1TL4A

Solution structure of cu(i) hah1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Copper transport protein ATOX1
publication title Solution Structure of the Apo and Copper(I)-Loaded Human Metallochaperone HAH1.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl4A00
5F0UA 1X8DA 2AP6A 4OJ3A 1OPZA 4Q2MA 5F0WA 3TRGA 5B0BA 2OFHX 2N7YA 3BGUA 1FVQA 1ULRA 3K7RA 1TL4A 2XMJA 3HX9A 1WD6A 1YJTA 2N4DA 2XMTA 1MWYA 1YJRA 1P6TA 2HLUA 2K7KA 3BR8A 1X7VA 3HHLC 2ASYA 2OD6A 1YG0A 4YDXA 1YJUA 2KYZA 2FTRA 3DXSX 3GZ7A 2KT2A 3BM7A 3FRYA 3HHLD 1W2IA 3FMBA 4A4JA 1CC7A 1CC8A 4DPOA 4Y2MA 5B0AA 4Y2KA 2GV1A 2IFXA 3KNGA 2ZDPA 1VQSA 3DCAA 1Q8LA 2AW0A 3HDSA 5K9FA 2L3MA 2OMOA 3CJKB 1FD8A 3HHLB 2CRLA 2GGPB 2RU9A 2IYIA 1Q4RA 5B0EA 1CPZA 4QOTA 1S6OA 3QMQA 3WDOA 3TNVA 2BJEA 2W4PA 1SB6A 1FESA 2K2PA 2XMMA 1AW0A 3VTIA 1Y3KA 1P8GA 3HHLA 2GGPA 2XMUA 1Q8BA 2ACYA 4A48A 3I9ZA 4HI2A 2W4DA 1Y3JA 4DL0C 1YRXA 2BYCA 2BJDA 2G9OA 4HI1A 1APSA 2QYCA 1FEEA 2AJ0A 2LQBA 3MCSA 5B0CA 5B0DA 5B0GA 2VH7A 1TL5A 4DN9A 2HQIA 2OAUA 4NL5A 2PGCA 2BUNA 4HL9A 5T7LB 1OSDA 4HH1A 2OKQA 1N5QA 4ZOSA 1X0PA 4OIXA 4Y2IA 5B0FA 1S6UA 3FGVA 4HH0A 3LGNA 4OJ1A 1Y9OA 3QGPA 2GO8A 2GFFA 3KG0A 5KAKA 2K1RB 1XBWA 2QLWA 2KT3A 3KG1A 3LO3A 1N5VA 1GXUA 1Y0HA 3CJKA 4A47A 2W4CA 1YJVA 2QIFA 2PD1A 2LQ9A 2Q3PA 2RILA 2OFGX 2K1RA 4ZA1A 1K0VA 1R6YA 2OP5A 2ROPA 2BBEA 3KKFA 4FNIA 2GA7A 2HFOA 2HIQA 2ROEA 1KVIA 5A6PA 3HFKA 2GCFA 4YEAA 1N5TA 3MZIA 2ZDOA 1AFJA 2HFNA 2IYGA 2XMVA 3HF5A 1TZ0A 2FHMA 1KVJA 1URRA 2AJ1A 3BN7A 1OQ3A 2HLTA 1FVSA 2RMLA 2FIUA 2ROGA 3F44A 2FB0A 1SQEA 3IWXA 5A6WA 1TR0A 1FE4A 5T7LA 1OQ6A 1N5SA 3E8OA 2OD4A 4F67A 4U9RA 3TOQA 5IXUA 4OJGA 3BF4A 3IWLA 4OJHA 5B09A 1VQYA 2VV5A 2N4CA 1GXTA 2JDJA 1MWZA 2XMWA 1RJJA 3BB5A 4Q2LA 3T9NA 4A46A 1JWWA 1QUPA 1TUVA 2XMKA 1FE0A 4FNHA 1IUJA 2RSQA 1KQKA 1Q53A 1JK9B 4NPOA 1U7LA 3BDEA 1LQ9A 1SI9A 5B08A 1V3ZA 2KKHA 2LDIA 1AFIA 2EW9A 2LXFA 4EFAC 3UDCA 2K7JA 2QLXA 3LGMA
chains in the Genus database with same CATH superfamily
2DRAA 4LF8F 5BYSA 1R8CA 3TRGA 3MEGA 2CQDA 1Q16B 2K7KA 1NCLA 2JRSA 4Q0BB 2B5JA 2P9CA 2L41A 4TXSA 4PWDB 1RTIA 2B7BB 3HP6A 3R7SB 3UW1A 5HVFA 1NUEA 1SB6A 5HK4A 5GAEU 5EDWA 2HBYB 3MM5B 3D0IE 4OV6A 4EEYA 4ZKAA 2ZUAA 4KH0B 3CJ0A 3T5JA 5IT9U 3DOKA 3TW0A 3JB9k 4IOAQ 1J5OA 3WHIA 3OFHA 1SKWA 2ZOMA 1BC6A 3LWLA 1UTAA 4DDFA 1JLCB 4RJVA 4QYZJ 1HR0J 2R8KA 2V9WA 1XTZA 4AQYF 5CHCB 2QLJB 5KFZA 1I5OB 4TYAA 5GMDA 5D0GA 3DRRA 1Q82T 4ZVEA 2XO7A 4YDXA 2VBYA 4C11A 1CJTB 2J7UA 4GKKF 4DFPA 5KG2A 3V6DA 1LFWA 4RO0A 1H7WA 2J6SA 1P9QC 4DV4F 3NAIA 3N5FA 4IKAA 4LF7J 3VR1A 2VH7A 4X65F 3M1VB 1RT4A 5T7LB 1WHYA 5GAEI 4A8QA 1X0PA 2E9TA 1Z4UA 4G1IA 3T9ZA 4XTTA 2WSCC 2JOQA 2LQ9A 2MKKA 1CSJA 1D1UA 3EVMA 4JI6J 2CDQA 3K0JA 4EZ6A 1WELA 1S79A 3GG0A 5E33A 4CYUA 4B3SJ 1YLXA 5SZTA 1JWWA 1S1VB 1ZYQA 3VALA 3TAPA 2EFGA 1WEZA 2HHHF 2ADCA 5AE1A 2PA3A 4LIRA 4CO5A 4Z37A 3ILOA 4Y2MA 2BM1A 3MMBA 1TUGB 4YP3A 4L6V3 3MUTP 3QMQA 5D78A 3LPYA 4NLOA 3FZBA 1U0HB 2V94A 2ACMA 3QSYB 4QYZK 3SSQA 2RF2A 5K14B 4P2FA 3B8HA 1ZTTA 3BO2A 3RR8A 3FGVA 2OH2A 4EU0A 1RB0A 5DETA 4ILLA 1RBOB 2HHTA 4ZMMA 2F7VA 2VA2A 3M32A 2XTJP 4DZDA 3W65A 5DQHA 4DZ6A 1NZ8A 4FKXA 1MWZA 2ZVIA 3VGSA 3EXCX 2L48A 3W7BA 1H3DA 4PXEA 4KPYA 4DHVA 2YNGB 3AHPA 2V5HG 2WOMA 1TL4A 4P2XA 2I6WA 2KYXA 2FGOA 3W63A 3MMCB 4A8YA 2IPOB 2RDJA 1RT1A 3OTOJ 4ZVHA 1MU2A 3MECA 2GW8A 1FESA 3P49B 1M0SA 4M5DB 4TU8A 7FDRA 5B0GA 4R8UB 1TKXA 4B3RF 2JH3A 1YRTA 4FKYA 1CJKA 4YDDB 1F9FA 2DNGA 1JLAB 4Y3CA 4XPEA 4P10A 2CQ0A 3H4DA 3H25A 3TJ9A 2ZFHA 4JI7F 5DDOC 1VRUA 2OPSB 1FNMA 4ECYA 3P4UB 2GMLA 2ZM6F 1FKAF 5I3UB 5E3RA 2DNHA 3IR5B 5KG5A 4TLRA 3VAGA 1VK8A 3PW5A 1DZ5A 5J1EB 3MFIA 4PKDB 5D6GA 4ECSA 1AA1B 1WWHA 3H59A 1RWWB 1FI4A 1CC7A 4AUKA 3E01B 4CP5A 1Y00A 1LWCA 4HACB 1UWAA 4P71A 1EETB 2A10A 4K7QA 3J80Y 1LWFA 4WU3A 4ED1A 4DFJA 4DX7A 3MHYA 1HNZF 2OPQB 2IDEA 2GO8A 3C14B 1XBWA 1S4FA 1D9FA 2YWFA 3JTNA 2MKYA 4O23A 4YB6A 3FC9A 2BBEA 4QIFA 1RT6A 2O01C 4ECVA 2R7XA 3NWRA 4PXDA 5E3PA 1QVFR 1AZSB 3AA8A 4OZ0A 3LP1B 4AFFA 4KV8B 2DRDA 2COLA 5AE3A 4I69A 1BQMB 3EXYA 3BJYA 3ET6B 6FD1A 3H7HB 5ETPA 3CMES 3GYGA 3OFGA 3MAQA 3GV5B 1FNXH 4PQAA 3I0RA 3FZ2A 4GKJF 2OSQA 4WKRA 2V4JA 3AB4B 1SJFA 1RABB 3HULA 4UTGA 1EIYB 3MEDB 1KR4A 3T1YJ 4C8MA 2DVIA 1DLOB 4ZHRB 3BKTA 1IVZA 3B54A 3Q2TC 4I68A 4DUYJ 2M0GB 3BSOA 4ZLPA 5FLXU 4WP9A 4JI3J 2BKNA 1NU4A 2C1EB 1NSAA 1Q78A 1DHMA 3ZO7A 2HFZA 2UVWA 4FN5A 1PG5B 4H4OA 1LW2B 1SIWB 1U1QA 3PG9A 1L3VA 4DR1J 2DGTA 4DLEA 4GC6A 3THPA 1SUQB 2XS5A 2H3EB 4LT6A 3QRRA 3PV8A 1XK8A 3RAQA 3CC2S 4FF4A 1Y5NB 2BMBA 2CNLB 2UUWA 4K4YA 2V2VA 2B5JB 3IFEA 3LW5C 4EBDA 2PA8D 2RUGA 2FHKA 3QATA 1ZM9A 2WW8A 1RTIB 4BWJA 2FY1A 1M5HA 4YHHF 2UXDF 3MM6A 1BQNA 5H9EJ 2AEMA 2IBKA 1Q7YT 5ETNA 2NUUG 3V81A 1UA0A 5GADU 2GGPA 2JHEA 3FSXA 5EWFA 2JJ4D 4FBUA 2F63A 1TP7A 2C2KB 3WX8A 4FYDA 4RBUA 3DOKB 4HTIA 1U45A 2VQFF 1S6UA 1J5OB 2XULA 1UZDA 2RVJA 5FLXY 2CPHA 2M3DA 3BREA 1U6FA 5HMWA 1UJ6A 4WE1A 5C25A 1U09A 1LNQA 2FIUA 2X3DA 4LR8A 1P27B 4ES3A 1FRHA 3IAM9 1VQYA 4ALZA 2ZHAA 1N34J 3GR0A 4FXDA 4DL3A 5CCLA 3DRRB 2VG7A 4HHJA 4DL7A 2XGQA 3VAMA 4C11B 3PHEA 3BGUA 3MAHA 3RB0A 3VWSA 4NOHA 3J7AN 4QPTA 1OJ4A 5LJ5Y 2XQCA 1NNDA 3WC0A 4WBFA 3KOAA 1RWUA 3HVWA 5C5JA 4DR4J 3LWMA 1N32J 2LEAA 4DSEA 2I38A 1UPMB 3QLHA 4RPFA 2D3ZA 1FDAA 2DNRA 4KYZA 3ZZTA 2HHSA 3CMQA 4NL5A 3EYZA 4FXWA 2BQ3A 4OIXA 5GADI 2ZHBA 3DN9A 2MY7A 3MM9A 3LTOA 1WC4A 3KHGA 3UDLA 1N5YB 3TQ1A 5LSLA 2XY5A 2QEXS 4TQRA 1HR0F 2W25A 3FBBA 3R7BB 1TK8A 4NLRA 2BVZA 2BKOA 2ROGA 3CDEA 5HN0A 2IM1A 1H7XA 2W7PA 2DB1A 3CJ8A 5DZ7A 1PBUA 4WKYA 5H9EK 3M6XA 3S1TA 4CO2A 1H38A 4OZLA 4MK8A 1ZA1B 2DBBA 1BUXA 3UDCA 4CO0A 2W7AA 2N82B 1FWPA 3H40A 2UU9J 2VUGA 3MMBB 3DXSX 2ZE2A 4TY9A 4JI4J 2KFNA 4LF7F 2HS3A 3KJVA 5KT3A 3ZTPA 3SI8A 2J9CA 4CLZA 5C24A 3GLJA 1I3OB 2ADBA 1NPPA 1DY3A 3RYLA 4KO0A 3UR3C 1PGZA 4ECQA 3M30B 1NAQA 1SVDA 3M8RA 1HNWJ 1PJ6A 2J9DE 4MIWA 4DV7J 4IG3A 3ULHA 1RZMA 2V0NA 4JI6F 3M32B 3MM8A 5ETLA 5KFBA 3SV3A 2VHGA 2ALZA 4B3SF 2DISA 1FRKA 4XDDA 5IOLA 1TR0A 4IUFA 3AD8C 3NGKA 4ETXA 1JJHA 3UNYA 3VCDA 3HHDA 4C98A 1YJ7A 1KQKA 1NKCA 2WOMB 5ETRA 3HD1A 2GX8A 1SV5A 4YUDA 1VQPS 2KM8B 1GMWD 3OSNA 4EZ9A 4WIQA 3CO0P 1RT1B 1FTRA 4U8VA 3MECB 2JVOA 1U02A 3A3PB 3ELHA 2CPIA 3CO9A 2WW4A 4C6AA 3HHLA 1Q8BA 2BYCA 4ES1A 3CXCR 3IC1A 1L3KA 1CJKB 3VVTA 2F8HA 2W9BA 3CCES 2HK3A 1S99A 3ADAC 2EK6A 2KH9A 1O6XA 5DDRC 4CIOA 3Q0AA 4YFUA 2R2SA 2B51A 4WPAA 2RAQA 4DU8A 1TL7A 3JAMU 1FWLA 4B9MA 4ID5B 2A3JA 1OY9A 2KTQA 3HT0A 4KHMA 3BBCA 3ISNC 3TARA 4FYYB 3QZ8A 4ZP7A 3RRKA 2D3UA 3Q8SB 5F3ZA 3A3OB 2VC0A 4X66J 4MKVA 5KFOA 2WSFC 4KGXB 3OTOF 3KHHA 3CSKA 2HWTA 5IC4B 1LWCB 2XYGB 2CA9A 3D3BJ 4B3MJ 2A18A 2R7WA 1JXEA 1CPZA 1U2RA 4H4MA 5HQLA 1LWFB 4ZLJA 5IQQA 1FDNA 3G71S 2PFDA 2YPZA 3OVSA 2DH7A 3VZHA 4OZ2A 1N36J 2GMHA 3QBCA 4QBUA 2WVCA 1GX6A 3F73A 2F4FA 3ZTSA 1LOUA 1TU0B 3TA0A 1PYSB 4OI3A 1WC1A 4CM2A 1QSSA 3KWMA 3WBZA 1RT6B 1YIJS 3KK2A 4PQUB 3HJFA 4LQ9A 2Z4PA 3HCXA 2OPPA 1HPZA 2VICA 4RW9A 2R9LA 1L5UA 4JI0J 3DDIA 3PX4A 3JYTA 2JC0A 1GXTA 5LXRA 1HWUA 1D3WA 3HFZB 2CZ4A 2Y1LB 2W01A 1R0CB 2AU0A 3I0RB 2XCPA 3QIPA 3D28A 1HBMA 3TEGA 1YJRA 2V4JB 1YJUA 1N48A 4AYBD 2NR0A 2KHCA 2BW7A 2JVRA 1GX5A 5KFAA 3LP0B 2MLXA 1YDLA 1CC8A 3GU0A 1BQXA 3R5BA 4LF9J 1S6QA 3TYTA 3RBDA 2YH1A 2VFUA 4QWAA 2LECA 3BH7B 3PYFA 1YSJA 2DRBA 3H5XA 3P5BP 4OZ5A 2GO9A 1FEEA 2R7TA 5ETSA 3G4SS 1IKVA 4MIAA 3CJTA 3VF0B 4QR0A 3AD9C 3U02A 4ED6A 1FFWB 3DU6A 4H4OB 3KG1A 5GMKa 4PRFA 4B9VA 4J91A 1Y5LB 4OZ3A 2V50A 2Q6BA 3D1HA 3M9NB 4J5OA 1N5TA 1T9WA 1C2PA 2D3O1 4KBIA 1S12A 1OQ6A 3W8PA 4R25A 2G0IA 2ZJPQ 2CZVC 5DG8A 4DUZJ 2R2RA 2DR7A 3K58A 5M2RA 2XI3A 2D69A 3U1MA 3ZZ0A 1UEKA 2K8GA 4UZCA 3K7RA 1RCOB 3GIRA 1H0HB 3G82A 4DCPB 1BQNB 2VONA 3BM7A 1ZBTA 1W2IA 3T1YF 4CLTA 1KN6A 4IFVA 3V81B 1HBUA 1NH8A 4O4GB 2V8DA 2GGPB 3CD7A 1R8AA 4R0EA 4L3KA 1TFYA 2C2MB 5KFQA 3Q2SC 4JI3F 3DLLQ 1KC8T 5HROA 4XDCA 2PO4A 2BANA 5DDPC 5E3AA 2HHUA 3I9V9 2NZ4A 2KRBA 3H42A 2UVVA 4WE1B 3CJ3A 4DR1F 3CJ5A 2IJFA 4F4KA 3DI6A 3PIOQ 4QR2A 4S0MA 1EAYC 1RTJA 5E5NA 5AXNA 3W1YC 2P6SA 4Q8EA 2EWHA 4TN2A 2DIVA 1N8RT 3RB6A 2RS8A 1VQ6S 5HMYA 3TJ8A 2RKIA 1FCAA 4I6YA 1T05B 2CXEA 4DFKA 1Q53A 5CYMA 1HD1A 3BDEA 2GHVC 5M2UA 2AX1A 4DLGA 3KLEA 2VPZB 1IJFB 5EWGA 1HNXJ 3KUHA 2OD6A 7AT1B 4NA2A 4RNOA 3KG4A 4DQSA 4U6PA 3NG8A 1N56A 1FNOA 1X4FA 1FD8A 4ZLNA 3KLGB 1KSPA 3QLHB 3QT8A 4OHXA 4X4QA 1NDKA 1JLFA 3MD3A 5CA5A 2V2ZA 4B02A 4FBTA 4I1TA 3JQMA 2HHWA 1GXUA 1NMEB 2MXYA 2UVUA 4DN0A 5M2PA 5KTQA 1PCAA 3C6UA 2X1GA 1N34F 2EVZA 2ZOGA 4AT1B 1SQEA 4ELTA 4HVZA 5HVHA 1U8WA 1N4LA 5KFUA 3DRSA 2FJDB 2LDIA 4OYZA 3N6MA 2BEFA 2OMLA 4HT7A 3A8KA 4DR4F 4NYPA 4ZVUB 2WAQD 2IIHA 2Y8WA 3G86A 1N32F 3KJVB 1U49A 2QMWA 3MCMA 3RR7A 2BXJA 1WHXA 2R2TA 2V2KA 4DMZA 4OYOA 3BR9A 2FLPA 1AW0A 3GIKA 1XWLA 1DURA 4WIIA 4KO0B 1SC6A 3PW7A 3K57A 4YQWA 5DQGA 3Q23A 2HQIA 1KRPA 5F8IA 4IG3B 5KG0A 1RTDA 3MM8B 2LCWA 1B7FA 4K4ZA 4I2PA 2CQPA 3D6TB 3VGUA 1QD1A 2JL9A 3BPSP 2GA7A 4DI6A 3MOJB 3BKUA 5ETTA 4X4OA 2C2ZB 2GQCA 3W5YA 2XWYA 4DF4A 3D66A 4UOHA 3D5MA 4DV3J 2RQMA 4KGKA 1SV5B 3GFHA 1LQ9A 1J27A 1JLQA 5HLFA 3LGMA 2UU9F 3Q8QB 2YX1A 1S1TA 2FDNA 1L3UA 2Q66A 4RNNA 2JLEA 2RD5C 5KFHA 1FA0A 2HQGA 1S72S 3KK1A 1VDHA 4WZQA 1HI8A 1OY6A 1NKEA 3AQPA 3HHLB 2AGOA 1NK0A 3DM2A 2H5EA 1VR6A 3IWNC 3PR5B 5HQMA 1Y3JA 2UZAA 1HNWF 2A0FB 5E3CA 4XPCA 3J7A1 3MEEA 2YPYA 3S01A 4DV7F 1HQEB 4FPIA 2YQ3A 1S0MA 3JQJA 2LQJA 1HL6A 4TNOA 3BYRA 1PJ5A 2VB6A 1R6YA 4UUXA 2HRUA 1QE1A 3G6VA 1LK5A 5CH7B 4KIAA 2MGZA 3TQEA 4QCLA 3GFZA 3M8ZA 4KHPJ 3A1YG 5IT0A 5D4NA 4KPCA 1C1CA 1HBOA 3GJSB 1Q5YA 1CULB 3BSAA 3W2VB 3PM9A 2ZZTA 1R0BG 3UWTA 2GAGC 4DFMA 1R0AB 5LMUJ 1GK8A 4EBCA 4IOCQ 1TFWA 5RUBA 5J2MA 2RT3A 1JLEA 1MN7A 1WG1A 2DEIA 2MTLA 3I96A 2FYXA 2HZVA 1QVGR 1EX8A 2E29A 1NSKL 1IBCB 2CNNB 2JLFA 3X3UA 3SCKE 4D3GA 4WYWA 3KTQA 2XMUA 3BQ0A 4I2QA 1FDDA 4J9NA 4CLPA 5KOXA 4WFBQ 3CJ4A 3GILA 3QWUA 4C2MA 2F9JA 4H54A 3TAMA 2RQ4A 2OPPB 1B99A 1I6JA 4TLQA 2Q79A 1HPZB 4J9PA 2J8AA 2W2MP 2FVSA 4CM0A 1UP1A 3JYTB 1VC6A 2I5JA 2XYHB 4F0HA 5A0YA 1X4HA 3Q89A 4ZVRB 5I4MA 3CEDA 4NLYA 2L9DA 4DQPA 1WC6A 3QIPB 1LWXA 4DQQA 4ER8A 5KFCA 5CQGA 1SKSA 4X66F 2MQMA 2ZC4A 2Q43A 2OFHX 4YR2A 2Y8YA 5HATA 2NXEA 4PABA 3TVYA 3U1NA 2FJAB 4B3MF 2B4OA 4WF9Q 2C3YA 1WORA 2AF6A 2DTJA 3IBWA 4UZBA 5EWEA 4NI2B 2HK2A 1E6VA 1OWXA 3PX6A 4NLQA 2BOPA 2YX4A 5AXMA 4N76A 1N36F 3R27A 1SL1A 1YRUA 2B3TB 1IKVB 4UF4A 3MWBA 5K20B 2XSJA 2AMCB 4HH1A 2G2ZA 2ZD1A 3D68A 2V9KA 4G6VB 1CJVA 2HBZB 3ENVA 4CDIA 3AY0A 3G8SA 4N47A 1IQZA 1ACMB 2OEMA 1S49A 2DGQA 4JI2J 2MMYA 4N7TA 3GJRB 2B7CB 1V6HA 2V6AA 2LA4A 3THTA 3PKMA 3DLBA 3ILJA 3BKFA 3Q83A 3I5AA 1PYOB 3I6PA 4ECUA 1PBAA 3CE8A 2Z30B 3FBCA 2AZ1A 2B9WA 5L9XA 2V63A 3G82B 2L08A 3N6NA 2XMJA 5DM6Q 4DX5A 2F8EX 4IFVB 5KG1A 3R1LA 2AT1B 2V34A 5SUHA 4NLTA 2QA4G 3OFEA 3AOCA 3MF5A 1JIHA 1MMLA 1RCXB 2DY9A 5ETKA 4ZIVA 2GS8A 5GMEA 5C2GA 2BANB 3GJQB 3UN3A 3DYAA 1N0VC 4TKTA 4M5HA 2CJBA 4M5NA 3P45B 1UMJA 2P9EA 2ZOFA 3UFCX 1JLGA 3BGRA 1WKJA 1D8YA 1RTJB 2KRRA 2XLIA 3D9BA 1UVNA 2M9KA 2MKCA 4A8SA 4DUZF 4KQZA 1R6VA 2H4WB 1ZAXA 3BF4A 5KT6A 3FEYB 3ZXWA 4Q2LA 2XMKA 3DC2A 2XHWA 2LKZA 2ASJA 2YNIA 3FCVA 5GVQA 4NYZA 3EGNA 1FRXA 4P7TA 4C48A 3WQPA 2J0WA 2WTFA 4F04B 5DGBA 1RE1B 4HDHA 5KFKA 1FK9B 5DGAA 5AJ3J 5J2PA 3VQSA 2AW0A 3I55S 1RTHA 2H54B 1JLFB 4GO5X 4QOTA 4YN3B 2W8KA 3H4BA 2UV8A 3QFHA 1K8AT 1JX4A 2GQ2A 2CQIA 2VQEJ 1YJ9S 4K4SA 4RBVA 1B0PA 1IKWA 2VL1A 2QMUB 2K06A 4NLUA 1HWKA 1RWMB 4IFYA 5IM0A 3C6UB 2EXUA 2APOA 5J2NA 3GMGA 4UW2A 2NXUA 4NCAA 3TVKA 1X4CA 2WB4A 2DGSA 3ILIA 3K8WA 2HLTA 3IWXA 2IMOA 4O44A 2HNZA 4O3OA 2KVIA 4LF8J 3IWLA 5C42A 4OHWA 3DRSB 4QZVB 4P9SA 4E0DA 4WJBA 1U1LA 4IR9A 1VK3A 1HNXF 4ILRA 2UUCJ 1U1RA 4KKOA 4OL8A 4DX8H 2IVMA 1FJ7A 4NLPA 3THVA 1P1TA 4K50A 4KH1B 2IRYA 3Q8VA 1UL3A 2HIYA 1B3TA 5D15A 1LWEA 1DTTA 4UOGA 4C7QA 3K5LA 4F4XA 1VHIA 2GVZA 2LQBA 2BV3A 1RTDB 1FXDA 1NLKL 3BEGB 2P9GA 4I2PB 1XERA 4K4VA 3Q24A 3R3TA 3F56A 4GO7X 3OXFA 4FVCA 2OHDA 3M4XA 3MR7A 4Z2XA 1EHWA 2LXIA 3CJQA 3L3CA 2ZDOA 1KP6A 2BQRA 3OPKA 1U1PA 3N28A 4IQMA 1EKRA 2FB0A 2DY1A 3GIIA 1IKYA 4DX6A 3MM7A 1WOSA 3FJ2A 1JLQB 4K2JA 2DKOB 5HLFB 2RSQA 5D0EA 1S1TB 1TV6A 2Z2YB 2PT0A 1Y4ZB 1D9AA 1S9GA 3KK1B 4PEOA 5HANA 1S57A 2ZH5A 1GT8A 2ASYA 2OELA 2HZCA 1GFWB 2OLWA 3A8JA 4ZDNA 2CPJA 3HSGA 3DM2B 1SQGA 1VQSA 3WIUA 1Q8LA 4MYUA 2YX7A 2C2EA 4X65J 3H0PA 2BJEA 4V19J 1U47A 5EX0A 1RTZA 4CT8A 1IJEB 3AOBA 3MEEB 2G4BA 5KFVA 2XI2A 4I7FA 2QYCA 4LF5J 4E2FB 1RHRB 3VGTA 2VIHA 4C8LA 1N5QA 1RKJA 3PO5A 3NOCA 5F9NA 4ENOA 4NZ0A 3OW2R 2E5HA 2B4PA 2MPUA 2XEXA 1QE1B 3MR3A 4DR7J 2LA6A 1URNA 3CD5A 3OXGA 2QV6A 3HSJA 3NKYA 1HNIA 2EC2A 1YK9A 1C1CB 1HBOB 3R5DA 1FRMA 2VOPA 2B6AA 4DV3F 1YWXA 3G6XA 4K4TA 4JOUA 2ASDA 3M7VA 1QDUB 4OFZA 4FF3A 2XMWA 3GFXA 1PAEX 4USWA 2F1FA 5J2MB 4EFAC 1HHSA 1JLEB 1X8DA 1YZ7A 1GQEA 4F4YA 3NGSA 4ZPTR 4NMLA 3SDEA 1M5VC 4CI0B 1T9XA 2V8PA 2XZDB 2BJ3A 1H73A 2OGUA 3C15A 1WSVA 2QJ3A 3DRYA 4QWEA 4Y28C 2CPXA 2RNEA 3QT7A 5A2QY 3SYZA 3HMJG 4LF4J 2KZMA 1FT8A 4YOEA 4WXWA 2E1CA 4PXCA 4M63A 2J7WA 3TAMB 4JI1J 4CLFA 1RLDA 3ITHA 1FF2A 3KLFA 1SL0A 2ZH7A 4E98A 1LW0A 1U48A 3CC7S 4RW7B 4KHPF 3QFWA 1DQ9A 3G8TA 4LREA 2I5JB 1GMVA 2DGWA 3GFYA 4HDGA 4KTQA 3DKDA 5A0YB 5F41A 2XLKA 3BN7A 4ZVQB 2R3VA 1FE4A 3KK3A 4PPZA 3OL6A 3VQTA 1QUPA 5LMUF 1KLNA 4OLOA 4G65A 2MKJA 3RBEA 1RSCA 4IO1A 2IM0A 1I94J 1VHFA 2EC0A 2NYHA 3CDBA 3HFVA 2VF3A 4OI0A 3RZAA 1E6VB 3M8PA 5B0AA 4Y2KA 3JSYA 2E9ZA 2FD2A 4KGVB 1KS2A 2Z2LA 3M6VA 3VAHA 1YQHA 5HSPA 2C3UA 2MZJA 2XSJB 3D67A 5AXLA 3TO8A 2DD8S 2E44A 4RWXA 1TK0A 1UZHA 2OAUA 2ZD1B 5HAOA 2CIMA 5D4PA 1CJVB 3SSRA 4K2XA 1ZOTA 1D0EA 4IQXA 2C3OA 2WVFA 4TU7A 3LPEA 1U1OA 3H5UA 4A8FA 3LQVA 3L7UA 2DIUA 4OYAA 1S10A 2EKNA 4C0BA 5C7PA 2FC8A 1S9EB 4ZVFA 1J5EJ 4JV2A 2ASLA 4BC7A 3KMQA 4CO4A 4LFCJ 2YWWA 3OVBA 2FGCA 2U2FA 2FHJA 2ZJRQ 4AD6A 1ZPWX 5EX3A 5L9NA 1G1XA 1R43A 3FK4A 4DQRA 3CW2C 3FMWA 5KFWA 4B9TA 2Y9HA 1JLBA 2HMIA 5B0EA 2KT5A 3DYAB 4LVNP 3M8SA 3W2WA 4O0IA 4HI2A 1LKZA 2QL9B 1HNVB 1ICEB 4OX8A 2KFYA 2AZ3A 3UQSA 1JJ2R 1SXLA 4JYAJ 1TKTA 2FVQA 1AB8A 2I0XA 4LSZB 1DQAA 3EWGA 5HJXA 2QGFB 2MQ8A 2Y1RI 1JLGB 3Q8RB 3PJ9A 3ONQA 1NK9A 3PVXA 4JI2F 3CCSS 1ZH5A 2UUTA 4F26A 2QZ8A 4OI2A 2JEFA 5DRKA 4NLXA 1UA1A 4AL5A 2CQ2A 2FVCA 4PG6A 3PW4A 2AV5A 3LALA 4RKUC 2WVEA 1DARA 3HM9A 4LFAF 2YNIB 5FJ4A 4OYIA 3NWGA 3JXOA 2W2PP 5L1JA 1K9MT 5A8WA 1ZAWA 3QYYA 3MPVA 3N01A 4F4WA 2C2OB 2Z2ZA 1RU1A 5J2PB 1HWJA 4LJMA 4NXNJ 1RTHB 4DSLA 3M9MB 2EKYA 1RHMB 4QQBA 3J81U 2VJVA 5BXIA 4ED3A 3C8YA 1XIQA 3W64A 5D8HB 1LFPA 2G2YA 1RK8A 1APSA 1NSQA 3MDFA 3RW7A 1M5SA 4QWCA 2BOAA 3AODA 3PW2A 1KTVA 4ZP8A 1PAUB 1T9TA 1IBMJ 1Y9OA 3PJXA 4DBQA 2EG1A 3W5XA 5LXYA 1KHVA 2ZBCA 3DXBA 5L1KA 3RTVA 1JJCB 4JI5J 2Q3PA 2GHPA 1GEHA 1WJ9A 3D0GE 2B56A 1MWQA 3TZZA 1X4BA 2HNZB 3A8EA 4N8NA 3WX4A 5C42B 4M1KA 2XCAA 2C2NA 2X1BA 1H98A 3FUYA 4KKOB 2DYAA 2Q1LA 1X4DA 1RT3A 2PMHA 4FP9A 3KUGA 5AJ3F 2ZKUA 2XLJA 2VC1A 2M4MA 1S4EA 3GYNA 1S7IA 2V68A 2BA9A 2ZUGA 1LWEB 1DTTB 2HHVA 3HDSA 2ZZMA 3JSBA 2GVZB 2VQEF 3WIVA 3V6JA 2VQFJ 1FKOA 3GPAA 1F5BA 3DNCA 4DWIA 4U7UK 1NRKA 1T02A 4BC9A 4CQ1A 3O5TB 3FCHA 5F8HA 2OTLS 2K3IA 4RW6A 2E1MC 2L9NA 2M5YA 1RQ0A 2MQNA 2MQQA 1RBLA 2HNYA 1IKYB 2R7SA 1ZS6A 3MM7B 4ED2A 3NCRA 3EGVA 3U27A 2O5DA 1X5OA 2UUCF 2EFPA 3TX0A 4IOBA 1ZETA 2WONA 3W60A 3ZTRA 3MR5A 2DXDA 2HFVA 5FD1A 2BE2A 1WTBA 3LAMA 4MK9A 3TP2A 1M5OC 1UVKA 3EPGA 2YKMA 3IBCB 1N6QA 4X2BA 2A2DA 1UVJA 3M2VA 4DSIA 2C2RA 3AQOA 4NLWA 1AUSL 4I7FB 4LRBA 3CWJA 2B9XA 4WTOB 2W8LA 2C42A 2L9WA 1BD6A 4OYXA 3CCJS 3K89A 4I6WA 3CGIA 4HH0A 1H2UX 1RUSA 3NS5A 3JTOA 2ZKTA 3CJKA 5L1IA 4ZVGA 4PZVA 3D4JA 2DHGA 1HNIB 3BN4A 2QL7B 3FNNA 2B6AB 4I64A 3TEHB 1HMVA 1SJ4P 3MPDA 2OIHA 2FHMA 3C3LA 2NXCA 2CNKB 1S0NA 1EZZB 1ZPVA 1FJEB 2OO4A 1RU2A 5IZHA 1P9YA 1SI9A 1QJHA 3SDEB 2ZZNA 3QJLA 1FVQA 3BV8A 4OX9J 3T41A 2PMZD 2XS7A 4LF1A 3IS9A 3QJJA 3C15B 5L38A 4TY8B 3V6HA 5BJRA 1REVB 4MFBA 4LF5F 1DQ8A 1KDNA 4B17A 1UKUA 1YRXA 3W66A 2FPHX 1D9DA 2IY5B 1S76D 2B0GA 3W5ZA 2KO1A 3ITHB 3KLFB 4GC7A 2D41A 4DR7F 1NH7A 1LW0B 1KFSA 3J7YU 2JWNA 3NGUA 4OLPA 1C1BA 2KXFA 2O66A 4YS2A 4JBCA 4F7VA 2KI2A 3OL7A 4PYDA 3KK3B 2RQCA 4USVA 5HVGA 4URGA 2AKWB 1JK9B 1YHQS 2UV8G 4RLEA 3MCNA 2P6TA 3AFGA 3ZC4A 2LXUA 1N0UA 2OPRA 1VCTA 3M8PB 2HVZA 3IO1A 5KFDA 2DH9A 4DR5J 2ZBRA 2DGVA 1U6ZA 4OZJA 3ZZOA 4B3OA 5C2CA 4LF4F 1GTHA 1P8GA 1WG4A 1MROA 3C2PA 2KN4A 1JB0C 4JI1F 1IKXA 1BGXT 2CQ4A 2YKPA 2E1RA 4JUZA 4X64J 3QGPA 1VQKS 1RKIA 1VQOS 2JEGA 1ELOA 2JC1A 3A8IA 3IG1A 3WC2A 4BHQA 3NNHA 2XYPB 3J7YI 1MG7A 5CZXA 3DMJA 1T7PA 4ED5A 5D77A 4M5KA 1HBNB 3DLGA 4U9RA 3NGDA 2QG9B 2C2DA 3AT1B 2RU3A 2AD9A 1I94F 1RWKB 1FTCA 2CQGA 4ECTA 1R8HA 1UW4A 4CH1A 4F02A 3ZNJ1 4OJ3A 3HVRA 3TX8A 3VAKA 1SKUB 3J80U 4J9KA 5G0RA 1S6PA 1X31C 3I5BA 3M6WA 2FZKB 1JLBB 5I3PA 4RUCA 2HMIB 5DLGA 2ZDPA 3W2WB 5KG7A 5IC6B 5J1PA 4P73A 5I42A 1RA7A 1TKTB 3L9ZA 4W4MA 4O3SA 2V8HA 4L72B 4OI6A 3G9CA 1RT7A 4YR0A 1NJYA 4P2MA 3L4BC 2M88A 3H2VE 3NRBA 1HLWA 2CYYA 2IAJA 2QLWA 5K8NA 5KT5A 2G0CA 1RXOB 2FJXA 3SFGA 2QMXA 4M5IA 1J5EF 4PUOA 1CVJA 4FNIA 3KJQB 2PI5A 2CJ9A 4LFCF 1M1HA 3POTA 4DR2F 3JQKA 2RIJA 5A6WA 3CCVS 3TOQA 2R8JA 1RAJA 4U67Q 2JDJA 2HSEB 3UDEA 5E41A 5A8WB 2ZH6A 2WHOA 5L8RC 1S1UA 2J9DA 1E6YA 5DM7Q 2GQQA 4F4ZA 1VOMA 2DNKA 3ZNUA 3DRXA 2NREA 3MXHP 4DUTA 5KFTA 3D3CJ 3NS6A 3UDVA 4NLDA 2P2CB 1AT1B 1HQUA 4XK8C 1UWBA 1RYRA 4JYAF 1EQMA 1OMSA 4WYLA 4ZN1A 5KFPA 1HW8A 1GXLA 3T5HA 4ZOSA 3LAKA 3NS7B 2PEBA 3DRPA 2XM3A 3TR5A 1F5CA 3OV7A 1Y0HA 2YWEA 2NPIA 1FRJA 2DK2A 2G1DA 1RHQB 3MURP 3LP2A 5K5MA 3US5A 5L39A 2IYGA 1QAXA 3BQ1A 3MFHA 2CJXB 4FYXB 3CCWA 2DHXA 2BQUA 3OL8A 3GIJA 3OFFA 3DU5A 2ZWOA 2B43A 4ZJOA 1O8BA 3OTDA 3VAFA 3HSDA 5A76A 4WCEQ 1VRQC 1YBTA 4ZIWA 4NXNF 4ED7A 1X9MA 1SC4B 2VBWA 1T9UA 4ILMA 2DT9A 2A6MA 1F1BB 2YWKA 1NJIT 1OYEA 3SV4A 5HP1A 2YH0A 2OJ3A 3KDOA 1FKOB 1XR5A 4DPUA 1FERA 3IAS9 4WP8A 4MJKA 1T9VA 4XO0A 4CH7A 3RBZA 1IBMF 1C0UA 1RLCL 4C0OC 2AGQA 2R7OA 2RDIA 4JI5F 4LMZA 4OJ1A 4RW6B 2BX6A 4N41A 3W8GA 1PO6A 1R31A 2ZC3A 4LR7A 1F9HA 1T03A 1S7HA 3MEGB 2DH8A 2E1AA 1KVJA 3H98A 5D0RA 3H5SA 5T7LA 2WONB 1CG2A 2HBQB 3SMZA 4JV0A 4F0MA 2X1AA 3A13A 3P6YC 3IM8A 3M2RA 4ID8A 2CPFA 4DEZA 2BE2B 4OHYA 4WXOA 4YR3A 2GNKA 2M52A 4EK2A 2JEIA 1XN9A 2VZ9A 3CPWR 2YKMB 4NLVA 3NOGA 5KFLA 1YJTA 1RAEB 1MWYA 3S7RA 1TTHB 3TA1A 3LGHA 3OT9A 3PEJA 1UFKA 3M2VB 1G4CA 1HWLA 3NNCA 4PWWA 4NRUA 3K5NA 3TNVA 3Q8PB 1NPKA 2QLFB 1H2TZ 3UD3P 1D09B 2W4DA 1XMQJ 2XZWA 1XNRJ 4DXLA 3NGRA 3DHWC 3E51A 3HVAA 2GC8A 4QW9A 2XC9A 2HGMA 3H90A 4F4AA 4TU9A 3SXLA 2D74B 2J7KA 4YB7A 1HMVB 4O3PA 2ROPA 1QSLA 1RWOB 1BHNA 1NHVA 1OSCA 3H8YA 4WFAQ 3W9HA 3V6DB 4URSA 1RT2A 2W9CA 5B09A 4UY85 1Q7LB 4A46A 1VBXA 3LA0A 4I0WA 3BO3A 1KOHA 2ZEJA 1Y7PA 5HJYA 4ZVTB 4UUWA 2G1HA 4UT4A 4UQGA 3Q22A 1PSDA 3IS9B 1T8EA 1RT4B 4DV6J 2ZH2A 4FYWB 2H65B 1BE4A 2W2OP 4W98A 4MFBB 4IRCA 2CQ1A 4RBTA 2HPUA 4ZPWR 2VDHA 3BBFA 2Z2MA 5JXSA 2J0QD 2X51A 1H6KX 3GONA 1JJ4A 3HHNB 2XMAA 1M1GA 4Y2IA 4CYUB 1UPPA 4M95A 4XAKA 3MMCA 2D9PA 2IRXA 2J0XA 1C1BB 4WFNQ 4KGZB 5DG7A 1S48A 4IDKA 3R5GA 3EDRB 4V1Ak 2B9YA 2RQKA 1XEZA 4M5DA 2CWKA 2CADA 2LP4A 4RZRA 3LUYA 1KWMA 3DLEA 4MIBA 2AJ1A 1IR1A 1C0TA 4DR6J 2DHAA 2DPJA 1IXKA 1G2EA 1HI0P 4OX9F 3T1HJ 2ZH8A 3UCGA 2AP6A 1NJWA 1Q0NA 2RF2B 1RWXB 2G2OA 3MTJA 1WC3A 4B3OB 3NXZA 3IA0A 3O3LA 4J9VA 3B4DA 3CD6S 2J5AA 1KFDA 4FS2A 3R8YA 4X4TA 1MROB 3C16A 1FKPA 4ZPDA 1KBRA 2PI4A 3Q8UA 3IGVA 2HHXA 2MLYA 3KMSA 1BXNA 1G6BA 1SC1B 3EDQB 2CJKA 5HL7Q 3TUJC 2ABYA 2W2NP 3IP0A 2AYBA 3V4IA 2FLOA 3IG1B 1UAWA 1BWEA 3HZEA 4DPWA 4GRSA 4N5SA 3T3FA 4ZA1A 2EEYA 2V67A 5LSOA 2HEKA 1WG5A 3E8OA 3QNWB 2GZOA 1HI1A 4OJGA 1SL2A 4DV5J 4IH7A 1LXNA 1MU2B 3QAUA 4QW8A 1B4SA 5G0RB 3KLIA 1FRLA 2H5IB 3IRWP 1SPBP 1U1KA 2Q6CA 4DR5F 2Z0GA 3M2UA 4IRKA 1TKXB 2HVHA 2V8GA 4EYIB 1ZM4A 2AGPA 4OI4A 3CCZA 2A6OA 4H4KC 1VBYA 3KNAA 5JVHQ 2W4PA 3ET6A 2FZCB 2LEPA 2YBVA 4X64F 1WKKA 1CJUA 1H74A 1VRUB 3GG1A 4QIVA 2IAJB 3I4HX 3AJDA 1F5AA 4LRDA 4XIUA 2GFFA 1HYSA 4LBIA 1VQ7S 2PD1A 3R6LB 2XNQA 2RS2A 2K1RA 2EBEA 3POTB 4ZHRA 1KVIA 2HRTA 3HFKA 4YEAA 1KNZA 5HI7A 3K5PA 4YY3J 4USMA 1FVSA 3FEZA 3U7JA 4KJIA 4K5RA 3R6GB 2ZBQA 1NZAA 1L3SA 4X84A 1S1UB 4BLGA 2CVEA 2WRMA 3I56S 3N4WA 2LQ5A 1VFJA 3UCZP 2MDAA 5B0BA 4ERDA 4QU7A 1AUDA 2A1BA 1MSWD 4DL5A 4ZCLA 3RW6A 4A8WA 3BSNA 4YB1P 2YNFA 3OR1A 2H51B 1VJWA 4N56A 1HQUB 1UWBB 2HYIB 4C8NA 2HG4A 2WSEC 3GR1A 2CRLA 2D9OA 1S6OA 3JSMA 4OZ1A 1I51B 2ZBIA 4NX9A 4QWDA 4ZP6A 2BRLA 3R2DJ 1YX2A 3DRPB 2DNMA 1U26A 4HL9A 2KB2A 3OJUA 2XNRA 3ILLA 2VG5A 3NCPA 1Q79A 3LP2B 3M8WA 2F9DA 5U47A 4Y6IA 5LL6d 2M8DB 3PACA 2XGPA 2KXNB 2HQFA 1Q8IA 5ADZA 3FDSA 2BJ8A 2HW3A 5IXUA 2IVFB 2VV5A 4B9UA 3I5CA 1T0TV 5DJBA 2ATCB 4K5SA 2J0SD 4OZNA 3IRXA 4CLYA 2N4DA 4NZ6A 1RISA 1RAOA 5DLFA 2GIQA 2R4FA 5HP1B 4C0HA 5CCMA 3NMRA 4DV1J 2N3LA 1FDBA 1HWIA 1G7CB 2ZH4A 3OVAA 4EO8A 1C0UB 1VYAA 2MZTA 4A8MP 3D2WA 2CPZA 2E7XA 1TL5A 3R97A 4ES2A 3X1LB 1MN9A 3GP9A 1W26A 2BKPA 5J2QA 3UN2A 1OIAA 2FQQB 4J9QA 4F50A 2E5GA 1T03B 3TAQA 1UETA 2AYGA 3AOAA 2F65A 1FXRA 2QSWA 1YGYA 3RAMA 4LQ3A 3UE2A 1OS5A 3BPDA 5CAAA 2NQPA 1Y5IB 1URRA 1BLUA 5DDQC 2E7VA 4W90B 1QSYA 3M2RB 2FUG9 3MM6B 2DGOA 2NSCA 5IT9Y 3QT5A 2R7RA 4DL6A 1H72C 4DPXA 4ANCA 3C6TA 5HQ8A 3QWPA 1X5PA 1NJZA 5KFRA 2RDDA 4RNFA 2W2QP 4J9UE 1N5YA 4NXMJ 5HBMA 1QY7A 2N7YA 3S8SA 2BE7D 1P6TA 2BW2A 3HSZA 4ZJQA 2LQ8A 4U96A 3CCMS 3N9UC 4G1PA 2MKSA 3PXGa 4MYTA 2ZVSA 3OHAA 2O3DA 3DCAA 4LRFA 2EI5A 2QT7A 3HD2A 3VTIA 5C25B 5JVGQ 4LIWA 3DLJA 4MKAA 4A8OA 2VU5A 3UPFA 2HWHA 5B0FA 1S97A 1VC0A 2MZ1A 1VQNS 2QRRA 5AT1B 5IS2A 1AYEA 2VG7B 2ALYB 1Y10A 3G96A 5KT2A 2CQCA 4HKQA 2PDAA 1RT2B 3C66A 3HKZD 3FKBA 1B70B 2W9CB 3OTCA 1RDRA 4RUBA 4BBYA 1RI7A 3M30A 3QZ7A 3DLHA 3RB4A 5MAOA 2IJNA 3BZQA 4OHZA 2OEJA 4ICLA 1MNEA 3B6BA 2MSTA 3NCQA 1CQNA 3K59A 1EARA 4ZVSB 2B8QA 3CT9A 4HTJA 2E1PA 4ELVA 3GZ7A 2DJWA 3HHLD 4F2SA 4MT1A 3MM9B 3JS9A 4PYAA 4URQU 3IMQJ 5LJ3Y 1XMQF 3CJ2A 4DJBA 1XNRF 4GVLA 3AXMA 1S9FA 3FBFA 2M8HA 1EP4A 4CCHA 3OTEA 1RADB 3BBBA 2KL8A 5IT4A 4LVOP 4USJC 4JI8F 4OX6A 4IDKB 8ATCB 4DCJB 2FHOB 1OPIA 4K4XA 4J7CA 4QR1A 1SH3A 1IBLJ 2C22A 3CJSA 4C97A 5H9FJ 3DLEB 5KOWA 2HIQA 2KG0A 1KHWA 4B08A 3CULA 1C0TB 2AYMA 4ETZA 1B0VA 3TUZC 2ZE2B 5GAGU 4R5PA 2GIFA 2HNDA 3SZ2A 1IBKJ 2GAHC 1ITPA 4DV6F 5C24B 1L3TA 2CZ9A 3GCWP 4KFBA 2O67A 1IN0A 5IV3A 2F8MA 4ID5A 2MHNA 1YITS 2YQ1A 1CEZA 3D6HB 3FRYA 1RWVB 4CH0S 3C16B 1FKPB 5T41A 4CLWA 2E7WA 4UY8T 5IWAJ 4O4RA 4ZP9A 3PX0A 1P1LA 2WBMA 2QFIA 1A0OB 1NPRA 3OLBA 1TAUA 2I9SA 3I0SA 3V4IB 4AL7A 3AJ2A 1WC0A 4U95A 4X4PA 3UN5A 1SJ1A 1KTQA 4K0KJ 2F5GA 1GMUA 3PR4A 2XS2A 2V4QA 2DNNA 3QGIA 2YKAA 1X4EA 4ZPVR 1ZA2B 2BACA 1DAXA 4DR6F 3HXMA 1R89A 4X4UA 1ZZFA 2CAJA 2Z8QA 4ZCIA 3T1HF 3MOZA 3KLIB 5FDLA 1Q1KA 5HMXA 2K7JA 4PQUA 5GAGI 3ENWA 3M2UB 3NMAA 4HT5A 2P8IA 2XMTA 2W9BB 2BM0A 1TAQA 3NY0A 1KQFB 2DR8A 1GMWA 4IH5A 2QYGA 1RA6A 3ETMA 4CTAA 9ATCB 1Y3KA 5H9FK 1CJUB 2YWHA 1TL7B 3OD2A 4PG7A 1IR2A 1HYSB 4NRTA 2OTJS 3LP0A 4E8UA 3KJNB 2J8SA 2K1RB 1B7YB 1AROP 4Q45A 2AIRB 4ZITA 4A47A 3SQGA 3UCUP 3RB3A 3FRZA 3KKFA 3WZ0A 4C4WA 4ED0A 2DNYA 3DLKA 4DV5F 1QAYA 1RAHB 3PFOA 4NLGA 2UP1A 2VASA 3QSIA 4HEA9 4H4MB 4NCBA 3KUEA 4EWTA 3I87A 4OQJA 2DPIA 4DG1A 2MQLA 2IA0A 4CNZA 2YNFB 3OR1B 3MEKA 1U2CA 5G4DA 3LH2S 2BRKA 3K5MA 2CJYB 1X4GA 3JSMB 1YBAA 1GTEA 5LOQA 2IC3A 2ZHOA 1WDTA 3KK2B 4MK7A 3DDNA 5LMNJ 3O8WA 2DEJA 2QLBB 4U7UD 1EQ0A 2VG5B 4RW9B 3QQCD 1VLYA 1X4AA 3RG6A 3CVKA 1RT5A 1ZTWA 4CO3A 4O4GA 4M5GA 3DOMA 4RNMA 2POKA 4YY3F 2RH3A 1SH2A 4MAKA 2ERRA 1HBMB 1WEXA 2GCFA 3QJPA 3BH6B 1NDLA 3BQ2A 2V2QA 3VVUA 5HO4A 4USTA 1VIXA 1VGYA 5KFJA 3L95X 5GAHU 2D1CA 1WOPA 1DBDA 1U25A 4WFYA 4C3MA 1T3NA 1S6QB 3IRXB 2HVEA 2LXFA 1RWPB 1X0FA 2H9ZA 3DHXA 5H1SV 3FEXB 2LEBA 4LSNA 2R7VA 4A8XA 3JTPA 4P7VA 4LBPA 2GV1A 2VFVA 3G87A 4Y34A 5K9FA 1HHQA 1T05A 1VLOA 5DQIA 4EI2A 4KE5A 3CDAA 2XMMA 3M6UA 2I1RA 2LLZA 5J2QB 2BUNA 3JSRA 5CYJA 3SCIE 1KKHA 1T94A 1MMNA 3C19A 1V9OA 4ZJLA 3KLGA 2G0JA 1KQGB 1K0VA 3D1QA 2FLLA 4EUVA 3LF0A 2GJIA 4PG8A 3A12A 2H4YB 4LFAJ 2XMVA 1ROFA 3OR2A 1S1WA 1S77D 2VODA 1LEOA 2AJFE 3C6TB 1JXVA 4V19X 4DV2J 1HBUB 2N4CA 1RJJA 2HQ3A 4LRCA 3EVWA 3MPUB 5HBMB 4Q8FA 4NPOA 1AFIA 1NDCA 2QE5A 3P8BB 3OL9A 5GAHI 4J9MA 5HROB 4DV1F 1T11A 3I31A 1ZM3A 2UUAJ 2Y3YA 3M9OB 4J9OA 3O6QA 1WTFA 5F8GA 1XQIA 1HARA 2YY3A 4IG0A 2MB0B 4LF2A 3KLHA 3DI6B 2LU2A 2AYEA 1N88A 1NK8A 4U8YA 3S6EA 4FVMA 2DITA 1GAOA 4DR3J 1U4BA 1NKBA 1XMOJ 4I56A 1YTYA 2YTCA 2CKWA 1TELA 3KHRA 4C9DA 2HWIA 2N7CA 3NLCA 2RKIB 1CQMA 5CYMB 5EUHA 1RBAA 4IRDA 3KLEB 3MGJA 4ANEA 2NUHA 3TANA 2ROEA 3PHTA 5K8PA 4KB7A 4ICLB 2GJFA 4NXMF 4OV1A 4F8RA 4NE9C 2QO3A 2CPYA 1SBRA 2VFRA 4RW8A 1Q86T 3OLAA 4LBHA 2SXLA 2VOOA 1GH8A 5D4OA 1NXIA 1RAIB 2XZTB 2BR0A 5E0OA 1V5IB 2XB2D 1WHWA 2CVIA 2HQDA 4WFZA 1YJWS 1A6LA 2ATLA 1EP4B 4L75A 5B0DA 3GE9A 2PGCA 1WF2A 2CDRB 4BS2A 5J1NA 5F3TA 2JEJA 3T6BA 1RHKB 3ICLA 1UFWA 4R5PB 1FO1A 3A3NB 4A8KA 4USIA 2B8PA 3R9LA 2KFZA 2HNDB 4DSJA 3KYLA 1HQEA 3G6YA 3FQKA 4D3HA 2EBGA 4MH8A 3J81j 3E3XA 2C28A 2MKIA 4KFBB 5DG9A 2QLXA 2VKZG 3VAJA 2R8HA 4QJVA 4RX6A 3B78A 5B7WA 2X3GA 3G2XA 4J9SA 4B9NA 1JMTA 2VPXB 4EGLA 4F36A 1RHJB 3PIPQ 1EKSA 4RUHA 1O5JA 2H48B 1CULA 3UVJA 3W2VA 2UXBJ 4B9LA 2OMOA 2OSRA 3QGHA 1NB2A 2O1PA 3ZZYA 3M8YA 2YVSA 5CXTA 2OI2A 2EFVA 1R0AA 2ACYA 1W2BR 3I0SB 4NYOA 1TKZA 4BWMA 2B9EA 2DXEA 3IM9A 1VQLS 1PILA 4QU6A 1IBLF 2CQ3A 4USUA 3RRHA 3RRGA 2AHOB 5KAKA 4WU2A 1S59A 1X5SA 1K47A 1PIEA 2ZNYA 2AJ4A 5K8MA 3MR2A 3CCUS 4NZ7A 1Z2LA 4P6QA 1WOOA 3SSSA 4LRAA 5KT7A 2QC3A 4L73A 1IBKF 2MKHA 1Q5VA 3CCQS 5FDLB 3TZWA 1RAAB 3PNIA 1UVLA 1M5KC 2PN6A 4PR6A 2DHHA 4OYWA 5A2QU 4MKYA 4HHUA 4X4VA 4NCGA 3JAMY 1MW7A 3MUVP 2W24A 4JV1A 2V8VA 5IWAF 4CTAB 3FMBA 3PEHA 3DGVA 2XY7A 3GQCA 3Q86A 3I32A 1GNKA 4P2SA 5CD4H 3O44A 1QM9A 2MGZB 4DN9A 2HGLA 1Z2ZA 4K0KF 3R7NB 1FJGJ 3EGWB 3SQGB 3N0VA 2H1YA 1TUWA 4PPDA 3GSDA 4NI2A 4F0KA 4C8KA 3AD7C 2VD3A 3EX7B 4LUBA 2IJRA 4ZCKA 2FVPA 3KLVA 2OFGX 4J37A 1DRZA 3J7Z5 2KJWA 3DLKB 4EMDA 4HYKA 2E66A 5A8RA 2DO0A 3PYEA 4X4NA 2DR9A 3HJVA 2FC9A 1NEEA 2LFVA 3MPYA 2RUSA 3EGZA 1U1MA 3T1AA 2OD4A 3GCXP 5F8MA 1VQ8S 2Z57B 2V4RA 1FX2A 5JUMA 1V3ZA 2KKHA 1FXLA 4DG1B 2K3KA 5F8NA 2KZZA 5F0UA 3W61A 3AB2B 2QN6B 4I2QB 3UR0A 4G3IA 2X1FA 1WD6A 2WZ1A 3MMAA 4Y2CA 2FJVA 4GVBA 2IC3B 4OX7A 4DPOA 4M5JA 1UFLA 2KDOA 1LK7A 4TYBA 1IWGA 3AAWB 4OYMA 1HA1A 6FDRA 4WZMA 4DL0C 1R27B 4FPRA 2DR6A 1RWNB 3UD5A 3CTRA 1RT5B 2BJ7A 1U0SA 3M05A 4O3QA 3DOMB 5KFNA 1YVFA 1YJNS 4P74A 2F4VJ 2MHEA 2OUGA 4DUYF 4KSEB 1WKLA 1UCNA 1WSRA 5A6PA 2UXCJ 3A4TA 3FFIA 4PAAA 3MAAA 3MI7X 2LMIA 5KFMA 3IGNA 2DR5A 3O2IA 4J90A 2CJAA 3BDPA 4KT0C 8AT1B 1RAFB 6AT1B 4B9SA 2FJEB 4LSNB 2AEFA 2WCXA 4Q2MA 1ULRA 5BR8J 8RUCA 4MKBA 1N52B 3QRQA 2J9EA 4RNHA 2YKNA 2WK4A 1BMQB 2NYIA 2CJQA 2FJBB 5LMNF 1HKAA 5KG3A 3CCLS 1WC5A 2JX2A 4DCOB 1SQFA 5CD4A 2FVRA 2RHSB 3PO4A 1F2HA 5T14A 3MCSA 2YQ0A 4UQTA 2UUBJ 1FK9A 4R0JA 3L7OA 4F25A 4DR2J 1NHKL 2IM2A 3FVYA 3TZYA 3MPWA 1KEKA 3OR2B 3CUNA 1S1WB 3QT6A 1TZ0A 2HGNA 5EGYA 5L1LA 4F3QA 1TL1A 3KHLA 3T5KA 1WHVA 2KM8C 1HHTP 3LOUA 4X62J 2EW9A 2IHR1 3PDNA 4DSKA 4DOZA 3NBPA 4AXIA 2CUYA 2GHWA 1WF0A 1HW9A 4IO9Q 1VI7A 4NA1A 2MQOA 2R7UA 3VHQA 1VC5A 3TUIC 4C8ZA 4IG0B 5KFGA 3KLHB 2QA1A 4OHVA 2IFXA 3EZOA 1FD2A 1R8PA 5KG4A 3BGRB 1ZZNA 1UVMA 1XNQJ 2RU9A 2ZH1A 4ZS6A 2DGXA 2F40A 1PYTA 3IR6B 1CS4A 1S0OA 4G1QA 3BGLA 4LSLA 1FFGB 3FBEA 4IYQA 1CLFA 1OO0B 4PG4A 5ITHA 2R8GA 2M7SA 3LO3A 1K44A 3CIMA 5IFMA 1YZ6A 5MLCV 2RILA 3PCOB 3QAEA 4ECRA 1KQSR 2LVWA 2IVYA 3P96A 4OYBA 1WEYA 2R42A 4DV2F 3SEOA 2V69A 3GWCA 4F67A 1SC3B 2MYFA 2VDIA 2FY8A 1OYDA 3G8QA 4N8OA 4RW8B 2VA3A 3GB0A 4QYRA 2W7OA 3PKYA 1OPZA 2UUAF 5L46A 5JMNA 1K1SA 5KFFA 4NMXA 4GMKA 1X9SA 4U7CA 4LR9A 2GJ2A 1S0VA 4KGMA 1IKWB 3CD0A 1YKWA 2AWZA 4DR3F 3PZPA 4IFYB 5IM0B 1XMOF 3M8QA 1SJRA 5KFYA 5J2NB 5KFSA 4JI4F 3CDWA 5B0CA 1UVIA 2MY8A 1ZM2A 5A8KA 4ZPCA 2E5JA 2D3OR 2OKQA 4O44B 2E5LJ 4N77A 4H4KA 4L74A 3LGNA 4KHRA 5IV4A 3E2EA 4RR5A 1MMDA 2HAIA 2E5IA 2QX0A 4F2RA 1W7WA 2ZBPA 3D54A 5BYQA 3ZFVA 4C3KA 1J2VA 5LM7E 2MQPA 1M90T 2G13A 4HHHA 3QIDA 1M1KT 1HD0A 2XG8A 1RHUB 1JKHA 2PFFB 1JNRB 1WI8A 5CABA 1LXJA 4CLKA 4EYHB 3OJSA 2D7SA 1X9WA 2GMJA 3HPOA 2CG8A 1S1XA 2WVDA 1K1QA 1NM2A 2HAFA 3DFEA 2EK1A 3KXDA 3F41A 2JZ5A 4FXVA 3T5LA 1AXQA 1U24A 1M5PC 1WACA 5EN1A 3UVJB 5D0HA 4W92B 4FZVA 2HQCA 1HIYA 3P5TL 3D6MB 1NK5A 4OYPA 2BDPA 4FF1A 4O3RA 4PXBA 2R2UA 1QTMA 3ZTOA 2BJ1A 3WDOA 1FRIA 1TKZB 1KLMA 1K0TA 1DJ0A 2MSSA 3DGPA 1VJQA 4M5MA 2DNZA 2YXLA 1NDPA 4KAIA 1UEVA 4WFXA 1N5VA 3O1LA 1TV6B 3FQLA 5KT4A 1NK6A 3T19A 4JV5J 1S9GB 1R8BA 2ZH3A 1N54B 5DS7A 4DU7A 3UD4P 3TVZA 2X7IA 1F0XA 2PEHA 2CG4A 2PC6A 4O0NA 3NP5A 1N33J 3BB5A 4L76A 5E3QA 3T9NA 1G3OA 4ZPAA 5ETMA 4ZVOB 4NCGB 4RW7A 5LT5A 3VZIA 2M70A 4DL2A 1VQMS 3OXLA 1F2GA 1PC5A 3BO4A 2VBZA 3NL0A 2UXBF 1VISA 2WBRA 3ENQA 1T95A 1QUVA 4ANDA 1NSPA 4NA3A 5E7OB 2VPWB 4IH6A 4EO6A 1QAIA 3V4MA 3BGFA 1R7IA 4Q44A 2VFTA 3PYDA 2HFUA 5KFXA 5HMZA 3D7SB 2Y0BB 5DZ6A 2DGUA 4ED4A 1REGX 3SIPB 3LANA 5THWA 1JQGA 4NEZA 1K73T 1WDDA 2UVRA 4USHA 5JJBA 4CZCA 3W9IA 4ZCMA 3EZ5A 1VQ5S 1LV5A 2OP5A 5A8RB 2EPIA 2GIRA 2C3MA 2I2YA 3R5CA 1A9NB 2LYVA 1TVRA 2FHJD 3HF5A 4WP3A 3FCWA 2BZ2A 2KVQE 3SFUA 3OUYA 3PYGA 2EFQA 4PWUA 1UJ4A 4RUAA 2ZH9A 3HI9A 3NAHA 3UNGC 3TJAA 1MLAA 4JI0F 3MMAB 2KHDA 4GVBB 4LFBJ 1X7VA 1S9EA 3I82A 1JXLA 5E2QA 4BCAA 2FTRA 3EZUA 4Q5VA 2DCUB 1FHTA 4C8YA 4B3TJ 1V3SA 2CWXA 2RE1A 1NB7A 2RJZA 1Q8KA 4MMOA 2XY6A 1FJGF 4LF9F 2CQHA 3QGGA 2HURA 3AH6A 2R7QA 1EB0A 1VBKA 3FSYA 3IBFB 3PRBA 2NPFA 2QIFA 2Y1JA 3BYPA 5FIIA 2YNHA 1XR7A 2VPYB 3FFIB 3MD1A 3MAAB 1NO8A 1HNVA 1NHUA 1WI6A 5CYQA 3CNQP 3AJ1A 3SCLE 2CPEA 4J9RA 1SIZA 3ZZPA 4DS5A 4OJHA 2DHSA 2HS4A 3IN5A 3ZZZA 3GV8B 4DV0J 2NS1B 3KJFB 4IR1A 3CJRA 3J7ZT 2YKNB 4PCQA 4I67A 1QTNB 2KYZA 2NXJA 3EVOA 3CCTA 5EHHA 2J6TA 3EICA 2NZCA 1YBUA 2ZITA 4ECZA 4ZVPB 1TL3A 2FZGB 2G9OA 2AJ0A 3D6FB 2RB7A 2F4VF 1OSDA 2KJVA 4K59A 3KG0A 5KFEA 3QPIA 1B0TA 2UXCF 2JFDA 2RHQB 3DOLA 4KR0B 3HLUA 5D3GA 1WUUA 2MEWA 1TL1B 4Q43A 3HVTA 1VRTA 5BYRA 2Y1IA 3ZTQA 4LF6J 2JLGA 2XO6A 3BSCA 3ISND 1FE0A 4FNHA 1IUJA 1U7LA 3NBPB 5BR8F 2KG1A 4I4BA 4ZPBA 2HRYA 3HX9A 3HHKA 4ELUA 3HHLC 2EG2A 3R5JB 2HZAA 3UI3A 2BE9B 1F60B 4WWSA 4AXJA 3GYXB 9RUBA 3R5AA 1U1NA 3KFWX 2IBOA 4Q7AA 1CS4B 1Q4RA 2B4VA 1V5VA 4G1QB 4LSLB 4K4UA 2IA6A 3B4MA 4HR2A 3AA9A 1DTQA 1B64A 1PKUA 2UUBF 3NEKA 2GVDA 2NSBA 1KVKA 1UW9A 2QSFA 2Z58B 2VG6A 2XHCA 3EUNA 3N6LA 1U6BA 1T9YA 3CDUA 1U8SA 2P5VA 2HFNA 2MLZA 3P3DA 4ZLLA 3RJMB 4X62F 2WB1D 4Y00A 1DFDA 3KDNA 2CPDA 1U2FA 2ZWPA 4I6AA 4DF8A 3W62A 1TUVA 3QO9A 3F0NA 1Z1ZA 4RL1A 5B08A 3HK2A 4AQYJ 1HQ2A 4RW4A 3GJTB 3BR8A 4K4WA 3RGIA 3CMAS 4UOCA 1CBKA 1XNQF 1VS3A 4USKA 5ETQA 2WVBA 4Q0BA 3M8QB 1T3OA 3T6JA 2B4UA 2IMWP 2L3MA 4GKKJ 4DSFA 2IYIA 3ENAA 4PWDA 2HVDA 2K2PA 3EE3A 3K5OA 4P52A 5F8JA 2HBRB 4P72A 5A8KB 2BJDA 4DV4J 3MM5A 4F3MA 3MUMP 1R3NA 5F8LA 5AXKA 4QWBA 1I1GA 2BABA 1BWVA 5LSRA 2RRBA 2HKEA 4YMEA 3H5YA 1SJ3P 2YKQA 3MTKA 1UEUA 1JKHB 1RT3B 3SCJE 4CLLA 3VGVA 1RACB 2C3PA 1JLCA 2LDYA 4RWWA 1F9EB 1S1XB 4NASA 4O3NA 3I4PA 4MTPA 3RUBL 4CWBA 1SCJB 3CB4A 2Z56B 2KXHA 3NGTA 3TA2A 4PG5A 1KD1T 3VAIA 2ILZA 1KONA 5CZVA 4ECXA 2RRNA 1HFEL 1XJWB 1TQLA 4NEYA 3G6ES 4CO1A 2HHHJ 4DPTA 3K8VA 1CJTA 5KG6A 3KNGA 3BGOP 1KLMB 2PE8A 4C3LA 2HHPA 1QAJA 3DGPB 5AE2A 3I9ZA 3SBMA 4RU2A 2HNYB 5F9LA 2E5LF 3BS9A 5ETVA 4FYVB 1EJ7L 3D0HE 1QLNA 1FEHA 3M1VA 1ZAVA 4TY8A 1H2VZ 2NCKL 3H2LA 3DDKA 4QIWD 2AQ4A 1F3VA 1REVA 2JNJA 1IM6A 3UO0A 2LU1A 3ISZA 1WNEA 1F6TA 3CIZA 3HKWA 2J76E 4M8LA 3MZIA 2R8IA 1Y11A 2RMLA 1N6QB 3N79A 1OY8A 3VV2B 4ZK7M 4NWBA 1S5ZA 3U1LA 2DNQA 3CF5Q 3GTYX 1IR0A 1V3RA 3W9JA 2JFKA 1KOOA 1S1VA 2AJQA 4FF2A 4J9LA 2HLUA 3CC4S 1YG0A 1IQTA 3TWZA 5KFIA 1IWAA 3GSIA 3PW0A 4WK1A 4Y65A 1XMBA 1SJQA 4WTYA 1RGVA 3TZXA 3CJKB 1FWKA 3D1OA 4QIEA 2XSFA 3H20A 4CRJA 1W25A 2MJUA 1TMMA 2QL5B 2AJ2A 2IM3A 3B82A 4JI8J 2HVIA 3NNAA 1U0HA 3OSPA 1FX4A 4ED8A 3EPIA 4JV5F 2FLNA 5K14A 2QA2A 2KT3A 4B3RJ 3HO1A 2W4CA 4RU9A 1RAGB 3OHBA 3L7PA 1TVRB 3PJWA 2DCLA 1N33F 1D8ZA 2N3OA 3OUYB 5D4LA 4DS4A 2CNOB 4TVAB 4DQIA 2F3JA 4JI7J 1N5SA 2PMWA 3RBXA 2MJNA 5IQ6A 4K8RA 2YWGA 2MZRA 1SKRA 2VKRA 4WK3A 3L09A 2EFOA 4HLBA 1FFSB 5F0WA 5K8OA 3OQ2A 2ZM6J 1TK5A 2DNLA 2PSZA 2QFJA 1VIOA 2YNGA 2M2BA 2KT2A 4JP8A 1HBNA 4A4JA 1VMBA 2ILYA 1O0PA 2AX0A 4KY3A 1X5TA 1Q95G 4Z7CA 4AL6A 2CFXA 2JSXA 4JB8B 1NK4A 4A48A 4Y0FA 4ATNA 4HI1A 7FD1A 3HT3A 1IM4A 2AEJA 3TUPA 3EJMA 3RU0A 4BDPA 3W3SA 1WF1A 2HFSA 4R8UA 1XR6A 2ZJQQ 2QA4S 2I8EA 3ZZRA 4OI1A 2YNHB 3K2YA 3R2CJ 1HNZJ 1JLAA 1NBEB 4KC5A 5CYQB 3PRVA 3SQOP 4DL4A 4M5LA 3Q8YA 2OPRB 2W1BA 4ITSA 1TKDA 3GIMA 1VQ9S 2FJWA 2U1AA 1OQ3A 1VQ4S 2H5JB 3F44A 4X4RA 3PTWA 2KU7A 2W9AA 4QIGA 1SH0A 2DNOA 2VBXA 2OPSA 4LFBF 4OMFG 1YI2S 2J6UA 4FS1A 3H2UB 5I3UA 1JNZB 4CT9A 1X60A 1IKXB 4B3TF 3AXKA 1F3FA 5J1EA 3HHEA 4YB5A 4FDFA 3ETOA 1UJ5A 4ZN3A 2QTWA 1TL3B 3MCOA 3PRDA 4GKJJ 2IRUA 3PFEA 3IR7B 2DO4A 5ETOA 4M94A 3HZGA 1BY9A 3E01A 3CCRS 4X4SA 4NLSA 4QPXA 4HACA 3DMJB 1EETA 3ZZUA 4ECWA 3DLGB 1Q81T 1VBZA 2XBPA 3K17A 3DOLB 2OPQA 3C14A 5D3GB 2VJUA 3IXQA 3RAXA 4L3NA 3HVTB 3V2UC 1VRTB 3V6KA 1S6PB 2RRAA 2YKOA 3C46A 2A2CA 1TMJA 1AZSA 3PY8A 3LP1A 3TI0A 4CLUA 1O51A 4Z7YA 4DV0F 4KV8A 2IDLA 3QRPA 3R1HA 4P75A 4DPYA 5I42B 1BQMA 2NXNA 1C4AA 3OTBA 2CQBA 4AE5A 3EMTA 1RT7B 2HS0A 2MZSA 2DNPA 4C8OA 3V5RA 3N5BA 1C4CA 4F3OA 4CLSA 1RYSA 4CNYA 1PC4A 1PJ7A 1FJCA 2HHQA 1RP5A 4YHHJ 2NLWA 2UXDJ 1DTQB 4PUOB 3MEDA 2GVDB 2VFSA 4UOFA 1DLOA 1NJXA 2PIIA 5DO2A 5I3QA 2VG6B 2DXFA 3OBIA 4KRWA 2MZQA 4TQSA 3MR6A 2Y0SD 1YJVA 3J81Y 1E6YB 1XC9A 4EBEA 2HFOA 2XWXA 4Y2AA 1A7GE 3EM1A 1AFJA 1NK7A 1LW2A 4LF6F 2BJ9A 3GV7B 3FSIA 3QO9B 2ZNZA 2EFNA 3MMJA 1SUQA 2E9RX 4RW4B 2OEKA
chains in the Genus database with same CATH topology
4DFMA 1R0AB 5BYSA 4LF8F 4MKYA 2DRAA 1O8BA 3OTDA 1R8CA 3TRGA 3VAFA 4WCEQ 4NXNF 4X4VA 4EBCA 4IOCQ 4ED7A 1TFWA 3MEGA 5J2MA 1X9MA 2CQDA 1Q16B 2RT3A 2K7KA 2VBWA 4NCGA 1JLEA 3JAMY 2JRSA 1WG1A 4Q0BB 2B5JA 4ILMA 1MW7A 3I96A 2P9CA 2DT9A 2W24A 3MUVP 4JV1A 2V8VA 2YWKA 1QVGR 2E29A 1NJIT 5IWAF 4CTAB 3FMBA 3SV4A 3PEHA 2L41A 4TXSA 2XY7A 2JLFA 4PWDB 1RTIA 2B7BB 3GQCA 3HP6A 3I32A 3X3UA 5HP1A 2YH0A 2OJ3A 3UW1A 3SCKE 4D3GA 1FKOB 1XR5A 4WYWA 1SB6A 5GAEU 5EDWA 3KTQA 1FERA 1GNKA 3IAS9 4P2SA 3MM5B 5CD4H 4MJKA 3D0IE 4XO0A 2XMUA 4EEYA 4CH7A 3O44A 1QM9A 3BQ0A 4I2QA 1IBMF 4ZKAA 1C0UA 1FDDA 2MGZB 4C0OC 2AGQA 3CJ0A 4J9NA 3T5JA 4DN9A 2R7OA 5KOXA 4WFBQ 3CJ4A 2RDIA 2HGLA 4JI5F 1Z2ZA 3GILA 4K0KF 3QWUA 4LMZA 3EGWB 4OJ1A 4RW6B 4C2MA 3SQGB 3DOKA 3N0VA 3TW0A 4PPDA 3GSDA 4N41A 2F9JA 4H54A 4C8KA 1PO6A 3JB9k 2VD3A 4IOAQ 3EX7B 3TAMA 1J5OA 1R31A 4LUBA 3OFHA 2ZC3A 1SKWA 2ZOMA 2RQ4A 4ZCKA 2FVPA 2OPPB 3KLVA 2OFGX 1BC6A 4J37A 1DRZA 3J7Z5 4TLQA 2Q79A 3LWLA 1I6JA 4DDFA 1JLCB 1HPZB 2KJWA 3DLKB 1T03A 4HYKA 1S7HA 2E66A 3MEGB 2DH8A 4J9PA 4QYZJ 5A8RA 2J8AA 2DO0A 2FVSA 2E1AA 4X4NA 1UP1A 1KVJA 3JYTB 3H98A 1VC6A 2DR9A 2FC9A 2I5JA 1NEEA 3H5SA 5T7LA 3MPYA 3EGZA 2R8KA 1U1MA 3T1AA 5A0YA 1X4HA 2OD4A 2V9WA 2WONB 1CG2A 5I4MA 3CEDA 4NLYA 3SMZA 5F8MA 1XTZA 4AQYF 1VQ8S 5CHCB 4JV0A 2X1AA 2V4RA 3P6YC 2L9DA 5KFZA 3M2RA 4ID8A 4DQPA 3QIPB 2CPFA 4TYAA 4DEZA 5JUMA 2BE2B 4OHYA 4WXOA 4DQQA 1V3ZA 2KKHA 1FXLA 4YR3A 4DG1B 5KFCA 5CQGA 2K3KA 1SKSA 5F8NA 4X66F 2KZZA 2MQMA 2ZC4A 2GNKA 2M52A 5F0UA 2Q43A 3AB2B 2JEIA 2OFHX 4I2QB 1XN9A 3DRRA 2VZ9A 3CPWR 2YKMB 4NLVA 3UR0A 4YR2A 1Q82T 4G3IA 5KFLA 2X1FA 3TVYA 1WD6A 1YJTA 3U1NA 1MWYA 3MMAA 4ZVEA 2FJAB 4Y2CA 3S7RA 2XO7A 4YDXA 2VBYA 2FJVA 4B3MF 4C11A 2J7UA 3TA1A 4DFPA 2B4OA 4GKKF 5KG2A 4WF9Q 2C3YA 3PEJA 2AF6A 2IC3B 3M2VB 3V6DA 1LFWA 2DTJA 3IBWA 1HWLA 4OX7A 4DPOA 3NNCA 5EWEA 1UFLA 2KDOA 1E6VA 1LK7A 1H7WA 1OWXA 4NRUA 4TYBA 3PX6A 3AAWB 4NLQA 2J6SA 1P9QC 2YX4A 2BOPA 5AXMA 4DV4F 1HA1A 3K5NA 4N76A 3TNVA 3Q8PB 1N36F 3R27A 3NAIA 3N5FA 1SL1A 6FDRA 1YRUA 2B3TB 4IKAA 1H2TZ 3UD3P 1IKVB 4WZMA 3VR1A 2W4DA 4DL0C 2XZWA 3MWBA 1R27B 4FPRA 2VH7A 2XSJA 4X65F 3CTRA 3M1VB 1RT4A 3DHWC 5T7LB 1RT5B 1WHYA 3E51A 4HH1A 5GAEI 3HVAA 1X0PA 2GC8A 4QW9A 4A8QA 2E9TA 1Z4UA 4G1IA 3T9ZA 3M05A 4O3QA 5KFNA 2XC9A 2WSCC 2HGMA 2ZD1A 2V9KA 1YVFA 4G6VB 3ENVA 1YJNS 4TU9A 2MHEA 3AY0A 3G8SA 4DUYF 3SXLA 2D74B 2JOQA 2J7KA 2LQ9A 4KSEB 2MKKA 4YB7A 1HMVB 4O3PA 4N47A 2ROPA 1IQZA 1CSJA 1QSLA 1S49A 2DGQA 1D1UA 5A6PA 2MMYA 3FFIA 2CDQA 3MI7X 1NHVA 1OSCA 3K0JA 3H8YA 4EZ6A 1WELA 4WFAQ 2B7CB 1S79A 2LMIA 3GG0A 1V6HA 5E33A 3V6DB 2LA4A 3THTA 4URSA 5KFMA 1RT2A 3IGNA 3PKMA 2DR5A 3O2IA 3DLBA 2CJAA 2W9CA 5B09A 4UY85 1Q7LB 4A46A 5SZTA 1VBXA 3I5AA 3BDPA 1JWWA 4I0WA 4KT0C 3BO3A 1KOHA 1S1VB 3I6PA 4ECUA 1ZYQA 3VALA 1Y7PA 3TAPA 3CE8A 4B9SA 2EFGA 4UUWA 2FJEB 4LSNB 2B9WA 5L9XA 2WCXA 4Q2MA 1WEZA 2L08A 2HHHF 1ULRA 3N6NA 2ADCA 4UQGA 2XMJA 3Q22A 1PSDA 3IS9B 5AE1A 5DM6Q 2PA3A 4MKBA 1N52B 1T8EA 4LIRA 1RT4B 2F8EX 4IFVB 5KG1A 4CO5A 2J9EA 4RNHA 2YKNA 3R1LA 2WK4A 4Z37A 2ZH2A 2NYIA 2CJQA 5SUHA 2FJBB 4Y2MA 2BM1A 4MFBB 3MMBA 4NLTA 4IRCA 2CQ1A 2QA4G 4RBTA 3OFEA 2HPUA 4ZPWR 4YP3A 5LMNF 4L6V3 3MF5A 1JIHA 1MMLA 5KG3A 3MUTP 3QMQA 3CCLS 5D78A 3LPYA 2JX2A 2Z2MA 4NLOA 5JXSA 2J0QD 3FZBA 2V94A 2BANB 2X51A 2FVRA 1H6KX 3PO4A 1JJ4A 3DYAA 5T14A 3HHNB 1N0VC 3MCSA 4TKTA 3SSQA 2RF2A 4UQTA 5K14B 3B8HA 4Y2IA 2CJBA 1ZTTA 3BO2A 3RR8A 4M95A 3FGVA 4XAKA 2OH2A 3MMCA 4EU0A 1UMJA 1FK9A 2P9EA 4R0JA 5DETA 2D9PA 3L7OA 2IRXA 2J0XA 2ZOFA 1C1BB 3UFCX 1JLGA 3BGRA 4F25A 4WFNQ 4ILLA 2HHTA 5DG7A 1S48A 4IDKA 1D8YA 2B9YA 2RQKA 1RTJB 1XEZA 2IM2A 2KRRA 2XLIA 3FVYA 4M5DA 4ZMMA 1UVNA 2F7VA 3MPWA 1KEKA 3OR2B 3M32A 2VA2A 3CUNA 4RZRA 1S1WB 2M9KA 2MKCA 3LUYA 4A8SA 4DUZF 3DLEA 5DQHA 1TZ0A 2HGNA 4MIBA 5EGYA 2AJ1A 5L1LA 4KQZA 4F3QA 1TL1A 1C0TA 1ZAXA 3KHLA 3T5KA 3BF4A 2DHAA 5KT6A 1WHVA 2DPJA 2KM8C 1MWZA 3FEYB 4Q2LA 1IXKA 2XMKA 3DC2A 3EXCX 2L48A 3LOUA 1HHTP 2XHWA 1G2EA 1HI0P 3W7BA 1H3DA 4PXEA 2EW9A 2LKZA 4OX9F 2ASJA 2IHR1 2YNIA 2ZH8A 3PDNA 4KPYA 5GVQA 2AP6A 3UCGA 4NYZA 4DHVA 4DOZA 4DSKA 2YNGB 3AHPA 2V5HG 3NBPA 4AXIA 2GHWA 2WOMA 1WF0A 3EGNA 1TL4A 1HW9A 1NJWA 4NA1A 1FRXA 1VI7A 2KYXA 4P7TA 2MQOA 4IO9Q 1VC5A 2R7UA 2RF2B 2FGOA 2J0WA 2WTFA 3MTJA 3TUIC 4B3OB 4C8ZA 4IG0B 5KFGA 3IA0A 3MMCB 5DGBA 4A8YA 3O3LA 4HDHA 5KFKA 1FK9B 3KLHB 2QA1A 2RDJA 5DGAA 4OHVA 1RT1A 2IFXA 3B4DA 5J2PA 3CD6S 3VQSA 2J5AA 1FD2A 1R8PA 2AW0A 1KFDA 1RTHA 5KG4A 3BGRB 3I55S 4FS2A 1ZZNA 1UVMA 4ZVHA 1MU2A 4X4TA 1MROB 2GW8A 2RU9A 3MECA 1JLFB 4GO5X 4QOTA 1FKPA 2ZH1A 4ZPDA 2W8KA 1FESA 4ZS6A 3H4BA 1M0SA 3P49B 2UV8A 4M5DB 2DGXA 2F40A 1K8AT 3IR6B 2PI4A 4TU8A 1JX4A 1S0OA 3IGVA 2HHXA 4G1QA 3BGLA 3KMSA 7FDRA 2GQ2A 4LSLA 2CQIA 1G6BA 5B0GA 4R8UB 1YJ9S 1TKXA 4B3RF 2JH3A 1YRTA 4IYQA 1CLFA 2CJKA 1OO0B 4K4SA 5HL7Q 4RBVA 1B0PA 3TUJC 1IKWA 2VL1A 4YDDB 4PG4A 1F9FA 2ABYA 2AYBA 2DNGA 1JLAB 5ITHA 2FLOA 3IG1B 4NLUA 3V4IA 1UAWA 4Y3CA 2R8GA 2M7SA 3LO3A 1BWEA 3CIMA 1HWKA 4XPEA 4IFYA 3HZEA 5IM0A 5IFMA 5MLCV 2RILA 3C6UB 2CQ0A 4N5SA 3H4DA 3T3FA 3H25A 2APOA 4ZA1A 2ZFHA 5J2NA 3GMGA 3QAEA 2NXUA 4UW2A 5LSOA 4ECRA 1KQSR 4JI7F 2LVWA 2IVYA 4NCAA 3TVKA 3P96A 1X4CA 2WB4A 2DGSA 5DDOC 1WEYA 1WG5A 4DV2F 3K8WA 3SEOA 1VRUA 2HLTA 3IWXA 2IMOA 4O44A 2OPSB 3E8OA 3GWCA 2HNZA 4O3OA 2KVIA 4F67A 1FNMA 1HI1A 4OJGA 3IWLA 4ECYA 5C42A 4OHWA 3DRSB 2MYFA 4QZVB 1SL2A 4IH7A 4E0DA 2GMLA 1LXNA 2ZM6F 3G8QA 1MU2B 4N8OA 4RW8B 4WJBA 5I3UB 1FKAF 5E3RA 1U1LA 3QAUA 4QW8A 4IR9A 1VK3A 2DNHA 3GB0A 3IR5B 5KG5A 1HNXF 2VA3A 4QYRA 4TLRA 2W7OA 3PKYA 3VAGA 5G0RB 3KLIA 1VK8A 1FRLA 4ILRA 3PW5A 1OPZA 3IRWP 2UUAF 1DZ5A 1U1RA 1U1KA 2Q6CA 4DR5F 4KKOA 1K1SA 5J1EB 2Z0GA 5KFFA 3MFIA 4GMKA 4PKDB 4OL8A 3M2UA 5D6GA 4DX8H 1X9SA 4ECSA 4IRKA 1TKXB 2HVHA 2IVMA 2V8GA 4U7CA 1WWHA 3H59A 1FJ7A 1S0VA 2GJ2A 4KGMA 4NLPA 4EYIB 1ZM4A 1P1TA 1IKWB 1CC7A 3THVA 4K50A 2IRYA 4AUKA 2AGPA 4OI4A 3CD0A 2AWZA 3CCZA 4DR3F 3E01B 3PZPA 1UL3A 4H4KC 4IFYB 1VBYA 1Y00A 1LWCA 5IM0B 1XMOF 3KNAA 3M8QA 1SJRA 5JVHQ 1LWEA 2W4PA 1DTTA 5KFYA 5J2NB 5KFSA 4C7QA 3K5LA 4F4XA 4JI4F 3CDWA 2LEPA 1EETB 2A10A 3J80Y 1LWFA 4X64F 2LQBA 4WU3A 5B0CA 4ED1A 2BV3A 1UVIA 2MY8A 1VRUB 1ZM2A 1RTDB 5A8KA 1FXDA 4ZPCA 3GG1A 4QIVA 2E5JA 2D3OR 2IAJB 2OKQA 4O44B 3I4HX 1F5AA 4XIUA 3BEGB 4DFJA 3MHYA 1HNZF 4N77A 4H4KA 2OPQB 3LGNA 4KHRA 2P9GA 4I2PB 3E2EA 2GO8A 1XERA 2GFFA 4K4VA 1HYSA 3Q24A 1MMDA 1XBWA 3R3TA 3F56A 1S4FA 1D9FA 2HAIA 2YWFA 3JTNA 4O23A 4YB6A 2E5IA 1VQ7S 4F2RA 4GO7X 2PD1A 3OXFA 2XNQA 3D54A 5BYQA 3ZFVA 4C3KA 2RS2A 4FVCA 1J2VA 2K1RA 2MQPA 1M90T 2BBEA 2EBEA 4QIFA 3M4XA 3POTB 1RT6A 2O01C 4ECVA 2G13A 2R7XA 3QIDA 4Z2XA 4PXDA 4ZHRA 5E3PA 1KVIA 1QVFR 3HFKA 1M1KT 1HD0A 2XG8A 3AA8A 4OZ0A 1JKHA 2LXIA 3LP1B 4YEAA 1KNZA 4AFFA 2ZDOA 3L3CA 2PFFB 5HI7A 3K5PA 2BQRA 3OPKA 1U1PA 1JNRB 3N28A 4IQMA 1WI8A 1FVSA 3FEZA 4KV8B 1LXJA 2FB0A 3U7JA 4KJIA 4K5RA 4EYHB 1NZAA 3GIIA 1L3SA 3OJSA 1IKYA 2D7SA 2COLA 5AE3A 4I69A 1X9WA 3MM7A 3FJ2A 1S1UB 2GMJA 1JLQB 4X84A 1S1XA 3HPOA 2CVEA 5HLFB 1K1QA 2WRMA 1BQMB 3DFEA 2RSQA 1S1TB 1TV6A 2EK1A 3EXYA 3I56S 3N4WA 2LQ5A