1OQ6A

Solution structure of copper-s46v copa from bacillus subtilis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGYHVVIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potential copper-transporting ATPase
publication title A core mutation affecting the folding properties of a soluble domain of the ATPase protein CopA from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 14
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1oq6A00
2KKHA 2LXFA 3LGNA 2GCFA 2XMUA 1CC7A 2K2PA 2FHMA 3CJKA 2HIQA 2AJ0A 3UDCA 5B0FA 2GA7A 2OD4A 1P6TA 2XMWA 4NL5A 4Q2MA 4YEAA 1APSA 1TL5A 1OSDA 2QYCA 3HFKA 2BJDA 3HHLB 2AP6A 4YDXA 3BN7A 2HFNA 1V3ZA 5B09A 4DPOA 2QIFA 1KVJA 1TUVA 2JDJA 2VV5A 1OPZA 2IYIA 1X0PA 3BR8A 3F44A 4HH0A 1FD8A 1Y0HA 2N4DA 3BGUA 3WDOA 4ZA1A 2Q3PA 5T7LB 1FE4A 2K1RA 4A48A 3LO3A 2QLXA 3FGVA 2QLWA 3DXSX 3KG1A 1Q53A 4FNHA 5B08A 1KQKA 1CC8A 1N5TA 1VQYA 4QOTA 1MWZA 3BF4A 1XBWA 3BM7A 1FESA 2IFXA 1SB6A 2PGCA 3DCAA 5B0AA 2RMLA 1IUJA 2FB0A 4HI1A 3FMBA 1R6YA 1W2IA 3TNVA 2W4CA 1RJJA 1MWYA 1U7LA 4Q2LA 5B0BA 1YJTA 1FVSA 1N5SA 1Y9OA 3KNGA 4Y2KA 2ROGA 1TR0A 2FTRA 2K7KA 3LGMA 3TRGA 1WD6A 3HX9A 2HLUA 1ULRA 4HI2A 2GV1A 2GGPA 2OAUA 3QGPA 3FRYA 1LQ9A 2AJ1A 2ASYA 4NPOA 1KVIA 2IYGA 2XMJA 2CRLA 5F0WA 5K9FA 5IXUA 1Q4RA 1K0VA 1TZ0A 4HH1A 2W4PA 1S6UA 2OD6A 1P8GA 3BB5A 2KYZA 2N7YA 2ACYA 2XMMA 4A46A 4OJ1A 1VQSA 4FNIA 4DL0C 2W4DA 5A6WA 1AW0A 5F0UA 3CJKB 3IWXA 2FIUA 1JK9B 3MCSA 5B0EA 1TL4A 4A4JA 4DN9A 3HHLA 1S6OA 2L3MA 4ZOSA 2N4CA 2BUNA 2LDIA 2LQ9A 4Y2MA 4U9RA 2LQBA 5KAKA 2RU9A 1X7VA 2PD1A 4OJGA 1YRXA 1N5VA 3HF5A 2HLTA 2RILA 1SI9A 2GGPB 4OIXA 3QMQA 4OJ3A 2BBEA 2EW9A 3E8OA 2BYCA 2XMTA 1QUPA 2K1RB 3KG0A 5B0CA 2KT3A 2GFFA 1X8DA 2OMOA 2ZDPA 3HDSA 1AFIA 1URRA 2OP5A 1Y3KA 1YG0A 2BJEA 2KT2A 2ROEA 3T9NA 3TOQA 3KKFA 1SQEA 2XMKA 2HFOA 1N5QA 1JWWA 2HQIA 2XMVA 2AW0A 1YJUA 1AFJA 2K7JA 3HHLC 3VTIA 2RSQA 1FVQA 3I9ZA 2OFHX 1GXTA 2G9OA 2ZDOA 3K7RA 5B0GA 5B0DA 1OQ3A 1CPZA 1Y3JA 4HL9A 4EFAC 2GO8A 1FEEA 4Y2IA 2ROPA 3IWLA 4OJHA 1FE0A 1GXUA 2OFGX 3HHLD 3MZIA 2OKQA 5T7LA 1YJRA 1Q8BA 3BDEA 1Q8LA 4A47A 4F67A 5A6PA 1OQ6A 1YJVA 3GZ7A 2VH7A
chains in the Genus database with same CATH superfamily
1JLFA 2FJAB 1M1GA 3FZ2A 4UOFA 2Z2MA 1QAIA 2U1AA 4K50A 1EP4B 4P2FA 4F02A 1ZOTA 3I96A 4NYOA 3QRRA 2AJ2A 3ICLA 4K4XA 5LM7E 2HGMA 3HCXA 2RDIA 1IM4A 1BWVA 1S1UA 3GIRA 1ZM3A 1UEKA 3POTA 4QWAA 1FWKA 4OYPA 1JLQA 5LMUF 4XTTA 2N7CA 3C6TB 2NREA 2PEBA 1TZ0A 2DH7A 4ECTA 3GE9A 3KLHB 3R1LA 1PAEX 4DOZA 3P96A 3WX8A 3DGVA 3KJVA 3M8RA 2HBQB 2IIHA 3CXCR 4ECUA 1XN9A 2K1RB 1D8YA 4JI4F 4DCPB 4ICLA 5M2UA 1QDUB 5B0GA 1TQLA 1NB7A 3OVSA 3I0SB 4J91A 1R0CB 1S1XA 1FJGF 3C15B 3H7HB 5IT4A 1D9DA 1QAJA 4LF9J 4Y3CA 2G2YA 4GKJF 1NSAA 2ERRA 2CJKA 2VV5A 4W92B 3PX4A 3DN9A 4LBIA 5EUHA 3G9CA 4LSLB 2QLXA 1NDCA 4B3RF 2QLWA 4I2PB 4RO0A 4DL3A 4USIA 3AD7C 3T3FA 1RTHA 4EYIB 4O4GB 1RUSA 3ENAA 1FHTA 3GFYA 2E1AA 3PYDA 1XMBA 3MR7A 5IV3A 3UR0A 1EX8A 1F9HA 2E66A 3M8PA 3T1HJ 4NXMF 4P2MA 2NXJA 4FYVB 3C6UB 3QJJA 3D1OA 1KSPA 3B8HA 2DHSA 2VKRA 2KXHA 2XYPB 4P52A 4I69A 3IXQA 1RT5A 2GHWA 1SJFA 2A6MA 3VZIA 4I7FA 5LMNF 5A8WA 3HULA 4PEOA 2ASLA 1UZDA 3CT9A 3GMGA 2GO8A 5HJXA 2KM8C 3B6BA 4DQQA 2XC9A 3RR7A 5H9FJ 2YNFA 3RR8A 2IAJB 3BPSP 3MM8A 2BOPA 3JSRA 4A8YA 5EWFA 1U1KA 4FYXB 2MQOA 3GFHA 4O3PA 2M4MA 3H2LA 3MCMA 1BHNA 2VG7A 2XGPA 5LL6d 5AXNA 4ZIWA 1RTDB 4AD6A 5JUMA 2XCAA 8RUCA 1NJXA 5ETSA 3GR1A 4B02A 5E3CA 4TU8A 5A6WA 4KFBA 3HJVA 2UUAJ 2CPYA 2XSJA 2DGOA 1XR6A 2N4CA 4OJGA 2IM0A 3GU0A 3HHDA 1U47A 3MECB 1U09A 2LQJA 2D41A 2DB1A 2P9EA 1VQPS 2E9ZA 4FS2A 3HVWA 1YI2S 2LP4A 3I32A 3OFHA 3L4BC 1JJ2R 1S1VA 3M2VB 3TZYA 3K5PA 2MKIA 2ADCA 3ISND 2OEMA 4BDPA 1MROA 2F63A 3KWMA 2VH7A 4NMXA 2QA4S 1NSQA 3HPOA 2V50A 3V6DA 4OYIA 1OSDA 2I6WA 4IOBA 4Z7YA 3ZC4A 1F3VA 2ZBRA 4LF6J 1G7CB 2M8HA 3I87A 3OR2B 4UUWA 3UQSA 3FKBA 2ZVSA 1TKTB 2ZC4A 3MPDA 4L72B 2OPSA 4Y65A 2VQEJ 1SV5B 3B82A 1VK8A 3KK3A 2EG1A 4F3OA 4QWDA 2C2EA 3V6HA 4TNOA 4HH1A 5DLFA 3M4XA 3Q23A 3H25A 4OHXA 2RU9A 1K44A 1N54B 1RWNB 4U95A 5J2PA 4PUOB 3CDBA 3TP2A 1RT4A 2QL5B 1Y3KA 2BE9B 1NZAA 4XIUA 1C1BB 1LWEA 1RI7A 2DITA 3PCOB 4R8UA 4NLYA 1S12A 4CNZA 2XWYA 1NK8A 4DG1B 3FEYB 2AP6A 5AE3A 4ER8A 1CJKB 1MG7A 1FD2A 2R7WA 3OVAA 4DR1F 3QGGA 3HSZA 2YKOA 4ZLLA 3MI7X 2WONB 4M8LA 4OI2A 2V4JA 2EK1A 4F2RA 1IKVB 4RZRA 4DX5A 4ZMMA 5GAEU 5JMNA 1Q4RA 3QFWA 3A1YG 3I5AA 4DSIA 3MM7A 2RE1A 2XS7A 2ZWOA 1D3WA 4PG4A 1FJCA 4MIBA 3UO0A 4DUYF 4PG5A 2MKSA 5KFMA 1HYSB 2R2RA 3GR0A 2LYVA 1S72S 2RILA 4ES2A 3G6XA 3LTOA 3MD1A 2CZVC 2NCKL 1OY8A 1HPZB 4KRWA 3ELHA 3KKFA 3KMSA 3QATA 1KQFB 3BQ1A 2NSCA 1MLAA 5FDLA 3QJPA 5F8LA 1AXQA 1JLCB 2D74B 1HNXF 1KQGB 1TKXA 1SQFA 2CPJA 2J5AA 2YH0A 4YY3J 3S1TA 2GA7A 2G0CA 1RK8A 2XHWA 4RJVA 3JTNA 4YB7A 4DR7F 1OPZA 4U67Q 3PR4A 3IRWP 1RT7A 2VPZB 2H9ZA 4TN2A 1UVNA 4RU2A 1IJFB 2IJRA 3KJQB 2JEJA 4PWDB 1EZZB 2BDPA 1JLEA 3C16B 2XY5A 3GV7B 2B7CB 3V81A 1TL1A 2DEIA 2GMLA 2UZAA 4NLGA 1JLBA 4ZCKA 3CNQP 5KFZA 5K20B 2AEJA 5KG3A 4RU9A 2GJ2A 4M95A 2J7KA 4DPTA 5LJ3Y 5J1NA 4ED5A 3V4IB 1HIYA 2B5JB 3D54A 2GC8A 3ET6A 3I5CA 3D6HB 4J9RA 2DO0A 4JI5F 3W64A 1EHWA 4MKBA 2VC0A 1KEKA 3QWPA 4YB5A 4CM2A 1RBOB 4LBPA 3UR3C 4IRKA 4JI6J 1HLWA 3OTDA 2E7VA 2YWFA 1WOOA 1KNZA 5GAEI 4ZJLA 3G8TA 2XEXA 3KHHA 2FLPA 1U1PA 4CT9A 3ENWA 5HVFA 2ZNZA 2YX1A 1RYRA 3VGSA 4RNHA 2UUWA 3EPIA 3FBEA 5GAGU 3QBCA 3RB4A 3DLKB 3C6UA 3PO5A 2FTRA 3IGVA 2Y1LB 3AHPA 2EKNA 5F0WA 4B3OB 2OPRB 3AA9A 4IO9Q 3IWXA 2P2CB 7FDRA 1HKAA 1UPMB 4DL7A 1PILA 2B56A 4HLBA 2R7UA 4QWBA 3OTOF 4EEYA 1HARA 1ZTWA 3KFWX 3MDFA 2IAJA 2XMKA 3PM9A 2UXBF 1WUUA 5L1IA 2XWXA 4R25A 4AL7A 2F7VA 4URSA 1FJEB 1M0SA 3SSSA 3ZFVA 1TV6A 2KO1A 2RU3A 4HACB 2B8PA 3R5CA 4F4YA 2KXFA 2DKOB 1H2UX 2MB0B 3W5XA 3K17A 2OEKA 3EGVA 4F50A 3HFKA 1WC4A 5A8RA 2C28A 1N5YA 4KY3A 4F2SA 2IC3A 2X51A 4ECVA 4RW6B 2VONA 1WOPA 1NEEA 3A13A 1AZSA 2AYGA 4X4PA 1IWAA 1ZZNA 3P3DA 4KT0C 5KFNA 3W2WB 2ASYA 5EWGA 3MUTP 3RBEA 3DLLQ 4Y28C 4JI8F 4RBVA 1NK9A 5C24A 3NEKA 2AKWB 2UXDJ 2AIRB 4WK1A 4OYZA 4Q45A 4J9KA 3KOAA 1NJZA 4Q44A 1YG0A 2ROEA 1S0MA 5GAGI 5AE1A 2DO4A 2R8HA 2C3UA 1SJ4P 2HHXA 3U1LA 1CC7A 1FT8A 1IQZA 5J2MA 4PG7A 2HW3A 3BR9A 5HLFA 3A8EA 1WTFA 4C11A 1JLGA 1VHIA 5D6GA 5KFKA 2QA1A 2V4QA 2IRUA 4LMZA 4MFBB 4LFAF 3ENQA 3D5MA 1WI8A 2DRDA 6AT1B 4GO7X 4L3NA 1IM6A 2EEYA 3KLFA 4JI0F 4DFMA 4ZS6A 1X4CA 5CQGA 4OYMA 2VU5A 2VICA 1BLUA 2RQ4A 3EGNA 2B7BB 1KR4A 2CZ9A 4M5JA 5C42A 1B64A 2OSQA 3R6LB 4L74A 3QO9B 1REVA 1G1XA 3M32A 4NLQA 4USMA 4ZPDA 5MAOA 4O44A 5CYQA 4DG1A 1HBUB 5BYRA 4FPRA 5ITHA 4DV0F 1LNQA 4ZVOB 2ZNYA 2VZ9A 5CD4A 3M30A 1I94J 1FRLA 2ZZMA 3IWLA 1FE0A 1X5PA 1UFLA 1M1KT 1NSPA 1PIEA 2WONA 2ZOGA 5B0FA 4M63A 3IG1B 1T3OA 5HANA 2CVEA 2E1MC 5LOQA 4OZ0A 3KMQA 3I4PA 4FF1A 2VG5B 3LOUA 4I64A 2YY3A 5A76A 4GKKJ 4IRCA 3CJ4A 3I9V9 3HSGA 3W3SA 4QIEA 2QG9B 4WU3A 3NCRA 2CQBA 3W9JA 3BQ2A 1HPZA 3NMAA 3K8WA 4DV7J 2RF2B 4DEZA 1NHUA 3G6YA 4YUDA 5A0YA 2YNIB 2X1AA 4NLOA 5HQLA 4EZ6A 4ZVHA 1ICEB 3KK2A 4MYUA 2GMHA 4NOHA 3FSIA 1FK9B 3TEGA 2PN6A 4OZ3A 1FKAF 4ZIVA 2PA8D 4N76A 3NWGA 1WORA 2KG0A 1NKEA 2JEFA 3P4UB 2FHMA 2HIQA 3Q86A 4DR5F 1RZMA 2XLIA 1APSA 2P6TA 3LPEA 4N77A 3BGRB 3DRXA 2JDJA 3IBWA 2E9TA 2ZM6J 2XS2A 1NK5A 5KT3A 4DV6F 2Q3PA 3M2UA 1CJUB 1NH7A 2B5JA 3BF4A 3RB0A 1T9UA 2DR7A 2E1PA 3P49B 1FVSA 3AB2B 3BO3A 2ROGA 1T11A 3F41A 3B78A 1Y4ZB 4ECWA 4DV5J 4CNYA 4LFCJ 1RHMB 1T02A 3NG8A 4YOEA 3BS9A 2JZ5A 3A8KA 2HVEA 5HROA 2YKAA 1Q7YT 2UXCJ 2ZKUA 4NASA 2QE5A 2EI5A 3LP0A 5KFPA 3EVWA 4JV5F 5KG1A 2MGZB 2HPUA 3PFOA 2ZH6A 3LW5C 2CWKA 1RAJA 4ZK7M 2AT1B 1Q1KA 2Y8YA 2XLJA 1BQNA 3SI8A 3PJWA 2KVIA 2L9DA 4UF4A 2OPQA 3DNCA 4MKYA 2B4UA 2EFVA 4NCGA 3SIPB 1WTBA 2HKEA 2ILZA 3HK2A 4ITSA 4B3OA 5K14B 3FGVA 1BE4A 2D69A 2BJ7A 1PSDA 2ZBQA 4C98A 4RUHA 1R6YA 4Q2LA 2N82B 1DARA 2FDNA 3RAXA 5CYJA 5HMXA 1X5TA 1BD6A 3DKDA 1H6KX 1RHKB 3RTVA 1RACB 1RT6B 4ELUA 3MCSA 4DR4J 2V8HA 4ZOSA 3Q8PB 1S6QB 3AOCA 3DFEA 2WK4A 1PBUA 1RWPB 5HI7A 2Y0BB 3MD3A 1BQMB 3W2VB 4C0HA 3QGHA 1KS2A 4HDGA 1CLFA 3PJXA 3JXOA 1B0PA 2RAQA 1RT3B 3ITHA 4OYOA 1JXEA 2OIHA 2BE2A 3GONA 2M0GB 2V2ZA 3BN7A 2MPUA 2HHUA 2YWWA 4NLDA 4I4BA 4KAIA 5KFBA 1E6VA 4R5PA 3I31A 4J9UE 3MR2A 2MKJA 3UN3A 2HFSA 2DGSA 3WIUA 2F5GA 3LPYA 1C2PA 4DHVA 2LCWA 1SQGA 4YN3B 4J9NA 1LK7A 2D3UA 1L3TA 3UD3P 2BKPA 1WD6A 1HWUA 4BBYA 2FLOA 5ETVA 3IO1A 3TO8A 2AEFA 5I42B 2AX1A 1NMEB 4A4JA 2ZH2A 4C8LA 5IV4A 4A8KA 4U9RA 3EJMA 1C0UA 1KBRA 2AJ4A 4LF8F 5D78A 3LAKA 3UVJB 1GTEA 1SKUB 1FNXH 2ABYA 4L6V3 2F4VJ 2JJ4D 3TJAA 3QWUA 1KLNA 4LF4F 5E3PA 3OFFA 4PQUB 1VRTA 3R7BB 2E7XA 2C3MA 4LSNA 3UFCX 2J6TA 3EZ5A 2C22A 4I2QB 1JMTA 1ZM4A 2QYGA 4CQ1A 1FE4A 4CO3A 3V4MA 1CC8A 1NK7A 1W7WA 1M1HA 4PXCA 4UZBA 4J9PA 1SL2A 1GH8A 3E01A 1Q86T 3HKZD 2QL7B 2E5LJ 3H20A 2F9DA 4X4SA 1GAOA 1G4CA 4OX8A 4LJMA 3J80U 2DY9A 4EYHB 1O8BA 3WQPA 4PXEA 1WKLA 1NNDA 3TUIC 1YIJS 1WG4A 4IG0B 3ISNC 2IVMA 8ATCB 3VAKA 2LQ9A 2LLZA 4IUFA 2BBEA 2EW9A 1WACA 2XZDB 3NGDA 1AFIA 2MDAA 5D77A 4ZHRA 1VFJA 4KV8B 2XGQA 4YFUA 2AX0A 3DOMB 3FVYA 2W9CA 1SKSA 2RSQA 3QNWB 4RW9B 3OTEA 2BM1A 2W2PP 1FDDA 1HWJA 3OSNA 4DCJB 2BJ1A 2VG5A 1Q8LA 2GVDA 5A2QU 3MAAA 2CG4A 3H98A 5GAHU 2C2DA 3T5LA 3G8SA 2CPEA 4EO8A 1UW9A 1SH3A 1MSWD 4V1Ak 5KT2A 2OI2A 1YK9A 4FVCA 1MMDA 2QMWA 3QRQA 4LF9F 3T9ZA 3FDSA 2RMLA 3FJ2A 4NA1A 3GIJA 2A3JA 1TVRA 1MWYA 4WJBA 2HLUA 2EFGA 5K8NA 5GMDA 2RB7A 2EBEA 1TK5A 1FEHA 2FJDB 1RWKB 1FK9A 1SC1B 4JI3J 4MYTA 4DFKA 1Q95G 5HMZA 4IKAA 4GO5X 1FERA 3QZ8A 4B9SA 2BX6A 2MZJA 3CC2S 5IOLA 1RU1A 1KDNA 5J2QB 1SIZA 2WVBA 3EDQB 3OSPA 2AV5A 3T1HF 2GS8A 2HFOA 3ZZYA 5F3TA 2V8DA 1A6LA 3R3TA 4X4UA 4TY8A 3BGRA 1P9QC 4KPYA 2V69A 4DR6J 2ROPA 3DOLA 2V9KA 5FLXU 1UVKA 2EXUA 2J7WA 3CCRS 3VAHA 3CMQA 2FC8A 3HXMA 3L7PA 3VR1A 4U7UD 2JFDA 4M94A 3MPYA 5KFGA 4QOTA 4K2JA 1HD0A 3UDLA 3PJ9A 4BS2A 3C2PA 3K2YA 3VF0B 5ETMA 1H72C 1U1NA 1L3KA 1TMJA 3PHTA 2ZEJA 3OR1B 3R2CJ 1V5VA 3IN5A 2FJEB 1FX2A 5GAHI 4YR0A 3K57A 3I0RA 1M5HA 4OLOA 3EXCX 4OJ3A 1WEYA 1RWVB 2UUAF 2OPPB 3NCQA 2F1FA 2XNRA 2HNZB 3A8IA 2HK3A 2ZD1B 2A0FB 3EVOA 3DGPA 4F0MA 2K7JA 4ZP8A 5L38A 2VHGA 1XNQJ 4OJHA 1RBAA 3TVZA 1KRPA 4HI2A 2DXFA 1H73A 5E7OB 2PFFB 4YHHJ 4B3MJ 4CO2A 2DNPA 1WSRA 1ZAWA 3WDOA 2HMIA 3TUJC 2FVCA 5B08A 1RT6A 2OEJA 2HZCA 4IFYB 1UVLA 3DCAA 3SCIE 3R5GA 4Q43A 4LF6F 1OJ4A 1UPPA 4X65J 2VQFJ 4Y2KA 2Y9HA 3K5LA 3MTKA 3FSYA 1RCOB 2H4WB 1S99A 4Y34A 1QUVA 4DL6A 2VQEF 4PKDB 2GAHC 3NGKA 2QFIA 3HFVA 3QFHA 3MEDA 3K5NA 1KFSA 1O5JA 3OJSA 4KHMA 3NS7B 1QSSA 3ZNJ1 4F0HA 4OYWA 2G2ZA 4MK7A 1Y00A 4ZP6A 5KFAA 2OUGA 7AT1B 2FGOA 8AT1B 2WHOA 1H7XA 1X4GA 3IMQJ 2DCUB 1R89A 3L7UA 3UDVA 2PMWA 2QA4G 1JLAA 2PIIA 2M3DA 1FJ7A 4GVBB 1JKHB 3DLHA 2CDQA 1R0AB 3C14B 1DTTB 1WF2A 3CGIA 2LECA 1B0TA 3L9ZA 1MU2B 1P6TA 2XQCA 1M5PC 1RLDA 3HHLB 1W2BR 5E33A 1YQHA 1S76D 2E29A 3OFEA 3NMRA 2HYIB 3AY0A 1XBWA 3OFGA 3KG4A 1U2FA 4C48A 4O3QA 1U4BA 4W4MA 3PACA 2WRMA 1U1RA 1VBZA 4NEYA 3N5FA 3UVJA 5F8IA 4KGKA 2WCXA 3OXLA 3VVUA 3M2RB 5D4OA 3PZPA 4QPXA 3ZTRA 3DLEB 2VPYB 1C1CA 3NGRA 1UJ5A 1DHMA 2FZCB 2CPZA 4IG3B 1LOUA 2W9BB 2H4YB 4H4OB 2B9YA 4OQJA 4PQUA 2XI2A 4M5DA 4FBUA 1X4HA 5HQMA 3WZ0A 3KK1B 4CYUA 2W8LA 1KOOA 1UKUA 4I2QA 5D15A 1GXUA 4K4ZA 2YNHB 4F67A 3AXMA 5KFEA 3SCLE 1JQGA 4WP9A 4UY85 2L9NA 2YKMB 2RHSB 4E98A 3GPAA 1J5OB 4KH1B 2OD4A 2XMWA 1VBYA 1OYDA 3PRBA 1TKDA 2GQQA 5C2CA 2FZKB 1C4CA 5K8OA 1F0XA 1WDDA 2Q66A 3K89A 4YY3F 3OUYB 2GZOA 4N56A 4X2BA 3AJ1A 4IG0A 4NLXA 4B08A 3BSNA 3LP1B 5HVGA 5BJRA 2DH8A 3AD9C 1SJ3P 1KVIA 2VF3A 2ZE2A 3NS6A 2LMIA 3CJ2A 4ES1A 4KV8A 5K8MA 4OYAA 4FF4A 3LQVA 3T1AA 4RW9A 2MKCA 2ILYA 5KAKA 2R42A 2JFKA 3UNGC 1S9GB 3H0PA 4C0BA 5L9XA 4G1IA 2IMWP 5CXTA 1UWBB 1VQ9S 3M9OB 2OFHX 4BWJA 4EFAC 1U25A 5CCMA 1RAEB 4GC7A 3RU0A 4C0OC 2MQMA 2FVPA 1F60B 3DC2A 2HQGA 4JI6F 2DH9A 2MHEA 1HWIA 2EFNA 4DU7A 5HN0A 1ZM2A 1HWLA 2C3YA 1NRKA 2JRSA 1FRMA 2H5EA 3HM9A 5KFIA 3ZNUA 2DVIA 1UVMA 1SB6A 4UT4A 5B0BA 3JYTA 4U96A 1HNIA 4OYXA 2POKA 3VQTA 3EWGA 1H0HB 4RL1A 3H2UB 3FNNA 1YJWS 1KHWA 1FDAA 2A2DA 2N7YA 1U1LA 2ZHOA 3ZO7A 1LW0B 2Y8WA 5E3AA 3S8SA 4RW4B 4DV4J 1T05B 5LSRA 1QVGR 1FFWB 1YRXA 3MMAB 3N28A 1FNMA 1NDKA 2KHCA 4ATNA 4DQIA 2RD5C 5B0CA 4NZ0A 2ZDPA 3MF5A 1LW2B 3U1MA 2C2ZB 2CA9A 4K5SA 3BBCA 4F4XA 2VB6A 3RG6A 3DLGA 1F5BA 4LF1A 3KLGB 5B7WA 3GWCA 1HBMB 2RKIB 2BQUA 3JTPA 2AWZA 3CJKA 2LEBA 1EETB 3BBBA 3G6VA 4YDDB 1RU2A 4A8QA 3OTBA 1IQTA 4OYBA 2H54B 5DQHA 3FMBA 3CJ8A 3OR1A 2ZVIA 4FPIA 5MLCV 4CLFA 4A8FA 4F4KA 3CO9A 3RB6A 4DFJA 3MM6B 1T9VA 1HI1A 5HBMA 1TELA 2YWGA 5DG9A 2E1RA 5DG7A 4HHHA 2MJUA 4HVZA 1HBNB 1B99A 4K5RA 2CJAA 4QWCA 2W1BA 3D67A 1HFEL 4CO1A 2UXDF 1L5UA 4N41A 3PY8A 4PQAA 2KJWA 4JV2A 4TLRA 4IFYA 1OO0B 3D68A 2ATCB 3CWJA 1M5VC 2MLZA 3W61A 3ZXWA 3RRKA 4Q8EA 1L3VA 1K47A 2HFUA 1ROFA 1C0TB 2WVEA 2XZTB 4I1TA 2OTJS 1GNKA 5IXUA 2AHOB 1K0VA 4KKOA 1VIXA 2VASA 2XMMA 2IPOB 1M5OC 6FDRA 2ZH9A 1KD1T 3EVMA 1LK5A 5KG2A 1DQ8A 5D8HB 5CABA 1AUDA 2CKWA 3BSOA 3BQ0A 5L39A 1HMVA 1SQEA 1HL6A 4FYDA 5IT0A 5LXYA 4CH1A 4LFBJ 2AYEA 4DZDA 3TZXA 2VG6B 3P8BB 4DV1J 2QMXA 1S1TA 1J5EJ 3IFEA 1HNVB 4X62J 2ZJPQ 5F9NA 3NBPB 1U0HA 4CP5A 1WHYA 2PEHA 1N36J 1UMJA 1I94F 1MN9A 4CLLA 4F4WA 5FD1A 4KGXB 1WC1A 5J2NB 5G4DA 1R43A 2HHHJ 1NZ8A 1S9EB 1I5OB 4XPCA 3DLEA 4TY9A 3FFIA 4ZPAA 4QQBA 5I3UB 4ZLJA 2ZH5A 2EPIA 2V2KA 4AT1B 2MQQA 4GKKF 2EFOA 4OFZA 3DHXA 3BH6B 5F8MA 3KK1A 2GVZB 3LP2A 2IDEA 1VQ5S 3TX8A 1WG1A 3NLCA 1N0UA 2RRBA 1K1SA 3QZ7A 4KO0B 5EWEA 2YKMA 3CMAS 5J1EB 4DV7F 2B51A 4URGA 1YRUA 4K4TA 3SV4A 3GIKA 3KJFB 2HQ3A 2KFNA 3ETMA 2PI5A 2VUGA 3F56A 4AE5A 3OUYA 4IOCQ 1MN7A 5KFFA 2GCFA 2FLNA 3I82A 3I55S 3LP1A 1MMLA 1X9WA 1R8AA 3CJ5A 1W26A 3JSMB 2GHVC 2YNGB 1HNWJ 1NHVA 3D1QA 2J9DE 3OL9A 3M1VB 2Z57B 4FNHA 2DNNA 3VAGA 2B0GA 1Q81T 3DI6A 4J37A 5JJBA 4K0KJ 2LQ5A 1HQ2A 4KQZA 4WZQA 2R7OA 3T5HA 2ZM6F 1Z1ZA 1NKBA 2DNHA 2KM8B 1VQ7S 1S9GA 2HHVA 4NLSA 2ZH8A 4NEZA 4QZVB 2MLXA 3WBZA 5KFQA 5B0EA 1JK9B 1U6FA 1YBUA 3NKYA 1KP6A 5DDPC 3N4WA 1HNZJ 5DDQC 1R6VA 4DV5F 4PCQA 3R5AA 1VGYA 5BYQA 4LFCF 2V6AA 3QQCD 3QIPB 3KLIA 3G71S 1NSKL 4K4VA 1PYTA 5HP1A 2CAJA 4P10A 4B9TA 2UXCF 4I68A 4EU0A 3VGUA 4IQMA 5L1JA 2BRKA 3W9IA 2W7AA 4FBTA 1IKXB 5KG7A 1WJ9A 2VBWA 4F36A 2V2VA 4A8WA 4DS4A 1LWXA 2Y3YA 2G0JA 5L9NA 3QGIA 1CS4B 2H65B 4Q0BB 3HT3A 2J0SD 1FTCA 1QM9A 3RGIA 3N6NA 5L1KA 2J9DA 3UCUP 1S6PB 3TANA 2H5JB 3DXSX 5IQQA 3THVA 3RBDA 1LW0A 2CIMA 4NRTA 3F0NA 3OL6A 3W5ZA 1UEUA 3V5RA 4RUCA 3M6VA 4FKXA 1TL3B 3Q24A 3HVTB 3GJRB 3AOBA 3TUPA 2HNDA 4PAAA 1LW2A 3PXGa 4CIOA 2QSFA 2WB4A 2CQ3A 4ZP9A 4WTOB 2BA9A 4M5MA 4DR4F 3CCSS 2JC1A 5KFHA 4RKUC 2DNMA 5CD4H 4RNOA 1VLOA 1QAXA 3EGWB 3JB9k 1ELOA 1X0FA 4TU7A 4JI1J 2F8EX 5G0RA 1CQMA 5DS7A 2H1YA 1HQEB 3MEKA 1PG5B 5DDOC 4CO0A 3VHQA 4LSZB 2R8IA 3OJUA 1L3UA 4R0JA 5H9EK 2YQ0A 1FDBA 1RHUB 2ZOMA 4G1QB 4IDKB 2CG8A 3K59A 3V6KA 4LRAA 1BUXA 4OIXA 5DGBA 2D3OR 1X8DA 4USVA 1NDLA 2ALZA 4LIWA 5KFXA 2X1GA 2IRYA 2YX4A 4MK8A 2LU1A 1IKWA 2R7VA 4N5SA 2BQRA 2BABA 4KPCA 4DSFA 1UZHA 2WBRA 3MHYA 2F4VF 1RAGB 2LEAA 2YKPA 2QV6A 4NLUA 2KJVA 1ZA2B 1VRUA 3P45B 4UTGA 1S7IA 3R8YA 3LWMA 5CYMA 3IS9A 4WZMA 4A48A 1ZM9A 1NHKL 5T41A 2V4RA 3BM7A 3DM2B 3M8SA 3R6GB 1XNRJ 3N0VA 1SUQA 2XYHB 3AODA 1SBRA 3Q8SB 4WE1B 3PYEA 1U2RA 1NPPA 1QSLA 4A8SA 1RB0A 1VISA 4AXIA 2DRBA 2JVRA 2RRAA 2E5LF 2K06A 3JQKA 4ZVQB 5GADU 2GGPB 3ZZUA 1ZBTA 1U8WA 1RWWB 3MUMP 5C7PA 1UA1A 1K9MT 2VBXA 3M8QA 1VK3A 3UN2A 2J8SA 1T9WA 4P71A 2GJFA 5J2NA 4K59A 1YJVA 1UVIA 3NRBA 2YH1A 2BR0A 4EWTA 4NXNJ 5ETNA 4MKVA 4C8ZA 4ANEA 4I56A 2B43A 4ZCIA 1IWGA 3Q83A 2KB2A 2B6AB 1ACMB 1KONA 3GG1A 1NDPA 5T7LB 3NP5A 1TAUA 1HQUB 3HP6A 3UD4P 1JJ4A 4TYAA 2W9AA 4DV3J 4QW9A 2R9LA 1VQ4S 1WF0A 2UVRA 2G1HA 2HQCA 1KLMA 5HL7Q 4R0EA 4KBIA 1NPRA 2J76E 2E7WA 1N56A 1JNRB 3AFGA 2MQNA 1CJVB 3C8YA 2DHGA 2MZRA 4ELVA 1REGX 4X64J 3TA0A 4CLUA 1IR1A 4GC6A 3P5TL 4Y0FA 4JI3F 4EO6A 1RYSA 1IKYA 2QO3A 3PW0A 5DLGA 4IRDA 4KIAA 5C25A 2B9WA 2NPIA 1NUEA 4NI2B 1FA0A 1N6QB 4DX7A 3JSMA 1ZTTA 3SZ2A 4JP8A 2GW8A 3P5BP 4ED8A 1RT1A 3CC4S 4B9LA 4C3KA 2CQCA 4ZVUB 4B3TJ 5F8GA 3ZZPA 2OH2A 3S7RA 3MEGB 4DR6F 3D66A 3MMCA 1XMQJ 4LQ9A 3O3LA 3SFGA 2Y0SD 1P9YA 4Q7AA 4TQSA 5GADI 4KHPJ 1IUJA 2YKNB 4M5NA 4X66J 3KNGA 4YR3A 5KFCA 1P27B 3L7OA 1G2EA 3FEZA 2IYGA 4DR2F 2KTQA 4RW8A 4OX7A 5KFYA 3VZHA 3DOKB 1UETA 2XYGB 1TUWA 1IBLJ 3DXBA 1XMOJ 1UWAA 3B54A 1S48A 5LSOA 1S9FA 2LA4A 2MJNA 2V8GA 5ETTA 3HSJA 2MSTA 4O3SA 2HWTA 3FBCA 4H54A 1TAQA 4I6AA 4U7UK 1TTHB 2ZBIA 1SXLA 1IBKJ 4OI3A 5C2GA 4L3KA 2CPXA 3GFZA 2ZDOA 4QYZK 2P6SA 4W90B 2OFGX 2OKQA 3OV7A 1X4FA 3C66A 2QZ8A 1WOSA 1HR0J 4A8XA 1TK0A 2ADBA 2IM3A 2HNYA 5IS2A 2MYFA 4AL6A 1FWPA 1GT8A 1XNQF 4PG8A 2XM3A 3BYRA 3C19A 5KFTA 2YTCA 1FCAA 3OQ2A 1R8PA 1RKIA 1OWXA 4B3MF 1TU0B 3ZTPA 2DR5A 1JXVA 4HI1A 3SQGA 3PV8A 5BR8J 4ECQA 1VC0A 2AMCB 2LQ8A 2HHQA 1RTJA 1HA1A 2I38A 1WDTA 2RT3A 1TL4A 3ZZTA 2VQFF 4X65F 1HI8A 2OTLS 3MM9B 1R8CA 4JI7J 2HS3A 3Q2SC 2FJBB 2IVFB 3CCZA 1U6BA 1FRXA 4XPEA 1WC0A 3H2VE 2KI2A 1F5CA 3KLEA 2H48B 1Y3JA 1PAUB 3DRSB 3QLHA 1ZH5A 3BKTA 3CULA 4N8OA 4OHYA 2NSBA 3ILJA 3MEEA 2OHDA 1HQEA 5DM6Q 1T9TA 4O0IA 3CJ0A 5B09A 3MXHP 1LFWA 2W2MP 1WKKA 3TAMB 4I67A 1CULB 3HKWA 3SDEB 2MKHA 2LXUA 3IRXA 1VQYA 3TA1A 4C97A 3ONQA 3UW1A 3HI9A 2W4CA 2ZUGA 4NX9A 3ILIA 4C6AA 1LWFA 2CWXA 3PHEA 3OLAA 4MIWA 4DSEA 2IRXA 4RWWA 1RGVA 1NAQA 1DURA 2MQ8A 1QLNA 2F9JA 2AZ3A 1RCXB 1J2VA 2NXNA 3H4DA 3FCWA 3DRRA 3E8OA 1PC5A 1DY3A 1NK0A 2J9EA 2RDDA 2FPHX 1VHFA 4M1KA 2IM2A 2CYYA 2FVSA 2Q43A 4Y2CA 4IQXA 2HWIA 4RW7A 1DQ9A 3SCKE 3JS9A 2ASDA 3TW0A 3NXZA 3CIZA 4YS2A 3PKYA 1RTIB 4ILRA 1S1WB 4IFVA 1YBAA 3MUVP 4ZVRB 1FKOB 3M7VA 1S59A 1GMUA 3CDEA 2DGVA 2DTJA 4HDHA 2DT9A 2RHQB 3L09A 2ACMA 4OHWA 4ELTA 1WHWA 2C3PA 4NYZA 4JYAJ 2GGPA 3CE8A 5SZTA 3BREA 2I5JA 1FWLA 2O3DA 3TQEA 1EP4A 2MY8A 3JAMY 3DRPB 2G0IA 4TYBA 3Q8YA 2NXEA 5KOWA 1I1GA 5I3PA 2KT3A 1CJTB 5KFJA 4FF2A 1NJWA 4DSKA 1TK8A 3BGFA 3OD2A 2HQIA 3UCZP 3D0IE 1Y11A 1H74A 4LT6A 5D0RA 5T7LA 3C6TA 1HQUA 4C9DA 2VKZG 3KLHA 2HURA 4QYRA 1NJYA 1NU4A 3GYXB 3TVKA 3G8QA 1FRHA 1K0TA 2NZCA 4C2MA 2K1RA 2X1BA 1H2TZ 4QIWD 4WK3A 2CQIA 2GMJA 2QFJA 1VJWA 4USUA 2E5JA 3R7SB 3DYAB 4WCEQ 1N52B 2DR6A 2ZHAA 3T5KA 3J7AN 2F4FA 3I0SA 4J9MA 4ERDA 3PW7A 3C15A 2C3OA 2CQ1A 2OD6A 3N6MA 1JLFB 4LF5J 4FYYB 2AJQA 4NI2A 4CO4A 4ECZA 1S77D 4DUZJ 1LKZA 3T1YJ 5F41A 3JAMU 1WHVA 2E1CA 3B4DA 4LSLA 4ED0A 3D0HE 3EM1A 4I2PA 1IR0A 1L3SA 4ZJQA 4O4GA 5ADZA 2EWHA 2RDJA 2Y1JA 1NXIA 4DV4F 3HHLC 1CBKA 4K8RA 1H98A 3POTB 2OO4A 4ZVSB 1JLQB 4D3GA 1EKSA 4LR8A 3RUBL 4RNMA 3R97A 3DLJA 4P72A 5KG5A 1T9YA 3ZZ0A 3ZTQA 2HFNA 1Q79A 1RA6A 3S01A 3KJVB 3DRYA 4QPTA 2DD8S 4ETXA 4DCOB 4NCBA 2KZMA 2LA6A 3SSRA 2OMLA 3IM8A 4B17A 1N5TA 5A8KB 4K4SA 4ICLB 3UWTA 2B8QA 4J9SA 2HZVA 4Z7CA 4QCLA 4F3MA 5KFVA 3RRHA 2D1CA 2XMJA 1FI4A 3PVXA 3PO4A 4ZPCA 4DJBA 2IA6A 2OSRA 3KXDA 1R8HA 4GMKA 1T8EA 1UA0A 2I1RA 1YWXA 1SH0A 5F3ZA 1SJRA 4CTAB 1RTDA 4JB8B 3OBIA 3TI0A 2EC2A 1RTHB 5IC4B 1UL3A 3LANA 4OX6A 3CDWA 4ED2A 2ATLA 4J9LA 3TZWA 1EQMA 4WIIA 2V8VA 2D3O1 3I5BA 4H4KA 3GIMA 3M8PB 3ZZZA 3M9NB 4J5OA 4FXVA 5DQGA 3MECA 1FD8A 3MURP 2J0QD 2LU2A 3VCDA 1RTZA 3ULHA 3PW2A 3PFEA 1RT5B 3Q2TC 2V34A 3HHKA 3W9HA 1YGYA 3BZQA 1XEZA 3M2VA 4I7FB 5HATA 5A8WB 3MM9A 1ULRA 4P75A 4EMDA 1PYOB 4DV2J 3MR6A 3U27A 1B4SA 3M6UA 1FFSB 1WC3A 2HK2A 1O0PA 3CCMS 1O6XA 3AOAA 1RWMB 4TLQA 3OR2A 4DLGA 4K4YA 1P1TA 1TKTA 2CQHA 1Q82T 5HO4A 3KG0A 1GTHA 2VG7B 1SV5A 1DJ0A 4BWMA 1XC9A 3ZZOA 1X5OA 1CULA 1YJ7A 4HT7A 2X3DA 3TAQA 1BQXA 4L73A 3BH7B 4OHZA 4LFBF 1MWQA 4KFBB 2O67A 4PZVA 4CO5A 2XSJB 2VDHA 4DV1F 1D1UA 1MW7A 2GAGC 4PUOA 3OTCA 4RNNA 1J5EF 2XSFA 1YJNS 4X62F 1IXKA 2HHTA 3VAJA 5HK4A 1N36F 2BANB 2ZH4A 2CPFA 1C1BA 1Q0NA 1S1VB 1IBMJ 1S79A 4ZPVR 4KH0B 2NYHA 2HHHF 2XLKA 2R3VA 1MROB 1F9FA 1WEZA 3IC1A 2DXDA 2YWHA 2YQ3A 4OZ5A 1XERA 2DK2A 3V6DB 1CJKA 6FD1A 2H51B 5KG6A 1WNEA 4ZPBA 1X9MA 4UW2A 2HVHA 1YITS 3CC7S 3T6BA 3ILLA 3MMBB 3NNAA 5F9LA 4V19J 2ZUAA 2GFFA 4NA2A 4CZCA 3G2XA 3D0GE 1S97A 1IKVA 4RUAA 4AXJA 3SXLA 1QJHA 3MTJA 3KK3B 2IBOA 4L76A 4WIQA 2AU0A 3SMZA 3AQOA 1YDLA 1HYSA 2Z0GA 3PYFA 1WC5A 1Y7PA 1DAXA 1V3ZA 3QT8A 4B9MA 4U6PA 4EBDA 4ZLPA 2I0XA 5ETKA 3JTOA 2XTJP 1SC6A 1LWCB 1RT4B 4DL2A 2DR8A 1Y10A 4DDFA 2C2RA 3SQOP 3RW6A 3NGUA 1JLCA 2K7KA 3TRGA 1HNWF 1LWEB 1RABB 2UU9J 1FDNA 4DUTA 2BRLA 1BC6A 2WW4A 1U1OA 3RBXA 1HWKA 4K0KF 1ITPA 3PNIA 2PMHA 4KGMA 4ZPWR 2Z4PA 4X4OA 1FXRA 4PWDA 1ZYQA 1VCTA 2MXYA 3C16A 4EBEA 5E41A 1HNZF 2V4JB 2KDOA 1GK8A 5HSPA 3VGTA 3RYLA 3V4IA 4DS5A 4JI2J 3MM7B 2PC6A 1VBXA 3DYAA 1K73T 3MFIA 1Y5IB 3E3XA 2YWKA 5GMEA 4P6QA 5DDRC 4ZPTR 2DIVA 1X5SA 1ZZFA 3TA2A 4FXDA 4X4RA 3PX0A 2VPXB 4F4AA 5FDLB 3R5DA 4K2XA 4CH0S 4EUVA 4ZN3A 2BOAA 4ECXA 1TKXB 9RUBA 2HQFA 2V8PA 2V68A 3H5YA 1VLYA 2R4FA 2WVFA 4RLEA 2CQPA 3D3BJ 3BSCA 1RT7B 2EKYA 3U7JA 2VFTA 3MM5B 3KLVA 1NCLA 3K5OA 1QD1A 3DLKA 1HI0P 1JLEB 1U0SA 3V81B 1TL1B 1RXOB 3KYLA 4FXWA 1JLBB 4AL5A 2OPRA 3HMJG 4E8UA 1AB8A 4CM0A 2DGTA 3M8YA 5A8KA 1QAYA 5AJ3J 4DPYA 5IM0B 4KHRA 4O3NA 3BKFA 1DLOB 1UJ6A 2BQ3A 3ET6B 2FYXA 3I56S 2FVQA 3QT7A 2O1PA 2IA0A 3NS5A 5ETLA 1RA7A 4JI1F 3K8VA 5LJ5Y 3CO0P 1W2IA 2EC0A 4WFYA 1N34J 4ZVEA 4IO1A 3FRYA 1LQ9A 1WWHA 4HACA 3O44A 2YX7A 1BGXT 2R2SA 1WG5A 4CTAA 3SEOA 2YBVA 2HS4A 2DR9A 4AQYJ 2I8EA 5IT9Y 2HQDA 4WKYA 1PYSB 4AUKA 4WF9Q 3IAM9 2QRRA 2RUGA 4RW6A 2KRBA 5HVHA 2PE8A 4NWBA 3GB0A 4AYBD 1WHXA 2C2NA 1E6YB 5GVQA 2QN6B 5KT4A 3AA8A 1TFYA 4BLGA 3W2WA 1GXLA 1MNEA 4EBCA 1YZ6A 4FVMA 1K8AT 1S57A 4FKYA 1VQOS 2HFVA 2C1EB 4GRSA 1TMMA 3MR3A 3C3LA 1TUVA 2WSCC 5HAOA 4DFPA 2N3OA 1SH2A 2FLLA 1AT1B 2CJXB 3NAHA 1FTRA 4PR6A 4LREA 5ETRA 1N5SA 5ETQA 2IY5B 4Q5VA 3GLJA 2OELA 2AJ1A 2LVWA 1TV6B 4K4WA 2K3KA 2BACA 2VOPA 2FIUA 3Q8UA 1XNRF 5IT9U 4WU2A 5A8RB 2IJFA 1X7VA 1N5YB 3GP9A 2XULA 4U8YA 3QMQA 2IC3B 3DHWC 1GX5A 3I6PA 4OLPA 4P73A 3X1LB 2V5HG 1U26A 1AZSB 2J9CA 4MFBA 2ZZTA 1VQNS 1S4FA 3J7YU 5F8NA 3ETOA 2GIQA 1LXJA 4ZVGA 2MY7A 5EX0A 5CAAA 5CZXA 1N32J 2BANA 2DBBA 3BV8A 5C24B 1VC5A 2OJ3A 4U7CA 3LAMA 3QO9A 1ZA1B 3UE2A 3HLUA 2C2KB 1OIAA 4NXNF 3HSDA 1HBUA 4NZ7A 2CUYA 3G6ES 1S7HA 1N48A 2E5HA 1RHJB 3WC2A 3MMBA 4MK9A 2DNRA 4CCHA 2X1FA 3W8GA 4DV3F 4DI6A 3IG1A 3A3PB 2CJBA 1SC4B 1T95A 5J2MB 3BO2A 4ILLA 2VDIA 2KZZA 3QIDA 4CDIA 1SC3B 5DG8A 2HVDA 5HLFB 2LDYA 3VAIA 3KJNB 3HF5A 3MPVA 2JHEA 2VFUA 1YSJA 4CLYA 2COLA 1PC4A 2DNZA 2FZGB 2W7OA 4X84A 4C11B 1JLGB 3CCLS 2RS2A 4DF4A 3ADAC 2G9OA 3FQLA 4X64F 3UDEA 3KUGA 3CCES 4A8MP 4G65A 4ZVFA 3MOJB 1OQ6A 3KLFB 1KTQA 1LWCA 2RF2A 3A8JA 2QX0A 4NZ6A 1QTMA 2QTWA 4OZJA 1EB0A 2YNIA 2UUTA 1SL0A 4MKAA 3GYGA 3RJMB 4WFAQ 1VMBA 5C42B 2C2MB 3WX4A 1REVB 2P8IA 3M32B 4B3TF 2NR0A 1F3FA 3IR7B 4O44B 5CYQB 1YJTA 3R5BA 4UQTA 3G4SS 4M5KA 5CCLA 1XMQF 2CNNB 3LA0A 3M30B 3PIPQ 2W2NP 5E0OA 4HYKA 4KHPF 3J7YI 2BV3A 2KYZA 2PO4A 3AB4B 2ACYA 2HEKA 1QY7A 5AXLA 2MTLA 4X66F 3GG0A 2BUNA 4F7VA 3UN5A 4Y2AA 1CJUA 2XG8A 2D9PA 3DU5A 1A7GE 1IBLF 1CG2A 1U2CA 2HRUA 1CQNA 2VFVA 1XMOF 1YJUA 3CEDA 4C8MA 2XI3A 4FP9A 2YQ1A 2BW7A 1HBOB 3LGNA 5IFMA 1IBKF 1LXNA 3EXYA 1V6HA 4OV1A 4Z2XA 3OXFA 5A0YB 4WP3A 2HHPA 4DQRA 2VPWB 3AAWB 3SV3A 1HR0F 4PABA 1S10A 3KK2B 3M8WA 2MGZA 2R8JA 4DLEA 2CQGA 2PGCA 1VQ6S 2HVIA 3NGTA 1CVJA 2VC1A 4LRBA 5IC6B 4GVLA 1EARA 4LF2A 4C3LA 2PSZA 1IBCB 1T3NA 1RAIB 3TEHB 2EVZA 3PYGA 4RPFA 3MM5A 1RDRA 1VC6A 5D0EA 1AW0A 5BR8F 3P6YC 4QJVA 3CMES 2WSFC 2C2OB 3NNCA 5K14A 3T19A 3D2WA 3M2UB 3BBFA 5IM0A 3CSKA 1DLOA 4E2FB 5IWAJ 1UW4A 4L75A 3FCHA 1WEXA 4JI7F 2KG1A 3GYNA 2HBYB 2XMAA 1S6QA 2KVQE 5LXRA 3SCJE 1K1QA 3CTRA 2VJVA 5HROB 2L9WA 3LP0B 9ATCB 1X4EA 1BQMA 1MMNA 2J6UA 3W2VA 2E5IA 4RX6A 3TNVA 2DNOA 5HQ8A 2NLWA 3Q8QB 2IMOA 3LGMA 2FHJA 3IM9A 1RISA 2GV1A 4UQGA 2ZFHA 2KT5A 1RT3A 4WFZA 5CHCB 2HRYA 1F2GA 1E6YA 3JSBA 1BQNB 5H9EJ 2OPQB 4MT1A 2RQCA 2PDAA 3RB3A 3VVTA 3NCPA 2FHKA 3M8ZA 4NCGB 4USKA 2VBZA 1QUPA 4ALZA 2FHJD 1URRA 4KJIA 4QWEA 4HTIA 4ECRA 3OL8A 4FS1A 3CF5Q 4YB6A 5U47A 3W62A 5J1PA 2VOOA 1JB0C 2JLGA 3CDAA 3WIVA 2WOMB 3H42A 1R0BG 2HRTA 2LXFA 5I42A 2K2PA 2AJ0A 2ZC3A 1YZ7A 2CNKB 1U24A 1VR6A 3FEXB 4USJC 2MZ1A 5DZ6A 3PRDA 3D9BA 3O1LA 4OI6A 1H38A 2QMUB 1OPIA 3BO4A 3H8YA 4G1PA 2J7UA 4NE9C 2WSEC 5E3QA 1HW9A 3CIMA 2NUUG 4HEA9 4OL8A 3O8WA 1QTNB 1WI6A 3GV5B 1F9EB 4WTYA 2DHAA 1QVFR 3PKMA 1OYEA 1U45A 5KFWA 1R27B 1XJWB 4DXLA 5KFSA 3ITHB 1GX6A 2BE2B 4HR2A 1U6ZA 1UAWA 4IH5A 4JYAF 2HVZA 2A6OA 1UP1A 4DR3J 2BKOA 1E6VB 2H5IB 4JV0A 4R5PB 3TR5A 1DBDA 3VGVA 1RADB 2VBYA 4JUZA 3Q0AA 4QIFA 1UTAA 2MZTA 2CQ0A 4F8RA 1PBAA 1X9SA 2HHWA 1N0VC 1X60A 5L8RC 1FFGB 1U1QA 3SBMA 4TXSA 2QLBB 4H4KC 2G4BA 1TL7B 2CPDA 4BC9A 4MH8A 1N33J 1X0PA 3PG9A 3Q89A 4E0DA 1C0UB 2XB2D 3H40A 3BGUA 3MPWA 4ECYA 5KFRA 3CB4A 1S4EA 1FESA 3DOMA 2RVJA 3L95X 3NWRA 2Z2ZA 1Y9OA 2Z8QA 3IBCB 3W65A 5K9FA 3W66A 1JXLA 2HWHA 1B7FA 4PRFA 1VRTB 3H5UA 2LQBA 4LSNB 4WWSA 3JQMA 2V63A 1SI9A 2UV8A 3CJRA 2WW8A 4IOAQ 1KKHA 4LF5F 4I0WA 5D4NA 4NA3A 1R8BA 2UUCJ 2QJ3A 3MCOA 5I4MA 4DUZF 1RHQB 3T1YF 1NM2A 1TFWA 3QRPA 1Y5NB 5B0DA 1B70B 4WXWA 3E01B 3N79A 1TUGB 1VQLS 3M9MB 3GJTB 4WYWA 3QT5A 5HJYA 2BM0A 1G3OA 5AT1B 3EX7B 3FQKA 2W01A 3HFZB 1QE1B 3X3UA 2L08A 3J7A1 3GJQB 5J2QA 2DRAA 2OLWA 2V2QA 1VRQC 2KHDA 2J6SA 4LR9A 1VI7A 3CJTA 2R7TA 3AT1B 4ZHRB 2DGWA 4DX8H 2DNLA 4FF3A 1RQ0A 1KC8T 1PKUA 2W9CB 4P2XA 3QGPA 2WZ1A 4B3SJ 3NOGA 4XO0A 2GVDB 2Z56B 5AXMA 2HFZA 3MAAB 2EFQA 4DN9A 2GIRA 3K58A 3FBBA 2J8AA 2R7RA 4LF7J 4C3MA 1HHSA 2FJVA 4NMLA 1DZ5A 1HBOA 4ED3A 2XMTA 1X31C 4DZ6A 2B4OA 2ZKTA 3SSQA 4JV1A 4ZN1A 2HGLA 4QR0A 4DL5A 2BEFA 1TVRB 1GQEA 2CPIA 1N8RT 3K5MA 4QYZJ 3BKUA 4CLWA 3US5A 3MAHA 3TZZA 1V9OA 4KC5A 2WTFA 3J7Z5 4OZ1A 3CPWR 2AJFE 2VD3A 3FZBA 4ANCA 3AXKA 3AJDA 2ZBCA 4OZNA 4KGZB 2LXIA 3HT0A 1Q53A 2OPPA 3TARA 3RZAA 3IAS9 1OS5A 2HNZA 2KFYA 2CNLB 2ZD1A 5D0GA 4WPAA 1X4AA 2XS5A 3PEJA 4S0MA 4TY8B 4C8OA 3JSYA 3UCGA 4B9UA 3DOLB 1RAFB 2PA3A 4KGVB 3GFXA 4MTPA 5DRKA 2WVCA 1ZS6A 2SXLA 4LRFA 1RWXB 4WFNQ 4P9SA 2JEGA 4DV2F 4ID5B 4XAKA 3Q8RB 3BJYA 5D4LA 3RRGA 2B9XA 1D8ZA 1N5QA 3IGNA 1Y5LB 4P7VA 3AJ2A 3LF0A 5H9FK 2WAQD 1KHVA 2EG2A 2IVYA 4M5GA 1VDHA 1T03B 5KT7A 2F8MA 2UVWA 2BJDA 1KN6A 1ZPWX 2BW2A 3I0RB 2B4PA 5KFOA 1M5KC 2ZH1A 2FQQB 1VQMS 2DNYA 1F5AA 3LH2S 4QIVA 3MAQA 4K4UA 4OX9J 2RRNA 3DGPB 2VODA 2M70A 1RBLA 3HX9A 3R7NB 4GVBA 4F04B 1JKHA 5D3GB 1R0AA 1S0VA 3C14A 1DTTA 1S6UA 4OV6A 5HMYA 1MU2A 1YVFA 3D6TB 3HHLA 2Q6CA 2O5DA 1IBMF 3D6FB 4N7TA 1FO1A 3TAPA 3CCQS 3EUNA 2WOMA 4PXBA 4MMOA 1M5SA 2OGUA 2HMIB 4ZKAA 3N9UC 1T0TV 4J9QA 2KT2A 3IA0A 4F3QA 2HG4A 1U49A 3KUHA 4CLSA 1HHQA 4IYQA 3HHLD 5E3RA 2JWNA 1URNA 1EAYC 3M2RA 2K3IA 2DGUA 3A3NB 4QR1A 3FSXA 4J9VA 1PJ6A 2NYIA 4IG3A 3CD5A 2DISA 4AFFA 4DPOA 4V19X 2W9BA 4PYDA 3MEDB 1SKWA 4H4OA 4CLZA 1RAOA 2N4DA 4KE5A 1V3RA 2ZBPA 1Q5YA 3LO3A 3R5JB 2R8GA 2Z30B 2ZWPA 2JX2A 4X4VA 4DMZA 2A10A 3N5BA 3CD0A 3JQJA 3EPGA 1JLAB 2YNHA 3PRVA 1C4AA 4NPOA 4NLTA 2P5VA 2XO6A 1T9XA 1A0OB 1J5OA 2RQKA 4WFXA 2DGXA 2RNEA 2UUBJ 1SJQA 2F3JA 1BXNA 4XK8C 2UU9F 4ANDA 2ZZNA 1PCAA 3DU6A 2D9OA 1N5VA 3FK4A 4ED7A 3E2EA 3J80Y 2A18A 4NLPA 4A8OA 4FZVA 1S0OA 4JBCA 2OMOA 4O23A 1NB2A 2GQCA 4YMEA 4U8VA 4C7QA 1TL7A 3MCNA 3UNYA 2NPFA 3O6QA 1CPZA 3W1YC 1TKZB 4CT8A 1PJ5A 1UFWA 4BCAA 1WELA 2LFVA 3WC0A 3FC9A 2BZ2A 1C1CB 2QIFA 4G6VB 2G2OA 3CD7A 2LEPA 4OI1A 2MQPA 4LQ3A 2FC9A 4JI2F 5A2QY 1VYAA 1UWBA 4IR1A 1Z2ZA 4M5DB 1J27A 4LRDA 3KNAA 3NOCA 2HS0A 2Z58B 2J0XA 4CYUB 1AYEA 3G82B 1UEVA 2V94A 2CZ4A 5L46A 1YLXA 1FRIA 2BXJA 2CJQA 2W4PA 2F8HA 2GX8A 1EIYB 3S6EA 2JLEA 4DL0C 5F0UA 2ASJA 2JSXA 2B9EA 3KUEA 5E2QA 4ZVTB 2HAIA 3KHGA 2BVZA 2RUSA 4ZCMA 4J9OA 3IR5B 2V0NA 4G3IA 2R7QA 3DDKA 2BYCA 3NY0A 1UFKA 5KTQA 5F8HA 2OP5A 3CCWA 1V5IB 4ES3A 2Q79A 2Y1IA 1SIWB 1QE1A 3OHBA 2HGNA 2M5YA 2Y1RI 3BB5A 3BEGB 1PO6A 1S5ZA 2ZE2B 2VIHA 5FIIA 4RW4A 2X3GA 4YDXA 1T05A 3MMAA 4WKRA 3U1NA 3TYTA 4UOCA 3IBFB 2KU7A 3F44A 2KRRA 5LMUJ 5KG0A 4J7CA 5AJ3F 3F73A 3H90A 5FLXY 3H5SA 1U8SA 2BJ9A 4ED4A 1FRJA 3TX0A 2F40A 3BSAA 3KLGA 1HBMA 4OZLA 2RKIA 1H7WA 4WXOA 4EZ9A 3A4TA 1DRZA 3TVYA 2JNJA 1EETA 1VBKA 4TU9A 4JI4J 1GMWA 3MPUB 1Q5VA 1N34F 3ISZA 4LIRA 3RW7A 2PD1A 5D4PA 2O01C 3EGZA 2HSEB 1AA1B 5KT5A 4AQYF 1NBEB 1FJGJ 1Q8IA 2Z2LA 3D7SB 1B0VA 1ZPVA 1DTQB 3JYTB 4GKJJ 4CLKA 3J81Y 1HNIB 2NXCA 3M6WA 2YKQA 1GMWD 3OVBA 4TQRA 4B9NA 4I6YA 2KH9A 4DPUA 3PW5A 3MM6A 4B3RJ 3BGOP 4CH7A 5CZVA 1F1BB 3T5JA 2QL9B 2R8KA 4ENOA 4NYPA 2XZWA 3FRZA 1UCNA 3IR6B 2UP1A 1YTYA 1SL1A 5AXKA 1FKPB 1HBNA 3NGSA 3HZEA 3A3OB 1RWUA 4NXMJ 1S49A 3L3CA 2W2QP 4O3OA 3OL7A 2XY7A 2YXLA 4ID5A 3THPA 2B3TB 7FD1A 3DLGB 2WBMA 2O66A 3PX6A 4DR2J 4FNIA 2W4DA 3CJKB 4LBHA 5LMNJ 2BJ3A 1YBTA 4PYAA 2E9RX 2AYMA 1PJ7A 3IWNC 1TP7A 3AQPA 3RBZA 5SUHA 2BJEA 1T03A 5EX3A 2JLFA 1C0TA 2MKKA 3J81U 3THTA 1KTVA 1FEEA 4Y2IA 3T6JA 3TJ9A 4A47A 5DO2A 4K7QA 1NJIT 3OT9A 4QU6A 5ETPA 4C8KA 1AUSL 2AZ1A 5KG4A 1Q7LB 1RAAB 4Q2MA 2EBGA 2XNQA 1DQAA 5HBMB 4CWBA 5D3GA 4P74A 4NCAA 2UVUA 1SVDA 3KHRA 2IM1A 4DBQA 1N32F 4KTQA 1KQKA 5KFLA 3OXGA 3QYYA 5DETA 2GQ2A 2VG6A 3GV8B 1RLCL 3D28A 4M5HA 2ZJRQ 5JVGQ 2HBZB 1HNVA 1WSVA 3LUYA 3NBPA 1FF2A 4LVOP 2L41A 3BGLA 2V67A 4OMFG 2L3MA 1BY9A 4FYWB 4YB1P 4X4NA 3QT6A 5D0HA 3QSIA 5IQ6A 3J7ZT 2DHXA 3D3CJ 1S9EA 3EDRB 4ZJOA 3T9NA 4N8NA 1D09B 5I3UA 3R1HA 4BC7A 2XMVA 2AW0A 4HL9A 4Z37A 1JX4A 4FDFA 2CQ2A 2ZITA 2FUG9 3HD1A 4M5LA 4KKOB 2ZH3A 2X7IA 2CQ4A 1G6BA 2GVZA 4MAKA 3K0JA 2I2YA 1FRKA 3M05A 4KO0A 3G96A 5J1EA 4NLVA 1NPKA 2G13A 1XWLA 2IBKA 1SKRA 2XBPA 1HMVB 2QLFB 3GCXP 3B4MA 3OW2R 3FUYA 2JVOA 2R2UA 3CCJS 2Q6BA 3DLBA 1JIHA 5EDWA 2YWEA 2CRLA 1S1TB 3ILOA 5M2RA 4HT5A 2ZJQQ 3ENVA 1RSCA 1JNZB 3PR5B 2AEMA 3QSYB 1U0HB 3CJQA 1YKWA 2DNQA 2YNGA 3EZOA 3MOZA 1TKZA 3M1VA 3LWLA 2GJIA 3CVKA 1U02A 2M2BA 4WBFA 1D0EA 4MIAA 1WKJA 4H4MB 1A9NB 1VIOA 2XCPA 3HHEA 3FFIB 1XQIA 1YJRA 2G1DA 5ETOA 3CUNA 4DR1J 2AYBA 1I6JA 4YEAA 2VFRA 3UI3A 3G82A 3GILA 2A2CA 2K8GA 2IYIA 3LP2B 2HIYA 4ZA1A 3KHLA 2QLJB 2CADA 3QIPA 2L48A 2A1BA 4DQPA 3W5YA 1WF1A 1RP5A 2LKZA 1LV5A 1RJJA 4OI0A 1O51A 2M7SA 3LALA 4CI0B 4ETZA 2XHCA 4DUYJ 5CH7B 3O2IA 1IKXA 4C8YA 2D7SA 2DY1A 3GSIA 4EI2A 1CS4A 1NO8A 2YPYA 4Q0BA 5T14A 1S6OA 4JOUA 2LDIA 4PG6A 3T41A 3SYZA 2I9SA 3MR5A 2M88A 1S6PA 4HHJA 4C4WA 1XTZA 2W24A 4USTA 1HNXJ 2BJ8A 3EZUA 4M5IA 3DI6B 2YVSA 5M2PA 3M6XA 2MSSA 3I9ZA 3N01A 1TL3A 2RJZA 2MQLA 4DR7J 3HVTA 5RUBA 1VQKS 3Q8VA 4YHHF 4YR2A 1ZETA 5IWAF 1RT2B 2XO7A 2CFXA 1S0NA 3WHIA 4Y00A 2R7XA 4WFBQ 2VFSA 1U48A 3V6JA 1DFDA 3GCWP 3FBFA 4PPDA 4USHA 3HVRA 1H3DA 3KLIB 2QEXS 1SPBP 3HJFA 4Y6IA 5HP1B 1KVKA 4KYZA 3TQ1A 1GEHA 2RS8A 2H3EB 2Q1LA 2JC0A 4JI5J 1KQSR 5DGAA 3CCUS 3AD8C 4I6WA 2NQPA 3EE3A 2AF6A 1DTQA 2EFPA 4EGLA 2BMBA 3DMJB 2NUHA 2FY8A 1R31A 4F26A 3VAMA 2HAFA 4F25A 1JWWA 1AFJA 1XK8A 3K7RA 2CDRB 1IN0A 3R27A 5A6PA 1FKPA 1AROP 3H5XA 5DZ7A 2KKHA 5BXIA 1IR2A 4G1QA 4RWXA 2CNOB 2HNDB 4IDKA 4X4QA 3GJSB 2NS1B 4FN5A 4N47A 2MLYA 1T7PA 1FXDA 4DSLA 4UUXA 3BDPA 1EKRA 3KG1A 3GIIA 4DL4A 4Q8FA 1BWEA 1RE1B 2W25A 5DJBA 2JEIA 1OY9A 2FVRA 1GMVA 3I4HX 3FCVA 4ILMA 3H4BA 3LGHA 3VALA 3FMWA 2BKNA 3OTOJ 3DDIA 4IH6A 4PWWA 1EQ0A 4A46A 1VQSA 1P1LA 3CCTA 3O5TB 4D3HA 3PEHA 2UXBJ 1CSJA 3CCVS 2M9KA 5G0RB 2QSWA 4LR7A 3DM2A 3HDSA 2JL9A 3VWSA 1I51B 2P9CA 4DSJA 4MJKA 4DR3F 1I3OB 3QPIA 4WE1A 1ZAXA 3PTWA 3HD2A 3MGJA 2U2FA 4B9VA 4RUBA 3UDCA 5KT6A 4KR0B 3A12A 2JH3A 4NL5A 5KOXA 4ID8A 5IZHA 1JJCB 4DX6A 4RBUA 3NNHA 1M90T 3CD6S 2DPIA 2D3ZA 4JI8J 5B0AA 1LFPA 5EHHA 2KL8A 2FB0A 1XR7A 1N33F 5I3QA 2UV8G 1IKWB 2KYXA 2ZOFA 3QAEA 1P8GA 1KOHA 4XDDA 1VOMA 4YQWA 5JVHQ 1NK6A 2DXEA 2GHPA 1F2HA 1VRUB 4DF8A 4Y2MA 5BYSA 2APOA 2B6AA 1D9FA 3W7BA 5CYMB 2MHNA 3IS9B 4OI4A 1H2VZ 2W2OP 2DJWA 4TVAB 2NXUA 1KFDA 3TOQA 1Z2LA 2DEJA 2MEWA 4DPWA 3HVAA 3QAUA 1SUQB 2QGFB 1SCJB 3BDEA 3GTYX 1HD1A 4NLWA 2XMUA 2UUCF 2M52A 2MZSA 1CJVA 1U1MA 3W63A 1NKCA 2HZAA 1R3NA 2IDLA 4LFAJ 1VQ8S 4HH0A 2HHSA 4QU7A 1OSCA 2DGQA 4PXDA 2KN4A 4JI0J 4HKQA 2DIUA 1N6QA 5EN1A 4CRJA 3HHNB 4IH7A 5AE2A 1BMQB 3M8QB 4RBTA 2VA3A 2OAUA 4PWUA 1PGZA 4ZCLA 2DHHA 3EICA 1OY6A 4H4MA 4EK2A 1S1UB 4UZCA 3MEGA 4RR5A 4DV0J 4B3SF 4NRUA 2FGCA 5C5JA 1WC6A 1W25A 2ZHBA 1R7IA 3UPFA 2CJ9A 2YKNA 2IHR1 4CLPA 4LF7F 3D1HA 3BYPA 4USWA 1Q78A 1OQ3A 3OPKA 5DQIA 1KLMB 2JOQA 3DOKA 2R2TA 4UOGA 1RHRB 1GFWB 3TJ8A 2AD9A 1RKJA 2ZH7A 5LT5A 3CW2C 3DDNA 4PPZA 3BR8A 4QIGA 2GIFA 4UOHA 3GQCA 1F6TA 1S1XB 2N3LA 2M8DB 2IJNA 1D9AA 4QW8A 1MWZA 1IKYB 4OZ2A 2W8KA 3EYZA 1Q8KA 3G87A 5C25B 4KB7A 3E51A 2C42A 3TWZA 1X4DA 2UVVA 5EGYA 3UD5A 1SJ1A 2B4VA 1RT1B 4LUBA 2PI4A 2WVDA 3RAQA 2PT0A 4IR9A 2RH3A 1UVJA 2DNKA 4O0NA 2CVIA 3MMCB 2VJUA 1V3SA 4LRCA 1RT2A 2KXNB 1N88A 3VQSA 4DR5J 1Q16B 4F0KA 4DN0A 5KFDA 4O4RA 2AGOA 3RAMA 2DPJA 4QR2A 4ECSA 4LVNP 2GO9A 2ALYB 4DV6J 3VTIA 1CEZA 4RW8B 3IP0A 3D4JA 2DYAA 3OLBA 4KSEB 2QYCA 4DPXA 2DCLA 3BPDA 4O3RA 4ZP7A 1B7YB 2IFXA 2YNFB 3NL0A 3MM8B 1U7LA 3VV2B 2R7SA 3DMJA 3DRSA 3SFUA 2QA2A 2E44A 5HMWA 3N6LA 1HHTP 2GNKA 4ZDNA 3OHAA 2CXEA 4JV5J 4OJ1A 1OMSA 2CQDA 2HNYB 4OX9F 1VS3A 4TKTA 4WP8A 4DU8A 3TAMA 2BE7D 4HTJA 5GMKa 1FXLA 2QT7A 1YHQS 3SDEA 1EJ7L 1FNOA 2XY6A 4NLRA 1IJEB 3V2UC 4X4TA 5E5NA 3SQGB 1FVQA 1T94A 2NZ4A 4UY8T 2WB1D 1B3TA 3QJLA 2AQ4A 4OHVA 2AGPA 3MZIA 4BHQA 3GZ7A 3ZTSA 1RTJB 5DM7Q 3KDNA 4ED6A 3U02A 5LSLA 1TL5A 3Q22A 2VL1A 2RQMA 2E5GA 3CJSA 3D6MB 3HO1A 3G86A 3BN4A 1Y0HA 3ZTOA 3NAIA 4HHUA 3CDUA 4ZLNA 4QBUA 2MZQA 3KLEB 2FJWA 1VJQA 3QLHB 1RTIA 1S1WA 5CA5A 1FX4A 3AH6A 3MEEB 4P7TA 1IVZA 2OPSB 2EK6A 1FKOA 2MKYA 4XDCA 2F65A 4W98A 3GSDA 3PIOQ 5THWA 1XR5A 5L1LA 3J81j 2FHOB 2DNGA 3VAFA 2UUBF 3IRXB 1QSYA 3MFHA 3HZGA 4ZITA 4YP3A 1GXTA 2FJXA 1LWFB 2RIJA 4URQU 3ZZRA 4DQSA 4F4ZA 1JJHA 1UJ4A 1NH8A 5J2PB 1Q8BA 4DWIA 1NLKL 3PW4A 5JXSA 2P9GA 1N4LA 5H1SV 2KFZA 3KTQA 3DRPA 1YX2A 2FY1A 3W60A 1KVJA 1ZAVA 5F8JA 4R8UB 1KWMA 2PFDA 2V9WA 1CJTA 3DRRB 2W7PA 5K5MA 1HW8A 2J0WA 4ZVPB 1RAHB 1Z4UA 4J90A 3KDOA 1YRTA 1TR0A 4RW7B 3EMTA 3TUZC 3H59A 4LF8J 4P2SA 4WYLA 3MMJA 5KFUA 4IFVB 3PDNA 2FD2A 3R2DJ 1XIQA 3R9LA 1NK4A 4C8NA 3CJ3A 4ED1A 2YPZA 2HLTA 4LF4J 2HBRB 2MMYA 2QC3A 1RWOB 4CLTA 2Z2YB 1X4BA 2PMZD 1LEOA 2CPHA 2CJYB 2VA2A 3C46A 5K8PA 2AGQA 5FJ4A 4RNFA 2I5JB 3W8PA 1YJ9S 3MWBA
chains in the Genus database with same CATH topology
2EG2A 2IVYA 1JLFA 2FJAB 4C9DA 2VKZG 3KLHA 5E7OB 2PFFB 1T03B 3FZ2A 5KT7A 4QYRA 2Z2MA 1QAIA 1NJYA 2U1AA 1NU4A 3GYXB 2F8MA 4CO2A 2UVWA 4K50A 1EP4B 2BJDA 3TVKA 1KN6A 2DNPA 4F02A 1ZOTA 3G8QA 3I96A 1ZPWX 2BW2A 4NYOA 1FRHA 1ZAWA 3I0RB 1K0TA 2B4PA 5KFOA 4C2MA 3WDOA 2K1RA 3ICLA 2HMIA 2X1BA 1H2TZ 1M5KC 3TUJC 4QIWD 2ZH1A 4WK3A 2FVCA 4K4XA 5B08A 1VQMS 2DNYA 1RT6A 2CQIA 2GMJA 2HGMA 2HZCA 4IFYB 2RDIA 1UVLA 1IM4A 3DCAA 3SCIE 1F5AA 3LH2S 2QFJA 1VJWA 4QIVA 3MAQA 4K4UA 4Q43A 1S1UA 2E5JA 3DYAB 4LF6F 1ZM3A 2RRNA 3POTA 4Y2KA 4QWAA 4WCEQ 2VODA 2M70A 1N52B 3HX9A 2ZHAA 3T5KA 1JLQA 5LMUF 3K5LA 3MTKA 1JKHA 2N7CA 5D3GB 3I0SA 3FSYA 4J9MA 1R0AA 1S0VA 4ERDA 3PW7A 1DTTA 3C6TB 2NREA 1S99A 2C3OA 1TZ0A 2CQ1A 4Y34A 2DH7A 1QUVA 1S6UA 2OD6A 3N6MA 4DL6A 4ECTA 1JLFB 5HMYA 1MU2A 3GE9A 3KLHB 3R1LA 1YVFA 2AJQA 2VQEF 4PKDB 4DOZA 3HHLA 2Q6CA 3NGKA 3P96A 4CO4A 4ECZA 2O5DA 1S77D 1IBMF 1LKZA 3MEDA 5F41A 3K5NA 1KFSA 1WHVA 3KJVA 1O5JA 1FO1A 3OJSA 3M8RA 2E1CA 3B4DA 4KHMA 3TAPA 1QSSA 4LSLA 3CCQS 3EUNA 4ED0A 3D0HE 3CXCR 2WOMA 4ECUA 4X4UA 4MK7A 1Y00A 4PXBA 4ZP6A 5KFAA 4MMOA 4I2PA 1M5SA 1XN9A 2K1RB 2HMIB 1IR0A 4ZKAA 3N9UC 1D8YA 4J9QA 2FGOA 1L3SA 2WHOA 4JI4F 1H7XA 1X4GA 2DCUB 2KT2A 4ICLA 1R89A 4O4GA 3IA0A 5ADZA 2EWHA 5M2UA 2RDJA 2Y1JA 4F3QA 2HG4A 4DV4F 1U49A 3HHLC 5B0GA 1TQLA 2QA4G 1JLAA 2PIIA 3OVSA 1H98A 2M3DA 3POTB 1NB7A 4IYQA 2OO4A 1JLQB 1FJ7A 3HHLD 1JKHB 5E3RA 3I0SB 3DLHA 2CDQA 2JWNA 1R0AB 1URNA 3M2RA 1S1XA 1DTTB 1FJGF 5IT4A 2K3IA 1D9DA 1WF2A 1QAJA 3CGIA 4D3GA 2DGUA 2LECA 1B0TA 4Y3CA 1MU2B 4RNMA 1P6TA 3DLJA 4QR1A 3FSXA 5KG5A 1M5PC 2NYIA 4GKJF 3ZZ0A 3HHLB 4IG3A 3CD5A 1W2BR 2HFNA 1Q79A 2ERRA 2DISA 4AFFA 4DPOA 4V19X 5E33A 2W9BA 2CJKA 2VV5A 4W92B 3MEDB 1YQHA 3PX4A 1SKWA 1RA6A 3DN9A 4H4OA 3S01A 3KJVB 1S76D 3DRYA 2N4DA 5EUHA 4KE5A 1V3RA 2DD8S 2E29A 4LSLB 4QPTA 3G9CA 4ETXA 3LO3A 2QLXA 3OFEA 4NCBA 3NMRA 2KZMA 4B3RF 2R8GA 2LA6A 2QLWA 2OMLA 3SSRA 4I2PB 4B17A 1N5TA 4DL3A 2HYIB 2JX2A 3AY0A 5A8KB 1XBWA 4USIA 3OFGA 3KG4A 4K4SA 1U2FA 1RTHA 3T3FA 4ICLB 4X4VA 3UWTA 4O3QA 4EYIB 4DMZA 4O4GB 4J9SA 1FHTA 2A10A 4QCLA 3GFYA 4F3MA 3N5BA 5KFVA 1U4BA 3CD0A 3RRHA 2E1AA 1XMBA 3EPGA 1JLAB 2D1CA 2WRMA 3PACA 1U1RA 2YNHA 1VBZA 1C4AA 3N5FA 4NPOA 4NLTA 2P5VA 2XMJA 5F8IA 3UR0A 4KGKA 2WCXA 3OXLA 3PVXA 1J5OA 3M2RB 2RQKA 4WFXA 2DGXA 2RNEA 3PO4A 2E66A 3M8PA 5D4OA 4ZPCA 4DJBA 4NXMF 3PZPA 4QPXA 1SJQA 2F3JA 3DLEB 2VPYB 2IA6A 1C1CA 2OSRA 1UJ5A 4XK8C 2UU9F 1R8HA 1DHMA 3C6UB 4IG3B 2CPZA 3QJJA 2ZZNA 3D1OA 3DU6A 1LOUA 2D9OA 1N5VA 2W9BB 1KSPA 4GMKA 1T8EA 4ED7A 1UA0A 3E2EA 2I1RA 3B8HA 4H4OB 2B9YA 3J80Y 2A18A 2DHSA 4NLPA 4A8OA 2VKRA 1YWXA 2KXHA 4OQJA 1SH0A 4I69A 5F3ZA 2XI2A 4FZVA 3IXQA 1S0OA 1RT5A 1SJRA 2GHWA 2OMOA 4JBCA 4O23A 4CTAB 2GQCA 4M5DA 4YMEA 1SJFA 1RTDA 3VZIA 1X4HA 4FBUA 4I7FA 3WZ0A 4C7QA 5LMNF 5A8WA 3OBIA 3TI0A 3KK1B 1RTHB 2W8LA 1UL3A 1KOOA 2NPFA 3O6QA 3LANA 1CPZA 4OX6A 2ASLA 3CDWA 1UKUA 3CT9A 4I2QA 3GMGA 2GO8A 4ED2A 2ATLA 2KM8C 4J9LA 1GXUA 1TKZB 4K4ZA 4CT8A 2YNHB 4F67A 5KFEA 4DQQA 3SCLE 4WIIA 2V8VA 2XC9A 4UY85 3RR7A 2L9NA 2YKMB 3I5BA 4E98A 5H9FJ 2YNFA 1J5OB 3RR8A 2IAJB 1UFWA 4BCAA 3MM8A 1WELA 4H4KA 2OD4A 3M8PB 2XMWA 3GIMA 3ZZZA 2BOPA 3JSRA 3WC0A 1VBYA 2BZ2A 5EWFA 3M9NB 4A8YA 1C1CB 1U1KA 2QIFA 3PRBA 4G6VB 2MQOA 4J5OA 4FXVA 5DQGA 3GFHA 4O3PA 1TKDA 3MECA 2M4MA 3CD7A 2LEPA 4OI1A 2MQPA 1FD8A 3MURP 3H2LA 2J0QD 4LQ3A 2GQQA 2LU2A 1C4CA 2FC9A 3VCDA 5K8OA 1F0XA 4JI2F 3ULHA 2Q66A 4YY3F 3OUYB 4N56A 5A2QY 3PW2A 4X2BA 3PFEA 3AJ1A 1UWBA 2VG7A 1RT5B 2XGPA 5LL6d 4IR1A 3Q2TC 4IG0A 1Z2ZA 4M5DB 5AXNA 1RTDB 3HHKA 4NLXA 1YGYA 4B08A 3BZQA 1XEZA 3M2VA 4I7FB 3BSNA 3KNAA 3LP1B 5A8WB 2HS0A 5BJRA 2J0XA 5JUMA 2XCAA 3MM9A 1NJXA 1UEVA 1ULRA 2V94A 2CZ4A 1FRIA 2DH8A 1SJ3P 1KVIA 2BXJA 2CJQA 3GR1A 3MR6A 2ZE2A 3NS6A 2LMIA 3U27A 2W4PA 4B02A 2F8HA 3CJ2A 3M6UA 4ES1A 2GX8A 4KV8A 5E3CA 3S6EA 4TU8A 2JLEA 4DL0C 5A6WA 4KFBA 5F0UA 5K8MA 2ASJA 2CPYA 2JSXA 1O0PA 2XSJA 2DGOA 3CCMS 1XR6A 2N4CA 5E2QA 3LQVA 4FF4A 3T1AA 4TLQA 2HAIA 3OR2A 4DLGA 4RW9A 3KHGA 4K4YA 2MKCA 2ILYA 2BVZA 5KAKA 4OJGA 4ZCMA 2IM0A 1P1TA 3HHDA 4J9OA 3IR5B 1TKTA 2CQHA 1U47A 2JFKA 3MECB 2V0NA 1U09A 2LQJA 4G3IA 2R7QA 2D41A 3DDKA 2BYCA 2DB1A 3UNGC 5HO4A 1Q82T 2P9EA 3KG0A 1GTHA 1S9GB 1VQPS 4C0BA 5KTQA 5F8HA 5L9XA 4G1IA 2OP5A 2E9ZA 4FS2A 3HVWA 2IMWP 1YI2S 3CCWA 3I32A 1UWBB 2VG7B 3OFHA 5CXTA 1SV5A 1JJ2R 4ES3A 1DJ0A 2Q79A 4BWMA 1XC9A 1S1VA 3M2VB 1VQ9S 3ZZOA 3M9OB 2Y1IA 2OFHX 4BWJA 4EFAC 1SIWB 3K5PA 1QE1A 2MKIA 3ISND 2ADCA 1U25A 1X5OA 3OHBA 2HGNA 2M5YA 4BDPA 1MROA 5CCMA 2Y1RI 3BB5A 3KWMA 4GC7A 4HT7A 3BEGB 2VH7A 3RU0A 1PO6A 2QA4S 2ZE2B 3TAQA 5FIIA 4C0OC 1BQXA 2MQMA 2FVPA 1F60B 3DC2A 4OHZA 3HPOA 4LFBF 3V6DA 4RW4A 4KFBB 1OSDA 2O67A 2X3GA 4CO5A 4JI6F 2DH9A 2XSJB 4IOBA 2MHEA 4YDXA 1T05A 4DV1F 3ZC4A 1HWIA 1D1UA 1MW7A 3MMAA 1G7CB 2EFNA 4WKRA 2M8HA 3I87A 3OR2B 3U1NA 4UUWA 3TYTA 4PUOA 4UOCA 5HN0A 1ZM2A 2KU7A 3F44A 3UQSA 1HWLA 2C3YA 2KRRA 3OTCA 4RNNA 2XSFA 1J5EF 1YJNS 1NRKA 2ZVSA 2JRSA 1FRMA 1TKTB 5KG0A 4X62F 2ZC4A 2H5EA 5AJ3F 3F73A 1IXKA 5FLXY 5KFIA 3HM9A 2HHTA 3H5SA 3VAJA 2DVIA 4L72B 1U8SA 1UVMA 1SB6A 2OPSA 4Y65A 1N36F 2BANB 2ZH4A 2CPFA 1C1BA 5B0BA 1FRJA 3JYTA 1SV5B 2F40A 1HNIA 1S1VB 2POKA 1S79A 3VQTA 3BSAA 1H0HB 4ZPVR 3KLGA 3B82A 1VK8A 3H2UB 1HBMA 3KK3A 4OZLA 2EG1A 1H7WA 2RKIA 3FNNA 4WXOA 4F3OA 4QWDA 1YJWS 4EZ9A 2C2EA 3V6HA 4TNOA 2HHHF 1DRZA 4HH1A 3TVYA 1KHWA 2XLKA 1FDAA 1MROB 1F9FA 1EETA 2A2DA 1WEZA 2N7YA 5DLFA 1U1LA 3IC1A 3M4XA 2ZHOA 4TU9A 2YWHA 2YQ3A 4OZ5A 1XERA 3Q23A 2DK2A 1N34F 1LW0B 3H25A 5E3AA 3ISZA 4LIRA 3S8SA 4RW4B 6FD1A 3V6DB 3RW7A 5KG6A 1WNEA 4ZPBA 4OHXA 2RU9A 1T05B 4UW2A 2PD1A 1X9MA 5LSRA 1QVGR 5D4PA 2HVHA 1YRXA 3MMAB 1YITS 1N54B 3CC7S 3T6BA 4PUOB 3N28A 1FNMA 2O01C 5J2PA 3EGZA 3MMBB 3NNAA 2KHCA 5F9LA 4V19J 4ATNA 3CDBA 4DQIA 2RD5C 5B0CA 3TP2A 2GFFA 4NA2A 4CZCA 1RT4A 4NZ0A 5KT5A 4AQYF 2ZDPA 3MF5A 1Y3KA 1LW2B 3U1MA 1Q8IA 2Z2LA 3D0GE 1S97A 1B0VA 1IKVA 1ZPVA 1NZAA 1DTQB 4XIUA 4K5SA 1C1BB 1LWEA 4RUAA 3JYTB 1RI7A 2DITA 3J81Y 4F4XA 2VB6A 4AXJA 1HNIB 3SXLA 4R8UA 3DLGA 3M6WA 2YKQA 1F5BA 1QJHA 3KLGB 5B7WA 3OVBA 3GWCA 3MTJA 1HBMB 4TQRA 3KK3B 4B9NA 2RKIB 4I6YA 2KH9A 3PW5A 2IBOA 3MM6A 2AU0A 2BQUA 3SMZA 3JTPA 4NLYA 2AWZA 3CJKA 4CH7A 2LEBA 1EETB 3AQOA 5CZVA 3G6VA 4CNZA 3PO5A 2XWYA 1NK8A 4YDDB 1HYSA 4DG1B 3T5JA 2Z0GA 3FEYB 1Y7PA 1DAXA 2AP6A 5AE3A 2R8KA 1V3ZA 4A8QA 3OTBA 4NYPA 4B9MA 4U6PA 4EBDA 1FD2A 2XZWA 3FRZA 4ZLPA 2R7WA 3IR6B 2I0XA 1YTYA 3OVAA 2UP1A 1IQTA 1SL1A 5AXKA 4DR1F 3JTOA 1FKPB 3QGGA 1HBNA 1SC6A 1LWCB 1RT4B 2YKOA 3MI7X 5DQHA 3HZEA 2WONB 4DL2A 4M8LA 2DR8A 3FMBA 3OR1A 4OI2A 1RWUA 4DDFA 2V4JA 1S49A 2C2RA 2EK1A 3L3CA 4F2RA 3RW6A 1IKVB 4RZRA 1JLCA 2K7KA 3TRGA 1HNWF 4O3OA 1LWEB 1FDNA 3OL7A 2XY7A 4ZMMA 4ID5A 5MLCV 3THPA 2B3TB 7FD1A 5GAEU 2BRLA 3DLGB 1BC6A 2WBMA 2O66A 1Q4RA 3PX6A 3A1YG 3I5AA 4A8FA 1U1OA 4DSIA 4F4KA 3MM7A 2RE1A 3CO9A 3RB6A 4DFJA 3MM6B 1HWKA 2XS7A 4K0KF 1D3WA 4FNIA 4PG4A 1HI1A 2W4DA 3PNIA 3CJKB 1FJCA 4MIBA 2PMHA 4DUYF 5HBMA 4PG5A 2MKSA 5KFMA 1HYSB 2YWGA 4KGMA 4ZPWR 5DG9A 2R2RA 3GR0A 2LYVA 2E9RX 1S72S 2AYMA 2RILA 4ES2A 2E