4GKKF

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4gkkF00
4B3MF 1G1XA 4DV1F 2KJVA 1IBLF 1HR0F 2E5LF 1IBMF 1XNQF 4JI6F 4JI1F 4JI5F 4DUYF 1CQNA 1J5EF 1FJGF 2YY3A 2ZM6F 2UXDF 4JI7F 4DR1F 1F60B 4JYAF 1G7CB 1QJHA 2RJZA 1HNXF 4DV6F 2B7BB 4JI0F 4JI4F 1XMOF 4LF5F 1HNZF 4X62F 2UXBF 1N36F 1HNWF 1GH8A 4X64F 5BR8F 4DV4F 4DUZF 1N33F 4LF4F 4YHHF 3T1HF 4LF6F 3R3TA 1IJEB 5AJ3F 2J5AA 1IBKF 4DR4F 1CQMA 5IWAF 4LF9F 4DR6F 4DV2F 3ZZPA 4X66F 4DV3F 2UUAF 4JI3F 1VMBA 4YY3F 4AQYF 4LFBF 2UU9F 1IJFB 1XNRF 4B3TF 4DR7F 4GKKF 4DV0F 4DR2F 4DR3F 4GKJF 2BVZA 4JI8F 4JV5F 4LFAF 1N34F 3OTOF 4LF7F 4NXNF 4KHPF 4DV5F 4B3RF 4DR5F 2B7CB 4K0KF 2UUBF 5LMUF 1I94F 2UXCF 2F4VF 2VQFF 2BXJA 4OX9F 2VQEF 4LFCF 4DV7F 1FKAF 4LF8F 4X65F 1XMQF 2KJWA 1LOUA 4JI2F 2UUCF 1B64A 1N32F 4NXMF 4B3SF 5LMNF 3T1YF 1RISA 2HHHF
chains in the Genus database with same CATH superfamily
1HHSA 5E41A 3HO1A 3R1LA 2HVZA 4Y65A 4X4NA 1IWAA 4ZP6A 2DPJA 4NEYA 1J5EF 4HI2A 2XY7A 4C3KA 3JB9k 1WEZA 2Y3YA 1VQ7S 5B0BA 1BGXT 3I5BA 3PW2A 3KJVB 4UF4A 4AL5A 2ILYA 2HFOA 2D69A 2JC1A 2YNIA 4PABA 1N6QB 1K73T 4U95A 1LK7A 3ZO7A 4N76A 2CQ1A 3I5AA 5A8WA 2G2OA 4DPYA 1VMBA 3OVSA 1AROP 3AD9C 5LJ5Y 4NXNF 4N8NA 2RU9A 2F5GA 5C42B 3NGKA 1CJTB 1Z2LA 4RKUC 4PR6A 2AU0A 2B6AA 3AA8A 2VQFF 4NLWA 3IWLA 1IR2A 1YBTA 4FYYB 2HS4A 4LFCF 1XNQJ 3A1YG 1L3KA 4EYHB 4B9NA 5HQMA 3OUYA 2NXEA 4C11B 4I2PA 2N4CA 1J5OB 1E6YA 1GT8A 3RU0A 3MTJA 4X4OA 4YB1P 5MAOA 2AHOB 2WW4A 1PJ7A 2JLGA 2V2KA 1T9YA 2UUAJ 5E3PA 3QRPA 3QPIA 1PILA 1N52B 7FDRA 4J9NA 6FD1A 4LF4J 2FGCA 3NP5A 3M2UA 4AE5A 1AW0A 2KH9A 4LRAA 1JLGA 4M94A 1VQNS 3SQGA 1JK9B 3CJ3A 3LP0B 3R5AA 2J5AA 3S7RA 4F50A 2MGZB 5K8MA 1UCNA 3MM5A 4QWEA 1QAIA 5E3CA 3CNQP 3U1MA 1NK8A 2CG4A 1RB0A 5IQQA 3DNCA 2IBKA 2XZWA 5IM0A 2BA9A 1HWUA 1LEOA 4FS1A 2GCFA 5A76A 3T9NA 3THPA 4C0HA 4C9DA 4H4KA 3JSMB 1KQGB 1APSA 2GZOA 5DQHA 2J6SA 1RHQB 5I3UB 1GXLA 4E0DA 2G13A 4LQ3A 2OO4A 3PFEA 1U1QA 4CT9A 3CCWA 2RB7A 4C8MA 4FF1A 4IYQA 2B4OA 2C2MB 2RVJA 3KLFA 3HMJG 5J2MA 4Y2IA 2DNRA 5ETTA 1RWWB 3DLKB 1W7WA 4ELUA 1R0AA 2EG2A 5GAGI 3TZYA 5LL6d 2WCXA 2ZH4A 2L9NA 3H5UA 2GAHC 4WZMA 3ETMA 5IWAJ 1CS4A 4RW4A 1VQ6S 2KFNA 2NXNA 2JX2A 3PIPQ 3FFIA 4DX8H 4PAAA 1RTHA 4W90B 3MR5A 1S97A 4Q7AA 4Z2XA 4DR6F 3TI0A 1T95A 3PIOQ 3GG1A 1E6VA 2ROEA 4JI8F 3KG4A 4U7UD 1X4AA 1JIHA 5GAEI 1ULRA 1TL4A 3BDEA 3QGPA 3OVAA 4OJ1A 5LMUF 2MB0B 2BMBA 3KK2B 3E3XA 1Q8BA 3BN4A 2IDLA 4DV7F 1WG4A 1ZS6A 4NLQA 4YDXA 2R8IA 2DHSA 3OD2A 4NLOA 2L41A 2PN6A 3H4DA 5IT9U 2VICA 3SDEA 4CO5A 1RZMA 2DCLA 2DXFA 3BGRB 5FIIA 3DRXA 5KT6A 2W4CA 5CZXA 1X4BA 1IKWB 3TNVA 1JLEA 4DFJA 5HP1A 1MWYA 2F7VA 2Y1IA 2GMJA 3E01B 3MCNA 5IC4B 2KRBA 2BOAA 3JQMA 3HSGA 1FX2A 2ZDPA 4F04B 1Q5VA 4CO3A 2G1HA 1RT5A 1Y00A 3KUGA 2ZH2A 2LEBA 1BQMB 1MLAA 2ZDOA 4WBFA 1F5CA 2MQMA 1DZ5A 2H48B 2YNFB 4WYLA 2DNYA 4U9RA 1HR0J 1N88A 1X4CA 1HPZA 1HQUB 2DXDA 3F73A 2LFVA 3HSZA 2PE8A 4LSNA 3QT5A 2CPFA 2DRBA 4RU9A 2BV3A 3TVKA 2VFUA 4TKTA 2FLNA 1KHWA 5C25A 2QGFB 2Z30B 1ZM4A 1WOOA 4RWXA 3PY8A 4EI2A 4ELVA 2RJZA 3I55S 1EQ0A 3T1HJ 2BACA 2MKJA 1BQXA 1YJNS 4LSLA 2QLWA 4RNHA 1SIZA 1NZ8A 1FDBA 1M0SA 3VGVA 3LWMA 2DNHA 5D0GA 4CT8A 2V67A 3QLHA 4QWDA 2D41A 3FCVA 3EPGA 3AFGA 3IRXA 1FRIA 4ER8A 1WF0A 1WEXA 3AXMA 4U7CA 5A0YA 3M2VB 1T3NA 3ET6B 3M9MB 4O3QA 4W98A 1S1XB 1R7IA 3G82A 1M5SA 5HK4A 1PBUA 4AXIA 2A10A 4WK1A 3CCMS 3QT6A 2CQIA 1JMTA 1PJ5A 2GVDA 2HW3A 3MXHP 2LDYA 4TY9A 4O4GB 3PO5A 4O23A 2JVOA 1UJ6A 2DNOA 3JTNA 2BJ3A 4X4PA 1OIAA 4I6WA 1FRKA 2AGOA 3W7BA 2DNLA 2HEKA 1OSDA 3PHEA 3J80U 1KP6A 3OBIA 3H20A 1WDDA 5M2PA 4JB8B 3GMGA 3PACA 2RUGA 5KG0A 1X5SA 2IYIA 2RS8A 2XM3A 1UW9A 5KFFA 4A8YA 2KXNB 3IMQJ 2AEFA 4N5SA 1W2BR 2DHGA 3G6VA 1FDNA 3FDSA 3H7HB 3CCLS 2VFSA 5ITHA 4CWBA 2HNDB 2HVHA 1U0HA 5J1PA 3VWSA 3OSNA 2E5HA 2XMJA 1LXNA 3UD3P 4K5SA 1VOMA 3SEOA 4WJBA 3MAAA 3J7YI 1AZSA 2BX6A 2HRUA 2QL7B 3U02A 1UVJA 3N6NA 2ZUAA 2MQOA 4WF9Q 1Q53A 3TZZA 4DEZA 4DV6F 4RPFA 5J2QA 4U67Q 2ZBCA 2FJVA 2QYCA 1RT4B 3D0HE 1EZZB 3AJDA 4PUOA 1RT6A 3N28A 2JOQA 3CO0P 4IUFA 2OHDA 4QR0A 2YNHB 1IQTA 4B9SA 4ZKAA 4LFBF 3KJFB 2A1BA 5J2PB 1I6JA 1S1UB 4UTGA 1J5EJ 2QO3A 2KKHA 3O44A 3FQKA 4A47A 3OXLA 1LWXA 1NSKL 2UV8A 4P9SA 3IC1A 3N0VA 3IA0A 3GWCA 2V34A 2OELA 2QE5A 1LWFA 4K4VA 1PBAA 1NB2A 4ANCA 1PC4A 4QIVA 4C6AA 2FY8A 2I5JA 5AE1A 1VBKA 2DT9A 4K4YA 2O3DA 2Z2MA 1XIQA 2DITA 3PG9A 2Z2ZA 4ZLPA 2ZH6A 4NZ7A 2AEJA 4A8QA 3M32B 3BQ1A 4LSZB 3CJ8A 4NXNJ 4OYWA 1RWKB 5CA5A 3MPVA 3NXZA 1YZ6A 1W25A 4F0MA 3KLEA 2V4JB 1HI1A 2HNYA 1IWGA 2XHCA 1HL6A 2BANB 1V9OA 1QUPA 5L39A 3CXCR 4K0KJ 3ENAA 2BW2A 2MLZA 3PEJA 3DLGA 1TVRA 4LF7F 5I3PA 1PYOB 1FJ7A 1VIXA 2EVZA 1HI8A 4RNMA 3D1OA 4F25A 2HBQB 4PYAA 3MGJA 3A8KA 1LWCB 3C15A 3AHPA 1XK8A 3PX6A 1JNZB 2CPDA 5KG6A 2HG4A 1M5VC 1IBLF 2DISA 3IR5B 5F8LA 4RWWA 5LXYA 4LR7A 3LGMA 4TU7A 3H5XA 4FP9A 2BBEA 4F67A 1V6HA 4F0KA 4LUBA 2B8PA 1SI9A 4HVZA 4OX8A 2YNIB 2W2OP 2HLUA 4QBUA 4ZVHA 4DV4F 1Q0NA 2V0NA 1RT2A 2VOPA 2YVSA 4PXCA 2K3IA 5A8WB 4YS2A 2JC0A 1HBMB 1A7GE 4OZ2A 3VV2B 3MEDB 1KS2A 4KT0C 1URRA 2ZZTA 1NSPA 4ANEA 2HLTA 4N77A 2OLWA 1PSDA 3Q8UA 2BJDA 2FLOA 5B08A 4QWBA 3QO9A 3K5OA 4B3SJ 3KDOA 5G0RA 1S12A 1CULA 2J7KA 1KLNA 1JNRB 4I2PB 3RBXA 4LF8F 1E6YB 1H2UX 3RGIA 4W92B 2XBPA 2J6UA 3T1YF 4EBEA 3BPSP 1G1XA 3TUIC 3V6DA 2IIHA 3CJRA 4DR6J 3M2RA 1TL1B 3DU6A 3M2UB 3DOLA 5F9NA 5KFGA 1NJZA 5SZTA 4BWMA 1JLGB 5F0UA 4NLVA 4PCQA 3SQGB 4DQPA 4ELTA 3GONA 2VG6B 4DR4J 4DHVA 2VA2A 1HQEA 3QQCD 4OHYA 4F4WA 3MM5B 1UW4A 1S57A 4ZPWR 5KFZA 1SQFA 1C0TA 3T5LA 1HNVA 5IM0B 2K2PA 3W8GA 1R43A 1RHRB 5HBMB 2OD4A 1N54B 1F6TA 5E3QA 2HWIA 4UUWA 3D9BA 1OPIA 1FK9B 1S7IA 2NYIA 4DOZA 1RWVB 1C1CA 2XULA 4LIRA 5EWEA 2AW0A 4UT4A 3GSDA 1SC4B 3EJMA 1BMQB 4ED0A 3QAUA 4JI2F 4QW9A 1B64A 1RWMB 3RB6A 2GX8A 2OMOA 2HHHF 4JYAJ 3QT7A 3KLFB 5J2MB 2EFNA 4BCAA 3ITHA 2LECA 1R0AB 4OZLA 3VAMA 3E2EA 4CLYA 3GFHA 4WFYA 2VBZA 3C6UA 1RUSA 4Q0BA 3PYGA 5M2RA 5HVGA 2HHUA 4RW4B 3SCLE 2YH0A 4KSEB 3LP2A 3FFIB 1RTHB 4P75A 1XN9A 1I51B 4K5RA 2DTJA 2R2TA 1E6VB 3ILJA 1TL5A 4NA3A 1MMNA 2WVFA 1DTTA 2C2NA 2CJKA 2VC0A 4PQAA 1B70B 4PWWA 4DQIA 4KGKA 2DKOB 1XMQJ 2MQ8A 5HLFA 2V5HG 4WIIA 4DCPB 5AT1B 1VRQC 1BD6A 3NCRA 1LOUA 2KZZA 3SDEB 3FMBA 2OPRA 2DR8A 3HPOA 4CLFA 3C3LA 4MH8A 2XCAA 1U6FA 4DQSA 1HYSA 1T9VA 2KVIA 1BHNA 1JLEB 3BBCA 1HIYA 4YHHJ 4RW7A 1H72C 4NI2B 2BJEA 4ED8A 1RYSA 3EGNA 1XR7A 1FJEB 1WHVA 1D9AA 2DRDA 3DDIA 4QIFA 2GNKA 3HF5A 2MYFA 5D3GA 4YUDA 1U47A 4QIWD 3WQPA 3IR6B 4F3OA 1RT5B 4DSLA 1IJFB 5IXUA 1U1OA 1VLOA 3EZ5A 2N7YA 2HHVA 4WP8A 2PMWA 5ETRA 1RP5A 1SCJB 3CMAS 3THTA 3R9LA 2NPIA 2GV1A 1HPZB 2ZEJA 1HA1A 5EX0A 1P1TA 5HJYA 1S79A 4ILMA 2XS7A 4LSNB 5DETA 4R5PA 3AA9A 4NYPA 3MF5A 4URGA 4ZJLA 3W9JA 3TQ1A 5C25B 4DV1F 2KM8C 2H3EB 2DB1A 1FRLA 3CCJS 3DRSA 1S6PA 3HP6A 4ETZA 5KFIA 2Y8WA 2XLJA 4LSLB 4CH7A 3LO3A 2QV6A 2VPZB 1FA0A 2JH3A 1FVSA 1BQNA 4ZJQA 3NOGA 3SSQA 4ECQA 1HNIA 3BBFA 3VQSA 5J1EB 3BH7B 3IRXB 4N47A 4ZVPB 1AB8A 2PO4A 4HL9A 5BXIA 3MEEA 5A0YB 3FBBA 4YR0A 2NSCA 2HGNA 3KMQA 3G82B 4ED4A 4B3RF 2WSCC 2V8PA 1CJKA 3DI6A 4K4TA 4KO0A 1M1GA 1XBWA 1R31A 4MYUA 3R5CA 2MLYA 5A2QY 4J37A 4DV6J 2R2UA 1V5IB 1GMWD 5HL7Q 2GVDB 2AJ1A 4P74A 2NLWA 1X4EA 5F8IA 4S0MA 3VF0B 3WBZA 1HNXJ 3OW2R 2HKEA 2ZOGA 3ZNJ1 2R2SA 2BZ2A 4LFBJ 1F60B 3MPDA 2KT5A 3JXOA 4K4SA 3EUNA 4O0IA 1TR0A 1HBOA 5E7OB 4H54A 2Z58B 4X4UA 4USVA 1GAOA 1VDHA 3QIPB 4HHJA 3LPYA 3UN5A 4C48A 5E2QA 1URNA 2IMWP 1RE1B 2VH7A 4Y2CA 4NCBA 2RH3A 4PG6A 3KG1A 2W7AA 2C2ZB 3BKFA 4N7TA 4OZ0A 2VDHA 2QN6B 5K9FA 3G96A 4DR3F 4GKJF 1R6YA 4WFAQ 5DDPC 3OTOF 1JLBA 4TY8A 5BYSA 3GFYA 5HAOA 1REVA 2QG9B 4F7VA 1NKCA 2ASDA 4Y34A 3QYYA 2QC3A 4JI6J 1ZPVA 2K06A 2P9CA 3W2WA 3OVBA 3MAAB 4CO1A 3CIMA 5LMNF 4FXDA 1A0OB 3KTQA 1IM6A 1HD1A 3HHLB 4LREA 3DRYA 3K2YA 2H65B 1N36J 3H5YA 5J2QB 1NHUA 5EUHA 2E9ZA 3H0PA 1FESA 4RW9A 4PUOB 2AYBA 3D5MA 1RT6B 4DN0A 1N56A 3I32A 3CF5Q 4DSKA 1KFSA 3TVZA 3G6YA 3B6BA 4PYDA 2KFZA 1FO1A 1RI7A 3Q8QB 3NBPA 2A2CA 4M63A 4HT7A 1FD2A 2O67A 2M88A 5IFMA 2MHNA 1IBLJ 1IXKA 3J7ZT 2NQPA 4CO0A 1FTCA 1CJUA 3PW4A 2B7CB 1ZAXA 4LIWA 2C42A 4NLPA 1NM2A 5K14A 1IKYB 1LWFB 3ENVA 2Z57B 2V63A 2ABYA 2M70A 2B5JA 4DUYJ 5EGYA 1RT7A 3L09A 3ZZ0A 1WWHA 2I5JB 2EK1A 1TL3A 4YDDB 5KT5A 3IXQA 1S0OA 1JLQA 3PCOB 2K1RA 2EG1A 3A3NB 2OTJS 3NAIA 3EE3A 3KK1A 2MHEA 2GQ2A 2PMZD 4XTTA 4IDKA 2OIHA 2DO4A 2IM2A 3DXBA 3KLEB 2HNYB 2IVYA 2LYVA 3HFVA 2UXBF 1XTZA 2M8DB 1NEEA 4UQGA 2X51A 3LANA 1D9FA 3TWZA 1P6TA 1T0TV 5E3AA 2GMLA 2XY6A 1NAQA 3DLGB 2WAQD 4USUA 1TVRB 3AB4B 4DCOB 3M8SA 4NCGA 1DAXA 1UWBA 4DR5F 2CFXA 3C15B 1L3VA 2IC3A 3H8YA 1UJ5A 4M5DA 3H42A 1VISA 2EBGA 2AKWB 2ZC3A 2ZHOA 2P9GA 3MMBA 2RDJA 4HEA9 2RSQA 3KLHA 1RCOB 4A8OA 3QWUA 1T9UA 4I4BA 2XWYA 2B3TB 3D3BJ 2YH1A 1WELA 2F1FA 4QIGA 1VQPS 1V3SA 2XGPA 4YOEA 3GLJA 4ZIVA 1BXNA 1IQZA 3JTOA 2F8EX 2RDIA 1RT2B 3V5RA 4OIXA 4IH5A 1WSVA 3PM9A 2FHJA 2W7PA 2HHQA 2HK2A 4KHMA 2BJ9A 1WNEA 4Q2LA 4USMA 4JI2J 2BRKA 2JEFA 4CH1A 1UZDA 1X60A 2HHHJ 1KQKA 5A8RA 3NKYA 3NWGA 3QO9B 2AIRB 2FZGB 2I0XA 3VTIA 5G0RB 4X65J 4WK3A 1PG5B 1NK9A 4Q5VA 5BJRA 4B9LA 2IJFA 5LJ3Y 3C8YA 2DH9A 1YITS 1T03A 3V6DB 1WUUA 2Y1LB 4XDCA 4FPRA 3QBCA 1TP7A 1UP1A 1OO0B 2RD5C 4FN5A 3T41A 1U4BA 1BWEA 2JDJA 1XC9A 3THVA 2FVSA 1TKZB 3RR7A 3M2RB 2XYGB 3DOLB 2IAJA 3VGUA 4MKYA 3VGTA 1NBEB 4EBDA 3BKUA 2POKA 4ZLLA 4I64A 4R25A 1MMLA 3AOAA 1HQEB 4TQRA 4DCJB 2Q1LA 2VHGA 4ZVFA 1C0TB 1TV6B 3PRDA 2KHCA 2FC9A 5U47A 1IJEB 2WBRA 4CLPA 5I4MA 2CVEA 2ZC4A 1GMUA 3HZGA 3IFEA 2HFZA 4Z7CA 2WHOA 5C5JA 2N3LA 1C1CB 2KL8A 1H38A 2F63A 1TK0A 3NNHA 1NHVA 5DG7A 2HVDA 3TUJC 1LQ9A 3MR7A 2BXJA 2R4FA 3TZXA 3SFUA 4B3OA 2FGOA 4PEOA 2RRAA 3MEGA 4JI7J 2W9AA 4RW6A 3ITHB 1SKRA 1IR0A 4RL1A 1X0FA 2Y1JA 5I42A 2MQQA 3AY0A 5ETOA 4R8UA 4U96A 4XK8C 3HJVA 4Q0BB 6AT1B 4B9MA 2DGOA 2ZITA 1DTQB 3LP2B 4I56A 5LT5A 2W4DA 2BJ7A 3V6KA 4ZK7M 4OQJA 1FCAA 3GV7B 1DTTB 1YRUA 4HDHA 3K5LA 5EWGA 3GFXA 3U1LA 4TYBA 4DV1J 2XS2A 2GO8A 2BVZA 5GVQA 4DQRA 4C8LA 3SI8A 4ZVTB 2X3GA 4DPUA 2ZKUA 1UJ4A 2V4RA 1BY9A 3MUMP 1VGYA 1UAWA 4TLQA 2PMHA 4USKA 2IVMA 2Y0SD 5EHHA 1FEHA 2DGVA 2G1DA 4Y28C 1VQYA 4LBIA 5KOXA 2BKOA 3I5CA 4E98A 4G1QA 4TNOA 3M8RA 1HYSB 5DS7A 4JI1F 2IFXA 3AT1B 4DL5A 4RW7B 3NEKA 4NLXA 3MCMA 1RWPB 1KR4A 3H25A 1F2GA 2ZOMA 2FD2A 4C3LA 5CCMA 2Q3PA 4A46A 5D3GB 1J2VA 1Q78A 4OHXA 4Y2AA 3J7Z5 3JAMY 2BQRA 4K7QA 3RBDA 4KFBA 1KVKA 4DI6A 1UFLA 4A8XA 4B9VA 2OJ3A 4GC7A 2B51A 4MJKA 1RCXB 4J9VA 4R5PB 1VQ9S 4DU8A 1J5OA 3K59A 1FD8A 1BWVA 3FBFA 2QMXA 2HBRB 3UD4P 2HHPA 3DRSB 4AUKA 1S6PB 3HHEA 1Y9OA 1OJ4A 1AFJA 1QDUB 1KKHA 3IM8A 4DX7A 4IKAA 4JI5F 2H51B 1XEZA 2DY9A 3C16B 4PQUA 2LQ5A 4R0JA 2J9CA 1BQNB 4DR3J 1Z1ZA 4I6YA 2R7VA 3M05A 4KRWA 3R2CJ 1JLFA 5ETSA 3LP0A 2HK3A 2NXUA 3TVYA 4J9UE 5BYRA 2MXYA 2MGZA 4NL5A 3FMWA 3A8JA 2UU9J 2QA4G 3PX0A 1H0HB 2HNZA 1F9EB 1SB6A 3NS7B 2CNKB 4J9PA 3BKTA 4KB7A 1GK8A 1NH8A 1U49A 7AT1B 2Z2LA 2QL5B 1CJKB 5KOWA 5CYMB 3T19A 3JS9A 2OAUA 2YKOA 3DI6B 5E33A 2YX1A 4KO0B 3JSMA 3DGVA 4AD6A 2XLIA 4ZPVR 1FWPA 4UZCA 2AYGA 3TRGA 4DL0C 4NYOA 3BDPA 4KYZA 3KDNA 2MDAA 3IGNA 3A3OB 1UVLA 2PC6A 1S9EB 4ZVOB 3TX8A 1IKVB 2AYEA 3ISND 3LUYA 3KUHA 2CAJA 1RDRA 5DG9A 2F4FA 1ZTWA 2KXHA 1XNQF 2PD1A 1HBOB 5JMNA 3DYAB 1LW2A 4LRBA 1YI2S 1RWUA 3HCXA 5L8RC 3RBZA 1B3TA 4DPOA 3B78A 3NGDA 5IOLA 4JI4F 2CQ0A 2E7WA 2YWHA 2AJQA 4LF4F 1VRTA 5KG1A 2X1AA 3GSIA 3CCES 4P6QA 3D66A 4YQWA 1CLFA 1NPKA 4ED7A 4USIA 3GCWP 3HZEA 2BRLA 3EDQB 3VGSA 2F4VJ 3CB4A 4TY8B 2XEXA 1REVB 1M5KC 3PVXA 3O2IA 4ZP9A 1VC5A 1X4DA 3W2WB 2FVQA 2DGXA 4X4QA 2L3MA 4DFKA 2GAGC 1TQLA 3CSKA 4DR1J 2IVFB 3D6HB 2YKNA 1VQSA 1EETA 1TKXB 2CQBA 1KVIA 1IKWA 3ILIA 2HWTA 4RW9B 2OPSB 3V4MA 5DRKA 1JJ4A 2QA4S 1S6OA 2C3YA 3TOQA 2NYHA 2FDNA 2MZJA 3ELHA 2I6WA 2XMMA 1ZA2B 1U25A 4EZ9A 3NBPB 2PSZA 4AQYJ 2ATCB 1IM4A 1FRHA 1U1NA 1SKUB 5AXLA 4DR7J 1OY8A 1H2VZ 3OFHA 2JL9A 3PZPA 1U48A 1CJUB 5IWAF 2PIIA 1QE1B 2YKPA 3H90A 3WX4A 3CCTA 5F8NA 4I2QA 5AE3A 2M7SA 1HQUA 3CDWA 4LF1A 3UFCX 2B5JB 2ZVSA 1T8EA 4DUTA 1B7YB 5KFXA 3AOCA 4LR9A 1VQ8S 3QSIA 2C2RA 4ECZA 3H59A 1RT7B 4CRJA 4L73A 1KEKA 2OPPA 1AT1B 2PEBA 5HI7A 1TL3B 4NOHA 1Y3JA 1FJGJ 1U6ZA 3QGIA 1JLQB 1UA1A 3PV8A 2K7KA 2ZJPQ 4RNOA 1B0TA 4IDKB 3OTBA 2GFFA 4KGMA 2DNNA 1JQGA 4GO7X 2BR0A 2YWEA 3I0RA 4KTQA 3UDVA 4U8VA 4B17A 1NDPA 1DJ0A 4DF4A 2U1AA 2UV8G 1R8AA 4YB7A 3MD3A 4LF9J 2ZJQQ 3RB3A 2ZOFA 2EC0A 4NCGB 3M2VA 1U8SA 3QAEA 2RNEA 3WIVA 3O8WA 2ILZA 1UWBB 2CVIA 1ZAVA 2FHOB 2J76E 2AJ2A 4KHPF 2ROPA 2ZH7A 1VC0A 1VQLS 3VVUA 2W2NP 4NXMJ 4UY8T 4XPEA 5L46A 3GYGA 1SH3A 3B8HA 1X4HA 3MMBB 1AFIA 4XAKA 2XNQA 3M1VB 3TA0A 1SQEA 2ZM6J 3L3CA 5KFCA 1HR0F 3GFZA 4UOCA 1HNZJ 1FNXH 4K4WA 4ERDA 2R7UA 1ZH5A 2LXIA 1WD6A 1UWAA 1WTFA 9ATCB 4FDFA 3TQEA 4DG1B 2HZVA 1Q1KA 2AWZA 2JZ5A 1M1HA 2KM8B 2RRBA 3NNAA 3GV5B 3T1HF 4IOAQ 3IGVA 2P6SA 2YQ0A 2PI5A 4CYUB 2CDRB 5B0EA 4WE1A 2VBXA 3Q8VA 4BLGA 1KTQA 1U1PA 2ZH5A 3HM9A 1YK9A 4ZLNA 2FIUA 3ENWA 1T03B 3NWRA 2ZE2A 4IFVA 3KOAA 1KWMA 2X1FA 3OL7A 1IVZA 1PIEA 2OTLS 5DQGA 4PWDA 3IG1B 5I3QA 1NK6A 3QZ8A 2IAJB 2IY5B 3HI9A 1YX2A 4ZVGA 2BW7A 3ZFVA 1S1WA 2HBYB 2Z8QA 2RQMA 2BOPA 2WZ1A 2LA6A 4CLLA 3EGWB 4IOCQ 1D1UA 3KJNB 2CQGA 3VZHA 5KG5A 4PXDA 2XMTA 5A2QU 3D68A 2CPIA 3MHYA 1NDCA 2AV5A 1VK3A 2GJIA 2F8HA 1SUQB 2YWGA 4RW8A 4N56A 3MPWA 3BEGB 1FEEA 1S1UA 1YQHA 3DGPB 4J9KA 1R8BA 4FYWB 1P9QC 1X0PA 2DD8S 3PKMA 1VIOA 2F8MA 2R9LA 1TK5A 3CD0A 1IBCB 1S1VB 2W1BA 2QIFA 3DDKA 4JI1J 1DY3A 3IR7B 4NRUA 3MFHA 3CJSA 4KV8B 4PKDB 1HWJA 1CJVA 3RZAA 1HMVA 2Z56B 1PAEX 4BBYA 3IM9A 3UCUP 3I9V9 2GGPA 4M5JA 3CC7S 2VFRA 4R8UB 3KFWX 4QYZK 1RHJB 8AT1B 3M32A 3J81j 1UETA 4FXWA 1FWLA 3D1QA 3H2UB 4ZCLA 2LLZA 5CQGA 3GZ7A 2PA8D 4YMEA 4R0EA 2MSTA 2VPXB 2IM0A 2HQ3A 4KGZB 2VD3A 5KFEA 3KLVA 2NZCA 1U8WA 5KT3A 1RHKB 4IR9A 2EPIA 4U6PA 3CJ2A 4CO2A 2MKSA 2X1BA 4M5IA 1KBRA 4DZDA 3C6TB 1X4FA 5B0GA 1CEZA 2DHAA 4ES3A 2WW8A 5K5MA 4YN3B 3ZC4A 1MMDA 1L3UA 2ZBQA 1WKKA 4EGLA 1K9MT 3CCSS 1F3VA 1K8AT 2AGPA 5GADU 3N4WA 5DDOC 3M8QB 3DOMA 4URQU 4G1QB 2E1RA 2D3O1 2L08A 3WDOA 4RU2A 2LVWA 4ECXA 4NMXA 5KFNA 3NMRA 2XG8A 1YRXA 4OI2A 2R7QA 3CD6S 3CVKA 1Q82T 2ACMA 1RT3B 1Y4ZB 2OEJA 3I96A 3D7SB 4J91A 3R7NB 1SPBP 4QOTA 3GB0A 4ZPTR 2DYAA 3G86A 3KMSA 3LGNA 2VG7A 1HBMA 3TAPA 2IBOA 4M8LA 1ZTTA 4ECUA 3MEDA 2QRRA 1SJ1A 2DJWA 2RF2A 3M6XA 4USJC 5HJXA 3BR9A 4KFBB 3B4MA 2FHKA 3FRYA 3R5DA 1H7XA 2MKCA 5KFPA 3FEXB 4OZ5A 5CD4A 1TKTA 4YY3F 3OL8A 1XNRF 5GMKa 1B99A 1S5ZA 3QJPA 2OPQA 4RUCA 4ID5A 2NSBA 4G1PA 3MR2A 4Q8FA 4K0KF 3T6JA 2FTRA 1FT8A 5D4OA 3KHLA 4E2FB 5DZ6A 3AH6A 3GIMA 1X31C 4F3QA 4JI4J 3HX9A 2G0IA 3CCVS 3U27A 2C1EB 1NDLA 2LMIA 5GAHU 2G2ZA 1DQ8A 4A8KA 2OP5A 1YVFA 1F0XA 2LU2A 5KFYA 2JEGA 1TL1A 1O5JA 4EEYA 1X9WA 3TUZC 2XZTB 4PQUB 3GIKA 3UDCA 1PGZA 3M8PA 3EPIA 2JLEA 1M5HA 2UXDF 4P72A 3CD5A 2VG6A 1JLFB 2GHPA 2QEXS 1I1GA 1N0VC 1JXEA 3SZ2A 2B7BB 1RHMB 5FJ4A 2V2ZA 3PYFA 4NLRA 5KFTA 2HNZB 3U7JA 3CMES 1N33F 4I1TA 5AXMA 3HHLC 1SL0A 1GMVA 2BABA 3TR5A 2E1MC 4B3TJ 5HBMA 4BC9A 2KYXA 3W60A 1IBKF 2YXLA 1NJIT 3UCZP 1RADB 4EBCA 1FK9A 3CJ5A 2ZH3A 2VC1A 1S4EA 2CJ9A 2OH2A 2E1PA 3TJ9A 3VAJA 3GU0A 3T5KA 1S59A 4OX9J 4LVOP 2QT7A 3T6BA 3QRQA 3X1LB 4QR2A 1RWXB 4BWJA 1OYDA 4CO4A 1F9HA 3DLJA 1RLCL 4L6V3 2R3VA 2MKIA 1YHQS 4B3SF 3TJAA 2RQCA 4Y3CA 5IT0A 2V8HA 2WSEC 3R6LB 2MQPA 1LW2B 5A8KA 1ZZFA 2H4YB 1TUWA 5L1JA 2HHXA 2KFYA 4GRSA 3W9HA 3CJTA 1DHMA 4OZ3A 4YFUA 3IRWP 1B4SA 1VRTB 3BO3A 1F3FA 1RT1A 2YWWA 2GO9A 4QWCA 3MM7A 2FJWA 2CPHA 2HYIB 2YKQA 3J7A1 3DRRB 3CE8A 3IBFB 4DR4F 4C4WA 3ONQA 1CQMA 5G4DA 2IA6A 2KI2A 3OFEA 3VAGA 4DL7A 2VQEJ 2ASYA 2H5EA 3L7PA 3I6PA 3VR1A 2OD6A 4CH0S 2CZVC 3GJSB 3KLIA 3JQKA 1PC5A 2KHDA 2YNGB 1FKAF 3OT9A 3W5XA 2YKNB 2UUCF 1EETB 3HT0A 3MR3A 1F5BA 3UQSA 4C97A 2V8DA 3H2VE 8ATCB 2CRLA 3DMJA 4JOUA 4MFBB 4NI2A 4JYAF 5KG4A 2JLFA 2ALZA 5KTQA 4ZVSB 2Q66A 3M8WA 4KHPJ 3TAMB 3M9NB 1QTMA 2NS1B 2JVRA 2DNGA 3CCQS 2KG1A 4G65A 3GJQB 1VBZA 4CM0A 3F56A 3D6TB 3VCDA 2J8AA 4BDPA 2UVVA 5K20B 2W9CA 1BUXA 2EI5A 3TANA 4I2QB 1U1LA 2LQ8A 3DHXA 2IJNA 2CJQA 1Z2ZA 2DIVA 2C2KB 4K4XA 2OPPB 4F0HA 3CDBA 4MIWA 4P73A 1N8RT 2APOA 4ZP7A 2Y0BB 4ECYA 3ZNUA 3DOKB 1XMQF 4F2SA 1VI7A 3OFFA 1EJ7L 2HFSA 1J27A 1Y5LB 1EKRA 3EWGA 3V81B 4WCEQ 2IA0A 4AXJA 5CHCB 5KFJA 2I1RA 1EP4B 2CQCA 3I0RB 3UVJA 1MWQA 3LF0A 4LF5J 3PW0A 5BR8J 1U7LA 3W61A 1NK5A 2AMCB 3H2LA 4WTOB 2E7VA 5CAAA 1UVMA 3FJ2A 5J1EA 1Q86T 3PEHA 4ILRA 3BPDA 1VJQA 1YKWA 3M6VA 3NRBA 1FDAA 2KVQE 3SV3A 4FBUA 1GTHA 4EO8A 1PO6A 2CPEA 2ZH9A 4ZVRB 1ZA1B 1NLKL 4YHHF 1H6KX 4NASA 2KB2A 5D4NA 1R6VA 4NLTA 4C98A 1OSCA 2CYYA 5T7LB 3V2UC 1S9FA 2G2YA 2VBWA 3G6ES 2HSEB 4P7TA 3H98A 2HFVA 3MM6A 4X84A 2KRRA 4K2JA 3HXMA 2A6MA 1QAYA 3L9ZA 3GJRB 1RKJA 4LQ9A 1UTAA 3IWXA 5F8GA 2QSFA 3JAMU 4DL3A 1I5OB 2QA1A 3VHQA 1TAUA 2WRMA 1HNWJ 3QIPA 3ZTQA 1U1KA 4L3NA 4NX9A 1NPPA 1WC0A 3UR0A 2EFVA 4N8OA 1ZBTA 2XI2A 4V19X 3PDNA 5J2NB 3A13A 2B4UA 3CEDA 4QU7A 3Q8YA 2I38A 4WE1B 4M5NA 2B43A 5K8PA 1R8HA 4TVAB 1H73A 5HMZA 2BYCA 3AB2B 3RRKA 2ZD1A 4A8MP 3OL9A 2J7WA 3CD7A 2XMVA 2CKWA 3GJTB 2V69A 3BSOA 3Q0AA 2ZE2B 2QLBB 1L3TA 4J9MA 4IFVB 3MMJA 4USHA 3LWLA 3UN3A 2L9WA 3JTPA 4GMKA 2UXCF 5E5NA 4PWDB 2F9DA 3FKBA 1Y11A 2JNJA 4DJBA 3Q83A 4CLZA 5C2CA 3HHLA 2OMLA 1S1WB 4X4TA 1TFWA 4RZRA 4WU3A 2I8EA 2CADA 2FYXA 2LXFA 2OFGX 1WORA 2E5LF 2R8HA 4PG5A 1BE4A 2RKIB 1P9YA 3BGOP 4KY3A 2NR0A 2DGWA 3TUPA 4OYPA 4X64J 3HULA 4K59A 2RDDA 4RUHA 2R8KA 1L5UA 4ITSA 1HNXF 2HURA 4RW8B 1C4AA 2G0CA 4UW2A 4UUXA 2YKMA 4DU7A 5JUMA 1EKSA 2HAFA 5JVGQ 4LRFA 1ROFA 3VAHA 3AOBA 3SFGA 4ZPDA 4NEZA 5T14A 2W25A 2GIQA 1CSJA 4CQ1A 3J81Y 2NUHA 5KFQA 4HH0A 4J9RA 1K44A 3AD7C 3HKWA 4FPIA 1IKYA 3IN5A 3TARA 4DSFA 2PDAA 1CJVB 2A3JA 1HMVB 5KFWA 4LVNP 2ADBA 5F41A 2NZ4A 1HW9A 4CI0B 1CC8A 2GGPB 1HD0A 5IZHA 1A9NB 4HH1A 1SIWB 4J7CA 4F4ZA 1FJCA 4OI0A 5KG3A 1JLCA 5HROA 5GMEA 2RHSB 3K8WA 5DM7Q 2COLA 3D6FB 3L7OA 3P96A 2VASA 2ZVIA 4JI6F 3VAFA 2BKNA 1CQNA 1YBAA 3UI3A 3WIUA 4YY3J 1XNRJ 4WP3A 3OR2A 2HBZB 3QFHA 4Q43A 1G7CB 3JQJA 4BC7A 3Q8RB 3CGIA 1VS3A 4LR8A 5A6WA 1T7PA 1N36F 4RBUA 4OMFG 2IHR1 4CTAA 1EB0A 1S6UA 5D6GA 4DPXA 1T9XA 2RRNA 1JLAA 4HI1A 3I4PA 2NUUG 3BO2A 4DPTA 1RJJA 4LFAJ 2VJVA 2BEFA 2ZBPA 1RTIA 4TU8A 1YSJA 3TW0A 4F4YA 5KFVA 3RRGA 3U1NA 3MECA 2UXDJ 4EUVA 5FD1A 5KFOA 3DOMB 4USWA 4NLGA 3BQ0A 3DLEB 5GAGU 3BYPA 1NJYA 2ZWOA 3SXLA 3KK3A 1N33J 3R2DJ 5DJBA 1YJTA 1Q7LB 2HRYA 1IBKJ 4DUYF 1VR6A 1NKEA 3EZUA 1N5VA 4NA2A 4DDFA 1NPRA 3H4BA 3CW2C 3QATA 4EZ6A 2VG7B 4CIOA 4DUZJ 4GVLA 1WC4A 5GAEU 2CPYA 2VA3A 3AJ1A 4Y00A 1RABB 4FYDA 2RF2B 2BE2B 2A6OA 3F44A 4ANDA 3KLGA 4JI3J 1NNDA 5HQ8A 2F65A 1UEKA 3NG8A 4OL8A 3M8ZA 1TKTB 4JV2A 2RUSA 1ZOTA 1NJWA 4AT1B 4ZCKA 2N3OA 4KBIA 1Q7YT 1WC6A 4KC5A 2OPQB 3LAKA 4ID5B 2ZNYA 2G9OA 3CMQA 2WSFC 5GMDA 2M8HA 3GTYX 1GX5A 2AZ3A 2AF6A 1TKZA 1N4LA 4KGVB 2HPUA 1UVNA 5F9LA 1YJ7A 3UPFA 3NOCA 2FZKB 3M8PB 2MMYA 2D9OA 4K4ZA 3HVTA 4JI0J 1D8YA 2E5JA 4J9SA 4ZITA 4RR5A 5C7PA 2J0QD 3QJJA 4PZVA 3PXGa 1D8ZA 3T5HA 3M30A 2YQ1A 8RUCA 1G4CA 1TV6A 1KLMB 2B9XA 3OTEA 2VKZG 2E1AA 5L1LA 2C3UA 4X66J 5IC6B 2IRXA 2YWFA 2DHXA 3TZWA 2UUCJ 3QJLA 2DY1A 3KHHA 4JP8A 1QTNB 3OTDA 2FPHX 1LK5A 1TUGB 4RO0A 2RS2A 3L4BC 2QZ8A 4KR0B 1R89A 3M4XA 1HW8A 5H1SV 1O6XA 3D1HA 4J9LA 1HARA 3VQTA 2LCWA 4K50A 1T02A 3UW1A 4X65F 2B9WA 1NK0A 5A8KB 1SKWA 3JSYA 3D4JA 4JV0A 3GILA 2D9PA 3QSYB 4LBHA 3W5YA 3RBEA 1DTQA 2RHQB 3RR8A 1JJCB 1RTJA 2MZSA 4I68A 1QD1A 4PPZA 1WC5A 3RAQA 3WHIA 1JXVA 2MZQA 4F3MA 1RT1B 2NCKL 3MM7B 4MK7A 4ZVQB 3W3SA 1QY7A 1RACB 2CUYA 4HACB 4M5LA 4ENOA 2QJ3A 2W2PP 4FVMA 2C2EA 3ZZUA 1B0VA 4YR2A 2KYZA 3R3TA 3UDLA 2XO6A 3LOUA 4L76A 2YPZA 1Q4RA 1JXLA 3DN9A 2B0GA 2DO0A 3KLIB 2UUWA 4EMDA 2WB4A 2YQ3A 3OR1A 4NA1A 5CD4H 3W64A 2XY5A 3T3FA 4C7QA 4FYXB 3MI7X 4ES2A 1YJ9S 1U45A 4K4UA 2MY7A 3DMJB 3PYEA 4OI1A 1WHXA 2DIUA 4DPWA 1JKHA 4YEAA 4JI7F 3M9OB 3FEYB 3MAHA 3P5BP 1RAAB 3BGUA 2K8GA 3S1TA 3HD2A 1G3OA 1YRTA 4NLSA 1X5TA 2W9CB 4NMLA 1XR5A 1YDLA 2HS0A 1UEVA 3OXGA 2E44A 4XIUA 1FXLA 2DVIA 4PXEA 2CXEA 1ZAWA 3RAMA 4ECVA 2AJ4A 4DF8A 1I94J 3J7YU 4ZHRB 4GKKF 3RB0A 3CTRA 5DGBA 3R1HA 4PG8A 3L7UA 2VG5A 4DSEA 1OY6A 4QPXA 3K58A 4RJVA 3HK2A 2CDQA 5LSLA 3C16A 3C46A 3LA0A 4OHVA 1TU0B 3UVJB 3BV8A 2V8VA 5B09A 1R0CB 3GIRA 1U1MA 4J90A 4WPAA 1C0UA 2JRSA 1FDDA 3O3LA 3ZZYA 5JXSA 1FRMA 3FNNA 3R5BA 3MWBA 3NS6A 4C8OA 2W24A 2LEPA 4XO0A 2UXCJ 4MIBA 4M95A 4FF2A 3R7SB 3DLBA 3FEZA 2YBVA 3RJMB 4DV3J 1X9SA 5T41A 4IH6A 3Q22A 2W01A 4ZS6A 5ETLA 1GEHA 5CYMA 2DEIA 1AUDA 4FVCA 3ETOA 4FNHA 2KTQA 1OMSA 3MPYA 2E5LJ 5IV4A 3MM6B 4ZLJA 4IOBA 4WZQA 1HBNB 1DLOA 5DM6Q 2C2OB 2CQ2A 3IBWA 1S9EA 3T9ZA 2HQFA 1IKVA 2G0JA 5DDQC 5F0WA 4A8WA 3OL6A 4FYVB 2HIYA 4V19J 4FS2A 1OQ6A 3MCSA 3DYAA 2J7UA 3TAQA 4MTPA 4MAKA 4HLBA 3TEHB 3HT3A 1SV5A 2F3JA 4F8RA 3R27A 4G1IA 3KKFA 1VLYA 2F9JA 5DDRC 1KOOA 5KFUA 2M52A 2FLLA 1JJHA 3B4DA 3FSYA 4YR3A 3HSJA 2EFOA 3LQVA 4IG0A 5ETPA 4FBTA 1FE0A 2ZD1B 3US5A 4QCLA 4IQMA 2XZDB 3B54A 4F02A 1SC3B 4ZA1A 2UUBJ 2W8LA 2UU9F 4USTA 1V5VA 2BJ1A 1TK8A 4H4MA 2XLKA 4OJ3A 4FF3A 3PW5A 3GIIA 3NMAA 4EFAC 3ZTRA 5A6PA 1TKXA 2R7XA 3KNAA 3ULHA 3CDEA 1Q16B 2OPSA 2QFIA 3I82A 4AL6A 3SQOP 1T9WA 2CZ4A 2DRAA 4C8ZA 3HVAA 3OTCA 2VF3A 4QQBA 5IQ6A 3DM2A 2AQ4A 2HAIA 1KD1T 3OPKA 2LDIA 2VUGA 1H3DA 2QLJB 3MDFA 3EVWA 3VALA 3QIDA 2YTCA 1WOSA 2DCUB 2MKYA 2CNNB 2YKMB 1YIJS 4ECSA 5FDLB 2UVWA 2KU7A 4IQXA 4DV2J 4BS2A 2ERRA 4OYMA 3E51A 1QE1A 1UFWA 2W2MP 5THWA 4DR2J 5CCLA 4MKBA 2BE9B 1U24A 3EX7B 3RW6A 3Q8PB 1MWZA 1S77D 3V4IB 3EXYA 2GQCA 4OYXA 2H5IB 2Z4PA 1MU2B 4C8YA 5CZVA 5D8HB 2AEMA 2HMIA 4OYAA 1S9GA 2DNPA 2F4VF 1D9DA 2V4QA 1JLCB 5HROB 4NLDA 4I7FB 5HMYA 3OQ2A 5B0AA 1IN0A 1QUVA 2B56A 1CC7A 3IO1A 2YX4A 2RIJA 1GFWB 2QLXA 3MPUB 4Q44A 4OLOA 2MKKA 3OR2B 1FRXA 3R5JB 3WC0A 4ZVUB 1VJWA 2MZRA 4DR1F 4NLYA 4TQSA 3K5MA 4CTAB 4KGXB 3ZZOA 1WI8A 4QPTA 2E7XA 2GW8A 1JLAB 4TXSA 4P2MA 2RU3A 1YTYA 2R42A 5D15A 3IS9A 4UQTA 3BO4A 3TJ8A 1RTZA 3F0NA 1RTIB 1CVJA 4J9OA 3PX4A 3Q2SC 3MECB 4AQYF 5C2GA 5HSPA 4DR7F 2RE1A 2QX0A 1RU1A 5KFAA 2EFQA 5HVFA 4CNYA 3M1VA 2Y1RI 1FFSB 4KIAA 4EWTA 3KK3B 1IUJA 2E66A 3UWTA 4P52A 1SVDA 2R7WA 1KQSR 4WFNQ 1N32F 2B4VA 1FFGB 2GS8A 4CP5A 3TEGA 4NZ0A 2CNOB 2ZHAA 3I0SB 2ZZNA 2R7RA 1FJGF 2YY3A 4DG1A 1VFJA 1NCLA 4RNFA 4V1Ak 3UNYA 1JWWA 5AXKA 1FWKA 2CJXB 1RWNB 3FCHA 3KLGB 3BN7A 4LF6J 1NK4A 4IR1A 5CYJA 2OSQA 1RA7A 1T3OA 2QFJA 4CYUA 4L72B 1Z4UA 1HWLA 3RAXA 1GQEA 3W62A 2H9ZA 1EQMA 4LF9F 2HFNA 3QFWA 1Q8LA 2WVCA 2M0GB 1NSQA 1N34F 2D1CA 2ZBIA 4RX6A 1RSCA 1JJ2R 1EAYC 1Y5IB 3D67A 3IG1A 2IM3A 4KH1B 2P2CB 4RBTA 3IAS9 1VQMS 3K5NA 3P8BB 1HWIA 2FHMA 3GR1A 3MMAA 3G8QA 4NXMF 2JFDA 3PTWA 3HVTB 1TTHB 1PJ6A 3KHRA 3MD1A 1HBUA 2HVIA 2D3OR 2R8GA 1VCTA 4KKOA 1SBRA 1D09B 2HQDA 4RBVA 3M30B 2ZM6F 3FVYA 5D78A 3PO4A 4F4AA 4ZVEA 3OJSA 2CQ4A 5L9XA 1YZ7A 1SUQA 4C8NA 2MZTA 1G2EA 3EGZA 1RBLA 1HNZF 3UN2A 4X62F 2ASJA 1LFPA 1RWOB 2QYGA 3DGPA 5LSRA 3RRHA 5K8NA 1S10A 4DFMA 1S1VA 1S1TA 4RUBA 2GJFA 1HLWA 2W9BA 1WF2A 3Q89A 1HHQA 4OZNA 1SH0A 1RAGB 2CJYB 4O3RA 1S0NA 1K0TA 2VQFJ 4KV8A 5LSOA 4LFCJ 4M5GA 5D0HA 2C22A 2AJ0A 4DZ6A 4OJHA 2N4DA 4MKVA 3JYTA 4ED1A 5KFDA 1B0PA 3ICLA 3NGTA 5MLCV 1FKPA 3LP1A 5E3RA 1O51A 1RAIB 1RTJB 1Y7PA 2MJUA 1U02A 3RTVA 1T05A 1RQ0A 2WBMA 3GE9A 3CJKB 3SSSA 2FUG9 3G87A 1IKXA 1KFDA 2WVEA 1ITPA 2E29A 3SCKE 3K7RA 4GKKJ 2Q6CA 4M5MA 4ES1A 5KG2A 5F3ZA 3R97A 1VBXA 3R6GB 2XSJA 2UVRA 1T11A 3C6TA 3OSPA 2RILA 5JVHQ 1GTEA 1LW0A 5ETKA 3G8SA 4EK2A 3FCWA 2JFKA 1WJ9A 3W65A 2C3OA 1UEUA 3OR1B 3J7AN 1FVQA 3ZZTA 4JV5F 3W1YC 2HZAA 1VYAA 3M8QA 3NGRA 2XC9A 2EEYA 3QT8A 1U09A 3CJQA 2O1PA 3PRVA 1PKUA 2O01C 3GR0A 4IRCA 4C0BA 4HDGA 1VC6A 3PNIA 1U2FA 5LM7E 2U2FA 3W5ZA 2XYPB 2B6AB 1LXJA 4HTIA 3MM9A 2BE7D 2HFUA 1RT3A 3J81U 1JKHB 5F3TA 2PFDA 2ACYA 2R7SA 3D6MB 1NXIA 2ZHBA 3EMTA 1QAJA 4L3KA 4ZCIA 3OUYB 5M2UA 3ZTOA 1FERA 5LXRA 2OEKA 4ALZA 1MG7A 3HLUA 4KPYA 1QJHA 2G4BA 1EX8A 1OWXA 3DC2A 2FLPA 2PA3A 1S48A 2V68A 4ED2A 3ZZZA 1U26A 1LKZA 3UDEA 2EBEA 4C3MA 1FXRA 4DSJA 1UZHA 3NY0A 2PEHA 4LBPA 5ETNA 4JI8J 4NCAA 1F9FA 2CZ9A 2W2QP 2B9EA 1UPPA 5LMUJ 1TELA 2HIQA 4C2MA 2CA9A 4QW8A 2VG5B 1V3RA 1WKJA 4C0OC 4DV7J 3EM1A 2E1CA 2J6TA 5F8MA 4CLSA 4P10A 4JBCA 3PW7A 1FTRA 3CJ4A 2C2DA 2AGQA 3DRPA 2X1GA 4QU6A 2H4WB 4WTYA 1WTBA 1RK8A 1DURA 3CC4S 1C0UB 3SMZA 3S01A 3CULA 1ZETA 2E5IA 4O4RA 3DLLQ 1D3WA 2WOMA 1LFWA 1NO8A 2D7SA 3B82A 4OX7A 3WX8A 4I6AA 2R7OA 3SCIE 3K17A 5AE2A 3O5TB 3VZIA 3C14A 4OYBA 4PG7A 4YB5A 1TZ0A 4FKXA 2NPFA 4NLUA 2HGLA 5HATA 1N5YA 1HKAA 2ZJRQ 3G9CA 2P6TA 1QAXA 2XS5A 1UVKA 1WOPA 3D0IE 5HO4A 1RTDA 2JSXA 3D54A 5L1IA 5C24A 1CS4B 3MOJB 1DLOB 3O6QA 2ADCA 4QZVB 1W2IA 3AJ2A 2Q6BA 4HHUA 4RLEA 1QSSA 2MZ1A 2HWHA 3Q24A 3S6EA 5H9FJ 3N5FA 5D4LA 4ZN1A 4B9TA 4NYZA 2VB6A 3DKDA 2CQDA 2IM1A 1SJFA 3OV7A 5CYQA 3CUNA 2MLXA 4KJIA 1SV5B 3W9IA 4X4SA 4X4VA 3C66A 2O66A 1M1KT 1DBDA 2KT2A 2YWKA 2OKQA 2P5VA 2JJ4D 1PCAA 5DG8A 2VPWB 4ZP8A 2CQPA 4IG0B 2DXEA 5FLXY 2LEAA 3OXFA 2E9TA 4KHRA 3DRRA 3EYZA 1REGX 1DFDA 2C3MA 5HMWA 4TLRA 1HWKA 1N5SA 3JSRA 3LPEA 3HSDA 3M6WA 1ZZNA 5AJ3F 3MR6A 1LWEA 5HP1B 3CCUS 2RMLA 3EVOA 3M7VA 5DLFA 1XJWB 3ZZPA 4LMZA 4H4MB 3SSRA 2MEWA 3N5BA 1S0MA 3QMQA 4B3TF 1VRUA 3CWJA 3O1LA 5HMXA 1M5PC 2YNGA 2XO7A 3HVRA 3P49B 2XMAA 2PI4A 4OX9F 3FUYA 1YBUA 1NH7A 3QWPA 1W26A 1FF2A 2J9EA 3DM2B 4MFBA 4OHWA 2ZH1A 1A6LA 3HHDA 1KDNA 2XMWA 1KONA 4XPCA 4W4MA 3TAMA 5EN1A 2MJNA 3UD5A 2FVCA 4CZCA 5DQIA 4OZ1A 1GXUA 4O44A 1FKOA 2C3PA 3UE2A 3OHBA 2XSFA 3I31A 4DS5A 1KRPA 3IBCB 5ETVA 3CO9A 1N5QA 2X3DA 2VKRA 3EXCX 4HYKA 4OZJA 1C1BA 1N32J 4I0WA 2AYMA 4MK8A 4MYTA 1H98A 2UP1A 2HMIB 1S9GB 1UPMB 3QLHB 1T9TA 5LOQA 3T5JA 3HHNB 3R5GA 1RHUB 3DOKA 4K8RA 1UKUA 2DPIA 1SC1B 2MQLA 3W8PA 3V81A 2VQEF 1SXLA 4ICLA 1EP4A 3OHAA 2Q79A 4WKRA 1BLUA 2N82B 3KWMA 5H9FK 4P2FA 4ETXA 3BGLA 4DL2A 2AX0A 4YB6A 2CQHA 1F1BB 1VHIA 4A8FA 1Y0HA 3HFKA 2NREA 2O5DA 2M3DA 1EIYB 1N34J 1TL7A 3K0JA 3IS9B 2LQJA 3QZ7A 3JSBA 1R8PA 2NXJA 5KFBA 1RKIA 2VDIA 2CQ3A 3ISZA 5B7WA 3GYXB 4J5OA 5T7LA 3MCOA 1UL3A 3FRZA 3PJXA 3QGHA 4FKYA 3A8IA 2I2YA 2D3UA 3NS5A 4QYZJ 1S99A 2FJBB 2HRTA 2CG8A 2FZCB 4GO5X 2AT1B 2DGTA 3AQOA 2N7CA 4F4KA 5D0RA 3BQ2A 3RG6A 4Y2KA 4OV1A 1RXOB 1N48A 3UCGA 1AYEA 2DR7A 1YJUA 3CPWR 3AODA 4X62J 2PGCA 2GHVC 3MM8A 2OFHX 4ILLA 2VOOA 3UO0A 4WYWA 1UFKA 3HD1A 5KFHA 4OLPA 3W66A 3I9ZA 4ECRA 5KT2A 1N0UA 1U0HB 2ZH8A 2HQCA 5DGAA 5EDWA 3A8EA 3N6MA 4Y2MA 1WG5A 1WDTA 1R8CA 1WEYA 3FGVA 5J2NA 1ZPWX 4KQZA 1AZSB 3POTA 1TMJA 4LF5F 3CT9A 4KE5A 1LV5A 5BR8F 3HKZD 2QSWA 1WG1A 1S6QA 5KT7A 2V6AA 2DH8A 4LJMA 1OS5A 4MKAA 5HN0A 1VQ5S 3X3UA 4LF7J 1Q79A 1NUEA 2H1YA 4M1KA 2OSRA 2DH7A 4WFXA 2RT3A 1NMEB 3EDRB 2R8JA 4XDDA 2W7OA 4WXOA 1QSYA 3MMAB 2HHTA 2FJAB 1JX4A 1Q81T 1Y5NB 2OEMA 2KJWA 1HBUB 1QLNA 2BM1A 2RKIA 4KKOB 4U8YA 3TP2A 3HHLD 4RNNA 2WTFA 4DL6A 3FC9A 2YKAA 2AD9A 3FSIA 1NSAA 1X5PA 3LALA 4DV4J 4HR2A 4JV5J 3AAWB 3V6JA 1Q5YA 1Y3KA 3DHWC 2J0SD 1HNWF 1CBKA 1ZM2A 1S1TB 2HVEA 1SJQA 1S72S 1X9MA 4CLKA 2CPJA 1AUSL 2VL1A 2DBBA 2W9BB 2QLFB 2M9KA 2XMUA 1MROA 2XQCA 3OLAA 2UZAA 5L1KA 2ASLA 4BHQA 4J9QA 4IG3A 2FQQB 1V3ZA 2VPYB 3KYLA 4GVBA 3CCZA 1YGYA 5DLGA 3JYTB 4LF8J 2V2QA 3KHGA 2KDOA 2MSSA 4O3NA 2OI2A 2YPYA 4O3OA 1FKPB 4CDIA 3LP1B 3T1YJ 2IMOA 1WSRA 2VODA 3EZOA 2FY1A 1RAHB 4IFYA 1XWLA 2CPZA 3QRRA 4X4RA 1K0VA 2HQIA 1T05B 4JUZA 1IKXB 4DSIA 4PXBA 5B0FA 4NPOA 4OI3A 1FFWB 5DO2A 1SH2A 3N01A 1U0SA 4WIQA 4E8UA 4WXWA 3F41A 1HFEL 2LA4A 1GX6A 4ZIWA 3IP0A 5KFKA 2XSJB 2ZNZA 4M5KA 2IRUA 2KG0A 1FI4A 4X64F 3PKYA 1LW0B 3Q8SB 2XWXA 4FNIA 2HGMA 3MEKA 4HHHA 2K3KA 1NRKA 2CJBA 2YX7A 3KJQB 3DLEA 3EICA 4CNZA 3CC2S 2AP6A 1SL2A 2QA2A 1U2RA 1AA1B 4Q2MA 3H40A 4PWUA 2EKYA 3G71S 5L9NA 2AZ1A 3MM9B 1X5OA 1ZM9A 1TUVA 2V8GA 4WU2A 2VFVA 2H5JB 1M90T 3NNCA 2GIFA 1CULB 4B3MF 3P6YC 1S49A 1JB0C 1VK8A 3N6LA 3VVTA 4X2BA 3G8TA 1CG2A 2BE2A 1WC1A 1SC6A 3DDNA 3PHTA 3KUEA 5IV3A 2XYHB 3WC2A 4UOFA 4ZN3A 2M2BA 1MNEA 3CCRS 2ATLA 4B9UA 3FZBA 3BF4A 1VQOS 5KG7A 2IJRA 1KNZA 4B02A 1RAFB 3K5PA 3FQLA 2LKZA 1P1LA 3P4UB 2I9SA 3BREA 5IT4A 2J8SA 4NRTA 2QMWA 5IT9Y 4WFBQ 2JHEA 4PPDA 3R7BB 4DV0F 2P8IA 4MK9A 4LFAF 2DNKA 4UOGA 1HNVB 2R7TA 2MPUA 3DRPB 1SJRA 3BJYA 1PYTA 5ADZA 9RUBA 1LNQA 4ZPAA 4CLTA 2BQUA 1F2HA 3BSAA 1KOHA 2WONA 4O3SA 4OYIA 2D3ZA 5K8OA 2W4PA 5SUHA 2GVZA 1RISA 4DLEA 4WP9A 2VFTA 2LXUA 3ADAC 1NU4A 2WOMB 3N79A 5AJ3J 3D2WA 2AX1A 4KAIA 2DK2A 2VU5A 4OI4A 4ID8A 3W2VA 4WFZA 1KLMA 1C4CA 2Y9HA 2QL9B 4DLGA 5KT4A 2JEJA 2BKPA 4L74A 3C14B 2VBYA 4DFPA 1XMOF 3MFIA 4Y6IA 1N5YB 2VJUA 3CIZA 3FK4A 3MUVP 3BS9A 1Q8IA 3C6UB 4DUZF 1ZM3A 2GMHA 4UY85 1RTDB 4C8KA 3MMCA 5C24B 3VAIA 2J9DA 4ZCMA 1RAOA 3LGHA 4H4OA 4FXVA 4JI3F 3UNGC 2QMUB 3DXSX 2VONA 4P2XA 4DV5F 1FXDA 2PT0A 1R27B 3PR4A 4CLUA 4M5HA 3TYTA 4B08A 4ZPCA 1XERA 2HZCA 5CYQB 1H74A 3SCJE 3C2PA 5HLFB 4TYAA 1I3OB 3A4TA 2DGQA 3LW5C 3NGSA 4DN9A 4MMOA 1U2CA 1IBMF 4LF2A 1N5TA 3RYLA 3P3DA 4PRFA 4WWSA 2RQKA 1PAUB 2QTWA 2OPRB 4HACA 1DRZA 3CDAA 3TO8A 2BJ8A 1DQ9A 2C28A 1EARA 4JI0F 1CPZA 3LTOA 2LU1A 4G6VB 1KQFB 1LWEB 2CJAA 2DHHA 3KJVA 3BBBA 4OYZA 5J1NA 2XHWA 1VRUB 4B3RJ 2EC2A 4X66F 1N6QA 4A8SA 3KXDA 2ZWPA 2J0WA 3BB5A 5F8HA 1FX4A 2B9YA 2BM0A 2DEJA 3KNGA 2FJDB 3FBCA 5E0OA 3J80Y 2IDEA 2GJ2A 4IO1A 1X7VA 1WI6A 3GCXP 5C42A 2UUTA 2EFGA 4Z7YA 1CJTA 1Y10A 1ELOA 2Y8YA 3W63A 2MY8A 1RA6A 1SJ3P 2A0FB 5L38A 4ZPBA 2ZZMA 5ETMA 3CJ0A 3MOZA 4DL4A 1SKSA 1ACMB 1FNMA 1B7FA 2GIRA 4C11A 2L48A 5RUBA 2DGSA 1WC3A 2AJFE 2BDPA 4O44B 2B4PA 1S7HA 3DFEA 1KVJA 1FKOB 4HT5A 5D0EA 1RU2A 4DMZA 3PYDA 1NJXA 3OFGA 2JWNA 1KC8T 1SQGA 3M8YA 4MIAA 2H54B 1C1BB 1Q95G 3PR5B 4OYOA 1X8DA 4GKJJ 4ZHRA 2ZBRA 1S0VA 1F5AA 5CXTA 3OTOJ 2IPOB 4ED5A 1MN7A 2DNQA 1HNIB 5AXNA 2XB2D 4NE9C 1HHTP 3H5SA 4FF4A 3GPAA 3RUBL 3MEEB 2EXUA 2XTJP 2ZUGA 3T1AA 1GMWA 3K57A 2FJXA 5LMNJ 4IO9Q 4GC6A 4ICLB 4ECTA 1WF1A 4OI6A 3NCPA 1PYSB 1XQIA 1KHVA 4O3PA 4DBQA 1QSLA 1T94A 4DS4A 1FHTA 2FJEB 2DNZA 3DCAA 5HANA 4OV6A 3K89A 2BQ3A 5I3UA 4QJVA 1QVFR 2A18A 5H9EJ 1M5OC 4ED6A 2XCPA 1TL7B 2CWXA 1NHKL 1RGVA 3TA1A 1D0EA 5KFLA 5GADI 2EK6A 3DLKA 3BSNA 1FNOA 4YP3A 3SIPB 2CIMA 3BM7A 4LRCA 4AYBD 3LH2S 3I87A 1MW7A 1S4FA 4Z37A 1HBNA 1K47A 2UUAF 4QR1A 1XR6A 4EO6A 2DR9A 2R2RA 2HHSA 1O8BA 5B0DA 1UVIA 3FBEA 2KO1A 5KFMA 1U1RA 1I94F 1OYEA 2B8QA 3MM8B 2PFFB 4KH0B 3ENQA 3D28A 1JLBB 2GHWA 4RUAA 3AXKA 3KK2A 3I4HX 4IRDA 2NXCA 4NZ6A 3BR8A 3MZIA 4P71A 2GA7A 2RQ4A 1RBAA 1NDKA 4DWIA 3G6XA 2K7JA 1FE4A 2UXBJ 4ECWA 3POTB 2V2VA 6FDRA 1NZAA 3FSXA 3BGRA 4DX5A 1S6QB 2ZKTA 3GP9A 4OHZA 1NK7A 5GAHI 1MSWD 2ZFHA 3Q23A 2LP4A 4ED3A 4LRDA 3A12A 1G6BA 4DR5J 4DV3F 1H7WA 2J9DE 3E01A 1ICEB 1OPZA 5KFSA 4D3HA 3V6HA 1SJ4P 1RBOB 1OY9A 4G3IA 5HVHA 4P2SA 4UZBA 2VV5A 2V94A 1O0PA 3A3PB 3LAMA 2L9DA 1BC6A 1BQMA 4OJGA 2P9EA 3BYRA 2YNFA 3ZZRA 2HHWA 1IR1A 5K14B 3SYZA 4WKYA 2WVDA 1KN6A 4EYIB 2D74B 2M4MA 1TKDA 3NLCA 2KJVA 4QYRA 4TU9A 4F36A 2XI3A 1WKLA 1KSPA 3DU5A 3RW7A 3PRBA 5FDLA 5D4PA 2HQGA 1VBYA 2X7IA 5EWFA 1TMMA 2K1RB 2M5YA 2LQ9A 4QWAA 4U7UK 4N41A 3GV8B 2DR6A 3KK1B 1MROB 2EKNA 3AQPA 5H9EK 3V4IA 2J0XA 4L75A 4IG3B 4DX6A 4PG4A 2VZ9A 4ZMMA 1MU2A 3Q86A 2EFPA 4GVBB 2DNMA 4B3MJ 3SBMA 4HKQA 2KT3A 5CH7B 2XMKA 3CDUA 4I7FA 2UUBF 3HVWA 4IFYB 3MURP 5FLXU 4HTJA 2MQNA 1QVGR 3Q2TC 3ET6A 3ILOA 4MT1A 2JEIA 1S1XA 1FRJA 4A48A 1WACA 2Q43A 2MTLA 7FD1A 3P45B 2IC3B 4AL7A 3PJWA 4M5DB 5DZ7A 4NWBA 1XMBA 3D3CJ 3I56S 3G4SS 4F26A 2ROGA 4F4XA 1RYRA 4O4GA 1RAEB 3KLHB 2E5GA 1GXTA 2XGQA 4OX6A 4DV0J 2E9RX 3EGVA 5KFRA 2LQBA 3BGFA 3G2XA 3MAQA 2MKHA 4CM2A 3ISNC 5BYQA 1GH8A 4H4KC 1K1QA 2OGUA 2EW9A 1Q8KA 3QGGA 4TN2A 1P27B 2KZMA 1R0BG 3PJ9A 3RB4A 4D3GA 2CNLB 1DARA 1YJRA 3GG0A 3TX0A 1U6BA 3DLHA 4DV2F 1VHFA 4K2XA 3OJUA 2VIHA 4CCHA 2FC8A 4P7VA 4DR2F 2IRYA 3HFZB 5A8RB 1YJWS 5CABA 2RAQA 3GYNA 2FVPA 1C2PA 1VQ4S 1XMOJ 2V9KA 4DQQA 1TFYA 3NGUA 5EX3A 3S8SA 2HNDA 5KAKA 3I0SA 3HDSA 3QNWB 4ZJOA 3UR3C 3MTKA 4Y0FA 3GQCA 1UMJA 1X4GA 1TAQA 2DGUA 1S76D 3VAKA 3R8YA 4A4JA 4F2RA 4KPCA 1GNKA 2DR5A 1EHWA 3BSCA 1VQKS 1UA0A 3PFOA 3GIJA 2FHJD 4ZDNA 3ZTPA 2EWHA 4DV5J 2W8KA 3IAM9 4O0NA 4IH7A 1KTVA 3KG0A 4AFFA 4JV1A 3K8VA 3HJFA 4ZOSA 3C19A 2Z2YB 3SV4A 1NKBA 2UVUA 3P5TL 1RT4A 2V9WA 1HQ2A 3L95X 1WHWA 2Z0GA 3TA2A 2CPXA 1IBMJ 2WVBA 2YNHA 3ZXWA 1OQ3A 2WONB 5J2PA 5JJBA 1WHYA 4ATNA 2V50A 3OLBA 2A2DA 2WK4A 4EU0A 4IRKA 3M6UA 2GVZB 1QM9A 1YJVA 2HS3A 1HI0P 3ILLA 2FB0A 2F40A 2SXLA 4I67A 3W2VB 5D77A 1AXQA 3MUTP 1K1SA 4B3OB 2CWKA 5B0CA 4CLWA 5F8JA 2KXFA 3MEGB 5ETQA 4Q8EA 1L3SA 4RW6B 1DQAA 4I69A 1YWXA 4OFZA 1RAJA 5I42B 3EVMA 2FVRA 1P8GA 4URSA 5HQLA 3MMCB 3ZTSA 3BH6B 2GC8A 1SL1A 2OUGA 1ZYQA 2BUNA 4H4OB 4LF6F 2V4JA 3AD8C 1YLXA 1RLDA 1YG0A 3HHKA 2BANA 2XNRA 3NAHA 3E8OA 2KN4A 3N9UC 1MN9A 4Q45A 2ALYB 1H2TZ 1R3NA 2WB1D 3WZ0A 3IWNC 4DXLA 1NB7A 4QIEA 2GQQA 3NCQA 2IYGA 4UOHA 3FZ2A 3D0GE 4JI5J 3BZQA 3CJKA 4LT6A 5IS2A 4FZVA 1LWCA 3NL0A
chains in the Genus database with same CATH topology
4X4SA 1HHSA 3KLHA 2QSFA 5E41A 4X4VA 3C66A 3HO1A 3R1LA 4A8OA 4DL3A 3QWUA 2HVZA 2O66A 4I4BA 4Y65A 4X4NA 2XWYA 4ZP6A 2QA1A 2DPJA 1M1KT 1TAUA 2B3TB 1DBDA 2KT2A 1J5EF 2YWKA 2WRMA 2OKQA 2P5VA 2JJ4D 2YH1A 1WELA 2F1FA 4QIGA 1VQPS 3QIPA 4HI2A 2XY7A 1V3SA 2XGPA 4C3KA 4YOEA 5DG8A 2VPWB 4ZP8A 1U1KA 3JB9k 4L3NA 4NX9A 2CQPA 1IQZA 1WEZA 1VQ7S 3JTOA 2F8EX 2RDIA 5B0BA 4IG0B 1BGXT 3UR0A 1RT2B 3V5RA 5FLXY 2EFVA 4OIXA 2LEAA 4N8OA 4IH5A 3OXFA 1ZBTA 3PM9A 2E9TA 2XI2A 4KHRA 4V19X 2FHJA 3I5BA 3DRRA 3EYZA 3PDNA 3KJVB 3PW2A 5J2NB 1DFDA 2B4UA 2C3MA 5HMWA 2ILYA 4TLRA 4AL5A 2HFOA 3CEDA 2JC1A 4QU7A 2W7PA 1HWKA 2I38A 1N5SA 2YNIA 2HHQA 4WE1B 4KHMA 3JSRA 2B43A 1N6QB 5K8PA 1WNEA 1R8HA 4Q2LA 3M6WA 1ZZNA 5AJ3F 3MR6A 1LWEA 1K73T 5HP1B 1LK7A 2BRKA 5HMZA 3CCUS 2JEFA 2RMLA 2BYCA 4CH1A 3AB2B 4N76A 2CQ1A 3I5AA 5A8WA 1KQKA 5A8RA 3RRKA 2ZD1A 3ZZPA 5DLFA 4LMZA 4H4MB 3OVSA 1VMBA 1AROP 4A8MP 3SSRA 3N5BA 1S0MA 3OL9A 3QMQA 4B3TF 3NKYA 2J7WA 3CD7A 1VRUA 2XMVA 2CKWA 3NWGA 5LJ5Y 3QO9B 3BSOA 3CWJA 3Q0AA 2ZE2B 3O1LA 1L3TA 5HMXA 4J9MA 4NXNF 2I0XA 2RU9A 4IFVB 3MMJA 4N8NA 4USHA 5G0RB 2YNGA 3VTIA 4WK3A 3LWLA 1M5PC 2L9WA 5C42B 3JTPA 2XO7A 4GMKA 3NGKA 1Z2LA 4RKUC 1NK9A 2UXCF 5E5NA 4PR6A 2AU0A 4PWDB 2B6AA 3AA8A 2VQFF 4Q5VA 4NLWA 5BJRA 3IWLA 2F9DA 3HVRA 4B9LA 3P49B 2IJFA 4DJBA 4OX9F 2PI4A 2HS4A 5LJ3Y 4LFCF 3C8YA 2DH9A 3A1YG 1L3KA 1YITS 1T03A 3V6DB 4XDCA 1NH7A 3HHLA 2OMLA 4FPRA 4EYHB 4B9NA 1S1WB 1TP7A 1OO0B 1UP1A 2RD5C 3QWPA 4FN5A 4X4TA 4RZRA 4WU3A 3OUYA 2JDJA 1TFWA 1XC9A 1FF2A 3THVA 2J9EA 4C11B 2FVSA 3DM2B 4I2PA 4MFBA 1TKZB 2N4CA 1J5OB 2I8EA 1E6YA 3M2RB 4OHWA 3RR7A 2LXFA 2ZH1A 1GT8A 2OFGX 1A6LA 3HHDA 2E5LF 3RU0A 3DOLB 2XMWA 2R8HA 3MTJA 4X4OA 4YB1P 5MAOA 4PG5A 2IAJA 1KONA 2JLGA 2V2KA 4XPCA 2RKIB 4MKYA 3TAMA 5EN1A 2NR0A 2MJNA 2DGWA 5E3PA 4EBDA 4K59A 2POKA 3QPIA 1PILA 2FVCA 4RUHA 1N52B 7FDRA 4J9NA 4I64A 2R8KA 6FD1A 4CZCA 1L5UA 4ITSA 5DQIA 4R25A 1HNXF 2FGCA 4OZ1A 3NP5A 1GXUA 3M2UA 1MMLA 4O44A 1HQEB 4RW8B 4AE5A 1FKOA 4TQRA 2C3PA 1AW0A 3UE2A 3OHBA 2KH9A 2Q1LA 1JLGA 1C4AA 4M94A 2XSFA 1VQNS 3I31A 2G0CA 4UW2A 4UUXA 2YKMA 3SQGA 4DS5A 1KRPA 5JUMA 3CO9A 4ZVFA 1C0TB 1TV6B 5JVGQ 3PRDA 1N5QA 1JK9B 2KHCA 1ROFA 3VAHA 2FC9A 3CJ3A 3LP0B 5U47A 3R5AA 1IJEB 3SFGA 2VKRA 4ZPDA 2WBRA 3EXCX 5T14A 2W25A 2GIQA 2J5AA 2CVEA 3S7RA 5I4MA 4OZJA 1CSJA 1C1BA 4F50A 4I0WA 2ZC4A 4HYKA 4CQ1A 3J81Y 2AYMA 4MK8A 2MGZB 2NUHA 5KFQA 5K8MA 3HZGA 3MM5A 3IFEA 4HH0A 4MYTA 4QWEA 5E3CA 1QAIA 1H98A 4J9RA 2UP1A 3HKWA 3U1MA 1NK8A 2CG4A 2HFZA 5IQQA 2WHOA 2HMIB 1S9GB 3DNCA 2N3LA 5C5JA 2IBKA 2XZWA 1C1CB 1IKYA 1H38A 3QLHB 5IM0A 3IN5A 1TK0A 3TARA 3T5JA 3HHNB 2BA9A 3NNHA 1NHVA 1HWUA 4DSFA 5DG7A 4FS1A 2GCFA 2PDAA 3DOKA 2A3JA 3T9NA 3TUJC 1UKUA 3THPA 1HMVB 5KFWA 2DPIA 1LQ9A 4LVNP 2BXJA 2ADBA 5F41A 4C0HA 2NZ4A 2R4FA 1HW9A 2MQLA 3SFUA 4CI0B 4H4KA 1CC8A 3JSMB 1KQGB 2GGPB 3V81A 1HD0A 5IZHA 5DQHA 2VQEF 1A9NB 1APSA 2J6SA 4HH1A 1SIWB 1SXLA 4F4ZA 1FJCA 4ICLA 4B3OA 5I3UB 4OI0A 1GXLA 1EP4A 5KG3A 1JLCA 4E0DA 5HROA 2G13A 2FGOA 2Q79A 3OHAA 4LQ3A 2OO4A 2RRAA 4WKRA 3PFEA 3K8WA 3MEGA 5DM7Q 2COLA 1BLUA 2N82B 2W9AA 3KWMA 1U1QA 4RW6A 3ITHB 4CT9A 1SKRA 1IR0A 3L7OA 3CCWA 1X0FA 2RB7A 2Y1JA 4ETXA 3P96A 2VASA 5I42A 3BGLA 2MQQA 3AY0A 4DL2A 4JI6F 3VAFA 2AX0A 4C8MA 1CQNA 1YBAA 4YB6A 3UI3A 4FF1A 2CQHA 4IYQA 2B4OA 4R8UA 2RVJA 4XK8C 4Q0BB 4A8FA 3KLFA 1Y0HA 3HMJG 3HFKA 2NREA 4B9MA 3OR2A 5J2MA 4Q43A 2O5DA 2DGOA 1G7CB 4Y2IA 4BC7A 2DNRA 3Q8RB 2M3DA 3CGIA 2ZITA 3DLKB 1DTQB 4ELUA 3LP2B 4I56A 2EG2A 1VS3A 2LQJA 2W4DA 3IS9B 5LT5A 5GAGI 3V6KA 1R0AA 5LL6d 4ZK7M 4OQJA 3QZ7A 2WCXA 2ZH4A 5A6WA 1T7PA 1N36F 4RBUA 3JSBA 2L9NA 1R8PA 3H5UA 4OMFG 5KFBA 2IHR1 4WZMA 1RKIA 4CTAA 2CQ3A 1FCAA 3ISZA 5B7WA 1S6UA 3GYXB 3GV7B 4J5OA 4RW4A 5D6GA 5T7LA 2RRNA 1JLAA 1UL3A 4HI1A 1VQ6S 3FRZA 2KFNA 3PJXA 3QGHA 3I4PA 2NUUG 3BO2A 1DTTB 1YRUA 2JX2A 3PIPQ 3FFIA 1RJJA 4DX8H 2I2YA 4HDHA 1RTHA 3K5LA 2D3UA 3MR5A 4W90B 1S97A 4Q7AA 5EWGA 4Z2XA 3NS5A 4QYZJ 3GFXA 4DR6F 3U1LA 3TI0A 4TYBA 1S99A 1T95A 1RTIA 2FJBB 3PIOQ 3GG1A 2XS2A 1E6VA 2GO8A 4TU8A 1YSJA 4GO5X 3TW0A 4F4YA 2BVZA 2ROEA 5GVQA 4JI8F 4DQRA 5KFVA 3RRGA 3KG4A 4C8LA 2DGTA 3SI8A 3AQOA 2N7CA 3U1NA 1X4AA 2X3GA 3MECA 4F4KA 3BQ2A 4EUVA 2ZKUA 1JIHA 1UJ4A 5GAEI 5FD1A 2V4RA 4Y2KA 1BY9A 5KFOA 1ULRA 3MUMP 1TL4A 3BDEA 3QGPA 3OVAA 4OJ1A 4OV1A 1VGYA 5LMUF 2MB0B 4NLGA 3BQ0A 3DLEB 3KK2B 1N48A 5GAGU 3E3XA 1UAWA 4TLQA 3UCGA 1Q8BA 2PMHA 3BN4A 2DR7A 1NJYA 1YJUA 3CPWR 4DV7F 2PGCA 2GHVC 2IVMA 2Y0SD 3MM8A 5EHHA 1FEHA 3SXLA 2DGVA 2G1DA 4Y28C 1VQYA 2OFHX 5KOXA 2VOOA 4ILLA 3KK3A 3I5CA 4WYWA 4E98A 1WG4A 4G1QA 4TNOA 5KFHA 4NLQA 4OLPA 5DJBA 1YJTA 3I9ZA 4ECRA 5KT2A 4YDXA 1Q7LB 3M8RA 1N0UA 2R8IA 2ZH8A 1HYSB 2DHSA 4NLOA 2L41A 2HRYA 2PN6A 3H4DA 5DGAA 5DS7A 3SDEA 4CO5A 4JI1F 2DCLA 5EDWA 4DUYF 1NKEA 3A8EA 3EZUA 1N5VA 3N6MA 4NA2A 4Y2MA 1WG5A 4DDFA 2IFXA 3BGRB 5FIIA 3H4BA 4DL5A 4RW7B 1R8CA 3DRXA 4NLXA 4EZ6A 1WEYA 2VG7B 3FGVA 5KT6A 4CIOA 5J2NA 1ZPWX 2W4CA 5CZXA 4KQZA 5GAEU 1X4BA 2CPYA 1IKWB 1KR4A 3POTA 3TNVA 2VA3A 3H25A 3AJ1A 4LF5F 1F2GA 4Y00A 1JLEA 3CT9A 4DFJA 4FYDA 2RF2B 2BE2B 2ZOMA 2FD2A 4KE5A 4C3LA 5CCMA 1LV5A 2Q3PA 5HP1A 5BR8F 3F44A 3HKZD 1MWYA 2QSWA 1WG1A 4A46A 5D3GB 3KLGA 1S6QA 5KT7A 1NNDA 5HQ8A 2F7VA 2Y1IA 3NG8A 2DH8A 4LJMA 1J2VA 4OL8A 1Q78A 1OS5A 1TKTB 4OHXA 4JV2A 2GMJA 3E01B 4MKAA 1ZOTA 1NJWA 4Y2AA 5HN0A 1VQ5S 3X3UA 2KRBA 4ZCKA 3J7Z5 3JAMY 4KBIA 2N3OA 2BQRA 1Q7YT 4KC5A 2ZDPA 2OPQB 3RBDA 3LAKA 4ID5B 1Q79A 4KFBA 4CO3A 4M1KA 2ZNYA 2OSRA 1RT5A 2DH7A 1Y00A 4WFXA 1UFLA 2ZH2A 2G9OA 2LEBA 2WSFC 4A8XA 2RT3A 2M8HA 1BQMB 4B9VA 2OJ3A 2ZDOA 1F5CA 2MQMA 4GC7A 2B51A 1GX5A 4MJKA 2R8JA 4XDDA 2W7OA 1DZ5A 4WXOA 1QSYA 2YNFB 4WYLA 3MMAB 2HHTA 2FJAB 4R5PB 1JX4A 2DNYA 2AF6A 1VQ9S 1TKZA 1N4LA 1J5OA 3K59A 4U9RA 1Q81T 1N88A 1Y5NB 2HPUA 1UVNA 1FD8A 5F9LA 1X4CA 1HPZA 2KJWA 3NL0A 1HQUB 1HBUB 2QMXA 3UPFA 1QLNA 3F73A 2BM1A 2RKIA 3UD4P 3M8PB 4KKOB 2HHPA 3DRSB 4AUKA 1S6PB 2PE8A 3HHEA 1Y9OA 4LSNA 3TP2A 2CPFA 1AFJA 2DRBA 2MMYA 3HHLD 2D9OA 4RU9A 2BV3A 4IKAA 4RNNA 3TVKA 4K4ZA 3HVTA 4JI5F 2VFUA 2WTFA 4DL6A 4TKTA 2FLNA 1KHWA 5C25A 1XEZA 1D8YA 2E5JA 4J9SA 4PQUA 2YKAA 2AD9A 1ZM4A 2LQ5A 4R0JA 3FSIA 2J9CA 2J0QD 3QJJA 1X5PA 3LALA 3PXGa 1D8ZA 1BQNB 3T5HA 4RWXA 3M30A 1Z1ZA 3PY8A 4I6YA 3AAWB 4ELVA 2RJZA 3I55S 2R7VA 3V6JA 3M05A 1TV6A 1KLMB 4KRWA 2BACA 1Y3KA 2MKJA 1JLFA 3LP0A 3DHWC 1BQXA 1YJNS 2B9XA 2J0SD 3OTEA 2NXUA 2VKZG 1HNWF 4LSLA 2E1AA 1ZM2A 2QLWA 3TVYA 1S1TB 5L1LA 1SJQA 1S72S 4RNHA 5BYRA 2MXYA 1SIZA 1X9MA 2MGZA 2CPJA 2C3UA 2VL1A 4NL5A 1FDBA 1M0SA 2DBBA 3FMWA 2W9BB 3LWMA 2M9KA 2DNHA 2IRXA 2XMUA 2YWFA 2DHXA 1MROA 2QA4G 3PX0A 1H0HB 2HNZA 4CT8A 3QJLA 1SB6A 3QLHA 4QWDA 2D41A 3OLAA 4J9PA 4KB7A 1NH8A 3KHHA 2UZAA 5L1KA 3OTDA 3EPGA 2FPHX 4BHQA 2ASLA 1LK5A 3IRXA 4IG3A 4J9QA 1FRIA 1U49A 2RS2A 2Z2LA 1V3ZA 1WF0A 1WEXA 4U7CA 5A0YA 2VPYB 2QZ8A 3KYLA 5KOWA 5CYMB 3CCZA 3T19A 2OAUA 2YKOA 3DI6B 4KR0B 5E33A 2YX1A 4KO0B 1YGYA 3JSMA 1R89A 5DLGA 3M2VB 2XLIA 1T3NA 3JYTB 3M9MB 4O3QA 3KHGA 2KDOA 3M4XA 4ZPVR 1HW8A 1S1XB 2MSSA 4O3NA 1R7IA 5H1SV 1M5SA 4O3OA 3D1HA 2AYGA 4J9LA 1FKPB 3TRGA 3LP1B 1HARA 2IMOA 4DL0C 4NYOA 4AXIA 2VODA 3BDPA 2A10A 4WK1A 3VQTA 3CCMS 2FY1A 4IFYA 2MDAA 2LCWA 1XWLA 4K50A 2CPZA 1T02A 3UW1A 4X65F 3IGNA 2B9WA 4X4RA 1NK0A 1UVLA 1K0VA 5A8KB 2HQIA 2PC6A 1S9EB 1SKWA 3TX8A 1IKVB 2AYEA 3ISND 3JSYA 2CQIA 3LUYA 1T05B 4JV0A 4JUZA 1JMTA 1RDRA 3GILA 2D9PA 2HW3A 3MXHP 2LDYA 4TY9A 1IKXB 5DG9A 4DSIA 4O4GB 1ZTWA 3PO5A 2KXHA 4O23A 3RBEA 4PXBA 1XNQF 5B0FA 2PD1A 2JVOA 1DTQA 4NPOA 1HBOB 4OI3A 3RR8A 1RTJA 2MZSA 5DO2A 1SH2A 3N01A 1UJ6A 3DYAB 1LW2A 4I68A 2DNOA 3JTNA 1RWUA 4E8UA 1YI2S 4X4PA 4PPZA 4WXWA 3RAQA 3F41A 1OIAA 1HFEL 2MZQA 1FRKA 1GX6A 2LA4A 4I6WA 5L8RC 3W7BA 4F3MA 2AGOA 1RT1B 4DPOA 2DNLA 3B78A 1OSDA 3PHEA 5KFKA 3MM7B 4MK7A 3NGDA 2XSJB 2ZNZA 2IRUA 3OBIA 2KG0A 4JI4F 3W3SA 1QY7A 3H20A 5M2PA 4X64F 3GMGA 2CQ0A 3PACA 4FVMA 2C2EA 2E7WA 2RUGA 3ZZUA 2YWHA 3PKYA 5KG0A 1B0VA 2AJQA 1LW0B 4LF4F 1VRTA 4YR2A 5KG1A 2X1AA 3Q8SB 3CCES 2XWXA 1X5SA 2KYZA 2IYIA 4P6QA