1WELA

Solution structure of rna binding domain in np_006038
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
GSSGSSGKSPSGQKRSRSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRNEADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords RNA-binding protein 12
publication title Solution structure of RNA binding domain in NP_006038
rcsb
source organism Homo sapiens
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1welA00
3CD6S 2DNHA 2VONA 2MZ1A 2DGOA 2GHPA 2F9DA 5IFMA 1RKJA 2PE8A 3CF5Q 4Y00A 2QFJA 3R1HA 3LQVA 2KYXA 3D2WA 2OSQA 1M1KT 2VODA 4FXVA 1UP1A 2M70A 2MQLA 5EN1A 1N8RT 3FEYB 4WF9Q 1FXLA 1VQNS 5ITHA 3SXLA 1JJ2R 2OTLS 2CPYA 3R1LA 2LCWA 2LEAA 1WTBA 1YI2S 3MOJB 2MMYA 2J8AA 1VBZA 1NU4A 2MY7A 3S7RA 1FT8A 2MGZA 2CQGA 4OZ0A 2LKZA 4WIIA 2LQ5A 5MLCV 2HYIB 1SJRA 2PEHA 4ZKAA 2V94A 2SXLA 2E5JA 2DNZA 2MKHA 1S79A 3P3DA 2CQPA 2KU7A 3TYTA 1ZH5A 1ZZFA 2CQDA 1UAWA 3N9UC 3V4MA 2JRSA 5CA5A 2KM8C 3CPWR 1VQ9S 4U67Q 2RS8A 2AYGA 4WFAQ 1VQ5S 1VQ8S 2DNPA 1YWXA 4TU9A 1M5PC 3VAFA 1B7FA 1OIAA 2DISA 5GVQA 1FJCA 1WEYA 2CPEA 1Q82T 5FJ4A 4WFBQ 1VC5A 3JB9k 2DNYA 2RRAA 3UWTA 2MSTA 2AYEA 2XNRA 1HD0A 3EX7B 2CQ1A 2FC9A 3BO2A 5DM6Q 2FC8A 2FPHX 3CXCR 1X4BA 1JMTA 2M4MA 1XN9A 2DHGA 2DNGA 2RNEA 2KXFA 1QM9A 1OPIA 2ZJPQ 2LA6A 1CVJA 1R8HA 1NJIT 1Q86T 3MDFA 5LJ5Y 2XB2D 3ULHA 3G8SA 3CCRS 3MI7X 1WG4A 2DIUA 3RW7A 3TO8A 2KN4A 5LXYA 1RK8A 3HHNB 5DDRC 1FO1A 3G9CA 3CC7S 3H2UB 1YITS 1VQ6S 3G71S 2MZRA 2XS5A 2X1BA 4WFNQ 1JJ4A 1FJ7A 3PIOQ 2CPJA 3I56S 1X4HA 5IQQA 1VQMS 3H2VE 4PR6A 2RRBA 3U1MA 1KOOA 2B0GA 1YIJS 4YB1P 4CQ1A 1VC6A 3UCGA 1G2EA 1QVGR 1H6KX 3NNAA 2CQCA 1WG1A 2MKJA 1SJ3P 4BS2A 5HL7Q 2ZJRQ 2L08A 4PKDB 1U1PA 3Q2SC 3MUMP 2LXIA 2QA4S 2M8DB 2XNQA 1KC8T 1FJEB 5CYJA 4IOCQ 3SDEB 3MD1A 5LJ3Y 4WKRA 2MZQA 3CCSS 2A3JA 1URNA 1UW4A 3UCZP 4YOEA 3MUTP 3CCMS 1WWHA 2U2FA 1H2TZ 2X1FA 2FY1A 2DHXA 2DK2A 5DETA 3B4DA 1U1LA 4W92B 2Q79A 3VAHA 1DZ5A 1DBDA 2RT3A 2E5GA 1Q81T 2N3LA 2DB1A 2ADBA 1OWXA 1K9MT 2NLWA 3BEGB 4C0OC 3THTA 2RS2A 2LA4A 1Q7YT 1K73T 4IOAQ 5GADU 2DNMA 2MQOA 1X4AA 2L41A 3LPYA 2YWKA 3CULA 2KG1A 2U1AA 2DH7A 1WEZA 2M52A 2CPIA 2JVRA 5GMKa 2L9WA 2YTCA 1BY9A 2AD9A 1WI6A 4TU7A 2D9PA 2OJ3A 2MKKA 1M90T 1X4DA 2DGTA 2DH8A 2DIVA 1D8ZA 1U1RA 1X4GA 5GAEU 1P1TA 4WCEQ 2G0CA 5IM0B 2DGXA 2DGWA 2JWNA 3VALA 5BJRA 1WHYA 1WHXA 2VOOA 1SJQA 1N52B 3UD4P 2MZJA 3ZZYA 4M5DB 1YJWS 2M88A 5LXRA 2EK6A 3UE2A 1VQKS 2X1AA 2EVZA 2CQHA 2CQ2A 3MD3A 3CCES 2BOPA 2DNQA 4RU2A 2M9KA 2MJNA 3L3CA 2F9JA 2ADCA 1U1MA 4C4WA 3CCVS 1QVFR 3P49B 1OO0B 2HGNA 2MZTA 2CQ0A 1X5OA 2MQNA 4P6QA 2QEXS 2MSSA 3S8SA 2J76E 5CXTA 2MPUA 3BS9A 1FNXH 5GAGU 2DGSA 2CPFA 3CC4S 1F9FA 1H2UX 2HVZA 1DHMA 2DO0A 4UY8T 4F26A 3SDEA 5LSOA 1VC0A 2RQ4A 3J7YU 3VAJA 4C7QA 3EGZA 4J5OA 2DHSA 2KRRA 1NO8A 1SJFA 1WELA 3BO3A 4LJMA 1YJNS 3UD3P 4IUFA 3CCJS 3SMZA 3UCUP 2E44A 2K3KA 2LYVA 2KVIA 3CCUS 3R27A 1WEXA 1KQSR 3NS5A 2JX2A 2DO4A 2KI2A 3IWNC 2CQIA 2X1GA 3NMRA 2LXUA 3U1LA 2DNKA 4QU7A 2RVJA 4QQBA 2KHCA 1WHWA 3CCLS 5JVHQ 4F02A 2LMIA 4LIRA 1M5KC 3I55S 4FXWA 5DM7Q 5D77A 1VBYA 1AUDA 2GO9A 1FHTA 2J0QD 2OSRA 2LEBA 5LSLA 2KT5A 4LMZA 1KD1T 2DNOA 2CPZA 1N88A 2CQ3A 1WHVA 2MXYA 1YHQS 3VAGA 3K0JA 5IM0A 4TU8A 2N82B 1X4EA 3P6YC 3B4MA 1A7GE 1WG5A 1ZZNA 2CPXA 1WF2A 1VQ4S 3TP2A 5HO4A 1X5TA 4TLQA 4QU6A 2F3JA 3MUVP 3FEXB 3EGNA 1YTYA 1DRZA 2MB0B 1HL6A 2KM8B 4CIOA 1WF1A 4QPTA 1U1NA 4EGLA 2DNNA 2M2BA 3P5TL 2KG0A 2KRBA 4F25A 2CQBA 3THPA 1U1KA 2CPHA 2JVOA 5JVGQ 1VQ7S 1SXLA 3ZZZA 1JJHA 1M5OC 2LECA 4UQTA 1U6FA 1X4CA 3CMAS 2MKCA 2OTJS 3BO4A 1N54B 2KH9A 1VQLS 3DLLQ 4CH1A 4ERDA 2MQPA 2HGLA 2XSFA 3VAMA 1VBXA 2E5IA 3MXHP 1HD1A 2CJKA 3J7ZT 1H2VZ 3CTRA 2J0SD 4OZ1A 2M8HA 1HA1A 2KXHA 3G8TA 1X5PA 1W2BR 1U1OA 2NZ4A 2DGUA 1X4FA 2D9OA 2DH9A 2MZSA 2M0GB 3G96A 2MHNA 3VAKA 2I2YA 5GAHU 1M5VC 3G4SS 2DGVA 3NS6A 1KOHA 4ED5A 2HGMA 2K8GA 2DGQA 1PO6A 4CH0S 1YJ9S 3MURP 1P27B 2KFYA 4PRFA 3DXBA 2O3DA 2OIHA 3CMES 2E5HA 2EK1A 1IQTA 1U6BA 3NNCA 3OW2R 3VAIA 5D78A 2FHOB 3PIPQ 1O0PA 1U1QA 3IRWP 2AYBA 2MGZB 1X0FA 2DNLA 1D9AA 2XS7A 2MYFA 3S01A 2ZJQQ 3RW6A 2UP1A 2M7SA 2ERRA 2YH0A 2N7CA 2MQMA 2RU3A 3Q2TC 2AYMA 2I38A 2DITA 2MY8A 2G4BA 1X5SA 2D3OR 1A9NB 2VOPA 3NNHA 1K8AT 3CUNA 2YKAA 2MKIA 2BZ2A 3CCQS 2RQCA 5DDOC 4IO9Q 1R8PA 2MJUA 3CC2S 2DHAA 2MQQA 4Y0FA 1UFWA 3S6EA 2DNRA 5DDPC 1VQPS 1WF0A 1L3KA 1U2FA 1PGZA 2CQ4A 3HI9A 3G6ES 2N3OA 3VF0B 2KXNB 1VQOS 2YH1A 2CPDA 5DDQC 2XS2A 1WI8A 4Z2XA 5H1SV 4A8XA 4W90B 2G1DA 2HZCA 4YUDA 1SJ4P 2RUGA 4V19X 3US5A 2WBRA 1S72S 2MKSA
chains in the Genus database with same CATH superfamily
4K5SA 2CA9A 3SV4A 1T95A 1KFDA 3T5HA 3HKZD 3OVBA 4CLUA 2EBEA 5ETSA 1UEKA 3FCVA 2Y1JA 1XK8A 4BC7A 3T1AA 2VU5A 3UDVA 2M70A 1Z2LA 3L09A 4NXMJ 2K7JA 3HT3A 2EG1A 2DY9A 1P1LA 4I7FB 1ZPVA 2XWXA 2AX1A 4FF2A 4DV3F 2YKNB 1MMLA 3MEEB 1Q8IA 3BKFA 2SXLA 2MKHA 3M8RA 1S6OA 3TYTA 4OI3A 1RWVB 1ZM3A 1S10A 4KGXB 1T9UA 4OX7A 4U67Q 3LGMA 1RT4B 2DNPA 1UJ4A 3AB4B 3UI3A 2XO7A 3C19A 5GVQA 3HHDA 2FJAB 3RTVA 3T9ZA 4K59A 1JNRB 2VFTA 4LBPA 1XN9A 3OQ2A 3NGDA 2KXFA 2QMXA 4DUZJ 5D4PA 1X7VA 3TO8A 4M8LA 5HVGA 3HHNB 4OHVA 4B02A 1DY3A 5MAOA 1X8DA 3H2UB 4EI2A 2XS5A 2WOMA 1XC9A 1X4HA 2KKHA 3W64A 2B0GA 3TZXA 1J5EJ 4YB1P 4J37A 3P5BP 4RUBA 4NCGA 1WG1A 3FQKA 2LXIA 2RKIA 1IKXB 3QAEA 2JFDA 1EKRA 2ATLA 2HW3A 2UUAJ 2FD2A 3TQEA 1FWKA 3RJMB 1SL1A 4JV1A 2XZWA 1N6QA 1HWLA 3VGTA 5HLFB 4Y2CA 1R8CA 2DB1A 2QYCA 1K9MT 1HW9A 3BEGB 2RS2A 4DCPB 1XMOJ 2JVRA 3C8YA 5GMKa 1BY9A 1HNZJ 1FRHA 4ZN3A 1SJ1A 2DIVA 3BN4A 1S48A 1NDCA 2V4JB 2B9WA 3C6UA 1VYAA 4ZP7A 3W8PA 1TL3A 4F0MA 1ACMB 3OLBA 2CUYA 1JLGA 2ROGA 3R6GB 3WC2A 2UUTA 4EYHB 2YPYA 3L3CA 1RU2A 4URQU 3CCVS 4AYBD 4KV8B 4F7VA 1CLFA 3FBBA 5CXTA 3EWGA 4MIWA 4DPYA 3W2VB 3LWMA 4RU9A 1DTQA 3R97A 3EGZA 2I0XA 2XY6A 1JXEA 2BACA 4DZDA 2KVIA 1TQLA 3JYTB 1N5YA 2EXUA 2OMOA 4LRBA 2UV8A 4PUOA 4X4SA 4O3PA 2R8GA 2HK3A 2IAJB 2BANB 3WQPA 3OUYB 5IWAF 2GO9A 2DPIA 4HYKA 1VJWA 1KD1T 4FBTA 1WHVA 1YBAA 2J7KA 4B3TJ 2CZ4A 2VICA 1ZZNA 3TP2A 3GSIA 1L3TA 1RGVA 5F3TA 5FLXU 3KXDA 1XMBA 3D5MA 3C16B 2G1HA 4X4OA 4DSIA 3EJMA 4ZN1A 2P9EA 4QR0A 5IXUA 1OQ6A 1UMJA 3TA1A 4F25A 1U1KA 4C8ZA 1W26A 3HHLA 5KFWA 1SXLA 3M32A 2LECA 3H2LA 4R0EA 1DURA 3IAM9 2VC0A 3DLLQ 5JJBA 4Y34A 1WUUA 2CJKA 3W2WA 3CJTA 4HT7A 3R6LB 2GZOA 2RB7A 4MYTA 1S0OA 2JC0A 4DR4J 4K8RA 1RI7A 3IM9A 2Z2LA 3M2UB 4IG3A 5KAKA 1FNMA 2RRNA 4DQSA 5LM7E 3NS6A 5AXKA 2BQ3A 4PXCA 1RYSA 1EKSA 1PILA 5FIIA 3TNVA 1YJ9S 4YR0A 2O3DA 2OIHA 3OPKA 2OFGX 1SUQA 2KYZA 3LANA 5HQMA 2B5JA 1JXLA 1S0NA 1TMMA 4AD6A 1HQ2A 3ZTSA 1C1CA 2DNLA 4OYMA 2JHEA 2M7SA 1HNIB 1U49A 4AXIA 3AQOA 4X66F 2GMHA 1D9FA 1PKUA 2RDDA 5DDOC 2W1BA 1UFLA 3KWMA 3D3CJ 3EICA 1VRQC 4YN3B 1XWLA 5K14B 1XQIA 5T7LB 3H5SA 3G6ES 1QAIA 4B9UA 4CM0A 2G1DA 4V19X 5HSPA 4ES2A 4CO5A 2VONA 1LNQA 3R5GA 2I5JA 4CH7A 1T7PA 2O66A 4DOZA 1UJ6A 3J80U 3UO0A 2HEKA 1F5AA 4HHJA 4FXVA 5KG4A 5B0GA 5ITHA 1JJ2R 1RT5B 2NCKL 3R1LA 4BDPA 2W24A 4B17A 2GW8A 2IM3A 4I64A 5H9EJ 3I6PA 1GXTA 5CYMB 2A18A 1S1TA 2E5JA 1Y5IB 4ID5B 1VRTA 1U6ZA 2HQGA 1IBKJ 1YWXA 3VAFA 1WEYA 2QLJB 2ASJA 1NK7A 4MK8A 4OZNA 3VTIA 2VD3A 2D3UA 4DJBA 4DSKA 1SL0A 2W9BB 2FVQA 4KY3A 4W98A 3CMQA 1FRXA 3T1YF 2FLOA 3PIOQ 2CPJA 5DG8A 4P9SA 1IBLF 4J9VA 2IM2A 4CQ1A 5IS2A 1G2EA 4B3SF 1QVGR 1KP6A 3KNAA 4Y2MA 2OD4A 2M8DB 3TAMB 3M8QA 3CCSS 1URNA 4GKKF 4FPIA 3I96A 3T1HJ 4ELUA 2DK2A 2PFDA 4L6V3 1VR6A 2WOMB 2HHVA 3VAHA 4YQWA 3KLEA 4KYZA 1DZ5A 2RT3A 1OY6A 4KHRA 1GFWB 3N79A 2V4RA 1K73T 1X4AA 3SIPB 2HHHF 5CABA 5K9FA 2DH7A 5A8RA 2RKIB 5JUMA 1WI6A 4TU7A 2CZ9A 1KKHA 4U6PA 4U8YA 2BABA 1N6QB 1G3OA 3R2CJ 1U25A 4JI2F 2EK6A 3ZFVA 2MJNA 5HATA 5KFDA 2E66A 3NP5A 3OL8A 3HPOA 4OYXA 1T0TV 1MMNA 3U02A 2HWIA 3C6UB 3PRBA 4OI0A 2HQCA 2I6WA 3UD3P 2LYVA 4PG4A 3R27A 3W9HA 5LT5A 3NMRA 1F3FA 1NLKL 5F0WA 1LW2B 3DGPA 3HLUA 1R8AA 2GMJA 3BDEA 3MM8A 2AJ4A 2E1RA 1YHQS 4KKOA 1RHUB 4KBIA 2CPXA 2LU2A 2PEBA 3MCSA 3AXMA 1NK0A 3MOZA 4PUOB 4X65F 2POKA 5EWEA 5B0CA 1SH3A 3PO4A 2OTJS 4L76A 5J2MA 3SCKE 3FMWA 1NJXA 2CADA 3J7ZT 1MN7A 3K5LA 2IBKA 4ELVA 1NKCA 9RUBA 3VAKA 2WB1D 3MECA 2AF6A 4O3RA 1YG0A 1P27B 1SC1B 3GP9A 2KFYA 2RE1A 4D3GA 3HKWA 5HBMA 4OHZA 4N8OA 3IBWA 4N41A 3W5YA 4YB6A 3QNWB 4CRJA 2JOQA 1GX5A 2YKMB 3RW6A 3JXOA 4IG3B 1FF2A 4FP9A 4DV5F 2N7CA 3M1VB 2LVWA 3BBBA 3HVTB 1DQ8A 1FRJA 1LW0A 3CUNA 4LF6J 3IGVA 3GIJA 4CM2A 2QG9B 3DMJB 3DM2B 1SUQB 2QIFA 1UFWA 4FYXB 3EUNA 4RX6A 4XPEA 2F63A 2CPDA 1XTZA 4A8XA 4YUDA 4ED3A 2MKSA 2K06A 2P2CB 3BN7A 3BPDA 5J1PA 2OAUA 3D2WA 1GQEA 5B0EA 5GAHI 4QPXA 2V5HG 4OLOA 5C42B 3SFGA 4P75A 5I3QA 4Z37A 1RTDA 1IKVB 1E6VA 4DV7J 2X7IA 1RWUA 3GMGA 2GVZB 2I5JB 1S79A 3KJQB 5F41A 1RSCA 2QE5A 3ILOA 5E33A 2QSFA 3UQSA 4LR8A 4N76A 5F8IA 3JQKA 2FC9A 4JUZA 1V9OA 1QLNA 2E5LF 4DU8A 1S1TB 3M2VA 1C0TA 1QM9A 4A48A 2WONA 4CLLA 3NG8A 4M5JA 2CNNB 4CO0A 4AL7A 2DIUA 1HNVA 2KN4A 4ZK7M 3G87A 4NYZA 4ZPWR 3GCXP 3GIIA 1SB6A 5EDWA 5E3CA 1UZHA 1SC6A 3FZBA 4PZVA 1ZPWX 3GG1A 1W7WA 2EFNA 1KC8T 3GJQB 3JAMY 3SDEB 5KFKA 4DSEA 4OHWA 4X4NA 2ZH4A 1UW4A 1WWHA 2X1FA 1KTVA 2ZHBA 5DETA 2CJBA 3A12A 2QZ8A 2N3LA 1QE1B 3W66A 1G7CB 2XYGB 3I82A 4IOAQ 4IR1A 4E98A 4DWIA 1HBNA 5H9EK 2CPIA 3DLBA 1MG7A 3VGUA 2F4VJ 1KONA 3DLGB 4FYYB 3PW5A 2GCFA 2NUHA 2ZBIA 1P1TA 3LALA 5IM0B 2OPRB 2DGXA 3LP1A 2UV8G 3GR0A 1HNWF 1IBMF 1T9XA 2R4FA 3KLEB 3IFEA 4LQ9A 3UE2A 2XSJA 3CJKB 1JKHB 4NMXA 4RU2A 3MPWA 1GMWD 4USHA 2FHKA 3UDCA 4C8OA 3P49B 1XBWA 2RF2A 2MPUA 5DQIA 4R8UA 2B4UA 1D9DA 1R0AB 4WFXA 1JJCB 4DR3F 5IWAJ 2X3DA 4NLXA 1CJTA 2F8MA 5HP1A 1JK9B 3MR2A 2KI2A 4J9NA 2CQIA 6FD1A 1KNZA 2F5GA 2LXUA 2ZDOA 2C22A 5LMNF 2FJXA 1OS5A 3OTDA 2J0QD 2OMLA 2JDJA 1B4SA 5KFEA 3DLEA 4LT6A 1YBTA 1E6YA 3VV2B 4NLGA 4LVOP 4NXNJ 4HH1A 1FDNA 5HO4A 1X5TA 4KGKA 2R2RA 1HMVB 1RU1A 2G2OA 1DRZA 2C42A 5KFBA 1UFKA 4MK7A 2W4PA 2C2DA 1S1XA 1RT3A 4RW9B 1XNRJ 3L95X 3QT6A 2PC6A 4YR2A 4G1QB 1RTHA 3ONQA 1U6FA 3H5UA 2MKCA 3DKDA 1MMDA 1GTHA 1UVKA 3GFHA 1VBXA 4CCHA 1RWWB 1VBKA 2NPIA 2FHJD 5AE3A 4CLYA 4ZLPA 2D9OA 4Q2MA 4KFBA 3C6TB 4CH0S 2CAJA 1M1GA 2PA3A 3UVJB 2ZH2A 4DSJA 4JI7J 4Y2KA 2FUG9 2GHWA 4DR2F 1M0SA 3QO9A 5IT9Y 2AYMA 2N4CA 4MJKA 1RT7B 2I38A 1AUSL 1X5SA 3LAMA 3H59A 1FK9A 5LMUF 2BZ2A 2LFVA 4C0BA 3JAMU 1UKUA 1BD6A 2HNZA 2YNIA 2DNRA 4DV4F 5DS7A 4IQXA 1L3KA 3AD9C 4USUA 1S6PA 3R3TA 2E9TA 2AP6A 1T9WA 1LWFB 3US5A 1R89A 2VBZA 2AWZA 1UWAA 1LW0B 4IYQA 1N48A 3CF5Q 3T9NA 1OYEA 1U47A 4TQSA 3M6WA 4JI0F 2W2MP 4LSNB 1KVIA 2VODA 1TKXA 5EN1A 3J7A1 1H98A 4M5IA 2ZHOA 1FRMA 2HRTA 1FRIA 1RTJB 2OTLS 4N5SA 3M8SA 3BYPA 4QWDA 2AEFA 3D66A 4UT4A 2MGZA 4ICLA 3MPUB 2ILZA 2H5JB 2V94A 2IJNA 3IBCB 3Q8PB 2LDIA 4LFAJ 1ZH5A 5F8MA 4DUYJ 4JYAF 1CULA 3JTOA 3I0SA 4IH6A 3I5CA 5KFSA 1SC4B 2E7XA 3MMCA 2RRAA 5LSRA 2EW9A 2B7CB 1Y4ZB 3GB0A 3PW0A 4DCOB 1IBLJ 2XWYA 1RT2A 3VQTA 1Q7LB 2D41A 1FJGF 2HFZA 3G8SA 3C66A 1WG4A 2ZOGA 5I4MA 3RW7A 1IBCB 3ISZA 2XMMA 2R7TA 3ENVA 2CYYA 2X1BA 1VCTA 3L7OA 3W9IA 4O0NA 5HK4A 2B4PA 4ZP8A 4PR6A 3B78A 3VZIA 2JSXA 4DL3A 2NREA 4DDFA 3V81A 4OJGA 1C0TB 2ZJRQ 3QGIA 2WONB 4YEAA 1ZYQA 4QYZJ 1GT8A 5LJ3Y 2MZQA 3MMAA 3M30A 3UCZP 1H2TZ 3NGSA 1HI0P 2UXDF 4IKAA 4NLWA 1FERA 1T03B 3RU0A 4OZJA 1VJQA 3DRSA 3TI0A 4C0OC 1Q7YT 1UPMB 3MHYA 2L41A 4IDKB 4B3RF 3MR5A 3FSIA 2IJRA 3UW1A 4QYRA 5KFPA 3FFIA 2K2PA 1RAJA 2DGWA 2VBYA 1EARA 1WHYA 2Q3PA 4P7TA 2F8HA 4K5RA 1ICEB 3MEGB 1PAUB 4Q0BA 4NLSA 2CQHA 3T41A 4DQQA 2Y1LB 1S77D 2HBYB 2O67A 2O1PA 2EPIA 1AROP 2CPFA 1YSJA 2DCUB 5IT9U 3LP1B 3CDBA 3KJVA 4RBUA 2GV1A 4F0KA 2V8PA 2XO6A 1RA7A 2GA7A 4RNMA 3BO3A 1IJFB 1T3NA 4DR5J 4OIXA 1REGX 3U1LA 5HANA 2H65B 3JTNA 5JVHQ 2ZM6F 4R8UB 3QGGA 1NK6A 2AJFE 4JI5J 3DLKA 4Y2AA 4ZIWA 3ZZPA 5GMDA 1FD2A 4PAAA 1HNXF 4ECSA 1CBKA 1LFWA 2DNOA 2RSQA 1KSPA 3K0JA 3VAGA 5KFXA 3OFGA 5BYQA 2P9GA 3LA0A 4X4QA 4M5DA 3GFXA 2MB0B 2APOA 3DOMB 2F65A 2DRAA 2HNYB 3DRPA 4LUBA 1WF1A 5E3AA 3AJDA 1KDNA 3MM5B 4PQUA 4G3IA 2PT0A 1E6YB 2WZ1A 1N34F 2YQ0A 1NRKA 3K5PA 1YJVA 4ZVTB 2E5IA 1C2PA 2V4QA 1U0HA 3M2RA 2V2VA 2ASLA 3K7RA 2AJ0A 2I2YA 1M5VC 1TL5A 5J2QA 1M1HA 2VPZB 5B0AA 1REVB 4C6AA 4ZPAA 4LQ3A 1RTHB 3MURP 4DL2A 2EG2A 4I2PA 3BSNA 3RGIA 2FHOB 1TMJA 3DDKA 2NYHA 1EIYB 3IRWP 4JI1J 1TL7A 4JB8B 4M5GA 3S01A 2YVSA 1H72C 3N6NA 5I3UB 2UP1A 1VLOA 2OPSB 3ADAC 1HQEB 2ABYA 3M9MB 2G2ZA 2VASA 2J7UA 1TR0A 5C7PA 2AU0A 4AE5A 4KFBB 1DQAA 4B3MF 2CNLB 1C0UA 1Q8KA 2BJ1A 3OHBA 3VWSA 3T5KA 2Q1LA 4HI1A 2FJEB 4DMZA 2GHVC 4K50A 4Q7AA 4ZVRB 1IWGA 5DDQC 1MW7A 1WI8A 3EXYA 2J5AA 1B99A 5M2UA 2WBRA 1ZS6A 4Y3CA 5D6GA 1T05A 1R6VA 3GJRB 1FK9B 3OTEA 3G6VA 2ZOMA 4LF8J 3SCLE 2HNZB 3GE9A 5LOQA 3K5OA 3FEYB 3SXLA 2PGCA 2YNGB 2HRUA 4LFBF 1NKBA 2V0NA 3S7RA 5KT2A 4A8MP 1I6JA 2VBWA 4J9PA 1NSAA 1J2VA 1S0MA 1MWQA 5K8MA 3P3DA 3PG9A 1NNDA 1ZZFA 3J81Y 2E5LJ 4HLBA 1DARA 2VG7A 1YZ6A 1NH7A 1TKXB 1WORA 2AYGA 1YBUA 3E3XA 3KLGB 4NRTA 2HMIA 4RUHA 2W9AA 1BHNA 5T14A 4ER8A 4JV2A 1LWEB 1NMEB 1V3RA 4YMEA 1ZOTA 3VGVA 1YQHA 2WK4A 2GGPA 4ICLB 2PMHA 4JI3F 2DNGA 1HPZA 4BHQA 1RT6B 2UXCF 1UA1A 1WC1A 2MEWA 4ZJQA 3CCRS 4BLGA 2RJZA 3CC7S 2GS8A 1SKRA 2WW8A 3G71S 2NZCA 2DY1A 3IMQJ 2ZKUA 4ECVA 2NS1B 4JV5J 3ETOA 1X9WA 3QMQA 4MKYA 1RTIB 1HR0J 4C9DA 5H9FJ 3KOAA 5KFAA 2RQMA 3LO3A 1P6TA 3GWCA 3EZUA 4MIBA 3OVSA 1UVNA 2QA4G 4KHMA 3QFHA 2ZUAA 3CEDA 3T5JA 2Z57B 1GMWA 4OL8A 1CJKB 1S1UB 2MQOA 4HH0A 2EC2A 4DPUA 4K4ZA 1RAIB 1U0SA 2L9WA 3EDQB 4UOHA 3M30B 4FXDA 4V19J 2HHUA 3GR1A 2O5DA 5IOLA 2KZMA 1CPZA 3VALA 1N33J 4KH0B 3DGVA 3EPGA 2WSFC 4ZVPB 5KG5A 3RRKA 2EWHA 1U1MA 2QJ3A 1FFWB 2MZTA 2DRBA 1JLEA 2OUGA 2HQ3A 5F9LA 3FFIB 3GIKA 1FNXH 1FI4A 3JSRA 1C1BA 1DHMA 4USKA 3G82B 3AOCA 2CXEA 2HLTA 3GZ7A 3VAJA 3D7SB 4C8MA 5HMYA 2EKNA 2EFQA 4Q0BB 3M8YA 4PG7A 3CCJS 5C2GA 3UCUP 2XCPA 2HLUA 4YY3J 1ZTTA 1LQ9A 2JZ5A 3OR1A 1HI8A 2DNKA 3IP0A 5CCLA 5CZVA 2H54B 1NPKA 1IUJA 1M5KC 3I55S 4QYZK 2FZGB 3OHAA 5JMNA 4ZPCA 1KEKA 4GKJJ 4NMLA 2DR8A 4QIEA 4OYIA 1HL6A 8RUCA 1CEZA 2P6TA 3IRXB 4IG0B 3G2XA 4EMDA 4DBQA 2IFXA 3NGRA 1GH8A 4X4UA 2CJXB 3D6MB 4F4WA 3QT7A 3J81U 1LWCA 4I56A 2K1RA 5KG7A 4DFMA 2XSFA 2PA8D 4L3NA 3KHRA 3CTRA 1WKLA 1S9FA 2J0SD 2NUUG 3D6FB 2KJVA 2JJ4D 1S1VB 2M8HA 1NH8A 1W2BR 2XMUA 1VK3A 3SSRA 1KS2A 1IR1A 2B9EA 3N6MA 1B70B 3QAUA 2HGMA 2QLBB 3QJPA 4PG6A 1N0UA 2GNKA 2GFFA 1KLNA 1YKWA 2RIJA 2WVDA 3VGSA 4DX6A 2LQ8A 1UJ5A 4XTTA 3OW2R 3VAIA 1VI7A 1KQFB 2AYBA 1MU2A 4W4MA 3WIUA 3OTOF 1TKTA 2FTRA 4LF1A 5J2QB 3FVYA 3ET6A 5EWGA 3NNHA 4M5NA 4ZOSA 1FFSB 1I51B 2MKIA 4K2XA 3F44A 2MDAA 2XMAA 3SSQA 1F6TA 2GAGC 2ZUGA 4F4KA 4I2PB 4K0KF 4Y0FA 2VB6A 3MM7A 1WF0A 5LL6d 4OYZA 3CIMA 4KR0B 4QIGA 2DVIA 1RABB 1XR7A 1TV6B 2BJEA 1S72S 3ENWA 2MZ1A 1UTAA 2OGUA 2F9DA 1IKYA 3ZZUA 1K44A 5A8WA 3LQVA 2HPUA 2OSQA 1M1KT 5JXSA 2FGOA 2RDIA 1TELA 2GO8A 4JI8F 3UN5A 2LCWA 1HBMB 2AMCB 4DV0F 3DHWC 1PSDA 3POTB 3TJAA 4QWEA 3KK3B 3H0PA 4DL0C 4OZ0A 4WWSA 2UU9J 3DI6B 1SJRA 1AZSA 3IXQA 1WOOA 3BGRB 3SI8A 3I32A 1KQKA 2KM8C 4C97A 3HVRA 1SQEA 4NE9C 2R2UA 4MFBA 4FKYA 5FJ4A 4ETXA 3UN3A 2LQJA 3HMJG 4ZLNA 2AYEA 4R25A 4CO3A 3CJ3A 3NCRA 5E2QA 3Q83A 1B3TA 4HACB 4X84A 1ZM4A 3LP0A 3RB0A 1R3NA 3MI7X 2HFUA 3LGHA 1X9MA 1RK8A 3V6DB 1XIQA 3QZ7A 1FDAA 1NBEB 3BBFA 2HMIB 2AIRB 4XDDA 4DV6J 4RUAA 3QJJA 3ZXWA 1JLAA 3NNAA 3MM6B 5KG2A 3FRZA 3W63A 5CYJA 4PEOA 1PYSB 4ZVOB 4DHVA 4WBFA 2IJFA 4RW7B 4W92B 3P8BB 4FKXA 4FZVA 4C98A 4RW8B 3PXGa 4HTIA 4G65A 1UWBA 2QRRA 1IKWB 4MMOA 1H7WA 2ZH9A 2QL9B 5G0RB 4KGVB 3K5NA 2RH3A 1X4DA 1S59A 5KFCA 1Y5NB 2FVPA 4RBTA 4ILMA 2HWTA 2HHQA 4H4KC 2F9JA 4D3HA 4WJBA 3EXCX 1EETB 5KFTA 4P10A 3PNIA 1I94J 3D67A 2EBGA 4USTA 4PPZA 3HHEA 3KLHB 3HHLD 1G4CA 2HVZA 4DV2J 2XM3A 3HFVA 4NWBA 1ROFA 4LF7J 1YK9A 3AB2B 3OFHA 1CC8A 1SJFA 1SCJB 3MEDB 2HBZB 1ZAVA 2GVDA 4DR1J 2HS0A 1RAOA 3ILLA 4LSZB 4KTQA 3GFZA 4ZJOA 1ZA2B 4CT9A 4X64F 1QSYA 2Y8YA 1C1BB 1RA6A 4QJVA 1AUDA 4YFUA 2FZKB 4ZHRA 2OPQA 1RWOB 3CO0P 1S9EA 3H4DA 2W4CA 4ZS6A 3OJUA 2HKEA 3MR6A 1YJTA 1N5QA 1A7GE 1Y00A 3KMSA 1N34J 4O23A 2J7WA 3EVOA 3IBFB 2BR0A 4LFCF 5CYQB 4DR7F 2W7OA 1HYSA 3JSMA 4CIOA 1NSPA 4EGLA 4X4VA 2UUCF 5IQ6A 1B7YB 4FYVB 2LQ9A 1FRLA 1Q5VA 4IFVA 2JVOA 1QSSA 3HVWA 3N5FA 3I4HX 2HFOA 1QTNB 4KH1B 4LRFA 4CO2A 5KT3A 3M7VA 2D3ZA 5T41A 3RB3A 3IM8A 2CRLA 2K7KA 4ZITA 5A8KB 2UUWA 2IC3A 4JI4J 3G96A 4EZ9A 4NL5A 3BJYA 3PFEA 3M9OB 1O5JA 1YX2A 2AJQA 2B43A 2ZH8A 1GXUA 4WE1B 1WC0A 3MTJA 4WU2A 1S9GA 4O4GA 1N4LA 2QYGA 1CC7A 2XS7A 5L38A 1WKKA 3JS9A 1P8GA 1DLOA 3BQ0A 3Q86A 1WJ9A 2CIMA 4TY9A 3RUBL 1XNQJ 2IRXA 2YKAA 3B82A 1XMQJ 4OFZA 5D3GA 2WSEC 4KQZA 1NSQA 3D0HE 2I1RA 2BBEA 1EX8A 1GEHA 1PGZA 1HQUA 1MU2B 3A3OB 3DDNA 1JQGA 3HI9A 3A3PB 3NMAA 1RBLA 1VQOS 1NK9A 5J1EA 4W90B 1FWPA 4GVBB 2RUGA 1CQNA 3NCPA 5K8OA 2A1BA 2XMKA 2J9CA 3ET6B 3EGWB 3U7JA 4CNYA 1DTTB 2PI5A 1SPBP 2RQKA 2CJ9A 1FKPB 3HJVA 1FXLA 4I2QA 3AXKA 1XERA 3BKTA 2GJ2A 1VBZA 2E1PA 4C11A 2NXNA 3PYDA 1T9TA 4KO0B 4DSFA 2PEHA 1IKYB 3HSJA 2VQEF 3M9NB 1IM6A 4WFAQ 4ED4A 1HKAA 2ZZNA 3THVA 5HMWA 5ETNA 2V2ZA 1ZA1B 2CPEA 2J6SA 4F50A 4QCLA 4X4PA 4X62J 1PCAA 3FCWA 5DM6Q 1HHTP 4ZVUB 2BE2A 1FD8A 1CJVB 1F9EB 3HJFA 1RWXB 1VRUA 3QRRA 4LVNP 4RBVA 1VMBA 3K5MA 4ECWA 2X3GA 3R7BB 1T02A 5E5NA 4OX9F 5BYRA 4MIAA 4BS2A 5HL7Q 2ASDA 4PKDB 3Q24A 3LP0B 2VC1A 1A6LA 1KN6A 1RT1A 2QT7A 3MAQA 4FDFA 4N77A 1MSWD 3PCOB 3C3LA 3W9JA 4AXJA 1URRA 2ACYA 4ANDA 5IT0A 2GQCA 4UOFA 1DQ9A 2MTLA 2E5GA 1F0XA 3KK1B 2B9XA 3O3LA 1ZTWA 2ACMA 2M52A 2DXDA 2OEKA 4ES1A 1KWMA 1D8ZA 4MKAA 3U1NA 5HROB 3GV7B 3OFEA 5FDLA 2IA0A 2DR7A 2V6AA 5FD1A 4RW4B 1XR6A 3DOKA 4C3KA 1RAHB 4UZCA 2CQ2A 2R7SA 2G0JA 1S97A 1OO0B 1WDTA 3BH6B 2GC8A 4DX8H 3A4TA 2DO0A 5EX0A 3EPIA 3R9LA 3KK2A 4F3OA 1NO8A 5CCMA 2HFNA 1VIOA 4DV1F 4L75A 4RJVA 2Z8QA 2DO4A 3IWNC 4ETZA 4DXLA 5C25A 2HS3A 2PMWA 4I0WA 1FDDA 2BV3A 3CDUA 3MMBA 2RD5C 3I0RA 1KRPA 3TEHB 1QAXA 3PW2A 2KT5A 2WBMA 2B3TB 4AQYJ 3PFOA 3TANA 2NPFA 2FY8A 1VQ4S 1O6XA 2AX0A 4P2FA 3A3NB 4QPTA 3GJSB 2UUBJ 5A0YA 5KT5A 3P5TL 2OPQB 3QATA 2Y1IA 3QGPA 3R7SB 4PYAA 4TXSA 2E9RX 2FJWA 1VQSA 2BDPA 2KB2A 1HYSB 3JSMB 1HHSA 2DEIA 1VLYA 3UD5A 2OELA 3TVKA 3DCAA 2ZVSA 3F73A 1KOHA 2C3OA 4B9LA 3VQSA 4GO7X 3W65A 1JIHA 2QX0A 1FTRA 4A46A 3QT8A 4Q43A 3EZ5A 3F41A 1HBUB 1D9AA 4O44A 3QRQA 1S57A 4HEA9 2G4BA 3M05A 3OSNA 2RQCA 1KLMA 4ZPVR 1CJUA 2MQQA 1HFEL 2R7OA 3C15A 1TL1A 3KKFA 1S1WB 4WZMA 1O51A 3SSSA 2N3OA 3OR2A 5IC4B 5J2PB 2HK2A 1VQYA 4JI8J 2P6SA 2EKYA 1HIYA 1Y11A 1Q4RA 4H4MA 1UVIA 2OFHX 1RKJA 3IO1A 3X1LB 1R43A 1JLFA 3MCNA 5D3GB 4A8OA 1SV5B 2H4YB 2NXEA 2DBBA 4WF9Q 1VQNS 1HQUB 3VCDA 4JP8A 3HULA 3UFCX 1TKZA 3MAAA 2W01A 4NEZA 3RAMA 2J8AA 2R2SA 5ETTA 1FT8A 1Y5LB 2YKPA 1R7IA 4ZKAA 5HN0A 3R7NB 4A47A 2VIHA 3BYRA 3N9UC 4DZ6A 4U7UD 1VQ9S 5KG3A 3W61A 3SQOP 2XMWA 2CJQA 1QSLA 2ZFHA 3PJ9A 2AGQA 3ICLA 1QAJA 2XZDB 2D7SA 1NHKL 3H98A 5L1IA 2DNYA 1IR0A 3PHEA 1T3OA 4C11B 3JTPA 1HD0A 3BO2A 3PJWA 3D4JA 4ZVEA 1Q78A 1R8HA 3JQJA 1NJIT 2OPPA 3NWRA 2AGPA 5B09A 1IJEB 2PMZD 1RKIA 1BWVA 4U8VA 3UDLA 3DHXA 2UXBJ 1XJWB 4AL6A 4OX8A 4P74A 1U48A 1VC6A 1H6KX 4UUWA 5IV4A 2VG6B 3GJTB 2CQCA 3T3FA 3G8QA 2MKJA 4LF9F 2L08A 3PACA 3PW7A 3E51A 1F9HA 3PKMA 5HI7A 3OFFA 3D1HA 3ZZRA 3CJ0A 4YHHF 4C8NA 2F8EX 3IG1B 2C2MB 2U2FA 4DPXA 2FY1A 1NM2A 3TJ8A 5CHCB 5D4NA 2BJ8A 3OXFA 1RISA 3R5BA 3ZTQA 2F4FA 3UR3C 2IM1A 4TY8A 2MLXA 2OP5A 3AHPA 4USVA 1N36J 3WIVA 1RT1B 3TWZA 3HFZB 2DGTA 2GAHC 5AJ3J 4FF3A 3M4XA 2ZBCA 4WCEQ 1N32J 2JWNA 3GG0A 2VZ9A 4NXMF 2YX1A 1AXQA 4RR5A 1GNKA 1YJWS 1Y10A 3BR9A 2VDIA 3CCES 1WSRA 4B3OA 1B0VA 1LWXA 2CG4A 2A2CA 3FDSA 3KDOA 4MYUA 4ILRA 4PXDA 1F3VA 2V8VA 5DG7A 2JEFA 2HWHA 5FDLB 1SL2A 3UN2A 2QGFB 1FKOA 5LSOA 1VC0A 4K4XA 4NZ0A 2KRRA 2B6AB 2C3MA 1B64A 3BSCA 5CH7B 2BKOA 1U8SA 2Z2YB 4B9SA 2BJ3A 4NI2A 1H73A 5ADZA 3TOQA 2H48B 3Q89A 3CCLS 2C2ZB 4DUZF 2DT9A 3ZC4A 5D77A 3BDPA 2HFSA 3EYZA 4LMZA 4DG1B 3PYEA 1Q16B 3H5XA 5CAAA 4TLQA 1YTYA 3GSDA 1BLUA 3GIMA 2DYAA 3QSIA 3MR7A 2Y1RI 3M6XA 2O01C 2KG0A 1VDHA 1AB8A 3RBZA 2UUAF 2BM1A 1MLAA 5K20B 1HBOB 3KLIB 2EFPA 3SQGB 5C2CA 2Q43A 4L73A 3DOLB 2ZZTA 2C3PA 1KQGB 4JBCA 4MKVA 4DR6J 3DRRA 2RAQA 4DUTA 4RNNA 5DO2A 1XMOF 4Q8EA 2IYGA 3KLFA 3C2PA 4OV1A 2ZKTA 3BSAA 3IS9A 1HNZF 1YLXA 3HF5A 4XDCA 4AUKA 5A0YB 3SBMA 1TL4A 4BWMA 3BPSP 4HKQA 4OZLA 2ZVIA 3KG4A 1I1GA 3PV8A 4XO0A 1X0FA 2WB4A 2VA2A 1RCOB 3NOCA 2RU3A 4R0JA 2VQFF 2DITA 2X51A 1EP4A 1LFPA 4ECQA 1A9NB 5BXIA 1N5SA 2YWEA 4O3OA 3ZNJ1 4DLGA 3ITHA 4FS2A 4NLOA 2A2DA 3ISNC 4WZQA 5DDPC 2ROEA 4O44B 2YH1A 4Z2XA 1K0TA 3C14A 3IWXA 3K8WA 1UW9A 2PN6A 4CT8A 3UR0A 4OI4A 6FDRA 3OL9A 3TVYA 1SIWB 3RBDA 4Y00A 3W3SA 1NUEA 1HHQA 1LK5A 2VQEJ 3Q23A 4DN0A 1H74A 3LP2A 1N8RT 4U7CA 1I5OB 1KHVA 2ASYA 3IN5A 4NCGB 4ITSA 4RLEA 2IVFB 2UVUA 2VDHA 4WIIA 4G1PA 3EZOA 3L4BC 2DNZA 4DLEA 4J9SA 1JLFB 1UAWA 3JQMA 5G4DA 2V2KA 4K2JA 4CI0B 1RUSA 4LRCA 4CTAA 3E01A 5E3PA 1NB7A 1UETA 3UWTA 4DR4F 3DNCA 4IFYA 4I6YA 4H4OA 3K89A 4OX9J 1CVJA 3H4BA 3NS7B 4P2MA 5EGYA 2HG4A 1TL3B 4PQAA 3AOAA 4QIVA 1JLGB 2G13A 1FJ7A 3PW4A 2ZE2A 3I9V9 3TVZA 5KFUA 2BOAA 4JOUA 1WTFA 2FZCB 4ZLJA 1TAUA 4IOBA 4Q2LA 4I7FA 3QQCD 1YZ7A 3LOUA 3Q22A 2YKNA 1DTQB 5AXNA 4LF5J 2WTFA 4TNOA 2MHEA 1N5YB 2HIQA 1RT4A 2GIQA 3FNNA 1H38A 3TQ1A 5GADU 2DNMA 4NLDA 1QUVA 4LF4J 4K4WA 4Q5VA 1YVFA 1R0BG 4J9LA 1M90T 2G0CA 1JLCA 3PKYA 2CVIA 5K8PA 2B4VA 1N52B 3UD4P 1V5VA 2H51B 3JSBA 1RP5A 1PJ6A 3IA0A 4UTGA 3CCZA 4ZP6A 3OTCA 4OYAA 4WFZA 3HHLB 2MQNA 3OD2A 4RW6A 3DU5A 1PC5A 3M32B 3M8ZA 4K4SA 1HLWA 1IKXA 1IBKF 2B56A 1IM4A 1RWPB 2QA1A 1NJWA 4F67A 4CLWA 3W2WB 3QFWA 1RHQB 2D74B 1YJNS 8ATCB 3ZO7A 2ZH5A 2KT2A 2OI2A 4JI6J 2DCLA 4MT1A 1APSA 1CG2A 4M5HA 4LIRA 1NCLA 1VBYA 4GC7A 1M5SA 3R5DA 2B5JB 2V8DA 3V4IA 1Z2ZA 5E3RA 2C2NA 4ED0A 1C1CB 1Y9OA 3CB4A 2V4JA 4CDIA 2VPWB 4NI2B 1MN9A 1RJJA 3CJQA 3PVXA 1GAOA 4DV3J 3QRPA 2M2BA 1AYEA 4NLQA 3AH6A 4KV8A 3T1HF 2E9ZA 4DS5A 3TJ9A 1VQ7S 3ZZZA 3CDWA 5KTQA 3D54A 1I3OB 4UQTA 2FJBB 3CMAS 3K59A 2ZD1A 1N54B 1KR4A 2VKZG 3W2VA 2MQPA 1RAEB 2QSWA 3I4PA 3KJFB 4X4TA 1A0OB 4CZCA 5CD4H 2R8HA 3TA0A 1U1OA 4HI2A 2KDOA 4CLFA 6AT1B 4N7TA 2ZH6A 4ZPDA 2IBOA 4A8YA 2BX6A 2E1CA 2IAJA 2BANA 3OUYA 2E5HA 4KGMA 5D78A 5D4LA 3CJ2A 3PIPQ 3DRRB 1U1QA 1R0CB 4F4XA 4ES3A 1PYOB 4ZIVA 2ZJQQ 4YR3A 1FRKA 1K1QA 4EO8A 3Q2TC 3O5TB 3SCIE 1VRTB 2D3OR 2C2KB 2HVEA 4WP8A 1TK5A 4GO5X 4R5PA 1EJ7L 3CC2S 3HSZA 5ETOA 2FVSA 1MNEA 2AJ1A 3HZGA 1NPRA 1FE0A 2KXNB 1RCXB 2OLWA 4ECXA 3O1LA 3P45B 5DJBA 2IDEA 3W60A 4YP3A 4UZBA 1EP4B 3ILIA 4NLRA 3M2UA 4K4TA 1JLQA 4NLTA 1YJ7A 2NXUA 2PDAA 2IY5B 3N01A 4J90A 2J9DE 4HVZA 1KVJA 3MOJB 3FSXA 2FGCA 3C14B 3M8QB 2WW4A 1AW0A 4C48A 4FYDA 4P52A 1HNIA 3FCHA 2B8QA 2QO3A 4CNZA 1F2GA 1IWAA 4K7QA 3FRYA 1NPPA 5KOXA 1OSDA 2BW7A 2NR0A 4O3NA 1IVZA 4USWA 3JB9k 5A8RB 5F8GA 3BGFA 2XI3A 4DL4A 2XNRA 1Y7PA 3EX7B 4TN2A 4JV0A 1X4BA 3FBCA 4ED8A 1Z4UA 1TU0B 2ZJPQ 2LA6A 1FEEA 3NWGA 3M6UA 3QYYA 2FVRA 2K3IA 4C0HA 5A2QY 3G9CA 2YNHA 5ETKA 2R7UA 3MMJA 2LDYA 4CTAB 1JB0C 3OXLA 3E01B 1FCAA 3RYLA 3J7AN 1YIJS 1X9SA 4ANEA 1PAEX 3IWLA 1SJ3P 3T5LA 4NYOA 3BGLA 2ALZA 4QZVB 4XAKA 4LF6F 1EB0A 3ZTRA 1BGXT 5DGAA 5CYMA 2JLEA 4I67A 1S7IA 2RILA 4ID5A 2Q79A 2ZE2B 4DF8A 2DXFA 5FLXY 2MLZA 3D6TB 4MK9A 4CO1A 2HVIA 2BYCA 3D0IE 3CULA 3R5AA 2U1AA 3DGPB 4PWUA 4M5LA 3TUJC 3LAKA 4P72A 4NCAA 3GYXB 3MM8B 4OZ3A 4KKOB 2W9BA 4M63A 2ZC4A 3NBPA 2WAQD 2BKNA 4HHUA 3BQ1A 3BV8A 3DRYA 4DV7F 4ALZA 1U09A 4CLTA 2ZH7A 4Z7CA 4EBCA 2CQ0A 3SCJE 2HBQB 3BR8A 4CLSA 4P6QA 4ZPTR 5KFIA 3A13A 5CD4A 2Z30B 3BS9A 5GAGU 4WFYA 4X66J 1H2UX 3NXZA 2XY7A 1JLCB 3TAMA 5J2MB 2RQ4A 1OY8A 1MROA 1JLBA 1FESA 1F60B 3RB4A 4O3QA 4IUFA 1TZ0A 2EFGA 4ED1A 2FLLA 1KQSR 4DEZA 2VV5A 3MECB 2J0WA 1GMUA 2XMTA 4RW6B 5HAOA 2RVJA 4K4YA 1RZMA 3GCWP 4ZCLA 3TX8A 4A8FA 2F40A 3A8JA 1FHTA 5HBMB 4RPFA 1YRUA 3CJ5A 5DLFA 1VS3A 2A0FB 3NCQA 2MXYA 2B8PA 4TU8A 3O2IA 3DRXA 4EWTA 5KOWA 5IV3A 2HURA 4ZVQB 2AEMA 1D3WA 2B7BB 4EBDA 4N8NA 2R7WA 4TVAB 1V3SA 3RZAA 1U1NA 2DNNA 2L48A 5L39A 2DR9A 3J80Y 2CQBA 3CDEA 3V4IB 4ED2A 3GV8B 3BO4A 3HCXA 3PEHA 4J9RA 2KVQE 1HWJA 3KHGA 3TUIC 2AW0A 3KUGA 1RLDA 1B0TA 1X5PA 2E7VA 4ZVHA 1W2IA 4UOCA 2F4VF 2AEJA 3B6BA 2R8KA 3BGOP 4ED5A 4IO1A 2K8GA 1YDLA 2VQFJ 1RE1B 1LW2A 2ZD1B 5CZXA 1HW8A 2WSCC 1IQTA 4NLUA 3T1YJ 1RTDB 5A2QU 1Q79A 1E6VB 3AAWB 2KHDA 5A6PA 1UEUA 1XEZA 5HVFA 5DRKA 4TKTA 4B3SJ 3FBEA 3KNGA 1KBRA 2AGOA 2VOPA 3Q8SB 3UNGC 2KT3A 4DCJB 4GKKJ 1D1UA 4I4BA 8AT1B 1N56A 3U27A 1VHIA 2CWXA 3FKBA 5KFZA 4NRUA 3DC2A 2DHHA 3M2VB 4KPCA 2HHHJ 1HNVB 2A6MA 2PFFB 2QFJA 5IT4A 2HNDA 1JXVA 1Q0NA 4R5PB 2BA9A 2E7WA 2ZC3A 4RO0A 1FNOA 1U2RA 2KTQA 3AFGA 4NXNF 3LTOA 3AJ2A 4U95A 2CPYA 3H42A 4JI2J 4P2XA 2MMYA 1S5ZA 1NU4A 5MLCV 4MAKA 2YKMA 3UNYA 1IQZA 2ALYB 1XNRF 1SI9A 2XYPB 2R8JA 3P4UB 1JLQB 3UDEA 3M1VA 3HVTA 3WC0A 4F2SA 2AT1B 1VQ8S 4I69A 1M5PC 1BC6A 2GJFA 3DMJA 3FZ2A 1FJCA 2CVEA 3DM2A 3HDSA 1HBNB 3NAIA 2YY3A 2M5YA 4M1KA 4OZ2A 3MFIA 4YDXA 1D09B 2Y3YA 1JMTA 3NAHA 4OYBA 1L3UA 1Q86T 3L9ZA 2XB2D 1FX4A 3ULHA 2HAFA 2VFRA 2ILYA 2R7QA 5DDRC 5IC6B 1MWZA 4TLRA 4KSEB 3T6BA 2ZDPA 2XSJB 4JI7F 3ZTOA 3MPYA 1Q5YA 3H2VE 2RRBA 1H3DA 4ILLA 3U1MA 3HD2A 5ETMA 2RF2B 3W62A 3O8WA 3H25A 5C42A 3N4WA 3IR7B 2KFZA 1IKVA 3JSYA 1SC3B 5DZ6A 4X65J 1NZAA 3MD1A 4FBUA 2QTWA 5KT6A 2GVZA 3RB6A 3ZTPA 2YNHB 4LRDA 2XMVA 2EFOA 3D0GE 2LEPA 1CJTB 2PO4A 5HP1B 4F04B 5DQHA 1OWXA 3I5BA 4DPTA 3TUPA 4F4AA 1UZDA 2CG8A 4WXOA 4PABA 1S0VA 3LWLA 2WVFA 4KAIA 3S1TA 2FVCA 3I31A 2D9PA 2XCAA 3DLEB 3GV5B 1T9YA 1CS4A 2F7VA 2I8EA 3I5AA 4DQRA 4E0DA 2MZJA 3ZZYA 2V63A 4ZA1A 5KG0A 3MD3A 2DNQA 4UUXA 2JEJA 1S1XB 1RT3B 3DFEA 1RDRA 3CJRA 3HO1A 2QMWA 4DV5J 2Z58B 2XYHB 1CQMA 4LFAF 3S8SA 3CC4S 2DGSA 4DUYF 1CSJA 3IR6B 3SDEA 4N47A 3NBPB 4Q44A 4NA1A 4TYBA 3OV7A 1KVKA 2COLA 3SMZA 4CWBA 1WEXA 3J81j 1S6QA 1QE1A 2J9EA 2DXEA 1RHKB 5GADI 3D68A 2JFKA 4C2MA 5BR8F 2FDNA 2XI2A 2FB0A 3QIDA 4FXWA 4ID8A 5DM7Q 4KJIA 4B08A 1MROB 5RUBA 1NJZA 1JLBB 3DLGA 4EU0A 3CGIA 3GYGA 5B7WA 5IM0A 2OPRA 4IR9A 1FVSA 3QO9B 1ELOA 2BJDA 3EGNA 4Y6IA 2D3O1 3CNQP 4Y28C 3CJKA 1JKHA 2FJVA 3THPA 2YNIB 2R7XA 2KL8A 5D0GA 1S6PB 2KH9A 1R0AA 4NASA 1SKSA 3MXHP 1WC6A 3HT0A 1HD1A 3HM9A 1QUPA 2VG5A 3OVAA 1NEEA 1KHWA 3CJSA 3K8VA 2MZSA 2M0GB 1L5UA 5E0OA 2YWWA 2QFIA 1T94A 4USJC 3W5ZA 2HS4A 2J6UA 4WKYA 2XQCA 3QIPA 3NNCA 3KG0A 2HVHA 5KFOA 1RACB 5EX3A 2QL5B 2ZITA 2MGZB 4IH5A 2V8HA 3CSKA 3CO9A 1FVQA 2YH0A 4IRCA 4RWWA 3T6JA 4F3MA 3IR5B 1HMVA 1CULB 1GMVA 3I0SB 2PI4A 3FJ2A 4LR7A 3IC1A 2H1YA 5KFVA 4IO9Q 4WU3A 1FTCA 4RW9A 3MMCB 4KRWA 1J5OA 4G1QA 3H7HB 2L9NA 3R5JB 2HHXA 4DR5F 1RT2B 3PX4A 2VJVA 4BWJA 5ETPA 1OSCA 2JH3A 3CD6S 3BKUA 2DNHA 4OYPA 1UVJA 5L1LA 3L7UA 4JI5F 3KMQA 5KFHA 2ZBRA 1VOMA 3C6TA 4GC6A 1HNWJ 1IBMJ 2EFVA 3F0NA 4FN5A 4WP9A 2AKWB 2DTJA 3V81B 3UVJA 2CJYB 2YXLA 3TR5A 2MY7A 2V34A 2ROPA 3PRVA 3MMAB 2LQ5A 4J9KA 4DX5A 2HNDB 1O8BA 1GK8A 2CQDA 1RT7A 2BM0A 2RS8A 2AHOB 1TK0A 3DRSB 4TU9A 1NJYA 1AA1B 4DR3J 1Q82T 2VPXB 4WFBQ 2OHDA 1Z1ZA 1EQ0A 2E29A 3M6VA 1P9QC 3R2DJ 4ZCIA 1LWFA 5D0HA 2YKQA 4WK3A 5LMNJ 2XBPA 4O3SA 5EUHA 4DU7A 4C8KA 1YITS 4NZ7A 4WFNQ 4DL5A 1TUVA 2JC1A 4LSNA 4JI1F 2OD6A 4UW2A 2IA6A 1KOOA 1RTJA 4G1IA 2V8GA 3HD1A 4Z7YA 3QSYB 3GTYX 5HQLA 1BQNA 2XNQA 5D4OA 2QA2A 3KJVB 2N7YA 5F8JA 1RWMB 3AJ1A 3MUTP 3CCMS 2DHXA 2WVBA 7FDRA 4LF2A 3Q0AA 4XIUA 3G6YA 1BMQB 2QLFB 4ANCA 1VK8A 4CLZA 2GJIA 5C24A 4HHHA 3DLKB 3AQPA 1UPPA 1RYRA 4ZP9A 4NEYA 5B08A 4PG8A 4UOGA 5GAEU 4LF8F 1U26A 3ZZ0A 4A8WA 1WHXA 2VOOA 1QY7A 5KT4A 2RHQB 2XHWA 4LRAA 4HT5A 4M5DB 2ZBPA 2X1AA 2EVZA 3DRPB 2P8IA 4O4RA 5E7OB 2M9KA 1W25A 2C2EA 2ADCA 2Y0BB 4PQUB 4DR2J 1RHMB 4ZLLA 4URGA 1PG5B 2LQBA 1WSVA 4GVLA 4AT1B 2N4DA 4DPOA 1DFDA 2BQUA 1CS4B 5LMUJ 1X60A 1S76D 3BGUA 4ZVSB 4C7QA 2FJDB 4B9TA 4M5KA 1TP7A 4FYWB 1U0HB 4DV4J 3M2RB 2VJUA 2YNFA 5KFLA 1T03A 2WVCA 4I6AA 4MKBA 1S49A 2H4WB 4QU7A 4IRKA 5E41A 4QQBA 1UVMA 3TARA 3OT9A 4F02A 4IDKA 2LMIA 2HFVA 5F8HA 3EVWA 1TKDA 4U9RA 5AT1B 2LEBA 2EEYA 2PD1A 4JI0J 1H0HB 1TL7B 3PX6A 4RNHA 4QBUA 3B4MA 2KO1A 4JV5F 1HARA 2ZHAA 1S6QB 2HZVA 1RBOB 4PWWA 3FEXB 1FEHA 1MWYA 1HR0F 2R8IA 2FHMA 3MEGA 1C0UB 1N5TA 2IPOB 3TZZA 3WHIA 2R42A 4OV6A 3AY0A 1RAGB 1HI1A 5DLGA 3ENQA 3WDOA 3PYFA 4JYAJ 1SIZA 5GAGI 1SQFA 2WHOA 4OZ5A 3FC9A 5A6WA 4PWDA 1R27B 2IVMA 1PBUA 4KPYA 5EWFA 1TFWA 2LU1A 5J2NA 1T05B 4URSA 3MAHA 3G8TA 4G6VB 2MHNA 3TRGA 4FVMA 1S4EA 2RDJA 1FJGJ 3V6KA 4LREA 1BQMA 2DGQA 5KFMA 3RR8A 1N33F 1T8EA 2JNJA 2EK1A 1U6BA 2IMOA 1RAFB 2QL7B 2ZWPA 2VG5B 2CNKB 3AODA 2E1AA 1LXJA 4OLPA 2VG7B 1OMSA 1U7LA 3DOMA 2HNYA 2C2RA 2GIRA 4P73A 4F4ZA 3MM5A 3QIPB 1DAXA 1WC5A 1ZBTA 1V3ZA 1F2HA 3LF0A 1RLCL 3AD8C 2UXDJ 1VISA 1RB0A 2GGPB 4MTPA 1SH2A 2UVWA 2WRMA 3D1QA 1HPZB 4YY3F 4WP3A 3WX4A 2AQ4A 3DN9A 4B3RJ 4DSLA 3Q8YA 3H40A 4I1TA 5KFFA 5KT7A 2KYXA 2VBXA 3TA2A 4I68A 1REVA 4LSLA 4NYPA 1J5OB 4GKJF 2Z2MA 3AA9A 3KDNA 4OI1A 2BJ9A 2CQGA 1D0EA 2HYIB 3ELHA 5KFRA 1NK5A 5I3UA 1NB2A 2OPSA 1HQEA 2C3YA 2J8SA 4WYLA 2V67A 2Q6BA 1EAYC 4K4UA 1VQ5S 3FUYA 4KHPF 2BKPA 5EHHA 2DISA 4A8SA 1S4FA 4PXBA 2V68A 4HR2A 2YWHA 2QMUB 1RBAA 3CXCR 2DHGA 3FQLA 2V2QA 2RNEA 1OPIA 2KJWA 3MDFA 5LJ5Y 4L74A 2ZM6J 4FNHA 4B9VA 5DG9A 4QR2A 1FO1A 3HK2A 1U4BA 1HNXJ 4M95A 2HHTA 1ZM2A 5IQQA 3OLAA 1QAYA 3TZWA 1RQ0A 4F2RA 2OEMA 1JLEB 4ECTA 4KB7A 5H9FK 2UZAA 2YNGA 3QWPA 2DR6A 3NRBA 3G6XA 3KHHA 5F8LA 3DDIA 1TAQA 2A3JA 3PRDA 4YOEA 5SUHA 7AT1B 4Q8FA 3CD5A 3QT5A 2C2OB 1VGYA 3KLGA 3B8HA 3OR1B 5D0RA 4QIWD 1TUWA 1LWEA 2H5IB 3RRGA 1HWIA 3LPYA 5ETLA 2I9SA 2YWKA 2RU9A 1RHRB 4QOTA 1BQNB 4A8QA 2ZNZA 3MWBA 2AJ2A 2MKKA 1RAAB 2MLYA 3AOBA 1WNEA 1RT6A 4FVCA 5BJRA 4DI6A 2IVYA 2DKOB 2J9DA 4DL6A 3X3UA 1EZZB 1Q53A 1K47A 5C24B 3UPFA 1SKUB 3KLVA 2UU9F 3OL6A 3M8PA 1X5OA 3MEKA 4KIAA 1RTIA 2DPJA 2D1CA 4J9QA 3HVAA 4B3MJ 1BXNA 1LWCB 2ZZMA 3MZIA 4F26A 2K1RB 5BR8J 4P71A 3J7YU 4DN9A 3V2UC 3ETMA 1NK4A 3RRHA 2MQ8A 1R8BA 2K3KA 3BH7B 3CCUS 3F56A 1C4AA 2LP4A 1TK8A 4BBYA 1CJKA 1S1UA 2RMLA 3QJLA 5L9NA 3HHKA 5B0DA 1Q1KA 3EGVA 5AXLA 3LGNA 5E3QA 4ZPBA 1U8WA 4X4RA 1BQXA 1N88A 5HMXA 4DV6F 2N82B 1X4EA 1RHJB 2HAIA 2YNFB 5SZTA 1TKTB 1WF2A 4WK1A 5K5MA 2F3JA 3MUVP 4LFBJ 1LEOA 2YBVA 1ZAXA 2R7RA 5KFJA 3NGTA 2XGPA 4M94A 4OJ3A 3NOGA 3MM7B 1H7XA 1JWWA 3K58A 2V9KA 2BJ7A 1VQLS 1WD6A 2JLFA 4ERDA 3G82A 4QW9A 3QBCA 3VHQA 3B54A 3BBCA 3KUEA 3R8YA 2JL9A 5A8WB 5AE2A 1T11A 2NQPA 4JI3J 1B0PA 1X0PA 2DGVA 1Q8LA 2UXCJ 1LKZA 3NL0A 1WACA 3CMES 4PWDB 2XULA 3N6LA 3GILA 4OI2A 1O0PA 3RAQA 4AFFA 5J2NB 1NHVA 5F3ZA 3P96A 2XG8A 2V9WA 2XHCA 1FE4A 2DRDA 1AZSB 4O0IA 4RZRA 3BF4A 1I94F 2MY8A 3W5XA 1NSKL 3MFHA 1BQMB 3IRXA 4IG0A 1YJUA 4DV2F 1PYTA 4MFBB 2FLNA 4LF7F 2H5EA 1UVLA 4UY85 3MGJA 3V6HA 1WOPA 3S6EA 2QN6B 4DR1F 2Z0GA 2CQ4A 2F1FA 1Y3KA 1FX2A 2XMJA 4EUVA 4TYAA 1QJHA 2DGOA 3HXMA 1S1VA 3NGUA 1N0VC 1VHFA 3R1HA 4ZDNA 2P9CA 3PYGA 5ETRA 2KZZA 1UP1A 3SV3A 4PXEA 3PY8A 1JLAB 1S7HA 4DFJA 1V6HA 3MPVA 1WTBA 3RBXA 5HMZA 2RUSA 3QPIA 4IQMA 4RKUC 3OSPA 3GYNA 3DXSX 2KU7A 2R3VA 1WC4A 3W7BA 2CJAA 4LSLB 3CPWR 1X31C 3TAPA 5B0FA 3OL7A 3Q8UA 1UWBB 3O6QA 4OJ1A 1TFYA 2MSTA 4JI4F 1GX6A 3FMBA 3K17A 1U24A 2MKYA 2FPHX 4F8RA 2M4MA 4QWCA 1GTEA 1TV6A 1KFSA 1IN0A 1LV5A 4RNOA 3PTWA 1NAQA 1Q95G 5HQ8A 5LXYA 1NDKA 2CWKA 1JJ4A 3I56S 1VQMS 2BE9B 4CP5A 3TW0A 1FDBA 1HBMA 2W7PA 1U1PA 3MUMP 1YRTA 3POTA 4NX9A 4C3MA 1XNQF 1FJEB 4NA2A 3AT1B 1OQ3A 4OX6A 4ZVFA 4IOCQ 2PIIA 3KK3A 3VR1A 4WKRA 1L3SA 1TTHB 3DI6A 3H5YA 1XMQF 4OQJA 2B9YA 3GONA 1F1BB 2GVDB 5D15A 3BGRA 9ATCB 4WXWA 1Q81T 2VFUA 3V6JA 2LXFA 2R9LA 3OJSA 4QIFA 2DR5A 3SFUA 2G9OA 3Q8QB 1WEZA 1AT1B 3CJ8A 3PHTA 2YTCA 5L46A 2AD9A 1OY9A 4EYIB 2YX7A 4ZHRB 2HHPA 2IM0A 5THWA 1S9EB 2DH8A 4HACA 2GX8A 5IZHA 1U1RA 3D28A 4RUCA 2EI5A 3M8WA 3QZ8A 4J9OA 3V6DA 2M88A 1VQKS 1J27A 1SQGA 4NCBA 2JEGA 2W7AA 5KFGA 4USIA 1UA0A 4C4WA 1QVFR 3OTOJ 4IFVB 2ZBQA 4XK8C 5L1JA 3W8GA 1FXRA 3DLHA 4N56A 3MM6A 2J76E 2W9CA 4V1Ak 3HSGA 4DFPA 2VKRA 4J5OA 1Y3JA 4K0KJ 2Z56B 1NZ8A 2IC3B 1NKEA 2DEJA 1YGYA 4X62F 2E44A 4RW7A 2YKOA 1VIXA 4GMKA 5I42A 4KGZB 2DJWA 4RW8A 2X1GA 3M8PB 1WDDA 3KHLA 1K0VA 2NXCA 1R31A 4L72B 1WHWA 5KG1A 4E8UA 1IKWA 1FKAF 4FF1A 4DQPA 1IR2A 4PCQA 5G0RA 4WIQA 1S9GB 2OSRA 2XTJP 4O4GB 5D8HB 2CPZA 2DD8S 5GAEI 3P6YC 5M2RA 1DLOB 4QU6A 2YQ1A 4DPWA 4DV0J 1SVDA 4ELTA 5DQGA 2BW2A 2OH2A 1IXKA 2NYIA 3E2EA 5C5JA 4B9MA 3FK4A 3KFWX 2KRBA 2W2NP 2HSEB 4L3KA 1TUGB 1EETA 4DQIA 1JJHA 5B0BA 1M5OC 4ENOA 3KLHA 4CH1A 4EO6A 3MF5A 5J1EB 3NGKA 3TEGA 1H2VZ 2IIHA 3MEDA 1RWKB 4F0HA 5BYSA 1BE4A 1HA1A 3DYAA 3AD7C 2NZ4A 2DGUA 3GQCA 1BWEA 3NKYA 2CDRB 1ZAWA 3MPDA 5AXMA 4LBHA 4I2QB 2CFXA 3DXBA 3BB5A 3PX0A 4CYUA 4HL9A 2GQQA 2R2TA 2A6OA 4USMA 4H54A 2Y0SD 2ATCB 4OHXA 3PDNA 4WPAA 5CYQA 3ZZTA 2XLIA 2HRYA 2XLKA 2W8LA 3LW5C 1TVRA 4LR9A 1R8PA 2YQ3A 3N0VA 2MJUA 1S99A 2J6TA 3T19A 4H4KA 3WZ0A 3CWJA 1U2FA 2VL1A 4P7VA 1YJRA 3VF0B 3A8IA 4ATNA 3I9ZA 1NDLA 2HZCA 2BE2B 1SJ4P 2FHJA 5A8KA 2IYIA 3PR5B 3LPEA 5DGBA 2GHPA 3GLJA 2YWGA 1VRUB 4AQYF 1ZM9A 4KE5A 4EK2A 4EEYA 4C8LA 1F5BA 5F8NA 4WE1A 1AFIA 2JEIA 4KHPJ 1YI2S 2WCXA 1WOSA 1NHUA 1V5IB 4YB5A 2LKZA 2UUBF 2CZVC 2GMLA 1Y0HA 2CQPA 2IRYA 2Y9HA 3BSOA 3GFYA 2JRSA 5CA5A 3MTKA 2FLPA 3HZEA 1OIAA 4FF4A 4RNFA 4GRSA 2VH7A 4ECUA 3IGNA 3BM7A 1FWLA 2CQ1A 4C3LA 3RR7A 3QLHA 3CJ4A 3N28A 2Z2ZA 1QTMA 2VHGA 4X64J 4GVBA 3OBIA 1G6BA 1NK8A 3CVKA 3DOKB 1DTTA 2ZH1A 5HJXA 2XGQA 4YS2A 5D0EA 1FKPA 4AL5A 4UF4A 3WBZA 4LFCJ 4DFKA 4DR7J 4EZ6A 3A1YG 3D9BA 2QA4S 2UUCJ 4F36A 3KK2B 4ZMMA 4KO0A 4WYWA 4PPDA 2QLXA 3EMTA 2H3EB 1Q8BA 3D1OA 4OMFG 3B4DA 1U1LA 2M3DA 2BQRA 1J5EF 3EDRB 3KTQA 4LIWA 4CLPA 3SZ2A 1S6UA 2W2QP 2ADBA 1WC3A 5C25B 2LA4A 4LBIA 3MMBB 3PR4A 2KG1A 4K4VA 2KFNA 3I0RB 3H8YA 1LK7A 2QV6A 2OJ3A 3LH2S 2XLJA 2W8KA 4OI6A 2VF3A 4ZVGA 1X4GA 4PYDA 3SEOA 1CJVA 1SJQA 3ILJA 4P2SA 3AA8A 4NZ6A 5LXRA 3CE8A 3I87A 4J9MA 2BOPA 4NA3A 5ETQA 3ZZOA 4KT0C 3EVMA 2YPZA 3MM9A 3BZQA 3TZYA 2QEXS 4FS1A 2ZH3A 1F9FA 3ISND 4NLVA 3NY0A 3HP6A 1EQMA 1NXIA 2BVZA 1RXOB 4LJMA 2D69A 2PSZA 3NS5A 2JX2A 1YRXA 3KK1A 3VZHA 4CO4A 3Q8VA 2BMBA 2W9CB 2IHR1 3GU0A 4S0MA 4U7UK 2P5VA 5L9XA 2QC3A 3MR3A 2HHWA 2UXBF 1FFGB 5HROA 4OJHA 4HDGA 3TUZC 1WG5A 5I42B 2OEJA 1D8YA 4RW4A 2GQ2A 2L9DA 2KM8B 1BUXA 4B9NA 1KLMB 4DF4A 1CJUB 1HWUA 2NSCA 1R6YA 2BEFA 3C15B 5JVGQ 1TL1B 4B3TF 1X4CA 3OR2B 1OJ4A 2YX4A 2L3MA 2HGLA 3J7YI 3VAMA 1U02A 2BRLA 1AFJA 4BCAA 3ENAA 4H4MB 3CCTA 1NDPA 3WX8A 1X4FA 2DH9A 2R7VA 3Q8RB 1N36F 5AE1A 4ECRA 5AJ3F 2LLZA 1N32F 1PO6A 4PRFA 4A8KA 4RL1A 1TKZB 3MAAB 4WTOB 2J0XA 2HVDA 3FEZA 4WTYA 1ZETA 4ZCMA 3DYAB 1UCNA 3IAS9 2VUGA 4ED7A 3HFKA 1K8AT 7FD1A 2AZ1A 4F3QA 1WKJA 2DHAA 3HHLC 2IMWP 4CYUB 4DX7A 3DLJA 2E1MC 3GPAA 3OXGA 2HBRB 2XEXA 2OKQA 3QWUA 5H1SV 1PIEA 2OPPB 4DS4A 3MEEA 4HTJA 5IFMA 2PE8A 2CDQA 1TVRB 3CW2C 2UVVA 1LXNA 4CLKA 2UVRA 2MQLA 4NOHA 4C8YA 4Y2IA 3TX0A 2XC9A 2W2OP 2LEAA 3K2YA 4FNIA 2EC0A 3C46A 3PM9A 3CCWA 3NEKA 1HBUA 2ZEJA 5M2PA 1RADB 2V50A 4RWXA 3HX9A 3PZPA 4EBEA 3CD7A 1QDUB 3V4MA 1S12A 1FA0A 5L1KA 3KJNB 4I6WA 1ITPA 2Q66A 1PJ7A 3QGHA 1B7FA 5U47A 4IRDA 4DR6F 1VC5A 4TY8B 3EE3A 4DV1J 2GIFA 3J7Z5 4QR1A 5KG6A 2B4OA 1S1WA 1HWKA 2VFVA 2FC8A 1N5VA 2HIYA 1RWNB 1VFJA 2HHSA 3BQ2A 1FXDA 5J2PA 4TQRA 3FSYA 3MCMA 3L7PA 2AZ3A 2BXJA 2C28A 1ULRA 2HQIA 1GXLA 4A4JA 2BRKA 1JX4A 5KFQA 1L3VA 1VQ6S 1C4CA 2MZRA 3FGVA 1OYDA 3CD0A 4B3OB 1SV5A 5L8RC 5HLFA 3UCGA 3H20A 3QLHB 3TAQA 3KUHA 2HQDA 2Q6CA 3Q2SC 2FIUA 4OYOA 2HQFA 1FKOB 3CIZA 2C3UA 3KYLA 2VFSA 3W1YC 5K8NA 4QW8A 4BC9A 3O44A 1DBDA 4KC5A 2C1EB 2FYXA 3E8OA 3ZNUA 2NLWA 3THTA 1DJ0A 2ZNYA 4UQGA 4FPRA 1U2CA 4ECZA 3R5CA 5KFYA 1F5CA 4PG5A 2AV5A 4YDDB 2ZWOA 3A8KA 2ZOFA 2BE7D 4U96A 4QWBA 1P9YA 3JYTA 1G1XA 2IRUA 1M5HA 2HGNA 3V5RA 2HZAA 2VG6A 2MSSA 1K1SA 1LOUA 5J1NA 5I3PA 2G0IA 4UY8T 3MCOA 4J7CA 2DHSA 2OO4A 3IG1A 4IH7A 1WELA 1EHWA 3NLCA 2W4DA 1SKWA 3KLFB 3IS9B 1XR5A 2NXJA 4MH8A 3KG1A 3C16A 2W2PP 3MM9B 4E2FB 2KHCA 1RTZA 2G2YA 2VPYB 4Y65A 3RBEA 4J91A 4Q45A 1PJ5A 1SBRA 3DU6A 2V69A 1OPZA 5LSLA 4NPOA 1JNZB 2CQ3A 3LUYA 5F9NA 3OTBA 3PJXA 2B51A 1SH0A 2BUNA 3RG6A 4X2BA 3D6HB 3ITHB 4LF5F 3VVTA 3K57A 4ED6A 3BREA 2CPHA 5ETVA 2YWFA 3G86A 4DL7A 2H9ZA 5HJYA 2W25A 3D3BJ 4OYWA 5GMEA 2B6AA 3SYZA 4M5MA 3PO5A 4LF4F 4OZ1A 2KXHA 2XY5A 5DZ7A 4F4YA 5GAHU 2FQQB 3G4SS 4NLYA 2A10A 3N5BA 1UEVA 2Z4PA 3LP2B 2Y8WA 4OHYA 1KTQA 1UL3A 3FBFA 4EFAC 3RAXA 4HDHA 4NLPA 4YB7A 3A8EA 5K14A 4ZJLA 5CQGA 5T7LA 4DG1A 2XZTB 3CDAA 2MYFA 2QLWA 5F0UA 3EM1A 3CT9A 4QWAA 1U45A 2ERRA 3VVUA 5KFNA 2MQMA 4LF9J 1T9VA 4ECYA 3GIRA 4XPCA 1PBAA 4J9UE 3CCQS 2NSBA 4YHHJ 1QD1A 2WVEA 2VA3A 2JLGA 2CKWA 1VQPS 3H90A 4IFYB 1HBOA 3KLIA 3PEJA 3SQGA 1RT5A 4H4OB 5A76A 2XS2A 1PC4A 3DOLA 4JI6F 2CNOB 3HSDA 2RHSB 5HVHA 2IDLA 4ZCKA
chains in the Genus database with same CATH topology
4Y3CA 3DN9A 3K8WA 5D6GA 1T05A 4DSLA 4K5SA 3H40A 3SV4A 2PN6A 4CT8A 3UR0A 4OI4A 6FDRA 3OL9A 3TVYA 1FK9B 1SIWB 1T95A 4I1TA 5KFFA 1KFDA 3RBDA 3T5HA 4Y00A 5KT7A 3OTEA 3W3SA 3HKZD 3OVBA 2KYXA 2VBXA 3G6VA 2EBEA 2ZOMA 3TA2A 2Y1JA 1LK5A 1XK8A 4BC7A 4I68A 3SCLE 3T1AA 2HNZB 3GE9A 3Q23A 1REVA 4DN0A 2M70A 1Z2LA 4LSLA 3LP2A 4NYPA 3K5OA 4U7CA 1N8RT 1KHVA 3FEYB 1J5OB 2ASYA 3IN5A 3L09A 4GKJF 3SXLA 2K7JA 3HT3A 2EG1A 2PGCA 2YNGB 4NCGB 1P1LA 4I7FB 1ZPVA 2Z2MA 2XWXA 2AX1A 4ITSA 2HRUA 3AA9A 4RLEA 4FF2A 4LFBF 1NKBA 4DV3F 2IVFB 2V0NA 2YKNB 3S7RA 5KT2A 4OI1A 2UVUA 4A8MP 1I6JA 2CQGA 1MMLA 2VBWA 4WIIA 4J9PA 3MEEB 1D0EA 4G1PA 2HYIB 1Q8IA 1J2VA 5KFRA 1S0MA 2SXLA 1NK5A 2DNZA 2MKHA 3P3DA 5K8MA 3M8RA 4DLEA 5I3UA 4J9SA 2OPSA 1HQEA 1S6OA 2C3YA 4OI3A 3TYTA 1NNDA 1JLFB 1ZZFA 1ZM3A 4WYLA 1UAWA 3J81Y 1S10A 4HLBA 2Q6BA 1DARA 2VG7A 5G4DA 1NH7A 2V2KA 1TKXB 4OX7A 4K4UA 4U67Q 2AYGA 3LGMA 1VQ5S 1RT4B 2DNPA 1UJ4A 3E3XA 3KLGB 4NRTA 4KHPF 3AB4B 3UI3A 2HMIA 4RUHA 2XO7A 5EHHA 2W9AA 2DISA 5GVQA 5T14A 4JV2A 4CI0B 4A8SA 1LWEB 1S4FA 4PXBA 4CTAA 3HHDA 1V3RA 3E01A 5E3PA 2FJAB 4YMEA 1NB7A 1ZOTA 1UETA 3UWTA 4DR4F 3RTVA 1YQHA 3DNCA 2WK4A 2YWHA 4IFYA 2GGPA 4I6YA 3T9ZA 4K59A 4ICLB 3CXCR 1JNRB 2VFTA 4H4OA 1XN9A 2DHGA 2PMHA 4JI3F 2DNGA 3FQLA 1HPZA 4BHQA 2RNEA 1RT6B 3OQ2A 2KXFA 3NGDA 1OPIA 2KJWA 2QMXA 1UA1A 1CVJA 2UXCF 3MDFA 5LJ5Y 3H4BA 3CCRS 5D4PA 4FNHA 5EGYA 1X7VA 2HG4A 3TO8A 4B9VA 5DG9A 4M8LA 1TL3B 4QR2A 3HHNB 1FO1A 4PQAA 2RJZA 4OHVA 4B02A 3HK2A 5MAOA 1U4BA 4QIVA 3CC7S 1X8DA 1SKRA 3H2UB 1JLGB 4M95A 2WW8A 3G71S 2HHTA 2G13A 2XS5A 1ZM2A 2WOMA 1XC9A 1FJ7A 3PW4A 2ZKUA 1X4HA 5IQQA 2KKHA 3OLAA 2ZE2A 3I9V9 4ECVA 1QAYA 2NS1B 2B0GA 3TVZA 1RQ0A 4YB1P 4F2RA 4J37A 3ETOA 5KFUA 1X9WA 1JLEB 4JOUA 1WTFA 4ECTA 4KB7A 3QMQA 4MKYA 4IOBA 2UZAA 2YNGA 4NCGA 1RTIB 3QWPA 1TAUA 1WG1A 4I7FA 4Q2LA 4C9DA 3FQKA 5H9FJ 3NRBA 3KOAA 3G6XA 3LOUA 5KFAA 2LXIA 2RKIA 1IKXB 3KHHA 3Q22A 2YKNA 5F8LA 1DTQB 2RQMA 3LO3A 5AXNA 2WTFA 3QAEA 1TAQA 2JFDA 2A3JA 1P6TA 3PRDA 3GWCA 2ATLA 4YOEA 3EZUA 4MIBA 5SUHA 4TNOA 3OVSA 4Q8FA 1UVNA 2HW3A 2FD2A 2QA4G 2MHEA 1SL1A 4JV1A 3CD5A 4KHMA 2XZWA 1N6QA 1HWLA 1N5YB 3CEDA 5HLFB 4Y2CA 2HIQA 3T5JA 1RT4A 2GIQA 1VGYA 1R8CA 2DB1A 3KLGA 3B8HA 2QYCA 3OR1B 3FNNA 1K9MT 1HW9A 3BEGB 3TQ1A 1H38A 2RS2A 4OL8A 5GADU 4QIWD 2DNMA 1LWEA 1S1UB 4NLDA 2MQOA 3RRGA 4HH0A 1HWIA 1QUVA 3LPYA 2I9SA 2YWKA 4K4WA 4K4ZA 2RU9A 2JVRA 4Q5VA 4QOTA 1YVFA 1BQNB 3C8YA 4A8QA 5GMKa 2L9WA 2ZNZA 4J9LA 1BY9A 1FRHA 3MWBA 3M30B 4FXDA 2MKKA 1M90T 4V19J 2HHUA 3GR1A 2O5DA 1SJ1A 1WNEA 2DIVA 1RT6A 3BN4A 1S48A 2KZMA 2G0CA 4FVCA 2V4JB 1CPZA 1JLCA 2B9WA 3VALA 5BJRA 2CVIA 3PKYA 3C6UA 5K8PA 2B4VA 4ZP7A 1N52B 3UD4P 1TL3A 2IVYA 3EPGA 3OLBA 3JSBA 1RP5A 2WSFC 5KG5A 1JLGA 2ROGA 3WC2A 2J9DA 3IA0A 2UUTA 3CCZA 3RRKA 4DL6A 4ZP6A 2EWHA 3X3UA 4EYHB 3L3CA 1Q53A 3OTCA 5C24B 3UPFA 3KLVA 1U1MA 4URQU 3CCVS 2UU9F 3OL6A 3M8PA 4AYBD 2MZTA 4KV8B 4WFZA 1CLFA 1X5OA 2DRBA 3HHLB 2MQNA 1JLEA 4RW6A 2HQ3A 3DU5A 3MEKA 5F9LA 3FFIB 4KIAA 1PC5A 1RTIA 5CXTA 3M32B 3GIKA 1FNXH 2DPJA 2D1CA 3JSRA 4J9QA 4K4SA 3HVAA 4MIWA 1C1BA 1LWCB 1IKXA 1DHMA 3W2VB 3MZIA 3LWMA 2B56A 1IM4A 4RU9A 1IBKF 2ZZMA 4F26A 2K1RB 1DTQA 2QA1A 3J7YU 1NJWA 2HLTA 3GZ7A 4F67A 3VAJA 3EGZA 2I0XA 4C8MA 3W2WB 2XY6A 4DN9A 3V2UC 5HMYA 1NK4A 1JXEA 3RRHA 1R8BA 2D74B 2EFQA 1YJNS 2BACA 4Q0BB 4PG7A 3CCJS 3UCUP 2K3KA 2KVIA 2ZH5A 3CCUS 1TQLA 2XCPA 3JYTB 2KT2A 1N5YA 2HLUA 3F56A 1C4AA 1ZTTA 1LQ9A 2OMOA 2JZ5A 2DCLA 3OR1A 1HI8A 2DNKA 2UV8A 5CCLA 1TK8A 4BBYA 4PUOA 1APSA 5CZVA 1CG2A 1S1UA 2RMLA 3QJLA 4X4SA 5L9NA 4O3PA 2R8GA 3HHKA 5B0DA 1IUJA 2IAJB 1Q1KA 2BANB 4LIRA 3I55S 1M5KC 3OUYB 1VBYA 5AXLA 4GC7A 3LGNA 5IWAF 2GO9A 5E3QA 1M5SA 3R5DA 2DPIA 2B5JB 4ZPBA 4HYKA 2V8DA 4X4RA 1VJWA 1Z2ZA 3V4IA 1KD1T 5E3RA 3OHAA 1BQXA 4ED0A 1C1CB 1N88A 1Y9OA 4ZPCA 5HMXA 4DV6F 1WHVA 4FBTA 1KEKA 1YBAA 3CB4A 2J7KA 2V4JA 4NMLA 1X4EA 2CZ4A 2N82B 2DR8A 2YNFB 2HAIA 5SZTA 1TKTB 4QIEA 1ZZNA 2VPWB 1WF2A 3TP2A 1L3TA 1RGVA 4WK1A 5K5MA 1RJJA 5F3TA 2F3JA 3MUVP 1XMBA 3PVXA 1HL6A 1GAOA 3D5MA 1ZAXA 1CEZA 4X4OA 2P6TA 2R7RA 5KFJA 2XGPA 3IRXB 4IG0B 4DSIA 4M94A 2P9EA 4QR0A 5IXUA 1OQ6A 2M2BA 1UMJA 4NLQA 3TA1A 3AH6A 4DBQA 4F25A 1U1KA 4KV8A 4C8ZA 2IFXA 3T1HF 2E9ZA 3HHLA 4OJ3A 4DS5A 5KFWA 3MM7B 1VQ7S 4X4UA 1SXLA 3ZZZA 1GH8A 3CDWA 5KTQA 1H7XA 3D54A 3M32A 2LECA 4F4WA 4UQTA 2FJBB 3CMAS 3H2LA 1JWWA 4R0EA 3K58A 3K59A 2ZD1A 1N54B 1KR4A 2V9KA 1DURA 3IAM9 1LWCA 4I56A 2VKZG 3W2VA 1VQLS 2VC0A 1WD6A 3DLLQ 2JLFA 2K1RA 5KG7A 4ERDA 5JJBA 4QW9A 2MQPA 4DFMA 4Y34A 2XSFA 2PA8D 2QSWA 3I4PA 4X4TA 2CJKA 3W2WA 4L3NA 3KHRA 3CTRA 1S9FA 4HT7A 4CZCA 5CD4H 2R8HA 2J0SD 2NUUG 2RB7A 4MYTA 1S0OA 2JC0A 2KJVA 2JJ4D 1S1VB 2M8HA 1NH8A 1W2BR 2XMUA 3TA0A 1U1OA 1VK3A 2JL9A 1RI7A 4HI2A 3M2UB 2Z2LA 4IG3A 3SSRA 5KAKA 2KDOA 5A8WB 1FNMA 2RRNA 5AE2A 2NQPA 1KS2A 1B0PA 1X0