1OQ6A

Solution structure of copper-s46v copa from bacillus subtilis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGYHVVIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A core mutation affecting the folding properties of a soluble domain of the ATPase protein CopA from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Potential copper-transporting ATPase
total genus 14
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1oq6A00
1RJJA 2KKHA 5B0DA 1MWYA 2RMLA 2K1RB 3IWXA 2FIUA 5B0FA 2BYCA 1IUJA 3CJKA 2XMMA 2N7YA 2XMVA 2AJ0A 3F44A 2ROPA 1SQEA 2BJEA 2KT2A 2OD4A 3FMBA 4OJ1A 5F0WA 4Q2LA 1N5TA 3DCAA 3KG1A 5B0GA 3TNVA 2OP5A 4NPOA 2ACYA 1ULRA 2PGCA 1P8GA 1Q8BA 3KG0A 1JK9B 1VQSA 2XMTA 3CJKB 2K2PA 2LQBA 2RSQA 3TOQA 1CC7A 1FESA 2ZDOA 3KKFA 4Q2MA 1TL4A 2GCFA 2RU9A 2L3MA 1JWWA 5A6WA 2RILA 3FRYA 1LQ9A 2GGPB 3E8OA 2W4CA 2GA7A 2AJ1A 2ROEA 2IFXA 1X8DA 2HFOA 1P6TA 3LGMA 2LQ9A 2KT3A 3FGVA 2BBEA 2EW9A 5A6PA 2QYCA 4DPOA 2N4DA 2HLUA 4Y2KA 3K7RA 4A46A 1YJRA 3VTIA 3HDSA 2QLWA 2VH7A 1Y0HA 2FHMA 3GZ7A 4OJHA 1Y3KA 1YRXA 2BJDA 4Y2IA 1Y3JA 5B0BA 3BB5A 3UDCA 2XMUA 2IYIA 2BUNA 2QLXA 3BR8A 4ZOSA 1XBWA 1YJTA 5KAKA 2FB0A 1W2IA 3IWLA 4NL5A 1KVJA 1FE4A 1AFIA 4YEAA 1OSDA 1FE0A 5B0AA 1S6UA 1Q4RA 1N5QA 1N5SA 2K7KA 4U9RA 5T7LB 4HL9A 5K9FA 2GO8A 4FNHA 2HLTA 1CPZA 1FD8A 2GGPA 3QGPA 4HH1A 1GXTA 5F0UA 2AP6A 2GFFA 4HI1A 1KQKA 3LO3A 4DN9A 1Q53A 5B08A 3MZIA 3LGNA 1TL5A 2HFNA 3BF4A 1AW0A 1KVIA 3BN7A 2OD6A 1U7LA 3I9ZA 5B0CA 2LXFA 2OAUA 1OPZA 2LDIA 4A48A 3WDOA 2W4DA 5B0EA 1FEEA 2OFHX 2XMWA 3KNGA 1Q8LA 2ZDPA 1CC8A 4QOTA 2G9OA 5IXUA 1V3ZA 1Y9OA 2PD1A 2XMJA 3HX9A 1OQ3A 3QMQA 1YJUA 2HIQA 1WD6A 4EFAC 2VV5A 1TUVA 1APSA 1X0PA 2OKQA 2N4CA 3HHLC 3DXSX 1SB6A 2HQIA 4A4JA 1YG0A 2IYGA 1K0VA 2OMOA 4YDXA 1N5VA 1S6OA 2K7JA 2OFGX 2JDJA 5B09A 1MWZA 1QUPA 1AFJA 2AW0A 2ROGA 2Q3PA 1FVQA 3BGUA 2CRLA 3HHLB 4HH0A 4HI2A 2W4PA 1OQ6A 1FVSA 4FNIA 1R6YA 4F67A 4DL0C 2K1RA 2QIFA 1VQYA 2KYZA 1X7VA 3HHLD 1YJVA 3MCSA 3HF5A 2GV1A 4OJGA 3HFKA 1TR0A 4A47A 3BDEA 4OIXA 5T7LA 2FTRA 4Y2MA 1TZ0A 3HHLA 3TRGA 2ASYA 3BM7A 3T9NA 2XMKA 4OJ3A 1URRA 1GXUA 4ZA1A 1SI9A
chains in the Genus database with same CATH superfamily
4HR2A 2HW3A 1S6PA 1C4AA 1R0BG 2B56A 5KOWA 3HPOA 3G82B 3PJ9A 4M5DB 4LF8F 3S01A 1B7YB 5IS2A 8ATCB 1NSPA 2XSJB 1SQEA 2VG7A 3RBXA 5DG8A 4DOZA 2O3DA 2X1FA 2HNYA 4J9RA 3RB3A 3MUMP 2PGCA 1CEZA 5DQIA 1R43A 3MCMA 1DLOB 2BKOA 3HJVA 3A8KA 3R3TA 1DZ5A 5KFGA 2BOPA 1IM4A 3A1YG 1SC6A 4PG6A 3EGNA 1HBNA 4WFNQ 3OTOF 2D69A 3KJVA 1RBAA 2V2ZA 1X4BA 3OQ2A 3CF5Q 3VAJA 3DLLQ 3I82A 3WZ0A 1UEUA 4WIQA 5A6WA 4ZCMA 4N47A 1ZM4A 2MZRA 3ZO7A 3SV3A 1ZZNA 1BC6A 2FJEB 2MKHA 5K14B 4ANEA 1FJGF 1PIEA 1NM2A 2GA7A 2M3DA 3I6PA 3I0RB 4FXVA 3ZZPA 3BQ1A 3I9V9 1N8RT 2BDPA 5A6PA 2VJUA 1EP4A 3A8EA 1R0AA 4DV1J 2DNHA 3RW7A 3NOGA 1S10A 3V6KA 4J9QA 2HWTA 3H5UA 3MR6A 2J0WA 3NWGA 3MM8A 3DGPB 3JAMY 4TU9A 1REVA 2NUHA 4CTAA 3AH6A 1IM6A 1OS5A 1ZZFA 2R8HA 2IM1A 2HMIB 1U1KA 1U09A 5HVFA 1K9MT 2R8KA 1XBWA 3G96A 2X1BA 1MLAA 4NRTA 1SKUB 5LJ5Y 3G71S 2O5DA 5H9FK 4EZ9A 2M9KA 4I56A 2VOPA 1TUGB 1R0AB 2I9SA 4PPDA 2VONA 2HRYA 3MM5B 4X4TA 2KFYA 2MQOA 4ZPDA 4EEYA 4RW6A 3QJJA 4H4KC 4AXIA 2GW8A 5KT4A 2KJWA 2I0XA 3DRXA 1X9SA 2NZ4A 1UEKA 4ECVA 3QGPA 4ITSA 2QE5A 2YKAA 3SCIE 3B8HA 4ZHRA 3H4BA 4PUOB 2R7QA 4OHWA 2F8EX 4WP8A 1XMBA 1FT8A 2FUG9 2RS2A 1WTBA 3BQ0A 1GTHA 3MTJA 2U2FA 1X5PA 2DHXA 5H1SV 1L3VA 2LKZA 4O23A 3IS9B 4KFBA 3TVYA 2YNFA 2J9DA 4HDGA 2DHSA 1S1TB 5MLCV 2MQQA 5B0CA 3NMAA 1S9EB 1KQSR 3HKZD 4ATNA 2ZD1B 2MKKA 5K8NA 3W60A 5KG2A 4USWA 3VAGA 1U47A 2E1MC 4ZVQB 3MOZA 5JUMA 4LF9J 1CQMA 3CPWR 2XMJA 1SJ3P 2DY1A 4P6QA 5E0OA 4H4OA 3CCTA 3W2WB 3QO9B 3M9OB 2B6AA 2DO4A 1TK0A 2YNFB 3W65A 1KLMB 2VV5A 1S1UB 3ZTOA 4B3OA 4DR6J 4JV5F 1RT3A 4MIAA 2CQHA 4Y2AA 3PR4A 1TP7A 5DQHA 1ZAWA 1VDHA 2HQIA 1JLQB 2CPXA 1NO8A 1U2FA 1VIXA 3PO4A 1VRQC 4YDXA 2KYXA 2PMZD 1RAOA 5L1LA 2KHDA 3JAMU 4GO7X 2HWHA 4C0OC 2QL5B 3FC9A 3MOJB 4ZLLA 1VLYA 1RT3B 3ISNC 2POKA 2LDYA 3BSNA 4LFBJ 2YWGA 3KDOA 2XLKA 1RAIB 2D74B 5THWA 3OLAA 4ICLA 2GV1A 2G2OA 2UUAJ 2DXEA 2YWKA 4U8YA 1ZPWX 2DTJA 1Z4UA 1TR0A 4G1PA 4WTOB 3GB0A 2IY5B 2K3KA 4KE5A 2HGMA 3GE9A 2JRSA 1GX6A 4FDFA 4ZIWA 2E9RX 3OVBA 1NRKA 3LPYA 3UDVA 4ED5A 1EB0A 2B7CB 3OFGA 4NCGB 3PR5B 2K1RB 2YNIA 2VKRA 5E3PA 3OL7A 2H5IB 2VPYB 2OTLS 2KL8A 1UVJA 2MEWA 4DV6J 4NMLA 3MHYA 2C2EA 1NK4A 1AA1B 2HBYB 2QYGA 1S5ZA 3DRRA 5B0GA 3HVRA 1GK8A 3BGLA 3D4JA 3RR7A 2HNDB 4BLGA 4OYOA 1F60B 4IUFA 2OTJS 1NZ8A 5ADZA 1RSCA 1ACMB 4A8OA 3OTCA 4I1TA 3AOBA 4URGA 2CQ1A 5LXRA 3DLBA 1FRHA 2WSFC 3GR1A 1BHNA 2VG7B 1BE4A 3A3OB 5D77A 2C3YA 3KUEA 3MM5A 4Q2MA 1LV5A 1UVKA 1RUSA 1YX2A 3FEYB 3K59A 4A8KA 2L3MA 5KG1A 3NNAA 2OPQA 1JWWA 4P2XA 1FXDA 3K2YA 3IBWA 1FNOA 3DRPA 4OI2A 4RBVA 3RYLA 3CCWA 2W4CA 1AUSL 4OX6A 2BE2A 4UW2A 1NB2A 4YQWA 2GQQA 4X65J 2IFXA 1RI7A 2IRXA 2KRRA 2MSSA 3EVMA 5L1KA 2RIJA 2P9GA 4RBTA 1T95A 4UZBA 4N41A 3ZTPA 2E9ZA 3N5BA 1VQ9S 1WNEA 3K7RA 3VVTA 1U48A 1ZBTA 3B4DA 3QGGA 4RLEA 4ZVOB 1TK5A 1FJGJ 4NA2A 5KT6A 1UWAA 3R8YA 1Y3JA 2WRMA 2W7PA 3UDCA 4Y34A 1JXEA 1TUWA 2J0XA 2RUSA 3BR8A 3Q23A 5J2QB 1S9FA 1QSYA 1IKXA 2CJAA 2M7SA 4LIWA 4YN3B 6FD1A 1F0XA 4PABA 3NRBA 4TLQA 2N3LA 5HL7Q 1TVRB 3Q8UA 4XAKA 4JI5J 1WG5A 3UW1A 5T7LB 3HHDA 1O6XA 3UNGC 1HFEL 2EC0A 3K89A 2NSBA 2ZKUA 3CTRA 2HLTA 3KUHA 4QIEA 4WE1A 4DSFA 2C2DA 1QSSA 3WIUA 4HH1A 2HFUA 1KDNA 3NS7B 4DN9A 1HNIB 2VC0A 4RPFA 1JNRB 5IWAF 1PAUB 8AT1B 5KFIA 4WU2A 4X62F 4ELVA 2WOMA 2F4VF 2ZE2B 2VZ9A 1X60A 2FLNA 1GEHA 4NZ7A 1F3FA 3I9ZA 2F4FA 1IR1A 2XM3A 2H65B 4NA1A 4C11A 1RCOB 2UXBF 1O0PA 5KFLA 4IKAA 4MIBA 2XMWA 3W7BA 1EQ0A 2L48A 3FK4A 1HWJA 3IS9A 2Z2ZA 3MEGB 1QTMA 3GLJA 4DSEA 1PJ5A 3WC0A 4RW6B 3JTPA 5KT3A 3SFUA 5EN1A 5GADI 2MZTA 3C6TB 4IG3A 5BR8F 5L39A 2AIRB 1U4BA 1VFJA 2ADCA 4P7VA 4CH7A 4F36A 3W62A 1IKWA 3EVWA 3NBPB 2FHJD 2XB2D 4YOEA 4HEA9 3ISZA 2AQ4A 2N82B 2HFZA 2OEKA 4DDFA 3EZOA 1FVQA 3UVJB 2CRLA 3DHWC 4R8UB 5GADU 3NGKA 2W4PA 2V8PA 3KLHB 4KO0A 3NNCA 1S9GA 3AD7C 1FVSA 2V8VA 3GFHA 1U2CA 3SIPB 4DL0C 5CCLA 5KFMA 5HJXA 4IH6A 2R9LA 5HO4A 5ETVA 3Q2TC 2UXCF 3RBZA 3VAHA 2EG1A 2NSCA 2ZWOA 4C0HA 5HQ8A 1GMWD 1QM9A 5F41A 3BO4A 2H51B 2BE7D 1RDRA 2W8KA 5LM7E 1PCAA 3A13A 3PHEA 4O3RA 2ASYA 4OJ3A 5HMZA 3DDNA 4K4VA 1F3VA 1Z1ZA 5B0FA 3ENAA 5LL6d 3TUJC 5F3ZA 2ZM6F 1JLQA 1RLDA 3MECA 4DX5A 2IMWP 2Z4PA 1FNMA 1JB0C 3IXQA 3BSCA 3PHTA 2J5AA 3KK3A 4UY8T 2B4VA 2HS0A 3M6XA 5HVHA 3DFEA 3D0HE 1KBRA 1ZPVA 2AU0A 1RYRA 4CLUA 4AT1B 2EFPA 1XMOF 2XSFA 2AHOB 1YJWS 2FJAB 1GQEA 3CJKB 2K2PA 3EZUA 2O66A 4R0EA 4EBDA 5ETOA 2VFSA 4JV1A 4ZKAA 4UTGA 2GVZA 4DF8A 2H3EB 1WC0A 2ZBPA 3POTB 2CZ9A 3VGTA 1MN9A 4QR0A 4KGXB 1F6TA 3DLEA 1RTZA 2MGZA 4K4UA 2UUCJ 4UOGA 2ZJQQ 1PBUA 1JJ2R 4NASA 3HD1A 1WF1A 5A8WB 4MKVA 3NCPA 5G0RB 4C4WA 3HULA 2BBEA 2DGUA 2PO4A 1IBKJ 2FLPA 3RB6A 1AB8A 2Z58B 2VB6A 3BJYA 4YMEA 4PWDA 3VTIA 3HDSA 2V4RA 5EX3A 5A8RA 4U67Q 2HHWA 2OO4A 1SJ1A 4PWUA 1RADB 2AMCB 1RXOB 2BABA 2XYPB 4C97A 1S99A 1UJ6A 3OL6A 4OZ5A 1TKZA 4IOCQ 1RBOB 3JSMB 3T1AA 3W5YA 1YITS 4ZN1A 3WC2A 1AFIA 5D6GA 3N79A 1RBLA 5A2QY 2QLJB 3AOAA 3BO3A 1N5QA 3D3CJ 5ITHA 3MM7B 4GKKF 2YQ0A 2CQ3A 3TAPA 4LSNB 3E3XA 1ZH5A 8RUCA 1ZTWA 2FY1A 2FHOB 4KY3A 5ETNA 4KBIA 2F1FA 3H5YA 5H9EJ 1K8AT 4C8OA 2XNRA 2MY8A 3KOAA 2AX1A 2BE2B 3JS9A 4OI3A 1C0UA 4RW8A 1KQKA 4JI3J 3AJ2A 5JXSA 2HZVA 2LA4A 2ZNYA 1NSKL 4IO9Q 2HVZA 3AB2B 1TL5A 2EG2A 1S4FA 2AZ3A 3CSKA 4LR8A 2DEJA 3UDEA 1SJ4P 2DR7A 1NZAA 4HT7A 2ZVIA 3SSRA 1M5VC 3M9MB 4C9DA 2WZ1A 1OPZA 5CYJA 2HYIB 1RTHA 3U7JA 1N52B 1U25A 4TLRA 4LRFA 5U47A 4MTPA 2WSEC 2DNLA 3J7ZT 3R1HA 1L3TA 3Q8VA 3EGVA 3KNGA 2ZDPA 5HMWA 2ZH5A 2P9EA 3JB9k 5FIIA 3M7VA 2ERRA 4LF7J 4M5IA 1NPKA 5E7OB 2A1BA 5DS7A 1K44A 5T41A 4GVBA 3M2VB 1RP5A 3WHIA 2HVDA 1YJ9S 1IBMF 2IVFB 1TK8A 4NEYA 2B5JA 5A8KA 3PO5A 3MMBA 4NLDA 4F4WA 1CG2A 1RT6B 2XULA 2OPRB 5F3TA 2JDJA 2LEBA 3HSDA 3J7Z5 3MCOA 4RR5A 3UN3A 2H48B 5IM0B 4C3KA 4EYHB 2J7KA 2ZE2A 2UV8G 4F8RA 2ASLA 1TAUA 2AF6A 2O67A 2V69A 2H4YB 4KGMA 4KR0B 2ZH6A 3J7AN 1HQUB 3MWBA 1NCLA 2B5JB 2XBPA 1WUUA 1HIYA 2QIFA 3QATA 3MPYA 2LVWA 3J81j 2LU2A 1FX4A 3CC4S 5FJ4A 2FGCA 4WJBA 4QBUA 3OVAA 4IRCA 1P1LA 2E7VA 1KHVA 4ZVPB 2W25A 4LR7A 5HK4A 4ELTA 1M5KC 2E1PA 3BM7A 3MDFA 1KKHA 1S1VB 3C6TA 2OD6A 1M1GA 4G6VB 2KFZA 4DV3F 2DPIA 1LK7A 4IYQA 2W2QP 4WF9Q 2QT7A 2VG6B 2PC6A 2VBXA 2BJEA 4H54A 2QV6A 4OJ1A 3S7RA 1EETA 4LIRA 1C1BA 4AXJA 3R7SB 1PO6A 2J0SD 2EFQA 1UFLA 1SXLA 1MW7A 3EGWB 1FEHA 4J37A 1OPIA 1T9YA 2QA4S 2LA6A 4PXEA 4DR1F 1YBTA 4DR7J 1U6BA 3K5LA 1NDKA 1M1KT 3IRXA 1XR7A 5AXLA 4P75A 2I1RA 2DH7A 3N5FA 1H98A 3QSIA 1DTTB 3TOQA 2V67A 1T9UA 2B8PA 1CJKB 3MM6A 4LBIA 4P2FA 1F9HA 4RNHA 2DGVA 2GIFA 2RU9A 4A8WA 2NREA 4FYWB 4K2XA 3W9JA 1FWLA 5A0YA 2ZJPQ 2FVCA 2OSRA 2DGWA 3BKTA 3FKBA 3SBMA 2FHJA 3RAXA 2DD8S 2UP1A 5KFUA 3D3BJ 3ET6A 4YS2A 4O3OA 3TZZA 1HR0J 1R7IA 1B7FA 3CJQA 4DZDA 5E41A 4CLPA 2YNHB 1F5CA 1PJ7A 2KFNA 1CJKA 3MM6B 4WXWA 3AQPA 3MURP 3IAM9 2BQ3A 1YJRA 2CQ2A 4DCPB 2VQEJ 5DLFA 4NWBA 4OJHA 1KEKA 5HN0A 4JI1F 3GONA 1HBMB 3HSZA 1TFYA 1KP6A 1Q95G 4USHA 1UWBB 5B0BA 4YHHF 1RKJA 2IYIA 4DFJA 2XLIA 2EI5A 3TEGA 2KTQA 1EX8A 1ZM9A 2CKWA 3FQKA 4OZ0A 4RJVA 4C8NA 5AXKA 1HLWA 4DJBA 1Q4RA 3AQOA 1N5SA 3VAIA 2LQJA 4Y6IA 2GVDA 4F2RA 3PYDA 1VGYA 1YKWA 5DGBA 3QFWA 2GGPA 1RB0A 1Y7PA 2KZZA 3P96A 2RRBA 4PRFA 2F4VJ 1HNZJ 4DS4A 2QN6B 1Q53A 2RQKA 3KFWX 1DJ0A 3SZ2A 1AW0A 3VGUA 1KVIA 2XY5A 2UXBJ 1IVZA 3ZZ0A 5B7WA 4WK1A 3R5BA 2B6AB 5J1EB 1M5OC 4IRKA 3KMQA 1MN7A 3V4MA 1RWUA 4X62J 2Z57B 1OO0B 5ETSA 3RAMA 1YJNS 2J9CA 1SQFA 4CH1A 3PW4A 3EICA 2ZBCA 1V3ZA 1S0OA 3UO0A 1DQAA 3G87A 2CQ4A 2RF2A 2C2MB 4YFUA 4C0BA 1T9VA 1RABB 3EZ5A 4CLYA 4DFKA 1MMLA 1TUVA 3LQVA 1Y11A 2BQRA 4RBUA 2RS8A 3DHXA 3CCES 1Q16B 5KG5A 4IH5A 3GU0A 4M95A 4UZCA 4PQUB 2FVSA 5C25B 2IM3A 3FMWA 2B4OA 1FO1A 1FRMA 3G8QA 3HD2A 2F9DA 3I4HX 2XCPA 5C24A 1KLNA 1FKOA 2DNYA 3EGZA 4OI4A 2HVIA 2C3PA 4DZ6A 1I51B 3MAQA 3G9CA 4KQZA 2XO7A 4H4KA 1TMJA 4NXNF 2ZVSA 5GMDA 3GCXP 1NJZA 3THVA 5C7PA 4HHHA 1TU0B 2J8SA 4NCGA 4MFBA 1S59A 3CDAA 3M2UA 5H9FJ 5C25A 5KFRA 1RQ0A 1TKXA 4B9VA 2HVHA 4L73A 4ER8A 3NS6A 4CLZA 1IKVB 4OZJA 4MAKA 5IQ6A 3PX4A 2E5LF 1PC4A 3HHLA 3IG1A 3P5TL 3MPWA 3M8QB 3BBCA 3M8WA 3PEJA 1PGZA 4DUZF 3DLKA 5B0DA 5KG0A 5E3RA 2E5HA 4N8OA 3KHLA 2XMVA 2WAQD 1JXLA 2HZAA 2KH9A 1SC3B 1NLKL 1RT7A 2D41A 2DNKA 3U1LA 3UR0A 2FDNA 3ZC4A 4HKQA 2UUTA 3EJMA 2HK2A 2X3DA 1JX4A 3J7A1 1FRIA 3VALA 3R2CJ 4KV8A 3DRPB 4K4TA 4CO0A 4JI7F 4GKKJ 4JI4F 1G4CA 2VFRA 3DYAA 3I5BA 4J5OA 3GIRA 2BANA 1F2HA 4KYZA 3TJ9A 3CDBA 4ID5A 4ZDNA 1KTVA 2E44A 3KLIA 4IFYB 4ES2A 2GCFA 3HXMA 1YK9A 5ETMA 2A0FB 2IM0A 2OEJA 3AJ1A 3OSPA 3K5PA 2WHOA 1KLMA 1HD1A 2DGOA 2MKSA 2KRBA 1M5HA 2C1EB 3BR9A 2PIIA 2HQCA 5E5NA 2Y8WA 4F3OA 1QE1A 3ZXWA 5J2QA 3J81U 3IRXB 3QRQA 4OI1A 1HW8A 1SH3A 2IRUA 2VBYA 4C3LA 4DV5J 2AYBA 1YRUA 2ZOGA 1NXIA 4ZVFA 3P49B 3ZTQA 1I3OB 3RU0A 1D8YA 4F0KA 3GR0A 2IDEA 5RUBA 5KFSA 3HK2A 1WC1A 3H2VE 5IQQA 3JYTA 3GIIA 1IQTA 2QL7B 1RE1B 4NZ0A 4Y2IA 2BV3A 4C7QA 3BDPA 1YTYA 2VODA 2BRLA 1TL1B 2RUGA 3M8PA 1QY7A 2BUNA 4MYTA 4DV2F 4FF3A 2VHGA 4NE9C 2DNRA 1N5YB 2FB0A 3AOCA 1W2IA 1H73A 1JJHA 3HJFA 1HNIA 3NL0A 3QIPB 4FYXB 3GJSB 5KFQA 4EO6A 1X4CA 1O51A 2ABYA 2CIMA 3MAAA 3OFHA 3FBFA 2HAIA 3ADAC 3OXGA 3T9ZA 2E1RA 3FBEA 3OTBA 2ZITA 4I6YA 3H2LA 1P9QC 4XTTA 4WFZA 4YDDB 3J80Y 1FK9A 2MKYA 4O3QA 2CNNB 1QVGR 2FC9A 3ZZZA 1B3TA 4MKBA 2JEIA 3MZIA 5DGAA 5LJ3Y 2LMIA 4QPTA 2DGQA 4H4OB 1HD0A 3NG8A 2YWWA 2MLZA 4N5SA 4LSZB 4Z7YA 2J7WA 1SQGA 4A8XA 1U1LA 2OMLA 4G1QA 3EYZA 3UCGA 1N33F 4X4OA 1RAGB 1Q8IA 2LDIA 3HFZB 5HQMA 3CCQS 1ZM2A 4GVLA 1H72C 4Q7AA 2JFDA 1EQMA 5HJYA 3HKWA 3QFHA 2FQQB 4OMFG 1I94F 7FDRA 1TKDA 2C2ZB 3MPDA 3QYYA 1IBMJ 1VQ4S 3M9NB 1H3DA 5BXIA 1VBYA 4K0KJ 3PRDA 2C3MA 4F25A 3MEDA 2BJ8A 1KR4A 3K58A 2HGLA 4R8UA 2AZ1A 3KLHA 4LF7F 2H4WB 5SZTA 2V50A 4ECSA 2CJBA 3AXMA 4ED0A 1NU4A 3TAMA 1Q82T 1WJ9A 2VD3A 3R7NB 4IR1A 4DN0A 4DPWA 2YBVA 3GTYX 1RAHB 5KFTA 3SV4A 1WOSA 2LYVA 3E51A 4M5HA 5B09A 2XHCA 2ALYB 2QC3A 3VAKA 4AL5A 2QL9B 1WEYA 4K7QA 4ZK7M 2VIHA 1WC5A 5J1EA 2XMAA 4NYZA 1JLCA 2CPIA 2DXDA 2VF3A 3KWMA 2CQCA 1FHTA 2K1RA 1S6PB 2GAGC 2YNIB 3QWPA 4NLVA 1NJXA 1TKTA 3M8ZA 2KG1A 3OL8A 1NEEA 2HEKA 1HR0F 3ZFVA 1WC3A 2FJXA 4OIXA 3MM7A 1R89A 4EGLA 2PFFB 1JNZB 1T3OA 1URRA 3F56A 5BJRA 3SYZA 5LSOA 2ZC3A 4MMOA 1QD1A 3GSDA 3BSAA 3I0RA 4ZVUB 1GAOA 4DPTA 2ZM6J 2YPYA 3CJKA 1IUJA 2P6SA 5EUHA 3TUIC 1ZYQA 4B3RJ 4LFBF 4M5KA 1KOOA 2EK1A 4X64J 2H5JB 1VBXA 3DM2B 3P5BP 2IAJA 1HARA 4Q2LA 1GH8A 1HBUB 3PCOB 3GIKA 2HRTA 5ETTA 3QPIA 3SCJE 1D9AA 4NI2B 3UPFA 3SSSA 1HKAA 2OGUA 3H59A 5HANA 5C2GA 2NZCA 5J1PA 3MMAB 1BWVA 2G0IA 2XMTA 5EX0A 3TO8A 4QCLA 2MMYA 3MF5A 4JOUA 2FZKB 1VC0A 3ULHA 3AY0A 1FESA 3QIPA 4L3KA 2JEJA 4I67A 1UPMB 4KRWA 3T19A 5CA5A 1RWKB 3W9HA 2R2SA 4J9UE 3G6VA 4DLEA 1LQ9A 2W2PP 4QR2A 5CD4H 2W8LA 4B3TJ 2AJ1A 2MJUA 2HMIA 4FXWA 2OJ3A 1U45A 1V5IB 4J9NA 1VS3A 1RT6A 4P52A 2W01A 3PXGa 2HFSA 2HLUA 4OL8A 4Q43A 1YRXA 1ZTTA 1NKBA 1MMNA 1RHRB 3BB5A 4USIA 4ZP8A 1RTJA 4WFAQ 1T9XA 2I5JA 2QLXA 3SFGA 4F4YA 1J2VA 1SKWA 2IHR1 1SIZA 4G65A 3IN5A 2DR9A 4ZLJA 1FFSB 5CCMA 1KC8T 2R3VA 4IFYA 2VPZB 2E5IA 3MEDB 3K57A 1UZHA 3C6UB 3RAQA 2BM1A 2GMLA 4FNHA 1UEVA 3D2WA 4B3OB 3NGDA 3DXBA 4RWXA 2R8GA 3SI8A 5KG6A 1GXTA 4LBHA 4AYBD 2AP6A 2YKQA 2HHHF 1HNXF 2B7BB 3L4BC 1PYSB 4H4MA 1UMJA 1CJTA 2CG4A 3CJSA 3GIMA 2HAFA 4WP9A 1FWPA 1V3RA 2DK2A 5D78A 3HSGA 3P8BB 1SKSA 2YY3A 4ZPTR 1QAIA 3C2PA 4NLTA 1XNQJ 3R2DJ 3MM8B 2BOAA 2HURA 3CDUA 4DQSA 3OHAA 1NHVA 4LJMA 3FBCA 5L8RC 4ILLA 3BQ2A 3CO0P 3CJ0A 2LECA 2QLBB 1WG1A 2JEGA 1HNWF 1H2VZ 1CSJA 2KZMA 2PD1A 3O1LA 1OQ3A 1RU2A 3M1VB 2CDRB 3DOMA 3QLHA 1T03B 3LW5C 1SJRA 5I3UB 3BBBA 4JI2F 2AT1B 2H1YA 4FPIA 1HQ2A 2DXFA 2J8AA 2XYGB 4ED4A 3TUZC 1WKLA 1FK9B 1T7PA 3P6YC 1SB6A 3QRPA 1E6VB 3TX0A 3K5NA 4GO5X 3NAHA 4URQU 4I6AA 1X4GA 2YKNB 3R5DA 5I3PA 3WBZA 1JMTA 2Y0BB 1AFJA 4JUZA 4K2JA 5DQGA 5E3QA 2E9TA 2B8QA 4LREA 1VHFA 1S9EA 1V6HA 4FNIA 5CYMA 1VC5A 1Q86T 5LXYA 1I6JA 1UTAA 1YJVA 2JLGA 4DUYJ 1L3UA 4HVZA 3PRVA 4P10A 4NXNJ 3CEDA 3AHPA 3PFEA 4EUVA 1ROFA 2COLA 1RWWB 5KFAA 3CJTA 4Y00A 2KM8B 2OSQA 1XMOJ 4B3MF 3PKMA 1S7IA 4B9TA 1VQNS 3N0VA 4BBYA 5F8GA 3V4IA 3KG4A 1RISA 4QOTA 5GAGU 2BA9A 2X3GA 3D7SB 3OFEA 1MWYA 4QIFA 3IR5B 4OQJA 4CH0S 5DM6Q 2AKWB 3DLJA 4V1Ak 4C98A 3CUNA 1S77D 5D0HA 3FMBA 4DV2J 2DRAA 2G0CA 3PJWA 4WYLA 4ZVTB 2J7UA 1XNQF 4K4ZA 1OYDA 3J7YU 2BJ9A 2F65A 1X4HA 2G0JA 4YB5A 4K5SA 2RDIA 5A8WA 4X66F 2EVZA 1CC7A 4ZVEA 4QIGA 3OJUA 2VPWB 2ZDOA 3BH6B 1VJQA 3VF0B 2Z56B 5CABA 4OYXA 2PI4A 3VV2B 3AXKA 3BN4A 2F7VA 3B78A 4F4ZA 2G13A 4P7TA 1HHSA 2DCUB 2K8GA 1LFWA 3M2VA 4AD6A 2CQBA 4ED7A 2ASDA 1MU2B 2EKNA 1UVLA 2J76E 4DX6A 3HVWA 2L08A 3THTA 3ILLA 1Q79A 1UA1A 4DSKA 1XR5A 4HDHA 2FLLA 2DNNA 4M63A 1U0HB 5AT1B 1HBUA 4DQPA 3CD6S 2GMJA 2GQ2A 2XWYA 1U02A 3HFVA 1I94J 3IC1A 4RUCA 2MYFA 2AJQA 3MMAA 3BREA 3TWZA 4U96A 2BQUA 3QJPA 2FJWA 1YJTA 3GSIA 1HWKA 4NL5A 3MUVP 2WVFA 1BXNA 5KFVA 3KHHA 4DUYF 1J5EF 3M4XA 3M32B 4RW9A 5L9XA 4U9RA 5KFOA 3CDEA 1V9OA 3NXZA 1RT5A 3I87A 2FVRA 2WVDA 2VQFF 1H7XA 1LFPA 2V2VA 3RRKA 1PILA 5HROB 4KIAA 2XWXA 4KT0C 2IA6A 1LKZA 2G1HA 4LRAA 1NB7A 2UUWA 4RL1A 3HT3A 4XIUA 3RGIA 4I7FB 3MEEB 4F02A 4P2MA 2B4UA 2VG6A 1U1OA 3QIDA 3CT9A 1C1BB 2WB1D 3D0IE 3M32A 4QIVA 5K8OA 1NK8A 4J9SA 1SCJB 5KFWA 3BBFA 2CQPA 2OELA 3RZAA 2LXFA 1FWKA 3RB4A 2GJ2A 1NJYA 4KGZB 1KS2A 3THPA 4Q0BB 2BANB 5BYSA 2RRAA 1FRKA 3PY8A 1R0CB 2JOQA 2G9OA 3OBIA 1NSAA 2QMXA 2F63A 3A3NB 5BYQA 3HLUA 4USUA 1S49A 4ETZA 1FRLA 1WD6A 1NBEB 4NZ6A 4RKUC 3S6EA 4MH8A 4DLGA 4UUXA 1KQGB 4UF4A 3MTKA 1APSA 1HQUA 2FYXA 1EARA 2BRKA 3LF0A 5DZ7A 5KG3A 4O0IA 3FSIA 2NYIA 1JLFA 1S4EA 2ZD1A 4Y2CA 3ZNJ1 4JI6J 4IOAQ 2IYGA 2CJYB 3FUYA 4H4MB 1K0VA 3W63A 2JC0A 1TQLA 3VHQA 4K4SA 1JLGA 1QUPA 2JL9A 3IGNA 5M2PA 1VQOS 4IR9A 2XO6A 3BGUA 5F9NA 3HHLB 2HSEB 4HI2A 4ETXA 2G4BA 3LWLA 4Q5VA 1QJHA 1S6QB 3T6JA 3T5LA 3FCVA 5L46A 3SQGA 4O44B 1KVKA 5KT5A 4B9UA 1E6VA 1X4AA 4O4RA 2XCAA 4DPUA 1T94A 2K3IA 5L38A 3TZXA 4DV4J 1SL1A 3QSYB 3BDEA 1N36J 3MAAB 3OW2R 4FYDA 1Y5IB 4P72A 3GYXB 3KHGA 4ECRA 4CNYA 4RNNA 3CULA 3FRZA 1GXUA 4WU3A 2RQCA 1JLAB 3VGSA 2WVBA 1U26A 4X64F 4D3GA 1MU2A 3OV7A 3KLEA 2W9CA 2CJ9A 1RAEB 4O44A 4DR2F 2FIUA 3VQTA 1QVFR 3BO2A 3GV7B 3F44A 4CI0B 2GHPA 2GVZB 2KM8C 1LWEB 3HVAA 2DIUA 2QZ8A 2B9EA 2Q43A 1IJEB 1N0VC 2ZOMA 4J9OA 4AQYJ 2YKNA 2BACA 1HPZB 3DLGB 3JQJA 3MI7X 2CQIA 2VKZG 3QRRA 2CYYA 3JQMA 2QA2A 4ECYA 4O3NA 4E8UA 3I4PA 2DT9A 1JK9B 2PA3A 1FRJA 1VBKA 2AGPA 4M5DA 2CAJA 1SVDA 3SMZA 5M2UA 4ED2A 2NCKL 3F0NA 3UN2A 5K5MA 4N76A 3KKFA 2R8IA 4B3SF 1BUXA 2DGSA 4I2PB 3M8RA 3LANA 2VA3A 4F2SA 3S1TA 2FD2A 3FRYA 3E8OA 2O01C 1HI1A 2RU3A 2DITA 2EC2A 4X4UA 4DSIA 1HHQA 3R97A 3KK1B 1N5YA 1TKZB 1FXRA 4WFYA 2KT3A 3UD3P 1T05A 1NK0A 5J2NA 1TVRA 2ILYA 2E1AA 2XY6A 3R5JB 4ZLPA 1P9YA 1M5PC 2DNMA 1JKHA 1SKRA 2FJBB 1Y0HA 2GVDB 1G6BA 5GMEA 1RAAB 1VRUB 1Q5VA 4KPYA 2CNOB 2JX2A 3CJ4A 4RU9A 2W1BA 2XMUA 3BH7B 5IT0A 5DG9A 3TI0A 1YDLA 4B9LA 2HQFA 2WONB 4FBTA 1KVJA 1FE4A 5B0AA 1S6UA 1ELOA 4FVMA 1IKVA 2RE1A 2J9EA 3FJ2A 3OFFA 1N36F 1YHQS 1TL7A 3DGPA 3FCWA 5GAEU 3IG1B 3QT7A 1WG4A 1EKRA 1NK7A 4NOHA 2XS2A 3OL9A 2E5GA 1DARA 4PR6A 3KTQA 4JI8J 1CVJA 2DNPA 2I8EA 4I6WA 2DJWA 2A6MA 4HACB 5CZXA 3CCMS 4DV3J 2UVUA 3GP9A 1J5OA 2I6WA 5CHCB 1WI8A 5KFZA 1NNDA 3DM2A 1Q81T 4FS1A 4DX8H 3PFOA 1DQ8A 1MNEA 2HS4A 1U7LA 3DRRB 3N28A 4P74A 2X1GA 3MAHA 3D28A 4B02A 1N88A 2V63A 5A8RB 4F0HA 5FLXU 3NS5A 1WC6A 2WK4A 4LUBA 3OUYA 1UCNA 2UVVA 3GFZA 4Z7CA 4YB7A 4O4GA 1VLOA 3RB0A 5F8HA 4I7FA 4YR2A 1NJIT 1IWGA 2VPXB 2MXYA 5KFYA 1NMEB 1N0UA 1YGYA 2M4MA 1BQNA 4QQBA 3R5GA 1H74A 3OT9A 2BE9B 2VFVA 1IBCB 2CDQA 1OIAA 1SH0A 3OR2A 4PXDA 4QZVB 1QLNA 2AEMA 2JNJA 2DNQA 4IO1A 4NLUA 4EFAC 4A8MP 4V19J 1MSWD 2OKQA 3VCDA 5SUHA 2D3ZA 4HT5A 2XGPA 4DL7A 4KHPF 3TUPA 3CGIA 1EP4B 3HO1A 2DB1A 1REGX 1TKXB 2OFGX 1UZDA 3N4WA 1IN0A 4QIWD 4X66J 1HQEA 5DDRC 1VOMA 4J9MA 4DR4J 2C3UA 2RJZA 3DI6A 3NLCA 2XY7A 2VQEF 2MSTA 4GC6A 4MKAA 5DDPC 1YZ6A 3QQCD 2MTLA 1TMMA 2MB0B 4UY85 3NNHA 5DZ6A 4OV1A 4QWDA 3C8YA 3QGHA 1R8AA 5HI7A 4F26A 2MQNA 3MECB 2UUCF 3PVXA 1S1WA 3MD1A 2P5VA 4LBPA 3PYFA 4QWBA 4Y0FA 4CT9A 5IFMA 1IBKF 1WKJA 1S6QA 2YH0A 4KSEB 4KO0B 3K8WA 4MK8A 5D15A 1W7WA 4ZA1A 5FD1A 4CZCA 1U1QA 2QSWA 3FSYA 3AD8C 3MMJA 1FXLA 1HNZF 1YSJA 3LPEA 3O8WA 1DBDA 2KT2A 2OD4A 2JC1A 3BKUA 1S1WB 3PRBA 1FI4A 3EMTA 3US5A 5E3CA 1EIYB 2MQLA 2W2MP 4PYDA 1LEOA 2ILZA 2OPSB 4P73A 4TY8B 1HBMA 3CW2C 1P8GA 5AE1A 2MZ1A 1Q8BA 2AV5A 3W9IA 2W9CB 5EWFA 3K0JA 3AAWB 2RD5C 4DL5A 4X84A 3KLFB 2LQBA 3C14B 1VQLS 3EE3A 1FNXH 1QSLA 5F8IA 4DI6A 1LWEA 9ATCB 4A8YA 2UUBJ 1YVFA 3CJ8A 2RRNA 1EZZB 3MEGA 2YKPA 3KK3B 1SJFA 1A9NB 2ZHAA 2HBRB 2HNDA 4DL2A 3UCUP 2CADA 2GGPB 4DUTA 2HHQA 4S0MA 4LFAJ 3BGFA 1RTJB 2FLOA 4OHXA 1VJWA 2PDAA 2ZFHA 4JI4J 2CPDA 1GMUA 1FKAF 3LGMA 2LQ9A 2YX1A 3FGVA 5I3QA 2DNZA 2YNGA 3HCXA 2DR6A 1N56A 1TL3B 2EFGA 2EWHA 5CAAA 1SC4B 1FX2A 2XI2A 3EDQB 2FHMA 3LUYA 3L9ZA 4M5GA 1G7CB 2OHDA 1C4CA 1NHUA 3LGHA 4DG1B 4EK2A 5LOQA 1J5EJ 4USKA 2UVWA 1C0UB 4RW8B 2RQMA 3N6NA 2LLZA 4WIIA 3R5AA 3SDEA 1CJTB 4DV5F 2AX0A 4TVAB 2CQGA 1KN6A 4LF4F 2GQCA 2PSZA 2E5LJ 5K9FA 1CJUB 2MQ8A 4FZVA 3GV5B 4FF1A 2AJ4A 4L75A 1XNRF 4RW7A 2MQMA 1GMWA 4OLOA 3FFIA 3AD9C 1LWXA 1VRTB 1LW0A 2EKYA 3TQEA 3IRWP 1UKUA 3V4IB 3CD0A 1N34J 2UU9J 4E98A 3Q86A 2Y8YA 1S76D 3W2VA 1A7GE 4USTA 3HP6A 2ZH4A 3DI6B 4DV7J 4LVOP 1EHWA 2ZWPA 5IT4A 1N6QB 4MKYA 2NR0A 2LQ8A 3LP1B 2IMOA 2YPZA 3BEGB 2YWFA 3PW7A 2V68A 3RUBL 4C2MA 2XZDB 3GFYA 2RAQA 2PFDA 3DKDA 4J91A 5IC4B 4XPEA 4JI7J 3FQLA 1HMVA 2NYHA 2OFHX 2XTJP 1Q8LA 5HLFA 3ITHB 1CC8A 2BMBA 1DQ9A 4OX8A 1RWOB 4ZVSB 7FD1A 5IM0A 4QR1A 2LXIA 4A8QA 3TR5A 4M1KA 3PIOQ 2D3O1 1FA0A 4LRBA 2CPJA 4AFFA 4DR5J 2LEPA 3OSNA 2YQ3A 3LP1A 3JTNA 1CJVA 1FJ7A 3V6DB 2Y1RI 2H9ZA 3OUYB 2LXUA 1LW2A 1RT1B 3HHEA 1X9WA 4O4GB 1SJQA 4FP9A 4O0NA 1B70B 4FS2A 2YH1A 1ZAVA 1WF0A 2AYEA 3TA2A 1RHMB 5IZHA 1JLEB 3FDSA 1BQXA 3NY0A 4DQIA 2HNZB 1MWZA 3CWJA 3D6TB 3D9BA 1EJ7L 2AW0A 2ROGA 2DBBA 3NEKA 3WX4A 1S7HA 2XS5A 3D1OA 3H2UB 1R8PA 2MHEA 3LOUA 1WHWA 1VQPS 4F04B 5JMNA 4DV4F 3CMES 1ITPA 1R6YA 5C42A 2P2CB 3DLKB 3B54A 1C0TB 1U8SA 4DL6A 5DJBA 3MMBB 3A3PB 3IWNC 4XDDA 3T1YJ 2V0NA 2CPFA 3RG6A 1PG5B 2X51A 4OX7A 3ZZRA 1HBOA 2RHQB 3GFXA 3LALA 4ZPAA 2QG9B 2ATCB 4YB1P 2PEHA 2J0QD 4HTIA 1RJJA 2B0GA 3MM9B 5E2QA 2Z2YB 1N34F 1Y10A 2UU9F 3P4UB 2V6AA 2N7YA 2BR0A 4IH7A 3LAKA 3ICLA 3G8SA 4EZ6A 1D3WA 4YHHJ 4UOFA 3C15A 5K8MA 2CQDA 3OXLA 5JVGQ 2U1AA 1ULRA 5L1JA 4L6V3 2JH3A 3KG0A 2W2NP 3L09A 3M30A 4YUDA 4TXSA 1L5UA 1N54B 2LFVA 1VQ8S 4LSLB 2QO3A 2GC8A 3CDWA 4RW4A 5DM7Q 2IVYA 4K5RA 1DHMA 3GCWP 3C15B 4UOCA 3H4DA 4F4XA 1CJUA 3W5ZA 4TY8A 1R27B 2B43A 5K8PA 4URSA 4J7CA 3TVKA 1REVB 5LSLA 3KHRA 3QT5A 1ZETA 5IT9Y 1SV5A 2K06A 1L3KA 3HVTA 4ZPCA 1CULA 4ZPBA 2ZZTA 4DQQA 3NBPA 1UETA 3I31A 1R31A 3POTA 1Q1KA 2VFTA 2ZNZA 3W2VB 1S57A 4ES1A 3OLBA 4LF2A 3CCRS 1BY9A 2QLWA 3BV8A 3GWCA 4Y3CA 1FKPB 1X4DA 4CLKA 1Y3KA 4X4SA 4U95A 3MFHA 2XNQA 3CC2S 1RKIA 2KXFA 3ZNUA 4LFCF 1U1RA 2CWKA 3M2RA 3QJLA 2ATLA 2KVIA 4YEAA 1J5OB 2R7RA 4ZJLA 4JI8F 3KJFB 3Q8PB 2QRRA 3GG1A 4ILRA 3B82A 6FDRA 2P8IA 2V9WA 3PTWA 3QT6A 1CPZA 4ZJOA 1FD8A 1RA6A 2FJDB 1CS4B 4DR4F 4X2BA 5IC6B 1AZSB 2GFFA 3PACA 3D6FB 3M2RB 1NDPA 3ETOA 4TNOA 5HAOA 4NEZA 1MWQA 2FGOA 4PZVA 4B3RF 3ENQA 2EPIA 3DRSA 5AJ3F 1KONA 1R3NA 4LSNA 1KTQA 1M5SA 2QFIA 3FZ2A 4K8RA 4IQXA 3V81B 3D66A 2PMHA 3U1NA 2C2RA 1FDBA 3WDOA 3U27A 2VUGA 2YWEA 1R8BA 3PX6A 2IPOB 1MROB 5CD4A 5F8NA 4PEOA 4QU7A 2B3TB 5KFDA 1T8EA 4YR3A 2FVQA 1UVIA 4NLGA 2R7VA 3KJVB 2IM2A 1Y9OA 1LXNA 3VQSA 4ED3A 3VAMA 1XN9A 1RT2A 4Q8FA 1OYEA 2DO0A 4M8LA 4CNZA 4CT8A 2BJ3A 1LW0B 2V8DA 3HHLC 5G0RA 3DXSX 2JLEA 5KG7A 3F73A 3Q2SC 4DFMA 2XQCA 5L1IA 2K7JA 2HIYA 1XJWB 4EMDA 4F0MA 2AYGA 1B64A 3CNQP 2Q3PA 2MKJA 4UQTA 4QU6A 4WBFA 1NH7A 1PYOB 1Q0NA 2KO1A 3ENVA 1RK8A 3BGRB 4GRSA 4I2QB 1RZMA 3UFCX 5A8KB 3JQKA 5EHHA 5EWGA 2J6SA 3JSBA 3UI3A 3GJRB 3EPGA 1ZA2B 2OPRA 1JQGA 1XTZA 4L72B 4RW9B 3RJMB 4LFAF 1H7WA 3HFKA 2AJFE 5T7LA 3UD5A 2IJNA 4PG4A 4L76A 2ZH8A 2VJVA 4TKTA 4NLOA 2XMKA 3NMRA 2PMWA 1OJ4A 5GMKa 2IDLA 3G86A 4CLWA 4XO0A 4X4RA 1Y00A 5LMNF 3LTOA 3AT1B 1C0TA 3NOCA 2HHHJ 2HPUA 3NGUA 1IKYA 3DOLB 4ID5B 2R4FA 5F0WA 2UVRA 3CVKA 5DDQC 1Z2LA 3DCAA 4ZVGA 3IR7B 4YP3A 4R0JA 3O44A 2ACYA 1UFKA 4N56A 2W9AA 3KLVA 1HA1A 2ZHBA 4LF4J 4LMZA 2CFXA 1WDTA 1XEZA 1KQFB 4R5PB 3CCZA 5EDWA 4NLRA 3NCQA 4HYKA 5DLGA 3R1LA 2Q6BA 2CPYA 3G82A 1Q78A 4B08A 3DRYA 4IDKA 1W25A 4EU0A 3I0SA 1S0MA 4NLWA 2XSJA 3K5OA 1BQNB 5GVQA 4DPXA 1UVNA 4I4BA 3GJTB 1BGXT 2M0GB 3OTDA 2QJ3A 1FDNA 1YRTA 1C2PA 3GYGA 3Q83A 5E3AA 3W2WA 2QX0A 2MJNA 3V6DA 2HHSA 3CB4A 1VHIA 5ETQA 5DETA 2UV8A 5EWEA 4Q44A 1T11A 2ZKTA 4LQ9A 2UUBF 4HTJA 3MR5A 1AZSA 2DRBA 1S1XB 2ZEJA 2HFOA 2L9WA 5A76A 2WBRA 3W1YC 4G1IA 4FKYA 2N4DA 3C66A 3DC2A 3KLIB 4KH0B 4F7VA 1WHYA 4A46A 2E7WA 2YX7A 2QFJA 4DL3A 2B9XA 2QA1A 2RDDA 4I64A 2R2UA 1NK9A 2Q6CA 3C6UA 2GHVC 4PG8A 5D0GA 3EVOA 4ENOA 1CBKA 2C2NA 3D6HB 4OYWA 4Y65A 5KFBA 3EXYA 3I96A 1WACA 2DRDA 4HACA 4ANCA 3BGOP 1BQMB 4WK3A 3W8PA 2XG8A 1VYAA 2RH3A 1HNWJ 5T14A 1JLBB 1UPPA 4OHVA 4ED1A 3NGRA 4CO2A 4EYIB 2FPHX 3HM9A 5AXNA 3SCLE 2CJQA 3A12A 1B0PA 1H6KX 5F0UA 5LMNJ 3HZGA 2GAHC 2AYMA 1BWEA 4BC9A 1XNRJ 2M2BA 4LVNP 3VAFA 5IT9U 4I68A 2LEAA 4XDCA 4KAIA 3VZIA 2GX8A 4KHRA 4DV0F 2XEXA 4BHQA 1W2BR 2OAUA 4BDPA 4DV1F 2EFNA 2RVJA 4PUOA 1SH2A 1ZM3A 2DHHA 3M6UA 1U2RA 4JI3F 3RBEA 5KOXA 1NKEA 1OSCA 2NXCA 2NXEA 3PJXA 4P9SA 1A6LA 3QMQA 3NGSA 1YJUA 2LP4A 3EDRB 4PYAA 1RHQB 2DEIA 3KLGB 4ZCIA 3T1HF 2I2YA 1B4SA 2EK6A 3CIMA 4NLYA 1RYSA 1F9FA 4DFPA 5HBMA 1S9GB 3SCKE 1SPBP 3LP2B 1MROA 3TYTA 2VDIA 4NLPA 1URNA 4QW9A 1T0TV 2EFVA 3M6WA 3ONQA 3RW6A 1LOUA 1RAJA 4MYUA 4TU8A 2WCXA 2E66A 1U49A 2R7TA 1FDAA 4F67A 4LF6J 5HBMB 4Q45A 1RAFB 2D7SA 2IJFA 2D3UA 2HVEA 3QZ8A 4ECWA 1RWXB 3DOKB 4YB6A 9RUBA 2DH9A 5CXTA 1X4FA 2CA9A 3AA9A 4LF1A 4B3TF 2ZUGA 1FKOB 2RQ4A 4EO8A 3MR2A 1HYSB 2UXDF 2FTRA 4GC7A 3E2EA 2HQ3A 3UNYA 3M8SA 2N7CA 4C8YA 5ETRA 4CM0A 3KJNB 1JJ4A 2CVIA 3PYEA 4R25A 3FCHA 1H2TZ 1T9TA 2RMLA 2V8GA 3EM1A 3HSJA 3IA0A 2BYCA 4KC5A 1ICEB 2XMMA 1MMDA 2CZVC 2CXEA 3KLFA 3W64A 2AJ0A 2KN4A 2OEMA 2W9BA 5JJBA 2AJ2A 4N7TA 3DU6A 4P2SA 5F8MA 2OPQB 2D9PA 2FZGB 5KFKA 4CTAB 1N6QA 5D3GB 1D9FA 3VZHA 4C11B 5D8HB 2C22A 2A10A 4PG7A 4AL6A 4L3NA 1BQMA 1YBAA 1S0VA 3G6XA 1T05B 1RWNB 1SUQA 3MMCB 2W9BB 1P27B 1FJEB 4WKRA 1F9EB 1WKKA 1SC1B 5HP1A 1KNZA 3CD7A 2E7XA 2IBOA 2NLWA 4YY3F 1RTDA 3H42A 1YZ7A 4UT4A 1RTIA 3T1HJ 2CG8A 2LCWA 1T9WA 4ZHRB 1NK5A 3UWTA 4X4VA 3DN9A 2I5JB 3CCJS 3A8JA 3IGVA 4K4WA 2KVQE 4EWTA 1IKXB 2AWZA 3L7OA 1HBNB 3M6VA 1FD2A 2QYCA 4ZVHA 1HQEB 3IAS9 5C24B 1OMSA 2HNZA 1MG7A 4CLFA 4CLSA 1D8ZA 2ZH3A 4JI0J 5KFXA 1OY8A 3OR1B 4OI0A 2WB4A 5F9LA 1IXKA 2BJDA 4LR9A 4ZP7A 1DLOA 1WI6A 3H7HB 5D4LA 2J9DE 2C3OA 2F5GA 3MGJA 4CP5A 1FE0A 1ZS6A 2DGXA 2DH8A 4LFCJ 3CCVS 4DR3J 3T5JA 3G6ES 4NXMJ 2UXDJ 4TU7A 1YLXA 3KLGA 1YQHA 4NLQA 3I56S 2OH2A 4PPZA 4N77A 1DAXA 1CQNA 5DDOC 3CMQA 1UAWA 4PWWA 3IP0A 3HT0A 4HI1A 5AJ3J 2ZH1A 4ECQA 3PW2A 4DR2J 3LO3A 2FVPA 4WZMA 4RO0A 2V9KA 2ZH7A 1BD6A 2BVZA 3MD3A 4OYMA 1WC4A 5G4DA 4CRJA 4NRUA 2IAJB 3BN7A 4FYYB 2HG4A 1U0HA 1X31C 2GJFA 2OPSA 2CPHA 2OPPB 2A2DA 3D6MB 3H5SA 1TAQA 2KT5A 2V34A 3I32A 2XZWA 4USVA 5KFHA 4ILMA 4ZN3A 3MEKA 3T3FA 2Z2MA 2APOA 2HFVA 5C2CA 5I4MA 4QYRA 3UR3C 4J9LA 3KDNA 3NKYA 1NK6A 4Y28C 4OLPA 4ZJQA 2FC8A 1GMVA 2GIRA 2JLFA 1TTHB 3ELHA 3BSOA 3DLEB 1RA7A 2PI5A 1X0PA 3FBBA 3PDNA 3TZWA 1VIOA 3OTEA 3Q0AA 3D67A 4KHMA 1H38A 4HHJA 2YQ1A 2XI3A 3BS9A 4M5NA 4CO5A 3R9LA 4ANDA 3MR7A 2M8DB 4ZMMA 3C19A 1S6OA 1VK8A 2V5HG 3LP0B 3A4TA 4C8KA 3TARA 1HPZA 3DLGA 4KFBB 1PSDA 2MY7A 1HHTP 2MLXA 4HH0A 2HHPA 4TYAA 2AGQA 4GKJF 3AFGA 3NGTA 1OQ6A 3DNCA 2M5YA 4NLXA 3KK2B 2Q66A 3GILA 2HZCA 3MM9A 1VQYA 3W8GA 2J6UA 4LF8J 2HQGA 2PA8D 3SDEB 1X7VA 2HKEA 3W66A 3GV8B 3HF5A 2F40A 5AE2A 3TP2A 3ETMA 3G2XA 2MKIA 4A47A 1QAYA 4CWBA 5HP1B 3Q89A 4NXMF 3R7BB 4J9VA 2FZCB 3PM9A 1NUEA 2YKMA 1F1BB 3GJQB 1VQ7S 2Z0GA 1U1NA 2NXUA 2KKHA 4RZRA 4MK9A 5J1NA 3VWSA 3VR1A 1RLCL 3BZQA 4ICLB 4G3IA 2KI2A 2R7XA 2ZBQA 5D4NA 5IOLA 5HMXA 4NCBA 3DRSB 2SXLA 1FF2A 2OIHA 2VDHA 4LF9F 1VRUA 2QMWA 2L9DA 1KFSA 4OI6A 4CQ1A 4JYAJ 2HK3A 2QMUB 1VQSA 2JVOA 2W2OP 4NMXA 4CIOA 2L9NA 2R7WA 1AROP 4X4QA 2XLJA 1X0FA 1XERA 1IJFB 4A8SA 1PBAA 3M1VA 4DQRA 1TL7B 2V4JA 3NAIA 3OJSA 3PKYA 1CJVB 1RT2B 1GXLA 3PV8A 4W4MA 5HVGA 4CO4A 1C1CA 4JV2A 2DKOB 1LW2B 1RT1A 1U6FA 1VISA 1GX5A 2BJ1A 3KMSA 3CD5A 1R8CA 3ILOA 3TAMB 4TN2A 2XYHB 1HNVB 2HQDA 1RU1A 4ED6A 3ILIA 4Y2KA 5FLXY 1VQMS 3I5CA 3PW0A 3ZTRA 5HROA 1VR6A 2Y3YA 4U7CA 3B4MA 3PYGA 4I2QA 2F8MA 2M8HA 1PAEX 2JHEA 2AGOA 5CYMB 4ELUA 1JIHA 4CLTA 2RDJA 3UE2A 1KSPA 4E0DA 2L41A 4M5MA 6AT1B 1OSDA 1HNVA 2DVIA 2HGNA 3SEOA 4JI6F 4B9NA 5J2MA 4DPYA 3EWGA 4DX7A 3C3LA 1N33J 4TQRA 5AE3A 1K47A 4I2PA 2BKPA 4R5PA 1LNQA 1NPRA 2H54B 2W7AA 4DU7A 3PZPA 2P6TA 5D4PA 3GPAA 3K17A 3VVUA 2ZH9A 2ZC4A 4ECZA 1HWLA 3TAQA 3CE8A 4Q0BA 2R7SA 2O1PA 1BLUA 3O6QA 3R6LB 1RACB 2RKIB 1IKYB 3DOLA 1V5VA 3LGNA 4DSJA 1VQ6S 2DYAA 3H20A 4WFBQ 2Y1LB 5GAHI 2MPUA 3HHKA 4OV6A 3G6YA 2R7UA 3HI9A 4DCOB 1NHKL 3AJDA 2HNYB 4IFVA 4NX9A 4WWSA 5J2PB 4ED8A 4OZ2A 3RRGA 3F41A 3Q8YA 1X5TA 4QJVA 1YI2S 2Y9HA 2DNOA 4O3SA 2ZZNA 1TELA 3AODA 4M5LA 3R27A 4E2FB 4RU2A 2M70A 2DR8A 4K4YA 4NYPA 2GZOA 2RKIA 5IXUA 3Q24A 3KYLA 1RCXB 3CC7S 4IRDA 2QA4G 1Q7LB 2OLWA 1N48A 3QNWB 3ZZTA 5J2PA 5I42B 4USMA 1IR0A 3NCRA 2DY9A 2BW2A 5K14A 3JSYA 5DO2A 5C42B 4X65F 3CCUS 1DFDA 1UL3A 3DMJB 3UCZP 4IOBA 3M8YA 1PJ6A 3RR8A 1N32J 3QAEA 4K50A 1AYEA 4WFXA 2E1CA 4K0KF 2QLFB 4ZVRB 1FKPA 4CM2A 2HHUA 4CLLA 4RNOA 2R2RA 4IG3B 2GO9A 5I42A 2B4PA 4B3SJ 1RT4A 5L9NA 1RGVA 2A18A 2IIHA 2KU7A 2KG0A 3N6LA 1S0NA 3DMJA 2DGTA 3LA0A 3MCSA 3O3LA 5HSPA 3LP0A 3GQCA 1EETB 1XWLA 1WF2A 3W5XA 4LF6F 2GMHA 3UDLA 3VGVA 2C28A 1JLGB 3EXCX 1IBLJ 4Y2MA 1HW9A 1TZ0A 3L95X 3TRGA 3WIVA 2BKNA 3LWMA 2ALZA 1C1CB 1P1TA 2OUGA 3DDIA 4WPAA 1S79A 4DS5A 3M30B 1VQ5S 2BXJA 1H0HB 3O2IA 3TJAA 4DHVA 1VQKS 3IWXA 4KKOB 1M0SA 2CPZA 2YXLA 4LSLA 1TFWA 3IBCB 2A2CA 4RW4B 3UN5A 5D0EA 1UP1A 3I0SB 3WX8A 4CYUA 4OHYA 1RHJB 3KG1A 4DV7F 3G8TA 3C46A 2WW8A 2VL1A 2OP5A 1L3SA 2R2TA 3D54A 2AEJA 1SBRA 3H98A 4QYZK 1O8BA 3MXHP 3MCNA 5D0RA 2D1CA 1S1XA 4KKOA 1UFWA 3CJ2A 1B0TA 1RWVB 2QSFA 3D1HA 2R7OA 3KUGA 4C8MA 1U1MA 1F5BA 1YWXA 4KGKA 4DR5F 1ZAXA 1M90T 2ASJA 2RILA 4ERDA 2YKMB 3IM9A 4OFZA 4USJC 1FJCA 1FTRA 1HL6A 3X3UA 5KTQA 2EFOA 4JI0F 4CO3A 3MR3A 1JLFB 2EBGA 2HWIA 1P6TA 4Q8EA 1RHKB 1FDDA 4AUKA 4OYIA 4RUAA 2CUYA 2MZQA 1PKUA 2LU1A 3KJQB 4DPOA 5DRKA 4CCHA 3L3CA 4OX9J 4OHZA 1NKCA 2HHXA 1K1SA 2B9WA 2VH7A 4MK7A 2YKOA 3T5KA 2X7IA 2P9CA 2VBZA 3FEXB 2MZJA 3BYPA 1CS4A 1JLCB 3TEHB 2WSCC 2YX4A 4KB7A 3ET6B 1HNXJ 3V5RA 3TANA 2ZUAA 3KK1A 1UW9A 3CXCR 2W7OA 1KOHA 2F8HA 3V6JA 2J6TA 1WTFA 5D3GA 2IA0A 3FEZA 1NH8A 5J2NB 4FBUA 4DR1J 2K7KA 1HYSA 4EI2A 3J7YI 2V4JB 1KHWA 3DLHA 1I1GA 1Q5YA 2MGZB 2BM0A 2DIVA 5HMYA 1U1PA 4ECTA 2DISA 2UZAA 1SL2A 3IO1A 2V2KA 4IG0A 1KRPA 1Y5NB 1HMVB 1JJCB 5B08A 2WONA 1HWIA 4MT1A 4TYBA 4DL4A 1J27A 1CLFA 4JP8A 3BF4A 1RT7B 3KXDA 4J90A 3OR2B 4PQAA 4WKYA 4ZCKA 3FSXA 2I38A 3OHBA 5KFNA 4JI2J 4DWIA 3W3SA 5BR8J 2ZBRA 3H5XA 1T3NA 1OY6A 5LMUF 5KT2A 3NP5A 3QBCA 2AD9A 3LP2A 4K4XA 3QZ7A 2EEYA 3CJ3A 2JZ5A 4IG0B 4DBQA 2PE8A 1LWFB 4FVCA 3SQOP 1T02A 2ZBIA 3L7UA 2NUUG 3HX9A 4YR0A 3Q8RB 4U8VA 2HIQA 2GIQA 2VASA 1G3OA 3PW5A 5K20B 4KJIA 1RTDB 2H5EA 3O5TB 1QAXA 1RTHB 3JXOA 3HZEA 1SIWB 2WBMA 4FYVB 4PXBA 4A4JA 3BPDA 4C8ZA 1YG0A 1FTCA 1LWFA 1N5VA 2BJ7A 3E01A 3Q8SB 3W61A 2XC9A 4GKJJ 5BYRA 4BWJA 3K8VA 2NS1B 2KXHA 1V3SA 2Z2LA 1R8HA 3OPKA 2JSXA 4B3MJ 4IFVB 1M1HA 1S1UA 2XHWA 4FF4A 1UA0A 2HHTA 3M8QA 2GHWA 4DU8A 2RT3A 4F4KA 2Y1JA 1HI8A 1QDUB 4ECUA 3HHNB 4I0WA 3IMQJ 3V6HA 4OZNA 2WW4A 2JVRA 1NPPA 4ZITA 2GNKA 2PEBA 2VC1A 3ITHA 4OJGA 3E01B 3V81A 2VOOA 3T41A 1G2EA 4LF5J 1JLBA 5LSRA 1RT5B 2IC3B 3TA1A 3CO9A 4WZQA 2DR5A 2VBWA 2YWHA 3MPVA 3T9NA 3UVJA 2KHCA 1FCAA 1FFWB 4JV0A 4F50A 4FKXA 4W92B 1O5JA 3LH2S 1XMQF 2DHAA 5KG4A 4TY9A 1BMQB 2JJ4D 3C14A 4WYWA 3FVYA 4TQSA 1AXQA 4DEZA 4D3HA 2ROPA 3MMCA 5FDLA 3RBDA 1JLEA 4JYAF 4C48A 4M5JA 4KHPJ 4W98A 1XR6A 4QW8A 2IC3A 1RWPB 2OPPA 1VI7A 2YTCA 3OXFA 3P45B 4NPOA 5IV4A 1G1XA 2V4QA 1S12A 2BZ2A 1E6YA 2ACMA 2C2OB 1WELA 1NSQA 4RNMA 5DG7A 5D4OA 2RB7A 2WVCA 3TNVA 3J80U 4DSLA 2QGFB 3Q22A 1TL3A 2HS3A 1QAJA 4ZCLA 1HBOB 3PX0A 4DG1A 4J9PA 2PT0A 3D1QA 1S1VA 4HLBA 5KT7A 3OVSA 3BPSP 2D3OR 2FJVA 3PG9A 2G1DA 1GFWB 2VU5A 2G2ZA 2KJVA 3ZZUA 2CJKA 3SXLA 1GNKA 1WOOA 4K59A 4RNFA 1IKWB 1WSRA 1UW4A 7AT1B 3EX7B 2DPJA 2R8JA 1F2GA 1WDDA 1VMBA 3FZBA 4DUZJ 1OY9A 2WVEA 5CZVA 2ZJRQ 1X4EA 2V94A 1S48A 3D5MA 3FFIB 4OYZA 5C5JA 1D1UA 3T6BA 4QWAA 3SQGB 1WWHA 2F9JA 3ZTSA 3TZYA 2MQPA 1XK8A 3KK2A 4HHUA 4WXOA 4C8LA 3H8YA 3GYNA 4CO1A 4Z37A 1DTQA 1EAYC 2IJRA 3K5MA 1DTTA 1Z2ZA 3RTVA 3EUNA 4A8FA 2DHGA 4N8NA 4QYZJ 2Z8QA 4HL9A 1NAQA 4ES3A 5EGYA 5A0YB 1XC9A 3JYTB 2HHVA 2YVSA 3DDKA 3DGVA 4XPCA 4EBEA 2VFUA 3OTOJ 1GT8A 1UWBA 1NJWA 1B99A 2CZ4A 1H2UX 5AXMA 3S8SA 2CPEA 3ZZYA 5H9EK 3HMJG 1CULB 1D9DA 4M94A 2KDOA 1PC5A 2Z30B 4PXCA 4B9MA 3QT8A 4C3MA 3I55S 3RRHA 2VG5A 3Q8QB 1PYTA 1W26A 5HATA 4NI2A 4KH1B 2Q79A 1XIQA 2VQFJ 3T1YF 1U8WA 4WE1B 5I3UA 1D0EA 2GJIA 1VC6A 1LWCB 4OYPA 2RHSB 2N3OA 1VRTA 4MFBB 1FEEA 1AUDA 4BC7A 1DURA 1F5AA 2CNLB 5KFPA 3D0GE 4ZLNA 2WTFA 4JV5J 1WHXA 3BKFA 2VG5B 1GTEA 3D68A 4RX6A 4EBCA 2NPFA 1UVMA 1S97A 4DV0J 1RTIB 1IR2A 2LQ5A 2CNKB 3GMGA 4MIWA 5CYQB 1LWCA 3H40A 2BW7A 3TW0A 4ZS6A 2MZSA 5MAOA 2BEFA 1NDCA 3CCSS 1TKTB 1WEXA 3DOKA 4OZ1A 3TJ8A 1VCTA 1DRZA 1DY3A 3N6MA 4JI1J 2RF2B 4OYAA 3N9UC 3KNAA 4ZP9A 3EPIA 4V19X 1HWUA 1X5OA 1N32F 5HQLA 1TV6A 4LRCA 3PEHA 1IBLF 4XK8C 3R5CA 3WQPA 3HHLD 1IWAA 3IFEA 4PKDB 1KD1T 4PCQA 2Y0SD 2A6OA 4OYBA 4BWMA 1D09B 1I5OB 1ZOTA 2HRUA 3GG0A 5CH7B 5A2QU 2W24A 1K1QA 4AQYF 2B51A 1XQIA 4GMKA 3UQSA 2IBKA 4B9SA 2NQPA 4FF2A 3IR6B 3H90A 2KB2A 1SI9A 4CDIA 3QAUA 3TVZA 2NXJA 5GAHU 4PAAA 3AA8A 1TV6B 3CMAS 2EXUA 2QEXS 1YJ7A 1X5SA 2MKCA 2ZHOA 3TX8A 1HI0P 1WSVA 5ETPA 4DR6F 2WOMB 2FHKA 1N5TA 3A8IA 1EKSA 4KPCA 5KFFA 5HLFB 2NPIA 4UUWA 4ZPWR 2FY8A 2JFKA 3OD2A 1QUVA 4JB8B 4UOHA 2M88A 2Q1LA 3L7PA 4WTYA 2X1AA 1SV5B 1WORA 1TL1A 2MHNA 2QTWA 3M8PB 4DV6F 1LXJA 1UJ4A 2A3JA 4C6AA 1LK5A 3P3DA 4FXDA 1JXVA 2G2YA 1U24A 2RSQA 3ILJA 4U7UK 4IQMA 2JEFA 5KFEA 3BYRA 2V2QA 3M2UB 4JBCA 3MFIA 5F8JA 4NA3A 1YBUA 5E33A 1TL4A 5LT5A 3DOMB 3QLHB 4KGVB 5CQGA 3OR1A 3JTOA 1RWMB 2ZH2A 1T03A 3C16B 3SSQA 2ADBA 4GVBB 4LQ3A 3N01A 1E6YB 4ZPVR 2UUAF 1YIJS 3DYAB 4F3MA 5F8LA 2D9OA 2ROEA 4KTQA 1R6VA 1X8DA 1FRXA 4I69A 3UD4P 2EW9A 4LRDA 1S72S 3AB4B 5FDLB 3CJRA 4DR7F 4U6PA 2C42A 5J2MB 4QWCA 3FNNA 3G4SS 3GZ7A 3JSRA 4ID8A 4YY3J 2CJXB 5KFJA 2XGQA 4DCJB 1U6ZA 4QPXA 4KV8B 3I5AA 4OX9F 4ZOSA 3MUTP 4AL7A 5KAKA 2DNGA 4L74A 5GAGI 2DCLA 4OZ3A 3IWLA 4OZLA 3MEEA 4Z2XA 4X4NA 1SL0A 4IDKB 2IRYA 4ALZA 3QGIA 2CWXA 1RHUB 5IV3A 2C2KB 2Y1IA 4W90B 2GO8A 1WHVA 1FFGB 4UQGA 4JI5F 1JLAA 3KLEB 1K0TA 1QE1B 2IVMA 4NYOA 5ETLA 4DMZA 2M52A 4FN5A 1DTQB 4O3PA 4AE5A 3JSMA 2VICA 2AEFA 3J81Y 2HFNA 1IQZA 3ENWA 4DF4A 4WP3A 5LMUJ 4DR3F 2OI2A 2VA2A 4WCEQ 4RUBA 3DU5A 4RW7B 2GS8A 2KXNB 4FPRA 5KFCA 4A48A 3T5HA 2MLYA 4LF5F 3M05A 2W4DA 3CCLS 5B0EA 4DXLA 4ZIVA 4X4PA 4QWEA 3PNIA 3NWRA 1Y4ZB 3IM8A 5JVHQ 1Q8KA 2RNEA 4LT6A 2CVEA 2E5JA 3H0PA 4ECXA 4BS2A 3QWUA 2F3JA 1KFDA 4G1QB 2E29A 4U7UD 3U02A 3BGRA 4BCAA 5GAEI 1K73T 1N4LA 1RT4B 2R42A 3TQ1A 1U0SA 2N4CA 1QTNB 2PN6A 3H25A 1WEZA 3HVTB 1VBZA 1A0OB 2XZTB 2BX6A 2YNGB 2OMOA 5ETKA 2YNHA 3ISND 4P71A 4J9KA 1Q7YT 2ZZMA 2CQ0A 4F4AA 2ZOFA 1JKHB 5M2RA 1Y5LB 1FERA 2JWNA 1S1TA 2B9YA 3CIZA 5CYQA 2HBZB 5IWAJ 4NCAA 2XS7A 2UXCJ 3X1LB 3LAMA 4PG5A 3PIPQ 1OWXA 1B0VA 1NDLA 2EBEA 4PWDB 2HBQB 1VK3A 1KWMA 2KYZA 1AT1B 4PQUA 1WOPA 3B6BA 3GIJA 1SUQB 4RUHA 2NXNA 4RWWA 3R6GB 4CYUB 1ZA1B 2MDAA 3IBFB 3ZZOA 1XMQJ 3MPUB 3C16A 1X9MA 3QO9A 3CJ5A 4ZP6A 2V8HA 4NLSA 3U1MA 4MJKA 3V2UC 4B17A 3TA0A 1UJ5A 4F3QA
chains in the Genus database with same CATH topology
2HW3A 1S6PA 1C4AA 2B56A 5KOWA 3HPOA 4M5DB 4LF8F 3S01A 5IS2A 2XSJB 1SQEA 2VG7A 5DG8A 4DOZA 2O3DA 2X1FA 2HNYA 4J9RA 3RB3A 3MUMP 2PGCA 1CEZA 5DQIA 1R43A 1DLOB 3R3TA 1DZ5A 2BOPA 5KFGA 1IM4A 3A1YG 1SC6A 4PG6A 3EGNA 1HBNA 4WFNQ 3OTOF 3KJVA 3CF5Q 1X4BA 3OQ2A 3VAJA 3DLLQ 3I82A 3WZ0A 1UEUA 5A6WA 3SV3A 4ZCMA 4N47A 1ZM4A 2MZRA 1BC6A 1ZZNA 2FJEB 2MKHA 5K14B 1FJGF 2GA7A 2M3DA 3I6PA 4FXVA 3BQ1A 3I0RB 2BDPA 3ZZPA 3I9V9 1N8RT 5A6PA 1EP4A 3A8EA 1R0AA 2DNHA 3RW7A 1S10A 3V6KA 4J9QA 2HWTA 3H5UA 3MR6A 2J0WA 3NWGA 3MM8A 3JAMY 4TU9A 2YH1A 1REVA 2NUHA 4CTAA 3AH6A 1OS5A 1ZZFA 2R8HA 2IM1A 2HMIB 1U1KA 1U09A 1K9MT 2R8KA 1XBWA 3G96A 2X1BA 4NRTA 5LJ5Y 3G71S 2O5DA 4EZ9A 2M9KA 4I56A 1R0AB 2VONA 2I9SA 4PPDA 2HRYA 3MM5B 4X4TA 2KFYA 2MQOA 4ZPDA 4EEYA 4RW6A 3QJJA 4H4KC 4AXIA 2GW8A 5KT4A 2KJWA 2I0XA 3DRXA 1X9SA 2NZ4A 4ECVA 3QGPA 4ITSA 2QE5A 2YKAA 3SCIE 3B8HA 4ZHRA 3H4BA 4PUOB 2R7QA 4OHWA 2F8EX 1XMBA 1FT8A 2FUG9 2RS2A 1WTBA 3BQ0A 1GTHA 3MTJA 2U2FA 1X5PA 2DHXA 5H1SV 1L3VA 2LKZA 4O23A 3IS9B 4KFBA 3TVYA 2YNFA 2J9DA 4HDGA 2DHSA 1S1TB 5MLCV 2MQQA 5B0CA 3NMAA 1S9EB 1KQSR 3HKZD 4ATNA 2ZD1B 2MKKA 5K8NA 3VAGA 5KG2A 1U47A 2E1MC 3MOZA 5JUMA 1CQMA 3CPWR 2XMJA 1SJ3P 4P6QA 5E0OA 4H4OA 3CCTA 3W2WB 3QO9B 3M9OB 2B6AA 2DO4A 1TK0A 2YNFB 1KLMB 2VV5A 1S1UB 4B3OA 4JV5F 1RT3A 4MIAA 2CQHA 4Y2AA 3PR4A 1TP7A 5DQHA 1ZAWA 2HQIA 1JLQB 2CPXA 1NO8A 1U2FA 1VIXA 3PO4A 4YDXA 2KYXA 2PMZD 5L1LA 2KHDA 4GO7X 2HWHA 4C0OC 3MOJB 1VLYA 1RT3B 3ISNC 2POKA 2LDYA 3BSNA 2YWGA 2XLKA 2D74B 5THWA 3OLAA 4ICLA 2GV1A 2YWKA 1ZPWX 2DTJA 1Z4UA 1TR0A 4G1PA 3GB0A 2K3KA 4KE5A 2HGMA 3GE9A 2JRSA 1GX6A 2E9RX 3OVBA 1NRKA 3LPYA 4ED5A 3OFGA 2B7CB 4NCGB 3PR5B 2K1RB 2YNIA 2VKRA 5E3PA 3OL7A 2VPYB 2OTLS 1UVJA 4NMLA 3MHYA 2C2EA 1NK4A 5B0GA 3RR7A 4PWDB 3DRRA 3HVRA 3BGLA 2HNDB 4IUFA 2OTJS 1F60B 5ADZA 4A8OA 3OTCA 4I1TA 4URGA 2CQ1A 5LXRA 3DLBA 1FRHA 2WSFC 3GR1A 2VG7B 5D77A 2C3YA 4Q2MA 3MM5A 1LV5A 1UVKA 3FEYB 3K59A 4A8KA 2L3MA 5KG1A 3NNAA 2OPQA 1JWWA 1FXDA 3K2YA 3IBWA 1FNOA 3DRPA 4OI2A 4RBVA 3RYLA 3CCWA 2W4CA 4OX6A 4ZCIA 2BE2A 4UW2A 4YQWA 1MSWD 2GQQA 2IFXA 1RI7A 2IRXA 2KRRA 2MSSA 5L1KA 2RIJA 2P9GA 4RBTA 1T95A 4N41A 2E9ZA 3N5BA 1VQ9S 1WNEA 3K7RA 1U48A 1ZBTA 3B4DA 3QGGA 4RLEA 1TK5A 4NA2A 5KT6A 1Y3JA 2WRMA 2W7PA 3UDCA 4Y34A 1JXEA 2J0XA 3Q23A 3BR8A 5J2QB 1S9FA 1QSYA 1IKXA 2CJAA 2M7SA 4LIWA 6FD1A 1F0XA 3NRBA 4TLQA 2N3LA 5HL7Q 1TVRB 4XAKA 1WG5A 3UW1A 5T7LB 3HHDA 3UNGC 1HFEL 2NSBA 2ZKUA 3CTRA 2HLTA 4QIEA 4WE1A 4DSFA 2C2DA 1QSSA 4HH1A 4DN9A 1HNIB 2VC0A 1JNRB 5IWAF 5KFIA 4WU2A 4X62F 4ELVA 2WOMA 2F4VF 2ZE2B 2VZ9A 2FLNA 4NZ7A 3I9ZA 4C11A 4NA1A 2UXBF 1O0PA 5KFLA 4IKAA 4MIBA 2XMWA 3W7BA 2L48A 1HWJA 3IS9A 1QTMA 3MEGB 4DSEA 3WC0A 4RW6B 3JTPA 5KT3A 3SFUA 5EN1A 5GADI 2MZTA 3C6TB 4IG3A 5BR8F 1U4BA 1VFJA 2ADCA 4P7VA 4CH7A 1IKWA 3NBPB 2FHJD 2XB2D 4YOEA 4HEA9 3ISZA 2AQ4A 2N82B 2HFZA 4DDFA 1FVQA 2CRLA 3DHWC 4R8UB 5GADU 3NGKA 2W4PA 3KLHB 3NNCA 4KO0A 1S9GA 1FVSA 2V8VA 3GFHA 4DL0C 5CCLA 2R9LA 5KFMA 4IH6A 5HO4A 3Q2TC 2UXCF 3VAHA 2EG1A 2NSCA 4C0HA 5HQ8A 1QM9A 5F41A 3BO4A 1RDRA 2W8KA 3PHEA 4O3RA 2ASYA 4OJ3A 5HMZA 3DDNA 4K4VA 5F3ZA 1Z1ZA 5B0FA 5LL6d 3TUJC 2ZM6F 1JLQA 3MECA 2IMWP 2Z4PA 1FNMA 1JB0C 3IXQA 3BSCA 3KK3A 2J5AA 4UY8T 2B4VA 2HS0A 3M6XA 3DFEA 3D0HE 2AU0A 1ZPVA 1RYRA 2EFPA 2XSFA 1YJWS 2FJAB 1GQEA 3CJKB 2K2PA 3EZUA 2O66A 4R0EA 4EBDA 4JV1A 2VFSA 3EGZA 4ZKAA 4DF8A 3POTB 4QR0A 3DLEA 2MGZA 4K4UA 2ZJQQ 1JJ2R 1WF1A 5A8WB 3NCPA 5G0RB 4C4WA 2BBEA 2DGUA 2PO4A 2FLPA 3RB6A 2VB6A 3BJYA 4YMEA 4PWDA 3VTIA 3HDSA 2V4RA 5EX3A 5A8RA 4U67Q 2HHWA 2OO4A 1SJ1A 4PWUA 2BABA 4C97A 1S99A 1UJ6A 3OL6A 4OZ5A 1TKZA 4IOCQ 3JSMB 3T1AA 1AFIA 1YITS 3WC2A 5D6GA 3N79A 3BO3A 5A2QY 1N5QA 5ITHA 3MM7B 4GKKF 3TAPA 2CQ3A 4LSNB 3E3XA 1ZH5A 1ZTWA 2FY1A 2FHOB 5H9EJ 1BWEA 4KBIA 2F1FA 3H5YA 4C8OA 1K8AT 3KOAA 2MY8A 2AX1A 2BE2B 4OI3A 1KQKA 1C0UA 4RW8A 3AJ2A 5JXSA 2LA4A 2ZNYA 4IO9Q 2HVZA 3AB2B 3CSKA 1TL5A 2EG2A 1S4FA 3VAKA 2DR7A 1SJ4P 1NZAA 4HT7A 3SSRA 1M5VC 3M9MB 4C9DA 1OPZA 5CYJA 2HYIB 1RTHA 3U7JA 1N52B 1U25A 4TLRA 5U47A 3R1HA 4MTPA 2WSEC 2DNLA 3J7ZT 1L3TA 3KNGA 2ZDPA 5HMWA 2ZH5A 2P9EA 3JB9k 5FIIA 2ERRA 5E7OB 2A1BA 5DS7A 5T41A 3M2VB 1RP5A 1YJ9S 1IBMF 2IVFB 1TK8A 2B5JA 5A8KA 3PO5A 3MMBA 4NLDA 4F4WA 1CG2A 1RT6B 2XULA 2OPRB 5F3TA 2JDJA 2LEBA 3V81B 3J7Z5 5IM0B 4EYHB 4C3KA 2J7KA 2ZE2A 2UV8G 4F8RA 2ASLA 1TAUA 2AF6A 2O67A 4KR0B 4KGMA 2ZH6A 1HQUB 3MWBA 2B5JB 2XBPA 2QIFA 3MPYA 2LVWA 2LU2A 3CC4S 5FJ4A 2FGCA 4WJBA 4QBUA 3OVAA 4IRCA 1P1LA 1KHVA 2W25A 1M5KC 4ELTA 3BM7A 3MDFA 1S1VB 3C6TA 2OD6A 4G6VB 2KFZA 4DV3F 2DPIA 1LK7A 4IYQA 4WF9Q 2QT7A 2VG6B 2PC6A 2VBXA 2BJEA 4H54A 2QV6A 4OJ1A 3S7RA 1EETA 4LIRA 1C1BA 4AXJA 1PO6A 2J0SD 2EFQA 1UFLA 1SXLA 1MW7A 3EGWB 1FEHA 4J37A 1OPIA 2QA4S 2LA6A 4PXEA 4DR1F 1U6BA 3K5LA 1M1KT 3IRXA 1XR7A 5AXLA 2I1RA 2DH7A 3N5FA 1H98A 3TOQA 1DTTB 3MM6A 4A8WA 4RNHA 2NREA 2DGVA 2RU9A 4K2XA 5A0YA 2ZJPQ 2FVCA 2OSRA 2DGWA 2FHJA 3RAXA 2DD8S 2UP1A 5KFUA 4O3OA 1R7IA 1B7FA 5E41A 2YNHB 1F5CA 2KFNA 3MM6B 4WXWA 3MURP 3AQPA 3IAM9 2BQ3A 1YJRA 2CQ2A 4JI1F 5DLFA 4NWBA 4OJHA 1KEKA 5HN0A 1HBMB 1TFYA 4USHA 1UWBB 5B0BA 4YHHF 1RKJA 2IYIA 4DFJA 2XLIA 2EI5A 2KTQA 1ZM9A 2CKWA 3FQKA 4OZ0A 4C8NA 5AXKA 4DJBA 1Q4RA 3AQOA 1N5SA 3VAIA 2LQJA 4Y6IA 4F2RA 5DGBA 1VGYA 2GGPA 1Y7PA 2KZZA 3P96A 2RRBA 4PRFA 4DS4A 1Q53A 2RQKA 3KFWX 1DJ0A 3SZ2A 1AW0A 1KVIA 2XY5A 3ZZ0A 5B7WA 4WK1A 3R5BA 2B6AB 5J1EB 1M5OC 4IRKA 3V4MA 1RWUA 1OO0B 3RAMA 1YJNS 2J9CA 4CH1A 3PW4A 2ZBCA 1V3ZA 1S0OA 1DQAA 2CQ4A 2RF2A 3EZ5A 4YFUA 4C0BA 4DFKA 1MMLA 1TUVA 3LQVA 2BQRA 4RBUA 2RS8A 3DHXA 3CCES 1Q16B 5KG5A 4IH5A 4M95A 4PQUB 2FVSA 5C25B 2IM3A 3FMWA 2B4OA 1FO1A 1FRMA 3G8QA 3I4HX 2F9DA 2XCPA 1KLNA 5C24A 1FKOA 2DNYA 4OI4A 2HVIA 2C3PA 3MAQA 3G9CA 4KQZA 2XO7A 4H4KA 4NXNF 2ZVSA 1NJZA 3THVA 4NCGA 4MFBA 3CDAA 3M2UA 5H9FJ 5C25A 5KFRA 1RQ0A 1TKXA 4B9VA 2HVHA 3NS6A 3PX4A 1IKVB 4OZJA 4MAKA 5IQ6A 2E5LF 1PC4A 3HHLA 3IG1A 3P5TL 3MPWA 3M8QB 3PEJA 1PGZA 4DUZF 3DLKA 5B0DA 5KG0A 5E3RA 2E5HA 4N8OA 3KHLA 2XMVA 2WAQD 1JXLA 2KH9A 2DNKA 3UR0A 1RT7A 2D41A 3U1LA 2FDNA 3ZC4A 4HKQA 2UUTA 1JX4A 3J7A1 1FRIA 3VALA 4KV8A 3DRPB 4K4TA 4CO0A 4JI7F 4JI4F 2VFRA 3DYAA 3I5BA 4J5OA 2BANA 3CDBA 4ID5A 4ZDNA 1KTVA 2E44A 3KLIA 4IFYB 4ES2A 2GCFA 3HXMA 2IM0A 3AJ1A 3OSPA 1HD1A 3K5PA 2WHOA 1KLMA 2DGOA 2MKSA 2KRBA 1M5HA 3BR9A 2PIIA 5E5NA 4F3OA 1QE1A 5J2QA 3IRXB 1HW8A 1SH3A 2IRUA 2VBYA 4C3LA 2AYBA 1YRUA 2ZOGA 4ZVFA 3P49B 1D8YA 3RU0A 3GR0A 3HK2A 5KFSA 5IQQA 3H2VE 3JYTA 1IQTA 3GIIA 4NZ0A 4C7QA 4Y2IA 2BV3A 3BDPA 2VODA 1YTYA 2BRLA 1TL1B 2RUGA 3M8PA 1QY7A 2BUNA 4MYTA 4DV2F 4FF3A 3HJFA 1N5YB 2DNRA 2FB0A 3NL0A 1W2IA 1JJHA 1HNIA 3QIPB 5KFQA 4EO6A 1X4CA 1O51A 2ABYA 2CIMA 3OFHA 2HAIA 3OXGA 3T9ZA 2E1RA 3OTBA 2ZITA 4I6YA 3H2LA 1P9QC 3J80Y 4WFZA 4YDDB 1FK9A 4O3QA 1QVGR 2FC9A 3ZZZA 4MKBA 2JEIA 3MZIA 5DGAA 5LJ3Y 2LMIA 4QPTA 2DGQA 4H4OB 1HD0A 3NG8A 4N5SA 1N33F 2J7WA 4A8XA 1U1LA 2OMLA 4G1QA 3EYZA 3UCGA 4X4OA 1Q8IA 2LDIA 3CCQS 1ZM2A 4Q7AA 2JFDA 3HKWA 4OMFG 1I94F 7FDRA 1TKDA 3QYYA 1VQ4S 3M9NB 1H3DA 1VBYA 3PRDA 2C3MA 4F25A 3MEDA 1KR4A 3K58A 2HGLA 4R8UA 3KLHA 4LF7F 5SZTA