4JYAJ

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4jyaJ00
2MQ8A 2MEWA 4JI6J 4DR1J 4DV7J 4DV6J 4LFAJ 1XNQJ 4JV5J 1HR0J 4OX9J 2HHHJ 4DV0J 1IBKJ 1N36J 3JAMU 4DR4J 4LFBJ 1N32J 2UUBJ 3D3BJ 4X62J 3OTOJ 4LF9J 4JI4J 1HNZJ 4PWWA 1HNXJ 4DR7J 5IT9U 4DUZJ 1N34J 4NXMJ 3T1YJ 4V1Ak 4YY3J 4LF8J 2UUAJ 4YHHJ 4DR6J 4DUYJ 1J5EJ 4B3SJ 4JI0J 1HNWJ 1XMQJ 2E5LJ 4KY3A 2VQFJ 4AQYJ 5LM7E 2UXCJ 4X65J 1I94J 1IBMJ 4LF5J 4DV3J 4B3RJ 4JYAJ 3J7AN 3J81U 2F4VJ 2ZM6J 4NXNJ 4B3MJ 4DV4J 1XMOJ 5LMUJ 4GKJJ 4JI1J 5LMNJ 2UU9J 4JI8J 4DV1J 4JI2J 4KYZA 3R2DJ 3R2CJ 3IMQJ 2KL8A 4K0KJ 4NEYA 3J80U 2KVQE 4LFCJ 4B3TJ 4HHUA 4RJVA 2UXBJ 2VQEJ 1FJGJ 5AJ3J 4GKKJ 4LF6J 3T1HJ 4JI3J 1N33J 2UUCJ 4JI5J 4KHPJ 4NEZA 5IWAJ 3W1YC 5FLXU 1XNRJ 4X64J 5BR8J 4DR2J 4X66J 4DR5J 4DV2J 4LF4J 4DR3J 4DV5J 2MTLA 4JI7J 3D3CJ 4LF7J 2UXDJ 1IBLJ 5A2QU
chains in the Genus database with same CATH superfamily
2RRBA 1UWBA 4ZVTB 3PRBA 3KHRA 2DNHA 5HMZA 2OD6A 2D3ZA 1P27B 5FJ4A 5KG1A 3HF5A 4DX8H 3QSIA 3Q2SC 4ZVHA 2MY8A 1N5VA 2FPHX 1SJ1A 1JLAB 2WSEC 2F8MA 3W5XA 3JYTA 5HMWA 2AMCB 2OFHX 1FRXA 4A8KA 3AHPA 2L48A 1IBMF 4ICLA 1HNZF 1R8CA 1LFWA 4IRDA 2JVRA 3T9NA 1TKTA 3AFGA 1F9EB 2F4VJ 2DGXA 5THWA 2F8HA 5BYRA 3M6UA 2JFKA 1FVQA 3IS9A 5I3UB 1ZA2B 3M8ZA 4CNYA 3JQMA 1U25A 2IC3B 2NYHA 4RW6A 4PABA 4MT1A 4Q45A 5B0AA 3GLJA 2CPXA 3CCZA 3QO9B 5GAHU 4F2RA 3IR7B 3U1NA 2E29A 5D4OA 3BKFA 1JJ2R 4D3HA 2DRBA 1LW2B 1U0HA 4ED5A 3M32B 3W2VB 1K0TA 2XULA 2BACA 3K5PA 3RB0A 3D0GE 5KFJA 2OJ3A 2KB2A 5ETKA 3CPWR 2FHJD 2XB2D 2HRTA 3KLGB 4DV7F 2K3IA 4FYVB 5I42A 1R6VA 1YJ7A 2F5GA 1RCOB 1SPBP 1VQ9S 4X2BA 3W8PA 1URNA 4NLGA 3QT8A 3N6NA 3HFVA 4NCGB 4ZPBA 4KH1B 3CCTA 5AE2A 2ADBA 2OPQB 1X8DA 1LFPA 4YP3A 4GKJF 3DLLQ 4A4JA 3NGKA 3IWXA 4JI2J 2DHGA 2VOPA 4OZ5A 5KFWA 4WU3A 3HPOA 2WVFA 2VB6A 3MCOA 3B54A 3IC1A 1FKPA 4ER8A 1T05A 2YKOA 2XMAA 1SQEA 2H3EB 4OYWA 5IQ6A 1PSDA 2UUCJ 2CJYB 4IR9A 4HI1A 1HPZB 4QCLA 1XQIA 1T9YA 2PDAA 1URRA 4G6VB 1PKUA 3G6YA 5E3CA 3PG9A 2QA4G 4UY8T 1C0TA 1Y4ZB 3WQPA 2MKSA 1N36F 4DV6J 1M0SA 2COLA 4LRFA 3OLBA 1N5QA 4CI0B 1RAJA 2HNDA 4QWDA 1KS2A 4DSIA 4M5MA 1AW0A 3BZQA 2BZ2A 1Q53A 4TYBA 2LXFA 2K1RB 3V6JA 2VBYA 3A8IA 1MU2B 1IJEB 1B7YB 2MZRA 3PDNA 3H40A 3EGWB 2E5GA 1T7PA 3GJSB 1OSCA 2VG5A 4KC5A 4NLSA 3PVXA 3SDEB 2YKMB 1EETB 2D9OA 3MWBA 1V9OA 3CIZA 2F7VA 2AKWB 2E7XA 1RI7A 4HT5A 5KFKA 2MDAA 1HI0P 2BRKA 4PXEA 4UOGA 3PM9A 5KFZA 1KONA 2V67A 1YG0A 4CT8A 2MGZA 1RT2A 2BQUA 2C3YA 3AB2B 2IA6A 4LSNB 5AXLA 3PX6A 3KUEA 4G1QA 4FS1A 4J9RA 4HH1A 1R6YA 1BE4A 1NDLA 3ILLA 2V34A 1TL1A 2B9XA 2G1DA 4Q43A 1AUDA 3R1HA 2CPJA 4ZVRB 4ZLNA 1SKUB 2V5HG 4DR4J 2VIHA 3OQ2A 1DQ9A 3EWGA 3DLKB 4ZPVR 5KFLA 3PYGA 1TKXB 1RAIB 2VUGA 1DTTA 2OI2A 4LF8J 1ZAVA 3ISND 5CXTA 4B3OB 4HTJA 2AJQA 3DCAA 5LM7E 3MEEB 4DFJA 1IWGA 3F73A 4RW7A 3MAQA 4UZCA 5HN0A 1TVRA 1NHKL 4NYOA 2KFYA 3DOLA 4Q8FA 3PR4A 1NPKA 4NCBA 2G9OA 2WVEA 3KMSA 3QIPA 2QA1A 5J2QB 2CWKA 3K0JA 3HD1A 5KOXA 3QWPA 1TFYA 3IWNC 1GMUA 2CVEA 1NK6A 3MM8B 1RTHB 3SQGA 2HQGA 4URQU 1S4FA 2P9GA 2DNGA 2HLUA 1HR0F 2ZWPA 2PC6A 4MK8A 3RU0A 1KFDA 4U95A 1SJ4P 3THVA 2GVDA 4NLTA 5F8MA 2PA3A 1IKXB 1C4AA 1UWBB 1FRJA 3O44A 2V9KA 3WX4A 2O5DA 1N32F 4EI2A 4KKOA 2HQCA 2Z2LA 2X7IA 2HEKA 1KN6A 2ZD1A 4HHJA 1TAQA 1WC1A 3JYTB 2DEIA 2G2YA 4M1KA 1WUUA 3VGSA 5A6WA 4ICLB 3FZ2A 3C66A 2PN6A 5K5MA 1TKTB 1WOOA 4X84A 3P49B 4LF6F 1S0NA 4HDGA 1G2EA 3F41A 3ET6A 3HULA 2GMJA 3IS9B 2CJKA 3EZ5A 4A8YA 4J9QA 4YMEA 3R9LA 2DHHA 1IBLF 5ETVA 2V2ZA 3M9MB 4FYXB 1N48A 3D6MB 3FK4A 1NSQA 2IJRA 3I0RA 5JMNA 6AT1B 2LMIA 3TWZA 5SUHA 2PEBA 2ZH5A 3CWJA 2AJ1A 3KXDA 2ZJRQ 2BE7D 2AX0A 2Y0BB 3UDLA 3MECA 2BJ1A 3W64A 3HFZB 4LR9A 1WHXA 4G65A 3HM9A 4DL2A 4RNOA 1QUPA 3IBWA 5ETRA 4DUTA 5I42B 2MKYA 2NSCA 5C24A 4LF5J 3CCLS 2F3JA 1XERA 3JTOA 3FC9A 1BUXA 2FYXA 1RBLA 3DI6A 3OL6A 4AFFA 2KTQA 2P9EA 4E2FB 4JOUA 4RJVA 4OI3A 3T1HF 2I5JA 3DDKA 4ZIWA 3HXMA 3HVRA 2V8GA 3TVZA 4FYYB 1KC8T 1DZ5A 1FKPB 1T05B 4WJBA 4TQSA 3MCNA 2RIJA 2M0GB 4IOBA 4JI7J 3S8SA 1N0VC 2V9WA 4C4WA 8AT1B 3WIUA 1RWKB 5GAEI 4HH0A 4I56A 3GR1A 2CNLB 4F4KA 1Q8KA 5DLGA 4P2MA 3OTOF 2FLLA 2CJBA 4PZVA 1TL5A 4ED4A 1C0TB 2PO4A 4C3LA 4F0MA 4PG8A 3OR2B 1WSVA 2HNDB 1S0VA 4CNZA 3RBXA 4DI6A 2WAQD 2QMWA 4AXJA 5LSRA 1IN0A 1YBAA 2YX4A 1HNWJ 1RT4A 3T6JA 2YXLA 3KK3B 3GIIA 2LA6A 3C2PA 4RZRA 3CD0A 3X1LB 2DGQA 5HVFA 2EC2A 1O5JA 2LECA 3LALA 4URSA 3NXZA 4BS2A 2JJ4D 3UN3A 3DRRA 4ZP6A 3QBCA 1A0OB 2ZVIA 4EYIB 2B56A 1S7IA 1U1RA 2GAGC 1HNIB 3I6PA 1RBOB 4TY8B 1RWXB 3GIJA 2MGZB 3M6VA 4CO0A 3KDOA 4P10A 2DJWA 4Y2IA 4G1QB 2B5JB 3MR3A 3A3NB 3GSDA 3JAMU 3OFFA 2X3DA 3NAIA 1D9DA 4WYWA 4CWBA 4YN3B 1TL1B 1HMVB 2RU9A 4W92B 1U1MA 2RAQA 5F9NA 2U1AA 4J5OA 4UOCA 3NGTA 3MZIA 2UXCF 5B0DA 2HVHA 5KG4A 4K2XA 4E0DA 2H5EA 2XS2A 2KM8C 1FXLA 1S79A 3M2VA 4O3NA 1DTTB 5LMNF 1M1GA 3M30A 3HCXA 4FDFA 4KR0B 2H1YA 1QAJA 2R9LA 1X4DA 3R2DJ 2JFDA 3K7RA 1QSLA 2E9ZA 2DTJA 2ZOFA 3MM7B 4RW7B 2RUSA 1Q95G 1TVRB 1KOOA 1TR0A 2E1PA 5IZHA 4LQ3A 5DZ6A 5B0CA 1KOHA 2XWXA 3DRPA 5FIIA 4GO5X 4ECSA 2KG0A 2HURA 2WVBA 1Q8BA 5KG7A 3ZFVA 1R31A 1KQSR 2PI5A 1UEVA 3MMJA 3SCJE 3LGNA 1LOUA 5IM0A 1ZH5A 2KXFA 2AEMA 1WG1A 2DR5A 3IRXA 3E3XA 2GVDB 2L41A 4CH0S 1P1LA 2HGLA 3P6YC 5EX0A 2CG4A 2R2SA 5ETTA 4JI0J 1K73T 1WI8A 4KKOB 1X0PA 2BM1A 1FRLA 1VK3A 2Z8QA 5E2QA 2F9JA 1VHFA 3MPYA 2H65B 2ZD1B 3T9ZA 2VG7A 3UCGA 1K44A 3ZZ0A 2VQEF 4MH8A 1VQ7S 1SV5A 3PW2A 3MEKA 5HATA 5RUBA 4JV2A 1Y7PA 4BLGA 1FXRA 2OGUA 5IQQA 4AL7A 4JI3J 3AQOA 2EI5A 4DQQA 1SL0A 4TU7A 4FXVA 2KT5A 3R5AA 5HMXA 2BDPA 4N77A 1QTMA 2LEBA 2MSSA 5B0FA 4A8WA 1T3OA 3SV4A 4LFAJ 1GX6A 2FLPA 2R7WA 3PO5A 3SSRA 1ZOTA 1RTDA 4AL6A 1DY3A 5LJ3Y 3T41A 3I0RB 3N0VA 1IJFB 2AJ0A 2O67A 2M52A 1U8WA 3HHDA 5I4MA 2M4MA 1VIXA 1OY9A 4NL5A 3QGIA 4M5DA 1OYDA 3LPYA 3MECB 3VGTA 4B3SJ 5K8OA 2POKA 3QFHA 1XMOF 2BJ3A 4ED6A 3GPAA 4Z7CA 2N82B 4P2XA 4A8FA 3EM1A 2ZNZA 1UEUA 3VZHA 2IRYA 1RWWB 3T5LA 3UWTA 4WZQA 1SIZA 3W5YA 1FWLA 3OW2R 1FDAA 5K8PA 1M5HA 5MAOA 5DDRC 2PT0A 3DRSA 2ZE2B 2WK4A 2CPIA 2B4VA 5CQGA 4DR5F 2CZ9A 3DGVA 3DI6B 1S1UA 2J8AA 5KFTA 3VVUA 4ZPWR 1QAYA 3ILIA 5HO4A 1X7VA 2Z57B 3R5CA 4ZKAA 3PFEA 4MK7A 5HLFA 2JX2A 2MEWA 4K4YA 2ZWOA 4DV0J 4BC7A 2ZDPA 3BN7A 2J0QD 3QT7A 4XIUA 4ELUA 3ULHA 4C8OA 2QLBB 1RAGB 4PUOA 4BWJA 2R2TA 1RE1B 2DK2A 2W1BA 1X5SA 1FNOA 2J76E 1RKJA 5F8IA 4NZ7A 4P75A 3E01A 3CJKA 2ATLA 4DCOB 4X65J 1HBOA 1HQEA 4OV6A 4BBYA 2ZKTA 2V94A 4ZCKA 1RT4B 4DPTA 4IH5A 4NMXA 3DRXA 2CQ1A 2A6MA 4X4UA 2DH7A 1XNRF 1RJJA 4ED3A 2PFDA 3CJQA 1U48A 2HHSA 4HEA9 2AEJA 3JSMA 3K8VA 4IYQA 1R8BA 3DRRB 4I69A 4CH7A 1SL1A 1NDKA 1AT1B 1NAQA 5ETLA 4ES1A 3H4BA 2RF2B 3D28A 1F1BB 2M3DA 3VGUA 1U4BA 2ACMA 3UD3P 3TJAA 1D8ZA 2DR8A 4PXCA 1F6TA 1K0VA 1CEZA 4OX9F 1S1WA 3HVTA 1VQMS 3MMBB 4O0IA 1FTRA 1I5OB 3ZTQA 4IG3A 2UUAJ 4DDFA 3Q8PB 4DUYJ 3JTNA 1Q82T 2IPOB 4ELTA 3PV8A 1QJHA 2ROPA 3EDRB 1NU4A 3MMCA 4USKA 2EG2A 4ZS6A 5D0EA 4N56A 5F8JA 4GC7A 2EFQA 5KFYA 1HWUA 3D7SB 1ZA1B 3K59A 2WOMA 1N52B 2K3KA 3PYFA 4JI8F 5CZXA 2GIFA 3D0HE 2DITA 3TJ9A 4DV5F 1XTZA 5IWAJ 3ETMA 4DV2J 4LF4J 5IT9Y 1WC4A 4DR1F 1VI7A 4XDDA 2CDQA 1S48A 2AHOB 3TZZA 1WEYA 3PRDA 2V69A 5ITHA 2EFVA 3D6TB 1FD2A 4RWXA 2RB7A 5D0GA 3DRYA 4ZCMA 2FY1A 3BS9A 5E3QA 4PG5A 3KLVA 3LAMA 3V4MA 3OVBA 4A47A 4DU7A 3FRYA 3M8RA 2C3MA 2FDNA 2LU1A 3EZUA 5A2QY 1GTHA 4DV3F 1FK9B 4OYBA 4U8VA 2HFSA 5IM0B 4YQWA 1T03A 1HW8A 4NE9C 1BHNA 2C2NA 2I38A 2DCLA 2ZBRA 3FQKA 2EFGA 2QT7A 4OHZA 2W2QP 5K8MA 4B3MJ 5IFMA 2OPRA 3AY0A 5JVHQ 4ID8A 3IR5B 2BE2A 5KFNA 5H9FJ 1XR7A 1NK4A 1KVIA 1U8SA 1NB7A 3L7OA 3KMQA 4ZVQB 2ILYA 1RLDA 2VG7B 2PIIA 2XC9A 1SH0A 4MIBA 3D5MA 1YJNS 2IBOA 3TA1A 2PI4A 3ZC4A 1U45A 4QW8A 2P6SA 4C97A 2B7CB 2MKHA 1Y5IB 4X62F 1IR2A 3U1LA 4DR7F 2Z0GA 2X1GA 1JMTA 1ZM3A 3KTQA 1SUQB 2OKQA 2ROEA 2QL9B 1AA1B 1V5VA 1WKJA 2QYGA 1WACA 2H9ZA 3ZTPA 1JQGA 2G2OA 1E6VB 1QM9A 2HQ3A 1OPZA 2JHEA 1CG2A 3QGHA 3FKBA 4NXNF 3TZYA 1IUJA 1LNQA 2GQCA 5CYQA 3OUYB 4I6WA 3M8WA 5AE3A 4YR0A 2HZCA 2W4CA 3BGFA 4OJHA 1UL3A 1REVA 2W2PP 3FMBA 1FDDA 2BEFA 4QWEA 3VHQA 1VRUA 3V5RA 4MIWA 3PW7A 3OTCA 3HHLA 1VBKA 1H38A 3J7ZT 2IRUA 1OSDA 3G4SS 1GXTA 1D9FA 2EFPA 3OL7A 1FVSA 3DRSB 3FFIA 3Q83A 5AXMA 2W4DA 1UCNA 4JV5F 4DXLA 5G0RB 1S1UB 5D78A 3M7VA 3I4HX 4NA1A 1B70B 2LXUA 4LF9F 4PG7A 1X5TA 3VTIA 4IO1A 5HLFB 8ATCB 2J0WA 3UFCX 4A8QA 2E7VA 1NSPA 1HI1A 2ZVSA 4QR2A 5C42A 1KTQA 4F3MA 3AD8C 1RAAB 1FT8A 3LPEA 5KT3A 2GVZA 1I94F 2VPXB 4X4RA 4PUOB 2OMOA 3KLEA 1N8RT 4L3KA 4DS4A 1PAEX 5KG6A 2GV1A 4C0BA 4DV1F 4K5SA 3GU0A 3VF0B 1UFWA 4ILLA 2IY5B 3E01B 2ALYB 4TLQA 3CJKB 4PWDA 4KH0B 2RDIA 1HBOB 3TVKA 1HQEB 1XK8A 4EK2A 4HVZA 1FJGJ 4RUAA 2OMLA 5SZTA 2AP6A 4M5JA 2NYIA 2N7CA 1ITPA 2UXBF 1Y11A 3HHEA 2VL1A 1WOPA 1AFJA 3NRBA 3NOGA 2EC0A 2UUWA 3LGHA 4EUVA 2X3GA 3JSMB 4FS2A 4L3NA 1VK8A 1WF1A 2V2QA 4F7VA 2KO1A 4PWWA 3ZZPA 4DR6F 2B9YA 4RNNA 2XCPA 3BSNA 2VBWA 1ZPVA 4CTAA 3OVAA 5EWFA 3ZTRA 7AT1B 1S1WB 3HVTB 3R7NB 1ACMB 4RW8B 3CCVS 3DGPB 5A8KA 3LGMA 2VFRA 2H4WB 3DN9A 2QLFB 4DCJB 4QIGA 3AJ1A 4GC6A 3ZZTA 2EBEA 1C1CA 3G6XA 4OYIA 4I0WA 5ETNA 4F0HA 3OLAA 3MMCB 2XI3A 3TO8A 4H4MA 3ZZUA 2AYEA 1U1QA 2IFXA 3C6UA 2BW7A 3CJ0A 3M2RB 3TNVA 2DRDA 1U1NA 1OWXA 1RXOB 2AEFA 2D3OR 2Y1RI 2OHDA 3FEZA 3H2VE 1DLOA 5HMYA 4Q7AA 4EBCA 3SFUA 4YB6A 2CPEA 1BQXA 2H5IB 2F1FA 4FF4A 1SKWA 3DMJA 4M8LA 4MKAA 1XN9A 5I3PA 3EPGA 1YJRA 1AZSA 5LOQA 4Y2KA 1DURA 2KRRA 1Q79A 3ZO7A 1AROP 2GJ2A 2DPJA 1MMLA 2CA9A 1T03B 2QC3A 3WHIA 4ID5A 4CH1A 2R42A 4OYMA 1C0UA 2ALZA 2OPRB 4K59A 4PPDA 1RT7A 3AOAA 3I4PA 2BE2B 2BW2A 2LCWA 5JXSA 3OJUA 5KFGA 1PG5B 1PILA 2UXDJ 1VHIA 4RUHA 1ZM4A 4RWWA 2UUCF 2IVYA 2WB1D 3RGIA 3Q8YA 3PEJA 4K4WA 3D66A 4UOFA 2A2CA 1NSKL 1R7IA 1Y9OA 3HVAA 1KLNA 1UJ5A 2D7SA 5LT5A 2XHWA 2VONA 2VKZG 1XMQF 2K8GA 1B0TA 5J2PA 2Y8YA 4E98A 4NOHA 3IBFB 3PZPA 4FNIA 4QU6A 2V4RA 1UFKA 1H2UX 2IHR1 4DV4F 1YX2A 1S6OA 1U26A 4RUCA 2ZFHA 2G0IA 3KJFB 2HSEB 3QYYA 2BBEA 1QDUB 2B4OA 1O0PA 5CYQB 4Q44A 2MQMA 1KLMA 1BGXT 4MJKA 3GJRB 1TK0A 1REVB 2XMMA 2WBMA 3BBFA 1RWPB 2N7YA 1IKYA 5F8GA 3TEHB 5DRKA 2W9CA 1S49A 1XEZA 4J37A 3A13A 4KGKA 1G3OA 3HHLB 1VIOA 2MTLA 4ED8A 4IG0A 1H98A 4LRDA 3MR2A 1F5CA 1YWXA 3CJ4A 3TZXA 1X60A 3NNCA 4ZCIA 2R8KA 5KT7A 4CM2A 2QN6B 2UUBF 1O8BA 3IFEA 3SV3A 3FFIB 3R5JB 2ZBQA 2I6WA 2EEYA 5C2CA 3DC2A 2VFVA 4I1TA 2DYAA 2VICA 2MJNA 3P8BB 3KJVA 3GV5B 4FPIA 1CJTA 2HBYB 4B9SA 2YX7A 5L1LA 1J5EJ 4LT6A 4WBFA 3FGVA 3GWCA 1HYSA 5C42B 3RZAA 3R1LA 4QQBA 4KPCA 1M5PC 2IAJA 2GVZB 2UVWA 2D69A 3OTDA 2KXNB 3KLEB 3VR1A 4C8ZA 4EMDA 4OHWA 2J7WA 3LF0A 4AXIA 2KH9A 1K1SA 2FHKA 3MPWA 3H2UB 3SCIE 3KK1A 1JLFA 4PWDB 3HP6A 4CO2A 4K4SA 3R5DA 2MLYA 2FVCA 1JJ4A 1XC9A 1R3NA 4N7TA 3HK2A 3IXQA 1TV6B 4DCPB 1X9MA 4NLPA 3TW0A 2GHVC 4I67A 2QLXA 2ASDA 2LKZA 4K5RA 4P7VA 4L75A 3ONQA 4URGA 3AODA 2CQ4A 3CUNA 3ZZOA 2CNNB 3DDIA 2KI2A 2IA0A 4O3RA 1Q16B 3UDVA 3HO1A 4H4KC 1T02A 3AT1B 2M9KA 2V8HA 5HROA 1KTVA 3DOMA 1YITS 3MURP 1N5SA 4QYZJ 2IM1A 4EO8A 2IM2A 4W98A 1MN9A 5LMUJ 3KOAA 1L3SA 1SC4B 3TUJC 1FDBA 3KHHA 3LQVA 5A8KB 3AXKA 1ZS6A 1TL3A 2A1BA 2Q6CA 3DDNA 1R0BG 1RHRB 3QMQA 5KFPA 1RT5A 1S9EB 4GKKJ 4XPCA 1C1CB 3JXOA 4RU9A 5CYJA 1FHTA 4DEZA 2RKIA 1RYRA 2LQ9A 4OYXA 4H4MB 1UVNA 1NCLA 3QGGA 5KG2A 2YWWA 1S76D 5D6GA 3C6UB 1NHVA 2HS4A 5D77A 2HNYA 5J1NA 1N88A 2HHHJ 4B08A 2AX1A 4KPYA 3J7YU 1VBZA 3RW6A 2IRXA 1VDHA 2C2DA 1IBCB 2ZOMA 3L4BC 1DBDA 5L9XA 3CCSS 2NZCA 1DLOB 3CB4A 5E33A 1EP4A 3D68A 3CCQS 3GJTB 4OHXA 3G96A 3I56S 5CH7B 3M1VA 4FYWB 1AUSL 1JB0C 2RHQB 5T14A 2RS8A 1AZSB 2JEGA 5DG8A 4RLEA 2HHUA 2BABA 1RABB 4GVLA 3KUGA 3AD7C 1R8PA 5IOLA 1VR6A 5DLFA 5DG9A 2Z2MA 4DSKA 1IVZA 4KO0A 2ZH3A 1C0UB 1NKBA 1IM4A 3KNGA 4QWAA 1RT7B 4DX5A 4ERDA 2V2KA 3M8QB 3R3TA 3JQJA 2IVMA 3D2WA 4B9NA 3I82A 4FZVA 3BQ1A 3NMRA 1FTCA 1JNRB 1H7WA 1RUSA 1HNXF 3GB0A 1U1KA 4NLUA 1U1LA 2ZITA 4EWTA 1YJWS 3AJDA 3BPDA 3CIMA 4DF4A 2J0XA 4M5HA 1UVKA 2HK2A 3BQ0A 5IC4B 3EPIA 4KFBA 4D3GA 1U24A 3I5CA 1L5UA 3MEGA 2VD3A 2Q79A 3K5MA 3J81U 5J2PB 2W7OA 2GCFA 3WIVA 1S9GA 3KHLA 2HAFA 4CYUA 3FQLA 3JSRA 3DU5A 4ZA1A 1ELOA 4P72A 3ZZZA 2UZAA 3MEDA 1A7GE 3SXLA 3NS6A 4ALZA 3OR1A 4ZJLA 2XZWA 5J1EA 3KK2A 4ITSA 4O4GA 1B99A 4DSEA 1QE1B 2O3DA 2GIQA 1O51A 3PKYA 4OX7A 5KFUA 3ADAC 4H4OA 2LVWA 4UY85 1GH8A 3W7BA 4Y6IA 4JI6J 3NY0A 1F2GA 2N3OA 3DXSX 2NZ4A 4IG0B 4KBIA 4ZP8A 4DUZF 1S6QA 2WRMA 1L3KA 5LL6d 1RYSA 1S1XA 4ETZA 4CLYA 3T1YJ 2DR6A 3SCLE 3BEGB 5B09A 3VV2B 3G2XA 5DM6Q 1DTQA 1TQLA 4C11A 1CJTB 5CHCB 1IBMJ 1S6PA 3HSGA 3W2WA 2DNMA 5EDWA 3G87A 5DZ7A 2W4PA 1HYSB 1WD6A 3M05A 2VOOA 1VLYA 4JBCA 4ZPCA 3IG1A 2LYVA 3FSYA 1MLAA 3JAMY 4EGLA 2XYGB 1DQAA 3IGNA 4WTOB 4QIWD 1JLFB 1Z1ZA 4KQZA 4DU8A 1B0VA 4QIVA 2C1EB 4ZLPA 1VQ8S 2XLIA 2G0JA 4WIQA 3V6DB 1X0FA 5I3UA 3NCPA 5GAGI 4AD6A 2XM3A 2J5AA 2RDDA 3GFHA 3OL9A 2IC3A 2KFNA 2BJDA 3R97A 2W9BB 3QO9A 2UU9F 2QL7B 1C1BA 4ES2A 2DGWA 3TAMB 4GKJJ 4DQRA 1LW2A 1TMMA 5E3RA 4NA3A 4Q2MA 1UVLA 3KLGA 2EWHA 4KHPF 4PRFA 3TP2A 1NJXA 2CNKB 4X66F 1VMBA 1TL3B 2ZH4A 2R8GA 1JLEA 3JSYA 5GADU 2ZZMA 3R8YA 1CPZA 5LSLA 1NKCA 3K5NA 3I31A 1VQOS 2ZNYA 2R3VA 1D09B 2HAIA 3EDQB 1LW0A 1N36J 1LWCA 1H73A 3LP1A 2RQKA 4LR8A 5L9NA 3W66A 3MUMP 2I2YA 2HNYB 4LFAF 2VJUA 1KFSA 1JJCB 3R6GB 4LRBA 4PQUA 4MMOA 5FDLB 4V1Ak 4EO6A 2CQ2A 1G7CB 1IWAA 1WC5A 4JYAF 2QLWA 1HPZA 4DL3A 3PRVA 5KFAA 1VLOA 5HJYA 1UA1A 2ZBCA 4Q0BA 3C14A 4QYRA 3M1VB 3MDFA 4I6AA 4HHHA 1N33F 3FMWA 1FCAA 2RU3A 1TFWA 3N6MA 1TMJA 3CO9A 3S1TA 2HZVA 2JC1A 3UN5A 2CRLA 3A4TA 2DGVA 4LR7A 3TRGA 3OHAA 3UI3A 3DHXA 4K8RA 2O1PA 1HHQA 4IRKA 1ZPWX 4KO0B 2QO3A 2DBBA 2YWEA 3FCVA 2RQ4A 4IO9Q 1EETA 1HD1A 5M2UA 1NNDA 4LRCA 1RDRA 1B0PA 1VRQC 1CQMA 3OPKA 4KTQA 4R8UA 3EYZA 1JXLA 4W90B 3QRQA 3C6TA 3VALA 2AZ3A 4LSNA 1N5YB 4UZBA 1LV5A 2A10A 4Q2LA 9RUBA 2PEHA 3RG6A 2FLNA 4C8KA 1CBKA 3AQPA 3HT0A 3GYGA 2XO7A 3HSZA 3GG0A 4WE1A 2WCXA 2QRRA 4K2JA 4IH7A 2NUUG 3UR0A 1V3RA 2LEPA 4GVBB 2A6OA 5F8HA 2XLJA 1MSWD 3GONA 3CMES 1S9GB 3EZOA 2ZBIA 3IM8A 1WDTA 3DLKA 4UUXA 2DR9A 1TKXA 3GZ7A 3BKTA 4PCQA 1IKVA 1N6QA 2X51A 4Y2AA 4NLWA 2H54B 3MEDB 2QGFB 1RT3A 3THTA 4HTIA 4PYAA 3Q8QB 3Q8SB 3KK2B 4B3OA 1SH2A 3P4UB 4O4GB 1UPMB 1HR0J 3U02A 2Y1IA 2F4FA 1V3SA 4H4OB 2V8DA 4WZMA 2IMWP 1NHUA 3NGUA 2RD5C 3BQ2A 3QGPA 3CDBA 2HHWA 2Y0SD 3GIRA 2KG1A 3Q24A 1EIYB 4ES3A 5DGAA 4DPUA 2ZH2A 4B3RF 1S1XB 3L9ZA 2NXUA 3MM8A 1TUGB 3DOKA 3MCMA 5EX3A 4USHA 4LQ9A 1OY6A 1MWYA 2FJAB 3B6BA 4ED1A 1U6ZA 1S6PB 2CPYA 4L76A 1RSCA 2HRUA 3W2WB 4DL7A 2FHOB 3KLIA 1IKXA 1LKZA 3MFHA 4LF6J 2VH7A 2WVCA 4ETXA 4DX7A 3IG1B 2DVIA 2LQ8A 1PJ6A 2I9SA 1IBLJ 2QSFA 3GV8B 2VZ9A 3MD1A 1K47A 4ZMMA 4WPAA 4DV2F 4LF4F 1YBTA 5E7OB 2GHPA 4UT4A 3RR7A 2LEAA 2CJXB 4U7UD 2UP1A 4CQ1A 4A8MP 3FBEA 1N4LA 4YY3J 3RRGA 3GP9A 4AT1B 5J2MB 3CVKA 4IH6A 3RR8A 5CZVA 1TP7A 5H9EK 1NH8A 3MF5A 1R0AA 3VAMA 3R2CJ 2CKWA 1C1BB 5F3TA 3EX7B 3T1HJ 4O23A 4RBTA 1K9MT 3DKDA 4RW9A 2YWKA 3LAKA 3PYEA 2DXDA 1EARA 3P5BP 2KYXA 1KNZA 3Q8VA 3W8GA 2R8HA 3FCHA 1VC0A 2JWNA 1JLEB 4JI4F 2KDOA 3E2EA 2MYFA 3N28A 3OTOJ 4LJMA 4YHHF 1BD6A 1RU1A 3HVWA 3BDEA 1LW0B 4ZDNA 1LWCB 3LP1B 2WSCC 4Z2XA 1RTZA 1Z4UA 2C2KB 3DYAA 4PQUB 1FNMA 2MQOA 1XR5A 2MPUA 1CQNA 4FXWA 1FE0A 3NP5A 3C15A 1OPIA 2DGOA 2YVSA 3CD6S 2ADCA 4FKYA 5D3GA 2FC9A 1SC3B 4Q0BB 3I9V9 3C14B 5AJ3J 4X64F 3RB4A 3OR2A 2B9EA 3LTOA 2MQLA 1ULRA 3CTRA 3O2IA 5AT1B 2IDEA 1RZMA 4CLPA 3M6XA 3MM6A 1XNQF 3PW4A 4HACB 1PJ5A 3KK3A 3NKYA 5MLCV 2IYGA 6FD1A 5GMDA 2KRBA 4O3SA 4MYTA 3F56A 2DXEA 2XMTA 4QR1A 2JC0A 4P73A 1N54B 1X9WA 2L9WA 3CJRA 3OXLA 4OL8A 1DHMA 3PFOA 4CLUA 1WC6A 5C2GA 4R8UB 2UXCJ 1S9FA 4ECYA 1NDCA 3KLFA 1PO6A 3C6TB 1HNIA 4FF3A 4TY8A 2HNZB 4ZHRA 4LBPA 4DLGA 1NMEB 4GO7X 5LMNJ 1VQPS 2B5JA 2ZZTA 2NXCA 2M8DB 1HBMB 4FBTA 2FUG9 1QSSA 1NEEA 1Q4RA 3N01A 2BKPA 4JI5F 1ZTWA 2YKPA 5F0WA 4WE1B 1HMVA 5BR8F 2AGOA 3N79A 2HQIA 1Y0HA 4BWMA 2CVIA 3IM9A 4OI6A 2CQIA 1FJGF 1T9UA 3TQ1A 4FF1A 2ZOGA 3AD9C 4UTGA 3OD2A 3TI0A 5A8RB 1IKVB 4LF2A 1IR1A 1N6QB 1P8GA 1FERA 3GYXB 1RT3B 4TU8A 1OYEA 1TELA 3G82B 4DL0C 3Q2TC 3MM7A 3NL0A 4K4VA 1W26A 5EHHA 2H48B 1O6XA 3RTVA 2DT9A 2JZ5A 2MQQA 3TUIC 3BR9A 4OI1A 2B8PA 3V6KA 2PGCA 1QD1A 1U6FA 3TANA 2GMLA 4IDKA 1RCXB 2K06A 1T9VA 3VQSA 1UVIA 2HVZA 1RACB 1FJ7A 3DOKB 2HGNA 2NR0A 3KKFA 4ZOSA 2EKNA 2VQEJ 1TKZA 5ETSA 1WF2A 1HHSA 2L9DA 5IS2A 4KGXB 2GA7A 2UVVA 2KFZA 3KLIB 3I9ZA 4DWIA 2N3LA 3EVMA 4BC9A 2MQPA 2P8IA 3H90A 2YWHA 1IXKA 2QSWA 1YGYA 1N56A 3D3BJ 1FKOA 4C48A 1ZAXA 5JJBA 1OY8A 1NPPA 2FTRA 4NRUA 1TUVA 2KZMA 2LDYA 4AQYF 5DDOC 2HBZB 2KJWA 3NWRA 1JX4A 1I1GA 3ENVA 1FEHA 2KXHA 1UZDA 2HG4A 1S1VA 2DEJA 3CCWA 1XMOJ 4C7QA 1FFSB 4NASA 2F63A 4LFCF 2YH0A 3Q89A 2F40A 1FDNA 2ZH9A 2XI2A 3OVSA 3D9BA 4Y00A 1SJ3P 4J9OA 1R0AB 2MQNA 3VGVA 3Q0AA 3UD5A 1VQSA 4DR5J 2BOPA 3TX8A 2L08A 4Y0FA 4JUZA 2ILZA 4IUFA 3ITHA 2W7PA 4DSJA 1EB0A 4XO0A 1M90T 2BANA 4R5PB 4F02A 3C3LA 2XCAA 2APOA 1YJTA 4RW9B 3HJVA 1IBKJ 5T41A 1RB0A 5A0YA 1UETA 3E51A 5GAGU 3DHWC 4NXMF 2EG1A 2Z4PA 3PKMA 3ZTOA 3U1MA 4HR2A 1N34J 4EYHB 3UQSA 2ZE2A 2E5LF 1S7HA 5F8NA 3MD3A 4IQXA 3A3PB 3CJTA 3TR5A 2YPYA 2XTJP 3K58A 1UZHA 1RP5A 4Y65A 1TU0B 4USMA 2WVDA 2JL9A 3DYAB 2DHXA 4J9SA 1LWXA 3JSBA 1CS4B 4UOHA 5KG5A 3OFGA 3C15B 3D1HA 2BQRA 2PMWA 2W8LA 3DLHA 2G13A 3CW2C 1XNRJ 2W01A 2YNFA 5D3GB 1G6BA 5DETA 4IRCA 3NNAA 1H6KX 5K9FA 2E1CA 1ZM2A 3IAS9 4DFPA 2BJ9A 4JB8B 3MM6B 3PX0A 3THPA 2UVRA 3MR5A 1R0CB 2PMZD 1LWEA 4CLLA 1HI8A 2JSXA 3SCKE 5LXRA 1J2VA 3MUTP 4YOEA 2ZUAA 1T94A 2YNIA 3CJ8A 3D67A 1TZ0A 2OEJA 1VC5A 2UUTA 1SKSA 3CC2S 1NK9A 4USIA 4KT0C 4P74A 2VASA 2B6AA 1SKRA 4BDPA 4JI1J 1UAWA 2BUNA 2RF2A 5GVQA 5DDPC 8RUCA 4ZVGA 3H2LA 3KLFB 3EGZA 1F2HA 3BGOP 4PG6A 4ZHRB 3BGUA 5EWEA 4HL9A 2RRAA 4WFNQ 1VRTA 1RHMB 1FEEA 5JVGQ 3J7Z5 3W5ZA 3MMBA 3NEKA 5IC6B 4L73A 3F0NA 2C3UA 4DV5J 1Q86T 5K20B 2CPDA 5A2QU 4F4WA 1EHWA 4DR1J 4I6YA 3RBEA 4Q5VA 1VCTA 3G9CA 2CYYA 5HI7A 4A8OA 4ENOA 5KFBA 1S1TB 4LF1A 3BN4A 3RAMA 1F0XA 3POTA 5F0UA 1Y5LB 5GMEA 4O44B 2HMIA 1OS5A 1RWUA 4EBEA 4ECVA 1FFGB 4KY3A 4XAKA 5IV3A 2ZM6F 4ECTA 2MJUA 2RNEA 4DV3J 2LLZA 5BJRA 2GHWA 1RWVB 2GC8A 3A8KA 2W7AA 2BR0A 2K7JA 3QZ7A 3MPUB 2NPIA 2D9PA 3V4IA 3AH6A 4IDKB 5LMUF 2D74B 4MKYA 5HK4A 2ZH1A 2ATCB 3GFYA 4F3QA 1BQMB 1ZTTA 3I96A 2OH2A 1OMSA 1TKZB 3MPVA 1FK9A 2BXJA 2FJBB 2DB1A 3B78A 1YJVA 2ACYA 3EJMA 5HANA 1RISA 4JV1A 1X4BA 2XG8A 4PAAA 3CSKA 4USJC 1Y10A 3ISZA 4DPXA 3TYTA 1EKSA 2RQMA 4X62J 5EWGA 5DO2A 3UDEA 2HHHF 1H7XA 4GMKA 4DR7J 4YS2A 1SJFA 1A9NB 1JLCA 1K8AT 1FKOB 3PACA 2RVJA 3UD4P 2VQFJ 1JLBA 3WX8A 4IKAA 4CP5A 4KHRA 3CCMS 2J9CA 4FP9A 4NXNJ 2DY1A 3K17A 2X1BA 4PG4A 4CO1A 4RW4B 5EN1A 4CLSA 4P52A 2MXYA 5BYSA 1WNEA 3J80U 1UW9A 1KQKA 4DG1A 2B8QA 1S1VB 4XK8C 4M95A 4NMLA 4TNOA 4DPYA 2LDIA 2W2OP 3I87A 2BX6A 1SUQA 3OBIA 4A46A 5B7WA 2GGPA 3PJWA 2BJ8A 3UR3C 3SI8A 1E6VA 3H7HB 3BM7A 3VAGA 5K8NA 4F26A 1PYSB 1YRUA 2WONA 4HLBA 3J81j 4WU2A 3OUYA 1X9SA 4JV5J 4FYDA 1JIHA 1WF0A 5ETOA 1DRZA 3ITHB 2GAHC 2JH3A 1U0SA 4NX9A 2BANB 4LF9J 3VAKA 3QRRA 4Q8EA 4KV8A 2WW8A 2J9DA 2SXLA 1HWKA 3EMTA 5A0YB 2Q1LA 2VKRA 1HWLA 2HFUA 2JLFA 2VDHA 4QIEA 1I94J 1WTFA 3T6BA 5G0RA 1RAHB 2CQGA 4USVA 4OV1A 4DV1J 4OZNA 2BKOA 1YBUA 4F8RA 4KGVB 1SJRA 3PTWA 3MAAB 3A1YG 2OPSA 1TL4A 1GX5A 3IP0A 1QAXA 2HW3A 1RTIB 3HSDA 1CLFA 5L8RC 4X4TA 2XYPB 4E8UA 4J9MA 2M8HA 2P9CA 4C8MA 2VA2A 5DG7A 2YNFB 1W7WA 3D54A 2KT2A 4OZ0A 1YIJS 3SZ2A 4NYPA 3J81Y 3F44A 4K7QA 2DNYA 1XWLA 2B7BB 2MZJA 2ZUGA 5C25B 2A18A 3CJSA 1ZYQA 4DR6J 4LSLA 3GG1A 1LWEB 4NLYA 2AIRB 3T1YF 2PA8D 2FD2A 2WW4A 2YNIB 2MKJA 2KJVA 2EK1A 2U2FA 3LO3A 4ED0A 3JB9k 4B3TF 1RTJA 3NCQA 3C8YA 4KRWA 2HVIA 2C2EA 4YR3A 1UWAA 2B6AB 2LFVA 2Z2YB 3SEOA 3TJ8A 5E3PA 1FD8A 2HZAA 4UW2A 4LF7F 1YVFA 1S4EA 1S77D 2E7WA 4NRTA 2QZ8A 4FPRA 4C8NA 1VRTB 1X4FA 2OP5A 2KZZA 2FHMA 4RW8A 2QJ3A 3J7YI 3DGPA 3TA2A 4KHMA 7FD1A 3QNWB 1GMVA 4ANDA 4CO4A 4ZVFA 5H9FK 3LA0A 1GT8A 1BQNB 1Y3JA 2CJ9A 4R25A 3IGVA 3M4XA 3BSAA 3UE2A 1A6LA 1KBRA 1CULA 2YTCA 4YUDA 1B3TA 3M2RA 4QPTA 3POTB 2UV8A 2CZVC 3PIPQ 2GMHA 3L95X 4X4PA 2HMIB 1X4HA 5KT4A 1Q1KA 2FHJA 5HJXA 4DHVA 2C2MB 4UF4A 3DNCA 3T5KA 5BYQA 1M5OC 2DIUA 2DHAA 3EVWA 3DXBA 2QMUB 1W2IA 4M5KA 4ZLJA 1FRIA 2BKNA 2JLGA 3P45B 2C3PA 4A48A 1D8YA 3I5AA 3V4IB 4ZN1A 4CCHA 3PO4A 1NLKL 3D3CJ 5HP1A 1VJWA 3N6LA 1VQ6S 5M2PA 2F65A 3CC7S 2RQCA 4OI2A 1JLQA 2ASJA 1S6UA 4AYBD 3GQCA 4ZPDA 3UDCA 1H0HB 3UNGC 4TN2A 3FSIA 5H9EJ 1KRPA 3R6LB 1JLGB 3NWGA 4NLOA 3AA9A 2KM8B 1OJ4A 3IWLA 1XMQJ 2QG9B 2V4QA 2Z2ZA 3EVOA 1NSAA 5D15A 1JLCB 4HT7A 4DV4J 4C0OC 4K0KF 1IKWB 1JLBB 3IMQJ 2PMHA 5ETMA 2AQ4A 2LU2A 2CJAA 3S7RA 2RHSB 1WHWA 4WCEQ 3MI7X 3QFWA 3DM2A 2CG8A 3N5FA 1UVJA 1WWHA 4N76A 4ED7A 4DG1B 1U1OA 4USTA 3W1YC 1X4AA 2BV3A 3G8TA 1RHKB 2J6SA 3W60A 1CJUB 3H8YA 4B17A 2GGPB 2QE5A 4J9VA 1YHQS 1F60B 2BMBA 4YB1P 3FEXB 3UW1A 3ILOA 4DPOA 2Y9HA 2UUBJ 1QY7A 2LQ5A 2B0GA 4B9TA 5LSOA 2WONB 1WKLA 1TL7A 1NK5A 5K14A 4Y2MA 1MN7A 4LRAA 2HWIA 3HHLD 2XZTB 1YTYA 3OSNA 3GIKA 4V19J 4KV8B 1FRHA 4ZN3A 4QPXA 3MR6A 3O6QA 2AT1B 4P71A 3RW7A 2GO9A 1VQNS 3HZEA 1Q7YT 2ZC4A 3RBDA 3MTKA 3T5HA 4OZLA 1J5OB 4B9VA 5KFOA 5CCLA 4OZ1A 4BCAA 2GW8A 3NBPA 1S97A 4MFBA 4C3MA 5L1IA 1R27B 1XIQA 4DN0A 4OX6A 4J9LA 4DR3J 3BO4A 2W8KA 3AXMA 1X31C 1U02A 4ZJQA 2CJQA 3R7SB 2OPSB 1FO1A 1LWFA 3AB4B 3AAWB 3BV8A 2B4PA 3HZGA 4LFBJ 5DQHA 3M2UB 1S5ZA 4MIAA 3RBZA 1F5BA 4NWBA 1RA6A 2RS2A 5KFMA 1L3VA 1SXLA 1PGZA 5CABA 1E6YB 1CC8A 5U47A 4DL5A 3QLHB 1K1QA 2W9AA 2QA2A 2YKNA 1RAEB 1TV6A 4BHQA 2FIUA 3HLUA 4LSLB 4J91A 5ETPA 1IQZA 4OI4A 2EPIA 3PW5A 1ZM9A 2JRSA 3UO0A 4ZPTR 4EU0A 1T9WA 2WSFC 2XS7A 2YKQA 3NLCA 4LVNP 1RTJB 1NRKA 4DR2F 2B51A 5GADI 1VYAA 4DSFA 2E9RX 4RU2A 1REGX 5FLXU 2XMWA 4W4MA 2XEXA 4M5LA 3UCUP 3OFHA 5E3AA 4PEOA 1YK9A 2H51B 3CULA 2G4BA 4LUBA 4RL1A 1YKWA 2RSQA 4O3PA 3MGJA 3PHEA 1VQKS 3CJ2A 2MLZA 4DL4A 3RJMB 4KGZB 4B02A 2HHPA 2J0SD 4NI2A 4G1PA 1U47A 4ZITA 4RW6B 2JEFA 4Z7YA 3D0IE 1S9EA 4PR6A 1R8HA 2F4VF 2M2BA 1KSPA 2FGOA 2YY3A 4YY3F 1U0HB 1JK9B 4QOTA 1CULB 1B4SA 1BMQB 2WBRA 3CT9A 2DNNA 3HKWA 2VC1A 4PYDA 1VFJA 2CUYA 1JWWA 2CIMA 3K5LA 4M5GA 1CC7A 4ZVUB 3TUPA 3IR6B 5A76A 4KJIA 2NS1B 2HHVA 5T7LA 3GSIA 3EGVA 3KUHA 4PPZA 1HQUA 4ECXA 1UEKA 4N47A 4X4SA 1JJHA 2E5IA 5CAAA 2OSQA 4R0EA 4LMZA 1M5SA 2AYBA 2IM3A 4WF9Q 5HP1B 1PJ7A 1RHJB 4U67Q 4EFAC 1Q78A 2V4JA 1HNXJ 1JLQB 1QTNB 4J7CA 2XMKA 2QTWA 2A3JA 4NZ6A 3B4MA 1FE4A 3FCWA 4OHVA 1KHWA 1WHVA 4O4RA 3J7AN 4JI2F 1KKHA 3RB3A 3OV7A 3M8QA 3BB5A 3JTPA 2VPWB 5IT4A 1VQLS 3P3DA 2Q66A 3ZNJ1 2V8VA 2I8EA 5D8HB 2EKYA 4FBUA 3MM9A 1ZZNA 3IAM9 2QA4S 3MOZA 2XMJA 2VG5B 4USUA 1L3TA 4C9DA 4OZ3A 4DV6F 5AJ3F 1P1TA 3DM2B 3NCRA 4OYZA 2AZ1A 1UP1A 2E1RA 2BE9B 4R0JA 2X1AA 3HFKA 2PSZA 1Q5YA 4B9LA 1X4CA 2JDJA 1HBUA 2VV5A 1WG5A 1D0EA 1NZAA 3C16A 1DFDA 1RT2B 4DUZJ 2ERRA 2DNRA 1F9FA 4LSZB 2AW0A 4CLTA 2Z56B 1X5PA 2F9DA 4WFZA 1TL7B 1QE1A 5K14B 1N5TA 2EBGA 2R8IA 1KR4A 3SSSA 4YR2A 2LXIA 1X4EA 2M70A 2EFNA 2R7TA 1FA0A 3CXCR 3AA8A 5F3ZA 1WEXA 2H5JB 1FF2A 5CD4A 1PC4A 4WFXA 2IJFA 3SMZA 4HHUA 1YRTA 1PIEA 1CJKA 2PE8A 3H0PA 2BRLA 1HQ2A 1LK5A 2GZOA 4F4XA 3GE9A 1HWIA 1PC5A 1VQ5S 3BJYA 4RNHA 3FBFA 1AYEA 5J2NA 3H98A 4ZLLA 2Y8WA 2P5VA 4FVMA 4RBVA 4ZK7M 2AGPA 1PYTA 3G6ES 4I64A 5KT5A 1FI4A 1YSJA 3NBPB 4MFBB 1WI6A 2NUHA 4DR4F 4QYZK 2ROGA 3DOLB 2MZSA 2FVQA 2BQ3A 2FVRA 4Y28C 2XHCA 3CCJS 2VDIA 4DLEA 2W2MP 4XPEA 1YZ6A 2A0FB 3QIPB 2ASYA 1H72C 1LWFB 4ZVPB 4RX6A 4LF8F 4LIRA 5HQ8A 5H1SV 1UKUA 4PKDB 1P6TA 3Q22A 3SQGB 3KFWX 2E9TA 4WKYA 3A12A 3O5TB 1T0TV 3H5XA 3RAXA 3CMAS 3C46A 2HPUA 1RAFB 4QJVA 1UA0A 3OL8A 1SB6A 1T9TA 4X4OA 3PR5B 1TTHB 4OFZA 5E5NA 2EK6A 2UU9J 1SH3A 2YKNB 5L38A 3O3LA 1H2VZ 4NEYA 3VAIA 3GV7B 2RT3A 2NCKL 4C8YA 2VHGA 3V6DA 2GQ2A 2KU7A 4ECZA 3TAPA 3QJLA 2I0XA 3MOJB 3CDAA 4KHPJ 3UN2A 2DO0A 4FVCA 4X66J 3ENQA 4DBQA 2HWHA 2OSRA 1TKDA 4DMZA 2W9BA 1UMJA 2XLKA 2G0CA 2FGCA 4B9UA 2GQQA 3FSXA 3TAMA 1RQ0A 2R7QA 4F67A 1FNXH 2VFUA 4YDDB 3ET6B 4ZVOB 3KHGA 2V2VA 4I2QA 3CCUS 4ED2A 3QJPA 2VPZB 1WOSA 2LQBA 4NI2B 5F8LA 2NXJA 3BSOA 4JYAJ 3BGRA 5L39A 4C3KA 1TK5A 1S99A 1MNEA 2QV6A 4WP3A 4YEAA 3ZZRA 5A6PA 3LWMA 1AB8A 2FY8A 1AFIA 1WTBA 5HL7Q 3LW5C 1RU2A 2OFGX 1T11A 1N33J 1RK8A 4ECUA 4OYAA 5FDLA 1S12A 2IMOA 4EZ9A 3BYPA 5C24B 2VPYB 1PCAA 3ENWA 1QVFR 2K7KA 4KAIA 4MKBA 4K4ZA 2GIRA 5T7LB 2AWZA 4H4KA 3WBZA 4ECWA 4HDHA 3GFXA 1HQUB 5C5JA 1WKKA 2C42A 2CADA 2I5JB 4X4VA 1F5AA 4M5IA 2M5YA 2DH8A 2XGQA 1SBRA 4TYAA 2GNKA 1IBKF 1RWNB 5EUHA 3CJ5A 1PAUB 3U7JA 4GRSA 2ZC3A 4RKUC 2C28A 4LF5F 2V4JB 5E41A 5AXKA 4CLFA 1N34F 1C2PA 1Z2ZA 4LREA 3DLJA 1NB2A 2B4UA 3LH2S 2OIHA 1BWVA 4C6AA 3I32A 2FJVA 2GJIA 1RGVA 3TZWA 4CLWA 1HL6A 5F9LA 2RH3A 1GFWB 3L7PA 1WC3A 2MZQA 1R89A 4M5NA 2YQ3A 3CD7A 2XSJA 4NA2A 4DJBA 2YWFA 4JI7F 4X4QA 2HVDA 4RO0A 3KLHA 4CRJA 3BO2A 4O3QA 5HVHA 1UPPA 3QWUA 4EBDA 4F50A 3HJFA 3MM9B 1D1UA 1N5YA 1HLWA 4CO5A 3M6WA 3GJQB 2YNGA 3QT6A 2V50A 3LUYA 3KNAA 2DY9A 2FJDB 2MLXA 2OTLS 3ILJA 3Q86A 1QLNA 3GCWP 2CZ4A 2R7SA 2O01C 4S0MA 3N4WA 4TXSA 1U49A 4GVBA 3FNNA 3TUZC 2Q3PA 1SI9A 1HARA 1Q8IA 1RADB 1HNWF 4DF8A 2JVOA 4WK1A 4QIFA 1HBUB 4J90A 4QU7A 1VQ4S 3C16B 4Z37A 3TX0A 1GXLA 2DD8S 4B3RJ 2OEKA 2XO6A 3T3FA 4UQTA 3CGIA 4TVAB 3OXFA 2BA9A 3WC2A 3I5BA 3H25A 2B3TB 4I68A 4N8OA 4L6V3 3E8OA 3M9OB 4JI1F 1GNKA 2IIHA 1SCJB 2HLTA 2OUGA 4X4NA 2K2PA 4ECRA 1CJKB 1V5IB 3M2VB 1FX2A 3OJSA 3M30B 2XMUA 1DAXA 2DGTA 5J2NB 4WFBQ 4CIOA 1HD0A 2N4CA 3CF5Q 1F3FA 3S01A 1QVGR 1R8AA 1HNZJ 2CQPA 2ZH8A 1NM2A 4ZP9A 2JNJA 1DARA 3G6VA 2AJ4A 2RUGA 5DGBA 1OQ6A 4A8XA 3DRPB 2GFFA 2WB4A 1YJ9S 2GS8A 4F2SA 3W9IA 3M8YA 1EQ0A 5ADZA 2ZEJA 3M8PA 4OMFG 5DJBA 1GEHA 4C8LA 2HYIB 2NQPA 3IRXB 1S10A 4V19X 1XMBA 5D4LA 4K4XA 2BOAA 3H42A 4OQJA 2NXEA 1RHQB 4FN5A 2MKCA 3CMQA 4OX8A 2IJNA 4YB5A 1U7LA 3MPDA 4OLOA 3BBCA 3CC4S 3M8SA 2Z58B 1NH7A 1NBEB 3HHLC 1GAOA 5J2MA 1NKEA 1RKIA 4DV7J 1VC6A 3D1QA 3LP2A 3CO0P 3BF4A 4DZ6A 1SV5B 2R2UA 2NLWA 3CJ3A 5HBMA 4OHYA 2VC0A 4JI4J 1RA7A 1NUEA 3BKUA 4K50A 3BDPA 4KSEB 2OTJS 2CDRB 2ZH6A 4JI0F 2ZKUA 2DNZA 3W9JA 3EE3A 3AOBA 4YHHJ 2RJZA 3ISNC 5M2RA 4DS5A 1FJCA 3R5BA 2L9NA 3KYLA 3N9UC 4I2QB 2XNRA 1WC0A 1P9QC 2RMLA 2DHSA 3OTEA 3RRKA 1KDNA 4DX6A 2IBKA 1RTDB 2HQDA 4NCAA 2VQFF 4LVOP 3SSQA 4CT9A 4O3OA 5AE1A 4DPWA 3QRPA 1AXQA 1LK7A 1G4CA 3BGRB 3PCOB 4JI3F 4P2FA 1Y5NB 1FKAF 1B7FA 3I0SA 2AU0A 4M5DB 3DLGA 2KT3A 3AJ2A 3WZ0A 3H4DA 5A8WA 1YZ7A 3KG0A 4JP8A 3W9HA 4X64J 2VBZA 1S59A 1WEZA 2MY7A 2OD4A 1RWOB 1VBYA 2DNPA 1WJ9A 1XNQJ 3RUBL 3B82A 2D41A 3T1AA 1VISA 4FF2A 4U96A 2N4DA 4OI0A 3CNQP 1NDPA 4WWSA 3BPSP 3IO1A 4G3IA 4I2PA 3RB6A 4RPFA 3EXYA 2MKIA 4B3SF 3HX9A 3GCXP 1NPRA 1PBUA 3J80Y 1HA1A 4WP9A 2HRYA 2Z30B 4HI2A 3ZTSA 1RT1A 1P9YA 4HACA 2C2OB 4U7UK 2ZHBA 3PEHA 1S57A 2HFZA 4KYZA 5KFIA 4U6PA 3FRZA 2KHDA 1B64A 4QWCA 3IA0A 3RRHA 4NYZA 5I3QA 3QZ8A 3QAUA 3NG8A 1I51B 3BGLA 3VQTA 2RRNA 1TAUA 3DLEA 1WG4A 2E5HA 4JI5J 3D6FB 5DM7Q 5BR8J 2YNHA 3NGDA 5KFVA 4AL5A 3DFEA 3V81A 4DV0F 5LJ5Y 2XSJB 4F4YA 3BSCA 5HAOA 3KLHB 1NJYA 3FBBA 4DL6A 2MHNA 2DNLA 2LP4A 2HNZA 2EW9A 5GAEU 2I1RA 1Q7LB 3DU6A 2QMXA 2ZZNA 5DS7A 2KHCA 2FJWA 2YNGB 1M5VC 5KFSA 1HBMA 3BH6B 3BO3A 1WHYA 4NPOA 3HD2A 2R7RA 3H5UA 4X65F 1M1HA 2HIQA 2OLWA 5KG3A 4YFUA 1SQGA 4PQAA 5KFQA 1H3DA 4K4UA 2DO4A 2KYZA 2FZCB 1JKHA 5A8RA 2DRAA 5HQLA 4LBIA 3OXGA 3G82A 4IG3B 4P6QA 1NJWA 2VBXA 3QATA 4UQGA 3G8QA 2JLEA 2CQ3A 1WDDA 4N8NA 3EGNA 2D3UA 1MROA 1TUWA 2V6AA 3MMAA 4ZP7A 1S0MA 1KHVA 4OIXA 1U2FA 3FZBA 3MFIA 2Y1JA 2WOMB 2HVEA 1N32J 4IOCQ 2ZHOA 2IYIA 3PY8A 2UUAF 4DUYF 1SC6A 2AF6A 2BYCA 2CFXA 5B08A 4HKQA 1RBAA 4UUWA 4OYPA 4TQRA 4ZVSB 2MZTA 1F3VA 3I55S 4AQYJ 5G4DA 3NMAA 2YKAA 3QQCD 1HHTP 5LXYA 1KP6A 5KFRA 2W24A 2JEIA 2E44A 4TLRA 4WFAQ 4QWBA 4C98A 4LFCJ 2W25A 1RWMB 3R27A 3D4JA 4U7CA 2PD1A 3M8PB 5D0RA 5IWAF 2UV8G 3PW0A 3MCSA 5FD1A 1DQ8A 3X3UA 3H5YA 3WC0A 5IV4A 4DQIA 4AE5A 4F4AA 3K2YA 3TQEA 1H74A 4WP8A 2NSBA 3AOCA 4RR5A 3J7A1 3OT9A 3K5OA 1HNVA 2FC8A 2HWTA 2XSFA 1PYOB 3NNHA 3LP2B 1NK0A 1D9AA 4NXMJ 5F41A 3C19A 1VBXA 5HBMB 1JNZB 1IR0A 3PNIA 1U2RA 4WFYA 4CM0A 2J8SA 2E5LJ 3D1OA 1KVKA 3ICLA 4B3MF 1UJ6A 3IBCB 2G1HA 3ENAA 3HHNB 4QZVB 2YQ0A 2YPZA 1XBWA 4RNMA 3FBCA 4R5PA 2BJEA 4NZ0A 1VS3A 1NO8A 2C3OA 2AJ2A 5L1JA 3FJ2A 4O0NA 1VQYA 2QYCA 3B8HA 2CQCA 3S6EA 5CYMA 4NLQA 2XZDB 4NEZA 2OPPA 5KFFA 3IN5A 3I0SB 2KN4A 4RNFA 3DLGB 5KFDA 2HKEA 4C0HA 3MM5A 5A8WB 4QW9A 1IQTA 4RUBA 4KIAA 5CCMA 1KWMA 1T9XA 2CPZA 3UCZP 1LXJA 2OO4A 1VRUB 3TARA 3IRWP 1V3ZA 4DFMA 1H2TZ 2FZKB 2M88A 3NGRA 1CS4A 4IQMA 4N41A 2E5JA 2J7UA 4OJGA 1U6BA 4TU9A 2HK3A 2C22A 2VU5A 4ZVEA 5KT2A 4F36A 4YB7A 4I2PB 2YX1A 3UVJA 5EGYA 1QSYA 1MMNA 3O1LA 2V63A 1TK8A 2VF3A 1CSJA 3BBBA 4I7FA 2Q6BA 2MB0B 4IFVA 4ILMA 2HBRB 2FZGB 1RT1B 2AV5A 2JOQA 2CXEA 4OZ2A 4MYUA 4WXWA 2V0NA 2DNOA 3SYZA 1YDLA 2HHTA 1T8EA 5HQMA 2MSTA 1LEOA 1RHUB 1ZBTA 3P5TL 4KGMA 2CQHA 1OO0B 2RE1A 2B9WA 4FXDA 1X5OA 2MQ8A 2R7VA 2QFJA 3DLEB 5GAHI 4F3OA 3US5A 2HS0A 4ZJOA 1FXDA 4DR3F 1F9HA 2YNHB 5JUMA 1GK8A 1R43A 3V81B 5HVGA 2BJ7A 4DN9A 5CD4H 1I3OB 2RILA 4WXOA 1HIYA 2NXNA 2ABYA 4LFBF 1FRKA 1RT6A 3MUVP 4ZPAA 3TAQA 4WYLA 2ZJPQ 2L3MA 4ZCLA 4N5SA 2XWYA 1V6HA 4FNHA 3MAHA 3GILA 3HKZD 2R2RA 2ZM6J 1PBAA 1KVJA 2ASLA 3KJNB 1UFLA 3PIOQ 1FESA 2HHQA 2J9DE 1SJQA 3PXGa 4EZ6A 4QR0A 3UPFA 2KL8A 4TY9A 5CA5A 3EUNA 2KKHA 3R5GA 4M63A 4MK9A 1S1TA 3T5JA 1JKHB 1Q0NA 1NXIA 5KAKA 2LQJA 3K57A 2QEXS 4CTAB 4ANCA 2MMYA 2A2DA 3LP0A 5KTQA 1FWKA 3O8WA 4O44A 3BR8A 5E0OA 2O66A 3H20A 3NS7B 2G2ZA 1SL2A 1J27A 1X4GA 2DH9A 1MROB 5BXIA 3MMAB 3KDNA 1DJ0A 3PYDA 3SBMA 1I6JA 1SIWB 1NK8A 3D6HB 1M1KT 2Y3YA 3VAHA 4IFYA 3FEYB 2NREA 1EJ7L 2C2ZB 3UNYA 1IM6A 3A8JA 2OELA 1G1XA 5KT6A 2R8JA 2JEJA 1JXEA 1BQMA 1RAOA 3FDSA 2W2NP 3VAFA 2B43A 1S72S 2MHEA 2CNOB 3BYRA 4K4TA 5FLXY 1MMDA 1HW9A 4ILRA 4OZJA 2FVPA 4FKXA 2VG6A 2DIVA 3VWSA 3T19A 3DMJB 1FJEB 3WDOA 2DGUA 4PXBA 4DFKA 2OAUA 3Q23A 4EEYA 1S0OA 4NLVA 1HFEL 2ZJQQ 4J9PA 1GTEA 3GR0A 3HI9A 4IR1A 2HIYA 3H59A 3V6HA 3KG1A 4ID5B 4CLZA 2EVZA 3K8WA 4RW4A 4IOAQ 2HGMA 2E1AA 1XR6A 4HYKA 4WIIA 3W62A 1LXNA 1N0UA 2YBVA 1HNVB 3RYLA 3H5SA 3KWMA 5J1PA 1FWPA 4PXDA 1FRMA 3PHTA 3TVYA 1T95A 6FDRA 2VA3A 2J6TA 1Q5VA 3SIPB 1VJQA 3V2UC 9ATCB 2D1CA 2LA4A 3QPIA 3W63A 2R7UA 1HBNA 2OEMA 1NJZA 3JS9A 2CQDA 4M94A 3P96A 4OYOA 3QSYB 2QFIA 2CPFA 2XNQA 2XMVA 4Y2CA 5ETQA 2DR7A 3QT5A 2UXDF 5B0BA 2YQ1A 2J7KA 4RBUA 4OJ3A 3N5BA 4ANEA 1FFWB 5CYMB 5IXUA 1KD1T 1EKRA 2HQFA 1YRXA 2OPPB 1GMWD 2HFVA 4ATNA 1KLMB 3GYNA 3MM5B 3K89A 1IKYB 2QL5B 2DXFA 4DQSA 1GMWA 2XBPA 4H54A 2W9CB 3BREA 2VODA 2EXUA 1U1PA 2AD9A 5DQIA 4WTYA 4JV0A 4DQPA 3NS5A 1Y3KA 3ZNUA 1Y00A 3MAAA 1VGYA 1GXUA 1GQEA 4MKVA 1RTIA 4I4BA 2AYGA 1NK7A 1ZETA 2ZBPA 2VFTA 1MWZA 2R7OA 4NLDA 3UVJB 3CE8A 2YWGA 5KOWA 1U2CA 4B3TJ 4I7FB 4WKRA 4CZCA 3KJVB 1CJVA 2DKOB 2IM0A 2R4FA 4L72B 4IFVB 2CPHA 3OHBA 1OQ3A 4P7TA 2EFOA 2HFOA 2WZ1A 2GX8A 5C25A 5GMKa 1KQGB 1Q8LA 3SQOP 2GJFA 4Y34A 2IAJB 4LF7J 1YJUA 1HKAA 4J9UE 3M9NB 4CO3A 3L3CA 2HBQB 4OX9J 4U9RA 1W25A 2MKKA 5D4PA 1SQFA 4AUKA 4DZDA 1JLAA 4F04B 5AXNA 2CQBA 3ZZYA 1RLCL 4XDCA 2FJXA 2QIFA 2XY6A 3KK1B 3ELHA 5IT9U 5KFEA 1J5EF 4XTTA 3MHYA 1Q81T 3VVTA 3KJQB 3EXCX 1VOMA 4P9SA 4MAKA 1CVJA 3LOUA 4F25A 3EICA 2D3O1 2DCUB 3QIDA 4NLRA 2Q43A 1RT6B 1U09A 3L09A 2DNQA 2FQQB 2J6UA 2VJVA 4JI8J 5L1KA 2P6TA 2XY7A 3LANA 4C2MA 1EAYC 2FJEB 2RDJA 1WORA 1HWJA 3NAHA 5HROB 3DOMB 5D4NA 1BQNA 3CEDA 3G8SA 3HSJA 1MWQA 3M32A 3W2VA 2XYHB 1EQMA 1UVMA 4B9MA 2WTFA 3ZXWA 3W3SA 2FLOA 3PX4A 2QX0A 4L74A 1ZAWA 4QBUA 1NZ8A 3LP0B 2PFFB 2FVSA 1ZZFA 2DPIA 2R7XA 5DDQC 2DGSA 1D3WA 4NLXA 3CCES 1APSA 1RT5B 4NCGA 1UTAA 4F4ZA 4YDXA 2BVZA 2OPQA 4J9NA 1W2BR 2RKIB 2DISA 3KG4A 2E1MC 4J9KA 1SVDA 4KB7A 4IFYB 1XJWB 4CDIA 3CDUA 3QJJA 1YQHA 4P2SA 1YI2S 5C7PA 1EX8A 3OTBA 4WK3A 2CAJA 4K0KJ 2KVQE 4GKKF 3Q8UA 2X1FA 4LIWA 3VZIA 2XS5A 2GO8A 4U8YA 1QAIA 5IT0A 3CD5A 1EP4B 5DQGA 3JQKA 2UVUA 2HFNA 2AYMA 1UW4A 2VG6B 1JLGA 2VFSA 3PJXA 4ECQA 3CDWA 2V8PA 3CDEA 1WSRA 1KEKA 3VCDA 1M5KC 3TEGA 1EZZB 3RAQA 2K1RA 2V68A 1IKWA 4G1IA 2ZHAA 1QUVA 2XQCA 3VAJA 1MU2A 3GFZA 1KQFB 3PJ9A 2CQ0A 2IDLA 4DSLA 1Z2LA 4CLKA 1WELA 3NGSA 5B0EA 3SDEA 2YKMA 2C2RA 3LWLA 3Q8RB 2FB0A 3HHKA 1MW7A 3QAEA 1C4CA 1CJUA 3MTJA 3OSPA 1UJ4A 4Y3CA 4KE5A 1BLUA 3FUYA 4LBHA 3A3OB 3MXHP 5KG0A 1MG7A 2P2CB 2IVFB 3ETOA 1HBNB 3L7UA 5B0GA 4KFBB 4DOZA 3HDSA 2NPFA 7FDRA 3MEGB 1ROFA 2XY5A 2E66A 2BM0A 3HMJG 2XGPA 3BH7B 1ICEB 3NOCA 4ELVA 4CYUB 5KFHA 2MZ1A 1LQ9A 2WHOA 1T3NA 3U27A 4MTPA 2HS3A 5KFCA 3OR1B 4TKTA 5J1EB 1J5OA 3GIMA 5KFXA 3MEEA 1BXNA 4A8SA 4F0KA 2ZDOA 5L46A 2J9EA 1NJIT 3G71S 2AJFE 2DNKA 2KVIA 3G86A 4OLPA 3GMGA 1SC1B 1BC6A 1BY9A 1JXVA 3FVYA 1FX4A 4USWA 3DLBA 2ZH7A 2QLJB 5J2QA 1BWEA 1OIAA 1S6QB 3GTYX 2CWXA 2HHXA 3CCRS 3TA0A 2AGQA 2YH1A 3R7BB 1RTHA 3M2UA 2UXBJ 3HT3A 3B4DA 5HSPA 3MR7A 1YLXA 1L3UA 5D0HA 3W61A 3TOQA 4ZIVA 2H4YB 2M7SA 3W65A 3SFGA 2Y1LB 4PWUA 1DTQB 4DR2J 1CJVB 4C11B 3A8EA 4OJ1A 4JI6F 2F8EX 3OFEA 1E6YA 3QLHA
chains in the Genus database with same CATH topology
2MQ8A 2MEWA 4JI6J 4DR1J 4DV7J 4DV6J 4LFAJ 1XNQJ 4JV5J 1HR0J 4OX9J 2HHHJ 4DV0J 1IBKJ 1N36J 3JAMU 4DR4J 4LFBJ 1N32J 2UUBJ 3D3BJ 4X62J 3OTOJ 4LF9J 4JI4J 1HNZJ 4PWWA 1HNXJ 4DR7J 5IT9U 4DUZJ 1N34J 4NXMJ 3T1YJ 4V1Ak 4YY3J 4LF8J 2UUAJ 4YHHJ 4DR6J 4DUYJ 1J5EJ 4B3SJ 4JI0J 1HNWJ 1XMQJ 2E5LJ 4KY3A 2VQFJ 4AQYJ 5LM7E 2UXCJ 4X65J 1I94J 1IBMJ 4LF5J 4DV3J 4B3RJ 4JYAJ 3J7AN 3J81U 2F4VJ 2ZM6J 4NXNJ 4B3MJ 4DV4J 1XMOJ 5LMUJ 4GKJJ 4JI1J 5LMNJ 2UU9J 4JI8J 4DV1J 4JI2J 4KYZA 3R2DJ 3R2CJ 3IMQJ 2KL8A 4K0KJ 4NEYA 3J80U 2KVQE 4LFCJ 4B3TJ 4HHUA 4RJVA 2UXBJ 2VQEJ 1FJGJ 5AJ3J 4GKKJ 4LF6J 3T1HJ 4JI3J 1N33J 2UUCJ 4JI5J 4KHPJ 4NEZA 5IWAJ 3W1YC 5FLXU 1XNRJ 4X64J 5BR8J 4DR2J 4X66J 4DR5J 4DV2J 4LF4J 4DR3J 4DV5J 2MTLA 4JI7J 3D3CJ 4LF7J 2UXDJ 1IBLJ 5A2QU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MQ8 A;  2MEW A;  4JI6 J;  4DR1 J;  4DV7 J;  4DV6 J;  4LFA J;  1XNQ J;  4JV5 J;  1HR0 J;  4OX9 J;  2HHH J;  4DV0 J;  1IBK J;  1N36 J;  3JAM U;  4DR4 J;  4LFB J;  1N32 J;  2UUB J;  3D3B J;  4X62 J;  3OTO J;  4LF9 J;  4JI4 J;  1HNZ J;  4PWW A;  1HNX J;  4DR7 J;  5IT9 U;  4DUZ J;  1N34 J;  4NXM J;  3T1Y J;  4V1A k;  4YY3 J;  4LF8 J;  2UUA J;  4YHH J;  4DR6 J;  4DUY J;  1J5E J;  4B3S J;  4JI0 J;  1HNW J;  1XMQ J;  2E5L J;  4KY3 A;  2VQF J;  4AQY J;  5LM7 E;  2UXC J;  4X65 J;  1I94 J;  1IBM J;  4LF5 J;  4DV3 J;  4B3R J;  4JYA J;  3J7A N;  3J81 U;  2F4V J;  2ZM6 J;  4NXN J;  4B3M J;  4DV4 J;  1XMO J;  5LMU J;  4GKJ J;  4JI1 J;  5LMN J;  2UU9 J;  4JI8 J;  4DV1 J;  4JI2 J;  4KYZ A;  3R2D J;  3R2C J;  3IMQ J;  2KL8 A;  4K0K J;  4NEY A;  3J80 U;  2KVQ E;  4LFC J;  4B3T J;  4HHU A;  4RJV A;  2UXB J;  2VQE J;  1FJG J;  5AJ3 J;  4GKK J;  4LF6 J;  3T1H J;  4JI3 J;  1N33 J;  2UUC J;  4JI5 J;  4KHP J;  4NEZ A;  5IWA J;  3W1Y C;  5FLX U;  1XNR J;  4X64 J;  5BR8 J;  4DR2 J;  4X66 J;  4DR5 J;  4DV2 J;  4LF4 J;  4DR3 J;  4DV5 J;  2MTL A;  4JI7 J;  3D3C J;  4LF7 J;  2UXD J;  1IBL J;  5A2Q U; 
#chains in the Genus database with same CATH topology
 2RRB A;  1UWB A;  4ZVT B;  3PRB A;  3KHR A;  2DNH A;  5HMZ A;  2OD6 A;  2D3Z A;  1P27 B;  5FJ4 A;  5KG1 A;  3HF5 A;  4DX8 H;  3QSI A;  3Q2S C;  4ZVH A;  2MY8 A;  1N5V A;  2FPH X;  1SJ1 A;  1JLA B;  2WSE C;  2F8M A;  3W5X A;  3JYT A;  5HMW A;  2AMC B;  2OFH X;  1FRX A;  4A8K A;  3AHP A;  2L48 A;  1IBM F;  4ICL A;  1HNZ F;  1R8C A;  1LFW A;  4IRD A;  2JVR A;  3T9N A;  1TKT A;  3AFG A;  1F9E B;  2F4V J;  2DGX A;  5THW A;  2F8H A;  5BYR A;  3M6U A;  2JFK A;  1FVQ A;  3IS9 A;  5I3U B;  1ZA2 B;  3M8Z A;  4CNY A;  3JQM A;  1U25 A;  2IC3 B;  2NYH A;  4RW6 A;  4PAB A;  4MT1 A;  4Q45 A;  5B0A A;  3GLJ A;  2CPX A;  3CCZ A;  3QO9 B;  5GAH U;  4F2R A;  3IR7 B;  3U1N A;  2E29 A;  5D4O A;  3BKF A;  1JJ2 R;  4D3H A;  2DRB A;  1LW2 B;  1U0H A;  4ED5 A;  3M32 B;  3W2V B;  1K0T A;  2XUL A;  2BAC A;  3K5P A;  3RB0 A;  3D0G E;  5KFJ A;  2OJ3 A;  2KB2 A;  5ETK A;  3CPW R;  2FHJ D;  2XB2 D;  2HRT A;  3KLG B;  4DV7 F;  2K3I A;  4FYV B;  5I42 A;  1R6V A;  1YJ7 A;  2F5G A;  1RCO B;  1SPB P;  1VQ9 S;  4X2B A;  3W8P A;  1URN A;  4NLG A;  3QT8 A;  3N6N A;  3HFV A;  4NCG B;  4ZPB A;  4KH1 B;  3CCT A;  5AE2 A;  2ADB A;  2OPQ B;  1X8D A;  1LFP A;  4YP3 A;  4GKJ F;  3DLL Q;  4A4J A;  3NGK A;  3IWX A;  4JI2 J;  2DHG A;  2VOP A;  4OZ5 A;  5KFW A;  4WU3 A;  3HPO A;  2WVF A;  2VB6 A;  3MCO A;  3B54 A;  3IC1 A;  1FKP A;  4ER8 A;  1T05 A;  2YKO A;  2XMA A;  1SQE A;  2H3E B;  4OYW A;  5IQ6 A;  1PSD A;  2UUC J;  2CJY B;  4IR9 A;  4HI1 A;  1HPZ B;  4QCL A;  1XQI A;  1T9Y A;  2PDA A;  1URR A;  4G6V B;  1PKU A;  3G6Y A;  5E3C A;  3PG9 A;  2QA4 G;  4UY8 T;  1C0T A;  1Y4Z B;  3WQP A;  2MKS A;  1N36 F;  4DV6 J;  1M0S A;  2COL A;  4LRF A;  3OLB A;  1N5Q A;  4CI0 B;  1RAJ A;  2HND A;  4QWD A;  1KS2 A;  4DSI A;  4M5M A;  1AW0 A;  3BZQ A;  2BZ2 A;  1Q53 A;  4TYB A;  2LXF A;  2K1R B;  3V6J A;  2VBY A;  3A8I A;  1MU2 B;  1IJE B;  1B7Y B;  2MZR A;  3PDN A;  3H40 A;  3EGW B;  2E5G A;  1T7P A;  3GJS B;  1OSC A;  2VG5 A;  4KC5 A;  4NLS A;  3PVX A;  3SDE B;  2YKM B;  1EET B;  2D9O A;  3MWB A;  1V9O A;  3CIZ A;  2F7V A;  2AKW B;  2E7X A;  1RI7 A;  4HT5 A;  5KFK A;  2MDA A;  1HI0 P;  2BRK A;  4PXE A;  4UOG A;  3PM9 A;  5KFZ A;  1KON A;  2V67 A;  1YG0 A;  4CT8 A;  2MGZ A;  1RT2 A;  2BQU A;  2C3Y A;  3AB2 B;  2IA6 A;  4LSN B;  5AXL A;  3PX6 A;  3KUE A;  4G1Q A;  4FS1 A;  4J9R A;  4HH1 A;  1R6Y A;  1BE4 A;  1NDL A;  3ILL A;  2V34 A;  1TL1 A;  2B9X A;  2G1D A;  4Q43 A;  1AUD A;  3R1H A;  2CPJ A;  4ZVR B;  4ZLN A;  1SKU B;  2V5H G;  4DR4 J;  2VIH A;  3OQ2 A;  1DQ9 A;  3EWG A;  3DLK B;  4ZPV R;  5KFL A;  3PYG A;  1TKX B;  1RAI B;  2VUG A;  1DTT A;  2OI2 A;  4LF8 J;  1ZAV A;  3ISN D;  5CXT A;  4B3O B;  4HTJ A;  2AJQ A;  3DCA A;  5LM7 E;  3MEE B;  4DFJ A;  1IWG A;  3F73 A;  4RW7 A;  3MAQ A;  4UZC A;  5HN0 A;  1TVR A;  1NHK L;  4NYO A;  2KFY A;  3DOL A;  4Q8F A;  3PR4 A;  1NPK A;  4NCB A;  2G9O A;  2WVE A;  3KMS A;  3QIP A;  2QA1 A;  5J2Q B;  2CWK A;  3K0J A;  3HD1 A;  5KOX A;  3QWP A;  1TFY A;  3IWN C;  1GMU A;  2CVE A;  1NK6 A;  3MM8 B;  1RTH B;  3SQG A;  2HQG A;  4URQ U;  1S4F A;  2P9G A;  2DNG A;  2HLU A;  1HR0 F;  2ZWP A;  2PC6 A;  4MK8 A;  3RU0 A;  1KFD A;  4U95 A;  1SJ4 P;  3THV A;  2GVD A;  4NLT A;  5F8M A;  2PA3 A;  1IKX B;  1C4A A;  1UWB B;  1FRJ A;  3O44 A;  2V9K A;  3WX4 A;  2O5D A;  1N32 F;  4EI2 A;  4KKO A;  2HQC A;  2Z2L A;  2X7I A;  2HEK A;  1KN6 A;  2ZD1 A;  4HHJ A;  1TAQ A;  1WC1 A;  3JYT B;  2DEI A;  2G2Y A;  4M1K A;  1WUU A;  3VGS A;  5A6W A;  4ICL B;  3FZ2 A;  3C66 A;  2PN6 A;  5K5M A;  1TKT B;  1WOO A;  4X84 A;  3P49 B;  4LF6 F;  1S0N A;  4HDG A;  1G2E A;  3F41 A;  3ET6 A;  3HUL A;  2GMJ A;  3IS9 B;  2CJK A;  3EZ5 A;  4A8Y A;  4J9Q A;  4YME A;  3R9L A;  2DHH A;  1IBL F;  5ETV A;  2V2Z A;  3M9M B;  4FYX B;  1N48 A;  3D6M B;  3FK4 A;  1NSQ A;  2IJR A;  3I0R A;  5JMN A;  6AT1 B;  2LMI A;  3TWZ A;  5SUH A;  2PEB A;  2ZH5 A;  3CWJ A;  2AJ1 A;  3KXD A;  2ZJR Q;  2BE7 D;  2AX0 A;  2Y0B B;  3UDL A;  3MEC A;  2BJ1 A;  3W64 A;  3HFZ B;  4LR9 A;  1WHX A;  4G65 A;  3HM9 A;  4DL2 A;  4RNO A;  1QUP A;  3IBW A;  5ETR A;  4DUT A;  5I42 B;  2MKY A;  2NSC A;  5C24 A;  4LF5 J;  3CCL S;  2F3J A;  1XER A;  3JTO A;  3FC9 A;  1BUX A;  2FYX A;  1RBL A;  3DI6 A;  3OL6 A;  4AFF A;  2KTQ A;  2P9E A;  4E2F B;  4JOU A;  4RJV A;  4OI3 A;  3T1H F;  2I5J A;  3DDK A;  4ZIW A;  3HXM A;  3HVR A;  2V8G A;  3TVZ A;  4FYY B;  1KC8 T;  1DZ5 A;  1FKP B;  1T05 B;  4WJB A;  4TQS A;  3MCN A;  2RIJ A;  2M0G B;  4IOB A;  4JI7 J;  3S8S A;  1N0V C;  2V9W A;  4C4W A;  8AT1 B;  3WIU A;  1RWK B;  5GAE I;  4HH0 A;  4I56 A;  3GR1 A;  2CNL B;  4F4K A;  1Q8K A;  5DLG A;  4P2M A;  3OTO F;  2FLL A;  2CJB A;  4PZV A;  1TL5 A;  4ED4 A;  1C0T B;  2PO4 A;  4C3L A;  4F0M A;  4PG8 A;  3OR2 B;  1WSV A;  2HND B;  1S0V A;  4CNZ A;  3RBX A;  4DI6 A;  2WAQ D;  2QMW A;  4AXJ A;  5LSR A;  1IN0 A;  1YBA A;  2YX4 A;  1HNW J;  1RT4 A;  3T6J A;  2YXL A;  3KK3 B;  3GII A;  2LA6 A;  3C2P A;  4RZR A;  3CD0 A;  3X1L B;  2DGQ A;  5HVF A;  2EC2 A;  1O5J A;  2LEC A;  3LAL A;  4URS A;  3NXZ A;  4BS2 A;  2JJ4 D;  3UN3 A;  3DRR A;  4ZP6 A;  3QBC A;  1A0O B;  2ZVI A;  4EYI B;  2B56 A;  1S7I A;  1U1R A;  2GAG C;  1HNI B;  3I6P A;  1RBO B;  4TY8 B;  1RWX B;  3GIJ A;  2MGZ B;  3M6V A;  4CO0 A;  3KDO A;  4P10 A;  2DJW A;  4Y2I A;  4G1Q B;  2B5J B;  3MR3 A;  3A3N B;  3GSD A;  3JAM U;  3OFF A;  2X3D A;  3NAI A;  1D9D A;  4WYW A;  4CWB A;  4YN3 B;  1TL1 B;  1HMV B;  2RU9 A;  4W92 B;  1U1M A;  2RAQ A;  5F9N A;  2U1A A;  4J5O A;  4UOC A;  3NGT A;  3MZI A;  2UXC F;  5B0D A;  2HVH A;  5KG4 A;  4K2X A;  4E0D A;  2H5E A;  2XS2 A;  2KM8 C;  1FXL A;  1S79 A;  3M2V A;  4O3N A;  1DTT B;  5LMN F;  1M1G A;  3M30 A;  3HCX A;  4FDF A;  4KR0 B;  2H1Y A;  1QAJ A;  2R9L A;  1X4D A;  3R2D J;  2JFD A;  3K7R A;  1QSL A;  2E9Z A;  2DTJ A;  2ZOF A;  3MM7 B;  4RW7 B;  2RUS A;  1Q95 G;  1TVR B;  1KOO A;  1TR0 A;  2E1P A;  5IZH A;  4LQ3 A;  5DZ6 A;  5B0C A;  1KOH A;  2XWX A;  3DRP A;  5FII A;  4GO5 X;  4ECS A;  2KG0 A;  2HUR A;  2WVB A;  1Q8B A;  5KG7 A;  3ZFV A;  1R31 A;  1KQS R;  2PI5 A;  1UEV A;  3MMJ A;  3SCJ E;  3LGN A;  1LOU A;  5IM0 A;  1ZH5 A;  2KXF A;  2AEM A;  1WG1 A;  2DR5 A;  3IRX A;  3E3X A;  2GVD B;  2L41 A;  4CH0 S;  1P1L A;  2HGL A;  3P6Y C;  5EX0 A;  2CG4 A;  2R2S A;  5ETT A;  4JI0 J;  1K73 T;  1WI8 A;  4KKO B;  1X0P A;  2BM1 A;  1FRL A;  1VK3 A;  2Z8Q A;  5E2Q A;  2F9J A;  1VHF A;  3MPY A;  2H65 B;  2ZD1 B;  3T9Z A;  2VG7 A;  3UCG A;  1K44 A;  3ZZ0 A;  2VQE F;  4MH8 A;  1VQ7 S;  1SV5 A;  3PW2 A;  3MEK A;  5HAT A;  5RUB A;  4JV2 A;  1Y7P A;  4BLG A;  1FXR A;  2OGU A;  5IQQ A;  4AL7 A;  4JI3 J;  3AQO A;  2EI5 A;  4DQQ A;  1SL0 A;  4TU7 A;  4FXV A;  2KT5 A;  3R5A A;  5HMX A;  2BDP A;  4N77 A;  1QTM A;  2LEB A;  2MSS A;  5B0F A;  4A8W A;  1T3O A;  3SV4 A;  4LFA J;  1GX6 A;  2FLP A;  2R7W A;  3PO5 A;  3SSR A;  1ZOT A;  1RTD A;  4AL6 A;  1DY3 A;  5LJ3 Y;  3T41 A;  3I0R B;  3N0V A;  1IJF B;  2AJ0 A;  2O67 A;  2M52 A;  1U8W A;  3HHD A;  5I4M A;  2M4M A;  1VIX A;  1OY9 A;  4NL5 A;  3QGI A;  4M5D A;  1OYD A;  3LPY A;  3MEC B;  3VGT A;  4B3S J;  5K8O A;  2POK A;  3QFH A;  1XMO F;  2BJ3 A;  4ED6 A;  3GPA A;  4Z7C A;  2N82 B;  4P2X A;  4A8F A;  3EM1 A;  2ZNZ A;  1UEU A;  3VZH A;  2IRY A;  1RWW B;  3T5L A;  3UWT A;  4WZQ A;  1SIZ A;  3W5Y A;  1FWL A;  3OW2 R;  1FDA A;  5K8P A;  1M5H A;  5MAO A;  5DDR C;  2PT0 A;  3DRS A;  2ZE2 B;  2WK4 A;  2CPI A;  2B4V A;  5CQG A;  4DR5 F;  2CZ9 A;  3DGV A;  3DI6 B;  1S1U A;  2J8A A;  5KFT A;  3VVU A;  4ZPW R;  1QAY A;  3ILI A;  5HO4 A;  1X7V A;  2Z57 B;  3R5C A;  4ZKA A;  3PFE A;  4MK7 A;  5HLF A;  2JX2 A;  2MEW A;  4K4Y A;  2ZWO A;  4DV0 J;  4BC7 A;  2ZDP A;  3BN7 A;  2J0Q D;  3QT7 A;  4XIU A;  4ELU A;  3ULH A;  4C8O A;  2QLB B;  1RAG B;  4PUO A;  4BWJ A;  2R2T A;  1RE1 B;  2DK2 A;  2W1B A;  1X5S A;  1FNO A;  2J76 E;  1RKJ A;  5F8I A;  4NZ7 A;  4P75 A;  3E01 A;  3CJK A;  2ATL A;  4DCO B;  4X65 J;  1HBO A;  1HQE A;  4OV6 A;  4BBY A;  2ZKT A;  2V94 A;  4ZCK A;  1RT4 B;  4DPT A;  4IH5 A;  4NMX A;  3DRX A;  2CQ1 A;  2A6M A;  4X4U A;  2DH7 A;  1XNR F;  1RJJ A;  4ED3 A;  2PFD A;  3CJQ A;  1U48 A;  2HHS A;  4HEA 9;  2AEJ A;  3JSM A;  3K8V A;  4IYQ A;  1R8B A;  3DRR B;  4I69 A;  4CH7 A;  1SL1 A;  1NDK A;  1AT1 B;  1NAQ A;  5ETL A;  4ES1 A;  3H4B A;  2RF2 B;  3D28 A;  1F1B B;  2M3D A;  3VGU A;  1U4B A;  2ACM A;  3UD3 P;  3TJA A;  1D8Z A;  2DR8 A;  4PXC A;  1F6T A;  1K0V A;  1CEZ A;  4OX9 F;  1S1W A;  3HVT A;  1VQM S;  3MMB B;  4O0I A;  1FTR A;  1I5O B;  3ZTQ A;  4IG3 A;  2UUA J;  4DDF A;  3Q8P B;  4DUY J;  3JTN A;  1Q82 T;  2IPO B;  4ELT A;  3PV8 A;  1QJH A;  2ROP A;  3EDR B;  1NU4 A;  3MMC A;  4USK A;  2EG2 A;  4ZS6 A;  5D0E A;  4N56 A;  5F8J A;  4GC7 A;  2EFQ A;  5KFY A;  1HWU A;  3D7S B;  1ZA1 B;  3K59 A;  2WOM A;  1N52 B;  2K3K A;  3PYF A;  4JI8 F;  5CZX A;  2GIF A;  3D0H E;  2DIT A;  3TJ9 A;  4DV5 F;  1XTZ A;  5IWA J;  3ETM A;  4DV2 J;  4LF4 J;  5IT9 Y;  1WC4 A;  4DR1 F;  1VI7 A;  4XDD A;  2CDQ A;  1S48 A;  2AHO B;  3TZZ A;  1WEY A;  3PRD A;  2V69 A;  5ITH A;  2EFV A;  3D6T B;  1FD2 A;  4RWX A;  2RB7 A;  5D0G A;  3DRY A;  4ZCM A;  2FY1 A;  3BS9 A;  5E3Q A;  4PG5 A;  3KLV A;  3LAM A;  3V4M A;  3OVB A;  4A47 A;  4DU7 A;  3FRY A;  3M8R A;  2C3M A;  2FDN A;  2LU1 A;  3EZU A;  5A2Q Y;  1GTH A;  4DV3 F;  1FK9 B;  4OYB A;  4U8V A;  2HFS A;  5IM0 B;  4YQW A;  1T03 A;  1HW8 A;  4NE9 C;  1BHN A;  2C2N A;  2I38 A;  2DCL A;  2ZBR A;  3FQK A;  2EFG A;  2QT7 A;  4OHZ A;  2W2Q P;  5K8M A;  4B3M J;  5IFM A;  2OPR A;  3AY0 A;  5JVH Q;  4ID8 A;  3IR5 B;  2BE2 A;  5KFN A;  5H9F J;  1XR7 A;  1NK4 A;  1KVI A;  1U8S A;  1NB7 A;  3L7O A;  3KMQ A;  4ZVQ B;  2ILY A;  1RLD A;  2VG7 B;  2PII A;  2XC9 A;  1SH0 A;  4MIB A;  3D5M A;  1YJN S;  2IBO A;  3TA1 A;  2PI4 A;  3ZC4 A;  1U45 A;  4QW8 A;  2P6S A;  4C97 A;  2B7C B;  2MKH A;  1Y5I B;  4X62 F;  1IR2 A;  3U1L A;  4DR7 F;  2Z0G A;  2X1G A;  1JMT A;  1ZM3 A;  3KTQ A;  1SUQ B;  2OKQ A;  2ROE A;  2QL9 B;  1AA1 B;  1V5V A;  1WKJ A;  2QYG A;  1WAC A;  2H9Z A;  3ZTP A;  1JQG A;  2G2O A;  1E6V B;  1QM9 A;  2HQ3 A;  1OPZ A;  2JHE A;  1CG2 A;  3QGH A;  3FKB A;  4NXN F;  3TZY A;  1IUJ A;  1LNQ A;  2GQC A;  5CYQ A;  3OUY B;  4I6W A;  3M8W A;  5AE3 A;  4YR0 A;  2HZC A;  2W4C A;  3BGF A;  4OJH A;  1UL3 A;  1REV A;  2W2P P;  3FMB A;  1FDD A;  2BEF A;  4QWE A;  3VHQ A;  1VRU A;  3V5R A;  4MIW A;  3PW7 A;  3OTC A;  3HHL A;  1VBK A;  1H38 A;  3J7Z T;  2IRU A;  1OSD A;  3G4S S;  1GXT A;  1D9F A;  2EFP A;  3OL7 A;  1FVS A;  3DRS B;  3FFI A;  3Q83 A;  5AXM A;  2W4D A;  1UCN A;  4JV5 F;  4DXL A;  5G0R B;  1S1U B;  5D78 A;  3M7V A;  3I4H X;  4NA1 A;  1B70 B;  2LXU A;  4LF9 F;  4PG7 A;  1X5T A;  3VTI A;  4IO1 A;  5HLF B;  8ATC B;  2J0W A;  3UFC X;  4A8Q A;  2E7V A;  1NSP A;  1HI1 A;  2ZVS A;  4QR2 A;  5C42 A;  1KTQ A;  4F3M A;  3AD8 C;  1RAA B;  1FT8 A;  3LPE A;  5KT3 A;  2GVZ A;  1I94 F;  2VPX B;  4X4R A;  4PUO B;  2OMO A;  3KLE A;  1N8R T;  4L3K A;  4DS4 A;  1PAE X;  5KG6 A;  2GV1 A;  4C0B A;  4DV1 F;  4K5S A;  3GU0 A;  3VF0 B;  1UFW A;  4ILL A;  2IY5 B;  3E01 B;  2ALY B;  4TLQ A;  3CJK B;  4PWD A;  4KH0 B;  2RDI A;  1HBO B;  3TVK A;  1HQE B;  1XK8 A;  4EK2 A;  4HVZ A;  1FJG J;  4RUA A;  2OML A;  5SZT A;  2AP6 A;  4M5J A;  2NYI A;  2N7C A;  1ITP A;  2UXB F;  1Y11 A;  3HHE A;  2VL1 A;  1WOP A;  1AFJ A;  3NRB A;  3NOG A;  2EC0 A;  2UUW A;  3LGH A;  4EUV A;  2X3G A;  3JSM B;  4FS2 A;  4L3N A;  1VK8 A;  1WF1 A;  2V2Q A;  4F7V A;  2KO1 A;  4PWW A;  3ZZP A;  4DR6 F;  2B9Y A;  4RNN A;  2XCP A;  3BSN A;  2VBW A;  1ZPV A;  4CTA A;  3OVA A;  5EWF A;  3ZTR A;  7AT1 B;  1S1W B;  3HVT B;  3R7N B;  1ACM B;  4RW8 B;  3CCV S;  3DGP B;  5A8K A;  3LGM A;  2VFR A;  2H4W B;  3DN9 A;  2QLF B;  4DCJ B;  4QIG A;  3AJ1 A;  4GC6 A;  3ZZT A;  2EBE A;  1C1C A;  3G6X A;  4OYI A;  4I0W A;  5ETN A;  4F0H A;  3OLA A;  3MMC B;  2XI3 A;  3TO8 A;  4H4M A;  3ZZU A;  2AYE A;  1U1Q A;  2IFX A;  3C6U A;  2BW7 A;  3CJ0 A;  3M2R B;  3TNV A;  2DRD A;  1U1N A;  1OWX A;  1RXO B;  2AEF A;  2D3O R;  2Y1R I;  2OHD A;  3FEZ A;  3H2V E;  1DLO A;  5HMY A;  4Q7A A;  4EBC A;  3SFU A;  4YB6 A;  2CPE A;  1BQX A;  2H5I B;  2F1F A;  4FF4 A;  1SKW A;  3DMJ A;  4M8L A;  4MKA A;  1XN9 A;  5I3P A;  3EPG A;  1YJR A;  1AZS A;  5LOQ A;  4Y2K A;  1DUR A;  2KRR A;  1Q79 A;  3ZO7 A;  1ARO P;  2GJ2 A;  2DPJ A;  1MML A;  2CA9 A;  1T03 B;  2QC3 A;  3WHI A;  4ID5 A;  4CH1 A;  2R42 A;  4OYM A;  1C0U A;  2ALZ A;  2OPR B;  4K59 A;  4PPD A;  1RT7 A;  3AOA A;  3I4P A;  2BE2 B;  2BW2 A;  2LCW A;  5JXS A;  3OJU A;  5KFG A;  1PG5 B;  1PIL A;  2UXD J;  1VHI A;  4RUH A;  1ZM4 A;  4RWW A;  2UUC F;  2IVY A;  2WB1 D;  3RGI A;  3Q8Y A;  3PEJ A;  4K4W A;  3D66 A;  4UOF A;  2A2C A;  1NSK L;  1R7I A;  1Y9O A;  3HVA A;  1KLN A;  1UJ5 A;  2D7S A;  5LT5 A;  2XHW A;  2VON A;  2VKZ G;  1XMQ F;  2K8G A;  1B0T A;  5J2P A;  2Y8Y A;  4E98 A;  4NOH A;  3IBF B;  3PZP A;  4FNI A;  4QU6 A;  2V4R A;  1UFK A;  1H2U X;  2IHR 1;  4DV4 F;  1YX2 A;  1S6O A;  1U26 A;  4RUC A;  2ZFH A;  2G0I A;  3KJF B;  2HSE B;  3QYY A;  2BBE A;  1QDU B;  2B4O A;  1O0P A;  5CYQ B;  4Q44 A;  2MQM A;  1KLM A;  1BGX T;  4MJK A;  3GJR B;  1TK0 A;  1REV B;  2XMM A;  2WBM A;  3BBF A;  1RWP B;  2N7Y A;  1IKY A;  5F8G A;  3TEH B;  5DRK A;  2W9C A;  1S49 A;  1XEZ A;  4J37 A;  3A13 A;  4KGK A;  1G3O A;  3HHL B;  1VIO A;  2MTL A;  4ED8 A;  4IG0 A;  1H98 A;  4LRD A;  3MR2 A;  1F5C A;  1YWX A;  3CJ4 A;  3TZX A;  1X60 A;  3NNC A;  4ZCI A;  2R8K A;  5KT7 A;  4CM2 A;  2QN6 B;  2UUB F;  1O8B A;  3IFE A;  3SV3 A;  3FFI B;  3R5J B;  2ZBQ A;  2I6W A;  2EEY A;  5C2C A;  3DC2 A;  2VFV A;  4I1T A;  2DYA A;  2VIC A;  2MJN A;  3P8B B;  3KJV A;  3GV5 B;  4FPI A;  1CJT A;  2HBY B;  4B9S A;  2YX7 A;  5L1L A;  1J5E J;  4LT6 A;  4WBF A;  3FGV A;  3GWC A;  1HYS A;  5C42 B;  3RZA A;  3R1L A;  4QQB A;  4KPC A;  1M5P C;  2IAJ A;  2GVZ B;  2UVW A;  2D69 A;  3OTD A;  2KXN B;  3KLE B;  3VR1 A;  4C8Z A;  4EMD A;  4OHW A;  2J7W A;  3LF0 A;  4AXI A;  2KH9 A;  1K1S A;  2FHK A;  3MPW A;  3H2U B;  3SCI E;  3KK1 A;  1JLF A;  4PWD B;  3HP6 A;  4CO2 A;  4K4S A;  3R5D A;  2MLY A;  2FVC A;  1JJ4 A;  1XC9 A;  1R3N A;  4N7T A;  3HK2 A;  3IXQ A;  1TV6 B;  4DCP B;  1X9M A;  4NLP A;  3TW0 A;  2GHV C;  4I67 A;  2QLX A;  2ASD A;  2LKZ A;  4K5R A;  4P7V A;  4L75 A;  3ONQ A;  4URG A;  3AOD A;  2CQ4 A;  3CUN A;  3ZZO A;  2CNN B;  3DDI A;  2KI2 A;  2IA0 A;  4O3R A;  1Q16 B;  3UDV A;  3HO1 A;  4H4K C;  1T02 A;  3AT1 B;  2M9K A;  2V8H A;  5HRO A;  1KTV A;  3DOM A;  1YIT S;  3MUR P;  1N5S A;  4QYZ J;  2IM1 A;  4EO8 A;  2IM2 A;  4W98 A;  1MN9 A;  5LMU J;  3KOA A;  1L3S A;  1SC4 B;  3TUJ C;  1FDB A;  3KHH A;  3LQV A;  5A8K B;  3AXK A;  1ZS6 A;  1TL3 A;  2A1B A;  2Q6C A;  3DDN A;  1R0B G;  1RHR B;  3QMQ A;  5KFP A;  1RT5 A;  1S9E B;  4GKK J;  4XPC A;  1C1C B;  3JXO A;  4RU9 A;  5CYJ A;  1FHT A;  4DEZ A;  2RKI A;  1RYR A;  2LQ9 A;  4OYX A;  4H4M B;  1UVN A;  1NCL A;  3QGG A;  5KG2 A;  2YWW A;  1S76 D;  5D6G A;  3C6U B;  1NHV A;  2HS4 A;  5D77 A;  2HNY A;  5J1N A;  1N88 A;  2HHH J;  4B08 A;  2AX1 A;  4KPY A;  3J7Y U;  1VBZ A;  3RW6 A;  2IRX A;  1VDH A;  2C2D A;  1IBC B;  2ZOM A;  3L4B C;  1DBD A;  5L9X A;  3CCS S;  2NZC A;  1DLO B;  3CB4 A;  5E33 A;  1EP4 A;  3D68 A;  3CCQ S;  3GJT B;  4OHX A;  3G96 A;  3I56 S;  5CH7 B;  3M1V A;  4FYW B;  1AUS L;  1JB0 C;  2RHQ B;  5T14 A;  2RS8 A;  1AZS B;  2JEG A;  5DG8 A;  4RLE A;  2HHU A;  2BAB A;  1RAB B;  4GVL A;  3KUG A;  3AD7 C;  1R8P A;  5IOL A;  1VR6 A;  5DLF A;  5DG9 A;  2Z2M A;  4DSK A;  1IVZ A;  4KO0 A;  2ZH3 A;  1C0U B;  1NKB A;  1IM4 A;  3KNG A;  4QWA A;  1RT7 B;  4DX5 A;  4ERD A;  2V2K A;  3M8Q B;  3R3T A;  3JQJ A;  2IVM A;  3D2W A;  4B9N A;  3I82 A;  4FZV A;  3BQ1 A;  3NMR A;  1FTC A;  1JNR B;  1H7W A;  1RUS A;  1HNX F;  3GB0 A;  1U1K A;  4NLU A;  1U1L A;  2ZIT A;  4EWT A;  1YJW S;  3AJD A;  3BPD A;  3CIM A;  4DF4 A;  2J0X A;  4M5H A;  1UVK A;  2HK2 A;  3BQ0 A;  5IC4 B;  3EPI A;  4KFB A;  4D3G A;  1U24 A;  3I5C A;  1L5U A;  3MEG A;  2VD3 A;  2Q79 A;  3K5M A;  3J81 U;  5J2P B;  2W7O A;  2GCF A;  3WIV A;  1S9G A;  3KHL A;  2HAF A;  4CYU A;  3FQL A;  3JSR A;  3DU5 A;  4ZA1 A;  1ELO A;  4P72 A;  3ZZZ A;  2UZA A;  3MED A;  1A7G E;  3SXL A;  3NS6 A;  4ALZ A;  3OR1 A;  4ZJL A;  2XZW A;  5J1E A;  3KK2 A;  4ITS A;  4O4G A;  1B99 A;  4DSE A;  1QE1 B;  2O3D A;  2GIQ A;  1O51 A;  3PKY A;  4OX7 A;  5KFU A;  3ADA C;  4H4O A;  2LVW A;  4UY8 5;  1GH8 A;  3W7B A;  4Y6I A;  4JI6 J;  3NY0 A;  1F2G A;  2N3O A;  3DXS X;  2NZ4 A;  4IG0 B;  4KBI A;  4ZP8 A;  4DUZ F;  1S6Q A;  2WRM A;  1L3K A;  5LL6 d;  1RYS A;  1S1X A;  4ETZ A;  4CLY A;  3T1Y J;  2DR6 A;  3SCL E;  3BEG B;  5B09 A;  3VV2 B;  3G2X A;  5DM6 Q;  1DTQ A;  1TQL A;  4C11 A;  1CJT B;  5CHC B;  1IBM J;  1S6P A;  3HSG A;  3W2W A;  2DNM A;  5EDW A;  3G87 A;  5DZ7 A;  2W4P A;  1HYS B;  1WD6 A;  3M05 A;  2VOO A;  1VLY A;  4JBC A;  4ZPC A;  3IG1 A;  2LYV A;  3FSY A;  1MLA A;  3JAM Y;  4EGL A;  2XYG B;  1DQA A;  3IGN A;  4WTO B;  4QIW D;  1JLF B;  1Z1Z A;  4KQZ A;  4DU8 A;  1B0V A;  4QIV A;  2C1E B;  4ZLP A;  1VQ8 S;  2XLI A;  2G0J A;  4WIQ A;  3V6D B;  1X0F A;  5I3U A;  3NCP A;  5GAG I;  4AD6 A;  2XM3 A;  2J5A A;  2RDD A;  3GFH A;  3OL9 A;  2IC3 A;  2KFN A;  2BJD A;  3R97 A;  2W9B B;  3QO9 A;  2UU9 F;  2QL7 B;  1C1B A;  4ES2 A;  2DGW A;  3TAM B;  4GKJ J;  4DQR A;  1LW2 A;  1TMM A;  5E3R A;  4NA3 A;  4Q2M A;  1UVL A;  3KLG A;  2EWH A;  4KHP F;  4PRF A;  3TP2 A;  1NJX A;  2CNK B;  4X66 F;  1VMB A;  1TL3 B;  2ZH4 A;  2R8G A;  1JLE A;  3JSY A;  5GAD U;  2ZZM A;  3R8Y A;  1CPZ A;  5LSL A;  1NKC A;  3K5N A;  3I31 A;  1VQO S;  2ZNY A;  2R3V A;  1D09 B;  2HAI A;  3EDQ B;  1LW0 A;  1N36 J;  1LWC A;  1H73 A;  3LP1 A;  2RQK A;  4LR8 A;  5L9N A;  3W66 A;  3MUM P;  2I2Y A;  2HNY B;  4LFA F;  2VJU A;  1KFS A;  1JJC B;  3R6G B;  4LRB A;  4PQU A;  4MMO A;  5FDL B;  4V1A k;  4EO6 A;  2CQ2 A;  1G7C B;  1IWA A;  1WC5 A;  4JYA F;  2QLW A;  1HPZ A;  4DL3 A;  3PRV A;  5KFA A;  1VLO A;  5HJY A;  1UA1 A;  2ZBC A;  4Q0B A;  3C14 A;  4QYR A;  3M1V B;  3MDF A;  4I6A A;  4HHH A;  1N33 F;  3FMW A;  1FCA A;  2RU3 A;  1TFW A;  3N6M A;  1TMJ A;  3CO9 A;  3S1T A;  2HZV A;  2JC1 A;  3UN5 A;  2CRL A;  3A4T A;  2DGV A;  4LR7 A;  3TRG A;  3OHA A;  3UI3 A;  3DHX A;  4K8R A;  2O1P A;  1HHQ A;  4IRK A;  1ZPW X;  4KO0 B;  2QO3 A;  2DBB A;  2YWE A;  3FCV A;  2RQ4 A;  4IO9 Q;  1EET A;  1HD1 A;  5M2U A;  1NND A;  4LRC A;  1RDR A;  1B0P A;  1VRQ C;  1CQM A;  3OPK A;  4KTQ A;  4R8U A;  3EYZ A;  1JXL A;  4W90 B;  3QRQ A;  3C6T A;  3VAL A;  2AZ3 A;  4LSN A;  1N5Y B;  4UZB A;  1LV5 A;  2A10 A;  4Q2L A;  9RUB A;  2PEH A;  3RG6 A;  2FLN A;  4C8K A;  1CBK A;  3AQP A;  3HT0 A;  3GYG A;  2XO7 A;  3HSZ A;  3GG0 A;  4WE1 A;  2WCX A;  2QRR A;  4K2J A;  4IH7 A;  2NUU G;  3UR0 A;  1V3R A;  2LEP A;  4GVB B;  2A6O A;  5F8H A;  2XLJ A;  1MSW D;  3GON A;  3CME S;  1S9G B;  3EZO A;  2ZBI A;  3IM8 A;  1WDT A;  3DLK A;  4UUX A;  2DR9 A;  1TKX A;  3GZ7 A;  3BKT A;  4PCQ A;  1IKV A;  1N6Q A;  2X51 A;  4Y2A A;  4NLW A;  2H54 B;  3MED B;  2QGF B;  1RT3 A;  3THT A;  4HTI A;  4PYA A;  3Q8Q B;  3Q8S B;  3KK2 B;  4B3O A;  1SH2 A;  3P4U B;  4O4G B;  1UPM B;  1HR0 J;  3U02 A;  2Y1I A;  2F4F A;  1V3S A;  4H4O B;  2V8D A;  4WZM A;  2IMW P;  1NHU A;  3NGU A;  2RD5 C;  3BQ2 A;  3QGP A;  3CDB A;  2HHW A;  2Y0S D;  3GIR A;  2KG1 A;  3Q24 A;  1EIY B;  4ES3 A;  5DGA A;  4DPU A;  2ZH2 A;  4B3R F;  1S1X B;  3L9Z A;  2NXU A;  3MM8 A;  1TUG B;  3DOK A;  3MCM A;  5EX3 A;  4USH A;  4LQ9 A;  1OY6 A;  1MWY A;  2FJA B;  3B6B A;  4ED1 A;  1U6Z A;  1S6P B;  2CPY A;  4L76 A;  1RSC A;  2HRU A;  3W2W B;  4DL7 A;  2FHO B;  3KLI A;  1IKX A;  1LKZ A;  3MFH A;  4LF6 J;  2VH7 A;  2WVC A;  4ETX A;  4DX7 A;  3IG1 B;  2DVI A;  2LQ8 A;  1PJ6 A;  2I9S A;  1IBL J;  2QSF A;  3GV8 B;  2VZ9 A;  3MD1 A;  1K47 A;  4ZMM A;  4WPA A;  4DV2 F;  4LF4 F;  1YBT A;  5E7O B;  2GHP A;  4UT4 A;  3RR7 A;  2LEA A;  2CJX B;  4U7U D;  2UP1 A;  4CQ1 A;  4A8M P;  3FBE A;  1N4L A;  4YY3 J;  3RRG A;  3GP9 A;  4AT1 B;  5J2M B;  3CVK A;  4IH6 A;  3RR8 A;  5CZV A;  1TP7 A;  5H9E K;  1NH8 A;  3MF5 A;  1R0A A;  3VAM A;  3R2C J;  2CKW A;  1C1B B;  5F3T A;  3EX7 B;  3T1H J;  4O23 A;  4RBT A;  1K9M T;  3DKD A;  4RW9 A;  2YWK A;  3LAK A;  3PYE A;  2DXD A;  1EAR A;  3P5B P;  2KYX A;  1KNZ A;  3Q8V A;  3W8G A;  2R8H A;  3FCH A;  1VC0 A;  2JWN A;  1JLE B;  4JI4 F;  2KDO A;  3E2E A;  2MYF A;  3N28 A;  3OTO J;  4LJM A;  4YHH F;  1BD6 A;  1RU1 A;  3HVW A;  3BDE A;  1LW0 B;  4ZDN A;  1LWC B;  3LP1 B;  2WSC C;  4Z2X A;  1RTZ A;  1Z4U A;  2C2K B;  3DYA A;  4PQU B;  1FNM A;  2MQO A;  1XR5 A;  2MPU A;  1CQN A;  4FXW A;  1FE0 A;  3NP5 A;  3C15 A;  1OPI A;  2DGO A;  2YVS A;  3CD6 S;  2ADC A;  4FKY A;  5D3G A;  2FC9 A;  1SC3 B;  4Q0B B;  3I9V 9;  3C14 B;  5AJ3 J;  4X64 F;  3RB4 A;  3OR2 A;  2B9E A;  3LTO A;  2MQL A;  1ULR A;  3CTR A;  3O2I A;  5AT1 B;  2IDE A;  1RZM A;  4CLP A;  3M6X A;  3MM6 A;  1XNQ F;  3PW4 A;  4HAC B;  1PJ5 A;  3KK3 A;  3NKY A;  5MLC V;  2IYG A;  6FD1 A;  5GMD A;  2KRB A;  4O3S A;  4MYT A;  3F56 A;  2DXE A;  2XMT A;  4QR1 A;  2JC0 A;  4P73 A;  1N54 B;  1X9W A;  2L9W A;  3CJR A;  3OXL A;  4OL8 A;  1DHM A;  3PFO A;  4CLU A;  1WC6 A;  5C2G A;  4R8U B;  2UXC J;  1S9F A;  4ECY A;  1NDC A;  3KLF A;  1PO6 A;  3C6T B;  1HNI A;  4FF3 A;  4TY8 A;  2HNZ B;  4ZHR A;  4LBP A;  4DLG A;  1NME B;  4GO7 X;  5LMN J;  1VQP S;  2B5J A;  2ZZT A;  2NXC A;  2M8D B;  1HBM B;  4FBT A;  2FUG 9;  1QSS A;  1NEE A;  1Q4R A;  3N01 A;  2BKP A;  4JI5 F;  1ZTW A;  2YKP A;  5F0W A;  4WE1 B;  1HMV A;  5BR8 F;  2AGO A;  3N79 A;  2HQI A;  1Y0H A;  4BWM A;  2CVI A;  3IM9 A;  4OI6 A;  2CQI A;  1FJG F;  1T9U A;  3TQ1 A;  4FF1 A;  2ZOG A;  3AD9 C;  4UTG A;  3OD2 A;  3TI0 A;  5A8R B;  1IKV B;  4LF2 A;  1IR1 A;  1N6Q B;  1P8G A;  1FER A;  3GYX B;  1RT3 B;  4TU8 A;  1OYE A;  1TEL A;  3G82 B;  4DL0 C;  3Q2T C;  3MM7 A;  3NL0 A;  4K4V A;  1W26 A;  5EHH A;  2H48 B;  1O6X A;  3RTV A;  2DT9 A;  2JZ5 A;  2MQQ A;  3TUI C;  3BR9 A;  4OI1 A;  2B8P A;  3V6K A;  2PGC A;  1QD1 A;  1U6F A;  3TAN A;  2GML A;  4IDK A;  1RCX B;  2K06 A;  1T9V A;  3VQS A;  1UVI A;  2HVZ A;  1RAC B;  1FJ7 A;  3DOK B;  2HGN A;  2NR0 A;  3KKF A;  4ZOS A;  2EKN A;  2VQE J;  1TKZ A;  5ETS A;  1WF2 A;  1HHS A;  2L9D A;  5IS2 A;  4KGX B;  2GA7 A;  2UVV A;  2KFZ A;  3KLI B;  3I9Z A;  4DWI A;  2N3L A;  3EVM A;  4BC9 A;  2MQP A;  2P8I A;  3H90 A;  2YWH A;  1IXK A;  2QSW A;  1YGY A;  1N56 A;  3D3B J;  1FKO A;  4C48 A;  1ZAX A;  5JJB A;  1OY8 A;  1NPP A;  2FTR A;  4NRU A;  1TUV A;  2KZM A;  2LDY A;  4AQY F;  5DDO C;  2HBZ B;  2KJW A;  3NWR A;  1JX4 A;  1I1G A;  3ENV A;  1FEH A;  2KXH A;  1UZD A;  2HG4 A;  1S1V A;  2DEJ A;  3CCW A;  1XMO J;  4C7Q A;  1FFS B;  4NAS A;  2F63 A;  4LFC F;  2YH0 A;  3Q89 A;  2F40 A;  1FDN A;  2ZH9 A;  2XI2 A;  3OVS A;  3D9B A;  4Y00 A;  1SJ3 P;  4J9O A;  1R0A B;  2MQN A;  3VGV A;  3Q0A A;  3UD5 A;  1VQS A;  4DR5 J;  2BOP A;  3TX8 A;  2L08 A;  4Y0F A;  4JUZ A;  2ILZ A;  4IUF A;  3ITH A;  2W7P A;  4DSJ A;  1EB0 A;  4XO0 A;  1M90 T;  2BAN A;  4R5P B;  4F02 A;  3C3L A;  2XCA A;  2APO A;  1YJT A;  4RW9 B;  3HJV A;  1IBK J;  5T41 A;  1RB0 A;  5A0Y A;  1UET A;  3E51 A;  5GAG U;  3DHW C;  4NXM F;  2EG1 A;  2Z4P A;  3PKM A;  3ZTO A;  3U1M A;  4HR2 A;  1N34 J;  4EYH B;  3UQS A;  2ZE2 A;  2E5L F;  1S7H A;  5F8N A;  3MD3 A;  4IQX A;  3A3P B;  3CJT A;  3TR5 A;  2YPY A;  2XTJ P;  3K58 A;  1UZH A;  1RP5 A;  4Y65 A;  1TU0 B;  4USM A;  2WVD A;  2JL9 A;  3DYA B;  2DHX A;  4J9S A;  1LWX A;  3JSB A;  1CS4 B;  4UOH A;  5KG5 A;  3OFG A;  3C15 B;  3D1H A;  2BQR A;  2PMW A;  2W8L A;  3DLH A;  2G13 A;  3CW2 C;  1XNR J;  2W01 A;  2YNF A;  5D3G B;  1G6B A;  5DET A;  4IRC A;  3NNA A;  1H6K X;  5K9F A;  2E1C A;  1ZM2 A;  3IAS 9;  4DFP A;  2BJ9 A;  4JB8 B;  3MM6 B;  3PX0 A;  3THP A;  2UVR A;  3MR5 A;  1R0C B;  2PMZ D;  1LWE A;  4CLL A;  1HI8 A;  2JSX A;  3SCK E;  5LXR A;  1J2V A;  3MUT P;  4YOE A;  2ZUA A;  1T94 A;  2YNI A;  3CJ8 A;  3D67 A;  1TZ0 A;  2OEJ A;  1VC5 A;  2UUT A;  1SKS A;  3CC2 S;  1NK9 A;  4USI A;  4KT0 C;  4P74 A;  2VAS A;  2B6A A;  1SKR A;  4BDP A;  4JI1 J;  1UAW A;  2BUN A;  2RF2 A;  5GVQ A;  5DDP C;  8RUC A;  4ZVG A;  3H2L A;  3KLF B;  3EGZ A;  1F2H A;  3BGO P;  4PG6 A;  4ZHR B;  3BGU A;  5EWE A;  4HL9 A;  2RRA A;  4WFN Q;  1VRT A;  1RHM B;  1FEE A;  5JVG Q;  3J7Z 5;  3W5Z A;  3MMB A;  3NEK A;  5IC6 B;  4L73 A;  3F0N A;  2C3U A;  4DV5 J;  1Q86 T;  5K20 B;  2CPD A;  5A2Q U;  4F4W A;  1EHW A;  4DR1 J;  4I6Y A;  3RBE A;  4Q5V A;  1VCT A;  3G9C A;  2CYY A;  5HI7 A;  4A8O A;  4ENO A;  5KFB A;  1S1T B;  4LF1 A;  3BN4 A;  3RAM A;  1F0X A;  3POT A;  5F0U A;  1Y5L B;  5GME A;  4O44 B;  2HMI A;  1OS5 A;  1RWU A;  4EBE A;  4ECV A;  1FFG B;  4KY3 A;  4XAK A;  5IV3 A;  2ZM6 F;  4ECT A;  2MJU A;  2RNE A;  4DV3 J;  2LLZ A;  5BJR A;  2GHW A;  1RWV B;  2GC8 A;  3A8K A;  2W7A A;  2BR0 A;  2K7J A;  3QZ7 A;  3MPU B;  2NPI A;  2D9P A;  3V4I A;  3AH6 A;  4IDK B;  5LMU F;  2D74 B;  4MKY A;  5HK4 A;  2ZH1 A;  2ATC B;  3GFY A;  4F3Q A;  1BQM B;  1ZTT A;  3I96 A;  2OH2 A;  1OMS A;  1TKZ B;  3MPV A;  1FK9 A;  2BXJ A;  2FJB B;  2DB1 A;  3B78 A;  1YJV A;  2ACY A;  3EJM A;  5HAN A;  1RIS A;  4JV1 A;  1X4B A;  2XG8 A;  4PAA A;  3CSK A;  4USJ C;  1Y10 A;  3ISZ A;  4DPX A;  3TYT A;  1EKS A;  2RQM A;  4X62 J;  5EWG A;  5DO2 A;  3UDE A;  2HHH F;  1H7X A;  4GMK A;  4DR7 J;  4YS2 A;  1SJF A;  1A9N B;  1JLC A;  1K8A T;  1FKO B;  3PAC A;  2RVJ A;  3UD4 P;  2VQF J;  1JLB A;  3WX8 A;  4IKA A;  4CP5 A;  4KHR A;  3CCM S;  2J9C A;  4FP9 A;  4NXN J;  2DY1 A;  3K17 A;  2X1B A;  4PG4 A;  4CO1 A;  4RW4 B;  5EN1 A;  4CLS A;  4P52 A;  2MXY A;  5BYS A;  1WNE A;  3J80 U;  1UW9 A;  1KQK A;  4DG1 A;  2B8Q A;  1S1V B;  4XK8 C;  4M95 A;  4NML A;  4TNO A;  4DPY A;  2LDI A;  2W2O P;  3I87 A;  2BX6 A;  1SUQ A;  3OBI A;  4A46 A;  5B7W A;  2GGP A;  3PJW A;  2BJ8 A;  3UR3 C;  3SI8 A;  1E6V A;  3H7H B;  3BM7 A;  3VAG A;  5K8N A;  4F26 A;  1PYS B;  1YRU A;  2WON A;  4HLB A;  3J81 j;  4WU2 A;  3OUY A;  1X9S A;  4JV5 J;  4FYD A;  1JIH A;  1WF0 A;  5ETO A;  1DRZ A;  3ITH B;  2GAH C;  2JH3 A;  1U0S A;  4NX9 A;  2BAN B;  4LF9 J;  3VAK A;  3QRR A;  4Q8E A;  4KV8 A;  2WW8 A;  2J9D A;  2SXL A;  1HWK A;  3EMT A;  5A0Y B;  2Q1L A;  2VKR A;  1HWL A;  2HFU A;  2JLF A;  2VDH A;  4QIE A;  1I94 J;  1WTF A;  3T6B A;  5G0R A;  1RAH B;  2CQG A;  4USV A;  4OV1 A;  4DV1 J;  4OZN A;  2BKO A;  1YBU A;  4F8R A;  4KGV B;  1SJR A;  3PTW A;  3MAA B;  3A1Y G;  2OPS A;  1TL4 A;  1GX5 A;  3IP0 A;  1QAX A;  2HW3 A;  1RTI B;  3HSD A;  1CLF A;  5L8R C;  4X4T A;  2XYP B;  4E8U A;  4J9M A;  2M8H A;  2P9C A;  4C8M A;  2VA2 A;  5DG7 A;  2YNF B;  1W7W A;  3D54 A;  2KT2 A;  4OZ0 A;  1YIJ S;  3SZ2 A;  4NYP A;  3J81 Y;  3F44 A;  4K7Q A;  2DNY A;  1XWL A;  2B7B B;  2MZJ A;  2ZUG A;  5C25 B;  2A18 A;  3CJS A;  1ZYQ A;  4DR6 J;  4LSL A;  3GG1 A;  1LWE B;  4NLY A;  2AIR B;  3T1Y F;  2PA8 D;  2FD2 A;  2WW4 A;  2YNI B;  2MKJ A;  2KJV A;  2EK1 A;  2U2F A;  3LO3 A;  4ED0 A;  3JB9 k;  4B3T F;  1RTJ A;  3NCQ A;  3C8Y A;  4KRW A;  2HVI A;  2C2E A;  4YR3 A;  1UWA A;  2B6A B;  2LFV A;  2Z2Y B;  3SEO A;  3TJ8 A;  5E3P A;  1FD8 A;  2HZA A;  4UW2 A;  4LF7 F;  1YVF A;  1S4E A;  1S77 D;  2E7W A;  4NRT A;  2QZ8 A;  4FPR A;  4C8N A;  1VRT B;  1X4F A;  2OP5 A;  2KZZ A;  2FHM A;  4RW8 A;  2QJ3 A;  3J7Y I;  3DGP A;  3TA2 A;  4KHM A;  7FD1 A;  3QNW B;  1GMV A;  4AND A;  4CO4 A;  4ZVF A;  5H9F K;  3LA0 A;  1GT8 A;  1BQN B;  1Y3J A;  2CJ9 A;  4R25 A;  3IGV A;  3M4X A;  3BSA A;  3UE2 A;  1A6L A;  1KBR A;  1CUL A;  2YTC A;  4YUD A;  1B3T A;  3M2R A;  4QPT A;  3POT B;  2UV8 A;  2CZV C;  3PIP Q;  2GMH A;  3L95 X;  4X4P A;  2HMI B;  1X4H A;  5KT4 A;  1Q1K A;  2FHJ A;  5HJX A;  4DHV A;  2C2M B;  4UF4 A;  3DNC A;  3T5K A;  5BYQ A;  1M5O C;  2DIU A;  2DHA A;  3EVW A;  3DXB A;  2QMU B;  1W2I A;  4M5K A;  4ZLJ A;  1FRI A;  2BKN A;  2JLG A;  3P45 B;  2C3P A;  4A48 A;  1D8Y A;  3I5A A;  3V4I B;  4ZN1 A;  4CCH A;  3PO4 A;  1NLK L;  3D3C J;  5HP1 A;  1VJW A;  3N6L A;  1VQ6 S;  5M2P A;  2F65 A;  3CC7 S;  2RQC A;  4OI2 A;  1JLQ A;  2ASJ A;  1S6U A;  4AYB D;  3GQC A;  4ZPD A;  3UDC A;  1H0H B;  3UNG C;  4TN2 A;  3FSI A;  5H9E J;  1KRP A;  3R6L B;  1JLG B;  3NWG A;  4NLO A;  3AA9 A;  2KM8 B;  1OJ4 A;  3IWL A;  1XMQ J;  2QG9 B;  2V4Q A;  2Z2Z A;  3EVO A;  1NSA A;  5D15 A;  1JLC B;  4HT7 A;  4DV4 J;  4C0O C;  4K0K F;  1IKW B;  1JLB B;  3IMQ J;  2PMH A;  5ETM A;  2AQ4 A;  2LU2 A;  2CJA A;  3S7R A;  2RHS B;  1WHW A;  4WCE Q;  3MI7 X;  3QFW A;  3DM2 A;  2CG8 A;  3N5F A;  1UVJ A;  1WWH A;  4N76 A;  4ED7 A;  4DG1 B;  1U1O A;  4UST A;  3W1Y C;  1X4A A;  2BV3 A;  3G8T A;  1RHK B;  2J6S A;  3W60 A;  1CJU B;  3H8Y A;  4B17 A;  2GGP B;  2QE5 A;  4J9V A;  1YHQ S;  1F60 B;  2BMB A;  4YB1 P;  3FEX B;  3UW1 A;  3ILO A;  4DPO A;  2Y9H A;  2UUB J;  1QY7 A;  2LQ5 A;  2B0G A;  4B9T A;  5LSO A;  2WON B;  1WKL A;  1TL7 A;  1NK5 A;  5K14 A;  4Y2M A;  1MN7 A;  4LRA A;  2HWI A;  3HHL D;  2XZT B;  1YTY A;  3OSN A;  3GIK A;  4V19 J;  4KV8 B;  1FRH A;  4ZN3 A;  4QPX A;  3MR6 A;  3O6Q A;  2AT1 B;  4P71 A;  3RW7 A;  2GO9 A;  1VQN S;  3HZE A;  1Q7Y T;  2ZC4 A;  3RBD A;  3MTK A;  3T5H A;  4OZL A;  1J5O B;  4B9V A;  5KFO A;  5CCL A;  4OZ1 A;  4BCA A;  2GW8 A;  3NBP A;  1S97 A;  4MFB A;  4C3M A;  5L1I A;  1R27 B;  1XIQ A;  4DN0 A;  4OX6 A;  4J9L A;  4DR3 J;  3BO4 A;  2W8K A;  3AXM A;  1X31 C;  1U02 A;  4ZJQ A;  2CJQ A;  3R7S B;  2OPS B;  1FO1 A;  1LWF A;  3AB4 B;  3AAW B;  3BV8 A;  2B4P A;  3HZG A;  4LFB J;  5DQH A;  3M2U B;  1S5Z A;  4MIA A;  3RBZ A;  1F5B A;  4NWB A;  1RA6 A;  2RS2 A;  5KFM A;  1L3V A;  1SXL A;  1PGZ A;  5CAB A;  1E6Y B;  1CC8 A;  5U47 A;  4DL5 A;  3QLH B;  1K1Q A;  2W9A A;  2QA2 A;  2YKN A;  1RAE B;  1TV6 A;  4BHQ A;  2FIU A;  3HLU A;  4LSL B;  4J91 A;  5ETP A;  1IQZ A;  4OI4 A;  2EPI A;  3PW5 A;  1ZM9 A;  2JRS A;  3UO0 A;  4ZPT R;  4EU0 A;  1T9W A;  2WSF C;  2XS7 A;  2YKQ A;  3NLC A;  4LVN P;  1RTJ B;  1NRK A;  4DR2 F;  2B51 A;  5GAD I;  1VYA A;  4DSF A;  2E9R X;  4RU2 A;  1REG X;  5FLX U;  2XMW A;  4W4M A;  2XEX A;  4M5L A;  3UCU P;  3OFH A;  5E3A A;  4PEO A;  1YK9 A;  2H51 B;  3CUL A;  2G4B A;  4LUB A;  4RL1 A;  1YKW A;  2RSQ A;  4O3P A;  3MGJ A;  3PHE A;  1VQK S;  3CJ2 A;  2MLZ A;  4DL4 A;  3RJM B;  4KGZ B;  4B02 A;  2HHP A;  2J0S D;  4NI2 A;  4G1P A;  1U47 A;  4ZIT A;  4RW6 B;  2JEF A;  4Z7Y A;  3D0I E;  1S9E A;  4PR6 A;  1R8H A;  2F4V F;  2M2B A;  1KSP A;  2FGO A;  2YY3 A;  4YY3 F;  1U0H B;  1JK9 B;  4QOT A;  1CUL B;  1B4S A;  1BMQ B;  2WBR A;  3CT9 A;  2DNN A;  3HKW A;  2VC1 A;  4PYD A;  1VFJ A;  2CUY A;  1JWW A;  2CIM A;  3K5L A;  4M5G A;  1CC7 A;  4ZVU B;  3TUP A;  3IR6 B;  5A76 A;  4KJI A;  2NS1 B;  2HHV A;  5T7L A;  3GSI A;  3EGV A;  3KUH A;  4PPZ A;  1HQU A;  4ECX A;  1UEK A;  4N47 A;  4X4S A;  1JJH A;  2E5I A;  5CAA A;  2OSQ A;  4R0E A;  4LMZ A;  1M5S A;  2AYB A;  2IM3 A;  4WF9 Q;  5HP1 B;  1PJ7 A;  1RHJ B;  4U67 Q;  4EFA C;  1Q78 A;  2V4J A;  1HNX J;  1JLQ B;  1QTN B;  4J7C A;  2XMK A;  2QTW A;  2A3J A;  4NZ6 A;  3B4M A;  1FE4 A;  3FCW A;  4OHV A;  1KHW A;  1WHV A;  4O4R A;  3J7A N;  4JI2 F;  1KKH A;  3RB3 A;  3OV7 A;  3M8Q A;  3BB5 A;  3JTP A;  2VPW B;  5IT4 A;  1VQL S;  3P3D A;  2Q66 A;  3ZNJ 1;  2V8V A;  2I8E A;  5D8H B;  2EKY A;  4FBU A;  3MM9 A;  1ZZN A;  3IAM 9;  2QA4 S;  3MOZ A;  2XMJ A;  2VG5 B;  4USU A;  1L3T A;  4C9D A;  4OZ3 A;  4DV6 F;  5AJ3 F;  1P1T A;  3DM2 B;  3NCR A;  4OYZ A;  2AZ1 A;  1UP1 A;  2E1R A;  2BE9 B;  4R0J A;  2X1A A;  3HFK A;  2PSZ A;  1Q5Y A;  4B9L A;  1X4C A;  2JDJ A;  1HBU A;  2VV5 A;  1WG5 A;  1D0E A;  1NZA A;  3C16 A;  1DFD A;  1RT2 B;  4DUZ J;  2ERR A;  2DNR A;  1F9F A;  4LSZ B;  2AW0 A;  4CLT A;  2Z56 B;  1X5P A;  2F9D A;  4WFZ A;  1TL7 B;  1QE1 A;  5K14 B;  1N5T A;  2EBG A;  2R8I A;  1KR4 A;  3SSS A;  4YR2 A;  2LXI A;  1X4E A;  2M70 A;  2EFN A;  2R7T A;  1FA0 A;  3CXC R;  3AA8 A;  5F3Z A;  1WEX A;  2H5J B;  1FF2 A;  5CD4 A;  1PC4 A;  4WFX A;  2IJF A;  3SMZ A;  4HHU A;  1YRT A;  1PIE A;  1CJK A;  2PE8 A;  3H0P A;  2BRL A;  1HQ2 A;  1LK5 A;  2GZO A;  4F4X A;  3GE9 A;  1HWI A;  1PC5 A;  1VQ5 S;  3BJY A;  4RNH A;  3FBF A;  1AYE A;  5J2N A;  3H98 A;  4ZLL A;  2Y8W A;  2P5V A;  4FVM A;  4RBV A;  4ZK7 M;  2AGP A;  1PYT A;  3G6E S;  4I64 A;  5KT5 A;  1FI4 A;  1YSJ A;  3NBP B;  4MFB B;  1WI6 A;  2NUH A;  4DR4 F;  4QYZ K;  2ROG A;  3DOL B;  2MZS A;  2FVQ A;  2BQ3 A;  2FVR A;  4Y28 C;  2XHC A;  3CCJ S;  2VDI A;  4DLE A;  2W2M P;  4XPE A;  1YZ6 A;  2A0F B;  3QIP B;  2ASY A;  1H72 C;  1LWF B;  4ZVP B;  4RX6 A;  4LF8 F;  4LIR A;  5HQ8 A;  5H1S V;  1UKU A;  4PKD B;  1P6T A;  3Q22 A;  3SQG B;  3KFW X;  2E9T A;  4WKY A;  3A12 A;  3O5T B;  1T0T V;  3H5X A;  3RAX A;  3CMA S;  3C46 A;  2HPU A;  1RAF B;  4QJV A;  1UA0 A;  3OL8 A;  1SB6 A;  1T9T A;  4X4O A;  3PR5 B;  1TTH B;  4OFZ A;  5E5N A;  2EK6 A;  2UU9 J;  1SH3 A;  2YKN B;  5L38 A;  3O3L A;  1H2V Z;  4NEY A;  3VAI A;  3GV7 B;  2RT3 A;  2NCK L;  4C8Y A;  2VHG A;  3V6D A;  2GQ2 A;  2KU7 A;  4ECZ A;  3TAP A;  3QJL A;  2I0X A;  3MOJ B;  3CDA A;  4KHP J;  3UN2 A;  2DO0 A;  4FVC A;  4X66 J;  3ENQ A;  4DBQ A;  2HWH A;  2OSR A;  1TKD A;  4DMZ A;  2W9B A;  1UMJ A;  2XLK A;  2G0C A;  2FGC A;  4B9U A;  2GQQ A;  3FSX A;  3TAM A;  1RQ0 A;  2R7Q A;  4F67 A;  1FNX H;  2VFU A;  4YDD B;  3ET6 B;  4ZVO B;  3KHG A;  2V2V A;  4I2Q A;  3CCU S;  4ED2 A;  3QJP A;  2VPZ B;  1WOS A;  2LQB A;  4NI2 B;  5F8L A;  2NXJ A;  3BSO A;  4JYA J;  3BGR A;  5L39 A;  4C3K A;  1TK5 A;  1S99 A;  1MNE A;  2QV6 A;  4WP3 A;  4YEA A;  3ZZR A;  5A6P A;  3LWM A;  1AB8 A;  2FY8 A;  1AFI A;  1WTB A;  5HL7 Q;  3LW5 C;  1RU2 A;  2OFG X;  1T11 A;  1N33 J;  1RK8 A;  4ECU A;  4OYA A;  5FDL A;  1S12 A;  2IMO A;  4EZ9 A;  3BYP A;  5C24 B;  2VPY B;  1PCA A;  3ENW A;  1QVF R;  2K7K A;  4KAI A;  4MKB A;  4K4Z A;  2GIR A;  5T7L B;  2AWZ A;  4H4K A;  3WBZ A;  4ECW A;  4HDH A;  3GFX A;  1HQU B;  5C5J A;  1WKK A;  2C42 A;  2CAD A;  2I5J B;  4X4V A;  1F5A A;  4M5I A;  2M5Y A;  2DH8 A;  2XGQ A;  1SBR A;  4TYA A;  2GNK A;  1IBK F;  1RWN B;  5EUH A;  3CJ5 A;  1PAU B;  3U7J A;  4GRS A;  2ZC3 A;  4RKU C;  2C28 A;  4LF5 F;  2V4J B;  5E41 A;  5AXK A;  4CLF A;  1N34 F;  1C2P A;  1Z2Z A;  4LRE A;  3DLJ A;  1NB2 A;  2B4U A;  3LH2 S;  2OIH A;  1BWV A;  4C6A A;  3I32 A;  2FJV A;  2GJI A;  1RGV A;  3TZW A;  4CLW A;  1HL6 A;  5F9L A;  2RH3 A;  1GFW B;  3L7P A;  1WC3 A;  2MZQ A;  1R89 A;  4M5N A;  2YQ3 A;  3CD7 A;  2XSJ A;  4NA2 A;  4DJB A;  2YWF A;  4JI7 F;  4X4Q A;  2HVD A;  4RO0 A;  3KLH A;  4CRJ A;  3BO2 A;  4O3Q A;  5HVH A;  1UPP A;  3QWU A;  4EBD A;  4F50 A;  3HJF A;  3MM9 B;  1D1U A;  1N5Y A;  1HLW A;  4CO5 A;  3M6W A;  3GJQ B;  2YNG A;  3QT6 A;  2V50 A;  3LUY A;  3KNA A;  2DY9 A;  2FJD B;  2MLX A;  2OTL S;  3ILJ A;  3Q86 A;  1QLN A;  3GCW P;  2CZ4 A;  2R7S A;  2O01 C;  4S0M A;  3N4W A;  4TXS A;  1U49 A;  4GVB A;  3FNN A;  3TUZ C;  2Q3P A;  1SI9 A;  1HAR A;  1Q8I A;  1RAD B;  1HNW F;  4DF8 A;  2JVO A;  4WK1 A;  4QIF A;  1HBU B;  4J90 A;  4QU7 A;  1VQ4 S;  3C16 B;  4Z37 A;  3TX0 A;  1GXL A;  2DD8 S;  4B3R J;  2OEK A;  2XO6 A;  3T3F A;  4UQT A;  3CGI A;  4TVA B;  3OXF A;  2BA9 A;  3WC2 A;  3I5B A;  3H25 A;  2B3T B;  4I68 A;  4N8O A;  4L6V 3;  3E8O A;  3M9O B;  4JI1 F;  1GNK A;  2IIH A;  1SCJ B;  2HLT A;  2OUG A;  4X4N A;  2K2P A;  4ECR A;  1CJK B;  1V5I B;  3M2V B;  1FX2 A;  3OJS A;  3M30 B;  2XMU A;  1DAX A;  2DGT A;  5J2N B;  4WFB Q;  4CIO A;  1HD0 A;  2N4C A;  3CF5 Q;  1F3F A;  3S01 A;  1QVG R;  1R8A A;  1HNZ J;  2CQP A;  2ZH8 A;  1NM2 A;  4ZP9 A;  2JNJ A;  1DAR A;  3G6V A;  2AJ4 A;  2RUG A;  5DGB A;  1OQ6 A;  4A8X A;  3DRP B;  2GFF A;  2WB4 A;  1YJ9 S;  2GS8 A;  4F2S A;  3W9I A;  3M8Y A;  1EQ0 A;  5ADZ A;  2ZEJ A;  3M8P A;  4OMF G;  5DJB A;  1GEH A;  4C8L A;  2HYI B;  2NQP A;  3IRX B;  1S10 A;  4V19 X;  1XMB A;  5D4L A;  4K4X A;  2BOA A;  3H42 A;  4OQJ A;  2NXE A;  1RHQ B;  4FN5 A;  2MKC A;  3CMQ A;  4OX8 A;  2IJN A;  4YB5 A;  1U7L A;  3MPD A;  4OLO A;  3BBC A;  3CC4 S;  3M8S A;  2Z58 B;  1NH7 A;  1NBE B;  3HHL C;  1GAO A;  5J2M A;  1NKE A;  1RKI A;  4DV7 J;  1VC6 A;  3D1Q A;  3LP2 A;  3CO0 P;  3BF4 A;  4DZ6 A;  1SV5 B;  2R2U A;  2NLW A;  3CJ3 A;  5HBM A;  4OHY A;  2VC0 A;  4JI4 J;  1RA7 A;  1NUE A;  3BKU A;  4K50 A;  3BDP A;  4KSE B;  2OTJ S;  2CDR B;  2ZH6 A;  4JI0 F;  2ZKU A;  2DNZ A;  3W9J A;  3EE3 A;  3AOB A;  4YHH J;  2RJZ A;  3ISN C;  5M2R A;  4DS5 A;  1FJC A;  3R5B A;  2L9N A;  3KYL A;  3N9U C;  4I2Q B;  2XNR A;  1WC0 A;  1P9Q C;  2RML A;  2DHS A;  3OTE A;  3RRK A;  1KDN A;  4DX6 A;  2IBK A;  1RTD B;  2HQD A;  4NCA A;  2VQF F;  4LVO P;  3SSQ A;  4CT9 A;  4O3O A;  5AE1 A;  4DPW A;  3QRP A;  1AXQ A;  1LK7 A;  1G4C A;  3BGR B;  3PCO B;  4JI3 F;  4P2F A;  1Y5N B;  1FKA F;  1B7F A;  3I0S A;  2AU0 A;  4M5D B;  3DLG A;  2KT3 A;  3AJ2 A;  3WZ0 A;  3H4D A;  5A8W A;  1YZ7 A;  3KG0 A;  4JP8 A;  3W9H A;  4X64 J;  2VBZ A;  1S59 A;  1WEZ A;  2MY7 A;  2OD4 A;  1RWO B;  1VBY A;  2DNP A;  1WJ9 A;  1XNQ J;  3RUB L;  3B82 A;  2D41 A;  3T1A A;  1VIS A;  4FF2 A;  4U96 A;  2N4D A;  4OI0 A;  3CNQ P;  1NDP A;  4WWS A;  3BPS P;  3IO1 A;  4G3I A;  4I2P A;  3RB6 A;  4RPF A;  3EXY A;  2MKI A;  4B3S F;  3HX9 A;  3GCX P;  1NPR A;  1PBU A;  3J80 Y;  1HA1 A;  4WP9 A;  2HRY A;  2Z30 B;  4HI2 A;  3ZTS A;  1RT1 A;  1P9Y A;  4HAC A;  2C2O B;  4U7U K;  2ZHB A;  3PEH A;  1S57 A;  2HFZ A;  4KYZ A;  5KFI A;  4U6P A;  3FRZ A;  2KHD A;  1B64 A;  4QWC A;  3IA0 A;  3RRH A;  4NYZ A;  5I3Q A;  3QZ8 A;  3QAU A;  3NG8 A;  1I51 B;  3BGL A;  3VQT A;  2RRN A;  1TAU A;  3DLE A;  1WG4 A;  2E5H A;  4JI5 J;  3D6F B;  5DM7 Q;  5BR8 J;  2YNH A;  3NGD A;  5KFV A;  4AL5 A;  3DFE A;  3V81 A;  4DV0 F;  5LJ5 Y;  2XSJ B;  4F4Y A;  3BSC A;  5HAO A;  3KLH B;  1NJY A;  3FBB A;  4DL6 A;  2MHN A;  2DNL A;  2LP4 A;  2HNZ A;  2EW9 A;  5GAE U;  2I1R A;  1Q7L B;  3DU6 A;  2QMX A;  2ZZN A;  5DS7 A;  2KHC A;  2FJW A;  2YNG B;  1M5V C;  5KFS A;  1HBM A;  3BH6 B;  3BO3 A;  1WHY A;  4NPO A;  3HD2 A;  2R7R A;  3H5U A;  4X65 F;  1M1H A;  2HIQ A;  2OLW A;  5KG3 A;  4YFU A;  1SQG A;  4PQA A;  5KFQ A;  1H3D A;  4K4U A;  2DO4 A;  2KYZ A;  2FZC B;  1JKH A;  5A8R A;  2DRA A;  5HQL A;  4LBI A;  3OXG A;  3G82 A;  4IG3 B;  4P6Q A;  1NJW A;  2VBX A;  3QAT A;  4UQG A;  3G8Q A;  2JLE A;  2CQ3 A;  1WDD A;  4N8N A;  3EGN A;  2D3U A;  1MRO A;  1TUW A;  2V6A A;  3MMA A;  4ZP7 A;  1S0M A;  1KHV A;  4OIX A;  1U2F A;  3FZB A;  3MFI A;  2Y1J A;  2WOM B;  2HVE A;  1N32 J;  4IOC Q;  2ZHO A;  2IYI A;  3PY8 A;  2UUA F;  4DUY F;  1SC6 A;  2AF6 A;  2BYC A;  2CFX A;  5B08 A;  4HKQ A;  1RBA A;  4UUW A;  4OYP A;  4TQR A;  4ZVS B;  2MZT A;  1F3V A;  3I55 S;  4AQY J;  5G4D A;  3NMA A;  2YKA A;  3QQC D;  1HHT P;  5LXY A;  1KP6 A;  5KFR A;  2W24 A;  2JEI A;  2E44 A;  4TLR A;  4WFA Q;  4QWB A;  4C98 A;  4LFC J;  2W25 A;  1RWM B;  3R27 A;  3D4J A;  4U7C A;  2PD1 A;  3M8P B;  5D0R A;  5IWA F;  2UV8 G;  3PW0 A;  3MCS A;  5FD1 A;  1DQ8 A;  3X3U A;  3H5Y A;  3WC0 A;  5IV4 A;  4DQI A;  4AE5 A;  4F4A A;  3K2Y A;  3TQE A;  1H74 A;  4WP8 A;  2NSB A;  3AOC A;  4RR5 A;  3J7A 1;  3OT9 A;  3K5O A;  1HNV A;  2FC8 A;  2HWT A;  2XSF A;  1PYO B;  3NNH A;  3LP2 B;  1NK0 A;  1D9A A;  4NXM J;  5F41 A;  3C19 A;  1VBX A;  5HBM B;  1JNZ B;  1IR0 A;  3PNI A;  1U2R A;  4WFY A;  4CM0 A;  2J8S A;  2E5L J;  3D1O A;  1KVK A;  3ICL A;  4B3M F;  1UJ6 A;  3IBC B;  2G1H A;  3ENA A;  3HHN B;  4QZV B;  2YQ0 A;  2YPZ A;  1XBW A;  4RNM A;  3FBC A;  4R5P A;  2BJE A;  4NZ0 A;  1VS3 A;  1NO8 A;  2C3O A;  2AJ2 A;  5L1J A;  3FJ2 A;  4O0N A;  1VQY A;  2QYC A;  3B8H A;  2CQC A;  3S6E A;  5CYM A;  4NLQ A;  2XZD B;  4NEZ A;  2OPP A;  5KFF A;  3IN5 A;  3I0S B;  2KN4 A;  4RNF A;  3DLG B;  5KFD A;  2HKE A;  4C0H A;  3MM5 A;  5A8W B;  4QW9 A;  1IQT A;  4RUB A;  4KIA A;  5CCM A;  1KWM A;  1T9X A;  2CPZ A;  3UCZ P;  1LXJ A;  2OO4 A;  1VRU B;  3TAR A;  3IRW P;  1V3Z A;  4DFM A;  1H2T Z;  2FZK B;  2M88 A;  3NGR A;  1CS4 A;  4IQM A;  4N41 A;  2E5J A;  2J7U A;  4OJG A;  1U6B A;  4TU9 A;  2HK3 A;  2C22 A;  2VU5 A;  4ZVE A;  5KT2 A;  4F36 A;  4YB7 A;  4I2P B;  2YX1 A;  3UVJ A;  5EGY A;  1QSY A;  1MMN A;  3O1L A;  2V63 A;  1TK8 A;  2VF3 A;  1CSJ A;  3BBB A;  4I7F A;  2Q6B A;  2MB0 B;  4IFV A;  4ILM A;  2HBR B;  2FZG B;  1RT1 B;  2AV5 A;  2JOQ A;  2CXE A;  4OZ2 A;  4MYU A;  4WXW A;  2V0N A;  2DNO A;  3SYZ A;  1YDL A;  2HHT A;  1T8E A;  5HQM A;  2MST A;  1LEO A;  1RHU B;  1ZBT A;  3P5T L;  4KGM A;  2CQH A;  1OO0 B;  2RE1 A;  2B9W A;  4FXD A;  1X5O A;  2MQ8 A;  2R7V A;  2QFJ A;  3DLE B;  5GAH I;  4F3O A;  3US5 A;  2HS0 A;  4ZJO A;  1FXD A;  4DR3 F;  1F9H A;  2YNH B;  5JUM A;  1GK8 A;  1R43 A;  3V81 B;  5HVG A;  2BJ7 A;  4DN9 A;  5CD4 H;  1I3O B;  2RIL A;  4WXO A;  1HIY A;  2NXN A;  2ABY A;  4LFB F;  1FRK A;  1RT6 A;  3MUV P;  4ZPA A;  3TAQ A;  4WYL A;  2ZJP Q;  2L3M A;  4ZCL A;  4N5S A;  2XWY A;  1V6H A;  4FNH A;  3MAH A;  3GIL A;  3HKZ D;  2R2R A;  2ZM6 J;  1PBA A;  1KVJ A;  2ASL A;  3KJN B;  1UFL A;  3PIO Q;  1FES A;  2HHQ A;  2J9D E;  1SJQ A;  3PXG a;  4EZ6 A;  4QR0 A;  3UPF A;  2KL8 A;  4TY9 A;  5CA5 A;  3EUN A;  2KKH A;  3R5G A;  4M63 A;  4MK9 A;  1S1T A;  3T5J A;  1JKH B;  1Q0N A;  1NXI A;  5KAK A;  2LQJ A;  3K57 A;  2QEX S;  4CTA B;  4ANC A;  2MMY A;  2A2D A;  3LP0 A;  5KTQ A;  1FWK A;  3O8W A;  4O44 A;  3BR8 A;  5E0O A;  2O66 A;  3H20 A;  3NS7 B;  2G2Z A;  1SL2 A;  1J27 A;  1X4G A;  2DH9 A;  1MRO B;  5BXI A;  3MMA B;  3KDN A;  1DJ0 A;  3PYD A;  3SBM A;  1I6J A;  1SIW B;  1NK8 A;  3D6H B;  1M1K T;  2Y3Y A;  3VAH A;  4IFY A;  3FEY B;  2NRE A;  1EJ7 L;  2C2Z B;  3UNY A;  1IM6 A;  3A8J A;  2OEL A;  1G1X A;  5KT6 A;  2R8J A;  2JEJ A;  1JXE A;  1BQM A;  1RAO A;  3FDS A;  2W2N P;  3VAF A;  2B43 A;  1S72 S;  2MHE A;  2CNO B;  3BYR A;  4K4T A;  5FLX Y;  1MMD A;  1HW9 A;  4ILR A;  4OZJ A;  2FVP A;  4FKX A;  2VG6 A;  2DIV A;  3VWS A;  3T19 A;  3DMJ B;  1FJE B;  3WDO A;  2DGU A;  4PXB A;  4DFK A;  2OAU A;  3Q23 A;  4EEY A;  1S0O A;  4NLV A;  1HFE L;  2ZJQ Q;  4J9P A;  1GTE A;  3GR0 A;  3HI9 A;  4IR1 A;  2HIY A;  3H59 A;  3V6H A;  3KG1 A;  4ID5 B;  4CLZ A;  2EVZ A;  3K8W A;  4RW4 A;  4IOA Q;  2HGM A;  2E1A A;  1XR6 A;  4HYK A;  4WII A;  3W62 A;  1LXN A;  1N0U A;  2YBV A;  1HNV B;  3RYL A;  3H5S A;  3KWM A;  5J1P A;  1FWP A;  4PXD A;  1FRM A;  3PHT A;  3TVY A;  1T95 A;  6FDR A;  2VA3 A;  2J6T A;  1Q5V A;  3SIP B;  1VJQ A;  3V2U C;  9ATC B;  2D1C A;  2LA4 A;  3QPI A;  3W63 A;  2R7U A;  1HBN A;  2OEM A;  1NJZ A;  3JS9 A;  2CQD A;  4M94 A;  3P96 A;  4OYO A;  3QSY B;  2QFI A;  2CPF A;  2XNQ A;  2XMV A;  4Y2C A;  5ETQ A;  2DR7 A;  3QT5 A;  2UXD F;  5B0B A;  2YQ1 A;  2J7K A;  4RBU A;  4OJ3 A;  3N5B A;  4ANE A;  1FFW B;  5CYM B;  5IXU A;  1KD1 T;  1EKR A;  2HQF A;  1YRX A;  2OPP B;  1GMW D;  2HFV A;  4ATN A;  1KLM B;  3GYN A;  3MM5 B;  3K89 A;  1IKY B;  2QL5 B;  2DXF A;  4DQS A;  1GMW A;  2XBP A;  4H54 A;  2W9C B;  3BRE A;  2VOD A;  2EXU A;  1U1P A;  2AD9 A;  5DQI A;  4WTY A;  4JV0 A;  4DQP A;  3NS5 A;  1Y3K A;  3ZNU A;  1Y00 A;  3MAA A;  1VGY A;  1GXU A;  1GQE A;  4MKV A;  1RTI A;  4I4B A;  2AYG A;  1NK7 A;  1ZET A;  2ZBP A;  2VFT A;  1MWZ A;  2R7O A;  4NLD A;  3UVJ B;  3CE8 A;  2YWG A;  5KOW A;  1U2C A;  4B3T J;  4I7F B;  4WKR A;  4CZC A;  3KJV B;  1CJV A;  2DKO B;  2IM0 A;  2R4F A;  4L72 B;  4IFV B;  2CPH A;  3OHB A;  1OQ3 A;  4P7T A;  2EFO A;  2HFO A;  2WZ1 A;  2GX8 A;  5C25 A;  5GMK a;  1KQG B;  1Q8L A;  3SQO P;  2GJF A;  4Y34 A;  2IAJ B;  4LF7 J;  1YJU A;  1HKA A;  4J9U E;  3M9N B;  4CO3 A;  3L3C A;  2HBQ B;  4OX9 J;  4U9R A;  1W25 A;  2MKK A;  5D4P A;  1SQF A;  4AUK A;  4DZD A;  1JLA A;  4F04 B;  5AXN A;  2CQB A;  3ZZY A;  1RLC L;  4XDC A;  2FJX A;  2QIF A;  2XY6 A;  3KK1 B;  3ELH A;  5IT9 U;  5KFE A;  1J5E F;  4XTT A;  3MHY A;  1Q81 T;  3VVT A;  3KJQ B;  3EXC X;  1VOM A;  4P9S A;  4MAK A;  1CVJ A;  3LOU A;  4F25 A;  3EIC A;  2D3O 1;  2DCU B;  3QID A;  4NLR A;  2Q43 A;  1RT6 B;  1U09 A;  3L09 A;  2DNQ A;  2FQQ B;  2J6U A;  2VJV A;  4JI8 J;  5L1K A;  2P6T A;  2XY7 A;  3LAN A;  4C2M A;  1EAY C;  2FJE B;  2RDJ A;  1WOR A;  1HWJ A;  3NAH A;  5HRO B;  3DOM B;  5D4N A;  1BQN A;  3CED A;  3G8S A;  3HSJ A;  1MWQ A;  3M32 A;  3W2V A;  2XYH B;  1EQM A;  1UVM A;  4B9M A;  2WTF A;  3ZXW A;  3W3S A;  2FLO A;  3PX4 A;  2QX0 A;  4L74 A;  1ZAW A;  4QBU A;  1NZ8 A;  3LP0 B;  2PFF B;  2FVS A;  1ZZF A;  2DPI A;  2R7X A;  5DDQ C;  2DGS A;  1D3W A;  4NLX A;  3CCE S;  1APS A;  1RT5 B;  4NCG A;  1UTA A;  4F4Z A;  4YDX A;  2BVZ A;  2OPQ A;  4J9N A;  1W2B R;  2RKI B;  2DIS A;  3KG4 A;  2E1M C;  4J9K A;  1SVD A;  4KB7 A;  4IFY B;  1XJW B;  4CDI A;  3CDU A;  3QJJ A;  1YQH A;  4P2S A;  1YI2 S;  5C7P A;  1EX8 A;  3OTB A;  4WK3 A;  2CAJ A;  4K0K J;  2KVQ E;  4GKK F;  3Q8U A;  2X1F A;  4LIW A;  3VZI A;  2XS5 A;  2GO8 A;  4U8Y A;  1QAI A;  5IT0 A;  3CD5 A;  1EP4 B;  5DQG A;  3JQK A;  2UVU A;  2HFN A;  2AYM A;  1UW4 A;  2VG6 B;  1JLG A;  2VFS A;  3PJX A;  4ECQ A;  3CDW A;  2V8P A;  3CDE A;  1WSR A;  1KEK A;  3VCD A;  1M5K C;  3TEG A;  1EZZ B;  3RAQ A;  2K1R A;  2V68 A;  1IKW A;  4G1I A;  2ZHA A;  1QUV A;  2XQC A;  3VAJ A;  1MU2 A;  3GFZ A;  1KQF B;  3PJ9 A;  2CQ0 A;  2IDL A;  4DSL A;  1Z2L A;  4CLK A;  1WEL A;  3NGS A;  5B0E A;  3SDE A;  2YKM A;  2C2R A;  3LWL A;  3Q8R B;  2FB0 A;  3HHK A;  1MW7 A;  3QAE A;  1C4C A;  1CJU A;  3MTJ A;  3OSP A;  1UJ4 A;  4Y3C A;  4KE5 A;  1BLU A;  3FUY A;  4LBH A;  3A3O B;  3MXH P;  5KG0 A;  1MG7 A;  2P2C B;  2IVF B;  3ETO A;  1HBN B;  3L7U A;  5B0G A;  4KFB B;  4DOZ A;  3HDS A;  2NPF A;  7FDR A;  3MEG B;  1ROF A;  2XY5 A;  2E66 A;  2BM0 A;  3HMJ G;  2XGP A;  3BH7 B;  1ICE B;  3NOC A;  4ELV A;  4CYU B;  5KFH A;  2MZ1 A;  1LQ9 A;  2WHO A;  1T3N A;  3U27 A;  4MTP A;  2HS3 A;  5KFC A;  3OR1 B;  4TKT A;  5J1E B;  1J5O A;  3GIM A;  5KFX A;  3MEE A;  1BXN A;  4A8S A;  4F0K A;  2ZDO A;  5L46 A;  2J9E A;  1NJI T;  3G71 S;  2AJF E;  2DNK A;  2KVI A;  3G86 A;  4OLP A;  3GMG A;  1SC1 B;  1BC6 A;  1BY9 A;  1JXV A;  3FVY A;  1FX4 A;  4USW A;  3DLB A;  2ZH7 A;  2QLJ B;  5J2Q A;  1BWE A;  1OIA A;  1S6Q B;  3GTY X;  2CWX A;  2HHX A;  3CCR S;  3TA0 A;  2AGQ A;  2YH1 A;  3R7B B;  1RTH A;  3M2U A;  2UXB J;  3HT3 A;  3B4D A;  5HSP A;  3MR7 A;  1YLX A;  1L3U A;  5D0H A;  3W61 A;  3TOQ A;  4ZIV A;  2H4Y B;  2M7S A;  3W65 A;  3SFG A;  2Y1L B;  4PWU A;  1DTQ B;  4DR2 J;  1CJV B;  4C11 B;  3A8E A;  4OJ1 A;  4JI6 F;  2F8E X;  3OFE A;  1E6Y A;  3QLH A; 
#chains in the Genus database with same CATH homology
 2MQ8 A;  2MEW A;  4JI6 J;  4DR1 J;  4DV7 J;  4DV6 J;  4LFA J;  1XNQ J;  4JV5 J;  1HR0 J;  4OX9 J;  2HHH J;  4DV0 J;  1IBK J;  1N36 J;  3JAM U;  4DR4 J;  4LFB J;  1N32 J;  2UUB J;  3D3B J;  4X62 J;  3OTO J;  4LF9 J;  4JI4 J;  1HNZ J;  4PWW A;  1HNX J;  4DR7 J;  5IT9 U;  4DUZ J;  1N34 J;  4NXM J;  3T1Y J;  4V1A k;  4YY3 J;  4LF8 J;  2UUA J;  4YHH J;  4DR6 J;  4DUY J;  1J5E J;  4B3S J;  4JI0 J;  1HNW J;  1XMQ J;  2E5L J;  4KY3 A;  2VQF J;  4AQY J;  5LM7 E;  2UXC J;  4X65 J;  1I94 J;  1IBM J;  4LF5 J;  4DV3 J;  4B3R J;  4JYA J;  3J7A N;  3J81 U;  2F4V J;  2ZM6 J;  4NXN J;  4B3M J;  4DV4 J;  1XMO J;  5LMU J;  4GKJ J;  4JI1 J;  5LMN J;  2UU9 J;  4JI8 J;  4DV1 J;  4JI2 J;  4KYZ A;  3R2D J;  3R2C J;  3IMQ J;  2KL8 A;  4K0K J;  4NEY A;  3J80 U;  2KVQ E;  4LFC J;  4B3T J;  4HHU A;  4RJV A;  2UXB J;  2VQE J;  1FJG J;  5AJ3 J;  4GKK J;  4LF6 J;  3T1H J;  4JI3 J;  1N33 J;  2UUC J;  4JI5 J;  4KHP J;  4NEZ A;  5IWA J;  3W1Y C;  5FLX U;  1XNR J;  4X64 J;  5BR8 J;  4DR2 J;  4X66 J;  4DR5 J;  4DV2 J;  4LF4 J;  4DR3 J;  4DV5 J;  2MTL A;  4JI7 J;  3D3C J;  4LF7 J;  2UXD J;  1IBL J;  5A2Q U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...