4JYAJ

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4jyaJ00
3IMQJ 2VQFJ 1XMQJ 2MQ8A 1HNXJ 4PWWA 4DV4J 4DR3J 4LF8J 3JAMU 4JYAJ 3J80U 4LF9J 5LM7E 3J7AN 4DV7J 4DR4J 4LF7J 4GKJJ 4YHHJ 2HHHJ 4NEYA 1FJGJ 4JI3J 1IBLJ 5IWAJ 2UUAJ 4V1Ak 4DR1J 5LMUJ 2MEWA 2KL8A 1HR0J 4NXMJ 1IBKJ 3T1YJ 1N32J 4OX9J 5BR8J 4JI2J 3T1HJ 4LF4J 4KYZA 4LF6J 2UU9J 4GKKJ 4DV0J 2UXCJ 3W1YC 3R2CJ 4JI0J 4JI8J 2ZM6J 3D3BJ 5IT9U 2E5LJ 4DUYJ 4DV6J 1XNQJ 4DR5J 4JI5J 4K0KJ 1N36J 4KHPJ 4B3TJ 2KVQE 1XNRJ 1I94J 1IBMJ 1XMOJ 5FLXU 4DR7J 1N34J 1HNWJ 2MTLA 4LF5J 4LFBJ 3R2DJ 4DR2J 2UXBJ 5A2QU 4NXNJ 2UXDJ 4YY3J 4LFCJ 4DV1J 1J5EJ 3OTOJ 4B3RJ 4X66J 4DUZJ 4KY3A 4JV5J 4JI7J 2UUCJ 4B3SJ 4LFAJ 4RJVA 3D3CJ 4HHUA 4JI6J 4NEZA 1HNZJ 2UUBJ 4DR6J 2F4VJ 4JI4J 5AJ3J 4B3MJ 5LMNJ 4DV3J 1N33J 4AQYJ 4DV2J 2VQEJ 3J81U 4DV5J 4X65J 4JI1J 4X62J 4X64J
chains in the Genus database with same CATH superfamily
4M5HA 3PIPQ 4LF8J 1VBZA 4X4RA 1X9MA 3SZ2A 4W90B 5D4OA 4G1PA 4ZMMA 1HW8A 6AT1B 3UFCX 1LW2A 5C24B 1KC8T 3CD5A 3I0RA 1CG2A 3K5MA 4QWDA 3Q8QB 3KNAA 3R5AA 2XM3A 4DL7A 4J9KA 2OAUA 1N0UA 3IRXB 1REGX 2C22A 4X2BA 5L1IA 3THTA 1WC0A 1CQNA 4N5SA 2MSTA 3GIMA 3CPWR 5LSOA 2X3DA 1IWAA 1YZ7A 3M1VA 1JWWA 1G4CA 5B08A 1FD2A 2DNQA 2DHXA 2QLFB 5HVFA 4DUZJ 1NK0A 2OPQA 3DLKA 4ILRA 3SCIE 1D3WA 2ZFHA 2RDIA 5JXSA 1HBOA 1LW0A 2B8QA 1X4GA 3BPSP 2GIQA 2CWXA 4AQYJ 2K8GA 3K5PA 4WFBQ 3CJKB 4DV3F 4CLLA 1KFSA 1VBKA 4DSIA 4C4WA 3KLHA 1UPPA 1YBUA 2V68A 1Q86T 4I6WA 1VLYA 2XYGB 2HNZB 2GIRA 1NDCA 2FJEB 2AV5A 2KFYA 2RJZA 3I5BA 4OI2A 4OYIA 1N6QA 2OPRA 2D9PA 1HPZB 2DH8A 2VG5A 2W4CA 3SMZA 4LSLB 4CO2A 2ZJPQ 2PEHA 5BR8J 5HJXA 2OLWA 3RB4A 3DM2A 3AFGA 3BREA 2UV8G 3FCWA 3DI6B 1AZSA 5IZHA 5T7LA 1XEZA 4HH0A 3OPKA 1KVIA 3GIJA 3N6LA 4ED5A 3FMBA 4C98A 3EGNA 5FDLB 4OZ1A 4ZVTB 5L1LA 3X1LB 1F5CA 4TNOA 1NK9A 2VA3A 1CPZA 1N36F 1LWFB 2QE5A 2X7IA 2B9YA 4X65J 2AJ2A 4TU7A 1RBLA 4PG7A 4JYAJ 1FWPA 2VBWA 3C6UA 4ZP8A 2QG9B 5L8RC 3BJYA 4RO0A 4FXVA 3RBZA 3OL7A 2BACA 2YXLA 4MK7A 4OZ5A 1RT4B 4UY8T 2YX7A 2ROPA 4OZ3A 2OFHX 3M9OB 4B9UA 1LV5A 3T1HJ 1NK7A 2PIIA 1X4BA 2DNPA 1L3SA 2E1RA 1RT5A 3UVJB 1AW0A 2J0XA 4ILLA 4JV0A 2XZTB 2I1RA 3RAMA 3AOCA 4J9NA 3NS7B 5C25A 3SQGA 2CQBA 3QYYA 3VGSA 5L9NA 4WE1A 2OSRA 3E3XA 3H98A 4YR0A 3MM9A 2G0JA 2F3JA 2GMHA 2J9DE 1SBRA 2M8DB 4ED8A 1P27B 2LECA 4NYZA 4DG1A 4CT8A 4DJBA 3QIPA 5FJ4A 1IJEB 3AQPA 1RTJA 3M7VA 1CULB 3KLFB 1IVZA 1ZA1B 2W9CA 4ED4A 4CLFA 1CSJA 3RTVA 1W7WA 4YY3F 4J37A 2N82B 1OSCA 5LJ5Y 3L3CA 1PAUB 3UI3A 5KG0A 4LF2A 5LXYA 4DR4F 2AGQA 3ZO7A 3V4IA 3DU5A 2W24A 3KHLA 1S10A 1F6TA 1M5KC 2VBYA 1IBLF 5LSRA 3RAQA 4F0KA 3PHTA 2GJIA 4HEA9 3U7JA 4ECTA 3MFIA 1RUSA 4JI0J 2HVZA 5J2NB 4OI4A 3DRPA 2EFNA 1VCTA 3VVTA 2LFVA 4ED2A 2WSCC 4NCBA 4ZLJA 5C42A 2B4PA 4QIGA 2R7XA 2LKZA 3CJ3A 1P6TA 1R0BG 5GVQA 3EVWA 2HS4A 1NZAA 3UD3P 2QYGA 4CIOA 1SXLA 5IFMA 4U7CA 3J7Z5 3ENVA 2PMWA 1RHRB 2PA8D 4WK1A 5I3PA 2FZGB 5G0RB 3E2EA 3K0JA 2RKIA 3UN2A 3G9CA 2W9AA 4FBUA 1ZETA 2CPHA 4JOUA 2FC9A 1U25A 1OJ4A 2YVSA 3CJTA 4DV4F 4DV7J 1TU0B 3NMRA 4M5JA 2UP1A 2XMVA 2C2DA 3CEDA 1QE1A 5DDQC 3K5LA 3LOUA 3CCRS 2HIQA 4DWIA 2HMIB 4DX8H 4DSJA 1NM2A 2IVYA 2N7CA 2XQCA 4K2JA 4KSEB 4Y6IA 2E9TA 2HG4A 3WIUA 4DXLA 2PI5A 1QSLA 3AJDA 3D2WA 1H7XA 2IM3A 4RPFA 5D6GA 2EK1A 2JVOA 2HHTA 2B43A 4OV1A 2M9KA 4NA3A 2CYYA 4Y28C 1FJCA 2MZQA 3KJQB 1LW2B 1BMQB 4TKTA 2RS8A 3UDCA 1X4DA 4WIQA 3KK2A 4CZCA 4NOHA 3JTOA 3AH6A 2QL5B 4PCQA 1N33F 3QMQA 2HHWA 5KFZA 3KMSA 3GJSB 4ETXA 3F56A 2EK6A 4RBVA 3EYZA 2HS0A 4AYBD 3AJ2A 2QEXS 3D54A 3JTPA 5SUHA 3T5JA 3LA0A 3I5CA 2OPQB 1FK9A 1HBOB 4RKUC 1LW0B 2GV1A 2BZ2A 1B7YB 1Q78A 4NASA 3NKYA 5IC4B 1M5VC 1U45A 5IT9U 4B17A 2A10A 4X4QA 3KLHB 2GA7A 3MHYA 3ZC4A 3SV3A 5HATA 1UZDA 4FS1A 3TQEA 3JSYA 2LDYA 1SH0A 1N6QB 2OPRB 1IBMF 3OTCA 4DPOA 1T9WA 2VG5B 2WW8A 2JHEA 3A13A 1HHSA 3NGTA 1B3TA 3DM2B 4IG0B 1SH2A 3CC7S 1AZSB 3K57A 3F0NA 4FDFA 4YB7A 5E7OB 3MURP 5L38A 2RT3A 3CE8A 2LQ8A 4WP9A 2AJ1A 2V8DA 4PWUA 3TOQA 4DFJA 3GMGA 4DN0A 3KHHA 2CQCA 2RQKA 4Q8EA 1OPZA 5AE2A 1N32J 2MY8A 2B9WA 4NXMF 1IR0A 3WHIA 3UCUP 2C2EA 3DLBA 5EWEA 1UW4A 3PXGa 5KFBA 1WHVA 3R8YA 1URRA 4BBYA 2QLXA 2ERRA 4B3TJ 5F9LA 5I42A 2PD1A 2DGSA 1HIYA 3C6UB 1AFJA 4ZIVA 3SCLE 3KJFB 2CPXA 3OQ2A 4LFCF 4WPAA 2HYIB 1QUPA 1KEKA 2XLJA 1C4AA 4NZ0A 4LFAF 3EX7B 2F4VJ 4JI6F 4M5DA 2AJQA 4RNOA 1U6BA 2CQ3A 2FUG9 2ZH4A 3IAS9 2YWKA 3NCQA 4O3NA 5KG2A 3PDNA 4RUHA 2LXFA 2R42A 4OJ1A 5EUHA 4DSFA 2KDOA 2LQ9A 4ZVRB 5C25B 4OL8A 5D4PA 4Q5VA 4JI3J 2IYIA 1RAEB 2DH7A 2KM8C 1RTIA 1TVRA 3AT1B 2IDEA 1T7PA 3NLCA 4ECUA 4N77A 5CYMA 5EX3A 1IBKJ 1XMQF 4IFVA 4OX7A 4DG1B 5FIIA 3C15A 4CNZA 4OX8A 1T8EA 3QIPB 1WC5A 5KG1A 1RTJB 1KHWA 3BO4A 2SXLA 1KOOA 2CNLB 5H1SV 2W9CB 3VV2B 1SI9A 2HWTA 4K5RA 4UQTA 2F9JA 2AF6A 1VQ5S 3Q2TC 3TAQA 1N5YB 2QTWA 1PSDA 3M8PB 4Q7AA 2AEFA 5KT4A 2W1BA 2OTJS 5CCMA 1IKWA 3HLUA 1BUXA 4O3SA 3GR1A 5D0EA 2HAIA 2NZ4A 2HHVA 3HZGA 2P6TA 1WELA 1PG5B 2GVDA 5KG4A 2GQ2A 3EE3A 2FVRA 1RI7A 4KV8A 4PWWA 4DR3J 3CD6S 3CCQS 3B54A 1PJ5A 3PZPA 2NXCA 3D66A 2DEIA 1VRUA 3DRPB 3KXDA 2R7WA 5E5NA 1TKZA 3ONQA 4ZLLA 3TZYA 4UOFA 5C42B 1OYEA 2F65A 3OFHA 6FDRA 3CF5Q 4AT1B 3B4MA 5GMDA 5D0RA 2CPIA 1HI1A 4WZMA 2J7KA 1VS3A 3EDQB 3ZTSA 4DV0J 2Z2LA 3HHLB 4A8OA 2MQMA 1ZTTA 2RKIB 5KT6A 2R2RA 3JS9A 4YMEA 2XHWA 4I64A 4MAKA 2AW0A 1SKWA 2ZOFA 2H4YB 4XO0A 5LJ3Y 1NUEA 1OY8A 1CS4B 1FTRA 2OUGA 1YJ9S 5BXIA 3LWMA 1HNWF 2YPZA 3M30B 1QE1B 1A9NB 1Q53A 1H6KX 1RLCL 1M5SA 1KR4A 3FKBA 3B6BA 2EFVA 1ZPVA 3DOMA 2R7RA 3T1AA 3UR3C 4OYBA 4A8XA 1U0HA 4RUBA 5D8HB 3TAMA 3Q2SC 4DUZF 2IPOB 2HHUA 4OJHA 3CCUS 4LRAA 5CA5A 2HFOA 1ZTWA 2XLKA 5ETSA 1FHTA 3PACA 1Q16B 4A8MP 1SL1A 2P9GA 3GIRA 5A8KA 2IC3A 3CDUA 2BUNA 3GSDA 4F02A 3T6BA 5K8OA 2KRBA 3C2PA 5E33A 1ZAWA 2W7OA 3OSNA 3W60A 4Q44A 1KP6A 4RW4A 5AE1A 4XAKA 3M8SA 4XDCA 4CLZA 1V9OA 4LFBF 4EMDA 3KG1A 2DNZA 1J5EF 2HWIA 3D3CJ 1P9QC 1FDAA 4LBPA 4OI1A 1FK9B 1YRTA 4LUBA 1NHUA 4PXDA 4WCEQ 2DR7A 5JVHQ 3J80U 1RP5A 2BW7A 4ICLB 2XCPA 2DXDA 2YTCA 1PBUA 3ZZ0A 2HQFA 1FJGJ 3BBCA 1SC6A 3MCNA 2YNIA 1Q7LB 4EI2A 8AT1B 5GAEU 4FBTA 1GK8A 2CNNB 4OX9J 1T0TV 3MEEB 5IM0B 2E1PA 3Q83A 1GTHA 4RW7B 4WFXA 2XGPA 4CLPA 1X4EA 2LLZA 3QWUA 4I7FA 2AKWB 2R8JA 5CHCB 1Z2LA 3PX4A 1XNRF 2CJYB 1HI8A 3T1HF 2ZBPA 4X66J 4DR2F 4IKAA 4QIFA 1UVJA 1UEUA 3N0VA 2UUCF 4NE9C 1D9FA 2HBZB 3LAKA 1SH3A 4DV2J 1L5UA 4O0IA 3WC2A 4MKAA 3EXYA 1R8HA 4DX7A 1Y3KA 3JQKA 1NKBA 1VHFA 3C6TA 3KG0A 4CTAB 3FSIA 4TYAA 4A48A 3PY8A 2IIHA 3AD9C 1NCLA 5HLFA 1HR0J 1AUDA 3ZNJ1 2AZ1A 3QLHA 4JV2A 2V94A 4DL5A 2WB1D 3HO1A 4H4OA 3ILLA 4C6AA 3P96A 2QZ8A 3PRDA 4RW6A 3CD0A 2NSBA 4USMA 3R5BA 4NYOA 3C3LA 1VJQA 1N5SA 3P5TL 2GHWA 1RTIB 1DURA 2YKNA 1JLFA 1FWLA 2WSFC 5SZTA 5CYMB 2UV8A 1U8SA 3US5A 2HKEA 4R25A 1X5SA 1D1UA 3C15B 4X62F 3ENWA 3HXMA 3Q24A 4NMXA 4ECWA 3D7SB 3W9IA 1VISA 5KFCA 2QT7A 3M8ZA 1H74A 2BEFA 4TLQA 3QRRA 3GFYA 4KAIA 3VZIA 3VQTA 3TNVA 3CIZA 4Y34A 2QMXA 3V6KA 1F60B 1TKDA 1GMWA 2XY5A 4WU3A 4HL9A 1I3OB 5IQQA 4HLBA 3S8SA 1AT1B 1NSAA 4FKXA 2GVDB 3KK3B 3H5UA 2UXCF 1APSA 3N6NA 3Q8UA 1XR6A 2B4OA 1HKAA 1RHUB 4QR1A 4FF3A 2WOMA 2ZD1A 4ZPDA 5F9NA 3QPIA 4LR7A 1TKZB 4X4OA 2VJVA 2UXDJ 3MMAA 1JK9B 5CQGA 1GQEA 2WB4A 3F73A 4B3RF 2AGPA 2CZVC 1KBRA 3V2UC 2L08A 1V3SA 4YDDB 5LMNF 4JI1J 4NLQA 2W01A 4UW2A 2ZJQQ 4AE5A 1HQEA 2QYCA 2ZH5A 3JTNA 1H38A 3UNGC 2W25A 2RDJA 4URGA 5KFSA 1U8WA 2ASJA 4BDPA 4GKJJ 1S0VA 3R6GB 2IDLA 2B7CB 2DR8A 2CWKA 3HHNB 3LP2A 4DHVA 4EU0A 3BGFA 4KKOB 4ITSA 2IM1A 1Q1KA 5G4DA 2OH2A 4QW8A 1SQFA 2QX0A 4HDGA 4WFNQ 4WXWA 2UU9J 3DOMB 3P45B 4LF4F 1UVMA 2XMUA 2K1RB 1L3VA 4QPXA 1U0HB 5CYQA 3ICLA 3IR5B 4I0WA 3MEGA 3OTEA 1S6UA 2RSQA 3PJXA 1CJKA 4OHZA 3H5YA 3BO2A 5DG9A 4WP3A 3I9V9 2UUBJ 1FX4A 4RX6A 5F8IA 4ZJOA 1T3NA 1PC4A 3PTWA 4QYRA 3CGIA 4RU2A 2IC3B 2VOPA 3IMQJ 2Q6BA 2C3YA 1HWKA 2CVIA 5KFHA 5RUBA 1YLXA 3M4XA 3MM5A 4ED3A 1O8BA 3IWLA 4P10A 2HFSA 3PW5A 5F8MA 2VODA 1KQKA 1C0UA 3G6XA 1Q0NA 1HMVA 4K4WA 3LP0A 5ETRA 3H4DA 4TVAB 1RAOA 1TR0A 4KHRA 2QC3A 4LIRA 4M5IA 3GZ7A 2APOA 3H2VE 2YNGA 3HT0A 5KFGA 1OQ3A 2Q3PA 4JI8F 4KBIA 4BCAA 2CQGA 2IA6A 2GMJA 2LEPA 3FCVA 2ZH8A 2AEMA 2ZH1A 1N32F 2GIFA 3GYNA 3FEXB 1U26A 4J9SA 2YNIB 1NH7A 1RAHB 2FJVA 2LXIA 3O1LA 5H9EJ 3LPYA 4B3TF 3R5CA 3J81U 3W5XA 2MKIA 2AD9A 2ROGA 5C7PA 4QYZJ 2KJVA 2R7SA 1XR5A 2RUGA 3VVUA 4OYPA 4RUCA 1KQGB 1JMTA 4I7FB 2KXNB 2V34A 3HF5A 1XC9A 3V6HA 1HWLA 4YR2A 1S9EA 1QY7A 3LP1A 4CO4A 3L09A 3T5LA 2HNYB 2E1AA 2CQHA 1K0TA 4FPRA 5CABA 2MY7A 2H65B 2CJQA 2G2OA 2XWXA 2FPHX 5B7WA 3CUNA 1QAJA 4ZVQB 2WCXA 3CMES 3RZAA 3BBBA 2L9DA 3HSZA 2VIHA 2OO4A 1XNQJ 4Y3CA 4F2RA 2W7AA 2PDAA 3V4MA 3KLGA 3MEDA 4DR7J 1S6QB 2AX1A 1IBKF 2C2OB 3BSOA 2EEYA 2FLNA 3S7RA 3C6TB 3ILJA 3E01A 2KYXA 4ZLPA 3MM7A 2BM0A 1RT7A 4LIWA 4OHYA 4DR6F 4ED1A 4LF6J 3NNCA 3FC9A 1YWXA 4GRSA 3QLHB 1HNXJ 2XZDB 3K58A 4H4OB 2YNFA 1JJ4A 1FKPA 4J9PA 1RB0A 3L9ZA 4RW6B 4DCOB 4ZJLA 4E98A 2GMLA 2ZBQA 2GS8A 3GB0A 2NS1B 4ZVHA 1WTFA 3MCSA 1VMBA 3FJ2A 2R7VA 3HULA 1RT3A 3EM1A 5D3GA 1TMJA 3FEZA 1U1QA 4O3PA 2L41A 2RHSB 5ETVA 1AA1B 5GMKa 1YHQS 2MJNA 5HMYA 5ETOA 2QA4S 4DUYF 5KT2A 3TX8A 3BH7B 1PYOB 2VFVA 1BY9A 1UVNA 1VK8A 4USIA 1JNRB 4DL2A 3MCMA 4ZCKA 1C1CB 4CO1A 2UXBF 1OY9A 3PYFA 4FVCA 1NK6A 2HFZA 3CC2S 4JI4J 4UF4A 4ZHRB 3A3OB 1MMDA 4P75A 3CTRA 2DITA 3L95X 3MR2A 3ZNUA 2I0XA 2XB2D 1T03A 4IUFA 2PMHA 2R2SA 2CQIA 2QL9B 2VQFF 3HSGA 2HLUA 1RKJA 1Q81T 2N3LA 2HGNA 4C8MA 1P8GA 1RACB 4X4SA 2LU2A 2WOMB 2PI4A 3SCKE 1GEHA 3QJJA 1FJEB 4DEZA 5EWFA 2MLXA 1NNDA 4IRKA 3RRHA 2ZHBA 2VA2A 4NX9A 3NEKA 4BWMA 4EFAC 3JSMA 3LW5C 2IM0A 1SJRA 2OD6A 2V63A 1FRIA 4I6AA 3D3BJ 1F0XA 2WW4A 2MGZB 3ZZRA 1HQEB 2X1AA 2N4CA 1UL3A 2E7VA 3HVTA 1NDLA 1HHQA 3OFGA 3BPDA 2ZDPA 1YTYA 3LP2B 3KDNA 3D1HA 5HMZA 2AYMA 3FBEA 4Y00A 1J27A 3DOKA 2BKOA 2DNHA 1VR6A 5AXKA 4GVLA 4EEYA 3DGPA 1SKSA 1UA1A 1CQMA 2VPWB 4OJGA 2XYPB 4GC6A 3PX6A 2JWNA 3W63A 5GAGU 3E8OA 3PKMA 1GT8A 2HHPA 5CYQB 3OJUA 4U67Q 4PWDA 3C14A 1S1XA 3VAMA 2ZH2A 2BJEA 3QZ8A 3EZUA 2OD4A 1CJKB 3M05A 5IC6B 3BGRA 2CQ4A 4OZJA 4M5MA 2WZ1A 1E6YB 1L3TA 3GV8B 1JLAA 2R8GA 1S48A 3O6QA 4IG3A 2O1PA 3LALA 3MM5B 5HP1B 2AX0A 2VH7A 2C2ZB 2ZITA 1U7LA 4P2SA 5LOQA 3DC2A 1WSRA 3SSRA 1HMVB 4B3SJ 2HIYA 2OKQA 3LP0B 1HNZJ 3FRYA 5HL7Q 2QLWA 4LREA 2WVBA 2DXFA 4EYHB 1FRLA 1X8DA 3MR7A 2Z8QA 3CVKA 1ACMB 1FXDA 1HHTP 5KFTA 4F4KA 2G2YA 2YNGB 4NI2B 1JLCB 2BANA 3B8HA 2KZZA 1Y4ZB 3NMAA 2HS3A 1X4HA 2RDDA 2WVCA 3GFZA 3NAIA 1MLAA 4QBUA 4DR1J 2EG2A 5KFVA 2ZVIA 5DGAA 1RABB 1HWUA 5JUMA 2MMYA 2DEJA 4CLWA 3U1MA 3PJ9A 4B9MA 3EDRB 3CNQP 3V81A 4DV6J 2QMWA 1FERA 5KFKA 4LBIA 3DMJA 1YBTA 3OFEA 2E5LF 1S57A 4HDHA 1RE1B 5B0FA 2JEIA 4HT7A 3GFHA 1SJ1A 1A7GE 2DHHA 3GQCA 2KB2A 4DV1J 2F4FA 1S9EB 2I6WA 5BJRA 3LP1B 1NPRA 4WBFA 2G4BA 2YPYA 1RA7A 1LWXA 2J5AA 4JI7F 5IT9Y 2PMZD 1PJ7A 4RW9A 4B3MJ 2CJ9A 2KKHA 2HRYA 2OPSA 1K73T 3EGZA 3CJ0A 2F9DA 3BKFA 2ZKUA 4Z37A 5KG5A 5D0HA 4ZP9A 5L1JA 3DOLA 4ZDNA 2L9NA 1DTQB 4RNFA 3M2UB 4CLTA 3KLGB 2ZJRQ 2VOOA 1U47A 3MEDB 3TA0A 1P9YA 2DXEA 2HHHF 2W2OP 4WTOB 5KFFA 2ZBCA 1TMMA 2MZ1A 1NDKA 4B3OA 3E01B 3CJRA 3THVA 2J8SA 3MM7B 4UZBA 4X4TA 1RT7B 2A2DA 4MIAA 3TJ8A 2YH0A 2M88A 2VUGA 2QJ3A 2HVDA 2HQGA 4RL1A 2YNFB 4TU8A 1DFDA 5C2CA 5LXRA 4I56A 3R5JB 1WOSA 3MEKA 1RWVB 2KM8B 1QUVA 4V19X 3V6DA 3Q8YA 4CLUA 4NXNF 2V8GA 3ZZZA 2B6AA 1VQ4S 3OUYA 2EBEA 1VI7A 1WSVA 1RT3B 3MPYA 3SQOP 2G1DA 1F3VA 2VQEF 3BGLA 5F41A 1V5IB 2E9ZA 4A8FA 3BYPA 3ZFVA 3FZ2A 1IN0A 1DARA 2X1GA 3CCZA 4UZCA 1RA6A 3SSQA 2ASLA 4F3QA 4FF2A 3MOJB 3VQSA 3AB4B 1B70B 1KD1T 2A0FB 3SXLA 1E6VA 3IN5A 3JQMA 4UUWA 1Q5VA 2CAJA 2DBBA 1JLGB 1U1NA 1EP4A 1U0SA 5E3QA 1UZHA 1YJRA 3PFOA 4JI2F 3OHAA 2CPJA 2H4WB 4Q43A 4AL7A 3MWBA 1EHWA 4OHVA 1T03B 4GO5X 2C2KB 2KVQE 3W8PA 2YWWA 3OLAA 3QGIA 1CJUB 5JVGQ 1BLUA 1XMOF 6FD1A 1GXLA 4P52A 1FRMA 1LWEA 4Q8FA 1VLOA 2IVMA 2VG6B 2V2ZA 3OTOF 2NYHA 4U96A 3RR7A 2OJ3A 2IJRA 3FNNA 3A3PB 2IAJA 1SKUB 5KOWA 3MF5A 2D3O1 3A8KA 2Y0BB 5M2PA 2VJUA 2VB6A 3X3UA 4Q0BA 1VGYA 4CDIA 3KOAA 4A8WA 4F2SA 4RW8A 4DS5A 4ER8A 2MQPA 4DU7A 5K8NA 4NEYA 1NZ8A 1TL4A 3HVTB 1IQTA 5GAGI 3TUZC 4TXSA 4CT9A 2NR0A 4OMFG 5J1NA 3NL0A 4LSNA 5KT7A 4ECXA 2PT0A 2DR5A 1NKCA 4B02A 3CDWA 2KFZA 3QT5A 1GAOA 2EVZA 2NUUG 3DDNA 3DOKB 5T41A 3CCMS 1C0TA 3DGPB 2BXJA 1D0EA 3FCHA 2QMUB 2V4JA 3OSPA 3OXGA 4ED7A 5M2RA 3RW6A 1VHIA 1XK8A 4CI0B 4IQMA 4PUOA 4PWDB 1S1XB 4QIWD 2GX8A 1CVJA 2BVZA 3KLVA 2IJFA 2FVPA 4QWBA 1HYSB 5ETMA 2CDQA 3BGRB 2YBVA 4DN9A 1FFGB 1RAJA 1HL6A 2EFGA 4TY8A 1H72C 4MFBA 2QRRA 3DRRA 1JLAB 4ECZA 2EKYA 1T9UA 3OR2B 4AL6A 4KIAA 3VZHA 2XG8A 3K8WA 2HHQA 2YNHA 3NCRA 1A6LA 1RHQB 2MQOA 2LQJA 2AU0A 3FFIA 4BWJA 1X4CA 1FNXH 1YI2S 2IBOA 2O66A 4KT0C 2ZH6A 5IXUA 4RU9A 5KFDA 1HBUA 1WC6A 2HQIA 2CADA 4KHPJ 2DHAA 2BANB 2RD5C 4H4KA 1RWPB 4USUA 2V9WA 3Q22A 2HZVA 1RBOB 4G3IA 3ZTPA 3W61A 1N54B 2Y3YA 1FRHA 5IS2A 2OPPA 1AFIA 4OI0A 1Q5YA 2RRBA 5AJ3F 3UCGA 1KQSR 3B82A 1VQKS 1OQ6A 3HD1A 4ID5B 1WOPA 4I4BA 3W9JA 2MKCA 2BABA 3O8WA 2DYAA 4OYAA 1DJ0A 3V81B 1RT2A 2JNJA 1Q8IA 4YHHF 1VBXA 4B9NA 2D3OR 1HI0P 5KG3A 3TW0A 1LXNA 3KUGA 2ZZMA 4W4MA 3J80Y 4F04B 2YH1A 2WRMA 4JV1A 3IBWA 2CQ1A 1MWQA 4C0BA 2GW8A 3R2CJ 2OPSB 1S4FA 3FUYA 1M5HA 4X4UA 3ENQA 4MIBA 1NK5A 1F9EB 4K0KJ 3TVKA 1ZOTA 5KFEA 5KFXA 2FLLA 4LRFA 1WACA 2V67A 3E51A 4OYWA 1WC1A 4K4YA 3A4TA 3W5YA 2XNRA 2KXFA 5B0DA 2KJWA 3D6FB 2J8AA 4DUTA 3BR8A 4PQAA 4ELUA 2PSZA 4BLGA 2BMBA 1RISA 4B3OB 3FVYA 4DQQA 2D3ZA 2MZTA 1FDBA 4P2MA 3I9ZA 2HVIA 3A8EA 3KYLA 4LF9J 3QT7A 1H2TZ 2DNKA 4NZ7A 4NLRA 4ANCA 4P73A 3L4BC 2FVCA 2MXYA 1KTQA 1RCXB 3EZ5A 2GQCA 2C3PA 4V1Ak 4B08A 2GVZA 3R5DA 3V6DB 2UUAF 4YFUA 5KFIA 2GJ2A 2FHJD 2B6AB 1G6BA 4E8UA 5H9FK 5C2GA 4LBHA 4J9QA 2UVVA 3FRZA 4GKKF 3ZZUA 2A18A 5B09A 4N8NA 4H4MA 3SBMA 1KQFB 3P5BP 1GNKA 1PILA 2QN6B 2W9BB 1R8AA 4BHQA 1MMLA 1N4LA 1U1PA 1L3UA 4P9SA 2MTLA 4LF5J 1WEXA 2XMJA 4MT1A 2KG1A 1VQ9S 1U6ZA 4RZRA 2QO3A 2XZWA 1SV5A 2CQ2A 1JLQA 1W2BR 4JP8A 3K89A 3MR5A 4HT5A 4OHXA 2VKRA 2B56A 1E6VB 2YWGA 3MM8A 4ANDA 4DL4A 3CJSA 1MROA 3H5SA 4R0JA 1EP4B 4H54A 2MQ8A 1ZA2B 4ATNA 1MN7A 2LQBA 1REVA 2RQMA 3DDIA 3HSJA 2XY6A 4CO5A 3OR1B 3VCDA 2VFRA 1SUQA 7FD1A 2P2CB 4QWEA 5KFUA 5J1PA 4YR3A 2DHSA 4KFBB 5DZ6A 3KTQA 1UFLA 2YKPA 4IFYA 2CZ9A 2Y1JA 1LWEB 1HNIA 5F8JA 4C0OC 4J9OA 3CIMA 2CPFA 2XEXA 3IXQA 3OT9A 1HQUB 4GMKA 3L7PA 2ZBIA 5E3AA 2IAJB 3UO0A 2QSWA 1ZAXA 3P4UB 3HI9A 4OZ0A 3SDEA 4Q0BB 4MTPA 1TTHB 2VPXB 5KFWA 5LT5A 4FXWA 2F1FA 5IV4A 2K3IA 1RHJB 4F4AA 1Y0HA 3LF0A 3K17A 3CC4S 4LSNB 4JV5F 2MPUA 2BJ7A 3QBCA 3K8VA 5F8HA 1YJTA 2XULA 1TFWA 1RAAB 3K59A 4KGZB 1XBWA 1YITS 1R3NA 1C0TB 3JAMU 1IKYA 4QIVA 4B3SF 4I67A 1YBAA 5D77A 2GHVC 5I3QA 4ZPAA 4WKYA 4PUOB 2FJBB 1NPKA 3SEOA 4FKYA 3CCJS 2MSSA 2IFXA 1T9XA 1MU2A 2ROEA 1OPIA 1V3RA 1AYEA 1NDPA 4MFBB 3EPIA 1S97A 2DHGA 4GVBA 2O3DA 4IRDA 2E7WA 4IQXA 5JMNA 2IHR1 2JVRA 3H0PA 1UA0A 1EJ7L 1HW9A 2YNHB 1M5OC 4M94A 3IBFB 3PR4A 2OGUA 4U7UK 3EGWB 2AT1B 2VDIA 1T94A 3FFIB 1WC4A 2C42A 3ET6A 3U27A 4DV1F 3OXFA 5HK4A 3T9NA 4PAAA 2E9RX 2K06A 4YUDA 3R6LB 1T05B 3SFGA 2PO4A 2CG8A 4TLRA 1SVDA 1U1MA 1TP7A 1VC0A 3N01A 2HRUA 2I5JA 1X4AA 1TK5A 1DAXA 3S01A 2GO8A 4C7QA 3MPWA 3T6JA 2GHPA 3M2VB 2PFDA 1XR7A 1IR1A 3PEHA 4XIUA 2OPPB 2ZM6J 3BQ0A 2BJDA 5E2QA 2NXJA 4Y2KA 2IRXA 2XTJP 2BBEA 1V5VA 4TQRA 1NJYA 4DL3A 2VBZA 3NBPB 1S76D 4ZPWR 1H2VZ 2XS7A 4KH1B 4YOEA 4F3MA 4USJC 2DR6A 4KB7A 4EWTA 3DHXA 2DNYA 2DY1A 3W65A 2UUWA 3I4PA 3KMQA 5M2UA 1VQSA 3G82A 4QU6A 1B7FA 2FB0A 3BGUA 2KT2A 5B0EA 4USTA 2FZKB 4M5LA 3CJ2A 2ZOMA 2AJ0A 5DDOC 3J81Y 5ETPA 2XS5A 3KUEA 1RCOB 3UN3A 3T1YJ 2IY5B 4NRTA 2R7UA 4NLYA 2MQQA 1PYSB 2C2RA 3CDBA 2VDHA 4U7UD 5AXLA 3BS9A 2LMIA 4OI3A 4F4YA 3AXMA 2XLIA 4R8UB 4ZCIA 2CZ4A 4I1TA 2ZHOA 4YB1P 4TYBA 3G96A 5D4LA 1RTDB 1NEEA 2NPFA 1T02A 1WTBA 4AL5A 2GC8A 1ZYQA 3NGRA 3RU0A 5A8RA 4UOGA 4R5PA 2RUSA 5IV3A 4DV3J 2KH9A 1XMBA 5DQGA 1WKLA 1U2FA 1HD1A 2RU9A 1UEKA 5K8PA 2DCUB 4CLKA 4X64F 1BQNA 3D5MA 3OD2A 3BQ1A 3I4HX 4YP3A 2AJ4A 2FZCB 2LVWA 3G71S 3I96A 2EFQA 2VG7B 3GIIA 1QSYA 1B0VA 4KTQA 4ZPTR 1B4SA 2DPJA 4TY9A 2ZUGA 1SV5B 4M8LA 1NJXA 1BHNA 4OZLA 2M8HA 2ACYA 4P7TA 3NRBA 3MM8B 4ALZA 4TU9A 2J6TA 1EAYC 1MROB 2Z0GA 4IDKA 1QM9A 3R3TA 3CB4A 4K4SA 1REVB 2XHCA 2XMMA 5HQMA 2KYZA 2G13A 2C3UA 4U9RA 3OW2R 1QDUB 1SUQB 2M70A 2DNNA 4NLXA 1KWMA 3VGUA 3CCLS 4C8OA 2E66A 4A4JA 2KRRA 3OTBA 1Q95G 4IFYB 3EZOA 4F7VA 1HNIB 3PYGA 2ALYB 3IWXA 2COLA 2VD3A 4DV5F 3KJVB 4CCHA 2RMLA 2NLWA 2WBRA 4UQGA 2V50A 4ECSA 1W25A 2IA0A 3NG8A 1WI6A 3D28A 5KTQA 1SQEA 5D78A 2J0SD 3TZWA 1RWOB 3WX4A 4ES1A 4EO6A 3PKYA 1RWUA 1Q7YT 1V3ZA 4XTTA 3MR6A 5DLFA 3I0RB 1TUWA 2XGQA 1F9FA 1IKYB 1OWXA 2NCKL 3MOZA 2AWZA 3SI8A 1PGZA 2YKMA 3J7YU 1X9WA 1ZM3A 1YGYA 1EIYB 3CW2C 1WG5A 1I6JA 2XSJA 1RWNB 3AOBA 3TJAA 2Q43A 2MJUA 2DNGA 2JC1A 1UPMB 4F0MA 3NS6A 2P9EA 3QAUA 3M1VB 4K7QA 2OIHA 5K9FA 1NK8A 4B9SA 2CXEA 3DLKB 4FYDA 3MR3A 4USHA 3J7AN 3D1QA 2HAFA 1VQYA 4DR4J 2Z2ZA 3VTIA 3HFKA 2KI2A 3H4BA 2VPZB 2V5HG 4DS4A 1FEEA 4GVBB 1HWJA 4RNNA 1FD8A 2FJDB 1IBLJ 2MDAA 3IM8A 1F9HA 2JDJA 4EBEA 1HQ2A 3GLJA 5DO2A 2FJXA 3BO3A 2RVJA 4ZVEA 3W1YC 1FFSB 4I68A 4N76A 3QJPA 5D15A 3J7ZT 2B5JA 4Z2XA 3ET6B 1RWKB 2DGXA 1R6YA 4ES3A 1U49A 1I94F 4IOBA 4KPCA 3ISZA 4P71A 4IRCA 3H40A 4K4TA 5T7LB 2BJ8A 4XPCA 1FTCA 2DKOB 4KGVB 2I5JB 4DF4A 2CPZA 3MCOA 5T14A 3ZZTA 5L39A 5K5MA 4K59A 1FEHA 3LTOA 4UUXA 4DV4J 4PXEA 5HQ8A 2KHDA 1VK3A 5LL6d 5HROA 3OL6A 1K1QA 2DRBA 2P9CA 3IGVA 1TZ0A 4WFZA 4EGLA 4PR6A 4A8KA 3PRBA 2AMCB 3PRVA 3MZIA 4ZIWA 1WJ9A 4LF9F 3D6MB 4O0NA 3EGVA 1LQ9A 4DPXA 2HHXA 3RRGA 1RWMB 3A3NB 1H98A 3G82B 1F1BB 5GMEA 3BBFA 3EICA 3H90A 5KFPA 3AOAA 2JH3A 3FQLA 4GC7A 2V2VA 1RT5B 4O3OA 1H7WA 4FN5A 1YRXA 1RQ0A 4HHUA 1NKEA 2MKKA 4G65A 1N33J 3SQGB 4WE1B 2KU7A 3MM9B 3HZEA 3MMBA 1Y5LB 2JFKA 1SJ3P 1XERA 3C19A 3DI6A 4LF7F 1FA0A 1TL5A 2PA3A 4J7CA 3BYRA 1NJZA 2PEBA 2GNKA 3M6VA 2HBRB 5HN0A 2ZC4A 2B7BB 4ELTA 3IAM9 1TKTA 4MKVA 3CJQA 3NGDA 5LMUF 1QAIA 1K0VA 2LXUA 1NBEB 2KT3A 4ERDA 4IR9A 4R5PB 3ILIA 3BN4A 5F0UA 3V4IB 1XTZA 1H2UX 3AAWB 1BQNB 3DYAA 3EVOA 2NQPA 1IBMJ 4NPOA 3G8SA 4O44A 1CBKA 1BE4A 2F40A 1NB7A 3MECA 3GJRB 2ALZA 2R8HA 3HVRA 4F67A 1RU2A 1G7CB 1ZPWX 2XYHB 4F25A 2KTQA 2RU3A 4DQRA 1NJIT 4ZVOB 2DO4A 1NHVA 3GJTB 4DLEA 4U8VA 3JSBA 4IDKB 1TL1A 5KFYA 3OV7A 1G2EA 4LF8F 3UVJA 3QFWA 5HSPA 2WVFA 4ENOA 2FGOA 1VC5A 3AQOA 2HFVA 1S72S 1VBYA 1UWBA 4NXMJ 1SJFA 2VPYB 4WYLA 5FD1A 2XMWA 4P74A 3CT9A 4NLVA 1FRXA 1VYAA 1QVFR 2BR0A 4RNMA 3JQJA 1OYDA 2YX1A 3IGNA 2FY8A 3KNGA 1ICEB 1CULA 3PIOQ 3KLFA 2HFNA 5A2QU 3MMJA 4U6PA 4LFCJ 3NWGA 4LSZB 7AT1B 3WZ0A 3VF0B 5CCLA 2XC9A 3I87A 4LFAJ 3GE9A 4JI6J 1R27B 4Y0FA 1S7IA 2EPIA 3J7YI 1XIQA 4NLTA 2MKJA 3TZXA 1NSQA 3VAIA 2W4DA 4AQYF 2VV5A 3GWCA 2XMTA 4HKQA 3OVSA 3NNHA 4ZLNA 1EKSA 3HD2A 1Y7PA 1YG0A 4K8RA 3KK2B 5KAKA 1GFWB 2Z4PA 4PZVA 1D8ZA 5J2NA 1WG4A 1AXQA 5IWAJ 2EBGA 3DXSX 4USKA 3VWSA 4DBQA 1U2CA 4HR2A 3QRQA 3OL9A 2BRKA 2D3UA 3H20A 3DLHA 5MAOA 1RAIB 2XSJB 3GCWP 1M1GA 5BR8F 5E0OA 4DX5A 4I2PA 1Q8KA 2MB0B 2B9XA 2HQCA 4NLPA 7FDRA 4IOCQ 1CEZA 5G0RA 2CKWA 3P8BB 3H7HB 4P2FA 5FLXU 3UPFA 3UN5A 2AYEA 2VF3A 4FYYB 4A8SA 3VGVA 1DHMA 4UT4A 4YS2A 3BB5A 4PKDB 5B0GA 4DOZA 1O0PA 3KLIA 3W62A 1QAXA 4ANEA 4X65F 1TQLA 3TVYA 2H48B 3MTKA 1LFWA 3AA9A 1VRQC 3N5BA 4JYAF 1FNOA 5CZXA 3MM6A 3R97A 4F0HA 1YDLA 3NGSA 1RDRA 4MKYA 3O5TB 4IO9Q 3HM9A 1NMEB 1N56A 2ILYA 1TL3A 4ZCLA 3CCTA 4CRJA 5E3PA 2DGUA 9RUBA 3ITHA 4ZKAA 3SV4A 1F5BA 3LWLA 2IMOA 1H0HB 1N52B 4UY85 3FSYA 4ZVFA 1N5QA 1HNWJ 3T1YF 5HROB 2DNOA 2EXUA 4FXDA 4NLWA 4C11A 2R8KA 3IG1A 1TK0A 4FF1A 3MD1A 4A47A 1WF2A 3IR7B 1H3DA 2DTJA 4U8YA 4OI6A 1Y9OA 1JJ2R 2Y8YA 4Q2MA 5I42B 4L3NA 2CJKA 1NLKL 1SJQA 2CQPA 1FNMA 1U02A 3QSIA 4HACA 5EX0A 1EQ0A 1YKWA 1X0PA 3JYTA 2V8HA 4Q2LA 4M5DB 3CJ4A 5KFQA 2B3TB 4NMLA 2XI2A 3HKZD 5J2PA 4WZQA 1WHYA 1U1LA 3R9LA 3WBZA 2U2FA 3QGHA 1S49A 4ECRA 5A6PA 1VQOS 3MI7X 1UJ5A 1SIZA 2EW9A 3OFFA 2C2NA 3TRGA 3MMCA 2DGOA 2CUYA 2XS2A 4JI0F 1TVRB 2E29A 3ADAC 1S4EA 3MMBB 1WI8A 1FXRA 8ATCB 2HURA 4IFVB 3AJ1A 4LFBJ 2AQ4A 4PG8A 1J5EJ 3HHDA 3MGJA 4IG0A 3A8JA 1ZZFA 1YJ7A 1PIEA 4RJVA 1RBAA 2R3VA 3I32A 2BOPA 2VZ9A 4JB8B 1WNEA 4KPYA 1TKTB 1IBCB 3QJLA 2XY7A 4CO3A 5F3TA 2FJAB 2DVIA 5MLCV 1IKWB 3PX0A 4KC5A 3FK4A 3ELHA 1C4CA 3T19A 2MHEA 2YKQA 1TUGB 1IM6A 1TAUA 1S79A 3DYAB 4DV7F 4KE5A 2VFSA 3Q8SB 3NP5A 4O44B 5DG7A 5CAAA 3MECB 2ZWOA 4KV8B 2DRDA 3HFVA 2NREA 1UAWA 2XCAA 1VRUB 4NLOA 1XQIA 2NPIA 1NSKL 3PCOB 4A8YA 2D41A 1P1LA 1YJNS 4LVOP 2YY3A 3KJNB 1TL1B 2CNOB 3HFZB 4Y2IA 1XNRJ 4F50A 4DSKA 3PW4A 2Z56B 5HMWA 3R27A 4DR2J 2UUCJ 1YRUA 2IRUA 4PG6A 1FDNA 1UWBB 2DGVA 1UMJA 3DN9A 1DZ5A 3NWRA 4NLDA 4A46A 5CZVA 3Q89A 1FT8A 1FVQA 3DFEA 4J5OA 1AB8A 1A0OB 2E5IA 1UVIA 2Y1IA 1AROP 3N4WA 3WIVA 1EQMA 3BH6B 4J90A 1YIJS 2EC2A 3VR1A 2A6MA 1P1TA 2YQ3A 3KUHA 3PJWA 1ZM9A 2JLFA 3PYEA 1SKRA 3TAMB 4OYMA 4QCLA 1X9SA 3W66A 1N5YA 2O5DA 3M8PA 3PFEA 1JXVA 1S0NA 4OLPA 4ZPCA 4QR0A 1PKUA 4OIXA 1FKOA 1O51A 3V5RA 1OSDA 3IWNC 3EUNA 4GO7X 5A8KB 4Z7YA 3LGMA 3LO3A 5GADI 1PAEX 4E0DA 2GZOA 1VQ7S 4EZ9A 2DPIA 5D4NA 3F44A 4O4GA 3Q8VA 3PW2A 1PCAA 3M6XA 2QV6A 4RW4B 4X62J 1DQ9A 4ZJQA 3TUPA 3OHBA 4I2PB 3KWMA 2XMAA 2JEFA 1S6OA 3D0GE 1R8PA 2V69A 1C2PA 2MZJA 4LT6A 3HHLA 3QIDA 3QRPA 2QA2A 3HSDA 1UVKA 3GCXP 4Y65A 2LYVA 4WIIA 2VASA 5KFOA 4ZCMA 3FSXA 2MKSA 3D0IE 1Q79A 1X31C 3DU6A 4WFAQ 3IM9A 3TA1A 2VBXA 2FQQB 3M2RA 1CS4A 3JAMY 3ZZOA 4KYZA 2NXEA 2V8VA 4H4KC 2UXCJ 3M30A 3RB0A 4J9VA 3KLIB 4AXIA 1WKKA 4PQUA 4PABA 1FKAF 4RWXA 4FS2A 4HVZA 4K4ZA 4URSA 1KN6A 2K7JA 1VQLS 1URNA 3NXZA 2PC6A 3MM6B 4B3RJ 3GPAA 3Q8PB 4L3KA 3PM9A 3TVZA 4OQJA 1VQMS 3NCPA 2YKOA 5E41A 5LMNJ 1FRKA 4FP9A 2A6OA 5H9FJ 1TL3B 2F4VF 4DLGA 1FE0A 1X60A 1S1UA 3ITHB 3D4JA 1L3KA 1JJCB 2W8KA 3CO0P 4U95A 4XK8C 4ZPBA 2QFJA 4CO0A 5F3ZA 2MZSA 4C11B 4QPTA 3IG1B 4JI3F 3ZXWA 2R7TA 2Z58B 2ZUAA 1KLMA 4C0HA 4LF4J 1S1TA 2POKA 2K2PA 3UDLA 1FRJA 3IFEA 2PFFB 1DBDA 4IH7A 3QT8A 3G2XA 2ADBA 4PYAA 5HLFB 3FDSA 4ZN1A 2OSQA 3TEHB 4HACB 3D1OA 3JYTB 5CXTA 4DF8A 2KXHA 4NRUA 5I4MA 3FZBA 4NL5A 2DY9A 2GO9A 4F4ZA 4OJ3A 2DD8S 4ICLA 4CM2A 5J2QA 5A6WA 5J2PB 5ETNA 2DGTA 4P7VA 3HHLD 1SCJB 4J9RA 1ZS6A 4HTIA 1RK8A 5KOXA 2RF2A 3QNWB 3FBCA 3CJ5A 4DFKA 2I2YA 3IA0A 3MMCB 2UVUA 3BM7A 4IYQA 1IR2A 4DR3F 1S9GA 2YKNB 2ZWPA 1JLFB 2ZVSA 3MEEA 2AIRB 5IM0A 1HWIA 2JJ4D 2B4VA 4NLSA 4RW7A 2DGQA 2P8IA 2DRAA 1JQGA 1MNEA 2AYBA 1X5TA 4ZVUB 1GXTA 1HFEL 3S1TA 3MFHA 3DLEA 2AP6A 2HZCA 3FEYB 4LRBA 4YB5A 2DO0A 4ZA1A 1ELOA 4JI8J 2U1AA 3W5ZA 4DV0F 1V6HA 2RQCA 1O5JA 4ZVPB 4JI5J 2Q1LA 1NK4A 2W2NP 2R7OA 3H2LA 3U1NA 3PW0A 3R5GA 4E2FB 1RHMB 3NOGA 4MIWA 4HI1A 2GGPA 5A8WA 2GJFA 3SCJE 3DLJA 3AA8A 1UW9A 1R43A 2OMLA 1UWAA 3RBEA 2OTLS 4OV6A 1X5PA 2OMOA 2HW3A 1YVFA 2DR9A 3OVBA 2F8EX 4C97A 3U02A 2ZD1B 3MPUB 3RBDA 3ETMA 4CTAA 3FGVA 3HJFA 3MMAB 1RYSA 2RS2A 4CP5A 1WEYA 2VFTA 3Q86A 2FC8A 3P6YC 2W7PA 1R7IA 3ENAA 1IQZA 4J91A 1NXIA 1WORA 1T11A 3IO1A 3UW1A 3N6MA 3G8QA 3DLGA 1K9MT 4WF9Q 1ROFA 4PG4A 2J9EA 1CC8A 1EX8A 2W4PA 4M5GA 2Q79A 3K5NA 2M7SA 1U1RA 2H3EB 3UE2A 5IWAF 2FVSA 2J7WA 5J1EA 2ATCB 4DQPA 1RLDA 2ABYA 1FJ7A 4HHJA 4C48A 3FBBA 3J7A1 2LP4A 1PBAA 1UP1A 3TUJC 4DR6J 2J9DA 3BV8A 4PPDA 9ATCB 3H8YA 3MEGB 1GMUA 3DGVA 4Q45A 1MSWD 3ISND 2O67A 4W98A 4WJBA 5DQIA 1FKOB 3KHGA 5BYRA 3D9BA 3KK3A 3EJMA 5B0AA 4O23A 1FJGF 2VFUA 4R0EA 2EI5A 2I9SA 2XMKA 1RJJA 4NWBA 1N5TA 3TARA 1Q4RA 3VAGA 4KGMA 2EKNA 4O4GB 3MTJA 1VQ6S 4OX9F 3KLEA 1WHWA 2NZCA 4MYUA 4OYZA 4QW9A 2VC1A 1C0UB 4IO1A 4S0MA 2X51A 2JC0A 4DUYJ 3NY0A 2HVEA 4ED6A 3ILOA 2LDIA 2CJXB 3A8IA 5KFAA 2B0GA 4F4WA 4MMOA 2UXBJ 4J9UE 2JRSA 1I5OB 2CIMA 4LR9A 3M9MB 2W8LA 4X66F 1GMVA 5K20B 1GH8A 3M2RB 4DV2F 2VQFJ 4KKOA 1RKIA 3T9ZA 2B8PA 4ZITA 4ELVA 5DGBA 4PQUB 4WKRA 3I6PA 3F41A 2AJFE 2JZ5A 3LANA 2K1RA 3WQPA 1VJWA 4LQ3A 2BX6A 4FNIA 1Q82T 2AZ3A 1HR0F 4EK2A 2MLYA 2PE8A 3KK1A 4FNHA 3I5AA 1LKZA 2AHOB 2ZNYA 1GX6A 1S1UB 2DK2A 2EG1A 4RLEA 4WTYA 2GFFA 2HVHA 2DISA 5F0WA 1RTZA 2NYIA 1GTEA 1VC6A 3FMWA 5HANA 3PG9A 1HNVA 2JL9A 4C2MA 2HQDA 4N47A 2W2PP 4B9TA 3HPOA 2ZDOA 3C46A 1TAQA 4QWCA 1Y3JA 1UJ4A 2BE9B 1AUSL 3GILA 3TJ9A 5KT5A 4FYVB 1KLMB 3GJQB 2DNRA 3TUIC 1S1TB 2Y0SD 1MW7A 3BF4A 4C3KA 1KHVA 4CH1A 2R9LA 1FCAA 4MK9A 4PXCA 3ZTRA 3D6TB 3QATA 5CYJA 5ITHA 3K7RA 4L74A 1O6XA 4XDDA 4OZ2A 2EFPA 3M9NB 1LXJA 2HFUA 4C8YA 1NU4A 3CSKA 3QT6A 2HGMA 2QLBB 2E1CA 1JX4A 3RBXA 3C66A 5DETA 1FO1A 2C2MB 2M5YA 2UVRA 2MEWA 1IWGA 3H42A 3ZTOA 5J2QB 1M0SA 2UZAA 1FKPB 1R8BA 3TA2A 4LQ9A 1WD6A 3OXLA 3KFWX 1RT6A 4KQZA 1F5AA 1KRPA 1IKXA 4RBTA 2RF2B 4EO8A 3PVXA 1JIHA 4A8QA 3AD7C 4NCGA 2LA4A 3DNCA 3C8YA 2WTFA 5BYSA 1F2GA 2CQ0A 1S9GB 5D3GB 2IYGA 3MXHP 1GX5A 4Y2AA 2PGCA 3TX0A 1EZZB 2UXDF 3PW7A 4OYOA 2N4DA 2IM2A 2GAGC 1YQHA 1QTNB 3MAHA 2HNDA 4K4VA 2BDPA 4KH0B 3VAFA 3DLEB 2HNYA 3DKDA 3NS5A 3IRWP 1B0TA 4WYWA 4JI1F 2M3DA 1TELA 5KG7A 1HD0A 5LM7E 1ZZNA 1TKXA 5IT0A 1H73A 4F36A 2LU1A 4GKJF 2D7SA 1S9FA 2GGPB 3HHKA 1Q8LA 5A8WB 1G1XA 1EARA 2HZAA 2KO1A 1WDTA 3TYTA 3WDOA 1WC3A 1S6QA 1IM4A 5E3RA 1G3OA 2KG0A 2Y1LB 1NB2A 2Z2MA 4ES2A 2V0NA 4PRFA 2P5VA 2UU9F 3GTYX 1R6VA 1ZBTA 3RJMB 3DCAA 2E5LJ 1Z1ZA 2R2TA 1N5VA 2RNEA 2E5HA 4ILMA 1X0FA 3UQSA 3TWZA 1KFDA 3JSMB 3HKWA 3RW7A 4ZOSA 1FE4A 5IT4A 1KONA 2JEJA 4JI7J 3M8YA 2J9CA 4EBDA 3ZTQA 3QO9A 4FPIA 1J2VA 2MQLA 2UUBF 3S6EA 4N56A 1UTAA 3DLGB 4NLGA 1OO0B 1Q8BA 4IH5A 1DRZA 4CWBA 1U24A 2QA1A 3QAEA 3BSNA 2MKYA 4K50A 1LFPA 1KVJA 1VQNS 2HHHJ 1LNQA 5D0GA 2ZNZA 4C9DA 5J1EB 3AXKA 3PNIA 5KFNA 1VQPS 2V4RA 3CCES 2M2BA 3GP9A 1ZH5A 3H2UB 1NAQA 4YN3B 4DQSA 1IUJA 1DTTA 2H1YA 1C1CA 3BR9A 1BQMA 2C1EB 3C14B 2BOAA 3GV7B 5DM7Q 2YQ0A 2FHKA 4ZHRA 3MD3A 3CMAS 1FWKA 5DQHA 1NO8A 1U1OA 4X4NA 5L1KA 1JLEA 4NXNJ 2Y8WA 4F26A 1J5OA 2D69A 4KY3A 3LAMA 5BYQA 3RGIA 2WVDA 5EN1A 2FD2A 4HH1A 2OHDA 4DDFA 4L6V3 3BDEA 4IG3B 2BKNA 2QA4G 4AXJA 3LPEA 2VQEJ 3KG4A 1RXOB 3KLEB 1YJUA 5A2QY 3OBIA 2R8IA 2Z2YB 1BXNA 4B9VA 2RILA 3GSIA 3DXBA 1KTVA 2ACMA 3O3LA 4B9LA 2N7YA 2ZH7A 4CLSA 2DNMA 4F4XA 1I51B 2LA6A 1RAGB 2ZEJA 2MGZA 3O44A 1LWCA 2BJ9A 4G1IA 1Y5IB 1R89A 1K1SA 2A1BA 1VQ8S 4CM0A 4WU2A 4P2XA 4JI2J 3VHQA 3CCVS 5KFJA 1TK8A 4DPYA 2FHJA 2RE1A 3BEGB 4USVA 1YX2A 2HEKA 2G1HA 4IH6A 1XNQF 3JB9k 3N28A 3M8QA 4RWWA 1RYRA 1XMOJ 1T9YA 1N34J 2F8HA 1FF2A 2BKPA 4DR7F 3OTOJ 2H54B 2KZMA 2C3OA 3UWTA 1S1VA 3PEJA 3H25A 3DDKA 1BWEA 4KJIA 4M1KA 3DMJB 3DRXA 3UR0A 2E7XA 3KK1B 5FLXY 1K44A 3BSAA 4LF6F 2CPYA 5C5JA 4DFMA 3B78A 1HNXF 1E6YA 2RQ4A 2YX4A 5DJBA 3UNYA 4RW9B 4NA1A 3WX8A 1HNVB 2HGLA 1BWVA 2KL8A 1U1KA 3DOLB 5HP1A 4DSLA 1GMWD 3R7SB 4X4VA 1F2HA 2Z57B 2FIUA 3LH2S 3RB6A 2AEJA 2ILZA 2Y9HA 4YQWA 2D9OA 1UFKA 1KDNA 2E5JA 2CA9A 3N9UC 4DR5J 1QVGR 1KVKA 1Z2ZA 1SPBP 1VRTA 1PC5A 4ZPVR 3M32A 5EHHA 2OFGX 4C3MA 5GAEI 4G6VB 2DNLA 4NI2A 1JLCA 2BV3A 2MQNA 2RB7A 4ZVSB 1HBNA 1SL2A 4PYDA 3QGGA 4AUKA 5IQ6A 4DPWA 1SL0A 5LSLA 3GONA 4JI5F 1YJVA 2D74B 2CPDA 3L7OA 3KHRA 2WVEA 5E3CA 1UKUA 2R2UA 4JI4F 2EWHA 2I38A 5AXMA 4Y2CA 1RT6B 4L73A 1IKXB 4LF1A 1NPPA 2M4MA 1BQXA 2G2ZA 4NCGB 5AE3A 1YSJA 3OUYB 2RRNA 3RB3A 4CYUA 3EVMA 3W3SA 4QR2A 3AB2B 2UVWA 1UCNA 3RRKA 3K5OA 2FLOA 2RRAA 2H51B 4PEOA 4ECYA 2P6SA 1HBMA 2HNDB 1IKVA 2R7QA 1GXUA 4K5SA 4UOCA 2CDRB 2RIJA 3PV8A 5HBMA 3VAHA 2X3GA 1WG1A 5I3UA 5A0YA 4OHWA 1TKXB 5AT1B 1LEOA 1WWHA 4XPEA 1DTQA 4C8LA 3M2UA 5AJ3J 4ECQA 1CC7A 1VFJA 2ZOGA 2H5EA 4W92B 4OYXA 2ZE2A 2FYXA 1RZMA 1T3OA 4FF4A 4DI6A 3MAAA 1VIXA 1S6PA 4YHHJ 4USWA 1SB6A 3T41A 1LOUA 3CD7A 2CFXA 5ETKA 1TV6A 1UETA 4EZ6A 2BQRA 4Z7CA 5HVGA 2JLGA 5A76A 4RW8B 3QO9B 5K14A 2VICA 4M63A 3NGUA 4OFZA 2WONA 1M90T 3DRYA 4DZDA 1U6FA 2VL1A 2BW2A 2GAHC 3T5KA 2BM1A 3PHEA 2R4FA 4ZS6A 2CVEA 2V4JB 1QAYA 1N48A 2NUHA 3W2VA 1HNZF 4O4RA 3R1LA 4M95A 3H5XA 3UDVA 4DFPA 4NA2A 1DTTB 3CO9A 3R1HA 5HJYA 4UTGA 1BQMB 2B4UA 1JJHA 2E44A 4AD6A 3MPDA 3GYGA 2DIVA 1JLGA 4QJVA 1T9VA 4LVNP 3HX9A 1QD1A 2ZC3A 1SC3B 4OZNA 2WK4A 3G6VA 3CDEA 4MKBA 5ADZA 1JLEB 2UUAJ 4DSEA 2IBKA 1SQGA 2VKZG 2MKHA 1J5OB 4RUAA 2L9WA 3M6UA 5DDPC 4TY8B 3G6YA 2B51A 4DR1F 5GAHU 1CJUA 3DRRB 1UJ6A 4BC9A 4GKKJ 2ZZNA 4C8KA 2VG6A 2OEJA 4ZP7A 3OVAA 4DV6F 1KLNA 3BSCA 4KGXB 4ETZA 2J6SA 1T95A 3I56S 5DRKA 1S0MA 4OX6A 4M5NA 5KG6A 4KRWA 3GYXB 1HBUB 1LWCB 3Q0AA 2J7UA 2ADCA 2K7KA 1DQAA 4B3MF 1WEZA 2BRLA 3D0HE 2L48A 2HSEB 1IJFB 2KHCA 1JXLA 3U1LA 3I82A 1M5PC 3C16A 3DHWC 4DX6A 3M8QB 4I2QA 3CCSS 2F8MA 2K3KA 1RSCA 1JXEA 4YDXA 3POTA 1XJWB 1RADB 4DL6A 4X4PA 1S1VB 2KFNA 8RUCA 3NAHA 1S5ZA 1RT2B 1K47A 1UVLA 5F8NA 1FI4A 3CULA 4PXBA 4J9MA 2UUTA 3I31A 2ZKTA 5B0BA 3O2IA 4TN2A 2H5JB 3IC1A 1HYSA 2YWHA 4WWSA 4LMZA 3D68A 1U48A 3N79A 4FYXB 5K8MA 4WP8A 3TR5A 2FHOB 4I69A 1CJTA 3GIKA 2HBYB 1D9DA 4JV5J 1KKHA 2FVQA 3HJVA 2JFDA 4O3RA 2VHGA 3Q8RB 3OR2A 1YK9A 3LUYA 2CJAA 4FZVA 1NSPA 2J0WA 2WHOA 3GU0A 3HVAA 1NJWA 2ASDA 2ASYA 4MYTA 3N5FA 3VGTA 3GR0A 2BE7D 1PJ6A 4QZVB 1D9AA 1EETA 1DY3A 1VRTB 1OMSA 5IOLA 1D8YA 3HDSA 5ETQA 3M32B 3TEGA 3I55S 2AYGA 4NYPA 4QIEA 1ULRA 2N3OA 3D67A 1HBNB 5EGYA 2BQ3A 4O3QA 2JSXA 1MN9A 3TI0A 4QQBA 3SYZA 1HA1A 1S99A 2JOQA 3WC0A 5L46A 2JEGA 3RG6A 1TL7A 2CRLA 2F7VA 2GVZB 2YQ1A 1RHKB 1RT1A 1VOMA 2WSEC 4ID5A 4EUVA 2XSFA 2AGOA 1R0AA 1X7VA 4CYUB 2CG4A 3HCXA 1M1HA 1LK7A 4RBUA 3JSRA 4H4MB 4RR5A 3UCZP 2IJNA 4CLYA 4RNHA 1RTHA 3M6WA 1R31A 4WXOA 1HBMB 1WF0A 5KFRA 3I0SA 1JLQB 1IKVB 1RAFB 1X4FA 2M52A 2XWYA 4M5KA 5HBMB 5AXNA 2LQ5A 3QWPA 5I3UB 2ZBRA 1N88A 5A0YB 3ETOA 3PR5B 2DIUA 2WBMA 4DCJB 2FTRA 3B4DA 3R7NB 1FESA 3QZ7A 3QSYB 5DLGA 4QOTA 3J81j 3IS9A 4EBCA 1S59A 2EC0A 4ZK7M 1TUVA 4KHMA 4ZN3A 2ZE2B 2BYCA 3VAJA 3L7UA 1N36J 1S77D 4IR1A 3SFUA 2O01C 3Q23A 4ED0A 5HI7A 2KT5A 3MAAB 1S6PB 4KO0A 2CQDA 3BKTA 3RUBL 1TV6B 3W7BA 2FHMA 2OEMA 5F8GA 3LGNA 3SDEB 2JLEA 4NCAA 5DM6Q 5DS7A 1T9TA 1MMNA 5K14B 1JLBA 3G86A 3HMJG 3TP2A 3FQKA 2D1CA 1WUUA 1DLOA 2WONB 4L72B 3EXCX 4HI2A 1S1WA 3HVWA 3RAXA 3EWGA 2HQ3A 1S0OA 1C1BA 3EMTA 2W9BA 2DJWA 4HHHA 5KFLA 1SIWB 3MDFA 5DDRC 3UDEA 2E5GA 3W2VB 5GAHI 4EYIB 4CNYA 4CQ1A 1BD6A 3DRSA 3KDOA 1U09A 2BE2A 2MHNA 1U2RA 3SIPB 1U4BA 1D09B 3W64A 3OLBA 5J2MA 2L3MA 4KHPF 4DMZA 1IXKA 3R2DJ 2J76E 2J6UA 1MU2B 4YY3J 1CLFA 1CJVA 2OP5A 1N8RT 3OR1A 2MZRA 1SC1B 2G0CA 2RH3A 4KFBA 3W2WA 2YKAA 1Y5NB 3M8RA 5HVHA 4YEAA 3HHLC 4QU7A 4C8NA 4X64J 1QLNA 1N34F 3TZZA 1M1KT 1WOOA 1RWWB 3THPA 3UD5A 1HQUA 2QL7B 5DG8A 3LQVA 3OJSA 3DLLQ 1FX2A 4L75A 4JUZA 4I6YA 3PO5A 4BC7A 1UFWA 2FDNA 1LK5A 1S12A 1JKHA 4PPZA 4F3OA 5KFMA 4J9LA 3JXOA 1MWYA 1K8AT 3TANA 4G1QA 3TO8A 1B0PA 4V19J 1B99A 3QFHA 1QSSA 1XN9A 5EWGA 2GCFA 3BQ2A 5B0CA 5DZ7A 4YB6A 2MYFA 4K0KF 1KOHA 3C16B 3OL8A 3SSSA 5C24A 2NSCA 4AFFA 4I2QB 1PYTA 2OEKA 5U47A 4IOAQ 2MLZA 1BGXT 4NEZA 3MUTP 4K4UA 3EPGA 2WAQD 4JBCA 4P72A 4ZP6A 3POTB 4DR5F 2FGCA 4URQU 1FXLA 3IRXA 4DV5J 1FDDA 3ZZPA 4TQSA 3HP6A 2HHSA 1Z4UA 3PO4A 1ZM4A 1SJ4P 2KVIA 5CH7B 2HK3A 3QGPA 2HRTA 1JB0C 4ID8A 1CJTB 2Y1RI 2OELA 2BA9A 3IR6B 2X1FA 2CNKB 3CJKA 2A2CA 3PYDA 1OY6A 5CD4A 4K4XA 5ETTA 2Q6CA 5ETLA 2QIFA 1ITPA 3NOCA 2HNZA 4HTJA 2XNQA 1N0VC 2ZH9A 2G9OA 4P6QA 1HPZA 4K2XA 1YJWS 1EETB 2ZH3A 3HT3A 1W2IA 5HMXA 4DPUA 3NNAA 2V2QA 4LSLA 4LF5F 3A12A 2V8PA 4NLUA 2V6AA 2DH9A 1T05A 3IP0A 3FBFA 4OLOA 4QWAA 4BS2A 4C8ZA 3CDAA 3HHEA 2IVFB 3H59A 2H5IB 2IRYA 4DL0C 4DCPB 3CCWA 4LRDA 1EKRA 3A1YG 5EDWA 3M2VA 3ISNC 1TL7B 5FDLA 3TAPA 5THWA 4N41A 4D3GA 1JNZB 5A8RB 2W2QP 1RT1B 1WF1A 3G87A 2NXNA 1FFWB 2ZZTA 3AHPA 1KSPA 4DU8A 2HK2A 1R0AB 3TQ1A 1FVSA 3MAQA 1UEVA 1LWFA 5CD4H 3GV5B 1Y10A 4WK3A 4F8RA 1VIOA 5F8LA 3NBPA 1RTHB 2FJWA 4N7TA 3BDPA 2DGWA 2NXUA 3BZQA 2C28A 4CH7A 2FY1A 2DT9A 2DB1A 1R0CB 3I0SB 4DQIA 1I94J 2H9ZA 3G8TA 2M0GB 4N8OA 1WDDA 3CMQA 3AD8C 2XO7A 3GG0A 2BQUA 2V9KA 4KR0B 2ATLA 1XWLA 1PO6A 2B9EA 1VDHA 1RT4A 1TFYA 3D6HB 2FLPA 2HBQB 3CWJA 1QJHA 4LJMA 2BJ1A 4WFYA 4NZ6A 1HLWA 3IS9B 2QSFA 2CPEA 4ECVA 2OI2A 4Y2MA 1WKJA 3MPVA 2J0QD 2IMWP 4LR8A 2XI3A 5HAOA 4HYKA 3BKUA 2VU5A 2YWEA 2RAQA 3K2YA 3QQCD 1MG7A 1RGVA 3CJ8A 1ZAVA 2XBPA 3NGKA 1KNZA 2W2MP 2GQQA 4KO0B 3W8GA 1QTMA 2QLJB 3AODA 3W9HA 2G0IA 1YZ6A 1RU1A 1OS5A 4R8UA 3T3FA 3GG1A 2CJBA 3UD4P 2HLTA 5H9EK 1RTDA 1DQ8A 2LEAA 4ZVGA 2ZHAA 3AY0A 3MUMP 2EFOA 2BJ3A 2Z30B 4QYZK 2F5GA 2KN4A 1JLBB 1MWZA 1KS2A 1HARA 2YWFA 1W26A 1DLOB 2Q66A 1SC4B 3IBCB 2QFIA 4FVMA 3G4SS 1S1WB 5KT3A 1R8CA 4L76A 2VC0A 1WHXA 1NRKA 2XO6A 3ULHA 1C1BB 2VG7A 4X84A 3P3DA 3OTDA 4DPTA 3RYLA 4PG5A 2E1MC 2YKMB 5L9XA 1XMQJ 2PN6A 2JX2A 4C3LA 3DRSB 4LF7J 2BE2B 3LGHA 1BC6A 3HK2A 1I1GA 2LEBA 5J2MB 3RR8A 5HQLA 1EB0A 1S7HA 3V6JA 2RHQB 5LMUJ 1CJVB 4D3HA 3BGOP 5GADU 5HO4A 3CXCR 3W2WB 3R7BB 4MJKA 2I8EA 3ZZYA 4DZ6A 2A3JA 2F63A 2ZM6F 2V4QA 3VAKA 1Y00A 1OIAA 3VALA 4KGKA 3KKFA 2DCLA 3BN7A 2X1BA 4FYWB 1F3FA 4UOHA 1X5OA 4CH0S 5JJBA 3KJVA 3M8WA 2C3MA 1B64A 3GFXA 2V2KA 2HWHA 1JKHB 3G6ES 2HMIA 2B5JB 1NHKL 1Y11A 3T5HA 1ZM2A 2LCWA 4MH8A 1RWXB 4LRCA 3MUVP 2QGFB 4MK8A 1NH8A 2HPUA 4G1QB 3P49B 2VONA
chains in the Genus database with same CATH topology
3IMQJ 2VQFJ 1XMQJ 2MQ8A 1HNXJ 4PWWA 4DV4J 4DR3J 4LF8J 3JAMU 4JYAJ 3J80U 4LF9J 5LM7E 3J7AN 4DV7J 4DR4J 4LF7J 4GKJJ 4YHHJ 2HHHJ 4NEYA 1FJGJ 4JI3J 1IBLJ 5IWAJ 2UUAJ 4V1Ak 4DR1J 5LMUJ 2MEWA 2KL8A 1HR0J 4NXMJ 1IBKJ 3T1YJ 1N32J 4OX9J 5BR8J 4JI2J 3T1HJ 4LF4J 4KYZA 4LF6J 2UU9J 4GKKJ 4DV0J 2UXCJ 3W1YC 3R2CJ 4JI0J 4JI8J 2ZM6J 3D3BJ 5IT9U 2E5LJ 4DUYJ 4DV6J 1XNQJ 4DR5J 4JI5J 4K0KJ 1N36J 4KHPJ 4B3TJ 2KVQE 1XNRJ 1I94J 1IBMJ 1XMOJ 5FLXU 4DR7J 1N34J 1HNWJ 2MTLA 4LF5J 4LFBJ 3R2DJ 4DR2J 2UXBJ 5A2QU 4NXNJ 2UXDJ 4YY3J 4LFCJ 4DV1J 1J5EJ 3OTOJ 4B3RJ 4X66J 4DUZJ 4KY3A 4JV5J 4JI7J 2UUCJ 4B3SJ 4LFAJ 4RJVA 3D3CJ 4HHUA 4JI6J 4NEZA 1HNZJ 2UUBJ 4DR6J 2F4VJ 4JI4J 5AJ3J 4B3MJ 5LMNJ 4DV3J 1N33J 4AQYJ 4DV2J 2VQEJ 3J81U 4DV5J 4X65J 4JI1J 4X62J 4X64J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IMQ J;  2VQF J;  1XMQ J;  2MQ8 A;  1HNX J;  4PWW A;  4DV4 J;  4DR3 J;  4LF8 J;  3JAM U;  4JYA J;  3J80 U;  4LF9 J;  5LM7 E;  3J7A N;  4DV7 J;  4DR4 J;  4LF7 J;  4GKJ J;  4YHH J;  2HHH J;  4NEY A;  1FJG J;  4JI3 J;  1IBL J;  5IWA J;  2UUA J;  4V1A k;  4DR1 J;  5LMU J;  2MEW A;  2KL8 A;  1HR0 J;  4NXM J;  1IBK J;  3T1Y J;  1N32 J;  4OX9 J;  5BR8 J;  4JI2 J;  3T1H J;  4LF4 J;  4KYZ A;  4LF6 J;  2UU9 J;  4GKK J;  4DV0 J;  2UXC J;  3W1Y C;  3R2C J;  4JI0 J;  4JI8 J;  2ZM6 J;  3D3B J;  5IT9 U;  2E5L J;  4DUY J;  4DV6 J;  1XNQ J;  4DR5 J;  4JI5 J;  4K0K J;  1N36 J;  4KHP J;  4B3T J;  2KVQ E;  1XNR J;  1I94 J;  1IBM J;  1XMO J;  5FLX U;  4DR7 J;  1N34 J;  1HNW J;  2MTL A;  4LF5 J;  4LFB J;  3R2D J;  4DR2 J;  2UXB J;  5A2Q U;  4NXN J;  2UXD J;  4YY3 J;  4LFC J;  4DV1 J;  1J5E J;  3OTO J;  4B3R J;  4X66 J;  4DUZ J;  4KY3 A;  4JV5 J;  4JI7 J;  2UUC J;  4B3S J;  4LFA J;  4RJV A;  3D3C J;  4HHU A;  4JI6 J;  4NEZ A;  1HNZ J;  2UUB J;  4DR6 J;  2F4V J;  4JI4 J;  5AJ3 J;  4B3M J;  5LMN J;  4DV3 J;  1N33 J;  4AQY J;  4DV2 J;  2VQE J;  3J81 U;  4DV5 J;  4X65 J;  4JI1 J;  4X62 J;  4X64 J; 
#chains in the Genus database with same CATH topology
 4M5H A;  3PIP Q;  4LF8 J;  1VBZ A;  4X4R A;  1X9M A;  3SZ2 A;  4W90 B;  5D4O A;  4G1P A;  4ZMM A;  1HW8 A;  6AT1 B;  3UFC X;  1LW2 A;  5C24 B;  1KC8 T;  3CD5 A;  3I0R A;  1CG2 A;  3K5M A;  4QWD A;  3Q8Q B;  3KNA A;  3R5A A;  2XM3 A;  4DL7 A;  4J9K A;  2OAU A;  1N0U A;  3IRX B;  1REG X;  2C22 A;  4X2B A;  5L1I A;  3THT A;  1WC0 A;  1CQN A;  4N5S A;  2MST A;  3GIM A;  3CPW R;  5LSO A;  2X3D A;  1IWA A;  1YZ7 A;  3M1V A;  1JWW A;  1G4C A;  5B08 A;  1FD2 A;  2DNQ A;  2DHX A;  2QLF B;  5HVF A;  4DUZ J;  1NK0 A;  2OPQ A;  3DLK A;  4ILR A;  3SCI E;  1D3W A;  2ZFH A;  2RDI A;  5JXS A;  1HBO A;  1LW0 A;  2B8Q A;  1X4G A;  3BPS P;  2GIQ A;  2CWX A;  4AQY J;  2K8G A;  3K5P A;  4WFB Q;  3CJK B;  4DV3 F;  4CLL A;  1KFS A;  1VBK A;  4DSI A;  4C4W A;  3KLH A;  1UPP A;  1YBU A;  2V68 A;  1Q86 T;  4I6W A;  1VLY A;  2XYG B;  2HNZ B;  2GIR A;  1NDC A;  2FJE B;  2AV5 A;  2KFY A;  2RJZ A;  3I5B A;  4OI2 A;  4OYI A;  1N6Q A;  2OPR A;  2D9P A;  1HPZ B;  2DH8 A;  2VG5 A;  2W4C A;  3SMZ A;  4LSL B;  4CO2 A;  2ZJP Q;  2PEH A;  5BR8 J;  5HJX A;  2OLW A;  3RB4 A;  3DM2 A;  3AFG A;  3BRE A;  2UV8 G;  3FCW A;  3DI6 B;  1AZS A;  5IZH A;  5T7L A;  1XEZ A;  4HH0 A;  3OPK A;  1KVI A;  3GIJ A;  3N6L A;  4ED5 A;  3FMB A;  4C98 A;  3EGN A;  5FDL B;  4OZ1 A;  4ZVT B;  5L1L A;  3X1L B;  1F5C A;  4TNO A;  1NK9 A;  2VA3 A;  1CPZ A;  1N36 F;  1LWF B;  2QE5 A;  2X7I A;  2B9Y A;  4X65 J;  2AJ2 A;  4TU7 A;  1RBL A;  4PG7 A;  4JYA J;  1FWP A;  2VBW A;  3C6U A;  4ZP8 A;  2QG9 B;  5L8R C;  3BJY A;  4RO0 A;  4FXV A;  3RBZ A;  3OL7 A;  2BAC A;  2YXL A;  4MK7 A;  4OZ5 A;  1RT4 B;  4UY8 T;  2YX7 A;  2ROP A;  4OZ3 A;  2OFH X;  3M9O B;  4B9U A;  1LV5 A;  3T1H J;  1NK7 A;  2PII A;  1X4B A;  2DNP A;  1L3S A;  2E1R A;  1RT5 A;  3UVJ B;  1AW0 A;  2J0X A;  4ILL A;  4JV0 A;  2XZT B;  2I1R A;  3RAM A;  3AOC A;  4J9N A;  3NS7 B;  5C25 A;  3SQG A;  2CQB A;  3QYY A;  3VGS A;  5L9N A;  4WE1 A;  2OSR A;  3E3X A;  3H98 A;  4YR0 A;  3MM9 A;  2G0J A;  2F3J A;  2GMH A;  2J9D E;  1SBR A;  2M8D B;  4ED8 A;  1P27 B;  2LEC A;  4NYZ A;  4DG1 A;  4CT8 A;  4DJB A;  3QIP A;  5FJ4 A;  1IJE B;  3AQP A;  1RTJ A;  3M7V A;  1CUL B;  3KLF B;  1IVZ A;  1ZA1 B;  2W9C A;  4ED4 A;  4CLF A;  1CSJ A;  3RTV A;  1W7W A;  4YY3 F;  4J37 A;  2N82 B;  1OSC A;  5LJ5 Y;  3L3C A;  1PAU B;  3UI3 A;  5KG0 A;  4LF2 A;  5LXY A;  4DR4 F;  2AGQ A;  3ZO7 A;  3V4I A;  3DU5 A;  2W24 A;  3KHL A;  1S10 A;  1F6T A;  1M5K C;  2VBY A;  1IBL F;  5LSR A;  3RAQ A;  4F0K A;  3PHT A;  2GJI A;  4HEA 9;  3U7J A;  4ECT A;  3MFI A;  1RUS A;  4JI0 J;  2HVZ A;  5J2N B;  4OI4 A;  3DRP A;  2EFN A;  1VCT A;  3VVT A;  2LFV A;  4ED2 A;  2WSC C;  4NCB A;  4ZLJ A;  5C42 A;  2B4P A;  4QIG A;  2R7X A;  2LKZ A;  3CJ3 A;  1P6T A;  1R0B G;  5GVQ A;  3EVW A;  2HS4 A;  1NZA A;  3UD3 P;  2QYG A;  4CIO A;  1SXL A;  5IFM A;  4U7C A;  3J7Z 5;  3ENV A;  2PMW A;  1RHR B;  2PA8 D;  4WK1 A;  5I3P A;  2FZG B;  5G0R B;  3E2E A;  3K0J A;  2RKI A;  3UN2 A;  3G9C A;  2W9A A;  4FBU A;  1ZET A;  2CPH A;  4JOU A;  2FC9 A;  1U25 A;  1OJ4 A;  2YVS A;  3CJT A;  4DV4 F;  4DV7 J;  1TU0 B;  3NMR A;  4M5J A;  2UP1 A;  2XMV A;  2C2D A;  3CED A;  1QE1 A;  5DDQ C;  3K5L A;  3LOU A;  3CCR S;  2HIQ A;  4DWI A;  2HMI B;  4DX8 H;  4DSJ A;  1NM2 A;  2IVY A;  2N7C A;  2XQC A;  4K2J A;  4KSE B;  4Y6I A;  2E9T A;  2HG4 A;  3WIU A;  4DXL A;  2PI5 A;  1QSL A;  3AJD A;  3D2W A;  1H7X A;  2IM3 A;  4RPF A;  5D6G A;  2EK1 A;  2JVO A;  2HHT A;  2B43 A;  4OV1 A;  2M9K A;  4NA3 A;  2CYY A;  4Y28 C;  1FJC A;  2MZQ A;  3KJQ B;  1LW2 B;  1BMQ B;  4TKT A;  2RS8 A;  3UDC A;  1X4D A;  4WIQ A;  3KK2 A;  4CZC A;  4NOH A;  3JTO A;  3AH6 A;  2QL5 B;  4PCQ A;  1N33 F;  3QMQ A;  2HHW A;  5KFZ A;  3KMS A;  3GJS B;  4ETX A;  3F56 A;  2EK6 A;  4RBV A;  3EYZ A;  2HS0 A;  4AYB D;  3AJ2 A;  2QEX S;  3D54 A;  3JTP A;  5SUH A;  3T5J A;  3LA0 A;  3I5C A;  2OPQ B;  1FK9 A;  1HBO B;  4RKU C;  1LW0 B;  2GV1 A;  2BZ2 A;  1B7Y B;  1Q78 A;  4NAS A;  3NKY A;  5IC4 B;  1M5V C;  1U45 A;  5IT9 U;  4B17 A;  2A10 A;  4X4Q A;  3KLH B;  2GA7 A;  3MHY A;  3ZC4 A;  3SV3 A;  5HAT A;  1UZD A;  4FS1 A;  3TQE A;  3JSY A;  2LDY A;  1SH0 A;  1N6Q B;  2OPR B;  1IBM F;  3OTC A;  4DPO A;  1T9W A;  2VG5 B;  2WW8 A;  2JHE A;  3A13 A;  1HHS A;  3NGT A;  1B3T A;  3DM2 B;  4IG0 B;  1SH2 A;  3CC7 S;  1AZS B;  3K57 A;  3F0N A;  4FDF A;  4YB7 A;  5E7O B;  3MUR P;  5L38 A;  2RT3 A;  3CE8 A;  2LQ8 A;  4WP9 A;  2AJ1 A;  2V8D A;  4PWU A;  3TOQ A;  4DFJ A;  3GMG A;  4DN0 A;  3KHH A;  2CQC A;  2RQK A;  4Q8E A;  1OPZ A;  5AE2 A;  1N32 J;  2MY8 A;  2B9W A;  4NXM F;  1IR0 A;  3WHI A;  3UCU P;  2C2E A;  3DLB A;  5EWE A;  1UW4 A;  3PXG a;  5KFB A;  1WHV A;  3R8Y A;  1URR A;  4BBY A;  2QLX A;  2ERR A;  4B3T J;  5F9L A;  5I42 A;  2PD1 A;  2DGS A;  1HIY A;  3C6U B;  1AFJ A;  4ZIV A;  3SCL E;  3KJF B;  2CPX A;  3OQ2 A;  4LFC F;  4WPA A;  2HYI B;  1QUP A;  1KEK A;  2XLJ A;  1C4A A;  4NZ0 A;  4LFA F;  3EX7 B;  2F4V J;  4JI6 F;  4M5D A;  2AJQ A;  4RNO A;  1U6B A;  2CQ3 A;  2FUG 9;  2ZH4 A;  3IAS 9;  2YWK A;  3NCQ A;  4O3N A;  5KG2 A;  3PDN A;  4RUH A;  2LXF A;  2R42 A;  4OJ1 A;  5EUH A;  4DSF A;  2KDO A;  2LQ9 A;  4ZVR B;  5C25 B;  4OL8 A;  5D4P A;  4Q5V A;  4JI3 J;  2IYI A;  1RAE B;  2DH7 A;  2KM8 C;  1RTI A;  1TVR A;  3AT1 B;  2IDE A;  1T7P A;  3NLC A;  4ECU A;  4N77 A;  5CYM A;  5EX3 A;  1IBK J;  1XMQ F;  4IFV A;  4OX7 A;  4DG1 B;  5FII A;  3C15 A;  4CNZ A;  4OX8 A;  1T8E A;  3QIP B;  1WC5 A;  5KG1 A;  1RTJ B;  1KHW A;  3BO4 A;  2SXL A;  1KOO A;  2CNL B;  5H1S V;  2W9C B;  3VV2 B;  1SI9 A;  2HWT A;  4K5R A;  4UQT A;  2F9J A;  2AF6 A;  1VQ5 S;  3Q2T C;  3TAQ A;  1N5Y B;  2QTW A;  1PSD A;  3M8P B;  4Q7A A;  2AEF A;  5KT4 A;  2W1B A;  2OTJ S;  5CCM A;  1IKW A;  3HLU A;  1BUX A;  4O3S A;  3GR1 A;  5D0E A;  2HAI A;  2NZ4 A;  2HHV A;  3HZG A;  2P6T A;  1WEL A;  1PG5 B;  2GVD A;  5KG4 A;  2GQ2 A;  3EE3 A;  2FVR A;  1RI7 A;  4KV8 A;  4PWW A;  4DR3 J;  3CD6 S;  3CCQ S;  3B54 A;  1PJ5 A;  3PZP A;  2NXC A;  3D66 A;  2DEI A;  1VRU A;  3DRP B;  3KXD A;  2R7W A;  5E5N A;  1TKZ A;  3ONQ A;  4ZLL A;  3TZY A;  4UOF A;  5C42 B;  1OYE A;  2F65 A;  3OFH A;  6FDR A;  3CF5 Q;  4AT1 B;  3B4M A;  5GMD A;  5D0R A;  2CPI A;  1HI1 A;  4WZM A;  2J7K A;  1VS3 A;  3EDQ B;  3ZTS A;  4DV0 J;  2Z2L A;  3HHL B;  4A8O A;  2MQM A;  1ZTT A;  2RKI B;  5KT6 A;  2R2R A;  3JS9 A;  4YME A;  2XHW A;  4I64 A;  4MAK A;  2AW0 A;  1SKW A;  2ZOF A;  2H4Y B;  4XO0 A;  5LJ3 Y;  1NUE A;  1OY8 A;  1CS4 B;  1FTR A;  2OUG A;  1YJ9 S;  5BXI A;  3LWM A;  1HNW F;  2YPZ A;  3M30 B;  1QE1 B;  1A9N B;  1Q53 A;  1H6K X;  1RLC L;  1M5S A;  1KR4 A;  3FKB A;  3B6B A;  2EFV A;  1ZPV A;  3DOM A;  2R7R A;  3T1A A;  3UR3 C;  4OYB A;  4A8X A;  1U0H A;  4RUB A;  5D8H B;  3TAM A;  3Q2S C;  4DUZ F;  2IPO B;  2HHU A;  4OJH A;  3CCU S;  4LRA A;  5CA5 A;  2HFO A;  1ZTW A;  2XLK A;  5ETS A;  1FHT A;  3PAC A;  1Q16 B;  4A8M P;  1SL1 A;  2P9G A;  3GIR A;  5A8K A;  2IC3 A;  3CDU A;  2BUN A;  3GSD A;  4F02 A;  3T6B A;  5K8O A;  2KRB A;  3C2P A;  5E33 A;  1ZAW A;  2W7O A;  3OSN A;  3W60 A;  4Q44 A;  1KP6 A;  4RW4 A;  5AE1 A;  4XAK A;  3M8S A;  4XDC A;  4CLZ A;  1V9O A;  4LFB F;  4EMD A;  3KG1 A;  2DNZ A;  1J5E F;  2HWI A;  3D3C J;  1P9Q C;  1FDA A;  4LBP A;  4OI1 A;  1FK9 B;  1YRT A;  4LUB A;  1NHU A;  4PXD A;  4WCE Q;  2DR7 A;  5JVH Q;  3J80 U;  1RP5 A;  2BW7 A;  4ICL B;  2XCP A;  2DXD A;  2YTC A;  1PBU A;  3ZZ0 A;  2HQF A;  1FJG J;  3BBC A;  1SC6 A;  3MCN A;  2YNI A;  1Q7L B;  4EI2 A;  8AT1 B;  5GAE U;  4FBT A;  1GK8 A;  2CNN B;  4OX9 J;  1T0T V;  3MEE B;  5IM0 B;  2E1P A;  3Q83 A;  1GTH A;  4RW7 B;  4WFX A;  2XGP A;  4CLP A;  1X4E A;  2LLZ A;  3QWU A;  4I7F A;  2AKW B;  2R8J A;  5CHC B;  1Z2L A;  3PX4 A;  1XNR F;  2CJY B;  1HI8 A;  3T1H F;  2ZBP A;  4X66 J;  4DR2 F;  4IKA A;  4QIF A;  1UVJ A;  1UEU A;  3N0V A;  2UUC F;  4NE9 C;  1D9F A;  2HBZ B;  3LAK A;  1SH3 A;  4DV2 J;  1L5U A;  4O0I A;  3WC2 A;  4MKA A;  3EXY A;  1R8H A;  4DX7 A;  1Y3K A;  3JQK A;  1NKB A;  1VHF A;  3C6T A;  3KG0 A;  4CTA B;  3FSI A;  4TYA A;  4A48 A;  3PY8 A;  2IIH A;  3AD9 C;  1NCL A;  5HLF A;  1HR0 J;  1AUD A;  3ZNJ 1;  2AZ1 A;  3QLH A;  4JV2 A;  2V94 A;  4DL5 A;  2WB1 D;  3HO1 A;  4H4O A;  3ILL A;  4C6A A;  3P96 A;  2QZ8 A;  3PRD A;  4RW6 A;  3CD0 A;  2NSB A;  4USM A;  3R5B A;  4NYO A;  3C3L A;  1VJQ A;  1N5S A;  3P5T L;  2GHW A;  1RTI B;  1DUR A;  2YKN A;  1JLF A;  1FWL A;  2WSF C;  5SZT A;  5CYM B;  2UV8 A;  1U8S A;  3US5 A;  2HKE A;  4R25 A;  1X5S A;  1D1U A;  3C15 B;  4X62 F;  3ENW A;  3HXM A;  3Q24 A;  4NMX A;  4ECW A;  3D7S B;  3W9I A;  1VIS A;  5KFC A;  2QT7 A;  3M8Z A;  1H74 A;  2BEF A;  4TLQ A;  3QRR A;  3GFY A;  4KAI A;  3VZI A;  3VQT A;  3TNV A;  3CIZ A;  4Y34 A;  2QMX A;  3V6K A;  1F60 B;  1TKD A;  1GMW A;  2XY5 A;  4WU3 A;  4HL9 A;  1I3O B;  5IQQ A;  4HLB A;  3S8S A;  1AT1 B;  1NSA A;  4FKX A;  2GVD B;  3KK3 B;  3H5U A;  2UXC F;  1APS A;  3N6N A;  3Q8U A;  1XR6 A;  2B4O A;  1HKA A;  1RHU B;  4QR1 A;  4FF3 A;  2WOM A;  2ZD1 A;  4ZPD A;  5F9N A;  3QPI A;  4LR7 A;  1TKZ B;  4X4O A;  2VJV A;  2UXD J;  3MMA A;  1JK9 B;  5CQG A;  1GQE A;  2WB4 A;  3F73 A;  4B3R F;  2AGP A;  2CZV C;  1KBR A;  3V2U C;  2L08 A;  1V3S A;  4YDD B;  5LMN F;  4JI1 J;  4NLQ A;  2W01 A;  4UW2 A;  2ZJQ Q;  4AE5 A;  1HQE A;  2QYC A;  2ZH5 A;  3JTN A;  1H38 A;  3UNG C;  2W25 A;  2RDJ A;  4URG A;  5KFS A;  1U8W A;  2ASJ A;  4BDP A;  4GKJ J;  1S0V A;  3R6G B;  2IDL A;  2B7C B;  2DR8 A;  2CWK A;  3HHN B;  3LP2 A;  4DHV A;  4EU0 A;  3BGF A;  4KKO B;  4ITS A;  2IM1 A;  1Q1K A;  5G4D A;  2OH2 A;  4QW8 A;  1SQF A;  2QX0 A;  4HDG A;  4WFN Q;  4WXW A;  2UU9 J;  3DOM B;  3P45 B;  4LF4 F;  1UVM A;  2XMU A;  2K1R B;  1L3V A;  4QPX A;  1U0H B;  5CYQ A;  3ICL A;  3IR5 B;  4I0W A;  3MEG A;  3OTE A;  1S6U A;  2RSQ A;  3PJX A;  1CJK A;  4OHZ A;  3H5Y A;  3BO2 A;  5DG9 A;  4WP3 A;  3I9V 9;  2UUB J;  1FX4 A;  4RX6 A;  5F8I A;  4ZJO A;  1T3N A;  1PC4 A;  3PTW A;  4QYR A;  3CGI A;  4RU2 A;  2IC3 B;  2VOP A;  3IMQ J;  2Q6B A;  2C3Y A;  1HWK A;  2CVI A;  5KFH A;  5RUB A;  1YLX A;  3M4X A;  3MM5 A;  4ED3 A;  1O8B A;  3IWL A;  4P10 A;  2HFS A;  3PW5 A;  5F8M A;  2VOD A;  1KQK A;  1C0U A;  3G6X A;  1Q0N A;  1HMV A;  4K4W A;  3LP0 A;  5ETR A;  3H4D A;  4TVA B;  1RAO A;  1TR0 A;  4KHR A;  2QC3 A;  4LIR A;  4M5I A;  3GZ7 A;  2APO A;  3H2V E;  2YNG A;  3HT0 A;  5KFG A;  1OQ3 A;  2Q3P A;  4JI8 F;  4KBI A;  4BCA A;  2CQG A;  2IA6 A;  2GMJ A;  2LEP A;  3FCV A;  2ZH8 A;  2AEM A;  2ZH1 A;  1N32 F;  2GIF A;  3GYN A;  3FEX B;  1U26 A;  4J9S A;  2YNI B;  1NH7 A;  1RAH B;  2FJV A;  2LXI A;  3O1L A;  5H9E J;  3LPY A;  4B3T F;  3R5C A;  3J81 U;  3W5X A;  2MKI A;  2AD9 A;  2ROG A;  5C7P A;  4QYZ J;  2KJV A;  2R7S A;  1XR5 A;  2RUG A;  3VVU A;  4OYP A;  4RUC A;  1KQG B;  1JMT A;  4I7F B;  2KXN B;  2V34 A;  3HF5 A;  1XC9 A;  3V6H A;  1HWL A;  4YR2 A;  1S9E A;  1QY7 A;  3LP1 A;  4CO4 A;  3L09 A;  3T5L A;  2HNY B;  2E1A A;  2CQH A;  1K0T A;  4FPR A;  5CAB A;  2MY7 A;  2H65 B;  2CJQ A;  2G2O A;  2XWX A;  2FPH X;  5B7W A;  3CUN A;  1QAJ A;  4ZVQ B;  2WCX A;  3CME S;  3RZA A;  3BBB A;  2L9D A;  3HSZ A;  2VIH A;  2OO4 A;  1XNQ J;  4Y3C A;  4F2R A;  2W7A A;  2PDA A;  3V4M A;  3KLG A;  3MED A;  4DR7 J;  1S6Q B;  2AX1 A;  1IBK F;  2C2O B;  3BSO A;  2EEY A;  2FLN A;  3S7R A;  3C6T B;  3ILJ A;  3E01 A;  2KYX A;  4ZLP A;  3MM7 A;  2BM0 A;  1RT7 A;  4LIW A;  4OHY A;  4DR6 F;  4ED1 A;  4LF6 J;  3NNC A;  3FC9 A;  1YWX A;  4GRS A;  3QLH B;  1HNX J;  2XZD B;  3K58 A;  4H4O B;  2YNF A;  1JJ4 A;  1FKP A;  4J9P A;  1RB0 A;  3L9Z A;  4RW6 B;  4DCO B;  4ZJL A;  4E98 A;  2GML A;  2ZBQ A;  2GS8 A;  3GB0 A;  2NS1 B;  4ZVH A;  1WTF A;  3MCS A;  1VMB A;  3FJ2 A;  2R7V A;  3HUL A;  1RT3 A;  3EM1 A;  5D3G A;  1TMJ A;  3FEZ A;  1U1Q A;  4O3P A;  2L41 A;  2RHS B;  5ETV A;  1AA1 B;  5GMK a;  1YHQ S;  2MJN A;  5HMY A;  5ETO A;  2QA4 S;  4DUY F;  5KT2 A;  3TX8 A;  3BH7 B;  1PYO B;  2VFV A;  1BY9 A;  1UVN A;  1VK8 A;  4USI A;  1JNR B;  4DL2 A;  3MCM A;  4ZCK A;  1C1C B;  4CO1 A;  2UXB F;  1OY9 A;  3PYF A;  4FVC A;  1NK6 A;  2HFZ A;  3CC2 S;  4JI4 J;  4UF4 A;  4ZHR B;  3A3O B;  1MMD A;  4P75 A;  3CTR A;  2DIT A;  3L95 X;  3MR2 A;  3ZNU A;  2I0X A;  2XB2 D;  1T03 A;  4IUF A;  2PMH A;  2R2S A;  2CQI A;  2QL9 B;  2VQF F;  3HSG A;  2HLU A;  1RKJ A;  1Q81 T;  2N3L A;  2HGN A;  4C8M A;  1P8G A;  1RAC B;  4X4S A;  2LU2 A;  2WOM B;  2PI4 A;  3SCK E;  1GEH A;  3QJJ A;  1FJE B;  4DEZ A;  5EWF A;  2MLX A;  1NND A;  4IRK A;  3RRH A;  2ZHB A;  2VA2 A;  4NX9 A;  3NEK A;  4BWM A;  4EFA C;  3JSM A;  3LW5 C;  2IM0 A;  1SJR A;  2OD6 A;  2V63 A;  1FRI A;  4I6A A;  3D3B J;  1F0X A;  2WW4 A;  2MGZ B;  3ZZR A;  1HQE B;  2X1A A;  2N4C A;  1UL3 A;  2E7V A;  3HVT A;  1NDL A;  1HHQ A;  3OFG A;  3BPD A;  2ZDP A;  1YTY A;  3LP2 B;  3KDN A;  3D1H A;  5HMZ A;  2AYM A;  3FBE A;  4Y00 A;  1J27 A;  3DOK A;  2BKO A;  2DNH A;  1VR6 A;  5AXK A;  4GVL A;  4EEY A;  3DGP A;  1SKS A;  1UA1 A;  1CQM A;  2VPW B;  4OJG A;  2XYP B;  4GC6 A;  3PX6 A;  2JWN A;  3W63 A;  5GAG U;  3E8O A;  3PKM A;  1GT8 A;  2HHP A;  5CYQ B;  3OJU A;  4U67 Q;  4PWD A;  3C14 A;  1S1X A;  3VAM A;  2ZH2 A;  2BJE A;  3QZ8 A;  3EZU A;  2OD4 A;  1CJK B;  3M05 A;  5IC6 B;  3BGR A;  2CQ4 A;  4OZJ A;  4M5M A;  2WZ1 A;  1E6Y B;  1L3T A;  3GV8 B;  1JLA A;  2R8G A;  1S48 A;  3O6Q A;  4IG3 A;  2O1P A;  3LAL A;  3MM5 B;  5HP1 B;  2AX0 A;  2VH7 A;  2C2Z B;  2ZIT A;  1U7L A;  4P2S A;  5LOQ A;  3DC2 A;  1WSR A;  3SSR A;  1HMV B;  4B3S J;  2HIY A;  2OKQ A;  3LP0 B;  1HNZ J;  3FRY A;  5HL7 Q;  2QLW A;  4LRE A;  2WVB A;  2DXF A;  4EYH B;  1FRL A;  1X8D A;  3MR7 A;  2Z8Q A;  3CVK A;  1ACM B;  1FXD A;  1HHT P;  5KFT A;  4F4K A;  2G2Y A;  2YNG B;  4NI2 B;  1JLC B;  2BAN A;  3B8H A;  2KZZ A;  1Y4Z B;  3NMA A;  2HS3 A;  1X4H A;  2RDD A;  2WVC A;  3GFZ A;  3NAI A;  1MLA A;  4QBU A;  4DR1 J;  2EG2 A;  5KFV A;  2ZVI A;  5DGA A;  1RAB B;  1HWU A;  5JUM A;  2MMY A;  2DEJ A;  4CLW A;  3U1M A;  3PJ9 A;  4B9M A;  3EDR B;  3CNQ P;  3V81 A;  4DV6 J;  2QMW A;  1FER A;  5KFK A;  4LBI A;  3DMJ A;  1YBT A;  3OFE A;  2E5L F;  1S57 A;  4HDH A;  1RE1 B;  5B0F A;  2JEI A;  4HT7 A;  3GFH A;  1SJ1 A;  1A7G E;  2DHH A;  3GQC A;  2KB2 A;  4DV1 J;  2F4F A;  1S9E B;  2I6W A;  5BJR A;  3LP1 B;  1NPR A;  4WBF A;  2G4B A;  2YPY A;  1RA7 A;  1LWX A;  2J5A A;  4JI7 F;  5IT9 Y;  2PMZ D;  1PJ7 A;  4RW9 A;  4B3M J;  2CJ9 A;  2KKH A;  2HRY A;  2OPS A;  1K73 T;  3EGZ A;  3CJ0 A;  2F9D A;  3BKF A;  2ZKU A;  4Z37 A;  5KG5 A;  5D0H A;  4ZP9 A;  5L1J A;  3DOL A;  4ZDN A;  2L9N A;  1DTQ B;  4RNF A;  3M2U B;  4CLT A;  3KLG B;  2ZJR Q;  2VOO A;  1U47 A;  3MED B;  3TA0 A;  1P9Y A;  2DXE A;  2HHH F;  2W2O P;  4WTO B;  5KFF A;  2ZBC A;  1TMM A;  2MZ1 A;  1NDK A;  4B3O A;  3E01 B;  3CJR A;  3THV A;  2J8S A;  3MM7 B;  4UZB A;  4X4T A;  1RT7 B;  2A2D A;  4MIA A;  3TJ8 A;  2YH0 A;  2M88 A;  2VUG A;  2QJ3 A;  2HVD A;  2HQG A;  4RL1 A;  2YNF B;  4TU8 A;  1DFD A;  5C2C A;  5LXR A;  4I56 A;  3R5J B;  1WOS A;  3MEK A;  1RWV B;  2KM8 B;  1QUV A;  4V19 X;  3V6D A;  3Q8Y A;  4CLU A;  4NXN F;  2V8G A;  3ZZZ A;  2B6A A;  1VQ4 S;  3OUY A;  2EBE A;  1VI7 A;  1WSV A;  1RT3 B;  3MPY A;  3SQO P;  2G1D A;  1F3V A;  2VQE F;  3BGL A;  5F41 A;  1V5I B;  2E9Z A;  4A8F A;  3BYP A;  3ZFV A;  3FZ2 A;  1IN0 A;  1DAR A;  2X1G A;  3CCZ A;  4UZC A;  1RA6 A;  3SSQ A;  2ASL A;  4F3Q A;  4FF2 A;  3MOJ B;  3VQS A;  3AB4 B;  1B70 B;  1KD1 T;  2A0F B;  3SXL A;  1E6V A;  3IN5 A;  3JQM A;  4UUW A;  1Q5V A;  2CAJ A;  2DBB A;  1JLG B;  1U1N A;  1EP4 A;  1U0S A;  5E3Q A;  1UZH A;  1YJR A;  3PFO A;  4JI2 F;  3OHA A;  2CPJ A;  2H4W B;  4Q43 A;  4AL7 A;  3MWB A;  1EHW A;  4OHV A;  1T03 B;  4GO5 X;  2C2K B;  2KVQ E;  3W8P A;  2YWW A;  3OLA A;  3QGI A;  1CJU B;  5JVG Q;  1BLU A;  1XMO F;  6FD1 A;  1GXL A;  4P52 A;  1FRM A;  1LWE A;  4Q8F A;  1VLO A;  2IVM A;  2VG6 B;  2V2Z A;  3OTO F;  2NYH A;  4U96 A;  3RR7 A;  2OJ3 A;  2IJR A;  3FNN A;  3A3P B;  2IAJ A;  1SKU B;  5KOW A;  3MF5 A;  2D3O 1;  3A8K A;  2Y0B B;  5M2P A;  2VJU A;  2VB6 A;  3X3U A;  4Q0B A;  1VGY A;  4CDI A;  3KOA A;  4A8W A;  4F2S A;  4RW8 A;  4DS5 A;  4ER8 A;  2MQP A;  4DU7 A;  5K8N A;  4NEY A;  1NZ8 A;  1TL4 A;  3HVT B;  1IQT A;  5GAG I;  3TUZ C;  4TXS A;  4CT9 A;  2NR0 A;  4OMF G;  5J1N A;  3NL0 A;  4LSN A;  5KT7 A;  4ECX A;  2PT0 A;  2DR5 A;  1NKC A;  4B02 A;  3CDW A;  2KFZ A;  3QT5 A;  1GAO A;  2EVZ A;  2NUU G;  3DDN A;  3DOK B;  5T41 A;  3CCM S;  1C0T A;  3DGP B;  2BXJ A;  1D0E A;  3FCH A;  2QMU B;  2V4J A;  3OSP A;  3OXG A;  4ED7 A;  5M2R A;  3RW6 A;  1VHI A;  1XK8 A;  4CI0 B;  4IQM A;  4PUO A;  4PWD B;  1S1X B;  4QIW D;  2GX8 A;  1CVJ A;  2BVZ A;  3KLV A;  2IJF A;  2FVP A;  4QWB A;  1HYS B;  5ETM A;  2CDQ A;  3BGR B;  2YBV A;  4DN9 A;  1FFG B;  1RAJ A;  1HL6 A;  2EFG A;  4TY8 A;  1H72 C;  4MFB A;  2QRR A;  3DRR A;  1JLA B;  4ECZ A;  2EKY A;  1T9U A;  3OR2 B;  4AL6 A;  4KIA A;  3VZH A;  2XG8 A;  3K8W A;  2HHQ A;  2YNH A;  3NCR A;  1A6L A;  1RHQ B;  2MQO A;  2LQJ A;  2AU0 A;  3FFI A;  4BWJ A;  1X4C A;  1FNX H;  1YI2 S;  2IBO A;  2O66 A;  4KT0 C;  2ZH6 A;  5IXU A;  4RU9 A;  5KFD A;  1HBU A;  1WC6 A;  2HQI A;  2CAD A;  4KHP J;  2DHA A;  2BAN B;  2RD5 C;  4H4K A;  1RWP B;  4USU A;  2V9W A;  3Q22 A;  2HZV A;  1RBO B;  4G3I A;  3ZTP A;  3W61 A;  1N54 B;  2Y3Y A;  1FRH A;  5IS2 A;  2OPP A;  1AFI A;  4OI0 A;  1Q5Y A;  2RRB A;  5AJ3 F;  3UCG A;  1KQS R;  3B82 A;  1VQK S;  1OQ6 A;  3HD1 A;  4ID5 B;  1WOP A;  4I4B A;  3W9J A;  2MKC A;  2BAB A;  3O8W A;  2DYA A;  4OYA A;  1DJ0 A;  3V81 B;  1RT2 A;  2JNJ A;  1Q8I A;  4YHH F;  1VBX A;  4B9N A;  2D3O R;  1HI0 P;  5KG3 A;  3TW0 A;  1LXN A;  3KUG A;  2ZZM A;  4W4M A;  3J80 Y;  4F04 B;  2YH1 A;  2WRM A;  4JV1 A;  3IBW A;  2CQ1 A;  1MWQ A;  4C0B A;  2GW8 A;  3R2C J;  2OPS B;  1S4F A;  3FUY A;  1M5H A;  4X4U A;  3ENQ A;  4MIB A;  1NK5 A;  1F9E B;  4K0K J;  3TVK A;  1ZOT A;  5KFE A;  5KFX A;  2FLL A;  4LRF A;  1WAC A;  2V67 A;  3E51 A;  4OYW A;  1WC1 A;  4K4Y A;  3A4T A;  3W5Y A;  2XNR A;  2KXF A;  5B0D A;  2KJW A;  3D6F B;  2J8A A;  4DUT A;  3BR8 A;  4PQA A;  4ELU A;  2PSZ A;  4BLG A;  2BMB A;  1RIS A;  4B3O B;  3FVY A;  4DQQ A;  2D3Z A;  2MZT A;  1FDB A;  4P2M A;  3I9Z A;  2HVI A;  3A8E A;  3KYL A;  4LF9 J;  3QT7 A;  1H2T Z;  2DNK A;  4NZ7 A;  4NLR A;  4ANC A;  4P73 A;  3L4B C;  2FVC A;  2MXY A;  1KTQ A;  1RCX B;  3EZ5 A;  2GQC A;  2C3P A;  4V1A k;  4B08 A;  2GVZ A;  3R5D A;  3V6D B;  2UUA F;  4YFU A;  5KFI A;  2GJ2 A;  2FHJ D;  2B6A B;  1G6B A;  4E8U A;  5H9F K;  5C2G A;  4LBH A;  4J9Q A;  2UVV A;  3FRZ A;  4GKK F;  3ZZU A;  2A18 A;  5B09 A;  4N8N A;  4H4M A;  3SBM A;  1KQF B;  3P5B P;  1GNK A;  1PIL A;  2QN6 B;  2W9B B;  1R8A A;  4BHQ A;  1MML A;  1N4L A;  1U1P A;  1L3U A;  4P9S A;  2MTL A;  4LF5 J;  1WEX A;  2XMJ A;  4MT1 A;  2KG1 A;  1VQ9 S;  1U6Z A;  4RZR A;  2QO3 A;  2XZW A;  1SV5 A;  2CQ2 A;  1JLQ A;  1W2B R;  4JP8 A;  3K89 A;  3MR5 A;  4HT5 A;  4OHX A;  2VKR A;  2B56 A;  1E6V B;  2YWG A;  3MM8 A;  4AND A;  4DL4 A;  3CJS A;  1MRO A;  3H5S A;  4R0J A;  1EP4 B;  4H54 A;  2MQ8 A;  1ZA2 B;  4ATN A;  1MN7 A;  2LQB A;  1REV A;  2RQM A;  3DDI A;  3HSJ A;  2XY6 A;  4CO5 A;  3OR1 B;  3VCD A;  2VFR A;  1SUQ A;  7FD1 A;  2P2C B;  4QWE A;  5KFU A;  5J1P A;  4YR3 A;  2DHS A;  4KFB B;  5DZ6 A;  3KTQ A;  1UFL A;  2YKP A;  4IFY A;  2CZ9 A;  2Y1J A;  1LWE B;  1HNI A;  5F8J A;  4C0O C;  4J9O A;  3CIM A;  2CPF A;  2XEX A;  3IXQ A;  3OT9 A;  1HQU B;  4GMK A;  3L7P A;  2ZBI A;  5E3A A;  2IAJ B;  3UO0 A;  2QSW A;  1ZAX A;  3P4U B;  3HI9 A;  4OZ0 A;  3SDE A;  4Q0B B;  4MTP A;  1TTH B;  2VPX B;  5KFW A;  5LT5 A;  4FXW A;  2F1F A;  5IV4 A;  2K3I A;  1RHJ B;  4F4A A;  1Y0H A;  3LF0 A;  3K17 A;  3CC4 S;  4LSN B;  4JV5 F;  2MPU A;  2BJ7 A;  3QBC A;  3K8V A;  5F8H A;  1YJT A;  2XUL A;  1TFW A;  1RAA B;  3K59 A;  4KGZ B;  1XBW A;  1YIT S;  1R3N A;  1C0T B;  3JAM U;  1IKY A;  4QIV A;  4B3S F;  4I67 A;  1YBA A;  5D77 A;  2GHV C;  5I3Q A;  4ZPA A;  4WKY A;  4PUO B;  2FJB B;  1NPK A;  3SEO A;  4FKY A;  3CCJ S;  2MSS A;  2IFX A;  1T9X A;  1MU2 A;  2ROE A;  1OPI A;  1V3R A;  1AYE A;  1NDP A;  4MFB B;  3EPI A;  1S97 A;  2DHG A;  4GVB A;  2O3D A;  4IRD A;  2E7W A;  4IQX A;  5JMN A;  2IHR 1;  2JVR A;  3H0P A;  1UA0 A;  1EJ7 L;  1HW9 A;  2YNH B;  1M5O C;  4M94 A;  3IBF B;  3PR4 A;  2OGU A;  4U7U K;  3EGW B;  2AT1 B;  2VDI A;  1T94 A;  3FFI B;  1WC4 A;  2C42 A;  3ET6 A;  3U27 A;  4DV1 F;  3OXF A;  5HK4 A;  3T9N A;  4PAA A;  2E9R X;  2K06 A;  4YUD A;  3R6L B;  1T05 B;  3SFG A;  2PO4 A;  2CG8 A;  4TLR A;  1SVD A;  1U1M A;  1TP7 A;  1VC0 A;  3N01 A;  2HRU A;  2I5J A;  1X4A A;  1TK5 A;  1DAX A;  3S01 A;  2GO8 A;  4C7Q A;  3MPW A;  3T6J A;  2GHP A;  3M2V B;  2PFD A;  1XR7 A;  1IR1 A;  3PEH A;  4XIU A;  2OPP B;  2ZM6 J;  3BQ0 A;  2BJD A;  5E2Q A;  2NXJ A;  4Y2K A;  2IRX A;  2XTJ P;  2BBE A;  1V5V A;  4TQR A;  1NJY A;  4DL3 A;  2VBZ A;  3NBP B;  1S76 D;  4ZPW R;  1H2V Z;  2XS7 A;  4KH1 B;  4YOE A;  4F3M A;  4USJ C;  2DR6 A;  4KB7 A;  4EWT A;  3DHX A;  2DNY A;  2DY1 A;  3W65 A;  2UUW A;  3I4P A;  3KMQ A;  5M2U A;  1VQS A;  3G82 A;  4QU6 A;  1B7F A;  2FB0 A;  3BGU A;  2KT2 A;  5B0E A;  4UST A;  2FZK B;  4M5L A;  3CJ2 A;  2ZOM A;  2AJ0 A;  5DDO C;  3J81 Y;  5ETP A;  2XS5 A;  3KUE A;  1RCO B;  3UN3 A;  3T1Y J;  2IY5 B;  4NRT A;  2R7U A;  4NLY A;  2MQQ A;  1PYS B;  2C2R A;  3CDB A;  2VDH A;  4U7U D;  5AXL A;  3BS9 A;  2LMI A;  4OI3 A;  4F4Y A;  3AXM A;  2XLI A;  4R8U B;  4ZCI A;  2CZ4 A;  4I1T A;  2ZHO A;  4YB1 P;  4TYB A;  3G96 A;  5D4L A;  1RTD B;  1NEE A;  2NPF A;  1T02 A;  1WTB A;  4AL5 A;  2GC8 A;  1ZYQ A;  3NGR A;  3RU0 A;  5A8R A;  4UOG A;  4R5P A;  2RUS A;  5IV3 A;  4DV3 J;  2KH9 A;  1XMB A;  5DQG A;  1WKL A;  1U2F A;  1HD1 A;  2RU9 A;  1UEK A;  5K8P A;  2DCU B;  4CLK A;  4X64 F;  1BQN A;  3D5M A;  3OD2 A;  3BQ1 A;  3I4H X;  4YP3 A;  2AJ4 A;  2FZC B;  2LVW A;  3G71 S;  3I96 A;  2EFQ A;  2VG7 B;  3GII A;  1QSY A;  1B0V A;  4KTQ A;  4ZPT R;  1B4S A;  2DPJ A;  4TY9 A;  2ZUG A;  1SV5 B;  4M8L A;  1NJX A;  1BHN A;  4OZL A;  2M8H A;  2ACY A;  4P7T A;  3NRB A;  3MM8 B;  4ALZ A;  4TU9 A;  2J6T A;  1EAY C;  1MRO B;  2Z0G A;  4IDK A;  1QM9 A;  3R3T A;  3CB4 A;  4K4S A;  1REV B;  2XHC A;  2XMM A;  5HQM A;  2KYZ A;  2G13 A;  2C3U A;  4U9R A;  3OW2 R;  1QDU B;  1SUQ B;  2M70 A;  2DNN A;  4NLX A;  1KWM A;  3VGU A;  3CCL S;  4C8O A;  2E66 A;  4A4J A;  2KRR A;  3OTB A;  1Q95 G;  4IFY B;  3EZO A;  4F7V A;  1HNI B;  3PYG A;  2ALY B;  3IWX A;  2COL A;  2VD3 A;  4DV5 F;  3KJV B;  4CCH A;  2RML A;  2NLW A;  2WBR A;  4UQG A;  2V50 A;  4ECS A;  1W25 A;  2IA0 A;  3NG8 A;  1WI6 A;  3D28 A;  5KTQ A;  1SQE A;  5D78 A;  2J0S D;  3TZW A;  1RWO B;  3WX4 A;  4ES1 A;  4EO6 A;  3PKY A;  1RWU A;  1Q7Y T;  1V3Z A;  4XTT A;  3MR6 A;  5DLF A;  3I0R B;  1TUW A;  2XGQ A;  1F9F A;  1IKY B;  1OWX A;  2NCK L;  3MOZ A;  2AWZ A;  3SI8 A;  1PGZ A;  2YKM A;  3J7Y U;  1X9W A;  1ZM3 A;  1YGY A;  1EIY B;  3CW2 C;  1WG5 A;  1I6J A;  2XSJ A;  1RWN B;  3AOB A;  3TJA A;  2Q43 A;  2MJU A;  2DNG A;  2JC1 A;  1UPM B;  4F0M A;  3NS6 A;  2P9E A;  3QAU A;  3M1V B;  4K7Q A;  2OIH A;  5K9F A;  1NK8 A;  4B9S A;  2CXE A;  3DLK B;  4FYD A;  3MR3 A;  4USH A;  3J7A N;  3D1Q A;  2HAF A;  1VQY A;  4DR4 J;  2Z2Z A;  3VTI A;  3HFK A;  2KI2 A;  3H4B A;  2VPZ B;  2V5H G;  4DS4 A;  1FEE A;  4GVB B;  1HWJ A;  4RNN A;  1FD8 A;  2FJD B;  1IBL J;  2MDA A;  3IM8 A;  1F9H A;  2JDJ A;  4EBE A;  1HQ2 A;  3GLJ A;  5DO2 A;  2FJX A;  3BO3 A;  2RVJ A;  4ZVE A;  3W1Y C;  1FFS B;  4I68 A;  4N76 A;  3QJP A;  5D15 A;  3J7Z T;  2B5J A;  4Z2X A;  3ET6 B;  1RWK B;  2DGX A;  1R6Y A;  4ES3 A;  1U49 A;  1I94 F;  4IOB A;  4KPC A;  3ISZ A;  4P71 A;  4IRC A;  3H40 A;  4K4T A;  5T7L B;  2BJ8 A;  4XPC A;  1FTC A;  2DKO B;  4KGV B;  2I5J B;  4DF4 A;  2CPZ A;  3MCO A;  5T14 A;  3ZZT A;  5L39 A;  5K5M A;  4K59 A;  1FEH A;  3LTO A;  4UUX A;  4DV4 J;  4PXE A;  5HQ8 A;  2KHD A;  1VK3 A;  5LL6 d;  5HRO A;  3OL6 A;  1K1Q A;  2DRB A;  2P9C A;  3IGV A;  1TZ0 A;  4WFZ A;  4EGL A;  4PR6 A;  4A8K A;  3PRB A;  2AMC B;  3PRV A;  3MZI A;  4ZIW A;  1WJ9 A;  4LF9 F;  3D6M B;  4O0N A;  3EGV A;  1LQ9 A;  4DPX A;  2HHX A;  3RRG A;  1RWM B;  3A3N B;  1H98 A;  3G82 B;  1F1B B;  5GME A;  3BBF A;  3EIC A;  3H90 A;  5KFP A;  3AOA A;  2JH3 A;  3FQL A;  4GC7 A;  2V2V A;  1RT5 B;  4O3O A;  1H7W A;  4FN5 A;  1YRX A;  1RQ0 A;  4HHU A;  1NKE A;  2MKK A;  4G65 A;  1N33 J;  3SQG B;  4WE1 B;  2KU7 A;  3MM9 B;  3HZE A;  3MMB A;  1Y5L B;  2JFK A;  1SJ3 P;  1XER A;  3C19 A;  3DI6 A;  4LF7 F;  1FA0 A;  1TL5 A;  2PA3 A;  4J7C A;  3BYR A;  1NJZ A;  2PEB A;  2GNK A;  3M6V A;  2HBR B;  5HN0 A;  2ZC4 A;  2B7B B;  4ELT A;  3IAM 9;  1TKT A;  4MKV A;  3CJQ A;  3NGD A;  5LMU F;  1QAI A;  1K0V A;  2LXU A;  1NBE B;  2KT3 A;  4ERD A;  4IR9 A;  4R5P B;  3ILI A;  3BN4 A;  5F0U A;  3V4I B;  1XTZ A;  1H2U X;  3AAW B;  1BQN B;  3DYA A;  3EVO A;  2NQP A;  1IBM J;  4NPO A;  3G8S A;  4O44 A;  1CBK A;  1BE4 A;  2F40 A;  1NB7 A;  3MEC A;  3GJR B;  2ALZ A;  2R8H A;  3HVR A;  4F67 A;  1RU2 A;  1G7C B;  1ZPW X;  2XYH B;  4F25 A;  2KTQ A;  2RU3 A;  4DQR A;  1NJI T;  4ZVO B;  2DO4 A;  1NHV A;  3GJT B;  4DLE A;  4U8V A;  3JSB A;  4IDK B;  1TL1 A;  5KFY A;  3OV7 A;  1G2E A;  4LF8 F;  3UVJ A;  3QFW A;  5HSP A;  2WVF A;  4ENO A;  2FGO A;  1VC5 A;  3AQO A;  2HFV A;  1S72 S;  1VBY A;  1UWB A;  4NXM J;  1SJF A;  2VPY B;  4WYL A;  5FD1 A;  2XMW A;  4P74 A;  3CT9 A;  4NLV A;  1FRX A;  1VYA A;  1QVF R;  2BR0 A;  4RNM A;  3JQJ A;  1OYD A;  2YX1 A;  3IGN A;  2FY8 A;  3KNG A;  1ICE B;  1CUL A;  3PIO Q;  3KLF A;  2HFN A;  5A2Q U;  3MMJ A;  4U6P A;  4LFC J;  3NWG A;  4LSZ B;  7AT1 B;  3WZ0 A;  3VF0 B;  5CCL A;  2XC9 A;  3I87 A;  4LFA J;  3GE9 A;  4JI6 J;  1R27 B;  4Y0F A;  1S7I A;  2EPI A;  3J7Y I;  1XIQ A;  4NLT A;  2MKJ A;  3TZX A;  1NSQ A;  3VAI A;  2W4D A;  4AQY F;  2VV5 A;  3GWC A;  2XMT A;  4HKQ A;  3OVS A;  3NNH A;  4ZLN A;  1EKS A;  3HD2 A;  1Y7P A;  1YG0 A;  4K8R A;  3KK2 B;  5KAK A;  1GFW B;  2Z4P A;  4PZV A;  1D8Z A;  5J2N A;  1WG4 A;  1AXQ A;  5IWA J;  2EBG A;  3DXS X;  4USK A;  3VWS A;  4DBQ A;  1U2C A;  4HR2 A;  3QRQ A;  3OL9 A;  2BRK A;  2D3U A;  3H20 A;  3DLH A;  5MAO A;  1RAI B;  2XSJ B;  3GCW P;  1M1G A;  5BR8 F;  5E0O A;  4DX5 A;  4I2P A;  1Q8K A;  2MB0 B;  2B9X A;  2HQC A;  4NLP A;  7FDR A;  4IOC Q;  1CEZ A;  5G0R A;  2CKW A;  3P8B B;  3H7H B;  4P2F A;  5FLX U;  3UPF A;  3UN5 A;  2AYE A;  2VF3 A;  4FYY B;  4A8S A;  3VGV A;  1DHM A;  4UT4 A;  4YS2 A;  3BB5 A;  4PKD B;  5B0G A;  4DOZ A;  1O0P A;  3KLI A;  3W62 A;  1QAX A;  4ANE A;  4X65 F;  1TQL A;  3TVY A;  2H48 B;  3MTK A;  1LFW A;  3AA9 A;  1VRQ C;  3N5B A;  4JYA F;  1FNO A;  5CZX A;  3MM6 A;  3R97 A;  4F0H A;  1YDL A;  3NGS A;  1RDR A;  4MKY A;  3O5T B;  4IO9 Q;  3HM9 A;  1NME B;  1N56 A;  2ILY A;  1TL3 A;  4ZCL A;  3CCT A;  4CRJ A;  5E3P A;  2DGU A;  9RUB A;  3ITH A;  4ZKA A;  3SV4 A;  1F5B A;  3LWL A;  2IMO A;  1H0H B;  1N52 B;  4UY8 5;  3FSY A;  4ZVF A;  1N5Q A;  1HNW J;  3T1Y F;  5HRO B;  2DNO A;  2EXU A;  4FXD A;  4NLW A;  4C11 A;  2R8K A;  3IG1 A;  1TK0 A;  4FF1 A;  3MD1 A;  4A47 A;  1WF2 A;  3IR7 B;  1H3D A;  2DTJ A;  4U8Y A;  4OI6 A;  1Y9O A;  1JJ2 R;  2Y8Y A;  4Q2M A;  5I42 B;  4L3N A;  2CJK A;  1NLK L;  1SJQ A;  2CQP A;  1FNM A;  1U02 A;  3QSI A;  4HAC A;  5EX0 A;  1EQ0 A;  1YKW A;  1X0P A;  3JYT A;  2V8H A;  4Q2L A;  4M5D B;  3CJ4 A;  5KFQ A;  2B3T B;  4NML A;  2XI2 A;  3HKZ D;  5J2P A;  4WZQ A;  1WHY A;  1U1L A;  3R9L A;  3WBZ A;  2U2F A;  3QGH A;  1S49 A;  4ECR A;  5A6P A;  1VQO S;  3MI7 X;  1UJ5 A;  1SIZ A;  2EW9 A;  3OFF A;  2C2N A;  3TRG A;  3MMC A;  2DGO A;  2CUY A;  2XS2 A;  4JI0 F;  1TVR B;  2E29 A;  3ADA C;  1S4E A;  3MMB B;  1WI8 A;  1FXR A;  8ATC B;  2HUR A;  4IFV B;  3AJ1 A;  4LFB J;  2AQ4 A;  4PG8 A;  1J5E J;  3HHD A;  3MGJ A;  4IG0 A;  3A8J A;  1ZZF A;  1YJ7 A;  1PIE A;  4RJV A;  1RBA A;  2R3V A;  3I32 A;  2BOP A;  2VZ9 A;  4JB8 B;  1WNE A;  4KPY A;  1TKT B;  1IBC B;  3QJL A;  2XY7 A;  4CO3 A;  5F3T A;  2FJA B;  2DVI A;  5MLC V;  1IKW B;  3PX0 A;  4KC5 A;  3FK4 A;  3ELH A;  1C4C A;  3T19 A;  2MHE A;  2YKQ A;  1TUG B;  1IM6 A;  1TAU A;  1S79 A;  3DYA B;  4DV7 F;  4KE5 A;  2VFS A;  3Q8S B;  3NP5 A;  4O44 B;  5DG7 A;  5CAA A;  3MEC B;  2ZWO A;  4KV8 B;  2DRD A;  3HFV A;  2NRE A;  1UAW A;  2XCA A;  1VRU B;  4NLO A;  1XQI A;  2NPI A;  1NSK L;  3PCO B;  4A8Y A;  2D41 A;  1P1L A;  1YJN S;  4LVO P;  2YY3 A;  3KJN B;  1TL1 B;  2CNO B;  3HFZ B;  4Y2I A;  1XNR J;  4F50 A;  4DSK A;  3PW4 A;  2Z56 B;  5HMW A;  3R27 A;  4DR2 J;  2UUC J;  1YRU A;  2IRU A;  4PG6 A;  1FDN A;  1UWB B;  2DGV A;  1UMJ A;  3DN9 A;  1DZ5 A;  3NWR A;  4NLD A;  4A46 A;  5CZV A;  3Q89 A;  1FT8 A;  1FVQ A;  3DFE A;  4J5O A;  1AB8 A;  1A0O B;  2E5I A;  1UVI A;  2Y1I A;  1ARO P;  3N4W A;  3WIV A;  1EQM A;  3BH6 B;  4J90 A;  1YIJ S;  2EC2 A;  3VR1 A;  2A6M A;  1P1T A;  2YQ3 A;  3KUH A;  3PJW A;  1ZM9 A;  2JLF A;  3PYE A;  1SKR A;  3TAM B;  4OYM A;  4QCL A;  1X9S A;  3W66 A;  1N5Y A;  2O5D A;  3M8P A;  3PFE A;  1JXV A;  1S0N A;  4OLP A;  4ZPC A;  4QR0 A;  1PKU A;  4OIX A;  1FKO A;  1O51 A;  3V5R A;  1OSD A;  3IWN C;  3EUN A;  4GO7 X;  5A8K B;  4Z7Y A;  3LGM A;  3LO3 A;  5GAD I;  1PAE X;  4E0D A;  2GZO A;  1VQ7 S;  4EZ9 A;  2DPI A;  5D4N A;  3F44 A;  4O4G A;  3Q8V A;  3PW2 A;  1PCA A;  3M6X A;  2QV6 A;  4RW4 B;  4X62 J;  1DQ9 A;  4ZJQ A;  3TUP A;  3OHB A;  4I2P B;  3KWM A;  2XMA A;  2JEF A;  1S6O A;  3D0G E;  1R8P A;  2V69 A;  1C2P A;  2MZJ A;  4LT6 A;  3HHL A;  3QID A;  3QRP A;  2QA2 A;  3HSD A;  1UVK A;  3GCX P;  4Y65 A;  2LYV A;  4WII A;  2VAS A;  5KFO A;  4ZCM A;  3FSX A;  2MKS A;  3D0I E;  1Q79 A;  1X31 C;  3DU6 A;  4WFA Q;  3IM9 A;  3TA1 A;  2VBX A;  2FQQ B;  3M2R A;  1CS4 A;  3JAM Y;  3ZZO A;  4KYZ A;  2NXE A;  2V8V A;  4H4K C;  2UXC J;  3M30 A;  3RB0 A;  4J9V A;  3KLI B;  4AXI A;  1WKK A;  4PQU A;  4PAB A;  1FKA F;  4RWX A;  4FS2 A;  4HVZ A;  4K4Z A;  4URS A;  1KN6 A;  2K7J A;  1VQL S;  1URN A;  3NXZ A;  2PC6 A;  3MM6 B;  4B3R J;  3GPA A;  3Q8P B;  4L3K A;  3PM9 A;  3TVZ A;  4OQJ A;  1VQM S;  3NCP A;  2YKO A;  5E41 A;  5LMN J;  1FRK A;  4FP9 A;  2A6O A;  5H9F J;  1TL3 B;  2F4V F;  4DLG A;  1FE0 A;  1X60 A;  1S1U A;  3ITH B;  3D4J A;  1L3K A;  1JJC B;  2W8K A;  3CO0 P;  4U95 A;  4XK8 C;  4ZPB A;  2QFJ A;  4CO0 A;  5F3Z A;  2MZS A;  4C11 B;  4QPT A;  3IG1 B;  4JI3 F;  3ZXW A;  2R7T A;  2Z58 B;  2ZUA A;  1KLM A;  4C0H A;  4LF4 J;  1S1T A;  2POK A;  2K2P A;  3UDL A;  1FRJ A;  3IFE A;  2PFF B;  1DBD A;  4IH7 A;  3QT8 A;  3G2X A;  2ADB A;  4PYA A;  5HLF B;  3FDS A;  4ZN1 A;  2OSQ A;  3TEH B;  4HAC B;  3D1O A;  3JYT B;  5CXT A;  4DF8 A;  2KXH A;  4NRU A;  5I4M A;  3FZB A;  4NL5 A;  2DY9 A;  2GO9 A;  4F4Z A;  4OJ3 A;  2DD8 S;  4ICL A;  4CM2 A;  5J2Q A;  5A6W A;  5J2P B;  5ETN A;  2DGT A;  4P7V A;  3HHL D;  1SCJ B;  4J9R A;  1ZS6 A;  4HTI A;  1RK8 A;  5KOX A;  2RF2 A;  3QNW B;  3FBC A;  3CJ5 A;  4DFK A;  2I2Y A;  3IA0 A;  3MMC B;  2UVU A;  3BM7 A;  4IYQ A;  1IR2 A;  4DR3 F;  1S9G A;  2YKN B;  2ZWP A;  1JLF B;  2ZVS A;  3MEE A;  2AIR B;  5IM0 A;  1HWI A;  2JJ4 D;  2B4V A;  4NLS A;  4RW7 A;  2DGQ A;  2P8I A;  2DRA A;  1JQG A;  1MNE A;  2AYB A;  1X5T A;  4ZVU B;  1GXT A;  1HFE L;  3S1T A;  3MFH A;  3DLE A;  2AP6 A;  2HZC A;  3FEY B;  4LRB A;  4YB5 A;  2DO0 A;  4ZA1 A;  1ELO A;  4JI8 J;  2U1A A;  3W5Z A;  4DV0 F;  1V6H A;  2RQC A;  1O5J A;  4ZVP B;  4JI5 J;  2Q1L A;  1NK4 A;  2W2N P;  2R7O A;  3H2L A;  3U1N A;  3PW0 A;  3R5G A;  4E2F B;  1RHM B;  3NOG A;  4MIW A;  4HI1 A;  2GGP A;  5A8W A;  2GJF A;  3SCJ E;  3DLJ A;  3AA8 A;  1UW9 A;  1R43 A;  2OML A;  1UWA A;  3RBE A;  2OTL S;  4OV6 A;  1X5P A;  2OMO A;  2HW3 A;  1YVF A;  2DR9 A;  3OVB A;  2F8E X;  4C97 A;  3U02 A;  2ZD1 B;  3MPU B;  3RBD A;  3ETM A;  4CTA A;  3FGV A;  3HJF A;  3MMA B;  1RYS A;  2RS2 A;  4CP5 A;  1WEY A;  2VFT A;  3Q86 A;  2FC8 A;  3P6Y C;  2W7P A;  1R7I A;  3ENA A;  1IQZ A;  4J91 A;  1NXI A;  1WOR A;  1T11 A;  3IO1 A;  3UW1 A;  3N6M A;  3G8Q A;  3DLG A;  1K9M T;  4WF9 Q;  1ROF A;  4PG4 A;  2J9E A;  1CC8 A;  1EX8 A;  2W4P A;  4M5G A;  2Q79 A;  3K5N A;  2M7S A;  1U1R A;  2H3E B;  3UE2 A;  5IWA F;  2FVS A;  2J7W A;  5J1E A;  2ATC B;  4DQP A;  1RLD A;  2ABY A;  1FJ7 A;  4HHJ A;  4C48 A;  3FBB A;  3J7A 1;  2LP4 A;  1PBA A;  1UP1 A;  3TUJ C;  4DR6 J;  2J9D A;  3BV8 A;  4PPD A;  9ATC B;  3H8Y A;  3MEG B;  1GMU A;  3DGV A;  4Q45 A;  1MSW D;  3ISN D;  2O67 A;  4W98 A;  4WJB A;  5DQI A;  1FKO B;  3KHG A;  5BYR A;  3D9B A;  3KK3 A;  3EJM A;  5B0A A;  4O23 A;  1FJG F;  2VFU A;  4R0E A;  2EI5 A;  2I9S A;  2XMK A;  1RJJ A;  4NWB A;  1N5T A;  3TAR A;  1Q4R A;  3VAG A;  4KGM A;  2EKN A;  4O4G B;  3MTJ A;  1VQ6 S;  4OX9 F;  3KLE A;  1WHW A;  2NZC A;  4MYU A;  4OYZ A;  4QW9 A;  2VC1 A;  1C0U B;  4IO1 A;  4S0M A;  2X51 A;  2JC0 A;  4DUY J;  3NY0 A;  2HVE A;  4ED6 A;  3ILO A;  2LDI A;  2CJX B;  3A8I A;  5KFA A;  2B0G A;  4F4W A;  4MMO A;  2UXB J;  4J9U E;  2JRS A;  1I5O B;  2CIM A;  4LR9 A;  3M9M B;  2W8L A;  4X66 F;  1GMV A;  5K20 B;  1GH8 A;  3M2R B;  4DV2 F;  2VQF J;  4KKO A;  1RKI A;  3T9Z A;  2B8P A;  4ZIT A;  4ELV A;  5DGB A;  4PQU B;  4WKR A;  3I6P A;  3F41 A;  2AJF E;  2JZ5 A;  3LAN A;  2K1R A;  3WQP A;  1VJW A;  4LQ3 A;  2BX6 A;  4FNI A;  1Q82 T;  2AZ3 A;  1HR0 F;  4EK2 A;  2MLY A;  2PE8 A;  3KK1 A;  4FNH A;  3I5A A;  1LKZ A;  2AHO B;  2ZNY A;  1GX6 A;  1S1U B;  2DK2 A;  2EG1 A;  4RLE A;  4WTY A;  2GFF A;  2HVH A;  2DIS A;  5F0W A;  1RTZ A;  2NYI A;  1GTE A;  1VC6 A;  3FMW A;  5HAN A;  3PG9 A;  1HNV A;  2JL9 A;  4C2M A;  2HQD A;  4N47 A;  2W2P P;  4B9T A;  3HPO A;  2ZDO A;  3C46 A;  1TAQ A;  4QWC A;  1Y3J A;  1UJ4 A;  2BE9 B;  1AUS L;  3GIL A;  3TJ9 A;  5KT5 A;  4FYV B;  1KLM B;  3GJQ B;  2DNR A;  3TUI C;  1S1T B;  2Y0S D;  1MW7 A;  3BF4 A;  4C3K A;  1KHV A;  4CH1 A;  2R9L A;  1FCA A;  4MK9 A;  4PXC A;  3ZTR A;  3D6T B;  3QAT A;  5CYJ A;  5ITH A;  3K7R A;  4L74 A;  1O6X A;  4XDD A;  4OZ2 A;  2EFP A;  3M9N B;  1LXJ A;  2HFU A;  4C8Y A;  1NU4 A;  3CSK A;  3QT6 A;  2HGM A;  2QLB B;  2E1C A;  1JX4 A;  3RBX A;  3C66 A;  5DET A;  1FO1 A;  2C2M B;  2M5Y A;  2UVR A;  2MEW A;  1IWG A;  3H42 A;  3ZTO A;  5J2Q B;  1M0S A;  2UZA A;  1FKP B;  1R8B A;  3TA2 A;  4LQ9 A;  1WD6 A;  3OXL A;  3KFW X;  1RT6 A;  4KQZ A;  1F5A A;  1KRP A;  1IKX A;  4RBT A;  2RF2 B;  4EO8 A;  3PVX A;  1JIH A;  4A8Q A;  3AD7 C;  4NCG A;  2LA4 A;  3DNC A;  3C8Y A;  2WTF A;  5BYS A;  1F2G A;  2CQ0 A;  1S9G B;  5D3G B;  2IYG A;  3MXH P;  1GX5 A;  4Y2A A;  2PGC A;  3TX0 A;  1EZZ B;  2UXD F;  3PW7 A;  4OYO A;  2N4D A;  2IM2 A;  2GAG C;  1YQH A;  1QTN B;  3MAH A;  2HND A;  4K4V A;  2BDP A;  4KH0 B;  3VAF A;  3DLE B;  2HNY A;  3DKD A;  3NS5 A;  3IRW P;  1B0T A;  4WYW A;  4JI1 F;  2M3D A;  1TEL A;  5KG7 A;  1HD0 A;  5LM7 E;  1ZZN A;  1TKX A;  5IT0 A;  1H73 A;  4F36 A;  2LU1 A;  4GKJ F;  2D7S A;  1S9F A;  2GGP B;  3HHK A;  1Q8L A;  5A8W B;  1G1X A;  1EAR A;  2HZA A;  2KO1 A;  1WDT A;  3TYT A;  3WDO A;  1WC3 A;  1S6Q A;  1IM4 A;  5E3R A;  1G3O A;  2KG0 A;  2Y1L B;  1NB2 A;  2Z2M A;  4ES2 A;  2V0N A;  4PRF A;  2P5V A;  2UU9 F;  3GTY X;  1R6V A;  1ZBT A;  3RJM B;  3DCA A;  2E5L J;  1Z1Z A;  2R2T A;  1N5V A;  2RNE A;  2E5H A;  4ILM A;  1X0F A;  3UQS A;  3TWZ A;  1KFD A;  3JSM B;  3HKW A;  3RW7 A;  4ZOS A;  1FE4 A;  5IT4 A;  1KON A;  2JEJ A;  4JI7 J;  3M8Y A;  2J9C A;  4EBD A;  3ZTQ A;  3QO9 A;  4FPI A;  1J2V A;  2MQL A;  2UUB F;  3S6E A;  4N56 A;  1UTA A;  3DLG B;  4NLG A;  1OO0 B;  1Q8B A;  4IH5 A;  1DRZ A;  4CWB A;  1U24 A;  2QA1 A;  3QAE A;  3BSN A;  2MKY A;  4K50 A;  1LFP A;  1KVJ A;  1VQN S;  2HHH J;  1LNQ A;  5D0G A;  2ZNZ A;  4C9D A;  5J1E B;  3AXK A;  3PNI A;  5KFN A;  1VQP S;  2V4R A;  3CCE S;  2M2B A;  3GP9 A;  1ZH5 A;  3H2U B;  1NAQ A;  4YN3 B;  4DQS A;  1IUJ A;  1DTT A;  2H1Y A;  1C1C A;  3BR9 A;  1BQM A;  2C1E B;  3C14 B;  2BOA A;  3GV7 B;  5DM7 Q;  2YQ0 A;  2FHK A;  4ZHR A;  3MD3 A;  3CMA S;  1FWK A;  5DQH A;  1NO8 A;  1U1O A;  4X4N A;  5L1K A;  1JLE A;  4NXN J;  2Y8W A;  4F26 A;  1J5O A;  2D69 A;  4KY3 A;  3LAM A;  5BYQ A;  3RGI A;  2WVD A;  5EN1 A;  2FD2 A;  4HH1 A;  2OHD A;  4DDF A;  4L6V 3;  3BDE A;  4IG3 B;  2BKN A;  2QA4 G;  4AXJ A;  3LPE A;  2VQE J;  3KG4 A;  1RXO B;  3KLE B;  1YJU A;  5A2Q Y;  3OBI A;  2R8I A;  2Z2Y B;  1BXN A;  4B9V A;  2RIL A;  3GSI A;  3DXB A;  1KTV A;  2ACM A;  3O3L A;  4B9L A;  2N7Y A;  2ZH7 A;  4CLS A;  2DNM A;  4F4X A;  1I51 B;  2LA6 A;  1RAG B;  2ZEJ A;  2MGZ A;  3O44 A;  1LWC A;  2BJ9 A;  4G1I A;  1Y5I B;  1R89 A;  1K1S A;  2A1B A;  1VQ8 S;  4CM0 A;  4WU2 A;  4P2X A;  4JI2 J;  3VHQ A;  3CCV S;  5KFJ A;  1TK8 A;  4DPY A;  2FHJ A;  2RE1 A;  3BEG B;  4USV A;  1YX2 A;  2HEK A;  2G1H A;  4IH6 A;  1XNQ F;  3JB9 k;  3N28 A;  3M8Q A;  4RWW A;  1RYR A;  1XMO J;  1T9Y A;  1N34 J;  2F8H A;  1FF2 A;  2BKP A;  4DR7 F;  3OTO J;  2H54 B;  2KZM A;  2C3O A;  3UWT A;  1S1V A;  3PEJ A;  3H25 A;  3DDK A;  1BWE A;  4KJI A;  4M1K A;  3DMJ B;  3DRX A;  3UR0 A;  2E7X A;  3KK1 B;  5FLX Y;  1K44 A;  3BSA A;  4LF6 F;  2CPY A;  5C5J A;  4DFM A;  3B78 A;  1HNX F;  1E6Y A;  2RQ4 A;  2YX4 A;  5DJB A;  3UNY A;  4RW9 B;  4NA1 A;  3WX8 A;  1HNV B;  2HGL A;  1BWV A;  2KL8 A;  1U1K A;  3DOL B;  5HP1 A;  4DSL A;  1GMW D;  3R7S B;  4X4V A;  1F2H A;  2Z57 B;  2FIU A;  3LH2 S;  3RB6 A;  2AEJ A;  2ILZ A;  2Y9H A;  4YQW A;  2D9O A;  1UFK A;  1KDN A;  2E5J A;  2CA9 A;  3N9U C;  4DR5 J;  1QVG R;  1KVK A;  1Z2Z A;  1SPB P;  1VRT A;  1PC5 A;  4ZPV R;  3M32 A;  5EHH A;  2OFG X;  4C3M A;  5GAE I;  4G6V B;  2DNL A;  4NI2 A;  1JLC A;  2BV3 A;  2MQN A;  2RB7 A;  4ZVS B;  1HBN A;  1SL2 A;  4PYD A;  3QGG A;  4AUK A;  5IQ6 A;  4DPW A;  1SL0 A;  5LSL A;  3GON A;  4JI5 F;  1YJV A;  2D74 B;  2CPD A;  3L7O A;  3KHR A;  2WVE A;  5E3C A;  1UKU A;  2R2U A;  4JI4 F;  2EWH A;  2I38 A;  5AXM A;  4Y2C A;  1RT6 B;  4L73 A;  1IKX B;  4LF1 A;  1NPP A;  2M4M A;  1BQX A;  2G2Z A;  4NCG B;  5AE3 A;  1YSJ A;  3OUY B;  2RRN A;  3RB3 A;  4CYU A;  3EVM A;  3W3S A;  4QR2 A;  3AB2 B;  2UVW A;  1UCN A;  3RRK A;  3K5O A;  2FLO A;  2RRA A;  2H51 B;  4PEO A;  4ECY A;  2P6S A;  1HBM A;  2HND B;  1IKV A;  2R7Q A;  1GXU A;  4K5S A;  4UOC A;  2CDR B;  2RIJ A;  3PV8 A;  5HBM A;  3VAH A;  2X3G A;  1WG1 A;  5I3U A;  5A0Y A;  4OHW A;  1TKX B;  5AT1 B;  1LEO A;  1WWH A;  4XPE A;  1DTQ A;  4C8L A;  3M2U A;  5AJ3 J;  4ECQ A;  1CC7 A;  1VFJ A;  2ZOG A;  2H5E A;  4W92 B;  4OYX A;  2ZE2 A;  2FYX A;  1RZM A;  1T3O A;  4FF4 A;  4DI6 A;  3MAA A;  1VIX A;  1S6P A;  4YHH J;  4USW A;  1SB6 A;  3T41 A;  1LOU A;  3CD7 A;  2CFX A;  5ETK A;  1TV6 A;  1UET A;  4EZ6 A;  2BQR A;  4Z7C A;  5HVG A;  2JLG A;  5A76 A;  4RW8 B;  3QO9 B;  5K14 A;  2VIC A;  4M63 A;  3NGU A;  4OFZ A;  2WON A;  1M90 T;  3DRY A;  4DZD A;  1U6F A;  2VL1 A;  2BW2 A;  2GAH C;  3T5K A;  2BM1 A;  3PHE A;  2R4F A;  4ZS6 A;  2CVE A;  2V4J B;  1QAY A;  1N48 A;  2NUH A;  3W2V A;  1HNZ F;  4O4R A;  3R1L A;  4M95 A;  3H5X A;  3UDV A;  4DFP A;  4NA2 A;  1DTT B;  3CO9 A;  3R1H A;  5HJY A;  4UTG A;  1BQM B;  2B4U A;  1JJH A;  2E44 A;  4AD6 A;  3MPD A;  3GYG A;  2DIV A;  1JLG A;  4QJV A;  1T9V A;  4LVN P;  3HX9 A;  1QD1 A;  2ZC3 A;  1SC3 B;  4OZN A;  2WK4 A;  3G6V A;  3CDE A;  4MKB A;  5ADZ A;  1JLE B;  2UUA J;  4DSE A;  2IBK A;  1SQG A;  2VKZ G;  2MKH A;  1J5O B;  4RUA A;  2L9W A;  3M6U A;  5DDP C;  4TY8 B;  3G6Y A;  2B51 A;  4DR1 F;  5GAH U;  1CJU A;  3DRR B;  1UJ6 A;  4BC9 A;  4GKK J;  2ZZN A;  4C8K A;  2VG6 A;  2OEJ A;  4ZP7 A;  3OVA A;  4DV6 F;  1KLN A;  3BSC A;  4KGX B;  4ETZ A;  2J6S A;  1T95 A;  3I56 S;  5DRK A;  1S0M A;  4OX6 A;  4M5N A;  5KG6 A;  4KRW A;  3GYX B;  1HBU B;  1LWC B;  3Q0A A;  2J7U A;  2ADC A;  2K7K A;  1DQA A;  4B3M F;  1WEZ A;  2BRL A;  3D0H E;  2L48 A;  2HSE B;  1IJF B;  2KHC A;  1JXL A;  3U1L A;  3I82 A;  1M5P C;  3C16 A;  3DHW C;  4DX6 A;  3M8Q B;  4I2Q A;  3CCS S;  2F8M A;  2K3K A;  1RSC A;  1JXE A;  4YDX A;  3POT A;  1XJW B;  1RAD B;  4DL6 A;  4X4P A;  1S1V B;  2KFN A;  8RUC A;  3NAH A;  1S5Z A;  1RT2 B;  1K47 A;  1UVL A;  5F8N A;  1FI4 A;  3CUL A;  4PXB A;  4J9M A;  2UUT A;  3I31 A;  2ZKT A;  5B0B A;  3O2I A;  4TN2 A;  2H5J B;  3IC1 A;  1HYS A;  2YWH A;  4WWS A;  4LMZ A;  3D68 A;  1U48 A;  3N79 A;  4FYX B;  5K8M A;  4WP8 A;  3TR5 A;  2FHO B;  4I69 A;  1CJT A;  3GIK A;  2HBY B;  1D9D A;  4JV5 J;  1KKH A;  2FVQ A;  3HJV A;  2JFD A;  4O3R A;  2VHG A;  3Q8R B;  3OR2 A;  1YK9 A;  3LUY A;  2CJA A;  4FZV A;  1NSP A;  2J0W A;  2WHO A;  3GU0 A;  3HVA A;  1NJW A;  2ASD A;  2ASY A;  4MYT A;  3N5F A;  3VGT A;  3GR0 A;  2BE7 D;  1PJ6 A;  4QZV B;  1D9A A;  1EET A;  1DY3 A;  1VRT B;  1OMS A;  5IOL A;  1D8Y A;  3HDS A;  5ETQ A;  3M32 B;  3TEG A;  3I55 S;  2AYG A;  4NYP A;  4QIE A;  1ULR A;  2N3O A;  3D67 A;  1HBN B;  5EGY A;  2BQ3 A;  4O3Q A;  2JSX A;  1MN9 A;  3TI0 A;  4QQB A;  3SYZ A;  1HA1 A;  1S99 A;  2JOQ A;  3WC0 A;  5L46 A;  2JEG A;  3RG6 A;  1TL7 A;  2CRL A;  2F7V A;  2GVZ B;  2YQ1 A;  1RHK B;  1RT1 A;  1VOM A;  2WSE C;  4ID5 A;  4EUV A;  2XSF A;  2AGO A;  1R0A A;  1X7V A;  4CYU B;  2CG4 A;  3HCX A;  1M1H A;  1LK7 A;  4RBU A;  3JSR A;  4H4M B;  4RR5 A;  3UCZ P;  2IJN A;  4CLY A;  4RNH A;  1RTH A;  3M6W A;  1R31 A;  4WXO A;  1HBM B;  1WF0 A;  5KFR A;  3I0S A;  1JLQ B;  1IKV B;  1RAF B;  1X4F A;  2M52 A;  2XWY A;  4M5K A;  5HBM B;  5AXN A;  2LQ5 A;  3QWP A;  5I3U B;  2ZBR A;  1N88 A;  5A0Y B;  3ETO A;  3PR5 B;  2DIU A;  2WBM A;  4DCJ B;  2FTR A;  3B4D A;  3R7N B;  1FES A;  3QZ7 A;  3QSY B;  5DLG A;  4QOT A;  3J81 j;  3IS9 A;  4EBC A;  1S59 A;  2EC0 A;  4ZK7 M;  1TUV A;  4KHM A;  4ZN3 A;  2ZE2 B;  2BYC A;  3VAJ A;  3L7U A;  1N36 J;  1S77 D;  4IR1 A;  3SFU A;  2O01 C;  3Q23 A;  4ED0 A;  5HI7 A;  2KT5 A;  3MAA B;  1S6P B;  4KO0 A;  2CQD A;  3BKT A;  3RUB L;  1TV6 B;  3W7B A;  2FHM A;  2OEM A;  5F8G A;  3LGN A;  3SDE B;  2JLE A;  4NCA A;  5DM6 Q;  5DS7 A;  1T9T A;  1MMN A;  5K14 B;  1JLB A;  3G86 A;  3HMJ G;  3TP2 A;  3FQK A;  2D1C A;  1WUU A;  1DLO A;  2WON B;  4L72 B;  3EXC X;  4HI2 A;  1S1W A;  3HVW A;  3RAX A;  3EWG A;  2HQ3 A;  1S0O A;  1C1B A;  3EMT A;  2W9B A;  2DJW A;  4HHH A;  5KFL A;  1SIW B;  3MDF A;  5DDR C;  3UDE A;  2E5G A;  3W2V B;  5GAH I;  4EYI B;  4CNY A;  4CQ1 A;  1BD6 A;  3DRS A;  3KDO A;  1U09 A;  2BE2 A;  2MHN A;  1U2R A;  3SIP B;  1U4B A;  1D09 B;  3W64 A;  3OLB A;  5J2M A;  2L3M A;  4KHP F;  4DMZ A;  1IXK A;  3R2D J;  2J76 E;  2J6U A;  1MU2 B;  4YY3 J;  1CLF A;  1CJV A;  2OP5 A;  1N8R T;  3OR1 A;  2MZR A;  1SC1 B;  2G0C A;  2RH3 A;  4KFB A;  3W2W A;  2YKA A;  1Y5N B;  3M8R A;  5HVH A;  4YEA A;  3HHL C;  4QU7 A;  4C8N A;  4X64 J;  1QLN A;  1N34 F;  3TZZ A;  1M1K T;  1WOO A;  1RWW B;  3THP A;  3UD5 A;  1HQU A;  2QL7 B;  5DG8 A;  3LQV A;  3OJS A;  3DLL Q;  1FX2 A;  4L75 A;  4JUZ A;  4I6Y A;  3PO5 A;  4BC7 A;  1UFW A;  2FDN A;  1LK5 A;  1S12 A;  1JKH A;  4PPZ A;  4F3O A;  5KFM A;  4J9L A;  3JXO A;  1MWY A;  1K8A T;  3TAN A;  4G1Q A;  3TO8 A;  1B0P A;  4V19 J;  1B99 A;  3QFH A;  1QSS A;  1XN9 A;  5EWG A;  2GCF A;  3BQ2 A;  5B0C A;  5DZ7 A;  4YB6 A;  2MYF A;  4K0K F;  1KOH A;  3C16 B;  3OL8 A;  3SSS A;  5C24 A;  2NSC A;  4AFF A;  4I2Q B;  1PYT A;  2OEK A;  5U47 A;  4IOA Q;  2MLZ A;  1BGX T;  4NEZ A;  3MUT P;  4K4U A;  3EPG A;  2WAQ D;  4JBC A;  4P72 A;  4ZP6 A;  3POT B;  4DR5 F;  2FGC A;  4URQ U;  1FXL A;  3IRX A;  4DV5 J;  1FDD A;  3ZZP A;  4TQS A;  3HP6 A;  2HHS A;  1Z4U A;  3PO4 A;  1ZM4 A;  1SJ4 P;  2KVI A;  5CH7 B;  2HK3 A;  3QGP A;  2HRT A;  1JB0 C;  4ID8 A;  1CJT B;  2Y1R I;  2OEL A;  2BA9 A;  3IR6 B;  2X1F A;  2CNK B;  3CJK A;  2A2C A;  3PYD A;  1OY6 A;  5CD4 A;  4K4X A;  5ETT A;  2Q6C A;  5ETL A;  2QIF A;  1ITP A;  3NOC A;  2HNZ A;  4HTJ A;  2XNQ A;  1N0V C;  2ZH9 A;  2G9O A;  4P6Q A;  1HPZ A;  4K2X A;  1YJW S;  1EET B;  2ZH3 A;  3HT3 A;  1W2I A;  5HMX A;  4DPU A;  3NNA A;  2V2Q A;  4LSL A;  4LF5 F;  3A12 A;  2V8P A;  4NLU A;  2V6A A;  2DH9 A;  1T05 A;  3IP0 A;  3FBF A;  4OLO A;  4QWA A;  4BS2 A;  4C8Z A;  3CDA A;  3HHE A;  2IVF B;  3H59 A;  2H5I B;  2IRY A;  4DL0 C;  4DCP B;  3CCW A;  4LRD A;  1EKR A;  3A1Y G;  5EDW A;  3M2V A;  3ISN C;  1TL7 B;  5FDL A;  3TAP A;  5THW A;  4N41 A;  4D3G A;  1JNZ B;  5A8R B;  2W2Q P;  1RT1 B;  1WF1 A;  3G87 A;  2NXN A;  1FFW B;  2ZZT A;  3AHP A;  1KSP A;  4DU8 A;  2HK2 A;  1R0A B;  3TQ1 A;  1FVS A;  3MAQ A;  1UEV A;  1LWF A;  5CD4 H;  3GV5 B;  1Y10 A;  4WK3 A;  4F8R A;  1VIO A;  5F8L A;  3NBP A;  1RTH B;  2FJW A;  4N7T A;  3BDP A;  2DGW A;  2NXU A;  3BZQ A;  2C28 A;  4CH7 A;  2FY1 A;  2DT9 A;  2DB1 A;  1R0C B;  3I0S B;  4DQI A;  1I94 J;  2H9Z A;  3G8T A;  2M0G B;  4N8O A;  1WDD A;  3CMQ A;  3AD8 C;  2XO7 A;  3GG0 A;  2BQU A;  2V9K A;  4KR0 B;  2ATL A;  1XWL A;  1PO6 A;  2B9E A;  1VDH A;  1RT4 A;  1TFY A;  3D6H B;  2FLP A;  2HBQ B;  3CWJ A;  1QJH A;  4LJM A;  2BJ1 A;  4WFY A;  4NZ6 A;  1HLW A;  3IS9 B;  2QSF A;  2CPE A;  4ECV A;  2OI2 A;  4Y2M A;  1WKJ A;  3MPV A;  2J0Q D;  2IMW P;  4LR8 A;  2XI3 A;  5HAO A;  4HYK A;  3BKU A;  2VU5 A;  2YWE A;  2RAQ A;  3K2Y A;  3QQC D;  1MG7 A;  1RGV A;  3CJ8 A;  1ZAV A;  2XBP A;  3NGK A;  1KNZ A;  2W2M P;  2GQQ A;  4KO0 B;  3W8G A;  1QTM A;  2QLJ B;  3AOD A;  3W9H A;  2G0I A;  1YZ6 A;  1RU1 A;  1OS5 A;  4R8U A;  3T3F A;  3GG1 A;  2CJB A;  3UD4 P;  2HLT A;  5H9E K;  1RTD A;  1DQ8 A;  2LEA A;  4ZVG A;  2ZHA A;  3AY0 A;  3MUM P;  2EFO A;  2BJ3 A;  2Z30 B;  4QYZ K;  2F5G A;  2KN4 A;  1JLB B;  1MWZ A;  1KS2 A;  1HAR A;  2YWF A;  1W26 A;  1DLO B;  2Q66 A;  1SC4 B;  3IBC B;  2QFI A;  4FVM A;  3G4S S;  1S1W B;  5KT3 A;  1R8C A;  4L76 A;  2VC0 A;  1WHX A;  1NRK A;  2XO6 A;  3ULH A;  1C1B B;  2VG7 A;  4X84 A;  3P3D A;  3OTD A;  4DPT A;  3RYL A;  4PG5 A;  2E1M C;  2YKM B;  5L9X A;  1XMQ J;  2PN6 A;  2JX2 A;  4C3L A;  3DRS B;  4LF7 J;  2BE2 B;  3LGH A;  1BC6 A;  3HK2 A;  1I1G A;  2LEB A;  5J2M B;  3RR8 A;  5HQL A;  1EB0 A;  1S7H A;  3V6J A;  2RHQ B;  5LMU J;  1CJV B;  4D3H A;  3BGO P;  5GAD U;  5HO4 A;  3CXC R;  3W2W B;  3R7B B;  4MJK A;  2I8E A;  3ZZY A;  4DZ6 A;  2A3J A;  2F63 A;  2ZM6 F;  2V4Q A;  3VAK A;  1Y00 A;  1OIA A;  3VAL A;  4KGK A;  3KKF A;  2DCL A;  3BN7 A;  2X1B A;  4FYW B;  1F3F A;  4UOH A;  1X5O A;  4CH0 S;  5JJB A;  3KJV A;  3M8W A;  2C3M A;  1B64 A;  3GFX A;  2V2K A;  2HWH A;  1JKH B;  3G6E S;  2HMI A;  2B5J B;  1NHK L;  1Y11 A;  3T5H A;  1ZM2 A;  2LCW A;  4MH8 A;  1RWX B;  4LRC A;  3MUV P;  2QGF B;  4MK8 A;  1NH8 A;  2HPU A;  4G1Q B;  3P49 B;  2VON A; 
#chains in the Genus database with same CATH homology
 3IMQ J;  2VQF J;  1XMQ J;  2MQ8 A;  1HNX J;  4PWW A;  4DV4 J;  4DR3 J;  4LF8 J;  3JAM U;  4JYA J;  3J80 U;  4LF9 J;  5LM7 E;  3J7A N;  4DV7 J;  4DR4 J;  4LF7 J;  4GKJ J;  4YHH J;  2HHH J;  4NEY A;  1FJG J;  4JI3 J;  1IBL J;  5IWA J;  2UUA J;  4V1A k;  4DR1 J;  5LMU J;  2MEW A;  2KL8 A;  1HR0 J;  4NXM J;  1IBK J;  3T1Y J;  1N32 J;  4OX9 J;  5BR8 J;  4JI2 J;  3T1H J;  4LF4 J;  4KYZ A;  4LF6 J;  2UU9 J;  4GKK J;  4DV0 J;  2UXC J;  3W1Y C;  3R2C J;  4JI0 J;  4JI8 J;  2ZM6 J;  3D3B J;  5IT9 U;  2E5L J;  4DUY J;  4DV6 J;  1XNQ J;  4DR5 J;  4JI5 J;  4K0K J;  1N36 J;  4KHP J;  4B3T J;  2KVQ E;  1XNR J;  1I94 J;  1IBM J;  1XMO J;  5FLX U;  4DR7 J;  1N34 J;  1HNW J;  2MTL A;  4LF5 J;  4LFB J;  3R2D J;  4DR2 J;  2UXB J;  5A2Q U;  4NXN J;  2UXD J;  4YY3 J;  4LFC J;  4DV1 J;  1J5E J;  3OTO J;  4B3R J;  4X66 J;  4DUZ J;  4KY3 A;  4JV5 J;  4JI7 J;  2UUC J;  4B3S J;  4LFA J;  4RJV A;  3D3C J;  4HHU A;  4JI6 J;  4NEZ A;  1HNZ J;  2UUB J;  4DR6 J;  2F4V J;  4JI4 J;  5AJ3 J;  4B3M J;  5LMN J;  4DV3 J;  1N33 J;  4AQY J;  4DV2 J;  2VQE J;  3J81 U;  4DV5 J;  4X65 J;  4JI1 J;  4X62 J;  4X64 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...