3IBWA

Crystal structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
b'TDFLAGIRIVGEDKNGMTNQITGVISKFDTNIRTIVLNAKDGIFTCNLMIFVKNTDKLTTLMDKLRKVQGVFTVERLSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GTP pyrophosphokinase
publication title Crystal Structure of the ACT domain from GTP pyrophosphokinase of Chlorobium tepidum.
rcsb
source organism Chlorobaculum tepidum
molecule tags Transferase
total genus 18
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ibwA00
3W7BA 4LUBA 2NYIA 1LK5A 3TUZC 3HHEA 2QMXA 1LKZA 4PWUA 2FGCA 2JOQA 2RQKA 3L7OA 3TUJC 3ENWA 3LOUA 5IT0A 2P9EA 2QRRA 3U7JA 2RQMA 3IBWA 1RWUA 2F8MA 1YGYA 3DDNA 3DHXA 5IS2A 3N0VA 3OBIA 2LQJA 1M0SA 1Y7PA 4NMLA 4GO7X 2P9GA 3KWMA 3DC2A 2LVWA 3TUIC 3AB4B 3OFHA 2PC6A 2J0XA 2DTJA 4GMKA 2ZHOA 3AB2B 3DHWC 5FIIA 2P9CA 1ZPVA 4IO1A 2QSWA 3O1LA 3K5PA 3AAWB 2QMWA 2JHEA 1UJ4A 3OFGA 3CEDA 3P96A 5IT4A 1PSDA 2J0WA 1SC6A 1UJ6A 3MAHA 2DT9A 2KO1A 3OFFA 5T41A 3ENVA 3NRBA 2F1FA 4M8LA 2PA3A 3IXQA 3MWBA 1UJ5A 4X84A 4GO5X 2RE1A 2I9SA 1KS2A 3UW1A 2MDAA 2CDQA 1YBAA 3S1TA 5JJBA 1LK7A 2H9ZA 3OFEA 1O8BA 1U8SA 3ENQA 1XTZA 3LUYA 3MTJA
chains in the Genus database with same CATH superfamily
2YH1A 3RR7A 1WC4A 5KG1A 4EBDA 1IKVB 1ZZNA 2ZM6F 4X66F 4Z7YA 4ZCMA 1WHXA 4IG0A 2Y1RI 5KFLA 3QLHA 1GQEA 2MY7A 3MD3A 2C28A 5KFEA 3D28A 4X66J 2ZH9A 3PX4A 4CH1A 4RW8A 3PZPA 1N5SA 5D4OA 2R42A 4H4MA 3QSIA 4DXLA 1NSPA 2C2DA 5GADI 1GH8A 1HBNB 1KQKA 3H4DA 1FEHA 3PJWA 4WE1A 1LFWA 1LNQA 1O6XA 1M90T 4TYBA 2RU9A 1WC0A 2QZ8A 3LANA 5IT4A 5M2UA 1R89A 1VFJA 3HSDA 2BE7D 1SC6A 1RWWB 6FDRA 3D1OA 3DRXA 3T5KA 1S1UA 4PAAA 4LMZA 4LQ9A 1JLEB 3MZIA 3HVTA 2PA3A 2RJZA 2CPIA 4ILMA 5D8HB 3AXMA 2RD5C 2VF3A 1SKRA 1HNIA 1GFWB 1SCJB 2EK1A 4FF3A 2DNQA 2JRSA 2D3ZA 1TKXB 2HVHA 5J2QA 4CQ1A 3NNHA 2CZ9A 4CLZA 3H2VE 2GO8A 1OO0B 1L3SA 1Q7LB 3V81B 2L9NA 1S1XA 5DO2A 1JLQA 2Y8YA 4AL6A 2KI2A 5BR8F 1RTDB 2F8MA 1RLCL 3JYTA 5IC6B 4P7TA 4ZK7M 1CJTA 1RDRA 4F02A 4JBCA 1SL0A 1P9QC 5BR8J 1SV5B 2V8DA 4PCQA 1HMVA 2M8DB 3LW5C 1U1LA 1SC3B 2V2KA 3H20A 1C1BB 3BGUA 1RTZA 1U1MA 4JV5F 4DOZA 4C48A 1OQ3A 2P9CA 4A46A 4DHVA 4DWIA 1VQYA 1HHSA 5A8RA 4JV5J 1G4CA 2OELA 5J2MA 1NLKL 1VISA 4X4PA 2R2SA 4F4XA 4U7UD 2F1FA 4ZPAA 1N32F 2MSSA 5DDQC 1HWLA 3RB6A 1U7LA 1UP1A 1S9EA 2HQCA 4JV1A 5K14B 2D9PA 1V3ZA 4LSNA 3GG1A 2ALZA 1QVFR 3BDEA 3I6PA 5ADZA 2RDJA 4RW4A 2EFQA 2NZ4A 4R0EA 1H2TZ 2EBEA 4WTYA 1PG5B 4M5IA 5DM7Q 2GS8A 1RT6A 4USJC 4C2MA 5EUHA 1OS5A 4PXBA 4IRDA 4FS2A 2B9WA 4CO4A 2ACYA 2ZE2B 2HIQA 2DR7A 1XIQA 4DG1B 4DL2A 4BWJA 1ZPVA 3C14B 3A4TA 4MMOA 2BRKA 4Y0FA 2VG7B 3DU5A 1J5OB 3EVMA 4PG5A 3AD7C 5A2QY 3A3OB 4DV3F 1SVDA 4DV2J 5KG2A 4ZJOA 4EUVA 4U95A 1Q8KA 4Z7CA 3JTNA 5C5JA 1QSSA 4B3MJ 2XG8A 1UVNA 5ETMA 2G2ZA 2IM2A 1REGX 3M8QB 4PWUA 2V68A 4P6QA 4IDKA 1HBOA 3KNGA 4RKUC 2APOA 3MEEA 3TQ1A 4DQQA 4WK3A 2BM0A 2WVFA 1VDHA 4MIWA 2XYGB 3JTOA 3LP2B 2KH9A 2E9RX 5HMZA 2UU9F 2DH9A 2D3UA 3OFHA 3QO9A 2AEFA 2DTJA 4ZLNA 1H7XA 2ZFHA 4IFYB 3I4HX 2IHR1 2UU9J 4ZVQB 4WKYA 1KSPA 3BKUA 4DU7A 5AE1A 1OMSA 2HS0A 2FHJA 4ID5A 1QUPA 2R7VA 3HSZA 5CYQB 2XHWA 2WONB 4PG7A 2YVSA 2VFTA 4X4NA 4BBYA 3EVOA 2FVQA 4RWWA 1S6OA 4KFBB 4YN3B 2MDAA 1WC1A 1TMMA 3H98A 2CZVC 4YDDB 4IR1A 2XY5A 4FPIA 3VTIA 3ZZYA 1VYAA 1BQMA 4WXWA 4DSLA 1NK8A 3U1NA 1VK8A 1D0EA 4A4JA 2BKOA 4RUAA 2QRRA 1A6LA 4YHHJ 3K17A 1TKZA 2GIFA 3HHDA 3FVYA 2ZZMA 3GFYA 3I5BA 1PGZA 5B0EA 4ZVFA 1ZOTA 3QYYA 2QL5B 5C25A 1Y0HA 2ABYA 4F04B 3HHLB 3BREA 2ZC3A 3MM7A 3EUNA 2XULA 1B99A 3QMQA 4JI1J 1RT7B 2XTJP 4I69A 3DYAA 3Q24A 1Y3JA 3TX8A 1VIOA 3CJ8A 3M8PB 5KG7A 2EFGA 2E1AA 2CQGA 2EK6A 3IWXA 1X9SA 3R9LA 3AODA 4ANDA 2HHXA 4QCLA 2ZBPA 3OTCA 4AYBD 2MMYA 3PACA 4KIAA 1Y10A 3N6LA 2H5IB 3PRBA 1U48A 1NJWA 5A2QU 1PYSB 3LA0A 4HKQA 4BHQA 1MROA 1FK9A 5SUHA 2WVEA 2AP6A 1JMTA 1BQNA 4YS2A 3OSPA 4DFMA 2QLFB 3G82A 1UFKA 3MAAA 3NWRA 3NS6A 3HLUA 1Q8BA 2ZITA 2R7QA 4DV7F 4KC5A 2FHMA 1WJ9A 4W92B 4LF9F 2UP1A 2LA6A 2MZJA 1S7IA 4ZVTB 2QN6B 2W4PA 4KHPJ 4DV7J 1RAOA 4Q44A 1X0FA 1M5OC 2F63A 1RXOB 1GMWA 2ZHOA 5L1KA 2Q3PA 4C11A 1NHKL 3R6GB 4CH7A 2GAHC 3AH6A 3UO0A 3UDCA 3HF5A 1VHFA 2MYFA 5GAHI 5LSLA 5IWAJ 3MF5A 2HNZB 4DR5F 3LP1B 5HP1A 3M32B 1O51A 1SQGA 3GCWP 1SKSA 2X3GA 3MHYA 3CCWA 3ZZZA 4JYAJ 5LSOA 3KJVB 3ET6B 4DX8H 1S6PA 5CD4A 2KDOA 2EW9A 3VAHA 2XMJA 2ZEJA 5F3ZA 3Q8SB 2HIYA 4GVBA 4X64F 4LIWA 3JSRA 4O0IA 2KT3A 5JMNA 3NP5A 1KLMA 5A8KB 3TARA 3V6HA 2KU7A 4X64J 1S99A 4U67Q 1FDNA 2BANA 1UL3A 1UVMA 4UZBA 1JX4A 1C1CB 3O2IA 1VOMA 2HBQB 2ZH2A 4EI2A 1VQNS 4F3OA 1TK0A 2NUUG 2XNQA 1QE1A 7FDRA 2ERRA 5MAOA 2RS8A 2XCAA 1DBDA 3FDSA 1QAJA 3H5XA 4LJMA 4RO0A 1CJKA 4NLOA 2PE8A 4X4RA 4G1IA 3FCHA 2ZH1A 1Q5VA 4EBEA 2CPFA 2YNHB 2XO7A 1NAQA 2AYEA 4I6AA 4QIGA 1YG0A 2H5EA 4H4KC 2HHUA 4IG3A 3UD3P 4A8FA 3MTJA 3C19A 4OX9J 4NLVA 1HBMB 4LFBF 3O8WA 2A2CA 2ZBQA 2UUCF 5EX0A 2LQ9A 5DQGA 3RBXA 3HVRA 3CJ0A 4CI0B 1IBKF 1NXIA 1QUVA 3KHLA 3UFCX 2L3MA 5L39A 2CAJA 2RHQB 2AX1A 4CO5A 1B0VA 2RS2A 4Y2AA 4UQTA 5AJ3J 3NAIA 1KD1T 1E6YB 5DQIA 2D74B 2ZNZA 3J7ZT 3T1HF 1NK6A 4CP5A 4ILLA 4NASA 3DRSB 1RT3A 1Q4RA 1YWXA 4NI2B 1G7CB 2OFGX 4RW9B 4CYUA 5KFHA 2FY8A 4OFZA 3TNVA 2OSQA 3NRBA 1ZM4A 1S7HA 1NO8A 2V8PA 4F7VA 5JJBA 4YB1P 2B9EA 5ETTA 2Y1LB 3A8KA 3W7BA 5HN0A 2AJQA 2DXDA 4K4ZA 2CWXA 4B3TJ 4J7CA 1AZSA 3C15A 1OY9A 2P6SA 3PCOB 4X4TA 1S0NA 2Q43A 2AT1B 3SI8A 2IVMA 4ZMMA 4QWAA 4JP8A 5KFVA 1IBCB 4C7QA 3FCWA 4IKAA 5ETSA 2BX6A 4UUWA 1NBEB 1ROFA 1KHVA 3OXLA 4B02A 2DXFA 3IMQJ 4QIVA 2YH0A 3SSSA 3BS9A 2OGUA 4DFJA 3GONA 2CNLB 4K8RA 2YNFB 4KGZB 2YQ0A 1VRTB 1MLAA 1DTTA 1U09A 2QMWA 4EZ9A 5CQGA 1B70B 2HWIA 3GSIA 5IQ6A 3CJKB 2AW0A 3TOQA 3UD4P 2HFNA 1C0UA 3AD8C 1VQ9S 1G6BA 4U6PA 2FJWA 5THWA 5B7WA 2W01A 2K06A 2NR0A 5D3GA 5AE2A 2I9SA 3MMAA 3QAUA 3ZZTA 1R8PA 2PMWA 1WWHA 3K5NA 4C98A 4PYDA 1LFPA 2ZKTA 2G1DA 2E1PA 2D9OA 2UUBJ 2DR6A 1FE4A 1HBUA 3OXGA 4JI2J 1VRUB 2RNEA 2F9DA 4M5MA 3OR2A 1RLDA 3D67A 3CJSA 1I51B 2HLUA 5HL7Q 4RLEA 1S59A 3FNNA 4Y2MA 2OPRB 2BKNA 1OPZA 3EDQB 3PW2A 1CBKA 2M4MA 5E3PA 2GHWA 5C42A 4QYRA 4DS5A 2F3JA 2GQQA 4X4VA 2P8IA 5J2NB 2F4VF 1TAUA 2BE2B 1FNXH 4LRFA 1T94A 1FRMA 2WZ1A 4O3PA 4ELVA 4ZVPB 3DM2B 2OSRA 3CC7S 4KJIA 4CRJA 3MAHA 3OJSA 2H51B 2UUWA 1YJRA 3MECA 2EFPA 2XWYA 3PEHA 2K3IA 3WBZA 1JJ2R 5H9FK 5KG0A 2BXJA 4IYQA 2AEMA 4DUZJ 3R5GA 1U26A 1I94F 3SMZA 4CH0S 2V9WA 3GFHA 1U2CA 2XZWA 5LMNF 3MM6A 2HW3A 1X5PA 2O1PA 1N0VC 2OKQA 3CGIA 1UCNA 4N7TA 3H5YA 4YY3F 2E7WA 1K0TA 1ZTWA 1JB0C 2MGZB 1ZAXA 3CWJA 1UZHA 3N5FA 4ZP6A 4DCPB 2MKHA 2KN4A 4F67A 2QLJB 1QTMA 3R1LA 4LBIA 1S6QA 3S01A 2JJ4D 3AOAA 4DV1F 5E3QA 2HURA 3GZ7A 2AJ4A 2XLKA 1TUWA 5J1EA 4MKBA 3KK3A 3MCMA 2ASDA 3HCXA 3G71S 3D54A 3LTOA 4A8YA 3KDOA 3MR6A 1PJ6A 1TZ0A 4QYZK 2AMCB 1VQKS 1RISA 2K1RB 2YTCA 2KO1A 1QTNB 3CXCR 3S6EA 2W7AA 3LGHA 4B3RJ 1N33F 1YTYA 3MURP 1QD1A 2F7VA 2UXCJ 4FNIA 5A6WA 3S1TA 4PUOA 1H38A 2C2RA 4IOBA 4JB8B 1PAEX 1R43A 1R8HA 3FMBA 2JVOA 3MUVP 1HQEA 2DNHA 1HNWF 2IYIA 1PO6A 1T9UA 1CJUA 5KTQA 5KFKA 3ZZPA 9ATCB 4Z2XA 3D2WA 2E5GA 1IKXB 4DV0F 2ZNYA 3LP0A 3EYZA 4LF1A 3T9ZA 4QWEA 2JEJA 4P2FA 2FJVA 3KHHA 4RUBA 1N8RT 2PGCA 2IC3B 2VU5A 4DV4F 2XLIA 1WSVA 4DV0J 2M7SA 3DDKA 4DN0A 4ED5A 2CPJA 4P2XA 2J6SA 1AT1B 3THPA 1BUXA 1N6QB 1Q1KA 3PFEA 1N5QA 1RAHB 4DV4J 5DM6Q 4UT4A 1VIXA 1VQLS 2V2VA 3T1YJ 1NJYA 3W5XA 3MMBB 2JVRA 2DGUA 2LFVA 3PO5A 1NSKL 3M8SA 4I1TA 1XMBA 3OUYA 3G86A 4JI8J 4NXNF 2EC2A 4F3MA 1UJ5A 4R8UA 3VAIA 2GIQA 1I5OB 3HFKA 3M8RA 5KT6A 4TY8B 8AT1B 1XWLA 4NXNJ 2VJUA 2ZVSA 4CO0A 3OV7A 2ZBIA 1AFIA 4ED6A 1R7IA 3GIIA 4WKRA 1YRXA 3T5JA 3EM1A 3LWMA 3J80Y 3CCLS 5CCMA 2BUNA 2ADBA 5B0FA 4ERDA 1TL3B 3ZNUA 3VF0B 1R0AB 4J9QA 1YZ7A 3P45B 3CJTA 3I87A 2DGXA 4HDGA 4KQZA 1WELA 2OI2A 1RK8A 4NYOA 4U7CA 4NL5A 3BDPA 2YNGB 4OHZA 4RU9A 2HHVA 3JB9k 3P49B 4LREA 4RUCA 4KB7A 4P9SA 2RQ4A 2GMHA 1XJWB 3IC1A 1DLOB 2ROGA 1T05A 4M8LA 2FB0A 2CQCA 2MSTA 2N7CA 3M2RB 2BA9A 1NNDA 1YK9A 3KUEA 2GJ2A 3RYLA 2CJXB 2XEXA 2DGOA 4IH5A 5ETQA 1RT5B 2HGLA 3CE8A 3W8PA 5IC4B 4K7QA 3PEJA 3I32A 1UWAA 1Q53A 2IMWP 3K5OA 3MEGB 4JI4J 4P74A 2HVEA 5EWFA 2YKPA 3MMCA 3FSYA 2B7BB 2QA1A 5B0BA 2LQBA 2DPJA 2HZCA 1WC6A 3QWUA 3AQOA 2FLPA 5AT1B 2BQRA 3HSGA 2W2NP 2W2MP 3C66A 3Q2SC 4LF7F 2XYHB 4EFAC 1X4GA 4GKJF 2HNDB 1X4AA 4MK8A 2MKKA 4ITSA 2LQ5A 5F0WA 2N3OA 1FX4A 3R5DA 2BE9B 3OFFA 3CDEA 5T41A 1D1UA 3GJQB 4TVAB 1AXQA 3JQJA 3S7RA 2IBOA 1NJIT 5CHCB 3Q22A 3CULA 6FD1A 1S4EA 3GYGA 2KRRA 4LIRA 1V6HA 2XSFA 4NMXA 1FWKA 2GMLA 4UQGA 3IBFB 2H48B 1S1WB 2IJFA 3BKFA 2DH8A 1Q8IA 1FFSB 2A10A 1EKRA 2RAQA 4UF4A 3GFXA 4NLTA 1S49A 5F0UA 1DAXA 2NXCA 2CPXA 2DJWA 4JV2A 1AROP 1MU2B 2JLFA 3NGSA 3H42A 4O4GB 4Y2IA 1D9DA 1UKUA 1Q82T 2VC0A 4PZVA 1T7PA 3VGTA 3D66A 3EZOA 5HMYA 3SDEA 1FRIA 2W4DA 1OIAA 2E66A 2X1BA 3ILIA 2WRMA 4KHRA 3KUHA 1HI0P 1N36F 4WYLA 1S97A 3FFIA 5FD1A 2GCFA 1UWBA 4OZ1A 2DT9A 2MZ1A 1N36J 4RNNA 1TFYA 2H4YB 2J9EA 2J76E 1QSYA 4QU7A 1S1VB 3MXHP 1HHTP 1IWAA 5JUMA 1O5JA 2ASLA 3EZ5A 3IR5B 2QGFB 4OYZA 3V4IA 3CDBA 1RA7A 5F8JA 5E41A 4DR4J 2C22A 3PTWA 1RUSA 3JAMU 3R6LB 2ATCB 4K50A 4O44A 1CULA 1TUVA 4CLUA 3BQ2A 2G2OA 3EPGA 1WG1A 2J9DE 3T1AA 1NH8A 3HVAA 3A8EA 1SKWA 3B4DA 3CCTA 4E8UA 1U1NA 2RKIA 4A48A 1S0OA 3DC2A 2AHOB 3RJMB 4RW8B 1JLBB 1IN0A 3MPWA 2WVDA 1YZ6A 2RB7A 3JSMA 4RWXA 8RUCA 4L73A 1WHWA 3ZTOA 1H98A 4WE1B 2HBRB 5SZTA 2AEJA 1ZA2B 2AYGA 3QGIA 3TZYA 3MPVA 1RU1A 2V9KA 3VV2B 3VQSA 1L3KA 2UUAF 2N3LA 1SH0A 2Z30B 3VALA 1S1UB 3PKMA 2ZVIA 3SCJE 4J9OA 5D0EA 3KDNA 1IVZA 5GAGU 4USMA 3B82A 1HNIB 4PXEA 4ELTA 2MQNA 2I5JA 5J2QB 3QZ7A 3CCES 3D7SB 1FRXA 1WOSA 1S1XB 1JLQB 2JZ5A 1IKWA 3A3NB 2KFNA 3UN3A 1KQSR 4QQBA 4CLTA 2BJ1A 2ZDPA 4ZVHA 3OVSA 1JK9B 2E9TA 2VICA 1CJTB 2WOMA 1H6KX 3H59A 1RT1B 1W2IA 4GMKA 2R8HA 3KLGA 2KM8B 1HNVA 4FYXB 1HMVB 1KTQA 2CPHA 2R7RA 2P6TA 4M5GA 3IO1A 2B9XA 4KO0A 4CLLA 4FXDA 4HI2A 2V6AA 6AT1B 3CIMA 1T8EA 2OAUA 5A8RB 4L76A 5J2MB 4DR7J 3TJ9A 3RB0A 1N4LA 2FJXA 4L74A 4YP3A 1LK5A 3OVBA 1JLGA 1QAYA 1JLCA 3OTBA 4F0HA 4NLWA 2DNZA 3JTPA 4ECWA 1KDNA 1UVJA 2UXBJ 4DSEA 4OYOA 5LOQA 4LSNB 3NCQA 3J81j 4LVNP 1TP7A 4UUXA 4Q8EA 1FHTA 3IRXB 1RAFB 4RR5A 3QRQA 2LDYA 2A6MA 1K1SA 2JEIA 2F8EX 1CJVA 3HULA 2Z58B 4ALZA 1VCTA 1S77D 1JLFA 2YWKA 3K8VA 3LGNA 2VQEF 3BN4A 3RTVA 5T7LA 1ICEB 5L9NA 2OHDA 5EN1A 1AUDA 3BJYA 3L3CA 4WP3A 3OR1A 4OI4A 1HNXF 2CJBA 4B3OA 1F6TA 3ENAA 4QR2A 5A76A 4O3RA 2FZGB 3AA8A 4I2PA 2DRBA 2VBXA 3C16B 2R8GA 1DY3A 5IM0A 2C2ZB 5HMXA 3UI3A 2J6UA 2DNMA 1W7WA 1FERA 3TUJC 1XBWA 2B5JA 4Q2LA 4JOUA 3W2VA 3BR8A 4QZVB 5KOXA 1X7VA 1X4EA 3OT9A 4IDKB 5KT3A 1HBOB 5DDRC 1U25A 4CM2A 3AXKA 1DQ9A 1GMUA 3MEEB 5DS7A 2RRBA 5GADU 1R6VA 2ZH6A 5FDLB 1HHQA 5F41A 2W25A 2C42A 4DPUA 2HZAA 3P3DA 1VK3A 4FN5A 3Q8YA 2NSCA 2UUTA 3B4MA 1T03A 3ZTPA 5EX3A 2ZZTA 1YBUA 2OIHA 1IR2A 1SIZA 1S0MA 4J5OA 1PSDA 1TKTA 2NXEA 4RJVA 5D4NA 1ZBTA 3MPUB 4ATNA 4K2XA 4GRSA 2FLNA 3C6TB 5IQQA 1JIHA 4QWDA 3I31A 4X84A 1YITS 4XAKA 2OPPA 4LBHA 4QW9A 1JNRB 1JWWA 2RH3A 1KVKA 2AJ1A 3K58A 3L09A 4N8NA 1FD2A 1UETA 2FGCA 2KXHA 2HHPA 2K8GA 5E33A 1WEYA 3CB4A 3FEYB 1V3RA 4I7FB 3A8JA 1YBTA 3OBIA 4M5LA 2CRLA 4OJ1A 5D6GA 1TKZB 4OZNA 3IFEA 2HPUA 4R0JA 2HFSA 1FNOA 3QRPA 3K8WA 4U7UK 2BW7A 5C25B 4TY9A 1NJZA 1X4CA 2NLWA 3MM7B 3O6QA 1WD6A 3GE9A 2RU3A 3HZGA 4DR1F 4LQ3A 3MM9A 1DQAA 3DYAB 5BJRA 2V8VA 2MHEA 1U6ZA 3BQ0A 1SJFA 3BGRA 1RZMA 3HX9A 4BC7A 4CT9A 3HD1A 4DR1J 3GCXP 1RADB 5LJ3Y 2M0GB 2IDEA 3W1YC 4F0KA 4ZPTR 3T6BA 2FVSA 2J6TA 3L9ZA 2LKZA 1SC1B 5F3TA 1WI6A 1N54B 1Z1ZA 2CPDA 3VQTA 1UFLA 1MROB 1FK9B 1BQNB 4GC6A 4NLPA 3CCMS 3G82B 4RPFA 3A1YG 2QMUB 2HHTA 1KKHA 1WG5A 2MZQA 1KONA 1PJ7A 1IBLF 3WDOA 2PC6A 2BVZA 1UW9A 3PXGa 5DG9A 4NLGA 4V19X 2C1EB 4PRFA 2EG1A 3RUBL 3RU0A 1KR4A 4P73A 4C11B 3DN9A 3R3TA 3PFOA 4YR3A 4J9PA 3MOZA 2WHOA 1FA0A 4PXDA 3SV4A 2XHCA 3K5MA 1Y11A 1YRTA 1JKHA 4ZPVR 3MI7X 1VLYA 2HVZA 2LECA 1JJHA 2D69A 2FD2A 3TWZA 1IJEB 4BS2A 4OYPA 2IBKA 2MKSA 4OX8A 3DOMB 3MCOA 5E3RA 2DYAA 2ZH8A 5LMUF 5F8NA 2Y3YA 1S6PB 2V4JB 1KRPA 2HMIA 1XMQF 2BJ9A 4GVBB 5F8LA 1F1BB 2R4FA 2HNYB 2HQ3A 1DARA 2E5JA 2H4WB 3GYXB 1E6VA 4CDIA 1KLMB 2BRLA 5HVGA 3G96A 4KKOA 4NPOA 5HJXA 2AYMA 3H2UB 3CCJS 3GP9A 5D0HA 3AB4B 3PW4A 2XM3A 4MTPA 4RW7A 2BANB 4HT5A 4Y34A 4JI3J 3GJRB 3KTQA 2J7UA 3KOAA 5CA5A 3GIRA 2WVBA 1GTEA 1NKEA 4HH1A 3G6YA 3VZHA 1QE1B 3AY0A 4AQYF 2ZJQQ 4MJKA 1MMDA 4NXMF 1WKJA 2LXIA 2CQBA 1TL1A 1GX5A 3DRRA 1S9FA 5HAOA 1CJKB 1X4BA 4K4VA 3SV3A 1VR6A 1VGYA 4NXMJ 4CO3A 1XNRF 2EFNA 5BYSA 5C7PA 4C8YA 2EEYA 4KTQA 1FDBA 3I9ZA 1KFDA 4EYIB 3L95X 1L5UA 3US5A 5T14A 4IG3B 3EGVA 3EGZA 1IKVA 3AHPA 1LW2A 1LWCA 2JEGA 1P9YA 3IG1A 2WSCC 5DDOC 2GGPA 1ZETA 2BJEA 2CYYA 3KJNB 5KFWA 1N34F 3BN7A 3UPFA 1D9AA 1B3TA 4DI6A 5M2RA 2CA9A 2DR9A 2P2CB 3W60A 4B08A 3TAMA 3D9BA 1H2UX 2G2YA 1NDLA 1GXTA 3K7RA 1WOPA 3GSDA 2CJYB 1QSLA 3KK2A 1DZ5A 4ZIWA 2DEIA 2VPWB 4UOGA 2DR5A 2LCWA 3M6VA 3RRHA 4F4ZA 1XK8A 1K47A 4CT8A 2HHHF 2L9WA 1HW9A 2HBYB 4F4KA 1RT3B 3EWGA 2ZHAA 1AYEA 3N6NA 3QRRA 3IXQA 2NZCA 5KFXA 1S12A 4CYUB 3W5ZA 4EZ6A 2HGNA 4YUDA 3SQGB 2ZOMA 5EDWA 2GVZA 4BC9A 3HHEA 1OY6A 4PR6A 1W2BR 4DR6F 2HEKA 4ED2A 5IXUA 2NXJA 2XS7A 3QIPA 1YQHA 1PC4A 3LF0A 3R2CJ 3EXCX 3BYRA 3LAKA 2XC9A 3CO9A 1AZSB 2K2PA 5DJBA 3GIMA 1TKDA 1VQOS 1WOOA 2B9YA 4ZP9A 4ED3A 2KJVA 1F9EB 1X8DA 4XDDA 1LEOA 3V6DA 2Z4PA 2VC1A 4OJHA 5F8MA 3IM9A 4OZJA 3PRDA 3E01A 1AW0A 5C2GA 2VL1A 4L3KA 3QPIA 5LJ5Y 5GMKa 2L41A 2B0GA 3H90A 5KFYA 4LF6F 2QT7A 2VD3A 1XN9A 1C0UB 1YDLA 3I0RA 2CDQA 1U0HA 1HQ2A 2A1BA 2JFKA 3DLKA 2QTWA 2KL8A 4TKTA 4OZ5A 1RT2B 3MMAB 3D4JA 4KR0B 2OMLA 1A0OB 5K14A 3J7AN 1T9XA 1BWEA 4PXCA 2UXDF 1X5SA 4NRTA 2P9EA 5DQHA 2KVIA 1RWUA 1HBUB 5JVGQ 1B7YB 1VRQC 3OW2R 4RBVA 5EWGA 4P52A 1FRKA 3A8IA 4OI1A 4L72B 1RI7A 3GIJA 2A3JA 2YWHA 3PYGA 2XGQA 3KNAA 2JLGA 4JI6F 4OJ3A 5L1LA 1NK0A 4IOAQ 1UTAA 2Q66A 5C42B 4F4AA 2K7KA 3W63A 3TA1A 1J2VA 3ICLA 5H9EJ 3GR0A 2KRBA 3C14A 1HYSA 5DLGA 1D09B 1MWYA 1PC5A 2HG4A 4ED1A 3W64A 1DRZA 2NCKL 3JQKA 4J91A 1HNZJ 1EETA 4DR2F 4GKKJ 4HYKA 4L3NA 4LF4F 2KZMA 5A0YA 2OPQA 2O5DA 2B43A 2R7SA 3VVUA 5IV4A 2XQCA 3R5JB 2G0JA 3Q8VA 3L7PA 2BV3A 3NWGA 3IS9A 4F36A 2M3DA 3G6ES 3K2YA 1TV6A 4ER8A 3QFHA 1VHIA 3PW5A 4LF5J 1ZPWX 3JSYA 1H3DA 4C8ZA 1S48A 4ECZA 1HKAA 2DHHA 4ID8A 3BGOP 4M5NA 4N41A 1FF2A 1S6QB 1HI8A 4MH8A 2G9OA 1IUJA 3O1LA 3B54A 1WSRA 1PBAA 2B3TB 4DPOA 4IFYA 3PR4A 2RQCA 3J81Y 3KK3B 3P96A 3NG8A 4DPTA 3TEGA 2DIVA 1Q16B 1CG2A 4C8KA 2DNPA 1T9YA 4K4XA 4F26A 2VIHA 3IWLA 2WONA 1YJ9S 1FXLA 2MQPA 3IR6B 2HQGA 1GEHA 4KAIA 1XNQJ 3VWSA 1RQ0A 3NBPA 4PUOB 1KFSA 1JXVA 1FD8A 2QYGA 1FDAA 3I5AA 4I0WA 3G4SS 2I6WA 3MOJB 4ELUA 5CZVA 1HQEB 4X65F 4C4WA 3QJLA 2LQJA 4WIIA 1ZYQA 2G0CA 1CJUB 1BHNA 4B9TA 1HFEL 2VG6A 3MFHA 5KFSA 2IJRA 1NU4A 5DG7A 2OEMA 2DNGA 4DN9A 2ZOGA 1B7FA 3DNCA 2J5AA 1K1QA 3FQLA 3RW7A 3ZTQA 2PEBA 3KUGA 1HW8A 2W9BA 4M95A 4CZCA 1LV5A 4DV6J 4ED8A 1DFDA 3I0SA 2WB4A 3TA2A 1Z2LA 2ZWOA 4DUYJ 3DFEA 5LM7E 4U8YA 5G0RA 1X5OA 2W1BA 3CD7A 3MM5B 3HPOA 3DRPB 4CO2A 4Z37A 2E9ZA 4IOCQ 1U02A 2R7TA 3OUYB 2QA2A 4M5JA 2NYHA 4DBQA 2LA4A 4A8SA 1IQZA 2CFXA 2YKQA 3N9UC 1M1GA 3HXMA 4B3SF 3GV5B 3MUTP 3TUPA 3SFUA 4P2MA 3BSAA 4URSA 1GMVA 3Q89A 2C3YA 3V2UC 4B3SJ 3QATA 3DGPB 1RGVA 4MIBA 4I64A 4C9DA 2E5LJ 2PFFB 4DF4A 4KGVB 3OL9A 1SI9A 1X4FA 2B4PA 4MK9A 1URNA 4I67A 2O3DA 1H7WA 2OPSB 2JWNA 1T95A 3QQCD 1FO1A 5KFCA 2CXEA 4ZVGA 1ZM3A 1UW4A 3C8YA 1U47A 1MMLA 3ZTSA 3PG9A 3RRKA 3QFWA 3J81U 4CLFA 3DXSX 5KT2A 5HQ8A 1T05B 3R8YA 1NRKA 2HRTA 1VC6A 4XIUA 1RTJA 4FF4A 3MEKA 1X9WA 5IT9U 1VBZA 4I56A 4FYWB 3A12A 3I82A 1GMWD 3ET6A 5D78A 4LF2A 5IT0A 2Z2LA 2CQ1A 2F8HA 5D4PA 4LRBA 3Q8RB 2DK2A 4PPZA 5E0OA 5A8KA 2HKEA 3M8WA 4YEAA 4WIQA 4AE5A 4RNOA 3TW0A 2KFZA 2V67A 3MMCB 1RAEB 3BPDA 2DHGA 3RZAA 2AJ0A 2H65B 5GMEA 4CCHA 2C3PA 2A6OA 3HHLC 3TRGA 1KLNA 1M5VC 1HWUA 4N76A 3G6VA 4DLEA 1YX2A 2BJ7A 2ASJA 3ULHA 3I4PA 1KC8T 2NQPA 1V3SA 1WDTA 4LR8A 3AFGA 1TVRA 4UOFA 2GC8A 3KJQB 3FJ2A 3ENQA 2NSBA 1ZTTA 2BM1A 2Z0GA 2W2OP 2RILA 1S10A 2VBZA 1RWVB 4K0KF 1P6TA 5KG3A 5DG8A 4RW6A 2ZUAA 3FEXB 3OQ2A 3FC9A 5KFIA 2DHAA 4K0KJ 2VQFF 2HFOA 4LSLA 1LXNA 4DV2F 2D3O1 1YI2S 3VHQA 2HHSA 3C6UA 3FSXA 4KGMA 4PQAA 4XPEA 2VQFJ 1X0PA 2DBBA 2NS1B 2BOPA 2RVJA 3T9NA 4B3MF 2KHCA 2AGQA 3MCNA 4OZ0A 4GVLA 4ZVOB 2POKA 3NS5A 2AIRB 4N8OA 5ETKA 1XMOJ 4ZP7A 3SDEB 4P71A 1UEKA 1B0TA 4DMZA 1SKUB 1FXRA 2HS3A 4WPAA 3UN5A 3CJQA 3DLBA 3GJTB 4DFKA 2ZBRA 5EGYA 1VQ4S 5KG4A 4P10A 4LF8J 2KT5A 3AOCA 2A18A 2QO3A 4KRWA 2UVWA 3M4XA 4ECYA 4HL9A 2NREA 1LKZA 3C46A 3V4IB 2QV6A 4FYVB 4DR3F 2V4RA 2LEPA 3AA9A 2ZWPA 3RAQA 4KV8A 5KFGA 1YLXA 1WKLA 1FKAF 3VAFA 4DR3J 2R7WA 1VQPS 3OL6A 2Q79A 2RKIB 2CADA 2E1RA 1FJ7A 2F4FA 4OYXA 4QR1A 1UMJA 4DQRA 5L46A 3EXYA 2GO9A 4FBTA 4RBTA 2YNFA 2QL7B 4OI6A 3JSMB 2UVRA 2M2BA 3D0IE 3HI9A 2ACMA 1NM2A 5B0CA 1UA0A 1UJ6A 4YHHF 3GLJA 2V2ZA 4NLQA 3FEZA 1RWKB 3CJKA 3P8BB 2RMLA 4ZIVA 2XO6A 4QIWD 3M2UB 3H7HB 2WBMA 4ZCLA 4ES1A 3NGDA 2QIFA 2GV1A 3VCDA 5B0GA 4ZVRB 4JI1F 3F44A 4EEYA 2JL9A 4PKDB 3M8YA 1MMNA 3MR5A 2DD8S 1PKUA 1TELA 1YJVA 1VRUA 2LU2A 5F9NA 3M8ZA 2FZCB 3DHXA 2I5JB 2O67A 2AV5A 3G8TA 2X7IA 1ZM9A 3SCKE 2VASA 2V2QA 3RR8A 4M5DB 2XGPA 3WC0A 2OPRA 1IKWB 2SXLA 2L9DA 2CPZA 5FIIA 5IV3A 4AL5A 2WOMB 3GJSB 2YX4A 4ZDNA 3KLGB 2WK4A 3D1QA 2PD1A 4H4KA 5J2NA 4DV5J 1RWXB 2E5IA 4HACB 3UD5A 3OLAA 3DLEA 1RU2A 2BQ3A 4KO0B 1PCAA 1MWZA 4IRKA 1A7GE 2RHSB 5I3PA 4J9SA 1FT8A 4KHPF 4USWA 3CVKA 5HO4A 2B4UA 1NPRA 4TQSA 3EX7B 4ZLPA 2RF2B 3D6TB 5K5MA 2MTLA 3CMES 2FJAB 2DXEA 5KFAA 1H2VZ 3WC2A 4LFAJ 1JLGB 1JLCB 1SJ4P 4X2BA 3QZ8A 1MN9A 2VPZB 2BKPA 1BE4A 3GYNA 1LWXA 5IWAF 4QBUA 4PPDA 2QA4S 1FKPA 4WFXA 3PO4A 4FKXA 3W9JA 3HHNB 3JQMA 2I8EA 4JYAF 1NK4A 1CJVB 3PRVA 2ZJRQ 3LPYA 1AUSL 2V69A 4ZVUB 2IM3A 4CM0A 3Q23A 3C3LA 1R6YA 5KFZA 3KLVA 4OL8A 5T7LB 3R1HA 3EZUA 4RU2A 1TK5A 2I1RA 4WU2A 4DCOB 3OR1B 4OI2A 3KK1B 1YHQS 3R7NB 2K1RA 1FE0A 2CIMA 3NGKA 1IM4A 2HK3A 1B64A 4DUTA 1N88A 1URRA 1RAJA 1KTVA 4NYZA 3UDVA 3FBCA 3GU0A 5CD4H 4R5PA 2NXUA 2G13A 1SUQB 3GQCA 4LRAA 2DNYA 3W61A 4NEZA 4MKYA 1FCAA 4OLOA 4N56A 2B5JB 1JQGA 1TU0B 4DS4A 2OEKA 3QT8A 1HLWA 3KLEA 1BQXA 2X1GA 2GVDB 2IC3A 1FRJA 5DRKA 2XS2A 2HQIA 4OX9F 2QC3A 5KG6A 4DPYA 4KT0C 1T03B 1WHVA 3BBBA 3EE3A 3RAXA 3UDLA 1UA1A 1WF0A 3MMBA 3LALA 5AE3A 4DX6A 2XMTA 1TKTB 4NZ0A 4ANCA 4E98A 2YPZA 3UW1A 2DR8A 3E51A 4UOHA 2J9DA 3M9OB 2B7CB 1NUEA 2FPHX 3GWCA 3KLFA 1RKIA 4MFBA 3THTA 5AJ3F 1SJRA 3R5AA 2MLXA 1G2EA 2NPFA 1F60B 2QMXA 4CLKA 4ZA1A 2RDDA 3FRYA 4X62J 2DH7A 2GIRA 2R7UA 1Y4ZB 3CDUA 3PYEA 4CTAA 2IDLA 5B0AA 1FJCA 1H0HB 3DLLQ 1FXDA 1U4BA 3B6BA 2M88A 1OYDA 2AKWB 4B9MA 3OD2A 4EMDA 4KBIA 3HZEA 4C8MA 4PWDA 3PYDA 3QT7A 2Z2ZA 4J9NA 4ECVA 2YWEA 3LH2S 1Y3KA 4B3TF 1FJGJ 3R5BA 2OTJS 2Z2MA 2C2OB 4J9KA 1I3OB 5E5NA 4E2FB 4FVCA 4WXOA 4ED0A 1ITPA 4F4YA 1YBAA 2ZH3A 3KLHB 3DGVA 3DOLA 1K44A 1V9OA 3CCQS 2EVZA 3MGJA 2H54B 1U6BA 4HHUA 3X3UA 3D6MB 4C8OA 2DGTA 2B8PA 2N4DA 3KKFA 2BBEA 5KT5A 4ECSA 3VAKA 2QJ3A 3ISNC 2HFUA 4LFCJ 4KPYA 1XERA 4KH1B 2VPXB 2VKZG 3WX4A 1NZAA 2LP4A 1GK8A 3MEGA 5F8HA 4RNFA 2J9CA 1RHKB 2DGWA 4OHVA 2IVFB 2PIIA 2EC0A 3NOGA 4F2SA 2C2KB 1WORA 2XCPA 2UUBF 2DISA 2MJNA 3TZZA 4O3SA 4JI2F 3HSJA 3D1HA 4MK7A 2QFIA 3W62A 2J8AA 1X4HA 3MFIA 1SH2A 1KP6A 3RG6A 2OLWA 5L8RC 4NA2A 3K89A 3MM8B 2WBRA 4USIA 2XMAA 3W8GA 1SIWB 3TZWA 3POTA 1PYTA 1HA1A 4Q0BA 3TVZA 4WP8A 1JKHB 4W4MA 2JFDA 1HD0A 3OLBA 3HFZB 5B0DA 3MUMP 3IBWA 5KG5A 4ZCKA 5L9XA 4IR9A 3M6XA 1S1TB 2FC8A 2KG1A 2KTQA 5DLFA 1RCOB 2G4BA 3MEDA 2HMIB 1QVGR 2N7YA 4Y2CA 3F56A 1E6VB 1MU2A 1NK9A 3HKWA 4KKOB 3DLJA 4K4TA 4DUZF 1WC3A 3CDAA 2HFVA 4O4GA 2DY1A 1OSDA 4WF9Q 4RW7B 2M8HA 3E8OA 5U47A 2YBVA 4Q45A 4UW2A 2XBPA 1SQFA 3AD9C 2Y0SD 3R27A 3X1LB 2IAJA 1MWQA 3AQPA 2JLEA 2IPOB 1KOOA 4LRCA 5J2PA 1Y5LB 3A13A 4OYIA 3GV8B 4NLDA 1TL1B 3CCSS 2Y9HA 1T3OA 3V5RA 3ZZUA 5L1JA 2XNRA 1S1VA 1YIJS 2YKMA 1L3UA 2J7KA 4AD6A 4YOEA 4BLGA 1JNZB 4WFZA 3CT9A 1PILA 1AFJA 2R8JA 1RT4A 3NY0A 5C24A 3EICA 1FWLA 2AGPA 2EFVA 5J1NA 4C8LA 1LW2B 2AZ3A 1T11A 4J37A 1LWCB 4ES2A 3HVWA 3ETOA 3IG1B 1JLAA 3P5TL 2GGPB 4B3RF 4PG4A 4NOHA 2YWGA 2UXCF 2ZM6J 2Z57B 2J0XA 1T9VA 2DY9A 5KFQA 1WF2A 2WVCA 4WBFA 3IGNA 3VVTA 4TLRA 1JLBA 2RRNA 4LT6A 1NPKA 3TAMB 3PY8A 5KFNA 2XYPB 3UNGC 5HVHA 3IA0A 2AD9A 3DDIA 3MR7A 4PEOA 3KK2B 2X3DA 2Y0BB 1N5TA 4ECUA 4QIFA 1W26A 4NRUA 4Q5VA 2M52A 3QGGA 2MLZA 2G1HA 2ASYA 3VGVA 1FI4A 5AXKA 5HJYA 1U8WA 1KOHA 2GVZB 3LOUA 1LWFB 3CW2C 3HKZD 3T1YF 2H1YA 1N0UA 3BZQA 1KQGB 2GFFA 1NB7A 3DMJB 3BBCA 3QIPB 3GIKA 4DQIA 1JXEA 3TP2A 5HBMB 4C3LA 5A8WA 1YRUA 4JI8F 2XI2A 3BF4A 1RTIA 1P8GA 4URGA 1RAGB 2FHOB 1RT1A 2E1MC 2DITA 3KFWX 1YVFA 4EO8A 4DF8A 4ZLJA 2ROPA 4RNMA 3H2LA 3V6DB 4ETXA 1NHVA 1Q79A 4UY8T 3E01B 3SEOA 4WU3A 3PM9A 5DGAA 1H72C 4DL6A 1RWMB 3SZ2A 4AFFA 1SH3A 4G1PA 2FGOA 2ZC4A 2F5GA 2GJIA 3I0RB 2DB1A 1U0HB 4IFVB 3I56S 2PMZD 1G1XA 3DLKB 2VFRA 3HFVA 1IWGA 5EWEA 2FJBB 3VZIA 1IKYA 1YJTA 2XSJA 4F4WA 1VQSA 4ZITA 1N32J 3CD6S 2L48A 3BO4A 4NLSA 1ZH5A 5KFPA 3H40A 2V50A 4ZS6A 3JXOA 4D3HA 3IRXA 3DI6A 9RUBA 4Y65A 4OHWA 1FRHA 1M5HA 1HQUA 1DTQB 2B4VA 4EK2A 5LXRA 2ROEA 3HO1A 3JAMY 4JV0A 2IJNA 2JX2A 1FEEA 4A8OA 5F9LA 3OFGA 4RL1A 3KLIA 1RACB 1FFWB 3T5LA 1FWPA 2LXUA 1GX6A 1KEKA 2J7WA 3CMAS 3D0HE 2OTLS 1HD1A 1KBRA 3HD2A 2HRYA 1BGXT 4JI4F 2B51A 4USUA 1HYSB 1KS2A 2HS4A 5F8IA 5KFJA 1L3TA 2AJ2A 1CLFA 3C16A 2JC1A 4LUBA 3SCIE 2CQHA 1GAOA 3V4MA 4J9VA 2LXFA 1RYSA 1EETB 4DPXA 4TU9A 2LMIA 1KVIA 4LR9A 4DV3J 2MB0B 5A0YB 2JEFA 2OPQB 3NLCA 2XMWA 3NGRA 3FK4A 2HWHA 5IFMA 4FNHA 3ELHA 3N01A 4RX6A 2ATLA 3IS9B 5CYJA 4F8RA 4Y3CA 1TV6B 1OQ6A 5ITHA 3PW7A 5FDLA 4FXVA 5KOWA 1CS4A 2QYCA 2VZ9A 2DNKA 1SBRA 2XY7A 4C0HA 2KM8C 4Y28C 4NYPA 2DKOB 3CEDA 5RUBA 4B9NA 1Y9OA 3VGUA 4OZ3A 2LEBA 3SYZA 4F50A 4M5HA 2PFDA 1RHJB 1UEUA 2Z56B 1CQNA 2F40A 3T3FA 4M63A 2D3OR 3C6TA 2D1CA 1O8BA 4OLPA 5MLCV 1XTZA 5E3AA 2HVIA 3HDSA 3U27A 3OTOF 5B08A 3M6UA 3UR0A 4X4UA 2RQMA 4O3OA 4DX5A 3NBPB 2VDIA 3IGVA 2XZTB 3DDNA 3OTOJ 2M70A 3NS7B 3FBFA 4OI3A 1IXKA 2IA6A 2YKNA 2UVVA 3OTEA 3Q83A 4I7FA 1R27B 3CC4S 3BEGB 3MAQA 1OYEA 4J90A 5HROA 5H9FJ 1IJFB 1F9FA 1LQ9A 5K8MA 5DETA 1EARA 3SCLE 2VG6B 3RW6A 5K20B 2GNKA 3K5PA 1CSJA 2W7PA 3AAWB 4ILRA 2UZAA 2YKOA 4DR4F 1VQ6S 4HR2A 4Q2MA 5CH7B 4WFYA 4QPTA 3H8YA 4ICLB 4C3MA 5DZ6A 2W9BB 3M30A 2CQ3A 2VB6A 3EGWB 1XQIA 3I0SB 3G8QA 2OFHX 4JUZA 4ZHRA 3KMQA 4IG0B 1U1PA 5G0RB 3BGFA 2R8KA 2UV8G 3QLHB 1VJQA 2XY6A 2CQIA 2LEAA 1WC5A 1WNEA 2VH7A 5B09A 1TL5A 3JSBA 2E29A 3UN2A 4OZLA 1RAAB 4EBCA 3U1LA 1EKSA 4H4MB 4QYZJ 4HHHA 1M0SA 4FPRA 2MJUA 4M5KA 3VAGA 1NDCA 1DURA 1AB8A 2WTFA 1LXJA 1GXLA 2DPIA 3N79A 4Q8FA 2QLWA 2CG8A 4U96A 4U8VA 3M9MB 5ETRA 3CCVS 5E3CA 4KPCA 1EP4A 3HVTB 2GW8A 3TVYA 1F3VA 1NSAA 2NXNA 4LF9J 2OMOA 1IR0A 2BACA 1NEEA 4NE9C 4I6YA 1RKJA 1R3NA 4B9UA 1FKOA 8ATCB 2X51A 2H9ZA 4UTGA 3HMJG 3W2WA 5G4DA 3KHGA 4PQUA 4E0DA 4XK8C 1S5ZA 4OQJA 4OI0A 3JYTB 1RTJB 4DR5J 4NCBA 2DGVA 1S9GA 3DOMA 1IR1A 4CIOA 5KAKA 1HL6A 3WQPA 4OMFG 4DJBA 4FYYB 2V4JA 5I3UA 3FMWA 2FIUA 2VOPA 2GJFA 5L1IA 4AXIA 2HNYA 3HJFA 3RAMA 1WHYA 4HTJA 3CO0P 4G1QA 4FKYA 1WTFA 5GMDA 5DDPC 2DRAA 4DR7F 4H54A 3CF5Q 2E5HA 1UEVA 4M94A 2ZJPQ 3GG0A 2MKCA 4C97A 4PG8A 1TAQA 3NGUA 1S0VA 4AT1B 2UXBF 2R7XA 2Z8QA 5HSPA 1U49A 4HTIA 3MPYA 2WW8A 1S9EB 2FUG9 1J5EF 1HI1A 4TU8A 4X4OA 1G3OA 1B4SA 2XI3A 2EFOA 5I42A 2YWFA 4N77A 2YNIA 1RWNB 1ULRA 1J5EJ 3WHIA 2B56A 4HH0A 3UVJA 4RW4B 3J7YI 2R2TA 2BR0A 1TVRB 3H5SA 2MKYA 3BO2A 1TFWA 2HK2A 2JNJA 3CD0A 5KFOA 2AF6A 1RT6B 4U9RA 4OV1A 3BGLA 5I4MA 4RW6B 4DQPA 3HK2A 1PJ5A 3PHEA 2DIUA 1SJ3P 4OHXA 4G3IA 3G6XA 4CNYA 4L6V3 1M5SA 5F8GA 4LSLB 2DRDA 2BJDA 2KG0A 2XZDB 1R8CA 4ANEA 4LFBJ 3C6UB 4EWTA 3QIDA 2UUCJ 4KY3A 5CAAA 2OO4A 2VBYA 4NA1A 2DO0A 1HPZA 1RTHA 1IBKJ 2XMMA 3G2XA 1YJWS 3ISZA 3CC2S 3QGPA 5GAEI 3N6MA 2Y1JA 4O4RA 3S8SA 1BWVA 1C2PA 2XMKA 2EI5A 5HANA 3TVKA 3FGVA 3R97A 3T1HJ 1UFWA 1FTRA 2FVCA 4F25A 2R2RA 2O01C 3H4BA 4H4OA 3SQGA 1RABB 2EKYA 3U7JA 1Q86T 3QJJA 1F9HA 1X31C 3VAJA 4QW8A 4USVA 2B8QA 3TAPA 2VA2A 2WSFC 2I0XA 2WCXA 3QO9B 2FZKB 4V19J 2VPYB 2C2NA 4ZVSB 3IAM9 1RHMB 1WI8A 2KT2A 4KV8B 2GHVC 2PT0A 1A9NB 3OL7A 4OX7A 3NKYA 1ZM2A 4ID5B 3GFZA 1EJ7L 5K9FA 1TK8A 4IQMA 2IMOA 3D6FB 4FVMA 3H25A 2N4CA 3FUYA 1XR6A 2RRAA 4PYAA 3NNAA 1ZAWA 3CCRS 1RP5A 4WYWA 1BQMB 4WCEQ 4CLYA 4ENOA 3R2DJ 2QL9B 1BXNA 2H5JB 1ZZFA 2DNOA 2VG5A 3CJ4A 2HQDA 1RT2A 2DHXA 3QJPA 1LW0A 1QAIA 3FSIA 2BYCA 2DNLA 2QG9B 2FVRA 3TYTA 5IS2A 1U6FA 1MG7A 5CYMA 1REVA 1TQLA 5CABA 1M5KC 2VV5A 5KFTA 3BM7A 2RSQA 2CVIA 1SQEA 4ECXA 1K9MT 4OHYA 2W9CA 3I55S 5DZ7A 2MQLA 3UWTA 4A8KA 2UV8A 3QAEA 2EWHA 1XR5A 4DL3A 1EZZB 2IFXA 3D0GE 2AU0A 4I2QA 1NSQA 1LWEA 3TI0A 4OIXA 2H3EB 2VJVA 2IIHA 2R8IA 5BYQA 3DLEB 1Q81T 1FX2A 2EKNA 1Q95G 2F4VJ 4TNOA 2ZH5A 3KG4A 3D3CJ 2R2UA 3MAAB 3NL0A 2MY8A 2GQ2A 2WAQD 3DOKA 4BWMA 1RHUB 1IQTA 4IQXA 1F5AA 2ZD1A 3TANA 4USHA 2CJKA 1C0TA 1Y5NB 3DLGA 4I6WA 4AL7A 4NWBA 3AJDA 1I94J 1BY9A 4I4BA 4N47A 1XEZA 5LMNJ 4NLYA 4YR2A 2XLJA 1FKPB 3W5YA 1U1QA 2BDPA 3LWLA 3M1VA 4ETZA 4YY3J 2AJFE 5ETVA 3UCGA 5CZXA 3BPSP 2EPIA 2KJWA 3P4UB 5HLFA 1WEXA 1UJ4A 2B6AA 5HP1B 2PSZA 2CQ4A 3M2VA 1EHWA 4DSKA 4CLWA 2CDRB 3DU6A 3CPWR 4DV1J 2DHSA 3GTYX 4WP9A 2FHKA 3BR9A 3RRGA 4FDFA 3V6KA 3T6JA 3OFEA 1SL2A 3OJUA 3FBEA 1R0BG 1BMQB 4KH0B 4NX9A 4JI3F 3DRYA 4K4SA 1K0VA 4PABA 1N52B 2LYVA 3BH6B 4ED7A 1HARA 1N5YA 1F2HA 4R5PB 4DL7A 4NLUA 1BLUA 2FLOA 3EJMA 1N33J 1S57A 4HVZA 5HMWA 2C3UA 2RUGA 7AT1B 1P27B 2YKAA 1U1RA 1TL4A 5H1SV 5KFFA 4L75A 1RWPB 4KGXB 5BYRA 2IRYA 4IO9Q 3FRZA 4TN2A 4IO1A 3KLEB 1HNWJ 1ACMB 4NCGA 5IZHA 4B9VA 2AYBA 1WUUA 2V4QA 2J0WA 1ZS6A 2QLXA 3ITHA 4ZPBA 2IM1A 3TJAA 1TL7A 3BSNA 1GXUA 2GX8A 3RB4A 3IM8A 4EYHB 4EO6A 1R0CB 1F2GA 1UPPA 3Q8PB 4FF2A 4C8NA 2OD4A 2KXFA 2B4OA 2D7SA 3MM5A 2HVDA 1WTBA 3DRPA 3KHRA 1R8BA 1NB2A 3PV8A 3N4WA 3U1MA 4DQSA 5LL6d 3KLFB 4MFBB 3HHLD 2HGMA 3I96A 1VQMS 2ZUGA 3PIPQ 2ZOFA 3KXDA 3M05A 2ZBCA 1HBNA 5I3QA 2VDHA 2L08A 2V5HG 2HZVA 3DGPA 2IM0A 4CTAB 4HLBA 2KFYA 5HATA 3DKDA 2X1AA 2FLLA 2VOOA 2CUYA 1RHRB 1XC9A 3NNCA 3OHBA 1JLEA 5BXIA 4NZ6A 1RJJA 4PWDB 4UOCA 1U2RA 4DCJB 3NMAA 4KE5A 2OPSA 3UNYA 3DXBA 1U2FA 4CWBA 2PDAA 3MWBA 4A8MP 1TKXA 1T02A 3O5TB 4IH7A 3SQOP 2MZRA 4EU0A 5E7OB 4MIAA 2QFJA 4WFBQ 3V81A 2MQOA 2Y8WA 1C4CA 3BSOA 4DSIA 3C15B 2XB2D 1RTDA 2ILZA 3QGHA 1U1KA 1W25A 2KVQE 3DOLB 3LPEA 2GHPA 4XTTA 3THVA 4WFAQ 1SV5A 1CC8A 3IWNC 2HLTA 1C1BA 4HEA9 5CXTA 3N28A 1M1KT 5GAHU 2CJ9A 2P9GA 1O0PA 1MSWD 3PR5B 1RE1B 3TUIC 3OSNA 4K5RA 3KG1A 1DTTB 2HAFA 1WEZA 3OXFA 3WZ0A 5ETLA 4IH6A 1F0XA 3TEHB 4IRCA 3T5HA 3NMRA 4USTA 5D3GB 3HP6A 5ETPA 3F41A 1NHUA 4MT1A 3K59A 2FTRA 2RIJA 3ETMA 1D8ZA 3DCAA 3Q2TC 1HIYA 4HT7A 4J9UE 1D8YA 1Q0NA 4LF7J 3BO3A 3PX0A 5D0GA 1K8AT 2KZZA 4GKJJ 4TYAA 2Q6CA 3OR2B 2FVPA 3L7OA 2COLA 3ENWA 3UDEA 3VR1A 3Q8QB 1TMJA 1ZAVA 3OVAA 2DEJA 3POTB 4Q0BB 3OTDA 4G6VB 2FJDB 5JVHQ 3GMGA 2ZE2A 4DG1A 2QE5A 3WIUA 4C0BA 4OYBA 1VBYA 4MAKA 4N5SA 3MEDB 1HNZF 1QDUB 1EQ0A 4GKKF 3DHWC 4NEYA 2HHQA 2VG7A 4EGLA 1J5OA 1Z4UA 3FKBA 2W4CA 4ZKAA 1NDPA 1T9WA 4B9SA 3FZBA 4OX6A 1RHQB 1IM6A 3MECB 3CUNA 3CJ2A 3J80U 3NGTA 3LO3A 2K7JA 1GTHA 4YB6A 3ZZRA 2I2YA 1FDDA 3WIVA 5E2QA 3IRWP 2HRUA 3MM6B 4B9LA 4LF5F 1Q78A 2UVUA 3TAQA 3M8QA 2IAJB 5C2CA 2J8SA 2NYIA 2WW4A 1APSA 3AT1B 4CLSA 5J2PB 2RQKA 1V5VA 3CMQA 2YKMB 3EDRB 4DU8A 5ETOA 2NUHA 3LP2A 3O44A 2GMJA 5KFBA 4ZPCA 5J1EB 1RT4B 5C24B 3SXLA 2DNNA 7FD1A 3MPDA 2IRUA 4RNHA 3L7UA 3BBFA 1JLAB 5IT9Y 3QNWB 4FXWA 4OYMA 2EG2A 4DL5A 1XNQF 2KYXA 1YJUA 2MXYA 4TQRA 5CYQA 2DCLA 1LOUA 1P1LA 2GQCA 4KFBA 2A0FB 3CJ5A 2BQUA 4WZMA 2CJQA 1S6UA 4ZN1A 4PWWA 4NCAA 1FVSA 4GO5X 4C3KA 1VS3A 1UVKA 4G65A 4NA3A 4XDCA 5FLXY 2BZ2A 1TR0A 3FZ2A 3M2UA 1QJHA 4QJVA 5KT7A 1NMEB 3M9NB 3LP0B 2UUAJ 4K59A 1RA6A 3KG0A 3R7BB 4DV6F 4LSZB 4ECTA 3HHLA 4WFNQ 2ILYA 3CD5A 5K8NA 2V8HA 2RT3A 2G0IA 4GO7X 2W8LA 4DUYF 4QU6A 2P5VA 1WACA 1RT7A 2HAIA 2KXNB 1R31A 4UZCA 3M8PA 5A8WB 3W9IA 3P6YC 4M5DA 4Q43A 4ZPDA 4OYWA 1RTIB 1CEZA 4AXJA 3HM9A 4K4YA 3VAMA 4K5SA 2XS5A 1NDKA 2V34A 1KN6A 2CQ0A 1SL1A 4DEZA 3CJ3A 3D3BJ 1H74A 3CIZA 2OD6A 4R8UB 3MR3A 3ENVA 1HWIA 4HACA 4ZJQA 2ZH4A 1TTHB 1BC6A 1U0SA 4XPCA 2K3KA 1EX8A 4NLXA 3CCUS 4NLRA 4HI1A 1OJ4A 3PX6A 2W7OA 2V0NA 4YMEA 3GR1A 4RBUA 3RBZA 2CKWA 3PDNA 3UE2A 4J9LA 2E5LF 3QSYB 2YQ3A 2RF2A 1U24A 4X4SA 4LBPA 5D15A 2WB1D 2MQ8A 1VMBA 4ZPWR 1FTCA 4NMLA 2MZTA 4ZP8A 3N5BA 1IKYB 2XSJB 3NCPA 3EVWA 2CWKA 4RZRA 3UCZP 4DL4A 3CJRA 1RBAA 2HNZA 2QSWA 2V63A 4MKAA 3DI6B 4OZ2A 1VBXA 3PHTA 3LP1A 4W90B 3ZZOA 3M32A 1HQUB 4DDFA 3RGIA 4YQWA 2CNOB 3G87A 3Q86A 3MTKA 3KJVA 1NK5A 2DO4A 3KLIB 1EIYB 3BB5A 3OPKA 1V5IB 3JS9A 2VQEJ 1F5CA 4YFUA 4ECQA 3KK1A 5KFRA 3B78A 2F9JA 5AXMA 3NEKA 1HNXJ 3BV8A 4B17A 5GVQA 2CQDA 2VBWA 1SUQA 1UVLA 2E44A 4FBUA 4ZOSA 5FLXU 2PI5A 4LR7A 4WWSA 3R7SB 1U45A 2LLZA 1C1CA 1Y7PA 3PNIA 4FS1A 4MYTA 5M2PA 3KWMA 4O3NA 1RCXB 3LQVA 5AXLA 3ONQA 1NZ8A 4ED4A 4RUHA 2OUGA 1NH7A 2PI4A 1I1GA 2BEFA 3IBCB 2CJAA 5ETNA 2VODA 2WSEC 3KJFB 3KMSA 1EB0A 2DNRA 1PIEA 4HDHA 2R3VA 2M9KA 1NPPA 2GVDA 1KNZA 3MMJA 4C6AA 2PN6A 1CS4B 2YNHA 3PW0A 3C2PA 4O0NA 1WG4A 4DSJA 3ISND 1CC7A 2F65A 4O23A 2CPYA 2JH3A 5HI7A 2HHWA 1VQ8S 3ZC4A 3QT5A 1HBMA 4V1Ak 4A47A 3LUYA 1S76D 1Z2ZA 5FJ4A 4QPXA 2YY3A 3TZXA 3UQSA 1SJ1A 3G8SA 3AOBA 4DZDA 3MD1A 2RUSA 1XMOF 3N0VA 1QAXA 4OJGA 4XO0A 3HHKA 1Q8LA 3KYLA 1E6YA 2IRXA 3L4BC 2YKNB 3DRSA 4LF8F 1Q5YA 3MCSA 4NI2A 3FFIB 1QLNA 3D5MA 1VC5A 4RW9A 5HROB 3RBEA 1UWBB 3F73A 1M1HA 1M5PC 3IAS9 1DHMA 4HHJA 1UVIA 2MKIA 1KHWA 1PBUA 1RBLA 3BKTA 1U1OA 5K8OA 3GV7B 4A8WA 1VQ7S 3SBMA 4P72A 4MYUA 2V94A 3P5BP 3M30B 2CPEA 1UAWA 4O44B 1NKBA 1CULB 4ZHRB 2IY5B 1YJNS 3KLHA 5H9EK 4F3QA 2C2EA 4A8XA 4CLPA 5CCLA 4D3GA 4K2JA 1YGYA 1N56A 1SXLA 4ZLLA 3Q8UA 1T9TA 2CZ4A 4NZ7A 4FF1A 5K8PA 4QIEA 1VRTA 1YJ7A 3H0PA 3MR2A 2GAGC 4TU7A 5LXYA 1QY7A 4JI0F 1NCLA 1R8AA 4O3QA 3RB3A 2D41A 4LVOP 2FC9A 1SPBP 2YQ1A 2VKRA 1XR7A 1D9FA 3NOCA 2N82B 4QWCA 5A6PA 4JI0J 2YXLA 2R9LA 4ZVEA 3WX8A 4FYDA 3CSKA 1EP4B 2OEJA 1OWXA 1IBLJ 2EXUA 2RE1A 1OPIA 4K4UA 2PA8D 4UY85 2LQ8A 2IVYA 5KFMA 2NPIA 3LAMA 1IBMF 4Q7AA 2VFSA 4J9RA 2DGQA 1FKOB 3MM8A 3TA0A 4AUKA 3W2WB 3R5CA 1IBMJ 4PQUB 2ZKUA 2C3MA 2MLYA 2W2PP 1N5VA 1X9MA 4DV5F 3E3XA 3W3SA 1NK7A 2ALYB 1ELOA 3ZXWA 1S9GB 2BJ8A 1X60A 1S1TA 1HNVB 4K4WA 4FZVA 1ZA1B 1F3FA 2MQMA 3PJ9A 1NJXA 5I3UB 2BE2A 2QEXS 3J7A1 1FFGB 2OP5A 5LMUJ 2AWZA 3M6WA 4G1QB 5IOLA 3DM2A 4URQU 2KB2A 3PVXA 2BJ3A 3FQKA 4Y6IA 1XMQJ 3HT3A 2CG4A 2Q1LA 5HVFA 5EHHA 1CPZA 3ZNJ1 4LFAF 3ADAC 3HT0A 3W9HA 1K73T 3UCUP 1WKKA 4ZN3A 1HR0F 2MHNA 4I68A 1RBOB 4KYZA 1PYOB 2PO4A 4C0OC 1RSCA 1Y5IB 2VFUA 4Y00A 4TXSA 2CQ2A 1HR0J 2MGZA 5I42B 1CQMA 1N48A 2ZDOA 2YNIB 2GZOA 2JOQA 3BSCA 1WF1A 2KYZA 4AQYJ 3UVJB 2MZSA 3UR3C 1PAUB 3ZFVA 2A2DA 4MKVA 3QBCA 1RAIB 1GNKA 2I38A 2ADCA 2GA7A 4YB5A 3BH7B 4ES3A 1JLFB 4YDXA 2VFVA 1XNRJ 1RYRA 2O66A 2FQQB 4WJBA 1VC0A 2HQFA 1BD6A 1T3NA 1UZDA 3EGNA 3CTRA 1B0PA 2W2QP 1OY8A 2VHGA 4OYAA 1EAYC 2MPUA 4B3OB 4ZCIA 4YB7A 2FY1A 2AGOA 2X1FA 3F0NA 4I2PB 1TUGB 4DFPA 2YX7A 1VJWA 3RBDA 1N34J 1MN7A 1HPZB 4DSFA 1RTHB 2C2MB 5IM0B 2U2FA 4TLQA 3H5UA 1KQFB 2OH2A 1F5BA 1I6JA 2HBZB 1LK7A 1DJ0A 1KWMA 3K5LA 1JJ4A 2FYXA 1YSJA 4BCAA 3W2VB 3PIOQ 3HJVA 2PMHA 4KGKA 4Y2KA 2YWWA 3SIPB 3VGSA 2CQPA 1MW7A 1IKXA 4WK1A 2W8KA 2HHHJ 5AXNA 1P1TA 3W66A 2M5YA 4OV6A 4H4OB 5KT4A 2J0QD 5KFDA 2LDIA 4JI5F 1LWFA 3EPIA 2C3OA 5HQMA 2Z2YB 4DPWA 3NAHA 2AQ4A 5HK4A 3TQEA 3W65A 2BMBA 2XMVA 1N6QA 4JI5J 4F0MA 3DMJA 2HSEB 3TO8A 5HBMA 2W24A 1OSCA 4DR6J 2IA0A 3K57A 2W9AA 2MEWA 2VUGA 2AX0A 3ZZ0A 3T19A 1S72S 1SJQA 3AJ1A 4X62F 4M1KA 3OHAA 3TR5A 4KHMA 2CVEA 2OPPB 3B8HA 2VA3A 3SSRA 4TY8A 3BYPA 3T41A 3BQ1A 3FCVA 3LGMA 1VI7A 1SB6A 3IR7B 1U8SA 3CCZA 4WZQA 5D77A 3ZO7A 2BOAA 2E7XA 1S79A 4P2SA 1TL3A 2QSFA 1HWKA 1R0AA 3ILLA 4QWBA 4IFVA 1VLOA 3G9CA 4CO1A 1MNEA 1Q7YT 4LF6J 2CNNB 2QA4G 2VG5B 1VQ5S 3MDFA 1FJGF 1LW0B 1WDDA 2Y1IA 2KHDA 2DGSA 1FJEB 1H73A 2YNGA 2EBGA 2HWTA 5LSRA 3ILJA 5D4LA 5CYMB 1REVB 3AB2B 1JXLA 2UXDJ 4GC7A 3MM9B 3D6HB 1D3WA 1CVJA 1DLOA 3GILA 3FBBA 2W9CB 1DTQA 3SSQA 3PKYA 3BGRB 4DX7A 4DZ6A 4CNZA 3M2RA 3ILOA 2YPYA 3IN5A 3D68A 4I2QB 4LFCF 4W98A 1LWEB 1FESA 5D0RA 3ZTRA 4JI6J 4X4QA 1RT5A 2Q6BA 3GB0A 4P7VA 2HYIB 1RWOB 3U02A 1UPMB 2AZ1A 3J7YU 4A8QA 3TUZC 4DLGA 5GAGI 3K0JA 3TJ8A 2U1AA 1JJCB 2E1CA 2BABA 2ZH7A 2YX1A 4F2RA 5JXSA 3DOKB 2IYGA 2ZD1B 5KFUA 4FP9A 2CNKB 4DR2J 4LF4J 2DVIA 2MQQA 2LVWA 2HNDA 1FVQA 1L3VA 1C0TB 1FNMA 3DLGB 4KSEB 3NCRA 3PYFA 3NXZA 3I5CA 4P75A 2JC0A 1S4FA 1J27A 2JHEA 1FRLA 1C4AA 2RDIA 3M1VB 3A3PB 1Y00A 2JDJA 5GAEU 5HQLA 3TX0A 1SC4B 4ZJLA 5LT5A 3OL8A 5HLFB 1HWJA 2B6AB 1RB0A 1AA1B 3M2VB 3V6JA 3AJ2A 4ECRA 1S1WA 5DGBA 4LRDA 2HFZA 3EMTA 3IP0A 3O3LA 1KVJA 3QWPA 2R7OA 3I9V9 2XMUA 2VONA 1T0TV 3QT6A 3CDWA 3PJXA 2PEHA 3DLHA 2JSXA 4S0MA 3SFGA 1VBKA 2BW2A 1YKWA 2MKJA 2QX0A 4IUFA 2FJEB 3M7VA 4USKA 3E2EA 1N5YB 4JI7F 2XWXA 3Q0AA 4PG6A 4BDPA 2V8GA 2J0SD 1DQ8A 1X4DA 4QR0A 2E7VA 4YR0A 4JI7J 3GPAA 2LU1A 2FHJD 1QM9A 1GT8A 2DCUB 1EQMA 4DL0C 1X5TA 2ZHBA 5J1PA 4QOTA 3CNQP 3DRRB 4X65J 2FDNA 4NCGB 2KKHA 4R25A 4WTOB 2ZZNA 3ITHB 4ICLA 5L38A 1NKCA 2QLBB 1TL7B 4J9MA 3J7Z5 2OJ3A
chains in the Genus database with same CATH topology
2YH1A 2B4UA 3RR7A 5KG1A 4TQSA 4EBDA 1IKVB 5GAGU 3EX7B 1ZZNA 4ZLPA 2ZM6F 4X66F 2RF2B 4NX9A 4ZCMA 1WHXA 3B82A 4IG0A 1HNIB 2Y1RI 4PXEA 5K5MA 5KFLA 3CMES 2MQNA 3DRYA 4ELTA 4JI3F 2FJAB 3QLHA 2I5JA 5KFAA 1H2VZ 5J2QB 3WC2A 3QZ7A 1JLGB 4K4SA 1K0VA 1GQEA 1N52B 2LYVA 2MY7A 1JLCB 3MD3A 4ED7A 1SJ4P 1HARA 2C28A 4X2BA 5KFEA 3QZ8A 1N5YA 4R5PB 3D28A 2ZH9A 3CCES 4DL7A 4NLUA 2VPZB 1BLUA 3GYNA 3PX4A 2FLOA 5IWAF 1FRXA 4HVZA 4QBUA 4CH1A 4RW8A 5HMWA 2C3UA 4PPDA 3PZPA 1N5SA 5D4OA 2RUGA 1S1XB 2QA4S 1JLQB 2JZ5A 1IKWA 1FKPA 4WFXA 3PO4A 2KFNA 1KQSR 4QQBA 1P27B 2ZDPA 3OVSA 4ZVHA 4H4MA 1JK9B 2YKAA 1U1RA 2E9TA 3HHNB 1TL4A 5H1SV 2C2DA 5KFFA 2WOMA 1H6KX 5GADI 3H59A 1GH8A 2I8EA 1RT1B 1HBNB 1W2IA 1KQKA 4JYAF 3H4DA 1FEHA 1NK4A 5BYRA 4GMKA 2R8HA 3KLGA 2IRYA 2KM8B 3PJWA 4WE1A 1HNVA 4IO9Q 3FRZA 4TN2A 1HMVB 4IO1A 1LFWA 2ZJRQ 3LPYA 1M90T 3KLEB 4TYBA 1KTQA 2CPHA 2R7RA 2P6TA 2RU9A 4NCGA 5IZHA 2QZ8A 4B9VA 2AYBA 3IO1A 3LANA 2IM3A 2B9XA 3Q23A 5IT4A 3C3LA 2V4QA 4KO0A 1R6YA 5M2UA 5KFZA 4FXDA 2J0WA 1R89A 3KLVA 5T7LB 4OL8A 1VFJA 4HI2A 3R1HA 2QLXA 3EZUA 1SC6A 4RU2A 3CIMA 3ITHA 6FDRA 3D1OA 1TK5A 2I1RA 3DRXA 2IM1A 4ZPBA 1S1UA 3T5KA 2OAUA 1T8EA 4LMZA 5A8RB 4LQ9A 4WU2A 1JLEB 3MZIA 3OR1B 3BSNA 3HVTA 2PA3A 2RJZA 4OI2A 5J2MB 1GXUA 3KK1B 1YHQS 2CPIA 4ILMA 2GX8A 3RB4A 5D8HB 2K1RA 1FE0A 2CIMA 4EYHB 3NGKA 4EO6A 1IM4A 2RD5C 1F2GA 1SKRA 1B64A 1HNIA 3Q8PB 3RB0A 4FF2A 4C8NA 2OD4A 1N88A 1N4LA 2EK1A 2KXFA 2B4OA 2D7SA 1URRA 3MM5A 2FJXA 4FF3A 2DNQA 2JRSA 2D3ZA 1RAJA 1LK5A 1TKXB 4YP3A 1KTVA 4NYZA 1JLGA 3DRPA 4CQ1A 3KHRA 5J2QA 3NNHA 1QAYA 3OVBA 1R8BA 1JLCA 3OTBA 3PV8A 3N4WA 4NLWA 2DNZA 3JTPA 3H2VE 5CD4H 4ECWA 2GO8A 1OO0B 2G13A 1SUQB 2NXUA 3U1MA 4R5PA 3GQCA 1UVJA 4DSEA 4DQSA 1L3SA 5LL6d 1Q7LB 3V81B 3KLFB 2L9NA 4MFBB 2DNYA 4LSNB 1S1XA 3NCQA 5DO2A 1JLQA 4AL6A 2KI2A 5BR8F 1RTDB 3HHLD 2F8MA 2HGMA 3I96A 3JYTA 4MKYA 4LVNP 1VQMS 1TP7A 2ZUGA 4P7TA 3PIPQ 4UUXA 4ZK7M 4Q8EA 2ZOFA 1FHTA 1FCAA 4OLOA 4N56A 2B5JB 3IRXB 3M05A 2ZBCA 1HBNA 5I3QA 1RDRA 4F02A 4JBCA 4DS4A 2L08A 1SL0A 1P9QC 2LDYA 1K1SA 2JEIA 2F8EX 1SV5B 2V8DA 4PCQA 1HMVA 2V5HG 2M8DB 3LW5C 1U1LA 4ALZA 3KLEA 1BQXA 1S77D 1JLFA 2V2KA 2YWKA 2IM0A 3DGPA 3H20A 4CTAB 1C1BB 3BGUA 3K8VA 4HLBA 3LGNA 2KFYA 1U1MA 4JV5F 2VQEF 4DOZA 2X1GA 2X1AA 3BN4A 2FLLA 1OQ3A 3RTVA 2P9CA 4A46A 2VOOA 5T7LA 4DHVA 2IC3A 4DWIA 1VQYA 5L9NA 1FRJA 5EN1A 1XC9A 1AUDA 5DRKA 3BJYA 3NNCA 2XS2A 3OHBA 3L3CA 2HQIA 1HHSA 4OX9F 5A8RA 5KG6A 1JLEA 3OR1A 4OI4A 1HNXF 4KT0C 5J2MA 1T03B 1WHVA 4NZ6A 2CJBA 4B3OA 1RJJA 4PWDB 4X4PA 4UOCA 1U2RA 3NMAA 3RAXA 4KE5A 4QR2A 2OPSA 3UDLA 1UA1A 3DXBA 2R2SA 1WF0A 4F4XA 1U2FA 3MMBA 2F1FA 3LALA 5AE3A 4ZPAA 2XMTA 1N32F 4O3RA 2PDAA 1TKTB 3MWBA 3AA8A 4I2PA 4NZ0A 2MSSA 5DDQC 4E98A 4A8MP 1HWLA 2DRBA 1TKXA 1T02A 3O5TB 4IH7A 2VBXA 3RB6A 2R8GA 1U7LA 3UW1A 2DR8A 1UP1A 1S9EA 2MZRA 4EU0A 5E7OB 3E51A 5IM0A 4MIAA 2QFJA 5HMXA 2J9DA 4WFBQ 3M9OB 4JV1A 2B7CB 2FPHX 5K14B 3V81A 2MQOA 3KLFA 2D9PA 1C4CA 1RKIA 1V3ZA 4MFBA 4LSNA 3UI3A 3BSOA 4DSIA 2J6UA 3THTA 5AJ3F 3GG1A 2XB2D 1SJRA 1RTDA 3R5AA 2ALZA 1G2EA 2NPFA 1F60B 1QVFR 2QMXA 3BDEA 2ILZA 2DNMA 3QGHA 3I6PA 4ZA1A 1U1KA 1FERA 1W25A 5ADZA 3TUJC 2RDJA 1XBWA 2B5JA 4Q2LA 2EFQA 4JOUA 4RW4A 2NZ4A 3FRYA 3W2VA 4R0EA 3BR8A 3DOLB 2DH7A 2GIRA 2GHPA 4QZVB 3THVA 5KOXA 1H2TZ 4ECTA 1X7VA 1X4EA 2R7UA 2EBEA 4WFAQ 1SV5A 1CC8A 1Y4ZB 4WTYA 3IWNC 4IDKB 5KT3A 3CDUA 1HBOB 5DDRC 1U25A 5DM7Q 1RT6A 4CTAA 2HLTA 4USJC 1C1BA 4C2MA 4HEA9 5B0AA 1FJCA 1DQ9A 3MEEB 1H0HB 1OS5A 2RRBA 3N28A 1FXDA 4PXBA 5DS7A 5EUHA 1M1KT 5GAHU 3DLLQ 4IRDA 2CJ9A 2P9GA 1O0PA 5GADU 4FS2A 1MSWD 2ZH6A 2B9WA 1U4BA 5FDLB 5F41A 2W25A 2C42A 2ACYA 2ZE2B 3TUIC 4CO4A 2HIQA 2M88A 3PR5B 3P3DA 3OSNA 1VK3A 2DR7A 4FN5A 4B9MA 4K5RA 3KG1A 4DG1B 1DTTB 2NSCA 2UUTA 1WEZA 4KBIA 4DL2A 3OXFA 4BWJA 1ZPVA 3B4MA 3WZ0A 1T03A 3HZEA 4C8MA 5EX3A 4PWDA 4IH6A 1F0XA 2OIHA 4MMOA 4J9NA 1SIZA 4IRCA 1S0MA 4ECVA 2BRKA 3T5HA 2YWEA 3LH2S 4Y0FA 1Y3KA 4J5OA 3NMRA 4B3TF 1PSDA 1TKTA 2VG7B 3DU5A 5D3GB 3HP6A 1J5OB 5D4NA 4PG5A 1ZBTA 3R5BA 2OTJS 2Z2MA 5A2QY 4J9KA 4DV3F 3F41A 1NHUA 4ATNA 5KG2A 4K2XA 3K59A 5E5NA 2FTRA 2RIJA 3C6TB 2FLNA 4EUVA 4FVCA 1JIHA 4WXOA 5IQQA 4QWDA 4ED0A 3I31A 1D8ZA 4X84A 3DCAA 3Q2TC 1YITS 4HT7A 4XAKA 2OPPA 3JTNA 4F4YA 1YBAA 5C5JA 2ZH3A 1QSSA 1D8YA 4QW9A 1JNRB 1JWWA 2RH3A 3BO3A 2AJ1A 3K58A 3PX0A 3L09A 3KLHB 1K8AT 2KZZA 4N8NA 2XG8A 1UVNA 3DOLA 4TYAA 1FD2A 2Q6CA 1V9OA 3CCQS 2IM2A 3OR2B 2EVZA 3MGJA 1UETA 2FVPA 3M8QB 4PWUA 2FGCA 1U6BA 3X3UA 4P6QA 4C8OA 4IDKA 3L7OA 2COLA 2KXHA 3ENWA 2HHPA 1HBOA 2DGTA 2K8GA 1WEYA 2N4DA 3KKFA 5E33A 3VR1A 3Q8QB 1ZAVA 2BBEA 3OVAA 5KT5A 3CB4A 3KNGA 4RKUC 4ECSA 3FEYB 3POTB 3VAKA 1V3RA 4Q0BB 3ISNC 2APOA 3MEEA 3OTDA 4G6VB 2FJDB 5JVHQ 4I7FB 3TQ1A 3GMGA 4KPYA 2ZE2A 3OBIA 2CRLA 1XERA 4DQQA 4WK3A 2VPXB 2BM0A 2VKZG 4OJ1A 3WX4A 5D6GA 4DG1A 1NZAA 1TKZB 2QE5A 4OZNA 3IFEA 4C0BA 3MEGA 2HPUA 4MIWA 4R0JA 3JTOA 5CXTA 3LP2B 2KH9A 2E9RX 5F8HA 1VBYA 5HMZA 2UU9F 4MAKA 2DH9A 2J9CA 4RNFA 2D3UA 3OFHA 4N5SA 1FNOA 3MEDB 2DGWA 3QO9A 1HNZF 2DTJA 3K8WA 4OHVA 4U7UK 4GKKF 1H7XA 3DHWC 2ZFHA 4IFYB 2IVFB 3I4HX 2HHQA 2IHR1 2PIIA 5C25B 4TY9A 2EC0A 2VG7A 4EGLA 1J5OA 1NJZA 4F2SA 1Z4UA 1X4CA 2XCPA 2UUBF 2W4CA 4WKYA 1KSPA 2DISA 2NLWA 4ZKAA 3MM7B 4B9SA 2MJNA 3FZBA 3O6QA 4OX6A 4O3SA 5AE1A 3MECB 3CUNA 4JI2F 2HS0A 2FHJA 1WD6A 3GE9A 2RU3A 3HZGA 3CJ2A 4DR1F 4LQ3A 3D1HA 3MM9A 1DQAA 1QUPA 3DYAB 4ID5A 4MK7A 3LO3A 2R7VA 5CYQB 2K7JA 2XHWA 5BJRA 2V8VA 1GTHA 2MHEA 1U6ZA 2WONB 4YB6A 4PG7A 3ZZRA 3BQ0A 1SJFA 2J8AA 2I2YA 1X4HA 3BGRA 3MFIA 3HX9A 1FDDA 1SH2A 2YVSA 2VFTA 4X4NA 4BBYA 4BC7A 5E2QA 2FVQA 4RWWA 4CT9A 3IRWP 1S6OA 4KFBB 2HRUA 2OLWA 3MM6B 4B9LA 4LF5F 5L8RC 1Q78A 2MDAA 5LJ3Y 2UVUA 4NA2A 2M0GB 3TAQA 3MM8B 3M8QA 3H98A 2CZVC 2WBRA 2IAJB 4ZPTR 4YDDB 4IR1A 2NYIA 4USIA 3T6BA 2XY5A 2FVSA 1APSA 2J6TA 1SIWB 3VTIA 3ZZYA 5J2PB 3POTA 2LKZA 1BQMA 4WXWA 1HA1A 4DSLA 4Q0BA 3TVZA 1NK8A 1JKHB 3U1NA 2RQKA 2JFDA 1VK8A 1HD0A 1D0EA 3OLBA 5F3TA 1WI6A 4A4JA 1N54B 4RUAA 2QRRA 1Z1ZA 5B0DA 1A6LA 2CPDA 3MUMP 3IBWA 2YKMB 5KG5A 3VQTA 1TKZA 1UFLA 1MROB 4ZCKA 1FK9B 5L9XA 3HHDA 4IR9A 3FVYA 3M6XA 2ZZMA 3GFYA 1S1TB 2NUHA 3I5BA 1PGZA 3LP2A 1BQNB 3O44A 2FC8A 2KG1A 4GC6A 4NLPA 5B0EA 2KTQA 4ZVFA 5DLFA 3CCMS 1ZOTA 2G4BA 2GMJA 3MEDA 5KFBA 3A1YG 3QYYA 2HMIB 4ZPCA 2HHTA 5J1EB 1QVGR 1RT4B 5C24B 2N7YA 3SXLA 4Y2CA 3F56A 2DNNA 1WG5A 2MZQA 1Y0HA 5C25A 7FD1A 2ABYA 1KONA 2IRUA 4RNHA 1IBLF 3HHLB 3WDOA 3BREA 1E6VB 2PC6A 1MU2A 1NK9A 2BVZA 2ZC3A 3HKWA 3MM7A 3DLJA 3EUNA 4KKOB 4K4TA 1JLAB 4DUZF 2XULA 5IT9Y 4FXWA 3QMQA 3PXGa 3CDAA 5DG9A 4NLGA 4V19X 4O4GA 2EG2A 1RT7B 4DL5A 1XNQF 2KYXA 4I69A 1YJUA 4PRFA 2EG1A 2MXYA 3DYAA 4TQRA 1OSDA 1Y3JA 3TX8A 3Q24A 5CYQA 4WF9Q 4RW7B 3RU0A 2M8HA 1KR4A 1VIOA 3E8OA 4C11B 3DN9A 2DCLA 1LOUA 5U47A 3M8PB 3R3TA 5KG7A 2EFGA 2E1AA 1P1LA 2GQCA 3PFOA 4Q45A 4KFBA 4YR3A 2CQGA 4J9PA 4UW2A 2XBPA 3MOZA 2EK6A 2Y0SD 3CJ5A 3R27A 3IWXA 3X1LB 2BQUA 2WHOA 4WZMA 2CJQA 1FA0A 1S6UA 2IAJA 1X9SA 4NCAA 1FVSA 3AQPA 4PXDA 2JLEA 3SV4A 2HHXA 4GO5X 4C3KA 4QCLA 1KOOA 1VS3A 1UVKA 3OTCA 5J2PA 4AYBD 3K5MA 2MMYA 3PACA 4KIAA 1Y5LB 1JKHA 1YRTA 4ZPVR 3MI7X 1VLYA 3N6LA 2HVZA 3GV8B 4NLDA 2LECA 1TL1B 4NA3A 4XDCA 3CCSS 3PRBA 1JJHA 1T3OA 1U48A 3V5RA 2FD2A 1NJWA 5FLXY 3ZZUA 5L1JA 2XNRA 1IJEB 1S1VA 4BS2A 2BZ2A 1TR0A 2IBKA 2MKSA 1YIJS 2YKMA 4HKQA 4BHQA 4OX8A 1L3UA 1MROA 1FK9A 2J7KA 3FZ2A 3M2UA 5E3RA 5SUHA 2AP6A 2ZH8A 5LMUF 1JMTA 5F8NA 1QJHA 1BQNA 4QJVA 5KT7A 3OSPA 4DFMA 1S6PB 4YOEA 2V4JB 1JNZB 4WFZA 3CT9A 3M9NB 1PILA 1AFJA 1KRPA 2HMIA 3NS6A 2R8JA 3LP0B 3HLUA 1Q8BA 1RT4A 4K59A 2ZITA 5C24A 2R7QA 1XMQF 1RA6A 3KG0A 5F8LA 4DV7F 2R4FA 4KC5A 2AGPA 2HNYB 2EFVA 5J1NA 2FHMA 2HQ3A 1DARA 2E5JA 4C8LA 4W92B 4DV6F 1LW2B 3HHLA 3GYXB 4WFNQ 2ILYA 3CD5A 5K8NA 4J37A 1E6VA 1LWCB 4ES2A 4LF9F 1KLMB 2V8HA 3HVWA 2BRLA 2RT3A 2LA6A 2MZJA 2UP1A 3G96A 3ETOA 4KKOA 3IG1B 4NPOA 2W4PA 4GO7X 1JLAA 2W8LA 4DUYF 4QU6A 3P5TL 2AYMA 2P5VA 3H2UB 1WACA 2GGPB 4PG4A 4B3RF 1RT7A 4NOHA 3CCJS 2HAIA 2YWGA 3AB4B 4Q44A 2KXNB 3PW4A 1X0FA 1M5OC 2UXCF 1R31A 4MTPA 4RW7A 2J0XA 2ZHOA 2BANB 5L1KA 2Q3PA 5KFQA 1WF2A 4C11A 4HT5A 3IGNA 4Y34A 3M8PA 5A8WB 3KTQA 4CH7A 4TLRA 3P6YC 3AH6A 2J7UA 4M5DA 1JLBA 2RRNA 4LT6A 5CA5A 4Q43A 3UDCA 3HF5A 3KOAA 4ZPDA 1VHFA