1OQ6A

Solution structure of copper-s46v copa from bacillus subtilis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGYHVVIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Potential copper-transporting ATPase
publication title A core mutation affecting the folding properties of a soluble domain of the ATPase protein CopA from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 14
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1oq6A00
3T9NA 4FNIA 1S6OA 5B0FA 2OP5A 2OFGX 1N5VA 1XBWA 3HHLC 2XMWA 1OQ3A 2HQIA 1TR0A 2OD6A 5B0GA 2GO8A 1X0PA 4OJGA 1LQ9A 5IXUA 1GXUA 2QYCA 5T7LB 1JWWA 2ASYA 2ROEA 2OKQA 3BM7A 1W2IA 2BBEA 3FGVA 2OD4A 2BUNA 2HLTA 2JDJA 4Y2IA 4Q2MA 5KAKA 3QMQA 2KT3A 4NL5A 1Q8LA 1IUJA 1QUPA 3KG1A 1KVJA 3IWXA 1FE4A 4ZA1A 2OFHX 3KKFA 2HFOA 2PD1A 3MZIA 3K7RA 2KT2A 5A6PA 2ROGA 4ZOSA 5B0EA 4OJ1A 3HHLA 4HL9A 1FESA 1URRA 2LQBA 1ULRA 2OAUA 2RMLA 5B0BA 1N5QA 1OPZA 2CRLA 1TUVA 2PGCA 5A6WA 2LXFA 1FEEA 2GA7A 5B09A 1AFIA 1KVIA 4OJHA 2ROPA 2GCFA 2HFNA 2W4PA 3TOQA 4U9RA 2LQ9A 1WD6A 4DN9A 2N4CA 3HDSA 4A4JA 4DPOA 4EFAC 1Y3JA 1OQ6A 2G9OA 3HHLB 1Y3KA 2IYIA 1Q53A 3UDCA 2XMUA 2VH7A 3BGUA 2BYCA 3TNVA 2GGPB 1FVQA 2K1RA 4YEAA 4HI1A 3GZ7A 3HF5A 3HX9A 3TRGA 1N5TA 1RJJA 1KQKA 2K2PA 1S6UA 1U7LA 2XMVA 4OJ3A 1Y9OA 2HIQA 3HFKA 5B0DA 2IFXA 3BR8A 1AFJA 2K7JA 2AJ0A 1Q8BA 1X7VA 2K1RB 4A47A 1FD8A 1FE0A 3KNGA 1CC7A 1FVSA 1TL5A 2GGPA 2QIFA 2VV5A 3FRYA 1Q4RA 4FNHA 1K0VA 2BJDA 1CC8A 3E8OA 2AW0A 1SB6A 1P6TA 1CPZA 3CJKA 1JK9B 4OIXA 5B0CA 5B08A 3LGMA 2AP6A 3WDOA 2RSQA 1VQYA 2LDIA 1VQSA 2K7KA 2W4CA 1AW0A 2XMKA 5K9FA 3FMBA 3I9ZA 1N5SA 1YJUA 1YJRA 5B0AA 2RU9A 2FTRA 2QLWA 3DCAA 2KYZA 4HH1A 3CJKB 4Y2MA 4A48A 4HI2A 4YDXA 2HLUA 2XMJA 2IYGA 5F0UA 3LGNA 3KG0A 1TZ0A 1SQEA 1X8DA 2QLXA 5F0WA 4HH0A 3F44A 2ZDPA 3DXSX 2FHMA 2Q3PA 2W4DA 1Y0HA 2L3MA 3BN7A 1SI9A 3BB5A 4NPOA 1APSA 4Q2LA 1R6YA 4DL0C 1YRXA 4F67A 3HHLD 2N7YA 1V3ZA 2EW9A 3BF4A 4QOTA 3VTIA 3MCSA 2FB0A 1GXTA 2GFFA 3QGPA 1MWYA 2BJEA 2GV1A 2FIUA 4A46A 3IWLA 1OSDA 2ZDOA 2OMOA 3LO3A 2AJ1A 2N4DA 1YG0A 2XMMA 1TL4A 2RILA 1MWZA 2ACYA 1YJTA 4Y2KA 1YJVA 2KKHA 5T7LA 2XMTA 1P8GA 3BDEA
chains in the Genus database with same CATH superfamily
3T9NA 3TVYA 3MCMA 3DLEA 3P8BB 2WCXA 5C24B 3O6QA 5E3CA 4DX8H 3PRDA 3UDEA 4FF2A 2W01A 2B8PA 2H1YA 3Q8VA 3KNAA 2XZWA 4OJ1A 5A2QU 4HL9A 2MSTA 1JLFB 2RS2A 1S72S 5B0BA 1SC4B 4GMKA 5F9NA 5DG8A 2GCFA 1AZSB 1FVQA 2W24A 3MPUB 2KXHA 2BVZA 1DY3A 1AUSL 5HL7Q 3HT0A 3QSIA 1MW7A 2HHQA 4DR1F 2OPSA 2BJ1A 4MIWA 1VC6A 3U1LA 4DBQA 4O3RA 2XYGB 3TAMB 4NLDA 2F1FA 3CT9A 4C3LA 3W1YC 3H7HB 2O66A 4F36A 2HFSA 4M63A 2BDPA 1REGX 4M5KA 1SQGA 4PQAA 4IFVB 3DRPA 2UXCJ 5GMEA 2VC1A 1VISA 2ZD1A 4YHHJ 4P10A 1RU2A 2VL1A 3T6JA 1KVJA 2QEXS 1IR1A 2E5LF 3W8PA 1N5QA 2G0JA 2QLFB 2HW3A 3M32B 2ZNYA 1NDLA 4EFAC 2W9CA 3BSAA 3SDEB 1VQ8S 4OHZA 2M7SA 4C2MA 1S6UA 3MM7B 2DKOB 3OJSA 2HRTA 2YTCA 4UT4A 2B7CB 1SUQB 5HK4A 1Q4RA 2FHJD 1U1OA 4N7TA 4IRDA 1OPIA 4C8YA 3G2XA 4NLVA 2CQPA 5CYMB 3KHRA 2CQIA 1V9OA 2D3UA 3CJTA 3C16A 1RT7B 1RT3B 5RUBA 4UTGA 2OPQB 5GAHI 4WP8A 3WBZA 3W7BA 4XPCA 1YIJS 1FKPB 2YX7A 3VGVA 5T7LB 5AJ3F 2GIQA 2BBEA 1SPBP 1WHYA 4NYPA 1X60A 2KFYA 1AYEA 5A6PA 3DMJA 2V63A 2CRLA 2IBKA 2KHCA 4JI0J 3TP2A 5J1EA 3Q8SB 3F0NA 2KJVA 1U0HA 4DR3F 5D4OA 4ZVHA 1EP4B 1Q86T 2HURA 2F63A 1XNQJ 4NASA 5IT9Y 1S77D 2VICA 2C2RA 1KDNA 4KV8B 2AMCB 3MMBB 1C0UB 4UQTA 4QPXA 1YLXA 5AXLA 4ZIVA 1RWMB 2VODA 4R0EA 4I67A 3R97A 1IBLF 2DO0A 5HMYA 2BV3A 4DR5F 5ETSA 2Z58B 2G2OA 1PBAA 3W8GA 2OMOA 4R5PB 4J9PA 2ZBCA 2Y1JA 1MU2B 2C2ZB 2CJ9A 4C97A 1BWEA 4QIEA 3SCIE 4FKYA 1SJ3P 3TUZC 2HHHF 1ZM2A 1QM9A 1IKVB 1OYDA 4CCHA 2PEBA 2E5GA 4NXNJ 2GVDA 4K59A 3LOUA 4ILLA 1MSWD 4NLRA 2J8SA 5FDLA 1Y3JA 2IA0A 3RU0A 1F3VA 5DLFA 4PZVA 2DB1A 2A10A 2JNJA 1GNKA 1WWHA 2MKIA 3BV8A 4F8RA 2HK2A 3H20A 4HYKA 5KFKA 3GYGA 1TKXA 2J9CA 4QPTA 3M2VA 3FMBA 1XTZA 2WK4A 1FRLA 4DFJA 5I4MA 4GO5X 3ENWA 1KLMA 1T03A 2XEXA 3FFIA 3HHLD 3PACA 4EBDA 4B9TA 4D3HA 4EBCA 2FHJA 3C14B 4P6QA 2LYVA 2XBPA 3OXFA 4Z37A 3NWRA 4LSLB 2ZE2B 1KNZA 1UCNA 2WVFA 2ZZNA 3QRPA 4MK7A 4PABA 1A7GE 3LP2A 3CD7A 4UW2A 2OELA 4UZCA 5CD4H 2CWXA 1E6YA 2XCAA 1S1TA 1S9GA 4F4ZA 5DO2A 3R27A 3V2UC 3NRBA 4CH1A 1T05A 3IWNC 3KK3B 1D9AA 4ED5A 4I7FA 5DJBA 2VKRA 1ZH5A 1F6TA 2R8KA 1CJVA 3SSQA 1FDAA 1UWBA 4TNOA 2AW0A 5HQLA 1WDTA 2J6TA 3MEKA 1R0AA 1UJ5A 2BMBA 1QTNB 1PG5B 4C98A 3JSYA 1SVDA 2ZHAA 2RNEA 1LWFB 4ZPBA 3SYZA 3RW6A 3MMAB 5E3AA 2PE8A 4LIRA 3I32A 3GSDA 2VQEJ 2HRYA 3M2RA 3T19A 3E2EA 1FRIA 4JV2A 2HHXA 2QRRA 2H48B 3RJMB 4OHWA 4I64A 3ONQA 1REVA 2V4QA 4PEOA 1CULB 4RNNA 5C5JA 2LQBA 1R8CA 1K47A 3D7SB 4TQRA 3OFHA 4DSEA 4Y2CA 3MEDA 5A2QY 2GGPB 3AQOA 4ZHRB 2UXCF 2DBBA 1U2FA 3ZZPA 2E1RA 1NK7A 3SFGA 3OTOF 2QN6B 3V6HA 2GMJA 4BCAA 4DSKA 4NZ6A 4RW7A 5GAGU 4RUCA 5B0CA 4OV6A 3KHGA 1JLEA 1SJQA 1RISA 1FK9A 1Q78A 5KFFA 1VBZA 1G6BA 3LGNA 2K3KA 2QT7A 1NJIT 3AQPA 2YKQA 1RYSA 2M8DB 2QL5B 1QD1A 2GV1A 4KE5A 5GAEU 2HEKA 2XTJP 2HSEB 1JJHA 1OIAA 4LREA 2XMWA 3HHNB 1NH8A 1WOOA 3QLHA 4I2PA 3HVWA 4PYDA 1JLBA 4AYBD 1C1CA 5DRKA 2YNFA 3CD5A 4KPCA 3AB4B 4PXDA 1NK5A 3C46A 1RA7A 4F3OA 2WVDA 3HHLA 5G0RB 2C1EB 3JSBA 4M5JA 3E01B 2BYCA 3V4IB 1GMUA 4DR7F 3WQPA 1GTHA 1RAJA 1QAIA 1T9UA 1K8AT 2YNGA 3JTNA 4CT8A 3X3UA 3AB2B 3U27A 1RAHB 4NWBA 5LOQA 4P75A 3L95X 3QBCA 3CCLS 4OHXA 4LF5F 3R5BA 4TU8A 4DCOB 2X3DA 3C66A 3K5OA 3N5BA 1WG1A 4B3MF 2QLJB 1XEZA 1HD0A 2DGQA 2PFFB 4K4SA 2H65B 1YJVA 1NM2A 3BBBA 1ZAVA 3CJ3A 1XNQF 1K1SA 2DRBA 2F4VJ 1ZZNA 5I3UA 4JP8A 5IOLA 3H25A 2FJWA 1D1UA 2RRBA 1NB7A 2I38A 3N4WA 2MZTA 3HK2A 4RR5A 1KFDA 4OZNA 3HSJA 1S7IA 4NXMJ 1AXQA 2PI4A 1VQKS 3WC2A 3J7AN 3MPWA 1KOOA 1Y10A 3QT5A 2V6AA 2MQOA 1BQNB 4R8UB 1LW0A 5B08A 2CADA 3RBXA 2K7KA 2H5IB 2ASJA 5AE1A 1HMVA 2FVRA 3AOCA 3Q8RB 1Y5NB 3IBCB 7FD1A 5HQ8A 1PIEA 1FFSB 3GV5B 1F2GA 3FUYA 4Q2LA 4CZCA 2NPIA 1NNDA 1V5IB 1UZHA 2HNYA 1U4BA 1X5OA 2JEJA 4O4GB 1JXVA 1HHSA 3FK4A 3A8IA 5B0GA 1C1BB 4O4RA 5ITHA 1KQSR 1LW2B 1S6QB 2RKIA 3A3OB 3SQGA 2DNPA 4MIBA 3L09A 3JS9A 2HGNA 3IN5A 4Y0FA 2VA3A 1WHVA 1RT5B 2PN6A 5IFMA 1ZA2B 1RBOB 2EK6A 4Q43A 2YXLA 3FZBA 4ITSA 3R6LB 4PUOB 4RNHA 1S5ZA 5KFGA 2QO3A 3OR2A 1DRZA 2W2PP 3I0SB 1ZYQA 1NEEA 4F50A 8RUCA 1X5SA 3PO4A 4KGZB 4URQU 3OPKA 1B0PA 1F5AA 2WONB 4N47A 2JRSA 3HVAA 1WEYA 1YZ6A 5CABA 3DXSX 1M90T 2BACA 3NS6A 3QIPB 2CG4A 2G0CA 2GS8A 2HS4A 1TKTA 2DNGA 4LSNA 3PX0A 3R5DA 3K59A 2G4BA 4DXLA 2BOPA 1KQGB 1X4FA 1QUVA 1X9WA 4DUYJ 1MNEA 2QYGA 4FPIA 3N6LA 1S57A 1M5KC 4BS2A 3OW2R 5F8LA 2BJ3A 4ZPTR 3AODA 5AE3A 2HFZA 3LALA 4I2QA 1WOSA 3RRHA 1NB2A 4K4UA 3KUEA 4JUZA 5D4LA 2AJ2A 3SV4A 3DM2B 3TOQA 4OQJA 2WVEA 4FZVA 2I8EA 4DL5A 4ZITA 1UA1A 1WUUA 2IRYA 2XLJA 4C48A 1HWIA 3LWMA 3VALA 2IC3B 5IM0B 3KJVB 3M4XA 2IMWP 2IVFB 1KD1T 1Q0NA 3MM6B 2GC8A 4U7UD 1RHQB 3I9V9 4ZVPB 3TUIC 1TK8A 4JI4F 1Z1ZA 2KYZA 2UXDJ 3OFGA 4TKTA 2OPPB 3DRSA 1VBXA 2HQ3A 2NXUA 1H74A 1T3OA 2VQFJ 2VG5A 3QGPA 3EDQB 3KUGA 1IM6A 3C6UB 4ES3A 1FXLA 2HHSA 1HBOB 3H90A 2DGWA 2GHPA 5C24A 1VDHA 2P5VA 4C8KA 3VR1A 3GQCA 5DG7A 2KZZA 2RDJA 1JLFA 1S12A 3KLVA 3L7UA 1AZSA 2RUGA 4ZOSA 5CCLA 1DTQB 3N79A 2LEAA 2BZ2A 2C2DA 4USTA 4ZJQA 2HVZA 1OYEA 2E44A 2MKKA 3TAMA 1FI4A 4JOUA 2BE2B 2XHCA 4PG5A 1X9SA 3JTPA 3PO5A 1B70B 1SH3A 4EBEA 4DL2A 4ZVSB 2RJZA 1RTJB 2QLBB 1SKUB 3G8SA 5JVHQ 3QNWB 4XPEA 2BQ3A 4WFYA 2V2KA 3JQJA 2L3MA 4ECQA 3BKFA 2EW9A 2P6TA 1A0OB 4IFVA 3TEGA 1HHQA 3EZUA 1VBKA 4RU2A 5KG0A 3EYZA 4DWIA 3ZZ0A 2YWWA 1Q8KA 1HW9A 3HHLC 5F41A 1T02A 1FFGB 2QZ8A 2OD6A 1D0EA 3CCWA 1YDLA 1SKSA 1VBYA 4Y3CA 3M32A 4QWBA 3KG4A 3M9NB 4H4OB 4IYQA 4LF8J 1ELOA 4OYWA 3UN5A 2JX2A 1EARA 2B9YA 2V8PA 7AT1B 2WW8A 5AT1B 3MM7A 3JSMB 3U02A 1SUQA 3AFGA 1UFLA 2ATLA 1KLNA 3CCJS 2F4VF 1HNVB 4NMLA 2QIFA 4CP5A 3C8YA 1SB6A 2D9PA 2HBRB 5CYMA 3B54A 5D0GA 2B43A 4LRCA 4RX6A 2DY9A 1RT7A 1RT3A 1TZ0A 4TU9A 4D3GA 4G3IA 2OPQA 5DG9A 1EIYB 1HPZB 1ZM9A 1IWAA 4L3KA 3KOAA 1R7IA 3RAMA 3IWLA 1FKPA 3KWMA 4I6WA 2ZDOA 3VAMA 4LVOP 2OJ3A 4CQ1A 3VZHA 5T7LA 1RWXB 2BKNA 2ZZTA 1UVKA 3R7NB 1QLNA 4MAKA 3W5ZA 5EHHA 4USVA 5KFOA 3H0PA 4OYXA 2XGPA 1MLAA 3V6JA 4R0JA 4KKOB 4ECVA 4QIFA 4ES2A 4F02A 1T0TV 3FQKA 1VR6A 4N76A 2Q43A 5F8MA 1EP4A 2QSFA 2IHR1 3R5GA 1MMLA 1VQ7S 3VCDA 2J0SD 3TUPA 3ZNJ1 1H98A 2W25A 2ZJRQ 4KV8A 2QMUB 3QIDA 3MMBA 1C0UA 2MKJA 5CD4A 1TVRB 4DN0A 1WORA 2CFXA 4S0MA 1N52B 1JXEA 3IBFB 2JLFA 3N01A 2YPZA 3P49B 2VFUA 4NRTA 4EI2A 4R5PA 1G7CB 4I69A 3N9UC 4ZCMA 2MKCA 5KT3A 1MU2A 1H6KX 1SH2A 3UD5A 1FTRA 3GIIA 2DNHA 2ASLA 2KVQE 3EMTA 2ZHOA 1XIQA 4NYOA 5IXUA 1IKVA 4F0MA 4RW6B 4PG6A 3CTRA 4JI8F 5H9EK 3IWXA 1UVMA 5GAGI 2DNRA 3MTKA 3PR4A 1S4EA 4EO6A 2CG8A 4QR2A 3GYNA 2W7AA 2C22A 2KFNA 1FDDA 2O01C 2HZCA 2AWZA 2L9NA 2OEMA 4LR7A 5D4PA 4OZ5A 3M6UA 3CDAA 2AJ0A 3RGIA 5GAEI 4DUYF 3NOGA 2LCWA 4Q8FA 1CPZA 4WJBA 4GKJJ 5CZXA 2AJ4A 2R2RA 4B9MA 5CH7B 1C4CA 3M6VA 4FDFA 3PEJA 3BR9A 1FRKA 2FB0A 2BJEA 3C14A 3ENVA 3HKZD 4WP3A 2PMHA 2UXBJ 1LFPA 4BHQA 2Q79A 2MDAA 1FD2A 1U6ZA 4DPOA 4LSLA 2XSJA 2ZE2A 3KK2B 4N5SA 4GO7X 1Q7YT 2ZUAA 2V69A 2F5GA 3BM7A 1VJQA 2UXDF 4PG7A 3CC4S 2VQFF 3KK3A 2WHOA 3C2PA 2ATCB 4UY8T 2DTJA 1DTTB 1KTVA 5KFSA 3CDWA 3W5YA 3MR3A 2FGOA 3HJVA 1NCLA 5LXYA 3Q23A 1K0VA 1RAGB 2DNNA 3G87A 3BGFA 1BY9A 4CO2A 3GIRA 1LWFA 2DIUA 1FRMA 2KJWA 4FVCA 3I56S 2ZC3A 1VK3A 3MMAA 2Q66A 1D8YA 1LV5A 2E1CA 1WEZA 1SQEA 3F44A 4JI7J 1ROFA 2Q3PA 2W4DA 2MQNA 1RKIA 3PEHA 4QOTA 1N8RT 3J7Z5 2YWHA 2WW4A 4JYAF 2KRBA 1Y5LB 1W26A 1BD6A 4JI1J 2AYMA 3OUYB 1CULA 1B99A 2JEFA 3F73A 3TANA 3MR2A 3GMGA 3NOCA 1RAFB 4MFBB 2NXEA 2FJAB 2ZITA 3R1HA 3NNHA 1MWQA 2HFNA 4PXBA 4ZHRA 4CI0B 2C2EA 1QSSA 3HX9A 2VPXB 1Z4UA 1Y00A 2G1HA 2X1GA 2WVBA 2KFZA 4RW9B 3CCSS 2CDRB 1HQUB 2DD8S 2FLPA 2MQLA 2F9DA 4Y28C 1SBRA 4MTPA 3PYGA 2BANB 2DNKA 2X51A 2ZH8A 1RWVB 2D74B 5F0UA 3JYTB 1QVGR 3KG0A 3M8RA 2N82B 1VQ5S 2XCPA 4TXSA 5J2NB 2NR0A 5ETOA 2VOOA 3VTIA 4DV7J 5CZVA 1ACMB 3KLHB 4K5SA 2AJFE 3K5LA 4DU7A 1L5UA 2M0GB 5L8RC 4LF6J 1HWJA 5HO4A 4OX8A 4M5DB 2KTQA 2P6SA 4ES1A 4PXCA 2PC6A 5G0RA 2ZBQA 1DQ9A 1B7FA 4QWEA 2J6UA 3E01A 1KS2A 4ID8A 3V4IA 1TK0A 3BH6B 2AX0A 4P74A 4X66F 5K8OA 4BWJA 4L74A 5DDOC 2F7VA 1UVIA 5KOWA 4Y65A 5GMDA 5L1KA 1XR5A 2Y9HA 2FZGB 2CJXB 5C25B 3NMAA 3B78A 3QO9B 2AF6A 2O5DA 4LBPA 1YRUA 2HLUA 3LP0A 5D77A 2MZRA 3M8YA 1RZMA 2IM3A 4HKQA 2CQCA 4RPFA 3MF5A 4W92B 2JC0A 1SKRA 4GVBB 2XLIA 5IQQA 2MZQA 1HW8A 5DZ6A 3LUYA 4OX7A 2RS8A 1OO0B 1XBWA 4C0OC 4DUZJ 2IIHA 1LQ9A 1AB8A 2KL8A 3UVJB 1KONA 3GILA 5KAKA 4RL1A 3SI8A 1TL1B 2UP1A 5EX0A 2B0GA 5HROB 2PA8D 1RDRA 4F4AA 2KN4A 4KY3A 3G8TA 2L9WA 4L73A 2FY8A 1EQ0A 1S9FA 2CZ4A 5J1PA 1RT4B 5SZTA 1BQNA 2AGOA 3EZ5A 4R8UA 4E8UA 3DLBA 2Y1IA 4DF4A 4JV1A 1FCAA 2K8GA 1RAAB 5K8NA 1F9HA 4NOHA 1TTHB 4P7TA 3MWBA 4HH1A 1R31A 2DHSA 5KT4A 1X8DA 4KSEB 4CLUA 3KHLA 1B7YB 4X2BA 1APSA 4KIAA 2FPHX 4RUAA 5I3QA 1HR0J 3RTVA 4O4GA 4LBIA 5ETKA 2Z0GA 1C1BA 2F3JA 3A3NB 1KEKA 2H54B 3D0IE 1VCTA 1WKKA 2OP5A 4C8ZA 3MFIA 5JJBA 1LW2A 1S6QA 4DOZA 2KZMA 1VQOS 4OI4A 3WX8A 2KT3A 1IR2A 1WC4A 4HLBA 1NDKA 1RT5A 2XO6A 3OL9A 4C8MA 4X4RA 2VJUA 2BE9B 4WK3A 4L3NA 2FVPA 1XN9A 2VDHA 2UVWA 1F9EB 2UXBF 4PUOA 1FJGF 2ZH9A 1L3SA 1TMJA 4CTAB 3EVWA 5KT6A 3I0SA 2IFXA 2R3VA 3O5TB 2BJ8A 3O8WA 2WONA 3LGMA 2V2VA 2CQ2A 4WBFA 1NHUA 1M5OC 3QIPA 5LJ3Y 3OTDA 5E3QA 4X4TA 5LSOA 3P96A 3K0JA 1FFWB 1BWVA 1GTEA 2AGPA 1S1UB 1RTIB 3MOZA 3M1VB 2EWHA 3BSCA 3EE3A 5K8MA 4X4VA 4X84A 4B3OB 4DEZA 3THTA 3GJSB 3CXCR 3DM2A 2B6AB 4ECXA 3U1MA 3ZTOA 2VF3A 3B6BA 3CIZA 1IM4A 1L3TA 2ZJQQ 4BLGA 2IC3A 1S6PB 5IM0A 1RJJA 2VBXA 4KBIA 2Z8QA 3KJVA 1EETB 2VUGA 3RUBL 4DQSA 4MYUA 1AFJA 1XR6A 2GHWA 5KFBA 2VG7B 4X4UA 4JI1F 3MM6A 2RAQA 4P2FA 3T1YF 4K7QA 1RWWB 2UUWA 2HGMA 4B3RF 4UQGA 2OPPA 1U1LA 2FVCA 1G3OA 3Q8YA 5DM7Q 1NJWA 1IQZA 3C6UA 4F0HA 3VQSA 1HBOA 5KFEA 2HQFA 2N4DA 3ISZA 4CDIA 4QR1A 2B5JB 4DUTA 2HBQB 2CQDA 2AT1B 3EZOA 3W64A 4XTTA 5CAAA 2J7UA 1NU4A 1DTQA 1LFWA 2DH8A 4OLOA 4FXDA 4KGVB 4DV7F 1DBDA 3KMSA 4ED2A 5KFWA 3K89A 5CHCB 3UD4P 1TKXB 1DAXA 4I0WA 4ZN3A 1JLAB 1FE0A 1WJ9A 2BE2A 4LF6F 2CWKA 1RTJA 4Q7AA 2B4PA 4JI3J 3QJJA 3DKDA 2GJIA 4RW8B 5F0WA 1KRPA 1VQPS 1OY9A 3U1NA 2RF2B 2XS7A 5J1NA 1S10A 1QJHA 1YG0A 3HULA 4F2SA 3EGWB 2LU2A 2DY1A 2HFUA 4ANCA 3C3LA 5GAHU 2BRKA 3TARA 4H4OA 3OHBA 4ICLB 4OI0A 4BBYA 4M5MA 1WELA 1HWUA 3EDRB 3JSMA 2BJ9A 4LRAA 1PSDA 2DGTA 1RWUA 2IAJB 3EXCX 2LECA 3I5BA 4IH5A 4OL8A 2LXUA 1HNVA 4EYHB 1SIWB 4DV2J 4FF4A 4HI1A 3I4PA 3FBBA 4PAAA 1T3NA 2R7QA 3H5XA 1WG5A 1VRUB 4YR2A 3PFOA 3BKTA 2JVRA 5F3ZA 1U1MA 2CPFA 3U7JA 1HPZA 3BEGB 2ALYB 3SCKE 3M6WA 2J8AA 4LT6A 1WTFA 4ILRA 3K2YA 2KO1A 3BREA 4A46A 4ATNA 4JV5J 2XZDB 1L3UA 3RR7A 3AT1B 4KKOA 3DLJA 2I6WA 3I31A 3R9LA 3Q86A 1TMMA 2ROEA 2VBZA 5LL6d 6FDRA 3ILOA 3QJPA 2QMXA 2MXYA 3L7PA 3J7ZT 3PNIA 2J7WA 2YNHB 4WZQA 5KFNA 4USUA 2DHGA 4HDGA 1PYOB 1ZAXA 1U1RA 1W7WA 4QIWD 1V3RA 5KFDA 3F56A 1HA1A 4KT0C 4K4WA 1YHQS 4QWCA 1TVRA 4NLPA 2IM2A 3EVOA 3NY0A 2B7BB 5EDWA 4WYLA 5KFJA 3AD7C 1RLDA 1Y7PA 2LEPA 3DRYA 3S8SA 3DOMB 4K4XA 1NK6A 2VBWA 2VPZB 1UAWA 1WF2A 4CRJA 4G1QB 2B9WA 3UDLA 2FHMA 4WP9A 3J7YU 4JBCA 4LF1A 5L46A 2FZCB 4DR1J 3BPDA 2BXJA 4CLWA 1IBCB 2XY6A 1CJUB 1FNXH 2OI2A 4RW6A 3W2WB 1LOUA 4YB7A 1SC3B 3CEDA 2VIHA 2QSWA 3VZIA 3H2UB 1RBLA 2HNDB 2R8IA 4IOCQ 2V4RA 3HZEA 5BYSA 3G6VA 1N33F 2OHDA 2W2MP 3Q2SC 4LRBA 4DV3J 3FRZA 4FYWB 3W9IA 4QIVA 4CM0A 4ZLJA 3FCVA 3FCWA 8AT1B 1SJ4P 2K2PA 2XMVA 4ZVFA 5DS7A 5C7PA 3OVBA 2YKNB 5E0OA 1TL5A 3UDVA 2NUUG 2G2ZA 1WOPA 2I2YA 3W65A 3E8OA 1KHVA 2N7CA 3NNCA 3NG8A 4DV0J 4AXIA 1FEHA 1LWCB 4P2SA 1ZPVA 4YR0A 4CH7A 3RZAA 3TZXA 4XO0A 1UKUA 2EC2A 3KK2A 2GAHC 2RVJA 2AGQA 3TEHB 3Q22A 3AA8A 4KC5A 1RADB 1F5CA 1WHXA 3EWGA 3GONA 2XYPB 2FJDB 4IQXA 3CIMA 4DSLA 5B0EA 1LWXA 5KFLA 3CF5Q 2B4OA 1TUVA 3I6PA 3OXGA 1DTTA 3DGPB 2AU0A 2QX0A 1HL6A 2D7SA 1U7LA 1G1XA 3T1HF 2BEFA 2LLZA 1N0VC 1RBAA 2VV5A 1UW9A 3MPDA 4F3QA 5KFZA 2C3YA 3D6FB 2CJQA 3I9ZA 3K57A 2OSRA 3MAQA 3T5LA 4HH0A 3UE2A 5KFAA 2DH9A 2V50A 4ID5B 4B08A 1T94A 1VQLS 2BJ7A 3OUYA 3PIPQ 1QSYA 2OFGX 3SQGB 2EFQA 4Q45A 4NA3A 4MFBA 4FYXB 2G2YA 4Y2IA 4RWXA 2BOAA 3KG1A 2HVIA 5L9XA 3KLEB 2EFPA 2KYXA 3QGGA 2M9KA 4ZVQB 3QFHA 4LQ9A 4A8QA 3PG9A 3NXZA 4WKYA 3KLFB 3UDCA 3OR2B 4IOBA 3ISND 4RW9A 2HHHJ 1IQTA 1HQUA 3N28A 5D0HA 2DYAA 4X4QA 3VAFA 2O3DA 2D9OA 2SXLA 2BANA 2VFTA 1N54B 2UUCJ 4CLFA 3W62A 3JYTA 2LA6A 1WC1A 3T6BA 1JB0C 2GJ2A 5J2NA 2A2CA 4MYTA 1IXKA 4WYWA 4FP9A 1X9MA 2YX4A 4ZKAA 1OS5A 2ZFHA 4DV2F 2RT3A 3KLHA 3ZZOA 1MWYA 1SL1A 3WC0A 2CQ3A 1XQIA 4RW4B 1YKWA 1RUSA 3IAS9 1MWZA 3HHKA 2NPFA 3DDIA 2ZM6J 4YFUA 1N32F 4M5DA 2HQGA 1N5VA 1R27B 1GX6A 2B56A 4FYDA 2XLKA 4CNZA 1XMOJ 1P1LA 2ZOGA 3I5AA 3GPAA 2R4FA 1BGXT 4IG0B 4PKDB 4OZJA 2OAUA 2ZNZA 5FLXY 4ECZA 2MKHA 2B4VA 3CC2S 4DN9A 4LMZA 5KG3A 3BO3A 3THVA 3PJWA 5C25A 4V1Ak 5J2QA 3KLGB 4AT1B 2NSBA 1Z2ZA 3DU5A 3QO9A 3HLUA 3I0RB 6FD1A 3PVXA 3FRYA 5F8NA 2CXEA 1N36F 1F5BA 1U1QA 1FWPA 3R2DJ 3V81B 3AD9C 1VQSA 1X4HA 3NWGA 3T9ZA 2ADCA 4J9QA 5IQ6A 4NLQA 4K2XA 1Q82T 2YVSA 3BN7A 4GVBA 3PTWA 1V3ZA 4H4KA 3UVJA 3BQ1A 5B0FA 1TL1A 2GQQA 2QYCA 4ED6A 4Q8EA 1JWWA 1FRXA 4IO1A 2MTLA 5HROA 3AJ1A 2NREA 3BSNA 1UL3A 3M30B 3KJFB 1UJ4A 1GH8A 1X4CA 2HFOA 2NLWA 3CSKA 3MZIA 3HPOA 2XM3A 1FESA 1ULRA 2QG9B 2ABYA 2CQBA 2O1PA 3KLIB 1RT4A 3DNCA 4U9RA 3HDSA 4O3QA 3BSOA 1IVZA 1YBUA 3MEEB 1WKJA 2EC0A 4NLSA 4FS2A 1NSQA 5KFRA 3ADAC 3TX0A 3I96A 3HMJG 1I6JA 1ZBTA 2QA1A 1HNZF 2UUTA 3V4MA 1IBKJ 2XMKA 2Z2LA 5JMNA 3EM1A 3FMWA 4HHUA 4DV3F 4FBTA 2XMJA 2MKYA 5J2MB 1GMWD 3OTOJ 1NUEA 2MZ1A 1Y0HA 3MEGB 1KC8T 4BDPA 1TFWA 1RWNB 3GR0A 2RRNA 4A8MP 4BC7A 3CCUS 3R5JB 3RB4A 1YITS 3PX6A 4RBVA 3CCMS 4URSA 1Q79A 1S99A 4DV0F 1BLUA 4ECRA 2IVYA 5D78A 2XO7A 4IR9A 2E5HA 2CQ1A 1FDBA 1HWLA 2Y8YA 3RAXA 1OY8A 4CTAA 2VOPA 3QRRA 3GE9A 1RT1B 4NCGB 4ZJLA 3TNVA 3KJNB 1QAYA 2FVQA 1X0FA 4R25A 2YNIB 3FVYA 3RB6A 1UVNA 5L1IA 4C4WA 4KHPJ 4DV4F 3DRRB 2KDOA 1RTZA 4CH0S 1FXDA 2Z2YB 1TKDA 1WDDA 3TJ9A 4LJMA 4DR2J 4DR7J 2F8EX 2CQ0A 4YDXA 2IDLA 1A9NB 4DR6F 1ZPWX 3PKMA 2VJVA 4YB6A 2HHTA 2PO4A 3CUNA 1S1UA 1IKYB 2L9DA 3TO8A 1RTIA 4DX5A 2AJ1A 3M1VA 1I94J 2DXEA 3NCRA 5E3RA 3LPYA 4DV1J 4B3OA 3FZ2A 4LF5J 1HNWJ 4AD6A 4QBUA 1BMQB 1RAEB 4J9OA 5HP1B 3TA1A 4A8SA 3DGVA 3POTB 4B3MJ 2B6AA 1NDPA 3NBPB 3W61A 3AJDA 5CA5A 4DQIA 4NI2B 3NGRA 4I6AA 3OTEA 3ILIA 3SQOP 1VQ6S 4DX7A 4UUWA 3GV8B 5IC4B 1S6PA 2LU1A 5ETQA 2RD5C 1EETA 3D4JA 1RKJA 2VG7A 1U1NA 2HHVA 4CLYA 1UA0A 5KFYA 3FBEA 3B4DA 4CO4A 2ZH3A 3AA9A 4OLPA 1KKHA 1EZZB 1UFKA 2JLGA 3IC1A 4DPUA 2P9CA 3TJ8A 3LWLA 4EWTA 1CQMA 2UV8A 2POKA 1I51B 5H9FK 1EJ7L 1NSKL 1GXTA 2VU5A 4Z7CA 3GG0A 2B5JA 5J2PB 1TL4A 4ZCLA 4IR1A 3HT3A 3BF4A 1RSCA 5CYQB 2XYHB 1RTDB 1ZOTA 2CPEA 1IR0A 1OQ3A 2UUCF 5KFHA 3SCJE 4P52A 3ZZZA 4DF8A 1WSRA 2KM8B 4B3TJ 4ED7A 4PR6A 3QMQA 2EK1A 1YWXA 3MPYA 1GMWA 1K44A 2PD1A 3GFZA 2UZAA 4DZ6A 4KO0B 1S48A 2PGCA 2VKZG 3CNQP 1HI1A 1DLOB 4HHHA 4NZ7A 3IGVA 2DT9A 1JLAA 2H9ZA 2ZM6F 1U2RA 1VQ4S 2R8HA 1XWLA 4WXWA 3ITHB 3TX8A 2CPYA 3J7YI 1XMOF 3IS9B 2ZUGA 4WFNQ 2L48A 2HYIB 4NEYA 4OX6A 3FSXA 4RW8A 3IM9A 1U0SA 4CLLA 1YJUA 1YJRA 4AL6A 1S1XB 1GEHA 4Y2MA 5H9FJ 2RF2A 1CS4B 1I3OB 1RU1A 5AE2A 2XSJB 2N7YA 2Q1LA 3AH6A 2HBZB 2RQCA 1NZAA 1PC4A 2FIUA 4GC7A 4DX6A 2R42A 3OR1B 1U8WA 4O3NA 5KT2A 3IXQA 4ICLA 4DR4F 3OLBA 1S0NA 4DZDA 3CCZA 4XDCA 1SQFA 2GZOA 4U8VA 2IAJA 3DN9A 3OT9A 2CNKB 4K2JA 5E3PA 2R7UA 2VDIA 4C0HA 3V5RA 3FSYA 2HNZB 3BBCA 2CVIA 4DQQA 3OVAA 1XJWB 1TUWA 2DVIA 3M9OB 1LWEB 2YWEA 4OJ3A 4MK9A 2H4WB 1VRUA 2Z2ZA 4ZPCA 2J0XA 5L9NA 3MM5B 4OX9J 1J5OB 3CJ8A 4KH0B 3ZZRA 4H4KC 2RUSA 5H1SV 3G96A 3I5CA 1HBMB 4I68A 1D9FA 3DCAA 1SCJB 4O0IA 2ZDPA 3SEOA 3A1YG 4ZLNA 3GIKA 5A8WB 3R3TA 2F8HA 1ITPA 4ZLPA 5DDQC 1PILA 1GXLA 4JI4J 2ZBRA 2XMTA 5A8RB 4X65J 1YBAA 2EPIA 2XSFA 3VF0B 2I9SA 1IBKF 2YNHA 4IRKA 4ELUA 5D0EA 3QT7A 5KFIA 2BQUA 1PJ5A 3SCLE 4K0KJ 1URRA 1N5YB 3MOJB 1CSJA 2DNLA 2AHOB 2DR5A 2DGVA 2Z57B 3RBEA 3MR6A 2IJNA 3NMRA 4G65A 4WFBQ 4QW9A 2CPIA 2CPXA 1B3TA 5ETLA 3IAM9 3NL0A 3ISNC 1U45A 3I82A 1YQHA 1JJCB 3A13A 3DOMA 4G1QA 4OHVA 3CCRS 2ILZA 3DU6A 3ET6B 1TU0B 2MQ8A 1CJTB 2GJFA 1GT8A 2DIVA 2VG6B 2CJKA 2IJRA 2M4MA 2XGQA 1XC9A 4YR3A 3SZ2A 1CJUA 5KTQA 3W2WA 4K4YA 4RBTA 1WI8A 2HAFA 4PQUB 1QAXA 2RU3A 3M05A 4KHPF 3DI6B 1O6XA 1H73A 2HNDA 1HNIB 2GO8A 4ZN1A 3MHYA 2WRMA 2GIFA 3GP9A 2GHVC 4DR2F 4WIQA 5CQGA 4AFFA 1U1PA 3PW7A 2ZZMA 4F3MA 5D0RA 5U47A 2G9OA 2C3UA 1I94F 4U95A 1VHFA 2YKNA 2WZ1A 4OYOA 2N3LA 1M1HA 2OLWA 4DV1F 3OSNA 2NZ4A 2YKPA 3MAAB 1HNWF 5LSLA 1U48A 2MJNA 2JVOA 1JIHA 2FC8A 3G6ES 1LWCA 2ILYA 2RQMA 2PMZD 2E29A 3M2UB 3LP0B 2AZ1A 2FHKA 5HATA 3PW0A 4HDHA 2E1MC 3N5FA 3PJXA 1KR4A 3BJYA 4QW8A 4F04B 1EX8A 3SXLA 3R6GB 4ANDA 5HAOA 3JQMA 1FERA 1UEVA 1QVFR 1KSPA 2ZOMA 4QR0A 4DSFA 1N48A 4Y34A 2ZH2A 4C8LA 5JVGQ 4DI6A 3A4TA 4ZS6A 2WOMA 3DXBA 4B9LA 5GVQA 1IBMF 3EICA 2W8LA 3LA0A 2J7KA 1UEUA 2Y0BB 2V4JB 1S97A 2ZEJA 2KI2A 2OGUA 2ADBA 3R8YA 4LF9J 3PW4A 2MB0B 3DGPA 3WX4A 2RMLA 1HWKA 1DURA 3QQCD 5LMUF 2KHDA 2R2SA 3LPEA 3PCOB 4P9SA 1WI6A 2YQ0A 3GWCA 1PAEX 2W9BB 3DFEA 3TAQA 2HZVA 2D3ZA 4MKAA 4Y00A 2HWHA 4LFBJ 4LIWA 3NAIA 4UOHA 5IV4A 4B3TF 3X1LB 3IR5B 1C4AA 2IMOA 3IR7B 2VD3A 5I3PA 3GG1A 1Y11A 3MUVP 5LMNF 4IFYB 3HXMA 4G1PA 4C8OA 2IM1A 4V19X 2IYGA 4ID5A 3CJ0A 2JHEA 2PT0A 3RYLA 4W4MA 2ZVIA 2DITA 1IKXB 2Y0SD 4ER8A 4WFZA 4ZCIA 2CPZA 3HSDA 2V67A 1I1GA 2MYFA 2VA2A 1Z2LA 3KLEA 1DHMA 1S76D 4OI2A 2CNOB 3H59A 3CGIA 3CWJA 3KLFA 3PRVA 4X62F 3QJLA 5KFUA 1B64A 1XMQJ 1TL3A 2ZVSA 2FJVA 3UNYA 2V8GA 2FLNA 4EK2A 2VB6A 1CLFA 1VLOA 4CLPA 3HFKA 4JI8J 4W98A 1S1VB 5CXTA 1WEXA 4USHA 4OYBA 3M8WA 4JV0A 2AEJA 1KBRA 4PWDB 4UZBA 1T7PA 3LW5C 5DDRC 4KQZA 3IP0A 4RW4A 4TY8B 1T8EA 3J80U 4F67A 4KGXB 2PDAA 4QWDA 3VGSA 1PJ6A 5LXRA 2V9KA 1U26A 4OX9F 4E98A 1W2BR 3D3CJ 1HKAA 2DPJA 1TR0A 2C3OA 4IH7A 4ENOA 4IG0A 1T9YA 3HJFA 2KG1A 1PYSB 2U1AA 1V5VA 4MJKA 3K5PA 3GCWP 2HVDA 2OEKA 4NLOA 1CQNA 5D3GB 5A0YB 4A8WA 4J5OA 4C0BA 3KLGA 2OSQA 3AXKA 2W2NP 3I0RA 4F2RA 3A8JA 4KJIA 3H42A 4X65F 3V81A 1JLGB 1UETA 3UNGC 1OWXA 2H5JB 2GAGC 4J90A 2ZH6A 4QZVB 2AZ3A 3R7SB 3NCPA 3GLJA 1NK0A 4C3MA 3FCHA 2R7SA 4K0KF 1T9VA 1RT6B 4N77A 3PHEA 3JXOA 3K5NA 2HMIB 2C3MA 1X4BA 5C42B 2W2OP 1P1TA 4X4PA 3D3BJ 3M30A 4OHYA 2ASYA 4X4NA 4WKRA 3G86A 2LA4A 2ZKTA 4KHRA 4JYAJ 1S59A 3KLIA 4PG4A 2PMWA 4ZMMA 3MEEA 1OPZA 2P8IA 2CPDA 4LFAF 2Y3YA 1OQ6A 3VAGA 2XWXA 5IT0A 1TP7A 1RAIB 5KFXA 1X4AA 4YUDA 2EBGA 1DARA 2DNOA 4ZVRB 2H4YB 2GW8A 1SKWA 2CZVC 4HT7A 1CC8A 2JWNA 1VMBA 2QFJA 5KFPA 5DGBA 4ZP9A 5KG1A 4DJBA 5J2MA 1N5SA 2RU9A 4K50A 2Z30B 3MEGA 1YGYA 3KK1B 2PSZA 3HD2A 2FJEB 4M8LA 3N0VA 1RHRB 1U47A 3WZ0A 3GJQB 3DLKB 4MT1A 2J0QD 5DQGA 5ETRA 2MPUA 4F25A 1UPMB 3NKYA 3T3FA 4AL7A 3FEXB 4YY3F 2HWIA 2FLLA 1H72C 4OMFG 6AT1B 1UFWA 1Y4ZB 1RT1A 1V3SA 9RUBA 4NCGA 5HLFA 4EUVA 2YX1A 1HLWA 1M5HA 3HM9A 1XR7A 4FBUA 2LQ9A 1X5PA 1Q53A 5IS2A 3BGUA 4ZCKA 2YNIA 5E41A 2UUAF 1VFJA 2VFVA 3RBDA 2MHNA 3DRRA 4CYUB 2ZWPA 2K7JA 2BRLA 1CC7A 2XS2A 1FNOA 5DQIA 4H54A 1P6TA 2XQCA 2EFOA 4LF9F 4X66J 3ETMA 2EG1A 4ZVEA 1SJ1A 4QJVA 5B0AA 2MLXA 2QL9B 5M2UA 2DHAA 1IKYA 3QWPA 2Z2MA 5AXNA 2A6OA 5IZHA 4Y2AA 1H38A 2C2NA 4P71A 2ACMA 4AL5A 3GYXB 2OPRB 2EI5A 4ZPAA 5HP1A 2QGFB 2R7RA 4LFBF 2L08A 3POTA 3V6DB 3NBPA 3UQSA 4NI2A 3NEKA 1JMTA 3MCNA 4ZLLA 3ELHA 1FJCA 1RK8A 4RWWA 2E7XA 1NPKA 3B82A 3OFFA 3DYAB 1RP5A 4NLUA 2ZH5A 4OFZA 4WU2A 5D8HB 4J9UE 3CW2C 1WG4A 2OMLA 4P72A 4YQWA 4RZRA 2OEJA 2DRDA 4QYZK 3K58A 2DRAA 2PEHA 1SL2A 1NZ8A 1SC1B 5B0DA 1MN7A 5BYQA 3PW5A 3DLGB 4C8NA 3HVTB 3BH7B 2D69A 4ZJOA 1OMSA 3C15B 2LQJA 3MECB 4DHVA 3QYYA 4JI6F 5D6GA 2X1FA 4FYVB 1XMQF 1D09B 3W63A 2WAQD 1N6QB 1GMVA 3MPVA 5J2PA 1YI2S 3JTOA 4DFKA 2DEJA 5CYQA 2BA9A 1RTDA 5G4DA 1SC6A 4WZMA 3PIOQ 3G71S 4NA2A 4LVNP 3NLCA 4C11B 4PWUA 5HN0A 1H0HB 4KFBB 2KT5A 4M5NA 4HACB 1F0XA 2WSEC 3AXMA 2WB1D 4XK8C 4C7QA 2HRUA 2ALZA 4KO0A 3VGUA 2LDYA 1IUJA 2HHWA 1DLOA 3ULHA 3VAIA 2R2UA 4WWSA 3MM8B 5KG2A 4QYZJ 2RIJA 2J5AA 3ITHA 2EG2A 2PI5A 5KG6A 4FN5A 4J91A 1TAQA 4ED8A 4ETZA 3IS9A 1HBUB 4TVAB 1HBNB 2K1RB 4I56A 4DV6J 1FD8A 4O0NA 4X4SA 2BR0A 1FHTA 4RNFA 2XI2A 1S1XA 4U96A 2CAJA 3N6NA 4J9MA 1IN0A 1CS4A 3G82B 1FJGJ 2JEIA 1MG7A 3FQLA 3QT8A 3LANA 3OR1A 1R6YA 4FYYB 5FD1A 4OYZA 1X5TA 3J80Y 2WTFA 3BDEA 5I42B 5M2RA 3O3LA 3JSRA 5E7OB 1FX4A 5ETPA 4USIA 1NJXA 1XMBA 1LXJA 2FGCA 1NKCA 4YP3A 3ENAA 5KG7A 2HIYA 1Q8LA 2H5EA 1YJ7A 3BGOP 1S0OA 1NH7A 3QAEA 2HNZA 2YQ1A 4U6PA 2R7TA 2AV5A 4ZPVR 1U25A 1U09A 2I0XA 4HTIA 1AUDA 2UVVA 1LWEA 5CCMA 3BDPA 2IYIA 5BXIA 2DNQA 3TRGA 1KQKA 3MM5A 3VV2B 3D1QA 3ILLA 1J5OA 2V34A 4TYAA 3RRGA 1Q8IA 1Q8BA 4OV1A 4P2XA 1HBMA 4IOAQ 3GU0A 4CO3A 2AP6A 4LF4J 2OIHA 2M70A 2H3EB 5A8WA 1IJFB 2V5HG 1T95A 4LUBA 4UOCA 1FKOB 3T1YJ 3W9HA 4YS2A 4ED0A 3M7VA 4FXVA 5A8RA 4B3RJ 3RAQA 1EAYC 3MMCB 1KTQA 2V9WA 4C6AA 3LP1B 1TL7B 3R5AA 1S6OA 2RDIA 3E3XA 3RRKA 4M5GA 1VQNS 3QAUA 3HCXA 1WC6A 2HVEA 3FBFA 1SV5B 1N5YA 4HTJA 4DLGA 2R7VA 5D4NA 1N34J 3BZQA 4PCQA 3CJQA 3KKFA 1JJ2R 3K7RA 4IUFA 4OZ3A 3MAHA 4OYIA 4M5IA 1P9YA 5KFMA 4X4OA 2KB2A 2MGZB 5EWEA 2V68A 1JXLA 4DQRA 2V2QA 1EB0A 1O51A 2H51B 1EHWA 5JXSA 1JKHB 3FDSA 4TYBA 4B9UA 1RTHB 2E7VA 2B9XA 1S7HA 3EUNA 1JK9B 1IKWB 3ET6A 2YPYA 2EFVA 1CJTA 3GJTB 3FEYB 2VG6A 3MD3A 2LMIA 3D2WA 4A48A 3UW1A 1KVKA 2CQHA 2AQ4A 2NYIA 1F1BB 1X4DA 4YHHF 3TYTA 3ZC4A 4B9NA 3KUHA 4EGLA 5LM7E 2GX8A 4PQUA 1PCAA 4DL7A 3DI6A 1OSDA 2DNYA 1HNIA 1RWOB 3L9ZA 3G4SS 2FD2A 1BHNA 5L39A 3GJRB 4NCBA 3W5XA 3NGKA 5DDPC 2ZC4A 4K5RA 3PHTA 3HKWA 5KT5A 4M94A 4BC9A 3I87A 3M8QB 3EX7B 4QU6A 4ZVOB 1UZDA 2YKOA 2VZ9A 3UN2A 2AJQA 5J2QB 1FX2A 4OYPA 2I5JB 2C2MB 4ECWA 3EXYA 1BC6A 3MAAA 1RCXB 3G8QA 1JQGA 1ZAWA 1ZS6A 3AD8C 4PXEA 5K8PA 2AIRB 3M2UA 4DS5A 2MQQA 1U1KA 2B4UA 1RWKB 4DS4A 4FVMA 3D1HA 2M2BA 4J9VA 1NPRA 2E66A 2LDIA 2KH9A 5AXMA 1AW0A 3KDOA 2A1BA 3K5MA 2DO4A 2IY5B 4OI6A 4HI2A 3TZZA 4F4YA 1BUXA 2CQ4A 3MM9B 1NK8A 3AOBA 3VAJA 1WC5A 3TWZA 5DGAA 5L38A 2DGOA 3D6TB 2XHWA 4LSZB 3TI0A 4KGMA 3QRQA 2V4JA 2M3DA 1MMNA 2WBRA 2J9DA 3JB9k 3ENQA 4JI0F 1TKZB 3TZYA 1S1WB 2E9ZA 4CLTA 2XY7A 2DGXA 4ILMA 4TQSA 4ECTA 3IGNA 4M95A 1T9XA 2D41A 4UY85 4TLRA 1JLCB 3ZFVA 2Y1RI 2BKOA 2W9BA 3EPGA 1ZTWA 1RWPB 1VC0A 1T11A 5KT7A 2XNQA 3DOKB 2CJAA 3BR8A 1FJEB 4NYZA 4LF2A 2JFDA 3PYFA 2HQDA 4X64J 1L3VA 4IFYA 3V6KA 2NXJA 2C28A 2V0NA 2E1AA 3QZ8A 1JNRB 2NXNA 1RGVA 3H2VE 1IKXA 3KMQA 4ZVGA 4M5LA 2KM8C 3QZ7A 2GQCA 1PGZA 1X31C 4LR9A 1NK4A 4ZPWR 4A8XA 5IWAJ 2NCKL 4DV6F 4NXNF 4O3PA 1RHKB 4M5HA 1N88A 3CE8A 3WHIA 2DGSA 4QIGA 1DQ8A 1RT2B 2B3TB 5KFTA 4RNOA 2W8KA 1NKBA 2ROGA 4L76A 3VGTA 2ZWOA 1KQFB 3D9BA 3T5KA 2MZSA 1FTCA 1J5EJ 3RW7A 3IG1B 4GVLA 1S1VA 3EGVA 1Y3KA 1RYRA 2NS1B 4J37A 3L3CA 4O44B 4Q44A 3AJ2A 3ZTSA 3M9MB 4H4MB 1N33J 4KGKA 4PWDA 2C2KB 4WK1A 1RAOA 5DM6Q 2V8DA 2QJ3A 3FNNA 1S0VA 3D0GE 3MTJA 3ETOA 4CIOA 4TY8A 1HARA 4RJVA 2ZHBA 2AD9A 2ASDA 3FJ2A 1VS3A 1MROB 2XMMA 3K8WA 2Q6CA 2P9EA 2J6SA 2GVZB 2HWTA 1VLYA 4EO8A 2FJXA 4LF4F 1C0TB 2J9DE 5D3GA 5A0YA 4Q2MA 2DR8A 1H2VZ 1TAUA 4ERDA 1X4GA 2EXUA 4PPZA 3O1LA 2HK3A 2EVZA 1K9MT 1LK7A 1SJRA 2J76E 4USWA 2UV8G 4PWWA 1NSAA 1JLGA 4Q0BB 4K4VA 4MK8A 5HMWA 1M5PC 1Q95G 1N5TA 3Q8PB 2V8HA 2D3O1 3TQEA 1UWAA 1URNA 4LQ3A 3PYDA 3UN3A 3H98A 2LKZA 3E51A 1N34F 3PFEA 2VQEF 1RT6A 1DZ5A 2IJFA 2AYGA 5K14B 3CMAS 3NAHA 1JLQB 3DC2A 1TV6B 4YOEA 4ZVTB 3T1HJ 2HMIA 2ZBPA 4URGA 2Z56B 1Q5YA 4Y6IA 1VRTB 1ZM3A 1HNXJ 5C42A 4P73A 4J9KA 3LO3A 2A2DA 5HVFA 1YJTA 4PRFA 1IJEB 1R8PA 4J9NA 1S9EB 1WSVA 2OO4A 1HYSB 2XS5A 5L1LA 3EGZA 4OYMA 5IT4A 1RCOB 2FLOA 2HAIA 2OTJS 3C6TB 4KRWA 1QUPA 2B8QA 2Y8WA 2IPOB 2RQ4A 5DLGA 1NO8A 2F8MA 2XWYA 1NLKL 2R8GA 4IG3B 2R9LA 1AFIA 1K0TA 4OJHA 4YB1P 4JI2J 1LEOA 1QDUB 2A18A 1KOHA 5KOXA 2DHXA 4P7VA 2KXNB 4FNHA 2D1CA 2BJDA 2DR7A 4AXJA 1G2EA 3KK1A 3GFHA 2YKMB 4U7UK 4BWMA 3VWSA 4E2FB 5BR8J 3D28A 1YJ9S 5HBMB 3DLKA 2HHUA 3UR3C 2FUG9 4AUKA 3NP5A 1YZ7A 3HFZB 4GRSA 2DR6A 1F3FA 2W7OA 4ANEA 2FY1A 4U7CA 1MN9A 4FS1A 4LFCJ 3PV8A 2YKAA 4ZDNA 4RUHA 3Q2TC 2M8HA 1RQ0A 1HD1A 3QFWA 5BJRA 1NHVA 4U67Q 1T9TA 3DOLB 1I5OB 3A3PB 1NPPA 3TJAA 2WB4A 3OD2A 3Q83A 1N32J 5LSRA 4OI3A 4DFPA 1R3NA 2HZAA 4TLQA 4DL3A 4DQPA 4CYUA 2MHEA 1VHIA 4A8OA 3GZ7A 5M2PA 1RE1B 5HVGA 1T9WA 5HJXA 1M0SA 2J9EA 3AHPA 5T14A 2X1BA 1UEKA 3SDEA 4IDKB 1VOMA 2FVSA 4FPRA 3OL7A 1K1QA 2YWKA 1M5VC 3P45B 5D15A 1SIZA 1OSCA 1BXNA 1KHWA 2A0FB 2R8JA 2HS0A 4KAIA 2OPRA 4NLYA 3HZGA 4RBUA 1N36J 1P9QC 1TFYA 3V6DA 4F26A 1QY7A 2LP4A 1KP6A 4X64F 4CLKA 1FT8A 2HFVA 3VAHA 4F4WA 4NXMF 2F65A 2OH2A 3DYAA 3HVRA 4UOFA 2YWFA 3R2CJ 4NL5A 3H2LA 4A8FA 1YVFA 2OFHX 1UVLA 3LF0A 1GFWB 4ZP6A 5A8KB 3CPWR 3ICLA 4OZ1A 1UJ6A 3BYPA 2JFKA 2CUYA 3TQ1A 3BQ0A 7FDRA 4FXWA 3DLGA 1U02A 5IWAF 3HVTA 3QGHA 1FKAF 3M8PB 3QSYB 3C15A 2MSSA 3MECA 2DR9A 1OY6A 3FEZA 3SV3A 2W1BA 4ED4A 3MD1A 4CO1A 1O5JA 4AQYJ 1N6QA 3CDUA 1CG2A 3LGHA 2KVIA 3BQ2A 2FTRA 1C2PA 3HHEA 1RACB 4DG1B 1J5EF 3MGJA 1JX4A 3SMZA 2FHOB 3OBIA 4NPOA 4HR2A 1ZA1B 2DXDA 3S6EA 2XB2D 2DNZA 1HNZJ 1DJ0A 4C11A 1LNQA 2IBOA 5C2GA 4KFBA 2DCUB 2G0IA 4HACA 2CA9A 1QE1B 3UCGA 2NYHA 3W2VB 4B02A 5LJ5Y 1GXUA 2BM1A 2XULA 3CJRA 5T41A 2MMYA 2BUNA 2JDJA 4PPDA 4ECSA 3D54A 3MM8A 2DK2A 2CIMA 3EVMA 4K4ZA 2LXFA 1HBUA 5EGYA 2YH0A 3DLHA 1HBNA 2K1RA 1Y9OA 3JAMU 2GO9A 4UUXA 3KYLA 3G82A 1V6HA 1O0PA 4ETXA 2YBVA 3CO0P 4ELVA 2MQPA 2LQ5A 2GIRA 4MKVA 3LH2S 4CO5A 5B7WA 4MMOA 2WOMB 4DV4J 2P9GA 1UW4A 5I42A 2ZH4A 4XIUA 3JQKA 3GSIA 5HJYA 3BYRA 3PY8A 3CDEA 2RILA 4WE1B 2XG8A 3QPIA 3NS5A 3RB0A 3SBMA 3O2IA 3D0HE 2D3OR 4DR6J 1NHKL 3H40A 4PYAA 2OKQA 4EZ9A 3FGVA 1WACA 2CJBA 1FE4A 1R43A 2FYXA 2DCLA 5BYRA 3OLAA 4DDFA 2R2TA 2ERRA 4LRFA 3SSRA 5A6WA 1FEEA 3UI3A 3BGRB 4A4JA 1HNXF 1WC0A 5H9EJ 1PBUA 2XZTB 1XERA 2BABA 4YEAA 2JOQA 4RNMA 2G13A 2NXCA 3CJ2A 3KNGA 2BKPA 1CJKB 1R8BA 2NZCA 5E33A 4DCJB 4P2MA 2R7XA 4B17A 2RSQA 3QATA 3THPA 2K3IA 3WIVA 1KN6A 2RH3A 2QA4G 1FKOA 4DL6A 3D67A 3ZNUA 3CJKB 3H5SA 1Q1KA 2YQ3A 3MMJA 2EFGA 3TVKA 1FDNA 4JI2F 1SI9A 1R8HA 3BB5A 3MMCA 3LP1A 2QMWA 1TL7A 3OL6A 2JSXA 1M1KT 3UCUP 2E9TA 2HQCA 2ACYA 1Q81T 3J81U 1P27B 5MAOA 1SV5A 4LBHA 2L41A 4GKKJ 3ZTRA 2XNRA 1TL3B 1PO6A 4G1IA 3D66A 5BR8F 3EJMA 2XI3A 2MGZA 4F0KA 1Q7LB 5EX3A 4TU7A 2CVEA 4HEA9 4DFMA 3ZZYA 1JKHA 4UOGA 2IRUA 3OXLA 1G4CA 1NSPA 1RTHA 4NX9A 4LFCF 3BO4A 2VPWB 2BM0A 1S49A 3KHHA 4WCEQ 2W2QP 1IKWA 3QT6A 2FDNA 2GGPA 4NEZA 3UR0A 3PRBA 1HI8A 2DPIA 2OUGA 3G6YA 2HG4A 3NNAA 5K5MA 3Q8UA 3CD6S 1LKZA 2QC3A 2VHGA 4J7CA 1YJNS 2M5YA 1B0VA 1R8AA 2R7OA 4FF3A 2OTLS 4C3KA 4EMDA 2LXIA 1B0TA 3D68A 4LF8F 4Z2XA 2QTWA 2EFNA 1WTBA 2M52A 3O44A 5ETNA 3M8QA 3TUJC 2QA4S 1UMJA 2X3GA 3CCTA 2EBEA 4NLGA 1WNEA 3OSPA 2I5JA 4RU9A 3RR8A 1PYTA 2VFRA 1RI7A 1BQMB 1LK5A 1FWLA 2C2OB 3IRXB 4DR4J 3CCES 4DPXA 2IVMA 3OV7A 4KYZA 2HKEA 2LFVA 4WXOA 2GMLA 1H7WA 4MH8A 3W3SA 1M1GA 1BQXA 4J9RA 4CO0A 3FSIA 3NCQA 2YH1A 3MI7X 3MM9A 4CM2A 1HI0P 1WF0A 3R7BB 1E6VB 1VI7A 2QE5A 3Q24A 1HQEB 4ELTA 2XC9A 1K73T 3TW0A 4RKUC 3SSSA 1YTYA 3FBCA 2FQQB 1TKZA 3FKBA 2RE1A 1S1WA 3R1LA 3Q0AA 1NMEB 1J27A 1AROP 4QQBA 1FNMA 4AQYF 1W2IA 2RHQB 1YBTA 3DDKA 1YX2A 1JLCA 1W25A 3DLEB 3PXGa 2UU9J 3A8KA 1FJ7A 1WHWA 5HVHA 2UVUA 3IM8A 2J0WA 3DOKA 4QCLA 3CJ4A 3H4BA 2QA2A 4NZ0A 3QWUA 1R6VA 1X7VA 1H2TZ 2PFDA 2M88A 4OZ0A 1WKLA 1NK9A 3IRWP 2UUBJ 5ADZA 4CLZA 4WPAA 3VHQA 2AKWB 1CBKA 3P3DA 3T41A 5HSPA 4E0DA 3MCOA 4NLTA 3PYEA 2KXFA 2JJ4D 2OPSB 1TELA 3VQTA 3M8ZA 2R7WA 2APOA 4NRUA 4CWBA 4IKAA 3ZZTA 2E9RX 1WF1A 5KFCA 4DL4A 1GX5A 4M1KA 1N0UA 4O3SA 3ILJA 1S0MA 2EEYA 3PM9A 2IA6A 2QFIA 4O23A 1NKEA 3TR5A 2DEIA 4ALZA 1FRJA 2QL7B 2WVCA 1B4SA 1RT2A 4IH6A 3AOAA 3PDNA 1LXNA 1N56A 5F8IA 1Q5VA 5HLFB 2MEWA 3DRPB 2ZD1B 2V8VA 3IO1A 1NDCA 3IG1A 3W60A 2ZKUA 4TN2A 4KTQA 2VASA 3CB4A 1U6BA 5KG5A 2LEBA 3PR5B 3ZO7A 3EPIA 1PC5A 3KFWX 3TVZA 3PKYA 4O44A 5KFVA 5C2CA 4GKJF 4H4MA 2GNKA 4ED1A 4RO0A 2AX1A 3BKUA 2E7WA 4DV5J 2W9CB 1KFSA 2RDDA 3MURP 4EZ6A 2LQ8A 2AEFA 4DSIA 2VBYA 5SUHA 3JAMY 4DPWA 5ETTA 4NMXA 3RB3A 1MROA 5E5NA 1ICEB 4USMA 2A3JA 2GFFA 2GVZA 3TA0A 1JJ4A 4USKA 1C0TA 3C16B 4JI5J 3DRXA 3IR6B 1D8ZA 2Z4PA 3TA2A 4HT5A 3I55S 3L4BC 5EUHA 3OQ2A 4FF1A 3T1AA 3OL8A 1F60B 4Q0BA 4MKBA 4LF7J 3MXHP 1QAJA 1IBMJ 3B4MA 2C42A 1QTMA 5F9LA 2N4CA 3GFXA 3DMJB 5GADU 2XMUA 2CPHA 3HHDA 1ZM4A 1VGYA 2CZ9A 4DSJA 4JI7F 2V2ZA 5J1EB 4GKKF 1U0HB 2Q6BA 2YWGA 5K14A 2XY5A 4IO9Q 3HI9A 4XAKA 1JLQA 2AYEA 1TV6A 3WDOA 5LMUJ 3N6MA 4U8YA 1M5SA 1H3DA 3HFVA 5DETA 4ED3A 4NCAA 1VRTA 2MY8A 2YY3A 3GFYA 4RLEA 2VFSA 1S9EA 1HYSA 5LMNJ 5EWFA 2MQMA 1FO1A 3C6TA 2JZ5A 3CMQA 1SH0A 4AE5A 3J81Y 3OTBA 4IG3A 2JLEA 1BE4A 4ZA1A 3UD3P 3HSZA 3IA0A 2MLYA 2HBYB 4QWAA 2CJYB 5DZ7A 2ZH7A 3D5MA 1SL0A 5DQHA 1WD6A 4RUBA 4W90B 1Q16B 2GVDB 1RHJB 1MMDA 1RHUB 5THWA 3HF5A 3PZPA 1R0BG 5FDLB 5FJ4A 2HIQA 3KDNA 2BE7D 2JL9A 1F9FA 1OJ4A 4A8KA 2YKMA 4X62J 3H4DA 2NUHA 1FRHA 4NLXA 5ETVA 4OYAA 3KJQB 3OJUA 4MKYA 4OIXA 5HBMA 1VQYA 3US5A 2WBMA 5K9FA 1D3WA 1GAOA 3S7RA 2IRXA 4N56A 3M2VB 4HVZA 4L75A 3J81j 1NJYA 3BPSP 1VQMS 1Y5IB 1F2HA 1KLMB 2E1PA 5HI7A 3SFUA 4DCPB 1T03B 3CVKA 3FFIB 2DJWA 1NRKA 4LRDA 1RLCL 2WSFC 4KR0B 3DOLA 5F3TA 1VRQC 2LVWA 2B51A 4MIAA 4WFAQ 3CULA 1VK8A 2RB7A 2FC9A 5GMKa 4XDDA 1KVIA 3MR7A 2ROPA 4NA1A 3UWTA 3LP2B 2F4FA 2HHPA 1FWKA 3RG6A 2VH7A 3J7A1 5FLXU 3BO2A 3CJSA 1E6YB 1RHMB 4J9SA 1S1TB 4IDKA 1S9GB 2EKYA 3CMES 5HMZA 1VJWA 1AA1B 4KH1B 2C3PA 1DFDA 1ZZFA 1T05B 3SIPB 4I7FB 1GQEA 1CJVB 3BN4A 3NGDA 1ZETA 3LQVA 2RHSB 3OVSA 4FKXA 1UWBB 4N8OA 2UU9F 1L3KA 3P5BP 4PG8A 4DUZF 4HHJA 1R0AB 4CLSA 1SXLA 2PA3A 2IM0A 2HPUA 2WSCC 2MY7A 4F4XA 3MCSA 3UO0A 4WFXA 3WIUA 1FA0A 1EQMA 1CEZA 3HO1A 1P8GA 2E5JA 2O67A 4FNIA 3PX4A 2B9EA 4ZVUB 4K4TA 2IDEA 3C19A 2CNNB 3ZZUA 1YJWS 2G1DA 2UUBF 1HQ2A 3M2RB 1VQ9S 4I1TA 1U8SA 3D6HB 2HLTA 1SJFA 3GTYX 4B9SA 5A8KA 2DGUA 4K8RA 1XNRJ 4IQMA 3VAKA 5L1JA 4B3SJ 1O8BA 3AAWB 3GV7B 2A6MA 2CKWA 2CYYA 1H2UX 1AT1B 1REVB 1UP1A 3H8YA 1H7XA 2W4PA 3LTOA 3LAMA 5FIIA 3M8PA 2KU7A 3T5JA 3OFEA 1NAQA 4G6VB 3K17A 1U6FA 1DQAA 2BX6A 1RA6A 1NJZA 3MEDB 3PJ9A 3BS9A 2CNLB 4ZP7A 4NLWA 2BW7A 1HR0F 3CC7S 4LFAJ 4DG1A 3T5HA 3NGUA 3A12A 5CYJA 5A76A 4DPTA 3L7OA 4RW7B 4KB7A 1JLEB 4YMEA 1FK9B 4DL0C 5F8HA 1QE1A 3LAKA 4DV5F 1XK8A 2P2CB 3W2VA 1EKSA 3KXDA 3G9CA 2GMHA 4EU0A 5KG4A 3F41A 2JEGA 5HQMA 2V94A 4OJGA 5MLCV 5EWGA 1VIXA 3UCZP 2OD4A 3MUMP 4ZP8A 2GQ2A 3UFCX 2RRAA 3QLHB 1TQLA 4I2PB 1JLBB 1C1CB 2YNFB 4YB5A 2GA7A 2E5IA 2DXFA 4YY3J 1NBEB 1S4FA 4DLEA 3HHLB 4TY9A 2JH3A 3P5TL 2VC0A 4DMZA 3P6YC 4JI5F 3VVUA 4Z7YA 4WU3A 1UTAA 2CDQA 4LR8A 1PAUB 4DPYA 4ZK7M 2VPYB 4OZLA 3W9JA 3DHXA 3CCVS 5JUMA 2DISA 2W4CA 2YNGB 4IRCA 4L72B 2UUAJ 3OHAA 2MJUA 2Y1LB 4LF7F 2CQGA 2E5LJ 1FXRA 4WE1A 2KG0A 3A8EA 4J9LA 2KKHA 1ZTTA 3TAPA 4OI1A 2PIIA 1TK5A 2RQKA 1U49A 2HQIA 3DHWC 2HGLA 4ZIWA 2ZJPQ 5HANA 2XMAA 1N4LA 5I3UB 5F8JA 1PJ7A 2KT2A 3BGRA 2MZJA 5F8GA 2QV6A 3IFEA 3Q8QB 4JB8B 4O3OA 5AXKA 3AY0A 3ZTPA 3MUTP 2HVHA 3MDFA 5IT9U 1CJKA 3TZWA 2U2FA 1J2VA 5K20B 3GB0A 2KRRA 1R0CB 4A47A 1JNZB 1R89A 3QGIA 1D9DA 3BBFA 3S01A 3CJKA 1FF2A 4EEYA 5AJ3J 3IMQJ 3D1OA 2QLWA 1LW0B 1YSJA 3GR1A 1HMVB 3IBWA 3NGSA 4I6YA 3I4HX 3MFHA 1YRXA 3ZTQA 2ZBIA 3G6XA 1UVJA 1RB0A 4JI6J 4B9VA 4V19J 4DR3J 3GIJA 3K8VA 4CNYA 1GK8A 5EN1A 3M6XA 2HNYB 3MR5A 3H5UA 1IWGA 1HFEL 4NE9C 2MLZA 3FC9A 1KWMA 3BGLA 1HHTP 4EYIB 2I1RA 4F7VA 2N3OA 1RABB 2AEMA 4L6V3 4WIIA 2VONA 3UPFA 1X4EA 2NQPA 4UF4A 3P4UB 2RKIB 4QU7A 4C9DA 2K06A 4JI3F 5HMXA 4KPYA 1TUGB 1IBLJ 4DR5J 3CO9A 2F9JA 3H5YA 2X1AA 3GIMA 2W9AA 3S1TA 2W7PA 2AYBA 3VVTA 1UPPA 1CVJA 1EKRA 3HD1A 1VYAA 1HIYA 2HS3A 2DH7A 1S79A 4OZ2A 4ECYA 3R5CA 4USJC 2QLXA 5IC6B 2EKNA 3NS7B 3D6MB 4DU8A 3EGNA 4WTOB 1U2CA 2BQRA 3CD0A 4Y2KA 5KFQA 2MKSA 4I4BA 2ZOFA 1VIOA 2FJBB 1TKTB 4LSNB 1X0PA 5IV3A 3NGTA 2COLA 8ATCB 1YRTA 3HSGA 1BQMA 3ZXWA 3W66A 2BW2A 1A6LA 1PKUA 3IRXA 2X7IA 4YDDB 1VC5A 2DNMA 2DHHA 5B09A 1QSLA 5ETMA 4I2QB 3KTQA 3DLLQ 4WTYA 2FZKB 5LT5A 4KHMA 5E2QA 4CT9A 4A8YA 3PW2A 2ZH1A 1FVSA 1WC3A 1U24A 1E6VA 2UVRA 2F40A 3OTCA 4Q5VA 1NXIA 4GC6A 3CCQS 4JV5F 1XNRF 4B3SF 1RXOB 4YN3B 1HQEA 1YK9A 3DDNA 4F4KA 3HP6A 3M8SA 4N41A 3GCXP 2CPJA 2JC1A 3RBZA 3Q89A 4N8NA 3B8HA 3CJ5A 3DRSB 4QYRA 4WF9Q 3CDBA 4ZPDA 9ATCB 4ECUA 2NSCA 5GADI 2VG5B
chains in the Genus database with same CATH topology
3T9NA 4K5SA 2AJFE 3TVYA 3K5LA 5A8RB 1L5UA 2M0GB 1YBAA 2YKAA 2EPIA 4ZDNA 4RUHA 3Q2TC 2M8HA 1RQ0A 2XSFA 5L8RC 2I9SA 3VF0B 1HD1A 5BJRA 3DLEA 1HWJA 5HO4A 1IBKF 4OX8A 1NHVA 4U67Q 4M5DB 2WCXA 2YNHA 4IRKA 2KTQA 5C24B 4ELUA 2P6SA 3O6QA 5E3CA 4ES1A 3DOLB 4PXCA 2PC6A 3PRDA 4DX8H 5G0RA 5KFIA 4FF2A 1DQ9A 3KNAA 1B7FA 4QWEA 2XZWA 2BQUA 2J6UA 4OJ1A 3SCLE 4HL9A 2MSTA 1URRA 1N5YB 1JLFB 3E01A 2RS2A 1S72S 1KS2A 1CSJA 2WB4A 4ID8A 5B0BA 3MOJB 3V4IA 4GMKA 5LSRA 5F9NA 4OI3A 5DG8A 4DFPA 1R3NA 1TK0A 4TLQA 2GCFA 4DL3A 2DNLA 2AX0A 4X66F 4DQPA 5K8OA 2DR5A 4BWJA 2MHEA 5DDOC 1FVQA 2DGVA 2F7VA 4A8OA 3RBEA 1UVIA 3GZ7A 5KOWA 5M2PA 3MR6A 4Y65A 2IJNA 5L1KA 3NMRA 2W24A 1M0SA 1XR5A 2J9EA 3AHPA 5T14A 4WFBQ 2X1BA 2KXHA 4QW9A 4K4XA 5C25B 2CPIA 2CPXA 3NMAA 3SDEA 4IDKB 1VOMA 2FVSA 3IAM9 4FPRA 3NL0A 3OL7A 3B78A 1K1QA 2BVZA 3ISNC 1U45A 2YWKA 1YQHA 3I82A 1M5VC 5HL7Q 3QO9B 3DOMA 1SIZA 4G1QA 1MW7A 2HHQA 4DR1F 2AF6A 2OPSA 4MIWA 1VC6A 1OSCA 4OHVA 3CCRS 3U1LA 4DBQA 4O3RA 2ILZA 3TAMB 2O5DA 4NLDA 1KHWA 3DU6A 1YRUA 2HLUA 3LP0A 2F1FA 3CT9A 5D77A 2R8JA 2MZRA 1GT8A 2HS0A 4KAIA 2DIVA 2VG6B 2CJKA 2IM3A 4HKQA 2M4MA 2OPRA 2XGQA 2CQCA 4C3LA 4NLYA 1XC9A 3HZGA 4RBUA 1P9QC 4YR3A 3SZ2A 1TFYA 5KTQA 3MF5A 3V6DA 3W2WA 4K4YA 2O66A 4F26A 2JC0A 4W92B 4M63A 4RBTA 1SKRA 1QY7A 2XLIA 2BDPA 5IQQA 1WI8A 2MZQA 1HW8A 1QAXA 4PQUB 2RU3A 3LUYA 4OX7A 3M05A 4PQAA 4IFVB 4KHPF 3DI6B 2RS8A 1OO0B 3DRPA 4X64F 1XBWA 1FT8A 4C0OC 2HNDA 2VC1A 3VAHA 2ZD1A 1HNIB 4F4WA 2GO8A 4NXMF 1LQ9A 3MHYA 2WRMA 2OH2A 1KONA 3GILA 5KAKA 3DYAA 2GHVC 2VL1A 3HVRA 2YWFA 1TL1B 3SI8A 4DR2F 4NL5A 3H2LA 3T6JA 4A8FA 1KVJA 1YVFA 2OFHX 5CQGA 4AFFA 2QEXS 2UP1A 5EX0A 2E5LF 1UVLA 3LF0A 2B0GA 5HROB 2PA8D 1U1PA 3PW7A 2ZZMA 1N5QA 4ZP6A 2HW3A 5A8KB 3CPWR 3M32B 2ZNYA 3ICLA 1RDRA 4F3MA 2KN4A 4OZ1A 1UJ6A 5U47A 2JFKA 4EFAC 2G9OA 3G8TA 2W9CA 2L9WA 2C3UA 3TQ1A 3BQ0A 7FDRA 1I94F 3BSAA 4FXWA 3DLGA 3SDEB 1VQ8S 5IWAF 1VHFA 4OHZA 2YKNA 1S9FA 2M7SA 3HVTA 2N3LA 2CZ4A 4C2MA 2OLWA 4DV1F 5J1PA 3OSNA 1S6UA 2NZ4A 2YKPA 3MM7B 3QGHA 1RT4B 3OJSA 1FKAF 5SZTA 1BQNA 2YTCA 2AGOA 3M8PB 1HNWF 2B7CB 2MSSA 3MECA 5LSLA 1U48A 3EZ5A 4R8UA 2DR9A 1SUQB 2MJNA 2JVOA 1JIHA 2FC8A 3FEZA 3G6ES 4E8UA 3DLBA 2Y1IA 3SV3A 1LWCA 1Q4RA 2ILYA 4DF4A 4JV1A 2RQMA 2FHJD 2PMZD 1FCAA 2E29A 3M2UB 2K8GA 3LP0B 5K8NA 2FHKA 3MD1A 4CO1A 1U1OA 3PW0A 1O5JA 4NOHA 4HDHA 1N6QA 2E1MC 3CDUA 1OPIA 1CG2A 3N5FA 1KR4A 2KVIA 3PJXA 4P7TA 4QW8A 3BJYA 3BQ2A 4C8YA 2FTRA 4NLVA 2CQPA 3MWBA 3SXLA 1C2PA 3HHEA 4HH1A 1R31A 2DHSA 4DG1B 5KT4A 3PO5A 5CYMB 1X8DA 1J5EF 3KHRA 2CQIA 1V9OA 3MGJA 4KSEB 1JX4A 3KHLA 1FERA 1UEVA 2D3UA 3SMZA 2FHOB 3OBIA 4X2BA 4NPOA 1QVFR 1APSA 4KIAA 2ZOMA 1KSPA 4QR0A 2FPHX 4RUAA 4DSFA 1RT7B 1RT3B 3S6EA 5I3QA 1N48A 4Y34A 2ZH2A 3RTVA 2XB2D 2DNZA 1DJ0A 4O4GA 4C11A 2OPQB 4C8LA 2IBOA 5GAHI 2Z0GA 1C1BA 5JVGQ 2F3JA 4KFBA 1KEKA 3WBZA 2DCUB 4ZS6A 2WOMA 3D0IE 3DXBA 1QE1B 4B9LA 3W7BA 4XPCA 5GVQA 1YIJS 3UCGA 2OP5A 1IBMF 1FKPB 2YX7A 2W8LA 4C8ZA 3W2VB 4B02A 3MFIA 5JJBA 1LW2A 1S6QA 1GXUA 2BM1A 5LJ5Y 5T7LB 5AJ3F 2J7KA 1UEUA 2GIQA 2XULA 5T41A 4DOZA 1VQOS 2KZMA 4OI4A 2V4JB 2BBEA 2MMYA 2BUNA 2JDJA 1S97A 4PPDA 4ECSA 3D54A 2KT3A 2KI2A 2ADBA 3PW4A 3MM8A 2MB0B 4HLBA 1WHYA 4NYPA 2KFYA 3DGPA 1RT5A 5A6PA 2DK2A 3OL9A 2CIMA 3DMJA 4C8MA 2RMLA 3WX4A 4X4RA 4K4ZA 2CRLA 1HWKA 2LXFA 2IBKA 4WK3A 4L3NA 2KHCA 2FVPA 1HBUA 1XN9A 1DURA 5EGYA 2UVWA 2UXBF 2YH0A 5LMUF 3DLHA 4PUOA 1HBNA 3TP2A 5J1EA 1FJGF 2K1RA 2KHDA 3Q8SB 2R2SA 2ZH9A 1L3SA 2KJVA 4CTAB 1WI6A 4DR3F 3GWCA 5KT6A 3I0SA 1Y9OA 2W9BB 2IFXA 3DFEA 5D4OA 4ZVHA 3TAQA 1EP4B 1Q86T 2GO9A 2D3ZA 4MKAA 3O5TB 1NK6A 4UUXA 4Y00A 2HWHA 3KYLA 4LIWA 5IT9Y 3NAIA 1S77D 1V6HA 1O0PA 4ETXA 3O8WA 2C2RA 4B3TF 2WONA 3X1LB 3IR5B 1C4AA 2IMOA 3IR7B 3LGMA 4KV8B 3MMBB 1C0UB 2CQ2A 2VD3A 4UQTA 5I3PA 3GG1A 4QPXA 5AXLA 1NHUA 3MUVP 5LMNF 1M5OC 4IFYB 4ELVA 3HXMA 4G1PA 2MQPA 3QIPA 4C8OA 2IM1A 4V19X 2IYGA 5LJ3Y 2LQ5A 2GIRA 2VODA 4ID5A 3CJ0A 2JHEA 3LH2S 4R0EA 4I67A 3OTDA 2PT0A 3RYLA 4CO5A 5E3QA 4X4TA 5B7WA 5LSOA 4MMOA 1IBLF 3P96A 2WOMB 2DO0A 2P9GA 2BV3A 5HMYA 4DR5F 3K0JA 1UW4A 2DITA 1IKXB 2Y0SD 5I42A 2ZH4A 4XIUA 4WFZA 2OMOA 1GTEA 4R5PB 2AGPA 3PY8A 3CDEA 2RILA 4J9PA 4ZCIA 4WE1B 2CPZA 2ZBCA 2XG8A 3QPIA 2Y1JA 1S1UB 3NS5A 3RB0A 1MU2B 3O2IA 1I1GA 1RTIB 3D0HE 2CJ9A 3MOZA 2D3OR 4C97A 2MYFA 3M1VB 2VA2A 1BWEA 2EWHA 3BSCA 3H40A 4QIEA 1Z2LA 3KLEA 3SCIE 5K8MA 4X4VA 4X84A 1DHMA 2OKQA 1S76D 4B3OB 4EZ9A 3FGVA 1WACA 3TUZC 1SJ3P 2HHHF 4DEZA 3THTA 2CJBA 4OI2A 1ZM2A 1QM9A 3H59A 3CXCR 1FE4A 1IKVB 1R43A 3DM2A 2DCLA 5BYRA 3OLAA 4CCHA 3CGIA 3CWJA 3KLFA 3QJLA 4X62F 4DDFA 2R2TA 2B6AB 2ERRA 2E5GA 5KFUA 1B64A 4ECXA 3SSRA 3U1MA 4K59A 3LOUA 5A6WA 4ILLA 1TL3A 1FEEA 2ZVSA 4NLRA 3UI3A 2FJVA 1MSWD 2V8GA 2FLNA 3CIZA 1IM4A 5FDLA 3BGRB 4A4JA 1HNXF 1Y3JA 5H9EJ 2VB6A 1XERA 2IA0A 1L3TA 2ZJQQ 2BABA 4YEAA 2IC3A 2JOQA 1CLFA 4RNMA 1S6PB 3RU0A 1RJJA 2VBXA 4KBIA 2Z8QA 5IM0A 3KJVA 1EETB 2VUGA 5DLFA 4DQSA 2G13A 3HFKA 2DB1A 4MYUA 1S1VB 2A10A 1AFJA 5CXTA 1XR6A 2GHWA 1WEXA 4USHA 2VG7B 5KFBA 3CJ2A 4X4UA 4JI1F 3KNGA 1GNKA 3MM6A 3T1YF 4JV0A 1WWHA 1R8BA 2MKIA 4F8RA 5E33A 2UUWA 2HGMA 3H20A 4HYKA 5KFKA 2R7XA 4B3RF 1TKXA 4PWDB 4UQGA 2J9CA 4B17A 4QPTA 2RSQA 1T7PA 3THPA 3M2VA 2K3IA 2OPPA 1U1LA 3FMBA 1KN6A 2RH3A 1XTZA 3LW5C 2FVCA 2QA4G 1FKOA 5DDRC 4DL6A 2WK4A 1G3OA 3CJKB 3H5SA 1Q1KA 1FRLA 5DM7Q 2YQ3A 1NJWA 1IQZA 3MMJA 5I4MA 4DFJA 4GO5X 3ENWA 1KLMA 4KQZA 2EFGA 3TVKA 4RW4A 3C6UA 1T03A 1FDNA 2XEXA 4TY8B 1SI9A 1R8HA 3BB5A 3FFIA 3MMCA 4JI2F 3VQSA 4F67A 1T8EA 3HHLD 3LP1A 2QMWA 3PACA 1HBOA 3OL6A 5KFEA 2JSXA 1M1KT 4EBDA 2PDAA 3UCUP 4B9TA 2N4DA 2E9TA 4QWDA 2ACYA 4D3HA 3ISZA 5LXRA 2V9KA 4EBCA 2FHJA 1Q81T 1P27B 1U26A 4P6QA 4OX9F 4E98A 4QR1A 5MAOA 1W2BR 1SV5A 2B5JB 2CQDA 2LYVA 2XBPA 2DPJA 1TR0A 2C3OA 2L41A 4IH7A 3OXFA 4Z37A 4IG0A 2XNRA 4LSLB 3HJFA 2ZE2B 2KG1A 1KNZA 2U1AA 2J7UA 1TL3B 1PO6A 4G1IA 1NU4A 4MJKA 1DTQA 3K5PA 2ZZNA 5BR8F 4MK7A 1A7GE 2XI3A 4NLOA 1CQNA 5D3GB 2MGZA 1LFWA 2DH8A 3LP2A 5A0YB 3CD7A 1Q7LB 4UW2A 5EX3A 4A8WA 4OLOA 4FXDA 4TU7A 2CVEA 4J5OA 4C0BA 5CD4H 4HEA9 2OSQA 3KLGA 1E6YA 2XCAA 3ZZYA 1JKHA 1S1TA 4DFMA 1S9GA 4F4ZA 2IRUA 4DV7F 1DBDA 3OXLA 3KMSA 5DO2A 4ED2A 1RTHA 3R27A 3V2UC 3NRBA 4NX9A 5KFWA 3I0RA 4F2RA 4CH1A 4LFCF 4KJIA 1T05A 3IWNC 3KK3B 1D9AA 4ED5A 4I7FA 5CHCB 3UD4P 3BO4A 2VPWB 5DJBA 4X65F 1TKXB 2BM0A 1DAXA 1S49A 3KHHA 4I0WA 2VKRA 4WCEQ 3V81A 1ZH5A 1IKWA 1JLGB 2R8KA 1UETA 1JLAB 3SSQA 3UNGC 1FE0A 1OWXA 2FDNA 2BE2A 4LF6F 1FDAA 2GGPA 3UR0A 1UWBA 4TNOA 3PRBA 2ZH6A 1HI8A 2DPIA 1RTJA 4QZVB 2AW0A 3G6YA 4Q7AA 2B4PA 2J6TA 3NCPA 2HG4A 3MEKA 3NNAA 5K5MA 1NK0A 4C3MA 3FCHA 1R0AA 1UJ5A 2R7SA 3QJJA 3CD6S 4K0KF 1LKZA 4C98A 1YJNS 2M5YA 3JSYA 1RT6B 1B0VA 2ZHAA 2GJIA 4RW8B 5F0WA 1KRPA 2RNEA 1LWFB 4ZPBA 4N77A 3PHEA 1R8AA 3SYZA 3RW6A 2R7OA 1VQPS 4FF3A 3K5NA 3U1NA 3MMAB 5E3AA 2HMIB 2PE8A 2RF2B 2XS7A 4LIRA 2OTLS 5J1NA 3I32A 3GSDA 4C3KA 2LXIA 1S10A 1B0TA 2C3MA 1QJHA 1YG0A 4LF8F 4Z2XA 2EFNA 2HRYA 4F2SA 3M2RA 1X4BA 1WTBA 2M52A 3EGWB 3O44A 2LU2A 3T19A 3E2EA 3C3LA 5C42B 1FRIA 4JV2A 2HHXA 1P1TA 4X4PA 3M8QA 3TUJC 2QA4S 3M30A 5GAHU 2QRRA