3IBWA

Crystal structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
TDFLAGIRIVGEDKNGMTNQITGVISKFDTNIRTIVLNAKDGIFTCNLMIFVKNTDKLTTLMDKLRKVQGVFTVERLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords GTP pyrophosphokinase
publication title Crystal Structure of the ACT domain from GTP pyrophosphokinase of Chlorobium tepidum.
rcsb
source organism Chlorobaculum tepidum
total genus 18
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ibwA00
3L7OA 2I9SA 2P9CA 2QSWA 3P96A 3OBIA 3HHEA 1UJ4A 2LQJA 3W7BA 1YBAA 2FGCA 2RQKA 3DC2A 2PA3A 3OFEA 3LOUA 1ZPVA 2F1FA 2DT9A 1UJ6A 3KWMA 3LUYA 2ZHOA 3MAHA 5IT0A 3OFFA 3NRBA 2RE1A 3DDNA 4GO5X 1LKZA 2JHEA 3AB4B 2JOQA 2DTJA 5IS2A 2J0XA 1M0SA 1LK7A 1RWUA 4PWUA 3CEDA 4LUBA 5T41A 1U8SA 2QMXA 3MTJA 3DHXA 5JJBA 3TUZC 3IXQA 2LVWA 5IT4A 3IBWA 4X84A 1SC6A 1YGYA 4M8LA 3AB2B 4GO7X 2KO1A 4IO1A 1UJ5A 1KS2A 1XTZA 2PC6A 3ENVA 2NYIA 2J0WA 4GMKA 3U7JA 3AAWB 2P9GA 2RQMA 3TUJC 2P9EA 1Y7PA 3MWBA 3OFHA 3UW1A 3OFGA 5FIIA 4NMLA 2H9ZA 3O1LA 1O8BA 3ENQA 3DHWC 3K5PA 1PSDA 2CDQA 2F8MA 3N0VA 3ENWA 1LK5A 3TUIC 3S1TA 2QRRA 2QMWA 2MDAA
chains in the Genus database with same CATH superfamily
4M5MA 1YLXA 4DUYJ 2W7AA 5ETKA 2HNYB 1O5JA 1SCJB 1HBMB 3HK2A 2DNZA 4RW6B 4A46A 1SJ4P 3W9IA 3M8QB 3DN9A 3OTDA 4JI3J 1NKBA 2AEFA 2XI3A 5LSOA 4TY9A 1XWLA 3FSXA 2GMLA 1LNQA 1YRUA 3K0JA 1N32F 2YWWA 3RRGA 1K73T 1XERA 3MM6A 2CIMA 4MIBA 2CPJA 4OYIA 5EGYA 3EUNA 5D0HA 4GVBB 2NLWA 1JB0C 3BF4A 3SYZA 3GIMA 3M9NB 2HFSA 3EGVA 2HBZB 1VQ9S 3MMAB 1EB0A 2HFOA 4JI2F 2PGCA 4NASA 3W9HA 1FRXA 1HR0F 1GEHA 5C25A 4CQ1A 8RUCA 2NXJA 2V8VA 2W2PP 4ECUA 1JX4A 2HQCA 2B7CB 3B78A 1FCAA 1Z2LA 3MEGB 3CD6S 4Z7YA 2FY8A 1FJCA 4KV8B 3QATA 2BJDA 1HNXJ 2DH7A 3KHLA 4I2QB 2V4JA 1NCLA 2IVFB 2OEMA 4ENOA 1Y5IB 2KHCA 3TQ1A 4Q5VA 5HMWA 1NB2A 4EO6A 2G0CA 1ACMB 1T05A 1YKWA 3NEKA 3NRBA 2R7WA 2DGWA 2PMWA 2YNHA 2XCAA 3NAIA 1MNEA 2XMMA 1JNRB 1LW0B 2FLNA 4F4KA 4UZBA 1G7CB 1KQSR 3C6TA 3VAMA 2V2VA 2MJNA 1LXNA 2IHR1 2QMXA 3PJXA 2MKSA 4Y2AA 4DSJA 3QIPB 2ZOFA 2B6AB 2C2ZB 1TKDA 1UEUA 4USIA 3CJSA 2A3JA 3D0IE 2AJFE 2U1AA 4HT5A 2UXDJ 2E5HA 4KPYA 4OQJA 3TUJC 4EYHB 2K06A 4RW7A 1LEOA 3DHWC 1VR6A 1K1SA 4W4MA 1WOPA 2F8MA 5F0WA 2GHPA 1F5CA 3CCUS 4R5PA 1NB7A 4NZ7A 1UVKA 1YJRA 1HNVB 2DNYA 4NYZA 1D09B 3B4DA 2GGPB 1RQ0A 1U4BA 3CJ5A 2D41A 5CQGA 4J9SA 2DHGA 2IM0A 3FCVA 1AYEA 2XEXA 3M9OB 2RS8A 4YN3B 4EZ6A 1EP4B 1X5OA 2CADA 2MTLA 2G13A 3F0NA 2XSFA 4FBTA 1XJWB 1KRPA 3MPUB 3ZZYA 1YGYA 1VFJA 2VDIA 1IBMJ 3M2VA 4C2MA 1R7IA 2XGPA 3X1LB 2HQIA 3IRWP 3Q8QB 3PW2A 3OR2B 3GPAA 1LFWA 2XTJP 1CJUA 4KB7A 3K57A 3K5PA 2K1RB 2ZZNA 2HHXA 2V68A 2HS0A 3Q2SC 2FHMA 4F0HA 4CTAB 3VR1A 2QIFA 2M3DA 1NJIT 1HD1A 5D0RA 4H4MB 2OO4A 4ELUA 1HWJA 1H6KX 3CD0A 1DHMA 2DR9A 3KLHA 1WTFA 2HPUA 1S6QB 3KK3B 2L41A 1AT1B 5DG8A 4G6VB 2HVIA 4F4WA 1KP6A 1UWBA 5E3AA 1X4GA 2BQUA 2KT2A 1BQNA 4X84A 3V5RA 1XC9A 3ENAA 2C2EA 3IS9A 3TA2A 4PRFA 2IRUA 4R25A 1N4LA 4P2MA 1IVZA 1XEZA 2L3MA 1N52B 1SC4B 4U96A 2W2NP 1CC7A 1U6FA 5DM6Q 4IRDA 4F3MA 2OPPB 2ADBA 2LMIA 2CWKA 3NXZA 2XM3A 1EARA 3MPWA 3PVXA 2IDEA 4ER8A 2QE5A 1Q8LA 3ZZ0A 3R7NB 3CJRA 2XMTA 1RKJA 4P72A 1BGXT 1Q81T 2MQOA 1KBRA 4YOEA 3WBZA 2WVEA 2DCUB 3FNNA 2Q6BA 2HVHA 2DR6A 2KT3A 2JFDA 2DKOB 2JHEA 2OPSA 4X4OA 4ECTA 2UU9F 4ED7A 3CCSS 4DL6A 4LFBF 2VU5A 4CO4A 3H5XA 3UO0A 2J7UA 4E2FB 5KFQA 3F44A 1HNWJ 2AKWB 3G96A 5E41A 4FYDA 4HT7A 2W7PA 3TZZA 4YR3A 2HGLA 2ZC3A 4B3TJ 2OSRA 3JYTB 1UJ5A 5HVFA 1Z4UA 4NRTA 4O3PA 2LU2A 2ZNYA 3IRXA 1HBNB 2XCPA 2IM3A 1RDRA 3A1YG 3RR8A 2H9ZA 1RTDA 1U0SA 4HH0A 1YI2S 5JXSA 3I87A 2DNMA 2X51A 1DQ9A 3IBCB 2MJUA 2A0FB 4ED2A 1EKSA 3TX0A 3IM9A 5H9EK 3S8SA 1WKLA 2IBOA 1TL7B 3GU0A 2MLZA 4RW4A 1Q79A 2ZNZA 2DXFA 2E5LF 1FX2A 3SSSA 2JH3A 2B8QA 3PW4A 4FVCA 3A4TA 5F0UA 1URRA 3PM9A 4ZPTR 2RU9A 3W3SA 2QYGA 1QAXA 4C3KA 2BEFA 1S48A 4DX8H 3NNCA 3HD1A 3UE2A 1WG5A 1RT6A 1RAEB 1VBKA 1X4FA 3T1HF 4ZVPB 1MMLA 3QNWB 3UNGC 2YPZA 4ECZA 2RH3A 4ZN1A 3RB4A 3DI6A 2DH8A 3LAMA 1PAUB 3KUGA 1X5TA 5KFJA 5KOWA 1IQZA 4RNFA 4TY8B 3MEEA 4ED8A 1FRJA 1RTHA 2PSZA 3KWMA 4C3MA 2BRKA 3LUYA 3MOJB 1S0OA 1OYEA 1WACA 4YB5A 4YHHJ 3GFZA 2KFZA 4B17A 4IO9Q 1BQMA 3DOMB 3LQVA 4I64A 1U2FA 4N8OA 2EBEA 2HZAA 1RHRB 1JLGA 4WFZA 3E01A 2H51B 2WB4A 2WCXA 1JLEA 4Y3CA 4DI6A 3MM8A 5A8RB 3T5LA 4KE5A 4MK7A 2W8KA 2E1RA 3H5YA 2ASLA 1S1VA 1RTIB 4CZCA 2OPQA 1KQFB 4QR2A 5LSRA 2MSSA 4YR0A 3QAEA 1NKEA 1K47A 2F4FA 1N5QA 1R8BA 2ZE2A 4LF8J 3M2RA 2R7RA 4DCJB 5E0OA 1CJVB 4ATNA 3H5UA 3BGRA 1VBXA 1RK8A 2AX1A 1X9SA 2RRBA 4O23A 3US5A 2RQ4A 1M5OC 1JXEA 4YR2A 3G82B 3EM1A 3LGNA 2JFKA 1O51A 3HZEA 4F50A 2CZVC 1TAQA 4B9VA 1SIZA 1C1CB 3VF0B 3Q0AA 3Q2TC 3J81Y 1M1GA 1AZSA 1DFDA 4N7TA 2ATLA 2CPIA 4IRCA 1UVLA 5LMNF 4HI1A 1HNIB 1PJ6A 1RWVB 4ZCIA 3KLGB 2CKWA 4OL8A 3KG1A 1QTMA 2BDPA 3KJQB 1IR2A 2XMVA 3R2CJ 1FKOB 3FFIA 4WCEQ 3BBCA 1S57A 4JI0F 2LQ9A 5F9NA 1DAXA 2DNHA 1NH7A 1U8WA 3DYAB 2C3MA 3T1YF 3P49B 1ZM4A 3EYZA 4LF5J 4I1TA 3M8ZA 3MM9B 3MCSA 3KUHA 1S5ZA 1WC0A 3W63A 3VCDA 4QYZK 1S9GB 2LECA 1ELOA 2KG0A 2KM8B 3HHLA 2V34A 2R7QA 5DZ7A 4HVZA 4NLGA 1SUQB 4P71A 2D7SA 5KG7A 4URSA 2R2TA 4BS2A 4QJVA 4ICLB 1T11A 3PEHA 3AB4B 2CPHA 1RAFB 1N32J 2J0XA 1RYRA 4L6V3 3PR5B 4XK8C 4OZJA 4N41A 1X4AA 1SKWA 5HLFB 1EAYC 3OXLA 1R0BG 2MZJA 2XWXA 5D3GA 1RWWB 5E3QA 1HWLA 5KFRA 3KHRA 5KFFA 4DV2F 2H4WB 5EN1A 1VQ7S 1HR0J 4WK1A 5SZTA 2W7OA 2A6MA 4K4VA 2X7IA 1IXKA 4A8KA 2M9KA 4YMEA 2VQFF 4RUAA 3ETOA 3M1VB 3ZZRA 2GVDA 4DFPA 2HHSA 4PUOB 1REVA 4DR5F 3OUYA 2I1RA 2ZBPA 3ILLA 2GIFA 4CLFA 3AA9A 4WE1A 4A8QA 4TVAB 3N4WA 4I2PB 2OD6A 3OPKA 2KTQA 1EJ7L 4DSEA 4ALZA 3OTOF 2IRXA 4GRSA 3GB0A 2BQRA 2XS2A 2AQ4A 2KXHA 3N28A 3NNHA 2W25A 4RNOA 5HMYA 4LQ9A 2QL9B 3JTOA 1N5SA 4DS4A 1JXVA 5CCMA 2DNRA 1RABB 4M8LA 1Y5LB 4Z7CA 1XBWA 5GAGU 1KWMA 4AYBD 1ZTTA 2OJ3A 4WJBA 4ZVSB 4KH0B 1WF1A 8ATCB 4NLXA 3MWBA 3R5BA 1HBMA 2NREA 4JOUA 2HS4A 2FHJA 4YB7A 4C8NA 3GJQB 2FLOA 4RW6A 4MK8A 3IP0A 4NLOA 5B08A 2AZ1A 2LQBA 1KVKA 3UQSA 3BPDA 1R8CA 3W2VB 4L76A 4KFBB 3FRYA 2EEYA 4U67Q 3DLJA 2NXEA 1TL5A 3DU5A 4PG7A 1FHTA 1FWLA 2QA2A 3NGTA 4L72B 4O4GB 2NR0A 4GVBA 2N7CA 1F9HA 4WU3A 3OHBA 4QPTA 5BYRA 3PR4A 1O6XA 1TELA 4LRFA 3B82A 1MWYA 3BQ1A 4ZP6A 4ZVTB 1MMNA 3TQEA 4IFVA 2OLWA 1WOOA 2ZVIA 3WDOA 4WP3A 4NLQA 3LP0B 3I4HX 2YWEA 1WEYA 1ITPA 3JSYA 1YHQS 1P6TA 2ASYA 4K4SA 3GIIA 2KXNB 1CS4B 1NH8A 3DU6A 1NJZA 1F6TA 2W2MP 4X66F 4B3MF 2QGFB 2CQ3A 2W24A 2PD1A 3ISNC 1H38A 3V2UC 3MM7A 3CT9A 2LEPA 3FMBA 2QV6A 1PCAA 4M5DB 2DYAA 3H4BA 3C15A 1DLOB 1FA0A 1S6PB 2B6AA 2AX0A 2G0JA 2NPIA 4PQAA 1VQOS 2VG6B 3EPIA 3OSPA 2XMAA 2CG4A 2PT0A 4ETZA 1Y9OA 3DRYA 5GVQA 1IKXB 1IBLF 1PBUA 2DGUA 3R5AA 2BBEA 1HI0P 3BO2A 2H5EA 2CQGA 3T5HA 1GX6A 2ZFHA 3FSYA 3EX7B 2OFHX 1FD2A 5HAOA 2R7UA 1SL1A 4OX9F 4HLBA 1GK8A 2D3O1 2ZWPA 1D8ZA 4K4UA 1RADB 3QYYA 1OJ4A 1HNVA 2CJ9A 2HGNA 3A13A 1HNZJ 1Y3JA 2JVRA 2WSFC 2DY9A 1S6UA 1PJ7A 2GGPA 3QJLA 4ED3A 1GT8A 3QGIA 4CH1A 4OZLA 3H20A 2WVCA 4LF7F 3OBIA 4P73A 4ZS6A 2IDLA 4ZKAA 4CNYA 4RKUC 4FKYA 2VFVA 4IG3B 4MIAA 4DJBA 5A0YA 1HFEL 4R8UA 3LA0A 2IM1A 1YJ9S 2IAJA 4JI5F 2PI5A 1LKZA 4IOAQ 1C4AA 4MK9A 4K4YA 2UU9J 3MMJA 4RNHA 3C46A 4OYMA 2GAGC 4LFBJ 1NJWA 3ZTRA 1DTTB 4CM2A 4HKQA 3PYFA 3OVBA 4PAAA 4C11B 3OXGA 4Y2MA 4JI6F 5AXMA 2NYIA 1KONA 2HKEA 3JSMA 4BBYA 3R2DJ 4CTAA 4WWSA 1WORA 2XSJB 4KKOB 3WQPA 2UVRA 4H4MA 1H3DA 4DR7F 4M1KA 4QWCA 4A8WA 1F0XA 3TUPA 5DGAA 5DG9A 1EZZB 4UZCA 3TP2A 2CQDA 4G1QB 4RU2A 2AV5A 2HRYA 3KJVA 1X7VA 5HQ8A 2DGSA 2E5LJ 1RYSA 3SSRA 4ES2A 1Q53A 1N88A 2AT1B 2AYMA 5EWEA 1VLYA 1KOOA 3I96A 4KGZB 3QJJA 4Y0FA 3HKWA 2IFXA 3IXQA 2ZOMA 1VCTA 1N6QA 4NCAA 3W9JA 3ET6B 4A8OA 2UUCF 3VTIA 3K5NA 5I42B 3UDEA 1FDBA 1D3WA 4P7TA 3GIRA 4EBCA 1T3OA 3AHPA 2V9WA 3T1HJ 3PXGa 5EDWA 3D9BA 3D6MB 3DLKA 4Y65A 4ES3A 4UT4A 1N34F 2W9BB 3DDIA 2X1FA 3UCZP 2QRRA 3CGIA 1YJWS 1VHFA 1BD6A 4PKDB 3RBZA 2F40A 2P9CA 5KFYA 4Y34A 3R3TA 2P6TA 5L8RC 1GXTA 1I1GA 2ZKUA 1RXOB 2E9TA 3M6XA 1RT4B 3JSRA 4OHYA 3U02A 3A3OB 2QC3A 4I0WA 3HM9A 1HQ2A 3L09A 2WONA 3JAMY 3OQ2A 3PFOA 3DLBA 3NMAA 2HHVA 4X65F 3DOKA 4DX5A 2W4CA 3JYTA 2HQGA 3FQLA 1FE4A 1M5SA 1TUGB 1TL4A 2X1AA 3FC9A 1Q5VA 3OVAA 3TZWA 3N79A 3KFWX 3CEDA 3LP1B 3TAMA 1J5OB 1C0TA 3BEGB 3MPYA 4FNHA 3OT9A 4ZOSA 3ULHA 3VAHA 2GVZA 4LF1A 5IXUA 4QBUA 3H2UB 4X62F 2XI2A 1U09A 4IDKB 1WI8A 1FWKA 2KN4A 3FDSA 1NBEB 3Q8YA 4ZLJA 3DGPB 3OR1A 2L9WA 5KFXA 1M1KT 2CQIA 2AW0A 4C8YA 4QOTA 2ROEA 1U49A 3HULA 4U9RA 1JJCB 5L9NA 3BKFA 1RHUB 2ZH4A 2DPIA 4PPZA 2NQPA 4X4NA 2IJRA 3C2PA 3W66A 4ZPDA 1RU2A 2YKMB 5GMDA 4F02A 4W92B 2ZH3A 1WKJA 3KXDA 2HFUA 3ZZZA 1NK9A 2B5JA 2VC0A 5LMNJ 4LRCA 2KRRA 3LPYA 4O44B 2XYHB 1U2RA 3TA1A 1IR1A 1UVIA 1PILA 1CEZA 2PDAA 3R5DA 3DRPB 1N5TA 1NM2A 1D8YA 3DRRB 4OI2A 1PYOB 2GIQA 2F9DA 4JI0J 2PC6A 3ENVA 2NUHA 3R8YA 5E33A 4CYUB 2FJBB 5D15A 3D3BJ 4NE9C 2ZJQQ 4FP9A 1L3SA 3J81U 3GQCA 1IKVB 2HLUA 3T1YJ 4TY8A 1S1TA 3KLIB 1R3NA 3ZO7A 3RW6A 1AB8A 2SXLA 1AFJA 4CLPA 1NO8A 2YPYA 5T7LB 4B3OB 3LWLA 3GV7B 2FHOB 5B0FA 2FVCA 4CRJA 5D6GA 2FVSA 2BQ3A 3R6GB 1E6VB 4E8UA 2J7WA 3DOMA 2RU3A 1DY3A 1MSWD 3GYXB 2F65A 3HZGA 4Y2CA 2XMWA 2IVMA 3VQSA 3D1HA 4U7UD 3OXFA 3EMTA 4HR2A 4X4VA 3NP5A 4ZN3A 1U6BA 4NLRA 4IG0B 3M30B 2HNZA 1WHYA 4F8RA 4PQUA 2GZOA 2ZITA 1L5UA 1S9EB 2OKQA 2HGMA 4IRKA 5IT4A 4RW9A 4ZJQA 1Y10A 4JV1A 5DJBA 2W9CB 2E1MC 5KFTA 3TWZA 1WI6A 2YH0A 1VK3A 4J91A 4DQRA 1U1NA 4DL3A 3BZQA 3KNAA 3PNIA 1HQUA 4DV2J 1RHKB 3DRSB 5CHCB 4Q7AA 3NCPA 2ZM6F 4LBPA 3NBPA 4PZVA 3PRBA 1QAIA 4ZHRB 2VQFJ 1VRUB 1MG7A 5LOQA 3QZ8A 4LSNA 3RTVA 4MAKA 3MCMA 2NXCA 4NI2A 2DGVA 4DR5J 4OMFG 5FJ4A 3P3DA 2QLXA 3IWNC 4N5SA 3K5LA 3KLGA 3N6LA 2MZSA 4DU8A 4AL5A 4O3QA 1V6HA 1R0AA 3GZ7A 3OLAA 5KFOA 3OTOJ 3DLHA 3I56S 4ED6A 3TZXA 1V3RA 2XYPB 2COLA 2E7VA 3MM6B 4ZCMA 4O0NA 2AJ2A 1OY8A 3DHXA 4Z37A 4J9VA 1JJ4A 2EFQA 2CJYB 4C0BA 5F3ZA 2N7YA 1GFWB 1FFWB 2OFGX 3BV8A 4KGVB 1RGVA 3MAAA 3G8TA 4F2SA 4USUA 1GMWD 3HLUA 1CC8A 5C25B 1NK4A 5DQIA 4ZPWR 4NA3A 4ID5B 2LXFA 2VJVA 4RL1A 3MGJA 3H25A 1HHQA 2XYGB 3TYTA 3CJ3A 2FVRA 3ZC4A 4NLPA 4NL5A 3K5OA 2JVOA 2V4JB 2CZ4A 4DR2J 3Q23A 3HHNB 2WVBA 1SB6A 3T5KA 1W2IA 3E3XA 2XZTB 2F63A 3PYDA 4EO8A 1T05B 2MQ8A 1F9EB 2H5JB 4DQIA 4LFAF 5LJ5Y 2AU0A 2YBVA 3C6TB 4CH0S 3L7PA 5HMXA 1SV5A 2W2QP 1ULRA 2ROGA 3HJFA 1WELA 3T19A 3K8WA 2HK3A 3KMQA 3AXMA 1SJ3P 1ZBTA 4WPAA 5K14B 4RW7B 1FKAF 3G6YA 2QX0A 4X66J 2RQCA 4B3MJ 3ZZPA 3M9MB 3IAM9 4BWMA 2BXJA 4YDXA 2WAQD 3CCLS 4R5PB 4RW8A 1YK9A 1RJJA 1ZZNA 2BJ1A 4O3SA 3Q24A 2VQEF 4UOFA 3CCJS 3D4JA 5DS7A 4ECXA 4CH7A 4ED4A 2CQ2A 2J9DA 1S59A 2O01C 3TX8A 3D3CJ 4MTPA 2A2DA 3H2VE 1SH3A 3MR2A 1S1UB 3VWSA 2W9AA 4LUBA 1IBLJ 3MTJA 1MROA 4P10A 2ZJRQ 4O4RA 3GV5B 5ETMA 5SUHA 1VRTB 4DN0A 1GTHA 2AYGA 4NCGA 4G3IA 1A6LA 1HNXF 1EKRA 4NXNF 4OX9J 3W2VA 2IA6A 2YKAA 5J2MA 1TK0A 1FNMA 3W8GA 2KG1A 2BR0A 4LF2A 4PYDA 1N5YB 2M2BA 2ZWOA 1A7GE 3TVZA 2RILA 4DXLA 4OIXA 4ZIVA 3C6UA 2DEIA 4LR7A 3PO4A 4KR0B 1MN7A 3K59A 2XMKA 2BJ8A 4LF7J 1RA7A 3V4MA 1HPZA 1HBOB 1W2BR 2YQ3A 1JLCA 4NEYA 3HSDA 3TJAA 1RBAA 2H1YA 4OLOA 4YFUA 4YEAA 1FKPA 4K4WA 1S7IA 3R5GA 2QJ3A 3LP0A 4C9DA 3I5CA 5B0GA 1CBKA 3KLHB 4JI5J 4MKYA 5HVHA 1FWPA 2EFOA 2LEBA 4NRUA 2DXDA 2D1CA 1T9XA 2RIJA 4ANEA 2DRBA 1UWBB 1HWUA 3JTNA 3IBWA 4UOHA 2DBBA 1K0TA 5IC6B 1BQNB 3PYGA 1QDUB 2RD5C 3AB2B 4RJVA 4I67A 3KK2A 3IS9B 4JI6J 4HDHA 5CYQA 1VOMA 1UCNA 4B08A 4RPFA 3QO9B 2P9EA 4YY3F 5M2RA 2KYZA 2DGQA 4DN9A 4DX7A 4AT1B 2VZ9A 3HX9A 1TQLA 1DLOA 1Q16B 1RAHB 5GADU 1S6PA 4HACA 2RRAA 4DR7J 3LO3A 5L38A 1B64A 3CDBA 3G6VA 3NNAA 1F3VA 2Y1RI 3FZBA 4U7UK 1IKXA 5KFZA 2BABA 4NEZA 4LVNP 1OPZA 4W98A 2W4DA 3HDSA 3EWGA 2IJFA 4TLQA 1OWXA 4I7FA 3HJVA 1RTJA 5E2QA 2F4VF 2VASA 4RU9A 1SH0A 2HVDA 2ACMA 2Z30B 2D9PA 1VQ4S 4P75A 3PHEA 2YTCA 3PV8A 4CT8A 4G1IA 4JBCA 4A47A 4USKA 3EZUA 4K2JA 2UUCJ 1R43A 1REGX 2VF3A 3CJ8A 2CPDA 2XLIA 3IRXB 3CO9A 5CD4H 4GVLA 2W2OP 3S6EA 2MQNA 4JV2A 4IG3A 1N34J 3FSIA 4ZDNA 2ZZTA 2BM0A 1UEKA 2MHEA 4WYWA 2Q1LA 3GV8B 3ZNJ1 2B9WA 1WEZA 3DM2A 3NS7B 4DQQA 1IBKF 5J2PB 2PEHA 2X3GA 4RW4B 3BSNA 4OX7A 5HBMB 4IFYA 4X65J 2ASJA 2CQPA 1G2EA 2HURA 5DDQC 3ZTOA 4C8LA 1KQGB 4XDCA 5L39A 4ZLPA 2E9ZA 1RUSA 3HVRA 1X9MA 3CDEA 4HH1A 1SH2A 2F3JA 2I5JB 4OJGA 1JLFA 2V4QA 3CULA 4X62J 1RT6B 3MD3A 2P9GA 3V6JA 1MU2B 3AJDA 5HN0A 1UEVA 3JAMU 1QM9A 2AMCB 3TI0A 4NMLA 1UVNA 5ETNA 2FTRA 1O8BA 2V0NA 4G1QA 4C4WA 1ICEB 1Y11A 1NKCA 3Q89A 2VD3A 4X4QA 3HFVA 3ZXWA 4QZVB 3R5CA 3GONA 1T8EA 4I4BA 1PAEX 4CT9A 1B3TA 1WSRA 5DLGA 1NSPA 1VQ8S 1G6BA 5GAHU 3PY8A 3ONQA 4ZP8A 4QQBA 2I8EA 4XO0A 2VUGA 1KNZA 4HI2A 1VQ6S 4Y2IA 3ET6A 3NMRA 3BGLA 3TRGA 2J9EA 4LRBA 3M6UA 2IPOB 5T41A 1BQMB 2E1PA 2WBRA 2PFDA 3SCJE 4KQZA 4C3LA 3G6XA 3VAFA 4CO0A 1JLGB 1FF2A 1EETB 3R1HA 1H73A 1N56A 3LWMA 3W2WA 3IFEA 1FO1A 2XB2D 1S1VB 5ADZA 2OPQB 3A12A 3EZOA 3KDNA 4XDDA 1RT4A 5A8KA 3UWTA 1WG4A 1NDLA 3FGVA 3UDLA 4FVMA 3M2RB 2B4PA 1H2TZ 3BGRB 3N5FA 1XNQF 1KSPA 4DLEA 4OYZA 3S7RA 5IZHA 2EFNA 1D1UA 2C2MB 2DHHA 5DDPC 1U1QA 3W61A 2ZH2A 2M0GB 1J5OA 3FVYA 4B3RF 3JSBA 2WK4A 2YXLA 1WC5A 1AZSB 3HP6A 3QMQA 5FLXY 4J37A 1UVJA 2Y9HA 3TOQA 3ZZTA 2CUYA 2FVQA 3VVTA 4KRWA 2QZ8A 5L1IA 2KFNA 2CQCA 2F9JA 1ZETA 3DGPA 2E5GA 2XWYA 3FRZA 2EWHA 2PO4A 3CCRS 3FFIB 3ILJA 3UR0A 2EXUA 2E44A 3H90A 1KVIA 2R2RA 3R7SB 2AGPA 2L48A 1I94F 1K0VA 3F56A 1V5IB 4R0JA 4F0MA 3FMWA 3M8RA 2GAHC 2LXIA 2X1BA 4URGA 2XULA 1VQKS 1H98A 2PMHA 5CYJA 2EFPA 3HHLB 2PN6A 1Q86T 2POKA 2OPRA 1R27B 3V4IA 1FTRA 4UUXA 4PXDA 4IOCQ 2RKIB 1UJ6A 3MR5A 1U2CA 3IMQJ 3DRPA 2J6TA 1HI1A 1TU0B 1LWFB 3PW7A 2FGOA 3GFHA 1SJQA 1M0SA 4NYOA 2XBPA 2W01A 5JJBA 5AT1B 1NXIA 3KLIA 2WZ1A 3UPFA 2UUBF 5D3GB 1CQMA 5T7LA 2MHNA 4O3NA 1FXLA 5JVGQ 4BWJA 3EDQB 3N6NA 3DXBA 2H4YB 3NS6A 2EW9A 2HAIA 1KR4A 2VV5A 1B4SA 1SJRA 3CJKB 2GVDB 4DLGA 1REVB 1FT8A 3OUYB 4ZJOA 3SBMA 1LXJA 1RWKB 4WE1B 3I82A 3HSJA 2C3OA 5CYMB 2N3LA 5CABA 1K44A 1NSKL 3CCQS 4KGKA 3FK4A 3RBXA 1T9UA 4GO5X 1Q1KA 2HFVA 2CRLA 1U7LA 1YJNS 3BJYA 5KT2A 2DHXA 4LFAJ 3P6YC 3FEYB 3U1NA 4CLWA 3M8PA 4LMZA 4EU0A 4OYXA 2Y0BB 4HTJA 1WC1A 4PG8A 4ZHRA 3K58A 1QSLA 2VPZB 2J0WA 4AL7A 1LWCA 4PPDA 4GMKA 2FLLA 3OL6A 3NKYA 2DEJA 2PFFB 2M52A 2AJ0A 2EC0A 4ZK7M 3KLFB 1U1PA 3SV4A 3RB3A 3T6BA 1FRIA 4CDIA 4DV4F 1QD1A 4CO3A 2WOMB 1IN0A 4ELTA 1Q95G 3BYPA 3IG1B 2FJWA 5HL7Q 4K4XA 2VQEJ 3C16A 2ZUGA 1Q78A 4ZPCA 4LREA 3C14A 2VICA 3OHAA 4GC7A 1IM6A 3GP9A 1R8HA 4X2BA 2DNNA 2AJ1A 2XO6A 2BA9A 2XY6A 3ETMA 2YKNA 2QLWA 2LP4A 1KC8T 1KLMB 4IFVB 1HI8A 2M8HA 4OI0A 2CQ0A 1IUJA 1P9YA 3LW5C 2Y3YA 1XR7A 4ID5A 4GO7X 4F0KA 5DQHA 5KG2A 5A8WA 4X4TA 1RWPB 2VG5B 2HIQA 3T41A 5IQ6A 2N3OA 2OELA 4NXNJ 1XMBA 3CJ2A 5EHHA 2GHWA 5L1KA 2HQ3A 2AJQA 5RUBA 1T3NA 2GIRA 3F41A 5KFBA 3VAGA 4K2XA 2NZ4A 3MM7B 3BREA 2AP6A 4DSFA 2ATCB 4U7CA 2RHQB 5KAKA 3BM7A 1NJYA 3ZTQA 2QA4G 3EJMA 4FN5A 3C15B 2VOOA 4PXBA 3GIJA 1Q7YT 4JV5J 3I0SB 1LFPA 5D4LA 3AD7C 2O5DA 3NGSA 2EKYA 1D9AA 2GA7A 2B3TB 3DXSX 1S1XA 3UCGA 3MEKA 5K14A 5ITHA 4YP3A 4PWUA 2D69A 5H1SV 3L4BC 4LR8A 1NAQA 4Q0BA 4WTOB 5HO4A 3HVTA 2QFIA 1GMVA 4DQSA 1CJKA 4Y28C 2KHDA 4CLUA 2DCLA 4WIQA 3RB6A 1TFYA 4MFBA 1QSSA 1WEXA 1U1LA 3CCES 1RSCA 3PZPA 4YY3J 1RWOB 1X4CA 2MKJA 3CJ0A 3GIKA 1JQGA 2QLFB 4LFCJ 2VC1A 5KFUA 4LSLA 1TK5A 4P74A 2I9SA 1V9OA 4ZCKA 2QSWA 1G3OA 5IQQA 1TZ0A 1YJTA 1KLNA 1F9FA 4M5IA 1S1UA 4OYAA 2DT9A 1S10A 2ZH1A 3PIOQ 1WTBA 5A0YB 4N76A 3RRHA 3U1LA 4R8UB 1FRKA 1HARA 4ZCLA 4DPOA 3MXHP 1VISA 2IAJB 1VRTA 1UW9A 2YWFA 2IY5B 2F4VJ 3C8YA 1U8SA 1KTQA 2JL9A 3R27A 2YVSA 2LVWA 1OMSA 1N5YA 2IMOA 4LF9F 3CIZA 3IGVA 2CNKB 2B7BB 1FFGB 3TEGA 3MI7X 5B09A 1H72C 2XNRA 2MGZB 3MMCA 3JSMB 5LM7E 3M6WA 3QRRA 2M4MA 4KH1B 3C3LA 1V3SA 1HBOA 1R8PA 1WHVA 4F2RA 2YKOA 3CTRA 1RWMB 4DG1B 1SL2A 2V2QA 4DEZA 2KT5A 2UXCF 4NLTA 1FERA 2OMOA 5AXNA 3KG0A 5U47A 2BZ2A 2CVIA 5ETQA 3CUNA 2K7KA 1X0PA 3A8KA 1KFDA 3CMAS 1XR6A 2XS7A 3OTBA 2VFTA 4CO5A 1KHVA 1WUUA 2JWNA 1IBKJ 3R6LB 3KJVB 2DO0A 4Q2LA 1ZM9A 3V6HA 2Z57B 1CULA 5LXYA 2JOQA 2GQQA 2DGTA 3Q8SB 3CJQA 2IMWP 3QO9A 3D6TB 4IOBA 1SJ1A 2Q6CA 2ROPA 3HVWA 1HNZF 1SVDA 4L74A 2FC8A 4AXIA 1N6QB 4RBUA 2HWIA 2ZH7A 1WKKA 2CPXA 5GAEI 3ILOA 5J2NA 3G8SA 1VYAA 1IKYA 4ZVGA 2MQQA 2JJ4D 4MKBA 1FJGF 2V8HA 3IC1A 5BR8F 2G1DA 1TTHB 1F5BA 4F67A 3RAXA 4KTQA 4CO1A 2OTJS 5HQMA 3CVKA 2MZ1A 1JXLA 3DLKB 3M32A 3Q8RB 2C2DA 3ZFVA 1DZ5A 3J7YI 4HHHA 2XMJA 4L3KA 4TQRA 4YS2A 1HMVA 4URQU 1FRLA 2CJBA 8AT1B 3FEXB 3IO1A 3WX4A 4NA1A 1N0VC 1KN6A 4DR6F 1WOSA 3Q83A 2WONB 4F3OA 2KXFA 4NLUA 4DPTA 4JYAF 2OAUA 3SZ2A 1UFWA 3DOKB 4QYRA 3HKZD 1PGZA 5HANA 2ZC4A 2M5YA 1TUWA 3TAMB 2KKHA 1C0TB 3AA8A 2AEJA 1URNA 4MYUA 3IR6B 1DQAA 1SI9A 1GXLA 2GVZB 4DL0C 3NOCA 1RHJB 3C66A 3UCUP 3E8OA 3N6MA 5A2QY 1Y7PA 3OFGA 2UZAA 1NMEB 1M5VC 1CSJA 2V69A 3AQPA 3OR1B 2CXEA 3TARA 1HLWA 5J2PA 1T03B 4UQGA 2VFRA 2QL5B 2ZHBA 4NLYA 1YZ7A 1TKZA 4WZMA 4ILLA 5HBMA 1XNQJ 4QIEA 4CM0A 1XMQF 3THVA 5J1NA 2PA3A 4H54A 2JEJA 1SPBP 2C3UA 3IM8A 3BQ0A 4H4KA 3V6DA 2VH7A 4B3RJ 2CAJA 3SQGA 4AQYJ 3P5TL 3OFFA 3GMGA 1WHXA 4OZ1A 2CPYA 2ERRA 2LCWA 4DL2A 2I5JA 2WVDA 4OHZA 2B5JB 2D9OA 2V50A 1FTCA 2E7XA 2O66A 2R8IA 1MU2A 5KG0A 3MD1A 1GX5A 2DK2A 4DR3F 4XPCA 3M2UA 4BC9A 2BANA 5J1PA 5IFMA 1K8AT 4YQWA 5L1JA 2HAFA 2JC0A 3D1QA 4OV1A 3NGUA 5KFKA 2ZJPQ 2GJ2A 1SQFA 2HRUA 2HHTA 3V81A 4P9SA 2HSEB 1I94J 4XIUA 1VGYA 3D6HB 1S1TB 5FLXU 4PABA 2R7XA 2Z4PA 5KG6A 2GHVC 3PKMA 4M5GA 4RZRA 2OIHA 1YRTA 3KG4A 2GJFA 4I68A 5DGBA 3EVMA 3CCTA 3M8YA 5G0RA 2DIUA 2G2YA 2HBRB 1B99A 1EQMA 2RHSB 1ZAWA 1EETA 1HWKA 1GNKA 4B3SF 4DR4F 1FXRA 2HNZB 3IBFB 2GMHA 3HMJG 4PQUB 1BWVA 2V9KA 3IWXA 3UFCX 5BXIA 1S77D 1HW8A 5KG5A 1TKXA 4QIWD 4RW9B 2JC1A 3QGHA 1GTEA 4RWXA 5HROA 2UUBJ 3GFXA 3UD3P 4EMDA 4ZA1A 1HQUB 4USTA 1GH8A 3WC2A 2VFUA 3NBPB 3AY0A 5L9XA 3CC4S 1QSYA 2HK2A 3AT1B 4KGMA 4LSNB 3KLVA 2J9CA 1TR0A 1S9FA 4OHWA 2HHWA 4NI2B 4D3HA 3VZHA 4FF1A 2ZBRA 4TLRA 2XZWA 3JS9A 1JNZB 3MR3A 2BE7D 7FD1A 2LA6A 5J1EA 4O3OA 4PXEA 1R0AB 4FNIA 1RT5A 2QLBB 1UL3A 3HD2A 3W5YA 3I0RA 3GTYX 4OX6A 3FUYA 2H3EB 1RCOB 4FZVA 3PX0A 3RU0A 3T3FA 2A6OA 2FJVA 4KAIA 4JP8A 4IO1A 2EK6A 3O44A 4F4AA 2G9OA 2MLYA 4Q8EA 1LW2A 3E51A 1W7WA 3K5MA 5ETPA 3MAAB 3HVAA 5KTQA 4O3RA 4OI4A 1W25A 5ETSA 5GMEA 3OL7A 2PIIA 2CNOB 2RKIA 3QT8A 5CZVA 4NZ6A 3PFEA 4Y2KA 4DUTA 2IC3A 3CC2S 1LWFA 4JI7F 1OS5A 4DV4J 2D3UA 3D6FB 4V19X 2K7JA 5A6PA 3WIVA 3I55S 1AFIA 1P9QC 3CC7S 3QLHA 2CQBA 2LDIA 2C3YA 1KD1T 4ED5A 3L9ZA 3VVUA 2QFJA 3AOCA 5L46A 3A8EA 5BYQA 4L75A 2JX2A 1N36F 3D2WA 1Q4RA 5KFHA 4WKRA 2N4DA 1CG2A 1YZ6A 3BGUA 1SV5B 3IGNA 4WKYA 1Y5NB 1QVFR 4X64F 5D4OA 5E3PA 2V5HG 4WFYA 1TL1A 1GAOA 2HQDA 3CJKA 2A18A 3NAHA 1U1KA 2OH2A 1TFWA 2JLGA 1FEEA 1F60B 4JB8B 5IT9Y 5ETVA 3T9ZA 5CYMA 3MEDB 5D77A 1RT1A 3TJ8A 5H9EJ 4F4YA 4LSZB 1JLQA 1YRXA 3BR8A 1NZAA 1PG5B 5D4NA 4NXMF 1DRZA 1QY7A 3KTQA 2CJKA 1VDHA 3ILIA 2J0SD 4RW8B 4LF6F 2JRSA 4XPEA 2RQKA 4BC7A 2B4UA 2RNEA 5DM7Q 1QJHA 4ZVUB 2I2YA 5I3PA 1QLNA 4WXWA 2IIHA 1Q8BA 3MAHA 3QGPA 5IT0A 5F8MA 1VC5A 2J5AA 9ATCB 1GMUA 3PRDA 1RAJA 3RGIA 1TMJA 3B6BA 2FDNA 1S72S 2I6WA 3KK1B 4CWBA 2HFNA 3PHTA 1L3VA 2BVZA 3R9LA 1MROB 2NXNA 2G2OA 2ALZA 1ZM3A 5JMNA 5KFLA 1VC0A 3KLFA 2Z2YB 2CQHA 1E6YA 5KFAA 1O0PA 4NCGB 3G86A 3RZAA 2NSCA 4WXOA 4DF8A 2H5IB 2RJZA 2DB1A 5C42B 3SI8A 3M8SA 2O67A 2B4OA 2DHAA 2WOMA 4K8RA 4DR2F 5J2MB 1UW4A 2XHCA 3IG1A 1U1MA 4K4ZA 1S99A 3LP2A 2MEWA 3UVJB 4FYXB 2MDAA 1WG1A 5F8NA 3C6UB 2YNGB 4C0HA 4K5RA 1IQTA 2ZD1A 2OI2A 2DRDA 2Z2MA 1RT2A 1HPZB 1KLMA 4P7VA 1VQ5S 1JLCB 5HI7A 4OHVA 4JUZA 3H5SA 5DDOC 4CIOA 2G0IA 2QEXS 5DDRC 4LF4F 1FKPB 2VG5A 2FQQB 1VMBA 1L3KA 2B56A 4DR1F 4DPUA 2PE8A 1H74A 4PWWA 4XAKA 1XN9A 5F8HA 2KU7A 4TU7A 1SC6A 1QE1A 1Q8KA 2J9DE 2B0GA 4LJMA 3KK2B 4DV0F 3HXMA 4LF9J 5A6WA 5CYQB 2JLEA 4OYBA 2IM2A 1NHUA 2R7SA 3WZ0A 5KT3A 3CO0P 5B0DA 4ED1A 4JI8F 3CD7A 4B02A 5MAOA 4ZVQB 4MKAA 3FBBA 4HACB 3I0SA 3SV3A 1UMJA 3L7OA 2UXCJ 4OYOA 3D0GE 5L1LA 2HBYB 1S4EA 1NPPA 2HW3A 4CLZA 2GO9A 3UDVA 2WSCC 3KKFA 1DBDA 3H98A 3GG0A 4ZVFA 3K8VA 3Q22A 1HBUA 4I7FB 4V1Ak 1WF0A 1RTJB 5HJYA 3CCWA 5CCLA 2Z58B 4M5KA 2YWHA 1UTAA 1TVRA 2R8HA 5CH7B 3H7HB 1VLOA 3GILA 1TP7A 4FYWB 3RW7A 2FD2A 1N5VA 1P27B 3FBFA 3GR1A 1C0UB 1FJGJ 5F8LA 1R89A 3I31A 5BR8J 2V8DA 4KY3A 4QYZJ 5LMUF 4AL6A 4OZ0A 6FD1A 4LRDA 4HYKA 1RU1A 3OV7A 1TL3A 4RBTA 2KJWA 2DH9A 1J5EF 4WP9A 5THWA 1YITS 1X0FA 5KFMA 3QAUA 4RO0A 2C28A 2LQJA 5CA5A 3D28A 3DM2B 2HWTA 3PKYA 5B7WA 4ECRA 2JZ5A 4DR6J 2KRBA 4RBVA 4EZ9A 2KB2A 3BGFA 4JYAJ 3GWCA 3EDRB 2QL7B 3O6QA 4DX6A 4IFYB 2BJ9A 1IKWB 2IVYA 5B0EA 2DGOA 3JQMA 1LK7A 1FI4A 1HA1A 2MGZA 5JVHQ 2RMLA 3W64A 4CLLA 3BO4A 3W8PA 1U6ZA 1M5KC 1LV5A 3CPWR 2WRMA 4DG1A 1UETA 4WU2A 3OJUA 5KFNA 2AYBA 1JLFB 4N47A 2EVZA 1XNRF 1S0NA 2H65B 3ZNUA 2BE2B 4M95A 1J2VA 4MJKA 2PEBA 4KT0C 1NNDA 4WZQA 3LF0A 3OLBA 4KGXB 1N0UA 1KOHA 3JTPA 2V2ZA 1HKAA 2Z56B 2ACYA 4Q2MA 4YUDA 4FXWA 4HL9A 2ZVSA 2EPIA 3J7ZT 1LWXA 3BGOP 1IR0A 2LU1A 3CD5A 2E1CA 1UJ4A 3L7UA 4OI6A 3IR7B 4OJ1A 3W7BA 1XMQJ 3AOAA 5DETA 3AD9C 2KZMA 1RISA 2DIVA 3AD8C 2I38A 4DU7A 4QPXA 4QIFA 4GC6A 5A2QU 2DXEA 4EFAC 5KFDA 1BLUA 3BR9A 2MKYA 2CQ1A 3HT3A 3JQJA 3GYGA 3MECA 1X9WA 5B0AA 4M5NA 4DR3J 1VRQC 4C0OC 4C97A 1XIQA 5KT7A 4EUVA 1TV6A 3D0HE 5C2CA 1ZAVA 4M5HA 2GNKA 2BV3A 2UVUA 4FPIA 3TJ9A 3HO1A 2O1PA 3W2WB 3MUTP 2DISA 3PYEA 2DRAA 1T94A 4DFJA 2G4BA 3J80Y 3QZ7A 5BJRA 2UUTA 2XY5A 3R1LA 1ZH5A 1F2GA 3CF5Q 4H4OA 3PTWA 2R7OA 5A8KB 2GMJA 1JLBB 4DV1F 1C1BA 4U8YA 3M8WA 5DLFA 3DLEB 3SDEA 2QA1A 1SXLA 3NLCA 4TU8A 2X3DA 2AJ4A 3POTB 1ZS6A 1WF2A 1I6JA 1LWEB 2LA4A 1RACB 4QCLA 1ZM2A 3OFEA 5HP1A 2FPHX 1UP1A 4FF4A 3P5BP 1T9WA 4CI0B 2HG4A 2KH9A 4Y00A 1C2PA 3RAMA 4LIRA 1YSJA 3NWRA 1F2HA 2RAQA 1WSVA 1FXDA 2WBMA 1YTYA 4B3SJ 5E5NA 2M88A 4OJHA 4DR4J 3DMJB 1W26A 1N54B 3TVKA 1T7PA 3DGVA 5DRKA 4ELVA 2DITA 1OIAA 2QSFA 4FF2A 1VI7A 2AEMA 1VK8A 1T03A 3R97A 3CW2C 3M05A 4J9QA 3P45B 4DHVA 3D66A 3AAWB 3N01A 4PCQA 1S7HA 1BC6A 3NL0A 3MCNA 3UNYA 3KMSA 2G1HA 3OTEA 4ZJLA 5ETRA 4CLKA 4WTYA 2QO3A 2Z2LA 3BSOA 4ZITA 3CJTA 1U0HA 2LQ5A 1ZA2B 2LQ8A 3ZTPA 2X1GA 2OPRB 4BHQA 3V4IB 2R2SA 2MY7A 1ZYQA 3KUEA 4ECVA 4MIWA 3GFYA 3QIDA 1HQEB 4WYLA 5IM0B 2B9EA 3HHLD 4P2SA 3SCKE 1R0CB 1B0PA 1FVSA 1Y0HA 2HYIB 3MPVA 2KM8C 2IRYA 2C2OB 2YWGA 5I3UA 5GMKa 1R6YA 4NPOA 3LGHA 5D0GA 5C24A 1XMOF 2NPFA 3D68A 1OYDA 5F8GA 1MMDA 1OSCA 3QRPA 3BB5A 4WFNQ 4AD6A 3LANA 4JI7J 4LRAA 3DC2A 2F1FA 2EI5A 1ZOTA 2IYIA 1SJFA 2RE1A 3QBCA 5KFSA 4TU9A 1N36J 3THPA 1FE0A 4EEYA 4DV3F 3UN2A 2RUGA 4F3QA 1S1WB 4KO0A 4RLEA 2BJ7A 1IJEB 4AXJA 3M8PB 3BSAA 4PWDA 2PA8D 4X64J 4CLTA 4JI1F 2ZDPA 2YQ1A 1F1BB 2R4FA 3EXYA 3U1MA 1LWCB 2QA4S 3A3PB 2GQ2A 2A1BA 1YIJS 1HYSA 1RWXB 4J9KA 2GFFA 2AHOB 4M5JA 3R5JB 2UVVA 2ZHAA 1NK7A 4NXMJ 3BN4A 3BN7A 4LF6J 2FHJD 1VBYA 3FQKA 3SCIE 1RWNB 4CNZA 1U24A 3C16B 3HCXA 4V19J 4IR1A 4E0DA 4OYWA 3ITHA 3UDCA 3C14B 4DV5F 1Z1ZA 2HBQB 1XK8A 2J8AA 1X5SA 1NU4A 1H7XA 2VBZA 1CJTA 2DR8A 5IT9U 2YKNB 1RLDA 4RNMA 1XR5A 3S01A 2BMBA 3J7A1 4Q8FA 2MLXA 2MKCA 3J81j 4OZ3A 2YX7A 2CNNB 1R8AA 2Y1IA 5A8WB 2DNOA 3M4XA 2BOAA 1S6OA 2M8DB 4DQPA 4A8MP 2YNIB 4OX8A 3J7Z5 4B9SA 2MQLA 3I5BA 1JKHA 2FC9A 5HJXA 4CLSA 5ETTA 4WFAQ 2RDDA 5KFPA 4QU7A 1ZA1B 3LGMA 1HIYA 1RZMA 3I32A 4UY8T 3W62A 1SBRA 2YWKA 1QUVA 2MQMA 1YBAA 2AIRB 2DNGA 4UOGA 1P1LA 4KIAA 3DDKA 4DOZA 4LT6A 1MW7A 1NPKA 4KC5A 4TKTA 2DNQA 4QR0A 1GQEA 5B0BA 2UUWA 1WJ9A 2CA9A 4NLDA 3NGDA 4LF4J 2ZKTA 2OD4A 2K8GA 3FBEA 2CJAA 4DPYA 1S1XB 4ZMMA 2YKQA 2BOPA 4YB6A 3RYLA 5MLCV 4DR1J 3MTKA 4D3GA 4Q0BB 3HVTB 3EXCX 2W4PA 2CJXB 1SKSA 3OD2A 1CJKB 1JLAA 4QU6A 2YY3A 3MEDA 4USWA 3OVSA 2RRNA 2EG2A 4NLSA 3MM5B 4ETXA 4DV0J 1U26A 4Z2XA 3MMBA 4MFBB 2RQMA 1DTQB 2C22A 4A8XA 2BX6A 2EK1A 1C4CA 1NDKA 4FYYB 4DZDA 3HT0A 1RT3A 3MURP 2HVEA 4JI4F 2QTWA 4ES1A 2DVIA 4JI8J 1IJFB 2FHKA 1LOUA 4J5OA 5KFVA 4ZPVR 4LSLB 2VKRA 3IAS9 2JDJA 4QIVA 4JI2J 1WC3A 3SFGA 1H2UX 1D9DA 1HW9A 1FK9A 3FBCA 4EWTA 2AZ3A 1FDDA 3KK1A 4S0MA 5FDLB 4RR5A 1RT7A 2LYVA 4J9LA 1Q5YA 2VA3A 3AOBA 3T5JA 2EFVA 3DDNA 1KHWA 3OL9A 2DTJA 1PC5A 5HVGA 2ZBIA 2HFZA 3GCWP 2FZGB 5C42A 2QN6B 2E5JA 2FJAB 4H4KC 4C8ZA 4P2XA 3HF5A 5DO2A 3SSQA 2DD8S 1QTNB 3QFHA 1FNOA 3UVJA 2NYHA 4OHXA 3QT7A 4QW8A 4X4UA 2W1BA 2HNDA 1CPZA 2YNGA 4UW2A 2UV8A 3QGGA 3QQCD 3G87A 1B70B 3MMCB 2CNLB 2J8SA 3R7BB 3KLEA 1AROP 5LMUJ 4ZIWA 2XY7A 5CAAA 4JV5F 1U48A 5K8MA 4HTIA 2HVZA 3VQTA 1NK8A 2HNYA 1J5EJ 5IOLA 3PX4A 5H9FJ 3IR5B 2G2ZA 4LBIA 4CLYA 1UZHA 1ZAXA 3JB9k 3G9CA 3M8QA 3ISZA 5IV4A 3KOAA 3RR7A 1YWXA 2J76E 2HLTA 3NCRA 3Q8PB 3I6PA 1UPPA 5LJ3Y 1UWAA 1CULB 4UQTA 4I6AA 2JSXA 1F5AA 4J90A 3IA0A 5LT5A 4GKKF 1APSA 1GMWA 3MDFA 1IWGA 4HHJA 1U02A 1X4BA 2CG8A 3H8YA 4LFCF 4DV6F 2MKHA 2FZKB 3MMAA 4FBUA 2DHSA 5J2NB 1IKYB 4DPWA 3KJNB 2NZCA 2FVPA 4WIIA 3MFHA 2EFGA 4MMOA 4OZ2A 1XNRJ 2XHWA 2N4CA 4DSIA 4PG5A 3EZ5A 4O0IA 1FX4A 2WW8A 5D8HB 3MEGA 2NCKL 4QWBA 3NOGA 3M32B 4IH7A 4KV8A 1RAIB 3QSYB 4FKXA 1HMVB 4I2QA 2E9RX 1NPRA 4CP5A 3FZ2A 1S0VA 1EX8A 1JK9B 1N33F 2LEAA 5EX0A 4NMXA 3OW2R 4NLWA 3EE3A 1LW0A 3AJ1A 3HHKA 2APOA 4ECQA 2ZH8A 1UA0A 5GAGI 3Q8VA 3P4UB 2VIHA 1C0UA 2Q43A 4F25A 3QIPA 1Y4ZB 1NDCA 3JQKA 2V2KA 3PCOB 5JUMA 2OSQA 2MMYA 2JNJA 3PJWA 4WF9Q 4B9UA 4OZNA 4ILMA 2ZH6A 3ZZOA 2XQCA 1X8DA 5HQLA 2FY1A 3SEOA 3TANA 2L9DA 4K0KF 4OLPA 1AA1B 3CE8A 1B0VA 2DNPA 2VPXB 3JXOA 1G4CA 1I3OB 4DV1J 2KVQE 3DRXA 1VQNS 2OEJA 2F7VA 2BM1A 3NCQA 2QYCA 3PIPQ 2J6SA 3PRVA 1TKZB 3QFWA 4MKVA 1NK5A 1U25A 1IKWA 3HHEA 4WFXA 2PI4A 4QWAA 2UXBF 3N9UC 2OHDA 1T95A 3EGNA 3V6DB 2XGQA 3SQGB 3AODA 2U2FA 3AQOA 4BDPA 3MUVP 3X3UA 4L3NA 2VBXA 3J80U 1H0HB 2HWHA 1S12A 1EP4A 3SXLA 1WNEA 2BE2A 1ZTWA 1YX2A 1KKHA 3M2UB 3IWLA 2FLPA 3GJRB 2BANB 2ZH5A 4I56A 1M1HA 2NUUG 1L3TA 4FPRA 2MZRA 1RA6A 1FDNA 4UY85 4K59A 5LSLA 2VG7B 3OR2A 2XC9A 3V81B 3OFHA 1KEKA 4DMZA 1NSQA 2ZUAA 2QG9B 3V6KA 2DPJA 2K1RA 4DCOB 1NSAA 3ENWA 1UZDA 4DV7F 2ZBCA 4KHPF 4UTGA 3ZZUA 2RF2B 4M94A 2XZDB 4YB1P 3M7VA 5G0RB 4KJIA 1UFLA 5K5MA 2BW2A 1S6QA 5KFGA 4FDFA 4K5SA 3KK3A 1RTZA 2HMIB 1HWIA 1XQIA 1TKTB 2F8HA 1OQ3A 2A2CA 4ECYA 4C8OA 1VIXA 2E7WA 2V8PA 1PKUA 1T9VA 3G2XA 4RUBA 2FYXA 2R8JA 3CSKA 1TKXB 4DWIA 3RJMB 1NZ8A 4J9MA 1JLBA 3H4DA 3DCAA 2CVEA 1XTZA 3DLEA 1RE1B 5HROB 1XMOJ 3POTA 3MUMP 1LWEA 2BACA 3RAQA 4AUKA 2B9XA 1OSDA 3A3NB 3HSGA 2OPPA 4G1PA 4DFMA 4J9RA 2CDQA 4AQYF 4EBDA 1Q8IA 3S1TA 3HFKA 2L9NA 2D74B 4DL5A 2CPZA 2IBKA 1PIEA 3OTCA 3CWJA 3DMJA 1FVQA 2KFYA 1NHVA 5AE1A 1ZPVA 4DDFA 1QVGR 4LQ3A 3DLGB 2P6SA 5EWFA 2BKPA 2BRLA 5J1EB 2XO7A 1M5PC 4A8FA 3RB0A 1DURA 1P8GA 1BE4A 1RT5B 2AD9A 4F4ZA 3J7AN 3D54A 2OMLA 3L3CA 3I0RB 3VGVA 4DV3J 2ABYA 2C2KB 2CWXA 2HZCA 3OL8A 1VQSA 4RWWA 2CPEA 5AJ3F 3GR0A 2CZ9A 4PYAA 5D0EA 5IC4B 4JI1J 5K20B 1X4DA 4ZVEA 5DQGA 5HK4A 2ADCA 1LW2B 4AFFA 1VJWA 1HBNA 1J27A 5HATA 2W8LA 1L3UA 2VBWA 3BKUA 2C2NA 1GXUA 4ZP7A 3H40A 3SCLE 1V5VA 3BBFA 4RUHA 2BKNA 2Q79A 3FCWA 3N0VA 5B0CA 3AXKA 3TW0A 4YDDB 2F8EX 2WTFA 3TA0A 1HQEA 2QMWA 4R0EA 3THTA 3VZIA 5IM0A 1OY6A 2IC3B 5E3RA 1TL7A 3SIPB 3L95X 4DCPB 2YNFB 2HQFA 4I6WA 3W5XA 4LBHA 2N82B 3VGUA 3QLHB 1YVFA 2R9LA 5LL6d 1YJ7A 5FD1A 1WHWA 1EQ0A 4DV5J 2RSQA 5IS2A 2VBYA 2FJXA 1B7FA 2KI2A 1M90T 1TUVA 2BYCA 2ZZMA 4WP8A 4BLGA 2FIUA 4K50A 2VA2A 5KT5A 4C8MA 3BO3A 2A10A 1R6VA 1LQ9A 3BBBA 1X31C 2AWZA 3AH6A 1TL1B 4MYTA 3TO8A 2CYYA 1T9TA 4N56A 4TXSA 1KTVA 2LDYA 4TNOA 4TQSA 2XMUA 3DNCA 4NWBA 4PEOA 1RT1B 4E98A 1JLQB 1JJ2R 3CB4A 2PMZD 2KVIA 5J2QB 1I51B 2FGCA 2GX8A 3VAKA 1S76D 1K1QA 2J0QD 1S1WA 2RVJA 4P6QA 5E7OB 4WBFA 2J7KA 2ASDA 4LR9A 3DOLB 3T6JA 3KHGA 2OGUA 4IQXA 5DZ6A 2MZTA 1S79A 1YBTA 4F4XA 4ITSA 4A8SA 3K2YA 4NYPA 5KG1A 2HIYA 2QMUB 4GKJF 2CPFA 5H9FK 2MSTA 4K4TA 1YQHA 4F26A 2DR5A 4ZVHA 1N48A 5A8RA 3VHQA 4OFZA 1PYTA 3QT5A 1WC4A 4K7QA 1E6YB 2E29A 5KOXA 1RTIA 1KQKA 1MN9A 2EKNA 4TN2A 3NGRA 4RX6A 4TYBA 3AJ2A 1RAOA 1P1TA 1OO0B 2BKOA 1N8RT 2WW4A 3WC0A 3MAQA 4LIWA 5K8OA 1CJVA 4C98A 2HHHF 4JI4J 1PO6A 3LP2B 2CJQA 1BQXA 3ADAC 1SQGA 3T1AA 2IA0A 4PR6A 3G82A 2LLZA 3EGWB 5T14A 3MFIA 2ZD1B 2KDOA 1CVJA 3QWUA 1RT2B 1C1CA 1FDAA 3MPDA 3BDEA 2ZHOA 3DLLQ 5EX3A 2ZEJA 4JV0A 5K8NA 1FESA 4C8KA 1HNIA 1SC1B 4J9UE 3TNVA 2YNIA 2UUAF 4J9OA 4OZ5A 1MWQA 2K2PA 5IV3A 4ID8A 1FKOA 4NOHA 3O8WA 4M5LA 1V3ZA 3SQOP 4X4SA 3G6ES 4EBEA 2GQCA 2VOPA 1QE1B 1VQMS 2R42A 1KS2A 3PO5A 5M2UA 4EI2A 4USMA 4U95A 3KHHA 1VJQA 1VS3A 5C7PA 4UOCA 2B8PA 3DYAA 1FEHA 3HI9A 1VHIA 3O2IA 1RKIA 2P8IA 2ZDOA 4DZ6A 2Z0GA 3MM9A 1PYSB 1RHMB 4ILRA 4J7CA 1PJ5A 5IWAF 1RBOB 5KG4A 4P2FA 1S9GA 1WWHA 2CFXA 2R7TA 3CIMA 2Y0SD 5CD4A 2YQ0A 4J9NA 1SUQA 4B9TA 4HDGA 1SIWB 4I6YA 3KYLA 4ZP9A 5AXKA 4U6PA 2VKZG 4EGLA 2M7SA 2ILZA 2RT3A 4ICLA 4DUZF 5DG7A 1QAJA 1HBUB 3MM5A 4USJC 4IKAA 2OEKA 1DTQA 2MPUA 1TMMA 4GKKJ 2Z8QA 5HLFA 5K9FA 1TVRB 1OY9A 1PC4A 1RB0A 1RP5A 2YNHB 1ROFA 4WFBQ 1X4EA 2VL1A 5I4MA 4DV6J 1NUEA 4DL4A 2V8GA 2WHOA 4KBIA 4B9MA 3PJ9A 3SFUA 4DL7A 5AXLA 3G4SS 2Y1LB 3UW1A 3HPOA 2DJWA 5KFEA 1ZZFA 4MT1A 4NX9A 2HZVA 5GAEU 5FDLA 3M1VA 5AE3A 4LVOP 3I4PA 3UN5A 1TL3B 2FZCB 4DUYF 4PUOA 3MCOA 2YH1A 3RBDA 2E5IA 3P96A 3BDPA 4FF3A 3CJ4A 4I2PA 1PBAA 3PG9A 1MLAA 3RUBL 3LOUA 4Q44A 4JI3F 3TZYA 3J7YU 1N33J 3W65A 1NK0A 3MOZA 2EC2A 2YX1A 1YJVA 2RDJA 1T0TV 2AYEA 2L08A 1SQEA 3W60A 1S97A 4KSEB 1CQNA 3K89A 4FYVB 4IH6A 3UD5A 1RAGB 2P2CB 1OQ6A 1TAUA 4OI1A 5F9LA 1U47A 3IN5A 3TEHB 1NEEA 2V67A 3CMQA 4DF4A 2Y8WA 4J9PA 3HHDA 1QAYA 4F7VA 2OTLS 3BQ2A 3O5TB 3A8JA 2ZH9A 3EPGA 5EUHA 3LALA 1WDTA 2VDHA 3LH2S 2JEIA 1A9NB 3G71S 4N77A 5E3CA 4RNNA 3B54A 5FIIA 4UF4A 4K0KJ 4U8VA 2AGQA 3M2VB 2Q66A 2DY1A 3TR5A 4AE5A 2ZOGA 5C5JA 3G8QA 1DJ0A 1UKUA 2HHPA 3OJSA 2D3OR 6AT1B 3FCHA 3WHIA 4KFBA 1FNXH 4PG6A 3P8BB 1DARA 1CJUB 2UXBJ 4USVA 4O4GA 1FJ7A 2KJVA 3CCZA 3WIUA 1S4FA 4ZLNA 3MR6A 2GJIA 2MQPA 1ZPWX 1RWUA 3RBEA 2B4VA 1EHWA 2VODA 2GCFA 3H42A 2BUNA 4M63A 3MECB 3BH7B 1M5HA 1BMQB 1WC6A 3QWPA 3K7RA 3ISND 1Y3KA 2C3PA 1TV6B 2UXDF 4I69A 2C2RA 2Z2ZA 3FKBA 1KVJA 1Q82T 3U7JA 4CCHA 2B43A 1CS4A 3CDAA 1RAAB 4H4OB 3O1LA 4IYQA 2R2UA 3D5MA 5CZXA 4L73A 1C1BB 2UVWA 5BYSA 4QIGA 3TUIC 3SDEB 5KG3A 4OV6A 2GS8A 1SL0A 2DNKA 1VQPS 4DV7J 4FXDA 1IM4A 3SMZA 1D9FA 4KHPJ 3HFZB 2HHQA 3MZIA 2R8GA 1BHNA 1WD6A 4M5DA 2V6AA 5HP1B 1HL6A 2J6UA 2R3VA 1U1RA 4EYIB 2VG6A 3M6VA 1HHSA 2B51A 5D4PA 2K3IA 3GLJA 4MH8A 2ALYB 1I5OB 4KHRA 3ELHA 2WSEC 4C6AA 2Q3PA 4WK3A 4IUFA 4ANDA 1AUDA 3TAPA 1HHTP 4DBQA 3I5AA 1IBMF 4HEA9 2OPSB 2OP5A 3HSZA 2YX4A 2KYXA 2D3ZA 3NGKA 1NLKL 5F8IA 2NXUA 2VPWB 2LXUA 4X4PA 1IBCB 3CCMS 5G4DA 2XG8A 4ZLLA 2R7VA 3H0PA 2WB1D 1PSDA 2F5GA 1X60A 1LK5A 2XLJA 4DS5A 1S49A 5ETLA 4OI3A 3QSIA 1A0OB 1AXQA 5F8JA 1T02A 2V4RA 1JJHA 2AGOA 1U0HB 3T9NA 1FJEB 1RTDB 4IR9A 2UP1A 2JLFA 2VHGA 2MXYA 1B0TA 4XTTA 3NWGA 3O3LA 3MR7A 2MKKA 3VV2B 3LAKA 1G1XA 3U27A 2OUGA 4ZVOB 3Q8UA 1JWWA 5KFCA 1UPMB 5C2GA 4QW9A 3GCXP 1DTTA 2E1AA 2VG7A 2QT7A 3GJTB 2LKZA 3QJPA 1RHQB 3FJ2A 4NLVA 4F36A 1RLCL 1VC6A 1SKRA 4C11A 2DGXA 1D0EA 4RUCA 5AE2A 4HHUA 4KHMA 5AJ3J 3HHLC 5I3UB 3KDOA 5GADI 2RDIA 3CMES 3EVOA 1BUXA 5C24B 2Y1JA 4OJ3A 7AT1B 1UA1A 3D67A 2DNLA 4ECWA 3CCVS 2GC8A 1U45A 2FJEB 4ZPAA 2XSJA 2VB6A 1RCXB 4KKOA 4CO2A 2RF2A 2XLKA 3UI3A 5F41A 3VAJA 2MZQA 3A8IA 1YG0A 1VBZA 4Q43A 3LPEA 1MWZA 4PG4A 1SKUB 3VAIA 2VJUA 5KT6A 2P5VA 2K3KA 2BJEA 4FXVA 7FDRA 3GJSB 2HMIA 1TKTA 2VFSA 4A48A 2HS3A 4F04B 4ED0A 1RBLA 2HRTA 3EICA 3DI6B 3GYNA 5ETOA 2VPYB 1AW0A 3I9V9 3MHYA 3GSDA 2C1EB 4ZVRB 1R31A 3TVYA 3MEEB 2MKIA 2EG1A 1RTHB 1YJUA 1HNWF 3QPIA 4KO0B 5F3TA 1H2VZ 2I0XA 4B3TF 4PXCA 4A8YA 4PWDB 5I42A 4TYAA 3MF5A 2MB0B 2RB7A 1FRMA 5KFIA 3E01B 3GE9A 1JLEB 2W9BA 3MM8B 3DLGA 3D7SB 2V94A 3B4MA 1HYSB 3BYRA 3CXCR 1IWAA 1NDPA 4B9NA 1BXNA 4ERDA 3GSIA 5HMZA 1OPIA 1Q7LB 5KT4A 3E2EA 2ZE2B 3ICLA 4BCAA 9RUBA 3PDNA 1FD8A 1Y00A 5LXRA 1FRHA 2LFVA 1AUSL 3ITHB 3UR3C 1CJTB 5HSPA 3LP1A 3H59A 3QRQA 1BWEA 4GKJJ 5CXTA 2GO8A 2MY8A 5EWGA 2BE9B 4DFKA 1YBUA 3KNGA 3LTOA 4USHA 3I9ZA 2KO1A 2Y8YA 4IDKA 5K8PA 1UVMA 3D1OA 3NY0A 2AF6A 3NS5A 3BS9A 2GV1A 2BJ3A 2QLJB 1U1OA 2VONA 2DO4A 4Q45A 1JKHB 4FS1A 4NCBA 2YNFA 1UAWA 3ENQA 5GAHI 4A4JA 2O3DA 2HHHJ 2M70A 3CNQP 1NK6A 2NS1B 1K9MT 3BH6B 3WX8A 3DKDA 2B9YA 1UFKA 1HD0A 3VALA 3KJFB 3DFEA 3NG8A 3Q86A 1QUPA 1WDDA 2YKMA 4B9LA 2ZM6J 3CDUA 1NJXA 3EGZA 2XNQA 4OYPA 1VQLS 4NZ0A 2FUG9 4KYZA 2KL8A 1BY9A 4YHHF 4N8NA 2WVFA 2RUSA 4W90B 3EVWA 2UV8G 1YDLA 4O44A 1VQYA 3UD4P 2HHUA 3N5BA 3ZTSA 3F73A 4UUWA 2FJDB 3H2LA 1EIYB 2E66A 4NA2A 4QWDA 2UUAJ 1B7YB 3TUZC 2KZZA 3VGSA 1DQ8A 5I3QA 2CDRB 4X4RA 3DRRA 5M2PA 1JLAB 2RS2A 3BSCA 2JEFA 3PX6A 4CYUA 3K17A 4P52A 1CLFA 4ANCA 3MMBB 1FFSB 3GG1A 1Z2ZA 4Y6IA 4LF8F 1JMTA 1IKVA 5J2QA 4EK2A 1RT3B 6FDRA 4FS2A 4QWEA 2V63A 3DOLA 5IWAJ 4B3OA 3VGTA 4C7QA 1KFSA 2JEGA 1NRKA 3PACA 4ECSA 2CQ4A 2MYFA 1FK9B 2H54B 1E6VA 1VIOA 3AFGA 3RG6A 3BKTA 2ILYA 1S0MA 1SC3B 1RT7B 1RI7A 2H48B 2IJNA 3TAQA 3PW0A 3CDWA 4IG0A 3M30A 4KPCA 4G65A 2EBGA 4DUZJ 4DSKA 1X4HA 3BPSP 3PW5A 2ZBQA 5D78A 4IH5A 3QT6A 1S9EA 1T9YA 1Q0NA 4DPXA 1X5PA 1F3FA 2IYGA 2R8KA 4ZPBA 2FB0A 3OSNA 2YKPA 1KDNA 2W9CA 4QR1A 3PEJA 5A76A 2C42A 4DSLA 2NSBA 2GW8A 1H7WA 1JIHA 2HNDB 1TK8A 4C48A 2HEKA 4LF5F 3DRSA 4IQMA 3RRKA 3W1YC 3UN3A 2DR7A 3B8HA 3KLEB 2BW7A 3FEZA 1NHKL 5KFWA 3C19A 3W5ZA 1VRUA 2XS5A
chains in the Genus database with same CATH topology
1HMVB 4I2QA 3GV7B 1TKZA 4WZMA 4ILLA 2FHOB 2W7AA 5HBMA 5B0FA 2E9RX 4QIEA 2FVCA 1O5JA 2HNYB 5D6GA 1XMQF 2FVSA 1HBMB 3THVA 3HK2A 2BQ3A 3FZ2A 1S0VA 5J1NA 2DNZA 1E6VB 2PA3A 4H54A 4RW6B 4A46A 4E8UA 2C3UA 1SJ4P 2JEJA 1JK9B 2J7WA 1N33F 3DOMA 3BQ0A 3M8QB 2RU3A 1MSWD 3DN9A 2LEAA 3GYXB 4H4KA 5EX0A 3OTDA 3HZGA 4Y2CA 2VH7A 3OW2R 3V6DA 1NKBA 4NLWA 2XMWA 3SQGA 2IVMA 3P5TL 2XI3A 3OFFA 3VQSA 5LSOA 3D1HA 4TY9A 1XWLA 3GMGA 1WHXA 3OXFA 2CPYA 4OZ1A 2ERRA 3FSXA 4X4VA 1LW0A 3NP5A 2GMLA 1U6BA 1YRUA 3AJ1A 3K0JA 1N32F 3HHKA 4NLRA 2APOA 2LCWA 4IG0B 4DL2A 2I5JA 3M30B 4ECQA 2HNZA 1WHYA 2B5JB 2D9OA 4OHZA 2ZH8A 1UA0A 5GAGI 3RRGA 1K73T 1FTCA 4F8RA 4PQUA 1XERA 3MM6A 1C0UA 2Q43A 4F25A 2CIMA 2E7XA 4MIBA 2O66A 2R8IA 1MU2A 5KG0A 1L5UA 2ZITA 2CPJA 3QIPA 3MD1A 1Y4ZB 1GX5A 1S9EB 2DK2A 2OKQA 3EUNA 5EGYA 4XPCA 4DR3F 2NLWA 2HGMA 3M2UA 1JB0C 4BC9A 2V2KA 4IRKA 3BF4A 5IT4A 5JUMA 4RW9A 4JV1A 3SYZA 3GIMA 2OSQA 3M9NB 2BANA 2MMYA 5J1PA 5IFMA 1K8AT 3PJWA 4YQWA 5L1JA 1VQ9S 3MMAB 5DJBA 2W9CB 2E1MC 5KFTA 1WI6A 4WF9Q 2YH0A 2JC0A 1VK3A 4OZNA 4B9UA 4ILMA 2ZH6A 4DQRA 3D1QA 1U1NA 3ZZOA 4DL3A 2HFOA 4OV1A 2PGCA 3BZQA 4JI2F 5KFKA 2ZJPQ 1X8DA 3KNAA 2GJ2A 2FY1A 3SEOA 1FRXA 3PNIA 1HR0F 1HQUA 2HRUA 3V81A 2HHTA 5C25A 4CQ1A 3TANA 2V8VA 2L9DA 3DRSB 4ECUA 1JX4A 5CHCB 4XIUA 4Q7AA 2B7CB 4K0KF 3B78A 1FCAA 4OLPA 3NCPA 1VGYA 1Z2LA 3CE8A 1B0VA 2ZM6F 2DNPA 1S1TB 3MEGB 3CD6S 2VPXB 3NBPA 3PRBA 1QAIA 4ZHRB 3DRXA 2R7XA 1VQNS 1FJCA 2F7VA 4KV8B 1VRUB 2BM1A 3NCQA 3QZ8A 2QYCA 2Z4PA 2BJDA 5KG6A 3PIPQ 4LSNA 2DH7A 3RTVA 2J6SA 2GHVC 4MAKA 3KHLA 4I2QB 3PKMA 1TKZB 2DGVA 2V4JA 4RZRA 2OIHA 1NK5A 1U25A 1IKWA 1YRTA 3HHEA 4WFXA 3KG4A 4OMFG 5FJ4A 2IVFB 3P3DA 2QLXA 4I68A 4N5SA 5DGBA 3K5LA 3IWNC 3KLGA 2PI4A 3N6LA 1Y5IB 2KHCA 3CCTA 4QWAA 3TQ1A 2UXBF 3N9UC 4Q5VA 2MZSA 5HMWA 5G0RA 2DIUA 4EO6A 4AL5A 2G0CA 4O3QA 1T05A 1V6HA 1T95A 1R0AA 3GZ7A 3EGNA 3V6DB 3OLAA 2XGQA 1ZAWA 1EETA 1HWKA 3SQGB 5KFOA 2U2FA 3AQOA 3NRBA 3I56S 2R7WA 4ED6A 2DGWA 3DLHA 3MUVP 1GNKA 2YNHA 3X3UA 3NAIA 2XCAA 4L3NA 1MNEA 1V3RA 2XMMA 2VBXA 1JNRB 1LW0B 2FLNA 2COLA 4F4KA 4B3SF 1H0HB 2HWHA 1G7CB 4DR4F 1KQSR 3C6TA 1FXRA 2HNZB 3VAMA 2GMHA 1EP4A 2MJNA 3HMJG 4PQUB 3MM6B 4ZCMA 1LXNA 3SXLA 2V9KA 2IHR1 2QMXA 3PJXA 2MKSA 1WNEA 3DHXA 2BE2A 4Y2AA 1ZTWA 3IWXA 3UFCX 4Z37A 4DSJA 3QIPB 1JJ4A 2ZOFA 1S77D 2B6AB 1HW8A 1TKDA 1UEUA 5KG5A 4USIA 2EFQA 1TKXA 3M2UB 4C0BA 4QIWD 4RW9B 5F3ZA 3IWLA 2N7YA 2JC1A 3QGHA 2FLPA 1GTEA 2A3JA 2BANB 2ZH5A 4I56A 4RWXA 3D0IE 2NUUG 5HROA 1L3TA 2OFGX 2AJFE 2U1AA 3GFXA 4FPRA 1RGVA 4HT5A 2MZRA 3UD3P 3G8TA 1RA6A 4F2SA 1FDNA 2E5HA 4KPYA 4OQJA 4UY85 4K59A 3TUJC 5LSLA 2VG7B 3HLUA 3OR2A 2XC9A 4ZA1A 4EYHB 1HQUB 3V81B 3OFHA 1KEKA 4DMZA 1CC8A 5C25B 1GH8A 3WC2A 1NK4A 4RW7A 5DQIA 3V6KA 2DPJA 4ZPWR 2VFUA 4NA3A 4ID5B 2LXFA 3DHWC 2K1RA 3MGJA 3NBPB 1K1SA 2F8MA 3ENWA 3AY0A 3H25A 5F0WA 2GHPA 1F5CA 5L9XA 3CCUS 3CC4S 4DV7F 1QSYA 2ZBCA 3TYTA 3CJ3A 2FVRA 4KHPF 4R5PA 3ZC4A 4NLPA 1NB7A 4NL5A 4KGMA 4LSNB 3KLVA 3K5OA 2J9CA 4NZ7A 1TR0A 1S9FA 1UVKA 4OHWA 2HHWA 4D3HA 2JVOA 2V4JB 3VZHA 4FF1A 2CZ4A 1YJRA 1HNVB 2DNYA 3Q23A 3HHNB 4NYZA 4TLRA 3ZZUA 2XZWA 3B4DA 1SB6A 2RF2B 4M94A 1JNZB 3T5KA 1W2IA 4YB1P 3E3XA 3MR3A 7FD1A 5G0RB 2GGPB 4KJIA 2LA6A 5J1EA 4EO8A 1UFLA 1RQ0A 1T05B 4O3OA 4PXEA 1U4BA 1R0AB 5K5MA 3CJ5A 2D41A 5CQGA 2BW2A 4J9SA 4FNIA 1RT5A 2DHGA 1S6QA 5KFGA 2IM0A 4K5SA 1UL3A 3KK3A 2HMIB 1HWIA 4DQIA 1TKTB 4LFAF 2XEXA 5LJ5Y 2AU0A 2F8HA 1OQ3A 2A2CA 4ECYA 3C6TB 3M9OB 3I0RA 2RS8A 4OX6A 4CH0S 4C8OA 1VIXA 2E7WA 3L7PA 5HMXA 4EZ6A 1EP4B 1X5OA 4FZVA 1SV5A 3PX0A 1ULRA 2ROGA 3RU0A 2R8JA 3T3FA 3CSKA 2G13A 2XSFA 2FJVA 4FBTA 1KRPA 3HJFA 3ZZYA 1YGYA 1TKXB 1VFJA 1WELA 4KAIA 4DWIA 4J9MA 1JLBA 3H4DA 3T19A 3DCAA 2CVEA 3K8WA 3KMQA 4IO1A 3M2VA 4C2MA 2EK6A 1XTZA 3DLEA 3O44A 1SJ3P 1R7IA 2G9OA 4Q8EA 1ZBTA 2XGPA 1LW2A 3X1LB 5HROB 2HQIA 3IRWP 3Q8QB 5K14B 3E51A 3K5MA 3POTA 3PW2A 3MUMP 3HVAA 5KTQA 1LWEA 3OR2B 2BACA 3RAQA 4AUKA 4O3RA 4OI4A 2B9XA 1OSDA 1W25A 4RW7B 1FKAF 3G6YA 2OPPA 4G1PA 1LFWA 4KB7A 3OL7A 3K57A 2PIIA 4DFMA 2RKIA 3K5PA 4J9RA 2RQCA 2CDQA 2K1RB 5CZVA 3ZZPA 4AQYF 4NZ6A 3M9MB 2ZZNA 3IAM9 4EBDA 1Q8IA 3S1TA 4BWMA 2BXJA 4YDXA 2WAQD 2HHXA 3PFEA 4Y2KA 3HFKA 2L9NA 3CCLS 4R5PB 2D74B 2HS0A 2IC3A 3CC2S 3Q2SC 1LWFA 4DL5A 4RW8A 2CPZA 4JI7F 1OS5A 2IBKA 1RJJA 2D3UA 2FHMA 1ZZNA 4O3SA 4CTAB 3VR1A 4V19X 2K7JA 2QIFA 2M3DA 3Q24A 3OTCA 3CWJA 5A6PA 3DMJA 1FVQA 2KFYA 3I55S 1NJIT 2VQEF 1HD1A 1AFIA 1P9QC 1NHVA 5AE1A 1ZPVA 3CC7S 3QLHA 2CQBA 3CCJS 2LDIA 4DDFA 1QVGR 2C3YA 4H4MB 4LQ3A 3DLGB 1KD1T 2P6SA 5EWFA 4ED5A 2OO4A 4ELUA 1HWJA 2BRLA 5DS7A 2QFJA 1H6KX 5J1EB 4ECXA 2XO7A 4CH7A 2CQ2A 1M5PC 3CD0A 4A8FA 2J9DA 2O01C 3A8EA 1DHMA 3TX8A 3RB0A 2DR9A 5BYQA 1DURA 1P8GA 4MTPA 3KLHA 1WTFA 2JX2A 1N36F 1RT5B 2A2DA 2HPUA 3H2VE 1S6QB 2AD9A 3D2WA 1SH3A 4F4ZA 3KK3B 2L41A 3D54A 2OMLA 3MR2A 3L3CA 5DG8A 1S1UB 4G6VB 1Q4RA 3I0RB 5KFHA 4WKRA 3VWSA 2ABYA 1CG2A 2N4DA 2W9AA 2HVIA 3BGUA 4LUBA 3MTJA 1SV5B 4F4WA 3IGNA 2HZCA 1MROA 4WKYA 3OL8A 1Y5NB 1QVFR 1UWBA 1VQSA 5E3AA 4X64F 4RWWA 5D4OA 2CPEA 5AJ3F 1X4GA 2BQUA 2KT2A 1BQNA 3GR0A 4O4RA 4X84A 5E3PA 2V5HG 3V5RA 2ZJRQ 1XC9A 3GV5B 2C2EA 4WFYA 5SUHA 3IS9A 3TA2A 4PRFA 1VRTB 4DN0A 1TL1A 2IRUA 1GAOA 4R25A 1GTHA 2AYGA 1N4LA 1X4DA 4ZVEA 2A18A 3CJKA 5DQGA 1XEZA 2L3MA 3NAHA 4NCGA 1N52B 1U1KA 4G3IA 2OH2A 1A6LA 1TFWA 2ADCA 1HNXF 1LW2B 2JLGA 4NXNF 4AFFA 1VJWA 1CC7A 1FEEA 1HBNA 1F60B 2W8LA 3W2VA 2IA6A 2YKAA 5J2MA 1TK0A 1U6FA 1L3UA 5DM6Q 2VBWA 1FNMA 5IT9Y 2KG1A 1GXUA 2BR0A 4ZP7A 4IRDA 3H40A 3SCLE 1N5YB 4F3MA 3T9ZA 2OPPB 2M2BA 5CYMA 3MEDB 1A7GE 3TVZA 4RUHA 2ADBA 2Q79A 5D77A 2LMIA 3N0VA 2RILA 5B0CA 1RT1A 5H9EJ 4F4YA 3TW0A 4YDDB 3MPWA 2F8EX 3PVXA 1JLQA 2WTFA 3TA0A 1YRXA 1HQEA 2QMWA 3BR8A 1NZAA 4OIXA 5D4NA 3C6UA 4R0EA 1DRZA 4NXMF 3PO4A 1QY7A 3THTA 3VZIA 5IM0A 2QE5A 3KTQA 1Q8LA 4KR0B 3ZZ0A 2CJKA 3K59A 2IC3B 5E3RA 2XMKA 2J0SD 4RW8B 4LF6F 2JRSA 2XMTA 4XPEA 1RKJA 1RA7A 3V4MA 1HPZA 2RQKA 1BGXT 1HBOB 1Q81T 3L95X 2YNFB 1W2BR 2MQOA 2YQ3A 4I6WA 1JLCA 4BC7A 2B4UA 4YOEA 2RNEA 2N82B 3WBZA 3QLHB 5DM7Q 1QJHA 2DCUB 3FNNA 2I2YA 1YVFA 5I3PA 4OLOA 2Q6BA 2R9LA 4YFUA 4YEAA 1QLNA 2HVHA 4WXWA 2KT3A 1FKPA 1Q8BA 3MAHA 3QGPA 5IT0A 5F8MA 5LL6d 1VC5A 4K4WA 3LP0A 5FD1A 2J5AA 4C9DA 1WHWA 2JFDA 3I5CA 3PRDA 2JHEA 1RAJA 2OPSA 5B0GA 3KLHB 4X4OA 4ECTA 2RSQA 2UU9F 4ED7A 2FDNA 4MKYA 5IS2A 3CCSS 2VBYA 2FJXA 1S72S 4DL6A 1B7FA 4LFBF 2KI2A 1M90T 1TUVA 4CO4A 2EFOA 3KK1B 2LEBA 4NRUA 3H5XA 2HFNA 2BYCA 2ZZMA 1L3VA 2J7UA 2D1CA 2FIUA 2BVZA 5KFQA 3F44A 4K50A 2RIJA 2VA2A 3G96A 5E41A 2DRBA 1MROB 5KT5A 1UWBB 4C8MA 1HWUA 3JTNA 1ZM3A 2A10A 3BO3A 4HT7A 3IBWA 5KFLA 2ALZA 1VC0A 2DBBA 1LQ9A 1K0TA 2W7PA 1BQNB 2AWZA 2HGLA 2RD5C 2ZC3A 3AB2B 4YR3A 3KLFA 2OSRA 4I67A 3JYTB 2CQHA 3KK2A 3AH6A 1UJ5A 3IS9B 1E6YA 1K0VA 1TL1B 5KFAA 4HDHA 5CYQA 1Z4UA 4NRTA 1O0PA 4NCGB 3G86A 3RZAA 1VOMA 2NSCA 4O3PA 4WXOA 4MYTA 4DF8A 3TO8A 2LU2A 2RJZA 2CYYA 2DB1A 2ZNYA 4B08A 5C42B 4TXSA 4N56A 3M8SA 2O67A 3SI8A 3QO9B 2P9EA 2B4OA 4YY3F 2DHAA 2WOMA 3IRXA 1HBNB 1KTVA 2XCPA 4DR2F 2IM3A 5M2RA 5J2MB 2KYZA 1RDRA 1UW4A 2DGQA 2LDYA 4TNOA 3A1YG 4DN9A 3RR8A 4TQSA 3IG1A 2H9ZA 1U1MA 4K4ZA 2XMUA 3DNCA 1S99A 2VZ9A 3HX9A 1TQLA 1RTDA 4NWBA 1DLOA 3LP2A 1Q16B 4HH0A 1YI2S 5JXSA 5GADU 3I87A 1S6PA 2DNMA 1RT1B 2RRAA 4E98A 2X51A 1DQ9A 2MDAA 1WG1A 5F8NA 1JLQB 3LO3A 5L38A 1B64A 2MJUA 3C6UB 2YNGB 4C0HA 4K5RA 1IQTA 4ED2A 1JJ2R 3CDBA 3G6VA 3NNAA 3CB4A 2ZD1A 2PMZD 2KVIA 2Y1RI 3S8SA 3FZBA 5J2QB 2FGCA 2GX8A 2Z2MA 1IKXA 1RT2A 2IBOA 4U7UK 3VAKA 1S76D 1HPZB 1KLMA 5KFZA 1K1QA 2BABA 4P7VA 1VQ5S 2J0QD 1S1WA 4LVNP 1OPZA 2RVJA 1JLCB 4P6QA 5E7OB 2W4DA 5HI7A 4OHVA 4JUZA 4RW4A 2J7KA 2ASDA 3H5SA 5DDOC 4CIOA 1Q79A 2ZNZA 3DOLB 3HDSA 3T6JA 2QEXS 5DDRC 3KHGA 4IQXA 4LF4F 2E5LF 1FKPB 2IJFA 3SSSA 2MZTA 1S79A 4TLQA 1OWXA 4F4XA 4ITSA 4A8SA 3K2YA 4NYPA 2JH3A 4I7FA 5KG1A 2VG5A 1RTJA 5E2QA 3PW4A 2F4VF 2VASA 4FVCA 1VMBA 1L3KA 2B56A 4RU9A 4GKJF 4DR1F 1SH0A 2CPFA 2PE8A 5F0UA 4XAKA 2MSTA 1URRA 3PM9A 4ZPTR 2RU9A 2D9PA 4K4TA 1XN9A 1YQHA 1VQ4S 3W3SA 4F26A 2KU7A 5F8HA 4TU7A 3PHEA 1SC6A 1QAXA 2YTCA 4ZVHA 4C3KA 2DR5A 1S48A 4CT8A 3PV8A 4G1IA 5A8RA 1QE1A 4JBCA 4A47A 1N48A 4DX8H 3NNCA 2J9DE 2B0GA 4LJMA 4OFZA 3EZUA 3KK2B 4DV0F 3UE2A 3HXMA 1E6YB 2E29A 5KOXA