3IBWA

Crystal structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
TDFLAGIRIVGEDKNGMTNQITGVISKFDTNIRTIVLNAKDGIFTCNLMIFVKNTDKLTTLMDKLRKVQGVFTVERLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GTP pyrophosphokinase
publication title Crystal Structure of the ACT domain from GTP pyrophosphokinase of Chlorobium tepidum.
rcsb
source organism Chlorobaculum tepidum
molecule tags Transferase
total genus 18
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ibwA00
3LUYA 4NMLA 3TUZC 2F8MA 1LK5A 4IO1A 5JJBA 1RWUA 3OBIA 3OFEA 1UJ6A 3DC2A 3DHWC 2CDQA 2H9ZA 5FIIA 2DTJA 1LKZA 2F1FA 2P9CA 1XTZA 1UJ5A 3MTJA 2RQMA 3N0VA 1SC6A 4GMKA 3HHEA 3O1LA 3L7OA 2KO1A 3ENVA 2RE1A 3CEDA 3DHXA 1UJ4A 3AB4B 3IXQA 2RQKA 2PA3A 2JHEA 3U7JA 3W7BA 1U8SA 3S1TA 1Y7PA 3DDNA 4GO7X 3LOUA 2QRRA 2P9EA 1YGYA 3TUJC 2MDAA 5IT0A 1KS2A 3ENQA 1YBAA 3K5PA 3AB2B 2ZHOA 4LUBA 5IT4A 3IBWA 2QSWA 3MWBA 2J0XA 5T41A 1PSDA 3AAWB 2I9SA 3OFGA 2QMWA 4M8LA 2DT9A 1LK7A 1O8BA 4GO5X 2NYIA 3OFHA 3NRBA 5IS2A 3TUIC 1M0SA 2J0WA 2QMXA 2P9GA 4PWUA 3MAHA 2FGCA 4X84A 1ZPVA 2LVWA 3ENWA 3KWMA 3UW1A 2LQJA 2PC6A 3OFFA 2JOQA 3P96A
chains in the Genus database with same CATH superfamily
1PC5A 1HPZB 3NBPA 2GJIA 5HQ8A 1RWUA 1X4DA 5EX0A 4JI4J 3WX4A 5A8KA 1TKDA 3N5FA 1ZAWA 4F50A 1IBKF 5HLFA 3QJLA 1OJ4A 3EXYA 2CIMA 2V94A 3MM5B 3D3CJ 3I0SA 3PRBA 3NCPA 3QRRA 3U7JA 3GJQB 1IVZA 1VBZA 2AYEA 3H2VE 4EYHB 2VODA 4U96A 1GMUA 4LFBJ 1T9VA 3KFWX 4HACB 2ZH6A 3G9CA 1PJ7A 1B0VA 2JEIA 4ZVEA 2O67A 2C2ZB 4KGZB 3SCIE 3AQOA 3W60A 3R5DA 4DWIA 3CDUA 2WW8A 1JK9B 4CDIA 3FCVA 4QJVA 3A3OB 2XHCA 4WK1A 3KLIB 3W9JA 4DCOB 2DNQA 3GJSB 5D3GB 1VBKA 4EBDA 2OD6A 2W7AA 4FVMA 4JI7J 3BN4A 1NJXA 2LQJA 1YVFA 1YJUA 2P8IA 3W9IA 4UOCA 5M2RA 4QOTA 4NRUA 3CUNA 4IOCQ 1RA6A 2D7SA 4I56A 4XDCA 3NWGA 4OIXA 4DV7J 1RTJA 4ZVFA 5AXMA 3CJQA 5K5MA 3EXCX 2UUBF 1R0AA 3C66A 3MAAA 5DLFA 2WONB 2PGCA 1GTEA 1H7WA 4Z2XA 2OH2A 3R97A 1MSWD 3PX0A 2CJAA 4DSIA 2WCXA 1ZZNA 1NO8A 3M8PA 1JJ4A 1CG2A 2OLWA 1HBOB 4CO2A 3M6VA 2Q3PA 4OX9J 2CQ0A 3DKDA 5DQIA 4X4VA 1S6PA 1EQMA 5C2GA 5GAHI 1VRUB 4B17A 1RSCA 3PHEA 1FE4A 4NEYA 4LSNA 4NLRA 2E7VA 2J8SA 5FDLA 5LMUJ 3PRDA 1RP5A 4ZN1A 2C22A 1F3VA 5K8OA 2OTLS 3I9ZA 2CNLB 1UJ6A 2ZVSA 1N36J 5F8MA 1SQEA 4LF7F 5B0GA 1KWMA 4YR0A 2M7SA 4YS2A 2VG5A 1VQ8S 4ZLPA 2UU9J 4C3LA 3HVWA 3GIRA 1RZMA 1N88A 3NP5A 5J2MB 3IR5B 1K73T 1RBLA 1UKUA 2J8AA 2W9CA 4LFCF 3BSNA 1KS2A 1U1PA 2MQMA 2GIFA 1UZHA 4UOHA 1IXKA 2O1PA 4NCGB 2YTCA 3M8ZA 2HHXA 1EETA 3QT7A 2BA9A 3FEYB 2HFZA 2HNYB 4CNZA 3C19A 3PIOQ 3DOMB 2CVEA 2COLA 3J81Y 4DL5A 3R7SB 5FLXY 2WVBA 4TNOA 2E29A 2P9GA 2Q43A 1Q79A 1PIEA 2VKZG 3D1OA 1X4FA 2XMMA 2C3MA 1VQSA 1T9TA 3CCLS 4F2SA 2OMLA 4QYZK 2H4WB 4OZ0A 2R8HA 2Z2ZA 3MPVA 1NDPA 2P9CA 3CB4A 1SKSA 3DXBA 4ZIWA 2F63A 4RLEA 2QJ3A 4KGKA 4CYUB 3FMWA 1X0FA 1N48A 4NI2B 1Q0NA 5K20B 3MCOA 1HBNB 2P6SA 3UD3P 1S1TA 1YQHA 4KSEB 6FD1A 3P4UB 3QZ7A 2KVIA 3FGVA 5KTQA 3A8KA 2VG7A 3EGZA 2J0XA 3HSJA 2MGZA 1T9YA 4HKQA 2NXJA 3CO9A 1CS4B 1AFIA 3PZPA 3H2UB 4HDGA 3WC0A 2C2MB 2V34A 1CPZA 3G6YA 3VZHA 5EHHA 2YX7A 2K8GA 1NHVA 1IQZA 2NSCA 3EYZA 3QLHA 1KD1T 2QLWA 1KOOA 3BS9A 1PJ5A 5DQHA 1K47A 2W2NP 4USHA 4IOBA 1WHWA 4IQXA 3A8EA 5CYQA 3ZNUA 1KN6A 1UWBB 3AXKA 4FYVB 4IG0A 1S99A 2AJFE 3RR7A 4DLEA 5E33A 2OTJS 4WJBA 3MPWA 2AGPA 4A8OA 1DTTB 2C1EB 2R7OA 2BANB 2VQEJ 3T1YF 2CQIA 3K5OA 4C4WA 1PYOB 5ETVA 1F3FA 2R9LA 2GIRA 2XY5A 4OYIA 3TUJC 2QYCA 2ABYA 4JB8B 3CDWA 2JLGA 3LWMA 1QE1B 3T5HA 1AROP 5A6WA 1N5YB 3JAMY 3HHKA 4AE5A 2RJZA 1OS5A 2EG2A 2YH0A 4B9VA 4LRCA 4AUKA 4DDFA 5SZTA 2HS0A 2DRDA 4NLGA 4JI2F 2AIRB 2AJQA 1NBEB 1HQ2A 3ZZOA 3DYAB 2XMUA 1ZPVA 2LVWA 1RGVA 2MB0B 2XLJA 5BJRA 2ZOFA 2B5JB 1M5SA 4C97A 2B3TB 4ZCLA 2ZH8A 1I51B 1R8CA 4U8VA 3MEGA 1GQEA 1X31C 1MLAA 5KFIA 1B70B 3DI6A 1OQ3A 1S6QA 1C2PA 3PV8A 4QYZJ 1HBUA 4RU2A 4JOUA 1YBTA 3KUEA 4B3OA 1ZAVA 1G4CA 4KC5A 4H4MA 2Q6CA 3M05A 4DL4A 4U8YA 3T19A 2FHKA 3MD3A 3GFYA 4NRTA 1TL3B 1FXRA 1UW4A 3C8YA 4MMOA 3F0NA 2HW3A 3CDEA 1TUWA 4CH0S 4MIWA 3SZ2A 2C2EA 4J9UE 2MKCA 2DH8A 3RB4A 2DXDA 1Q8LA 2QIFA 5C25B 4ELUA 4BCAA 4DCPB 4QIFA 4OX7A 2CG8A 2W01A 2V9WA 3O6QA 2BEFA 2BE2B 2BACA 5KFUA 3DLGB 3ZZUA 2W8KA 2YQ0A 2HVEA 5A2QY 1WF1A 3MCSA 2YQ3A 1PAUB 3MM8B 1FI4A 1IN0A 3FEZA 4DG1A 1DHMA 4BC9A 2W4PA 1TMJA 2KVQE 5HQLA 3EWGA 4DSEA 3DLKB 1I94F 1F1BB 3FK4A 3HHEA 4BWMA 3OW2R 4USMA 3CGIA 3E51A 4QZVB 2E7WA 3QNWB 1NKBA 4RW9B 1H74A 3OXLA 3B78A 3WDOA 2LDYA 4M5JA 4JV2A 4J9QA 1NB7A 4NPOA 3BN7A 2DGQA 3NEKA 1S6OA 2AZ1A 2GVZB 1F0XA 1KONA 4UQTA 2JVRA 4DX8H 3EDQB 2R7WA 3UDEA 1BWEA 2FJDB 2XSJB 3D7SB 3CJKA 2E5HA 3PW0A 3CF5Q 2Q79A 4LF5J 2OPRB 4V19J 1OPZA 2HVZA 4O23A 4FS1A 1YRXA 3RAMA 1Q5YA 4I2PB 3L7UA 3CCES 2IMOA 4EYIB 2VOOA 3M2RA 2C2OB 1U24A 4DU7A 2XZWA 4Y65A 4P2MA 3M2UA 1QJHA 1U8SA 4WIQA 2O3DA 4ZVSB 3PEHA 3D4JA 4JV1A 1T9XA 4YOEA 4KYZA 2L3MA 5DDPC 2YQ1A 3GR0A 3ZFVA 4B9SA 2JX2A 1JLAB 4P2SA 1YZ7A 1M1HA 2E7XA 1BMQB 4O4GB 5D8HB 3UI3A 4DV4J 2E9RX 4M5IA 2LU2A 2MTLA 4ETZA 1CJVA 4CO1A 1X5PA 2LA6A 4LQ9A 5DM6Q 2AD9A 4U67Q 4KE5A 1WELA 4K4UA 3J80U 3M8YA 3JQKA 3BGRB 2NSBA 1XC9A 3NOGA 5KG5A 4QBUA 3PKMA 2BQUA 4K4ZA 1YX2A 2KFYA 2KB2A 1UETA 1VQ7S 1N32J 4DX6A 3MTJA 2OPPB 4OYOA 1OY8A 2AGOA 3TAMB 1JLQB 3O1LA 4UY85 3IGVA 4Q0BB 3CJTA 2VD3A 7FDRA 4DLGA 4O4RA 4WCEQ 3FC9A 4QPXA 1D1UA 2IC3B 2N7CA 2BJ3A 2BXJA 5AXNA 2Y1IA 4HT5A 2CRLA 2HBQB 1TP7A 3OJUA 3MMAA 3MOJB 2QE5A 2HIYA 2K1RA 4ED1A 1REVB 3DMJB 4C98A 3PIPQ 2MHEA 3HSGA 2JH3A 1MW7A 1U1RA 3SFGA 2MZRA 3GE9A 4L74A 3T1YJ 5ETSA 4G1QA 3AXMA 1CLFA 3MM7A 1NSAA 3NGSA 4OI4A 2UUTA 1D9AA 1MROA 4K4VA 5B0EA 2GJ2A 5E3PA 1XMQF 3MPDA 3AOBA 2OFGX 4DFMA 1RADB 1WKKA 4B3TF 2F8HA 4MFBB 2BE9B 3UD4P 3RB0A 1QSYA 2FLNA 2EW9A 1Z1ZA 5AE3A 4J9KA 1FNOA 3JSYA 3DDIA 1IM6A 3IXQA 3UN3A 1LW2B 4I68A 1U2RA 3SSRA 1U25A 2LDIA 3GSIA 4K50A 4ETXA 4NOHA 2FJAB 5I3PA 1ZPWX 4I7FA 1ZZFA 1IJEB 4F3OA 4LBHA 2DR6A 4PQUA 4LUBA 5HBMB 3BGFA 4IH5A 3UNGC 2UV8A 2Z30B 3OFGA 3GV7B 5J2PB 1WDTA 1YKWA 3N6NA 2XNRA 4GRSA 1S1XA 1NH7A 3EZ5A 1XR6A 4WIIA 3N4WA 4L73A 4KHPJ 2OAUA 1GTHA 3NNAA 4UF4A 4B9UA 3BEGB 2QTWA 4CO5A 2B9XA 3DRXA 2M4MA 2Q1LA 4JI1J 4LSLB 4HH0A 1NEEA 3DHWC 3ZZZA 2A0FB 2Z2YB 3C6TB 2CQHA 3DRRB 1RHQB 1OY9A 3QGIA 2G0IA 4WYLA 3X3UA 5IM0B 1SVDA 2H54B 2MXYA 2HYIB 4C0BA 2NPFA 1PYTA 2DNRA 5J2QB 2WW4A 1GXTA 2IPOB 2VJVA 3WZ0A 4EZ9A 5IT0A 1NDLA 3GTYX 5KFYA 1SL2A 1FNXH 2QSWA 1LOUA 2RRAA 5AE1A 1P1TA 1RT7A 1W2IA 1IKWB 1FKPB 1M5HA 3RRKA 2LU1A 2RU9A 5KT7A 1R8PA 1WTBA 5HROB 4N8NA 3HJFA 1FRXA 5HJXA 3S7RA 4P72A 2M8DB 1RKIA 1XERA 2MZTA 1DLOB 2YNGA 5EWFA 3OVBA 1OO0B 4YB7A 4OZJA 1UEKA 2VB6A 2WAQD 4FF3A 2F9DA 4FVCA 3R1LA 2R8JA 4NLQA 4NLSA 2JEGA 2DNMA 1UEUA 5ETMA 4XTTA 3IRWP 3UVJB 1FRJA 2PEBA 4J9RA 4QU6A 1FJGJ 4R25A 3B4MA 2GHVC 1TV6A 1VBXA 2R7VA 3GV5B 1HHQA 2DITA 3DXSX 2G4BA 3PR5B 2XY7A 1RUSA 1JLGA 1OY6A 5IZHA 3QSIA 1MN9A 5D4LA 1B99A 2AX1A 1GXLA 1S0NA 1WHYA 3UO0A 2PD1A 4QR0A 1HR0J 2HK3A 3UFCX 4N76A 3KUHA 2BM1A 5IC6B 5DG9A 1XK8A 4KFBA 4AQYF 2MKYA 2CPEA 3KNAA 2DR5A 2ZBQA 1N0UA 2Y9HA 2ZD1B 1CULB 4Q2MA 3KDOA 2RSQA 1WG1A 5F0WA 3TUIC 3BGUA 4ED7A 2G9OA 1HBMB 1IR1A 2ZH9A 4DV1J 4LF8J 2R7UA 5E3RA 4CLFA 1REGX 4DV2J 5RUBA 4N7TA 3ZZYA 3EX7B 3M30B 5T7LB 3GLJA 4J9LA 1CQNA 3MUTP 4ZP7A 2PI4A 1RTDB 2H9ZA 4WP9A 1RBOB 4HHJA 5A8WB 3HFZB 4N56A 1VQ6S 2LXIA 3BSAA 4I1TA 5KT3A 2DVIA 4Y00A 1IBMJ 1N34F 2HHHF 3QAEA 4ELVA 4CP5A 1MWQA 4K2JA 2V63A 5BYSA 4GVLA 2UV8G 4FF2A 2Y0SD 4RUHA 1RWVB 4DR2J 1AT1B 5CQGA 3O8WA 2GS8A 1WEYA 2YKAA 3NAIA 4N47A 4LR9A 1IKVA 1VQPS 4OMFG 1JLBA 4C11A 1LK7A 4DX7A 2HVHA 1RJJA 1C0UA 4B9TA 2E9TA 5DDRC 1H72C 4IRKA 4UZBA 2XBPA 3CCMS 1NKEA 1KOHA 3T5JA 3V6JA 4ZITA 3DLHA 2IVFB 1T9UA 4XO0A 4EO6A 4QR1A 2CPDA 2XYPB 1S10A 2LQ5A 4J9OA 4PUOB 2QGFB 1RABB 2F4VF 3FZ2A 1RTHB 3LP1B 3SQGB 1U49A 3J7AN 3ITHB 3SEOA 2CDQA 5KT4A 1KLMA 3V5RA 1VC6A 4XPEA 1N56A 1TVRB 3TANA 1AYEA 1J5EF 1WG4A 4GMKA 2FIUA 3KNGA 3HF5A 4L3NA 1JX4A 4F04B 5IQQA 2X1AA 4F0HA 1F5AA 3NMRA 3PVXA 5KG0A 3TX0A 2XO7A 2OMOA 4A8KA 2CZVC 3CW2C 1VK8A 1I6JA 1K0TA 2A1BA 1XWLA 1JKHA 2VFRA 3KOAA 1U0HB 4C7QA 2YKPA 2KN4A 2D9OA 4IUFA 1ZM9A 2VQFJ 4CM2A 4DR6J 4M5GA 4TU9A 1YWXA 3MPUB 2E1RA 1VK3A 1M0SA 2WVFA 1U6FA 3MGJA 3LWLA 2BQRA 1C1BA 2DR9A 1BWVA 1GAOA 2VICA 1LV5A 3DOLA 1AZSB 2MHNA 3C16A 2NR0A 1SKUB 3BSOA 2BABA 1QVFR 1RA7A 2HNZA 4K0KJ 4Y2KA 3HKZD 1F9FA 5HLFB 3VAKA 3F41A 3PYGA 3J80Y 5KFQA 4A8FA 2UUCJ 1JNRB 2W2MP 4P74A 2C3PA 2DNOA 4TU7A 3WIVA 1TKZB 3M6UA 3E01B 1C0TB 1XQIA 3VGTA 3WHIA 3CCSS 4H4KC 3R6GB 2CADA 4YHHJ 4RL1A 3OVSA 3SFUA 2KG0A 2BJDA 1GX5A 2HRTA 4MT1A 3QAUA 5E3QA 5LXRA 1S79A 2K7JA 2UXBF 5L46A 2VC1A 1FX2A 1RWKB 1S72S 2DEJA 3MECA 1S6UA 3KLVA 3DC2A 3RRHA 1S7HA 2E1PA 4UY8T 2Y1JA 4KO0A 2KJWA 2VZ9A 4TLRA 1Q5VA 2JDJA 1R3NA 1R0AB 3UQSA 3MAAB 4ZK7M 3KLHB 2ALYB 2D74B 1NK7A 2VFTA 4W92B 2R2SA 1QAXA 3C15A 3KK2A 2AV5A 1SJRA 5F0UA 5E3CA 2P2CB 4CRJA 5E41A 2VFUA 3I5BA 3IWNC 4RBUA 2MKIA 3HT0A 3UDLA 1Z2LA 3M8PB 5L9NA 1F6TA 4JI0F 4I64A 2Z56B 4PCQA 1T02A 2DGVA 2XI3A 2CQ4A 4Y2AA 2YNFB 1I1GA 2FLPA 3M32A 3G2XA 3RBXA 4EWTA 1KVJA 3BJYA 4LSNB 4ILRA 4XK8C 2GIQA 1J27A 1SKWA 1N4LA 2KRRA 1RHMB 2B8PA 2ZM6F 2X1BA 2DNKA 2FVQA 2O66A 1TQLA 3LQVA 4MYUA 4YFUA 1R43A 3LANA 1RYSA 4DQPA 1O6XA 3D6HB 5KG6A 2ZVIA 2HS4A 1VFJA 1FVSA 3GR1A 5KFEA 3NWRA 1HNZF 5LXYA 5I42A 2C3OA 3BKFA 4NXMF 5IQ6A 2XGQA 2VBZA 1NJZA 2W9CB 3NLCA 4FKYA 1BQMB 3RZAA 1N6QB 2RQ4A 1NK8A 4RW8A 3ZZ0A 4ZIVA 3AJ2A 4TN2A 3D54A 5F8LA 3LP2A 3G8SA 1EETB 1S59A 2EFQA 2V5HG 3VAIA 1WHXA 1WUUA 4PYAA 2W9BA 1GNKA 1TU0B 2AHOB 2MQPA 1N5TA 3AD9C 2QG9B 1N52B 2HHSA 3DOKB 3RTVA 4CLPA 4KHRA 3HKWA 3HXMA 1NK9A 3FUYA 5GADU 3JSBA 3AY0A 4MIBA 2LXFA 2DGSA 1VGYA 1ZTTA 2DYAA 4LR7A 1URRA 2FYXA 1Q4RA 5DZ7A 3L4BC 2AQ4A 4X65F 4F7VA 1W26A 3TZYA 1BHNA 1FHTA 1IR2A 1YLXA 3FRYA 1JWWA 3FSIA 4C8MA 2LQ8A 1SV5A 4GC6A 2HAFA 4NZ7A 2JHEA 4UT4A 4ZKAA 5D6GA 4FF1A 4C8YA 1YBUA 3WX8A 1Y7PA 4M5DB 2D41A 2MKHA 1RT5B 4ID8A 2HBRB 3TQEA 5HN0A 2HG4A 4DSFA 4F25A 1HNWF 2ASYA 1YIJS 3DRYA 3MTKA 4P2FA 2DIUA 2MQ8A 3QQCD 4PXCA 3PW2A 2BX6A 2MGZB 3ILOA 4F4XA 1RT3A 3P49B 1TKXA 2RILA 4M94A 4OFZA 1S48A 4D3HA 5J2NA 4QPTA 4JI5F 1X4GA 2XI2A 3ZZTA 3SDEA 3H4BA 5C24A 4E8UA 2CWKA 4YN3B 4WE1B 4ZPVR 3UN5A 2UVRA 2HMIB 2E5GA 2IAJA 2V8HA 3ZXWA 2O5DA 3MMCA 1UCNA 1ZH5A 2GJFA 4YY3F 4ID5B 3MR5A 2E5LF 3NAHA 2IVMA 1SH0A 4DPOA 2XG8A 5K8MA 2N3LA 4ZLLA 3VQSA 1SC6A 3W8GA 2E5IA 1CJKB 3M8WA 2J9DA 1FVQA 4RW4B 2VBYA 4MYTA 1KQKA 4X4QA 2MDAA 3LAMA 1M90T 2ROPA 2RT3A 3TX8A 5F8GA 3N5BA 4ZCMA 1R0BG 3SBMA 5DZ6A 2CJKA 4WBFA 1TK0A 1RT2B 2I2YA 3ISZA 1LW0A 3MFHA 2WB4A 3I0RA 3HJVA 3VR1A 4Q45A 3Q22A 3B82A 3G86A 3BH7B 3HVTA 1J2VA 1S1WA 4USVA 4Y28C 2V2QA 2HHWA 2YH1A 2MJNA 4V1Ak 2FC9A 3LGNA 1HI1A 1V9OA 1WI6A 3C14B 2CZ9A 3RBEA 2HBZB 3GIKA 4JBCA 1RT4A 1NJWA 2PSZA 2I1RA 3OFFA 1FK9A 4JI3J 3BQ2A 3OTBA 3BBFA 2UUAF 1VBYA 1RDRA 3MPYA 1X4AA 2X1GA 2HQIA 4BWJA 2IM1A 3MEGB 2U2FA 2JC1A 1RAEB 1UJ5A 2YY3A 3OV7A 3DI6B 4NMXA 4IDKA 4OHWA 3MEKA 2F40A 4A48A 2K06A 1YRUA 3ONQA 1U09A 3L95X 4IFVA 1MU2A 2J9EA 2ZEJA 2MYFA 1VRTA 4H4MB 1IBCB 4WYWA 4KAIA 1SQFA 1R6YA 3HO1A 1WHVA 3RRGA 1JJHA 2WBMA 3CULA 4ZCIA 1NAQA 3K5PA 1G2EA 1L5UA 5J1EA 2GO8A 3SYZA 2IM3A 2KYZA 4OLOA 3BO4A 3G4SS 1U48A 3V6DA 2AZ3A 1RT1B 1N33J 2GVDA 5AJ3J 1U0SA 3CC4S 3EUNA 1S9EB 5KFAA 3IS9A 1VHIA 1S0OA 3N79A 4OLPA 1SJ1A 1BE4A 1J5OB 3DM2B 2YVSA 2CZ4A 2W8LA 4DUYF 1BY9A 3OL9A 2CPHA 1UPMB 3TA0A 1UA1A 2CPYA 3AA9A 4DMZA 2XMJA 3NY0A 2VUGA 3W63A 3OTCA 1RAFB 1V5VA 2RE1A 2OPSB 4Q2LA 3EICA 4UUXA 5HP1B 1Y5LB 2W1BA 1S1VA 4DL2A 3FBBA 4I6WA 1VCTA 4ZLJA 2DR7A 4O44A 2MKJA 1ZOTA 3MWBA 3O5TB 3IWLA 3US5A 4K4TA 3Q8RB 2J0SD 4ICLA 1ZM2A 4LFAJ 4ECYA 5EWEA 4EMDA 3HHLA 1Z4UA 3TI0A 1BC6A 1O8BA 3CJKB 1UVLA 2VG6B 4Y2MA 4NZ6A 3M1VB 5DM7Q 1RWOB 1ZTWA 2W7PA 3GFHA 2RF2A 3QSYB 2VPWB 2QFJA 2L9WA 4YDXA 1DTQA 4RR5A 4ZVHA 3GIIA 2D3OR 4OZ3A 3D1HA 3T41A 5H1SV 1ZETA 4HLBA 4LF4J 4H4OA 3D68A 1UFKA 3BQ1A 3CTRA 3K7RA 5D4NA 4K8RA 3QIPB 1B4SA 1RAAB 3M2UB 4CI0B 2IA6A 3RYLA 3R5BA 5G4DA 5JUMA 1KVIA 2R8GA 2WZ1A 1X5OA 5GMDA 2LQ9A 2BR0A 5KFXA 5EX3A 1UA0A 2QL9B 2HQCA 1N54B 3VAJA 1IBLJ 2VASA 3VQTA 4LF9J 1RAHB 1HQEB 3KK1A 3ZZPA 4HDHA 2R2RA 2JFKA 5GAGI 1LWCB 2E5JA 2HGLA 1CJTA 2XMWA 4DV3F 2EK6A 2XC9A 2LMIA 3H0PA 2HRUA 4DR7F 4ED6A 5F3ZA 1E6YB 3KK3A 1NXIA 1R27B 3VGSA 1TL1A 3H25A 3FJ2A 5HQMA 4PXEA 1YJRA 2W2OP 1VR6A 4ZVOB 2K7KA 2PFDA 4A47A 1K9MT 4PWDA 3HLUA 3DHXA 1W25A 3AB4B 2JNJA 3QYYA 3AT1B 1O5JA 4JI4F 3DLLQ 1T95A 3CJ8A 2PFFB 4DI6A 4I2QA 1N5SA 4PEOA 3BGOP 1MWZA 4ZOSA 2UXDJ 4J37A 4DQSA 3MMAB 1R8BA 2IJFA 3POTA 1BQNB 3PO5A 4JI8J 1OWXA 4NA2A 4N41A 1R8AA 3CPWR 4P10A 1YK9A 4LFBF 3CJSA 4URQU 1V6HA 2OUGA 5D15A 1KHVA 1U26A 2G1HA 4Y0FA 4K4XA 4JV0A 2NYHA 1MROB 2DISA 1NPRA 1RWNB 2XZTB 2JOQA 3PDNA 3U1NA 4OQJA 4EBEA 3GPAA 1PO6A 1KTVA 4DZDA 2IYIA 4ES3A 3H98A 3LALA 1Y11A 4ECZA 3KXDA 1UJ4A 3EGWB 3HVAA 1SKRA 4PG5A 5HK4A 3QO9A 4DV7F 5M2PA 1IWAA 4BDPA 3NL0A 3JYTA 2XS7A 4F0MA 4B3SJ 2X7IA 3AOCA 3EVMA 2E9ZA 4K5SA 2LEPA 2MLYA 1X5TA 1UW9A 2UUWA 3CCZA 3GV8B 3JSMB 2QT7A 2DHSA 1U8WA 1QAJA 2W25A 3ETMA 4HACA 3ZTSA 5IT9U 3AFGA 4OX9F 1FEEA 2GC8A 2FGCA 4P73A 1F9HA 1FT8A 4M95A 5HATA 2V4JB 3BF4A 3J7YU 5B0DA 1C4CA 4MKAA 2L9NA 1YSJA 2XYHB 2AYGA 4AXIA 4Y34A 2V2VA 4LR8A 3FVYA 4WU2A 1W2BR 3U1LA 4QU7A 5LMUF 2ASLA 9RUBA 4FXDA 1LKZA 4ED0A 5D3GA 2YX4A 3CIMA 3AJ1A 2BJ8A 3HSDA 5CA5A 3W5ZA 4N77A 4TQRA 2HFVA 1EQ0A 4ANCA 1N36F 4FF4A 5C42B 2I38A 5HVGA 4PXBA 1DZ5A 2P9EA 3RR8A 2J7WA 3NKYA 4BC7A 3PFOA 2UU9F 1B3TA 1L3TA 3N9UC 2HHPA 3D28A 2WONA 1PSDA 2ILZA 5CABA 2IM2A 3PFEA 4NZ0A 2LEBA 3Q8UA 4M8LA 3ELHA 4DL6A 2N4DA 5E3AA 1G3OA 2YWGA 3PXGa 5IS2A 1HBOA 2OSQA 2EWHA 3ULHA 4OI2A 2LLZA 3C6UB 4RW6B 5IV4A 3CJ0A 4IRCA 1EHWA 1TMMA 1X4CA 3LAKA 2X51A 2Y1RI 2PC6A 4DUTA 3OSPA 3M8QB 1VRUA 4DV5J 3VGVA 1VISA 1QLNA 2VF3A 1U2FA 2ALZA 6FDRA 2DBBA 2EBEA 2DD8S 2HKEA 4C0OC 2ZJPQ 4NEZA 1RTIB 2ZZNA 4C9DA 3HD1A 2DGXA 5D4OA 2KO1A 2OIHA 2AYMA 3TEHB 5LMNJ 4RUAA 3CO0P 1LWXA 4OYBA 4NA1A 5LL6d 1QM9A 2JLEA 2F65A 3IGNA 1S1UB 1VLOA 2M88A 2J9CA 5IFMA 3LW5C 3GILA 1XNRJ 1OSCA 2AEFA 3I6PA 1Y9OA 1RQ0A 4ECQA 3JTOA 2BOAA 1Y4ZB 2RH3A 4KV8B 5ETNA 5DJBA 4NCGA 1NK6A 1XN9A 3BV8A 4LJMA 2HLTA 2HNYA 4LVOP 4URSA 2H1YA 3UW1A 4M5NA 2R7RA 3DOMA 3TJAA 1SXLA 1BLUA 3QPIA 4R8UB 2HFSA 1RI7A 3QBCA 3NOCA 1T11A 2ZJQQ 4WFXA 1KDNA 2POKA 5GAHU 1U1NA 2EFNA 1PBAA 1WORA 5J1PA 3OUYA 4CLYA 4AYBD 3E8OA 5A2QU 3G8TA 2HVDA 4ZHRB 1D09B 2VQEF 3K17A 4CYUA 4F02A 1YITS 1H2UX 4YDDB 3FEXB 3G87A 4NI2A 2I6WA 1HBNA 2ZUGA 3HK2A 1Q53A 4FXWA 4OI3A 3HHDA 4Z7YA 2EEYA 4C11B 2NYIA 3RUBL 4DR3J 1CJUB 1WJ9A 3PYFA 2ZE2B 2V4RA 2Y8WA 1CS4A 2ZDPA 1WKLA 4CO3A 2RS8A 4DZ6A 2KT2A 4PKDB 1NH8A 3HVRA 1XNQJ 3K58A 2OD4A 1HWJA 3RW7A 1KLMB 4X4SA 1Q8BA 4OJ3A 4LF6J 1LFPA 3QWPA 1T3NA 1NK4A 4YR3A 1UWBA 1SJ3P 3JSRA 2KDOA 1DTTA 2BANA 9ATCB 5KT2A 1YBAA 4DFKA 1JKHB 3NNCA 1HNVA 3NCQA 4PQAA 4X64F 4P75A 5E7OB 2ZBRA 4PR6A 1RE1B 2GFFA 4OJ1A 3NGKA 4DPWA 1Y5NB 1WDDA 1QE1A 2OELA 3Q0AA 2WVEA 2OP5A 2VFSA 1QTNB 1UMJA 2V2ZA 2BKOA 1VQ4S 1YZ6A 1H98A 3C46A 2OEKA 3IWXA 1SL0A 4Q44A 3JTNA 3JB9k 2XB2D 1L3KA 4DQIA 1SQGA 3C16B 5EDWA 3DYAA 5BYRA 4UOGA 3EVOA 3CIZA 2KT3A 3DNCA 1KLNA 5L1KA 1NCLA 2VH7A 3NGRA 1EB0A 4WFAQ 2B5JA 2VBXA 3IAS9 1IUJA 1DFDA 2R7TA 2XNQA 2HGMA 1UWAA 4LREA 3V4IB 2G2YA 1S97A 3IBWA 4R0EA 1CVJA 2DNNA 3WQPA 1RHUB 4ZP6A 2QA1A 1TL3A 1P1LA 3I96A 4RNHA 3PCOB 2QFIA 2B9YA 4GKKJ 4GO5X 3I55S 3GG1A 3UCZP 2BUNA 2M2BA 1F2GA 2BJ9A 5KT6A 2PE8A 2XZDB 2HQ3A 1SI9A 3HHLD 5I4MA 4HTIA 2DGOA 4BLGA 7AT1B 3OBIA 4LF5F 2RD5C 1JJ2R 2BJ7A 2BE2A 3M4XA 4ZLNA 4WFNQ 3Q89A 2EXUA 3KMQA 1QD1A 1QY7A 4JI6J 3MM8A 3SV4A 1Q82T 3CJ5A 3MEDB 3OR2A 1RHKB 4RNNA 3LTOA 1M5VC 2KL8A 3BO3A 2H51B 1VLYA 1D3WA 3KK2B 3VAFA 2HFUA 3DLKA 2VPZB 3FCWA 4CO4A 3SV3A 4C0HA 2V68A 2DO4A 3H20A 4IRDA 2QZ8A 3I4PA 4WP3A 4QIEA 2QSFA 2ZKUA 4RWXA 1MMLA 5GADI 4LVNP 5GMKa 2EFPA 3TP2A 2VC0A 1TELA 4ZVPB 3BYRA 1NRKA 3QZ8A 1HNXJ 3THPA 4ED3A 2GVZA 5KT5A 3P6YC 5E0OA 4DV4F 4F3MA 1WD6A 1R31A 3KUGA 4AL7A 4C8NA 2J9DE 5THWA 4YEAA 1TAQA 3N28A 3PG9A 3TVZA 2OPRA 2B56A 5IT9Y 1DQ8A 4W98A 1BXNA 2C2DA 1Q7YT 2DEIA 4J9NA 3ADAC 5BXIA 1RT6A 1KKHA 3VGUA 1EZZB 3DFEA 1KSPA 4I2PA 2IDLA 2HVIA 1WOPA 4DX5A 4TU8A 1S5ZA 1N32F 3DDNA 1WF0A 3EDRB 3MUVP 5G0RA 3PY8A 4LRDA 3PNIA 3R9LA 2XS5A 1IJFB 3B6BA 4U7UK 4O3QA 3CT9A 4QWDA 2HWIA 1M1KT 5A8RB 3CD6S 3WC2A 4QWAA 3OT9A 2R8KA 4K4YA 3RB6A 1F60B 3KHHA 3R1HA 5KOWA 1L3VA 1S49A 2B9WA 4X62J 1DURA 1JLAA 2QMXA 5D0RA 4O4GA 1FKOB 4OYXA 3FBEA 3DGVA 5CH7B 3AH6A 2RUGA 4NMLA 4L75A 5K8NA 3OFEA 4WFBQ 4TYAA 3IN5A 3T1HJ 1FF2A 3HDSA 4DHVA 2WVDA 1NKCA 4X4UA 3W5YA 3D0IE 5KFJA 3HD2A 3HULA 2VONA 4P52A 5BR8J 2AMCB 3BGRA 2R8IA 2WOMA 3M9MB 3ENVA 2PO4A 1SV5B 1AFJA 4L76A 4PZVA 3SSSA 2NUHA 2R3VA 2VKRA 3TARA 2UVVA 1DBDA 3FFIB 3RBDA 1H2TZ 2E66A 2OPPA 4KKOB 5B0BA 3TAMA 1PKUA 3CWJA 2XQCA 1JLQA 4QWBA 2AYBA 3H5XA 4Q0BA 2YWKA 4P6QA 2YPYA 3SXLA 4B3MJ 1HI8A 2YNHB 3MZIA 4M63A 2L41A 2RDDA 5EN1A 4PG8A 1SB6A 2MSSA 2IC3A 3BREA 3FRZA 1DRZA 4K7QA 1RT3B 2J6TA 4OX6A 4WWSA 2CPFA 1X4HA 1GEHA 5F9LA 5K14A 1X7VA 1REVA 2UP1A 3DMJA 4PWUA 1RCXB 2ADBA 4NLOA 3A3NB 3PACA 1HW9A 1LWEB 3O3LA 3MMCB 4YQWA 1IQTA 4X64J 5D77A 4O0NA 4FYWB 4KHPF 5AXLA 3HT3A 1U1LA 4DR4J 4OZNA 4A8SA 4Q8EA 1WOOA 4F4KA 4JI1F 4NLVA 3AOAA 2LEAA 2ZBCA 1P6TA 3BYPA 4B9NA 3KJFB 2AGQA 4NYOA 4CO0A 4WFYA 1SH2A 1YGYA 3EZUA 3L3CA 3ENQA 2E1AA 4PAAA 1NSKL 2OPQB 2QC3A 1DARA 3W2WB 1EP4A 3LPYA 4YUDA 1LW2A 2V8PA 3UNYA 4OV1A 3HVTB 3PJXA 1HYSB 1S1WB 1WEZA 5HBMA 1U2CA 3DLJA 2VJUA 1B0PA 1WC0A 5KOXA 3TZXA 3DRSB 1U02A 5J2PA 4TY9A 2A3JA 4RZRA 1RT4B 3D1QA 4FBTA 3KHRA 1UVJA 1BD6A 2HNDB 1VQKS 2XSFA 4K4SA 2A10A 3KJQB 4DUZJ 3MR7A 3A12A 5EUHA 2IFXA 2KH9A 3QIDA 1T3OA 3KJVB 1YJWS 1NLKL 1M1GA 2WSFC 4WXWA 2CQBA 1PCAA 4LSLA 4IQMA 3TWZA 4IFVB 4DL0C 1KP6A 3GIMA 3LGHA 3MEEB 2CPJA 4J9MA 3C6TA 4P2XA 2MKSA 2RVJA 2BM0A 2GV1A 4NWBA 2XMTA 2MMYA 2VOPA 2KU7A 1FJGF 1N5VA 5IM0A 3P45B 3TO8A 4G1IA 3KLEB 4QWEA 4ZJLA 1LNQA 3R5GA 3VTIA 3JTPA 3CCQS 2DGUA 3V6DB 2CPIA 1IM4A 4ED8A 2GVDB 2D3O1 4EBCA 1FJCA 2V8VA 3HSZA 4KGMA 1HR0F 4BBYA 1TAUA 2CJ9A 1G6BA 2Z57B 3MAHA 2D9PA 1FKPA 3IS9B 1FESA 3QRPA 2V8GA 2CAJA 4A8WA 4Y3CA 1T7PA 4FNIA 2FY1A 5HROA 1V5IB 4DV1F 4LF8F 2GHPA 1Q8KA 3OSNA 4DSKA 4DV2F 1DLOA 3V81A 1S9GB 2Y0BB 1R89A 2W2QP 1LWFB 4O0IA 5CYJA 1XBWA 4B9MA 1P9QC 4ILLA 1EKRA 4FBUA 3OPKA 4NXNJ 3NS6A 4YB6A 4QIVA 1SIWB 5F8HA 2CPZA 3OR1B 1S1VB 1IBMF 1APSA 1SJQA 3VVUA 3UVJA 4A8YA 1X5SA 2AEMA 2IM0A 1VRQC 3FBCA 4IR1A 3AAWB 2ZWOA 4CLSA 3KLFB 1NZAA 1L3SA 2B4UA 3DLEB 1T05B 4DPXA 3GYGA 5KFOA 4B9LA 4X2BA 3OFHA 2UXCJ 4DR2F 4DV0J 1SL1A 1NMEB 2PN6A 4A8XA 3MDFA 3D2WA 5A0YA 3JXOA 3KWMA 2YKQA 2MSTA 3CD5A 4A4JA 5AE2A 2G2ZA 5JVGQ 4CZCA 2ZD1A 1CULA 4ZN3A 3OJSA 5LJ3Y 1FD8A 1DTQB 1HKAA 1RXOB 4PPZA 4LQ3A 3DGPB 3GONA 2HHVA 4GVBB 3ISND 2M9KA 1NDKA 2IA0A 2XM3A 3M30A 5T7LA 3TAQA 2YNIA 1RTDA 1QUPA 4GKJJ 5A8WA 1TKTA 3BKTA 4EI2A 1NNDA 4WZQA 4F3QA 1OSDA 3IP0A 2RS2A 2WVCA 1GH8A 3AJDA 2WHOA 4IH6A 2E1MC 2H48B 4DBQA 3KK1B 2X3DA 1OQ6A 1TUVA 1FNMA 1EAYC 2B7CB 1GFWB 1CJTB 1XMOJ 4WKRA 3J7ZT 2PMWA 2HBYB 3QFHA 1OPIA 2VQFF 4DR6F 4F2RA 2ZWPA 4ES1A 2QV6A 2YKNB 5B09A 4R5PA 1F5BA 1CQMA 2OO4A 4USTA 2PI5A 2C2KB 1Y0HA 2H3EB 2ZH4A 2HQDA 2AEJA 3Q2SC 3DRPB 4C48A 4PUOA 3D3BJ 1RTHA 3LP1A 3LP0B 3SQGA 2AJ0A 2JRSA 4UQGA 3W5XA 5F9NA 4A8MP 1H3DA 3W2VB 2AP6A 1TVRA 4K0KF 2LA4A 3Q8YA 1K1QA 2Y3YA 1FDNA 2QX0A 3D0HE 3KHGA 5IT4A 2UUCF 1URNA 4IR9A 4L6V3 2RU3A 2DXEA 2RDIA 3VAHA 2XMKA 3M2VB 1B7YB 4I6AA 1FDAA 2J76E 2LYVA 4TXSA 2DY1A 1T03A 5I3QA 2DPIA 5JXSA 4M5HA 4ZPTR 3CCTA 2NXUA 4YHHF 4I67A 2KTQA 4PRFA 4DU8A 3OL8A 1TL7B 2MQNA 1FFWB 2MLXA 4Q7AA 5K9FA 5DDOC 5F8IA 4JV5J 2F9JA 3UCGA 2GO9A 3W62A 4U6PA 3H59A 3MMBB 3A8IA 4F8RA 5E5NA 1E6VB 4ZP8A 4CM0A 4DV6J 1AZSA 1AB8A 4AL5A 2P5VA 2M5YA 3RJMB 3PW7A 3MM6B 3QO9B 4ZVGA 1CSJA 3JYTB 5CAAA 3MOZA 3AB2B 4ER8A 2KT5A 3TZWA 3RW6A 4OZ5A 3HFVA 2I9SA 4TVAB 3NGUA 1AUSL 2F3JA 3BKUA 2IBOA 1RISA 2NXNA 4L3KA 1TKZA 4J90A 1JLEB 2CJBA 2V67A 1ZA1B 3E01A 1SUQA 1C0TA 4PXDA 2B7BB 1XR5A 4DS4A 2B4OA 2MZJA 5DGBA 4B02A 4XPCA 2J6SA 1JXVA 2EK1A 1U1QA 2U1AA 3IA0A 3PX4A 3ILJA 5EWGA 5F8NA 1PG5B 2QN6B 5A6PA 2ZZTA 3CD7A 1WC1A 1O51A 1RBAA 2FHMA 3MUMP 3I5CA 3NG8A 1NPPA 3SCLE 3T9NA 3FQLA 3NGDA 2ZH7A 4B3RF 2Q66A 3R27A 1VQNS 1WNEA 5HAOA 2DCLA 4ED5A 5L38A 4J5OA 3BPDA 4GO7X 1ZBTA 3TVKA 3PW5A 3ILIA 2B6AB 2W4CA 3IRXB 2DCUB 3MR2A 4LSZB 3ZTQA 3PM9A 3KLHA 4X66J 1JLCB 4X4OA 3IO1A 3V2UC 2AJ2A 1HHTP 3H2LA 3UDCA 4CQ1A 4CTAB 3CC2S 1JJCB 2HSEB 1ICEB 1JLFB 2FHJA 4NCAA 2DRAA 4I69A 3NCRA 2I8EA 4J9VA 4DR1J 3SCJE 3IAM9 1FCAA 2WTFA 3AD8C 2YNFA 3HCXA 4MK9A 3F44A 4QR2A 2R2TA 1LK5A 3GQCA 1U7LA 2I5JA 5ETLA 2HZCA 2KM8C 2XLIA 5KFVA 2X3GA 3RAQA 1K8AT 5LM7E 3IM8A 4ZCKA 4IFYB 1FFGB 4FP9A 5C5JA 1FDDA 4TLQA 4DEZA 2HHUA 2ZZMA 2L08A 3NNHA 4YP3A 3H5SA 3SQOP 2NCKL 2DHHA 2ZC4A 2OKQA 3K59A 2B43A 2NUUG 2JEFA 2GGPA 2IRUA 1JB0C 2Y1LB 4YB5A 4ZVUB 3GU0A 5KG7A 4U7UD 3OL7A 1GXUA 4DS5A 3QMQA 3CJRA 1BQMA 1N6QA 1R0CB 1UEVA 3MF5A 3HPOA 4G3IA 2J0QD 5D4PA 3QWUA 3OTEA 5KFLA 1WEXA 1IKXB 2J5AA 3CVKA 2CNNB 4OV6A 3S8SA 1YJ7A 1LEOA 3TOQA 2DH9A 2QLXA 1XR7A 1VS3A 2DY9A 2QEXS 5IWAJ 5HL7Q 5U47A 2QA2A 3DOKA 4PPDA 3TQ1A 2HZAA 2CWXA 3J7A1 1KR4A 4NLUA 4JYAJ 2UZAA 1HQUA 3IMQJ 3SIPB 3Q8QB 2EKYA 1FWPA 2NZCA 4ILMA 5AXKA 1P8GA 1RACB 4LIRA 3KLGB 2VDHA 1HMVA 3W1YC 1DJ0A 3OUYB 2B4PA 4BS2A 2QRRA 3KMSA 2YWWA 1CC8A 3NGTA 1SH3A 3MM9A 2BRKA 1AXQA 2WRMA 3D5MA 1VDHA 2RQCA 5CCLA 2RKIB 4DR5J 2DHGA 3W66A 4M5DA 3U02A 1X8DA 3U27A 4DSJA 5AT1B 5LOQA 2QLFB 1RT5A 1TR0A 2IRYA 1HW8A 2NXCA 4IG3A 3NBPB 3P3DA 1MN7A 4XDDA 5HVFA 5A8KB 1BQXA 3CJ2A 1UZDA 1FX4A 2B8QA 2IIHA 3UDVA 2HPUA 4P71A 3I4HX 1KNZA 1Y3KA 1KEKA 1TK5A 4JUZA 3I0SB 4X4PA 1NK0A 2MQLA 4ELTA 1H73A 4PABA 2KHDA 4WE1A 2GHWA 2APOA 4EEYA 2HMIA 3CMQA 5KFWA 4JI3F 1QVGR 4ID5A 4ATNA 1RCOB 1VMBA 3CXCR 4WXOA 5L1IA 2FY8A 4FPIA 3V6KA 1ZYQA 4NYPA 3D6MB 4ZPCA 2VV5A 1HNVB 1PGZA 2FJBB 2O01C 1UVNA 2KXNB 2RHQB 1NSQA 1CJKA 2AU0A 1NHKL 1LXJA 1U4BA 3ENAA 3H5UA 3K8VA 4OZ2A 2YBVA 4RW4A 3S01A 3H8YA 1S9FA 3GIJA 2XY6A 3MHYA 1QUVA 4ZPDA 1F5CA 4ECRA 5GAEU 5ETKA 1KRPA 1RT2A 1L3UA 1XJWB 2QO3A 4WPAA 1HNIA 3AODA 3OXGA 1RTJB 1HL6A 3HHLC 1N33F 1IBKJ 3BBCA 5AJ3F 5KFKA 4URGA 2DJWA 2XHWA 2YPZA 5HMYA 3LPEA 1R7IA 2A2CA 5IOLA 4FDFA 3C14A 1XTZA 1K1SA 3IBCB 1I5OB 4ZP9A 1QSLA 2CNOB 2M0GB 1VOMA 4DL3A 4WP8A 3GB0A 2CFXA 3TA1A 3MMJA 3ICLA 1RU1A 3UR0A 4WFZA 1S6PB 3QRQA 3SCKE 3PO4A 2VU5A 1RAIB 3K57A 3FQKA 3PJWA 4HYKA 3D67A 5DO2A 4WK3A 4LIWA 5FDLB 1HD1A 2OI2A 1PYSB 6AT1B 4OHYA 2HZVA 2IBKA 4FN5A 4KQZA 1Y10A 4B3RJ 2RDJA 2BW2A 2G1DA 2HFOA 4MKBA 1JXEA 1OIAA 4NLWA 2LP4A 3ET6A 4F4AA 4LT6A 4LFAF 1X0PA 3FBFA 3BH6B 2R7SA 2WSEC 3WBZA 4RBVA 1RT1A 2DRBA 2VG5B 3CSKA 2IJNA 2YKMA 2UUBJ 4YR2A 4DXLA 3T6BA 1DQAA 1S9EA 2CQPA 4KRWA 1GK8A 4Q8FA 4RO0A 1U6BA 4PG7A 4CIOA 3PW4A 3K2YA 1J5OA 3DM2A 3L7OA 3M7VA 3W7BA 3A3PB 3OR2B 4OJGA 2ZH5A 3CMES 4LF4F 1HARA 2XULA 2HURA 4LMZA 4DOZA 4LF1A 1HWLA 2ZHOA 3UD5A 5JMNA 2JWNA 1Q81T 4FZVA 3THVA 3D6FB 2OPSA 1SIZA 1YRTA 3BSCA 1MMDA 1U1KA 4S0MA 2IJRA 5HP1A 4OI0A 3G82A 3I56S 3THTA 4F36A 1RYRA 1IBLF 2AWZA 1QDUB 4OJHA 4LF9F 1S57A 4H54A 4TKTA 4J9SA 3EMTA 3CE8A 4J91A 4QW8A 4LF7J 3KKFA 1ZS6A 2EFOA 3CCJS 3RAXA 4XAKA 3U1MA 2VG6A 2ZH1A 4X4TA 2DKOB 1VQLS 3M1VA 4NCBA 4I6YA 1S1TB 4OYWA 3CMAS 4NLPA 1RT6B 4LFCJ 3N0VA 3NS7B 1KFSA 3OLBA 2HWTA 3W64A 1X9MA 3RGIA 4O3OA 2IYGA 4OI1A 1Q7LB 3CEDA 1Q16B 2FZGB 2VG7B 3VF0B 2KXHA 2BJEA 2FVSA 3ZZRA 1ZA2B 5G0RB 8ATCB 2BYCA 1RTZA 2Z58B 2QL5B 4B08A 2FLLA 3GWCA 4NLTA 2DHAA 2IDEA 3R5AA 3R8YA 4OL8A 2OEJA 3M8RA 2C2RA 2ZOGA 5I3UA 2FVRA 3QIPA 1NZ8A 2IHR1 2Z2MA 3FDSA 3QLHB 4NLYA 5K8PA 1IKYA 2VDIA 1MMNA 5CZXA 4P7TA 5CXTA 2UXDF 4WZMA 5CYQB 3N01A 4E0DA 5HMZA 4IG0B 4JI8F 1HIYA 4AD6A 1B7FA 1HQEA 2QL7B 4KJIA 4WTOB 2IVYA 4DN0A 2ZHAA 3T6JA 5KFNA 3TUZC 1LWCA 4CLZA 4KT0C 4UW2A 4LRBA 3PYDA 1YTYA 4FYDA 4KR0B 4G1PA 3I87A 2CQCA 3PRVA 1LFWA 1E6YA 1QAIA 4KPYA 2JC0A 2EC2A 2WOMB 3FZBA 4U7CA 5GVQA 3GYNA 4KTQA 3GMGA 4QQBA 4TYBA 1U1OA 2W2PP 4Q43A 2EC0A 4GC7A 1T8EA 4W4MA 5CYMA 1HWIA 3V6HA 2HHQA 1WG5A 2CJQA 3M9OB 4USUA 4QIWD 4ZS6A 3V4MA 1X4EA 3IBFB 1G7CB 1FRKA 2K3KA 2GZOA 1UVMA 1VQOS 4B3SF 4KGVB 1T94A 3TVYA 4NYZA 3W8PA 4KPCA 4CNYA 1C1CA 5K14B 2YX1A 1BQNA 3QT8A 2SXLA 1NU4A 1S6QB 1RHJB 3MCMA 1HBUB 3LUYA 3H42A 4ALZA 1FKAF 2GA7A 4B3OB 1XIQA 3DN9A 1NPKA 2XTJP 5M2UA 4IH7A 5ETQA 2DO0A 3UWTA 3QATA 5GAGU 3D9BA 2CQ1A 3TR5A 2L9DA 2RQKA 1EARA 2OEMA 2AJ4A 4RUBA 3G6ES 2DNZA 2CA9A 2DNYA 4N5SA 4NX9A 1NJYA 2M3DA 4FNHA 1WC3A 4CT9A 2Z8QA 2RHSB 3HM9A 4JI2J 2GQ2A 2ZJRQ 1EP4B 2F4FA 1FFSB 1RK8A 4F4ZA 3C2PA 2M8HA 4EFAC 2P6TA 3J81j 3O2IA 3OTOF 3RG6A 4R0JA 3CCRS 3OHBA 5KG2A 3GG0A 3SI8A 2ROEA 1IWGA 1S4EA 5C7PA 3NRBA 1Y00A 4DG1B 1YDLA 1KQFB 3JSMA 1RWWB 2DPJA 5HVHA 1D9FA 3I82A 1QTMA 4ECSA 4J9PA 2FHJD 4CLTA 2EI5A 1RAGB 5D0EA 1Q8IA 2V4JA 4HVZA 5MLCV 5IXUA 3OHAA 4DV5F 5CZVA 5LJ5Y 2PA3A 2G0JA 4Z37A 3R2CJ 2DNHA 3GYXB 4DPUA 4V19X 5L8RC 5LMNF 5C42A 1HD0A 4J7CA 3QJJA 1KQGB 2H5JB 1TK8A 2BBEA 2H4YB 2R7QA 4QYRA 3VAGA 4AFFA 1ZAXA 2M70A 2JFDA 4K4WA 2AX0A 1XNRF 2JJ4D 4E2FB 4ECUA 2RNEA 1R6VA 3Q8SB 3M2RB 1I3OB 2BKPA 5B0FA 3EPIA 1DQ9A 3D6TB 1I94J 2LKZA 1ZM4A 3GSDA 4RW7A 1S7IA 1UFLA 2LCWA 3C6UA 2DTJA 2RIJA 3ISNC 4RW6A 2FJWA 3Q2TC 4Q5VA 3BM7A 3V81B 2RQMA 4NA3A 3R5CA 3LH2S 5FJ4A 4TY8A 3M8QA 1N8RT 1RHRB 3MAQA 3E2EA 3CC7S 1RTIA 2XS2A 5ADZA 1K0VA 1H6KX 1CJVB 4Z7CA 4USKA 4UTGA 1UVKA 2IMWP 1AW0A 2EPIA 1TFWA 4Y6IA 2MEWA 2C28A 3K89A 2FJVA 2R4FA 1S1UA 1A0OB 4DFPA 2EFGA 3HMJG 3QT5A 4ANDA 3TZZA 3TNVA 2FHOB 3RBZA 2FD2A 4CLWA 5A0YB 4U95A 2V0NA 4LRAA 4DPYA 3GJTB 4KV8A 3ZNJ1 1H2VZ 1H38A 3DDKA 4DR3F 4NLXA 3KG0A 3R7BB 2QYGA 4HR2A 2E1CA 3VZIA 3I32A 3HI9A 4F4WA 1U45A 3VHQA 3MCNA 1D8ZA 4UZCA 4R8UA 2K1RB 3NXZA 2CVIA 1XNQF 4D3GA 2YNIB 2R7XA 5ITHA 1TKTB 2EKNA 4LF6F 1FTCA 3T5LA 4G1QB 2W24A 5KFTA 3ZO7A 3MM7B 2OSRA 3G96A 4YMEA 2G13A 3M9NB 2HHTA 2XMVA 2QA4S 2VPXB 5LSOA 4DF4A 1KHWA 4OX8A 4HHUA 4ZHRA 4M5KA 4AL6A 3DU5A 4ZVRB 4M5LA 4OYZA 4OI6A 3IG1A 3ZTRA 5HANA 2HLUA 3Q83A 2MZSA 3Q24A 1HPZA 4HEA9 4R5PB 4ECVA 1S77D 3CNQP 1N0VC 1CJUA 2W9AA 2ZE2A 4I7FB 5B08A 1VYAA 2ZFHA 3T5KA 4ZDNA 4PQUB 2EG1A 3MD1A 3MM5A 4CLUA 1LXNA 1P27B 3T1AA 3UPFA 2ZC3A 1EIYB 4KHMA 4DJBA 2C42A 3Q86A 2HS3A 2ZDOA 1NDCA 4CWBA 4DF8A 2D3ZA 1S1XB 1VC5A 4NASA 2IRXA 4MK8A 4OZ1A 2N82B 1P9YA 2HGNA 3CJ3A 1PILA 1QSSA 4KY3A 2LFVA 1NM2A 1YJVA 3O44A 2DT9A 1XMQJ 2YWEA 3BZQA 3LA0A 5ETTA 4E98A 2MLZA 3KLIA 5LSRA 4B3TJ 1T03B 4RNMA 3T3FA 3L9ZA 1FRHA 2CJXB 2AKWB 4GKKF 1H0HB 4RPFA 4EK2A 2ZHBA 1HHSA 4NLDA 1UAWA 3QGGA 2B9EA 2RB7A 2HAIA 2ZOMA 4F26A 3OTOJ 2BMBA 1VIOA 3UR3C 2D3UA 1FD2A 3VAMA 5DQGA 5KFMA 2HWHA 2KYXA 2BVZA 2AW0A 3AQPA 3IM9A 2HIQA 1RT7B 2NQPA 2V4QA 5H9EK 3EVWA 1ELOA 5GMEA 5ETOA 3BO2A 4ERDA 2XWXA 4X4RA 5KFSA 4USJC 4JI6F 2H5IB 1DAXA 2ROGA 4C8OA 2RRNA 3W65A 1AA1B 4C2MA 1VQMS 2FGOA 3I9V9 4O3PA 2YNGB 3HZEA 4G65A 4RBTA 3KYLA 2CYYA 2JZ5A 3V4IA 1SUQB 2B0GA 1HWKA 3CJ4A 1FRLA 4MIAA 3AA8A 4X84A 4ZMMA 1G1XA 1JMTA 5HI7A 1A7GE 1HNXF 1TV6B 3BPSP 4FYYB 3Q23A 1JLGB 3OTDA 4P9SA 2RRBA 2ZNYA 2Z2LA 2QLBB 5KAKA 3KG1A 2DXFA 1PBUA 2Q6BA 5J2MA 3SSQA 1MWYA 4KFBB 4DCJB 2N7YA 1B64A 2GW8A 2YXLA 2PEHA 4HI2A 3X1LB 4BHQA 1VQ9S 5A76A 2VFVA 1F9EB 4CLKA 3BDPA 3MEDA 5DRKA 1WC6A 3IR7B 1Q86T 1WACA 1KVKA 2Z4PA 3JQJA 1Y3JA 5DETA 4CH1A 3S6EA 3OD2A 1RLCL 1X9SA 4O3NA 3H90A 2FZCB 4LF2A 1WC4A 1SC3B 2RMLA 3KG4A 4HL9A 2HK2A 4MTPA 4X62F 2KHCA 2I5JB 4ZPBA 4ECTA 1X9WA 2GX8A 1H7XA 3M8SA 2V50A 1ZM3A 5T14A 2Z0GA 1GMWA 3NS5A 2GAHC 2KFNA 4I4BA 3T1HF 4WU3A 1IKVB 1KC8T 2C2NA 4AQYJ 1NJIT 1JLBB 5BR8F 1NHUA 3LO3A 3R5JB 1V3SA 4M1KA 1OYDA 2PA8D 1C0UB 2XWYA 2X1FA 5HSPA 5KFZA 1HLWA 2GGPB 4HTJA 1K44A 4DSLA 3E3XA 5H9EJ 3BDEA 4RWWA 3VV2B 3MXHP 5HMXA 2GQCA 3I31A 1FTRA 2N3OA 3OXFA 4HH1A 1YJNS 3OVAA 1CBKA 3BGLA 2GMLA 4B3MF 4DFJA 5D0GA 1FDBA 3DCAA 1GT8A 2XCPA 5F41A 5A8RA 1HI0P 3ILLA 1OMSA 2E44A 2GQQA 3W61A 1N34J 2NLWA 2HHHJ 3TRGA 2VIHA 4DL7A 4QCLA 3BR8A 1SC4B 2WB1D 1FKOA 1FA0A 2CKWA 2NREA 2JSXA 2ZITA 3H40A 4P7VA 1HQUB 2FQQB 2FB0A 3MURP 2HQGA 2CUYA 1GMVA 1HMVB 2MQOA 4HI1A 2CQ3A 4ZPWR 4DR4F 1VI7A 1X60A 3MM9B 2V9KA 5B0AA 1N5YA 5H9FK 3K5LA 3TA2A 5GAEI 4X4NA 3L7PA 1C1BB 5KFCA 3FFIA 5IV3A 5B7WA 3DLBA 2VL1A 5L39A 4KKOA 1V3RA 1U6ZA 1VQ5S 2F4VJ 1PJ6A 3DOLB 4IG3B 4ED4A 2ZH2A 2J7KA 2KXFA 2J0WA 2YNHA 5F8JA 2KI2A 5LSLA 2VPYB 1HWUA 5DLGA 2HNZB 3EPGA 1NB2A 4EGLA 1YG0A 4ZVTB 2QLJB 1A9NB 1J5EJ 2LQBA 4ZVQB 4KB7A 2BDPA 1RLDA 3EZOA 2CDRB 4O3RA 3KHLA 3FMBA 2HEKA 2CPXA 2BV3A 1WI8A 4AT1B 2K3IA 3R2DJ 4A8QA 3OQ2A 1LWEA 7FD1A 4RUCA 4EZ6A 2GCFA 3CCUS 2KFZA 2ACMA 4EU0A 4DUZF 1WSVA 1SJFA 2MY8A 3D66A 5E2QA 5KFGA 3EGNA 4FPRA 2EVZA 8RUCA 3B8HA 3AD7C 4QWCA 1Q1KA 2JEJA 3HHNB 3QGPA 3K8WA 5IC4B 2OGUA 2A6MA 2F8EX 1LQ9A 2XMAA 5B0CA 3P5BP 3N6MA 3R3TA 4KH1B 5SUHA 2VA2A 3RU0A 4DPTA 4FYXB 3PYEA 3J7Z5 3TEGA 4WKYA 2DIVA 5C25A 2CJYB 2OPQA 3MECB 3T9ZA 3W2WA 1MG7A 2PT0A 2XCAA 3WIUA 2W4DA 1U47A 3DLGA 4KO0B 3K5NA 1HNIB 3HP6A 3ENWA 1MNEA 3MI7X 3A8JA 2C3UA 1HYSA 2ZUAA 2F8MA 1KBRA 3KJNB 2FZKB 4ITSA 3DRSA 3JQMA 2MY7A 3C15B 1NUEA 4LRFA 1SPBP 4K5RA 1FWKA 2HNDA 5HJYA 3QT6A 4U9RA 2FVCA 2A18A 4HT7A 2MZQA 3TJ9A 1EX8A 1RAJA 2A2DA 4RW9A 5J1NA 5L1JA 3CD0A 3HX9A 1JIHA 2DNLA 2FLOA 1UP1A 2ATCB 4UUWA 4N8OA 3KJVA 3M32B 3FSYA 3R7NB 4C6AA 4EUVA 2HFNA 4PG4A 4NXNF 4RX6A 2BQ3A 2FUG9 1OYEA 3MEEA 4C3KA 2UXBJ 5DG7A 2QMWA 4XIUA 4PWWA 5H9FJ 3BB5A 2XSJA 3HZGA 5CD4A 2DK2A 1NSPA 4USWA 1FJEB 3KLEA 1XEZA 3ET6B 1D0EA 3H4DA 3D0GE 4FXVA 2BOPA 1R8HA 3G71S 4C8ZA 2KJVA 3VALA 2ZNZA 2MKKA 1QAYA 3P96A 3ZTPA 1YI2S 2YKMB 3GFZA 3SMZA 2UXCF 1WF2A 5KFPA 2R2UA 4DV0F 3QJPA 1VJWA 4OYPA 5I42B 3VWSA 2ASJA 2PIIA 4TQSA 4MKYA 2D1CA 3UE2A 4M5MA 1ULRA 1FO1A 3G8QA 4RW8B 4I0WA 3G6VA 2VA3A 2VBWA 3LP2B 2ADCA 2XYGB 5KG1A 4G6VB 5KFBA 2GAGC 4JI0J 4H4KA 3GCXP 2W9BB 3H5YA 1S9GA 2V69A 1LWFA 4W90B 2CG4A 5L1LA 2JVOA 2YWHA 4Y2CA 8AT1B 4GKJF 1S4FA 2WBRA 2EFVA 2XLKA 2CXEA 3UCUP 3BBBA 3OR1A 4Y2IA 2UVWA 3G82B 1RWMB 2KRBA 2Y8YA 1B0TA 3R6LB 1FEHA 2ZM6J 2CNKB 5JVHQ 4KH0B 4ZA1A 2FPHX 4F4YA 3KLFA 1N5QA 2DB1A 3F73A 3GJRB 3DLEA 1T05A 2YKOA 5KFHA 3W9HA 3GP9A 1RU2A 4ANEA 4ZPAA 2NPIA 1M5OC 1XMOF 2ZH3A 2KZZA 2H5EA 1HNZJ 5EGYA 2K2PA 4NXMJ 3FKBA 3A13A 1KQSR 1M5KC 1TL4A 4OYMA 3PTWA 2V6AA 3MR3A 3M6WA 4MAKA 4ECXA 3DU6A 2ATLA 3DGPA 3LOUA 4GVBA 2FC8A 1BGXT 1S76D 1TKXB 4DQRA 5J2NB 2DGTA 3SDEB 1IR0A 1W7WA 2DH7A 2N4CA 5C24B 5HMWA 1S0VA 5I3UB 4RU9A 5CCMA 2KM8B 1UVIA 5ETRA 3EM1A 3GCWP 2ERRA 1IKYB 1Z2ZA 3Q8PB 2IAJB 3P5TL 2IY5B 1VIXA 3RB3A 1D9DA 4X65J 1FE0A 2HQFA 1FXDA 3A4TA 1VQYA 4OHZA 5FD1A 2FTRA 2I0XA 3GZ7A 4O3SA 1RAOA 1FJ7A 1RWPB 2WK4A 5JJBA 2LECA 3GFXA 4PYDA 4MFBA 4FS2A 4ES2A 4MJKA 2UVUA 1Q95G 5KFFA 2YKNA 4NL5A 3VVTA 5D0HA 1JNZB 1HNWJ 4JV5F 1LW0B 2MPUA 3I0RB 4RJVA 3S1TA 3HFKA 1TUGB 1SC1B 4A46A 1TL5A 4UOFA 1HFEL 3TJ8A 3DRPA 1JQGA 5HO4A 4LBPA 2BJ1A 4DV6F 4JI5J 3LP0A 5CYMB 3PJ9A 5DGAA 5D78A 4KIAA 1S12A 4NE9C 3PX6A 2W7OA 5DS7A 4OZLA 3W2VA 1WKJA 1EKSA 3B54A 1YHQS 3CCVS 1WWHA 1FK9B 2PMZD 2L48A 2CQ2A 3TUPA 4RNFA 4YY3J 2NS1B 2JLFA 1TFYA 3K5MA 1C1CB 4K2XA 2J7UA 3BQ0A 3ZTOA 1YJ9S 2E5LJ 4CCHA 3EJMA 2AF6A 3FCHA 2BRLA 3OL6A 4IDKB 3M2VA 2ZBPA 2WSCC 1D8YA 1X4BA 2H65B 4C3MA 4IO1A 2RUSA 1FERA 1MU2B 1VRTB 2BZ2A 3L09A 4RKUC 4KGXB 3QGHA 4ENOA 1VHFA 1FWLA 3DRRA 2GMHA 2ZKTA 2JL9A 1TL7A 4KBIA 1PAEX 1GX6A 1RB0A 5J1EB 1SCJB 2A6OA 5J2QA 3BR9A 2QMUB 1UFWA 4JI7F 3MMBA 1NK5A 4EO8A 3J81U 1E6VA 5FLXU 1Q78A 2MJUA 4DN9A 3IR6B 1PC4A 1V3ZA 3I5AA 3MR6A 2F5GA 3CDBA 3QFWA 1IKWA 1UTAA 3MM6A 1U1MA 4DQQA 2BE7D 1CC7A 3AHPA 1TTHB 4X66F 2UUAJ 2NXEA 3M6XA 2FJXA 3NMAA 1VJQA 2CQGA 2XGPA 1WC5A 1YJTA 3ZC4A 2FDNA 3PKYA 3PHTA 1JLEA 3OLAA 2XEXA 4OHVA 2ASDA 3MFIA 2DGWA 5FIIA 5BYQA 2F1FA 4DR1F 4OYAA 3FSXA 2DNPA 4ECWA 4O44B 2KKHA 1XMBA 5KG4A 4AXJA 5DDQC 2MQQA 4FKXA 2KZMA 2F7VA 1CEZA 4ICLB 4JP8A 4WTYA 1ROFA 1A6LA 2V2KA 4MKVA 1ACMB 4C8LA 3HHLB 1GMWD 1EJ7L 1S0MA 1F2HA 1WSRA 5T41A 4CLLA 3LF0A 1FRMA 3CDAA 1UPPA 2G0CA 2B6AA 3IRXA 4QW9A 2RF2B 1Y5IB 1T0TV 4CH7A 4DUYJ 4USIA 1JLCA 1DY3A 1HBMA 3TW0A 2DHXA 5KFRA 1KFDA 4ZJOA 4H4OB 3LGMA 4CT8A 4RNOA 4CTAA 1TZ0A 2PMHA 1JLFA 4RW7B 4QIGA 2BW7A 3KTQA 2R42A 5LT5A 5IWAF 3JAMU 1FRIA 4L72B 4TY8B 2OHDA 4F67A 4WF9Q 3IC1A 4F0KA 4C8KA 3G6XA 4JYAF 1FXLA 5CHCB 2PDAA 1RWXB 4YB1P 1KTQA 2ACYA 4IFYA 4PG6A 1JXLA 4HHHA 5KFDA 3Q8VA 1SBRA 4IO9Q 4ED2A 2VHGA 2GMJA 1VC0A 2RAQA 1C4AA 2B4VA 3KK3B 5L9XA 1T9WA 1TL1B 2AT1B 4K59A 3B4DA 3H7HB 2NZ4A 2B51A 2EBGA 2HRYA 3KDNA 2GNKA 2M52A 4DR5F 1UL3A 2FJEB 5F3TA 2J6UA 4PWDB 2KG1A 3TAPA 2BKNA 4ZJQA 3C3LA 2FVPA 1RKJA 3ITHA 3W3SA 2QA4G 3IFEA 2YWFA 1AUDA 2ILYA 1IKXA 3JS9A 5DG8A 2OJ3A 4I2QB 2V8DA 2LXUA 2G2OA 3ETOA 1O0PA 2DR8A 3TYTA 2OFHX 1BUXA 4LBIA 5MAOA 4MK7A 1ITPA 3A1YG 3POTB 3UN2A 2D69A 1SJ4P 2MZ1A 1WTFA 3J7YI 3CCWA 4IOAQ 3PEJA 1M5PC 2ZBIA 5CD4H 1U0HA 4IYQA 3EGVA 3KLGA 4DV3J 5KG3A 3N6LA 4DR7J 1HA1A 5ETPA 2AJ1A 3F56A 3PR4A 5C2CA 2DNGA 4IKAA 4MH8A 3EE3A 1WOSA 2RKIA 2C3YA 3VCDA 3IG1B 3FNNA 3P8BB 2XO6A 4OHXA 2CQDA 3K0JA
chains in the Genus database with same CATH topology
1PC5A 1HPZB 3O3LA 3GSDA 3MMCB 3NBPA 2ZM6F 4YQWA 1IQTA 2GJIA 2X1BA 5HQ8A 2DNKA 1RWUA 4RW7A 2FVQA 1UFLA 5D77A 1X4DA 2O66A 1TQLA 2LCWA 3LQVA 5EX0A 3C6UA 4KHPF 3WX4A 2DTJA 2RIJA 3ISNC 4MYUA 4RW6A 2FJWA 3Q2TC 5AXLA 5A8KA 4YFUA 4Q5VA 3BM7A 3HT3A 1R43A 1U1LA 1TKDA 3N5FA 1ZAWA 3LANA 4F50A 1RYSA 4DQPA 3V81B 2RQMA 4NA3A 4OZNA 3R5CA 1IBKF 5KG6A 4A8SA 5HLFA 2HS4A 3QJLA 4Q8EA 3LH2S 1VFJA 3EXYA 2CIMA 5FJ4A 1FVSA 2V94A 4TY8A 3M8QA 3MM5B 1N8RT 4F4KA 3GR1A 4JI1F 5KFEA 4NLVA 2LEAA 2ZBCA 1P6TA 3I0SA 3PRBA 3NCPA 3MAQA 3U7JA 3E2EA 3CC7S 4B9NA 1HNZF 5LXYA 2AGQA 5I42A 2C3OA 4NYOA 4NXMF 5IQ6A 2XGQA 2VBZA 4CO0A 4WFYA 1RTIA 1SH2A 3NLCA 2W9CB 1NJZA 1YGYA 5ADZA 3EZUA 1H6KX 3RZAA 1BQMB 3L3CA 1VBZA 1N6QB 1K0VA 2RQ4A 2AYEA 3H2VE 1NK8A 3ENQA 4EYHB 2E1AA 2VODA 4RW8A 3ZZ0A 2OPQB 1DARA 3AJ2A 4TN2A 3KFWX 3W2WB 3D54A 5F8LA 1EP4A 3LPYA 1AW0A 1UVKA 2ZH6A 2IMWP 2EPIA 3LP2A 3G9CA 4YUDA 1LW2A 3G8SA 1EETB 1TFWA 4Y6IA 1B0VA 2EFQA 2JEIA 2V5HG 4ZVEA 2O67A 3VAIA 1WHXA 2C28A 4OV1A 2FJVA 2R4FA 1S1UA 3SCIE 3HVTB 2W9BA 1GNKA 3PJXA 3AQOA 1HYSB 2MQPA 1S1WB 3R5DA 1N5TA 1WEZA 4DFPA 1N52B 5HBMA 4DWIA 2HHSA 3CDUA 2EFGA 3DLJA 3HMJG 3DOKB 2WW8A 3RTVA 1B0PA 1JK9B 4KHRA 4QJVA 3TNVA 2FHOB 3HKWA 4WK1A 5KOXA 3HXMA 3KLIB 1NK9A 2FD2A 2DNQA 5D3GB 5A0YB 3DRSB 5GADU 4EBDA 3JSBA 2OD6A 3AY0A 2W7AA 4MIBA 4FVMA 5J2PA 3BN4A 4TY9A 2LXFA 2DGSA 2A3JA 1VGYA 4RZRA 1RT4B 3D1QA 1NJXA 2LQJA 4FBTA 1YVFA 2V0NA 3KHRA 1ZTTA 1UVJA 1YJUA 1BD6A 2HNDB 4KV8A 1URRA 1H2VZ 1VQKS 1Q4RA 2XSFA 4K4SA 2A10A 1H38A 4UOCA 2AQ4A 5M2RA 3DDKA 4X65F 4QOTA 4DR3F 4NRUA 4NLXA 3KG0A 3CUNA 4IOCQ 2E1CA 3VZIA 1RA6A 2D7SA 3I32A 4I56A 3HI9A 4XDCA 4F4WA 3NWGA 5EUHA 2IFXA 2KH9A 1U45A 1FHTA 4OIXA 3FRYA 1RTJA 3QIDA 1JWWA 4ZVFA 5AXMA 1T3OA 3KJVB 1YJWS 5K5MA 3EXCX 3FSIA 4C8MA 2UUBF 1D8ZA 2WSFC 1R0AA 4WXWA 4R8UA 1SV5A 2K1RB 2CQBA 3C66A 4GC6A 5DLFA 2CVIA 4LSLA 2JHEA 4IQMA 4NZ7A 4D3GA 1XNQF 2WONB 4IFVB 4DL0C 2PGCA 4ZKAA 5D6GA 2YNIB 4FF1A 3GIMA 4C8YA 1GTEA 1Y7PA 1H7WA 3MEEB 4M5DB 2CPJA 4Z2XA 1TKTB 3C6TA 5ITHA 4J9MA 2MKSA 2OH2A 2RVJA 1MSWD 2D41A 2MKHA 3PX0A 2BM0A 2GV1A 1RT5B 4ID8A 4NWBA 4LF6F 2CJAA 2XMTA 4DSIA 1FTCA 2MMYA 3T5LA 2VOPA 2WCXA 5HN0A 4G1QB 2HG4A 2KU7A 1ZZNA 1FJGF 1NO8A 4DSFA 3M8PA 4F25A 1HNWF 2W24A 1N5VA 2ASYA 5KFTA 1YIJS 1JJ4A 5IM0A 1CG2A 3DRYA 3MTKA 2OLWA 3MM7B 1HBOB 2DIUA 2OSRA 3TO8A 4YMEA 3G96A 2G13A 4G1IA 4CO2A 3KLEB 3M9NB 4PXCA 3M6VA 2Q3PA 4QWEA 2HHTA 3PW2A 2MGZB 2CQ0A 2XMVA 2QA4S 5DQIA 4X4VA 3VTIA 3JTPA 3CCQS 2DGUA 2VPXB 5LSOA 4F4XA 1RT3A 1S6PA 1KHWA 4DF4A 4OX8A 3V6DB 2CPIA 4ZHRA 3P49B 1TKXA 5GAHI 2RILA 4M94A 1IM4A 4AL6A 3DU5A 1S48A 4OFZA 4D3HA 4ED8A 5J2NA 4QPTA 4JI5F 1X4GA 2XI2A 4EBCA 1VRUB 3ZZTA 1FJCA 2V8VA 3SDEA 4KGMA 4B17A 1HR0F 3PHEA 1FE4A 3H4BA 4LSNA 5C24A 4BBYA 4E8UA 4NLRA 1TAUA 4OI6A 2CJ9A 3IG1A 1G6BA 5FDLA 3MAHA 3PRDA 2D9PA 4WE1B 1FKPA 3IS9B 1FESA 1RP5A 2HLUA 4ZPVR 2UVRA 2HMIB 2V8GA 2E5GA 2IAJA 2V8HA 2C22A 4A8WA 2MZSA 4Y3CA 1T7PA 4FNIA 5K8OA 3Q24A 1HPZA 2O5DA 2FY1A 3MMCA 4HEA9 2OTLS 4R5PB 1ZH5A 3I9ZA 4ECVA 5HROA 1S77D 4YY3F 1UJ6A 4ID5B 3MR5A 1N0VC 2ZVSA 4DV1F 2W9AA 5F8MA 2E5LF 3NAHA 4LF8F 1SQEA 2ZE2A 2IVMA 1SH0A 2GHPA 4DPOA 2XG8A 4LF7F 5K8MA 5B0GA 3OSNA 2N3LA 4DSKA 4I7FB 4DV2F 1DLOA 3V81A 3VQSA 5B08A 2ZFHA 4YR0A 1S9GB 2M7SA 3T5KA 1R89A 1SC6A 2VG5A 1LWFB 1VQ8S 4ZDNA 4O0IA 4ZLPA 5CYJA 4C3LA 3HVWA 4PQUB 2EG1A 1XBWA 2E5IA 4B9MA 1P9QC 3MD1A 3MM5A 1LXNA 1P27B 4ILLA 1N88A 3NP5A 3T1AA 3UPFA 4FBUA 3OPKA 2ZC3A 3NS6A 5J2MB 3IR5B 2J9DA 4YB6A 1FVQA 4KHMA 1K73T 4RW4B 4QIVA 2VBYA 1UKUA 4MYTA 2C42A 4DJBA 1SIWB 2HS3A 2J8AA 1KQKA 2ZDOA 2W9CA 4DF8A 5F8HA 4X4QA 2MDAA 3LAMA 2CPZA 3OR1B 1M90T 4LFCF 2ROPA 3BSNA 2RT3A 2D3ZA 3TX8A 1KS2A 1S1VB 1U1PA 1S1XB 1IBMF 5F8GA 1APSA 2MQMA 1VC5A 1SJQA 2IRXA 3N5BA 4A8YA 4ZCMA 1X5SA 1IXKA 2O1PA 4NCGB 4MK8A 4OZ1A 2CJKA 2YTCA 2N82B 1TK0A 1EETA 1RT2B 2IM0A 2HHXA 2BA9A 3FEYB 2HFZA 3ISZA 2HNYB 1LW0A 2I2YA 3MFHA 4IR1A 2WB4A 3AAWB 3I0RA 4CNZA 3KLFB 1NZAA 1L3SA 2HGNA 2B4UA 3CJ3A 3PIOQ 3VR1A 1PILA 4Q45A 3Q22A 3DLEB 1T05B 1QSSA 3B82A 3G86A 3HVTA 1YJVA 1J2VA 2CVEA 3O44A 1S1WA 2DT9A 5KFOA 4B9LA 2COLA 4X2BA 2YWEA 4Y28C 3J81Y 2HHWA 3OFHA 4DL5A 5FLXY 2YH1A 3BZQA 2MJNA 4E98A 2FC9A 3LGNA 4DR2F 4TNOA 3KLIA 5LSRA 1SL1A 2E29A 2P9GA 2PN6A 4A8XA 1HI1A 3MDFA 3D2WA 1V9OA 5A0YA 1T03B 2Q43A 1Q79A 1WI6A 2VKZG 3D1OA 4RNMA 3RBEA 3T3FA 3KWMA 2YKQA 3GIKA 4JBCA 1FRHA 1X4FA 1RT4A 2XMMA 1NJWA 2MSTA 2PSZA 2C3MA 3CD5A 2I1RA 1VQSA 4A4JA 3CCLS 5AE2A 3OFFA 4GKKF 4F2SA 2OMLA 5JVGQ 1FK9A 4CZCA 1H0HB 3BQ2A 2ZD1A 2ZHBA 1HHSA 3OTBA 2UUAF 3OJSA 4NLDA 1VBYA 1RDRA 3MPYA 1UAWA 4OZ0A 5LJ3Y 1X4AA 1FD8A 2X1GA 3QGGA 2R8HA 1DTQB 2HQIA 3MPVA 2RB7A 2HAIA 2IM1A 3MEGB 4PPZA 4BWJA 4LQ3A 2U2FA 2ZOMA 2P9CA 4F26A 2HHVA 2JC1A 3CB4A 1VIOA 3ISND 3UR3C 1UJ5A 2M9KA 2D3UA 2YY3A 3DXBA 3OV7A 4RLEA 1SKSA 1FD2A 3DI6B 3VAMA 4KGKA 5DQGA 4IDKA 3FMWA 5KFMA 4OHWA 2HWHA 2IA0A 2KYXA 3MEKA 2F40A 4A48A 1X0FA 1N48A 2BVZA 2AW0A 1YRUA 3M30A 5T7LA 3TAQA 3AQPA 3ONQA 1U09A 3J7YI 2HIQA 3L95X 4IFVA 1MU2A 2J9EA 2MYFA 1VRTA 1HBNB 2P6SA 1RT7B 2YNIA 1RTDA 4H4MB 4WYWA 1QUPA 4KAIA 3UD3P 2NQPA 2V4QA 1R6YA 5A8WA 3HO1A 1TKTA 1S1TA 1YQHA 1ELOA 1WHVA 4KSEB 3RRGA 1JJHA 4ERDA 3BO2A 2WBMA 2XWXA 6FD1A 3CULA 4ZCIA 1NNDA 3QZ7A 2KVIA 3FGVA 4WZQA 4X4RA 5KFSA 4F3QA 4USJC 1NAQA 1OSDA 3K5PA 4JI6F 5KTQA 1DAXA 2ROGA 1G2EA 4C8OA 2RRNA 1L5UA 4C2MA 5J1EA 2RS2A 2VG7A 3EGZA 2J0XA 1GH8A 2MGZA 2GO8A 3SYZA 2IM3A 1VQMS 4HKQA 2KYZA 2FGOA 4OLOA 2WHOA 3BO4A 4IH6A 3G4SS 3CO9A 2E1MC 4DBQA 1U48A 3V6DA 3I9V9 4O3PA 3KK1B 1AFIA 3PZPA 2YNGB 3H2UB 3HZEA 1RT1B 4HDGA 1OQ6A 4RBTA 3WC0A 3KYLA 2CYYA 1TUVA 1FNMA 2JZ5A 3V4IA 1CPZA 3G6YA 2B7CB 1SUQB 3VZHA 3EUNA 3CC4S 2B0GA 1HWKA 3CJ4A 4WKRA 5EHHA 2YX7A 2K8GA 1NHVA 1S9EB 1FRLA 3J7ZT 1IQZA 5KFAA 2NSCA 4MIAA 3AA8A 3EYZA 3QLHA 4X84A 1KD1T 2QLWA 3IS9A 1KOOA 4ZMMA 1S0OA 1G1XA 1OPIA 3BS9A 3N79A 2VQFF 4OLPA 4DR6F 4F2RA 1JMTA 5DQHA 1SJ1A 4ES1A 1J5OB 2QV6A 3DM2B 4USHA 2YKNB 5HI7A 4IOBA 1WHWA 5B09A 2YVSA 4R5PA 1A7GE 2CZ4A 4IQXA 2W8LA 3A8EA 1BY9A 1TV6B 5CYQA 1F5BA 4DUYF 1HNXF 3OL9A 2CPHA 3TA0A 1CQMA 1UA1A 2OO4A 2PI5A 2CPYA 1KN6A 1UWBB 3AA9A 4DMZA 1Y0HA 2XMJA 2ZH4A 3Q23A 1JLGB 4IG0A 1S99A 3OTDA 2VUGA 2AJFE 3RR7A 4DLEA 2RRBA 5E33A 2OTJS 4WJBA 3MPWA 3Q2SC 4A8OA 2AGPA 3DRPB 1DTTB 2R7OA 4PUOA 2ZNYA 2BANB 3OTCA 3T1YF 2CQIA 2Z2LA 3K5OA 4C4WA 1RTHA 3LP1A 2RE1A 3LP0B 3SQGA 5KAKA 2AJ0A 2JRSA 3KG1A 2OPSB 4UQGA 2Q6BA 4Q2LA 5J2MA 2R9LA 3SSQA 5F9NA 1MWYA 2GIRA 4UUXA 4A8MP 1H3DA 2XY5A 4KFBB 2N7YA 1Y5LB 5HP1B 3W2VB 2AP6A 1TVRA 3TUJC 1B64A 4K0KF 1S1VA 2GW8A 2LA4A 4DL2A 2QYCA 2ABYA 1K1QA 2PEHA 3CDWA 4I6WA 1FDNA 2JLGA 3LWMA 3D0HE 1QE1B 3KHGA 4HI2A 3T5HA 3X1LB 1AROP 5A6WA 4BHQA 1VQ9S 2DR7A 1N5YB 3JAMY 5IT4A 4O44A 2UUCF 1URNA 3HHKA 4IR9A 2MKJA 1ZOTA 2VFVA 3MWBA 3O5TB 3IWLA 3BDPA 4AE5A 4L6V3 3US5A 3MEDA 4K4TA 5DRKA 2RU3A 2RJZA 2RDIA 3Q8RB 2J0SD 1OS5A 4ICLA 1ZM2A 3IR7B 3VAHA 4ECYA 5EWEA 1Q86T 1WACA 2EG2A 2XMKA 2YH0A 4B9VA 4AUKA 2Z4PA 4DDFA 1Y3JA 3M2VB 5SZTA 3HHLA 5DETA 1Z4UA 2HS0A 4NLGA 3TI0A 4JI2F 1BC6A 4CH1A 3S6EA 4I6AA 1O8BA 3CJKB 1UVLA 2VG6B 1FDAA 2AJQA 2J76E 1X9SA 4Y2MA 2LYVA 4NZ6A 4TXSA 4O3NA 3ZZOA 3DYAB 2XMUA 3M1VB 5DM7Q 1T03A 5I3QA 2DPIA 5JXSA 1ZPVA 2LVWA 4ZPTR 3CCTA 2NXUA 4YHHF 2RMLA 3KG4A 4I67A 2KTQA 4HL9A 1ZTWA 1RGVA 2W7PA 2MB0B 3GFHA 4PRFA 3OL8A 5BJRA 2XLJA 2ZOFA 2B5JB 4MTPA 1M5SA 2RF2A 4C97A 4X62F 2B3TB 2MQNA 4ZCLA 2ZH8A 2VPWB 4Q7AA 2KHCA 2L9WA 2QFJA 4YDXA 2I5JB 1DTQA 4ZVHA 5K9FA 5DDOC 3GIIA 1R8CA 5F8IA 2F9JA 4ZPBA 4ECTA 3MEGA 1X9WA 2GX8A 3UCGA 1H7XA 3M8SA 2D3OR 2GO9A 1GQEA 4U6PA 3D1HA 1ZM3A 3H59A 3MMBB 5H1SV 5KFIA 1ZETA 4HLBA 3DI6A 4H4OA 1OQ3A 5T14A 4F8RA 5E5NA 1S6QA 1C2PA 3PV8A 1E6VB 2Z0GA 4ZP8A 3NS5A 4QYZJ 1HBUA 4RU2A 3BQ1A 3CTRA 3K7RA 5D4NA 2KFNA 4JOUA 4I4BA 3T1HF 4B3OA 1ZAVA 3QIPB 3M2UB 2P5VA 4AL5A 2M5YA 4KC5A 4H4MA 2Q6CA 4CI0B 2IA6A 3M05A 4DL4A 3T19A 2FHKA 3RYLA 4WU3A 3PW7A 3MM6B 3MD3A 3GFYA 3QO9B 3R5BA 4NRTA 5G4DA 5JUMA 1KVIA 1TL3B 1IKVB 1FXRA 1KC8T 1UW4A 4ZVGA 3C8YA 1NJIT 2R8GA 1CSJA 4MMOA 1JLBB 5BR8F 1X5OA 3JYTB 1NHUA 2LQ9A 3LO3A 2BR0A 1V3SA 3MOZA 5KFXA 4M1KA 3AB2B 2HW3A 5EX3A 1UA0A 2PA8D 3CDEA 2KT5A 3RW6A 4OZ5A 1C0UB 2XWYA 4CH0S 2X1FA 1N54B 3VAJA 5KFZA 4MIWA 3SZ2A 2VASA 2GGPB 4HTJA