1WELA

Solution structure of rna binding domain in np_006038
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
GSSGSSGKSPSGQKRSRSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRNEADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of RNA binding domain in NP_006038
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords RNA-binding protein 12
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1welA00
5H1SV 1WWHA 2WBRA 1H2UX 2MZQA 2CQ2A 3EGNA 1A7GE 3U1MA 4ERDA 2CPDA 1U6FA 2E5IA 4BS2A 2MQMA 2RQCA 1WELA 2DNLA 1UW4A 1X4CA 3US5A 2KM8B 3MOJB 3N9UC 3MURP 5ITHA 2M8DB 5EN1A 3S6EA 1HD0A 2CQ1A 1VQ9S 3G4SS 2CPFA 5DDOC 2L41A 2M88A 1U1MA 1HD1A 2MYFA 2JVRA 1H2TZ 2X1BA 5FJ4A 2MMYA 3SDEB 4CQ1A 2MSSA 4WFBQ 2MB0B 3S8SA 2QA4S 1JMTA 3R1HA 2M4MA 3V4MA 2VOOA 4Y00A 2D3OR 3MI7X 5DDPC 2L08A 1YJNS 2RVJA 1X4EA 2G4BA 2XB2D 1X5OA 1YJWS 2DGQA 2KM8C 1VQ8S 2VOPA 2FY1A 2AYGA 3L3CA 3R1LA 2MJUA 3UCUP 4WFNQ 1FJEB 2YTCA 1W2BR 2DGXA 4TU7A 4EGLA 2CQ3A 2OSQA 1X4GA 2ADCA 2E44A 2V94A 2KVIA 3VAMA 2N3OA 2M2BA 3BEGB 1VBYA 2M8HA 2DH8A 2MZJA 3CCLS 3BO2A 5IM0A 1N52B 4YOEA 1VQ4S 4FXVA 5IFMA 1DZ5A 1P27B 4P6QA 2MPUA 3CC4S 3UD4P 3MUTP 3S7RA 5GADU 5CXTA 1X4HA 2CQPA 2DHXA 2OJ3A 2MQOA 4C0OC 2MZ1A 1U6BA 2DGOA 2CJKA 3TP2A 2MXYA 2RS2A 1D8ZA 2M0GB 2DHAA 2DIUA 2KRBA 1DRZA 2NZ4A 2N3LA 3I55S 2DNZA 2KRRA 3SMZA 2DHSA 1FT8A 1WHYA 5LSLA 5LJ5Y 5DM6Q 1L3KA 1WF0A 3ZZZA 1K73T 1ZZFA 1G2EA 1YIJS 4QU7A 1WEXA 1VQMS 1UP1A 2RT3A 2QEXS 2CQCA 2KXHA 2JWNA 2GHPA 3CCRS 4J5OA 3DXBA 2U2FA 2DO4A 1S79A 3CCUS 2DGWA 3J7YU 1WEYA 2LEAA 2ERRA 2NLWA 1Q81T 3Q2SC 3MDFA 2RS8A 4C7QA 2L9WA 1WG4A 2MQPA 2KXFA 1XN9A 2DGUA 1U1LA 2HGMA 2VODA 3TO8A 2XS2A 1YTYA 1HL6A 2X1GA 1VBZA 1JJ2R 2CQIA 2MQNA 4QU6A 2N82B 2KG1A 2Q79A 4OZ1A 2DNHA 1FHTA 2DB1A 2KYXA 2E5JA 3CPWR 5D78A 2DNOA 1SJRA 2DGVA 2DIVA 3VALA 2M70A 3NNCA 1P1TA 1VQ6S 3ZZYA 1WHXA 4IOCQ 1A9NB 2KFYA 5DM7Q 2X1FA 1WEZA 2J8AA 3J7ZT 2DK2A 3CCQS 3VAIA 3G96A 4WF9Q 1U1PA 3CMAS 1VQPS 1SXLA 2MZRA 2MQLA 2KHCA 2LXUA 3G8TA 3LQVA 2DNMA 3HI9A 2MQQA 1WI6A 3HHNB 1VQLS 1X4AA 1U2FA 5GAEU 2EK6A 4OZ0A 2MKCA 3OW2R 2MGZB 4ED5A 3NNAA 1PGZA 3IRWP 2MKKA 2RUGA 1F9FA 1B7FA 2LKZA 3MD3A 1YJ9S 1UFWA 5CA5A 5DDRC 1M5VC 2MY7A 3CCVS 1QVGR 4ZKAA 2RU3A 3SDEA 2U1AA 4F02A 1FJCA 1H6KX 5LXRA 2RRAA 3CD6S 4WKRA 2G1DA 3NMRA 4F25A 1X5SA 3MUVP 3TYTA 2KXNB 2X1AA 2CQ0A 3CTRA 1YITS 2CPIA 2J76E 3PIPQ 1JJ4A 2PEHA 1IQTA 1NO8A 4YUDA 1FO1A 3U1LA 2LXIA 4C4WA 1DHMA 3BO3A 2MHNA 4M5DB 5GAGU 2CPYA 1R8PA 5CYJA 3THPA 5D77A 1NU4A 2CQGA 1CVJA 1WG1A 1BY9A 2HGNA 2LYVA 3G8SA 1AUDA 3BS9A 1X5TA 3THTA 1K9MT 3DLLQ 3CXCR 1VQ5S 2KU7A 4PKDB 1SJ3P 1VC0A 2XSFA 5LSOA 1QVFR 1FNXH 3NNHA 1O0PA 5LJ3Y 1OPIA 4W90B 2CQ4A 2YWKA 2LQ5A 1OO0B 2QFJA 2MKIA 1U1QA 2F3JA 1X4BA 2AYEA 2DNYA 2F9DA 4F26A 2LEBA 2DITA 2CPEA 1WF1A 1HA1A 2G0CA 2J0QD 1WI8A 3RW6A 1VQNS 2DO0A 3FEYB 2CQDA 3NS5A 5DDQC 4A8XA 3CCMS 3UE2A 2DGSA 1RK8A 2FPHX 3VAGA 3MXHP 2K3KA 3VF0B 3VAHA 3CC7S 2HZCA 3P3DA 4U67Q 2OSRA 2ADBA 2DNPA 4FXWA 1Q86T 1OIAA 2CPHA 3VAFA 4LIRA 5JVGQ 2KH9A 2DNRA 2FC9A 5MLCV 4WFAQ 2D9PA 5IQQA 4TU8A 2O3DA 3IWNC 1H2VZ 4Z2XA 2LA6A 1KOOA 3EX7B 1VBXA 2OIHA 2M9KA 2YH0A 3SXLA 1X4DA 1U1OA 1N8RT 5HO4A 2AYBA 1DBDA 2E5HA 3JB9k 1N54B 1VC5A 2XNRA 2DNKA 1S72S 3RW7A 2ZJQQ 3UCGA 3CCSS 2JX2A 3ULHA 4UY8T 2GO9A 1PO6A 1X0FA 2YKAA 1KQSR 1M5KC 5GVQA 2E5GA 2DH7A 3G9CA 2J0SD 3VAJA 2AD9A 3UCZP 3CCES 3CMES 2RNEA 1URNA 1QM9A 2CPZA 4LMZA 2MSTA 2FHOB 2DH9A 4RU2A 2MKJA 2MY8A 2VONA 2XS7A 1WHWA 2CPJA 3CF5Q 4YB1P 1M5OC 1M5PC 2CQHA 2M7SA 4PRFA 2LA4A 5JVHQ 3LPYA 5GAHU 2OTJS 2MZSA 4IOAQ 2I38A 2DHGA 2HGLA 5DETA 3PIOQ 1Q82T 1X5PA 3G6ES 1RKJA 5GMKa 5HL7Q 4CH0S 1ZZNA 3B4MA 4IO9Q 2MKHA 2MZTA 2PE8A 2LCWA 1YWXA 2MKSA 1WG5A 1KD1T 1WTBA 3H2UB 1M1KT 4LJMA 4TLQA 2SXLA 2RQ4A 3S01A 2BZ2A 3MD1A 1UAWA 1WHVA 4CH1A 1NJIT 1Q7YT 3CUNA 3H2VE 2BOPA 2KI2A 3P5TL 1YI2S 2N7CA 1FXLA 2DNNA 2KG0A 2A3JA 2EK1A 1R8HA 1VQ7S 4UQTA 2I2YA 2CPXA 3UD3P 2DISA 3B4DA 3CULA 3FEXB 1JJHA 2M52A 2XS5A 3D2WA 1SJQA 5BJRA 3Q2TC 2JVOA 1FJ7A 3NS6A 3CCJS 4QPTA 1ZH5A 2CQBA 2KN4A 2RRBA 2ZJRQ 2D9OA 1N88A 2LECA 2OTLS 2HYIB 2DGTA 1YHQS 3EGZA 3R27A 3UWTA 4IUFA 2K8GA 4Y0FA 3MUMP 2EVZA 2AYMA 3CC2S 2LMIA 2HVZA 1K8AT 1U1RA 3P6YC 3VAKA 4PR6A 2DNQA 2F9JA 1OWXA 2XNQA 5LXYA 2B0GA 4TU9A 2YH1A 4QQBA 2UP1A 2DNGA 1WF2A 1KC8T 1U1KA 4CIOA 2MGZA 2ZJPQ 2JRSA 3BO4A 3K0JA 1SJFA 2FC8A 1VQKS 3G71S 1SJ4P 1X4FA 3P49B 1VQOS 4WCEQ 4WIIA 2MJNA 1U1NA 1VC6A 1D9AA 2KT5A 1KOHA 4V19X 3I56S 5IM0B 1M90T 4W92B
chains in the Genus database with same CATH superfamily
1MMNA 2AX0A 2UUTA 3Q0AA 3K5LA 4K4WA 4ILLA 1DFDA 1NM2A 3M6WA 4DN9A 4YHHJ 4OYIA 4JV2A 4I2PB 3D66A 1SV5B 1IKYA 1U6FA 3I96A 3FUYA 2VPWB 5HMXA 4BS2A 4V19J 1SCJB 5HMZA 1ZETA 3UDEA 1OYDA 1R43A 8ATCB 3CVKA 3MPYA 4USHA 5IV3A 3ENWA 1HQ2A 2JLFA 3BSCA 4ICLB 3M32A 3T9NA 2DR6A 3N9UC 1KLMA 2CNKB 5ITHA 4DL4A 2AGOA 4C8OA 3ELHA 2HK2A 1XJWB 3OT9A 3PO5A 1IM4A 4FPRA 1HD0A 3EZUA 2Y1RI 4DF8A 2PA3A 3J81j 2XYHB 5HN0A 1PIEA 1UEVA 4OMFG 5C42B 2R7RA 3Q24A 1RAGB 4LFCF 1FJGF 1V3ZA 2YXLA 3IN5A 3E01A 3NLCA 1LW2B 4ZMMA 2N4CA 3AQPA 5DG8A 4DLGA 4ED6A 4ED8A 2BQ3A 4XAKA 4FF4A 1F3FA 4A4JA 2NR0A 2Y8WA 1KVIA 1HWJA 4OZJA 1H2TZ 4QR2A 4ECWA 3SDEB 4F4KA 4C8ZA 4F4XA 2R4FA 3FBCA 4YQWA 4JI0F 5GMDA 4RBUA 2BOAA 2QLJB 3DRYA 3MR7A 4K8RA 5CZXA 4DPWA 3HHLC 5C7PA 4U7CA 2V63A 3OXGA 3T5HA 2XZDB 1GMUA 3HVRA 4ED1A 2C22A 2GVDB 5J2QB 5KFVA 1MN7A 1C0UA 2GJIA 4NZ0A 3H5UA 2B3TB 5A0YA 3SV3A 1F9EB 3CD5A 1HNWF 1UW9A 1VISA 4NCBA 2LLZA 4XDDA 1CEZA 3OR1A 2VG7A 3DDIA 3P8BB 1TFYA 1RWXB 2FY1A 2AYGA 2PT0A 4X65J 1KR4A 4WZMA 4JI3J 3UCUP 2BDPA 5K14B 3R5CA 1NRKA 1X31C 2PFFB 1RTHA 5I3QA 3PHEA 1VMBA 4ZPDA 2GC8A 1T9YA 3LTOA 1S4FA 3W62A 3QWUA 3CJKB 5KFAA 4EGLA 3KK1A 4F4ZA 2ADCA 1MU2B 4IO1A 2QGFB 3JYTA 2P9CA 2KVIA 4G6VB 3VAMA 5C2CA 1LW0B 2HAIA 3BEGB 3MCMA 2M8HA 4TVAB 4K59A 2OPPB 3AOCA 4FF3A 1IBKF 1RQ0A 1N52B 3FRZA 2OPQA 4B9NA 4NZ7A 2GQQA 2ILYA 2XMJA 3DKDA 5IFMA 1DZ5A 1SPBP 1RWOB 3WX8A 3JXOA 2AQ4A 1CJUA 3OL8A 3PX0A 3GV5B 4OIXA 4F3QA 1HQUA 1X9SA 2XMUA 2BW7A 4LF4J 2Y0SD 5GADU 2Y1IA 1X4HA 1ZA1B 4ZP6A 3FKBA 2DHXA 3LP2A 4USTA 3WIVA 2W7OA 2OJ3A 2MZ1A 4M5KA 1R27B 1NPPA 1EQMA 1QE1A 2IC3B 2CJKA 3TW0A 1N32J 2BJ3A 3FCHA 3TP2A 5CCLA 4LQ9A 2AMCB 2MXYA 5AJ3F 2H4WB 2M0GB 1WDDA 4K0KF 2JZ5A 4U95A 3Q8SB 2XLJA 3O3LA 5K8PA 1TK5A 1FEHA 4LF5F 1HHQA 4TNOA 2ZDPA 2KDOA 3GV8B 3QRQA 4B02A 3ET6A 3ZTPA 4HHUA 4XPCA 2B5JB 3QQCD 1WHYA 2RQKA 2W2QP 3DM2A 4KHMA 4OHZA 5DM6Q 2ATCB 4FVCA 2WW8A 2V69A 4MTPA 1G2EA 1T94A 2B4PA 4KQZA 5L9XA 4DV7F 1YIJS 4QU7A 1VQMS 1G4CA 4N7TA 2ZBIA 5CZVA 1TV6B 2E29A 2QEXS 1WJ9A 4O3RA 1N5VA 1UZHA 3DRSB 4J5OA 3SQGB 2HBYB 4ES1A 3CJKA 1RB0A 2U2FA 1ZM2A 2H51B 3AQOA 5DS7A 2C3OA 1S79A 2HK3A 3LH2S 2IBOA 1WSRA 2VZ9A 1DTQA 3M8QA 3IR6B 3CCUS 2DGWA 2LEAA 4KKOA 2W9CB 3Q2SC 5L38A 4EO6A 1RAIB 2L9WA 4ZLPA 2EFOA 1M1GA 2J9EA 4KO0B 5J2NB 1O51A 4NMLA 1XN9A 3RGIA 5F8HA 2F1FA 3AOAA 3TO8A 3BSAA 3MEEA 3ZTRA 4BC9A 1CJKB 2K06A 2UXCF 1VBZA 4IOBA 3D1QA 4LSNB 5B09A 4ZVTB 4HI2A 1JJ2R 1UCNA 4OYXA 3W9JA 2P2CB 3QATA 4RUHA 1DJ0A 3N0VA 4X4PA 1XIQA 3IG1A 4CM0A 1LV5A 1S59A 3O1LA 3HJFA 1QAIA 2MQNA 4IYQA 1B3TA 3HSJA 2N82B 2HVEA 2D69A 1QAXA 2D41A 4OZ2A 2XC9A 1FHTA 2DB1A 4RBVA 4ZP8A 4PG7A 3LWLA 2BBEA 4R5PB 4NLTA 2ALYB 5D0HA 2VQEF 1SJRA 5D0GA 4XPEA 4NLDA 3DOLB 2POKA 1X9WA 2HHPA 2K1RA 3I82A 4Y2MA 2M70A 3M2RB 3A8JA 3QYYA 4PXEA 5HANA 3RU0A 2CG4A 4ZVFA 1IKWB 3R6GB 2C2RA 1RJJA 1LK7A 2VD3A 1WHXA 4OV6A 3ZZYA 3OTDA 1JB0C 1CS4B 3QFWA 3K58A 3O2IA 1SKRA 5IT4A 4EYHB 4XO0A 4JI8J 4NOHA 3TQ1A 5DM7Q 3HSZA 2NREA 2J8AA 3CT9A 2MDAA 2MHEA 4P75A 1VBKA 5HQ8A 2AZ3A 2HNYA 2DK2A 4C8LA 3VAIA 4FF1A 2PGCA 5CABA 2H4YB 1LOUA 5HVFA 5KT5A 1SXLA 2MZRA 3EM1A 4YB6A 4IQMA 4DUZF 1UJ6A 1WOPA 3FSIA 2VF3A 1ZA2B 3CJ8A 4FNHA 1HPZA 1LWCB 2B9YA 3RB3A 1VIXA 4KT0C 4B3TF 3H5YA 2J7WA 2DNMA 2HLUA 5IT9Y 2MQQA 4OX7A 1NUEA 1NDKA 2VBWA 4B9UA 2QMUB 4QIEA 1VQLS 2A2DA 1FRJA 3PRDA 4OFZA 4EZ9A 4IR1A 5T7LA 2H5JB 3CJTA 2ZE2B 3G82A 2QTWA 4NMXA 4OLOA 3UVJA 4RNFA 5E0OA 4DDFA 1N6QA 5AXNA 1HYSB 1V6HA 5KFMA 3PO4A 4PXCA 4KJIA 2MLYA 3IMQJ 2LDYA 3GJQB 2Z2MA 5D4OA 4J7CA 2AJ2A 4NX9A 2D3ZA 1B7FA 4JI3F 3BKUA 1J27A 4NLWA 1YJ9S 4ELTA 4C3MA 1UFWA 1VOMA 1S77D 5CA5A 1XR7A 4MFBA 5DDRC 4LREA 3F73A 3BDPA 1M5VC 5U47A 3OR2A 4X62J 1N48A 4H4MA 4RPFA 3OHAA 4ZKAA 4FF2A 1VQSA 1FE4A 4JB8B 3J80Y 1FI4A 1H6KX 1A0OB 2FZKB 3AJ1A 2QLXA 2GIFA 2H48B 3CD6S 4WKRA 4F25A 3KHHA 2FVCA 4HT5A 3GJSB 5A76A 4HL9A 5E3RA 4PABA 2HRTA 2QA1A 3CJSA 2BE2B 3CTRA 1IBMF 2OH2A 3NXZA 1RCXB 4MIWA 3PIPQ 4Q8FA 1M0SA 4GKKJ 4ANCA 2M3DA 4DR7J 2WOMB 4K4TA 4LF4F 5K20B 1J2VA 5IXUA 1F1BB 1NPKA 1VI7A 3PM9A 3GIJA 1TK8A 4WZQA 2LXIA 3HLUA 4C4WA 3GV7B 4OHXA 2JSXA 3DN9A 4XTTA 4F3MA 6FDRA 2HHTA 3BSOA 4R0EA 5KG3A 4ZLLA 1R8PA 5CYMB 5KT2A 3GR1A 5AJ3J 4F4WA 4X64F 2IFXA 4FN5A 4UY85 4QWBA 2HGNA 3MAAA 4Y6IA 1FKAF 2LYVA 2KVQE 2YNFA 4AQYF 2VFVA 3PX4A 3UR3C 3LALA 4LF5J 3THTA 1RT2B 3M9OB 3OTEA 5A8KB 2ZKTA 3CXCR 1VQ5S 2HHHF 3T6JA 2WVDA 3R5DA 5HK4A 1R0CB 3DLJA 1VC0A 2XSFA 3B78A 1KVJA 2FB0A 4ZPTR 3TUIC 1MG7A 4OZ5A 5LJ3Y 1FTCA 1NKEA 2FJXA 3NWGA 4H4MB 4OZLA 2P5VA 4W90B 1FKOA 1UMJA 2CQ4A 3JSYA 2YNHB 3MF5A 1HR0J 1OO0B 2QFJA 4WTYA 3C14B 5M2UA 2F3JA 1NLKL 3H98A 3IWXA 5GAGI 2LEBA 1AYEA 4N5SA 4A48A 8AT1B 1X60A 2CPEA 2XO6A 2YQ3A 1N56A 1WI8A 2J0QD 3RW6A 4LF6F 1RT4A 4ZCKA 1NCLA 3N28A 1N33F 3K17A 2XHWA 1T03A 1RHRB 3DLKA 4A8XA 2AT1B 4QJVA 3IM8A 2VH7A 4P2MA 3CCMS 2IM0A 2VBYA 1BQXA 2DJWA 3CJQA 5GAEI 1RK8A 1T9XA 4A47A 3MXHP 2YKNA 2A10A 2K3KA 4DXLA 4DL7A 2VB6A 1EETA 3GQCA 2GZOA 3VAHA 1OQ3A 2P9EA 2VJVA 2VDIA 2BE2A 2GJ2A 4HTIA 5BR8F 4JI4F 2W7PA 4KAIA 4ZJQA 3G8QA 1N36J 2R7QA 2HMIB 1UVJA 4HVZA 3WHIA 5DG9A 4X4TA 1N34J 2Q6BA 4MK9A 2V68A 3RBEA 1R8BA 2IMOA 3SFGA 4OX9J 4Y2AA 2CWKA 1V9OA 3MM9A 3CB4A 3MOZA 1KTQA 3IBFB 3CIZA 4UOHA 5FIIA 1XMOF 4UOGA 4YN3B 2GCFA 2R7VA 2VQEJ 3H5XA 4RUBA 2GX8A 1ACMB 3N79A 1QSSA 4DG1B 2L3MA 3E2EA 3A8EA 2ZUAA 3D0HE 2X51A 2M9KA 3PHTA 4KGKA 1VRQC 1X4DA 2FUG9 4LVOP 3SXLA 3TJ9A 4YY3F 1U1OA 1N8RT 3Q22A 2KZMA 3MCOA 5HO4A 5HLFA 3V6DB 2J6SA 1VLOA 2RAQA 4LRAA 4R8UA 1N54B 1NBEB 2IM1A 2XNRA 5T14A 1FD2A 5HATA 4I64A 4L76A 5CH7B 2CXEA 5M2RA 2ZH4A 3TARA 3CCSS 4CDIA 3UDVA 3C6UA 4ED4A 3KK2B 4DX7A 2VJUA 3BH6B 3OL6A 4C8YA 1XMBA 4NI2B 3MEDA 5A8RB 2YKAA 3DCAA 2C3YA 2IIHA 3NGTA 4W98A 3OUYA 2H65B 3RRHA 3W8PA 1YRTA 2C2ZB 4K4ZA 1BUXA 1TL7A 3VAJA 2AD9A 3HM9A 4USUA 1WTFA 1UL3A 1REVA 2CNOB 1MROB 3UCZP 4WFZA 1QDUB 4N77A 1IUJA 1URNA 4CLLA 3AXMA 2MSTA 1FD8A 1RTIA 3DGPA 2DH9A 1RAAB 2MKJA 2MY8A 5E3CA 1JXLA 4DSEA 4F3OA 2CPJA 3T6BA 3FBFA 2CZ4A 3IR7B 3D7SB 4I6AA 4YB1P 1K47A 1S1TB 2CQHA 4M63A 4FNIA 4PRFA 4FBUA 1IKWA 1U2CA 3R3TA 5EX3A 1Q5VA 1Z2LA 4GKJF 3DU5A 5GAHU 4YR0A 4X4NA 1L5UA 1Q78A 3PJWA 1ZAVA 1RU2A 2I38A 5KG6A 4H54A 3FBEA 3CJ2A 4H4OA 4P2XA 5KG4A 2AHOB 5DETA 5F9NA 1VHIA 4NLVA 3U02A 5K14A 3A3NB 4ECRA 5GMKa 5HL7Q 4CH0S 4HTJA 1IBLF 4F04B 1UWAA 5KFWA 3T1YF 4JI6J 2G1HA 3B4MA 4QYRA 1UJ5A 3W5YA 4IO9Q 4M1KA 2MKHA 3BBCA 2C3UA 1KONA 4M5HA 1SQFA 2GNKA 4N8NA 4RW4B 4U9RA 2EFVA 4RNNA 2N4DA 3ZZPA 1WTBA 1VJWA 1NJWA 4NCAA 3BYRA 4TLQA 3DRRB 1VDHA 1JJ4A 2FLLA 1S9EB 2RQ4A 3GG1A 3GU0A 2WVCA 3MM8B 3S01A 1WHVA 2B43A 4DV1F 1NJIT 1NHKL 3HXMA 1Q7YT 1VRUB 4I56A 4WPAA 4GC6A 1TL3B 1HW8A 4PWDA 4FP9A 5KG1A 2DR9A 2DNNA 4WKYA 1HBNA 4RW4A 3PDNA 3G87A 1IBCB 1XBWA 4O3SA 3JAMU 2OPSB 1R8HA 1VQ7S 3OJUA 1CQMA 2I2YA 3KUEA 2R7WA 1SH2A 4WBFA 3ILIA 2UUCF 2V8VA 4WK1A 2FHKA 3RJMB 3IS9B 1RT6A 2BACA 3CCJS 2Q1LA 4M5NA 4E2FB 1HLWA 4DV6J 5KFYA 1F9HA 5KFUA 1NK4A 2KJWA 1HW9A 1S1TA 2Z57B 4BWMA 1XQIA 4C6AA 2ZJRQ 2VL1A 4UTGA 3DRPA 3RBDA 2P9GA 3UW1A 4DHVA 5KTQA 1NK0A 4ZN1A 1YHQS 4FYVB 3R27A 2V4JA 4QIGA 4IUFA 3PJ9A 1WUUA 4KPCA 2AEFA 4NCGB 4UOCA 2ZH9A 1FFWB 2K8GA 4ELVA 2IRUA 2EVZA 5D4LA 2YWEA 4UZBA 4ZS6A 1U1RA 3AFGA 2G0JA 1KNZA 3O44A 2L9DA 3R9LA 2JEIA 5LMNJ 3ZTQA 1BQMA 1OWXA 3K2YA 2WCXA 3SQOP 4ID5B 5J2PA 3A3OB 1IR1A 1U25A 4TYBA 4RW8A 4QQBA 3ZNUA 2WSEC 2R8GA 1WF2A 1NK9A 3DOKA 1S48A 3PR5B 3QMQA 2H5IB 4GC7A 1S49A 1RWUA 3HULA 2ZJPQ 1P6TA 3GFYA 4UUXA 4ZPBA 1CQNA 1JLFB 3K0JA 1BXNA 3MHYA 5K8NA 1ZYQA 4C8NA 2VQFF 1Q7LB 1VQKS 3G71S 1APSA 2JL9A 2QT7A 3JQMA 4PG8A 1UVLA 1SC1B 4R25A 1HWUA 3V81B 3T5KA 3W9HA 4B17A 1YJTA 3CDWA 3L95X 1X4FA 1LNQA 4RW9A 4WCEQ 4YDXA 4OI2A 2EG1A 4B3SF 1U49A 3HK2A 4B9VA 4Y2KA 2MJNA 2XM3A 1FE0A 3IAM9 3IWLA 3K5NA 2E5LJ 2O67A 1WORA 4DMZA 2JOQA 2DPIA 3EZOA 3OTCA 3I56S 4V19X 5ETTA 3CJRA 4OYAA 3HSDA 1LW0A 2COLA 2F8MA 5CHCB 2W01A 5J1EA 1IQTA 2K3IA 2YQ1A 1LXJA 2WBRA 5HP1A 2C2DA 2OUGA 3GWCA 1BHNA 4LR8A 2LU1A 4YFUA 1A7GE 3QSIA 3OVSA 3U1MA 3BM7A 5CQGA 2ZM6J 1U1KA 3DC2A 2UUBF 1H72C 1QD1A 4RWXA 3T5JA 1FDBA 3V81A 4B3OA 2RQCA 1HHTP 2IRXA 2ZH1A 1JIHA 1CULA 4JI7F 1X7VA 3KDNA 2VFSA 4KE5A 3TI0A 1X4CA 2W4PA 4C48A 5AE3A 2DY9A 4KH0B 4DCOB 5D15A 3EVOA 4ZCLA 1FDNA 3PRVA 4HHJA 2HNDA 1VK8A 4RWWA 3TVZA 3US5A 3RR8A 4ZJLA 3X3UA 7FD1A 2M8DB 3DOKB 3KLGA 4L3NA 4J9VA 4KKOB 4CO1A 5G0RB 2I8EA 1D09B 1T9WA 2J7KA 1NSQA 4H4OB 3NEKA 1U0HB 2W8KA 1YLXA 1B0TA 3HX9A 3KHGA 2CPFA 5DDOC 1IKYB 1UZDA 1HBOA 5BXIA 1ZPWX 1U1MA 1N5TA 2R7UA 2R3VA 4DV0F 2WVBA 1HBUB 4DS4A 3OFHA 2JVRA 3QJLA 2VPXB 4PPZA 2R42A 4O3PA 5FJ4A 2MMYA 3ITHA 4AFFA 1QY7A 4CQ1A 4ALZA 4PG4A 5L1JA 2V6AA 2B56A 3I9ZA 2EKYA 1FWPA 1L3TA 3A4TA 4KGXB 4DQRA 3V4MA 2VOOA 1Q79A 3OBIA 1WD6A 2CAJA 4CI0B 2NS1B 2W24A 4JOUA 4ZJOA 2D3OR 2D7SA 3MI7X 3SFUA 2H5EA 3TJAA 2ZNYA 1TR0A 2GVZB 5DDPC 3PKYA 1YJNS 1T05A 1NKBA 4NLXA 2Y9HA 1NHUA 4KY3A 3ZZUA 3KUGA 4ECQA 2IJRA 1Q16B 2G4BA 2XB2D 3PVXA 1X5OA 5E3QA 5ETSA 2RHSB 4B3MF 3AD9C 1BWVA 2EC2A 2ZOFA 3L3CA 1D3WA 3C66A 3T1YJ 1BD6A 1KHVA 7AT1B 1TUWA 1G7CB 4R8UB 2GVZA 1XMQF 3C46A 1IKVA 1FNOA 2IYGA 3IG1B 4PQAA 2OAUA 4TQSA 2ACYA 2RMLA 2YNIA 5F3TA 1RTJA 4LSNA 5AXKA 4ED2A 2UXCJ 2HIQA 1KBRA 2E44A 4RUCA 4GVLA 1BGXT 3K89A 3GONA 4FYDA 1NJZA 2N3OA 4EYIB 2VG5A 4ITSA 1PYSB 1RHJB 1W26A 1Y5NB 1VBYA 3MM9B 2F7VA 4DR4F 3L7UA 4DV2F 5IM0A 1ICEB 4BC7A 3HMJG 4EZ6A 4PCQA 1IJEB 2LU2A 1MU2A 2RKIA 4FYYB 4P6QA 4OQJA 1FXDA 4OJHA 2MPUA 4USIA 4KTQA 1PKUA 2BJ9A 1FRKA 3AXKA 3CC4S 5DZ7A 1HMVB 2CVIA 4YB7A 2QA2A 3TQEA 4QOTA 3ZO7A 4JI1J 3D9BA 3AH6A 4J9OA 2CQPA 2HQ3A 2PMWA 2YKPA 3MMJA 4ZLJA 4Q7AA 1UEKA 2I9SA 2QMWA 2R2TA 1U6BA 1EKRA 2FY8A 3MR3A 1JLBB 4ZCIA 1VFJA 4QIWD 5F8LA 4X4OA 2NXUA 2V2ZA 3ISZA 2BR0A 4IG0A 1TK0A 1HIYA 2Z2YB 5HJYA 2B4VA 2DHAA 3ONQA 5KFQA 1PBUA 3I9V9 3LA0A 1NNDA 2ZHAA 4S0MA 2ZEJA 1SKWA 3D68A 3HJVA 5EWGA 2NPFA 4F0MA 4ZLNA 5LMNF 1RWPB 3PCOB 1NK8A 4DUZJ 3R5BA 1C4AA 5J2MB 2C2OB 4DPUA 1FKOB 1L3KA 2J6TA 1VLYA 2BM1A 3AB4B 4FS1A 2LFVA 3QPIA 1K73T 2HS3A 3QGIA 3J81U 2KB2A 1TUVA 1WEXA 2APOA 1UP1A 2BX6A 1TUGB 5BYRA 2OD4A 2VC0A 3BZQA 4C98A 1WKKA 4MT1A 1HNZJ 1S9GB 1Y9OA 2GHPA 4NEZA 2RUSA 4YEAA 5L9NA 3CCRS 3C15A 1YKWA 1YG0A 2OEMA 2HRUA 1GEHA 3DXBA 5F3ZA 5KAKA 5I3UB 1RTJB 2XMWA 1IWGA 5AE1A 1OSDA 5A6WA 1AFJA 2Q66A 4A46A 3QT6A 4J9SA 2RF2B 3P96A 4ED3A 2ZWPA 3M8WA 3J7YU 1SUQB 4B9LA 2NLWA 4B3SJ 2RS8A 3QBCA 2O01C 2HHSA 4LRCA 2H1YA 1KLMB 4CTAA 2XULA 1LKZA 2WONA 4X4QA 3I6PA 5K8OA 3GSDA 3HHLA 2FZGB 1U1LA 2HGMA 2BQUA 1LWFA 1HI1A 1RWVB 3FVYA 3RBZA 1HBOB 1HWLA 1VQYA 3RYLA 5HVGA 1S97A 2VFUA 4ZVSB 2A18A 2HLTA 3CCWA 4W4MA 3KJFB 3M8ZA 2GHWA 2DRBA 1YVFA 1DLOB 3VQSA 1JLCA 4EU0A 3LUYA 5B0BA 1QAYA 2IYIA 2ZKUA 1OY6A 3M6XA 3MEEB 2UVUA 1UVMA 1CJKA 3R7SB 2J5AA 2IMWP 4A8FA 2Q79A 2W2OP 4JI7J 4KO0A 2DNHA 4OZ1A 4AT1B 3CEDA 3EMTA 1ROFA 3BGUA 4FXDA 4DV5F 1TMMA 5DLFA 4M5IA 2AEJA 2ZZNA 4J91A 3D54A 1RT4B 3KXDA 3UO0A 4URGA 2VUGA 2HFZA 3MGJA 3CIMA 2DIVA 2VU5A 2YX4A 2I0XA 4ANDA 5J2NA 3PRBA 2XMMA 3BQ0A 3NNCA 1P1TA 3V4IA 4N56A 1FX2A 2XHCA 1ZM9A 3NBPA 4IRDA 1IR2A 2CJQA 2ZHBA 3N5FA 4YP3A 3EUNA 2R7OA 4P7TA 3AT1B 4ZVQB 5G0RA 4RW6A 3EVMA 3OL9A 3UFCX 5KOXA 4DV0J 4DSIA 2X1FA 5SUHA 3V5RA 2HHXA 4ILRA 4PYDA 3H40A 3CCQS 1U1PA 3CMAS 1TU0B 2ZBCA 5SZTA 3A12A 1H74A 5HVHA 3F41A 1HNWJ 1JLAB 2KHCA 1B99A 2MQLA 3IO1A 5KFRA 2HBRB 3MM7A 1TL7B 2YNIB 4DL2A 4E0DA 2HS4A 4A8SA 4F2SA 2XBPA 3ZZRA 4DR1J 2CIMA 4F0KA 1JWWA 1S9FA 4WFXA 3I0RA 4O4RA 2OHDA 3HHNB 2WAQD 2HBQB 4ZVRB 4F8RA 1U2FA 3LP1B 5I42B 3M32B 1Y5LB 1SL1A 2ZH2A 1Q53A 4KB7A 4URQU 2CNNB 3BDEA 2R8HA 4KRWA 1Q95G 3CWJA 4J9MA 1HQUB 3Q86A 4WWSA 2ALZA 3IC1A 4OYPA 3MTJA 1NDPA 1YJUA 2LKZA 1R7IA 3D0GE 4RW9B 1XMQJ 3OHBA 4DWIA 5F8MA 3TA0A 2BABA 3OLAA 1NDLA 3B8HA 2DXEA 1D9DA 2MY7A 4CM2A 1HI0P 3MM6B 3PXGa 2HHUA 3N6LA 2V2KA 4ZVUB 4Y65A 5ETVA 2RU3A 3GFXA 2ZZMA 2YPZA 1C1CA 1AA1B 2U1AA 1FJCA 4BDPA 1EB0A 5LXRA 2RRAA 1S99A 2L9NA 1REVB 3MUVP 1NKCA 3MEGA 3ENAA 3R5GA 3PR4A 1G6BA 3V4IB 2C2NA 2XLIA 3ZTOA 2KXNB 4ID8A 2X1AA 3SZ2A 4PWUA 1MSWD 1SC4B 2RDJA 4QWDA 2J76E 3I31A 4LF7J 4DI6A 5KFFA 4XK8C 4N8OA 2G2YA 4KGZB 4USWA 3TWZA 1NO8A 4JI1F 4YUDA 3G6VA 1JXEA 3M9NB 1NSAA 2VG7B 3UDLA 1VJQA 1R8AA 3IP0A 4OHVA 4ECUA 4CT9A 2E7VA 1DHMA 2IJFA 4PPDA 3SBMA 1K0TA 3TA2A 4LFBJ 2XGQA 4FBTA 4HI1A 2CPYA 2UVWA 5D77A 1NU4A 1R89A 1U24A 2V9KA 3BN7A 3A3PB 1WG1A 3A8KA 3HVTB 3LP0B 4L73A 5D4PA 1NMEB 1KN6A 2LP4A 4LR7A 1Z1ZA 4JV5J 2B9XA 3M9MB 1AUDA 3C8YA 1P8GA 2YQ0A 3BS9A 4YDDB 1K0VA 1BLUA 1X5TA 1HI8A 3I0SB 2KHDA 4MKVA 3T1HJ 2KU7A 3GPAA 4CTAB 4IQXA 2O66A 2G2OA 1X0PA 2BANB 4KV8A 4OYWA 5CCMA 3H25A 2Z0GA 2A6OA 3GR0A 2EBGA 4FYXB 4MIBA 1OPIA 1RLDA 3VZIA 1GQEA 4DR5F 3UQSA 2E9ZA 1OPZA 2EWHA 2YWKA 3MEKA 2FVPA 1FEEA 1VS3A 2QZ8A 1X4BA 2CJYB 4I7FA 2AYEA 2F9DA 3LP0A 2HNZA 4FDFA 1RBAA 5DJBA 4ZVOB 2XYGB 3RAMA 1IXKA 4YS2A 1AROP 3D4JA 1WF1A 3MWBA 2V67A 1VQNS 2DO0A 3FEYB 5HQLA 1H7XA 4ICLA 2LQBA 3VGUA 4V1Ak 3VTIA 5B08A 3I5AA 5DQHA 4OI0A 2FPHX 4UT4A 4QYZJ 2DEIA 2KKHA 2LQJA 3VAGA 2QL7B 1RDRA 3VF0B 4RJVA 1FA0A 1U02A 1YRXA 1YX2A 3JSRA 2DVIA 2FGCA 3CC7S 3I5CA 3AD8C 5KFJA 4K2XA 4U67Q 2OSRA 2ADBA 2BYCA 2DNPA 1H0HB 1SV5A 4Z7CA 1HARA 1OIAA 2CDRB 3IGNA 1X9MA 1RP5A 4WXOA 2KH9A 1TL1B 3NAHA 4DOZA 2PIIA 2FC9A 3FSYA 1Y0HA 4WFAQ 2C2MB 1HHSA 2BVZA 2GJFA 3M1VA 3J80U 3K8WA 2O3DA 2QYGA 3V6KA 4B9TA 4RW6B 2O1PA 3D1OA 4QWEA 1FVSA 4NLPA 1T8EA 3DRPB 5HBMB 4RU9A 5H9EJ 1KOOA 1VBXA 1PAUB 2OGUA 2IDLA 3TR5A 5MAOA 1GXUA 2J7UA 3HDSA 1U0HA 3JTOA 3LPEA 2BJDA 4I4BA 3DRSA 1IKXB 1FFGB 2XI2A 2C1EB 2DKOB 2VFRA 3D5MA 4OI6A 4DV6F 1DBDA 4DL3A 1S72S 2VC1A 1PYOB 1G3OA 1Q5YA 1QJHA 2ILZA 2VBXA 2ZBPA 2XCAA 4UY8T 3GB0A 2HVIA 1BQNA 2GO9A 3Q83A 4R0JA 4PWDB 1RU1A 3IXQA 2YPYA 2CADA 5D0RA 2YWHA 1KQSR 1PYTA 3DXSX 5GVQA 1S6QB 3BH7B 4P9SA 4AQYJ 5HJXA 2BQRA 2EFNA 1JLAA 4M5JA 5HI7A 4CO5A 3ILOA 1SL2A 2FJAB 1QAJA 2J0SD 4PZVA 2RH3A 4NRUA 1U7LA 2IM2A 1BQNB 3KLEB 2FQQB 1F0XA 3P4UB 1KVKA 5K5MA 2CPZA 2AP6A 3RTVA 1DURA 1RAOA 3OFFA 4BHQA 4RU2A 2ROPA 2VONA 3U27A 1WHWA 1XWLA 1NSPA 3CF5Q 3M30B 4J9LA 1ZTWA 5LMUF 3ADAC 3IBCB 2VQFJ 3GMGA 5GAHI 3LPYA 1RISA 2CRLA 2CDQA 2FTRA 1S1XA 3O6QA 4C97A 8RUCA 3JQJA 2FJVA 5HBMA 1GX5A 2ASYA 2HGLA 1F60B 2DT9A 2MKYA 2B9EA 2ZVIA 3HHLD 3RUBL 4F50A 4CH7A 1Q82T 1G1XA 3G6ES 2VASA 3CE8A 3DOLA 3TVYA 3D1HA 2CNLB 1ZZNA 4DX6A 1RTIB 3DGPB 3GFHA 1KFDA 2OEKA 5F8NA 4TY8A 2A6MA 1WG5A 2GQ2A 2JC0A 3CCTA 1YBUA 2HURA 2KL8A 2SXLA 3Q8VA 2QX0A 3OQ2A 4I2QA 3KLFA 1D9FA 1RZMA 1XERA 3R7BB 3J7AN 3QT7A 5C24A 3LAKA 1B70B 1U6ZA 4I2PA 4ILMA 3H2VE 1JLGA 2XWXA 3P5TL 2YX7A 2UUBJ 3NWRA 1M5SA 1LEOA 4OJGA 1F6TA 4WP8A 3KLGB 2ASDA 2JHEA 1YI2S 1FXLA 4DN0A 2XZTB 4I6WA 4NLQA 4CNYA 1RABB 1WC6A 4UQTA 2J0XA 1KLNA 1S0MA 2EFPA 2CPXA 2FGOA 4ES2A 1FDDA 4DPYA 3UD3P 2W2PP 2PFDA 3DOMA 3R5JB 4KFBB 2PMZD 2GW8A 1DQ9A 1Z4UA 4ECXA 4DQQA 2XS5A 1FTRA 4LFBF 3SCIE 3BB5A 3K5PA 2HNZB 1RUSA 2JVOA 3G2XA 3HHKA 3NS6A 2GMHA 4QPTA 4ZVHA 1Q8BA 2OFHX 1XNQF 1ZH5A 1M1HA 1LWEB 1GAOA 3TJ8A 3FZBA 2UVVA 1NK7A 4AXJA 2LECA 1UA1A 2HYIB 2IY5B 2CJ9A 1PJ5A 5F41A 1JQGA 2ZBRA 2BKOA 3M30A 4IH5A 1N32F 5KFTA 1CLFA 4RBTA 3BSNA 4Y0FA 3OR2B 1SKSA 1T7PA 2LMIA 1Y10A 5J2MA 3I0SA 3M8PA 4MFBB 3OFGA 1AUSL 5D0EA 3TEHB 2HFVA 2F9JA 3ILJA 2XNQA 4B3RF 3SV4A 5HROB 2W9AA 3T41A 2YH1A 3NOCA 2DNGA 1PJ7A 4DQIA 4LF8J 2R7XA 1KC8T 1SB6A 2OD6A 4O0IA 4G65A 4CIOA 2MGZA 4G1IA 1EX8A 1TKTA 3CW2C 1MLAA 1PC4A 2ZE2A 2JRSA 4HLBA 3BR9A 2ZH7A 4C11A 3DMJB 1UVKA 4FKXA 5B7WA 2XY7A 3R2DJ 1SJFA 2FC8A 5KFDA 1JLEB 2R7TA 4O44A 4Q8EA 5KFKA 2WTFA 4USJC 3WBZA 4Q2MA 4M94A 1W2IA 4O4GB 1BQMB 2BV3A 3GG0A 3NY0A 3J7Z5 4ECVA 2H9ZA 3P49B 4KIAA 3PFEA 1S1VA 1N5YA 2QJ3A 3V2UC 1IBLJ 3ICLA 5D6GA 3K5MA 1D9AA 2HNYB 3KJQB 4ZPCA 4EBEA 1KOHA 2F4VJ 2YVSA 3HZGA 2OMOA 3R6LB 4W92B 4AYBD 5H1SV 1UETA 1WWHA 5I3PA 3L4BC 3MCSA 1H2UX 3HSGA 4OZNA 1RT2A 1Q8LA 3KYLA 3EGNA 1AT1B 3FBBA 1HNVB 1JLCB 2CPDA 3DHXA 3K7RA 4DX5A 5ETRA 4ERDA 2NYHA 1ZM4A 2MQMA 3OV7A 1TVRA 2W9BB 2KZZA 2Z2LA 4NA2A 2AGPA 2AGQA 2UXDF 3JSMB 1Q4RA 3RB6A 4K4UA 2HHWA 3E8OA 4GRSA 3BPSP 4M5DA 1UJ4A 5DG7A 4HDHA 4USVA 3OTOJ 2KM8B 2FYXA 3QGGA 5CYQB 1T95A 2V0NA 1S57A 2RDDA 2HQCA 2YX1A 2UUCJ 2GO8A 2V8HA 1TL3A 4RR5A 3S6EA 4A8MP 1TKDA 1QTNB 3TZWA 1XR5A 5HQMA 2XO7A 2W4CA 4MIAA 2WHOA 1VQ9S 3EICA 3Q89A 3MFHA 1DY3A 2CJAA 3G4SS 5D3GA 2C3MA 2GVDA 3IFEA 5KT4A 3THVA 4XDCA 2VA3A 3TX8A 3N4WA 4HYKA 4QIVA 3FJ2A 3BGLA 4LRDA 5KT7A 5D8HB 1HD1A 3UNGC 3QO9A 3W60A 2PO4A 5EWEA 2B6AA 3BGRA 2DR5A 2E1AA 2V4QA 2X1BA 2BANA 2EXUA 4I0WA 4KV8B 4O23A 1UWBA 1RT5B 1O5JA 3MMCB 5HMYA 2MSSA 2C2KB 1VCTA 1QSLA 5JUMA 3R1HA 1DTQB 3H90A 3VHQA 2M4MA 1HNZF 4IH7A 4P72A 4AXIA 2JEGA 4YMEA 3PZPA 3I4PA 1C2PA 5EWFA 2A1BA 3NAIA 4Y00A 2JJ4D 1R8CA 3E01B 2F63A 4KGVB 4WU3A 4RW7A 3VCDA 1RKIA 5L8RC 4A8YA 4JI5F 2KO1A 2L08A 1KFSA 3DRRA 3W2WA 2G13A 3OTBA 2RVJA 3M8YA 1X4EA 2XG8A 3TNVA 4IG0B 3NGDA 3IRXB 4YR3A 1NEEA 3B6BA 4B9MA 5L46A 1WC5A 2DGQA 2JH3A 3LGNA 3TVKA 2BMBA 2ZC4A 4EO8A 5LOQA 1KP6A 1VQ8S 3TAMB 3MECA 1TKXB 3KJVB 1WC3A 3W9IA 3R1LA 2Y8YA 3K8VA 5A0YB 1D8YA 1TFWA 2MJUA 1KS2A 4WFNQ 4DR6F 3KNAA 3TUZC 1NZAA 2RE1A 1DLOA 2YWFA 3JSMA 4ECZA 5J2QA 3PW0A 4NXNF 2DGXA 2YNGA 2K7JA 2LXFA 1TVRB 1RWNB 3DLHA 2EG2A 5HSPA 2W4DA 2F40A 2OSQA 2QRRA 3H42A 1X4GA 3MEDB 3MEGB 4NI2A 3BPDA 3IM9A 3SQGA 2K2PA 2WW4A 5CAAA 1XTZA 2M2BA 3RG6A 1IQZA 2FVQA 1FKPA 2DH8A 1RWWB 2V8DA 3CCLS 2EC0A 3M7VA 1MW7A 2ABYA 1YRUA 4DR3J 1N5QA 2QL5B 1SUQA 1RI7A 4DV3J 3D6TB 1UA0A 1EZZB 3DRXA 3LOUA 2CZVC 2HZVA 3PW7A 1DQ8A 2A2CA 2HBZB 2HFUA 4K4VA 4K4XA 1FJ7A 1SC3B 2BA9A 3P5BP 1J5EJ 5F8GA 3OXFA 4NLYA 2EFGA 4PAAA 3ETOA 3C2PA 2RQMA 5CXTA 1Y5IB 4TN2A 1W25A 4NASA 4C0OC 3OD2A 4UOFA 2MQOA 1YK9A 5E41A 5FLXU 3GJTB 2KYZA 1FKPB 3ZZOA 3C6UB 4PXDA 4EI2A 2RS2A 4JI2J 1TKTB 2E9TA 2DIUA 2KRBA 1DRZA 2NZ4A 4PXBA 1T05B 1EP4A 4PUOB 1P9YA 2Z2ZA 3MM8A 2DNZA 1N0UA 5LSRA 4K50A 2HHHJ 2H54B 2VV5A 2UU9F 4JYAJ 4QCLA 1GXLA 2KRRA 2ACMA 4OJ1A 2AF6A 3DI6A 2JEFA 4X4UA 5LSLA 3TAMA 5LJ5Y 2BKPA 5IWAJ 1WF0A 4M5GA 4UF4A 1CC8A 1ZZFA 4A8KA 1AFIA 1IM6A 3DLKB 2YWGA 1YBAA 4G1PA 1O6XA 4DL5A 2CQCA 1HBUA 2JWNA 2P6TA 4I67A 3MAQA 1S4EA 2GS8A 2EW9A 4ATNA 3SI8A 3L9ZA 1RT6B 4DBQA 1JKHB 4LF6J 2DO4A 1RHMB 3WDOA 2V2QA 5KFIA 2HHVA 2PC6A 3HPOA 1WEYA 4CLKA 4X4SA 5LL6d 1N5SA 2QFIA 1IR0A 2ERRA 3MDFA 1DTTA 1KQKA 1Q81T 4PQUB 2E7WA 2CYYA 5GMEA 2ZWOA 4OYMA 1CSJA 1B7YB 2MQPA 2KXFA 2D3UA 1KEKA 5ETKA 1GXTA 1WNEA 1I5OB 2BE7D 3ZNJ1 4DUTA 2HPUA 2VODA 3C19A 2W25A 2W1BA 3PNIA 4CP5A 2XS2A 1HL6A 2E1RA 4F67A 2AV5A 2XY6A 1Z2ZA 5C24B 2H3EB 2QLBB 1JLQA 2CQIA 1N34F 4C0HA 2D1CA 2IA0A 3F56A 1HBMB 1QUVA 2B7BB 3HHLB 2I6WA 2KG1A 1JX4A 4LF7F 2WONB 1LWFB 2Z58B 1XMOJ 3PJXA 2KYXA 6AT1B 2XYPB 1A6LA 2AJQA 2E5JA 3SCJE 1ZS6A 5D78A 1AB8A 1YJRA 3M05A 4MJKA 1AZSA 1HKAA 4WYWA 3EPGA 3QWPA 1CS4A 4YY3J 1VIOA 2NXEA 5B0FA 3FCWA 2DGVA 3AA9A 5A8KA 3GIMA 3VALA 3TUJC 1TMJA 2DPJA 1TAUA 3GSIA 4LF1A 2GIRA 2OLWA 1CJUB 2ZHOA 2R7SA 1FFSB 2OFGX 3QIDA 2DBBA 2K1RB 3WIUA 1A9NB 4P71A 3POTA 4NE9C 3R97A 1RLCL 4JP8A 1Y7PA 2DR7A 2UVRA 3GLJA 2V2VA 1UVNA 2LQ9A 4ED7A 5B0DA 3QJPA 1Q8KA 3MMAB 2G9OA 2VICA 2JLGA 1S1VB 1N5YB 5C25B 3DYAA 2JFDA 3PW5A 4JI0J 1UEUA 2V8GA 4EEYA 1V5IB 4ELUA 3MPVA 1URRA 3ZTSA 2CVEA 3CO9A 3LQVA 4ZN3A 4U6PA 3AD7C 3VGTA 5C2GA 2VKRA 4LIWA 5JJBA 4DR7F 5AT1B 1IVZA 2OPRB 2Q3PA 1WI6A 2J9DE 1FWLA 3D67A 3QFHA 1TQLA 3KG1A 1FNMA 9ATCB 2HIYA 4K7QA 5B0AA 4DPTA 1GFWB 3MCNA 1RCOB 2BRKA 2MGZB 4ED5A 3IAS9 1F3VA 3NKYA 3NNAA 3EGWB 3EYZA 1U0SA 1B0PA 5BYSA 2RUGA 3W2WB 3W5ZA 1F9FA 2B8PA 3MMBB 4KR0B 4N47A 3RBXA 4X65F 1S1XB 4DR6J 3MD3A 1GH8A 1MWQA 3GILA 1HNIA 2E1CA 4IDKA 3ZXWA 2F4FA 2VG6B 4QBUA 2IBKA 2RKIB 3TZXA 4FZVA 5AE2A 2X3GA 4U7UD 4JI6F 1OMSA 3H7HB 1LK5A 4HACA 2YKMA 3SDEA 4F02A 3UVJB 2V9WA 4ZPWR 5HMWA 1RWMB 2B6AB 2G1DA 3BGRB 3NMRA 3TYTA 2NQPA 3P45B 1LW2A 1GMWD 3HCXA 4DV1J 2CQ0A 2ATLA 3F44A 2GAGC 1HNXF 4F7VA 4EWTA 1YITS 1EP4B 3QIPB 3DOMB 1TELA 4KFBA 1J5EF 3BREA 4GO7X 1B0VA 1C4CA 1XNRJ 4CLSA 2EBEA 5C25A 3M6VA 3M4XA 1FO1A 1EQ0A 1JLFA 3U1LA 3T19A 3F0NA 1RHUB 2IRYA 2FLPA 2NPIA 4I6YA 2MHNA 4M5DB 4G3IA 4DU8A 5GAGU 5DGBA 3K59A 4CT8A 2ZBQA 1NXIA 2W2MP 4IFYB 3CJ4A 2D3O1 4GO5X 2CQGA 2RF2A 4K4YA 2V34A 1C1BB 1WDTA 1S6PB 1SQEA 3ZFVA 1LWEA 2KT3A 3TAPA 5IS2A 2WB4A 1KTVA 3C14A 3G8SA 4RUAA 1X8DA 1Y4ZB 2FZCB 4QIFA 2HRYA 2I1RA 1K9MT 2GAHC 3OXLA 4H4KA 4Y2IA 3DLLQ 4NLUA 2E1MC 1L3SA 2PEBA 2OKQA 2DTJA 2RDIA 1SJ3P 4A8OA 2VFTA 3ITHB 4KHPJ 1NZ8A 2C3PA 1EARA 4DR2J 3NP5A 4C3LA 2OPPA 1DTTB 5LSOA 5HAOA 3DDKA 4IFVB 1O0PA 3EZ5A 3NGSA 1FNXH 3MAHA 4Z7YA 2PN6A 2UV8G 4DV7J 4EBCA 1NJYA 3AJDA 2PI5A 1V3SA 2UXBJ 2UUAF 1RAFB 4ED0A 4DFMA 2LQ5A 1HBMA 1J5OB 1I94F 2MKIA 2M5YA 2IVYA 3I32A 2AJFE 2NSCA 4KGMA 4WFYA 2DNYA 1C1BA 1S6PA 3QLHA 4KYZA 4F26A 2DITA 5KFEA 1T9TA 3OUYB 2B51A 1HA1A 2DCUB 3U1NA 2W2NP 4EK2A 3J7YI 3M8RA 4LF9F 4Y28C 1UFLA 2CQDA 3NS5A 3OJSA 4ECSA 3AODA 1VK3A 4NXMF 3NCPA 3UE2A 2OP5A 3L7OA 4F4AA 3G82B 3KLEA 2DGSA 1S1UA 2DRDA 3ZZTA 2ZC3A 2CWXA 1S0NA 1S0VA 5G4DA 2B9WA 3GIIA 2DCLA 2VPYB 1ZBTA 1SL0A 5F8JA 3QIPA 3ETMA 3WC0A 2HZCA 1IJFB 1V3RA 3P3DA 2BJ8A 1RT3B 2QLFB 4I7FB 5KT6A 2ZOGA 1T02A 2MQ8A 4I69A 1Q86T 2E5LF 4C8KA 1JK9B 2I5JB 4QZVB 3M8PB 1PAEX 2QL9B 2XSJB 2GHVC 2NYIA 3UN5A 3FK4A 2AX1A 3QRRA 3KUHA 1HQEB 3IBWA 2Z56B 4DPOA 1S1WA 5EDWA 2Y1JA 5IQQA 1D0EA 3T1AA 3TX0A 4TU8A 2FJBB 4ZP7A 4Z2XA 1VHFA 2V50A 1WKJA 4JV5F 3M6UA 3EX7B 2EPIA 2NXNA 4NA1A 2W7AA 1DQAA 1K1SA 4OLPA 1RTDA 1RT3A 3HFVA 4CRJA 4QWCA 3D0IE 1TL5A 1IKVB 5IT9U 5EUHA 4O3QA 2AYBA 2E5HA 3JB9k 1VC5A 2DNKA 1PC5A 2G0IA 2LVWA 3N5BA 4G1QB 4NEYA 3SCKE 3LGHA 4CNZA 3RAXA 2GA7A 5DQIA 3LW5C 2QLWA 3LGMA 2HFOA 5KG5A 4NLGA 3ULHA 2IC3A 1C0TA 3M2UB 5H9FJ 2VPZB 1SJ1A 2RSQA 3BYPA 1RT7A 1LFWA 2UUWA 2RIJA 3LP1A 4OX8A 1PO6A 1X0FA 1RAJA 3KK1B 1JLGB 5J2PB 1M5KC 2DH7A 3MPWA 1YSJA 1IKXA 4DUYF 3FFIA 3J81Y 2GGPA 4L6V3 4B3TJ 2WRMA 2WBMA 2P8IA 5DZ6A 2RNEA 4WIQA 1FRXA 1UKUA 2IHR1 1QM9A 3KK2A 4LF8F 1C1CB 1JXVA 2B7CB 1VRTA 1BMQB 2E7XA 4ETZA 5T41A 4X2BA 1FWKA 2BJEA 3RAQA 1U8WA 4ZCMA 4MAKA 1M5PC 4CZCA 4ZA1A 3RB4A 5KFBA 4DQSA 3AAWB 2LA4A 2XMAA 4OHWA 2HQGA 2MZSA 3M8SA 4X4RA 2BUNA 5DRKA 3Q8PB 3PIOQ 1F5CA 1KKHA 1DAXA 1RTZA 1U09A 1X5PA 2DY1A 4HHHA 5ETQA 5I4MA 1RKJA 4B3MJ 3Q8YA 1S1WB 1TKXA 3QAEA 4CLPA 5M2PA 4X62F 1YDLA 1GTHA 4JV0A 2VG5B 3CGIA 5KG0A 1H3DA 3W66A 1FESA 2MZTA 3DDNA 1HWIA 3WX4A 1YWXA 2MKSA 4DCJB 3GE9A 1MNEA 4NRTA 3MZIA 5KG2A 4ECTA 1M1KT 2Y0BB 3ET6B 3VQTA 4CLYA 2BM0A 2V4RA 4B3OB 3R7NB 4WTOB 2BZ2A 3JTNA 3EWGA 3KFWX 2DYAA 2IAJA 3IR5B 3MM7B 4U96A 3R8YA 4DX8H 4CH1A 3CUNA 4L72B 1IBMJ 2BOPA 2OI2A 4TYAA 4Q45A 2N7CA 3EJMA 2QSFA 3HO1A 2UXDJ 2G2ZA 2Q6CA 4L74A 1DARA 4DV2J 4DFJA 2ZVSA 1GX6A 1MMLA 2A3JA 2EK1A 1I1GA 4EFAC 4ECYA 2R2RA 1NH8A 3VV2B 4M95A 4M8LA 2QV6A 3CD7A 1FK9B 2J0WA 2IVMA 3FEXB 3G86A 5B0GA 2M52A 4AE5A 3M8QB 2YY3A 4TQRA 3D2WA 4FS2A 3QSYB 4LVNP 3PYFA 3QLHB 1HNVA 3FEZA 2KN4A 3ZC4A 2XGPA 2RRBA 3LAMA 2D9OA 1N88A 3ENQA 3MMBA 2OTLS 1PILA 3S1TA 3T5LA 2OPQB 2DGTA 3MTKA 4NYOA 2R8IA 1RGVA 3AJ2A 1VRTB 2N7YA 3GYNA 4NPOA 2ZOMA 2FDNA 3MM6A 3K5OA 3R5AA 5CYQA 3MUMP 2AYMA 2CA9A 3DI6B 3MPDA 2IM3A 4LR9A 5EGYA 3CC2S 3VAKA 4DR2F 1LWXA 4ZITA 3P6YC 2DNQA 1FX4A 2YNFB 1VYAA 4OI3A 4J9PA 3PTWA 1F5BA 3O5TB 3H59A 4RL1A 1I94J 2UUAJ 2B0GA 1LWCA 4QU6A 1RACB 5KFLA 2C42A 3QRPA 3DLEA 3CDEA 1UPPA 4JI5J 2KJVA 2R2SA 5A8RA 3ZZ0A 4CO3A 1N33J 3KMQA 3AHPA 4WXWA 4C3KA 3OVBA 1ZOTA 1TTHB 2OPSA 3KG4A 5IC6B 1FRMA 2BW2A 3GYXB 1H98A 1KWMA 4J37A 4UW2A 3VR1A 2HHQA 3CCZA 3UDCA 4Z37A 2BRLA 2FJEB 1MMDA 2DEJA 2Z4PA 3VZHA 2O5DA 4ZIVA 4CLUA 3KJNB 2GIQA 5KFGA 4WYLA 1CJTB 2IPOB 4DEZA 2WVEA 5EHHA 4X66J 1NJXA 4WIIA 1Y00A 1E6VA 2X7IA 1FK9A 4OHYA 1ITPA 1JLEA 1OYEA 2IA6A 2ZNZA 3UPFA 5IM0B 3CDAA 1FDAA 1M90T 4AL5A 1P1LA 3V6HA 2HMIA 3H2LA 4DZDA 3K57A 1IBKJ 4MYTA 4X4VA 4DSJA 2MZQA 2CQ2A 4RO0A 5IOLA 3FMBA 3BQ1A 1I6JA 4DV3F 1JLQB 3NCRA 2ROEA 2E5IA 2AU0A 1SIZA 3D6HB 1S7HA 1S9EA 4OV1A 4CYUA 4RNOA 3EDQB 1T11A 1WELA 4ZOSA 4CO2A 2HQDA 3QZ7A 1XC9A 3Q23A 1RBLA 2DNLA 2XEXA 1UW4A 3KLIB 1T0TV 3Q8UA 3MECB 2F5GA 4KC5A 4RX6A 3KJVA 4LQ3A 5B0CA 1NAQA 2CZ9A 4DSLA 1SI9A 3MOJB 3CDBA 1S1UB 3DLGB 1OS5A 2OELA 2HAFA 4FKYA 3W61A 2EKNA 3SSQA 1SVDA 1HFEL 1SH0A 3MURP 5EN1A 1CC7A 3DU6A 5C5JA 2PMHA 2CQ1A 4CLFA 1EKSA 5GADI 3MM5B 4Y2CA 4ID5A 1RYSA 3HFKA 3HVWA 1R6YA 2GMLA 1FF2A 2L41A 2M88A 3RRGA 1MN9A 2F8HA 1KSPA 3GZ7A 3PW4A 4NA3A 4DUYJ 3CJ5A 5KFOA 4JYAF 1EHWA 2MYFA 1ELOA 2FIUA 3SSRA 4MKBA 2QYCA 1QSYA 3PYGA 2RD5C 2V4JB 3L7PA 5IWAF 2AJ4A 4D3GA 2C2EA 3D28A 5RUBA 4WFBQ 4USKA 3S8SA 1JMTA 2QA4S 2MB0B 4Q0BB 1MROA 1Y3JA 4JUZA 3TZZA 3VGSA 4ZDNA 4IR9A 4ANEA 3TRGA 4B3RJ 3OL7A 2HG4A 1E6YB 2ZFHA 3NGUA 3QT8A 2DXFA 3KK3A 4DR1F 1KHWA 4P2FA 2OO4A 4GVBB 4DS5A 3VWSA 5CYMA 3KLFB 2QN6B 4F36A 4P73A 5DQGA 3E3XA 4C8MA 2HZAA 2AW0A 3GCXP 3D3BJ 4NLOA 3HD1A 3SEOA 5L1KA 2RJZA 1YJWS 2KM8C 4C11B 2VOPA 2HS0A 4A8QA 2HEKA 4ZP9A 4G1QA 2JC1A 3NS7B 3FZ2A 3OFEA 3M2VA 2XMTA 2BJ1A 2OMLA 1FJEB 3N6MA 2YTCA 1W2BR 4B08A 1CULB 4TU7A 3EVWA 5EX0A 3EGVA 3HF5A 3UD5A 2CQ3A 4CO4A 2Z30B 4CLTA 2DXDA 2BEFA 2V94A 2EI5A 4ZPVR 2PSZA 4IRCA 3FGVA 4LT6A 5KT3A 2A0FB 2MZJA 1JNRB 2HVDA 3BO2A 2LQ8A 4KHRA 2GFFA 1S12A 4YHHF 4YOEA 1VQ4S 1Q0NA 3EDRB 5DGAA 3PX6A 4FXVA 4F4YA 3V6JA 4DCPB 1P27B 2R8KA 2HWTA 2ZH5A 2VG6A 5KFPA 2QO3A 4DFPA 5AXMA 2UV8A 3UD4P 1SIWB 2P6SA 3MUTP 4DQPA 3S7RA 2QIFA 3W64A 1R3NA 1EETB 3W7BA 4DZ6A 1UFKA 9RUBA 3PV8A 1I51B 2AZ1A 4OI4A 2PA8D 4U8VA 1BWEA 2CJXB 1WC4A 3E51A 1ULRA 2PDAA 2DGOA 1RHKB 3BV8A 4QR0A 3DM2B 1B4SA 1D8ZA 3TEGA 2WSCC 1YZ7A 4WP9A 1C0UB 3DFEA 1F5AA 4LFCJ 2N3LA 4DPXA 2Y3YA 2XI3A 4HT7A 3I55S 2RU9A 1FJGJ 3OSPA 1HPZB 4DU7A 3FFIB 3Q8RB 1S10A 2FHMA 3FCVA 2ZZTA 1XR6A 4C2MA 2LEPA 3I5BA 3T1HF 1T3OA 3SMZA 2C28A 4C0BA 2DHSA 2EEYA 3BF4A 3CDUA 3LANA 1J5OA 1FT8A 1WSVA 2KT2A 2R2UA 3MR2A 4TY8B 4PWWA 1Q8IA 3NL0A 3NGRA 3ZZZA 4D3HA 4DR5J 3W1YC 3M1VB 3U7JA 1RT5A 3FSXA 3BJYA 4LF9J 3GYGA 4LF2A 4ZVPB 3ILLA 3TANA 1NB7A 4TXSA 2RT3A 3FNNA 4GMKA 3QO9B 2KXHA 4J9NA 5ETLA 2JNJA 1VR6A 5HLFB 1RWKB 5IC4B 1UPMB 4ZHRB 3EE3A 4EBDA 4HH0A 1ZPVA 1RADB 1XEZA 3MPUB 4YR2A 1EIYB 2EFQA 5K8MA 4OZ3A 1FVQA 3D3CJ 5E7OB 3JSBA 3FQKA 3IS9A 4P74A 3KLVA 1I3OB 4KH1B 3OLBA 2ASJA 1U26A 1S5ZA 4X66F 3G6YA 1B64A 2XY5A 4HR2A 4L75A 5KFXA 1IN0A 4LBHA 4C7QA 4DJBA 1WG4A 4R5PA 2E9RX 1N0VC 1HQEA 5I42A 2DGUA 4B9SA 1R0AA 2V8PA 2XSJA 4CLWA 3GIKA 4NXNJ 1NHVA 4JV1A 5ADZA 4OL8A 4C9DA 1NSKL 1R0BG 2X1GA 3DHWC 1YTYA 3AA8A 3VVUA 2XTJP 3AOBA 2YNGB 2IAJB 5BYQA 3MM5A 4IG3A 2RHQB 2AKWB 1RTHB 2CG8A 3A13A 3GJRB 5IT0A 1HNXJ 3JAMY 1S7IA 1SH3A 4KBIA 2V5HG 3TOQA 4Q0BA 5E2QA 4DR3F 1XNRF 2HSEB 3QT5A 1LFPA 3CPWR 2DNOA 4DSFA 1YJVA 3BN4A 2FLOA 4P2SA 1CBKA 1Y3KA 1GMWA 4NLSA 4P7VA 4QPXA 3EPIA 3W65A 2AWZA 1ZTTA 3KMSA 2RB7A 4RW7B 4AUKA 1K44A 2YKQA 3EXCX 3L09A 4X64J 4O4GA 2Z8QA 1U48A 1VQ6S 2FHJD 1KQFB 3W8GA 4K2JA 1FERA 1RA7A 4IOCQ 3O8WA 1N4LA 1TV6A 4M5LA 1H38A 3QNWB 4ZK7M 5KFHA 1GTEA 2CKWA 5LT5A 4O44B 4IFVA 5LM7E 2KFYA 1XK8A 1GNKA 4WJBA 2ZH8A 1NK5A 4MYUA 1WEZA 4F2RA 5IV4A 2NXCA 1N6QB 3HFZB 1HYSA 3J7ZT 3C6TB 5F9LA 1PSDA 1E6VB 1T9UA 4FVMA 5T7LB 1FRIA 3G96A 4WF9Q 5A6PA 1VQPS 4H4KC 3B82A 3HHEA 4O3OA 1VRUA 2MLZA 4L3KA 1ZAXA 5B0EA 2UU9J 2LXUA 3BR8A 4YB5A 3JTPA 4CLZA 3G8TA 4HKQA 4BWJA 4PUOA 2L48A 2AJ0A 1RT1A 2UZAA 5E5NA 3HI9A 4LBIA 5IQ6A 1FRHA 1LQ9A 4PG5A 4IFYA 1NDCA 5DLGA 1RYRA 2ZH3A 5E3AA 2BKNA 4Q43A 3A8IA 1R0AB 1X4AA 5JXSA 5GAEU 3PYEA 2EK6A 5HP1B 4OZ0A 2MKCA 4OJ3A 2VIHA 4BLGA 3OW2R 3GFZA 5LMUJ 2QC3A 3ISND 1PG5B 3IRWP 1Q1KA 3I0RB 4A8WA 1PGZA 4NXMJ 2MKKA 3B54A 1OJ4A 4TKTA 1S6UA 4Y34A 3SIPB 5A2QU 3KLHB 1D1UA 3LP2B 3W2VA 1BC6A 2F8EX 2NUUG 4J9KA 1GT8A 3MFIA 4MH8A 5I3UA 1NB2A 2NUHA 3TA1A 3C15B 4K4SA 4NWBA 1S9GA 3D6MB 5BR8J 4JI4J 3CCVS 5FLXY 2WK4A 1RAHB 3HHDA 4OYZA 1QVGR 1AZSB 2XZWA 3KLHA 1N36F 2QA4G 1WOOA 2ZDOA 4M5MA 4LRFA 2VA2A 2B4UA 1TL1A 3Q8QB 1RE1B 2IJNA 4KPYA 4OX9F 3QZ8A 4AL6A 3NMAA 4ZPAA 4DR4J 1X5SA 2MTLA 2QG9B 3JYTB 4LSZB 3MR5A 1HNIB 3OPKA 1MWYA 2NCKL 4CWBA 3W3SA 3FC9A 4QW9A 2CPIA 3I87A 1RA6A 2VHGA 2J8SA 1KQGB 3HVTA 3PACA 4NYPA 2PEHA 5E33A 4MKAA 2XQCA 4NYZA 5E3PA 5AXLA 1RT7B 4LBPA 3W63A 2WZ1A 1WC0A 5JMNA 1TKZB 1M5HA 1C0TB 2HQIA 3H0PA 3M2UA 4QW8A 3DMJA 1REGX 3DLGA 3C6TA 2GV1A 4ZVEA 2R8JA 1UVIA 3BO3A 2BE9B 2FLNA 3WQPA 1YQHA 4LRBA 1W7WA 3IRXA 5CYJA 3THPA 4KSEB 2BXJA 3OSNA 1XNQJ 2OPRA 3KNGA 3G6XA 4UZCA 1CVJA 1HMVA 1BY9A 1RAEB 3HKWA 3A1YG 4OI1A 3UN2A 1JKHA 2FJDB 4EUVA 1PJ6A 1PBAA 3LO3A 3MR6A 4J9QA 4IRKA 4N76A 2XMVA 4DG1A 3HP6A 3H8YA 4JI8F 1WACA 4WE1B 2DHHA 3HT3A 3H5SA 2JFKA 2JLEA 1CPZA 4J90A 2WB1D 4PKDB 1MWZA 1SBRA 1UWBB 2XLKA 2FJWA 1QVFR 4TY9A 3HT0A 4RNHA 4TLRA 4E8UA 3NGKA 3UI3A 4DLEA 3NNHA 2GMJA 2HWIA 2KTQA 3POTB 2X3DA 3BGFA 5THWA 1CG2A 3ISNC 3H4BA 5D4NA 3TAQA 2B5JA 2JDJA 4K5RA 1U1QA 3AB2B 3FRYA 3SSSA 3JS9A 5CD4H 3PFOA 3D6FB 4WP3A 3PW2A 5DO2A 1S6QA 2WSFC 3CD0A 4LSLA 2G0CA 5D3GB 1R6VA 3HZEA 2E66A 2E1PA 4Q44A 1VGYA 4XIUA 4MMOA 5DDQC 1PCAA 3NG8A 1OY9A 3BBBA 1SKUB 3N6NA 4Q5VA 3QJJA 3JQKA 3TUPA 2Y1LB 3CJ3A 3RB0A 2J6UA 4I68A 1SQGA 4U8YA 4J9UE 5KG7A 2GGPB 4RW8B 4ZVGA 2QE5A 2J9CA 2YBVA 5FD1A 4I2QB 3T3FA 4FXWA 2ROGA 2GQCA 2QSWA 1WOSA 2CPHA 3CSKA 4IH6A 4LFAF 3R2CJ 3VAFA 4LIRA 5JVGQ 2F4VF 4RKUC 1SC6A 4BBYA 1U4BA 1EAYC 3IGVA 2NZCA 2DNRA 5MLCV 2KFNA 2W8LA 2D9PA 5A2QY 3HKZD 2F65A 2YWWA 2ZH6A 3IWNC 4DV5J 3QGHA 3V6DA 3UR0A 1H2VZ 3UNYA 4E98A 2LA6A 4NLRA 2D74B 3I4HX 2OIHA 3FMWA 4X84A 3BGOP 2YH0A 1JJCB 4GKKF 1P9QC 3CJ0A 1TL4A 2FVRA 2JEJA 2HWHA 1R31A 3NRBA 3FQLA 2PD1A 3GCWP 3OTOF 3BBFA 1HWKA 3PG9A 7FDRA 3CNQP 3RW7A 3UCGA 2ZJQQ 2JX2A 3AY0A 3OR1B 1JLBA 1L3UA 4QYZK 2NXJA 1YGYA 3PYDA 1CJVB 1YBTA 1HBNB 3EXYA 1NK6A 1TZ0A 3QGPA 2HKEA 4LSLB 4URSA 4CYUB 3RRKA 2E5GA 4IG3B 4AL7A 2B8QA 3WC2A 5HROA 2LDIA 4HEA9 3HD2A 5ETPA 1S76D 3G9CA 3WZ0A 1NPRA 5F8IA 2XMKA 1RTDB 3H4DA 1UTAA 3PEHA 2Q43A 2YKOA 2YKNB 1V5VA 1H7WA 2XWYA 3KKFA 5L39A 4KHPF 1CJVA 3CCES 3CMES 2VBZA 4DL6A 1ZM3A 1LXNA 2YKMB 1KDNA 4BCAA 3DLBA 4LMZA 2FHOB 2UXBF 3KHRA 4UQGA 1HR0F 4DSKA 2FVSA 2XS7A 3PKMA 1FCAA 4DFKA 1M5OC 1U8SA 2CJBA 5H9EK 2M7SA 4GVBA 5A8WB 1CJTA 1S6OA 1IWAA 1U2RA 1YJ7A 2I5JA 5JVHQ 4IKAA 4PEOA 3NCQA 5KOWA 4ZHRA 4IOAQ 4DF4A 4PG6A 2DHGA 4U7UK 4I1TA 1OY8A 1WC1A 3KG0A 3M2VB 1T9VA 4AD6A 4UUWA 4OYBA 5K9FA 2ZD1B 3KHLA 2RILA 1Y11A 3J7A1 1S0OA 1NH7A 5FDLB 3W5XA 1K1QA 1RBOB 3GTYX 4Q2LA 3KOAA 2PE8A 1TKZA 2LCWA 3H20A 5CD4A 1KD1T 1T03B 3H2UB 2HW3A 3DLEB 1ZAWA 4LJMA 4RZRA 1F2GA 4DL0C 2RRNA 3LWMA 2DR8A 2HFSA 2W9BA 3RR7A 3MD1A 4MKYA 1TP7A 4CO0A 1UAWA 3SYZA 1T3NA 4N41A 2ZM6F 1OQ6A 3DYAB 2KI2A 3SCLE 1AXQA 4FPIA 5F0UA 1FXRA 2AJ1A 3BKFA 6FD1A 1H73A 2YNHA 3MMAA 5ETMA 4FYWB 4ER8A 2KG0A 3C3LA 3DGVA 1AW0A 2HNDB 5KFCA 4O0NA 4NCGA 3KTQA 2ZD1A 2XCPA 5J1NA 1QTMA 3VVTA 5ETNA 5FDLA 3T9ZA 5H9FK 2AEMA 4NZ6A 5KFSA 2WOMA 4QWAA 4RNMA 2DISA 3B4DA 2NSBA 3CULA 2FHJA 3C16B 1JJHA 5KFZA 4ENOA 4ES3A 3CMQA 2W9CA 1SJQA 5BJRA 3Q2TC 1O8BA 2DRAA 4OYOA 2HVHA 4K5SA 2CUYA 3KDOA 1GK8A 4PYAA 3NOGA 1OSCA 2CQBA 3X1LB 3M2RA 3CO0P 4DV4J 4O3NA 3MAAB 4MK8A 3W2VB 1RHQB 1F2HA 2CFXA 4WK3A 4ETXA 1GMVA 5A8WA 2FD2A 1BE4A 2VDHA 1KRPA 1QUPA 2HFNA 3DNCA 1WKLA 3HVAA 4HACB 4J9RA 5F0WA 3EGZA 3MMCA 3UWTA 4WU2A 4DV4F 2AIRB 4JI2F 1U47A 4K0KJ 3FDSA 1K8AT 2J9DA 4P52A 2HVZA 4WE1A 4PR6A 1QLNA 4IDKB 2IDEA 3UN3A 3N01A 5ETOA 3KLIA 1YZ6A 3ENVA 3OVAA 4Y3CA 5KFNA 1RT1B 3GIRA 5C42A 4JBCA 5LXYA 3PEJA 1RSCA 3BKTA 4P10A 2IVFB 4F0HA 4QR1A 4TU9A 2ASLA 4LUBA 3QAUA 4HH1A 3IA0A 1L3VA 4USMA 2UP1A 3RZAA 2OEJA 5L1IA 3BO4A 2QMXA 5J1EB 2ZITA 2DD8S 4EMDA 3TZYA 4PQUA 1QE1B 1EJ7L 2HQFA 4HDGA 2MEWA 2BJ7A 4MK7A 4OX6A 4GKJJ 5IZHA 2KFZA 3NBPB 2WVFA 1SJ4P 2B4OA 1JNZB 3PY8A 1FRLA 1U45A 2PI4A 5L1LA 1VQOS 1E6YA 3KK3B 3BQ2A 4RLEA 4NL5A 3VGVA 1U1NA 1VC6A 4CCHA 3C16A 2ZUGA 2KT5A 1TAQA 2OTJS 4LFAJ 2R9LA 3GP9A 3KWMA 5J1PA 3LF0A 4ZIWA 1RXOB 2K7KA 2MLXA 2VKZG
chains in the Genus database with same CATH topology
1MMNA 2AX0A 2UUTA 3Q0AA 3K5LA 4K4WA 4ILLA 1DFDA 3M6WA 4DN9A 4JV2A 4I2PB 1SV5B 1IKYA 1U6FA 3I96A 4V19J 2VPWB 5HMXA 4BS2A 5HMZA 1ZETA 1R43A 3CVKA 3MPYA 4USHA 3ENWA 2JLFA 3BSCA 4ICLB 3M32A 3T9NA 2AGOA 3N9UC 1KLMA 4DL4A 5ITHA 4C8OA 3PO5A 1IM4A 4FPRA 1HD0A 3EZUA 2Y1RI 4DF8A 2PA3A 5HN0A 1UEVA 4OMFG 5C42B 2R7RA 3Q24A 4LFCF 1FJGF 1V3ZA 3IN5A 3E01A 3NLCA 1LW2B 4ZMMA 2N4CA 3AQPA 5DG8A 4DLGA 4ED6A 4ED8A 2BQ3A 4XAKA 4FF4A 4A4JA 2NR0A 1KVIA 1HWJA 4OZJA 1H2TZ 4QR2A 4ECWA 3SDEB 4F4KA 4C8ZA 4F4XA 2R4FA 4YQWA 4JI0F 4RBUA 3DRYA 4U7CA 5CZXA 3HHLC 3OXGA 3T5HA 3HVRA 4ED1A 2C22A 5J2QB 5KFVA 1C0UA 2GJIA 4NZ0A 3H5UA 2B3TB 5A0YA 3SV3A 3CD5A 1HNWF 4NCBA 2LLZA 4XDDA 1CEZA 3OR1A 2VG7A 1TFYA 2FY1A 2AYGA 2PT0A 1KR4A 4WZMA 3UCUP 2BDPA 5K14B 3R5CA 1NRKA 2PFFB 1RTHA 5I3QA 3PHEA 1VMBA 4ZPDA 2GC8A 1S4FA 4F4ZA 3QWUA 3CJKB 5KFAA 4EGLA 3KK1A 2ADCA 1MU2B 4IO1A 3JYTA 2P9CA 2KVIA 4G6VB 3VAMA 1LW0B 2HAIA 3BEGB 2M8HA 4K59A 2OPPB 4FF3A 1IBKF 1RQ0A 1N52B 3FRZA 2OPQA 4B9NA 4NZ7A 2GQQA 2ILYA 2XMJA 5IFMA 1DZ5A 2AQ4A 3OL8A 3PX0A 3GV5B 4OIXA 4F3QA 1HQUA 1X9SA 2XMUA 2Y0SD 5GADU 2Y1IA 1X4HA 4ZP6A 3LP2A 2DHXA 2W7OA 2OJ3A 2MZ1A 1R27B 1QE1A 2IC3B 2CJKA 3TW0A 3FCHA 3TP2A 5CCLA 2MXYA 4LQ9A 5AJ3F 2M0GB 4K0KF 2JZ5A 3Q8SB 2XLJA 3O3LA 5K8PA 1TK5A 1FEHA 4LF5F 4TNOA 2ZDPA 2KDOA 3GV8B 4B02A 4XPCA 2B5JB 1WHYA 2RQKA 3DM2A 5DM6Q 4KHMA 4OHZA 4FVCA 2WW8A 4MTPA 1G2EA 1T94A 2B4PA 4KQZA 5L9XA 4DV7F 1YIJS 4QU7A 1VQMS 2ZBIA 5CZVA 1TV6B 2E29A 2QEXS 4O3RA 1N5VA 3DRSB 4J5OA 3SQGB 4ES1A 3CJKA 3AQOA 2U2FA 1ZM2A 5DS7A 2C3OA 1S79A 3LH2S 3M8QA 2IBOA 2VZ9A 2IBKA 1DTQA 3IR6B 3CCUS 2DGWA 2LEAA 4KKOA 2W9CB 3Q2SC 5L38A 4EO6A 2L9WA 4ZLPA 2EFOA 2J9EA 4KO0B 1O51A 4NMLA 1XN9A 5F8HA 2F1FA 3TO8A 3BSAA 3MEEA 4BC9A 2UXCF 1VBZA 4IOBA 3D1QA 4LSNB 5B09A 4HI2A 1JJ2R 4RUHA 1DJ0A 3N0VA 4X4PA 3IG1A 1LV5A 3O1LA 3HJFA 1QAIA 2MQNA 4IYQA 2N82B 2D41A 1QAXA 2XC9A 1FHTA 2DB1A 4RBVA 4ZP8A 4PG7A 3LWLA 2BBEA 4R5PB 4NLTA 2VQEF 1SJRA 4XPEA 4NLDA 3DOLB 2POKA 1X9WA 2HHPA 2K1RA 3I82A 4Y2MA 2M70A 3M2RB 3QYYA 4PXEA 3RU0A 2CG4A 4ZVFA 1IKWB 2C2RA 1RJJA 1LK7A 2VD3A 1WHXA 3ZZYA 3OTDA 1JB0C 3K58A 1SKRA 3O2IA 5IT4A 4EYHB 4XO0A 4NOHA 3TQ1A 5DM7Q 2NREA 2J8AA 3CT9A 2MDAA 2MHEA 5HQ8A 4C8LA 4FF1A 2HNYA 2DK2A 3VAIA 2PGCA 1LOUA 5KT5A 1SXLA 2MZRA 4YB6A 4IQMA 4DUZF 1UJ6A 3FSIA 4FNHA 1HPZA 1LWCB 2B9YA 3RB3A 1VIXA 4KT0C 4B3TF 3H5YA 2J7WA 2DNMA 2HLUA 5IT9Y 2MQQA 4OX7A 2VBWA 4B9UA 4QIEA 1VQLS 2A2DA 1FRJA 3PRDA 4OFZA 4EZ9A 4IR1A 5T7LA 4RNFA 2ZE2B 4OLOA 1N6QA 5E0OA 4DDFA 1HYSB 5AXNA 1V6HA 5KFMA 3PO4A 4PXCA 4KJIA 2LDYA 2Z2MA 5D4OA 4NX9A 2D3ZA 1B7FA 4JI3F 4NLWA 1YJ9S 4ELTA 4C3MA 1UFWA 1VOMA 1S77D 5CA5A 1XR7A 4MFBA 5DDRC 3F73A 3BDPA 1M5VC 5U47A 3OR2A 1N48A 4H4MA 3OHAA 4ZKAA 4FF2A 1VQSA 1FE4A 3J80Y 1H6KX 4WKRA 3CD6S 3AJ1A 2QLXA 4F25A 3KHHA 2FVCA 4HT5A 4HL9A 5E3RA 1IBMF 2QA1A 2OH2A 3CTRA 2BE2B 4MIWA 3PIPQ 4Q8FA 1M0SA 2M3DA 2WOMB 4K4TA 4LF4F 1J2VA 5IXUA 1TK8A 1VI7A 3PM9A 3GIJA 4WZQA 2LXIA 3HLUA 4C4WA 3GV7B 4OHXA 2JSXA 3DN9A 4F3MA 6FDRA 2HHTA 3BSOA 4R0EA 5KG3A 1R8PA 5CYMB 5KT2A 3GR1A 4F4WA 4X64F 2IFXA 4FN5A 4UY85 4QWBA 2HGNA 4Y6IA 1FKAF 2LYVA 2YNFA 4AQYF 2VFVA 3PX4A 3UR3C 3LALA 3THTA 1RT2B 3M9OB 3OTEA 5A8KB 2ZKTA 3CXCR 1VQ5S 2HHHF 3T6JA 3R5DA 1VC0A 3DLJA 1KVJA 2XSFA 3B78A 2FB0A 4ZPTR 3TUIC 4OZ5A 5LJ3Y 1FTCA 1NKEA 2FJXA 3NWGA 4H4MB 4OZLA 2P5VA 4W90B 1FKOA 1UMJA 2CQ4A 3JSYA 2YNHB 3MF5A 1OO0B 2QFJA 4WTYA 5M2UA 2F3JA 3H98A 3IWXA 5GAGI 2LEBA 4N5SA 4A48A 1N56A 2CPEA 2YQ3A 2J0QD 1WI8A 3RW6A 1N33F 4LF6F 1RT4A 4ZCKA 3N28A 2XHWA 1T03A 3DLKA 4A8XA 4QJVA 2VH7A 3CCMS 2IM0A 2VBYA 1BQXA 2DJWA 5GAEI 1RK8A 4A47A 3MXHP 2YKNA 2A10A 2K3KA 4DL7A 2VB6A 1EETA 3GQCA 3VAHA 1OQ3A 2P9EA 2BE2A 2GJ2A 4HTIA 5BR8F 4JI4F 2W7PA 4KAIA 3G8QA 2R7QA 2HMIB 1UVJA 4HVZA 5DG9A 4X4TA 2Q6BA 4MK9A 3RBEA 1R8BA 2IMOA 3SFGA 4Y2AA 1V9OA 3MM9A 3CB4A 3MOZA 1KTQA 1XMOF 3CIZA 5FIIA 2GCFA 2R7VA 3H5XA 2GX8A 3N79A 1QSSA 4DG1B 2L3MA 3E2EA 3A8EA 3D0HE 2X51A 2M9KA 4KGKA 4LVOP 3SXLA 1X4DA 2FUG9 4YY3F 1U1OA 1N8RT 2KZMA 3Q22A 5HO4A 5HLFA 3V6DB 2J6SA 4R8UA 1N54B 2IM1A 2XNRA 5T14A 1FD2A 4I64A 5M2RA 5CH7B 2ZH4A 3TARA 3CCSS 3KK2B 3C6UA 3OL6A 4C8YA 1XMBA 3MEDA 5A8RB 2YKAA 3DCAA 2C3YA 3OUYA 3RRHA 1YRTA 4K4ZA 3VAJA 2AD9A 3HM9A 1WTFA 1UL3A 1REVA 1MROB 3UCZP 4WFZA 4N77A 1IUJA 1URNA 2MSTA 1FD8A 1RTIA 3DGPA 2DH9A 2MKJA 2MY8A 5E3CA 1JXLA 4DSEA 4F3OA 2CPJA 3T6BA 3IR7B 2CZ4A 4YB1P 4I6AA 1S1TB 2CQHA 4M63A 4FNIA 4PRFA 4FBUA 1IKWA 3R3TA 5EX3A 4GKJF 1Z2LA 3DU5A 5GAHU 4YR0A 4X4NA 1L5UA 1Q78A 3PJWA 1ZAVA 3EPGA 2I38A 5KG6A 4H54A 4H4OA 3CJ2A 5KG4A 5DETA 5F9NA 4NLVA 3U02A 5K14A 4ECRA 5GMKa 5HL7Q 4CH0S 4HTJA 1IBLF 5KFWA 3T1YF 3B4MA 4QYRA 1UJ5A 4IO9Q 4M1KA 2MKHA 2C3UA 1KONA 4U9RA 2GNKA 4N8NA 4RW4B 2EFVA 4RNNA 1NKCA 2N4DA 3ZZPA 1WTBA 1VJWA 1NJWA 4NCAA 4TLQA 3DRRB 2FLLA 1S9EB 2RQ4A 3GG1A 3S01A 3MM8B