3IBWA

Crystal structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
TDFLAGIRIVGEDKNGMTNQITGVISKFDTNIRTIVLNAKDGIFTCNLMIFVKNTDKLTTLMDKLRKVQGVFTVERLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the ACT domain from GTP pyrophosphokinase of Chlorobium tepidum.
rcsb
source organism Chlorobaculum tepidum
molecule tags Transferase
molecule keywords GTP pyrophosphokinase
total genus 18
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ibwA00
2F8MA 2QMXA 4PWUA 3MWBA 1YGYA 1KS2A 4IO1A 3O1LA 3L7OA 2DTJA 1UJ5A 4NMLA 5T41A 3DDNA 3K5PA 5JJBA 3OBIA 3ENVA 5IT4A 3TUJC 3ENQA 1RWUA 3LOUA 2LQJA 3MTJA 1LKZA 2QRRA 3AB4B 4GO5X 2MDAA 2KO1A 3S1TA 3N0VA 3OFFA 1YBAA 3IXQA 1PSDA 2RQMA 3LUYA 2NYIA 2P9GA 1UJ6A 3TUIC 3P96A 1UJ4A 3UW1A 2RE1A 1XTZA 3TUZC 4GMKA 3OFHA 3KWMA 3AAWB 5FIIA 2ZHOA 3OFEA 5IS2A 3ENWA 3AB2B 2CDQA 1ZPVA 2JOQA 3CEDA 2F1FA 2QSWA 3HHEA 2DT9A 2I9SA 1LK7A 3OFGA 3W7BA 2H9ZA 2JHEA 3MAHA 4LUBA 1O8BA 3DHXA 1LK5A 3DC2A 1SC6A 1U8SA 3DHWC 1Y7PA 2PA3A 2J0XA 2P9CA 3U7JA 4X84A 4GO7X 2LVWA 2QMWA 3NRBA 3IBWA 1M0SA 2RQKA 2FGCA 2P9EA 5IT0A 4M8LA 2J0WA 2PC6A
chains in the Genus database with same CATH superfamily
1QAYA 4NXNF 5E2QA 3RRKA 3HCXA 4NRTA 4YOEA 1EETB 4P75A 4X62F 4RX6A 3MEGB 1LOUA 1R43A 5C2CA 2ZJQQ 3SFUA 1KRPA 3G71S 1S59A 3DRPA 2XI3A 1TK5A 2Y9HA 2DTJA 2UU9J 2CQCA 2CA9A 2L41A 5KFXA 3MMBA 5KFDA 1NKEA 4ICLB 2AF6A 4QPTA 2ZH3A 3UD4P 1Y0HA 4OZ5A 4ELTA 1RLDA 3R27A 4U96A 1YHQS 4WZMA 5AT1B 4B9UA 1AB8A 1RT5B 5M2RA 3PRVA 5L46A 4OX6A 3NGDA 3KHGA 3BYRA 2VODA 3MEEB 2XZTB 3C14B 4YQWA 1OO0B 3BGRB 3H2VE 2FZCB 2LLZA 2LQJA 3V6HA 2CJXB 2FJBB 1HW8A 3HVWA 3MPUB 2QO3A 5L39A 1U1QA 4L76A 4NXMJ 4FYWB 2JEFA 3BPSP 3EXYA 4F4ZA 3RUBL 3A12A 4LQ9A 3T1HJ 3Q8RB 1TL7B 4QR1A 4ZP6A 1ZM3A 4N41A 2LU1A 1AZSB 4B3MF 5HVFA 3VQTA 2X1AA 1GK8A 1OPZA 4K50A 1H73A 1RZMA 4J90A 2VJUA 2YWHA 3BGOP 3L09A 5LXYA 3BSCA 2VONA 1K1QA 1V5VA 1KFSA 4ECRA 5EDWA 2R4FA 1UFWA 2E5IA 3ET6A 4X4UA 4FPIA 4MKVA 5KFYA 2JVOA 3O3LA 1XNRJ 1YVFA 1A7GE 1SH3A 3PYGA 5HK4A 4B9VA 3MM5B 3MCOA 4TY8A 3TAMB 3THTA 4PUOB 4X4NA 4DR3F 2HHSA 5B0EA 2CG4A 2DGSA 2M0GB 3N6NA 1KQFB 3SFGA 4RNMA 3JTNA 7FD1A 4DFMA 2PDAA 5E3QA 2Q66A 1K44A 2OPPA 1T9TA 3UD3P 1DQAA 5E41A 3KWMA 4G6VB 4ZP8A 2VICA 5I42A 2R9LA 2HNZA 3I5CA 1T3NA 4NLSA 1K1SA 1SQGA 1KP6A 4K4UA 5GAEU 2GHPA 2XZWA 5DDPC 2AX1A 1U1KA 2M70A 1V3ZA 1U0HA 1S6QA 3CCZA 3I96A 1TAQA 3FQLA 4F4XA 2KZMA 1BY9A 1EB0A 1TUGB 2FY8A 1CG2A 2XSJA 3R7BB 3ZZTA 2XGPA 5HQMA 3KHRA 1W2BR 1L5UA 1T9VA 5T14A 3D2WA 2DEIA 3CD7A 2VA2A 3IGNA 2GGPB 3FKBA 3KK2A 2I9SA 3BR9A 4ELVA 1CULB 3QGGA 5KFQA 2QA1A 1HI1A 2K7KA 3OL6A 1NKCA 5D4LA 4DZDA 5C25A 3PACA 1X0PA 1U2RA 5JVGQ 1WTBA 4AUKA 1VMBA 3TEHB 3KDNA 1VQYA 3VR1A 3UDCA 4KH0B 2Z56B 1PAUB 3QIPB 1N5SA 1OIAA 4M5NA 3V6KA 3P4UB 4CDIA 2VOOA 2BZ2A 2BW2A 5LSLA 2OPSB 3CDEA 4LF1A 5MAOA 3QZ8A 3PX4A 2V8PA 2LKZA 5HMWA 3VAHA 4J9VA 2HNDA 3QLHB 5DJBA 3GFZA 4ZVPB 1SJ4P 1FVQA 1DJ0A 2FJVA 1FJEB 1AUSL 2BRKA 2DYAA 3C8YA 4OJ3A 5F8JA 4XK8C 4U7UK 4RU9A 1GH8A 4YP3A 1IR1A 2XMKA 5HVHA 5LSOA 2R7XA 4PUOA 3C6UA 2I6WA 3I0SA 3RTVA 3BJYA 1LWCA 2E1CA 2MY8A 4B3RJ 3Q23A 3KFWX 2GJIA 3MM6A 1U02A 3HVAA 2ILYA 1HBOA 4X64J 2VPZB 3P8BB 3BGFA 3GJQB 3OJUA 3G6YA 4LFBF 3MZIA 1UPMB 2BACA 4KQZA 2R2RA 4Y6IA 3CCJS 1ZETA 1DFDA 1UVKA 5LMNJ 3OPKA 2GMLA 4P52A 2J0SD 4X2BA 1PBAA 4OI6A 4W92B 2V4JA 3NY0A 4ZK7M 4ZCLA 2UXDJ 2V50A 4WTOB 1JLAB 3M6WA 4KC5A 1FD2A 3D68A 3VVTA 1RT1A 4KB7A 4MIBA 2VJVA 3EDRB 2FJDB 2A1BA 4OYXA 5U47A 3GIMA 3QAEA 5D0RA 2B5JA 2DKOB 5RUBA 4IR1A 1IBLF 2ZH9A 2IDEA 1J5OB 4HDHA 2WZ1A 3ICLA 3OUYB 1GXLA 3ENVA 3PHEA 4YR0A 1IN0A 2E1MC 3Q8SB 2GVZA 5EWEA 3AXKA 1KQKA 5K8PA 1N5TA 3I5BA 3NXZA 3HHKA 3QIPA 4FNIA 3BDEA 2C2RA 3V4IB 1F9HA 1WF2A 3W9HA 2HEKA 4Q5VA 1AXQA 3AD7C 3TZZA 3UVJA 3RR7A 1S77D 3HD2A 1LKZA 4HTIA 1P27B 1T9YA 1Z2LA 4R0JA 5FDLA 1Q82T 4OI2A 4PPDA 2IM2A 1C1CA 1H72C 2RRAA 5LM7E 1WEZA 2CJKA 4FYDA 1HYSA 3KDOA 3NAHA 2UUCF 3M9OB 1PYTA 1IR2A 1RWNB 1VYAA 2GZOA 3C6UB 4OX8A 4P2SA 3UO0A 4PG8A 2RD5C 3U1NA 4Z2XA 3OHBA 1X31C 2R2UA 2ZDOA 5HVGA 3K58A 3KG1A 1WC6A 2GVDA 2NPFA 4KSEB 3H4DA 4LVOP 4YMEA 1S9EA 4NLPA 2RF2B 3W2VB 4DUYF 3JSMB 3PV8A 3P96A 4M5MA 5EGYA 4ILMA 1H7XA 3FFIA 3KLEB 1ZTWA 3M8QA 2N82B 1RAEB 4G65A 3KK1B 1HPZA 1ICEB 2AEMA 5B7WA 2XS7A 3D7SB 3TQ1A 1SIWB 2A3JA 1FEEA 1FRIA 2RDIA 2ZHOA 2Z58B 4ZVHA 4CO1A 2DB1A 2B0GA 1Q7LB 3ZC4A 1TVRA 4MYUA 3OUYA 1RAOA 4ZDNA 3SSSA 3UDVA 1L3SA 5HATA 4JB8B 3EGWB 1FESA 4TYAA 3M8WA 3TJAA 3ZTRA 1NHVA 1UFKA 5KFSA 4DV4F 2MZRA 1H74A 2R7VA 2HFZA 2RDJA 1L3UA 4X4TA 3N6LA 4NLUA 1RGVA 3KJQB 4Q2LA 4EFAC 1RWVB 3UVJB 3NWRA 2VOPA 3G9CA 2O66A 4MKAA 3GIJA 2W8LA 4NCGA 4USKA 3MMAB 1OY8A 4X4SA 1B7FA 1C1CB 3B78A 3V4MA 1UA1A 3ELHA 5JXSA 5KFRA 3J80U 3PR4A 3QO9A 5F8LA 4H54A 2O67A 5CQGA 3C15A 5HJXA 1SJQA 2X51A 3IFEA 3L4BC 3DLGA 2GVDB 4DV7F 3GMGA 3OQ2A 1MMNA 3D0IE 1LW2A 4DZ6A 4BC9A 3DGPB 3JSMA 2NSCA 1UA0A 2AJ4A 4WP3A 4L75A 3IRXB 4H4KC 4A47A 1S7HA 2E9TA 4H4MB 4HACB 4ZOSA 2WBRA 3O8WA 1VK8A 4TXSA 3PKMA 1UAWA 1BWVA 1OMSA 2VQEJ 4LF5F 1VBKA 1VJWA 5B0CA 1QSLA 2YNHB 5F9NA 1N5VA 1M1HA 3CMQA 3O6QA 4M8LA 3TVYA 5F9LA 2V8HA 4I6YA 2ROGA 2CXEA 3ZZZA 3P45B 2HFNA 2E1RA 3DRRA 5D77A 2VPYB 1TMJA 1HQUB 2Q6BA 4OZ0A 3ULHA 4OI3A 2J9EA 1GTEA 3J7Z5 2BABA 1JKHB 4P6QA 2BJ9A 1MMDA 2R8GA 2NXEA 4YY3F 2R7RA 3N5BA 5T41A 5FJ4A 1DTQA 2CKWA 2QC3A 4NEYA 3R7SB 4K5SA 2B9XA 2BJ8A 3HSJA 5KFIA 1WNEA 2OEJA 4CNZA 5C5JA 4JI7J 1PG5B 5J2MA 4CO0A 3S6EA 4RW9B 4RW7B 3DLEB 3KG0A 2RRBA 3POTA 3LTOA 5IV4A 2XLJA 4FS1A 3W63A 1Y5IB 2G2ZA 4P7VA 3SEOA 2AJ0A 2CNNB 2VBXA 2G9OA 4OYBA 1MU2A 5CAAA 2DHGA 3A8IA 1VISA 4XPEA 4IG0A 4WKRA 1CBKA 3DRXA 3FCHA 1R0BG 3EJMA 3VALA 2V0NA 4X62J 2R8JA 2FGOA 2EXUA 2EFNA 1JXEA 4ZHRB 2HLUA 2VG5A 4GO5X 3MFHA 1LW2B 1N5YA 2DNRA 3BKFA 2J6UA 1KVJA 1H2VZ 4KGXB 2VKRA 3BH6B 3FEYB 4M5GA 5CD4H 3S1TA 3BDPA 3IAM9 2CUYA 2QZ8A 2AP6A 2W9BA 5BJRA 4DU7A 3RRHA 3K57A 2D3O1 1UWBB 2J9CA 4I2PA 4QIVA 2HQCA 4NLGA 2HRUA 2GQQA 1OPIA 2NXNA 5D6GA 1NSQA 4KR0B 2ADCA 2HVDA 4F7VA 1JWWA 4FKYA 3KLHB 4DR5F 2ZBCA 2LFVA 3RAXA 5KFZA 2ALZA 2FC9A 3J81U 4ZVQB 1XMOJ 4JYAJ 2V2KA 2C2ZB 1R89A 2PFDA 1CEZA 4P10A 1IJFB 2E1PA 4GKJF 1PJ7A 2QLWA 3BSAA 4WIQA 4DQRA 3G2XA 3AT1B 2IYGA 2LYVA 3DDIA 1UEUA 3IG1A 1FHTA 1IKXA 1TL1B 2UUWA 1S1TB 5HAOA 3HKWA 5E0OA 3J81j 4LF4J 1ZM4A 2JL9A 2IBKA 4ZPBA 4QIWD 1O5JA 4LSNA 2AYGA 3W2WA 4L3NA 2MXYA 1IBKF 4PAAA 5IZHA 2BE9B 4DR1F 2YNIB 3CEDA 3D6FB 1VDHA 2HGMA 2MMYA 1WKJA 1I5OB 3HT3A 1HWLA 1YIJS 3WIUA 1U48A 5ETTA 1NHKL 2RKIA 3RB3A 1R8AA 1TELA 1HHQA 4KIAA 4P2XA 5EX3A 4NOHA 4QBUA 9ATCB 2KZZA 3W7BA 4DUTA 3FBEA 2IRXA 3MDFA 1RYSA 4G1QB 1UVJA 5K8OA 2XYHB 4OYIA 4DSKA 1VI7A 3QNWB 1S79A 4ZLJA 1GQEA 2HKEA 3VAGA 4PXDA 4M1KA 1FKAF 1FTRA 1X4HA 2MKYA 2HNYA 1WDDA 1EARA 3FQKA 4CT8A 1CLFA 1S97A 1FFSB 1YKWA 4I2QB 5E7OB 1SUQB 4P71A 3CC2S 5HP1A 4FXDA 5A2QU 3TRGA 4C9DA 3MAAA 3EICA 1ELOA 3RG6A 2JLFA 3IBCB 4OHWA 1Y3KA 4GVLA 4YFUA 1HWUA 2F3JA 2NUUG 4CM0A 3GWCA 2JDJA 3EVWA 2DH7A 3W60A 3PR5B 2NREA 1QY7A 2UUAF 3C19A 2AKWB 3PY8A 2VG6B 1KHWA 1IKVB 1HFEL 1SI9A 3IBWA 4UQTA 4DFJA 4JI1J 2F5GA 3AOBA 3W5YA 1VR6A 1HKAA 1SH0A 2FVCA 2R7SA 4KBIA 3BSOA 4C3LA 3OHAA 3R8YA 1VJQA 2J7WA 2ZC3A 3B8HA 4X65J 4XPCA 4F4WA 4R8UA 4UUWA 2ZJPQ 5HJYA 1S1TA 2YXLA 3KJNB 2O5DA 1CJTB 2VUGA 2E5LJ 4DPYA 1N52B 3L7UA 1ULRA 4U8VA 2HHUA 3NWGA 3LAKA 1Y3JA 2DNZA 2YNIA 3DRSB 4L73A 5GMKa 1WEYA 1BMQB 4RNOA 1S49A 4JI0J 1NK9A 2J9DE 4IOBA 1QD1A 2PN6A 2MKIA 2EPIA 1H2UX 1LWXA 3K5PA 1QSYA 3TNVA 2O3DA 2ASLA 2G4BA 1O6XA 3JQJA 3QFHA 1RT6B 2BJ1A 3DU6A 2OTJS 2M3DA 4B3RF 3HSGA 5I3QA 2I38A 4DSLA 4NZ0A 1BC6A 3TUJC 2NQPA 2LDYA 5IM0B 4OX7A 4IH6A 5ETRA 1RA6A 1H0HB 4C11B 4HT5A 4X4OA 4IFYB 3KOAA 2DGUA 2R2SA 4UZCA 2MY7A 5C42A 1XJWB 2XMUA 1RAHB 3R9LA 2KH9A 1HW9A 2QIFA 3KHLA 4J9NA 5D8HB 2FIUA 1WHXA 3AB4B 3JYTA 3CCUS 3UI3A 2JX2A 3H5SA 4WK3A 3HT0A 4C3MA 5HLFA 4AFFA 4LF4F 1RHQB 3AA8A 2L9NA 2LEPA 3M8YA 1RISA 2BA9A 3ILOA 3CCLS 2VFTA 4PWDA 4A8XA 4DR1J 1BQMB 2E5HA 1FX4A 1UP1A 2BE2A 3C16A 3CDAA 4RW8B 5EWFA 4ZVOB 4LF9F 1X4EA 3LUYA 2AJ2A 3NBPA 2OHDA 2Z30B 1JLGB 4U8YA 3V6JA 4LQ3A 1CC7A 4OI1A 4IDKB 4PYDA 3PO4A 2H5JB 2F4FA 2H65B 4UOFA 3TA2A 2ZHAA 1SVDA 1HNXF 2HFSA 3EYZA 2H51B 2C3OA 1F5AA 1RAFB 1S0NA 3L9ZA 4LFCF 3X3UA 1VBXA 4TQSA 2CYYA 2WSCC 4W4MA 5D4NA 4KGKA 1LEOA 1O51A 3DRSA 4Q7AA 5FIIA 3SQOP 2HBQB 3FGVA 2JJ4D 4F25A 3M4XA 4DS5A 1SL2A 1BGXT 3HHLD 4F02A 2OUGA 1X5TA 2UUCJ 2NS1B 3I9V9 3HM9A 2XM3A 4F4KA 4O3RA 2CVIA 4FS2A 2B4UA 3Q2SC 3P49B 2KXHA 3IAS9 1IKYB 2Y1LB 2BYCA 2FLOA 3GU0A 4DR7J 2KTQA 3DMJB 3HJFA 2V5HG 3HVRA 4TVAB 2CJ9A 4LR8A 2QSWA 5AXNA 1OQ6A 2BX6A 2ZD1B 2E5JA 3DNCA 3G82A 3MMCB 4OYMA 3TR5A 1R31A 4LF9J 2Y8WA 3OVAA 1JLQB 2DD8S 3NP5A 4EUVA 4WFZA 4IQXA 2BJ3A 1UVLA 3MCMA 4HVZA 4MIAA 2QLBB 3ZTQA 2HHTA 2H9ZA 3FMBA 1OYDA 1BE4A 2DR6A 1V5IB 2K1RB 2KT2A 1HQ2A 2IJFA 4LSLB 5A0YB 4Z37A 1VLYA 5FLXU 2C2OB 2EC0A 2C2KB 3ILJA 5A6WA 4C48A 3HVTB 3DM2A 5LOQA 5KFTA 4MKYA 1ZH5A 3T1HF 1TL5A 1GMUA 1S6PB 2FJEB 2M9KA 3M6XA 5KG5A 5SZTA 4G3IA 4J9LA 4OHZA 5JMNA 4TU9A 4CTAB 4C2MA 1TMMA 4YB6A 4LBIA 5J2PB 1AYEA 3T19A 3CD5A 4ANEA 2L9DA 4TU8A 4HLBA 1SPBP 1XIQA 4QWCA 5KFEA 1Q79A 4RUCA 4DQIA 2P6TA 3DOMB 1KC8T 1S1UA 1U25A 1ZS6A 5AXKA 4V19X 3IWNC 1H7WA 2RQKA 2CPYA 3K89A 1NHUA 3F56A 2GJFA 3DXSX 2AW0A 3VZIA 2M8DB 1C1BA 1JMTA 4ENOA 1R8PA 4DV6F 4O3SA 2YQ0A 2J0WA 1UEKA 2AIRB 3OV7A 1GMVA 4DSEA 1SIZA 1VQPS 1AUDA 2QLFB 4X4QA 1HBNB 4KO0B 4CO5A 1CS4A 1BQNA 3PFEA 1T0TV 1X60A 4WXOA 2DO4A 9RUBA 4DV5F 3ZTOA 4IG3B 5CYMB 1FXDA 3V6DB 3CD6S 3MI7X 4K4YA 4NE9C 2AJFE 4NLDA 4F26A 1MWQA 2BUNA 2M4MA 1PBUA 2X1BA 2RS8A 2VG7A 3PJ9A 5ETKA 3GONA 4S0MA 2VV5A 1UZDA 3N4WA 3W9IA 2DR7A 2XEXA 2XMVA 2C2DA 1S48A 3K7RA 3ZTSA 3SDEA 3LWMA 4KHMA 3ADAC 2ZHBA 2DHHA 3J7YI 1SV5A 4Y28C 2E9ZA 3H2LA 2OFGX 2YWFA 3QIDA 2D41A 2QLJB 4ZPWR 2FVSA 2GFFA 2WAQD 3H8YA 2K3KA 3BH7B 1HNIA 1JNRB 1S1VB 2DITA 2PMZD 4E2FB 4ZLNA 4N56A 3OTOF 1U4BA 2OEMA 1S6PA 2HQIA 4DQPA 3E3XA 2C1EB 3DDKA 3O2IA 2GC8A 2XC9A 5GAGU 4J9OA 4ECVA 1XN9A 4KV8A 3NGRA 2BXJA 4YB1P 5HMZA 2ZNYA 5B0GA 3GG1A 4WK1A 3M32B 1YJNS 3FDSA 3B6BA 3VGSA 4AXJA 4RKUC 4CH0S 3QBCA 4K0KJ 2V2ZA 2J6SA 4O0NA 1VQ4S 1Q78A 3B54A 1X7VA 2XMJA 3GIRA 2HBZB 4BC7A 2P2CB 5C7PA 4NASA 1PSDA 3FCVA 2RQMA 2X7IA 4KKOB 3CJ5A 3SCLE 2K8GA 5IQ6A 2DGWA 3UPFA 4ERDA 1HBMB 4KPYA 3LF0A 3UDEA 4N77A 3H5XA 3K5OA 4YN3B 2R7QA 4M5HA 1S6OA 4I56A 3UW1A 2JEGA 4B3OB 3BR8A 5L9NA 1NSAA 1CJKB 3TYTA 3KLFA 3O5TB 4LFBJ 1F5BA 3T3FA 1GMWA 2CG8A 3IGVA 3MPDA 5HN0A 1BQNB 1I94F 4C8NA 3MEGA 2UZAA 3OFHA 4I1TA 1ZOTA 4FF4A 3MMJA 3DYAA 1EQMA 1RK8A 3V6DA 3J81Y 3J7AN 1JLFB 2CJBA 3CXCR 2E5GA 3MMBB 3SQGB 1HNVA 4ICLA 3LQVA 1S9FA 3A8JA 2VG7B 2DGVA 3TUPA 1J5EF 2JNJA 2DPJA 3HK2A 2DXDA 1U26A 3SSRA 4Q45A 3PG9A 1N6QA 3AD9C 4RW4A 4JI5F 4ZLPA 5F0WA 1CJVB 4Q0BB 2V67A 1I51B 2C3YA 5CHCB 3C14A 3R5AA 1FK9B 4O44A 4WFXA 4USWA 2C2MB 1XNQF 3R2DJ 1G3OA 1RCXB 1SCJB 2OLWA 3T5JA 1X9MA 1HMVB 4EWTA 5LMNF 2C3UA 2MHNA 3D6HB 1L3KA 3Q89A 5AJ3F 4ELUA 3GR0A 4DQQA 1I94J 2UXBJ 2DXFA 2IC3A 1GMWD 5DG8A 4Y0FA 2XMAA 4CRJA 3M32A 1WI8A 5K5MA 3ENAA 3T1YJ 2FVPA 2J9DA 2PMHA 1FJCA 1HL6A 3ISNC 5H9EJ 2AHOB 3NNAA 2HS0A 3EWGA 4DV1J 4AXIA 2J6TA 3A1YG 3N79A 2BVZA 1IBKJ 3CW2C 3UR0A 1FE0A 1VFJA 3PYFA 1J5EJ 3PW2A 3ILLA 4HL9A 1EX8A 3TEGA 5MLCV 5IV3A 2B4VA 2ZOGA 1XR6A 3Q83A 4ZP9A 1LXNA 3QSYB 2OPPB 2C3PA 2XTJP 2R8IA 4AL5A 2HGLA 3GYNA 5A8KA 1KLMB 1S1WB 4H4KA 4WFBQ 2CFXA 3PX0A 3PHTA 3FRZA 3TI0A 1VRTB 1QJHA 1NXIA 2RB7A 4MK8A 4QIFA 4EYHB 2QLXA 4ECTA 4OI0A 1OS5A 1TL3A 2G2YA 5BYRA 2B7BB 3CJKA 1RHMB 2QTWA 1X5OA 3I82A 5CH7B 1U0HB 1KR4A 3MWBA 4QIGA 5FD1A 5LXRA 5J1PA 2XSJB 4ZPVR 2E7VA 5DQHA 3CB4A 1LQ9A 4GVBB 5BYQA 4ANDA 2F63A 3F41A 4CYUB 2MZTA 2VA3A 3ZZOA 3OR1B 4JI6J 1JLEA 4JV5J 4C4WA 4CLUA 1UTAA 1RT7B 2VB6A 2ZKUA 4QR0A 4DV3J 2VQFJ 5ETMA 4DPXA 2QL7B 3WZ0A 3KJVA 2O01C 2WOMB 2V4RA 3CCWA 1RAIB 2JC1A 5I3PA 4F04B 5HL7Q 1R0CB 3OT9A 4WYLA 5KT7A 5JVHQ 1X5SA 3RW6A 3KTQA 1KONA 1WSRA 4DWIA 1DLOB 4KJIA 4DHVA 2QMUB 4K4WA 1X0FA 7AT1B 2HNDB 4AL6A 4FN5A 2HYIB 1Y4ZB 4Q8FA 4X4PA 1KKHA 3RBDA 4DSJA 1Y5LB 1QSSA 2RQCA 1P1TA 1U1MA 1Y9OA 4KFBB 3DLJA 5J2NB 6AT1B 4U9RA 2WTFA 4PQUA 1FXRA 5HBMA 3N0VA 4ANCA 1WHVA 3QSIA 4OHVA 2ZUAA 4CH1A 3K8VA 3MM6B 4DL2A 3CE8A 3DLLQ 4U6PA 4DUYJ 3I4PA 4ECYA 4F0HA 3DU5A 4OHXA 1B7YB 1ZYQA 2Z2MA 4BDPA 3R1LA 3IP0A 4JI4F 1UW9A 2DISA 1TL3B 4ZVRB 2L08A 1C2PA 1RXOB 2HPUA 4LBPA 2KXNB 4BWJA 3TZWA 4LF5J 2GAHC 2GV1A 2W2NP 1WG1A 3MFIA 2OD4A 2HQ3A 4ZS6A 2ZBPA 1I6JA 1K47A 3RR8A 3SV4A 1S99A 4HHHA 1S12A 4ED6A 3D66A 3FEZA 2PO4A 4I7FB 4J5OA 4ED3A 2G0JA 4CQ1A 1NK4A 3H5YA 1X9WA 1IQTA 3VZHA 3D54A 5CZVA 4F2SA 1IBCB 1TK0A 2CDQA 1MMLA 2LXIA 2LMIA 4MYTA 3KK3A 1TQLA 2ZOMA 5K8MA 1IVZA 5DGAA 3M30A 2W9CB 2GVZB 3DI6B 2BOPA 4B9TA 1FWKA 1MNEA 1TP7A 1EAYC 2ZC4A 1FD8A 4UTGA 4UOGA 3CVKA 3BKUA 3GCXP 4ID5B 1LK7A 3EE3A 4DCPB 2IPOB 4USVA 5GADU 3CCES 2VH7A 3CC7S 1DLOA 3K59A 1SL1A 1WI6A 2DRAA 2KKHA 2HVZA 4C6AA 4FKXA 4DX5A 1ZTTA 1UW4A 1X9SA 1NRKA 1RBLA 1W26A 4QW9A 4C0BA 2DIVA 4NYPA 4IRCA 3UQSA 3CTRA 1KSPA 1VQLS 3ZZPA 5HO4A 4M94A 4ZVFA 4LRDA 5LMUF 3MR5A 1S6UA 4LIRA 2Z2YB 3H59A 4A8MP 2AYBA 4DR7F 1PJ5A 2VL1A 5CCMA 1N4LA 1DTTA 1MWZA 1Q8IA 3TWZA 3DLKB 4ITSA 2HNZB 4EYIB 1VC5A 1Q8LA 2A10A 2DIUA 1MN9A 3KLEA 4LF8J 3ETMA 2DEJA 5KFJA 5KFKA 4ED2A 4EZ9A 4RPFA 1NJZA 1ZAVA 4ER8A 4WTYA 3W9JA 2LECA 2W2OP 3WIVA 3HMJG 3BO4A 5LL6d 3MR3A 1SC3B 1Y11A 2YQ3A 1QAXA 1Q5YA 2Q43A 1YK9A 2LEAA 3CJ0A 4RBVA 2W8KA 2ZH5A 2HSEB 1NM2A 2DNPA 5G4DA 4K4TA 5GAHU 5ADZA 3PX6A 3RB0A 1DQ9A 1ZPWX 1OSCA 1WELA 4YY3J 4TN2A 2IM1A 4FVMA 2BJEA 2HAIA 2HVEA 3DI6A 6FD1A 4NMLA 4X4RA 4F0KA 1U45A 1KQSR 4HI1A 1YQHA 1IBLJ 3NL0A 3CJ8A 5BXIA 5KOWA 4JI2J 2JWNA 2BDPA 2RU3A 4PRFA 2DNGA 2G0CA 2IAJB 2HRTA 3HZGA 3WHIA 3GJTB 3LALA 4ZIWA 5L1KA 1RTDB 1Q8KA 3QLHA 2XWYA 3LPEA 1N8RT 5E3AA 2YQ1A 4ZPTR 1HR0F 3OW2R 5CYJA 3JSRA 2UV8A 4RWXA 2CQGA 1KHVA 3VAIA 4B3TF 2MJUA 5KFNA 1Q7YT 4I6AA 3MM8B 4G1PA 2HG4A 4YDXA 3BO2A 3H25A 1U1PA 1RT3B 2DNKA 3BN4A 2KG1A 1UFLA 3CJRA 3KUEA 2FLLA 2UXCJ 1JB0C 2BOAA 1MROB 3LW5C 4E8UA 3PCOB 4USUA 2UUBF 3CMES 3H40A 4P2FA 4DX6A 4WZQA 3MUTP 2EFPA 1TKZB 1T9UA 3S01A 4UQGA 1KQGB 1S1XA 4ZVUB 2W01A 4HACA 2FY1A 1NDPA 3NGTA 4DV0F 3SSQA 4OFZA 1RT4A 4DS4A 4IFVA 1DARA 2MKCA 3NCQA 4OYOA 3UN2A 2UUAJ 2V68A 4TKTA 5KG6A 3IM9A 1BHNA 2OPRA 3BQ2A 1U8WA 2QA2A 1YJ9S 4OV1A 4JYAF 2KT5A 1HQUA 5KT6A 3SI8A 4W90B 4FBTA 5CYQB 1D09B 3E01B 2XY6A 1X4CA 4NA2A 1U6ZA 4QOTA 5IS2A 4ED7A 1YJRA 1RWOB 1YSJA 4WU2A 5GAGI 3V4IA 3C66A 3FSYA 1JJ4A 4AQYJ 3EVOA 1UWAA 1JIHA 1VQ8S 1Q8BA 3POTB 1TR0A 2XSFA 2BQ3A 1N0VC 3UCUP 3HFZB 1N32J 4FBUA 4J9KA 1BQXA 3VV2B 1QVFR 4C8MA 2G1DA 3MOZA 3CIMA 1HARA 3S8SA 4ECXA 1RAJA 1VQKS 2YVSA 5IFMA 3Q22A 4HDGA 3FZ2A 3PO5A 4MTPA 1KVKA 1KOHA 3PDNA 4EEYA 3GPAA 2NLWA 4ED0A 2CIMA 4KHRA 4ZHRA 4UUXA 1NCLA 2PEHA 2B9EA 2BEFA 1MN7A 2IJRA 4LUBA 2KJWA 3W2VA 2XNQA 4CLYA 4LRBA 5A8RB 3R1HA 2KXFA 2HWTA 5KAKA 1OY9A 3FFIB 3NMRA 1M5HA 1YZ6A 3TO8A 1RT5A 1S1XB 1NK8A 3WBZA 2HHXA 3TX0A 4DJBA 2EKYA 3IR5B 2PMWA 1M1KT 2POKA 1TTHB 1VQMS 4M63A 4LMZA 2NSBA 2Z0GA 1FKPB 2HZAA 3IWLA 4JI2F 2MZJA 1U2CA 1C0TA 2P9CA 2RSQA 3A4TA 2OMLA 2YWKA 3I55S 2CQ4A 1DRZA 4GO7X 3U1LA 4M5DB 4KAIA 3QJLA 4DMZA 5BYSA 2AD9A 1SKSA 4DF8A 2BJDA 4FZVA 2XGQA 1HA1A 3VVUA 1ZM9A 2IRYA 3JXOA 4QQBA 3H90A 1YJVA 1IKXB 3JQKA 3UCZP 4ECZA 4O3PA 1UPPA 4KH1B 4C98A 3ILIA 2OFHX 2V63A 3LP1B 1CQMA 1K73T 4Q0BA 5CD4A 1PO6A 1RE1B 3MM5A 4QYZK 2BKOA 3JTPA 3FBFA 4NCGB 3L7OA 1WUUA 4FXVA 4A8FA 1FT8A 2GS8A 3VGVA 3OL7A 2YNGA 2YKMB 2NXCA 5T7LA 4HTJA 4RUHA 1ACMB 1IKWA 5B0FA 2WB4A 2YPYA 5I42B 2DJWA 3CDUA 3D4JA 4I68A 1JLCB 3W5XA 3AJDA 3VCDA 3C15B 4EO6A 5IT4A 1SJ3P 1RTIA 2HBRB 2R7TA 1FDNA 4DG1A 3E2EA 1FTCA 4AT1B 2R3VA 1NLKL 1R8HA 1TV6B 5ETNA 2AJQA 1UZHA 5L1LA 1D9DA 2KU7A 4WFAQ 4OZ3A 4NYZA 1RTHA 4C8KA 1QLNA 2EFQA 2IYIA 4O4RA 4BCAA 2F40A 2EBGA 3U27A 2ASJA 3D28A 4ETZA 1WDTA 1U24A 4DDFA 1KBRA 5GADI 1XMBA 3CDWA 2CQ2A 3IS9A 1VQ6S 3MUVP 3GTYX 1CJUA 3MGJA 1D8ZA 4PEOA 2YNFA 1U2FA 3R5BA 4ZN1A 4F2RA 2FDNA 4DXLA 6FDRA 4NMXA 1VIOA 4NZ7A 1UCNA 4C8ZA 2R7UA 1QTNB 1KDNA 5A8WA 3KJFB 3QGIA 4NLQA 2U2FA 5KFPA 2JEJA 1BUXA 3FUYA 4NLWA 2QEXS 2ERRA 1G6BA 2WSEC 1F9EB 1PKUA 4QZVB 1U6FA 4QW8A 3JS9A 1MSWD 1T11A 3K0JA 2MKSA 2FPHX 1YBUA 4A8YA 2VFVA 4PR6A 5KFWA 1GFWB 1XTZA 3HDSA 2Z57B 4I69A 2LA4A 1YG0A 1M5SA 4R5PA 1SJFA 2AWZA 2FD2A 3DLEA 2FLNA 4ZLLA 1HD0A 2ZWPA 2XBPA 2X3GA 3A3NB 3GZ7A 4EMDA 3AHPA 3ENWA 4DPTA 3I0RA 5T7LB 1HBOB 5KFMA 1RT6A 4PG7A 2XCAA 1RCOB 2AU0A 3J80Y 5KT5A 1REVB 3Q24A 4OZLA 4O23A 4PG5A 2QT7A 4DBQA 2FTRA 5IM0A 2PSZA 8RUCA 3OTEA 4XIUA 1N5YB 4QU6A 2LCWA 3GQCA 2ADBA 1JLAA 1P8GA 4HH0A 1RKJA 3PRDA 1T95A 2H4WB 4AYBD 2YKOA 3EZOA 3HHLB 4OYPA 4RBUA 1IR0A 1T3OA 4XTTA 4CO3A 4YHHF 3TAPA 3SMZA 1TK8A 3HJVA 1U47A 3EM1A 2B5JB 2AYEA 2XWXA 2LU2A 4QCLA 3ZNUA 4A4JA 4M5JA 2HVHA 2RMLA 1B99A 2QJ3A 2BV3A 2U1AA 2GO8A 1EIYB 3C6TA 4WBFA 3NGSA 3KHHA 1QE1A 1SC6A 1IBMJ 2R8HA 2CNLB 3DHWC 5HMYA 3RZAA 3T5HA 1X4BA 2DNMA 1FERA 3B4MA 1Q0NA 2FHOB 4IDKA 2XB2D 1A6LA 2DHXA 4F8RA 2EFGA 4JI4J 4FPRA 1N56A 4PABA 5D78A 1NU4A 2B7CB 1TL1A 2LVWA 1URRA 5FDLB 4CIOA 3SYZA 1XNRF 1WOOA 2XG8A 3NAIA 4BS2A 3HO1A 4LSNB 2EK1A 4DR3J 1XMOF 2V9WA 4DSFA 4OZ2A 2N4DA 3EMTA 4PKDB 4X65F 4DL7A 2H54B 4KGMA 1C0UA 1FRJA 5B0AA 4ZP7A 2RRNA 5AE2A 2QMXA 3AY0A 3DFEA 3LH2S 1Q86T 1R8CA 2F8EX 2I8EA 2CPIA 2RF2A 3HHDA 3BKTA 3NCPA 2W7OA 2BQRA 2VDIA 3DMJA 3JQMA 2RILA 4IQMA 3VTIA 4DF4A 2RHQB 2XS5A 3BV8A 4K0KF 1UJ5A 1K8AT 3THVA 1TZ0A 3EDQB 3KLGB 2J7KA 4N5SA 1JLQA 2GW8A 1YJWS 2QG9B 4X66J 2M52A 5ETQA 2OSQA 3TJ8A 2J76E 2ZFHA 1VQ9S 1UL3A 2KB2A 1KNZA 2B56A 1RSCA 3TJ9A 4TY9A 3M2VB 2EBEA 2DGOA 3AA9A 3D3CJ 3HVTA 3D6MB 3OTCA 2OELA 4OJ1A 2CQBA 3M9NB 4A46A 3NKYA 4FNHA 3ISND 4CTAA 4K4XA 1RKIA 3CJ3A 1EZZB 8AT1B 4TLQA 3K17A 2ZUGA 4PXBA 5F0UA 5HI7A 3UDLA 2MDAA 3UNGC 2HMIA 1VIXA 5DG7A 3FEXB 3R6LB 4JI0F 2WVCA 3DXBA 5KT2A 3NOGA 3G8SA 4B9LA 4DV2J 3I87A 3K2YA 4EBEA 5D4PA 4IKAA 4JI5J 2RT3A 4K7QA 1KTQA 1TKTA 1FA0A 2VF3A 3BBBA 3KUGA 4DFKA 1N32F 2AEJA 3QO9B 4RL1A 4IH7A 4OMFG 1NDCA 2MKJA 3AOAA 3MM9B 4P72A 2KL8A 2VFUA 2N3LA 1F6TA 1RQ0A 4ZJOA 3VGTA 2PFFB 2OJ3A 3DLGB 2KHDA 1R3NA 4DCOB 2CQ1A 1KOOA 1AA1B 3VAJA 3HD1A 3HHLC 4MH8A 2CNOB 2HZCA 1F0XA 2V8GA 3IRXA 3CWJA 4IG3A 2OPQB 1ZZFA 4KGZB 3GE9A 3OFEA 4QYRA 4DOZA 2MZQA 1MW7A 4ZKAA 5EHHA 3MURP 4V19J 4PG4A 3KLGA 3GYXB 3QRPA 2OTLS 2AJ1A 4O4GA 2K2PA 4WCEQ 2FC8A 2FHKA 2FVRA 3LP2B 1YJ7A 4HH1A 3PXGa 4DV2F 1EQ0A 2W2QP 4AD6A 2YNHA 1U1NA 3G8TA 4KY3A 1SV5B 1WG5A 3JYTB 3FCWA 4B3SF 3IM8A 2BE7D 1F3FA 1CC8A 5K20B 5IT9U 1K9MT 1HNIB 1S1VA 3KLIA 1HHTP 5AE1A 3PIOQ 3FJ2A 2MQNA 4FYVB 4LR7A 1JKHA 4DPUA 1RTJA 2BE2B 3C16B 4DLEA 2AZ3A 2YH0A 1NUEA 5L9XA 3HXMA 2WVFA 5IOLA 1SKRA 1FRLA 1XMQJ 1A0OB 1JLGA 1H6KX 2G13A 3NS6A 4LVNP 4O3NA 2OAUA 5SUHA 4DEZA 3CJ4A 2LA6A 2PA8D 2Y1RI 2C3MA 1LV5A 4URQU 2EG2A 4RW9A 4RW7A 4ALZA 4KPCA 5KG0A 3J7YU 4DR6F 3MEKA 4P9SA 4DL6A 2UP1A 2WCXA 5J2QA 2EI5A 2JLGA 3IC1A 2BM1A 4URGA 2CZ4A 1T05B 4F50A 3P5BP 2Y3YA 2ACMA 2QYCA 2VBWA 3BPDA 3WDOA 4X66F 1EP4A 2VQFF 4OQJA 2X1GA 1IXKA 4PPZA 2G2OA 4I0WA 3HPOA 4XAKA 2WW4A 3NLCA 2DHAA 2JH3A 2SXLA 1TAUA 4NYOA 1N88A 2ASDA 5DQIA 4LFCJ 2MSSA 1MWYA 3R2CJ 3EGZA 1M5VC 3G87A 4F4YA 3CDBA 5K9FA 2W9BB 3IBFB 3SQGA 1FX2A 3MMCA 2KFZA 1JQGA 3BGUA 2E66A 3R5CA 4PWWA 3AQOA 3A3OB 5G0RB 3R5GA 2DCUB 1VRUB 4ID8A 3MEDB 4XDCA 1N6QB 4MK7A 1N33F 3CPWR 2HFVA 3FMWA 2XO7A 2BQUA 1CJVA 3T6BA 1R0AB 4CLWA 2DH9A 1IWGA 3KLHA 1LWFB 3DDNA 3FRYA 5DO2A 5I4MA 5GAHI 1NNDA 2E7WA 5DLFA 1FJGJ 5JJBA 3KLIB 4Y2AA 4CLZA 4M95A 3V2UC 4ZPDA 1WACA 2XI2A 3JAMY 2KN4A 2XS2A 1HWKA 1WKLA 4NI2B 4Y2IA 3EZ5A 2OI2A 3KUHA 1VC6A 4LIWA 1RI7A 2HHHF 2E7XA 1PIEA 3P6YC 2D1CA 3M2UA 1JLBA 4ZITA 3M8ZA 3TAQA 3GLJA 4DR4F 5F8IA 3CSKA 1YJUA 4N8OA 2EC2A 3DOMA 4OYZA 2IFXA 4Z7YA 1X4FA 5J2QB 1BLUA 1NK6A 1T05A 2CQPA 2APOA 2ZM6F 2KO1A 3G6ES 3G6XA 4O3OA 1E6YB 4ATNA 4DPWA 1NPPA 3MCSA 1L3VA 2WONB 3LPYA 4CI0B 2G1HA 1KD1T 1N36F 1XWLA 3LO3A 3UR3C 2EW9A 3TUIC 2MPUA 3AODA 5A8KB 7FDRA 1B64A 2OD6A 4UOCA 2MHEA 3EGNA 3EUNA 4HT7A 2CQDA 4Q2MA 4DR6J 3CJKB 1JJCB 2AQ4A 4B08A 4CZCA 2ZE2A 3Q86A 5F8GA 4I4BA 2J8AA 1S7IA 2BANB 4ED1A 2XMMA 2Y1JA 1HNWJ 5G0RA 1GT8A 4L72B 4EBDA 3LA0A 3KLVA 2KYXA 4USHA 4DL3A 2D9OA 1HD1A 2Y0SD 1N54B 2XY7A 4CYUA 1LWFA 2ZBRA 2XMTA 3OR1A 1EKRA 5KFBA 1Q4RA 2KI2A 2DBBA 1RT7A 4NPOA 1H3DA 4IO9Q 1W25A 1XK8A 2RUGA 2JOQA 4JI8F 2GNKA 5GVQA 3NS7B 4J37A 1Q95G 4NI2A 5HROB 4CWBA 1TL4A 2WOMA 2W2PP 2DT9A 2RVJA 3BEGB 1QDUB 1FWPA 2FLPA 1TKXB 2IHR1 1N36J 1FXLA 5IWAF 2IVMA 5H9FJ 1JLBB 4UY85 3QT7A 2CJYB 1FRKA 2O1PA 2QX0A 4O3QA 2ASYA 2V69A 3NMAA 1MG7A 3W65A 1AROP 1UETA 2JHEA 4QU7A 2VC1A 4KFBA 5J2NA 1J27A 2I1RA 2OO4A 1O8BA 5B0BA 4UW2A 3MUMP 2JEIA 3GP9A 5C24B 2MZ1A 3T1YF 4WKYA 1ZAWA 3QMQA 3MPWA 4ZVGA 3IR7B 1E6YA 3W61A 2AZ1A 4JP8A 1XC9A 4WYWA 2K7JA 2WONA 4O0IA 4IFYA 3V5RA 2XHWA 2ZDPA 5C42B 3ITHA 4CCHA 1V3SA 3DYAB 1ZAXA 1EKSA 2UUTA 1VOMA 2FJWA 3CCRS 4RJVA 2OP5A 2QMWA 1DAXA 2ZBQA 2ZE2B 3ZNJ1 4CLSA 4NCBA 5H9EK 1M90T 2BKNA 3LAMA 5JUMA 1DY3A 3SV3A 4RW4B 4Y2CA 5DQGA 3BN7A 5IT0A 4JV1A 4P2MA 4I7FA 4DR4J 1RWXB 1Y00A 4NLTA 3GFXA 4PWUA 1CULA 1RLCL 2ABYA 2UXDF 3M1VA 2V4QA 2LQ9A 3KK3B 4DV1F 4IO1A 4F3QA 4GC7A 1FNOA 5KT4A 3M30B 1F2HA 4DR2F 1NSPA 4Y65A 5HROA 3M2RA 3QT5A 4UY8T 2LQ5A 4ZCIA 2HS3A 5H1SV 3K5MA 4M5KA 3PJXA 2ZBIA 2OPSA 4A8SA 4P7TA 4BWMA 4DL5A 1S0MA 5DM6Q 1U49A 3RB6A 1PC5A 3I9ZA 3TZXA 2F9JA 3M8PB 3QPIA 2A2CA 1Y5NB 3LOUA 3HULA 1VQSA 2V8DA 1HNWF 2LQBA 2UXBF 4HHUA 3THPA 4C3KA 5C24A 5ITHA 3Q8PB 5DLGA 3RAMA 1YI2S 4DN9A 1WHWA 4USTA 3VQSA 1N5QA 5ETOA 5GAEI 3K5LA 2VC0A 3ZTPA 3J7ZT 2B6AA 4TLRA 4NRUA 5KFUA 2WW8A 3ITHB 3NGKA 1JXVA 4P73A 5DZ6A 4PZVA 1FNMA 4TQRA 3TZYA 4DR2J 2WB1D 1G1XA 1CPZA 1RAGB 1FJGF 2FHMA 3RB4A 2AMCB 2EG1A 3M6UA 2V4JB 3IXQA 4J9PA 3PW0A 1H38A 4U7UD 1EHWA 4K2XA 1RT1B 1JXLA 4DSIA 3AOCA 1GAOA 5K14B 1HLWA 2IRUA 2EVZA 5J1EB 4I64A 4RNNA 2CZ9A 4KYZA 2W24A 4N8NA 3QJJA 1KWMA 2AX0A 5KG2A 4A8KA 2GMJA 3QRRA 1E6VB 1RWPB 5HQLA 2HHPA 5K8NA 2GJ2A 2FJXA 4NLOA 3PYDA 2HURA 5LMUJ 3WQPA 3KJVB 1IWAA 4FF1A 3E51A 1KEKA 4RNHA 4H4OA 5EWGA 3D1OA 3JSBA 2M2BA 3AB2B 4L3KA 4I67A 2ILZA 1NBEB 1QM9A 2I0XA 1T9XA 4RWWA 1RTDA 1C1BB 2ZITA 1HBUA 5CA5A 3JB9k 1VQNS 5A2QY 3M8PA 3KG4A 5CZXA 2XLKA 4QYZJ 5B09A 1HYSB 3EXCX 4EGLA 3MAQA 1EETA 3QAUA 4J9SA 1ROFA 2IBOA 4WP8A 3AJ1A 4OI4A 2MQQA 5DS7A 3DRPB 1D0EA 3MM8A 4URSA 4QPXA 2Y0BB 4DQSA 1RTZA 1WC5A 5KFVA 1RHJB 3H42A 1GX6A 1RT2B 2BRLA 5L1IA 4RU2A 2B51A 4DI6A 2XYPB 5KFGA 2YKQA 1NZ8A 1RU2A 5B08A 5KFCA 1T8EA 4OX9J 4IRKA 2AGQA 2IVFB 2W2MP 3WX8A 5EUHA 2EEYA 1U8SA 2YY3A 4J9UE 3KK1A 2RAQA 4Y3CA 1F1BB 4D3GA 3CF5Q 1Q1KA 3UN5A 1B0PA 5I3UA 4CM2A 1VLOA 2UVWA 2CPDA 3ZZYA 5M2PA 4HKQA 2KFNA 1VS3A 1VBZA 5J1EA 4J7CA 2OPRB 2NR0A 2A6OA 2UVUA 2LP4A 2D3ZA 4WE1B 1JJHA 2HS4A 3DOLA 5DDOC 4MMOA 3H5UA 4MFBA 3QGPA 1X5PA 2RU9A 4CNYA 4C7QA 2L3MA 1AT1B 2HQFA 5IXUA 4DLGA 3U1MA 5CABA 5D3GA 2ZKTA 2FJAB 1PAEX 2UVRA 4YDDB 1RDRA 3W1YC 4ED5A 2GIQA 2C42A 1P9QC 2QFJA 2E5LF 4RW6A 2W4CA 1YGYA 2WHOA 4OX9F 4P74A 3GFYA 3VHQA 3AD8C 4K4SA 3T1AA 1RHUB 2ACYA 3KLFB 3MPYA 1SL0A 1S76D 2QA4S 3AFGA 1U6BA 2HBYB 3T5KA 1WC4A 2YBVA 2YX7A 3OBIA 4LRAA 2W4DA 3KMSA 4WFYA 1XQIA 3Q8UA 3GR1A 2XLIA 3BQ0A 3DOKB 3ENQA 3VAFA 3TOQA 2AV5A 4LF7J 3JAMU 1DTTB 3A13A 1S6QB 5D0EA 3BBFA 3DGPA 4C8YA 3DLKA 3OXLA 2YKAA 4OYWA 2IVYA 4NXMF 2HW3A 1FO1A 2B4PA 2RIJA 4IYQA 1FVSA 3H98A 4DX7A 3M8SA 3DLBA 3KMQA 2QRRA 2ATCB 3A8KA 4AL7A 4K5RA 2YWGA 2MLXA 1R6VA 2CJQA 2GGPA 3RJMB 3IN5A 3BQ1A 3GJSB 1UKUA 5I3UB 2HIQA 5BR8J 3N01A 3N6MA 4N76A 2MZSA 2V9KA 5C25B 1TFYA 2F4VF 4F67A 4B9SA 2I2YA 1DURA 4CLKA 3ONQA 4ECSA 4JI8J 3NCRA 2D74B 4U7CA 5CYMA 2IA6A 4WE1A 2CADA 1OQ3A 3TA0A 4MFBB 4DV0J 2JZ5A 2IC3B 1NSKL 4JI1F 1WJ9A 4N47A 1Q16B 5KFHA 3M6VA 2NPIA 2WVBA 2UV8G 2VKZG 2EFVA 3BM7A 3MPVA 3R3TA 3CCVS 3PTWA 4NX9A 1Q53A 1DTQB 4HYKA 3TVZA 3RW7A 4DR5J 4LF6J 2VHGA 3TUZC 4RW6B 2ZVSA 4ES3A 3MOJB 4KHPJ 1SQFA 4ES2A 2MYFA 1WSVA 2QSFA 5KFFA 3RBEA 3I0SB 2HLTA 4QIEA 2RHSB 1I3OB 2ZEJA 3CCTA 1LWCB 3LP0B 3HKZD 5HMXA 3CUNA 3UN3A 1PILA 3BF4A 2GQCA 3I5AA 2XYGB 2YKMA 3P5TL 2DPIA 1T94A 4USMA 2MQLA 5F41A 1NDLA 3H0PA 2CRLA 2DO0A 1VRTA 4UOHA 3MM7A 3I56S 3VAMA 3PW7A 1RTIB 3HFVA 2F1FA 3HSZA 3PEHA 4F3MA 4W98A 1S10A 1S4FA 3MHYA 2F9DA 2VG5B 4OZJA 2RS2A 1TV6A 1RBAA 1VQ5S 2WVDA 3GFHA 1RADB 1RTHB 2ALYB 3F0NA 4GVBA 1B0VA 5F8NA 3MEEA 5L8RC 2W1BA 2FQQB 2Q79A 3D0HE 1PYSB 4Q44A 1UWBA 2GA7A 2MKHA 2QN6B 4LREA 3PRBA 1D9AA 2D7SA 3IS9B 3QZ7A 2DHSA 3N28A 2R42A 3CD0A 2N4CA 2ROEA 3HP6A 1NK0A 3ZFVA 2H4YB 1NJWA 4OL8A 1TL7A 2BM0A 4AQYF 1X4DA 2ZZTA 1B70B 2ZH7A 3CCSS 1AZSA 4ILRA 4BLGA 4ZIVA 4I6WA 1VCTA 2HIYA 3TA1A 3E01A 4ZVEA 4ZMMA 1VQ7S 1WKKA 4NCAA 3IG1B 4WF9Q 4HHJA 1SC4B 4QWAA 4B3SJ 3QGHA 2DH8A 3AJ2A 4ZPAA 4X64F 1VBYA 1M0SA 2B8QA 3W2WB 3SZ2A 3QATA 2AT1B 2PE8A 5GMDA 3G8QA 4TY8B 3TAMA 2KG0A 3PZPA 2NCKL 1QUPA 4L6V3 4GKJJ 3LP0A 1N34J 4YR3A 2RKIB 1KN6A 3BO3A 3CGIA 2PD1A 2ZH4A 4KGVB 2WK4A 3F44A 3M9MB 1MLAA 2F7VA 4OYAA 2VD3A 1KS2A 3PKYA 1REVA 3UFCX 2FHJA 3MM7B 4G1QA 5KOXA 2X1FA 4DV5J 2A0FB 3M8QB 1T7PA 2RJZA 1WOSA 2HAFA 3BGLA 4JI3F 1HPZB 2A18A 3ZXWA 4CLTA 5FLXY 3MCNA 1Y10A 1D8YA 1TU0B 2QE5A 1WWHA 2E1AA 2HNYB 4DUZF 4EO8A 2PIIA 2IIHA 3AXMA 5D0GA 3KK2B 1TVRB 2QL5B 2W25A 4LR9A 1FKPA 1AFJA 3JTOA 3MTJA 1IM6A 1B4SA 1BD6A 2CPXA 2VPXB 3M7VA 3C6TB 5KFOA 4M5DA 1RWWB 2HWIA 3Q8YA 1QE1B 1DHMA 2C2NA 2LQ8A 1IKVA 1XBWA 3PIPQ 2C2EA 1FFGB 1W2IA 2DNLA 2FUG9 2M8HA 2XULA 1RWKB 4ID5A 3OL8A 1NJYA 3NNCA 5KG4A 1RACB 4USJC 3Q8VA 2B9YA 4LFAJ 4ETXA 4G1IA 3RAQA 2BKPA 1RA7A 1YBAA 3MF5A 3MMAA 1LNQA 3OSNA 3IRWP 3C2PA 1UVMA 2VU5A 3QJPA 3LP1A 4YS2A 2E29A 5DDRC 1WOPA 4QJVA 3FSXA 1RUSA 1QVGR 4EBCA 3GB0A 1FFWB 2HRYA 1EJ7L 3OLBA 5ETVA 3IMQJ 3DKDA 4GKKF 1FDAA 2D69A 5HSPA 3RRGA 1RHRB 2YNGB 4UT4A 2B4OA 2KVQE 4TU7A 2BR0A 2HHHJ 2W7PA 1IKWB 3AAWB 4FYXB 1R27B 2YKPA 1NAQA 1JLCA 3QQCD 1T9WA 2R8KA 1N48A 2OH2A 4H4MA 1ITPA 5L1JA 2KJVA 5KTQA 1VRQC 4IOCQ 2HK3A 2MEWA 4JV5F 2XNRA 3UD5A 3HX9A 5F3TA 2LXUA 3D3BJ 3RBXA 1NH8A 1PC4A 1AW0A 1JX4A 3IR6B 3CCMS 5HLFB 2H1YA 1J5OA 2CQIA 2B8PA 2XZDB 3MTKA 4ZN3A 3HI9A 3VAKA 4GRSA 2DK2A 3PEJA 1BQMA 1DQ8A 2HGNA 1Z1ZA 1SB6A 3EVMA 4PCQA 2DNQA 3DCAA 5IC4B 3OTOJ 3K5NA 2WSFC 1VQOS 3M05A 4B3TJ 2VBYA 4WJBA 5AJ3J 4B02A 1NK5A 2G0IA 4NXNJ 5A8WB 4DCJB 4HEA9 2HMIB 4YR2A 2ZOFA 3Q8QB 3T9NA 3MD1A 1OYEA 5M2UA 1LWEA 2I5JA 3J7A1 2BMBA 2NYHA 3QYYA 1N33J 1TUVA 4ECUA 1FRXA 3UNYA 4LRFA 4LBHA 4IRDA 2HFOA 1XERA 4PQAA 3WC0A 3CULA 3ZZ0A 2FZKB 2J0XA 4JOUA 4TNOA 2RH3A 5ETPA 3W8PA 1MU2B 1NB2A 2AYMA 2CJAA 2JRSA 1GEHA 4F0MA 4R5PB 1HI0P 5J1NA 4DUZJ 4OZNA 3MM9A 4X84A 5L38A 4JI7F 4L74A 1UMJA 4ZVTB 5KG1A 2A2DA 1RT3A 3GV7B 1SBRA 2QFIA 3ZZUA 1AFIA 3B4DA 5D0HA 1SC1B 4RNFA 4Y2KA 3QRQA 1S9EB 2FGCA 1G2EA 3CJSA 1IKYA 1KTVA 1F60B 3T6JA 1HWJA 3H2UB 2N7CA 1DZ5A 4LT6A 2QGFB 1RWMB 3EZUA 2M88A 3OXGA 2ZD1A 2F8MA 2GAGC 1QAIA 1QTMA 2E9RX 4LSZB 1R6YA 4PXEA 1RT4B 4CP5A 4IFVB 1WHYA 1X4AA 3BBCA 4QR2A 1FE4A 1FRHA 3LP2A 3MR7A 4N7TA 4WU3A 5DDQC 2CWKA 3US5A 1NDKA 5BR8F 2QL9B 3GV8B 2R7WA 5A0YA 1FEHA 1VK3A 2CAJA 4U67Q 3L3CA 1PCAA 1WC1A 4ZCKA 3GV5B 1G4CA 3A8EA 3OTDA 2RNEA 1CQNA 1FI4A 3KNAA 4Y34A 1YBTA 1YWXA 4WPAA 2ZNZA 2D3UA 2DXEA 5CYQA 3V81B 2FHJD 4CLFA 4TYBA 1D1UA 3NNHA 2HQDA 3G6VA 4EZ6A 5J2PA 2YH1A 3GSIA 3FNNA 2D3OR 2CWXA 2A6MA 4PYAA 1LWEB 2I5JB 4LJMA 4EI2A 3UCGA 4UZBA 2HQGA 2VASA 4ZJQA 1BXNA 4MIWA 3W62A 1GXUA 1RU1A 1QUVA 2JVRA 3K8WA 1HI8A 2DGXA 3H7HB 2KFYA 2KT3A 3FZBA 4RR5A 1L3TA 2ZH1A 4U95A 4QWDA 4J9RA 3OFFA 2J0QD 2IA0A 2ZVIA 4CLLA 1NO8A 2MTLA 2KDOA 5F8HA 1YTYA 4J9QA 1PGZA 2NYIA 2OIHA 3GYGA 1UJ6A 1HWIA 1NEEA 3AH6A 3MD3A 3FVYA 5A8RA 3PYEA 3VF0B 4ECQA 1Q5VA 3LWLA 1U09A 5KFAA 2RE1A 2GHWA 4CO4A 3DGVA 4C97A 4HI2A 2CPZA 1SXLA 2KHCA 3R6GB 1NPKA 1SUQA 2EWHA 3R5DA 3RGIA 1FKOB 3UWTA 1F3VA 1NMEB 5B0DA 3X1LB 2GIFA 2HHVA 4DL0C 4M5LA 3MAAB 1CSJA 1S72S 4MKBA 3MR2A 3MEDA 1C0TB 2Q3PA 1YRXA 3SDEB 2GCFA 1JNZB 1PJ6A 2GO9A 2IMWP 3D6TB 1IJEB 1W7WA 2LDIA 3PNIA 3DRRB 2V6AA 4KE5A 4CT9A 1P1LA 4K8RA 4RUBA 1YLXA 2Q6CA 3BREA 3EGVA 3MXHP 2F65A 3D0GE 3HZEA 3V81A 2MJNA 1O0PA 2IM0A 4KV8B 4FF2A 3OJSA 3TARA 5IWAJ 4C8OA 4DX8H 2NXUA 1ZA2B 2DCLA 3A3PB 4ZVSB 2LXFA 1JJ2R 2NXJA 3FBBA 5J2MB 2BJ7A 2YWWA 1HR0J 4B9NA 3D1HA 1FJ7A 3TX8A 1LW0B 1APSA 1WD6A 3HF5A 3CIZA 2K3IA 2N7YA 4KKOA 4IR9A 1XMQF 4XDDA 4ZJLA 1C4AA 3BYPA 1N34F 2H48B 4DU8A 4EU0A 1UVIA 2GIRA 3SXLA 3OL9A 4IG0B 4RO0A 5E3PA 3CC4S 2UUBJ 1NPRA 4R25A 4DG1B 3D5MA 4C11A 1S0VA 2PA3A 1ZA1B 4V1Ak 4DV7J 4C8LA 5E33A 2UU9F 2IY5B 4KTQA 1ZBTA 1XR7A 4JI3J 1TUWA 1VHFA 3O44A 1P6TA 4LF8F 4OLOA 2XQCA 2CPHA 4DV4J 2OPQA 2PGCA 3AQPA 1JLFA 4QWEA 1R7IA 1IQZA 1RBOB 1J2VA 1I1GA 1YRTA 3DN9A 1HNVB 5DGBA 3R7NB 1FKOA 2MKKA 4FF3A 4FVCA 1TFWA 1A9NB 2NUHA 1X4GA 3LANA 1P9YA 2IMOA 4I2PB 2HZVA 1PYOB 1XR5A 2COLA 2DGTA 1CJUB 4RBTA 3RYLA 4B17A 2YNFB 3R97A 3ZZRA 1LFPA 2JFDA 1FK9A 3PFOA 4NLRA 4O44B 4BHQA 2WRMA 4KT0C 1YZ7A 2GQ2A 1FF2A 3ETOA 2HFUA 3LGMA 4M5IA 4D3HA 2PEBA 1RTJB 2KYZA 5F8MA 2N3OA 3HHNB 2CZVC 2FVQA 2CVEA 4J9MA 2VDHA 3SCIE 4UF4A 1TKXA 4GC6A 1H98A 1OWXA 1WF0A 2J7UA 3I4HX 1VGYA 1NH7A 5DETA 4FDFA 2F8HA 2V2VA 5THWA 1LW0A 1BWEA 2WVEA 2VPWB 3R5JB 1RWUA 3I0RB 5C2GA 2MQMA 4ED8A 1HQEB 1M5OC 3OSPA 1EP4B 3OR2B 5AXLA 2KM8B 1Z2ZA 3KXDA 2GHVC 1JK9B 1HHSA 3SCKE 3GJRB 4JV2A 3G82B 2H3EB 2UXCF 4ZCMA 4YUDA 4RLEA 1REGX 2CPJA 2VIHA 2MLZA 3C46A 2NZ4A 5AXMA 2W7AA 1V9OA 2OGUA 3QFWA 4LF2A 3GILA 3HHLA 2AGPA 4YB7A 2KRRA 1YRUA 2DNHA 2EFOA 3S7RA 3TW0A 5CXTA 2XHCA 2K1RA 3D9BA 4I2QA 4LSLA 5HP1B 1XEZA 3H20A 2DR8A 3CJQA 2VZ9A 2KM8C 4E0DA 2HWHA 1D9FA 2FB0A 2P9GA 1SJ1A 3BZQA 3DM2B 1U1RA 4F4AA 5DG9A 3VGUA 1VRUA 3HFKA 2MQPA 4ILLA 2RQ4A 1UJ4A 5GMEA 1RHKB 2VQEF 1HNXJ 4R0EA 1WEXA 2V94A 2MB0B 3QWPA 2B9WA 2IDLA 4LF7F 2OEKA 2K06A 1JLEB 2VG6A 3HLUA 4XO0A 5LSRA 3ZO7A 3HSDA 1SH2A 2IJNA 3FC9A 3M1VB 5IQQA 2DR9A 4OIXA 1T03A 2HK2A 2W4PA 4IOAQ 3BS9A 4ED4A 4CLPA 4R8UB 5F3ZA 4DPOA 3I6PA 3KNGA 3F73A 2E44A 3B82A 1CJTA 3MR6A 3RU0A 2JFKA 1LXJA 3M2UB 3PW4A 2M5YA 3M8RA 1FWLA 1RABB 2Q1LA 2DNOA 3PJWA 1UEVA 3GIKA 1SKUB 4OLPA 1C0UB 3HHEA 3EX7B 1HBNA 4DN0A 1RYRA 4KO0A 4PQUB 1HNZF 1TKDA 1CS4B 2Z2ZA 3CMAS 2XO6A 4WP9A 1HQEA 1R8BA 3RBZA 5HBMB 4NA1A 3KKFA 3OR2A 4MK9A 1WORA 3NOCA 5ETSA 5EN1A 1WF1A 4Q43A 2JC0A 1GX5A 2P6SA 5HANA 1RB0A 2B6AB 3BB5A 4DFPA 3NG8A 1IUJA 5D4OA 3T5LA 4C0HA 3L7PA 1S57A 3DHXA 3OD2A 1URNA 1S5ZA 1Z4UA 4YB5A 1KLNA 5HQ8A 5H9FK 2ZM6J 2CPFA 2P5VA 2BANA 1OJ4A 1RP5A 1FDBA 3I32A 4JBCA 3M2VA 3KYLA 2UVVA 1B0TA 3NGUA 2YPZA 4JUZA 3T9ZA 2C28A 2ZJRQ 4ECWA 4PWDB 1S4EA 4WIIA 2H5EA 2M7SA 4NEZA 1GNKA 4NWBA 4PXCA 2R2TA 4RW8A 1NK7A 4F36A 3SCJE 5E3RA 2B3TB 2MGZB 1ZZNA 3NRBA 3NBPB 4OZ1A 1E6VA 4E98A 5KT3A 3CCQS 4NZ6A 5D15A 2BW7A 4NLYA 5KFLA 1U1LA 2HVIA 2HHWA 1T03B 4J91A 1V3RA 4OJHA 1IM4A 4DV6J 2P9EA 2W9CA 1NKBA 1LFWA 5DZ7A 4A8WA 2PC6A 3IWXA 2W9AA 5EX0A 4NA3A 1U0SA 3OXFA 2ZZMA 1NJIT 1TKTB 1Q81T 5ETLA 1NZAA 2XY5A 4FXWA 4CH7A 1NB7A 1HBMA 3N5FA 5IC6B 3O1LA 1HBUB 2DGQA 4B9MA 4NLVA 2F4VJ 2ZZNA 3W3SA 3TQEA 2QV6A 3CO9A 3MECB 8ATCB 5LT5A 3OLAA 3GIIA 3E8OA 4MJKA 2QA4G 3SBMA 2ATLA 1M5KC 1UVNA 2Y8YA 2CQHA 4HR2A 4A48A 2ZH6A 3BSNA 1S9GB 1B3TA 2YX4A 1FNXH 5LJ3Y 1SKWA 2OMOA 3D1QA 1CVJA 3G4SS 1KVIA 4A8OA 2MLYA 2YTCA 3GSDA 3L95X 2L9WA 2GX8A 2KRBA 3GG0A 2YWEA 1RT2A 2JLEA 3OTBA 5KG7A 3CNQP 3Q2TC 4O4GB 2PI4A 1VC0A 2XCPA 1WG4A 3N9UC 3TANA 3SIPB 4ES1A 1V6HA 3UE2A 2V34A 1HIYA 4MT1A 3T41A 3OVBA 1F2GA 2BBEA 4KRWA 4PG6A 1M1GA 1K0TA 2AEFA 3U02A 2D9PA 4K59A 3PW5A 2MQ8A 3TVKA 2Z8QA 3CJTA 2CNKB 4FYYB 1HMVA 1YDLA 1YX2A 2YX1A 3GCWP 3NS5A 4WXWA 2MGZA 2VFRA 4FP9A 1NJXA 4LF6F 4K4VA 2YKNA 4F3OA 3DOLB 1H2TZ 2JSXA 2J5AA 5DRKA 4OHYA 2RDDA 3CT9A 1DBDA 2ROPA 1FCAA 3CJ2A 3D67A 3PM9A 3IO1A 4AE5A 5D3GB 3W5ZA 5CCLA 4A8QA 2DNYA 1XNQJ 2DRBA 3DLHA 3M2RB 3VWSA 4JV0A 1S1UB 1G7CB 2B43A 4WWSA 4K4ZA 1SJRA 2FYXA 2FZGB 5E5NA 2MQOA 2HHQA 4GMKA 2IAJA 3QT6A 4ZPCA 2PT0A 3W8GA 3QWUA 3I31A 1GXTA 4USIA 4MAKA 3WC2A 3MECA 4EK2A 2ZH2A 1N0UA 4B3MJ 2X3DA 1OY6A 2MSTA 4IH5A 3IA0A 4NLXA 4Z7CA 1F5CA 5A6PA 4BBYA 1S9GA 1KLMA 1S1WA 1ZPVA 3EPGA 4LFAF 3G86A 3W66A 4IUFA 2GMHA 2NZCA 1U1OA 3DOKA 2CPEA 1OSDA 2DNNA 1RJJA 2EKNA 4X4VA 3CO0P 2IM3A 1MROA 4OV6A 5E3CA 2Z2LA 1VHIA 4Y2MA 1FRMA 3DRYA 3LGHA 3OFGA 4RUAA 4DL4A 1YITS 4Q8EA 2XMWA 3G96A 4K2JA 1TKZA 2Z4PA 2C22A 1K0VA 2CQ3A 1RAAB 1X8DA 3TP2A 5LJ5Y 4YHHJ 2V8VA 1R0AA 2DVIA 3C3LA 4KHPF 5IT9Y 1ZM2A 3FSIA 3ISZA 3FK4A 4WFNQ 3BGRA 2ZWOA 3MAHA 3PVXA 2EK6A 5KG3A 3QT8A 5A76A 2R7OA 4OJGA 1T02A 1S0OA 5DM7Q 5K14A 4LRCA 2OSRA 4RZRA 1LK5A 1WC3A 1WTFA 1WC0A 2OKQA 3DC2A 3JSYA 4QWBA 2DY1A 4Y00A 3W64A 5AE3A 1M5PC 1QAJA 1KFDA 1D3WA 2WBMA 3LGNA 2YKNB 1C4CA 2J8SA 1Y7PA 3EPIA 1IBMF 1YJTA 1FDDA 2DY9A 2KVIA 2VFSA 3WX4A 2DRDA 2ZH8A 2P8IA 2LEBA 4JI6F 2Y1IA 3U7JA 2V2QA 4YEAA 2L48A 4NL5A 2VBZA 1GTHA 4C0OC 4DV3F 4H4OB 2AGOA 2CDRB 1F9FA 1HNZJ 2PI5A 3ET6B 3Q0AA 3P3DA 2H5IB 1SQEA 2DR5A 3FBCA 2QYGA 1U7LA 4CO2A 3OVSA 4GKKJ 3NEKA 2CQ0A 3H4BA 2RUSA 4B3OA 4ZA1A 1CJKA
chains in the Genus database with same CATH topology
1QAYA 4NXNF 5E2QA 3RRKA 4NRTA 4YOEA 1EETB 4X62F 4RX6A 3MEGB 1LOUA 1R43A 2ZJQQ 1KRPA 3SFUA 3G71S 3DRPA 2XI3A 1TK5A 2DTJA 2CQCA 2L41A 5KFXA 3MMBA 5KFDA 1NKEA 4ICLB 2AF6A 4QPTA 2ZH3A 3UD4P 1Y0HA 4OZ5A 4ELTA 3R27A 1YHQS 4WZMA 4B9UA 1RT5B 5M2RA 3NGDA 3KHGA 4OX6A 2VODA 3MEEB 4YQWA 1OO0B 3BGRB 3H2VE 2LLZA 2LQJA 3V6HA 2FJBB 1HW8A 3HVWA 3G9CA 2QO3A 5L39A 1U1QA 2JEFA 3EXYA 4F4ZA 4LQ9A 3Q8RB 4ZP6A 4QR1A 1ZM3A 4N41A 2LU1A 4B3MF 3VQTA 2X1AA 1OPZA 4K50A 2YWHA 3L09A 5LXYA 3BSCA 2VONA 1K1QA 1KFSA 4ECRA 5EDWA 2R4FA 1UFWA 2E5IA 4X4UA 5KFYA 2JVOA 3O3LA 1YVFA 1A7GE 1SH3A 4B9VA 3MM5B 4TY8A 3TAMB 3THTA 4PUOB 4X4NA 4DR3F 2HHSA 5B0EA 2CG4A 2DGSA 2M0GB 3N6NA 1KQFB 3SFGA 4RNMA 3JTNA 7FD1A 4DFMA 2PDAA 5E3QA 2Q66A 2OPPA 3UD3P 1DQAA 5E41A 3KWMA 4G6VB 4ZP8A 5I42A 2R9LA 2HNZA 3I5CA 1T3NA 4NLSA 1K1SA 4K4UA 5GAEU 2GHPA 2XZWA 5DDPC 2AX1A 1U1KA 2M70A 1V3ZA 1S6QA 3CCZA 3I96A 1TAQA 3FQLA 4F4XA 2KZMA 1BY9A 2XSJA 1CG2A 3ZZTA 2XGPA 3KHRA 1W2BR 1L5UA 5T14A 3D2WA 3CD7A 2VA2A 3IGNA 2GGPB 3KK2A 2I9SA 3BR9A 4ELVA 3QGGA 5KFQA 2QA1A 1HI1A 2K7KA 3OL6A 1NKCA 5D4LA 5C25A 3PACA 1X0PA 1U2RA 5JVGQ 1WTBA 4AUKA 1VMBA 1VQYA 3VR1A 3UDCA 3QIPB 1N5SA 1OIAA 3V6KA 2VOOA 2BZ2A 2BW2A 5LSLA 2OPSB 3CDEA 5MAOA 3QZ8A 3PX4A 5HMWA 2LKZA 3VAHA 2HNDA 3QLHB 5DJBA 3GFZA 1SJ4P 2FJVA 1FVQA 1DJ0A 1FJEB 2BRKA 3C8YA 4OJ3A 5F8JA 4XK8C 4U7UK 4RU9A 1GH8A 4YP3A 2XMKA 5LSOA 2R7XA 4PUOA 3C6UA 3I0SA 3RTVA 3BJYA 1LWCA 2E1CA 2MY8A 3Q23A 3KFWX 2GJIA 3MM6A 3HVAA 2ILYA 1HBOA 2VPZB 3OJUA 3BGFA 4LFBF 3G6YA 3MZIA 2BACA 4KQZA 2R2RA 3CCJS 4Y6IA 1ZETA 1DFDA 1UVKA 3OPKA 2GMLA 2J0SD 4X2BA 4OI6A 4W92B 2V4JA 4ZK7M 4ZCLA 1JLAB 3M6WA 4KC5A 1FD2A 1RT1A 4KB7A 4MIBA 2FJDB 2A1BA 5U47A 3GIMA 4IR1A 3QAEA 2B5JA 1IBLF 2ZH9A 1J5OB 4HDHA 3OUYB 3ICLA 1GXLA 3ENVA 3PHEA 4YR0A 1IN0A 2E1MC 3Q8SB 5EWEA 1KQKA 5K8PA 1N5TA 3I5BA 4FNIA 3HHKA 3QIPA 3BDEA 2C2RA 3V4IB 1WF2A 4Q5VA 1AXQA 1S77D 1LKZA 4HTIA 1P27B 1Z2LA 4R0JA 5FDLA 1Q82T 4OI2A 4PPDA 2IM2A 1C1CA 2RRAA 4FYDA 1WEZA 2CJKA 1HYSA 3NAHA 2UUCF 3M9OB 1FNXH 4P2SA 4OX8A 4PG8A 3C6UB 2RD5C 3U1NA 4Z2XA 3OHBA 2R2UA 2ZDOA 3K58A 3KG1A 2NPFA 4KSEB 3H4DA 4LVOP 4YMEA 1S9EA 4NLPA 2RF2B 3W2VB 4DUYF 3JSMB 3PV8A 3P96A 5EGYA 4ILMA 1H7XA 3FFIA 3KLEB 1ZTWA 3M8QA 2N82B 3KK1B 1HPZA 5B7WA 2XS7A 3TQ1A 1SIWB 2A3JA 1FEEA 1FRIA 2RDIA 2ZHOA 4CO1A 4ZVHA 2DB1A 2B0GA 1Q7LB 3ZC4A 1TVRA 4MYUA 3OUYA 4ZDNA 3SSSA 1L3SA 3EGWB 1FESA 4TYAA 1NHVA 5KFSA 4DV4F 2MZRA 2R7VA 2HFZA 2RDJA 1L3UA 4X4TA 3N6LA 4NLUA 1RGVA 4Q2LA 4EFAC 2VOPA 2O66A 4MKAA 3GIJA 2W8LA 4NCGA 3MMAB 4X4SA 1B7FA 1C1CB 3B78A 3V4MA 1UA1A 5JXSA 5KFRA 3PR4A 3QO9A 5F8LA 4H54A 2O67A 5CQGA 1SJQA 2X51A 3IFEA 3DLGA 4DV7F 3GMGA 3OQ2A 1MMNA 3D0IE 1LW2A 4BC9A 3JSMA 2NSCA 1UA0A 2AJ4A 3IRXB 4H4KC 4A47A 1S7HA 2E9TA 4H4MB 4ZOSA 2WBRA 3O8WA 1VK8A 4TXSA 3PKMA 1UAWA 4LF5F 1VJWA 5B0CA 1QSLA 2YNHB 5F9NA 1N5VA 3O6QA 4M8LA 5F9LA 3TVYA 2V8HA 4I6YA 2ROGA 3ZZZA 2HFNA 2E1RA 3DRRA 5D77A 2VPYB 4OZ0A 1HQUB 2Q6BA 3ULHA 4OI3A 2J9EA 1GTEA 3J7Z5 2BABA 1JKHB 4P6QA 1MMDA 2R8GA 4YY3F 2R7RA 3N5BA 5T41A 5FJ4A 1DTQA 2CKWA 5KFIA 1WNEA 4K5SA 2B9XA 4CNZA 5C5JA 5J2MA 4CO0A 3S6EA 4RW9B 4RW7B 3DLEB 3KG0A 2RRBA 3POTA 4FS1A 2XLJA 1ZZNA 1Y5IB 4P7VA 3SEOA 2AJ0A 2VBXA 2G9OA 1MU2A 2DHGA 4XPEA 4IG0A 4WKRA 3DRXA 3FCHA 3VALA 2V0NA 2R8JA 2FGOA 4ZHRB 2EFNA 1JXEA 1N5YA 2HLUA 2VG5A 4GO5X 3MFHA 1LW2B 2J6UA 2DNRA 1KVJA 1H2VZ 2VKRA 3FEYB 5CD4H 3S1TA 3BDPA 3IAM9 2QZ8A 2AP6A 2W9BA 5BJRA 3RRHA 3K57A 1UWBB 2J9CA 4I2PA 4QIVA 4NLGA 2HRUA 2GQQA 1OPIA 5D6GA 2ADCA 4KR0B 1JWWA 3KLHB 4DR5F 2ZBCA 2ALZA 3RAXA 5KFZA 4LF6F 2FC9A 2V2KA 1CEZA 1R89A 1IJFB 4GKJF 3BSAA 2QLWA 4DQRA 2IYGA 2LYVA 3IG1A 1UEUA 1FHTA 1IKXA 1TL1B 2UUWA 1S1TB 3HKWA 5E0OA 1ZM4A 2JL9A 2IBKA 4ZPBA 4QIWD 1O5JA 4LSNA 3W2WA 4L3NA 2MXYA 1IBKF 5IZHA 4DR1F 2YNIB 3CEDA 2HGMA 2MMYA 3HT3A 1HWLA 1YIJS 1U48A 2RKIA 3RB3A 1R8AA 4KIAA 5EX3A 4QBUA 4NOHA 2KZZA 3W7BA 2IRXA 3MDFA 1RYSA 4G1QB 1UVJA 5K8OA 4DSKA 1VI7A 1S79A 1GQEA 3VAGA 4PXDA 4M1KA 1FKAF 1FTRA 1X4HA 2HNYA 1CLFA 3FQKA 4CT8A 1S97A 5E7OB 4I2QB 1SUQB 5HP1A 3CC2S 4FXDA 3TRGA 4C9DA 1ELOA 2JLFA 4OHWA 1Y3KA 4YFUA 3PX0A 1HWUA 2F3JA 2NUUG 2NREA 3GWCA 2JDJA 3PR5B 2DH7A 2UUAF 1QY7A 3PY8A 2VG6B 1KHWA 1IKVB 1HFEL 1SI9A 3IBWA 4UQTA 4DFJA 4UY85 2FVCA 1SH0A 2R7SA 4KBIA 3BSOA 4C3LA 3OHAA 4XPCA 2J7WA 2ZC3A 3B8HA 4F4WA 4R8UA 4UUWA 2ZJPQ 1S1TA 2O5DA 2VUGA 1N52B 1ULRA 2HHUA 3NWGA 3LAKA 1Y3JA 2DNZA 2YNIA 3DRSB 5GMKa 1WEYA 4RNOA 1S49A 1NK9A 2J9DE 4IOBA 2MKIA 2PN6A 2EPIA 1H2UX 3K5PA 2G4BA 1QSYA 3TNVA 2O3DA 2ASLA 1RT6B 3DU6A 2OTJS 2M3DA 4B3RF 5I3QA 2I38A 4DSLA 4NZ0A 1BC6A 3TUJC 2NQPA 2LDYA 5IM0B 4OX7A 4IH6A 1RA6A 1H0HB 4C11B 4HT5A 4X4OA 4IFYB 3KOAA 2DGUA 2R2SA 5C42A 2MY7A 2XMUA 4J9NA 2KH9A 1HW9A 2QIFA 3KHLA 5D8HB 2FIUA 1WHXA 3AB4B 3JYTA 3CCUS 3UI3A 2JX2A 3H5SA 4WK3A 4C3MA 5HLFA 4LF4F 4AFFA 3AA8A 2L9NA 2LEPA 1RISA 2BA9A 3CCLS 2VFTA 4PWDA 4A8XA 1BQMB 2E5HA 1UP1A 2BE2A 3CDAA 4RW8B 5EWFA 4LF9F 1X4EA 3LUYA 3NBPA 4Q0BA 3V6JA 4LQ3A 1JLGB 1CC7A 4OI1A 4IDKB 3PO4A 2ZHAA 3TA2A 1HNXF 3EYZA 2C3OA 1F5AA 1S0NA 4LFCF 3X3UA 1VBXA 4TQSA 2CYYA 2WSCC 5D4NA 4KGKA 1O51A 3DRSA 4Q7AA 5FIIA 4F25A 1VQ5S 3FGVA 2JJ4D 4DS5A 3M4XA 1SL2A 4KHPF 1BGXT 3HHLD 4F02A 1X5TA 4F4KA 2NS1B 3I9V9 3HM9A 4O3RA 2CVIA 4FS2A 2B4UA 3Q2SC 3P49B 2KXHA 3IAS9 1IKYB 2KTQA 2BYCA 2FLOA 3DMJB 3HJFA 2V5HG 3HVRA 2CJ9A 2QSWA 5AXNA 2ZD1B 1OQ6A 2E5JA 3DNCA 3MMCB 3TR5A 1R31A 3OVAA 1JLQB 2DD8S 3NP5A 4EUVA 4WFZA 4IQXA 1UVLA 4MIAA 4HVZA 2HHTA 2H9ZA 3FMBA 2K1RB 4LSLB 2KT2A 2IJFA 5A0YB 4Z37A 1VLYA 5A6WA 3HVTB 3DM2A 5KFTA 4MKYA 1ZH5A 3T1HF 1TL5A 2FJEB 1S6PB 2M9KA 3M6XA 5KG5A 5SZTA 4G3IA 4J9LA 4OHZA 4TU9A 4CTAB 4C2MA 4YB6A 5J2PB 3T19A 3CD5A 2L9DA 4TU8A 4HLBA 4QWCA 5KFEA 1Q79A 4RUCA 4DQIA 2P6TA 1KC8T 1S1UA 1U25A 5AXKA 4V19X 3IWNC 1H7WA 2RQKA 2CPYA 1NHUA 3F56A 3DXSX 3VZIA 2AW0A 2M8DB 1C1BA 1JMTA 1R8PA 4DV6F 4O3SA 2J0WA 3OV7A 4DSEA 1SIZA 1VQPS 1AUDA 4X4QA 1HBNB 4KO0B 4CO5A 1BQNA 3PFEA 4WXOA 2DO4A 3V6DB 4DV5F 4IG3B 5CYMB 1FXDA 3CD6S 4K4ZA 3MI7X 4K4YA 4NLDA 2AJFE 4F26A 2BUNA 2M4MA 2X1BA 2RS8A 2VG7A 3RR7A 1APSA 2VV5A 3N4WA 2DR7A 2XEXA 2XMVA 2C2DA 1S48A 3K7RA 3LWMA 3SDEA 1U1RA 4KHMA 2ZHBA 3J7YI 1SV5A 4Y28C 2E9ZA 3H2LA 2OFGX 2YWFA 3QIDA 2D41A 4ZPWR 2FVSA 2GFFA 2WAQD 3H8YA 2K3KA 1HNIA 1JNRB 1S1VB 2DITA 2PMZD 4N56A 3OTOF 1U4BA 4DQPA 4JV2A 1S6PA 2HQIA 3E3XA 3DDKA 3O2IA 2GC8A 2XC9A 5GAGU 4J9OA 4ECVA 1XN9A 4KV8A 4YB1P 2BXJA 5HMZA 2ZNYA 5B0GA 3GG1A 4WK1A 3M32B 1YJNS 3FDSA 4CH0S 4AXJA 4RKUC 2J6SA 1VQ4S 1Q78A 1X7VA 2XMJA 4BC7A 3SV4A 3SCLE 1PSDA 2RQMA 5IQ6A 4KKOB 3CJ5A 3UPFA 2K8GA 2DGWA 4ERDA 1HBMB 4KPYA 3LF0A 4N77A 3H5XA 3K5OA 2R7QA 1S6OA 4I56A 3UW1A 2JEGA 4B3OB 3BR8A 5L9NA 3KLFA 3TYTA 3O5TB 1F5BA 3T3FA 3IGVA 5HN0A 1BQNB 1I94F 4C8NA 3MEGA 2UZAA 3OFHA 4I1TA 1ZOTA 4FF4A 3MMJA 3DYAA 1RK8A 3V6DA 3J81Y 1JLFB 2CJBA 3CXCR 2E5GA 3MMBB 3SQGB 1HNVA 4ICLA 3LQVA 1S9FA 2VG7B 2DGVA 1J5EF 2DPJA 3HK2A 3SSRA 1U26A 4Q45A 1N6QA 4RW4A 4JI5F 4ZLPA 5F0WA 4Q0BB 5CHCB 2C3YA 3R5AA 1FK9B 4O44A 4WFXA 1XNQF 1G3OA 3T5JA 2OLWA 1X9MA 1HMVB 4EWTA 5LMNF 2C3UA 2MHNA 1L3KA 5AJ3F 4ELUA 3GR0A 4DQQA 4Y0FA 2IC3A 5DG8A 3M32A 1WI8A 5K5MA 2FVPA 2J9DA 2PMHA 1FJCA 1HL6A 3ISNC 5H9EJ 3NNAA 2HS0A 2J6TA 4AXIA 3A1YG 3N79A 2BVZA 3UR0A 1FE0A 1VFJA 3PW2A 4HL9A 5MLCV 2B4VA 2ZOGA 1XR6A 4ZP9A 1LXNA 2OPPB 2C3PA 2R8IA 4AL5A 2HGLA 3GYNA 5A8KA 1KLMB 1S1WB 4H4KA 4WFBQ 2CFXA 3TI0A 3FRZA 1VRTB 1QJHA 2RB7A 4QIFA 4MK8A 4EYHB 4ECTA 2QLXA 4OI0A 1OS5A 1TL3A 5BYRA 2B7BB 3CJKA 1X5OA 3I82A 5CH7B 5FD1A 1KR4A 3MWBA 4QIGA 5LXRA 5J1PA 2XSJB 4ZPVR 5DQHA 3CB4A 1LQ9A 5BYQA 3F41A 2MZTA 2VA3A 3ZZOA 3OR1B 1JLEA 4C4WA 1RT7B 2VB6A 2ZKUA 4QR0A 3WZ0A 3KJVA 2O01C 2WOMB 2V4RA 3CCWA 2JC1A 5I3PA 5HL7Q 5KT7A 3RW6A 4WYLA 5JVHQ 1X5SA 3KTQA 1KONA 4DWIA 1DLOB 4KJIA 4DHVA 4K4WA 1X0FA 2HNDB 4AL6A 4FN5A 2HYIB 1Y4ZB 4Q8FA 4X4PA 3RBDA 4DSJA 1Y5LB 1QSSA 2RQCA 1P1TA 1U1MA 1Y9OA 4KFBB 3DLJA 5J2NB 2WTFA 4U9RA 4PQUA 1FXRA 5HBMA 3N0VA 1WHVA 4OHVA 4CH1A 3K8VA 3MM6B 4DL2A 3CE8A 3DLLQ 4U6PA 3I4PA 4ECYA 3DU5A 4OHXA 1ZYQA 2Z2MA 4BDPA 3R1LA 2DISA 1TL3B 2KXNB 2L08A 1C2PA 2HPUA 4BWJA 2GV1A 1WG1A 3MFIA 2OD4A 2HQ3A 4ZS6A 1I6JA 3RR8A 1S99A 4ED6A 3FEZA 2PO4A 4I7FB 4J5OA 4ED3A 4CQ1A 1NK4A 1X9WA 3H5YA 1IQTA 3VZHA 3D54A 5CZVA 4F2SA 1TK0