1WELA

Solution structure of rna binding domain in np_006038
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
GSSGSSGKSPSGQKRSRSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRNEADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 12
publication title Solution structure of RNA binding domain in NP_006038
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1welA00
5LSLA 3Q2TC 4PKDB 2VOPA 2HYIB 1RKJA 2MQPA 1K73T 2L08A 1WF1A 1FT8A 2LCWA 4W92B 2CPHA 2CPIA 1D9AA 5BJRA 2N3OA 4WIIA 4WKRA 2U2FA 3UCZP 3G9CA 4Z2XA 2YKAA 2RRAA 1YJWS 1NJIT 1OIAA 1Q86T 3G4SS 3UD3P 3IWNC 2DH7A 3VAHA 2KXNB 3UCUP 1B7FA 3H2VE 1SJ3P 2KU7A 2DNGA 2CQ0A 1NO8A 5CXTA 2MPUA 2CPJA 1H2VZ 1FHTA 1WG5A 2YH1A 2CQ2A 3V4MA 1JJ4A 1L3KA 3R27A 3MDFA 3VAFA 3K0JA 1QVFR 5ITHA 3J7ZT 2CQIA 1WHXA 2LKZA 2RT3A 3G6ES 3FEXB 3CCLS 2MGZB 1UP1A 5DDPC 2MKKA 2OTLS 2LYVA 4OZ0A 1X4FA 2N82B 2CQ3A 5D78A 3CXCR 2CPXA 2PEHA 2RVJA 3S8SA 2MZ1A 3J7YU 1ZZFA 2GHPA 2X1AA 3CPWR 2EK6A 5EN1A 4OZ1A 3DXBA 2KH9A 4UQTA 2KG1A 3I55S 1WEYA 2DHSA 2DGTA 2MQOA 4FXVA 2DISA 3S7RA 4QU6A 1P27B 4IO9Q 1D8ZA 3VAIA 2HGMA 5LSOA 1ZH5A 1FJ7A 4CQ1A 2E5JA 5DM6Q 1F9FA 4FXWA 4C4WA 5LJ5Y 3D2WA 2M70A 4CH1A 1VQPS 5H1SV 2KN4A 5HO4A 2DNMA 3G96A 1VC6A 4V19X 4TU9A 2DNPA 2RRBA 3S6EA 1OWXA 1X4BA 2F9DA 3NS6A 4LIRA 2KM8B 1YITS 2VONA 4LMZA 2DH9A 2RUGA 3N9UC 1WF0A 5JVHQ 3SXLA 4CH0S 2MJNA 2M88A 4P6QA 3EGNA 1VQ9S 2XS2A 1JJHA 3LPYA 2LECA 2FC8A 3L3CA 4LJMA 2MJUA 3UE2A 1PGZA 2XS5A 2DHXA 2QEXS 2CJKA 4Y00A 2N7CA 1ZZNA 1S72S 2MY7A 1W2BR 2MSTA 2OIHA 2MZJA 3SDEB 3RW6A 2CQPA 2F3JA 1M5KC 2M7SA 1A7GE 5DM7Q 1X5PA 2KXHA 2RS8A 1VBXA 1KQSR 2BOPA 2MY8A 2FHOB 3G8TA 1VQ4S 1X4EA 2I2YA 2QFJA 2ADBA 2CQHA 2OSQA 2CPDA 3ULHA 1JMTA 4WFAQ 4PRFA 1WTBA 4IOCQ 3DLLQ 3PIPQ 1KD1T 2DHAA 3B4DA 1VC0A 3BO4A 2KYXA 2DHGA 2L9WA 2SXLA 2KM8C 1H2UX 1WHWA 2MKCA 2XNQA 2RQCA 1M5VC 2E5IA 2AD9A 2MKIA 2VOOA 2BZ2A 3MI7X 3VAGA 2M8HA 1O0PA 2CQ4A 1K9MT 1VQOS 3BO2A 2G0CA 5IM0A 2DIVA 2GO9A 4BS2A 3CCJS 2LEAA 1Q82T 2ZJPQ 4IOAQ 5CYJA 1URNA 3MXHP 1OO0B 2CPZA 2MYFA 2LA6A 2L41A 5FJ4A 2CPEA 3MOJB 2DNZA 3I56S 2J8AA 2YWKA 2M52A 3P49B 1DHMA 1R8HA 2J0QD 2A3JA 2G4BA 5GVQA 2MQLA 1SXLA 2B0GA 4IUFA 4YOEA 1M1KT 5D77A 1VQLS 1UAWA 3FEYB 1X4HA 2AYEA 2CQ1A 1HD1A 1HD0A 4UY8T 4C7QA 2G1DA 2K3KA 1SJQA 1CVJA 2JWNA 3VAMA 2MB0B 3NNHA 1X4AA 1YJNS 1X5TA 3MURP 2DGUA 2DGSA 2DNYA 2NZ4A 3P3DA 1U1PA 2KVIA 4QQBA 1G2EA 2OSRA 2ERRA 2KT5A 2DGOA 3VAKA 4TLQA 1U1KA 1WHVA 2KRBA 1U1QA 1NU4A 1M5OC 3HHNB 3PIOQ 3MUVP 2RQ4A 3UWTA 1X4GA 2CQGA 4EGLA 2AYBA 2CPYA 3G71S 3THTA 3JB9k 1N88A 5HL7Q 2EK1A 1Q81T 3MUMP 1WEZA 3CMAS 2DNQA 3MD1A 1WG4A 2RU3A 5JVGQ 2FY1A 5DDQC 3IRWP 2KI2A 4PR6A 3NNAA 2E5GA 1WELA 1WF2A 4CIOA 2M9KA 2XS7A 2MZSA 4TU8A 3VF0B 5LXYA 1AUDA 1R8PA 2LA4A 3CC7S 3CCRS 4ZKAA 1VC5A 1Q7YT 2DNRA 3U1LA 1UFWA 4YUDA 4C0OC 2LXUA 4F25A 4Y0FA 1HL6A 3ZZYA 2D9PA 2DITA 2DGVA 2CQCA 2DIUA 1M90T 1BY9A 5DDOC 5MLCV 2JVRA 1YIJS 2J76E 3LQVA 2K8GA 1IQTA 2YH0A 2PE8A 1UW4A 2D9OA 1FO1A 1X0FA 3BS9A 2DO4A 5GMKa 2YTCA 1WI6A 5GAEU 1X5OA 3VAJA 3EGZA 1DRZA 1VQ7S 1VBZA 2CQDA 2KG0A 2XB2D 2JVOA 2HVZA 2LEBA 3NS5A 1X4CA 2DNLA 2DNNA 2E44A 4M5DB 2JX2A 2DNOA 3TP2A 4YB1P 2DK2A 3TYTA 2F9JA 1HA1A 5CA5A 2MQNA 1DZ5A 1SJFA 2M4MA 3CD6S 4TU7A 2I38A 3ZZZA 5GADU 2DGQA 2MGZA 1YHQS 5LXRA 2KHCA 1KOHA 2MHNA 1VQ6S 1PO6A 2V94A 2X1FA 2NLWA 1U1RA 3CULA 2HGLA 1P1TA 2LXIA 1U1MA 1FNXH 2AYGA 2DH8A 1FJCA 3H2UB 1M5PC 1SJRA 2ZJRQ 3U1MA 2U1AA 3THPA 1YWXA 2LMIA 2M2BA 2OTJS 1N52B 3CCVS 2KFYA 1WWHA 1N54B 1X5SA 2M0GB 2MZQA 3NMRA 3CCSS 5DETA 1U1LA 2ZJQQ 2MXYA 2AYMA 2N3LA 2WBRA 1QVGR 2XNRA 5DDRC 2VODA 5IM0B 3NNCA 1K8AT 2MKJA 2EVZA 4W90B 2FC9A 1VQ8S 2JRSA 4RU2A 2UP1A 4QPTA 3CUNA 1N8RT 5LJ3Y 2KRRA 2MSSA 4ED5A 2D3OR 1H2TZ 1S79A 2Q79A 3EX7B 3R1HA 4ERDA 3RW7A 3HI9A 1KOOA 1X4DA 2M8DB 3CCQS 2E5HA 3UCGA 2MMYA 1H6KX 1VQ5S 1XN9A 2MKHA 3UD4P 5GAHU 3P6YC 1U6FA 2QA4S 3CTRA 1U2FA 3MUTP 2MZTA 4U67Q 2HGNA 2MQQA 3Q2SC 3TO8A 3P5TL 1WG1A 3CC4S 2MZRA 3SDEA 2OJ3A 1WEXA 4WF9Q 2DNHA 1YTYA 1VBYA 2DGXA 2MKSA 2DO0A 3SMZA 5GAGU 3R1LA 4F02A 1VQNS 1FXLA 1RK8A 2X1BA 3BEGB 1JJ2R 4WFBQ 2RS2A 2DGWA 3VALA 2O3DA 3CMES 1U1NA 1YJ9S 3S01A 4J5OA 2X1GA 2DNKA 2ADCA 2XSFA 1SJ4P 3CCMS 3MD3A 1OPIA 2FPHX 1VQKS 3US5A 2CPFA 3B4MA 2KXFA 3OW2R 4F26A 3CC2S 5IQQA 1QM9A 3CCES 1WHYA 1U1OA 5IFMA 3CCUS 3BO3A 2RNEA 4A8XA 2J0SD 1WI8A 2HZCA 4WFNQ 2MQMA 2CQBA 1YI2S 4WCEQ 4QU7A 1A9NB 2DB1A 1KC8T 1FJEB 1VQMS 1U6BA 3CF5Q 1DBDA 2LQ5A 3G8SA
chains in the Genus database with same CATH superfamily
1YKWA 3OXLA 5E33A 2V8PA 5G0RA 1WSVA 3DFEA 4LF1A 4ZIWA 4J9RA 1WTFA 1OIAA 4M95A 4IOBA 3IWNC 4HHUA 3VAHA 2EWHA 5G4DA 1JLBB 1RWVB 2KU7A 2OELA 5F8MA 3HPOA 3HO1A 2Z0GA 4F7VA 4K4UA 4PG7A 1VFJA 3X3UA 3M6UA 2CA9A 2EFNA 2M5YA 1JX4A 3MHYA 1WC1A 3A8JA 3DOMB 3FEXB 3W61A 3HZGA 5HBMA 2ZDPA 2RHSB 4F2SA 3CGIA 3CXCR 2PEHA 3WC2A 3D66A 2QIFA 3CJRA 5B0BA 4DUYJ 4UT4A 1ZPWX 2LVWA 5I42A 3KG0A 1L3SA 4Y3CA 2BX6A 2HGMA 2W1BA 4FPIA 3OL8A 2I5JA 1X9SA 1NDLA 1SVDA 3I0SB 3C14A 1ROFA 4OJHA 1X4BA 1YITS 4PZVA 1XQIA 5DGAA 4PG4A 1RWKB 2BW7A 3V81B 4J9QA 1FRKA 2YWHA 2WRMA 2QEXS 4KR0B 2GS8A 3D1HA 3RAMA 4GRSA 1KQSR 2MY8A 4KHMA 2W25A 4JI1F 3DLLQ 3M05A 2BKOA 3CVKA 4DR5J 4OI2A 1IKYA 4HH1A 2XNQA 3HSGA 2RQCA 4OI6A 1NK6A 1JNZB 3O5TB 1IBKF 2BZ2A 4OHVA 1VQOS 2G0CA 3ZTPA 5E5NA 2YX4A 1FE0A 1T95A 3MOJB 1S9FA 1TTHB 3DXSX 5SZTA 4PYDA 1HQUB 3SSRA 1K0TA 1W7WA 2YKNB 2IDEA 4ZMMA 1U1PA 4YR2A 2LP4A 1G2EA 4KKOB 1WHVA 4FZVA 4YB5A 1YBTA 2V9KA 3HHNB 2WONB 5J1NA 1I5OB 4KHPF 4CT8A 3BKFA 2KFNA 2DNQA 2C42A 1RZMA 2HS3A 4OI3A 1RHQB 4CM0A 3TQ1A 4MMOA 1RACB 1R0AA 3TW0A 1KEKA 1TUVA 5IT9U 4DFPA 2D9PA 3K8VA 4FYYB 1VCTA 3QAEA 2ZHAA 3T19A 3OD2A 3BS9A 1HWLA 1TMMA 2WBMA 4I7FB 4IR1A 3RTVA 4WBFA 1YGYA 1D3WA 2W9CA 1H74A 2XLKA 2N4DA 3KLFA 5CA5A 4OYAA 2NREA 3C19A 4ELVA 2D74B 4UZCA 5GADU 2KZZA 2GJIA 4KH1B 1U0HA 3BKUA 3H20A 2U1AA 4NLXA 5IC4B 4RW8B 4ZLJA 4F04B 3QNWB 1SL1A 1TKZA 2IC3A 1UPMB 1XMQF 4ZVHA 4P71A 4WXOA 1UVKA 1NSAA 1RTDB 1OSDA 3V6HA 2FLPA 2VH7A 2UP1A 3H98A 1F3VA 4GC6A 1KOOA 5T7LA 4O3OA 4DL7A 3O44A 2V9WA 1U6FA 1NB7A 1S57A 3TAMB 5D4PA 4LQ3A 2E1CA 3Q8RB 3GV7B 2L9NA 3AJ2A 4ELUA 3CJKB 3CDWA 4LR7A 2CDRB 2Q1LA 4IH6A 2HQFA 3V2UC 3SFGA 5LMUF 1QDUB 3L09A 4MYTA 3NBPA 2G2YA 3R97A 3AJDA 5A76A 3ISNC 2VQFJ 3MD3A 3TVKA 3UVJB 1KWMA 4OV1A 1N34F 2UXCJ 4R25A 1P9QC 4F26A 4ID5B 4LRBA 3H4DA 2FJEB 3QT8A 2FJVA 3WDOA 4F36A 3EVWA 1FWLA 3V6DA 3MMBA 4NLWA 3DOMA 3D0GE 4OYMA 3G9CA 4DX5A 3Q8VA 4ZPAA 3LO3A 4LREA 2OD4A 4ED1A 2ATCB 3OTOJ 4DMZA 2FVPA 1JQGA 4B3SJ 3EXCX 1FDNA 3IBWA 1S6OA 1KR4A 5DQHA 2MGZB 4KGVB 3FRZA 4DV0J 5D78A 2CPXA 3D4JA 3PO4A 3QGIA 4DUYF 1S4FA 2JEJA 2X1AA 3OUYB 2GO8A 3DXBA 2KG1A 5MAOA 4USVA 1SC1B 2HNZB 1HWUA 2OPSB 1BLUA 3VQTA 4DQSA 4CCHA 1WUUA 2HRUA 5LM7E 5HMZA 2KN4A 1KLMA 3I82A 1RWPB 4J9SA 3BKTA 5CH7B 3BGRA 2ZBQA 1NH8A 1RYSA 3H7HB 2VKZG 3QGHA 1IQZA 3VHQA 3M30B 1UMJA 4P6QA 2FC8A 1S1VA 2OFGX 1FKPB 2N7CA 4E98A 1IR0A 3KUEA 4J9MA 4R0JA 2HMIB 2YPZA 2UZAA 4I2PA 3TUIC 1UETA 4LF7J 3AOCA 1VC0A 3MEDB 4X62F 2WVBA 1T9VA 1EP4A 2L9WA 4DF4A 1UZHA 1BQMB 1YZ7A 1S12A 2FTRA 4ED7A 2AZ1A 4IOAQ 3VTIA 4A8MP 3WIUA 1RTHA 4JUZA 4ED0A 1RHJB 4NPOA 4EU0A 3LP0B 5DLFA 3TR5A 2OEJA 3HF5A 4Q7AA 1TVRB 4PXDA 2C2EA 4PWWA 5GVQA 4ES2A 3M2VB 1APSA 2YNGA 3R6GB 4ILMA 3ICLA 1U7LA 1MMNA 5IWAF 1N32J 3I5AA 4O3SA 1BWVA 3MWBA 3W66A 4RUAA 2RQ4A 4JI4F 2CPYA 3W9HA 3THTA 4RW9B 1IKVB 2EW9A 4NCGB 3GP9A 1FTRA 1G7CB 1AB8A 3JYTB 2O66A 3IA0A 4O0IA 1NK0A 4FKYA 1U26A 2CVEA 3VF0B 5CCMA 5FD1A 4DR7J 5B0GA 2Z57B 3A3NB 5DDOC 1JNRB 5HVHA 5J1PA 2DO4A 3NWRA 1RABB 4HEA9 1FKOA 1VISA 4HTIA 2F4VF 4URQU 2H54B 1R89A 1RP5A 3PRBA 1ITPA 3G82A 5K20B 1QSYA 2Z4PA 4YB6A 3CD6S 2IAJA 1NNDA 2IJNA 2NLWA 2JH3A 2NPIA 1WC3A 3U1MA 4DFMA 4NZ6A 1U2RA 2HHTA 3TAMA 4AL6A 3J7A1 5DETA 4IFVB 2JJ4D 1C4AA 3BR9A 3TOQA 2JDJA 2HK3A 2WBRA 1NK5A 3ZTSA 2KJWA 4OYZA 1N33J 3N79A 2PMWA 1KLNA 2YNHA 3NEKA 2KZMA 4N5SA 2CVIA 1PIEA 3CTRA 2MZTA 2V63A 1BE4A 4Y2KA 4D3HA 1HBUB 4H4OB 4RW7A 3DMJB 1YTYA 3GIIA 4KQZA 4I4BA 2QL7B 3CNQP 3ZTOA 2GIFA 2NUHA 2RS2A 4KSEB 1TMJA 2E9RX 2UUTA 3EZUA 4L3KA 4F0MA 2VQFF 3M8QA 2RDDA 3B4MA 5FDLB 3BJYA 3QBCA 4JI6F 5A2QY 1TL7A 4ED4A 4LSLA 2IIHA 1WI8A 3CCTA 4LVNP 3W63A 1YI2S 2DY1A 1DBDA 3FMBA 1PILA 1KONA 4BC9A 1EZZB 2UVUA 3MAQA 4TY8B 4X4OA 1SJ1A 4IDKA 3W8PA 1S0NA 4OZ5A 5C25B 2DEJA 2DH7A 3OTOF 4NLSA 3AQPA 1VS3A 2CJ9A 5C7PA 1H2VZ 4DPUA 5GMDA 3MDFA 2NXJA 3LF0A 2CQIA 1N5YA 1S77D 5KFLA 1NSKL 3R8YA 2V4JA 3S8SA 2RHQB 2AMCB 1NSPA 1LWFA 3BYRA 2IHR1 3CPWR 3W60A 4MYUA 2DHSA 3KMQA 2CWXA 2UUAF 4AT1B 2KL8A 4OZLA 4NL5A 1CJKB 2HFOA 3M8PA 4CO4A 2BJ8A 5LJ5Y 4JI8J 2Y0SD 1DFDA 4YR3A 3ADAC 3TANA 2DNMA 3G96A 2EBGA 2LU2A 2HKEA 4LSNA 2ZZTA 1T05B 2UXBJ 3SIPB 2F4FA 4AL5A 3IR7B 4GKKJ 4WXWA 4CLKA 3DDKA 2LECA 3HHLC 2VFUA 3D0HE 2GJFA 3G2XA 2MY7A 3RB3A 3CD5A 1J5OA 2XCPA 2RS8A 3N6NA 2V69A 1TU0B 4QIFA 4LF7F 5F8JA 2OSQA 4K2XA 2CKWA 2DEIA 3BH6B 1KD1T 2XGQA 1QSLA 2YWWA 3I87A 2JC0A 3Q8PB 3CT9A 3MM5A 2KM8C 1B0TA 4PPDA 1WHWA 4DSJA 2ACMA 3DDNA 4DU8A 2OHDA 1O0PA 8RUCA 3AQOA 3GSIA 2EFGA 2YNFA 1FE4A 1QUVA 5T14A 3EZOA 4CI0B 3QRQA 5EHHA 4DV7J 2ZVSA 4CNYA 1TAQA 2BRKA 3TJAA 3GJRB 3NWGA 2G4BA 3PW2A 3HMJG 4DF8A 1QY7A 1XR6A 2ZNYA 1D8YA 2ZE2B 2HK2A 4K4WA 5DRKA 4NXNJ 2X7IA 3Q8SB 1S9GA 1S7IA 2DGSA 5E3AA 3ZZ0A 1KVIA 1S9EA 1SQGA 1U1KA 2KRBA 2QC3A 4QWDA 4DPOA 4M94A 5F8HA 4C8OA 3M8WA 2R7UA 3Q83A 4BHQA 1NJXA 1C1BA 5DGBA 2KI2A 5HSPA 2E5GA 2M9KA 4DXLA 3CC7S 3CCRS 4N76A 4DR7F 3PEJA 3N6LA 1VC5A 2Z2LA 3MPVA 4Y0FA 1M90T 2HHHJ 1BY9A 2F40A 2VICA 1NEEA 2YH0A 3QJPA 3KOAA 1SBRA 2BJEA 5AE3A 3CE8A 4RUBA 1VQ7S 3PO5A 4B9VA 4CH7A 1FKAF 3R6LB 4MKAA 4IFVA 2RRNA 3T1YJ 4O44B 1KDNA 4GKJF 1SJFA 2UU9J 3M8ZA 3CCZA 4TU7A 3ILIA 4TYAA 4EWTA 1PO6A 2V6AA 1FNMA 1FXRA 2V94A 3PJXA 3CULA 1TZ0A 4FKXA 2XI3A 2AZ3A 2F5GA 2YX7A 2RE1A 4J9PA 4DV3F 4XDDA 4IH7A 4OI4A 3FSYA 3IWLA 4JI5F 1F9HA 3M1VB 3QFWA 2Y0BB 2GIRA 2VB6A 3RJMB 3A13A 2RKIB 4KHRA 3GJSB 3DLBA 3KK2B 3NY0A 2HBZB 2ZH1A 1VJQA 4LBIA 3KXDA 4ZN3A 2I0XA 3QLHB 2VC1A 2B6AA 5LJ3Y 2XHCA 5IXUA 1RT7B 5B0AA 3CJSA 3QRPA 1S79A 3JSMA 2HS4A 3B8HA 2GZOA 5GAHU 1TV6A 4LRFA 4C2MA 1GT8A 3LOUA 2R3VA 2B3TB 3DM2B 4KGXB 1X7VA 5K14A 4J9KA 2MKSA 2CNOB 4JYAJ 2DGWA 5ADZA 1OYEA 1V3SA 2FYXA 3WQPA 1C1CA 3DN9A 4K4SA 2ADCA 4USIA 1DTTA 1CLFA 1OPIA 4KB7A 4OX9F 4K4TA 4RR5A 3M32B 2QA2A 5IFMA 1ZOTA 3MM9B 3RAXA 4EI2A 3CF5Q 4Y34A 3LWLA 1TL1A 3DRYA 2HHPA 3JSYA 3NGUA 2RUSA 3PXGa 5HROA 5AXKA 5C42B 1LEOA 2LCWA 1F2HA 4LT6A 1HBOA 1YJWS 1NJIT 4B3RJ 3I31A 1SQFA 2NXCA 2UUCF 2HQCA 3TJ9A 4KO0A 5J2MB 1M5SA 1CQMA 1IKWB 4NLDA 5DO2A 1JLGA 2DBBA 4UOCA 3HVTB 1M5HA 1UJ6A 1RT3A 2R42A 2XC9A 2BE2A 1PBUA 1H0HB 2QX0A 4LFAF 5KG5A 2N82B 5F0UA 4P2XA 3M6XA 1FFSB 1UEUA 2WW4A 3QIPB 2YKQA 3MMCA 2MDAA 3O3LA 3CMQA 4C8KA 4LF9J 4JI8F 2OKQA 4M5IA 5H1SV 4DR1F 1TFYA 1N36F 3UR0A 2IVFB 3S6EA 2F9DA 2VD3A 4LMZA 1T9XA 1Y00A 3ETMA 3N9UC 3NL0A 3TX8A 2E66A 2VBXA 3BR8A 2M88A 1VGYA 4B9TA 2AWZA 2XS2A 3LPYA 3PZPA 2ZC3A 2MJUA 1HQEB 2F3JA 2R7XA 1EJ7L 3CJ4A 1CEZA 4I6YA 5IT4A 3OFGA 2VPZB 2ADBA 2WOMB 2C3UA 4MH8A 5D0RA 3FJ2A 2GFFA 4ZOSA 2WB4A 5B0DA 1WOOA 4JV5J 2VU5A 3CJQA 4MTPA 4ENOA 5B0EA 3MI7X 1V5IB 2CQ4A 1EHWA 4E0DA 4TYBA 2DIVA 5KT6A 4BS2A 3JTPA 3CCJS 2VJVA 4DV7F 1DY3A 4JI7J 4Q5VA 1JLFB 2CPEA 1Y0HA 4NMXA 2ZNZA 1QAYA 4NASA 1R8HA 4DG1B 1E6VB 3N6MA 4LSZB 2G9OA 2HHWA 1HBNB 2AP6A 2YNIA 5KTQA 1TKDA 2HURA 3A3OB 2BRLA 3MPWA 1GNKA 1RLDA 2XI2A 5IT0A 1KTQA 1VDHA 4DHVA 3BPSP 2DGUA 1HNIA 2BM1A 1M5OC 4ANDA 2UXDF 2H9ZA 2BDPA 4IG3B 2HW3A 4LRAA 5HL7Q 3GV5B 1NJYA 1WEZA 4WE1A 3UFCX 4ICLB 1EKRA 1SC4B 4HACA 4NLUA 5DDQC 1C4CA 4TN2A 1FJGF 1RT6B 1VLYA 1UWAA 1U2CA 2E1PA 3TQEA 4GVLA 4USHA 2GVDB 4NLVA 5E3QA 2H5EA 2BEFA 3OR2A 4UW2A 3MEKA 1TFWA 2MLYA 1RLCL 2PE8A 3DLEB 1TK8A 1ELOA 1X5OA 3OQ2A 2VUGA 5HI7A 3EGZA 1YG0A 1Q5VA 2FDNA 1KSPA 3K59A 2E44A 3HD1A 3T1YF 1ACMB 1HNXF 1G1XA 3TP2A 2UU9F 1FCAA 2DK2A 2P9GA 3T3FA 4ZVSB 3RG6A 4AXJA 1LV5A 4UOGA 2YWEA 1B0VA 3W9IA 3D68A 4HT5A 1C2PA 1PJ5A 1GXTA 4K4YA 4W98A 2CYYA 2YBVA 2KFYA 4ZS6A 3NMRA 1CG2A 3QWUA 2KVQE 5KFNA 2BJ1A 4ZN1A 2UVRA 3BSAA 3ENAA 1XNQJ 2X51A 4RW4B 3O2IA 2KRRA 1M1HA 3G6XA 1U49A 2HNDB 3MEGB 4UTGA 1X4DA 2GQCA 1YJUA 5HMWA 4ZVPB 2AJ2A 3UD4P 2ZZMA 2FZGB 3AXKA 3CDAA 2VG5B 4BDPA 4LBPA 2E7VA 4DL0C 3IWXA 2DGXA 1DLOA 1FWKA 4F02A 3H5YA 4AUKA 4OZ3A 2KFZA 3W2VB 1QJHA 1CSJA 1U1NA 4QR2A 4EK2A 1KNZA 4HYKA 1TAUA 2HAFA 2HRTA 4KPCA 4V19J 1EETA 1RTJA 4EUVA 5CQGA 3GYGA 2BXJA 4DPXA 1RA7A 1Y7PA 1RWUA 2IM0A 1FVSA 3GFHA 2IJFA 3QQCD 2BMBA 1VQMS 1QAXA 4PEOA 3G8SA 4DOZA 1RHRB 3AA8A 2VOPA 2B8PA 2HQDA 3TNVA 1K47A 3TA2A 4DV4J 1CJUA 2EG1A 1D9AA 3OJUA 4K8RA 1I94F 2JZ5A 2YKMA 3G4SS 2XGPA 4KY3A 1RAIB 4URSA 1FHTA 2YH1A 3J7YI 4P7TA 2ZH6A 3W62A 4F4KA 3IAM9 1JKHA 1RBOB 1F5CA 1PYTA 2OTLS 1WACA 2HWHA 4I67A 3MZIA 4HI2A 1EIYB 1S97A 5D4OA 3KLIA 2B43A 1FERA 1MWZA 2XY7A 5DQGA 3OTEA 4RWXA 4OZ1A 2KH9A 4UQTA 2ZVIA 4QU6A 3PACA 3D28A 4KIAA 5LSRA 5KFOA 3A1YG 5M2RA 3QJJA 4IRDA 1I1GA 4YHHJ 2V2QA 3I9V9 2QT7A 4ECZA 3VZIA 4ETZA 2IA6A 1NDKA 5KFCA 1UVIA 1PYOB 4Q0BB 2VONA 4LIRA 4URGA 1AW0A 1WNEA 5KG1A 4R0EA 4WP9A 3C6UB 3D3CJ 3PCOB 3DC2A 4Y00A 1W2BR 2AEMA 4A4JA 2JEIA 4IKAA 2R8GA 1VQ4S 4DSFA 3TVZA 3EXYA 3ENVA 2CPDA 1TKXA 3O6QA 4IOCQ 4OYXA 3CWJA 3C46A 2IPOB 8AT1B 3BO4A 3OVSA 2WB1D 1E6VA 2XHWA 4EFAC 1NSQA 2AKWB 4WYLA 3PW7A 2FHMA 4QIWD 1MG7A 2ZH7A 2PDAA 5KFQA 5IM0A 4R5PB 3NXZA 2GA7A 3T1HF 1HFEL 1OO0B 2LA6A 3HSZA 5HANA 1NB2A 1Y9OA 5A2QU 1MNEA 1LFWA 3KLGA 4N47A 4B3TJ 1VQLS 3CDBA 3MF5A 3K5MA 3W2WB 1LXNA 4IYQA 4ZDNA 4FDFA 2JWNA 3P5BP 3DOKA 2IYIA 1FWPA 2EC2A 4ECTA 1NHVA 2XZTB 3VAKA 4I56A 3SSSA 1RT2A 1DURA 4YDDB 5A8KA 2LU1A 4RBTA 2HIYA 3G71S 1P1LA 1N88A 4RUCA 2VG6A 3M8SA 2FY1A 1D0EA 4RKUC 2F8EX 1X8DA 1WF2A 3U02A 3DHXA 5EDWA 4JB8B 2DR5A 1ZAVA 5KOXA 2QLXA 5KFDA 4A8YA 3KHRA 3ZZYA 4CTAA 4ED2A 2XMMA 4IQMA 1UFKA 4JI0J 1NK8A 2FLNA 2J76E 3R5CA 1CJTA 2LXFA 1KTVA 2YTCA 5THWA 3GLJA 5CZXA 3CJ0A 2OEKA 3R5BA 2XB2D 3T5LA 4GO7X 3ZZOA 1PC5A 1UEKA 3KK3B 1G4CA 2R7SA 4PWDA 3ITHB 4O3PA 2OEMA 1CJVB 2R2RA 2VQEF 3ZNJ1 5CYQB 2DGQA 3A3PB 1RADB 3IMQJ 2CNNB 1REVB 3ET6B 2AYGA 3CO9A 1Q95G 7FD1A 3HHLA 1SJRA 1NDPA 1HKAA 1QSSA 4QWBA 5BR8F 1T3OA 2OPRA 2P9CA 4DQIA 2BKPA 4F3MA 3UPFA 1V3ZA 4WP8A 5KFUA 2B5JA 4J90A 2VF3A 4K5RA 4W90B 3W2VA 4EZ9A 3R1HA 3L7UA 2WZ1A 5AXMA 3U1NA 2HWTA 4CLUA 3SCLE 1GH8A 3LAMA 3RYLA 3I0RB 1L3VA 3D0IE 1NKBA 5LMNF 3DRPA 1YQHA 4ZPCA 2WAQD 4N8OA 4PABA 1VRUB 3AOAA 3CMES 3KFWX 1Q78A 3QGGA 1S6QB 1SL0A 3L9ZA 4OQJA 3C66A 2RU9A 3EWGA 1SJ4P 3CCMS 4IQXA 1XNRJ 2F63A 4M5LA 3CC2S 2DPIA 4A8XA 4NI2A 1IBCB 5K8MA 4IFYA 3D6FB 3G6YA 4DV4F 1TL3A 3ILJA 1KVKA 3F44A 1IN0A 1ZETA 2I9SA 4YP3A 2L08A 2HIQA 2N3OA 1FK9A 4Z2XA 5HN0A 2XMUA 5D3GB 1WC5A 1UWBA 2KT2A 1UJ4A 5LL6d 4NRTA 5IS2A 3PKYA 1AZSA 4G1PA 5ETQA 4U6PA 1FI4A 4CDIA 3J80Y 1UVJA 1X31C 3DGPA 3GPAA 1J5EJ 2C3PA 3CDUA 3C16B 4FBUA 4Q0BA 4DQRA 3FDSA 2RAQA 1L5UA 1ZZFA 2HNYB 2CJYB 4NA1A 1HW9A 5AE2A 3A12A 4OX6A 1GTHA 2MQOA 2DISA 4YHHF 2K7JA 1FJ7A 5HLFB 4OI1A 3DRRA 4FXWA 1HNZJ 4X84A 1CULB 5C2CA 4GVBA 1I3OB 4EYHB 4LF5J 3RZAA 3ZTRA 4RBVA 2K2PA 2ZWPA 2NSCA 3BN7A 1PG5B 4M5DA 2K7KA 4G1QA 4FP9A 2RQKA 1PKUA 2QRRA 1OQ6A 3IG1A 1KHWA 1AUSL 4FYDA 1X4EA 2OO4A 5F0WA 1R0BG 4DR4F 2FZKB 2GVZA 1Q0NA 1U47A 1RCOB 4RNHA 1LQ9A 5K9FA 3EVMA 3R7NB 3FEZA 1SC3B 5F9NA 1H2UX 1H98A 3HHEA 2AD9A 4HVZA 1IBLJ 1KN6A 3BDEA 2Q3PA 5FLXU 3F0NA 1RT1B 4O4GB 3LGMA 4QW9A 1HPZA 4EO8A 4NLYA 2RF2B 2MYFA 2XO7A 1JLAB 3PX0A 4NEYA 1DHMA 2J0QD 4B3TF 2J9DE 3Q86A 1OQ3A 2E5LF 4LFBJ 2QYGA 3H4BA 1CVJA 2ZOMA 2IRYA 4USKA 5KFGA 5KFFA 2OPQB 2D7SA 4K50A 1YJNS 3QMQA 1LWEA 4QQBA 1SIWB 4USUA 4Q8FA 4L3NA 3GCXP 4X4RA 2EFVA 3OLAA 2W7OA 3DYAB 2XZWA 4EGLA 2H1YA 3KG1A 4F4YA 2HZAA 1U09A 2EK1A 3NAHA 4QWEA 1U6ZA 3OSPA 4ECYA 1UZDA 2HFSA 4LQ9A 1F1BB 2ZH4A 4ED6A 2P8IA 2CQCA 2HEKA 2UVWA 3PR4A 1FA0A 5I3UB 2WVFA 3T5KA 3IP0A 4U95A 3ET6A 1UW4A 1BQNB 2YX1A 2L9DA 5KFPA 4AXIA 5IC6B 1QLNA 2VJUA 3SEOA 4ZP8A 3R3TA 2KKHA 1SUQA 2R8HA 3ZO7A 1NM2A 3Q23A 3SI8A 3E01A 5LXRA 3DDIA 4ZCMA 1S1XB 3RBZA 3W8GA 1R43A 1LW0B 1BC6A 5F8LA 2C3OA 1JJCB 5C24B 3OLBA 4UOHA 4ZVQB 1BMQB 5AXNA 4UZBA 3MECB 1Z4UA 4WU3A 4C3LA 3LW5C 1ZBTA 2MZQA 2AJ1A 2DR6A 5ETVA 1Y5LB 4YQWA 2NZCA 3KJNB 4YR0A 1E6YB 1FX2A 2FVSA 4HH0A 3RB4A 3P8BB 3NG8A 5GAGI 2IVMA 3LGHA 2VG7B 4ERDA 3QZ7A 2M8DB 3L7PA 1ZPVA 2H4WB 3EM1A 2HGNA 3P4UB 4U96A 4LR9A 3SDEA 2M3DA 3EZ5A 3CEDA 3KK1A 1FXLA 1RK8A 2PC6A 1FXDA 4H54A 1S6UA 3AD9C 3DLGA 1XNRF 4ED8A 4O3QA 5D3GA 2KXFA 3MAAA 3A8IA 5IQQA 4MKBA 3POTA 4ZVTB 2V2KA 3Q22A 2BQ3A 4DR3F 2CQBA 4N7TA 4N77A 4CM2A 1NBEB 3MCNA 4DX6A 3Q2TC 1NHUA 2C28A 3C16A 5B08A 3B6BA 2AHOB 3UQSA 4WIIA 4WKRA 2VV5A 3UCZP 2YKAA 4NMLA 3QJLA 2W4DA 3AFGA 4U7UD 3UCUP 1RHUB 3PW5A 3ETOA 3SFUA 1S1TB 2CPJA 1XTZA 3K17A 2ZZNA 3FCHA 2CQ2A 2ZH2A 2MHEA 2FY8A 4NWBA 3K5PA 3KYLA 1L3KA 2Q6CA 1SV5A 5T41A 3MEEB 3UNYA 2W24A 3KKFA 2RVJA 2J6SA 4CLZA 2GQQA 2VBZA 2G0JA 2FVQA 1HBMB 2Y3YA 5A0YB 2Z56B 3PVXA 4YB7A 1HNZF 4KC5A 4CQ1A 4B9NA 5KFWA 1Q53A 2J9CA 3GG0A 5BXIA 4ANEA 2M70A 5HO4A 4DJBA 1TELA 1VC6A 4KHPJ 2DNPA 2R8KA 2KDOA 2XSJB 2K06A 5JVHQ 4FYWB 3SXLA 3AD8C 4CH0S 4OFZA 1P8GA 1QUPA 2B9YA 4H4MB 2DHXA 3CCWA 3HT3A 4QOTA 1ZM3A 4Q45A 3DLKB 2R9LA 4OI0A 4QYRA 1Y5NB 5KT2A 3KLHA 1PAUB 2QMXA 4P2MA 3N28A 2OUGA 3PDNA 4KBIA 3ZZTA 5AT1B 1S49A 2SXLA 3EDRB 1XBWA 1IBLF 2V8GA 4NLQA 4I68A 3MMJA 2XZDB 3BQ1A 3QYYA 4OYWA 4CP5A 1AYEA 1PCAA 4USWA 2M52A 4LFBF 4B3OB 4C11B 2HFVA 1X4HA 3QRRA 3OHAA 1XEZA 1S6PB 2GAGC 5KOWA 2ROGA 5ETOA 1XMQJ 3TARA 2NUUG 4ZHRA 2BJ9A 2FJWA 4ZP6A 1VOMA 2DNYA 5J1EB 3HVRA 3JXOA 4QPXA 2IBOA 2MLXA 4JI3J 3H90A 1HWKA 1HMVB 3FSIA 2VZ9A 4XDCA 5ETTA 4DZ6A 2RD5C 4PXCA 5JVGQ 1SL2A 4J7CA 3NGKA 1DTQB 4QYZJ 4CYUB 1JLCA 2RIJA 3QGPA 4Q8EA 2DGVA 4DX8H 1S48A 3OTCA 1LW0A 3MCSA 5C24A 1LKZA 1S5ZA 1FO1A 5I3PA 1WI6A 2CDQA 3TA0A 1N34J 4ZK7M 2IVYA 2OLWA 3WC0A 3UNGC 1T94A 3NS5A 3IRXA 3I6PA 4RWWA 3FZBA 4RL1A 3TYTA 3OR1A 2PA8D 1XMOF 5BYQA 2ZBRA 4IG0A 4X66J 1BXNA 2F7VA 2JFKA 5LT5A 1T11A 2X1FA 1U1RA 1PJ6A 2ZUAA 4OYBA 2HHUA 2DH8A 2H5JB 3N0VA 1YWXA 3RRKA 3DRSB 2OPPB 3HJFA 4QR1A 2BKNA 2FB0A 4U8YA 2WVEA 1RT4B 2XNRA 4A8FA 3HK2A 1R0CB 2FC9A 2WVDA 4LUBA 4PG6A 5KAKA 3OT9A 3C6TB 5HK4A 3N01A 3OL7A 1PSDA 1U2FA 3IR5B 2XG8A 2XLIA 2MQQA 1H72C 5HJYA 1CS4B 3HULA 3I32A 2K1RA 4JV0A 2GMLA 1VQNS 2X1BA 3FBCA 5K8OA 5IV3A 4I2QA 2DR8A 1MU2A 3AH6A 3VALA 2HHXA 4QWCA 4UUXA 3GIMA 1ZA2B 2ACYA 5KG6A 1NJZA 3LALA 3OFHA 4C0HA 3ENQA 2DD8S 1HNWJ 4MKVA 4NA2A 3CCES 1NDCA 3PYDA 2O5DA 1OMSA 5HP1A 4X4TA 6AT1B 4PYAA 3P96A 4QU7A 2DB1A 4KGZB 4ZVGA 4RU9A 1NLKL 1SI9A 4LF8J 3MEEA 4DFJA 4X62J 4KTQA 3FUYA 3MR5A 2MKYA 5CYMB 4HDGA 3FFIB 3L7OA 2NQPA 1URRA 1ZYQA 4ETXA 5K8NA 2G1HA 1D1UA 1MN7A 1M1GA 2GGPB 2D3O1 3NGTA 1JJ4A 1SPBP 3K0JA 1QVFR 1IKXA 4DPWA 2V67A 3QSYB 1SB6A 3WX8A 1GTEA 3BB5A 1UA0A 1HI1A 2OH2A 2ROPA 4O3NA 1KP6A 1IWAA 1S59A 5E3PA 1FEEA 4KFBB 3MAHA 4RW6B 5A8WB 2J7KA 1RBLA 5IWAJ 2G2OA 1LOUA 4M5NA 2QE5A 2XCAA 4IO9Q 1N4LA 3NAIA 3UDCA 5LSOA 4UY85 4S0MA 3AA9A 1DQ9A 1TQLA 4JI4J 3KJVB 3SYZA 1SQEA 2B4OA 4AFFA 1OWXA 2HQGA 3D6MB 3UR3C 2R7OA 2YY3A 1YLXA 1R6VA 5RUBA 1R7IA 1ZTTA 4C8ZA 3IO1A 1HI0P 3AAWB 4LJMA 4BBYA 3VCDA 3IM8A 3PNIA 3FZ2A 1TL4A 1A7GE 5DM7Q 2Z2YB 1SH0A 2BM0A 3MM6A 1O51A 4LRDA 3PY8A 4TVAB 4ZITA 1MW7A 2KYXA 4B3OA 1X9WA 2NCKL 2F4VJ 3R5JB 3D3BJ 3M6WA 2VOOA 2J6TA 3VAGA 3RBEA 1VRTB 5E7OB 5CYJA 3R7BB 2HQIA 4PQUB 4EBEA 5L1JA 2QMWA 1KRPA 2YKPA 4K4VA 4V1Ak 3CB4A 3M2RB 2XM3A 4YFUA 2EKNA 2JNJA 5IT9Y 3WIVA 5D77A 5D4LA 3MM8B 5E0OA 4AE5A 1V5VA 4JV2A 4E8UA 3V4IB 4EMDA 4CYUA 1EQ0A 3NNHA 2XEXA 2I8EA 2KT5A 4JI3F 1DQ8A 5AE1A 3UWTA 2AYBA 1Q79A 4DPTA 3PW4A 4G65A 3M8YA 1WG4A 3AXMA 4Y65A 1LW2B 5J2PA 4N41A 4CIOA 3J80U 9ATCB 4P2SA 3V5RA 1LK7A 4YEAA 1WJ9A 2UVVA 4M63A 2DTJA 2MLZA 4ZPVR 5GADI 1JLBA 4X65F 4JI6J 5JXSA 3DRSA 2V2ZA 2DNNA 3IS9B 4QR0A 1FD2A 3NCPA 2W7AA 4X66F 2OGUA 3SQGB 5D4NA 2I38A 3MM7B 2AU0A 1YHQS 2ZD1B 4OMFG 3KLVA 5A6PA 4R8UB 1B4SA 1QE1B 4MFBB 1MN9A 3LP2B 4OHYA 2PMHA 5L39A 4F3OA 3QT6A 2BJDA 2OTJS 2PSZA 3K58A 3PEHA 3CCSS 1VR6A 4P73A 3BZQA 4MKYA 4Q43A 2FHKA 3EJMA 1RWXB 1GMWD 3FKBA 3I0SA 5A8RB 5DLGA 5L46A 1N0VC 2C1EB 4TNOA 3KG4A 4TXSA 2A2CA 4QYZK 2W2NP 1FX4A 2ZUGA 4WKYA 4C3KA 1RSCA 3VGVA 3J7Z5 3EPIA 1NPPA 3V81A 2EC0A 2UUAJ 2DNHA 3TAQA 1ZAXA 1FF2A 5H9FJ 2XWYA 1JJ2R 4K4XA 4LBHA 1SIZA 3KDOA 3AODA 2PD1A 3S01A 1RE1B 4A8OA 2FPHX 1HNWF 1JLQB 3US5A 4OYIA 4L76A 3LPEA 2GAHC 2JL9A 1U48A 1QM9A 5CYMA 3CCUS 3W5YA 2J0SD 3AD7C 2Q6BA 2Z2MA 1VK8A 1AT1B 1T8EA 4NLRA 1LFPA 1KC8T 4NRUA 1ZS6A 1XMBA 5DZ7A 4LF8F 3C15B 4DV2F 3G6VA 2BVZA 1FT8A 1N5SA 1O8BA 1MROB 2ALYB 5BJRA 3QPIA 2ZM6F 2RRAA 1HQUA 3MMAB 4ANCA 3ILLA 1HHQA 3DLHA 2YKNA 2KXNB 2DVIA 2UUWA 5CXTA 5I4MA 1FRXA 4ES3A 4DQQA 4P7VA 4Y2IA 4A47A 3OTDA 4KKOA 1B3TA 4PUOB 2WONA 2IM3A 2OMOA 2WK4A 4CWBA 2RT3A 3G6ES 4XPEA 2W9BB 4F0KA 1UP1A 3KJVA 1SKWA 4ECQA 1JLEB 3DOLB 1X60A 2IMWP 3AB4B 2MZ1A 2BJ7A 3GIJA 5KG2A 3JQMA 2QLJB 3VAIA 1Q8IA 1I51B 2ZOFA 3IXQA 3C8YA 4I1TA 4L74A 2ASDA 1T0TV 4I7FA 2QG9B 4OLPA 2DH9A 1B7YB 1WF0A 1VBKA 4DUTA 4MK7A 4DPYA 2OIHA 1VRTA 4USTA 4ZP7A 3H40A 3TX0A 3ULHA 1RT5B 4RW8A 5HQMA 3IBFB 1NPRA 1FDBA 1GAOA 2VHGA 1Q5YA 2MKCA 2C2MB 2XTJP 1S76D 2UV8G 1M0SA 1RTDA 4GKJJ 1VQSA 3W3SA 4A8SA 2EI5A 1CBKA 1URNA 3QSIA 4C3MA 2L41A 3KLEB 2LQJA 4WTYA 1T02A 1TR0A 3P49B 4DV3J 2GV1A 5G0RB 4RPFA 1NKCA 4JI5J 3CIZA 3GWCA 4E2FB 3GONA 4M1KA 1XWLA 1M1KT 1HD0A 1XIQA 3CJKA 1ZAWA 2K3KA 3MR7A 4I69A 5IOLA 1B70B 2HLTA 4WFZA 2KVIA 2PT0A 2RJZA 3I4HX 4I64A 1WOSA 3DI6B 3UVJA 5AJ3J 5H9EJ 4ID5A 4Q44A 5HBMB 4DBQA 1WC0A 4RNFA 2PEBA 4X4QA 4P52A 3OXGA 1ZM4A 1R27B 3UW1A 3HDSA 1R8PA 1NCLA 5I42B 2DNRA 3OL9A 3SQGA 1IBMJ 1V3RA 1Q8LA 2W01A 3E51A 3NP5A 4QIVA 8ATCB 2I5JB 2MEWA 2XMKA 2DR9A 5GAEU 2R7VA 4OX9J 1TP7A 2DT9A 1BQXA 3DRXA 2KG0A 1NK7A 2JVOA 4FVCA 4CLSA 1XR7A 3FCVA 3N4WA 2BJ3A 2MGZA 4JI2J 1VQ6S 3PJWA 1P1TA 2LXIA 4F0HA 3H2UB 3MFHA 4DS4A 3TZYA 3SCIE 1DQAA 3OUYA 2UUCJ 2EFOA 1QD1A 1N52B 1CC8A 4NCBA 4BLGA 1IKYB 1FRLA 2HNZA 3K57A 4FS2A 2OPSA 2QN6B 5BYSA 1WDDA 1RU1A 2VODA 4ZCIA 3NCRA 2FUG9 3HFVA 2FLOA 2A1BA 4RU2A 3R2DJ 4LFAJ 2QL5B 3EX7B 1PC4A 4LVOP 1VQ5S 3M30A 4LIWA 4LF4F 2LQ9A 3EE3A 4NEZA 1K44A 1FKPA 1CPZA 2OJ3A 2D41A 3LANA 2HMIA 3SMZA 2XMAA 4OL8A 3PV8A 5L9XA 3GU0A 2JEGA 2GX8A 3BDPA 2DXFA 4DR1J 3MEDA 5J2NB 1N36J 4M5JA 4BCAA 3GZ7A 2Y9HA 5KG3A 2GQ2A 3MMAA 1VQKS 5KFIA 1BQMA 3CD0A 1REGX 2ZOGA 2QZ8A 5KFBA 4C8LA 2MQMA 1R0AB 2G2ZA 1DARA 1U6BA 4PUOA 1Y3JA 2B7BB 2HSEB 4M5KA 4N8NA 2AJ0A 3LP0A 1VRQC 2LDIA 3MR2A 2AW0A 4NCAA 1O6XA 1TVRA 3PYFA 3DOLA 1VQYA 2V68A 4A48A 3M2VA 2H65B 2XMJA 2DNGA 3RU0A 1Z2ZA 2VC0A 2MPUA 1UL3A 2W9CB 3GV8B 1XR5A 3VAFA 4K4ZA 2J9EA 5KFVA 1KHVA 4NLGA 3GYXB 3MPYA 4DI6A 1S1WB 4RW9A 4DR2J 3O8WA 1IKVA 4NCGA 4P10A 4F4WA 3JYTA 4DV1J 1U0HB 5H9FK 2ZKUA 1YJVA 1Q16B 3RBDA 2QYCA 3TRGA 1TKZB 2IC3B 3NCQA 4A8QA 4DL6A 2UXDJ 5L8RC 1DJ0A 3OVAA 2ABYA 4C0BA 4V19X 2FIUA 4I6AA 3BBBA 5T7LB 3GTYX 1FJGJ 3AT1B 2MJNA 1RA6A 1HIYA 3FNNA 3RW6A 1Q8BA 1JXLA 1X5PA 2P6SA 3RUBL 1SCJB 1AFIA 1WTBA 1HLWA 3NBPB 4PCQA 2AV5A 2N4CA 1HI8A 1KVJA 3H0PA 2AEJA 1L3TA 1HNXJ 4BC7A 1K9MT 3BO2A 2LEPA 2EFQA 1F3FA 2ZJPQ 2LFVA 3UO0A 2B9EA 4F50A 4L6V3 5FJ4A 2GCFA 3DI6A 3V6DB 3MMBB 3I56S 2GC8A 2CAJA 3K5NA 3JAMY 3D9BA 4OZNA 5C5JA 4IUFA 2NXEA 2CQ1A 1HBUA 1WC6A 4H4OA 3DMJA 4WP3A 1SJQA 4DSKA 2JEFA 3W5ZA 1YJTA 3HZEA 2NZ4A 3P3DA 4ZPBA 4Y28C 3HKWA 2ERRA 4ZVOB 4D3GA 4ZLNA 4XO0A 1X4GA 5AJ3F 2AT1B 3T5HA 5FDLA 1AFJA 5F3TA 3J81Y 4YMEA 4ZPTR 3CD7A 6FD1A 2V0NA 1FNOA 5LXYA 1AUDA 1IBMF 4DR6J 2XYGB 1S4EA 2HHSA 3GMGA 3CJ3A 4YY3J 4TY8A 4DZDA 4TLRA 3DLJA 4ZJOA 2J7WA 2C3YA 3QFHA 2YQ3A 2Y1JA 1X0FA 1RCXB 1KLMB 5C25A 1VBZA 4HL9A 5EX3A 1U45A 2LEBA 4B17A 3BGRB 3CSKA 4GMKA 1A6LA 3PJ9A 2MQNA 1S1VB 1UKUA 3LUYA 2LDYA 4K0KF 3ZZPA 4JI2F 2YPYA 2CG8A 2E1RA 4M5HA 4I2PB 3S1TA 2YQ1A 4OJGA 2ZJRQ 1I94J 5JUMA 2QMUB 1GK8A 4C8YA 3RB6A 1RHKB 2A18A 5F3ZA 2Y1LB 1NHKL 1SKSA 2M2BA 4C6AA 3T41A 4ZVUB 2HVEA 1WWHA 1EP4B 3Q89A 4J9VA 1YRTA 5KFRA 4PWUA 5EWFA 3TZWA 1CJKA 5GAHI 2XLJA 1PYSB 3HJVA 4DL4A 5H9EK 1EARA 5KFKA 1K8AT 1IXKA 3LWMA 4LF6F 2FLLA 1RTHB 2Y1IA 1U8SA 5J2NA 3HVAA 4KRWA 3BQ0A 4XIUA 1T05A 2VFSA 3FRYA 1XN9A 4GO5X 4C8MA 3P6YC 2NXNA 3G8QA 1WG1A 1U02A 1YVFA 5DG9A 2EG2A 1S0MA 2CJXB 2YNGB 1JB0C 3T6BA 1GMVA 2DHHA 3HM9A 4CLWA 2IJRA 3M4XA 4J5OA 4EBDA 4CO2A 2QSFA 2XSFA 2ILYA 1T9TA 2CPFA 2D3ZA 4XK8C 3KTQA 4DCJB 2GIQA 4QCLA 1JK9B 1A9NB 2I6WA 3H8YA 3T5JA 4DLGA 1YZ6A 3H5XA 2PMZD 5LSLA 2XMVA 2MQPA 1S1WA 1WDTA 2BE9B 2CPHA 2CPIA 3HT0A 1FRMA 2ZE2A 1RWOB 3UD3P 4QJVA 1FKOB 3CIMA 1XC9A 1OPZA 1SJ3P 1FFGB 4P75A 2HHVA 4ZLLA 1YJRA 3G82B 2CNLB 3T1HJ 2LKZA 1B0PA 4DR2F 2IAJB 2ILZA 2BE7D 3L95X 4OZ0A 4DV1F 3ZZRA 3RBXA 3V6KA 4DCPB 4OYPA 2EK6A 3IR6B 3MOZA 4ER8A 1WEYA 5K5MA 1P27B 3GR1A 5CD4A 2CXEA 1SKUB 2HBYB 2R7WA 4K5SA 3OFFA 4CO0A 1F9FA 4C4WA 1UJ5A 5F8IA 4CH1A 2OD6A 2YNHB 3K8WA 3UI3A 3KHGA 3O1LA 4O44A 1C0TB 4L75A 2J5AA 3UE2A 1ZZNA 1S72S 2L3MA 4X4UA 4OZJA 4F8RA 3WZ0A 4RW7B 1CC7A 1M5KC 3R2CJ 1FRHA 3DNCA 4CLYA 2FD2A 3ZFVA 4KGKA 3F73A 1R8BA 1N0UA 4Z37A 2DHAA 2V8HA 1JXVA 1LXJA 4XTTA 5CZVA 3PX4A 3M1VA 3M8QB 3BBCA 1F6TA 3OXFA 2RKIA 3SCKE 4OHWA 2MKIA 3KK2A 1R8AA 4PPZA 3W1YC 3HD2A 1Q1KA 2E1MC 1TL7B 3PW0A 4LSLB 2XBPA 2LEAA 1Q82T 2VQEJ 3QLHA 2YWGA 3MXHP 1RT7A 2KB2A 1WSRA 1YJ7A 4NLPA 3BSNA 2GHWA 2DXDA 4IDKB 2IMOA 1MSWD 3DM2A 5D0EA 4ID8A 2OAUA 3FEYB 2AYEA 5BR8J 4UY8T 3FK4A 4H4KC 2MB0B 3DGVA 4HI1A 1NUEA 3E3XA 2EPIA 1NU4A 4J91A 1NKEA 1N5YB 3EMTA 4AD6A 3M32A 2RU3A 3MM9A 2V4JB 2CZ9A 2IRXA 3BH7B 1WELA 3GSDA 4DR6F 1LWFB 1ZM9A 4C9DA 2FVRA 5LMNJ 4ZKAA 1Q7YT 4EZ6A 2COLA 1UFWA 1FVQA 4YY3F 3D67A 4KYZA 5C42A 3M8PB 4KV8B 3ZZUA 2E9ZA 4LF2A 1DRZA 3R7SB 4LSNB 4DR5F 5J2MA 4C98A 1IKWA 5ETKA 2PFFB 2Z2ZA 2DNLA 3HVTA 2QO3A 1DZ5A 2M4MA 4OHXA 2PFDA 1VHFA 3ZZZA 4CO5A 1J5OB 2Q43A 1GX5A 3LP1B 1Q8KA 5I3QA 4WFYA 2HGLA 2C3MA 4X4VA 3THPA 3H5UA 2VFVA 2VDIA 3QIPA 1MWYA 3KNGA 3CCVS 1U24A 1X5SA 3FBFA 3MM5B 2C2KB 1C0UB 4DUZJ 2WSFC 3M6VA 1LNQA 5DDRC 2HG4A 2VASA 2YNFB 3NLCA 2N7YA 4AQYJ 2JRSA 3IN5A 2MSSA 4ED5A 4TY9A 4HDHA 2EXUA 4J9NA 3TEGA 3RW7A 5KFXA 4UF4A 4RJVA 3UCGA 5JJBA 4U67Q 3TVYA 1HQEA 4C8NA 4ZP9A 4CNZA 4EYIB 1RHMB 4P72A 3F56A 2JSXA 1S9GB 2ASJA 2WOMA 1GFWB 5KT3A 1U0SA 5CABA 1RB0A 1S9EB 1RBAA 5L1LA 2JLFA 3GIKA 2DRAA 4MK8A 2E7XA 1TK5A 2QLWA 2F8MA 4HR2A 4RBUA 3W65A 3A8KA 2Z30B 4DX7A 1GMUA 1C1BB 2V4RA 2HQ3A 5L9NA 5ETSA 3NOCA 4WFNQ 5M2PA 2AEFA 1RUSA 4DL3A 1JLFA 2AJ4A 4B08A 4NLOA 4F4XA 1N48A 2ZHBA 4DG1A 4DSEA 2JOQA 3GE9A 4DR4J 2RDJA 1HBNA 3HX9A 2KTQA 1RISA 2YXLA 3H2VE 2V8DA 2NS1B 4HHHA 3KUHA 2B4PA 2GMHA 4WU2A 3GYNA 3N5BA 4Y2MA 3J7ZT 2J6UA 1XK8A 4IG3A 3Q24A 2C22A 3QIDA 3CCLS 4ICLA 1X4FA 1VI7A 5KFSA 2E5LJ 1HW8A 3HSJA 3W7BA 1RT6A 1ULRA 5M2UA 4DSIA 3FBBA 5E3RA 1C0TA 1UPPA 2DGTA 2HFNA 1MMDA 3OBIA 2E7WA 2GVDA 3QATA 5A6WA 3FBEA 4B9LA 4WJBA 2EEYA 1IUJA 3DLEA 2OP5A 2DY9A 4TU9A 2B6AB 3HVWA 2NXUA 3H5SA 1V9OA 1YDLA 3JSMB 2UXCF 4HLBA 5CD4H 1TV6B 4U7UK 1EB0A 3PYGA 2Y8YA 5K14B 5DJBA 4RLEA 3CJTA 4FF3A 5IQ6A 1V6HA 2RSQA 2V34A 4QIGA 2W8LA 4U9RA 1D09B 1F60B 1Y11A 4DV6J 1RAJA 4PXBA 4EBCA 5D15A 1NK9A 2VPWB 1K1QA 2HWIA 1C1CB 3IFEA 2V2VA 1DTTB 1S7HA 3K5OA 4NZ7A 2DXEA 2M8HA 1RDRA 4ZVFA 4B3SF 1W2IA 4RW4A 1HWIA 5HVGA 2F8HA 2FGOA 4CT9A 4ZCLA 3OFEA 4QWAA 2HNDA 1TL1B 3MEGA 2A10A 1EAYC 3A4TA 3VV2B 5HROB 4DV0F 2VG5A 2H3EB 1UAWA 1HBOB 2X3GA 3HXMA 4WTOB 2AGQA 1MMLA 4F67A 2CFXA 4KO0B 2W4PA 1X4AA 3UDEA 1FRJA 1KKHA 2V50A 3Q8UA 1JLGB 2DKOB 4J9OA 4TLQA 5HQ8A 2APOA 2KT3A 5SUHA 1RT3B 4IO1A 3PIOQ 4KV8A 2BE2B 4DN0A 4RZRA 5KT5A 3MUMP 1YBAA 3IM9A 1ICEB 3IGNA 3HHDA 4PQAA 1TUGB 3BGOP 3ILOA 3NNAA 4JOUA 1RI7A 3J7AN 5KFAA 3U1LA 4YUDA 2ZFHA 2LXUA 3PKMA 3MPUB 2V4QA 3MMCB 2AGOA 1G3OA 1K0VA 3LP1A 5MLCV 1HNVB 1YIJS 3GCWP 3M8RA 3LQVA 2K8GA 1IQTA 3BPDA 3HCXA 2D9OA 5GMKa 2D69A 4QBUA 3PHEA 2CQDA 3PG9A 3QWPA 3GR0A 4CRJA 3N5FA 2W2PP 2XULA 3MTJA 3OJSA 3BSOA 4NLTA 5L1KA 2HPUA 1C0UA 4DR3J 4YB1P 4Z7CA 2BQUA 3VVTA 1GQEA 4G1IA 2JLGA 2F65A 4DL5A 5FIIA 3EPGA 1BUXA 2H5IB 1S99A 2CUYA 2AQ4A 4LR8A 1FJCA 1HQ2A 4RNNA 4ED3A 4ILRA 4DU7A 2GW8A 2FJBB 4DQPA 1Y3KA 2MTLA 2NYIA 4DUZF 2NR0A 1U8WA 4ECSA 1OY8A 2ZJQQ 2AYMA 2HZVA 4IR9A 1N32F 1Q7LB 3T9NA 2C2NA 5KFEA 1S1UB 2OI2A 4AQYF 3RB0A 1N56A 3FCWA 2Z8QA 2Q79A 5KT4A 3CCQS 1FDDA 1KBRA 3SBMA 3C6UA 3ZNUA 2YNIB 4NYOA 3CC4S 4C97A 2F1FA 3R1LA 3TUPA 1Y4ZB 4WFBQ 4OHZA 5ETPA 3HKZD 3JAMU 1HNIB 5HJXA 2O3DA 2AIRB 1HR0J 3G87A 1OY9A 4W4MA 4FNIA 3JSBA 1AROP 4WE1B 2DRBA 4RNOA 4WZMA 4HACB 3BO3A 2RNEA 4TQRA 4R5PA 2RMLA 4AYBD 4MIAA 1F5BA 4WCEQ 1WD6A 3TO8A 5KG4A 1Q4RA 1BWEA 2MQ8A 2A0FB 3OR2B 2BR0A 1RKJA 3J81U 1ZM2A 3MTKA 4NX9A 4Q2MA 3W2WA 2D3UA 1FRIA 5BYRA 3HHKA 4DN9A 1T3NA 5EX0A 4N56A 4OJ3A 2H48B 4USJC 4ECUA 3DU6A 2HRYA 4GC7A 3R27A 1WORA 3H59A 1WHXA 3R5AA 2DPJA 4DLEA 1N33F 2MKKA 3I5BA 1BGXT 4EEYA 3U7JA 2XYHB 3EDQB 2EFPA 1H7XA 1IWGA 1FFWB 2R2SA 2CNKB 3I5CA 5KFJA 1NRKA 3ZXWA 1YSJA 1B99A 1KS2A 3GILA 1PBAA 2CIMA 3VR1A 4O4RA 1RU2A 2H51B 2P6TA 2RRBA 4PG5A 2BANB 5FLXY 3RRHA 4WK1A 4KGMA 1N5QA 3K89A 3VZHA 2XYPB 4I0WA 3KK3A 1KQGB 4MIBA 3L3CA 3ITHA 4RO0A 1PGZA 3TJ8A 2CJKA 1CJVA 4TQSA 2IM1A 2MSTA 2ZWOA 5CYQA 2CQPA 1PAEX 3JS9A 1REVA 1DLOB 4YDXA 4DV6F 2QFJA 1F2GA 2CQHA 1U4BA 1JMTA 3AY0A 2HLUA 3BGFA 3I96A 4ECXA 1D9FA 4ZJQA 2DHGA 1VLOA 2ZH9A 2ASLA 2DR7A 1VIOA 3DHWC 1RGVA 1M5VC 5KFHA 1EETB 1RTJB 1XMOJ 1TL5A 2GO9A 2HBQB 3NGSA 4ZVRB 2DNZA 2VKRA 1OJ4A 2XY5A 2A3JA 1CJUB 4ILLA 2MQLA 1SXLA 1FDAA 4HKQA 5D8HB 3E2EA 2YKMB 4C7QA 3I0RA 4DDFA 2G1DA 2E29A 2W2OP 1F0XA 5KFYA 4ECWA 1X5TA 3MURP 5DG7A 5J2QB 3EYZA 1XERA 4DFKA 4UUWA 2C2ZB 1VRUA 1GEHA 2I1RA 4IRKA 3D6TB 1S6QA 1HNVA 3MUVP 1WKLA 4ATNA 1JKHB 3WX4A 2UXBF 3IAS9 4PR6A 4A8WA 1HWJA 4GKKF 3KLIB 1OY6A 3JTOA 4FS1A 2JFDA 2AGPA 4OX8A 1R31A 4F25A 2BA9A 1HL6A 1RWMB 4NYZA 3EICA 4J9LA 2UUBJ 2DIUA 4X4NA 2JVRA 3JSRA 2FQQB 1IR1A 4L73A 2HVZA 4DSLA 2R4FA 1VMBA 1IJFB 4FF4A 2B4UA 5KFTA 1RTZA 1GX6A 2B8QA 1I6JA 1R8CA 4ZIVA 1UA1A 1S1UA 1RAGB 1KOHA 3A8EA 1NZAA 2C2DA 5HMYA 2XQCA 2XMTA 1Z1ZA 2B9WA 1TKXB 2HNYA 2LMIA 4CO3A 1SC6A 3M2UB 2IBKA 2CJQA 4B9MA 2J7UA 3MPDA 2MXYA 4PXEA 5HLFA 2N3LA 4NXNF 3OSNA 2JC1A 1CULA 5IM0B 2BACA 3FC9A 3HP6A 2EVZA 1CQNA 2NYHA 4A46A 1VQ8S 1LWXA 4QPTA 2HBRB 2B4VA 2HAIA 3M9OB 3FSXA 1IJEB 2IRUA 1H2TZ 5IZHA 2E5HA 2VA3A 3MCOA 1H6KX 3D6HB 4NA3A 3QZ8A 3KLGB 1N6QB 4KE5A 3Q2SC 5DS7A 1T03B 3K2YA 3M7VA 3IC1A 2ALZA 5F8NA 4OYOA 3DOKB 2ASYA 4CZCA 2HHHF 2O1PA 1HR0F 3JQJA 5F9LA 1RT2B 3TAPA 5A8KB 4H4KA 1RAFB 3ENWA 3OL6A 4IRCA 1RAEB 5ETRA 2VG6B 2ZBIA 1KQFB 3I4PA 3VQSA 2GHVC 2HZCA 4DV5J 1RT1A 4O4GA 1UEVA 2RF2A 1DAXA 2A2DA 4OZ2A 1JLAA 2DYAA 2HYIB 4CTAB 2KHDA 4W92B 2QTWA 4HT7A 1CJTB 5E3CA 5DZ6A 5B09A 2FGCA 3VGTA 2VFTA 1QTNB 4WIQA 3GJTB 1OYDA 2OPQA 3HSDA 3R5DA 4CO1A 2CQ0A 5HQLA 1WG5A 3RAQA 2A6OA 4BWMA 3KMSA 2O01C 4PWDB 2B56A 2L48A 2CRLA 3DYAA 3TZZA 2BOAA 4NOHA 3VVUA 2LYVA 2FJAB 2AF6A 3UDLA 3GB0A 5CCLA 2BANA 1Y10A 2YKOA 3J7YU 1RKIA 3HHLB 2GHPA 3SSQA 4FXVA 2HFZA 2OPRB 2JLEA 1ZH5A 4JYAF 2QJ3A 5DM6Q 1VJWA 5I3UA 1BQNA 2BV3A 2B5JB 1H73A 3D2WA 2B51A 1VQPS 2R8IA 2KM8B 3PM9A 1NAQA 4KH0B 4DWIA 2IFXA 3UN3A 1SH3A 1NJWA 1NK4A 1S1XA 2BOPA 2VBYA 2FHOB 3G8TA 3DRPB 3UD5A 1VYAA 3DU5A 3H2LA 3ZC4A 3ISND 3Q8QB 1H3DA 2WW8A 4PRFA 3PIPQ 3GJQB 4ZPWR 3B4DA 3WBZA 1YRXA 2H4YB 2BQRA 3KHLA 3MECA 4X65J 4B3RF 2IY5B 1D9DA 3DCAA 2HHQA 2CG4A 2E5IA 1UVMA 2QA4G 4X4SA 5J2QA 4NI2B 3VWSA 2G0IA 2X3DA 1EQMA 1E6YA 4OV6A 4IFYB 2VG7A 1TL3B 4JP8A 2GJ2A 3NRBA 2B0GA 1FK9B 2B7CB 2EBEA 4RNMA 1UWBB 2E9TA 2DCUB 3JTNA 1HHSA 1AZSB 1VHIA 2YVSA 4ES1A 1LWCB 1JXEA 1KQKA 1HHTP 4LF9F 9RUBA 1W26A 2G13A 4KAIA 3NKYA 1JIHA 2YWFA 5U47A 3T6JA 3UN5A 3DGPB 3EGVA 7FDRA 3PRDA 4WWSA 2J8SA 1Q81T 4P2FA 3MD1A 4AL7A 3HLUA 3IRWP 2RQMA 2FJXA 4X4PA 1HYSB 2PA3A 2QL9B 3M9NB 2WHOA 3OV7A 2UUBF 2PI5A 5L1IA 3DRRB 4P74A 1P6TA 3C2PA 3EVOA 4CLPA 4QZVB 3L4BC 5KT7A 4ZLPA 4GVBB 2KYZA 4USMA 3PFEA 2WSCC 3Q8YA 1S1TA 3W64A 4WYWA 4JV5F 5B0CA 3M2UA 1Z2LA 2D1CA 4M5DB 3J81j 2DNOA 2R7RA 3BN4A 1AXQA 4G1QB 2F9JA 3PFOA 3D1OA 1NMEB 4DV2J 2MHNA 3IG1B 4JI7F 1J27A 3LH2S 3B54A 2KJVA 4TKTA 4MT1A 2ZM6J 4NZ0A 1GXLA 2GVZB 4QW8A 1N6QA 1HBMA 5A0YA 3T9ZA 1T03A 2M0GB 3GFXA 1BHNA 2W2QP 2WSEC 1UFLA 1RWNB 3OHBA 5KG7A 2BBEA 2VBWA 2UV8A 1Y5IB 3ELHA 3D54A 5L38A 2WCXA 4MIWA 3VGUA 3NNCA 1ZA1B 1NH7A 2XWXA 1HPZB 1RAAB 2XSJA 2P2CB 5F41A 2RB7A 1VK3A 2R2UA 3HI9A 1B64A 3ZTQA 5KFZA 4UOFA 2MKHA 4B9SA 3MUTP 3NOGA 3SV3A 4H4MA 1IR2A 2BW2A 5K8PA 1GMWA 4CLTA 4Z7YA 3DLKA 4FNHA 2CWKA 3BM7A 1WOPA 3BEGB 1LWEB 4FF1A 5LOQA 1IM6A 1FTCA 2QGFB 2JHEA 3G86A 2P5VA 3IGVA 3OW2R 1YK9A 1RQ0A 5AXLA 1U1OA 1NXIA 4ZPDA 2ZHOA 4DV5F 2W7PA 2ZH3A 4F3QA 4B02A 3CJ8A 5GMEA 1ZTWA 5E41A 2DCLA 2LQ5A 2V5HG 1F9EB 1HARA 1TKTB 4PKDB 1TUWA 1WC4A 2BABA 5EGYA 1K73T 3BQ2A 1WF1A 2K3IA 4B3MJ 4C11A 2P9EA 2LQBA 1S6PA 1Q86T 1X9MA 2XY6A 1SKRA 2GNKA 4KPYA 5J1EA 4FN5A 4HHJA 1UVNA 2LLZA 2OMLA 4MK9A 4DL2A 1P9YA 1SUQB 3NGDA 1HMVA 3BSCA 1XNQF 3FMWA 3E01B 2FZCB 3QT7A 1JWWA 5EWGA 3SCJE 1DTQA 3GQCA 2FVCA 4K59A 5EN1A 3KJFB 2R7QA 3I55S 3PTWA 1QTMA 4M8LA 3D5MA 3S7RA 1F5AA 4FF2A 2POKA 1D8ZA 3RR8A 5B0FA 2E5JA 2IM2A 2PN6A 1T9WA 4PAAA 4XAKA 2Y1RI 2IYGA 3GFZA 3PR5B 3W9JA 3TI0A 1JJHA 4F4ZA 1L3UA 2XS5A 3SDEB 3WHIA 2FHJA 3NMAA 2M7SA 3KK1B 2J0WA 2W2MP 3TEHB 4WFAQ 5JMNA 3DLGB 2OPPA 3KHHA 1YX2A 3B78A 3GIRA 3MAAB 2Z58B 3POTB 1RT4A 1LWCA 1KFSA 4KJIA 4L72B 4P9SA 5E2QA 1BD6A 3C6TA 3MFIA 3D7SB 4ZVEA 3PX6A 3D1QA 2YWKA 1OSCA 1H7WA 2LQ8A 4ELTA 4YOEA 1CS4A 4KT0C 1HD1A 3V6JA 1HYSA 3RRGA 1RTIB 3B82A 4IH5A 3QO9B 3KNAA 2ROEA 4B9UA 5HAOA 1G6BA 4X64J 2ZBPA 3K7RA 1SV5B 5ETNA 1SH2A 2DRDA 2VPXB 4LF4J 1RYRA 4NXMJ 1S10A 4DS5A 1OS5A 4J9UE 3FGVA 2XS7A 4YS2A 1UW9A 4Y6IA 3R9LA 2W9AA 4C0OC 5HVFA 2ZITA 2DITA 4A8KA 1T9YA 4DCOB 1NPKA 3BV8A 3QT5A 5ETMA 1AA1B 3FFIA 4XPCA 2KO1A 3AB2B 5B7WA 3HHLD 2HS0A 2OFHX 1X4CA 1FEHA 2GGPA 4RX6A 4O23A 1RWWB 1FESA 1R3NA 2VFRA 5DG8A 2KHCA 4ECVA 3TZXA 1UTAA 2HFUA 4OX7A 1X0PA 2B9XA 4FPRA 1GXUA 3KLHB 4KFBA 4K7QA 4U7CA 2FJDB 1S0VA 4RW6A 1IVZA 5A8WA 2W4CA 2NPFA 2W8KA 3OPKA 4BWJA 2AX0A 4MAKA 3MR3A 4CLFA 4J37A 1U1LA 2VPYB 2HVHA 2QA1A 2ZBCA 5KG0A 4FYXB 2CZ4A 2Y8WA 3H42A 2MKJA 3LTOA 3PRVA 4Y2CA 1N8RT 3CUNA 2D3OR 2VIHA 1EKSA 2YQ0A 2Q66A 5HMXA 1R6YA 1N5TA 4PG8A 4LFCJ 3LAKA 1RXOB 2QA4S 4WPAA 3P5TL 1PJ7A 5EUHA 1EX8A 2MZRA 4O0NA 3TUJC 5GAGU 4ZHRB 2FHJD 1K1SA 1TKTA 5HATA 3AHPA 4OLOA 4JI0F 2V8VA 1YJ9S 2DNKA 1QAIA 5KFMA 4DEZA 4MJKA 1XJWB 4WK3A 3HFKA 2ATLA 4JBCA 1WHYA 3I9ZA 3IBCB 1JLCB 2WVCA 1YBUA 1UCNA 2PI4A 1FJEB 4PQUA 3LGNA 2HVIA 3MCMA 3M2RA 4B3MF 2RDIA 3E8OA 2R7TA 2U2FA 3MM8A 4ALZA 3T1AA 1O5JA 3DKDA 3V4IA 3AOBA 4G3IA 3MGJA 1B7FA 5CAAA 1NO8A 3CJ2A 4CLLA 3IRXB 1RJJA 3V4MA 1W25A 3OR1B 5ITHA 2DJWA 4IG0B 2QLBB 3LA0A 3BGLA 4Y2AA 5DDPC 2PGCA 4F2RA 4NYPA 2CQ3A 4FVMA 1LW2A 7AT1B 4X2BA 3KDNA 3U27A 3SZ2A 3VGSA 3MR6A 5D0GA 5D0HA 4NE9C 1IM4A 1WKKA 1QAJA 3KJQB 4FYVB 3NS6A 2RUGA 3ISZA 3IS9A 2R2TA 2EKYA 2C2RA 2ZH8A 3EGNA 1VQ9S 3UDVA 4M5MA 1TK0A 3MM7A 2MZJA 2K1RB 2ZD1A 2KXHA 1VBXA 4ZA1A 4OIXA 3W5XA 2I2YA 4R8UA 3H25A 1QE1A 4I6WA 3EUNA 4MFBA 4EO6A 3RGIA 3PHTA 3C14B 4I2QB 3QAUA 2VDHA 1MU2B 4JI1J 3LP2A 4JV1A 3SV4A 2BUNA 3NS7B 3SQOP 3ONQA 1T7PA 3PYEA 1U25A 3THVA 4WFXA 3UN2A 2RH3A 1RTIA 3QO9A 5HP1B 5A8RA 3OTBA 5C2GA 1IBKJ 4K0KJ 3TUZC 5EWEA 2CPZA 2XO6A 1J5EF 2J8AA 2O67A 5F8GA 3GFYA 4UQGA 1NZ8A 4RUHA 3VAMA 2CADA 3P45B 2HVDA 3F41A 2RILA 4X64F 1J2VA 2OSRA 4ECRA 2DGOA 2ZH5A 1U1QA 2AJQA 4LF6J 2QSWA 2CQGA 1IKXB 3JB9k 1JLQA 2GMJA 4NXMF 3CMAS 4LF5F 3CO0P 3CJ5A 3R5GA 2VA2A 4C48A 5GAEI 2CZVC 2MZSA 3TWZA 4TU8A 3AJ1A 1N5VA 2LA4A 5D6GA 3C15A 2AX1A 2PO4A 3BBFA 2NSBA 2QLFB 3KWMA 4OJ1A 1MROA 2J9DA 1RAOA 4FBTA 4ZJLA 1MLAA 3VAJA 3RR7A 4O3RA 2R8JA 2ZKTA 3TA1A 4LRCA 4HTJA 2JX2A 3BYPA 3NGRA 1HA1A 2WTFA 2J0XA 1VIXA 4ITSA 1LK5A 2W9BA 3FQKA 1UVLA 5DQIA 1JLEA 4M5GA 4Q2LA 3MM6B 1U1MA 1FNXH 1M5PC 2IA0A 2E1AA 3OVBA 1T9UA 1MWQA 1N54B 4YN3B 1S0OA 4G6VB 3KLFB 2IDLA 4QIEA 5CHCB 3GG1A 3BF4A 6FDRA 1QVGR 3X1LB 1FD8A 3CW2C 1WKJA 1KFDA 2QFIA 4U8VA 4LFCF 2MMYA 5IV4A 4K2JA 3CDEA 1WEXA 4WF9Q 2AJFE 3EGWB 3K5LA 1VBYA 2DO0A 3BGUA 2CJBA 3HFZB 4ZCKA 2XMWA 3JQKA 5LMUJ 2A6MA 1YRUA 4WZQA 1RT5A 2X1GA 3Q0AA 1A0OB 3C3LA 3KUGA 2BYCA 4FXDA 4F4AA 3BREA 2QV6A 2ZEJA 3FQLA 2PIIA 3M9MB 5J2PB 2C2OB 2ZC4A 5ETLA 2ZDOA 3FVYA 2CJAA 1RAHB 2VL1A 1H38A 3KLEA
chains in the Genus database with same CATH topology
4DOZA 5KG4A 1Q4RA 3AA8A 1BWEA 2VOPA 4DV2F 3OR2B 3G6VA 3TNVA 2BVZA 3OXLA 2BR0A 1RKJA 3TA2A 5E33A 5G0RA 2EG1A 1FT8A 1ZM2A 1N5SA 3MTKA 1O8BA 1D9AA 3DFEA 1MROB 3OJUA 5BJRA 3QPIA 4NX9A 2ZM6F 1I94F 4J9RA 2RRAA 1WTFA 1HQUA 2JZ5A 3MMAB 1OIAA 4Q2MA 3W2WA 4M95A 2YKMA 3DLHA 2D3UA 3G4SS 4IOBA 2XGPA 1FRIA 3IWNC 2YKNA 5BYRA 3VAHA 2KXNB 2EWHA 3HHKA 4DN9A 2DVIA 2UUWA 5G4DA 1T3NA 1JLBB 5EX0A 2KU7A 4URSA 5CXTA 5F8MA 4N56A 3HPOA 4OJ3A 5I4MA 1FRXA 4ES3A 4DQQA 4P7VA 1FHTA 2YH1A 3J7YI 4Y2IA 4USJC 3OTDA 4KKOA 4P7TA 4A47A 3HO1A 2Z0GA 2ZH6A 4ECUA 4PG7A 4PUOB 4K4UA 1VFJA 3X3UA 3M6UA 3DU6A 2HRYA 4GC7A 3R27A 4F4KA 2WONA 2EFNA 2M5YA 1JX4A 2IM3A 3IAM9 3H59A 3MHYA 2OMOA 1WHXA 2WK4A 3R5AA 2DPJA 1JKHA 2RT3A 3G6ES 1F5CA 4XPEA 3FEXB 2W9BB 4DLEA 1UP1A 1N33F 3KJVA 1SKWA 2MKKA 4ECQA 2OTLS 1WACA 1JLEB 2HWHA 3DOLB 3HZGA 3I5BA 4I67A 2IMWP 5HBMA 2ZDPA 1BGXT 4F2SA 3MZIA 3AB4B 3CGIA 4HI2A 3CXCR 4EEYA 2PEHA 2MZ1A 3WC2A 1S97A 5D4OA 3U7JA 2QIFA 2B43A 1FERA 1MWZA 3KLIA 2XY7A 5DQGA 3GIJA 3OTEA 4RWXA 5B0BA 2EFPA 1H7XA 4OZ1A 5KG2A 2KH9A 4UQTA 1ZPWX 2R2SA 2LVWA 5I42A 3KG0A 4QU6A 3PACA 3D28A 4KIAA 1L3SA 5LSRA 3I5CA 4Y3CA 5KFJA 5KFOA 1NRKA 2HGMA 1Q8IA 3A1YG 5M2RA 3VAIA 2ZOFA 3QJJA 4IRDA 1YSJA 1I1GA 1KS2A 3IXQA 3C8YA 3OL8A 2I5JA 3GILA 2CIMA 4I1TA 1X9SA 3I9V9 2QT7A 4ECZA 3VR1A 2ASDA 3I0SB 3VZIA 4O4RA 4ETZA 2IA6A 1ROFA 5KFCA 4I7FA 1UVIA 4Q0BB 4OJHA 2P6TA 2RRBA 1X4BA 4OLPA 2BANB 4LIRA 4PG5A 5FLXY 1YITS 2VONA 3RRHA 2DH9A 5DGAA 4WK1A 4PG4A 4KGMA 1N5QA 1WF0A 4URGA 1AW0A 1WNEA 5KG1A 4R0EA 3VZHA 3V81B 3C6UB 4I0WA 3KK3A 4J9QA 1FRKA 2YWHA 4MK7A 1KQGB 4MIBA 3L3CA 3ITHA 2WRMA 1PGZA 2QEXS 3DC2A 4Y00A 4TQSA 1W2BR 2CJKA 2OIHA 2IM1A 2MSTA 4A4JA 4KR0B 5CYQA 3D1HA 3RAMA 2CQPA 1VRTA 2JEIA 1KQSR 2MY8A 4KHMA 4IKAA 2R8GA 1REVA 1DLOB 4YDXA 4ZP7A 1VQ4S 2W25A 4DSFA 3H40A 3TVZA 3EXYA 4DV6F 2QFJA 1F2GA 3ENVA 4JI1F 2CQHA 3ULHA 2CPDA 1U4BA 1JMTA 1TKXA 3AY0A 3O6QA 2HLUA 4IOCQ 3DLLQ 3BGFA 3I96A 3CWJA 4ECXA 3C46A 3M05A 1D9FA 3BO4A 1RT5B 3OVSA 2DHGA 3CVKA 4RW8A 2WB1D 1E6VA 2XHWA 4EFAC 4OI2A 4WYLA 1IKYA 2ZH9A 1FDBA 1GAOA 2ASLA 2DR7A 1VIOA 3DHWC 1RGVA 4HH1A 2XNQA 2MKCA 2RQCA 4OI6A 3PW7A 1NK6A 1M5VC 2FHMA 4QIWD 1S76D 2UV8G 2ZH7A 5KFHA 1JNZB 3O5TB 1IBKF 1EETB 1RTJB 2BZ2A 1M0SA 4OHVA 1VQOS 1RTDA 2G0CA 2PDAA 5KFQA 5IM0A 1TL5A 2GO9A 1VQSA 5E5NA 4R5PB 2GA7A 3W3SA 4A8SA 3T1HF 2EI5A 2YX4A 1URNA 1HFEL 1FE0A 1OO0B 1T95A 4C3MA 2LA6A 2L41A 3KLEB 3MOJB 2LQJA 4WTYA 1T02A 2DNZA 1TR0A 2VKRA 1S9FA 1Y9OA 3P49B 1MNEA 2GV1A 1LFWA 3KLGA 2XY5A 2A3JA 4N47A 5G0RB 1NKCA 4ILLA 3DXSX 2MQLA 3CIZA 1SXLA 1FDAA 4HKQA 3GWCA 5D8HB 4M1KA 3E2EA 1XWLA 1M1KT 1VQLS 5SZTA 3CDBA 3MF5A 3K5MA 1HQUB 3W2WB 1HD0A 1LXNA 3CJKA 1ZAWA 2YKMB 3SSRA 4C7QA 3I0RA 4DDFA 4IYQA 1K0TA 2G1DA 2E29A 2K3KA 4ZDNA 1F0XA 2JWNA 2YKNB 4I69A 3DOKA 5KFYA 2IYIA 4ZMMA 4ECWA 1X5TA 3MURP 5DG7A 5J2QB 3EYZA 2HLTA 4WFZA 1XERA 1U1PA 4YR2A 4DFKA 2KVIA 2PT0A 4UUWA 1G2EA 4ECTA 1NHVA 4KKOB 1VRUA 3VAKA 2RJZA 4I56A 1WHVA 4FZVA 2I1RA 4YB5A 3SSSA 3I4HX 1RT2A 4IRKA 1DURA 2V9KA 3HHNB 4I64A 4YDDB 2WONB 1S6QA 1HNVA 5A8KA 3MUVP 2LU1A 5J1NA 3DI6B 4RBTA 4ATNA 1JKHB 3G71S 4KHPF 1P1LA 4CT8A 1N88A 5H9EJ 2KFNA 4ID5A 4RUCA 2VG6A 2DNQA 3M8SA 3WX4A 2C42A 2HS3A 4Q44A 2FY1A 4OI3A 5HBMB 1D0EA 4DBQA 2UXBF 3TQ1A 3IAS9 4RNFA 4RKUC 4MMOA 4PR6A 1HWJA 4A8WA 2F8EX 4X4QA 4GKKF 1X8DA 3KLIB 1WF2A 1R0AA 3JTOA 3TW0A 3OXGA 3U02A 3DHXA 1ZM4A 4FS1A 2JFDA 2AGPA 4OX8A 1KEKA 1R27B 3UW1A 3HDSA 5EDWA 1R8PA 2DR5A 1R31A 5I42B 1ZAVA 2DNRA 3OL9A 5KOXA 1TUVA 3SQGA 2QLXA 5KFDA 1V3RA 4F25A 2BA9A 1Q8LA 1HL6A 4A8YA 3KHRA 3ZZYA 4DFPA 4CTAA 2D9PA 3E51A 4NYZA 3NP5A 4J9LA 2DIUA 3K8VA 4X4NA 4ED2A 2XMMA 4IQMA 2JVRA 4QIVA 3JSRA 1NK8A 2FLNA 2J76E 2I5JB 3R5CA 3QAEA 2ZHAA 2LXFA 3T19A 2XMKA 3BS9A 1KTVA 2YTCA 2DR9A 5GAEU 1HWLA 5THWA 2R7VA 5CZXA 1TP7A 3CJ0A 2WBMA 4I7FB 2DT9A 1BQXA 3DRXA 3R5BA 2KG0A 1NK7A 2JVOA 4IR1A 2XB2D 2HVZA 4FVCA 3RTVA 4DSLA 1YGYA 1XR7A 1D3WA 2R4FA 3T5LA 2W9CA 1VMBA 4GO7X 3ZZOA 1PC5A 1IJFB 4FF4A 2B4UA 3N4WA 5KFTA 3KK3B 2XLKA 2N4DA 3KLFA 5CA5A 2R7SA 4PWDA 3ITHB 2NREA 4O3PA 4ELVA 1GX6A 1I6JA 2R2RA 2D74B 1R8CA 2VQEF 1UA1A 5GADU 1S1UA 5CYQB 2DGQA 2MGZA 1KOHA 3A8EA 1VQ6S 1NZAA 3PJWA 2KZZA 2C2DA 5HMYA 1REVB 2GJIA 2XMTA 1P1TA 2LXIA 1Z1ZA 2AYGA 3CO9A 2B9WA 7FD1A 3H2UB 3HHLA 1SJRA 1TKXB 3H20A 3MFHA 2U1AA 4DS4A 2HNYA 3SCIE 1DQAA 3OUYA 4NLXA 1QSSA 2EFOA 2LMIA 4RW8B 1N52B 4QWBA 1SL1A 1CC8A 4CO3A 4NCBA 1SC6A 1IKYB 1T3OA 1TKZA 3M2UB 5BR8F 2IBKA 2OPRA 1FRLA 2CJQA 2IC3A 2P9CA 2HNZA 3K57A 4FS2A 2OPSA 5BYSA 1XMQF 4B9MA 2J7UA 4ZVHA 2MXYA 4PXEA 4WXOA 2N3LA 5HLFA 4DQIA 4NXNF 3OSNA 2JC1A 1UVKA 4F3MA 3UPFA 1RTDB 2VODA 1V3ZA 4ZCIA 1OSDA 5KFUA 3NCRA 2B5JA 5IM0B 2FUG9 2BACA 2FLOA 3HP6A 2EVZA 4K5RA 1CQNA 4A46A 4W90B 2A1BA 1VQ8S 3V6HA 2FLPA 2VH7A 4RU2A 2UP1A 4QPTA 3W2VA 2HAIA 2B4VA 4EZ9A 3M9OB 3H98A 3FSXA<