETA 1HNWF 5BR8J 5K8OA 4DR5J 1IN0A 4FF1A 2Y1LB 3MXHP 5EHHA 1QAXA 2WSCC 2D3OR 5LSOA 3TA2A 1FNMA 3CD0A 2C2OB 2GVDA 5GMDA 2KVQE 4M5DB 4XIUA 3IR5B 1RAAB 2FJAB 1DBDA 2FHKA 3HVWA 3OUYB 2B4PA 3DHXA 1FKPA 1CS4A 1UPPA 2R4FA 5A2QY 3KLVA 4O23A 4OHVA 4IKAA 2V63A 1WF2A 4QWCA 3HKZD 4NXMF 2CPEA 1HHTP 4CLFA 2PD1A 4IYQA 3D6TB 2BA9A 3QGGA 2VJVA 4DV3F 5GAEI 2V69A 4PEOA 3CMAS 4FF2A 4M8LA 2EBGA 3BN4A 3M2RA 2I38A 3RB6A 2HVDA 3MMBB 3IA0A 2WB4A 4H54A 2B7BB 3B78A 3SSRA 1AROP 4L3NA 2Y3YA 5I42B 4LSLB 1YJUA 3DNCA 5J2MA 1UEUA 1FRMA 2IRUA 1VK3A 3BSCA 4C8YA 3MFIA 3W8GA 3I5AA 2H5IB 3U02A 5CYQA 3W61A 2OELA 2V2KA 2DO0A 1VQ4S 3T5HA 4ELUA 2HG4A 1T03B 1VBZA 3MM7B 3CJ0A 5KFTA 2B4VA 3BF4A 3KLGA 4LVOP 3KK1A 2PO4A 3CULA 3DGVA 2HNDB 3CO0P 4MFBA 4DL5A 4M5MA 1X5PA 1MWZA 2DRAA 3QRPA 5EX0A 2UXDF 3RBXA 2Q6CA 3H90A 4FF4A 4X4TA 1N32J 3SMZA 3BBBA 3V6KA 1S1VB 4KIAA 4RNNA 4USHA 3OXFA 3I5CA 2BJ3A 2DHHA 3AFGA 3D0IE 3QRRA 2MPUA 4ECTA 2CPXA 4NYZA 3M8PA 3GILA 1HW8A 3NXZA 3EX7B 3KHGA 1TL5A 3QLHA 1Y5LB 2XY7A 1VIXA 2DNYA 4RX6A 3ZC4A 4QR1A 4USMA 1UL3A 3DLBA 1L3VA 4IH7A 1TKZA 1FNXH 1S1TB 3K5PA 3FFIA 4Y2AA 1TUWA 1RWNB 3MUTP 2DKOB 1YBUA 2ASDA 5HP1B 3QGIA 3LP1B 4DR4J 3AD7C 1KQSR 2UV8A 4PG6A 4LFCF 4PQAA 3TX8A 4WZQA 1DQ9A 4UOCA 5AJ3F 4WK3A 1UKUA 4LVNP 3THTA 2IRYA 2ZEJA 2OEJA 3M8WA 3R6GB 1SC3B 3RU0A 2EC0A 2V68A 3QFWA 1EKRA 1LK7A 1ICEB 3C3LA 4WWSA 4C98A 1SB6A 2ILYA 5DLGA 3HP6A 2NPIA 2FGOA 3D4JA 4UF4A 3JSBA 1BQMB 1C4AA 2RDDA 3RBEA 4R8UA 2IJNA 1PGZA 2WZ1A 3ZZRA 2PN6A 2WSFC 1X4BA 4KFBB 1S9EA 4F26A 2Z2YB 3DRSB 1Q8KA 4X2BA 1KOOA 4F4XA 4PYDA 4DQPA 2A18A 1YITS 2B5JA 1MMNA 4U7CA 2L48A 4QWBA 5CYMB 4O3NA 4DSLA 3FMBA 3OV7A 3ILIA 1WG5A 3KG1A 2LQ5A 5T14A 3PFEA 3PO5A 3IGVA 4ELVA 3Q2SC 1G2EA 1HQEB 2HQ3A 5HLFA 2VPZB 3NNHA 1RHMB 3OL7A 2MLXA 5MAOA 3H25A 5B0DA 5I3UB 3M8SA 2QGFB 1PYTA 1Y3KA 5IWAJ 2HHHF 2JSXA 3FKBA 2E1CA 2PMZD 2W7AA 3SEOA 4JI8J 3I56S 4C2MA 3R5JB 4TQSA 1TQLA 1H6KX 1RT4B 1ZA2B 2BJEA 1RAIB 4QIEA 2XS2A 2XGQA 1WTBA 2ATCB 2RU3A 4CQ1A 2N3OA 1MROB 1SJFA 1D3WA 1WG4A 1Y0HA 2IVYA 3JSMA 5D4NA 2MKYA 4KH1B 1CJVA 1QAJA 1KOHA 2E9ZA 4RBUA 1R8PA 4CLKA 4F2RA 1EP4B 4P10A 2CKWA 4OZLA 4A47A 3TX0A 5C42A 4DU7A 2QLBB 3LH2S 4DZ6A 1HLWA 4QPTA 4N47A 1S76D 1U2CA 4K4WA 1YIJS 3OR1A 1PSDA 3T9ZA 2WK4A 3PKYA 4JV1A 5KT5A 1IQZA 3D6MB 1K73T 1S12A 1C4CA 1XMQF 5F8LA 3AB4B 3M2UA 5D15A 3LP2A 2RHQB 4GO5X 4WFYA 1UFWA 4WTOB 4B9VA 1FEEA 2ACYA 3BH7B 3D54A 3SI8A 3UR0A 1CJUB 2GMLA 3VGUA 1NJIT 1VJWA 2I9SA 3GCXP 2ASJA 4I6YA 2AJ0A 2BXJA 3G2XA 1FVSA 3VQSA 1NK6A 2WVBA 3BR8A 2YKPA 4R25A 4IG3B 4ER8A 3ISNC 5AXMA 3IGNA 5ETQA 3VGVA 1VLYA 4P2FA 3MUMP 3U27A 1YK9A 2YNIB 1XEZA 4KV8B 3KJFB 5LMNJ 3R7SB 5GADI 2JLFA 4CNZA 3A8IA 4P71A 1VHFA 3I55S 2XS5A 2FLNA 5JXSA 1CG2A 4XDCA 3W5YA 3VWSA 4YB1P 3RAMA 1WEZA 3J7A1 3HD2A 4W4MA 2C3OA 4HR2A 1N88A 5H9EJ 4WFZA 2HVEA 4EZ6A 2Z2MA 4WKYA 3CC2S 1BQNA 1XMOJ 1N8RT 4H4OB 4JI3F 4N8NA 4P74A 4DCOB 3BV8A 1NJXA 3GJRB 4NI2B 2OTLS 4QU7A 3DMJA 2QMUB 2D9PA 3T1HJ 1X9SA 1NJZA 5KFUA 4JV5J 4EBEA 1AUSL 2MEWA 2DNQA 3OFGA 1SKSA 3O44A 1FI4A 5JUMA 3DLJA 1S5ZA 2XWXA 3RW6A 2IHR1 4A8SA 2BACA 1FKAF 4DCJB 1UJ6A 2YBVA 1IXKA 2XLKA 1H73A 1J27A 2EG2A 4DLGA 5LL6d 5HN0A 4OI4A 2HZVA 3BGFA 1S6QB 5ETRA 5H9FK 3CJ2A 2MKCA 2JDJA 5DRKA 2CQ2A 4ZVUB 3S8SA 2OPSB 4OYAA 2VODA 5IQ6A 4QW8A 4NLDA 3MD3A 2IRXA 2VFUA 3V6DA 3TAPA 2EFVA 1S7IA 1YX2A 5IZHA 4DFPA 1H72C 4HH1A 3MURP 4LF5J 3KUGA 3DOKA 5EWFA 4DR1J 1UVKA 2FY8A 4NXNF 4ZVGA 2H1YA 3MZIA 4O3SA 3CCQS 2RILA 3Q8RB 2HFVA 3NNAA 4I6WA 3SXLA 2CPYA 3PYFA 5ETVA 4IH6A 3NGDA 4WE1A 2HFUA 1IBLJ 1U1PA 1H74A 2DNOA 4FZVA 4D3HA 2IM3A 4DLEA 3SQGA 1RBLA 2KXHA 2HRTA 3KK2B 2Z0GA 5KFIA 3CCSS 5IV3A 4K5RA 3H4DA 2MHEA 2HLUA 3OQ2A 2C2RA 4GC6A 2EFPA 1PJ5A 2EFGA 2ROGA 2OJ3A 4Y34A 4ECRA 1RT6A 3US5A 4DSEA 3ZTPA 2DNGA 3D0GE 3IWNC 1DHMA 3I31A 4ICLA 3THPA 1WKJA 1KVKA 1P6TA 5F8IA 1NM2A 3WC0A 1N5SA 2Q3PA 3E01A 3MPUB 3W9IA 1S57A 1HNVA 1K44A 1GTHA 2CJBA 2NUUG 3QO9A 3I5BA 2ZH8A 3BJYA 1VRUB 1QTNB 1U0SA 1JLCA 1N33F 3ILOA 1FJ7A 2RQCA 4KH0B 4YN3B 2GJ2A 4URGA 3OPKA 4O3PA 4IOCQ 4F67A 1FJGF 3N79A 3Q8YA 2ZC4A 1N34J 1KN6A 3IRXA 3MEDB 5KT7A 3DM2A 2GS8A 2CJQA 2YQ1A 2UXCJ 2KN4A 4X4VA 3UD5A 1QY7A 2ZJQQ 5M2RA 4C8LA 5A0YB 2F4VF 2POKA 4A8OA 2HQFA 4L74A 3DU6A 1YTYA 2GMHA 2EFNA 4V1Ak 1NKEA 1HBNA 1XERA 1HWLA 1RAGB 4F36A 1KLMB 4FPIA 1HW9A 4H4KC 4ED2A 2VUGA 5RUBA 2E5IA 3B6BA 1FWPA 1R8AA 4NLVA 3T5KA 1R0AA 4K4TA 4ZLJA 3V6HA 2CZ4A 4XO0A 4UW2A 1X4EA 4IR9A 2EFOA 1LWCA 4KO0A 4ZMMA 3HHLA 1WHWA 5KG0A 4CO3A 1XNQF 2ZFHA 3P8BB 3JTNA 3J7ZT 4RZRA 1UFKA 2XEXA 4RWWA 5KFAA 1I94J 1RTJB 1RWPB 4GC7A 2BJ7A 1NBEB 3EZOA 1IKVB 2W9BB 4I56A 4B3SJ 3HHEA 2R8KA 1SUQB 3E2EA 1HYSA 1U6BA 5F3TA 3GQCA 3VZHA 4U9RA 2GO9A 2BOPA 4USKA 2W24A 3FRZA 4ZS6A 3OFHA 2VDIA 4N56A 2YNGA 4RR5A 3IXQA 4DV1J 2OH2A 2FUG9 3TUJC 2Z56B 3DRRA 2KRBA 1U0HB 3M2VA 3JQKA 3NL0A 4FYWB 2F65A 2QX0A 2F5GA 5AXKA 2HVIA 1TVRA 3H5SA 4Q5VA 1WEYA 1VRTB 2I2YA 4Y00A 3JQJA 2DRDA 1RKJA 4JI2F 3MM6B 3PDNA 2KZMA 4FP9A 2AJ1A 1FRIA 1PYOB 1RISA 2EVZA 3ZZYA 5G0RB 4ZN3A 1FESA 1S1WB 1NHUA 2ASYA 3KKFA 1J5EJ 2MQOA 4ANCA 1REGX 2IVMA 1FE4A 4J9LA 2UXBJ 1JNRB 4DR3F 1UP1A 2Q6BA 2V2ZA 4KGVB 4X4UA 3DLHA 3I0RB 4IO1A 4CYUB 4NE9C 4ECXA 3AB2B 2QLJB 2RQKA 1SQFA 3D5MA 6FD1A 2BM1A 4F8RA 3KLEA 1HNIB 4OIXA 1TL7B 3CEDA 4R5PB 5F8GA 3MEEA 3D3BJ 2NYHA 2JVRA 5HANA 3MF5A 2A3JA 4X64F 4QIGA 1WKKA 4PYAA 4ZP8A 2ZDPA 4LR8A 4OFZA 3EXYA 3GONA 2XY5A 3MM5B 2MGZB 3RG6A 1TELA 4BWJA 3Q8SB 4DV5J 1S72S 1DQAA 2J7WA 1GMVA 2HQCA 2DISA 2MQQA 3UD4P 1PC4A 1AYEA 2CVEA 1KS2A 2PMWA 4Q2MA 1C0TA 4C3MA 1ELOA 3AAWB 5J1EB 1NK9A 3Q8UA 2DEIA 6FDRA 4DU8A 4YDXA 1LNQA 4I67A 3GSDA 4Z2XA 3FGVA 4I4BA 3TEHB 2E7VA 3BYRA 1JXLA 2VC0A 3NAHA 1FKOA 2GZOA 4MKVA 3ITHA 1RGVA 5KFDA 2YWKA 3O2IA 1RWWB 5HK4A 3MR6A 3EWGA 3N0VA 4OX7A 2DHGA 4DF4A 3IAM9 4DL4A 4LRCA 2KFNA 4C11A 4CRJA 2ZDOA 2XQCA 3FSIA 5HSPA 4K59A 2HK3A 3BR9A 4OI6A 3AXKA 3T1YJ 1M0SA 4S0MA 3PW2A 2G1HA 1Y4ZB 2JLEA 1RWMB 2CG4A 2RT3A 4L75A 2VC1A 3PJ9A 2R8GA 1SC4B 3CDUA 4YMEA 1S6UA 3GYGA 2KYZA 3CJTA 2HS3A 2J0XA 3D1QA 2ZBQA 3TNVA 1UVIA 4GKJF 4ILRA 1YJTA 1R6VA 4CDIA 3TW0A 3R9LA 3E8OA 2MZTA 3CGIA 4JOUA 3OHBA 4C4WA 3MR2A 1V3RA 1FHTA 3RGIA 1C0UB 2YH1A 4NLPA 1RU2A 1BQXA 2DGTA 2MKIA 1QM9A 3ZZUA 2ZITA 2KFZA 4DQIA 2E44A 2EFQA 4DS4A 1SI9A 2PFFB 3ISZA 4ZVSB 3G6VA 2HBQB 2XY6A 3CJKB 1ZBTA 2E1RA 3DLEA 2DPIA 5A8WB 2ZNYA 4M95A 1WC1A 3OLBA 1RAEB 2WOMB 3HDSA 3GMGA 3I82A 1H2UX 4A8MP 1BHNA 3KHRA 4WXOA 1U47A 2NS1B 1L3TA 1AXQA 1FE0A 2JL9A 1T9WA 1X5SA 4LF6F 3CJ5A 4ZJLA 1CVJA 1HHSA 5DGAA 1VQKS 4MK7A 2JEFA 4J9VA 4UUWA 2MQLA 2U2FA 3B54A 3GFYA 5B0FA 2O67A 4ID5B 4AFFA 3H7HB 1XTZA 1KQGB 4Y2MA 1RHUB 3EM1A 3AOCA 3CJRA 2CQBA 3HFKA 4KBIA 5DDRC 5GMKa 3THVA 1JX4A 1FWLA 1UWBA 2WTFA 3QJJA 4LF9J 1K8AT 1T94A 4EWTA 4DDFA 3G4SS 2KG0A 3QPIA 4R0JA 3TJAA 3CCVS 4CI0B 3A12A 4C8ZA 1CULA 1UJ5A 4Q8EA 3N28A 2D41A 1EJ7L 2GQCA 2OPRB 3QIPA 4BDPA 3MOZA 2GC8A 3VVTA 2FLOA 3GR1A 2YKNB 2Y1JA 1TUGB 3KMSA 4Q0BA 3J80U 1B64A 4CLZA 3H5YA 1F1BB 1LW0B 2VHGA 3KDOA 2B0GA 1RWXB 1TL3B 1NDLA 2K3KA 3SBMA 4WIQA 2QSFA 4RW9B 3G6YA 1FF2A 3BYPA 1SCJB 5KT3A 3LF0A 1HQUA 3CUNA 2OD4A 4DFKA 2UUBF 2CQPA 4OI0A 2BANB 4IOAQ 2C28A 2LXUA 3EDRB 1S1UB 1KBRA 1WHVA 2YKMA 3CB4A 4YB5A 3S1TA 2CRLA 3RAQA 4HHUA 3HKWA 2JWNA 3O6QA 1DTQA 2KKHA 2YQ0A 2JFDA 3OTDA 2AGQA 2W1BA 1SH2A 3P4UB 3DRYA 2WBRA 4PPDA 3VQTA 4X65J 3T1AA 4DPXA 4YY3J 3MEGA 4ZPCA 4LUBA 3EPGA 4QJVA 2GIRA 4CLYA 2V34A 3R5GA 1S59A 4PQUB 3EZ5A 4KGKA 2KFYA 3OJUA 5HROB 3UDEA 1FD8A 2ZNZA 1R8CA 1R89A 3SDEA 3Q8PB 3DRXA 5GAHI 2LQ9A 2VQEJ 2NREA 2R7TA 5F9NA 4FXWA 2WVEA 4K50A 2E1PA 1T05A 4P72A 4RW8B 4KHPF 1TKDA 2LXFA 1ZM4A 3J81U 5K9FA 5FDLB 2VKZG 4I7FB 2ZM6J 1RA6A 4RW6A 3MR5A 1C1BA 3BO2A 2OFGX 2WONB 5K14B 4YHHJ 4OV1A 3IRWP 3OR2B 3Q8QB 3DC2A 3BKTA 2RF2A 4I64A 5DG7A 2NR0A 1NXIA 2HIQA 1NJWA 3GJTB 2AHOB 4G3IA 2YTCA 4FBUA 2DBBA 1WC3A 2PDAA 1RZMA 1TKXB 2ZBRA 3LQVA 3NCRA 3BB5A 2AEMA 5FJ4A 4NCGB 2DHAA 2RB7A 1DFDA 3IAS9 2FVRA 3C14A 3M8YA 1ROFA 4P2MA 3RB3A 3BREA 2XYGB 1V3ZA 3D6FB 4MYTA 2V6AA 4UQTA 5F0WA 4AXJA 2RKIA 1EAYC 3SIPB 4IFVB 2X1BA 4HLBA 1PIEA 5DS7A 1VQ7S 5EWEA 4J9SA 5IT4A 3AODA 3PR4A 1MN9A 5SZTA 4DL7A 3FUYA 4Y0FA 1RWKB 4AQYJ 3M8QB 2QA4S 4JI6F 2HWTA 2MB0B 1HIYA 2VICA 1EETB 1B3TA 4K0KJ 3FK4A 2RDIA 2C2MB 2WVDA 3UNGC 2DH9A 1T0TV 1U24A 5ETSA 2KU7A 4F0HA 5A8KA 1E6YA 2LU1A 2YWEA 5BR8F 4DR5F 2XMKA 3OTCA 2DNZA 2W4DA 2GVDB 1R0BG 1H7WA 1UAWA 2R2SA 5CYJA 4NLOA 1HNXF 4PUOA 1DTTA 1GX6A 1B7YB 1KONA 3Q86A 1HD0A 3VAGA 3BQ2A 1FKPB 1MWYA 3KHHA 4P2SA 5L8RC 5LOQA 1CS4B 3M30A 1SVDA 4Z7YA 1X60A 1KQKA 1QSLA 3MM9A 3SFGA 2CAJA 3KLIA 4G1QA 2J0SD 2CQ3A 1R3NA 2E5GA 3TANA 1IR0A 4RKUC 2O5DA 2IBKA 2L41A 1FTCA 2OI2A 4DMZA 2H65B 2QT7A 3EGVA 5AXNA 1VS3A 4RNMA 4KTQA 4WU2A 4K4ZA 3M2RB 2M9KA 2J6UA 1BY9A 3F73A 4HHHA 5CXTA 1VQYA 3TOQA 4WP3A 3K7RA 3RJMB 2CNOB 1U25A 2LFVA 2FJBB 5KFKA 3PW7A 5J2MB 1ZOTA 2M4MA 3AY0A 2ZHBA 3RYLA 5CYQB 1GQEA 2AD9A 1N54B 4J90A 1M5PC 1WNEA 3D2WA 2R2TA 2MY8A 3D68A 3HX9A 1U1KA 3PJWA 2DO4A 1DZ5A 2Q79A 4M5JA 1RP5A 4ZPBA 3KLGB 2VG7A 2YNHA 5K20B 2U1AA 2YPYA 3KK1B 3RUBL 1RQ0A 3MD1A 1GT8A 3TUZC 4C9DA 2KT5A 4O3RA 3DOMA 1ZZNA 1IBKJ 2ZC3A 4MFBB 3U1LA 1QE1A 3FEXB 3I6PA 5L1LA 1V5VA 4DS5A 5HMZA 4PRFA 5JMNA 3W2VA 1JJ2R 2E5HA 2NSCA 2DNLA 3QAUA 3HFVA 2D3ZA 3DLGA 4TLQA 4IR1A 3KUEA 3R8YA 1N32F 4FXVA 2CPJA 1FK9A 1HKAA 2LEPA 3DGPA 3M8PB 2Z57B 1F6TA 4XDDA 2G0IA 3MOJB 3J7YU 4PPZA 5E0OA 3QLHB 3L7UA 2GHWA 4YFUA 1KP6A 3F41A 4A8FA 2UUTA 3BDEA 4O4RA 2K3IA 3KLHA 1HI8A 4OLPA 2OFHX 3G86A 2BQUA 1TKZB 1X4FA 1NLKL 3FFIB 2DR8A 3MCOA 2MJNA 4CM2A 2ZH2A 3LALA 1XK8A 1TFYA 3WDOA 4V19J 1RKIA 1ZS6A 2L9NA 1KHVA 2ZBCA 1QVGR 2DY9A 2OKQA 1X9WA 1UJ4A 1N52B 1IKWA 4TN2A 2R7UA 3ZTSA 4PG8A 3JYTA 4DR2J 1KRPA 3L7PA 4IFYA 4IQMA 5HBMA 3RB0A 2DGUA 3N6NA 3BKUA 2MY7A 4KSEB 3AJ1A 1N5YA 3B4MA 1NK8A 1B0VA 3SQOP 2ZD1A 5BJRA 3VGTA 1VBXA 1GX5A 3VZIA 3ET6A 1SQGA 3PKMA 4ETZA 4UY85 4N7TA 2ZHAA 2QLXA 4I1TA 4NRUA 2UZAA 3TO8A 2GX8A 1S6PA 4R8UB 1RU1A 3MDFA 4DCPB 5B0CA 2MKKA 1S9EB 4KT0C 4NCBA 5C5JA 5K5MA 4FYVB 1Q81T 2DXDA 2D3UA 4UUXA 1NSPA 1RADB 1TL1B 4J37A 1VC6A 4NEYA 2B5JB 4ZITA 4O3OA 1PJ6A 2DHSA 2IMOA 1YJRA 2VF3A 2QG9B 1HR0F 5E7OB 2MDAA 2XB2D 2ALZA 4RO0A 3V81A 3NS7B 2AF6A 3CCUS 4ZPDA 2M8HA 2X1AA 5HLFB 4XPEA 2YPZA 2H51B 4L3KA 4DJBA 3UD3P 3EXCX 1UVNA 2MZSA 2PEBA 3J80Y 2KJVA 1Z2ZA 5JVGQ 3NAIA 5IWAF 1WC4A 4Y2IA 5D0RA 1YWXA 3CJ4A 4LT6A 2D1CA 3VR1A 2PGCA 4JI8F 4HKQA 2DJWA 2CWKA 4UOFA 1VQSA 3JSMB 4UZCA 4BHQA 2C2ZB 2G0CA 2M2BA 4ED7A 1UPMB 1CJVB 2Z4PA 1PBAA 4IO9Q 3NWRA 4ANDA 1VISA 1L3UA 3IO1A 1NMEB 1T9VA 2VBZA 1SBRA 3PHTA 5C42B 2CZVC 3T6BA 1W2BR 1RTDB 1VK8A 2C3UA 4UOGA 3NS5A 4F50A 2BBEA 2A2DA 3OR1B 4LFBJ 2WVFA 1SV5A 1NPRA 2QFIA 1BLUA 4RBTA 4HTJA 4I69A 4DV3J 1N36F 3OL9A 3DHWC 2G4BA 3K8VA 3M2UB 3LP2B 2XG8A 1WSRA 2RMLA 3DOLA 5KFFA 4OZ3A 1HI0P 1U6FA 5IFMA 5BXIA 2HGLA 1FRKA 2B8QA 3EPIA 4EO6A 3ONQA 3TI0A 3JQMA 3BSNA 4J9QA 2HQDA 2HHQA 2ZJPQ 4IH5A 1PO6A 2HRYA 4DI6A 3ZTOA 4YR3A 4LSZB 4U95A 1S0NA 3PO4A 2NZCA 2E29A 4RUAA 1G1XA 5IC4B 4ZKAA 4RU9A 4EEYA 2NXJA 2PC6A 3J81Y 4K7QA 3MMJA 2DGOA 3JAMU 1REVA 5LMNF 1RACB 4EYHB 4TU7A 2VA3A 3EE3A 4U6PA 1N0VC 4OJ3A 4JI1J 2LA4A 3CO9A 4DQSA 4ZPWR 1FX4A 3DDNA 4BS2A 4Q2LA 1MMLA 3M8ZA 2BKOA 1N0UA 2FJDB 1BQNB 1G6BA 5T41A 3H42A 3T41A 4N76A 1IQTA 1NB2A 1ULRA 3KJQB 3R3TA 1UZDA 1XR7A 3EVWA 3DMJB 4CNYA 3TJ8A 1X8DA 1QVFR 2QIFA 1LWFA 2DR7A 1VI7A 2QE5A 5KG1A 2CNKB 4DV0J 3T1HF 1YHQS 2ADBA 2FVQA 4JV5F 1VJQA 3CCZA 1UW4A 4DL0C 1RTIA 1HBUA 1IBMF 3GFHA 1AFJA 2GHPA 5A6PA 2CPHA 1N6QA 5DQIA 1SJQA 4NLRA 3C6TA 4AUKA 3SCKE 2MTLA 1HBMA 3HSZA 5HL7Q 1CBKA 2BW7A 1U1LA 3A8KA 3BO3A 5KFXA 4DX7A 1S99A 1YI2S 2I0XA 1JLGA 3V6DB 4JI5J 1G4CA 1M5HA 2B9XA 3DLLQ 1HI1A 4TY8A 3ZTQA 3QMQA 3GG1A 4PKDB 2OSQA 3DOKB 3I4PA 2BOAA 1WI8A 4KFBA 3KG4A 4LF5F 1EZZB 2XMMA 4OYMA 2MZJA 1JLBA 2Z58B 3LOUA 2O1PA 2BJDA 3A13A 2O01C 1YDLA 2P6TA 2XMJA 3M9MB 3PYDA 4WE1B 3A8EA 4LJMA 2V8GA 3FC9A 5ETPA 1I5OB 4LIRA 4TXSA 1FTRA 1JKHA 4J7CA 3SQGB 4QZVB 2R7RA 1IBLF 2Y8WA 3G71S 1KEKA 3N4WA 2C2KB 3H5XA 2V4RA 2VFVA 4U8VA 4HT5A 1JXVA
chains in the Genus database with same CATH topology
4YR0A 1FJGF 2L9WA 3N79A 1FD2A 4JI5F 2ZC4A 4N77A 5B0AA 2R8HA 1N5TA 4TY8B 2C22A 2QEXS 4LMZA 1RT6B 3JSYA 1HL6A 2HMIA 1T02A 3MAHA 1KN6A 3B82A 3IRXA 4DG1B 1S9GA 3MEDB 5KT7A 3DM2A 3UQSA 3OW2R 1UVJA 1LOUA 3CMES 2YVSA 2V4QA 4KPYA 3VCDA 1K1SA 2QZ8A 1F9FA 2VG5A 2CJQA 4ICLB 5LSRA 3I87A 3M05A 1OSDA 2VFSA 2KN4A 4MIWA 2JOQA 4X4VA 2AV5A 3LAMA 1LW2B 5D78A 4XAKA 1JLBB 5BYSA 1QY7A 5BYRA 4NX9A 4ZPVR 5E3AA 3CCMS 2Z8QA 2ZH4A 2ZJQQ 1TL1A 5M2RA 3RRKA 3H2VE 5DM7Q 3E01B 2I1RA 4Y2KA 4C8LA 5A0YB 3D0HE 5GAEU 1RTJA 3K58A 2F4VF 2POKA 2HHXA 2FTRA 4A8OA 2VBYA 5FD1A 5DDQC 5DG8A 3F56A 3EGWB 3DU6A 1YTYA 2GMHA 1HNVB 2QMWA 2EFNA 1RDRA 3L09A 3MMAA 1NKEA 1J5OA 1G3OA 2LKZA 3QO9B 1HBNA 1IKVA 2W9BA 1XERA 1HWLA 5KFGA 2BDPA 1ZPWX 2FJXA 2UVRA 4DL6A 1JLCB 4WF9Q 4ZPAA 1KLMB 1JKHB 2DK2A 1HW9A 3UDCA 1SUQA 4DN0A 1ZM2A 5KG3A 2EG1A 4ILMA 1MMDA 4H4KC 4ED2A 2VUGA 5KFJA 2NUHA 3UCGA 3CJ3A 4CO4A 1PC5A 4ZVHA 2FJWA 2E5IA 1VMBA 2FY1A 4USJC 2GQ2A 1R8AA 2D74B 4NLVA 1H2VZ 3T5KA 1R0AA 5KFPA 4O44A 1PILA 1VFJA 4K4TA 1XNRF 3NKYA 4PXEA 2P5VA 4C3LA 3V6HA 2AW0A 2CZ4A 1R8BA 1NK4A 2HMIB 5B09A 2YWHA 4H4MA 3M9NB 4XO0A 3IRXB 4UW2A 1X4EA 1S9GB 1VBYA 4IR9A 2EFOA 3DM2B 1LWCA 1FCAA 4DN9A 4KO0A 4ZVEA 1A7GE 2NLWA 4ZMMA 3HHLA 2VG5B 2KZZA 1Q4RA 4FYDA 3VAJA 2IAJA 1VGYA 1WHWA 5KG0A 2B9WA 1L3KA 1XWLA 4TNOA 4CO3A 4B9LA 1XNQF 2ZFHA 1RT7A 2IYIA 4HVZA 2NPFA 3JTNA 2W9CA 2UVUA 3LWMA 2FD2A 3SV3A 3J7ZT 4RZRA 2PEHA 3GYNA 2XEXA 4RWWA 4EU0A 5KFAA 1RTJB 3NCQA 3I9V9 5B0EA 2YWFA 1U6ZA 4ILLA 1VC5A 4GC7A 3K5LA 3MMAB 1U09A 1J5OB 2N3LA 3LANA 1HBNB 1VRTA 1IKVB 1UETA 4BC7A 2W9BB 4FS2A 4I56A 1P1TA 5KG4A 2DNMA 2GFFA 3Q0AA 5KFBA 3HHEA 1VIOA 1WEXA 3PY8A 4B9NA 2R8KA 2G9OA 4MKYA 1SUQB 1FA0A 3E2EA 4NA3A 1HYSA 1H0HB 2PA3A 1U6BA 5F3TA 3GQCA 3VZHA 1X7VA 3MM6A 4U9RA 2VKRA 2KM8B 4ECYA 3N6MA 2GO9A 1RTDA 2BOPA 5DO2A 2UVVA 1BGXT 1RT2A 2F7VA 3PEHA 2W24A 3CDAA 2O3DA 2HFZA 4G1IA 1L5UA 3FRZA 3OHAA 1IM4A 2DTJA 4ZS6A 3OFHA 4RUHA 2M7SA 1Q86T 4X4RA 2QA2A 4N56A 2YNGA 5G0RA 4OL8A 1S1WA 2AWZA 3FZBA 5KT6A 5AE3A 1R0AB 5EGYA 4QR0A 2K7JA 3IXQA 4O44B 2OH2A 2FUG9 2JEJA 5E3QA 2HQIA 4NLSA 3H8YA 4KE5A 3NMAA 3TUJC 4H4MB 2OD6A 3DRRA 3SZ2A 4B9TA 2KRBA 1LWCB 4KO0B 3BSOA 4I2PA 4QR2A 2E9TA 1H38A 2LA6A 3G6ES 3HHLB 2P9CA 1RTHA 1UVLA 2XZWA 5D8HB 3M2VA 3NWGA 1M5OC 1Z1ZA 2ZE2A 4A4JA 4C97A 4DL3A 2DVIA 3NL0A 2IAJB 3OBIA 2Y1IA 3PW5A 4Y6IA 1FJCA 3P49B 3I0RA 1YRTA 1U49A 1RT7B 2R7SA 4ALZA 5IQQA 2W9CB 5CQGA 3RRHA 4Y28C 5AXKA 5DM6Q 1T8EA 4ITSA 1WG1A 2BRKA 2HVIA 1NH8A 1TK0A 2IFXA 1TVRA 3H5SA 5L1JA 1UFLA 1MU2A 3R27A 1FVQA 4Q5VA 2R7VA 4CIOA 3HI9A 3L95X 4MMOA 1HNIA 1O51A 4DQRA 1WEYA 1VRTB 2B51A 2AJ4A 2XI3A 2I2YA 2R2UA 4Y00A 4RBVA 1S1XA 4F4WA 2CPDA 2W4PA 4FF3A 5LMUF 1R27B 4R5PA 2DHXA 1E6VA 1RKJA 4I2QA 4JI2F 1HYSB 1VQMS 3MM6B 3PDNA 2RQMA 2MZ1A 3IR6B 2FC8A 4NOHA 4B3SF 2KZMA 4FP9A 1F5BA 1RT2B 2AJ1A 1X0PA 4J9MA 1D0EA 3CDBA 3IBWA 1FRIA 3NRBA 1JLFA 2XLIA 4ES1A 4KHMA 5LJ3Y 3T5JA 4IRKA 5E3CA 2LU2A 1RISA 1YBAA 3CCWA 2EVZA 3BQ0A 5IT9Y 1Q16B 3ZZYA 1QUVA 1YJVA 3I0SA 2YNGB 3GE9A 5G0RB 1FESA 1S1WB 1NHUA 3MM5A 3KLFA 3D28A 3AQPA 1D1UA 3OXGA 2ASYA 3KKFA 2DH7A 2MGZA 2ZKTA 2MQOA 5D4PA 4ZLPA 4N41A 2XNQA 2IVMA 2KT2A 1FE4A 3DRRB 2JJ4D 4D3GA 4DUYF 3T3FA 2QSWA 3HVTA 5LXYA 4J9LA 1JNRB 2CPIA 4DV1F 4I2PB 1SJRA 4B9SA 4DR3F 3V4IA 1S9FA 1RTHB 3IG1A 1UP1A 4TU8A 4MIBA 5EDWA 2YKQA 3BDPA 3M2VB 1Z2LA 1X5TA 2Y1RI 2X51A 2ZE2B 3QGPA 4TLRA 2Q6BA 1SL0A 4IUFA 4X4UA 2H9ZA 4OJHA 1KLNA 3DLHA 4O4GA 3I0RB 4IO1A 2JFKA 5T7LA 4A8YA 4ECXA 3GIMA 4X84A 3AB2B 2RQKA 4TYBA 1VQNS 2N82B 1RK8A 1DLOA 5J1EA 1F0XA 3MM8A 4WIIA 1S0VA 2CJAA 1TVRB 3D5MA 1MU2B 6FD1A 2HFOA 2BM1A 2J8AA 4I0WA 2VL1A 4F8RA 3KLEA 1HNIB 3MFHA 4KQZA 4OIXA 2J0QD 3V5RA 4WFNQ 2DGWA 1KFSA 4B9UA 3QAEA 1S1XB 1S6OA 3OSNA 3HXMA 3CEDA 4R5PB 5F8GA 1E6VB 3MEEA 7FD1A 1K0TA 4I2QB 2FVCA 2FIUA 2X3GA 2VONA 3G8QA 4ES2A 5LT5A 2LLZA 3ZZOA 2GO8A 2JVRA 2R9LA 4ECZA 2DPJA 3MF5A 1NK5A 2A3JA 1N56A 1S6QA 4NYPA 4QIGA 4X64F 5U47A 4YUDA 1JLFB 2HAIA 2AJQA 4N8OA 4ZP8A 3AHPA 2ZDPA 2DH8A 4X66F 4YEAA 4HI2A 3I0SB 4MYUA 1U8SA 4OFZA 5J2PA 3J7YI 2APOA 3EXYA 2FHMA 2XY5A 1ZAVA 1IKYA 2VPYB 3MM5B 3KLFB 3RR7A 1D8YA 5KAKA 3TAQA 1H98A 2MGZB 3NLCA 1O0PA 3FJ2A 3L7OA 4BWJA 4JUZA 1SL1A 1SJ3P 1R6YA 4OHYA 4KJIA 1NZAA 3Q8SB 5ADZA 3ULHA 1S72S 3HVTB 4B9MA 4M94A 1DQAA 2WBMA 2QLWA 2J7WA 3OXLA 3V4IB 3CD6S 3IG1B 2JZ5A 2DISA 1TV6A 2MQQA 5J1PA 3S6EA 2FHJA 3UD4P 1PC4A 3HO1A 1LXJA 3N9UC 3ZZTA 1Q78A 1B7FA 1FRLA 2HNZA 2CVEA 4O4GB 1XR6A 3FEZA 4U7UK 5T7LB 5KFVA 1KS2A 4Q2MA 3PACA 4WJBA 1C0TA 2OPQA 3H2LA 4C0BA 2ZH6A 4C3MA 5L1IA 1JJ4A 2RRBA 4ZHRA 1RYRA 1ELOA 3AAWB 2LDIA 1OPIA 2BM0A 2BQRA 4NLYA 1DLOB 5J1EB 1NK9A 4NZ7A 3MM8B 4ID8A 1SKWA 3IWXA 6FDRA 4YDXA 2RDJA 3KLEB 2B56A 2ERRA 4I67A 4FNHA 4L6V3 3GSDA 4Z2XA