4JYAJ

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4jyaJ00
4NEZA 2KVQE 4LFAJ 5BR8J 4DV1J 2UUCJ 1XNRJ 5LMUJ 5IWAJ 4DUZJ 2F4VJ 2MEWA 4V1Ak 5LM7E 4DR4J 4DV5J 4KYZA 5AJ3J 3T1HJ 4YY3J 4DV3J 1N36J 2VQFJ 1IBMJ 4DV0J 4DR1J 4LF6J 5IT9U 4JI2J 3IMQJ 3T1YJ 4KY3A 4JI0J 4JI3J 4JI1J 4LF5J 1N32J 1HNZJ 1FJGJ 4JI8J 2MQ8A 4JI5J 3OTOJ 4B3SJ 4RJVA 1N33J 4B3TJ 4DR6J 4X66J 4LF8J 2ZM6J 4NXNJ 4NEYA 1IBKJ 4DR2J 5A2QU 4PWWA 4YHHJ 4X65J 4DV6J 3J7AN 4LFCJ 4DR7J 4NXMJ 4DV4J 4LF9J 1N34J 4JI7J 2KL8A 4AQYJ 4DR3J 2UU9J 1HNXJ 3J81U 4KHPJ 3JAMU 4HHUA 4X62J 4LFBJ 2UXBJ 4DR5J 2VQEJ 2UXCJ 4OX9J 4GKJJ 4JYAJ 2E5LJ 4LF7J 5FLXU 4JI4J 1XMQJ 4DV7J 4GKKJ 4B3RJ 4JV5J 1HR0J 4B3MJ 3D3BJ 2UUAJ 4X64J 1XNQJ 2UXDJ 1HNWJ 1XMOJ 4JI6J 3D3CJ 2UUBJ 3R2CJ 4LF4J 4K0KJ 3R2DJ 4DUYJ 1I94J 1J5EJ 3J80U 1IBLJ 2MTLA 5LMNJ 4DV2J 3W1YC 2HHHJ
chains in the Genus database with same CATH superfamily
1H0HB 3MCOA 3PVXA 4F0HA 2NXCA 3DDNA 2MEWA 4DV5J 3R27A 4X4NA 9RUBA 3MECA 3OBIA 5KFVA 3MMCB 3FCWA 1IM6A 5LXYA 2C2ZB 2R7OA 1P1LA 2LEAA 2HHUA 4M63A 4J9VA 3QT7A 1RAEB 3T5JA 3GYXB 2RUGA 4C97A 1JNRB 2JDJA 5CA5A 2QMXA 1RT4B 4YR2A 4B9SA 2ZEJA 4LF7J 3KK3B 2YWWA 1FRJA 2QTWA 4IFYA 5CXTA 4PQAA 3MEGB 5THWA 1FNXH 3HPOA 1FX2A 2QLJB 3PYDA 3CW2C 2ZOMA 4OI6A 2VIHA 2J0SD 4JP8A 4OJGA 5FIIA 3W2VA 1OJ4A 1FK9B 2VPZB 1HWLA 4URSA 1UVLA 1DHMA 4BWJA 5D0EA 2OKQA 1RADB 4ED3A 2VONA 2HQDA 4OYMA 2MSTA 2ZJQQ 3OR1B 5DG7A 2MHNA 2VG5A 5D15A 3FNNA 3BGOP 1MW7A 1JJHA 4M5MA 5AXMA 2RQMA 1RAJA 1WEZA 2HHSA 3W63A 4DFJA 1VQKS 4M1KA 4ZPBA 1RYRA 4NZ7A 3K2YA 5DGBA 3LQVA 2XYGB 5A8KA 4X84A 1KSPA 1N88A 5BYSA 3MMBB 4N7TA 3TNVA 3BF4A 1NEEA 1EP4B 4NXMJ 1FRKA 3AH6A 4JI7F 1VK3A 4DR3J 2CNOB 3TJ8A 3TJ9A 3ZNUA 1XMQF 2WVFA 2AGOA 1VQ8S 2CPEA 3CXCR 2R3VA 4NYPA 2AV5A 3UCZP 4Z7YA 1W26A 4V19X 4OLPA 4NA3A 3RYLA 2RDJA 4WIQA 2NLWA 3N9UC 3MM5A 3ZZOA 5DRKA 4ZA1A 1LWFB 4CLSA 2V2QA 4BHQA 1LV5A 2FGCA 2ZOFA 2WRMA 4DL4A 4LQ3A 2BUNA 4USUA 2ZM6F 2EXUA 3G8SA 4Y2CA 1TMJA 2OFGX 1UVMA 1C1CA 5I4MA 3MPUB 3RR8A 1VQ4S 2FD2A 1HD1A 4QJVA 1C0TB 4QR0A 3NMAA 1AFJA 2YKMA 2G13A 2ATCB 4NEYA 2XNRA 1ZTTA 3PM9A 4K4UA 1U6FA 4O3QA 3KJFB 5DQHA 5DM6Q 4X4RA 1FWLA 5B0BA 2LDYA 4F4XA 1IKXA 4EI2A 2NXEA 3Q8VA 1TUVA 2QT7A 4FZVA 2DKOB 4ZIVA 1F5CA 1BUXA 5KT6A 2ZBPA 2F1FA 4Q8FA 1VMBA 1Y5LB 3BQ2A 4L76A 4ENOA 1D9AA 5HVGA 2R7TA 3DDKA 2X3GA 2XY6A 2PMHA 2WTFA 4EBCA 3KYLA 2XY5A 2F4VF 4OI3A 2GAHC 4N77A 4RBTA 1TV6A 4GVBA 1X60A 2J6SA 2VV5A 1LFPA 3QWPA 3PO5A 1T0TV 2KI2A 2OTJS 4QW8A 4TVAB 3OHAA 2E29A 2K3KA 4JI8F 3TOQA 4USVA 2A6OA 1HL6A 2H48B 2DNMA 1NBEB 1DQ9A 2DGTA 2DTJA 2Z56B 2XS7A 4LBPA 1P6TA 1X5PA 3W3SA 3BQ1A 2CWXA 2Z2ZA 3EDRB 1VI7A 4WP8A 2KFNA 4P2MA 1IQTA 3L4BC 3SXLA 2GIQA 2VQEJ 3FMBA 4WIIA 4RUHA 1YBAA 3QQCD 2X51A 4ZPVR 2XWXA 3LP1A 2F3JA 5ETRA 1TVRB 1I94J 1CQNA 2DH7A 5FDLA 1QE1B 2D3UA 3DGPA 4CLLA 4DZDA 1OYDA 5G0RB 3OUYB 4QR2A 3AJDA 1D9DA 3CDUA 3HX9A 4I69A 1UZDA 5RUBA 4P2XA 4FKYA 3G6XA 5AJ3J 2JVRA 1FDBA 1XN9A 3ICLA 5KFGA 1VGYA 2AGPA 2WW4A 1LKZA 1G7CB 4FNIA 3FJ2A 3IG1B 1IXKA 2RT3A 1YWXA 4B9VA 1WG5A 1SJ3P 2HBYB 1H72C 1EZZB 4FF4A 3R3TA 1ZAWA 1WHVA 3R7BB 4XPEA 2MKIA 3WC2A 3RU0A 4IQMA 1F2GA 2KVIA 1DTQB 2IA0A 1NU4A 4AYBD 3NGRA 3HJVA 1YK9A 3TAMA 1UCNA 4OZLA 3LW5C 3SFGA 3W60A 2LLZA 3D4JA 2FHOB 1R31A 4HVZA 4RW8B 4DUYF 1C4CA 3R5DA 3EDQB 2ZE2B 1UVNA 2E44A 4J7CA 1FKPB 1WC6A 1S0MA 2CKWA 3LAKA 2HHHJ 3QJPA 2AYEA 2QZ8A 5DG9A 4ALZA 3M8PB 2EPIA 5K8NA 1Q53A 2PMZD 1RYSA 4C4WA 2OPSA 3QGGA 1HNVB 3LUYA 3PRDA 5HROB 2QG9B 1RTDB 1Q8KA 1ZA1B 3DCAA 1VFJA 1PJ5A 2WZ1A 3H5SA 4CO1A 4KE5A 3MUMP 1XQIA 2G4BA 3RB3A 1Q0NA 4ILLA 1BC6A 3SCIE 3LANA 2Q1LA 4LSLB 3J7A1 4NPOA 1EJ7L 2MLZA 4LREA 2V9WA 3DOMB 2Y3YA 2CQ1A 2A0FB 3MM6A 2CIMA 4NXNF 3BGLA 1NB2A 3V6DA 4Q7AA 2UXDF 4QIWD 4O3RA 4B9LA 4FXWA 3AJ1A 3MEDA 2IFXA 5ETPA 3FC9A 4WF9Q 2LECA 1CLFA 1UFWA 3DLBA 5HBMA 3EVMA 3LAMA 3C66A 3ZZ0A 1UVIA 4K59A 2CPDA 2MZSA 3OSPA 1MMNA 1H7XA 3AY0A 4NI2B 3VF0B 2AKWB 3N6MA 3AXKA 1SKSA 3A3PB 3IR5B 4ZVOB 3E51A 4CLTA 4FXDA 4MK7A 2DNZA 4Q2MA 4DV1F 2J0WA 4DLEA 1FEEA 3JTOA 3MMJA 3PRVA 4C48A 5HAOA 2DIVA 1HQUA 1N36J 1XIQA 4Y2IA 1U2CA 4PG7A 3MHYA 1TKTA 3PIPQ 5GADU 5J2NB 4JI1F 1SV5B 1XWLA 1U1RA 2W7AA 1WF1A 2CQ0A 2EFOA 2P5VA 4LFBF 4JV1A 2ZC3A 4NLOA 1R27B 4KJIA 4NCAA 3NGUA 2KJVA 3DI6A 5E33A 3IAM9 4JI7J 1UETA 1S5ZA 1DLOA 4JYAJ 1XMQJ 1O6XA 3MAAA 5KFDA 3U7JA 5IQQA 3L95X 2NCKL 2QX0A 1L3VA 3LA0A 3X1LB 4KH1B 2HRYA 3JSMB 1ZS6A 4FYDA 1N6QB 2CAJA 1WG1A 1IVZA 3JS9A 3KJNB 2EI5A 4P2FA 1U8SA 1WF0A 2CJAA 3H4BA 4TY8B 1WOSA 3IN5A 1C1BB 1FKOA 2HFSA 3T41A 4ECVA 3PCOB 4Q44A 5U47A 1S1XA 1UKUA 1TP7A 3K5LA 3F56A 2ROEA 4M8LA 3V6KA 3WQPA 2N3OA 3OV7A 3HHDA 4WPAA 3V81A 2RS8A 2H5IB 2ADBA 2DPIA 4G1QA 3QGHA 2XLIA 2C2MB 3CGIA 3KJVA 1W2BR 2QO3A 4U8YA 2E7WA 1A0OB 2AF6A 3KK1B 4I0WA 4K0KF 2J6UA 3W8GA 1M5VC 1UJ5A 4WP9A 3UVJB 3OL6A 4O0NA 2LKZA 2YPZA 3QMQA 2GMLA 1S1TB 4P9SA 4A8QA 3NNAA 1PJ6A 3UNYA 2F4VJ 3CUNA 1JLQA 3EVOA 5HLFB 1S6UA 2IPOB 3EZOA 3MM7A 4P73A 3TX0A 3W5XA 1DTTA 1XEZA 2QA1A 2QA2A 3DMJA 3S01A 1PKUA 1UW4A 4QWEA 4PG5A 1HHQA 4U6PA 4XK8C 4JI8J 1KQFB 4AFFA 2IDEA 3SDEA 2CJXB 1WSRA 1LWEA 2K7KA 1K73T 2H3EB 2BE9B 1HPZA 3CJ0A 3CSKA 5J1PA 3AXMA 5EWGA 4ES3A 3H5UA 3GIKA 1YVFA 3M8YA 2FIUA 4KO0B 2CVEA 4CH7A 2HRUA 3CD0A 1VBKA 3MXHP 5J2MB 3R2DJ 1TU0B 2HHVA 2MZQA 1IJFB 1UVKA 3T1AA 2AJ4A 3T9NA 1T95A 2LA6A 4WK3A 2V4JB 3I5BA 2XS2A 2V2KA 3ETMA 7FD1A 2Y0SD 2HQGA 1DQ8A 2HLTA 5K14A 1P9QC 2YKOA 3ETOA 2P6SA 5HVFA 1AYEA 1RKIA 2HZAA 4FYWB 3KK2A 1R6VA 4AQYF 1XBWA 3EGNA 4IG3A 3NS5A 1WKJA 2P9EA 1LW2A 2GIFA 3T19A 5F8IA 3GSIA 2WK4A 4BC9A 2F65A 4LF4F 2VOPA 3OL7A 4ZVHA 1BLUA 1MSWD 3GONA 2I6WA 2VA3A 2XULA 4OZ0A 1PBAA 4GC7A 2ATLA 1M5SA 1N4LA 2Z4PA 3G6YA 3PW4A 1JQGA 3GIJA 2B9YA 3PEHA 4RNNA 4DUYJ 5L39A 4J9LA 1CJTB 3TQEA 1Q8BA 3P5BP 3W7BA 3M1VB 2LFVA 2AD9A 1IWGA 3CCLS 5BR8F 1U2FA 3JQJA 2CQ4A 5SUHA 1H2TZ 1H2UX 3KG1A 4L3KA 3QRQA 2C22A 2G1HA 1RHMB 1OSCA 2BV3A 2BR0A 1ICEB 1P9YA 3IM8A 2QLBB 1HBOA 5I3PA 4NXNJ 1CG2A 2P9CA 1NK7A 1HQEA 2IM1A 1CSJA 2Z30B 1JLEB 3ZZRA 1WJ9A 2HZCA 3A1YG 5AXNA 2BKOA 3I32A 4I7FA 3CCJS 2MLXA 2UXCF 5IFMA 2O67A 4NASA 2X1AA 3PTWA 3QT8A 4DUTA 2PC6A 1NHKL 1JNZB 2ZHOA 4HTIA 3Q8RB 4H4MA 2KM8C 1S12A 3G6ES 1U4BA 2FJWA 3DLLQ 4ANCA 2IC3A 1X5SA 1U47A 3N4WA 2D7SA 2R42A 2OD4A 2ZDPA 1RT3A 4DV1J 1KLMA 4DFKA 2GHVC 5M2UA 1AZSA 2JEGA 3BS9A 4CLZA 2KN4A 4L74A 4I6AA 1BMQB 1GXTA 4ZN3A 4JI1J 5GMKa 1RAAB 1WC1A 2KB2A 4NYOA 2ZBCA 2DXDA 2FPHX 4X66F 3GYGA 2UV8G 2DNQA 3P96A 3PHTA 4ZJLA 1S99A 3AFGA 4LFCF 4DXLA 2OFHX 4OV1A 4MH8A 3PEJA 3GMGA 3IFEA 5LSLA 1RUSA 4MAKA 1YJVA 4Q0BB 2B3TB 3THVA 5J1EA 5HI7A 4Z2XA 1OPIA 3ZTQA 2RNEA 5DGAA 3PYEA 2HMIA 3MEEB 1IKYB 1U45A 5F0UA 3OJUA 4QZVB 2F7VA 2CDQA 2HYIB 1UWBA 2HHXA 3HHLA 2R8JA 4LF6F 1I51B 2M8HA 1VBZA 4FYYB 3VAMA 1VQ9S 4EZ6A 1Y5IB 5HJXA 3TP2A 3LP2B 1Q16B 5LJ5Y 3HKZD 3QJLA 2FC9A 1S6OA 2LQ8A 1O8BA 3ZXWA 1U25A 4YY3F 1K8AT 4MT1A 4PUOB 4PXDA 1D09B 3KHLA 2YKNA 1QSYA 2XZTB 1RHJB 2CQPA 3M8QB 4WU2A 1VQYA 2G2YA 2K3IA 5CYMA 3PJWA 3M2RB 4LMZA 5F0WA 2KU7A 2DNGA 3DU5A 3SBMA 3AODA 2Y8WA 4DR2F 3LF0A 1QVFR 1N48A 3NNHA 3C14A 3W66A 3W5ZA 1N54B 4CLYA 2ZH7A 3CCQS 1X9WA 2FHKA 1OWXA 4DQIA 4CDIA 1H38A 3R7NB 1EB0A 3AOCA 2HGLA 1X4DA 2OEJA 5LSRA 1PC5A 3M8RA 2MKHA 3GCXP 4ECZA 5CD4A 4DR4F 1JLCA 1N56A 4K0KJ 3BQ0A 3UD3P 3OW2R 5LMNF 1ROFA 4M94A 1SH2A 4ZVQB 4IRKA 2MMYA 2HGMA 1X7VA 1RT1B 4OYZA 4E98A 3MTJA 3Q22A 2GHWA 1QJHA 1YJNS 2R7WA 4ELUA 4WYLA 4DSIA 4X4TA 5D77A 1GK8A 3G6VA 4TQSA 3D28A 1V5VA 4KKOA 5MAOA 1VQ5S 2AT1B 2FQQB 3JAMY 4WE1A 1WC0A 3AD9C 3I5CA 4CTAB 1SPBP 2OIHA 2RKIB 3EVWA 4NLWA 5D8HB 2OPRB 2KFYA 1M0SA 3FGVA 3DM2A 2GAGC 4OX8A 2VBZA 4N47A 5D3GB 4U9RA 1HWKA 5EGYA 2DR5A 2QLFB 4RU2A 3PW0A 4ANEA 4F0MA 4UY85 4KPYA 3HXMA 3KHHA 2H51B 4NRTA 1BQMA 4RWWA 2VG7A 1IR1A 3EXCX 1RDRA 5KOWA 4OI0A 1KVKA 4E0DA 4P2SA 2HHPA 3D66A 5E41A 5KT4A 2HWTA 5BYRA 1JMTA 1LW0A 4O44A 1U0HA 2OD6A 1R89A 4NLDA 1KC8T 4KV8A 3RW6A 3R6LB 1APSA 2RIJA 2GFFA 2RQCA 5KFEA 1TL3B 2JLEA 1YITS 4RLEA 2WVEA 2W9CA 4KIAA 1UPMB 3CCMS 2CPFA 1MWQA 5I42A 3FRYA 2B43A 1DFDA 3JXOA 2WCXA 1IR0A 4WZQA 7AT1B 4M5DB 4I64A 6FDRA 2DGWA 3H40A 4DZ6A 2M0GB 5H1SV 3H98A 1NM2A 1HBNA 4HLBA 5L1KA 5D0RA 5BR8J 4L75A 4YB7A 4ZLNA 3I0RB 1MN9A 3AD7C 4RX6A 1NB7A 3MEGA 3H25A 4MYUA 2J0QD 4O4GA 1VDHA 3DOKB 4WYWA 1N5QA 3CJ2A 1L5UA 1YHQS 1FK9A 2QC3A 2DY1A 4W4MA 2DEIA 4OYIA 4DG1A 4ZVUB 2OSQA 3Q83A 1S9EB 5ETQA 1HQ2A 3GJTB 3L7OA 3GFZA 4I2QB 5D4LA 5H9FK 3DRPA 2MKYA 1IKVB 3H2VE 3OR1A 4GMKA 4DHVA 3ENAA 4IOCQ 2UXCJ 3HVAA 5IC6B 1F5BA 3CMES 2VJVA 5CABA 2MPUA 2KZMA 1R43A 1NK4A 3MMBA 4HI1A 2ZITA 3FCHA 3B54A 5E0OA 3DRXA 2PIIA 1VISA 4GVLA 2PE8A 2QN6B 3G8QA 2YX1A 3ZTRA 2RSQA 2DH8A 3DLKB 4YR3A 2QL5B 4FYXB 1BE4A 2HQFA 4BLGA 2LXUA 1FD8A 1MMLA 4DV3F 4MIBA 2EFPA 2MQMA 3RAMA 1H6KX 3HF5A 2KT5A 1S10A 4QWCA 2VPWB 4ILRA 2CQ2A 1WI8A 2HK2A 5C2GA 4UOGA 1WDDA 4C0OC 2DVIA 1EHWA 1NJWA 4X66J 3S8SA 1SXLA 5IM0A 2OHDA 3NS6A 5GAEU 3W2WA 2QA4S 4LFCJ 1V3ZA 2V0NA 1FFWB 4TN2A 1FXDA 5HP1B 4DPXA 4ID5A 3FK4A 1GMWD 2YKPA 2RB7A 2FVPA 2XSJB 1Y0HA 1RWXB 3DXBA 5DETA 4ES2A 4FVCA 3TAQA 1S77D 1YQHA 3R5JB 3Q8PB 1ZH5A 1FFGB 3ITHB 3TJAA 5GVQA 1F6TA 2M5YA 2E9ZA 2R7SA 2X1BA 1WI6A 2ROGA 4O3SA 5B0EA 3AOAA 2BABA 3G87A 1JJCB 2VU5A 2ZWOA 5EWFA 3Q89A 5C24B 1UEUA 1DQAA 4HACA 2BOAA 4K4WA 5J2QA 1NSQA 1YDLA 4YY3J 2C3UA 1SC1B 4Z7CA 4HL9A 4KGMA 2BM0A 5HK4A 2JSXA 3IMQJ 3CCWA 2ZBRA 4WFNQ 2MYFA 3ILLA 3GFXA 2IM3A 3VAIA 3BGRA 1KR4A 3G82B 2JH3A 1GXLA 3J7YI 2XGQA 3PR4A 1CS4A 4DR2J 2VB6A 1ZM2A 4LF9F 2W7OA 3OL8A 2QLXA 2OMOA 4OI2A 1RT2B 2G0CA 3QBCA 5K5MA 2W7PA 4JI4F 1RTJA 1RKJA 2LMIA 2FLLA 2PD1A 3FBCA 2KFZA 2FHJD 2XI3A 1FERA 3CDEA 4WFXA 1NZAA 1I1GA 2XMJA 4K2JA 3ILOA 2FVSA 5LMNJ 4GO5X 4OYXA 1REVA 1VJWA 3FUYA 1VRQC 3VTIA 2E9TA 3MM8B 4L3NA 3RB0A 4WU3A 3D6TB 1A9NB 3LTOA 1QE1A 2I5JB 2YNIA 1B0PA 1MG7A 1UZHA 5G0RA 3OUYA 3I31A 3E2EA 4USJC 5FD1A 4EYHB 3P3DA 3FSYA 4K4SA 1IN0A 2BW2A 1JLFA 3E01A 2PA3A 3EGVA 4J9RA 1RAIB 4NZ0A 3VGSA 2I9SA 3M2UB 3OFGA 2RRBA 3J81U 2F4FA 2CFXA 3MR5A 1RLDA 4K5RA 5KFLA 2GQQA 1HR0F 5H9FJ 2HHQA 3Q23A 3RTVA 1GT8A 2R2UA 2PFDA 2ZNZA 1W7WA 2FJAB 4OHXA 5M2PA 3TVYA 4WWSA 4U7UD 1HMVA 3LALA 3EZUA 2V9KA 5LJ3Y 4RW6B 1Y9OA 4TU7A 2PO4A 4NMLA 2MKSA 3CNQP 4O3OA 3CJQA 2AU0A 1Z2LA 4NA2A 4KHMA 2VDHA 4BC7A 3LPYA 1XR7A 5KG3A 3C16A 4PG8A 4RW8A 4QWDA 1KP6A 3TUJC 4YMEA 1FA0A 1FKPA 2HLUA 1VQ6S 3M8PA 3TO8A 2RHSB 3NLCA 2C2RA 2ZHAA 3W9JA 4XPCA 2E7XA 2W9BB 1DARA 3HVWA 1B99A 3Q8YA 1MROB 2VICA 4ZHRA 1N34F 3LO3A 3DYAA 4C3LA 4CH1A 2LEBA 2XMAA 1SC3B 4LSLA 4EO6A 3DOMA 2IAJB 4C8LA 4TLRA 3WIUA 2HNYA 2J9DE 2JWNA 3KTQA 1ULRA 4MFBB 4A8MP 5K8PA 1NDLA 3IRWP 1ZAXA 1KONA 4M5NA 2K1RB 1J2VA 4NEZA 1FJEB 4LFAF 4FPIA 4WXOA 3J7Z5 3S1TA 3BEGB 1CEZA 1TMMA 3VV2B 4FS1A 4OQJA 2XS5A 3HFVA 5B0FA 4FNHA 4QYZK 2CWKA 3U1NA 1FJGJ 2J5AA 3CD5A 4TY9A 2IMWP 1S57A 3FRZA 3V4IB 1UP1A 4ZLLA 1UVJA 1YG0A 3GG0A 3BZQA 1UA0A 5KFHA 5A8WA 3NCQA 1Q79A 4CLFA 3H4DA 3MMAA 1FCAA 1RTHB 4H54A 2OPQA 1WTFA 2XMMA 2Q3PA 3M9NB 3M4XA 2YNHB 2R8GA 1HNXF 2E1CA 2DEJA 2XSFA 5J2NA 2DCLA 1SV5A 1U24A 3C6TA 2BEFA 1GMVA 1H73A 3IRXA 1NSAA 4RW7B 1SBRA 2ZUGA 2HKEA 2WB4A 2D9PA 1NPKA 1JK9B 2Q6BA 2HFOA 3KLFB 1TK0A 3P4UB 3HZEA 3P49B 3MI7X 3LP0A 3I5AA 4UZBA 4J9KA 3PW5A 4ECSA 2NSCA 1IUJA 4CLUA 1SJ1A 4LF1A 4YB5A 1KVIA 1JIHA 1X4GA 1MLAA 1S79A 2HBZB 4HR2A 1KWMA 2FJVA 1TAQA 5JUMA 4EYIB 1LXNA 3M9MB 5KTQA 4EO8A 5C25B 4DV3J 2MKJA 3JSMA 3W9HA 3D0HE 4OI4A 2K06A 4QYRA 3PJXA 2AMCB 3GZ7A 3R5BA 3AT1B 4ZCLA 4DV6F 3FBFA 3LOUA 1N5YB 4J37A 1VQLS 2KXFA 4CI0B 5FLXY 2C3OA 4NMXA 2LA4A 4CM0A 2MQ8A 2OGUA 3QSYB 4MKBA 1JLGB 2N82B 2CQGA 3EZ5A 1CBKA 3BSNA 4A46A 2QFIA 2WBMA 3H59A 3VHQA 3FFIB 3O6QA 3T6BA 2CQ3A 1XJWB 4MTPA 2Y9HA 3DRRB 5CQGA 2M9KA 3I87A 2ZNYA 1F9EB 1J5EF 2KHCA 3GTYX 2QIFA 4OJ1A 4M5IA 2V8HA 2KXHA 2DK2A 4HH1A 1X9MA 3DLEA 2HPUA 4Y2AA 4I1TA 3GFHA 4RBVA 2HK3A 3VQSA 5A2QY 4F0KA 1YIJS 1FKAF 2WSEC 1SJRA 3US5A 1DY3A 1S0NA 3ONQA 5KT5A 3DHWC 4TU8A 3SCLE 4PXCA 2R8IA 3GR1A 1S1TA 2YXLA 2OI2A 2XLKA 4NLXA 3GCWP 3HVTB 3D68A 5B0DA 3W62A 2GZOA 4OX7A 2UZAA 3JYTA 3CCTA 1HWJA 4Y2MA 4X2BA 2B6AB 4LF9J 1SH3A 3CF5Q 1VS3A 1Y4ZB 4P7TA 4FP9A 4RW9A 2HVHA 2COLA 4JI4J 1M5OC 4CWBA 4GKKF 4B3RF 1VRTB 3TQ1A 1XTZA 1QTNB 4PYAA 4NLTA 2AQ4A 3GV8B 2BJ3A 3CJKA 3UDCA 3SSQA 1JXEA 2PEHA 4DL0C 1JX4A 4H4KC 1H2VZ 2MHEA 1GTHA 2JFKA 2W4CA 4DN0A 1FT8A 3RAQA 3MECB 2QL7B 3UDVA 1UL3A 2CQIA 3K17A 4HDHA 4ELVA 4CLPA 4DL5A 3LPEA 1YJTA 2DXFA 1R8PA 3BN4A 3HD2A 4PG6A 2ZH4A 2F5GA 4HT7A 1PJ7A 1IWAA 1VR6A 1YKWA 2PA8D 2WSFC 4B3SF 5HMWA 4UUXA 2M88A 1QY7A 3Q8UA 2DHAA 4QYZJ 1RGVA 1T94A 4X65F 3NNCA 4Y0FA 2C28A 1FDNA 5LL6d 4AT1B 4IFYB 4R0EA 2UXBF 1S9GB 3NS7B 4DFPA 4FF2A 2ZHBA 4A8OA 2CJKA 2MJUA 1HR0J 4DQSA 4XO0A 3SYZA 3I4HX 2CPIA 4OZ2A 4ZVFA 1SJQA 1NKEA 4LBIA 3W64A 3HSGA 1TL5A 3GU0A 3KXDA 4MKAA 4TLQA 3NMRA 2FZCB 2VASA 2R9LA 1Q7LB 4JBCA 2VG5B 4FKXA 1NZ8A 2FLNA 5EHHA 1CJTA 3UR0A 3G9CA 2ASLA 5A8KB 1UFLA 1SC4B 4PABA 4ICLB 1R8CA 5KG4A 3D5MA 4FBUA 4HH0A 3NAIA 4OJHA 4DJBA 1XK8A 2LEPA 5A6PA 2BRKA 4H4OA 1N34J 1FXLA 2CJYB 2RQKA 4LR9A 3VWSA 4RR5A 4M5KA 1QSSA 1HBMB 1QAYA 3D1OA 2IBKA 5JVGQ 1SJFA 2GNKA 3HHKA 4CT8A 1D8YA 1TL1B 1KLNA 3N6NA 3BO2A 2ALZA 2WONB 3JSRA 4ES1A 5I3QA 1M1HA 1RWMB 2EW9A 1EQ0A 4NOHA 2XNQA 1RA7A 4ZLJA 5ETSA 4LFAJ 3A3OB 2EFVA 4DL3A 3AHPA 1C1CB 3TUIC 3UPFA 3D54A 4C8ZA 4P75A 3HO1A 2YKMB 4NCGA 1LWCA 1S6QA 1P1TA 4DR6J 3G96A 4P74A 1IKXB 3CE8A 1CC7A 4HTJA 4J9SA 4C98A 3J7AN 3BBBA 1RT7B 4N76A 1I94F 3J81j 2AP6A 1HNXJ 3ZO7A 4K8RA 3KUEA 4PR6A 5KFTA 3ZZPA 3A8JA 2W01A 4W90B 1JJ4A 3TAPA 4C7QA 1A6LA 2WHOA 2YQ1A 2ERRA 3SQGA 3M8ZA 3MTKA 2IJFA 1KTQA 1BGXT 1U1MA 4WFZA 3KNGA 1E6VB 4J90A 3U02A 1VQOS 5D0HA 1TV6B 4LSNA 4GVBB 4KSEB 3B4MA 2DNYA 4DUZF 2HAFA 4KFBA 1FRMA 2ZH2A 1RHUB 5CCLA 2LP4A 2GO9A 1FHTA 3OTBA 2QGFB 4ATNA 1GFWB 4A8SA 4B17A 2ZH3A 2KXNB 2W8KA 1UFKA 4RNMA 4CIOA 2EFQA 2OEMA 2UVRA 1VCTA 3LP2A 4ZCKA 4MMOA 1R0AB 3GPAA 2CJQA 2B4VA 3CCVS 1NH7A 3H2UB 4LR8A 4LIRA 1T11A 2ALYB 3AAWB 2XCAA 1JXVA 1S48A 5DG8A 3GE9A 1PYTA 2AJ0A 2CQHA 4DN9A 3G2XA 1G1XA 1J5EJ 2J6TA 5C7PA 5I3UA 3M6WA 1NK6A 1BXNA 3BKUA 2H5EA 2B0GA 2YQ0A 4RPFA 2B9WA 3HVRA 1RSCA 2ZZTA 1Q7YT 5F8MA 2D3O1 4XDDA 2ZH8A 1VQPS 2VQFF 2R2RA 2MGZA 2RE1A 2LYVA 3OR2A 1TFWA 4DPTA 1Y7PA 3FBBA 4BWMA 2ILYA 1Y5NB 2GJ2A 2HFZA 1RP5A 1HYSA 4A8KA 4I4BA 1R7IA 1UEVA 4P10A 1Q86T 4LF8F 4D3GA 1FNOA 1IBKF 3D67A 2HGNA 2VG6A 2BANB 4WTOB 2V4RA 1VBYA 4J9NA 3TAMB 1CC8A 2NXNA 1EX8A 4C3KA 4IH7A 3EM1A 4F4KA 1D0EA 1R8AA 4GKKJ 4B3RJ 1WG4A 1XMOF 4USHA 1RBAA 3R2CJ 4ZITA 2PFFB 1IKWA 4CO4A 2WSCC 3HHEA 4CYUB 1N36F 1JLBA 2ZBIA 4WKYA 2OPSB 1R8BA 1WTBA 3HDSA 5ETTA 1NDPA 2MZ1A 1TZ0A 2UUCF 3QIPB 1Q8IA 2VC0A 3DXSX 1NCLA 1KS2A 4CRJA 4RNHA 1ZOTA 4UOCA 1RT5A 5KOXA 3P8BB 3ZTOA 1GNKA 3SCKE 2B5JA 3IWLA 4OFZA 4EWTA 1K47A 3MM6B 4LUBA 4JI5F 5M2RA 1RAHB 2HEKA 4I6WA 4B3SJ 4JYAF 3K8VA 4IRCA 3B78A 4ED5A 2JVOA 3R5AA 1RU1A 3OVSA 3DOLA 5H9EK 3MEDB 3KG0A 4ZDNA 4X65J 3J81Y 2Y1JA 3NL0A 1WEXA 5HBMB 4KHPF 1SKWA 2UXBJ 3H8YA 2ZZNA 4UZCA 3B4DA 1NK5A 5KAKA 3UD5A 2V4QA 1NRKA 1WC4A 3QATA 3MURP 4JI6F 2RDIA 2ZH5A 1TL3A 2GW8A 4NWBA 2R8HA 1HHSA 4UOHA 1YJUA 5KFFA 1YRTA 2G9OA 5HQLA 4CZCA 3QNWB 3PFOA 5F3TA 4LRAA 5GMDA 2C2DA 2F8MA 3AB2B 3U27A 1HQUB 2NZCA 1VQMS 4ILMA 1TL7B 5KFIA 1TKTB 4DFMA 1CJUA 3JQKA 5EDWA 3DHXA 3CIMA 1JWWA 1VOMA 3KMSA 2RF2A 2LU2A 3DRSB 4LF5J 5E3QA 1HNZJ 4USKA 3QZ8A 1WWHA 3BR8A 3RRKA 1P27B 3O5TB 3DI6B 4IDKB 4USMA 5A0YA 2GMJA 3I0RA 4KH0B 3UNGC 2R8KA 4U95A 2QE5A 2MJNA 1FNMA 5GAGI 2A2CA 3D6FB 1DLOB 4DR7F 3EJMA 4C9DA 4UW2A 3MAAB 5JMNA 5KFJA 3GIRA 1M5KC 2L08A 2VPXB 3WHIA 5HQ8A 3M6VA 1L3SA 3QAUA 1Z4UA 2IBOA 2WOMA 4B3MF 1MMDA 4OYPA 3CDAA 3B82A 1ZZNA 3M05A 3U1MA 4CLKA 1M5HA 1RBOB 3GQCA 2AEMA 1FKOB 1VC0A 5KFBA 2VPYB 4YDXA 1S1XB 3GR0A 1D8ZA 2BJDA 2IY5B 2Y0BB 1WEYA 1MU2A 5AT1B 3FDSA 4MK8A 4RW4A 1Q5VA 2R7QA 3J7ZT 1FRLA 3NGKA 2YWHA 3DGVA 3VGUA 1UMJA 4LJMA 3FZ2A 4USIA 2B4PA 2Y1RI 1QAJA 2FJXA 2W2PP 1B0VA 2RS2A 4TYAA 2CNKB 4DV4F 2LQ9A 5ETMA 4B3OA 2HWIA 4GKJF 1W2IA 2DGQA 3QT6A 3IO1A 5IT0A 2NZ4A 4ED8A 4AXIA 3MFIA 3IAS9 1LWXA 2AEJA 2IRYA 3VVUA 1BWVA 3KUGA 2KYZA 1UEKA 1TR0A 2E7VA 3TUZC 3W1YC 2R4FA 1NJXA 3N5FA 3SFUA 2E5HA 4R5PA 5HP1A 3ISZA 2VH7A 1X0PA 3MM7B 1H3DA 2XMUA 4X4QA 1VLOA 1DTTB 4OHVA 4DUZJ 1EAYC 2J9DA 3DMJB 3OLAA 1MWYA 3TZXA 2DISA 4DSEA 1HA1A 4MIWA 3WIVA 1RLCL 2HG4A 3EPIA 1WKKA 4PZVA 3SDEB 1AT1B 1F5AA 1GH8A 2E5JA 1N5VA 1SCJB 2C2KB 3NCRA 1MN7A 3BR9A 5D78A 1HPZB 3QZ7A 3MFHA 1ELOA 1RWNB 2XYHB 2KL8A 5DLGA 3GJRB 4DSFA 4HEA9 2P6TA 2Q6CA 1QAIA 2ZH1A 4DQQA 1T9TA 5L1IA 5H9EJ 5BJRA 2WW8A 3VZIA 4NLRA 1FI4A 2AW0A 5B0CA 3RJMB 1Y3JA 5AE1A 2B4OA 2R7UA 4CO3A 5E3CA 1XMBA 2ADCA 2GC8A 5DM7Q 2BJ9A 2MSSA 4OYOA 3QFHA 3CJ3A 3M32A 5A8RB 2IHR1 4QU7A 1HIYA 2AJFE 3E3XA 5KT7A 1HKAA 5K14B 3LH2S 1X31C 2W2MP 3UWTA 1BQNB 3RG6A 1J5OA 2P9GA 4ZJQA 4U7CA 4RBUA 2J7WA 3KK2B 3WX4A 2B8PA 5HMYA 5SZTA 2VQFJ 3K5NA 2M52A 3NBPA 1T3OA 1KDNA 4KY3A 2WVCA 4W92B 1UPPA 4K4TA 1SKUB 1LW2B 2MQOA 5F8HA 4C2MA 4DQPA 3MM9A 4DOZA 4LF8J 1FTCA 1Q95G 3N0VA 4F8RA 1RWOB 3MM8A 1IBKJ 3IGNA 1PAUB 2UP1A 2Z57B 2YH1A 1RT6A 2UU9F 3IM9A 4NLQA 4X4PA 3TEGA 5DQGA 4KR0B 4RUCA 4OZ1A 1U48A 3VCDA 2V2ZA 3C3LA 4DS4A 1XNQF 2YNFA 4NLSA 2GVDA 5T14A 1GXUA 1XMOJ 2FVRA 1YJWS 5T7LA 1RZMA 2YTCA 4YB1P 4A48A 2OELA 2EKNA 4DV2F 3I0SA 1PO6A 3M2UA 4C8KA 1T03A 1L3TA 3QPIA 2ASYA 4WFYA 2UUCJ 5F8NA 5ETLA 5HSPA 4OMFG 2A3JA 2ZJRQ 1NK8A 3F44A 2OMLA 4R8UB 2F9JA 4DQRA 3CJTA 3CJ5A 3L7PA 4DPOA 2HBRB 3UCGA 3AQOA 1JLAB 1U1QA 2RAQA 2KRBA 1HBOB 1TAUA 5CAAA 2MLYA 4JI5J 5HQMA 4UQGA 2YX4A 3NGDA 3PACA 3HULA 1HQEB 1S1VB 4ZCIA 3HHLD 4I7FB 1JKHA 4KGVB 1NO8A 2J76E 1FJ7A 5KFXA 2AZ1A 2F63A 3AA8A 2L9DA 4KHPJ 2EG1A 4OZ5A 3MZIA 3G71S 2PI5A 2VDIA 1ZA2B 2HNDA 4H4MB 3BH7B 3D3BJ 3M30B 1QUVA 1UTAA 4JI6J 4DU8A 2MKCA 2XZDB 4W98A 3P5TL 1RT3B 3PFEA 3MPWA 1KLMB 3R5CA 4PQUA 3GYNA 1R6YA 2CQCA 1AZSB 1RHQB 5J2PB 4RU9A 3VVTA 2B51A 5L38A 1TTHB 1TKDA 2XHWA 4CO2A 2MXYA 2H1YA 3UE2A 1L3UA 3AJ2A 2V63A 2FZKB 3VGVA 1DBDA 4MFBA 5GAHI 3G8TA 1N32F 2RU3A 4ECUA 1XR6A 5KG6A 2K1RA 2Z2YB 4RKUC 4UT4A 5MLCV 2LCWA 4QOTA 5IV4A 1RTIB 4F4YA 4DR7J 5J1EB 1U1PA 3BO3A 4M5HA 2HMIB 3TW0A 2V67A 1VRUA 2AEFA 2IRUA 4ZPWR 1KRPA 2IJNA 4B3MJ 2RUSA 3ELHA 3HHLB 2KTQA 3QYYA 4WXWA 2ACMA 3OFFA 1WF2A 4MYTA 1SKRA 2MZTA 4FYVB 2MQPA 1C4AA 3KHGA 1HARA 2O1PA 4KT0C 2HVDA 2OSRA 3Q2TC 4ZVSB 4DPYA 1YJRA 1ZPVA 4F50A 3G86A 3OTCA 4NLYA 3EGWB 3ET6A 4RW7A 3J7YU 3D6HB 3T1HJ 3DRYA 1G4CA 2NREA 1SVDA 1RWUA 3ZC4A 1HBUB 4ZPCA 4I67A 3NWRA 5CYMB 2DIUA 4ZP7A 1V3SA 2XC9A 5EX0A 2KT3A 4TYBA 4MK9A 2V8VA 4IOBA 3ZNJ1 2H5JB 2IYGA 1U2RA 2RRNA 2DPJA 1UW9A 1WKLA 3C14B 2HQIA 3PO4A 3SIPB 1CULB 3FEXB 2PGCA 1Y3KA 4DV4J 5K8MA 2GA7A 2NPFA 4WCEQ 4GKJJ 4ED7A 1UA1A 4Q8EA 3RAXA 1S1WA 1JLCB 2FJBB 5DQIA 1UWAA 2H4WB 6AT1B 5AXLA 3KLVA 4IG0A 3P45B 4ZVEA 2X3DA 4EFAC 1WC5A 1PYSB 1BQXA 3QSIA 1JJ2R 4V19J 3D2WA 4CT9A 2VF3A 1IM4A 2NQPA 4BDPA 1T02A 2C42A 2G1DA 3VAFA 2QEXS 1ZYQA 1FRHA 4KKOB 2FJDB 1WD6A 1EETB 3KLHB 4WE1B 3ISNC 5IT9U 1F3FA 2XMKA 1FX4A 3N79A 4DSJA 3CC7S 4TKTA 3DM2B 4F67A 4H4KA 3WDOA 5K20B 1K1QA 4S0MA 4IOAQ 3BDPA 3CJRA 2E5GA 3VR1A 5F8LA 6FD1A 4ZP6A 2DR9A 3THTA 3CCRS 2GHPA 2JL9A 3GSDA 2BJ7A 2P2CB 1BQMB 2VG7B 4JUZA 5LOQA 3TARA 3JSBA 2AJ2A 2MDAA 2WVBA 4PPDA 3J80U 5HL7Q 1U02A 1RU2A 1M1GA 2W2OP 1KQGB 4WZMA 4Y3CA 1T05A 1M1KT 4RL1A 1RI7A 2HRTA 4K4ZA 2B8QA 3C8YA 2XMTA 2HNZA 2CDRB 4L6V3 2ZBQA 4O44B 1HNIA 1OIAA 1U0HB 3H5XA 1QAXA 3KUHA 4KV8B 4I68A 1NH8A 3MEKA 4OZ3A 2CQDA 5JVHQ 2YKAA 4F3QA 1WDTA 4PWDB 4DL6A 3PR5B 1C0UA 4J9MA 1GMUA 3SZ2A 2W9CB 3GIIA 4M5JA 5I42B 2DNHA 2UU9J 2HVZA 2CYYA 3HT0A 1TK5A 2BZ2A 1AUDA 3MCMA 1PG5B 1NHVA 4WK1A 4DX8H 1XNQJ 2XLJA 5F41A 1HBNB 3HFKA 2VFTA 2VD3A 4YFUA 3GWCA 3EGZA 3Q2SC 4DV2J 3U1LA 1B70B 3C19A 4C8YA 5HN0A 2Z2LA 3NRBA 1S9GA 4M5LA 2A2DA 4OX6A 2XCPA 4O4GB 1SUQA 5DDPC 2KRRA 3SCJE 2E1PA 3MPVA 2QRRA 3ZTPA 2DNKA 1FJCA 2E9RX 3KLEA 1S6PA 4K4YA 2O3DA 1XC9A 4JI0F 4DG1B 4C11B 3OVAA 1YBTA 1ZBTA 1OY9A 3ILJA 4PPZA 1N5SA 1VYAA 3TA2A 1N33F 3DRPB 3TZWA 3SV4A 5L9NA 2DHXA 1R3NA 3OVBA 1U8WA 3L9ZA 2YY3A 4ZVGA 1VJQA 3DC2A 5BXIA 2JEFA 3R9LA 3VAJA 1GX5A 4F4AA 1YJ9S 3CEDA 4DX5A 4FXVA 4DL7A 1DZ5A 3M2VB 2M8DB 5F3ZA 2QJ3A 2VFVA 2AJQA 1UJ4A 2YNGA 4XDCA 4ICLA 4UTGA 1RJJA 1TKZA 2FVQA 3AD8C 4ELTA 3QLHB 3PJ9A 1T9WA 4QIFA 4Y2KA 2XO6A 1VC6A 2YH0A 2HIYA 1K0VA 3O1LA 2FLPA 1HBMA 3C15A 4ZPDA 1TL1A 2ACYA 2A6MA 3X3UA 2WONA 3HI9A 3WZ0A 1N32J 5IM0B 3A4TA 3OTOF 5KG1A 4ECWA 1C2PA 3W2WB 1F2HA 2ZUAA 3KFWX 3QT5A 4YHHF 4ID5B 2HS3A 4ZVPB 3HZGA 1YRUA 3KDNA 2HFNA 3BSOA 4JV2A 3F73A 3EUNA 4ID8A 4OIXA 3A13A 4CH0S 4EBEA 3SI8A 1F0XA 4OZNA 4DS5A 5JJBA 4F3MA 3FEYB 2KH9A 3H20A 2IMOA 4NLGA 4B08A 1RT7A 1K9MT 2VUGA 2AIRB 4HACB 2RILA 2Q79A 5J2QB 4CLWA 1NAQA 5C42A 4QQBA 1DRZA 4J9OA 2CA9A 2VZ9A 3VZHA 2XQCA 2DGOA 4ZJOA 3QO9A 4LQ9A 3AOBA 3OXGA 4KYZA 3BKFA 1R0CB 4NLVA 2HBQB 3DN9A 2A10A 2O01C 3BGRB 1X4FA 2OH2A 4I2PA 1CJVA 3NOCA 5K9FA 1NSPA 2OLWA 2WAQD 1E6VA 4R0JA 3KMQA 1CS4B 2OPPA 5AE2A 5B0GA 3SQOP 2B9XA 1VHIA 2L9WA 3T5KA 1RTJB 3IS9A 2IM0A 1HD0A 2EC0A 3JAMU 2FJEB 4FF1A 3KLGB 3EE3A 1RE1B 3L3CA 2HQ3A 1LOUA 1PSDA 4G1PA 3IP0A 4IR1A 1U1NA 2JX2A 2UUAJ 2XO7A 3C6UA 3TEHB 5KFWA 1R0AA 1QM9A 3BPSP 1X4EA 1REVB 1S1UA 1KFDA 5GMEA 1NXIA 4LIWA 4MIAA 4ECRA 4UUWA 1BWEA 1YSJA 2MQLA 2FY1A 2KO1A 2F9DA 4QBUA 1FF2A 3RGIA 3CCUS 2BYCA 2IYIA 9ATCB 2G2OA 4QIGA 2YNIB 2C2OB 1NPRA 1RACB 5CYQB 2D9OA 3VQTA 2DR8A 3MMCA 2DHSA 1NLKL 3ZZUA 3D0IE 2QFJA 3TWZA 3MR3A 1FWKA 3R6GB 1JLFB 3E01B 3I4PA 3V6JA 1G6BA 3MF5A 3GG1A 3ULHA 2OO4A 2JC1A 2J9CA 4JV0A 1FEHA 3ZZYA 4B9TA 4ZCMA 2EBGA 1U49A 1ZM4A 3R5GA 4X62F 2CZ9A 1QDUB 3PX6A 2Z2MA 3K58A 2LQBA 3MOZA 1RT4A 3RBZA 4ZIWA 1OY6A 2KZZA 3KK3A 1HMVB 4DEZA 3KDOA 2IA6A 4KBIA 2BANA 4B9UA 3FMWA 1O5JA 1YX2A 3R1HA 3POTB 1YRXA 8ATCB 1FJGF 4K2XA 3C16B 2Y8YA 4TU9A 2J7KA 5IS2A 1N0VC 2QMUB 1NHUA 1KQSR 3A8EA 4CYUA 3W61A 4PCQA 1KVJA 1B3TA 1VQSA 4CNZA 3TZZA 2AYMA 2P8IA 4ITSA 2CPYA 3QIPA 2FUG9 5B7WA 2D41A 3FQKA 4ZHRB 4BS2A 5HANA 2CG8A 4C8NA 4Y00A 3DYAB 1TKXB 2JHEA 3BBFA 5HJYA 3AA9A 1NJZA 4RZRA 3K7RA 1ZETA 1EP4A 1TUWA 4KAIA 1KNZA 4A4JA 2HW3A 2GVZB 2ILZA 2HNYB 2CPHA 2QV6A 3EX7B 1FFSB 5L1JA 3GP9A 1WORA 2RJZA 3CC4S 4QR1A 2RDDA 1O51A 4ZVTB 4ED6A 4F4WA 2G0IA 1CQMA 5HMXA 1V3RA 3RUBL 4CP5A 4J9UE 3TANA 2M70A 4OYAA 1FXRA 2W8LA 2V8DA 1NMEB 2I1RA 2YWKA 2L48A 1LWFA 4OI1A 3AB4B 4JI0J 4DPWA 2FVCA 2FHMA 5KFNA 3ENQA 5A8WB 4F02A 3OLBA 4RNOA 1B7FA 2EEYA 3H42A 1SI9A 3MMAB 3EYZA 2DO0A 2CPZA 1N33J 2OPQB 4Q43A 3KLIB 5DDRC 1QSLA 2LVWA 3PX0A 2PSZA 1TL7A 3SSSA 4PWWA 3HP6A 1C0TA 3L7UA 3C6TB 3IRXB 1S7IA 4DMZA 5KG5A 3DRSA 3H2LA 4RWXA 4K4XA 5F9NA 2V2VA 1NK0A 1SH0A 1J27A 4IDKA 3N01A 3LP0B 1FWPA 1VQ7S 1GX6A 1CVJA 1Q81T 2BE7D 1X8DA 1F1BB 5ADZA 2I2YA 2FB0A 3FSXA 3UN2A 1SIZA 4P71A 1EIYB 2W9AA 5E2QA 3HD1A 2AZ3A 4NZ6A 4GC6A 2SXLA 3GJQB 1WSVA 3DDIA 2DNRA 4JI2F 4LR7A 1RWVB 2Q43A 3RBXA 3UD4P 4UQTA 2E1MC 2IIHA 5KG2A 3OTOJ 2DT9A 5B09A 2BACA 3ISND 3K0JA 3EWGA 2GV1A 2XTJP 4YR0A 1PAEX 4LT6A 1D3WA 2DGVA 2C3MA 2CPXA 2ZM6J 3MPDA 3OHBA 2ZC4A 4YHHJ 4U8VA 1FTRA 1T3NA 4NLPA 3OSNA 4F2RA 3BGUA 5E7OB 5KFPA 2YVSA 3CT9A 4PYDA 1W25A 3TVKA 5IV3A 2ZDOA 4IH5A 4CNYA 2AWZA 4XTTA 4K4VA 2OEKA 3T5LA 3PYFA 1KKHA 2E66A 4B02A 1HNWF 4RUBA 4PEOA 4Y28C 4J91A 4A8FA 3VAHA 2NXUA 5CYJA 4N56A 2XMVA 4E2FB 3CO9A 4L73A 1QUPA 3FZBA 4L72B 2EFNA 4LBHA 2C3YA 3DLEB 1TVRA 5DS7A 3DNCA 3A3NB 2XG8A 2FDNA 1OMSA 1XR5A 2V68A 1B7YB 1H7WA 1R0BG 3CJSA 4P52A 4KRWA 2JEJA 1HI8A 1JXLA 2RD5C 1FVSA 2NUUG 3MR6A 1D9FA 3PIOQ 1QLNA 2V8GA 3IG1A 3JYTB 4IFVB 4QPXA 2HS4A 2OUGA 4I6YA 4RW9B 4DSKA 4Q5VA 2DXEA 4NE9C 3H5YA 1LFWA 3CPWR 1NJIT 1BHNA 4OX9F 3ADAC 1DTQA 2JC0A 3CJKB 1RHKB 1YBUA 4J5OA 5AXKA 4ER8A 4YP3A 2D69A 3BYRA 8RUCA 2K8GA 3H90A 4F3OA 4C8MA 3F0NA 4OYBA 2B7CB 2BX6A 1S4FA 2X7IA 4KQZA 2DGUA 3TZYA 3TYTA 2ZE2A 1NNDA 4ZPAA 5HATA 3NY0A 4ED1A 1TELA 5IT9Y 5L46A 2M4MA 1X4BA 2JLFA 3HSZA 1VK8A 1M90T 1I5OB 2O66A 5DLFA 2I0XA 1HNVA 1GEHA 1S4EA 5HROA 3CCES 4JI3F 3RW7A 5A8RA 1RTDA 2HHTA 1GQEA 1PBUA 4K5SA 2PDAA 3H7HB 2Z58B 3M6UA 5G4DA 2CJBA 1DURA 5ETNA 1BQNA 1S97A 2BE2B 3ILIA 3N28A 4PXEA 4TQRA 2GMHA 3KG4A 2J9EA 4LRFA 1NKBA 3CD7A 3UFCX 4X62J 4QW9A 2L3MA 4DPUA 3PRBA 4PG4A 4N8OA 2EWHA 1AW0A 3TA1A 1CPZA 1SL1A 5D0GA 3MCSA 5L1LA 3GFYA 3LGMA 3CMAS 2V50A 3IA0A 3J80Y 1X0FA 3M8SA 4P6QA 4R25A 2HWHA 2EVZA 3OXLA 3LGHA 4NI2A 3WBZA 1U1LA 4DX7A 2VFUA 2DH9A 2I38A 4IO9Q 2C1EB 2ZOGA 4ETZA 3Q8QB 5LMUF 1HLWA 4XIUA 4ECQA 1WOOA 2KM8B 1CJKB 4DR6F 4FDFA 1U09A 2XWYA 4EZ9A 1YI2S 3K57A 1U0SA 5GAGU 2CZVC 1VQNS 1XERA 5CZVA 5D4PA 1AA1B 3QIDA 3EMTA 3GV7B 2VOOA 2OP5A 2F8EX 1KQKA 1AUSL 4H4OB 4CM2A 4R8UA 3IXQA 1E6YB 4TNOA 4RO0A 3D7SB 2UUTA 4LVOP 3MAHA 1JLAA 4O23A 4NYZA 4ED0A 2Z0GA 2BA9A 2XMWA 2E5LF 3W8PA 2ZD1B 2LQJA 2DBBA 4X64F 1PILA 4FS2A 1S1VA 4D3HA 2GGPB 2UXDJ 2ROPA 2UUBF 4URQU 1IBLF 4EEYA 1WUUA 1B64A 3HJFA 5LT5A 5D4OA 1N6QA 3SV3A 1IJEB 1S49A 1MNEA 4F7VA 3CVKA 3I6PA 1X4HA 4TY8A 2NS1B 1C1BA 3CDBA 4KC5A 3M30A 3CULA 4NCGB 4G1IA 1LWCB 2LXIA 3FQLA 1S6QB 2HQCA 2YBVA 5CZXA 2PN6A 4QIVA 4LRBA 2M7SA 5J2PA 4U7UK 3GIMA 2MZRA 1RISA 2RHQB 2CADA 3PDNA 2BDPA 2AJ1A 3NXZA 2B7BB 2FLOA 2VHGA 3T6JA 4LFBJ 2AX0A 2CNLB 3W9IA 3H0PA 1RQ0A 5FLXU 4QWAA 2CG4A 2EBEA 3DLGB 1URRA 3SQGB 3PZPA 1S0VA 4OYWA 1RTZA 4NX9A 3M8WA 3DLJA 3PNIA 2G0JA 1PYOB 1Y10A 1RTIA 4LSNB 4IO1A 2GJIA 4U67Q 3KK1A 1SQFA 1LQ9A 4KFBB 2DNLA 2BMBA 1L3KA 4A8XA 2KVQE 3KOAA 3UVJA 5DDQC 1WACA 3QGIA 1PC4A 4X4VA 4NL5A 3HLUA 2CXEA 1KHVA 4V1Ak 2JNJA 1NKCA 2VA2A 4P7VA 2VL1A 2CVIA 3IR6B 1GTEA 4JI2J 5HLFA 3D0GE 2KJWA 3K5MA 4YS2A 2WBRA 1DAXA 3TA0A 2ASDA 1KTVA 1RK8A 2EK6A 2EC2A 3OJSA 2EKYA 1I3OB 3P6YC 5A2QU 2ZKUA 3K8WA 4Q2LA 2KG0A 2QLWA 2QA4G 1HBUA 4DR5F 5CHCB 3HHNB 4ZP8A 3MDFA 4C0BA 2CQBA 2BRLA 3WC0A 3R7SB 3ZZTA 5I3UB 2UVVA 1HNWJ 1NPPA 3MR7A 4KO0A 1CULA 2MTLA 3DU6A 3RB6A 1NDCA 2RH3A 5J2MA 2BBEA 1ZM3A 3T5HA 2NR0A 2MGZB 3PG9A 3OR2B 3T3FA 1RB0A 3HFZB 4IH6A 3CTRA 1OPZA 3BSAA 2V4JA 1Q78A 4EK2A 2HURA 1UJ6A 4YQWA 2LDIA 1HYSB 5ETVA 4F2SA 3SSRA 5DZ6A 3BYPA 1G3OA 4QU6A 2W1BA 4ZLPA 2QSFA 2RQ4A 1RCXB 2VG6B 3QGPA 1F9FA 5E3PA 4OHYA 2L41A 1KD1T 1RAGB 1B0TA 4E8UA 1EETA 3W2VB 3KLHA 1KHWA 2U2FA 4UY8T 2VBWA 1NK9A 1AFIA 2KG1A 1ZAVA 4OX9J 3PYGA 1ZTWA 3MCNA 3F41A 1Y00A 2YWFA 4ZMMA 1IKWB 5EX3A 2IVMA 1JLBB 2JJ4D 3MAQA 2KKHA 1AROP 3K89A 4XAKA 5KFKA 1U1KA 3HCXA 4N8NA 1H98A 2RMLA 4LF5F 2W2QP 4OL8A 1HNZF 1RT5B 5CCMA 4AUKA 2MQNA 3M1VA 1TQLA 5KFZA 3JTNA 2HVIA 2B5JB 4KTQA 3CDWA 1M5PC 2IRXA 4JI3J 3BKTA 4YEAA 5KFUA 2W4DA 3OTEA 3DOLB 5J1NA 4ZPTR 2XYPB 2I8EA 1F60B 3LGNA 4B3TF 3CJ4A 3MGJA 4AL6A 2N4DA 3BM7A 5HO4A 4O0IA 2J7UA 1X4AA 1MWZA 3K5OA 4AQYJ 4DL2A 3MM5B 1YTYA 4YOEA 5ITHA 4QWBA 5EN1A 1JLEA 2JLGA 2L9NA 4Y6IA 4PWDA 2NSBA 4GRSA 4LF4J 3NOGA 2R7XA 3IGVA 3I82A 2H65B 4WBFA 3NGSA 5AE3A 2YQ3A 2NXJA 4Z37A 2HHWA 3HSDA 3D1QA 1QD1A 4ZKAA 1LK5A 1CJUB 5LMUJ 5GAHU 3FCVA 4WFAQ 3QAEA 4FF3A 3MWBA 2BJEA 2RF2B 1FRIA 2H4YB 3MPYA 2F40A 1EKSA 1X5TA 4DR1F 2CPJA 3CD6S 2CUYA 2BKNA 1YGYA 4ANDA 1KFSA 2NUHA 4ZOSA 4OLOA 3NG8A 1TFYA 5C5JA 5A0YB 2UVWA 2YWGA 3AQPA 3PKMA 1ZM9A 2LU1A 2APOA 1RWPB 3V2UC 5GADI 3IBCB 3RR7A 3MUTP 1Q5YA 2RU9A 1YLXA 5B0AA 3I9ZA 4DCJB 4USTA 1T7PA 3OFHA 2WOMB 1WC3A 3MUVP 2DGXA 4C11A 2E5LJ 3FBEA 4DV7F 2FTRA 5L9XA 1VC5A 3BSCA 4DF4A 4EUVA 4Q0BA 2LQ5A 4X64J 1RABB 2W24A 4K50A 3CCZA 3M6XA 2DD8S 2UUBJ 3UQSA 1B4SA 3MEEA 1IBLJ 1IKYA 4KPCA 2DHGA 2BJ1A 2NYIA 4HDGA 5KFCA 3N5BA 2VJUA 1MU2B 3M2VA 4RW4B 2HVEA 2C2EA 3MD3A 3OL9A 2GIRA 2DB1A 2HZVA 5KFAA 3A8IA 1FRXA 4PUOA 1BD6A 3V4MA 1KN6A 3QLHA 3NWGA 3OQ2A 3PHEA 3M8QA 2KYXA 2GCFA 3VALA 3LP1B 1OS5A 5FDLB 4B3OB 3TUPA 2DRBA 3M2RA 3W65A 3DGPB 2G2ZA 1T9UA 3CMQA 5DDOC 4LRCA 5ETKA 3UN3A 2V94A 3ZTSA 1IQZA 3TRGA 2MKKA 1P8GA 5IXUA 4LF2A 1AB8A 2XZWA 3BBCA 1ZPWX 1Z1ZA 5FJ4A 2CRLA 2OTLS 3PY8A 1KOHA 4R5PB 1HWUA 2JFDA 3M9OB 2ZFHA 5F8JA 5CD4H 3UI3A 5LSOA 1XNRF 5IWAF 2MZJA 2F8HA 4ZS6A 2N4CA 3I56S 4QIEA 4WJBA 3CC2S 1URNA 5KFQA 3HM9A 4MKYA 2ZVIA 3R1LA 1RT1A 4LF6J 3SEOA 2BXJA 3QRPA 3CO0P 2V34A 4C8OA 2M3DA 4DCPB 1OY8A 2YWEA 2V6AA 5KFSA 4CTAA 2RKIA 3LWLA 2X1FA 2OPRA 1LXJA 3OFEA 1SL0A 3PXGa 2MB0B 3C2PA 4NA1A 3M7VA 3RRGA 4G6VB 2FGOA 2XEXA 3OPKA 4DR5J 5D3GA 3MR2A 4USWA 4F04B 2VBXA 3NKYA 4TXSA 3FVYA 4KGZB 2QL9B 2IVYA 4LVNP 2Q66A 2DR6A 1VBXA 2J8AA 3M32B 4NCBA 1NSKL 3T9ZA 3Q8SB 1H74A 2CZ4A 1FDAA 1QVGR 1ACMB 5C2CA 1FO1A 1TL4A 1J5OB 3KLGA 4UF4A 3JQMA 4PWUA 4DR4J 1FVQA 3NBPB 4OZJA 3V6DB 3QRRA 2GO8A 1IBMF 4DV0F 2DITA 3D9BA 4M95A 2BQUA 2D74B 1WOPA 2R2SA 2ZJPQ 3T1YF 1SB6A 3DKDA 3MM9B 4X4SA 1I6JA 3CJ8A 2J0XA 7FDRA 3GJSB 1HFEL 2MY8A 1WHYA 1R8HA 3KWMA 2A1BA 1RT6B 1T9YA 2O5DA 2V8PA 2YPYA 4N41A 1Q8LA 5DZ7A 2DJWA 3IR7B 1T9VA 5CYQA 2DCUB 3DLHA 1SQGA 2EG2A 2YNFB 4DDFA 2GVDB 3PW2A 3RBEA 5T7LB 2ZWPA 2M2BA 3I0SB 1NUEA 1IR2A 4IR9A 3GV5B 3PKYA 1T03B 3KNAA 5F8GA 1O0PA 4M5DA 5BYQA 1NDKA 3ZZZA 1ITPA 4Q45A 4Y34A 2AYBA 4YN3B 2BM1A 2BQRA 3Q86A 5T41A 4NRUA 1OO0B 3CWJA 1KEKA 4KGKA 3FKBA 2JOQA 1WELA 1TUGB 2J8SA 2AHOB 2Y1LB 3UN5A 4QPTA 2UV8A 1NJYA 2X1GA 3A12A 5IT4A 3DOKA 1JKHB 4EGLA 1RAOA 3POTA 1IBCB 2NPIA 1EKRA 1SL2A 2DGSA 4B3TJ 2BW7A 4IRDA 5KFRA 1S9EA 2H54B 2ZZMA 2HAIA 3EPGA 4I2QA 2HNDB 2V5HG 5IOLA 2XHCA 1LK7A 1OYEA 2UUWA 3NP5A 1IKVA 3HK2A 5LXRA 2NYHA 2HS0A 3NCPA 1U6ZA 2E5IA 3G4SS 3E8OA 2XGPA 3T1HF 4PQUB 4KB7A 4CCHA 1N52B 1TKXA 3RZAA 2K7JA 3GLJA 3PV8A 1EARA 2FYXA 3BGFA 4K7QA 2BJ8A 3ZFVA 1HW8A 3VGTA 1WHWA 2QYCA 1SJ4P 2GVZA 3V81B 2JRSA 2VKRA 3O44A 3DFEA 5JXSA 1VHFA 1S9FA 1U26A 2WVDA 4EMDA 3DLKA 2CJ9A 4DR1J 4G1QB 4WTYA 4PAAA 3GB0A 3KJVB 1T8EA 4BCAA 3C46A 1RHRB 5A76A 4DCOB 4F4ZA 4O3PA 5KG0A 2DRDA 2R7RA 2DR7A 1OSDA 3BPDA 2POKA 1LEOA 1U7LA 4G3IA 1VRUB 3BB5A 5KFYA 4DBQA 4HHUA 4CO0A 3RBDA 3OT9A 3IBFB 1S7HA 4DV7J 1N8RT 3MD1A 1JLQB 1BY9A 4DU7A 4ECYA 1WNEA 1N0UA 2IJRA 2XSJA 1V5IB 2HFUA 3KLIA 4CQ1A 4A8WA 1RCOB 2UVUA 5L8RC 1A7GE 3IBWA 4RNFA 2VFSA 2HIQA 3ITHA 5D6GA 4JB8B 3ET6B 4BBYA 2N3LA 2RRAA 2U1AA 4PRFA 1LWEB 1JB0C 4LRDA 4OHZA 1S76D 2AX1A 5C24A 3JSYA 2C3PA 3FSIA 4F26A 3I55S 4HI2A 1HI0P 3OD2A 4MJKA 4HKQA 4MKVA 3UDEA 3G82A 3WX8A 4GO7X 3LWMA 2YX7A 3R97A 4IQXA 2BKPA 1QTMA 2DRAA 5KT2A 1UAWA 3IC1A 1S1WB 1HWIA 3K5PA 4UOFA 4P72A 2D3ZA 4IG0B 1RT2A 4JV5F 3D6MB 4C0HA 2E1RA 3THPA 3EXYA 1AXQA 1OQ6A 3B6BA 1VIOA 2HFVA 3FEZA 2HSEB 2QMWA 3CB4A 1K44A 2OJ3A 4OV6A 2D3OR 4ZK7M 1K0TA 2KHDA 1TK8A 2XI2A 2PEBA 4ETXA 4IG3B 1XNRJ 5IWAJ 4N5SA 2E1AA 1GMWA 4DV5F 3Q24A 3TI0A 2DHHA 3B8HA 3ENVA 2GQ2A 3QJJA 5EUHA 1ZZFA 4DSLA 4AL7A 4YDDB 4AXJA 4KGXB 2IDLA 2B4UA 2I5JA 4URGA 4G65A 4YB6A 2MQQA 5KFOA 2B9EA 2MY7A 3UDLA 2XBPA 4J9QA 2GS8A 3UCUP 5HVHA 4CO5A 4LF7F 3W5YA 3VAGA 1N5TA 2QYGA 3BV8A 2ASJA 2IVFB 3L09A 4IFVA 4LSZB 1PIEA 3KKFA 4ZP9A 5IZHA 1T05B 4OHWA 5EWEA 2AGQA 2K2PA 2KDOA 4OJ3A 2W2NP 1HI1A 2WB1D 2HNZB 2IM2A 1HNIB 4DI6A 2N7CA 3UO0A 3JTPA 4ECTA 4RW6A 2CNNB 1IBMJ 1YJ7A 1V9OA 4DV0J 2XB2D 2EK1A 2ZKTA 1SQEA 2FHJA 2EFGA 3ENWA 1C0UB 3BN7A 3T1YJ 2R7VA 4O4RA 3TVZA 3OXFA 1S59A 2VODA 1VIXA 1U1OA 4IKAA 3TR5A 3PW7A 1REGX 3S6EA 4KHRA 2IC3B 4NXMF 4NLUA 2DNOA 2W9BA 1HHTP 3S7RA 4DR3F 1MROA 1YZ7A 4FPRA 4X4UA 5A6WA 1FDDA 2RVJA 4RUAA 2R2TA 3I9V9 1VLYA 4FN5A 2XY7A 5D4NA 2BE2A 3CIZA 4FVMA 2FZGB 4PKDB 2VKZG 1FE0A 4ZN1A 2IAJA 4B9MA 3MOJB 2OAUA 1SUQB 1F3VA 3BH6B 3SMZA 1Y11A 3R8YA 5K8OA 5E3AA 4JOUA 4WKRA 2PT0A 3KHRA 1S0OA 2ZH9A 3KLEB 1S6PB 4AD6A 3BJYA 4ED2A 4DF8A 1SC6A 1G2EA 4Y65A 3VAKA 3PX4A 4WFBQ 4F25A 2DYAA 1FE4A 5F9LA 2ZVSA 2DNNA 1UWBB 3O3LA 1S72S 3V4IA 1CJKA 2W25A 5E5NA 1RTHA 4U96A 4C6AA 3CCSS 2PI4A 4FBTA 2YNGB 3K59A 3NEKA 3O2IA 3I96A 3JB9k 5E3RA 1T9XA 2YNHA 1RWWB 4A8YA 2GQCA 1WHXA 1TKZB 3BREA 4IYQA 3V6HA 2A18A 2YKNB 5HMZA 1E6YA 2V69A 3KLFA 4O3NA 1F9HA 2YKQA 4DX6A 4M5GA 2FY8A 5CH7B 2W4PA 3RB4A 3HT3A 2ZD1A 3C15B 2BOPA 2C2NA 4ED4A 1FESA 5LM7E 3D1HA 4C3MA 4I56A 2JEIA 2PMWA 2QSWA 5IC4B 2GX8A 2BVZA 4X4OA 1PGZA 2GGPA 5B08A 3IWXA 5KT3A 3GILA 1GAOA 1Q4RA 1KOOA 2KT2A 4HHJA 1LNQA 5C25A 3KJQB 1HW9A 1EQMA 1FD2A 1V6HA 4YUDA 1KBRA 2DY9A 4F36A 1N5YA 2Z8QA 4ZVRB 4B9NA 4AL5A 2UUAF 2ABYA 3HHLC 3QFWA 2LXFA 4DWIA 1JLGA 2VBYA 2XM3A 2VQEF 3Q0AA 1PCAA 3V5RA 1OQ3A 1X5OA 5GAEI 2DNPA 1K1SA 2DO4A 2D1CA 3A8KA 3FFIA 4ERDA 2B56A 3N6LA 2FC8A 5C42B 4HYKA 3DRRA 1RXOB 2VC1A 1RBLA 3QO9B 4A47A 1X9SA 4DLGA 4AE5A 3O8WA 3DLGA 5KG7A 5AJ3F 4I2PB 1CJVB 2VFRA 4HHHA 3UW1A 1D1UA 1U6BA 5DO2A 2OPPB 3RRHA 4QCLA 3HSJA 5IQ6A 1Q82T 5ETOA 1X4CA 2ZH6A 1RA6A 2H9ZA 5KFMA 4RJVA 2Y1IA 2N7YA 2GJFA 1RWKB 3IS9B 3NAHA 1Q1KA 1RAFB 3QWUA 3IWNC 4DV6J 2JZ5A 3EICA 8AT1B 3HVTA 1YZ6A 1Z2ZA 3HMJG 4EBDA 4WP3A 5DJBA 3OTDA 2AYGA 2B6AA 3NGTA 4EU0A 3C6UB 3HKWA 4JV5J 4ECXA 3UR3C 1DJ0A 1S1UB 4HT5A 1SIWB 1VRTA 3D3CJ 1LW0B 4J9PA 3BO4A 2BQ3A 3TX8A 2HHHF 4IUFA 3BDEA 4PXBA
chains in the Genus database with same CATH topology
4NEZA 2KVQE 4LFAJ 5BR8J 4DV1J 2UUCJ 1XNRJ 5LMUJ 5IWAJ 4DUZJ 2F4VJ 2MEWA 4V1Ak 5LM7E 4DR4J 4DV5J 4KYZA 5AJ3J 3T1HJ 4YY3J 4DV3J 1N36J 2VQFJ 1IBMJ 4DV0J 4DR1J 4LF6J 5IT9U 4JI2J 3IMQJ 3T1YJ 4KY3A 4JI0J 4JI3J 4JI1J 4LF5J 1N32J 1HNZJ 1FJGJ 4JI8J 2MQ8A 4JI5J 3OTOJ 4B3SJ 4RJVA 1N33J 4B3TJ 4DR6J 4X66J 4LF8J 2ZM6J 4NXNJ 4NEYA 1IBKJ 4DR2J 5A2QU 4PWWA 4YHHJ 4X65J 4DV6J 3J7AN 4LFCJ 4DR7J 4NXMJ 4DV4J 4LF9J 1N34J 4JI7J 2KL8A 4AQYJ 4DR3J 2UU9J 1HNXJ 3J81U 4KHPJ 3JAMU 4HHUA 4X62J 4LFBJ 2UXBJ 4DR5J 2VQEJ 2UXCJ 4OX9J 4GKJJ 4JYAJ 2E5LJ 4LF7J 5FLXU 4JI4J 1XMQJ 4DV7J 4GKKJ 4B3RJ 4JV5J 1HR0J 4B3MJ 3D3BJ 2UUAJ 4X64J 1XNQJ 2UXDJ 1HNWJ 1XMOJ 4JI6J 3D3CJ 2UUBJ 3R2CJ 4LF4J 4K0KJ 3R2DJ 4DUYJ 1I94J 1J5EJ 3J80U 1IBLJ 2MTLA 5LMNJ 4DV2J 3W1YC 2HHHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEZ A;  2KVQ E;  4LFA J;  5BR8 J;  4DV1 J;  2UUC J;  1XNR J;  5LMU J;  5IWA J;  4DUZ J;  2F4V J;  2MEW A;  4V1A k;  5LM7 E;  4DR4 J;  4DV5 J;  4KYZ A;  5AJ3 J;  3T1H J;  4YY3 J;  4DV3 J;  1N36 J;  2VQF J;  1IBM J;  4DV0 J;  4DR1 J;  4LF6 J;  5IT9 U;  4JI2 J;  3IMQ J;  3T1Y J;  4KY3 A;  4JI0 J;  4JI3 J;  4JI1 J;  4LF5 J;  1N32 J;  1HNZ J;  1FJG J;  4JI8 J;  2MQ8 A;  4JI5 J;  3OTO J;  4B3S J;  4RJV A;  1N33 J;  4B3T J;  4DR6 J;  4X66 J;  4LF8 J;  2ZM6 J;  4NXN J;  4NEY A;  1IBK J;  4DR2 J;  5A2Q U;  4PWW A;  4YHH J;  4X65 J;  4DV6 J;  3J7A N;  4LFC J;  4DR7 J;  4NXM J;  4DV4 J;  4LF9 J;  1N34 J;  4JI7 J;  2KL8 A;  4AQY J;  4DR3 J;  2UU9 J;  1HNX J;  3J81 U;  4KHP J;  3JAM U;  4HHU A;  4X62 J;  4LFB J;  2UXB J;  4DR5 J;  2VQE J;  2UXC J;  4OX9 J;  4GKJ J;  4JYA J;  2E5L J;  4LF7 J;  5FLX U;  4JI4 J;  1XMQ J;  4DV7 J;  4GKK J;  4B3R J;  4JV5 J;  1HR0 J;  4B3M J;  3D3B J;  2UUA J;  4X64 J;  1XNQ J;  2UXD J;  1HNW J;  1XMO J;  4JI6 J;  3D3C J;  2UUB J;  3R2C J;  4LF4 J;  4K0K J;  3R2D J;  4DUY J;  1I94 J;  1J5E J;  3J80 U;  1IBL J;  2MTL A;  5LMN J;  4DV2 J;  3W1Y C;  2HHH J; 
#chains in the Genus database with same CATH topology
 1H0H B;  3MCO A;  3PVX A;  4F0H A;  2NXC A;  3DDN A;  2MEW A;  4DV5 J;  3R27 A;  4X4N A;  9RUB A;  3MEC A;  3OBI A;  5KFV A;  3MMC B;  3FCW A;  1IM6 A;  5LXY A;  2C2Z B;  2R7O A;  1P1L A;  2LEA A;  2HHU A;  4M63 A;  4J9V A;  3QT7 A;  1RAE B;  3T5J A;  3GYX B;  2RUG A;  4C97 A;  1JNR B;  2JDJ A;  5CA5 A;  2QMX A;  1RT4 B;  4YR2 A;  4B9S A;  2ZEJ A;  4LF7 J;  3KK3 B;  2YWW A;  1FRJ A;  2QTW A;  4IFY A;  5CXT A;  4PQA A;  3MEG B;  5THW A;  1FNX H;  3HPO A;  1FX2 A;  2QLJ B;  3PYD A;  3CW2 C;  2ZOM A;  4OI6 A;  2VIH A;  2J0S D;  4JP8 A;  4OJG A;  5FII A;  3W2V A;  1OJ4 A;  1FK9 B;  2VPZ B;  1HWL A;  4URS A;  1UVL A;  1DHM A;  4BWJ A;  5D0E A;  2OKQ A;  1RAD B;  4ED3 A;  2VON A;  2HQD A;  4OYM A;  2MST A;  2ZJQ Q;  3OR1 B;  5DG7 A;  2MHN A;  2VG5 A;  5D15 A;  3FNN A;  3BGO P;  1MW7 A;  1JJH A;  4M5M A;  5AXM A;  2RQM A;  1RAJ A;  1WEZ A;  2HHS A;  3W63 A;  4DFJ A;  1VQK S;  4M1K A;  4ZPB A;  1RYR A;  4NZ7 A;  3K2Y A;  5DGB A;  3LQV A;  2XYG B;  5A8K A;  4X84 A;  1KSP A;  1N88 A;  5BYS A;  3MMB B;  4N7T A;  3TNV A;  3BF4 A;  1NEE A;  1EP4 B;  4NXM J;  1FRK A;  3AH6 A;  4JI7 F;  1VK3 A;  4DR3 J;  2CNO B;  3TJ8 A;  3TJ9 A;  3ZNU A;  1XMQ F;  2WVF A;  2AGO A;  1VQ8 S;  2CPE A;  3CXC R;  2R3V A;  4NYP A;  2AV5 A;  3UCZ P;  4Z7Y A;  1W26 A;  4V19 X;  4OLP A;  4NA3 A;  3RYL A;  2RDJ A;  4WIQ A;  2NLW A;  3N9U C;  3MM5 A;  3ZZO A;  5DRK A;  4ZA1 A;  1LWF B;  4CLS A;  2V2Q A;  4BHQ A;  1LV5 A;  2FGC A;  2ZOF A;  2WRM A;  4DL4 A;  4LQ3 A;  2BUN A;  4USU A;  2ZM6 F;  2EXU A;  3G8S A;  4Y2C A;  1TMJ A;  2OFG X;  1UVM A;  1C1C A;  5I4M A;  3MPU B;  3RR8 A;  1VQ4 S;  2FD2 A;  1HD1 A;  4QJV A;  1C0T B;  4QR0 A;  3NMA A;  1AFJ A;  2YKM A;  2G13 A;  2ATC B;  4NEY A;  2XNR A;  1ZTT A;  3PM9 A;  4K4U A;  1U6F A;  4O3Q A;  3KJF B;  5DQH A;  5DM6 Q;  4X4R A;  1FWL A;  5B0B A;  2LDY A;  4F4X A;  1IKX A;  4EI2 A;  2NXE A;  3Q8V A;  1TUV A;  2QT7 A;  4FZV A;  2DKO B;  4ZIV A;  1F5C A;  1BUX A;  5KT6 A;  2ZBP A;  2F1F A;  4Q8F A;  1VMB A;  1Y5L B;  3BQ2 A;  4L76 A;  4ENO A;  1D9A A;  5HVG A;  2R7T A;  3DDK A;  2X3G A;  2XY6 A;  2PMH A;  2WTF A;  4EBC A;  3KYL A;  2XY5 A;  2F4V F;  4OI3 A;  2GAH C;  4N77 A;  4RBT A;  1TV6 A;  4GVB A;  1X60 A;  2J6S A;  2VV5 A;  1LFP A;  3QWP A;  3PO5 A;  1T0T V;  2KI2 A;  2OTJ S;  4QW8 A;  4TVA B;  3OHA A;  2E29 A;  2K3K A;  4JI8 F;  3TOQ A;  4USV A;  2A6O A;  1HL6 A;  2H48 B;  2DNM A;  1NBE B;  1DQ9 A;  2DGT A;  2DTJ A;  2Z56 B;  2XS7 A;  4LBP A;  1P6T A;  1X5P A;  3W3S A;  3BQ1 A;  2CWX A;  2Z2Z A;  3EDR B;  1VI7 A;  4WP8 A;  2KFN A;  4P2M A;  1IQT A;  3L4B C;  3SXL A;  2GIQ A;  2VQE J;  3FMB A;  4WII A;  4RUH A;  1YBA A;  3QQC D;  2X51 A;  4ZPV R;  2XWX A;  3LP1 A;  2F3J A;  5ETR A;  1TVR B;  1I94 J;  1CQN A;  2DH7 A;  5FDL A;  1QE1 B;  2D3U A;  3DGP A;  4CLL A;  4DZD A;  1OYD A;  5G0R B;  3OUY B;  4QR2 A;  3AJD A;  1D9D A;  3CDU A;  3HX9 A;  4I69 A;  1UZD A;  5RUB A;  4P2X A;  4FKY A;  3G6X A;  5AJ3 J;  2JVR A;  1FDB A;  1XN9 A;  3ICL A;  5KFG A;  1VGY A;  2AGP A;  2WW4 A;  1LKZ A;  1G7C B;  4FNI A;  3FJ2 A;  3IG1 B;  1IXK A;  2RT3 A;  1YWX A;  4B9V A;  1WG5 A;  1SJ3 P;  2HBY B;  1H72 C;  1EZZ B;  4FF4 A;  3R3T A;  1ZAW A;  1WHV A;  3R7B B;  4XPE A;  2MKI A;  3WC2 A;  3RU0 A;  4IQM A;  1F2G A;  2KVI A;  1DTQ B;  2IA0 A;  1NU4 A;  4AYB D;  3NGR A;  3HJV A;  1YK9 A;  3TAM A;  1UCN A;  4OZL A;  3LW5 C;  3SFG A;  3W60 A;  2LLZ A;  3D4J A;  2FHO B;  1R31 A;  4HVZ A;  4RW8 B;  4DUY F;  1C4C A;  3R5D A;  3EDQ B;  2ZE2 B;  1UVN A;  2E44 A;  4J7C A;  1FKP B;  1WC6 A;  1S0M A;  2CKW A;  3LAK A;  2HHH J;  3QJP A;  2AYE A;  2QZ8 A;  5DG9 A;  4ALZ A;  3M8P B;  2EPI A;  5K8N A;  1Q53 A;  2PMZ D;  1RYS A;  4C4W A;  2OPS A;  3QGG A;  1HNV B;  3LUY A;  3PRD A;  5HRO B;  2QG9 B;  1RTD B;  1Q8K A;  1ZA1 B;  3DCA A;  1VFJ A;  1PJ5 A;  2WZ1 A;  3H5S A;  4CO1 A;  4KE5 A;  3MUM P;  1XQI A;  2G4B A;  3RB3 A;  1Q0N A;  4ILL A;  1BC6 A;  3SCI E;  3LAN A;  2Q1L A;  4LSL B;  3J7A 1;  4NPO A;  1EJ7 L;  2MLZ A;  4LRE A;  2V9W A;  3DOM B;  2Y3Y A;  2CQ1 A;  2A0F B;  3MM6 A;  2CIM A;  4NXN F;  3BGL A;  1NB2 A;  3V6D A;  4Q7A A;  2UXD F;  4QIW D;  4O3R A;  4B9L A;  4FXW A;  3AJ1 A;  3MED A;  2IFX A;  5ETP A;  3FC9 A;  4WF9 Q;  2LEC A;  1CLF A;  1UFW A;  3DLB A;  5HBM A;  3EVM A;  3LAM A;  3C66 A;  3ZZ0 A;  1UVI A;  4K59 A;  2CPD A;  2MZS A;  3OSP A;  1MMN A;  1H7X A;  3AY0 A;  4NI2 B;  3VF0 B;  2AKW B;  3N6M A;  3AXK A;  1SKS A;  3A3P B;  3IR5 B;  4ZVO B;  3E51 A;  4CLT A;  4FXD A;  4MK7 A;  2DNZ A;  4Q2M A;  4DV1 F;  2J0W A;  4DLE A;  1FEE A;  3JTO A;  3MMJ A;  3PRV A;  4C48 A;  5HAO A;  2DIV A;  1HQU A;  1N36 J;  1XIQ A;  4Y2I A;  1U2C A;  4PG7 A;  3MHY A;  1TKT A;  3PIP Q;  5GAD U;  5J2N B;  4JI1 F;  1SV5 B;  1XWL A;  1U1R A;  2W7A A;  1WF1 A;  2CQ0 A;  2EFO A;  2P5V A;  4LFB F;  4JV1 A;  2ZC3 A;  4NLO A;  1R27 B;  4KJI A;  4NCA A;  3NGU A;  2KJV A;  3DI6 A;  5E33 A;  3IAM 9;  4JI7 J;  1UET A;  1S5Z A;  1DLO A;  4JYA J;  1XMQ J;  1O6X A;  3MAA A;  5KFD A;  3U7J A;  5IQQ A;  3L95 X;  2NCK L;  2QX0 A;  1L3V A;  3LA0 A;  3X1L B;  4KH1 B;  2HRY A;  3JSM B;  1ZS6 A;  4FYD A;  1N6Q B;  2CAJ A;  1WG1 A;  1IVZ A;  3JS9 A;  3KJN B;  2EI5 A;  4P2F A;  1U8S A;  1WF0 A;  2CJA A;  3H4B A;  4TY8 B;  1WOS A;  3IN5 A;  1C1B B;  1FKO A;  2HFS A;  3T41 A;  4ECV A;  3PCO B;  4Q44 A;  5U47 A;  1S1X A;  1UKU A;  1TP7 A;  3K5L A;  3F56 A;  2ROE A;  4M8L A;  3V6K A;  3WQP A;  2N3O A;  3OV7 A;  3HHD A;  4WPA A;  3V81 A;  2RS8 A;  2H5I B;  2ADB A;  2DPI A;  4G1Q A;  3QGH A;  2XLI A;  2C2M B;  3CGI A;  3KJV A;  1W2B R;  2QO3 A;  4U8Y A;  2E7W A;  1A0O B;  2AF6 A;  3KK1 B;  4I0W A;  4K0K F;  2J6U A;  3W8G A;  1M5V C;  1UJ5 A;  4WP9 A;  3UVJ B;  3OL6 A;  4O0N A;  2LKZ A;  2YPZ A;  3QMQ A;  2GML A;  1S1T B;  4P9S A;  4A8Q A;  3NNA A;  1PJ6 A;  3UNY A;  2F4V J;  3CUN A;  1JLQ A;  3EVO A;  5HLF B;  1S6U A;  2IPO B;  3EZO A;  3MM7 A;  4P73 A;  3TX0 A;  3W5X A;  1DTT A;  1XEZ A;  2QA1 A;  2QA2 A;  3DMJ A;  3S01 A;  1PKU A;  1UW4 A;  4QWE A;  4PG5 A;  1HHQ A;  4U6P A;  4XK8 C;  4JI8 J;  1KQF B;  4AFF A;  2IDE A;  3SDE A;  2CJX B;  1WSR A;  1LWE A;  2K7K A;  1K73 T;  2H3E B;  2BE9 B;  1HPZ A;  3CJ0 A;  3CSK A;  5J1P A;  3AXM A;  5EWG A;  4ES3 A;  3H5U A;  3GIK A;  1YVF A;  3M8Y A;  2FIU A;  4KO0 B;  2CVE A;  4CH7 A;  2HRU A;  3CD0 A;  1VBK A;  3MXH P;  5J2M B;  3R2D J;  1TU0 B;  2HHV A;  2MZQ A;  1IJF B;  1UVK A;  3T1A A;  2AJ4 A;  3T9N A;  1T95 A;  2LA6 A;  4WK3 A;  2V4J B;  3I5B A;  2XS2 A;  2V2K A;  3ETM A;  7FD1 A;  2Y0S D;  2HQG A;  1DQ8 A;  2HLT A;  5K14 A;  1P9Q C;  2YKO A;  3ETO A;  2P6S A;  5HVF A;  1AYE A;  1RKI A;  2HZA A;  4FYW B;  3KK2 A;  1R6V A;  4AQY F;  1XBW A;  3EGN A;  4IG3 A;  3NS5 A;  1WKJ A;  2P9E A;  1LW2 A;  2GIF A;  3T19 A;  5F8I A;  3GSI A;  2WK4 A;  4BC9 A;  2F65 A;  4LF4 F;  2VOP A;  3OL7 A;  4ZVH A;  1BLU A;  1MSW D;  3GON A;  2I6W A;  2VA3 A;  2XUL A;  4OZ0 A;  1PBA A;  4GC7 A;  2ATL A;  1M5S A;  1N4L A;  2Z4P A;  3G6Y A;  3PW4 A;  1JQG A;  3GIJ A;  2B9Y A;  3PEH A;  4RNN A;  4DUY J;  5L39 A;  4J9L A;  1CJT B;  3TQE A;  1Q8B A;  3P5B P;  3W7B A;  3M1V B;  2LFV A;  2AD9 A;  1IWG A;  3CCL S;  5BR8 F;  1U2F A;  3JQJ A;  2CQ4 A;  5SUH A;  1H2T Z;  1H2U X;  3KG1 A;  4L3K A;  3QRQ A;  2C22 A;  2G1H A;  1RHM B;  1OSC A;  2BV3 A;  2BR0 A;  1ICE B;  1P9Y A;  3IM8 A;  2QLB B;  1HBO A;  5I3P A;  4NXN J;  1CG2 A;  2P9C A;  1NK7 A;  1HQE A;  2IM1 A;  1CSJ A;  2Z30 B;  1JLE B;  3ZZR A;  1WJ9 A;  2HZC A;  3A1Y G;  5AXN A;  2BKO A;  3I32 A;  4I7F A;  3CCJ S;  2MLX A;  2UXC F;  5IFM A;  2O67 A;  4NAS A;  2X1A A;  3PTW A;  3QT8 A;  4DUT A;  2PC6 A;  1NHK L;  1JNZ B;  2ZHO A;  4HTI A;  3Q8R B;  4H4M A;  2KM8 C;  1S12 A;  3G6E S;  1U4B A;  2FJW A;  3DLL Q;  4ANC A;  2IC3 A;  1X5S A;  1U47 A;  3N4W A;  2D7S A;  2R42 A;  2OD4 A;  2ZDP A;  1RT3 A;  4DV1 J;  1KLM A;  4DFK A;  2GHV C;  5M2U A;  1AZS A;  2JEG A;  3BS9 A;  4CLZ A;  2KN4 A;  4L74 A;  4I6A A;  1BMQ B;  1GXT A;  4ZN3 A;  4JI1 J;  5GMK a;  1RAA B;  1WC1 A;  2KB2 A;  4NYO A;  2ZBC A;  2DXD A;  2FPH X;  4X66 F;  3GYG A;  2UV8 G;  2DNQ A;  3P96 A;  3PHT A;  4ZJL A;  1S99 A;  3AFG A;  4LFC F;  4DXL A;  2OFH X;  4OV1 A;  4MH8 A;  3PEJ A;  3GMG A;  3IFE A;  5LSL A;  1RUS A;  4MAK A;  1YJV A;  4Q0B B;  2B3T B;  3THV A;  5J1E A;  5HI7 A;  4Z2X A;  1OPI A;  3ZTQ A;  2RNE A;  5DGA A;  3PYE A;  2HMI A;  3MEE B;  1IKY B;  1U45 A;  5F0U A;  3OJU A;  4QZV B;  2F7V A;  2CDQ A;  2HYI B;  1UWB A;  2HHX A;  3HHL A;  2R8J A;  4LF6 F;  1I51 B;  2M8H A;  1VBZ A;  4FYY B;  3VAM A;  1VQ9 S;  4EZ6 A;  1Y5I B;  5HJX A;  3TP2 A;  3LP2 B;  1Q16 B;  5LJ5 Y;  3HKZ D;  3QJL A;  2FC9 A;  1S6O A;  2LQ8 A;  1O8B A;  3ZXW A;  1U25 A;  4YY3 F;  1K8A T;  4MT1 A;  4PUO B;  4PXD A;  1D09 B;  3KHL A;  2YKN A;  1QSY A;  2XZT B;  1RHJ B;  2CQP A;  3M8Q B;  4WU2 A;  1VQY A;  2G2Y A;  2K3I A;  5CYM A;  3PJW A;  3M2R B;  4LMZ A;  5F0W A;  2KU7 A;  2DNG A;  3DU5 A;  3SBM A;  3AOD A;  2Y8W A;  4DR2 F;  3LF0 A;  1QVF R;  1N48 A;  3NNH A;  3C14 A;  3W66 A;  3W5Z A;  1N54 B;  4CLY A;  2ZH7 A;  3CCQ S;  1X9W A;  2FHK A;  1OWX A;  4DQI A;  4CDI A;  1H38 A;  3R7N B;  1EB0 A;  3AOC A;  2HGL A;  1X4D A;  2OEJ A;  5LSR A;  1PC5 A;  3M8R A;  2MKH A;  3GCX P;  4ECZ A;  5CD4 A;  4DR4 F;  1JLC A;  1N56 A;  4K0K J;  3BQ0 A;  3UD3 P;  3OW2 R;  5LMN F;  1ROF A;  4M94 A;  1SH2 A;  4ZVQ B;  4IRK A;  2MMY A;  2HGM A;  1X7V A;  1RT1 B;  4OYZ A;  4E98 A;  3MTJ A;  3Q22 A;  2GHW A;  1QJH A;  1YJN S;  2R7W A;  4ELU A;  4WYL A;  4DSI A;  4X4T A;  5D77 A;  1GK8 A;  3G6V A;  4TQS A;  3D28 A;  1V5V A;  4KKO A;  5MAO A;  1VQ5 S;  2AT1 B;  2FQQ B;  3JAM Y;  4WE1 A;  1WC0 A;  3AD9 C;  3I5C A;  4CTA B;  1SPB P;  2OIH A;  2RKI B;  3EVW A;  4NLW A;  5D8H B;  2OPR B;  2KFY A;  1M0S A;  3FGV A;  3DM2 A;  2GAG C;  4OX8 A;  2VBZ A;  4N47 A;  5D3G B;  4U9R A;  1HWK A;  5EGY A;  2DR5 A;  2QLF B;  4RU2 A;  3PW0 A;  4ANE A;  4F0M A;  4UY8 5;  4KPY A;  3HXM A;  3KHH A;  2H51 B;  4NRT A;  1BQM A;  4RWW A;  2VG7 A;  1IR1 A;  3EXC X;  1RDR A;  5KOW A;  4OI0 A;  1KVK A;  4E0D A;  4P2S A;  2HHP A;  3D66 A;  5E41 A;  5KT4 A;  2HWT A;  5BYR A;  1JMT A;  1LW0 A;  4O44 A;  1U0H A;  2OD6 A;  1R89 A;  4NLD A;  1KC8 T;  4KV8 A;  3RW6 A;  3R6L B;  1APS A;  2RIJ A;  2GFF A;  2RQC A;  5KFE A;  1TL3 B;  2JLE A;  1YIT S;  4RLE A;  2WVE A;  2W9C A;  4KIA A;  1UPM B;  3CCM S;  2CPF A;  1MWQ A;  5I42 A;  3FRY A;  2B43 A;  1DFD A;  3JXO A;  2WCX A;  1IR0 A;  4WZQ A;  7AT1 B;  4M5D B;  4I64 A;  6FDR A;  2DGW A;  3H40 A;  4DZ6 A;  2M0G B;  5H1S V;  3H98 A;  1NM2 A;  1HBN A;  4HLB A;  5L1K A;  5D0R A;  5BR8 J;  4L75 A;  4YB7 A;  4ZLN A;  3I0R B;  1MN9 A;  3AD7 C;  4RX6 A;  1NB7 A;  3MEG A;  3H25 A;  4MYU A;  2J0Q D;  4O4G A;  1VDH A;  3DOK B;  4WYW A;  1N5Q A;  3CJ2 A;  1L5U A;  1YHQ S;  1FK9 A;  2QC3 A;  2DY1 A;  4W4M A;  2DEI A;  4OYI A;  4DG1 A;  4ZVU B;  2OSQ A;  3Q83 A;  1S9E B;  5ETQ A;  1HQ2 A;  3GJT B;  3L7O A;  3GFZ A;  4I2Q B;  5D4L A;  5H9F K;  3DRP A;  2MKY A;  1IKV B;  3H2V E;  3OR1 A;  4GMK A;  4DHV A;  3ENA A;  4IOC Q;  2UXC J;  3HVA A;  5IC6 B;  1F5B A;  3CME S;  2VJV A;  5CAB A;  2MPU A;  2KZM A;  1R43 A;  1NK4 A;  3MMB A;  4HI1 A;  2ZIT A;  3FCH A;  3B54 A;  5E0O A;  3DRX A;  2PII A;  1VIS A;  4GVL A;  2PE8 A;  2QN6 B;  3G8Q A;  2YX1 A;  3ZTR A;  2RSQ A;  2DH8 A;  3DLK B;  4YR3 A;  2QL5 B;  4FYX B;  1BE4 A;  2HQF A;  4BLG A;  2LXU A;  1FD8 A;  1MML A;  4DV3 F;  4MIB A;  2EFP A;  2MQM A;  3RAM A;  1H6K X;  3HF5 A;  2KT5 A;  1S10 A;  4QWC A;  2VPW B;  4ILR A;  2CQ2 A;  1WI8 A;  2HK2 A;  5C2G A;  4UOG A;  1WDD A;  4C0O C;  2DVI A;  1EHW A;  1NJW A;  4X66 J;  3S8S A;  1SXL A;  5IM0 A;  2OHD A;  3NS6 A;  5GAE U;  3W2W A;  2QA4 S;  4LFC J;  1V3Z A;  2V0N A;  1FFW B;  4TN2 A;  1FXD A;  5HP1 B;  4DPX A;  4ID5 A;  3FK4 A;  1GMW D;  2YKP A;  2RB7 A;  2FVP A;  2XSJ B;  1Y0H A;  1RWX B;  3DXB A;  5DET A;  4ES2 A;  4FVC A;  3TAQ A;  1S77 D;  1YQH A;  3R5J B;  3Q8P B;  1ZH5 A;  1FFG B;  3ITH B;  3TJA A;  5GVQ A;  1F6T A;  2M5Y A;  2E9Z A;  2R7S A;  2X1B A;  1WI6 A;  2ROG A;  4O3S A;  5B0E A;  3AOA A;  2BAB A;  3G87 A;  1JJC B;  2VU5 A;  2ZWO A;  5EWF A;  3Q89 A;  5C24 B;  1UEU A;  1DQA A;  4HAC A;  2BOA A;  4K4W A;  5J2Q A;  1NSQ A;  1YDL A;  4YY3 J;  2C3U A;  1SC1 B;  4Z7C A;  4HL9 A;  4KGM A;  2BM0 A;  5HK4 A;  2JSX A;  3IMQ J;  3CCW A;  2ZBR A;  4WFN Q;  2MYF A;  3ILL A;  3GFX A;  2IM3 A;  3VAI A;  3BGR A;  1KR4 A;  3G82 B;  2JH3 A;  1GXL A;  3J7Y I;  2XGQ A;  3PR4 A;  1CS4 A;  4DR2 J;  2VB6 A;  1ZM2 A;  4LF9 F;  2W7O A;  3OL8 A;  2QLX A;  2OMO A;  4OI2 A;  1RT2 B;  2G0C A;  3QBC A;  5K5M A;  2W7P A;  4JI4 F;  1RTJ A;  1RKJ A;  2LMI A;  2FLL A;  2PD1 A;  3FBC A;  2KFZ A;  2FHJ D;  2XI3 A;  1FER A;  3CDE A;  4WFX A;  1NZA A;  1I1G A;  2XMJ A;  4K2J A;  3ILO A;  2FVS A;  5LMN J;  4GO5 X;  4OYX A;  1REV A;  1VJW A;  3FUY A;  1VRQ C;  3VTI A;  2E9T A;  3MM8 B;  4L3N A;  3RB0 A;  4WU3 A;  3D6T B;  1A9N B;  3LTO A;  1QE1 A;  2I5J B;  2YNI A;  1B0P A;  1MG7 A;  1UZH A;  5G0R A;  3OUY A;  3I31 A;  3E2E A;  4USJ C;  5FD1 A;  4EYH B;  3P3D A;  3FSY A;  4K4S A;  1IN0 A;  2BW2 A;  1JLF A;  3E01 A;  2PA3 A;  3EGV A;  4J9R A;  1RAI B;  4NZ0 A;  3VGS A;  2I9S A;  3M2U B;  3OFG A;  2RRB A;  3J81 U;  2F4F A;  2CFX A;  3MR5 A;  1RLD A;  4K5R A;  5KFL A;  2GQQ A;  1HR0 F;  5H9F J;  2HHQ A;  3Q23 A;  3RTV A;  1GT8 A;  2R2U A;  2PFD A;  2ZNZ A;  1W7W A;  2FJA B;  4OHX A;  5M2P A;  3TVY A;  4WWS A;  4U7U D;  1HMV A;  3LAL A;  3EZU A;  2V9K A;  5LJ3 Y;  4RW6 B;  1Y9O A;  4TU7 A;  2PO4 A;  4NML A;  2MKS A;  3CNQ P;  4O3O A;  3CJQ A;  2AU0 A;  1Z2L A;  4NA2 A;  4KHM A;  2VDH A;  4BC7 A;  3LPY A;  1XR7 A;  5KG3 A;  3C16 A;  4PG8 A;  4RW8 A;  4QWD A;  1KP6 A;  3TUJ C;  4YME A;  1FA0 A;  1FKP A;  2HLU A;  1VQ6 S;  3M8P A;  3TO8 A;  2RHS B;  3NLC A;  2C2R A;  2ZHA A;  3W9J A;  4XPC A;  2E7X A;  2W9B B;  1DAR A;  3HVW A;  1B99 A;  3Q8Y A;  1MRO B;  2VIC A;  4ZHR A;  1N34 F;  3LO3 A;  3DYA A;  4C3L A;  4CH1 A;  2LEB A;  2XMA A;  1SC3 B;  4LSL A;  4EO6 A;  3DOM A;  2IAJ B;  4C8L A;  4TLR A;  3WIU A;  2HNY A;  2J9D E;  2JWN A;  3KTQ A;  1ULR A;  4MFB B;  4A8M P;  5K8P A;  1NDL A;  3IRW P;  1ZAX A;  1KON A;  4M5N A;  2K1R B;  1J2V A;  4NEZ A;  1FJE B;  4LFA F;  4FPI A;  4WXO A;  3J7Z 5;  3S1T A;  3BEG B;  1CEZ A;  1TMM A;  3VV2 B;  4FS1 A;  4OQJ A;  2XS5 A;  3HFV A;  5B0F A;  4FNH A;  4QYZ K;  2CWK A;  3U1N A;  1FJG J;  2J5A A;  3CD5 A;  4TY9 A;  2IMW P;  1S57 A;  3FRZ A;  3V4I B;  1UP1 A;  4ZLL A;  1UVJ A;  1YG0 A;  3GG0 A;  3BZQ A;  1UA0 A;  5KFH A;  5A8W A;  3NCQ A;  1Q79 A;  4CLF A;  3H4D A;  3MMA A;  1FCA A;  1RTH B;  4H54 A;  2OPQ A;  1WTF A;  2XMM A;  2Q3P A;  3M9N B;  3M4X A;  2YNH B;  2R8G A;  1HNX F;  2E1C A;  2DEJ A;  2XSF A;  5J2N A;  2DCL A;  1SV5 A;  1U24 A;  3C6T A;  2BEF A;  1GMV A;  1H73 A;  3IRX A;  1NSA A;  4RW7 B;  1SBR A;  2ZUG A;  2HKE A;  2WB4 A;  2D9P A;  1NPK A;  1JK9 B;  2Q6B A;  2HFO A;  3KLF B;  1TK0 A;  3P4U B;  3HZE A;  3P49 B;  3MI7 X;  3LP0 A;  3I5A A;  4UZB A;  4J9K A;  3PW5 A;  4ECS A;  2NSC A;  1IUJ A;  4CLU A;  1SJ1 A;  4LF1 A;  4YB5 A;  1KVI A;  1JIH A;  1X4G A;  1MLA A;  1S79 A;  2HBZ B;  4HR2 A;  1KWM A;  2FJV A;  1TAQ A;  5JUM A;  4EYI B;  1LXN A;  3M9M B;  5KTQ A;  4EO8 A;  5C25 B;  4DV3 J;  2MKJ A;  3JSM A;  3W9H A;  3D0H E;  4OI4 A;  2K06 A;  4QYR A;  3PJX A;  2AMC B;  3GZ7 A;  3R5B A;  3AT1 B;  4ZCL A;  4DV6 F;  3FBF A;  3LOU A;  1N5Y B;  4J37 A;  1VQL S;  2KXF A;  4CI0 B;  5FLX Y;  2C3O A;  4NMX A;  2LA4 A;  4CM0 A;  2MQ8 A;  2OGU A;  3QSY B;  4MKB A;  1JLG B;  2N82 B;  2CQG A;  3EZ5 A;  1CBK A;  3BSN A;  4A46 A;  2QFI A;  2WBM A;  3H59 A;  3VHQ A;  3FFI B;  3O6Q A;  3T6B A;  2CQ3 A;  1XJW B;  4MTP A;  2Y9H A;  3DRR B;  5CQG A;  2M9K A;  3I87 A;  2ZNY A;  1F9E B;  1J5E F;  2KHC A;  3GTY X;  2QIF A;  4OJ1 A;  4M5I A;  2V8H A;  2KXH A;  2DK2 A;  4HH1 A;  1X9M A;  3DLE A;  2HPU A;  4Y2A A;  4I1T A;  3GFH A;  4RBV A;  2HK3 A;  3VQS A;  5A2Q Y;  4F0K A;  1YIJ S;  1FKA F;  2WSE C;  1SJR A;  3US5 A;  1DY3 A;  1S0N A;  3ONQ A;  5KT5 A;  3DHW C;  4TU8 A;  3SCL E;  4PXC A;  2R8I A;  3GR1 A;  1S1T A;  2YXL A;  2OI2 A;  2XLK A;  4NLX A;  3GCW P;  3HVT B;  3D68 A;  5B0D A;  3W62 A;  2GZO A;  4OX7 A;  2UZA A;  3JYT A;  3CCT A;  1HWJ A;  4Y2M A;  4X2B A;  2B6A B;  4LF9 J;  1SH3 A;  3CF5 Q;  1VS3 A;  1Y4Z B;  4P7T A;  4FP9 A;  4RW9 A;  2HVH A;  2COL A;  4JI4 J;  1M5O C;  4CWB A;  4GKK F;  4B3R F;  1VRT B;  3TQ1 A;  1XTZ A;  1QTN B;  4PYA A;  4NLT A;  2AQ4 A;  3GV8 B;  2BJ3 A;  3CJK A;  3UDC A;  3SSQ A;  1JXE A;  2PEH A;  4DL0 C;  1JX4 A;  4H4K C;  1H2V Z;  2MHE A;  1GTH A;  2JFK A;  2W4C A;  4DN0 A;  1FT8 A;  3RAQ A;  3MEC B;  2QL7 B;  3UDV A;  1UL3 A;  2CQI A;  3K17 A;  4HDH A;  4ELV A;  4CLP A;  4DL5 A;  3LPE A;  1YJT A;  2DXF A;  1R8P A;  3BN4 A;  3HD2 A;  4PG6 A;  2ZH4 A;  2F5G A;  4HT7 A;  1PJ7 A;  1IWA A;  1VR6 A;  1YKW A;  2PA8 D;  2WSF C;  4B3S F;  5HMW A;  4UUX A;  2M88 A;  1QY7 A;  3Q8U A;  2DHA A;  4QYZ J;  1RGV A;  1T94 A;  4X65 F;  3NNC A;  4Y0F A;  2C28 A;  1FDN A;  5LL6 d;  4AT1 B;  4IFY B;  4R0E A;  2UXB F;  1S9G B;  3NS7 B;  4DFP A;  4FF2 A;  2ZHB A;  4A8O A;  2CJK A;  2MJU A;  1HR0 J;  4DQS A;  4XO0 A;  3SYZ A;  3I4H X;  2CPI A;  4OZ2 A;  4ZVF A;  1SJQ A;  1NKE A;  4LBI A;  3W64 A;  3HSG A;  1TL5 A;  3GU0 A;  3KXD A;  4MKA A;  4TLQ A;  3NMR A;  2FZC B;  2VAS A;  2R9L A;  1Q7L B;  4JBC A;  2VG5 B;  4FKX A;  1NZ8 A;  2FLN A;  5EHH A;  1CJT A;  3UR0 A;  3G9C A;  2ASL A;  5A8K B;  1UFL A;  1SC4 B;  4PAB A;  4ICL B;  1R8C A;  5KG4 A;  3D5M A;  4FBU A;  4HH0 A;  3NAI A;  4OJH A;  4DJB A;  1XK8 A;  2LEP A;  5A6P A;  2BRK A;  4H4O A;  1N34 J;  1FXL A;  2CJY B;  2RQK A;  4LR9 A;  3VWS A;  4RR5 A;  4M5K A;  1QSS A;  1HBM B;  1QAY A;  3D1O A;  2IBK A;  5JVG Q;  1SJF A;  2GNK A;  3HHK A;  4CT8 A;  1D8Y A;  1TL1 B;  1KLN A;  3N6N A;  3BO2 A;  2ALZ A;  2WON B;  3JSR A;  4ES1 A;  5I3Q A;  1M1H A;  1RWM B;  2EW9 A;  1EQ0 A;  4NOH A;  2XNQ A;  1RA7 A;  4ZLJ A;  5ETS A;  4LFA J;  3A3O B;  2EFV A;  4DL3 A;  3AHP A;  1C1C B;  3TUI C;  3UPF A;  3D54 A;  4C8Z A;  4P75 A;  3HO1 A;  2YKM B;  4NCG A;  1LWC A;  1S6Q A;  1P1T A;  4DR6 J;  3G96 A;  4P74 A;  1IKX B;  3CE8 A;  1CC7 A;  4HTJ A;  4J9S A;  4C98 A;  3J7A N;  3BBB A;  1RT7 B;  4N76 A;  1I94 F;  3J81 j;  2AP6 A;  1HNX J;  3ZO7 A;  4K8R A;  3KUE A;  4PR6 A;  5KFT A;  3ZZP A;  3A8J A;  2W01 A;  4W90 B;  1JJ4 A;  3TAP A;  4C7Q A;  1A6L A;  2WHO A;  2YQ1 A;  2ERR A;  3SQG A;  3M8Z A;  3MTK A;  2IJF A;  1KTQ A;  1BGX T;  1U1M A;  4WFZ A;  3KNG A;  1E6V B;  4J90 A;  3U02 A;  1VQO S;  5D0H A;  1TV6 B;  4LSN A;  4GVB B;  4KSE B;  3B4M A;  2DNY A;  4DUZ F;  2HAF A;  4KFB A;  1FRM A;  2ZH2 A;  1RHU B;  5CCL A;  2LP4 A;  2GO9 A;  1FHT A;  3OTB A;  2QGF B;  4ATN A;  1GFW B;  4A8S A;  4B17 A;  2ZH3 A;  2KXN B;  2W8K A;  1UFK A;  4RNM A;  4CIO A;  2EFQ A;  2OEM A;  2UVR A;  1VCT A;  3LP2 A;  4ZCK A;  4MMO A;  1R0A B;  3GPA A;  2CJQ A;  2B4V A;  3CCV S;  1NH7 A;  3H2U B;  4LR8 A;  4LIR A;  1T11 A;  2ALY B;  3AAW B;  2XCA A;  1JXV A;  1S48 A;  5DG8 A;  3GE9 A;  1PYT A;  2AJ0 A;  2CQH A;  4DN9 A;  3G2X A;  1G1X A;  1J5E J;  2J6T A;  5C7P A;  5I3U A;  3M6W A;  1NK6 A;  1BXN A;  3BKU A;  2H5E A;  2B0G A;  2YQ0 A;  4RPF A;  2B9W A;  3HVR A;  1RSC A;  2ZZT A;  1Q7Y T;  5F8M A;  2D3O 1;  4XDD A;  2ZH8 A;  1VQP S;  2VQF F;  2R2R A;  2MGZ A;  2RE1 A;  2LYV A;  3OR2 A;  1TFW A;  4DPT A;  1Y7P A;  3FBB A;  4BWM A;  2ILY A;  1Y5N B;  2GJ2 A;  2HFZ A;  1RP5 A;  1HYS A;  4A8K A;  4I4B A;  1R7I A;  1UEV A;  4P10 A;  1Q86 T;  4LF8 F;  4D3G A;  1FNO A;  1IBK F;  3D67 A;  2HGN A;  2VG6 A;  2BAN B;  4WTO B;  2V4R A;  1VBY A;  4J9N A;  3TAM B;  1CC8 A;  2NXN A;  1EX8 A;  4C3K A;  4IH7 A;  3EM1 A;  4F4K A;  1D0E A;  1R8A A;  4GKK J;  4B3R J;  1WG4 A;  1XMO F;  4USH A;  1RBA A;  3R2C J;  4ZIT A;  2PFF B;  1IKW A;  4CO4 A;  2WSC C;  3HHE A;  4CYU B;  1N36 F;  1JLB A;  2ZBI A;  4WKY A;  2OPS B;  1R8B A;  1WTB A;  3HDS A;  5ETT A;  1NDP A;  2MZ1 A;  1TZ0 A;  2UUC F;  3QIP B;  1Q8I A;  2VC0 A;  3DXS X;  1NCL A;  1KS2 A;  4CRJ A;  4RNH A;  1ZOT A;  4UOC A;  1RT5 A;  5KOX A;  3P8B B;  3ZTO A;  1GNK A;  3SCK E;  2B5J A;  3IWL A;  4OFZ A;  4EWT A;  1K47 A;  3MM6 B;  4LUB A;  4JI5 F;  5M2R A;  1RAH B;  2HEK A;  4I6W A;  4B3S J;  4JYA F;  3K8V A;  4IRC A;  3B78 A;  4ED5 A;  2JVO A;  3R5A A;  1RU1 A;  3OVS A;  3DOL A;  5H9E K;  3MED B;  3KG0 A;  4ZDN A;  4X65 J;  3J81 Y;  2Y1J A;  3NL0 A;  1WEX A;  5HBM B;  4KHP F;  1SKW A;  2UXB J;  3H8Y A;  2ZZN A;  4UZC A;  3B4D A;  1NK5 A;  5KAK A;  3UD5 A;  2V4Q A;  1NRK A;  1WC4 A;  3QAT A;  3MUR P;  4JI6 F;  2RDI A;  2ZH5 A;  1TL3 A;  2GW8 A;  4NWB A;  2R8H A;  1HHS A;  4UOH A;  1YJU A;  5KFF A;  1YRT A;  2G9O A;  5HQL A;  4CZC A;  3QNW B;  3PFO A;  5F3T A;  4LRA A;  5GMD A;  2C2D A;  2F8M A;  3AB2 B;  3U27 A;  1HQU B;  2NZC A;  1VQM S;  4ILM A;  1TL7 B;  5KFI A;  1TKT B;  4DFM A;  1CJU A;  3JQK A;  5EDW A;  3DHX A;  3CIM A;  1JWW A;  1VOM A;  3KMS A;  2RF2 A;  2LU2 A;  3DRS B;  4LF5 J;  5E3Q A;  1HNZ J;  4USK A;  3QZ8 A;  1WWH A;  3BR8 A;  3RRK A;  1P27 B;  3O5T B;  3DI6 B;  4IDK B;  4USM A;  5A0Y A;  2GMJ A;  3I0R A;  4KH0 B;  3UNG C;  2R8K A;  4U95 A;  2QE5 A;  2MJN A;  1FNM A;  5GAG I;  2A2C A;  3D6F B;  1DLO B;  4DR7 F;  3EJM A;  4C9D A;  4UW2 A;  3MAA B;  5JMN A;  5KFJ A;  3GIR A;  1M5K C;  2L08 A;  2VPX B;  3WHI A;  5HQ8 A;  3M6V A;  1L3S A;  3QAU A;  1Z4U A;  2IBO A;  2WOM A;  4B3M F;  1MMD A;  4OYP A;  3CDA A;  3B82 A;  1ZZN A;  3M05 A;  3U1M A;  4CLK A;  1M5H A;  1RBO B;  3GQC A;  2AEM A;  1FKO B;  1VC0 A;  5KFB A;  2VPY B;  4YDX A;  1S1X B;  3GR0 A;  1D8Z A;  2BJD A;  2IY5 B;  2Y0B B;  1WEY A;  1MU2 A;  5AT1 B;  3FDS A;  4MK8 A;  4RW4 A;  1Q5V A;  2R7Q A;  3J7Z T;  1FRL A;  3NGK A;  2YWH A;  3DGV A;  3VGU A;  1UMJ A;  4LJM A;  3FZ2 A;  4USI A;  2B4P A;  2Y1R I;  1QAJ A;  2FJX A;  2W2P P;  1B0V A;  2RS2 A;  4TYA A;  2CNK B;  4DV4 F;  2LQ9 A;  5ETM A;  4B3O A;  2HWI A;  4GKJ F;  1W2I A;  2DGQ A;  3QT6 A;  3IO1 A;  5IT0 A;  2NZ4 A;  4ED8 A;  4AXI A;  3MFI A;  3IAS 9;  1LWX A;  2AEJ A;  2IRY A;  3VVU A;  1BWV A;  3KUG A;  2KYZ A;  1UEK A;  1TR0 A;  2E7V A;  3TUZ C;  3W1Y C;  2R4F A;  1NJX A;  3N5F A;  3SFU A;  2E5H A;  4R5P A;  5HP1 A;  3ISZ A;  2VH7 A;  1X0P A;  3MM7 B;  1H3D A;  2XMU A;  4X4Q A;  1VLO A;  1DTT B;  4OHV A;  4DUZ J;  1EAY C;  2J9D A;  3DMJ B;  3OLA A;  1MWY A;  3TZX A;  2DIS A;  4DSE A;  1HA1 A;  4MIW A;  3WIV A;  1RLC L;  2HG4 A;  3EPI A;  1WKK A;  4PZV A;  3SDE B;  1AT1 B;  1F5A A;  1GH8 A;  2E5J A;  1N5V A;  1SCJ B;  2C2K B;  3NCR A;  1MN7 A;  3BR9 A;  5D78 A;  1HPZ B;  3QZ7 A;  3MFH A;  1ELO A;  1RWN B;  2XYH B;  2KL8 A;  5DLG A;  3GJR B;  4DSF A;  4HEA 9;  2P6T A;  2Q6C A;  1QAI A;  2ZH1 A;  4DQQ A;  1T9T A;  5L1I A;  5H9E J;  5BJR A;  2WW8 A;  3VZI A;  4NLR A;  1FI4 A;  2AW0 A;  5B0C A;  3RJM B;  1Y3J A;  5AE1 A;  2B4O A;  2R7U A;  4CO3 A;  5E3C A;  1XMB A;  2ADC A;  2GC8 A;  5DM7 Q;  2BJ9 A;  2MSS A;  4OYO A;  3QFH A;  3CJ3 A;  3M32 A;  5A8R B;  2IHR 1;  4QU7 A;  1HIY A;  2AJF E;  3E3X A;  5KT7 A;  1HKA A;  5K14 B;  3LH2 S;  1X31 C;  2W2M P;  3UWT A;  1BQN B;  3RG6 A;  1J5O A;  2P9G A;  4ZJQ A;  4U7C A;  4RBU A;  2J7W A;  3KK2 B;  3WX4 A;  2B8P A;  5HMY A;  5SZT A;  2VQF J;  3K5N A;  2M52 A;  3NBP A;  1T3O A;  1KDN A;  4KY3 A;  2WVC A;  4W92 B;  1UPP A;  4K4T A;  1SKU B;  1LW2 B;  2MQO A;  5F8H A;  4C2M A;  4DQP A;  3MM9 A;  4DOZ A;  4LF8 J;  1FTC A;  1Q95 G;  3N0V A;  4F8R A;  1RWO B;  3MM8 A;  1IBK J;  3IGN A;  1PAU B;  2UP1 A;  2Z57 B;  2YH1 A;  1RT6 A;  2UU9 F;  3IM9 A;  4NLQ A;  4X4P A;  3TEG A;  5DQG A;  4KR0 B;  4RUC A;  4OZ1 A;  1U48 A;  3VCD A;  2V2Z A;  3C3L A;  4DS4 A;  1XNQ F;  2YNF A;  4NLS A;  2GVD A;  5T14 A;  1GXU A;  1XMO J;  2FVR A;  1YJW S;  5T7L A;  1RZM A;  2YTC A;  4YB1 P;  4A48 A;  2OEL A;  2EKN A;  4DV2 F;  3I0S A;  1PO6 A;  3M2U A;  4C8K A;  1T03 A;  1L3T A;  3QPI A;  2ASY A;  4WFY A;  2UUC J;  5F8N A;  5ETL A;  5HSP A;  4OMF G;  2A3J A;  2ZJR Q;  1NK8 A;  3F44 A;  2OML A;  4R8U B;  2F9J A;  4DQR A;  3CJT A;  3CJ5 A;  3L7P A;  4DPO A;  2HBR B;  3UCG A;  3AQO A;  1JLA B;  1U1Q A;  2RAQ A;  2KRB A;  1HBO B;  1TAU A;  5CAA A;  2MLY A;  4JI5 J;  5HQM A;  4UQG A;  2YX4 A;  3NGD A;  3PAC A;  3HUL A;  1HQE B;  1S1V B;  4ZCI A;  3HHL D;  4I7F B;  1JKH A;  4KGV B;  1NO8 A;  2J76 E;  1FJ7 A;  5KFX A;  2AZ1 A;  2F63 A;  3AA8 A;  2L9D A;  4KHP J;  2EG1 A;  4OZ5 A;  3MZI A;  3G71 S;  2PI5 A;  2VDI A;  1ZA2 B;  2HND A;  4H4M B;  3BH7 B;  3D3B J;  3M30 B;  1QUV A;  1UTA A;  4JI6 J;  4DU8 A;  2MKC A;  2XZD B;  4W98 A;  3P5T L;  1RT3 B;  3PFE A;  3MPW A;  1KLM B;  3R5C A;  4PQU A;  3GYN A;  1R6Y A;  2CQC A;  1AZS B;  1RHQ B;  5J2P B;  4RU9 A;  3VVT A;  2B51 A;  5L38 A;  1TTH B;  1TKD A;  2XHW A;  4CO2 A;  2MXY A;  2H1Y A;  3UE2 A;  1L3U A;  3AJ2 A;  2V63 A;  2FZK B;  3VGV A;  1DBD A;  4MFB A;  5GAH I;  3G8T A;  1N32 F;  2RU3 A;  4ECU A;  1XR6 A;  5KG6 A;  2K1R A;  2Z2Y B;  4RKU C;  4UT4 A;  5MLC V;  2LCW A;  4QOT A;  5IV4 A;  1RTI B;  4F4Y A;  4DR7 J;  5J1E B;  1U1P A;  3BO3 A;  4M5H A;  2HMI B;  3TW0 A;  2V67 A;  1VRU A;  2AEF A;  2IRU A;  4ZPW R;  1KRP A;  2IJN A;  4B3M J;  2RUS A;  3ELH A;  3HHL B;  2KTQ A;  3QYY A;  4WXW A;  2ACM A;  3OFF A;  1WF2 A;  4MYT A;  1SKR A;  2MZT A;  4FYV B;  2MQP A;  1C4A A;  3KHG A;  1HAR A;  2O1P A;  4KT0 C;  2HVD A;  2OSR A;  3Q2T C;  4ZVS B;  4DPY A;  1YJR A;  1ZPV A;  4F50 A;  3G86 A;  3OTC A;  4NLY A;  3EGW B;  3ET6 A;  4RW7 A;  3J7Y U;  3D6H B;  3T1H J;  3DRY A;  1G4C A;  2NRE A;  1SVD A;  1RWU A;  3ZC4 A;  1HBU B;  4ZPC A;  4I67 A;  3NWR A;  5CYM B;  2DIU A;  4ZP7 A;  1V3S A;  2XC9 A;  5EX0 A;  2KT3 A;  4TYB A;  4MK9 A;  2V8V A;  4IOB A;  3ZNJ 1;  2H5J B;  2IYG A;  1U2R A;  2RRN A;  2DPJ A;  1UW9 A;  1WKL A;  3C14 B;  2HQI A;  3PO4 A;  3SIP B;  1CUL B;  3FEX B;  2PGC A;  1Y3K A;  4DV4 J;  5K8M A;  2GA7 A;  2NPF A;  4WCE Q;  4GKJ J;  4ED7 A;  1UA1 A;  4Q8E A;  3RAX A;  1S1W A;  1JLC B;  2FJB B;  5DQI A;  1UWA A;  2H4W B;  6AT1 B;  5AXL A;  3KLV A;  4IG0 A;  3P45 B;  4ZVE A;  2X3D A;  4EFA C;  1WC5 A;  1PYS B;  1BQX A;  3QSI A;  1JJ2 R;  4V19 J;  3D2W A;  4CT9 A;  2VF3 A;  1IM4 A;  2NQP A;  4BDP A;  1T02 A;  2C42 A;  2G1D A;  3VAF A;  2QEX S;  1ZYQ A;  1FRH A;  4KKO B;  2FJD B;  1WD6 A;  1EET B;  3KLH B;  4WE1 B;  3ISN C;  5IT9 U;  1F3F A;  2XMK A;  1FX4 A;  3N79 A;  4DSJ A;  3CC7 S;  4TKT A;  3DM2 B;  4F67 A;  4H4K A;  3WDO A;  5K20 B;  1K1Q A;  4S0M A;  4IOA Q;  3BDP A;  3CJR A;  2E5G A;  3VR1 A;  5F8L A;  6FD1 A;  4ZP6 A;  2DR9 A;  3THT A;  3CCR S;  2GHP A;  2JL9 A;  3GSD A;  2BJ7 A;  2P2C B;  1BQM B;  2VG7 B;  4JUZ A;  5LOQ A;  3TAR A;  3JSB A;  2AJ2 A;  2MDA A;  2WVB A;  4PPD A;  3J80 U;  5HL7 Q;  1U02 A;  1RU2 A;  1M1G A;  2W2O P;  1KQG B;  4WZM A;  4Y3C A;  1T05 A;  1M1K T;  4RL1 A;  1RI7 A;  2HRT A;  4K4Z A;  2B8Q A;  3C8Y A;  2XMT A;  2HNZ A;  2CDR B;  4L6V 3;  2ZBQ A;  4O44 B;  1HNI A;  1OIA A;  1U0H B;  3H5X A;  1QAX A;  3KUH A;  4KV8 B;  4I68 A;  1NH8 A;  3MEK A;  4OZ3 A;  2CQD A;  5JVH Q;  2YKA A;  4F3Q A;  1WDT A;  4PWD B;  4DL6 A;  3PR5 B;  1C0U A;  4J9M A;  1GMU A;  3SZ2 A;  2W9C B;  3GII A;  4M5J A;  5I42 B;  2DNH A;  2UU9 J;  2HVZ A;  2CYY A;  3HT0 A;  1TK5 A;  2BZ2 A;  1AUD A;  3MCM A;  1PG5 B;  1NHV A;  4WK1 A;  4DX8 H;  1XNQ J;  2XLJ A;  5F41 A;  1HBN B;  3HFK A;  2VFT A;  2VD3 A;  4YFU A;  3GWC A;  3EGZ A;  3Q2S C;  4DV2 J;  3U1L A;  1B70 B;  3C19 A;  4C8Y A;  5HN0 A;  2Z2L A;  3NRB A;  1S9G A;  4M5L A;  2A2D A;  4OX6 A;  2XCP A;  4O4G B;  1SUQ A;  5DDP C;  2KRR A;  3SCJ E;  2E1P A;  3MPV A;  2QRR A;  3ZTP A;  2DNK A;  1FJC A;  2E9R X;  3KLE A;  1S6P A;  4K4Y A;  2O3D A;  1XC9 A;  4JI0 F;  4DG1 B;  4C11 B;  3OVA A;  1YBT A;  1ZBT A;  1OY9 A;  3ILJ A;  4PPZ A;  1N5S A;  1VYA A;  3TA2 A;  1N33 F;  3DRP B;  3TZW A;  3SV4 A;  5L9N A;  2DHX A;  1R3N A;  3OVB A;  1U8W A;  3L9Z A;  2YY3 A;  4ZVG A;  1VJQ A;  3DC2 A;  5BXI A;  2JEF A;  3R9L A;  3VAJ A;  1GX5 A;  4F4A A;  1YJ9 S;  3CED A;  4DX5 A;  4FXV A;  4DL7 A;  1DZ5 A;  3M2V B;  2M8D B;  5F3Z A;  2QJ3 A;  2VFV A;  2AJQ A;  1UJ4 A;  2YNG A;  4XDC A;  4ICL A;  4UTG A;  1RJJ A;  1TKZ A;  2FVQ A;  3AD8 C;  4ELT A;  3QLH B;  3PJ9 A;  1T9W A;  4QIF A;  4Y2K A;  2XO6 A;  1VC6 A;  2YH0 A;  2HIY A;  1K0V A;  3O1L A;  2FLP A;  1HBM A;  3C15 A;  4ZPD A;  1TL1 A;  2ACY A;  2A6M A;  3X3U A;  2WON A;  3HI9 A;  3WZ0 A;  1N32 J;  5IM0 B;  3A4T A;  3OTO F;  5KG1 A;  4ECW A;  1C2P A;  3W2W B;  1F2H A;  2ZUA A;  3KFW X;  3QT5 A;  4YHH F;  4ID5 B;  2HS3 A;  4ZVP B;  3HZG A;  1YRU A;  3KDN A;  2HFN A;  3BSO A;  4JV2 A;  3F73 A;  3EUN A;  4ID8 A;  4OIX A;  3A13 A;  4CH0 S;  4EBE A;  3SI8 A;  1F0X A;  4OZN A;  4DS5 A;  5JJB A;  4F3M A;  3FEY B;  2KH9 A;  3H20 A;  2IMO A;  4NLG A;  4B08 A;  1RT7 A;  1K9M T;  2VUG A;  2AIR B;  4HAC B;  2RIL A;  2Q79 A;  5J2Q B;  4CLW A;  1NAQ A;  5C42 A;  4QQB A;  1DRZ A;  4J9O A;  2CA9 A;  2VZ9 A;  3VZH A;  2XQC A;  2DGO A;  4ZJO A;  3QO9 A;  4LQ9 A;  3AOB A;  3OXG A;  4KYZ A;  3BKF A;  1R0C B;  4NLV A;  2HBQ B;  3DN9 A;  2A10 A;  2O01 C;  3BGR B;  1X4F A;  2OH2 A;  4I2P A;  1CJV A;  3NOC A;  5K9F A;  1NSP A;  2OLW A;  2WAQ D;  1E6V A;  4R0J A;  3KMQ A;  1CS4 B;  2OPP A;  5AE2 A;  5B0G A;  3SQO P;  2B9X A;  1VHI A;  2L9W A;  3T5K A;  1RTJ B;  3IS9 A;  2IM0 A;  1HD0 A;  2EC0 A;  3JAM U;  2FJE B;  4FF1 A;  3KLG B;  3EE3 A;  1RE1 B;  3L3C A;  2HQ3 A;  1LOU A;  1PSD A;  4G1P A;  3IP0 A;  4IR1 A;  1U1N A;  2JX2 A;  2UUA J;  2XO7 A;  3C6U A;  3TEH B;  5KFW A;  1R0A A;  1QM9 A;  3BPS P;  1X4E A;  1REV B;  1S1U A;  1KFD A;  5GME A;  1NXI A;  4LIW A;  4MIA A;  4ECR A;  4UUW A;  1BWE A;  1YSJ A;  2MQL A;  2FY1 A;  2KO1 A;  2F9D A;  4QBU A;  1FF2 A;  3RGI A;  3CCU S;  2BYC A;  2IYI A;  9ATC B;  2G2O A;  4QIG A;  2YNI B;  2C2O B;  1NPR A;  1RAC B;  5CYQ B;  2D9O A;  3VQT A;  2DR8 A;  3MMC A;  2DHS A;  1NLK L;  3ZZU A;  3D0I E;  2QFJ A;  3TWZ A;  3MR3 A;  1FWK A;  3R6G B;  1JLF B;  3E01 B;  3I4P A;  3V6J A;  1G6B A;  3MF5 A;  3GG1 A;  3ULH A;  2OO4 A;  2JC1 A;  2J9C A;  4JV0 A;  1FEH A;  3ZZY A;  4B9T A;  4ZCM A;  2EBG A;  1U49 A;  1ZM4 A;  3R5G A;  4X62 F;  2CZ9 A;  1QDU B;  3PX6 A;  2Z2M A;  3K58 A;  2LQB A;  3MOZ A;  1RT4 A;  3RBZ A;  4ZIW A;  1OY6 A;  2KZZ A;  3KK3 A;  1HMV B;  4DEZ A;  3KDO A;  2IA6 A;  4KBI A;  2BAN A;  4B9U A;  3FMW A;  1O5J A;  1YX2 A;  3R1H A;  3POT B;  1YRX A;  8ATC B;  1FJG F;  4K2X A;  3C16 B;  2Y8Y A;  4TU9 A;  2J7K A;  5IS2 A;  1N0V C;  2QMU B;  1NHU A;  1KQS R;  3A8E A;  4CYU A;  3W61 A;  4PCQ A;  1KVJ A;  1B3T A;  1VQS A;  4CNZ A;  3TZZ A;  2AYM A;  2P8I A;  4ITS A;  2CPY A;  3QIP A;  2FUG 9;  5B7W A;  2D41 A;  3FQK A;  4ZHR B;  4BS2 A;  5HAN A;  2CG8 A;  4C8N A;  4Y00 A;  3DYA B;  1TKX B;  2JHE A;  3BBF A;  5HJY A;  3AA9 A;  1NJZ A;  4RZR A;  3K7R A;  1ZET A;  1EP4 A;  1TUW A;  4KAI A;  1KNZ A;  4A4J A;  2HW3 A;  2GVZ B;  2ILZ A;  2HNY B;  2CPH A;  2QV6 A;  3EX7 B;  1FFS B;  5L1J A;  3GP9 A;  1WOR A;  2RJZ A;  3CC4 S;  4QR1 A;  2RDD A;  1O51 A;  4ZVT B;  4ED6 A;  4F4W A;  2G0I A;  1CQM A;  5HMX A;  1V3R A;  3RUB L;  4CP5 A;  4J9U E;  3TAN A;  2M70 A;  4OYA A;  1FXR A;  2W8L A;  2V8D A;  1NME B;  2I1R A;  2YWK A;  2L48 A;  1LWF A;  4OI1 A;  3AB4 B;  4JI0 J;  4DPW A;  2FVC A;  2FHM A;  5KFN A;  3ENQ A;  5A8W B;  4F02 A;  3OLB A;  4RNO A;  1B7F A;  2EEY A;  3H42 A;  1SI9 A;  3MMA B;  3EYZ A;  2DO0 A;  2CPZ A;  1N33 J;  2OPQ B;  4Q43 A;  3KLI B;  5DDR C;  1QSL A;  2LVW A;  3PX0 A;  2PSZ A;  1TL7 A;  3SSS A;  4PWW A;  3HP6 A;  1C0T A;  3L7U A;  3C6T B;  3IRX B;  1S7I A;  4DMZ A;  5KG5 A;  3DRS A;  3H2L A;  4RWX A;  4K4X A;  5F9N A;  2V2V A;  1NK0 A;  1SH0 A;  1J27 A;  4IDK A;  3N01 A;  3LP0 B;  1FWP A;  1VQ7 S;  1GX6 A;  1CVJ A;  1Q81 T;  2BE7 D;  1X8D A;  1F1B B;  5ADZ A;  2I2Y A;  2FB0 A;  3FSX A;  3UN2 A;  1SIZ A;  4P71 A;  1EIY B;  2W9A A;  5E2Q A;  3HD1 A;  2AZ3 A;  4NZ6 A;  4GC6 A;  2SXL A;  3GJQ B;  1WSV A;  3DDI A;  2DNR A;  4JI2 F;  4LR7 A;  1RWV B;  2Q43 A;  3RBX A;  3UD4 P;  4UQT A;  2E1M C;  2IIH A;  5KG2 A;  3OTO J;  2DT9 A;  5B09 A;  2BAC A;  3ISN D;  3K0J A;  3EWG A;  2GV1 A;  2XTJ P;  4YR0 A;  1PAE X;  4LT6 A;  1D3W A;  2DGV A;  2C3M A;  2CPX A;  2ZM6 J;  3MPD A;  3OHB A;  2ZC4 A;  4YHH J;  4U8V A;  1FTR A;  1T3N A;  4NLP A;  3OSN A;  4F2R A;  3BGU A;  5E7O B;  5KFP A;  2YVS A;  3CT9 A;  4PYD A;  1W25 A;  3TVK A;  5IV3 A;  2ZDO A;  4IH5 A;  4CNY A;  2AWZ A;  4XTT A;  4K4V A;  2OEK A;  3T5L A;  3PYF A;  1KKH A;  2E66 A;  4B02 A;  1HNW F;  4RUB A;  4PEO A;  4Y28 C;  4J91 A;  4A8F A;  3VAH A;  2NXU A;  5CYJ A;  4N56 A;  2XMV A;  4E2F B;  3CO9 A;  4L73 A;  1QUP A;  3FZB A;  4L72 B;  2EFN A;  4LBH A;  2C3Y A;  3DLE B;  1TVR A;  5DS7 A;  3DNC A;  3A3N B;  2XG8 A;  2FDN A;  1OMS A;  1XR5 A;  2V68 A;  1B7Y B;  1H7W A;  1R0B G;  3CJS A;  4P52 A;  4KRW A;  2JEJ A;  1HI8 A;  1JXL A;  2RD5 C;  1FVS A;  2NUU G;  3MR6 A;  1D9F A;  3PIO Q;  1QLN A;  2V8G A;  3IG1 A;  3JYT B;  4IFV B;  4QPX A;  2HS4 A;  2OUG A;  4I6Y A;  4RW9 B;  4DSK A;  4Q5V A;  2DXE A;  4NE9 C;  3H5Y A;  1LFW A;  3CPW R;  1NJI T;  1BHN A;  4OX9 F;  3ADA C;  1DTQ A;  2JC0 A;  3CJK B;  1RHK B;  1YBU A;  4J5O A;  5AXK A;  4ER8 A;  4YP3 A;  2D69 A;  3BYR A;  8RUC A;  2K8G A;  3H90 A;  4F3O A;  4C8M A;  3F0N A;  4OYB A;  2B7C B;  2BX6 A;  1S4F A;  2X7I A;  4KQZ A;  2DGU A;  3TZY A;  3TYT A;  2ZE2 A;  1NND A;  4ZPA A;  5HAT A;  3NY0 A;  4ED1 A;  1TEL A;  5IT9 Y;  5L46 A;  2M4M A;  1X4B A;  2JLF A;  3HSZ A;  1VK8 A;  1M90 T;  1I5O B;  2O66 A;  5DLF A;  2I0X A;  1HNV A;  1GEH A;  1S4E A;  5HRO A;  3CCE S;  4JI3 F;  3RW7 A;  5A8R A;  1RTD A;  2HHT A;  1GQE A;  1PBU A;  4K5S A;  2PDA A;  3H7H B;  2Z58 B;  3M6U A;  5G4D A;  2CJB A;  1DUR A;  5ETN A;  1BQN A;  1S97 A;  2BE2 B;  3ILI A;  3N28 A;  4PXE A;  4TQR A;  2GMH A;  3KG4 A;  2J9E A;  4LRF A;  1NKB A;  3CD7 A;  3UFC X;  4X62 J;  4QW9 A;  2L3M A;  4DPU A;  3PRB A;  4PG4 A;  4N8O A;  2EWH A;  1AW0 A;  3TA1 A;  1CPZ A;  1SL1 A;  5D0G A;  3MCS A;  5L1L A;  3GFY A;  3LGM A;  3CMA S;  2V50 A;  3IA0 A;  3J80 Y;  1X0F A;  3M8S A;  4P6Q A;  4R25 A;  2HWH A;  2EVZ A;  3OXL A;  3LGH A;  4NI2 A;  3WBZ A;  1U1L A;  4DX7 A;  2VFU A;  2DH9 A;  2I38 A;  4IO9 Q;  2C1E B;  2ZOG A;  4ETZ A;  3Q8Q B;  5LMU F;  1HLW A;  4XIU A;  4ECQ A;  1WOO A;  2KM8 B;  1CJK B;  4DR6 F;  4FDF A;  1U09 A;  2XWY A;  4EZ9 A;  1YI2 S;  3K57 A;  1U0S A;  5GAG U;  2CZV C;  1VQN S;  1XER A;  5CZV A;  5D4P A;  1AA1 B;  3QID A;  3EMT A;  3GV7 B;  2VOO A;  2OP5 A;  2F8E X;  1KQK A;  1AUS L;  4H4O B;  4CM2 A;  4R8U A;  3IXQ A;  1E6Y B;  4TNO A;  4RO0 A;  3D7S B;  2UUT A;  4LVO P;  3MAH A;  1JLA A;  4O23 A;  4NYZ A;  4ED0 A;  2Z0G A;  2BA9 A;  2XMW A;  2E5L F;  3W8P A;  2ZD1 B;  2LQJ A;  2DBB A;  4X64 F;  1PIL A;  4FS2 A;  1S1V A;  4D3H A;  2GGP B;  2UXD J;  2ROP A;  2UUB F;  4URQ U;  1IBL F;  4EEY A;  1WUU A;  1B64 A;  3HJF A;  5LT5 A;  5D4O A;  1N6Q A;  3SV3 A;  1IJE B;  1S49 A;  1MNE A;  4F7V A;  3CVK A;  3I6P A;  1X4H A;  4TY8 A;  2NS1 B;  1C1B A;  3CDB A;  4KC5 A;  3M30 A;  3CUL A;  4NCG B;  4G1I A;  1LWC B;  2LXI A;  3FQL A;  1S6Q B;  2HQC A;  2YBV A;  5CZX A;  2PN6 A;  4QIV A;  4LRB A;  2M7S A;  5J2P A;  4U7U K;  3GIM A;  2MZR A;  1RIS A;  2RHQ B;  2CAD A;  3PDN A;  2BDP A;  2AJ1 A;  3NXZ A;  2B7B B;  2FLO A;  2VHG A;  3T6J A;  4LFB J;  2AX0 A;  2CNL B;  3W9I A;  3H0P A;  1RQ0 A;  5FLX U;  4QWA A;  2CG4 A;  2EBE A;  3DLG B;  1URR A;  3SQG B;  3PZP A;  1S0V A;  4OYW A;  1RTZ A;  4NX9 A;  3M8W A;  3DLJ A;  3PNI A;  2G0J A;  1PYO B;  1Y10 A;  1RTI A;  4LSN B;  4IO1 A;  2GJI A;  4U67 Q;  3KK1 A;  1SQF A;  1LQ9 A;  4KFB B;  2DNL A;  2BMB A;  1L3K A;  4A8X A;  2KVQ E;  3KOA A;  3UVJ A;  5DDQ C;  1WAC A;  3QGI A;  1PC4 A;  4X4V A;  4NL5 A;  3HLU A;  2CXE A;  1KHV A;  4V1A k;  2JNJ A;  1NKC A;  2VA2 A;  4P7V A;  2VL1 A;  2CVI A;  3IR6 B;  1GTE A;  4JI2 J;  5HLF A;  3D0G E;  2KJW A;  3K5M A;  4YS2 A;  2WBR A;  1DAX A;  3TA0 A;  2ASD A;  1KTV A;  1RK8 A;  2EK6 A;  2EC2 A;  3OJS A;  2EKY A;  1I3O B;  3P6Y C;  5A2Q U;  2ZKU A;  3K8W A;  4Q2L A;  2KG0 A;  2QLW A;  2QA4 G;  1HBU A;  4DR5 F;  5CHC B;  3HHN B;  4ZP8 A;  3MDF A;  4C0B A;  2CQB A;  2BRL A;  3WC0 A;  3R7S B;  3ZZT A;  5I3U B;  2UVV A;  1HNW J;  1NPP A;  3MR7 A;  4KO0 A;  1CUL A;  2MTL A;  3DU6 A;  3RB6 A;  1NDC A;  2RH3 A;  5J2M A;  2BBE A;  1ZM3 A;  3T5H A;  2NR0 A;  2MGZ B;  3PG9 A;  3OR2 B;  3T3F A;  1RB0 A;  3HFZ B;  4IH6 A;  3CTR A;  1OPZ A;  3BSA A;  2V4J A;  1Q78 A;  4EK2 A;  2HUR A;  1UJ6 A;  4YQW A;  2LDI A;  1HYS B;  5ETV A;  4F2S A;  3SSR A;  5DZ6 A;  3BYP A;  1G3O A;  4QU6 A;  2W1B A;  4ZLP A;  2QSF A;  2RQ4 A;  1RCX B;  2VG6 B;  3QGP A;  1F9F A;  5E3P A;  4OHY A;  2L41 A;  1KD1 T;  1RAG B;  1B0T A;  4E8U A;  1EET A;  3W2V B;  3KLH A;  1KHW A;  2U2F A;  4UY8 T;  2VBW A;  1NK9 A;  1AFI A;  2KG1 A;  1ZAV A;  4OX9 J;  3PYG A;  1ZTW A;  3MCN A;  3F41 A;  1Y00 A;  2YWF A;  4ZMM A;  1IKW B;  5EX3 A;  2IVM A;  1JLB B;  2JJ4 D;  3MAQ A;  2KKH A;  1ARO P;  3K89 A;  4XAK A;  5KFK A;  1U1K A;  3HCX A;  4N8N A;  1H98 A;  2RML A;  4LF5 F;  2W2Q P;  4OL8 A;  1HNZ F;  1RT5 B;  5CCM A;  4AUK A;  2MQN A;  3M1V A;  1TQL A;  5KFZ A;  3JTN A;  2HVI A;  2B5J B;  4KTQ A;  3CDW A;  1M5P C;  2IRX A;  4JI3 J;  3BKT A;  4YEA A;  5KFU A;  2W4D A;  3OTE A;  3DOL B;  5J1N A;  4ZPT R;  2XYP B;  2I8E A;  1F60 B;  3LGN A;  4B3T F;  3CJ4 A;  3MGJ A;  4AL6 A;  2N4D A;  3BM7 A;  5HO4 A;  4O0I A;  2J7U A;  1X4A A;  1MWZ A;  3K5O A;  4AQY J;  4DL2 A;  3MM5 B;  1YTY A;  4YOE A;  5ITH A;  4QWB A;  5EN1 A;  1JLE A;  2JLG A;  2L9N A;  4Y6I A;  4PWD A;  2NSB A;  4GRS A;  4LF4 J;  3NOG A;  2R7X A;  3IGV A;  3I82 A;  2H65 B;  4WBF A;  3NGS A;  5AE3 A;  2YQ3 A;  2NXJ A;  4Z37 A;  2HHW A;  3HSD A;  3D1Q A;  1QD1 A;  4ZKA A;  1LK5 A;  1CJU B;  5LMU J;  5GAH U;  3FCV A;  4WFA Q;  3QAE A;  4FF3 A;  3MWB A;  2BJE A;  2RF2 B;  1FRI A;  2H4Y B;  3MPY A;  2F40 A;  1EKS A;  1X5T A;  4DR1 F;  2CPJ A;  3CD6 S;  2CUY A;  2BKN A;  1YGY A;  4AND A;  1KFS A;  2NUH A;  4ZOS A;  4OLO A;  3NG8 A;  1TFY A;  5C5J A;  5A0Y B;  2UVW A;  2YWG A;  3AQP A;  3PKM A;  1ZM9 A;  2LU1 A;  2APO A;  1RWP B;  3V2U C;  5GAD I;  3IBC B;  3RR7 A;  3MUT P;  1Q5Y A;  2RU9 A;  1YLX A;  5B0A A;  3I9Z A;  4DCJ B;  4UST A;  1T7P A;  3OFH A;  2WOM B;  1WC3 A;  3MUV P;  2DGX A;  4C11 A;  2E5L J;  3FBE A;  4DV7 F;  2FTR A;  5L9X A;  1VC5 A;  3BSC A;  4DF4 A;  4EUV A;  4Q0B A;  2LQ5 A;  4X64 J;  1RAB B;  2W24 A;  4K50 A;  3CCZ A;  3M6X A;  2DD8 S;  2UUB J;  3UQS A;  1B4S A;  3MEE A;  1IBL J;  1IKY A;  4KPC A;  2DHG A;  2BJ1 A;  2NYI A;  4HDG A;  5KFC A;  3N5B A;  2VJU A;  1MU2 B;  3M2V A;  4RW4 B;  2HVE A;  2C2E A;  3MD3 A;  3OL9 A;  2GIR A;  2DB1 A;  2HZV A;  5KFA A;  3A8I A;  1FRX A;  4PUO A;  1BD6 A;  3V4M A;  1KN6 A;  3QLH A;  3NWG A;  3OQ2 A;  3PHE A;  3M8Q A;  2KYX A;  2GCF A;  3VAL A;  3LP1 B;  1OS5 A;  5FDL B;  4B3O B;  3TUP A;  2DRB A;  3M2R A;  3W65 A;  3DGP B;  2G2Z A;  1T9U A;  3CMQ A;  5DDO C;  4LRC A;  5ETK A;  3UN3 A;  2V94 A;  3ZTS A;  1IQZ A;  3TRG A;  2MKK A;  1P8G A;  5IXU A;  4LF2 A;  1AB8 A;  2XZW A;  3BBC A;  1ZPW X;  1Z1Z A;  5FJ4 A;  2CRL A;  2OTL S;  3PY8 A;  1KOH A;  4R5P B;  1HWU A;  2JFD A;  3M9O B;  2ZFH A;  5F8J A;  5CD4 H;  3UI3 A;  5LSO A;  1XNR F;  5IWA F;  2MZJ A;  2F8H A;  4ZS6 A;  2N4C A;  3I56 S;  4QIE A;  4WJB A;  3CC2 S;  1URN A;  5KFQ A;  3HM9 A;  4MKY A;  2ZVI A;  3R1L A;  1RT1 A;  4LF6 J;  3SEO A;  2BXJ A;  3QRP A;  3CO0 P;  2V34 A;  4C8O A;  2M3D A;  4DCP B;  1OY8 A;  2YWE A;  2V6A A;  5KFS A;  4CTA A;  2RKI A;  3LWL A;  2X1F A;  2OPR A;  1LXJ A;  3OFE A;  1SL0 A;  3PXG a;  2MB0 B;  3C2P A;  4NA1 A;  3M7V A;  3RRG A;  4G6V B;  2FGO A;  2XEX A;  3OPK A;  4DR5 J;  5D3G A;  3MR2 A;  4USW A;  4F04 B;  2VBX A;  3NKY A;  4TXS A;  3FVY A;  4KGZ B;  2QL9 B;  2IVY A;  4LVN P;  2Q66 A;  2DR6 A;  1VBX A;  2J8A A;  3M32 B;  4NCB A;  1NSK L;  3T9Z A;  3Q8S B;  1H74 A;  2CZ4 A;  1FDA A;  1QVG R;  1ACM B;  5C2C A;  1FO1 A;  1TL4 A;  1J5O B;  3KLG A;  4UF4 A;  3JQM A;  4PWU A;  4DR4 J;  1FVQ A;  3NBP B;  4OZJ A;  3V6D B;  3QRR A;  2GO8 A;  1IBM F;  4DV0 F;  2DIT A;  3D9B A;  4M95 A;  2BQU A;  2D74 B;  1WOP A;  2R2S A;  2ZJP Q;  3T1Y F;  1SB6 A;  3DKD A;  3MM9 B;  4X4S A;  1I6J A;  3CJ8 A;  2J0X A;  7FDR A;  3GJS B;  1HFE L;  2MY8 A;  1WHY A;  1R8H A;  3KWM A;  2A1B A;  1RT6 B;  1T9Y A;  2O5D A;  2V8P A;  2YPY A;  4N41 A;  1Q8L A;  5DZ7 A;  2DJW A;  3IR7 B;  1T9V A;  5CYQ A;  2DCU B;  3DLH A;  1SQG A;  2EG2 A;  2YNF B;  4DDF A;  2GVD B;  3PW2 A;  3RBE A;  5T7L B;  2ZWP A;  2M2B A;  3I0S B;  1NUE A;  1IR2 A;  4IR9 A;  3GV5 B;  3PKY A;  1T03 B;  3KNA A;  5F8G A;  1O0P A;  4M5D A;  5BYQ A;  1NDK A;  3ZZZ A;  1ITP A;  4Q45 A;  4Y34 A;  2AYB A;  4YN3 B;  2BM1 A;  2BQR A;  3Q86 A;  5T41 A;  4NRU A;  1OO0 B;  3CWJ A;  1KEK A;  4KGK A;  3FKB A;  2JOQ A;  1WEL A;  1TUG B;  2J8S A;  2AHO B;  2Y1L B;  3UN5 A;  4QPT A;  2UV8 A;  1NJY A;  2X1G A;  3A12 A;  5IT4 A;  3DOK A;  1JKH B;  4EGL A;  1RAO A;  3POT A;  1IBC B;  2NPI A;  1EKR A;  1SL2 A;  2DGS A;  4B3T J;  2BW7 A;  4IRD A;  5KFR A;  1S9E A;  2H54 B;  2ZZM A;  2HAI A;  3EPG A;  4I2Q A;  2HND B;  2V5H G;  5IOL A;  2XHC A;  1LK7 A;  1OYE A;  2UUW A;  3NP5 A;  1IKV A;  3HK2 A;  5LXR A;  2NYH A;  2HS0 A;  3NCP A;  1U6Z A;  2E5I A;  3G4S S;  3E8O A;  2XGP A;  3T1H F;  4PQU B;  4KB7 A;  4CCH A;  1N52 B;  1TKX A;  3RZA A;  2K7J A;  3GLJ A;  3PV8 A;  1EAR A;  2FYX A;  3BGF A;  4K7Q A;  2BJ8 A;  3ZFV A;  1HW8 A;  3VGT A;  1WHW A;  2QYC A;  1SJ4 P;  2GVZ A;  3V81 B;  2JRS A;  2VKR A;  3O44 A;  3DFE A;  5JXS A;  1VHF A;  1S9F A;  1U26 A;  2WVD A;  4EMD A;  3DLK A;  2CJ9 A;  4DR1 J;  4G1Q B;  4WTY A;  4PAA A;  3GB0 A;  3KJV B;  1T8E A;  4BCA A;  3C46 A;  1RHR B;  5A76 A;  4DCO B;  4F4Z A;  4O3P A;  5KG0 A;  2DRD A;  2R7R A;  2DR7 A;  1OSD A;  3BPD A;  2POK A;  1LEO A;  1U7L A;  4G3I A;  1VRU B;  3BB5 A;  5KFY A;  4DBQ A;  4HHU A;  4CO0 A;  3RBD A;  3OT9 A;  3IBF B;  1S7H A;  4DV7 J;  1N8R T;  3MD1 A;  1JLQ B;  1BY9 A;  4DU7 A;  4ECY A;  1WNE A;  1N0U A;  2IJR A;  2XSJ A;  1V5I B;  2HFU A;  3KLI A;  4CQ1 A;  4A8W A;  1RCO B;  2UVU A;  5L8R C;  1A7G E;  3IBW A;  4RNF A;  2VFS A;  2HIQ A;  3ITH A;  5D6G A;  4JB8 B;  3ET6 B;  4BBY A;  2N3L A;  2RRA A;  2U1A A;  4PRF A;  1LWE B;  1JB0 C;  4LRD A;  4OHZ A;  1S76 D;  2AX1 A;  5C24 A;  3JSY A;  2C3P A;  3FSI A;  4F26 A;  3I55 S;  4HI2 A;  1HI0 P;  3OD2 A;  4MJK A;  4HKQ A;  4MKV A;  3UDE A;  3G82 A;  3WX8 A;  4GO7 X;  3LWM A;  2YX7 A;  3R97 A;  4IQX A;  2BKP A;  1QTM A;  2DRA A;  5KT2 A;  1UAW A;  3IC1 A;  1S1W B;  1HWI A;  3K5P A;  4UOF A;  4P72 A;  2D3Z A;  4IG0 B;  1RT2 A;  4JV5 F;  3D6M B;  4C0H A;  2E1R A;  3THP A;  3EXY A;  1AXQ A;  1OQ6 A;  3B6B A;  1VIO A;  2HFV A;  3FEZ A;  2HSE B;  2QMW A;  3CB4 A;  1K44 A;  2OJ3 A;  4OV6 A;  2D3O R;  4ZK7 M;  1K0T A;  2KHD A;  1TK8 A;  2XI2 A;  2PEB A;  4ETX A;  4IG3 B;  1XNR J;  5IWA J;  4N5S A;  2E1A A;  1GMW A;  4DV5 F;  3Q24 A;  3TI0 A;  2DHH A;  3B8H A;  3ENV A;  2GQ2 A;  3QJJ A;  5EUH A;  1ZZF A;  4DSL A;  4AL7 A;  4YDD B;  4AXJ A;  4KGX B;  2IDL A;  2B4U A;  2I5J A;  4URG A;  4G65 A;  4YB6 A;  2MQQ A;  5KFO A;  2B9E A;  2MY7 A;  3UDL A;  2XBP A;  4J9Q A;  2GS8 A;  3UCU P;  5HVH A;  4CO5 A;  4LF7 F;  3W5Y A;  3VAG A;  1N5T A;  2QYG A;  3BV8 A;  2ASJ A;  2IVF B;  3L09 A;  4IFV A;  4LSZ B;  1PIE A;  3KKF A;  4ZP9 A;  5IZH A;  1T05 B;  4OHW A;  5EWE A;  2AGQ A;  2K2P A;  2KDO A;  4OJ3 A;  2W2N P;  1HI1 A;  2WB1 D;  2HNZ B;  2IM2 A;  1HNI B;  4DI6 A;  2N7C A;  3UO0 A;  3JTP A;  4ECT A;  4RW6 A;  2CNN B;  1IBM J;  1YJ7 A;  1V9O A;  4DV0 J;  2XB2 D;  2EK1 A;  2ZKT A;  1SQE A;  2FHJ A;  2EFG A;  3ENW A;  1C0U B;  3BN7 A;  3T1Y J;  2R7V A;  4O4R A;  3TVZ A;  3OXF A;  1S59 A;  2VOD A;  1VIX A;  1U1O A;  4IKA A;  3TR5 A;  3PW7 A;  1REG X;  3S6E A;  4KHR A;  2IC3 B;  4NXM F;  4NLU A;  2DNO A;  2W9B A;  1HHT P;  3S7R A;  4DR3 F;  1MRO A;  1YZ7 A;  4FPR A;  4X4U A;  5A6W A;  1FDD A;  2RVJ A;  4RUA A;  2R2T A;  3I9V 9;  1VLY A;  4FN5 A;  2XY7 A;  5D4N A;  2BE2 A;  3CIZ A;  4FVM A;  2FZG B;  4PKD B;  2VKZ G;  1FE0 A;  4ZN1 A;  2IAJ A;  4B9M A;  3MOJ B;  2OAU A;  1SUQ B;  1F3V A;  3BH6 B;  3SMZ A;  1Y11 A;  3R8Y A;  5K8O A;  5E3A A;  4JOU A;  4WKR A;  2PT0 A;  3KHR A;  1S0O A;  2ZH9 A;  3KLE B;  1S6P B;  4AD6 A;  3BJY A;  4ED2 A;  4DF8 A;  1SC6 A;  1G2E A;  4Y65 A;  3VAK A;  3PX4 A;  4WFB Q;  4F25 A;  2DYA A;  1FE4 A;  5F9L A;  2ZVS A;  2DNN A;  1UWB B;  3O3L A;  1S72 S;  3V4I A;  1CJK A;  2W25 A;  5E5N A;  1RTH A;  4U96 A;  4C6A A;  3CCS S;  2PI4 A;  4FBT A;  2YNG B;  3K59 A;  3NEK A;  3O2I A;  3I96 A;  3JB9 k;  5E3R A;  1T9X A;  2YNH A;  1RWW B;  4A8Y A;  2GQC A;  1WHX A;  1TKZ B;  3BRE A;  4IYQ A;  3V6H A;  2A18 A;  2YKN B;  5HMZ A;  1E6Y A;  2V69 A;  3KLF A;  4O3N A;  1F9H A;  2YKQ A;  4DX6 A;  4M5G A;  2FY8 A;  5CH7 B;  2W4P A;  3RB4 A;  3HT3 A;  2ZD1 A;  3C15 B;  2BOP A;  2C2N A;  4ED4 A;  1FES A;  5LM7 E;  3D1H A;  4C3M A;  4I56 A;  2JEI A;  2PMW A;  2QSW A;  5IC4 B;  2GX8 A;  2BVZ A;  4X4O A;  1PGZ A;  2GGP A;  5B08 A;  3IWX A;  5KT3 A;  3GIL A;  1GAO A;  1Q4R A;  1KOO A;  2KT2 A;  4HHJ A;  1LNQ A;  5C25 A;  3KJQ B;  1HW9 A;  1EQM A;  1FD2 A;  1V6H A;  4YUD A;  1KBR A;  2DY9 A;  4F36 A;  1N5Y A;  2Z8Q A;  4ZVR B;  4B9N A;  4AL5 A;  2UUA F;  2ABY A;  3HHL C;  3QFW A;  2LXF A;  4DWI A;  1JLG A;  2VBY A;  2XM3 A;  2VQE F;  3Q0A A;  1PCA A;  3V5R A;  1OQ3 A;  1X5O A;  5GAE I;  2DNP A;  1K1S A;  2DO4 A;  2D1C A;  3A8K A;  3FFI A;  4ERD A;  2B56 A;  3N6L A;  2FC8 A;  5C42 B;  4HYK A;  3DRR A;  1RXO B;  2VC1 A;  1RBL A;  3QO9 B;  4A47 A;  1X9S A;  4DLG A;  4AE5 A;  3O8W A;  3DLG A;  5KG7 A;  5AJ3 F;  4I2P B;  1CJV B;  2VFR A;  4HHH A;  3UW1 A;  1D1U A;  1U6B A;  5DO2 A;  2OPP B;  3RRH A;  4QCL A;  3HSJ A;  5IQ6 A;  1Q82 T;  5ETO A;  1X4C A;  2ZH6 A;  1RA6 A;  2H9Z A;  5KFM A;  4RJV A;  2Y1I A;  2N7Y A;  2GJF A;  1RWK B;  3IS9 B;  3NAH A;  1Q1K A;  1RAF B;  3QWU A;  3IWN C;  4DV6 J;  2JZ5 A;  3EIC A;  8AT1 B;  3HVT A;  1YZ6 A;  1Z2Z A;  3HMJ G;  4EBD A;  4WP3 A;  5DJB A;  3OTD A;  2AYG A;  2B6A A;  3NGT A;  4EU0 A;  3C6U B;  3HKW A;  4JV5 J;  4ECX A;  3UR3 C;  1DJ0 A;  1S1U B;  4HT5 A;  1SIW B;  1VRT A;  3D3C J;  1LW0 B;  4J9P A;  3BO4 A;  2BQ3 A;  3TX8 A;  2HHH F;  4IUF A;  3BDE A;  4PXB A; 
#chains in the Genus database with same CATH homology
 4NEZ A;  2KVQ E;  4LFA J;  5BR8 J;  4DV1 J;  2UUC J;  1XNR J;  5LMU J;  5IWA J;  4DUZ J;  2F4V J;  2MEW A;  4V1A k;  5LM7 E;  4DR4 J;  4DV5 J;  4KYZ A;  5AJ3 J;  3T1H J;  4YY3 J;  4DV3 J;  1N36 J;  2VQF J;  1IBM J;  4DV0 J;  4DR1 J;  4LF6 J;  5IT9 U;  4JI2 J;  3IMQ J;  3T1Y J;  4KY3 A;  4JI0 J;  4JI3 J;  4JI1 J;  4LF5 J;  1N32 J;  1HNZ J;  1FJG J;  4JI8 J;  2MQ8 A;  4JI5 J;  3OTO J;  4B3S J;  4RJV A;  1N33 J;  4B3T J;  4DR6 J;  4X66 J;  4LF8 J;  2ZM6 J;  4NXN J;  4NEY A;  1IBK J;  4DR2 J;  5A2Q U;  4PWW A;  4YHH J;  4X65 J;  4DV6 J;  3J7A N;  4LFC J;  4DR7 J;  4NXM J;  4DV4 J;  4LF9 J;  1N34 J;  4JI7 J;  2KL8 A;  4AQY J;  4DR3 J;  2UU9 J;  1HNX J;  3J81 U;  4KHP J;  3JAM U;  4HHU A;  4X62 J;  4LFB J;  2UXB J;  4DR5 J;  2VQE J;  2UXC J;  4OX9 J;  4GKJ J;  4JYA J;  2E5L J;  4LF7 J;  5FLX U;  4JI4 J;  1XMQ J;  4DV7 J;  4GKK J;  4B3R J;  4JV5 J;  1HR0 J;  4B3M J;  3D3B J;  2UUA J;  4X64 J;  1XNQ J;  2UXD J;  1HNW J;  1XMO J;  4JI6 J;  3D3C J;  2UUB J;  3R2C J;  4LF4 J;  4K0K J;  3R2D J;  4DUY J;  1I94 J;  1J5E J;  3J80 U;  1IBL J;  2MTL A;  5LMN J;  4DV2 J;  3W1Y C;  2HHH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...