1OQ6A

Solution structure of copper-s46v copa from bacillus subtilis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
b'MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGYHVVIEGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potential copper-transporting ATPase
publication title A core mutation affecting the folding properties of a soluble domain of the ATPase protein CopA from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 14
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1oq6A00
2BJDA 3IWXA 1IUJA 2W4CA 2OD6A 4FNHA 2RMLA 1X0PA 2QLXA 1WD6A 2FIUA 2IFXA 5F0WA 5B0BA 3VTIA 1S6UA 4FNIA 4F67A 4DPOA 2KYZA 3BB5A 1YJVA 1TL5A 3HHLA 1K0VA 5B0GA 1ULRA 2LDIA 3TOQA 2CRLA 2HFNA 3IWLA 4YEAA 4ZA1A 4A46A 5B08A 1FD8A 3LO3A 2XMUA 2LQ9A 5F0UA 3HX9A 3K7RA 4NL5A 2W4PA 1TZ0A 2QIFA 2N7YA 2RSQA 1N5QA 4YDXA 5A6PA 1TL4A 2W4DA 1QUPA 1MWYA 2G9OA 2GA7A 2HQIA 3E8OA 1N5TA 3HDSA 3KG1A 3HHLB 3CJKA 3BF4A 4QOTA 3TRGA 2HLTA 3BN7A 2OFGX 4Y2IA 4A48A 3BDEA 1KQKA 1SQEA 1CC7A 5B0FA 3QMQA 2XMMA 1W2IA 2ROGA 1APSA 2QLWA 1YJRA 3BR8A 1P6TA 3LGMA 5KAKA 2AP6A 2VH7A 4HI1A 2K2PA 2LXFA 4U9RA 3CJKB 1GXTA 1Q8LA 3MZIA 1N5VA 3WDOA 2K7KA 3FRYA 1OSDA 2OD4A 4Y2MA 3DCAA 1MWZA 1V3ZA 5T7LA 1Y9OA 3KNGA 2AJ0A 2XMJA 1Y3JA 3KKFA 2GGPA 4OJ3A 2RILA 3FGVA 4DL0C 1Q8BA 5IXUA 1Y0HA 4DN9A 1JWWA 2AJ1A 1FVSA 3BM7A 1U7LA 3HHLD 4HH0A 1FE0A 1YG0A 2HFOA 2FB0A 1AFIA 5B0CA 2VV5A 3TNVA 1LQ9A 2XMVA 5T7LB 2XMKA 4Y2KA 1YRXA 1FVQA 2BJEA 2GGPB 4HH1A 4OJGA 3UDCA 1X7VA 2GCFA 3GZ7A 3HF5A 2ACYA 5K9FA 3HFKA 5B0AA 4A47A 1S6OA 2FTRA 1OQ3A 2L3MA 2K1RA 2QYCA 5B0EA 1TUVA 1X8DA 2OKQA 4Q2LA 1GXUA 3HHLC 1SI9A 2EW9A 1P8GA 4HI2A 4ZOSA 1TR0A 3MCSA 2ROEA 4OJ1A 1YJUA 2GV1A 1OQ6A 1VQYA 2ASYA 1OPZA 1Q4RA 2XMWA 2OMOA 1YJTA 4OJHA 4A4JA 2ZDOA 3FMBA 1Q53A 2BBEA 1FEEA 2K1RB 2KT2A 1AFJA 1AW0A 1CC8A 1N5SA 3BGUA 2GFFA 1FE4A 2KT3A 1JK9B 3KG0A 5B09A 2ZDPA 2XMTA 3QGPA 2PGCA 2BYCA 4NPOA 3F44A 2N4DA 3I9ZA 2K7JA 1KVJA 1SB6A 2AW0A 2LQBA 1CPZA 1Y3KA 2ROPA 2IYGA 2JDJA 3DXSX 5B0DA 1R6YA 2Q3PA 1VQSA 2OFHX 4EFAC 2FHMA 1KVIA 2OP5A 2HIQA 4OIXA 3LGNA 2IYIA 2PD1A 2OAUA 3T9NA 2GO8A 1RJJA 1FESA 1URRA 4HL9A 4Q2MA 2N4CA 2BUNA 5A6WA 1XBWA 2KKHA 2HLUA 2RU9A
chains in the Genus database with same CATH superfamily
3CDEA 1JLBA 2CG4A 1NAQA 2J9DA 2KU7A 4DPTA 2RUSA 4RJVA 3UDEA 1QTNB 2V63A 2Z58B 1TKXB 3E8OA 3KG1A 4DX5A 2YBVA 2MZRA 3D0HE 2XCAA 4ZP6A 3HVTA 3K5MA 1GXTA 4K8RA 2R7VA 3MMCB 1LW0A 4ES1A 1RT3B 2WVCA 2EG1A 2FB0A 3IR6B 5KT3A 3HVAA 4M5LA 4ID8A 2MY7A 4QYZJ 3GPAA 2GVZB 1RTDB 1X4HA 1TP7A 4IOBA 4OJ1A 4ZP8A 5SUHA 3FC9A 2IVMA 3P6YC 2XMTA 3H98A 2XQCA 2HHQA 5F8NA 5MAOA 4X62J 2OP5A 1QUVA 1URRA 4KSEB 1PYOB 2WSFC 3KXDA 3FFIA 4WFXA 3IRXB 4AUKA 5B0BA 2HNDA 4AFFA 1KQFB 2LCWA 3DGPA 1KVKA 3NAHA 4LF7F 3MEKA 2XYPB 4OI6A 3T1AA 3GQCA 2FGCA 3AOCA 4C97A 4C3MA 3ISZA 3VR1A 3VF0B 2FJVA 1JLAA 1MU2B 2IVFB 5J1NA 2D3ZA 1VQ4S 1RWMB 4CLYA 3CCRS 4DCPB 1PYTA 3C6TA 2Y8YA 2FHOB 3CMQA 2XHWA 2MJNA 1J5EJ 1UVKA 1KEKA 1YGYA 2AZ1A 2B6AB 4IO1A 5K9FA 4ZVRB 3MM5B 3HT0A 3VGVA 5IC4B 1JQGA 3MF5A 3W2WA 3SYZA 3PIPQ 4JI5F 5KFBA 3GSIA 3PW5A 2B3TB 1E6VA 4LBIA 4JV5J 1N88A 3AA9A 2O01C 2CQGA 4DI6A 1X9WA 1AZSA 1ITPA 5HVFA 2E5IA 2Q3PA 2HIQA 1TMMA 4ZVEA 2W2MP 3JSMA 2UVWA 1WTFA 2WONA 4DV0J 3MM9B 1ULRA 4FYDA 4C8LA 5F0UA 5D4NA 2RSQA 2YQ0A 1S4FA 1RT5A 3VZHA 2CPZA 3FDSA 1NJWA 2KFYA 2XBPA 3DI6B 5BYQA 4MTPA 4EZ6A 4TY8A 3GCXP 5KOXA 5ETSA 1MN7A 3IBWA 2AEMA 4ECSA 4A8FA 3CJ4A 1KFDA 4I6WA 3SFGA 2AYEA 2U2FA 2XNRA 2ZHOA 3OL9A 1ICEB 1MNEA 2F1FA 2KXNB 1PAEX 2YNFA 2CZ4A 4X4SA 3G87A 1FTRA 4WXOA 1IBLF 3KUEA 3LAMA 4DL4A 4LVNP 5D3GB 5HBMB 3EGVA 2ROEA 1LNQA 4OHYA 2HWIA 1S72S 3RJMB 2FDNA 2J8SA 4RL1A 2GO9A 2G1DA 3QAUA 2E9ZA 2K7JA 3CCWA 3UO0A 3R2CJ 2DNKA 2BM0A 3WC0A 3PIOQ 1HNXF 4J90A 4ZJQA 3KHLA 3SMZA 5F8MA 2G2ZA 1UVLA 3M8PA 3DRXA 2GHWA 1RAHB 4JV0A 4PXBA 1RKIA 4WYLA 3UVJB 4DR1J 1DZ5A 4FYWB 3VV2B 2E1AA 1P1TA 3PG9A 2ZH5A 2ZBRA 2LQJA 1EHWA 1T9VA 1T02A 2FJEB 2D3O1 3QSIA 4QCLA 4YMEA 3VVTA 1H72C 2DGUA 2HZAA 2AJ2A 2VBXA 5I3PA 3T3FA 1Q8BA 2Q66A 4ZVOB 5J2MB 4ZVUB 3MTJA 2HBYB 4GKJJ 3US5A 3PW2A 3VCDA 3BH6B 1TUWA 3KJNB 1FKAF 2EK6A 4N77A 4TLRA 2FVRA 3J80U 3QSYB 1EJ7L 1L3UA 4RW7B 1UW4A 4H4MB 2FJXA 5HSPA 2QSWA 3MM6A 4KH1B 2DHSA 4Y3CA 4OI3A 5A6WA 2A6MA 4ZLPA 2R7OA 2YPZA 3A3PB 4ED8A 5BR8J 3VAGA 2V8PA 4CTAB 2LDIA 4GVBA 2VFUA 4MAKA 5DDPC 2A2CA 4EI2A 2FVPA 4K4VA 4CI0B 2X1GA 2VU5A 2ZE2A 4KH0B 3SZ2A 5EGYA 1U24A 5C2GA 2E5LF 3FBEA 1N6QB 2WBMA 4CNZA 2HHSA 1JLCA 3M1VA 3FNNA 4DV5J 3TNVA 5AE2A 4RW9B 3T1YF 1UVJA 2VFRA 2EK1A 1QY7A 2FTRA 3W65A 5IWAJ 1BY9A 3KK1B 5GAGI 1IBCB 1AFJA 4F2RA 1D9DA 4TY9A 3H59A 2ZDPA 2D74B 1H38A 3ETOA 4GRSA 2HHPA 4JI7J 2JDJA 1U25A 4EFAC 1WC3A 1U2RA 1M1KT 1UAWA 5D8HB 4USWA 3QT8A 2RQMA 2R8KA 4CLUA 3K17A 2L48A 4B9VA 5AXMA 1NPRA 5IC6B 3CJTA 1RT1B 2HLTA 4IDKA 1K8AT 4EK2A 4RW6B 1HKAA 4RX6A 2QLWA 5JVGQ 3I0RB 5DQGA 3PFEA 2ERRA 2DR7A 3OQ2A 1JXVA 4I6YA 5I3UB 2W1BA 3ZC4A 2BMBA 4IYQA 1RE1B 3MEEB 1QDUB 1FI4A 4AQYF 1NK6A 5HQ8A 1U1NA 4OJGA 4K4TA 2I0XA 2F7VA 4IQMA 1IKXB 1S1UB 4DF8A 3RTVA 2E1CA 1HBNB 1S57A 2OTJS 3ISNC 2YX1A 2HNZB 3ENWA 2CUYA 3R8YA 3NGTA 4QR0A 1LV5A 1VQ7S 1ZBTA 4DHVA 3M2VB 1CJTA 4RUAA 2CJXB 4ENOA 2P9GA 3CCTA 2A1BA 1FTCA 5EWFA 2CXEA 4FP9A 3VAIA 3RBXA 1SBRA 3FBFA 4Y65A 1KHWA 4TQSA 2CZVC 2ALZA 4HTIA 1RU1A 3RAXA 2JSXA 1GMUA 1XJWB 4K2XA 3OLAA 5EHHA 1TKDA 2DR8A 4U9RA 3AQOA 3UE2A 3GJQB 5KG7A 2WOMB 1UVIA 1YDLA 1LW2B 4ECRA 3HZGA 1WUUA 2M52A 1RT4B 2XO7A 1K1SA 1V5IB 1EETA 4DOZA 5CD4A 4IG3A 2Q1LA 3LF0A 5LMUJ 5B0AA 4ZKAA 1S0VA 2C2KB 2VQEF 2EW9A 1R3NA 4YB1P 4RUCA 2QFJA 5A76A 3SBMA 4YR3A 1DTQB 2G0JA 1P9QC 5ETPA 3P8BB 3DM2B 2DNLA 3H2UB 4O4GB 3X1LB 5F8HA 2DNQA 5IQ6A 2M2BA 1J2VA 2GMLA 3EZOA 1FRKA 4I2QA 4URGA 1V6HA 2VG5A 1WHWA 1N5YB 3P3DA 4LF6J 3M32A 3KK3A 3H40A 1JJ4A 2R2TA 3DN9A 3J7YI 3DHWC 2ZBPA 4IFYA 2R7TA 1KQKA 1JLEA 4KR0B 2HS4A 3P4UB 1WEZA 4YY3F 1P6TA 2LKZA 4NRUA 2XC9A 2RNEA 2W9CA 3C6UA 5KFTA 5K8NA 3GTYX 3CD0A 4B3SF 3SCIE 1WG5A 2MQNA 4IR9A 2Y9HA 3AB4B 4F4KA 2VPWB 2X3DA 4DSIA 2XI2A 3OFHA 1NEEA 1Z1ZA 1S6PA 2K1RA 4OHWA 1FEHA 2OHDA 2XM3A 4CYUB 2YNIB 3V4IB 2BVZA 1TUGB 1VMBA 2UVVA 1FKPA 2B9XA 3BQ2A 2FVSA 2JL9A 3NMAA 3E51A 3MGJA 2CQPA 5J2NB 2MY8A 2DIVA 1EX8A 5DJBA 3GWCA 3B54A 3KLHB 1MMNA 1IBMJ 2RMLA 3OTCA 3C15A 2AJ4A 3R2DJ 3LUYA 1RHKB 2XB2D 5CYJA 1JLQB 4DR5F 2ZWOA 3MMBA 3A13A 2HHWA 2BKOA 2OPSA 4N47A 2KM8C 4CQ1A 5AT1B 2GJ2A 3CJKB 4BLGA 1WKLA 1SJ3P 4KJIA 1YHQS 2AJ0A 2YQ1A 3SSQA 4FS1A 3SV3A 3W60A 1ELOA 2YWEA 4L73A 1RZMA 4LRAA 3KLVA 3LP1A 3DRRB 2R7QA 3TVKA 2NLWA 4ZJLA 3HFKA 3BH7B 2CJ9A 4EUVA 3VAJA 3D0GE 2UXCF 1EKRA 1KTVA 2DRAA 1VLYA 2GVDA 4U95A 2OMOA 3UW1A 2OSRA 1Q53A 3SDEA 3J7A1 2W2NP 3M6XA 4ZCLA 4LSLA 2BW2A 2F40A 3IG1B 1XNRF 4QIFA 4X4PA 2HMIA 2YKAA 3I6PA 4JI4F 3THPA 1TKTA 5J1EB 3W9JA 1X9MA 4EO6A 5HMZA 2MLZA 5LXYA 1NK9A 2WHOA 3Q8QB 4PG4A 5KG0A 2F4VF 2H54B 2EKNA 1YI2S 2IHR1 1FX4A 2Y1JA 1BC6A 4U67Q 1F3VA 2DTJA 3B4MA 1JJHA 1ZM9A 1R8BA 2BXJA 2CPEA 3JSBA 1P9YA 1YJRA 3TJAA 1SH0A 1SKSA 4C3LA 2XLKA 4PABA 4QWBA 5DG8A 4JI1F 2ZKTA 5LJ5Y 1HNVA 3G6XA 4DV3F 3CVKA 3AA8A 3D0IE 3R7NB 5I3QA 2YKPA 4PWDB 2CQBA 3UWTA 3I87A 2CQ1A 2YWKA 4NEZA 3MHYA 3MD3A 3AY0A 4Q8EA 1RHRB 1FKOB 1DURA 4I6AA 1UWBA 2GFFA 8RUCA 2V4QA 2G0IA 3DHXA 3OR2A 1X9SA 4F4AA 1VQSA 2HNDB 4DR4J 2UXDF 3BPDA 2BOAA 1HHSA 3NOGA 2HGLA 4NXNJ 1KWMA 5BYSA 3T9ZA 4X4UA 2VKZG 1H6KX 3HHLA 1NMEB 4ED1A 3VAKA 4F3MA 2DCLA 2VA3A 3K7RA 2XMAA 3E01A 2PO4A 1F6TA 4ID5B 5CABA 3HHEA 2BV3A 3ITHA 2V69A 4QWDA 4FXWA 4O3QA 2BE2B 4MKBA 3OL7A 3QRRA 4DLGA 4TU7A 4ZITA 3Q8VA 5JJBA 2GIQA 2JC0A 1T9UA 4NLOA 3QJJA 2MKHA 3JYTB 2BACA 3BV8A 4R5PB 4PQAA 3OVBA 5CCLA 5HAOA 1DJ0A 2E5JA 3OVAA 3ILLA 3UN5A 3TJ9A 3GV8B 2DD8S 4HDHA 1VQYA 3QLHB 3ZTQA 4FF1A 3JQJA 2V4JB 3MPYA 2P9EA 4X84A 3QGPA 1PO6A 2CJYB 4IG0A 3GJTB 2JJ4D 2OFHX 5HQLA 2NYIA 3ELHA 4DUYF 4NA3A 3EM1A 3CDBA 2AHOB 1SV5A 2LYVA 1I6JA 1YBUA 5ETMA 3TANA 1RT5B 2CA9A 3KHGA 4AXJA 4HKQA 3JTNA 1BQMA 2DK2A 4Z7CA 4Q45A 5DM7Q 1WC5A 4DR6J 1S9GA 5KFHA 3RB0A 2OGUA 2FHJA 3ZZ0A 3LWLA 2EPIA 2R8IA 2HHHJ 4TNOA 3QPIA 4C0OC 4E2FB 1JLGA 3MI7X 1RAOA 1U02A 3VGUA 1LOUA 4I67A 4ETZA 4WTYA 3ZZPA 1CJUA 3CPWR 4YDDB 3G8SA 4ZJOA 4YS2A 1H98A 2HYIB 4IFVB 5B0EA 3CDWA 3G8QA 3DDIA 1Y5LB 3MCMA 2LLZA 2LQ5A 4K5SA 3DLEA 1RTJB 5K5MA 4LFBJ 4OLOA 1RBLA 3NWRA 2MDAA 4I64A 2BQ3A 2H65B 1YSJA 2IRXA 2BANA 1VBZA 3M9NB 4TKTA 3E3XA 1H2UX 2DY1A 3BSOA 3MR5A 2OD6A 4FF4A 2Y8WA 3SCJE 4QWCA 4XPCA 3OSNA 4NLGA 3RAQA 2VB6A 4P71A 5KFKA 1S1VA 3EMTA 2UUAJ 4ELUA 1Y7PA 5DGBA 1RYSA 3BGOP 2QLJB 5DG9A 3ZZTA 4WU3A 2XGQA 2D41A 1HBOA 3FJ2A 3PHEA 3BYRA 2HRTA 1QLNA 2C3YA 2X1FA 3WQPA 2VFTA 4OYPA 1TVRA 1CG2A 5IZHA 2P5VA 5GMDA 2CPIA 2VF3A 3QIPB 2MMYA 3P5TL 3OXGA 1N36F 2ILZA 1VYAA 2FVCA 4AL7A 3A8IA 2UVUA 2DNZA 3C46A 4ED0A 2PGCA 3MM6B 3MMAA 1IN0A 3G4SS 2Y1IA 3R7SB 4QR2A 4P2FA 3ONQA 3OTBA 4X4TA 1N0UA 4MIBA 4TYBA 4Y2AA 3U1LA 1F2HA 3OSPA 4H4OB 1MWQA 3NKYA 4NL5A 1U1PA 4EU0A 1UEVA 4YDXA 1SJFA 1YRUA 1I51B 1C0UB 3CB4A 4DQRA 2R8JA 2IRYA 3F41A 2LEPA 4C4WA 3TAMB 3LP2A 2RKIA 1CULB 2K2PA 5GAGU 1IBKF 1SKUB 5GAHI 4DPYA 3M1VB 3OLBA 3ETMA 4GO7X 5J2QB 1VR6A 2W9BA 4ZIVA 3POTA 5GMEA 3EPGA 3GSDA 2F8EX 3UCGA 1HLWA 3DLHA 2JLFA 3G86A 1V3SA 4WFZA 4RO0A 4DFKA 2CQDA 4OI4A 3QZ8A 1FJEB 5HJYA 3ENQA 3C14A 1S7HA 4WFNQ 4JI3F 2RRAA 2VG6A 3DC2A 2HFUA 1H74A 4K0KJ 1XWLA 3OVSA 1FE4A 1VRUA 3CO0P 2E9RX 4U96A 4NPOA 1SB6A 4LF5J 2IRUA 2W7OA 5L1KA 4YP3A 3N01A 1LWEB 5FIIA 4WE1A 4J9PA 1U2FA 4USIA 1REGX 5HLFA 2C3OA 2HFNA 5D0EA 2LXUA 1GH8A 3OHAA 2B9EA 2JVOA 2BJ7A 4A48A 3RBDA 5IM0A 1W2IA 1OPIA 1N33J 2HW3A 4OHVA 2B43A 5J2PA 2R4FA 4HI1A 1RQ0A 2RQKA 2EEYA 3H42A 5JMNA 1RABB 3H5UA 2GJIA 4NOHA 8ATCB 4YUDA 2DIUA 4QPXA 3SSRA 2DGTA 5F8JA 1SUQA 2GIFA 1FVQA 1HNWF 1XR5A 2C2ZB 3LGHA 1NCLA 2V8HA 2OKQA 4OX9F 1UA1A 3HVRA 4TN2A 1WC6A 1XIQA 2I1RA 4E8UA 4ZS6A 1N5SA 2V2KA 4Q0BA 2XZWA 4ZN1A 1KVJA 5GAEI 2XSJB 5BYRA 1CJTB 2RS2A 1FWLA 4FVMA 5HP1B 4NI2A 2XY6A 1WI8A 2EC0A 4W90B 4WYWA 4PG8A 2VUGA 4Y2CA 2ZHBA 3QWUA 4EBEA 3CGIA 1T95A 3I4HX 1NDPA 1RT6A 4OQJA 3R7BB 2V68A 4DZDA 1T03A 9RUBA 2J8AA 2Q6CA 1YBTA 3V4MA 4F7VA 1KLMA 2VODA 2YNHA 2LXFA 5A8WB 2R2SA 5IV4A 2DNRA 3L95X 2MGZB 4CLTA 4N41A 5G0RA 4NX9A 2I5JB 3TQEA 3D6MB 4A8QA 3IS9A 2HAFA 3HD1A 3NGDA 4Y34A 1V9OA 1I94F 3KLGB 2WW8A 4RNMA 1CJVA 3PZPA 2B7CB 3J7YU 2N4DA 1FRHA 3MEGB 1N56A 3OTOF 4DV6J 4JV1A 2MHEA 2KRBA 1VRQC 2ADBA 2EBGA 3O44A 5CA5A 2BJDA 2VIHA 2GHVC 4LF9J 3GV7B 4ZPTR 2X3GA 1XMOJ 4C11A 4ELTA 4OYZA 1EARA 1RT2A 4DSJA 2AMCB 3MURP 2AF6A 2K7KA 1VQLS 2F5GA 3DOMB 2G13A 3K2YA 4KGVB 2PI4A 5F9LA 4O3PA 2XZTB 3BDPA 3UDCA 4Y00A 4B9LA 4EWTA 4IQXA 2UU9J 4WK1A 3M30A 1TUVA 3EUNA 3RBEA 5KFQA 4D3GA 4EMDA 6FD1A 3Q8UA 3EVWA 3BS9A 2VOPA 2HBZB 3FSIA 4OZ3A 2RUGA 1WOSA 1PBUA 3O6QA 4PPDA 3J7Z5 4F4YA 2MQMA 1NSKL 2NXUA 5C24A 1SJQA 2V67A 4KV8B 2DGSA 4A8SA 4B3TF 1NO8A 4LSNB 1NZ8A 3EGNA 1YJ7A 1HD1A 4DG1A 5B0GA 4B9SA 7AT1B 1DRZA 1RWVB 4RNHA 2RRNA 3CXCR 2YKQA 2ZH9A 2G9OA 2B4UA 4DV7J 4A8YA 3LP0B 4ILMA 3R5AA 3BBFA 1C4CA 2DKOB 2U1AA 1FNMA 5T7LA 3L4BC 4IH5A 3KNGA 4WWSA 3FGVA 5E2QA 2EFQA 2V2QA 2EFNA 2XSFA 5GADI 4FBUA 2KB2A 4MK7A 1A7GE 4AT1B 2DCUB 3OV7A 1HI1A 1LK7A 1F5BA 4G1QA 4DL3A 3ZO7A 3CCJS 1TL1A 3M8QA 4DLEA 4W4MA 3QJPA 2UUBF 3IRWP 1H2TZ 4LR9A 2R2UA 4KTQA 3CCLS 3FCHA 1SL2A 1Q1KA 1SPBP 2IY5B 3DYAB 4JOUA 4RU2A 4NZ0A 2BUNA 4GVLA 3MUMP 1LWCB 4FNHA 1TKXA 2J5AA 3NMRA 3PDNA 1K9MT 4F67A 4PYDA 4NLQA 3VZIA 3KDOA 4OYOA 4ECQA 2ZC3A 3TAPA 4LFAJ 4DUZJ 1N5QA 3OPKA 3QT7A 4O23A 1ZZNA 2XCPA 4WF9Q 2D7SA 3MMCA 3CJQA 1RT3A 2ZEJA 2PMHA 3CCMS 3DLGA 2MLYA 4ZPDA 1URNA 4BHQA 1X31C 2GVZA 1RTDA 2ZH1A 1B0TA 2JLGA 1A0OB 1L3KA 1SJ4P 2IA6A 1NHVA 1EIYB 1NSAA 2Y1LB 2F4FA 1RLDA 2DNGA 3OR2B 1U6ZA 4P2XA 4ECYA 1D9AA 2XYGB 1V5VA 1FERA 3MMJA 4LREA 4F3QA 3IRXA 5KT4A 3AB2B 2ZNYA 1KVIA 4OIXA 3KYLA 1O0PA 5KFYA 4LT6A 4RBTA 1K0TA 3SEOA 1QVFR 3FZBA 4LQ3A 3AD7C 5B08A 4CO1A 5A6PA 1VHIA 4XDCA 2PT0A 1MU2A 3FSXA 3NL0A 3KNAA 4JI8F 3I82A 3U02A 4JI6F 4E98A 3I9V9 3JQKA 4DL0C 1FJCA 2B6AA 2WRMA 5LXRA 1JNZB 2LA4A 3C19A 3BKUA 4NXMF 1VGYA 3H8YA 1BHNA 2QMUB 5L1IA 3PW4A 3TEGA 3D1HA 2E7XA 4A47A 4DV2J 3ET6B 4KT0C 4F4XA 1GXUA 1N32J 4X62F 2AX1A 2ASYA 4UY8T 1UPMB 3ZXWA 5DGAA 5D4LA 1FD2A 3T5KA 2ZZNA 3AXMA 3QATA 3CJRA 2FY1A 3QBCA 3D1QA 1RCXB 3RBZA 3TUPA 3MM9A 1Q86T 1GTHA 4C2MA 2DHHA 2NPFA 3MD1A 2KVIA 4U8VA 3OJUA 3UN2A 1QM9A 1LKZA 3DI6A 3GJRB 3HX9A 1DLOB 2QIFA 5HMWA 1DFDA 1EP4B 2GA7A 3M8ZA 4JI5J 2LU2A 1FWKA 2OPPB 1TTHB 2GQCA 5EUHA 1KLNA 5IFMA 2ZFHA 4M94A 1CJUB 2ADCA 2XMJA 2YTCA 4KGKA 4LBPA 4DN9A 2NZ4A 2AJ1A 1R27B 1U09A 3LA0A 5D3GA 2YKNB 3BO3A 1X7VA 1WOPA 3HF5A 4IOCQ 3AJ2A 3EDQB 4WFBQ 1SC4B 4AD6A 1QAJA 1SI9A 1GX6A 1QAIA 2R7WA 1L3TA 4IOAQ 3GP9A 1OY9A 4RLEA 2DH7A 1PCAA 3LWMA 5M2PA 4X65J 4CDIA 5KFNA 4KO0B 3EZUA 5D6GA 4ED3A 3PYGA 3FCVA 2HFSA 3R27A 4U7UK 5KFSA 2VICA 3VGTA 1BWVA 1IBLJ 2QTWA 1B99A 4C8MA 2JEIA 1ZZFA 4YB5A 4RWXA 1IKVB 1O51A 2W2QP 3HXMA 1T11A 2IIHA 2JZ5A 5KT7A 4CH1A 2QRRA 1WHYA 5LMNF 1WF1A 2E7WA 3BGRB 3I32A 3IM9A 5J2MA 1PG5B 1Y5IB 4J9VA 3RW7A 1TVRB 4RZRA 3BSNA 3SCKE 4O3OA 3P96A 1LWFA 3LPEA 2IMWP 2CVEA 5B0CA 2W24A 1T7PA 5CH7B 4WXWA 3RW6A 3M8WA 4H4KA 1FRJA 3EXYA 1B7FA 4X4OA 3DLKB 4UOFA 4RW7A 1S1XB 2CNOB 4Q43A 2ATLA 2KT2A 4H4MA 2QL9B 1YJ9S 3HD2A 3AXKA 3SCLE 2VG7B 2NXJA 2PDAA 3B8HA 4DR1F 4CTAA 1OYEA 3P5BP 1TKZB 4USVA 5GAHU 2I6WA 1S59A 5D15A 2OPQB 1VK8A 4ZA1A 2OSQA 4DFJA 5EX3A 4OZ1A 2AGQA 4CT8A 1TL4A 1FXLA 5KFCA 4ERDA 3BN4A 3IAS9 3BDEA 3ENAA 1UFKA 4ILRA 3IFEA 1N6QA 1UKUA 4UOGA 4K5RA 5C7PA 1C0TB 4RW9A 1FXDA 1EQMA 1YG0A 2MQOA 2J0XA 4WP3A 5IS2A 2KZZA 3KK1A 1KKHA 4ANCA 5C42B 1UVMA 1FFSB 2YNGB 4PUOB 3GFXA 4QW9A 3R5JB 3S1TA 3GJSB 1LXJA 3ZZYA 1UCNA 4TU9A 4CNYA 1U1LA 5THWA 1LFWA 3N9UC 2GZOA 5BR8F 2KM8B 2LQBA 2E5LJ 2XYHB 1FXRA 2CG8A 3DLBA 1T9WA 3TX8A 5EDWA 2PEBA 4WZMA 1UZDA 2CADA 2MKKA 1O5JA 5KG4A 1WKKA 1RT1A 1SKWA 4C8ZA 1B0PA 2CNLB 4DZ6A 2HVEA 2HK3A 2M9KA 3M8RA 3I0RA 5J2PB 4F8RA 1QUPA 1VIXA 2Y0BB 3OBIA 2QFIA 3W2VB 1IWGA 3PXGa 1RWOB 3MEEA 2B7BB 4LR7A 4KHMA 3HFVA 1WF2A 1H0HB 2G2OA 4DSKA 4CH7A 5IXUA 4OJ3A 3PKMA 3RR8A 4QU6A 1S0MA 3PEHA 4Q7AA 5GAEU 3W5XA 1IKXA 1S1UA 3N6LA 4X66F 1YRXA 3NNAA 3THTA 2CQHA 1HBNA 4XTTA 1XTZA 2HNZA 1R8HA 2J0WA 3W9IA 4BC9A 1T0TV 4RBVA 1U1QA 2DRDA 5DQHA 4BS2A 2ZVSA 2IAJB 3D68A 1DTTB 3M2VA 4BCAA 1Q0NA 1KHVA 3TYTA 2QEXS 3UD3P 2VJUA 9ATCB 4Q44A 3W5ZA 4AQYJ 3FEYB 2RQCA 2UUTA 3W5YA 4P52A 5IT9U 4UW2A 4WIQA 4RBUA 2Z2ZA 1KC8T 1H7WA 2KXHA 5HO4A 2J9EA 3HSZA 2R7XA 2MHNA 2W4DA 2C3UA 4CLWA 2YNHB 2ZJQQ 2HQIA 2WOMA 1XQIA 3DRPB 3K5PA 3QMQA 1Y5NB 1LW2A 2ROGA 4OHZA 1XMBA 2JH3A 1K47A 1RT4A 4CLLA 1RU2A 1NM2A 3FRYA 4B9NA 2K8GA 5FLXU 1X4EA 4ED7A 1IJFB 3EJMA 2QZ8A 4PXCA 1TFYA 3DOLA 2Y3YA 3H7HB 1DTQA 2IDEA 3DM2A 4O4GA 2IM0A 4USKA 2F3JA 1S9FA 4LMZA 4ANDA 3H4BA 2C3PA 2EI5A 1RAGB 2HQGA 3FK4A 2DPIA 2OEJA 5FD1A 4IUFA 3D67A 1T05B 3Q2TC 2QG9B 2XHCA 1VC6A 2EFOA 4G3IA 1RJJA 2CPJA 5I42B 4M5IA 1S4EA 5K8OA 3HULA 4F02A 1WD6A 3GG0A 4ZVFA 2VFSA 1U6BA 4ECWA 2EWHA 2VQEJ 4DX8H 4DPWA 2GX8A 2RH3A 1OO0B 2QA4G 1DQ8A 4J9MA 1RADB 1ZM2A 4MFBB 1N5VA 4ECXA 2DNOA 4ZP9A 4P73A 5DETA 1I5OB 5DO2A 1RHJB 2Q6BA 4IH7A 1WG4A 4CYUA 3FSYA 2YNIA 3B4DA 3V4IA 2XS7A 4RPFA 1S12A 2V5HG 4M5HA 1RTZA 1CEZA 1H73A 5CCMA 2H5IB 3SIPB 2QC3A 3KLHA 2IMOA 3GE9A 3CD6S 4B3SJ 4YOEA 4DG1B 2BOPA 5H9FK 2GHPA 3T9NA 2KG0A 3O2IA 1JLQA 3D5MA 2ZH7A 3M9OB 4FNIA 2UVRA 3ULHA 2CRLA 3PACA 2E1MC 5GADU 3A1YG 3GV5B 2BKNA 4JYAF 3CJKA 1N5TA 1RYRA 1AA1B 2RU3A 2XMMA 3W9HA 2GMHA 1NSQA 3PNIA 1WWHA 1U8SA 2ASLA 4NYZA 4KFBA 4OFZA 4ECTA 3DRRA 5AXLA 4H4KC 3ZTOA 2MQ8A 2KHDA 4G1QB 1VQ9S 5BJRA 3EPIA 3AAWB 5LSLA 1KSPA 3L7PA 3N4WA 1PGZA 4O3RA 4WJBA 1JB0C 3IG1A 5K8MA 2L9DA 3CIMA 4PYAA 4WFAQ 1SIZA 4L6V3 2CDQA 5J1EA 4GO5X 1CPZA 2HNYB 1VBXA 4FVCA 3M05A 4NYPA 2IYIA 2N4CA 2HLUA 2DVIA 2B56A 3QO9B 3HK2A 4LUBA 4PWWA 1NK8A 1TELA 3PW0A 2UXCJ 1H2VZ 1JIHA 4AL6A 1HMVB 3JQMA 5LM7E 3U1NA 2QLFB 2VQFF 2DBBA 1YIJS 3DLGB 1VJQA 4K4YA 1FHTA 4JI4J 2J9DE 4B9MA 3H2LA 2V4RA 3I0SB 5G4DA 4KE5A 2Z8QA 3G71S 4PWDA 4EO8A 3RRKA 2HQDA 2DXDA 2F4VJ 1FKOA 2DPJA 5E3RA 2FJWA 1F1BB 1UTAA 3QRQA 1F2GA 2RF2B 4ZPCA 4DR3F 1KS2A 3DOKB 2AV5A 4X4QA 4I2PB 1K73T 2IJRA 1TK8A 1QSSA 5A2QU 2RIJA 4JI1J 1F9FA 1WHXA 3ZZUA 4JP8A 2QN6B 4DV3J 4OZJA 2WW4A 4PXEA 3R5DA 4S0MA 4C98A 3QZ7A 2QLXA 2ZJRQ 2HAIA 4NCBA 3NGKA 1WDDA 2FJBB 2I9SA 4ID5A 2JFKA 2YKMB 4G1PA 3QGIA 5ITHA 2XMUA 1QAXA 3WHIA 1KN6A 2BE2A 2LU1A 3D1OA 3BF4A 4FYVB 1IR1A 3BR8A 3C16B 1S48A 2XS2A 3JYTA 3CJ0A 2W9AA 4R5PA 2UXDJ 3W3SA 3HSDA 5IV3A 2P2CB 3KJVB 2GQ2A 3KLEB 4EYIB 3HHLD 3DRSA 3OXFA 3K57A 4ED2A 2CQIA 2KJWA 2W7AA 2EFPA 3QLHA 3BSCA 1IVZA 2V4JA 4R0JA 3IO1A 4MKAA 3TX0A 1GEHA 3V5RA 4ZOSA 1BLUA 3UQSA 1WDTA 1AYEA 2WVFA 3FMBA 2NZCA 2W01A 4X64F 1SIWB 1NPKA 4NXNF 3N0VA 3OR1B 2LA6A 1SL0A 1QE1B 3GU0A 4ZLNA 5B0DA 4NZ7A 5FDLB 2B4OA 2KRRA 4HT5A 4X4NA 2A0FB 4OLPA 2QMXA 3EZ5A 5K8PA 1VQPS 4NA2A 8AT1B 4DSFA 3C2PA 5CYMB 2OMLA 5DM6Q 2J7UA 4USTA 3T5LA 3MR7A 4DWIA 2W4PA 1UZHA 1YVFA 1K44A 4JI2F 2G4BA 4I7FB 1PC5A 5KAKA 1RWWB 3R1LA 2SXLA 3D7SB 1KBRA 1NXIA 3PYFA 4DUYJ 2DITA 3NLCA 3MECB 1M1HA 4IFVA 1TAQA 2WSCC 3NS5A 5A8RB 4NLYA 2QA2A 2FHJD 3J81j 1RTJA 2L9NA 2R9LA 1F3FA 3RRGA 4YB7A 1RAJA 3AFGA 4K4ZA 4PR6A 5LL6d 3D3CJ 1MLAA 3JSRA 2V2VA 3MOZA 2FJAB 2VDIA 5JXSA 1KQGB 3IA0A 1P27B 1JJCB 1VK3A 4Q2MA 4C0HA 4RNOA 3CCQS 3PCOB 2IM3A 2OELA 3AQPA 2XG8A 2HHHF 4A8OA 5HVHA 1RHUB 5KFVA 2MXYA 2KXFA 4LF8F 3TJ8A 1E6YB 1LWFB 1SC1B 3W7BA 4MT1A 1R0CB 4F25A 1HL6A 1X4AA 1SH3A 4JV2A 5SZTA 4KHPJ 1SQGA 2HFOA 2B8PA 3DU5A 5F8LA 2JEGA 3QIPA 2VBZA 3EVOA 2LEBA 5E3QA 3H5XA 4LFBF 3TZZA 5D0GA 4V1Ak 4QYZK 3WX8A 3T5JA 2AWZA 3D6FB 2VONA 3AH6A 2HGMA 1R8PA 1H3DA 4KHRA 3PHTA 4CM0A 3KFWX 4DV4F 4NCAA 5GVQA 3NEKA 4M5KA 2O66A 2JX2A 5DQIA 1F9HA 4DR2F 1M0SA 3T6BA 3EXCX 3CUNA 1OMSA 2J6TA 5L8RC 4H4OA 2JNJA 2APOA 3NG8A 4K50A 3TP2A 1NKEA 4PG5A 1NJXA 5CYQB 1C0UA 1SJ1A 4TVAB 2QL5B 1VI7A 3W8GA 3TAMA 1RDRA 4Y28C 1CULA 2BRKA 1RP5A 4XO0A 6FDRA 2EC2A 3T19A 3G6VA 3CNQP 3I55S 3KOAA 2X1BA 5J2QA 2RVJA 2R7UA 4X4RA 2X1AA 1WSVA 1JNRB 1L3VA 1JKHB 4WP9A 1GK8A 2VKRA 1FJGF 1FVSA 1Q79A 4DXLA 5DS7A 3H25A 1XR6A 4A8KA 2MPUA 2GGPB 3FBBA 1GQEA 3SQGB 2H4WB 4KAIA 1DBDA 5I4MA 4KYZA 2W2PP 3NCQA 1HBMB 1LWEA 2ILYA 1RISA 2IBKA 1Q5YA 4QIVA 4QYRA 3GLJA 3TZXA 2M70A 3Q8PB 2PFFB 2ZH8A 4NLTA 2YX4A 5L1JA 1QVGR 3KK2B 2RT3A 1Q78A 5F0WA 3M6WA 4WU2A 1HBUB 2AJFE 4DV1J 1R0BG 4JI3J 1WACA 1EQ0A 5DDQC 1CQNA 1YQHA 5DRKA 4JI0F 3PX4A 2D69A 3EVMA 3TZYA 3LALA 2DGWA 4OI2A 4LIWA 1Q95G 2V50A 1NK4A 4DFPA 1VQ5S 2J7KA 3I56S 2ZVIA 1FK9B 4ALZA 4FZVA 2AX0A 4ES2A 2HPUA 5HVGA 4B17A 3UN3A 2A3JA 4MIAA 2L9WA 4IRCA 4K2JA 1IQTA 3I4PA 1NU4A 1OQ6A 1NJIT 2UZAA 1YJWS 2XSJA 5K14A 4RU9A 1F5CA 5HP1A 4FPRA 2IC3A 4I69A 3K89A 4E0DA 3C66A 2JWNA 4BWMA 3E2EA 3HFZB 1VQKS 3PEJA 6AT1B 3J7ZT 1J5OB 4HL9A 1IM6A 2OO4A 3HT3A 2AEFA 3ZTRA 2OJ3A 5D77A 2Z2MA 2RD5C 4OX8A 4OX9J 1G2EA 3DLLQ 5H9FJ 3R97A 1TK5A 5A8WA 3TRGA 4RW4B 2MGZA 2XZDB 5B0FA 5IOLA 3W61A 4LJMA 4BDPA 1X5PA 3J80Y 3DOLB 3RUBL 2YWHA 2MKSA 2I5JA 5LSRA 3G6YA 4ZVHA 3O3LA 4ETXA 3RR7A 2XMVA 4ATNA 4YN3B 1XC9A 3GFHA 5LOQA 1N34J 3GYGA 4ITSA 3KLGA 4Q2LA 4KPCA 1G1XA 3MCNA 4UT4A 1FDNA 4X2BA 3MEGA 1S9EB 4M5NA 4L72B 3HI9A 3V6DB 1FNOA 1IQZA 4HYKA 2FVQA 3EDRB 4OV1A 2HGNA 4FXVA 2PIIA 2ZUGA 3LGNA 2QV6A 3CIZA 4ZPWR 4TYAA 2HKEA 2OUGA 1RSCA 1N54B 2RU9A 4L3NA 4U7UD 1LEOA 3I5AA 3WBZA 3TUZC 4A8WA 2VC0A 1F9EB 1FD8A 2XTJP 3NBPB 3EE3A 2EFVA 4B9UA 1LWXA 3LPYA 1I94J 1HI8A 3DOMA 1RWUA 1SL1A 7FD1A 2AP6A 3CE8A 2M7SA 2IBOA 2DEJA 3CW2C 2JLEA 4KKOB 4QBUA 4PG6A 1Y0HA 1U1RA 1S5ZA 1SC3B 3ILIA 3ZZRA 1CJKB 3SSSA 2MZTA 3UPFA 2VPZB 1SXLA 2FZCB 2CPFA 1HNIB 1G7CB 2N3OA 2FPHX 1C4AA 5H9EK 4FS2A 4KV8A 3MAHA 4B3MJ 3BPSP 4LF4F 4BC7A 1M90T 4LSNA 4C7QA 2BJ1A 1S99A 1G3OA 1QD1A 3TWZA 1W25A 4YQWA 3KLFB 2MSSA 4XAKA 1FDAA 3CDUA 2DGQA 2IFXA 5U47A 1YJNS 4AXIA 3MWBA 4IO9Q 3LP0A 2A18A 1T3OA 4O0IA 4DF4A 1XN9A 2L41A 1NK0A 3D66A 1IWAA 4KFBB 4HLBA 5HMXA 4KGZB 1ACMB 1UJ5A 2ZOGA 2GQQA 1IJEB 1OSDA 2AIRB 1D0EA 4CO3A 2BR0A 2B8QA 4UZCA 5HATA 4PKDB 1Z2ZA 1FNXH 2ZOMA 3HHDA 4JBCA 4M1KA 4USHA 4NLXA 3OUYB 3M7VA 4ZVPB 2HZCA 1YWXA 4MYTA 4NLVA 4FPIA 3DYAA 2VC1A 5ETNA 4CLSA 2O5DA 2XI3A 2AW0A 5CD4H 1LWCA 2IYGA 2OPRB 2J0SD 1R6YA 3CWJA 3PYDA 3CF5Q 4DV7F 2Z56B 2WK4A 1WSRA 3NRBA 3LANA 4RW8B 2X51A 4USUA 3K59A 3CMES 2DT9A 2UUBJ 3M2RB 3KMQA 4DL2A 2BE9B 4F0HA 4YHHF 1ZAWA 2V34A 4CO4A 3EX7B 4DCJB 1VBKA 1KDNA 3KHRA 1VQNS 1KD1T 4J9LA 2M8HA 3GIJA 1ZETA 4CT9A 2CJQA 3BQ1A 4ZCIA 1ZAXA 1JXEA 1TL7B 1ZM4A 5E3CA 2V8GA 4KIAA 2UXBJ 2RQ4A 3FZ2A 4IH6A 3L7UA 5E0OA 4M5JA 3P45B 4I4BA 1ZA2B 3QIDA 3VALA 5D4OA 1S7IA 3KLIB 5KFUA 4F4ZA 4HT7A 4DSLA 2KT3A 3OFEA 2H48B 1X4FA 3THVA 4QU7A 3HSGA 4C0BA 4ZLJA 4XDDA 2PEHA 2J6UA 3KUGA 4OZ5A 4KY3A 4O3SA 1TQLA 3TW0A 1QTMA 4ZCMA 4FF3A 3PO4A 1HD0A 5KFOA 1GT8A 4A46A 4F0MA 2MYFA 4DX6A 3F56A 4A8MP 2BX6A 1Y00A 1T9XA 1S1TB 3X3UA 3W8PA 4QQBA 5C25B 2ZHAA 1V3RA 3DRSB 1OY8A 1X4CA 4CIOA 1HHTP 2EBEA 4P72A 2LXIA 3KWMA 1U7LA 3ET6A 3UNGC 5DLGA 3QFHA 1R8CA 2Z0GA 1WELA 2HWHA 2JHEA 4WBFA 2PSZA 3L3CA 4U7CA 2ZWPA 3I31A 4I68A 1TR0A 4OYIA 2NXCA 1YJTA 4JI8J 4JI6J 3MM8B 3TUIC 4G6VB 4WFYA 3A12A 2CQCA 4G65A 2C42A 2XEXA 4MKVA 3SXLA 4NXMJ 2W4CA 1DLOA 2KH9A 4PQUB 3CJ3A 4Y6IA 1EP4A 1GAOA 5AE3A 2F65A 2OPPA 1Q8KA 4N56A 1HQUB 2B5JB 3CEDA 1C1BB 4XIUA 5KG5A 3BYPA 2CQ0A 3FVYA 2B9YA 1G4CA 3GIIA 1MWZA 4DV2F 4WIIA 2YKNA 3VHQA 4Z7YA 1N32F 3CC4S 2J9CA 1FE0A 1HNZF 2VD3A 1U0SA 5D0RA 2HSEB 3R5BA 2CQ3A 2C2RA 1HIYA 2KG1A 2MZQA 1A6LA 4J37A 4KO0A 4LIRA 1OPZA 1C2PA 1R0AB 1FDDA 2HHUA 1Y3KA 2F63A 3MAAB 5EWEA 2B9WA 5HJXA 3IN5A 2AYMA 1KP6A 1IKVA 5AJ3F 3WZ0A 4QIEA 3PTWA 3BJYA 4KBIA 3BGRA 3V2UC 1RT7B 5IT4A 1S76D 4U6PA 3MAQA 3MM7B 3OT9A 1CQMA 2UUCF 4N8OA 2QA1A 5AXNA 1HW8A 4OX6A 1TV6B 3TQ1A 4NLWA 3OL6A 2D3UA 4L76A 4U8YA 2RHSB 3TZWA 3KMSA 1BQNB 4DU8A 2KFZA 5C2CA 4OL8A 4X65F 3DLKA 2RDDA 1M5OC 1S1XA 1NBEB 2ATCB 5HANA 1FDBA 3NGRA 2VG7A 3BO2A 5LMNJ 4C3KA 3IAM9 5D4PA 1X4BA 2NYHA 4URQU 2PE8A 1TKZA 1FA0A 4NLRA 3ZTPA 3AOBA 5F3TA 3Q83A 3IMQJ 2OPQA 1YTYA 1S1WB 3BZQA 3QWPA 2O3DA 3DMJB 5KFWA 4RNFA 2FIUA 4FYYB 4DQQA 2KYZA 4XPEA 3L7OA 4DMZA 4CO2A 3JTOA 1XNQF 2ALYB 1NKBA 1C0TA 2XNQA 1UP1A 2CPHA 3CJ8A 2DR9A 3WDOA 2P6SA 2ZOFA 4PWUA 4F0KA 2ZM6J 2IJFA 5C42A 1S79A 2K3KA 2AKWB 2ZH2A 2YNGA 4PUOA 1HW9A 3F73A 3PRDA 4DCOB 2HQ3A 1HR0F 4K4WA 2KHCA 2M5YA 5KT6A 2MKCA 2FLOA 1PJ7A 2KVQE 3D2WA 1HQEB 1PSDA 1M1GA 1S6QB 1RHMB 2H3EB 2EFGA 1U26A 3F44A 4G1IA 4NMLA 1KNZA 1IKWB 3G96A 2CVIA 2QMWA 4C6AA 4UY85 2COLA 4P74A 3F0NA 4ZVGA 1F0XA 5KFZA 2CQ4A 2BM1A 2KKHA 3LW5C 3HHNB 3QT6A 2LMIA 4DPOA 1L3SA 4YEAA 3W2VA 5KOWA 1ZH5A 2CKWA 1EZZB 2DYAA 1DQAA 3TVYA 4ZVQB 1YRTA 3AJ1A 1S49A 5AE1A 3OFGA 4WP8A 3Q0AA 3K5LA 4WCEQ 4DBQA 2ZZMA 5L46A 2N3LA 4ECVA 3ZZZA 5L1LA 4UOHA 1XR7A 3CJSA 1RAIB 3C3LA 2BA9A 2J76E 3UR3C 1Y10A 4HH1A 2X7IA 1REVB 2R42A 2NUUG 2PC6A 5F8GA 5K14B 4OYWA 3MFIA 4O4RA 5JUMA 1IM4A 1TK0A 3HHLC 2CJAA 3H5SA 3HM9A 2IC3B 1HI0P 2IAJA 5F9NA 1DTTA 1WJ9A 3RRHA 4OZ0A 4TQRA 2MKIA 2GNKA 3ZNJ1 5A0YB 1JLFB 3K5OA 3R5GA 3S8SA 4EZ9A 2WVBA 3CCVS 1C1CB 1FT8A 2LDYA 2KZMA 4DQIA 5H9EJ 4X66J 4J9OA 1T94A 4OV6A 3JB9k 3DRPA 2BEFA 3CULA 4LFCF 4LVOP 1RTHB 1TZ0A 2M8DB 4C8OA 4DR7F 1I1GA 2ZD1B 4Q8FA 1RWPB 4ICLB 3AD8C 5A8KB 4K4XA 3WIVA 4NASA 4P6QA 2OD4A 4B02A 2CNKB 2HVHA 5F3ZA 7FDRA 3Q2SC 1UMJA 1CS4A 2AT1B 3AT1B 1MN9A 4J9SA 1X4GA 3D6TB 4PAAA 2BKPA 3PV8A 1RAFB 4DX7A 2GIRA 1RGVA 3CDAA 2QL7B 3T1HF 5KFAA 2BW7A 4M5MA 3TR5A 1U1OA 3VQSA 5KG6A 3QGGA 4Z2XA 1T05A 1VISA 4MYUA 3N5BA 2E44A 4ZHRB 1RKJA 5I42A 5CHCB 3GR0A 2HURA 4B3OB 4OI0A 4F50A 1X5TA 3W1YC 3Q24A 3MTKA 2W2OP 2HRUA 3K8VA 2E5GA 2IDLA 2NSBA 3HKZD 1OYDA 4CP5A 2YKOA 2R3VA 2FC8A 4P9SA 1VRTB 1MWYA 1XMQJ 4MFBA 3HCXA 1RHQB 4M5DB 1U0HB 5D78A 2WVDA 3QT5A 3GG1A 3R9LA 3NCRA 3R1HA 3DGVA 4LSZB 1RCOB 2Y1RI 1MG7A 4CCHA 2DXFA 2YH0A 5ETTA 1UL3A 1DY3A 3L9ZA 3MCSA 4NWBA 2CQ2A 1HYSB 2ZDOA 2WSEC 1XK8A 3WX4A 2V6AA 2LP4A 2FHKA 4KRWA 5KFDA 2HG4A 1TU0B 2DO4A 4HVZA 1XERA 2VOOA 2PMWA 4R0EA 4HACB 5HMYA 3JAMU 4QWAA 1X0PA 2CNNB 1VC0A 4NCGB 4P75A 2YWGA 2BZ2A 2DRBA 2BJ3A 2J7WA 1T8EA 2DB1A 3MXHP 1WOOA 1RTIB 4MK8A 4NYOA 3Q8SB 4R25A 2XWXA 1AB8A 2RDJA 5ETQA 5HROB 4BWJA 1T9YA 4B3RJ 3TO8A 4NZ6A 1MROA 1NJYA 2PA3A 4GC7A 3CCSS 1MW7A 5KG3A 4CWBA 4UZBA 1TAUA 2LFVA 4ANEA 1NRKA 1RBAA 3TI0A 4OZLA 5T41A 4WKRA 1UEKA 1GNKA 1X8DA 2CJKA 3BGFA 3HLUA 4JYAJ 2VBYA 3QYYA 2HNYA 2FJDB 2IM2A 3MEDB 2ZBIA 1GMWA 2CJBA 5EWGA 3CCUS 1HPZB 3W62A 4RKUC 3QO9A 5KFMA 2IPOB 2K06A 2FHMA 2XLIA 4ZVSB 2PA8D 3ICLA 1HMVA 3HHKA 3UCUP 3NCPA 4DL5A 3V81B 2R7RA 3NP5A 4TXSA 3PY8A 5E7OB 4AYBD 3D6HB 2DR5A 4ECUA 4LRDA 2QO3A 3BO4A 1Q8IA 3I0SA 5EX0A 1X60A 4P10A 4GKKF 1HQ2A 4ZVTB 5KFXA 3NOCA 1IKYB 2NXEA 2XULA 1SVDA 3PFOA 3KG4A 4J9KA 2FZGB 2UP1A 3G2XA 2RF2A 1RWNB 4O44B 2VQFJ 2Z57B 2L3MA 4DJBA 3DOKA 3HO1A 2ABYA 4YB6A 2HZVA 4I2PA 2BDPA 2QT7A 1NHUA 1HWKA 4PRFA 1JK9B 1YX2A 4NA1A 4AE5A 3G82A 1FF2A 3AD9C 3HPOA 2YKMA 2XGPA 3OD2A 1RLCL 2B0GA 5FJ4A 4KC5A 4QWEA 3PR4A 4V19J 1JLBB 3U1MA 1M5SA 3GIMA 2N7YA 3C16A 2DNMA 5F8IA 1UW9A 4L74A 2Z4PA 2LECA 1X5SA 2KYXA 4QOTA 4DR3J 1APSA 3P49B 2H9ZA 3KJVA 1HHQA 4J91A 3KLEA 2AEJA 4LR8A 2R8GA 2HFZA 1U48A 2AGPA 3W66A 4LF7J 3PW7A 1DQ9A 1Q7LB 3HVTB 5E3AA 1UA0A 2R8HA 2B4VA 2ZBCA 3I96A 1LW0B 2IJNA 5B7WA 2GS8A 2KI2A 3GR1A 3NS6A 5D0HA 2FD2A 3OR1A 1QE1A 1GMVA 3SFUA 2VPXB 2BBEA 5FDLA 2W8KA 3JAMY 2CWXA 2E29A 3IR7B 4M63A 4M5GA 4WZQA 2KO1A 3UNYA 1D3WA 1KRPA 1RUSA 5CYMA 1IUJA 4M95A 1J5EF 1BMQB 3HSJA 5CAAA 2FLLA 3CO9A 3MUTP 2QLBB 2A6OA 4MH8A 3OL8A 4I7FA 2VBWA 3FFIB 3MR3A 1U4BA 2D9PA 5K20B 4UQGA 2YH1A 4X64J 3DGPB 2RRBA 4JV5F 3MECA 2BABA 1X4DA 4WTOB 3T5HA 5EN1A 3H5YA 1B4SA 3AODA 5A8RA 2C2OB 1RAEB 4F3OA 1JLAB 4MMOA 2V8VA 4OZNA 4DV0F 3ZNUA 3C6TB 4DUTA 1R43A 2XO6A 1TL3A 3B6BA 3BGLA 2DGOA 4JI2J 3G9CA 3OFFA 2F9JA 4ZDNA 3V6KA 1AW0A 4EBCA 2M3DA 2VHGA 5DDOC 3W2WB 3CJ5A 1W2BR 1DAXA 1ROFA 1E6VB 4USMA 1FFGB 1XBWA 1AZSB 3PR5B 2P6TA 1YLXA 3KJFB 3JSMB 1HNXJ 3Q22A 2WONB 4USJC 4B08A 1GX5A 2UUWA 1R31A 1E6YA 3UFCX 3WIUA 3QFWA 3EGWB 1QSLA 2OI2A 2CYYA 3W63A 2DNHA 2DHAA 1U2CA 2VFVA 1RWXB 2Q43A 1B7YB 4TY8B 2QX0A 4K4UA 3IR5B 3BM7A 1NDKA 4LQ9A 2KJVA 1WEXA 1BXNA 4C48A 2FLNA 3IC1A 4LBHA 1OQ3A 3VAHA 2YNFB 4ELVA 5DZ7A 1TFWA 3KJQB 4OJHA 3VGSA 4LF8J 2OEKA 1CC8A 4C8KA 3NNCA 1S10A 2ROPA 2I2YA 2Z2YB 5CYQA 2NSCA 1FESA 3QQCD 3N5FA 3PO5A 2ZH6A 3GB0A 4GKJF 2KT5A 3PX6A 2KFNA 3M8PB 2DNYA 2DO0A 3DKDA 3O8WA 4P2MA 4J7CA 3VVUA 2MTLA 1N4LA 4QR1A 1BQXA 1LXNA 3Q8YA 4KHPF 4DV4J 1JKHA 2I8EA 4ZPVR 3RB6A 4UUWA 2MJUA 3OTEA 4DR2J 1Q16B 3MZIA 1VIOA 4ZP7A 2GGPA 2J0QD 3TUJC 4R8UA 1NB2A 3SQGA 3KHHA 5HI7A 3CMAS 2HVDA 1HWLA 2BJEA 1PJ5A 5ETKA 4UUXA 1HBMA 4FF2A 3DU6A 2GV1A 1X0FA 2DNPA 1KOOA 4PZVA 1VC5A 3RAMA 3T1YJ 1OS5A 3BREA 5CXTA 4LF2A 3G8TA 4TU8A 3EGZA 3KK2A 2EKYA 2YXLA 1BUXA 1U1KA 1AROP 3DXSX 1FJGJ 1S0NA 2GO8A 1HBUA 1WC4A 1VLOA 4KQZA 4DV5F 1EAYC 3VTIA 3NGUA 4OYXA 4QJVA 2ZKUA 3SI8A 3BR9A 2WCXA 4WKYA 5IWAF 1VOMA 3BN7A 3BBCA 4GVBB 5ETVA 1CVJA 1UJ6A 1VJWA 1P1LA 3FQKA 3PRVA 2DXEA 2HBRB 1CLFA 3FCWA 4UF4A 4FBTA 2PMZD 1FK9A 3MPVA 2AD9A 4JI7F 2NS1B 1NKCA 1PIEA 2ZE2B 4LRCA 2JVRA 3O1LA 2CFXA 1GFWB 3GZ7A 3DDNA 2DGVA 1Z4UA 3FMWA 1WTBA 2BQUA 3PRBA 1JLCB 2MZJA 1NPPA 1NSPA 4DU7A 3PJ9A 1Q4RA 5LSOA 4JI0J 2V9KA 4M8LA 1Q82T 2UV8G 1VS3A 1J5OA 2CWKA 4DV1F 3R5CA 1Q5VA 1GTEA 1NUEA 1KQSR 2RE1A 5BXIA 4FYXB 3JSYA 1WG1A 1JJ2R 3TAQA 1QAYA 1S6UA 4F2SA 1YJVA 3A8EA 2WBRA 4RW4A 2NQPA 2HS0A 4J9RA 1EB0A 3Q86A 2MZ1A 3HDSA 4OMFG 2VPYB 2JOQA 1M5VC 1CS4B 2MEWA 5J1PA 4IDKB 2DEIA 3M2UA 1RA7A 4C8NA 1AFIA 1BD6A 1ZM3A 3AOAA 2YY3A 4CO5A 1S9EA 1U8WA 2QA4S 1D9FA 4PXDA 3V6DA 2B4PA 4ZMMA 4P7TA 1M5HA 2ZZTA 2HK2A 4DQPA 2BYCA 2E7VA 1PYSB 4K7QA 1F5AA 3JXOA 1M5KC 2FGOA 1S97A 3TVZA 2XS5A 3TA2A 1FWPA 1NNDA 1KR4A 1FX2A 3MPUB 3NBPA 3CC2S 1SKRA 4HDGA 3HP6A 5LMUF 2RDIA 3HMJG 1WNEA 1HA1A 1S77D 3ZTSA 3GCWP 1CC7A 1Y11A 4K4SA 4KKOA 3ILOA 4F4WA 1N34F 1CJKA 3Q8RB 1M5PC 1R8AA 2HVZA 3GMGA 4YY3J 1HARA 4LF6F 1LQ9A 3IBCB 1FRIA 3C8YA 1HNIA 4ED4A 4DFMA 3K58A 1EETB 2YPYA 4IG3B 5ETRA 4NLPA 2ASJA 1NHKL 5DZ6A 1FRMA 4DPUA 2AZ3A 1RB0A 3KLFA 2J6SA 5F41A 2F8MA 2JFDA 3WC2A 2H5EA 2DGXA 1B3TA 3ILJA 1JX4A 4I2QB 2VG5B 1TL5A 1YITS 3M32B 3KK3B 2WB4A 3LO3A 2AYGA 3NGSA 5E33A 3EICA 4KGMA 2Y0SD 4A8XA 5M2RA 1JMTA 4LF4J 3LGMA 4J5OA 1MROB 4DR5J 4IFYB 3PM9A 4IR1A 4EEYA 1JLEB 3KKFA 3IM8A 4UTGA 3OUYA 1RA6A 1UFWA 2W9CB 2FLPA 4DL6A 3C6UB 1KOHA 1IBMF 1H7XA 3G6ES 1ZYQA 2GCFA 3CSKA 5KFRA 4B3MF 2CPXA 4CO0A 2AYBA 5IT9Y 2QYCA 3QJLA 4ZIWA 1SC6A 4NEYA 2ZH3A 3A3NB 2MQQA 5KFLA 1U6FA 2BRLA 1RWKB 3K0JA 1S6PB 2OPRA 2K1RB 1RK8A 4RR5A 1D1UA 2HIYA 5L39A 2JRSA 3J7AN 1D8ZA 1FKPB 1IXKA 2OAUA 4RW8A 1YBAA 5FLXY 3CTRA 4KGXB 3B82A 4DSEA 2JEJA 4L75A 2RAQA 3M2RA 1XNRJ 1RBOB 4DEZA 4CLPA 3C15B 2KN4A 3UDVA 2YX7A 1VFJA 3RYLA 1N48A 5KFEA 1T3NA 1T9TA 1A9NB 3MMBB 1EKSA 3EWGA 1S0OA 4JUZA 2YQ3A 4HR2A 3FRZA 1UWAA 2OPSB 1TL7A 1O6XA 3GFYA 4ECZA 4EGLA 3HJFA 2AGOA 3KLIA 1W7WA 1WC1A 3MOJB 2F8HA 2DY9A 1U49A 1VHFA 3LP1B 1PC4A 4YHHJ 4EYHB 3G82B 2YWFA 4LRBA 1J27A 1WEYA 5B09A 2GVDB 2WZ1A 2ZITA 2W25A 4DDFA 2MQPA 1N52B 3R6LB 3SDEB 2N7CA 2UV8A 3ZFVA 4PEOA 2E9TA 1VDHA 2AU0A 3GONA 4LSLB 2EVZA 2O67A 3TEHB 2HMIB 3IGVA 1VQ8S 4IRKA 1ZTWA 3ZZOA 1SJRA 1GXLA 2G1HA 4I1TA 1TKTB 3D54A 2HWTA 1K1QA 3IWLA 1S1TA 3NXZA 3UDLA 5KT2A 5C25A 2NXNA 3TA0A 3K8WA 4GMKA 2I38A 1WC0A 2MKYA 2F9DA 5KT5A 5DDRC 5IT0A 4OX7A 3LOUA 2UXBF 2ZNZA 3T41A 4URSA 3CC7S 2DH8A 2BJ9A 2WVEA 1AT1B 2M4MA 4MIWA 3H4DA 4DR4F 4H54A 4ED6A 1RI7A 3UR0A 5KG1A 3QAEA 1HNVB 2ACYA 2GAHC 4UQTA 3QRPA 3M6UA 2VZ9A 2ZH4A 3MM8A 2JC1A 2V94A 2D1CA 2OLWA 1OY6A 5L9NA 3GIRA 2IM1A 3PKYA 4EBDA 3HZEA 1ZPVA 3MUVP 4D3HA 1UWBB 4PQUA 1YZ7A 3RZAA 1W26A 2FZKB 2V0NA 5IQQA 3UI3A 3RB4A 2A2DA 4KB7A 4QPTA 4ES3A 4J9UE 4OZ2A 1HQUA 1L5UA 2EG2A 2B5JA 1C1BA 4RUBA 1KTQA 2GC8A 1PKUA 1OWXA 3N79A 1CSJA 1IR0A 3HHLB 4F36A 4PPZA 1SQFA 1ZS6A 2HHTA 4ZPBA 1Z2LA 2B51A 4PCQA 3E01B 2MLXA 2PFDA 4CZCA 1UETA 3ITHB 2LQ8A 4OI1A 3IXQA 2GW8A 1TL3B 5HN0A 4CRJA 5L38A 2C28A 3ISND 4GC6A 3JTPA 3I5BA 3FKBA 2QYGA 3OHBA 2R2RA 1P8GA 3NWGA 1AXQA 3DFEA 1R0AA 2XMWA 4DQSA 4DR6F 3R6GB 3MM5A 4N8NA 3MAAA 5JVHQ 1PBAA 2PI5A 2A10A 3MCOA 2C22A 1MMDA 3IGNA 1WI6A 1HNZJ 2MB0B 2V8DA 4IG0B 3OXLA 1RT7A 1R89A 2E1RA 3MM7A 1KONA 3B78A 1WHVA 3FUYA 3O5TB 1SV5B 2AQ4A 3K5NA 1TV6A 4RUHA 2MQLA 2BE7D 3CJ2A 1HWJA 2HEKA 3UD5A 3N6NA 1U45A 1BQNA 2VH7A 1BQMB 1HWIA 1S9GB 4F04B 4Z37A 5H1SV 5A2QY 4QZVB 3AHPA 5AJ3J 3M6VA 1JLGB 3J81U 1UFLA 2G2YA 4FKXA 2YVSA 2FUG9 5E3PA 1BE4A 3QNWB 1R7IA 3PYEA 4N7TA 1YJUA 4DS5A 2UUCJ 2UUAF 1KFSA 3VAFA 3UCZP 2C2MB 3S01A 3OJSA 4PG7A 5HBMA 1DHMA 1YK9A 1S1WA 3GILA 3AJDA 1Q7YT 3FBCA 1PILA 2RHQB 3W64A 2IA0A 3DMJA 3DLEB 4DS4A 1N36J 2CDRB 3KUHA 1G6BA 2WAQD 1FRXA 2D9OA 3IP0A 3UD4P 4WK3A 1QJHA 3LAKA 2V9WA 1R6VA 4J9NA 2BANB 2C1EB 3KTQA 3Q23A 2C3MA 3BKFA 2EXUA 1NB7A 5HK4A 3V6JA 2RB7A 2XY7A 4Y2IA 3UVJA 3U27A 2CPYA 3VWSA 3FEZA 1MSWD 2HFVA 4DL7A 2DISA 1D8YA 2HVIA 4R8UB 1S1VB 2DNNA 3DDKA 4IKAA 4CLZA 2ZC4A 1HBOB 1NDCA 1WF0A 2W7PA 2QE5A 3VAMA 2VV5A 2VASA 1IBKJ 1HQEA 2D3OR 1S6QA 4W92B 2CZ9A 3QGHA 1XNQJ 1MMLA 2LVWA 4K59A 2JEFA 4FN5A 2W8LA 5C5JA 3BQ0A 1TMJA 1IKWA 1ZPWX 2POKA 4HHHA 2LEAA 4I56A 2FC9A 1NJZA 2C2EA 1RAAB 1FJ7A 2OEMA 1FO1A 3H90A 3BSAA 4ED5A 3LTOA 3D9BA 3MMAB 2HRYA 2ZUAA 4FDFA 5T14A 1FEEA 3HJVA 4ZCKA 1HR0J 3A3OB 4TLQA 2MKJA 2Z2LA 3RU0A 1NZAA 3EYZA 1VQOS 3U7JA 2ZM6F 3N6MA 2YWWA 4ZLLA 1SQEA 4I0WA 4OYMA 4K0KF 4NRTA 2OIHA 3S7RA 1Q8LA 1Y9OA 1Y3JA 4LF5F 3LP2B 1REVA 5ETLA 2Q79A 2RKIB 1ZTTA 4MK9A 2ZBQA 3MR6A 3D28A 3BBBA 1VQMS 1Y4ZB 1PAUB 3H0PA 1RXOB 4CLKA 3RB3A 1ZA1B 3A4TA 2W9BB 3POTB 3NY0A 2VJVA 3CD5A 5A0YA 1JLFA 2KTQA 1ZAVA 1BGXT 3OTDA 3M8YA 3C14B 1HNWJ 1C1CA 4B9TA 1N33F 2GJFA 1PJ6A 2VG6B 3VQTA 2H5JB 3MFHA 4LRFA 1OIAA 1NK5A 1ZOTA 1VRUB 2WTFA 3DLJA 3R3TA 1FFWB 2HHXA 3CCZA 1RTHA 4RNNA 2DHXA 1SH2A 5E41A 4J9QA 2HQCA 2ZD1A 3TOQA 4JB8B 4WE1B 5ADZA 4ICLA 5A8KA 4X4VA 4FXDA 2NCKL 5HLFB 4MKYA 4HHUA 1LK5A 4KPYA 4OYBA 2E5HA 3MPWA 2NUHA 3H2VE 4CH0S 2M88A 3M2UB 3J81Y 4Q5VA 3DCAA 1V3ZA 2FYXA 4RW6A 5IM0B 4HTJA 5KFGA 1B0VA 1N0VC 2XMKA 5I3UA 3V6HA 2WB1D 1SCJB 2C2NA 2H4YB 4LFCJ 4Y0FA 5CQGA 4DR7J 4ZHRA 2E66A 2DR6A 1SUQB 4HEA9 5KFIA 4ER8A 4A4JA 5GMKa 1UVNA 1X5OA 2ZJPQ 1Q81T 4ZN3A 2KL8A 5HQMA 4B3OA 4O0NA 4ILLA 3ADAC 1O8BA 1AUSL 1VCTA 2OH2A 3GYXB 3DNCA 2FY8A 3GIKA 3FQLA 2IVYA 3T6JA 5MLCV 4Q0BB 5LT5A 2FQQB 2O1PA 3GFZA 1YZ6A 5KTQA 4NI2B 4ZK7M 1OSCA 1VRTA 1IR2A 4NLSA 3BB5A 3OTOJ 1WORA 1K0VA 5E5NA 2C2DA 3T1HJ 3MPDA 5AXKA 4M5DA 5M2UA 3RG6A 1U0HA 2BQRA 2VA2A 1RT6B 4QW8A 4DPXA 3NNHA 1XEZA 3S6EA 1I3OB 4DN0A 2R7SA 2HBQB 1DARA 3D4JA 2M0GB 3H20A 4NLDA 1VBYA 1T03B 1U47A 2E1PA 4Y2MA 3M9MB 5CZVA 3CD7A 4DV6F 1KLMB 2RILA 2NREA 4L3KA 1JWWA 2Z30B 4O3NA 2CAJA 1VQ6S 2PN6A 2K3IA 4WPAA 4LF1A 2MZSA 3DRYA 3FEXB 2AJQA 1HYSA 4LF9F 1S6OA 4ZPAA 1HFEL 3PJWA 1XMOF 5G0RB 1OJ4A 4N76A 4P2SA 5KFPA 3LQVA 3IS9B 5ETOA 1AUDA 2NR0A 3PVXA 3BGUA 4YR0A 1NLKL 1U1MA 4FKYA 4HACA 2ASDA 3BEGB 1UJ4A 4QIWD 4C8YA 1CJVB 4YFUA 4NCGA 2PD1A 3NS7B 3L09A 4F26A 5HL7Q 3SV4A 1XMQF 2CIMA 4RWWA 2N82B 1N5YA 1RTIA 2UU9F 4CLFA 2QGFB 4B3TJ 4W98A 4QIGA 2KDOA 4OHXA 2OFGX 5KG2A 5HROA 2QSFA 2P8IA 1B64A 2BJ8A 3SQOP 4C11B 4HHJA 1RT2B 2L08A 1NH8A 1FRLA 2GMJA 3OW2R 3CCES 4MJKA 3TARA 3JS9A 3KDNA 4IRDA 1JXLA 4XK8C 2VDHA 3IBFB 2H51B 3LH2S 2CPDA 2XY5A 3MEDA 2XLJA 2DJWA 1HPZA 1B70B 1LFPA 3RGIA 5LJ3Y 2VL1A 3M30B 5KFFA 1F60B 3M8SA 2OTLS 3MR2A 2NPIA 4P7VA 1UEUA 1N8RT 5L9XA 2HS3A 5CZXA 3PX0A 4NMXA 3V81A 4OYAA 2P9CA 4V19X 3IWXA 2XWYA 3N28A 5C24B 5J2NA 1NK7A 4BBYA 1BWEA 3GYNA 3ENVA 2LQ9A 2QJ3A 4AL5A 1GMWD 1RACB 4B3RF 4NE9C 2DHGA 4YR2A 3HVWA 5DLFA 1IKYA 1QSYA 2RJZA 2MSTA 3BKTA 3Q89A 3I5CA 3CT9A 1NH7A 2DH9A 4O44A 1CBKA 1YKWA 4C9DA 4HH0A 3M4XA 3A8KA 1D09B 5T7LB 3IWNC 4Y2KA 2G0CA 3HKWA 3NAIA 2RS8A 4HI2A 4LFAF 4DUZF 4N5SA 2H1YA 1HWUA 2HQFA 4CM2A 3DXBA 1FCAA 3D3BJ 1UPPA 4NLUA 3KG0A 4GKKJ 1NDLA 1TL1B 3M8QB 5RUBA 3I9ZA 3PJXA 5DG7A 2ACMA 2HHVA 4UOCA 1WKJA 3A8JA 3MDFA 2GAGC 2V2ZA 5KFJA 3TA1A
chains in the Genus database with same CATH topology
3CDEA 2BJDA 3PR5B 1JLBA 2CG4A 1NAQA 2GHVC 2J9DA 5F0WA 3M6WA 2P6TA 4WU2A 2KU7A 1HBUB 2AJFE 3JSMB 3GV7B 3Q22A 2WONB 4ZPTR 4USJC 2X3GA 4B08A 1GX5A 1TKXB 2UUWA 1R31A 1E6YA 3UFCX 1WACA 3E8OA 4C11A 4ELTA 3KG1A 5DDQC 1CQNA 2MZRA 3D0HE 1RT2A 1YQHA 4DSJA 2XCAA 5DRKA 4JI0F 3PX4A 3EGWB 1QSLA 2CYYA 4ZP6A 2DNHA 3MURP 2DHAA 3HVTA 3LALA 2AF6A 2VFVA 3K5MA 2Q43A 2DGWA 1GXTA 4OI2A 2K7KA 4LIWA 2R7VA 1VQLS 2G13A 4TY8B 3K2YA 1NK4A 4DFPA 2PI4A 4K4UA 3IR5B 3MMCB 1LW0A 4ES1A 3BM7A 1VQ5S 4LQ9A 2J7KA 5F9LA 1RT3B 3I56S 2EG1A 2FB0A 3IR6B 4O3PA 5KT3A 3HVAA 1FK9B 2KJVA 3BDPA 1WEXA 3UDCA 4ALZA 4FZVA 2AX0A 4ES2A 2FLNA 4Y00A 2HPUA 4B9LA 3IC1A 4B17A 4EWTA 4IQXA 4ID8A 2A3JA 1OQ3A 2MY7A 3M30A 4WK1A 4QYZJ 3VAHA 1TUVA 4MIAA 2YNFB 2L9WA 4ELVA 1RTDB 3EUNA 3RBEA 1X4HA 4IRCA 1TP7A 1IQTA 4IOBA 4OJ1A 5KFQA 3I4PA 4D3GA 1NU4A 1OQ6A 4ZP8A 6FD1A 5SUHA 1NJIT 2UZAA 1YJWS 4OJHA 1TFWA 2XSJA 3BS9A 5K14A 2VOPA 4RU9A 3FSIA 1F5CA 5HP1A 1CC8A 4C8KA 2RUGA 4FPRA 2IVMA 3P6YC 2XMTA 2IC3A 3O6QA 3NNCA 4I69A 3H98A 4PPDA 1S10A 3J7Z5 4F4YA 4E0DA 3C66A 2MQMA 2HHQA 5MAOA 5F8NA 2ROPA 2I2YA 2JWNA 2NXUA 5C24A 1SJQA 4BWMA 3E2EA 4KV8B 4NLGA 2DGSA 2OP5A 5CYQA 4A8SA 1QUVA 1VQKS 3PEJA 4B3TF 3J7ZT 1J5OB 2NSCA 1FESA 1URRA 1NO8A 4HL9A 4KSEB 2WSFC 2OO4A 3N5FA 4LSNB 3HT3A 3PO5A 3FFIA 3EGNA 4WFXA 3IRXB 2ZH6A 3GB0A 4AUKA 4GKJF 5B0BA 2HNDA 2OJ3A 2KT5A 5D77A 2Z2MA 4AFFA 1HD1A 4DG1A 3PX6A 1KQFB 5B0GA 2RD5C 4B9SA 2KFNA 4OX8A 1DRZA 3M8PB 4RNHA 2LCWA 3DGPA 2DNYA 2RRNA 3NAHA 3CXCR 2DO0A 3O8WA 1G2EA 3DLLQ 2YKQA 5H9FJ 2ZH9A 1TK5A 2G9OA 1N4LA 4LF7F 3MEKA 4QR1A 5A8WA 2B4UA 4OI6A 3T1AA 3TRGA 3GQCA 2FGCA 1BQXA 4RW4B 4C97A 4A8YA 1LXNA 3LP0B 2MGZA 4ILMA 3R5AA 5B0FA 4C3MA 4KHPF 3ISZA 1JKHA 2I8EA 4ZPVR 4LJMA 3RB6A 4UUWA 3VR1A 3VF0B 2FJVA 2MJUA 4BDPA 1C4CA 3OTEA 1Q16B 3MZIA 1VIOA 1JLAA 1X5PA 1MU2B 4ZP7A 3J80Y 2U1AA 1FNMA 5T7LA 4IH5A 5J1NA 2IVFB 2D3ZA 3KNGA 3DOLB 1VQ4S 2GGPA 2J0QD 2YWHA 3FGVA 5E2QA 2MKSA 3CCRS 2EFQA 2I5JA 5LSRA 3TUJC 4R8UA 3G6YA 4ZVHA 3C6TA 3SQGA 2EFNA 3O3LA 3KHHA 2FHOB 2XSFA 5HI7A 4ETXA 2XHWA 2MJNA 5GADI 3CMAS 3RR7A 1HWLA 1UVKA 2XMVA 1KEKA 4ATNA 1YGYA 2KB2A 2BJEA 4MK7A 1A7GE 1XC9A 3GFHA 2B6AB 4IO1A 5K9FA 2DCUB 3OV7A 1HI1A 1LK7A 1F5BA 3MM5B 4UUXA 4G1QA 4ITSA 1HBMA 3KLGA 4DL3A 4Q2LA 3CCJS 4FF2A 1TL1A 3M8QA 1G1XA 4DLEA 3QJPA 3DU6A 2GV1A 3MF5A 1FDNA 3W2WA 1X0FA 2UUBF 3MEGA 1S9EB 2DNPA 1KOOA 3IRWP 3SYZA 3PIPQ 1VC5A 1H2TZ 3RAMA 4L72B 4JI5F 5KFBA 3PW5A 1OS5A 3HI9A 2B3TB 1E6VA 1FNOA 3V6DB 1N88A 3AA9A 3BREA 1IQZA 2CQGA 2O01C 4HYKA 2FVQA 5CXTA 4OV1A 1X9WA 3G8TA 4TU8A 3EGZA 2R2UA 4KTQA 3KK2A 2EKYA 3CCLS 1U1KA 3FCHA 2HGNA 4FXVA 1AROP 1SL2A 3DXSX 1Q1KA 2PIIA 2E5IA 2Q3PA 2ZUGA 3DYAB 2HIQA 3LGNA 1S0NA 2GO8A 1HBUA 2QV6A 4JOUA 3CIZA 4ZPWR 4ZVEA 3JSMA 4RU2A 4NZ0A 4TYAA 1WTFA 2BUNA 2UVWA 1N54B 2WONA 2RU9A 4L3NA 3MUMP 1LWCB 4KQZA 4FNHA 1TKXA 2J5AA 3NMRA 4DV5F 3I5AA 3PDNA 1K9MT 3VTIA 4F67A 3WBZA 3TUZC 3MM9B 4NLQA 4QJVA 1ULRA 3VZIA 4FYDA 4A8WA 2VC0A 4C8LA 4ECQA 1FD8A 2ZC3A 5F0UA 3TAPA 2ZKUA 3NBPB 3SI8A 3BR9A 2WCXA 5D4NA 2RSQA 2EFVA 4B9UA 1N5QA 1S4FA 1RT5A 4WKYA 3VZHA 5IWAF 3OPKA 2CPZA 3FDSA 1VOMA 3LPYA 1NJWA 3BN7A 2KFYA 2XBPA 1HI8A 3DI6B 4O23A 1ZZNA 3DOMA 5BYQA 1RWUA 4MTPA 1UJ6A 1VJWA 4TY8A 2XCPA 1SL1A 5KOXA 1P1LA 4EZ6A 4WF9Q 3FQKA 3IBWA 2D7SA 3MMCA 7FD1A 4ECSA 2AP6A 3CE8A 2M7SA 1RT3A 4A8FA 2IBOA 1CLFA 3CJ4A 1KFDA 4FBTA 4I6WA 2PMZD 3SFGA 2AYEA 1FK9A 2PMHA 2U2FA 3MPVA 3CCMS 2AD9A 2XNRA 2ZHOA 2JLEA 2NS1B 3DLGA 4KKOB 4QBUA 4PG6A 1Y0HA 1NKCA 4JI7F 3OL9A 1U1RA 1MNEA 2ZE2B 2F1FA 2KXNB 4ZPDA 1URNA 4BHQA 3ZZRA 2YNFA 2CZ4A 4X4SA 2JVRA 1FTRA 3SSSA 1RTDA 2ZH1A 1B0TA 2CFXA 3O1LA 4WXOA 2JLGA 1IBLF 3GZ7A 3LAMA 3DDNA 2DGVA 1Z4UA 1L3KA 3FMWA 2MZTA 4DL4A 1WTBA 1SJ4P 2BQUA 2IA6A 3PRBA 4LVNP 1NHVA 3UPFA 1JLCB 2MZJA 2VPZB 5D3GB 5HBMB 1SXLA 1HNIB 2CPFA 2ROEA 2DNGA 4OHYA 1G7CB 1Q4RA 2HWIA 5LSOA 2N3OA 2FPHX 3OR2B 1S72S 1U6ZA 1C4AA 2FDNA 4ECYA 2V9KA 4M8LA 1Q82T 2GO9A 4FS2A 4KV8A 3MAHA 2G1DA 3QAUA 1D9AA 2E9ZA 2UV8G 1VS3A 1J5OA 1FERA 4LF4F 3MMJA 2K7JA 3CCWA 4BC7A 1M90T 2DNKA 4LSNA 4C7QA 4F3QA 2BM0A 3WC0A 1S99A 3IRXA 5KT4A 3PIOQ 1G3OA 3AB2B 4DV1F 1HNXF 2ZNYA 3R5CA 1KVIA 4OIXA 3KHLA 3SMZA 1W25A 5F8MA 1GTEA 1O0PA 4YQWA 5KFYA 3KYLA 1KQSR 1UVLA 3KLFB 4LT6A 2RE1A 3M8PA 4RBTA 1K0TA 2MSSA 3DRXA 3SEOA 3JSYA 1QVFR 3FZBA 4XAKA 1FDAA 1WG1A 3CDUA 1JJ2R 3TAQA 2DGQA 2GHWA 2IFXA 5U47A 1YJNS 1QAYA 1S6UA 4F2SA 4LQ3A 1YJVA 3A8EA 3MWBA 4JV0A 4AXIA 2WBRA 4IO9Q 4PXBA 5B08A 4RW4A 1RKIA 4WYLA 4CO1A 2HS0A 1DZ5A 2NQPA 3LP0A 2A18A 2E1AA 1T3OA 4J9RA 4O0IA 4DF4A 1XN9A 5A6PA 2L41A 1P1TA 4XDCA 2MZ1A 1NK0A 3HDSA 2ZH5A 2PT0A 1MU2A 3FSXA 4OMFG 3NL0A 2VPYB 4KFBB 3KNAA 2LQJA 4JI8F 1T02A 4HLBA 5HMXA 2FJEB 3I82A 3U02A 2JOQA 4JI6F 1M5VC 4QCLA 4YMEA 1UJ5A 4E98A 2ZOGA 2GQQA 2DGUA 1IJEB 3I9V9 5J1PA 1OSDA 4IDKB 2VBXA 5I3PA 1D0EA 3T3FA 4DL0C 4CO3A 1Q8BA 1FJCA 2BR0A 2Q66A 2B6AA 2WRMA 5LXRA 5J2MB 3MTJA 3M2UA 1JNZB 1RA7A 4C8NA 2LA4A 4PKDB 1Z2ZA 1AFIA 1FNXH 2ZOMA 3US5A 1BD6A 3HHDA 4NXMF 3PW2A 1VGYA 4JBCA 4M1KA 3H8YA 4USHA 3PW4A 5L1IA 1ZM3A 2YY3A 4NLXA 1S9EA 3VCDA 4CO5A 3D1HA 3OUYB 2E7XA 2QA4S 4A47A 1D9FA 4KT0C 4X2BA 4PXDA 4F4XA 3V6DA 2B4PA 1GXUA 4X62F 4ZMMA 2AX1A 4P7TA 1M5HA 2ASYA 4UY8T 2HZCA 1YWXA 4MYTA 4NLVA 1FKAF 2EK6A 5DGAA 4DQPA 5D4LA 1FD2A 4N77A 4TLRA 3DYAA 2VC1A 2FVRA 3T5KA 2BYCA 2O5DA 2XI3A 2AW0A 1F5AA 1L3UA 4RW7B 2ZZNA 5CD4H 1M5KC 1LWCA 2FGOA 1UW4A 1S97A 2FY1A 2IYGA 2OPRB 2J0SD 1R6YA 3D1QA 3CWJA 4H4MB 2FJXA 3TVZA 2QSWA 2XS5A 3MM6A 3MM9A 2DHSA 4Y3CA 4OI3A 3TA2A 5A6WA 1KR4A 1NNDA 4ZLPA 2R7OA 1Q86T 1GTHA 3CF5Q 3NBPA 4DV7F 4C2MA 4ED8A 3CC2S 1SKRA 3VAGA 2NPFA 3MD1A 2WK4A 2KVIA 4HDGA 3OJUA 4CTAB 1QM9A 3NRBA 3LANA 4RW8B 2LDIA 2X51A 3HP6A 1LKZA 3K59A 3DI6A 5LMUF 2RDIA 3HMJG 3HX9A 2VFUA 1DLOB 2QIFA 4MAKA 5HMWA 2DT9A 3CMES 1DFDA 5DDPC 1WNEA 1HA1A 1S77D 2A2CA 1EP4B 2GA7A 3M2RB 3KMQA 2LU2A 4DL2A 2FVPA 2OPPB 4YHHF 1ZAWA 1CC7A 4CO4A 3EX7B 4K4VA 4CI0B 4K4SA 4KKOA 4F4WA 2GQCA 5EUHA 2X1GA 3KHRA 1KLNA 5IFMA 2ZE2A 2ZFHA 1VQNS 3SZ2A 1KD1T 1N34F 4M94A 5EGYA 2ADCA 1U24A 4J9LA 2XMJA 2YTCA 4KGKA 3Q8RB 2M8HA 2E5LF 1M5PC 3GIJA 4DN9A 1N6QB 1ZETA 2NZ4A 1R8AA 2HVZA 2AJ1A 4CT9A 2CJQA 3BQ1A 1R27B 1U09A 2WBMA 4CNZA 4ZCIA 1ZAXA 3GMGA 2HHSA 1JLCA 1HARA 4LF6F 3M1VA 3FNNA 1JXEA 3TNVA 1LQ9A 1ZM4A 5AE2A 5E3CA 5D3GA 2V8GA 4RW9B 4KIAA 3T1YF 1FRIA 2YKNB 3C8YA 1HNIA 3BO3A 2RQ4A 1X7VA 1UVJA 2VFRA 3FZ2A 3HF5A 4IH6A 2EK1A 4DFMA 1QY7A 5E0OA 4IOCQ 3AJ2A 4I4BA 4WFBQ 2FTRA 3K58A 1EETB 1QAJA 3QIDA 1SI9A 3VALA 1GX6A 5D4OA 4IG3B 1BY9A 4NLPA 3KLIB 1QAIA 2ASJA 5KFUA 3KK1B 2R7WA 5GAGI 1L3TA 4IOAQ 4F4ZA 4HT7A 4RLEA 2DH7A 4DSLA 1FRMA 5M2PA 3LWMA 4F2RA 1AFJA 1D9DA 4TY9A 5KFNA 2KT3A 3H59A 2ZDPA 2D74B 1H38A 3OFEA 4KO0B 3ETOA 3KLFA 2J6SA 5F41A 3EZUA 1X4FA 3THVA 4QU7A 2F8MA 5D6GA 4ED3A 2JFDA 2HHPA 2JDJA 3WC2A 4C0BA 1U25A 4EFAC 4XDDA 2H5EA 3R27A 1U2RA 2PEHA 2DGXA 2J6UA 1M1KT 1UAWA 5D8HB 4OZ5A 4O3SA 4U7UK 5KFSA 1JX4A 1TQLA 3TW0A 1QTMA 4I2QB 4ZCMA 2VG5B 4FF3A 3PO4A 1HD0A 4C8MA 5KFOA 2JEIA 1TL5A 1ZZFA 2RQMA 4YB5A 1YITS 1GT8A 4RWXA 4A46A 1IKVB 2MYFA 3M32B 3KK3B 1O51A 2WB4A 3LO3A