2NXUA

Atomic structure of translation initiation factor aif2 beta-subunit from archaebacteria sulfolobus solfataricus: high resolution nmr in solution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
134
structure length
134
Chain Sequence
EYVEMLDRLYSKLPEKGRKEGTQSLPNMIILNIGNTTIIRNFAEYCDRIRREDKICMKYLLKELAAPGNVDDKGELVIQGKFSSQVINTLMERFLKAYVECSTCKSLDTILKKEKKSWYIVCLACGAQTPVKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 beta subunit
publication title Solution structure of the beta-subunit of the translation initiation factor aIF2 from archaebacteria Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 26
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nxuA01
2NXUA 1NEEA 2D74B 2DCUB
chains in the Genus database with same CATH superfamily
3HO1A 2HG4A 4K50A 1PG5B 3MGJA 1HQ2A 3F41A 5SUHA 2MLYA 5J2PA 4ZPWR 1D1UA 4KR0B 3MM7B 3ITHB 1GXTA 2JC1A 1UEKA 4NI2A 1PIEA 1CSJA 2UUAF 2YH1A 4KKOA 1WELA 2F8EX 3SIPB 4WP9A 1TAQA 2D9PA 4EFAC 4DQSA 2O66A 4M5GA 5EX3A 4FF1A 4IFYB 1SKSA 2Z2LA 4DS4A 1ZM3A 3WBZA 1CQMA 2NUHA 4RNNA 5DLGA 3PX6A 3OTOJ 4FKYA 4LFCF 3LANA 2RJZA 4KPCA 2VPZB 3M2VB 1HWJA 2BX6A 2OUGA 1X9SA 1RQ0A 4QPTA 2YQ3A 3Q83A 1PYOB 4RBVA 1XWLA 3HSJA 1FCAA 3CIZA 3VWSA 4HACB 1XBWA 3IWXA 3QGGA 5F8IA 2HHHF 4CRJA 4RUHA 4OI4A 1SQGA 3H2VE 1U0HA 5KG2A 5F8MA 2HVIA 3D0IE 5LJ5Y 3SBMA 1RB0A 6FD1A 2PI5A 3KDNA 2RSQA 2V34A 3I87A 4I2PA 2Y1JA 2BE7D 2W4CA 4CO3A 2BA9A 3BKTA 1RT3B 4LF1A 1YJ7A 2CJKA 5G0RA 2GAHC 2C2MB 4PUOA 2X1FA 2BR0A 5IQQA 5F0WA 2XC9A 3BKUA 1VQSA 5HAOA 1OY6A 1S9EA 1SVDA 2BQ3A 4PXBA 5GAGU 3RYLA 3AODA 4FP9A 5D3GA 4USTA 2RDDA 2DNMA 1FK9A 4X4OA 2QN6B 4LRDA 2LVWA 1YDLA 5D0RA 2BM1A 3F73A 2DXEA 1T95A 1JK9B 3DI6A 2FGCA 4I1TA 1S1TB 2RIJA 3H5YA 2UXCJ 1K1QA 4A8QA 2ZVSA 2ILZA 1VQOS 4X4UA 1WI8A 2Y1RI 5LMNF 1VRQC 2QSWA 3WX8A 5A8KB 1YWXA 3JSMB 2HWIA 1VLYA 3ZZRA 5HL7Q 2NPFA 1XMQJ 1TKXB 4WFAQ 1HI0P 2KH9A 4GVLA 5B08A 5ETMA 3UO0A 3K58A 1WHWA 1EKRA 1UEUA 4Y0FA 3G8QA 4EUVA 4L72B 1KQSR 4V1Ak 2KU7A 1JLQB 1N36F 1VGYA 4S0MA 2GVZB 2QIFA 1RT4A 2CPFA 2VKZG 3OL7A 2N4CA 4BDPA 1QSYA 3D7SB 2DGTA 1KSPA 1XNQJ 1U6ZA 2Q1LA 4QIGA 4HI1A 4C0BA 2MGZA 2J8AA 1C0TB 1TL4A 4KAIA 4FS2A 2E9RX 2FQQB 1X8DA 1U6BA 3M30B 2FC8A 4LRBA 5KOXA 2HZAA 4NX9A 2VG5B 5THWA 4QWBA 2YH0A 2GJIA 5HVFA 5IV3A 2EBGA 2B9WA 3IM9A 4DPXA 1M1HA 3MR3A 3I0RA 1YRUA 5KFTA 4MAKA 2B4PA 2DEIA 3FQLA 5J1NA 3S01A 1RAJA 2JZ5A 5D6GA 2OD4A 2FTRA 3EICA 4FYVB 1GMWD 4C9DA 1TUGB 4A4JA 2KHCA 1NHUA 1N4LA 2NXNA 1S1UA 4JI3J 2OFHX 2AV5A 2XLJA 3QT6A 4KO0A 2AKWB 2XTJP 4YDDB 3I9V9 4LSNA 4DL2A 1T03B 1HQEB 2W01A 2NREA 4B9NA 5J2QA 3HVAA 2ADBA 3QZ8A 2HIQA 2AT1B 4JI4J 3WHIA 4ZCMA 2MQOA 2E5GA 5KFIA 2U2FA 1AT1B 3MUMP 3ZZTA 3RRKA 1YVFA 4DF8A 3ENAA 3IRWP 3P5BP 3U27A 1VMBA 2V4RA 1NUEA 4OI6A 5LM7E 3SDEB 2YKNA 2PGCA 3OFEA 2XMKA 4GRSA 3DLKA 4DFPA 2W24A 1Y5NB 3T6JA 2GZOA 2BRLA 1M1KT 2BEFA 1CPZA 3QLHA 1DZ5A 4P6QA 3HJFA 3MM6B 3HSDA 4NYZA 4CCHA 4LRAA 2N82B 1I6JA 3CJRA 4ZP8A 2KFZA 3O5TB 3JSRA 4DSLA 3TAMA 3CDAA 4JV2A 1EAYC 1U2FA 3JSBA 3HT0A 3UD5A 2R7XA 4KGVB 5DGAA 4J91A 4U8YA 4DN9A 1RAHB 1D9AA 4DBQA 2V0NA 1CQNA 2WVEA 5B0GA 1FNXH 1CC8A 3QIDA 4LFBJ 2YX7A 1VISA 5C25A 2AZ3A 2FLOA 3GFHA 3N5FA 5E3CA 4UOHA 4OL8A 5E3QA 1U49A 3CULA 4WK3A 1OJ4A 4PG7A 2OH2A 2QA4S 1IBKF 4X4RA 4IKAA 3C3LA 4DV0J 2QLXA 4NLWA 2VG6A 2Z57B 3QQCD 4JI1F 4B17A 3MURP 2MPUA 2BOPA 3PYEA 2B8PA 2YNIB 3PIOQ 1S6UA 3AOBA 2B6AB 3TQEA 3KLIB 1TV6A 4QYZK 3NP5A 1RTIA 1FFWB 1S5ZA 3Q8UA 4WU3A 5DG8A 1CVJA 1CJUA 1S4FA 4KV8A 4FS1A 1Z1ZA 3POTB 3MEDA 4NZ7A 3EXYA 2OPQA 1T7PA 3W8PA 4GO5X 4DPWA 2PO4A 4YHHJ 4Q44A 2HBZB 1LWCB 2FYXA 3HKWA 3SSQA 2BQRA 5IS2A 1J27A 2YNHA 1TTHB 5A8WB 2IYIA 1AA1B 4ES1A 3B78A 1WKKA 3TAQA 4B3TF 3MM5B 1F1BB 2V8HA 3W8GA 5EX0A 1TKZA 3DLGB 2HPUA 2G4BA 2BJ9A 1ZAWA 1JKHA 1BQMB 3RBDA 3A4TA 4P10A 1Y10A 1TL7A 4IG3A 4RBTA 2MQ8A 1WSVA 3ILOA 4DL7A 1LWFB 3DDNA 4ELTA 4EEYA 1XNRJ 3R7BB 4A8SA 1IKYA 4WK1A 3NG8A 1LNQA 2W9CB 2LQ5A 2FHJA 2C1EB 4RW7B 1FRMA 3T5LA 3BQ0A 1UJ5A 1C4AA 2F65A 4LBIA 4DR4J 1GXUA 2GO8A 1NK6A 3US5A 4M63A 2IJRA 1S1VA 1RTDB 3SQOP 1JLBA 2HFVA 4EO6A 1NO8A 3IWNC 3D28A 1NHKL 3ELHA 3W2VB 4NPOA 1E6YA 1H98A 3G8TA 3C14A 4UQTA 4XPCA 1J5OB 4ES2A 2ADCA 3MD1A 3LGMA 3TNVA 3NMRA 3GFZA 1D3WA 2VQEJ 2BYCA 1SKUB 2QRRA 5DDOC 4ETZA 2V8VA 4EBCA 1O8BA 5BR8J 3W62A 2ZH5A 1G4CA 3W65A 1EP4B 3BO2A 2CFXA 2EEYA 4EU0A 3PYFA 2EC0A 3D3BJ 1RTHA 4YB6A 1RCOB 1ZZFA 1HNWF 3HFKA 2VL1A 5FLXU 2CQBA 4J9SA 3FMBA 5HANA 1WTBA 3CMAS 3M8ZA 3ZNJ1 3UNGC 1GEHA 1RE1B 3TI0A 2JFKA 3CJ0A 1F2GA 1D09B 5JVGQ 5KTQA 4B02A 1IBMJ 2OMLA 1VQ8S 1NEEA 1C2PA 4P2XA 3U1NA 2E5LF 3OTEA 2WRMA 2YNFA 2C2DA 1GK8A 3KK2A 5KFVA 2XS2A 4PABA 3FZBA 3AA8A 4MJKA 2F4VJ 3AY0A 2W7AA 2C2NA 3D2WA 4YB7A 2V94A 4PQUB 1PO6A 2R7RA 1NNDA 3GTYX 4Y2CA 2XCAA 3PYDA 2VA3A 2XMTA 3KWMA 1UWBA 8RUCA 2VFVA 2M8DB 2KTQA 1BWEA 2Z2YB 2FJXA 4CP5A 2CPXA 5HN0A 1SL2A 1JLGB 5IT4A 3BQ2A 3KJVA 3U02A 3HVTA 2D3ZA 3W2WA 5I3PA 2CKWA 4OYBA 3TRGA 1WSRA 1HKAA 3HJVA 3ZZOA 3M32B 3WC0A 4WU2A 3MMAB 3D9BA 1KP6A 3VVTA 4USWA 4Z37A 4U96A 3R2CJ 2QG9B 1YLXA 2JDJA 4P9SA 4ANCA 2VBZA 2L9WA 1VQ5S 3CE8A 4MIWA 3KK3A 3LWMA 2V2VA 2YPZA 1JXVA 2C2RA 1JWWA 2EC2A 2GFFA 4F4AA 3OR1B 5D4LA 3MUVP 1M5KC 4IR1A 5BYQA 5HMWA 2HMIA 2DITA 4KFBB 4NXMJ 1YJUA 2OPSA 2I38A 1RT2A 2MZRA 4DX5A 1S1XB 4FXWA 4HTIA 3TJ9A 5HLFA 3IMQJ 4DWIA 3DRYA 2OTLS 4BCAA 4A8FA 1U02A 5HK4A 2B56A 3JYTB 4NOHA 1O6XA 3FBBA 1CEZA 2FVSA 3KLHA 3NCRA 4RW8A 5J2PB 2D3OR 3DOKA 4N76A 4LUBA 2G0CA 1WTFA 2VG7A 2V2ZA 3JAMU 2HSEB 4NI2B 4O3OA 3CVKA 4LMZA 3CD0A 3KLEA 3KYLA 4KKOB 4QYZJ 1P6TA 5FIIA 4UTGA 4CO1A 5CXTA 2R2RA 1X31C 2J5AA 3H2UB 3WX4A 3H4BA 1BLUA 4ID5A 3CO9A 1YBAA 4XAKA 4JYAJ 4A8XA 2VHGA 4F4ZA 1QD1A 3L7PA 5DDQC 4IO9Q 1XC9A 1QE1A 4AYBD 3W5YA 4J9NA 2QV6A 1C1BA 3PR5B 3NEKA 1S10A 1BQNA 4EBEA 3M6XA 2KHDA 4MKYA 2VU5A 1Y3KA 1RWUA 1HIYA 1Q81T 3HHLD 1U0HB 1FDDA 2DXFA 3NNAA 3FCVA 3NGTA 5A6PA 2RNEA 2RS2A 4I2PB 3RW6A 1WC6A 1B99A 1AUDA 4ZVOB 1KR4A 1T9XA 5CA5A 5KFQA 2QZ8A 2DRDA 5G0RB 1X4DA 4C0OC 2FJAB 1FRKA 1WC1A 4NA1A 3L95X 2VUGA 4RWXA 4NLSA 4PUOB 2KT3A 3HHNB 2F7VA 4HH0A 2CXEA 3SSSA 4W92B 4E0DA 5KFFA 2M7SA 1RAFB 3A8IA 4C3LA 3B4DA 1IKXA 4JI6F 5K8NA 5D3GB 3GJRB 4FNIA 1U09A 2XI3A 3HDSA 2V67A 1TUWA 1EB0A 3R6GB 3DDKA 2B3TB 1FK9B 3SFGA 2H3EB 4CLUA 3D6FB 3R3TA 1N33J 3Q8PB 4IYQA 1NJXA 3DI6B 2OGUA 4DUTA 4DR5J 1GMVA 4BC7A 4JOUA 4OYOA 3TP2A 1SJRA 1WDDA 1Y4ZB 3TEGA 2CRLA 3PFEA 1HPZA 5I3UA 2GAGC 2UXBJ 2YXLA 5K14B 2DISA 3Q8YA 1UPPA 4OZ0A 4WTOB 4ZPVR 3ISND 3KLVA 1R6VA 5IC4B 2QLFB 4TU9A 4USJC 3DM2A 2CJBA 4E8UA 2KN4A 4RZRA 3KHGA 1IJFB 2SXLA 2Z4PA 2NPIA 5CCMA 3FRYA 3BGRA 4QIFA 2LYVA 2BXJA 1S0OA 3LH2S 2BQUA 4W4MA 4PYDA 4AQYF 4I6WA 3D1HA 2CAJA 1WC5A 4ZVHA 3CMQA 1N34J 1T0TV 2J76E 4LIRA 5DG7A 2MGZB 3T1YF 2QJ3A 3Q8RB 2RAQA 2UUCF 4FYWB 2NSBA 2Q3PA 3CJ5A 1CULA 3G96A 2ABYA 4ZIWA 2RS8A 2IVMA 5KG4A 4MYUA 2AJQA 4KE5A 1SJ4P 4O44B 4QWDA 5GMEA 4RU2A 2NSCA 2RRNA 1F9HA 3V4IA 2VBWA 2VDHA 4PYAA 4DV3F 4WYWA 4D3GA 3ZZPA 4ES3A 4H4KC 2DHGA 2YVSA 3I0RB 1SJQA 1QUPA 2MHNA 2H65B 2CG4A 2CDRB 2XO7A 3FK4A 4URSA 4L73A 3OL8A 3J7AN 3ISZA 1N52B 2O67A 1JXLA 1M5OC 4ZIVA 5HQLA 2FLPA 2CQ2A 3ZC4A 4UUWA 2IM0A 4ZK7M 1R8HA 3MR6A 2JLGA 1REGX 2CWKA 4K4UA 3NGDA 2A18A 4KO0B 4LRFA 3CB4A 3CCVS 2QYCA 1H3DA 2UVUA 1X7VA 3GIMA 2CJYB 4PG6A 4LSNB 2C2ZB 3P3DA 1HBNA 3OD2A 5J2QB 2DNYA 4DU8A 3UCZP 2APOA 4B3MJ 2RUGA 1SKRA 2HHXA 5CYMA 2HRUA 5F8JA 4K4YA 4LF6J 4F02A 3OT9A 4FN5A 5ETRA 4DCPB 2YKNB 3QSYB 1U4BA 1JNRB 4DR6F 2DH8A 3IN5A 3FJ2A 3QLHB 3A8JA 1NJWA 2HW3A 4HI2A 1S0NA 3CJKA 4NLRA 1DY3A 2CVIA 2WTFA 2IBOA 2EG2A 3LW5C 1Y9OA 1HBOA 1TQLA 1VBXA 4TKTA 5IWAF 3HFVA 4ZVFA 2AGOA 3CJ3A 3M8RA 4RX6A 3O8WA 1RI7A 2FC9A 3C2PA 3H2LA 4KBIA 3EWGA 1HNXF 3LWLA 2YKOA 3MPYA 2BOAA 4ICLA 1H7WA 1XIQA 3J80U 3IR6B 3GE9A 1U48A 4AL5A 3RTVA 5EDWA 4YB1P 3RB0A 2GV1A 2DCLA 4AXJA 4F04B 1OSCA 1TKDA 4DUYF 1RWWB 2H51B 3K8VA 4B3SF 3Q0AA 1M5VC 2VG6B 1YQHA 1WHXA 2E7VA 3MR7A 4F2SA 4WXOA 2IJNA 2ZHOA 2CYYA 4IQMA 3DKDA 1TV6B 1S6PB 3RR8A 5B0CA 2XSJA 1RTIB 3J81U 3H40A 4F4WA 2QTWA 1LV5A 2LQ9A 1WG1A 1CJUB 4N5SA 1PC4A 2NUUG 2JEGA 4KV8B 4WFBQ 2BVZA 1OO0B 2GHPA 3MEDB 2ZBQA 4IDKA 3Q24A 3G2XA 2VPWB 2OPQB 4HVZA 3E01A 3CTRA 2IVFB 5T7LA 3ADAC 5H9FJ 2YNHB 2MQLA 2R7SA 1N5VA 1ZOTA 1RGVA 3GR0A 4GO7X 1XJWB 2ZH1A 1TKZB 5KT5A 2OAUA 2EWHA 4RUCA 4WKRA 2F9JA 3KMSA 1JKHB 3VAIA 1V5IB 1YIJS 3BDPA 1TL7B 1WEZA 5KFGA 4IG3B 2OMOA 3UW1A 1XERA 1ZH5A 2KO1A 1CBKA 1IKYB 5LSLA 1S6QB 5IT9U 2MY7A 1F2HA 1FESA 3UNYA 4FVMA 1VK3A 4UZCA 3HHLC 2Y1LB 3MHYA 2HGMA 3SQGB 4F36A 4X62J 4A48A 1NXIA 2J9EA 2MLXA 2GCFA 4WFXA 1C4CA 4ZP6A 1KS2A 4ZLNA 1V6HA 3T9NA 1ZM9A 1V3RA 4J9UE 3ZFVA 4QWEA 4IQXA 2UUTA 1S1VB 3HM9A 5DLFA 3V6DA 1FWLA 5ETLA 3G86A 2EK6A 2YKPA 4OYIA 1N8RT 5SZTA 1NPKA 2XNRA 1KNZA 4CO5A 4ZVGA 5HVHA 2PSZA 1IBCB 3DFEA 1E6YB 3AT1B 1Q82T 3C14B 1X0PA 2ASYA 2UXCF 4UQGA 3GYGA 1RP5A 3PEJA 1HWUA 4GMKA 3PW7A 1HWKA 1HR0J 4Q45A 4NLYA 4X65F 1F9EB 3DYAA 2BACA 1RYRA 1QAYA 2ZD1A 1YITS 3R5CA 2WSEC 2KM8B 4X4SA 4IOBA 4O4GB 3AOCA 3JB9k 2G9OA 4K5SA 4HLBA 4UOCA 2FVCA 2KYXA 1NPPA 2DB1A 2NXEA 1DAXA 1SV5A 2DVIA 1RTHB 4DR7F 3VQSA 1CLFA 3NNHA 3ISNC 1U6FA 2C2OB 2MHEA 4JV1A 1NKCA 2I5JA 3MCSA 4F26A 4ZCLA 1MROA 3MTKA 1VJWA 2BV3A 2NYHA 4RNMA 3OTDA 3GP9A 1J5EF 1IXKA 5CABA 1LQ9A 3H90A 1FJ7A 3CCZA 2YNFB 2N7CA 4AT1B 3KK2B 3H4DA 1MWZA 1FDAA 1VQ6S 3H5SA 4AL7A 4ZPTR 3ZNUA 3TAPA 4UF4A 3DRRA 5F9LA 3NAIA 2LP4A 4WWSA 4CH0S 3C66A 3C46A 1U2CA 2K8GA 3VTIA 1U45A 3D5MA 2FB0A 1PILA 2E5HA 5DZ6A 1YJRA 1S48A 1MG7A 1UWBB 2UU9F 2BABA 2JJ4D 1RAEB 2XEXA 5AE2A 5HMYA 2KJVA 2IA6A 1EQMA 5GAEU 5HROA 1FX4A 3QJJA 3KJVB 3MUTP 1K73T 2UZAA 4QIEA 3HVTB 3DU6A 1BUXA 2O5DA 3D67A 2EKYA 5EN1A 3EZ5A 4JI3F 3W2WB 2XMMA 1YGYA 4G1PA 4O4RA 4XTTA 1VBYA 2ZM6J 3BGUA 2JOQA 1T02A 1FFSB 1PAUB 4KQZA 4DMZA 3OSPA 5DQIA 1DLOA 5FLXY 2KT5A 4XK8C 2M5YA 4O3PA 2XYGB 5IZHA 1P1LA 4KGXB 4URGA 4JI4F 1N32J 1IR0A 3BYPA 2J0QD 3VAMA 3OTBA 3CMES 1XK8A 4DV4J 3TA1A 1B0PA 1HD1A 3IA0A 3KK3B 3AFGA 2ZUGA 4JV5F 4JI8J 4ZITA 3MM7A 1B7YB 2PIIA 4DZ6A 2RHQB 4WIQA 2W2NP 5H9EK 3UPFA 2HMIB 2VOOA 3IBWA 1Q8LA 1B4SA 2RD5C 2OPSB 4CDIA 1RT2B 5L1IA 5HLFB 1ZPWX 1LWEA 4NWBA 3ILLA 4ANDA 4CIOA 5GMKa 2M4MA 2FHOB 4P7VA 1UA1A 5DG9A 3SCIE 5BXIA 4ECXA 2C3PA 4HEA9 3GJTB 2ZBRA 2Y8WA 1SC6A 5DS7A 2CJAA 3KLHB 5CH7B 3AD8C 3MDFA 1QAIA 4X4QA 1Q86T 2V50A 2IRUA 4P2SA 4RW8B 3DOKB 2ZJPQ 3PCOB 2VG7B 5K5MA 5K8MA 1RU1A 4LIWA 4ECYA 4FYDA 1F0XA 5C42A 3KLEB 4ECTA 4NCAA 2MQPA 3BPDA 2PD1A 4X66J 4B9LA 4LFBF 1NK8A 1L3SA 3H0PA 2WSCC 2QL5B 4KHPJ 1U1KA 4TQRA 2AYBA 1TVRA 3I6PA 3CIMA 4J9LA 2XS5A 3CPWR 1IJEB 2GMJA 3VHQA 1XR6A 4OZLA 5F41A 1QE1B 5F0UA 2L41A 3RRHA 1C1BB 3T5KA 1BQNB 3CCMS 2QMUB 5KT4A 2IPOB 3WIVA 3OL6A 3I0SA 4FF2A 3FEZA 3L9ZA 4HDGA 1LXNA 3TWZA 2J0SD 4KGZB 1MMLA 1S1TA 2Z2MA 4ZN3A 4C2MA 2VBYA 3IXQA 2Z58B 2HS3A 5K8OA 1K1SA 4QR2A 5A8KA 3NS5A 4BBYA 1LW0B 4ZA1A 3C16B 5ETPA 3E2EA 1SIWB 3UN2A 3LGHA 2LQJA 4DV7F 1AB8A 1YI2S 3DLJA 1TKXA 4EGLA 3AA9A 3K0JA 4RJVA 2WONB 3WIUA 3JAMY 5HP1B 3I9ZA 4OLPA 1IKXB 3W60A 4I6YA 3PVXA 3OFGA 4DL3A 1PAEX 1REVA 3AHPA 1T9VA 2CNOB 4OJHA 3TO8A 4J37A 1W2IA 4I7FA 3QYYA 2DPJA 3KUGA 4FYYB 2G0IA 4RUAA 2J6TA 2GO9A 4OZ1A 4ZVPB 4ZVSB 4PG5A 2ZDOA 3RUBL 4HHUA 1NDKA 3QGIA 1BWVA 5EWEA 1HPZB 2XM3A 2HRTA 2KRBA 4PG8A 2AP6A 5LOQA 1FRLA 4A8MP 3LP0A 2ZE2B 2R4FA 2OI2A 2DH7A 4DR4F 1PBAA 1WHVA 3DM2B 4K4SA 3M8WA 1D9DA 2H4WB 1SCJB 3P96A 4N8OA 3OJSA 1VJQA 4CLTA 1UW9A 1NJIT 3BGRB 4MK8A 3N79A 4K0KF 4TNOA 4NLGA 4DR1F 2RMLA 3IO1A 4J9VA 1TFWA 1VDHA 1H2UX 1OYEA 4DQPA 4KH0B 1D0EA 4JI0J 2F40A 3EDQB 2XLIA 2DXDA 5KFXA 4MKBA 2XG8A 1YJVA 1CULB 2WB4A 4Z2XA 1FRHA 2NS1B 5KFLA 2P9CA 4R8UA 3OFFA 1QY7A 2IM1A 1JMTA 1URRA 3W9HA 1NPRA 1GTHA 5BR8F 3D4JA 3CCUS 3V4IB 2XMWA 3RG6A 2LU1A 1FNMA 2W8KA 1PCAA 3G6XA 1X9WA 1CJVA 3I56S 2V4JA 1X5SA 2OPPA 2EW9A 2HGLA 1S12A 3DGPA 2HHQA 1UVLA 1XMOJ 1RXOB 4R0JA 3THVA 1N5TA 1Q1KA 4UY8T 4G3IA 4ZLPA 4U67Q 1UVJA 1NU4A 5K9FA 4J9KA 2KVQE 3K2YA 3GIIA 5ADZA 3T1HJ 1K44A 1WOOA 2LA4A 1HBNB 1H0HB 3LUYA 4LRCA 2F4VF 4Y2AA 2DRAA 4PEOA 2JEFA 5DGBA 2HLUA 5CYMB 5GAEI 1P9QC 1F5CA 1JLEA 4Q8FA 2GIQA 2J0XA 2QO3A 5KG5A 1SC4B 1RHQB 3D0GE 3RBEA 3HXMA 2I6WA 4MIAA 4L3NA 1VHIA 2R7VA 2EFOA 4CLYA 1TKTA 1TELA 1U26A 2J6SA 3CJKB 3ENQA 1Q16B 4Z7CA 5GADI 1TU0B 1FJGJ 4CZCA 2Z2ZA 4HT5A 1SBRA 4K4WA 1S4EA 1R27B 1H73A 3I5CA 3EGWB 4L6V3 4LF4F 3AOAA 3CD7A 4BWJA 3R8YA 5E41A 1S9GA 1DARA 1GX6A 4ICLB 3PTWA 1UZHA 3S6EA 3MOZA 2OO4A 5KFHA 1L3KA 1YK9A 2DHSA 7FDRA 1ZS6A 2ZNYA 1UCNA 4DL0C 4LF5J 2JLFA 5C24A 3W9IA 5KFJA 4NXMF 1XQIA 4ZVEA 2E5JA 4Q0BA 1A7GE 2Z8QA 2PMHA 3MAQA 2OD6A 3DU5A 3MMCA 2GHWA 4LBPA 1EX8A 2J7WA 3RR7A 4O0IA 1TL5A 4I67A 3FCWA 1SJ1A 2EI5A 3BYRA 4DF4A 2IHR1 2XSJB 1H2VZ 4GC7A 1FJCA 4WKYA 3EUNA 4WXWA 1BQMA 1OY8A 4E98A 4DOZA 1G1XA 2VODA 5B0EA 4IOAQ 5A0YA 2AGQA 3MCOA 4ECWA 5ITHA 4MIBA 1NDLA 3MFHA 4IDKB 3V6HA 2N4DA 1RKJA 1B64A 4EZ9A 4B9TA 4WBFA 3E01B 5L46A 3K7RA 1VIOA 3VZHA 4M94A 3OL9A 4HYKA 4P72A 2Y0BB 3J80Y 5T7LB 1FI4A 4LFCJ 1GT8A 2QLWA 3UWTA 2CJXB 4KYZA 2G1DA 4ZHRA 3DLHA 1VI7A 2HBRB 1AXQA 5EWGA 3RB6A 2R42A 2QEXS 4NLPA 2R7UA 4RO0A 5M2PA 2DHAA 3QGPA 4KC5A 2ZITA 2HHHJ 5DETA 3O1LA 4GKKJ 3QPIA 1NK5A 3G6YA 3U1LA 1XN9A 2YWFA 2BRKA 4OHYA 2KI2A 4CO4A 2OP5A 2ROEA 2HVDA 1RBOB 3OQ2A 2DJWA 2VJUA 2ZKTA 4A8YA 2E9TA 3Q8QB 2V8DA 4J9MA 2YY3A 2RB7A 4UOGA 3J81Y 3HZGA 2E1MC 3NNCA 2CNNB 1NK4A 4DQIA 5HMXA 3FVYA 3MCNA 4OJ1A 9ATCB 1BQXA 2ZZTA 3V6DB 1IQTA 1PYTA 1F5BA 1HARA 2PT0A 2CWXA 4NLQA 4MK7A 2MKCA 2DGWA 4IH5A 3BH6B 1AZSB 1PYSB 2C3MA 4KY3A 2ZVIA 1DRZA 1M5SA 3NCPA 2PFFB 3NS7B 1PC5A 5LMNJ 3IG1A 4F50A 3QGHA 3HHEA 3LPYA 5D78A 3QNWB 3OPKA 4PQAA 3X1LB 2UXBF 1M5HA 2FJVA 1S99A 2H9ZA 2ROPA 2ZD1B 3HSGA 1JXEA 2QFIA 2H5JB 2WK4A 4U7CA 1NDPA 3G9CA 5LL6d 3JTPA 4A8WA 2DHXA 3C19A 4J9QA 4IH7A 1N36J 2WVBA 5IT9Y 1SV5B 2VC0A 2I1RA 4U7UD 1X60A 1WC0A 3TUIC 2ZWOA 1LOUA 1XEZA 3R5BA 1VK8A 1UMJA 1WD6A 1N34F 3NKYA 2I5JB 4OJGA 1WOPA 4FXVA 4MK9A 2I8EA 4YS2A 2P6TA 1VBKA 3J7ZT 3MCMA 3LO3A 1JLGA 3PRBA 3KUHA 3ZTQA 3GFYA 3KG4A 4MKVA 5AXKA 1KFSA 1RBLA 2DNKA 3AJDA 3EMTA 1KVJA 3MAAA 4OZJA 2QA2A 2XHWA 2LMIA 4RW4A 2VFTA 2IM3A 3DRRB 4WE1A 3VV2B 3RB4A 2DGSA 5IM0B 3IR7B 3NGSA 2YPYA 3IFEA 1NDCA 2ASJA 1Y5IB 2PE8A 3HMJG 4V19J 1Q7LB 3AQPA 2KVIA 2IFXA 1EARA 3BR9A 2VA2A 3BBBA 5HROB 2FLLA 3K5NA 3KHRA 4YB5A 1UW4A 3KG1A 5HATA 2ZH2A 2QSFA 2QL7B 3TVZA 2HBYB 3HD1A 1KWMA 1ZTWA 3EXCX 2W2OP 3PJWA 1ACMB 1CG2A 3CJQA 1S1XA 7FD1A 2KT2A 1DLOB 2YWEA 4JI7F 4YY3F 1ZAVA 4PWWA 1EJ7L 3GG1A 1RWPB 4OLOA 4B3MF 4L75A 2HS4A 4DSFA 3PKMA 1K0VA 4C11A 3CW2C 4Y34A 5LMUF 3I5BA 1I5OB 4KGMA 3IBFB 1KONA 8ATCB 3HFZB 4CT8A 1H72C 1SI9A 3A3PB 2B51A 4R5PA 3QT5A 4PWUA 4JB8B 5L39A 2C2EA 3FBEA 2E29A 4EK2A 3NLCA 1PGZA 3MFIA 3M9MB 1SB6A 4EI2A 3VAGA 4DR2F 2ASDA 1LWEB 1URNA 2GC8A 3EYZA 2X1GA 1QVGR 1R89A 3RJMB 5JXSA 4N8NA 4CH7A 1BXNA 3MM8B 2LQBA 2IYGA 4DJBA 1LFPA 2P9EA 1U7LA 1TK5A 3AJ2A 1HA1A 2K1RB 4DSIA 4Q2MA 3GV7B 2AU0A 1R7IA 4F4YA 2RILA 1MU2A 5C42B 1KLNA 4PPDA 3VF0B 4IFVA 3TEHB 3M4XA 5CD4A 4MTPA 4K2JA 2AJFE 3OFHA 3G4SS 3DLLQ 1V3SA 4B3RF 1NLKL 3IC1A 4Y6IA 2X3GA 4NLTA 1TVRB 4LF9F 2LXIA 2CPYA 3SCLE 2UUBF 4MH8A 4LVOP 3CDBA 2QGFB 1IBKJ 2H1YA 4ATNA 2E7WA 1JNZB 3OLAA 4W90B 4DPOA 2YX4A 2QLJB 5DQGA 3BGOP 4JI1J 4ZP7A 4LR9A 2GQCA 3P4UB 3MI7X 2DR5A 1M0SA 3SEOA 4YOEA 2R7WA 1GQEA 1FRIA 4A8OA 1R6YA 1FWPA 3TANA 1GXLA 1U8WA 4O23A 4OX9J 3I0SB 2ZBPA 3D54A 3D66A 4Q5VA 2Q66A 3PHTA 1WACA 3S8SA 3CD6S 3SZ2A 1T9TA 1FDBA 2CPJA 3R27A 2I2YA 2ZJQQ 2DT9A 5K14A 2AJ4A 4DPUA 4F0MA 4NCGA 1YJWS 3QT7A 1S77D 4G1IA 4KHMA 4DV2J 5HSPA 3TZWA 1KFDA 1RAAB 1REVB 1KKHA 2HHWA 2FHJD 4QCLA 4I7FB 2KG0A 1T94A 4DQRA 5E3PA 2GIFA 3KJNB 3OHBA 4CNZA 1KLMB 2BM0A 1IKVA 1X5OA 5D0HA 1NZ8A 1DTQA 2ZBIA 3GV8B 1ZZNA 1Q8IA 2KXHA 4KB7A 4X62F 2VB6A 1X4GA 3LP0B 4WP3A 2HLTA 2HHTA 3FC9A 4DPTA 3NOCA 4AUKA 4ED2A 4O44A 4JI5F 4QR1A 4ID8A 4YFUA 2YTCA 2F3JA 4FPRA 1HYSA 2KDOA 1OQ6A 1VQLS 2QA4G 5BYRA 2RDIA 4ZJOA 4NMLA 3BN4A 2HAFA 1G3OA 4YR2A 3OJUA 4CYUA 4H4MA 4ZVUB 2O1PA 1FT8A 5J1EA 4UY85 4USIA 4WP8A 3LP1A 4M5DA 2YWGA 4R8UB 1VC0A 2GQ2A 1UETA 3KJQB 4QW9A 1MWQA 4DEZA 3A12A 2AJ2A 2W2PP 3FKBA 4FPIA 1IBLJ 3DMJB 4CLZA 1CJVB 2V4JB 1FD2A 3O6QA 2OPPB 1X4FA 3DGPB 2CPZA 1HNWJ 4NEZA 2J6UA 2JEIA 4DV1J 2CQDA 1WWHA 2FJDB 3HF5A 1Y0HA 3QWUA 2AIRB 1RLDA 2FD2A 3HSZA 3FZ2A 2ASLA 4WFNQ 3TYTA 2QA1A 2XZDB 3T5JA 4J90A 2W2QP 3ULHA 2BBEA 3QSIA 4ZCIA 2HZCA 3BV8A 1X5PA 4ERDA 5DM7Q 1IR1A 4Q2LA 3CDEA 3FBCA 3SFUA 4OI2A 3MPWA 4MFBA 3KNGA 4HT7A 1EKSA 4FF3A 3KLFA 4FNHA 1JLEB 3CCJS 2LFVA 1AFIA 5D0EA 4RPFA 2GA7A 4AD6A 3FMWA 3J7YU 1WDTA 1Y11A 3W64A 2HQFA 3ZO7A 2GQQA 3CCTA 5ETSA 5IT0A 2J0WA 2XBPA 4DHVA 2UV8G 2YNGA 1TKTB 4M5IA 1VS3A 4RNHA 1V3ZA 5H1SV 3JTNA 3JSYA 3QFWA 1RWNB 5HBMA 1FA0A 4YDXA 2ZM6F 4OHWA 5B0DA 3PR4A 4YR3A 2BW7A 1Q53A 2I9SA 5IV4A 2VQFF 1R8PA 3T9ZA 1R8AA 3Q22A 1V9OA 3PO4A 3GG0A 1N32F 3SV4A 1DQ8A 1S9GB 4LSLA 1S1WA 2FVQA 2Z0GA 5KFKA 1S6PA 1EIYB 1QSSA 3H5XA 4H4OA 4JI8F 2YX1A 2NR0A 3S7RA 2HBQB 2D3UA 2HGNA 2CZ9A 4HR2A 1IWGA 1K47A 5C24B 1RA6A 2ZOFA 3FDSA 2GJFA 2D7SA 4Q0BB 2CPHA 1VOMA 1RSCA 3H7HB 3RW7A 1K0TA 2DGXA 3MMCB 3FGVA 3UD3P 5F8GA 5L1JA 2MLZA 1U8SA 2RU9A 3M8QA 3CCLS 5E3AA 1UWAA 3LGNA 2V2QA 4TY8A 3D68A 3UCGA 2ALZA 3A3OB 1UZDA 4HKQA 1NKEA 3LOUA 2AD9A 5A0YB 2U1AA 3Q8VA 1TFYA 1NSKL 4QOTA 4NLVA 2V9KA 2DD8S 1Y5LB 1WOSA 4X66F 3DOMA 5CYJA 1S6QA 3SI8A 3V6JA 2GNKA 4Y00A 4KHPF 2V4QA 3FUYA 2XQCA 2HQGA 2HURA 3SQGA 1BMQB 3VGSA 4NZ6A 4ZHRB 4C6AA 4FZVA 5E33A 4LF8F 3EZOA 5I42A 4DFKA 2COLA 2AZ1A 3GIRA 4BLGA 3D0HE 5L38A 3OW2R 3BQ1A 2E7XA 4DXLA 5GAHI 2BKPA 5D15A 1SJFA 2HQDA 2YKMA 1S6OA 5DRKA 2AYEA 1U24A 1VQNS 1MW7A 4YQWA 3I82A 2ROGA 3PG9A 1X4HA 4X2BA 2PMWA 3SV3A 2W4DA 1KOOA 3NGRA 3TX8A 2H5IB 4AE5A 3BSOA 2HFOA 2GHVC 1JLFB 4XIUA 3OVAA 4O4GA 2EFNA 4JI6J 3Q2SC 1RUSA 5D4NA 4B9UA 2F1FA 2ZC3A 5J2MA 4PZVA 1MLAA 5U47A 2RF2A 4L74A 2P5VA 3OHAA 4OV1A 3PYGA 2MTLA 3UN5A 2B8QA 3QIPA 1S57A 4K4TA 3N5BA 2H48B 3WZ0A 3FSYA 3IG1B 3J7Z5 2DBBA 1VQKS 2K2PA 3C15A 2VF3A 1OYDA 3KNAA 3R5JB 3JTOA 1OQ3A 1WHYA 2WW4A 3TUJC 2ZOMA 2WVCA 2VFRA 1UPMB 4U7UK 2MB0B 5CYQA 4CTAA 2MZ1A 2HRYA 1C0UA 3PNIA 1KBRA 1HHSA 1YKWA 3SYZA 3UI3A 4C8ZA 2VASA 3MZIA 1RTZA 2D74B 2FUG9 4AQYJ 4I0WA 3OXFA 2C3OA 5IQ6A 1KRPA 4NYPA 1A6LA 2HK3A 1UFKA 3UDVA 4OX6A 1GAOA 1VC6A 4RL1A 1RHMB 2CJQA 2DNLA 1RADB 1LFWA 4JI0F 2E66A 2LQ8A 1MWYA 2RQCA 1BY9A 2EFPA 2XYPB 1YRXA 1NRKA 1UJ4A 5J2NA 4ELUA 4DUZF 2D69A 5F3ZA 4Y2MA 4EWTA 1YSJA 1NSPA 2KM8C 2DNHA 3MAAB 2JRSA 1S7HA 1DQ9A 1NMEB 4RNFA 4RW4B 3R1LA 4WE1B 2AX1A 4DV3J 3HPOA 2KB2A 1RKIA 3KJFB 1U1OA 2NLWA 5GMDA 4CI0B 2FJBB 1NZAA 5G4DA 2ZH3A 1KQKA 1VQ9S 4B08A 3B54A 4JUZA 4UUXA 2R8GA 2J7UA 3QAUA 2YQ0A 4PXCA 1RT1A 5I4MA 2DO4A 2X1BA 3KHLA 2WSFC 1KQGB 1Z4UA 2NXJA 2F63A 3DNCA 2XULA 3W63A 4OZ2A 3QJLA 1GH8A 2B9XA 2GW8A 5HMZA 4C8LA 5KG3A 1RLCL 1UTAA 2YWHA 3EGZA 4I68A 1TL3B 3J7YI 3TZYA 2A2CA 3MPVA 5KFPA 3EPIA 2HNYA 5DJBA 4QQBA 4C11B 3LP2A 1W25A 3PFOA 2HVZA 2W8LA 2R8IA 4JI2J 1OY9A 1RTJA 5KT6A 1EETA 3C6UA 2A1BA 2LEAA 4ECRA 4R5PB 5D4PA 3GPAA 1U1RA 4Z7YA 4DR6J 1HQUA 5E7OB 1VFJA 2DNOA 1HI1A 1CJTA 1AROP 2E5IA 2J9DA 2XZTB 4A8KA 2DCUB 2JHEA 1D8YA 2FLNA 1PSDA 1N88A 2OTJS 4DCOB 3K57A 5KFDA 2W7PA 1YHQS 1IQZA 2HHVA 4NRUA 1HNXJ 1OSDA 3ETOA 4F67A 4TN2A 1JB0C 1BGXT 5AE3A 3M8SA 3AD7C 2XHCA 3KKFA 1KTQA 3VALA 3ONQA 4ZKAA 1RT5A 3TVYA 4D3HA 1TR0A 3GCXP 3WC2A 1MU2B 5D0GA 4ECZA 4IFVB 4FBTA 3BREA 4LFAJ 1I94F 4KIAA 1MMNA 1W26A 4LF5F 1WC3A 4O3NA 2CPEA 2V2KA 1FX2A 4R0EA 5H9FK 2LDYA 3OTCA 4L3KA 5AXLA 4XPEA 3ICLA 1LW0A 3C16A 5B7WA 4B3SJ 3SXLA 4Q43A 2O01C 4I4BA 1F60B 2WONA 3N6LA 1JLCA 5HP1A 4DX7A 4PAAA 1B0VA 1QTNB 1ELOA 2M8HA 5IOLA 3PW0A 3TZZA 1HNVA 1YRTA 2R3VA 4Q8EA 2HIYA 3KDOA 3EJMA 5JJBA 2WW8A 4DV6J 2D3O1 4DSEA 2MYFA 3HZEA 1EHWA 3J7A1 2YKAA 4GC6A 3CT9A 2ZH7A 2HAIA 5HQMA 3QT8A 1HHQA 1FWKA 3EGNA 2PN6A 2WAQD 2ZE2A 4NCGB 3B6BA 2B9EA 2HHPA 3UCUP 4K7QA 1R3NA 4GKJF 1L3TA 3ENWA 4LT6A 2E44A 2W2MP 2A3JA 3ZTSA 4USVA 2Z56B 2W9AA 1WI6A 4GKKF 2AYGA 4ILRA 1VQPS 5AJ3F 1IKVB 3A8EA 1ZA1B 2IAJB 3UDCA 1CS4A 2RHSB 1DTQB 1SQFA 3DXSX 3MF5A 1NAQA 1R31A 2FZKB 4IOCQ 5EWFA 4Y2KA 4X4VA 3EDRB 2ZNZA 5CQGA 4U6PA 4I64A 4IG0A 2OELA 4DR3J 2K7JA 2RKIA 2AW0A 4PRFA 2QE5A 3AB2B 3P45B 5HI7A 2GJ2A 2VC1A 2DIVA 5DDRC 4TVAB 4DSKA 2OLWA 1HYSB 1DURA 1UFLA 2AEFA 2KRRA 2UXDF 4ZVQB 6AT1B 3MWBA 3IGVA 1HNZF 2LXUA 4WFYA 3TJ8A 4NXNF 3IS9A 4EZ6A 2XZWA 1G2EA 4CYUB 1VYAA 2B9YA 4H4MB 1RHJB 1Q7YT 3M2RA 5J1EB 4I69A 4XDCA 1X9MA 1FF2A 1MMDA 2ATLA 1FVQA 1R0CB 2XSFA 4DQQA 2R9LA 3M8YA 3LP1B 4M5DB 2PEBA 4X65J 2BMBA 3FFIA 4K8RA 3K17A 5A8RB 5DM6Q 1S72S 1E6VA 1NHVA 1ZM4A 3D1OA 4OI3A 4CLWA 3NY0A 3VAKA 1F3VA 2ZC4A 1JJ2R 3EVMA 4ECVA 4N7TA 5KFYA 4F3QA 3KLGA 3R6LB 4DR7J 4O3QA 4G6VB 4X64J 3G71S 1JJCB 2A6MA 3THPA 3PRDA 1FE4A 4QR0A 5E2QA 2BJDA 2ALYB 3G87A 1RAGB 4ZOSA 4ER8A 1D9FA 1J2VA 3GIKA 3BDEA 3N28A 2B7CB 1J5EJ 5E0OA 4G1QA 2VIHA 3ZZ0A 4JV0A 1TZ0A 1QVFR 2ZBCA 2CZ4A 1KHWA 3HKZD 2P6SA 1R0BG 4OHZA 3W1YC 4MFBB 4KGKA 2MZSA 5GVQA 2KXFA 4EBDA 3W5ZA 3KLFB 1HBMA 2KZMA 4QWCA 4DFJA 1LK7A 4N47A 2NZ4A 2HS0A 4IR9A 4TYAA 2J9DE 1RHRB 2UU9J 1X0FA 3IBCB 1FKOA 3CJTA 3CCSS 2G2ZA 2V68A 2YNGB 3ZZYA 3PKYA 3L7UA 4ED4A 5B0FA 2OSQA 3G82A 1ICEB 4U8VA 5HBMB 1T11A 4ED7A 1FE0A 4YUDA 2XB2D 3T6BA 3A13A 3T19A 2FZGB 3C6TB 4RR5A 1A0OB 2K3KA 2HKEA 5FD1A 4ECUA 4LSLB 1S1WB 3DHXA 2HFNA 4M1KA 2Q6CA 2V5HG 4H4OB 1VQ7S 2OFGX 3NAHA 3GIJA 1M1GA 4JV5J 2HK2A 2VBXA 3UDEA 4BHQA 5KFOA 4TYBA 1T9WA 4FF4A 1FD8A 1SH0A 3O2IA 1L3VA 2VD3A 1RYSA 4WPAA 3V2UC 2HYIB 2ZWPA 2AYMA 3DRPB 2D1CA 3P49B 2GGPB 1QSLA 1U25A 1AYEA 1RACB 3EVOA 2BDPA 4IRKA 1SL0A 3K5MA 2NXUA 3FEXB 3OTOF 2G13A 3RZAA 3M8QB 2CADA 4C8MA 1KD1T 2I0XA 4TY8B 3LAMA 2R7OA 4USMA 1DHMA 3L4BC 1IM6A 3AAWB 3VZIA 2K7KA 3HT3A 4C8KA 3IGNA 1ITPA 2M0GB 1F3FA 1FXRA 2EG1A 2PMZD 2H4YB 5F8LA 5MLCV 2ZZMA 2ZUAA 2RU3A 3W3SA 4WIIA 1U47A 1TK0A 2GIRA 1SC3B 1SL1A 3DOMB 1FFGB 5B09A 2VICA 2B4VA 3TUPA 1S79A 1N6QA 4BS2A 2MKKA 5JUMA 1Q4RA 2CQPA 4W98A 2OPRA 2FVRA 3N01A 2X7IA 5KOWA 1I3OB 4WTYA 4B9SA 3C8YA 5I42B 5KFBA 1HHTP 3CC4S 2CIMA 5KFNA 3GFXA 3A1YG 4E2FB 4CLFA 3UQSA 4ED6A 2FHKA 2LU2A 4OX9F 2VONA 2YKMB 2E1RA 1UL3A 3UR0A 1AZSA 1LW2A 2MEWA 5DO2A 4QWAA 3IRXA 4QW8A 5KFCA 2DNGA 2F4FA 5HJXA 1QDUB 2NYIA 2QC3A 1S97A 1HWIA 3R5AA 1CJKA 2ATCB 1NB7A 1Q95G 5CHCB 1XMQF 4DV7J 2MZJA 4OZNA 4ANEA 1TP7A 2CQIA 3HVRA 2OJ3A 3PJ9A 4DV2F 3N9UC 3THTA 2RUSA 4CLSA 2FHMA 1Y00A 5BYSA 2L9DA 5J2MB 5FJ4A 2RF2B 1MN7A 2VKRA 1O0PA 2EPIA 2FIUA 1XMBA 2XMAA 2IJFA 4ZPBA 1DQAA 3W7BA 3D6TB 1XNQF 3QIPB 5C7PA 1RT7A 1LXJA 5GAGI 1HWLA 1UVKA 1RABB 3M9NB 4M5MA 3C15B 2LXFA 1TL1A 2DIUA 1F9FA 3UDLA 1LK5A 1UVMA 3NWGA 3TUZC 2Y0SD 1NSAA 1VBZA 3AXKA 1YJ9S 5CYQB 1HNIA 4CTAB 3UE2A 2DR7A 1VLOA 3S1TA 1C0UB 5CAAA 2Y1IA 2KKHA 2VFSA 5IM0A 3OUYB 4K0KJ 3KUEA 2JX2A 4ZPCA 4PWDA 4DR1J 1DJ0A 4Y3CA 2PFDA 2G0JA 3T1AA 4K59A 3GU0A 1BD6A 2IIHA 2PA8D 5J2NB 3W9JA 1B3TA 1VRTA 3TA2A 1FDNA 4RU9A 4DX8H 1U1PA 4KTQA 3GJSB 1T05B 4PCQA 2R7TA 3CJ2A 3ZZZA 3GWCA 1VCTA 4OQJA 3EGVA 4NASA 2XS7A 2BANA 2HNZA 2RQMA 1GMWA 1IBLF 1RA7A 1B70B 5GADU 2R2UA 4ELVA 1HW8A 5KFUA 5HVGA 2MQNA 1IUJA 4DI6A 4NA3A 1IM4A 2DGVA 1C1CB 2M2BA 1OIAA 4IRCA 1RT6A 1U1NA 3NXZA 4DV1F 3DLEB 1KHVA 5KT7A 1OPIA 3GYNA 4C8YA 1FEHA 1RT1B 3BBFA 3EZUA 5T14A 4FYXB 3RAQA 3GQCA 3M6VA 2DYAA 2PEHA 1U2RA 8AT1B 1HFEL 1YJNS 4RUBA 3BGFA 1HI8A 3ENVA 4N56A 2Y8YA 2XO6A 3K59A 3CD5A 3GYXB 3MM8A 3MEKA 2HNYB 3FSIA 3LP2B 3DN9A 2LDIA 2L48A 4P74A 1SUQA 2VFUA 1RJJA 5E5NA 2W9BB 2AEJA 1ZTTA 1RTJB 2K1RA 1EETB 5KG7A 3C6UB 4ECQA 1SXLA 3RAXA 2B7BB 1UA0A 1FEEA 1WG5A 4RKUC 6FDRA 2MZTA 1NH7A 3LAKA 4LF7J 1QUVA 2OEKA 3MM9B 4QJVA 1HQUB 5L1KA 1CJTB 1QLNA 3N6NA 1WKJA 2EKNA 4HTJA 1U1MA 2Q6BA 1IKWA 2HWTA 2MY8A 4M5NA 2DHHA 2D41A 1H2TZ 3BKFA 2DH9A 4DLEA 2WVDA 1S0MA 2UVWA 3TVKA 2MMYA 4QIVA 3E3XA 3M8PA 3NBPB 4DV0F 1F5AA 4U95A 3CDUA 4LF4J 2JEJA 3HK2A 3IAS9 2IMWP 3MEEB 2JNJA 3ILJA 2ACMA 2EVZA 2MSTA 1N48A 4K4XA 2F8HA 4ZLJA 1Q78A 3HD2A 1RT5B 3MPDA 2DPIA 2BE2A 1TAUA 1HLWA 5AXMA 4TQSA 3VR1A 1VQYA 3M6UA 2E1CA 3ET6A 4DX6A 1NJYA 4C8NA 1IR2A 3T41A 1NKBA 5IC6B 5F9NA 3BSNA 3IM8A 4YHHF 3A8KA 1M5PC 3M1VA 3HULA 1WF2A 1PJ5A 1N5SA 4F4KA 2CDQA 1JLCB 4DV5J 1RISA 4ZS6A 4LQ9A 2V8PA 1R8CA 1HNVB 3OLBA 4ED3A 3I4HX 1RHKB 3BGLA 1M90T 1FNOA 1KLMA 3R97A 1OPZA 3A3NB 2R2TA 1LKZA 3MMBA 4M8LA 1XNRF 4J5OA 1FRXA 2FDNA 1ZBTA 2AQ4A 4F3OA 2W4PA 3OR2A 2KFNA 4NLUA 4LREA 2DY1A 2JFDA 1WEYA 1R8BA 2YWKA 2XY7A 4URQU 3PV8A 3DRSA 2BJ7A 5IXUA 3M2UA 3MEGA 3SCJE 3O44A 2GMHA 2MKHA 2EFQA 2YWWA 1R43A 3X3UA 1CS4B 1NSQA 3LA0A 1VRUA 3JXOA 2MKYA 4KT0C 2OHDA 3M6WA 2UVRA 4ED0A 2ZJRQ 2XGQA 4GVBA 2VQEF 3I4PA 1VR6A 3RU0A 1MN9A 3UVJA 4IG0B 5KG6A 2BJ1A 2RKIB 2RT3A 3GSDA 1OWXA 1VC5A 4QIWD 1S9EB 2LCWA 1GFWB 3VGTA 4J9RA 5L8RC 3U1MA 5DZ7A 4LQ3A 1N54B 3HP6A 4F25A 3GB0A 5B0AA 2AMCB 4Q7AA 4YEAA 2XNQA 3DMJA 1YJTA 4DL5A 4P2MA 3IS9B 4YR0A 1NB2A 4H4KA 3DOLA 1SKWA 3ETMA 4CO0A 3PX4A 1YBTA 1NK7A 2LECA 4DG1A 4Y65A 4NRTA 1XR7A 3M2RB 2ACYA 3DHWC 2BJEA 2X1AA 3Q8SB 2C3YA 1DBDA 4YMEA 3E51A 2MKIA 2GX8A 4DPYA 4OMFG 2CQ0A 1IBMF 1FXLA 2RH3A 4M5LA 3FFIB 1AUSL 4U9RA 2EK1A 3K5OA 1E6VB 4A46A 4QU7A 1RAIB 5JMNA 4USKA 1RT4B 3KLGB 3KG0A 3LTOA 2UP1A 4CO2A 3TZXA 2XI2A 2CG8A 1TMJA 2IC3A 4HHHA 3VGVA 1Y7PA 5K8PA 2XY5A 2JC0A 2G2OA 4EO8A 2RDJA 5M2UA 2IVYA 4R25A 3TJAA 2FY8A 4CM0A 2ZH6A 1YZ6A 4G1QB 3D3CJ 2IRYA 2XYHB 2VDIA 2RRBA 4QBUA 2FZCB 3QAEA 2OKQA 2V9WA 3R5GA 1DFDA 2MDAA 2OEMA 1PJ7A 4OFZA 2CJ9A 2WCXA 3VAHA 1VQ4S 1HBMB 2DNPA 2JSXA 4F0KA 3DXBA 3QATA 3VGUA 2JVOA 3BF4A 2HWHA 1A9NB 3QBCA 4RNOA 4G65A 4P73A 4OYMA 5EUHA 4M95A 3TR5A 1KDNA 5C2GA 5K20B 2LLZA 1FKOB 4LSZB 2HFUA 4KPYA 4AL6A 2WBMA 1DTTA 1WNEA 3GV5B 5ETNA 1IN0A 1JJHA 1KVKA 4DU7A 4ZPAA 3G82B 2DKOB 1FKPA 1JIHA 2AF6A 5KFRA 1S1UB 2XY6A 2VPYB 1WF1A 2J9CA 1IVZA 2AWZA 1ROFA 5HQ8A 2XCPA 3T5HA 2KL8A 4JI7J 1PKUA 3VAFA 4YY3J 4OHVA 1Y3JA 3QZ7A 3PRVA 4DLGA 4C7QA 3BO3A 2Q79A 2Y9HA 2HNDA 3MPUB 2XMVA 4CQ1A 3D6HB 3PIPQ 1KEKA 3F44A 1JX4A 4FDFA 5LSRA 5LMUJ 1H74A 2CVEA 4YP3A 1KQFB 4JI2F 3KOAA 1N0VC 1RWOB 4NZ0A 2YKQA 2BKOA 2CQ1A 1T9YA 3CXCR 3PW2A 3Q23A 2POKA 3K8WA 2UUAJ 3DLKB 5EHHA 4B3OA 3PHEA 1N5YA 1KTVA 2V6AA 3ILIA 1KC8T 2NXCA 4DR2J 5A6WA 4NLOA 3UR3C 2CNLB 3MECA 2FJWA 4TLRA 4JYAF 4LR8A 2Z30B 4LF2A 4NMXA 2VPXB 4FVCA 1ZA2B 3TAMB 3H25A 1O51A 5ETKA 5T41A 2H54B 3MMJA 1WF0A 3DCAA 5LXRA 4NCBA 3EVWA 1HMVA 2DEJA 1ZETA 3FRZA 5MAOA 3R1HA 1H38A 2VV5A 2KFYA 4LFAF 1WUUA 2ZOGA 2KXNB 4CLLA 4B3RJ 1RWXB 5C25B 4KRWA 3KK1A 1N6QB 4LF9J 2N3OA 1UJ6A 1Q0NA 4NE9C 2UUBJ 4F8RA 2RQKA 4M5JA 3HHLA 2DY9A 2RRAA 4ILLA 2OPRB 2CPDA 4PG4A 4OZ5A 3RRGA 2DNNA 2ZFHA 2N3LA 5A2QU 1JLFA 3CNQP 2V63A 4CM2A 2FPHX 2AGPA 1T3NA 1ULRA 3V4MA 2CQCA 5KT2A 2BW2A 2EXUA 3GONA 1N33F 1LW2B 4F2RA 1YX2A 3IRXB 4ZMMA 4WF9Q 4DV6F 4DR5F 1RDRA 1S49A 4UT4A 3N6MA 3PXGa 2CQGA 1CJKB 1S9FA 3F0NA 3TA0A 2DR6A 1VIXA 4OZ3A 2IM2A 4P71A 3FSXA 3QRQA 4ZDNA 3PX0A 3V81A 4ZCKA 3HCXA 4P7TA 4RW9A 1R0AA 2VJVA 4PXEA 4ILMA 4OHXA 2DNZA 3P8BB 1MNEA 3GR1A 3PW5A 1GMUA 3BR8A 1PBUA 3MOJB 3BJYA 3R7SB 2PA3A 4F3MA 3QRPA 1RT7B 3F56A 2CNKB 1RCXB 4I2QA 3M05A 3SCKE 1TL1B 3O3LA 4WZMA 4OIXA 3TOQA 3D6MB 3ZTPA 2L08A 4DR3F 2AEMA 4JI5J 1HNIB 2DR8A 4NA2A 3I5AA 1FO1A 4UZBA 3VAJA 1JLBB 3AH6A 3JQMA 2W7OA 4BC9A 2PDAA 3EE3A 3AJ1A 4PWDB 3QO9A 1B0TA 3AB4B 4P2FA 3WQPA 1UKUA 1D8ZA 3GLJA 4C97A 1RK8A 2QMXA 3QMQA 3KTQA 3B82A 3P6YC 1X5TA 4DDFA 4B9VA 3HI9A 4DL6A 2JL9A 1VRTB 2CQHA 3OBIA 4OJ3A 2MKJA 2RQ4A 4ZJQA 1BE4A 3CF5Q 3U7JA 5E3RA 3DLBA 5LJ3Y 4NEYA 4RWWA 3G6VA 2NZCA 1TL3A 1VQMS 2BANB 2HNZB 2MZQA 3BM7A 2PI4A 3CGIA 3HHDA 2UUWA 2HQCA 3V5RA 3CWJA 4DL4A 5KFAA 2IA0A 1Z2ZA 1HW9A 3MXHP 5LT5A 4RW6A 4LF6F 1UAWA 4X64F 3AQOA 5RUBA 1UVNA 1SH3A 1RT6B 5C2CA 2B0GA 2W1BA 5FDLA 1AFJA 3R2DJ 2F8MA 1HBUA 1FVSA 4MMOA 1OS5A 1EZZB 3I55S 5DQHA 4OYXA 2RVJA 1XR5A 2EBEA 3RAMA 2OEJA 2ERRA 4AXIA 1RWMB 1Q8BA 3K89A 3M9OB 4BWMA 4X4NA 5KFSA 4WJBA 1SUQB 2ZHAA 2WOMA 5HJYA 3PY8A 2HZVA 2GVDA 4XDDA 2BZ2A 2A0FB 3BEGB 2B5JA 1S59A 4CH1A 1NH8A 1JLAA 1YBUA 4MKAA 1I1GA 2HHUA 2YQ1A 2DK2A 4HL9A 5I3QA 3QJPA 2J8SA 4YN3B 1SJ3P 3UN3A 4LR7A 1V5VA 1UVIA 4WYLA 1IKWB 3PEHA 1QAJA 1YG0A 4NYOA 4P52A 3IR5B 3M8PB 2CUYA 2QX0A 3GZ7A 4X4TA 2ZKUA 4DCJB 2WZ1A 2K3IA 2VQFJ 3KXDA 2KZZA 3BPSP 4N77A 1APSA 4OX8A 5LXYA 2LA6A 1WEXA 4CLKA 4DN0A 4ZVTB 3D1QA 2JVRA 2BE2B 2W25A 3I32A 3G8SA 1SH2A 3ITHA 2A6OA 3QRRA 3DGVA 3B8HA 2XMUA 2MQMA 2C3UA 3ET6B 4KJIA 2ILYA 3RBZA 1AW0A 1WG4A 1G6BA 5GAHU 3CC2S 3GCWP 3Q89A 4B9MA 1QTMA 3CJ4A 4IFYA 2ZEJA 3M1VB 3N0VA 2HFZA 5L9NA 5ETTA 3AXMA 3M2VA 2WHOA 1Q8KA 2WB1D 1ZPVA 3DRXA 4B3TJ 1LWXA 3LPEA 2ZZNA 4USHA 4ED8A 2UV8A 1QJHA 4HACA 4F7VA 5D77A 2P9GA 2FGOA 2R7QA 4M5HA 3BZQA 3Q86A 1VHFA 3I96A 2IAJA 4EMDA 2AJ0A 3WDOA 3MMBB 3UD4P 3TX0A 1RT3A 3V6KA 4OI0A 4ZP9A 4ZN1A 4L76A 4TXSA 2Y3YA 3OR2B 4ID5B 2MQQA 2QLBB 3NS6A 2IRXA 1U0SA 3J81j 2B43A 3DRSB 3ZZUA 3IWLA 5L9XA 4LF8J 2BUNA 5C5JA 1PJ6A 3QFHA 3M2UB 1L3UA 4Y2IA 2HQIA 4ED1A 3MEGB 2LEBA 1IWAA 4RBUA 5KT3A 1X4CA 1FJEB 4TU7A 1W7WA 2M88A 1VRUB 4F0HA 4C0HA 2M70A 4LJMA 4DSJA 1H6KX 1YZ7A 2DNQA 4LVNP 4GVBB 5L1LA 3T3FA 4I6AA 2AX0A 3UVJB 3JSMA 2R8KA 1HR0F 2JH3A 5BJRA 4J9PA 3BH7B 4N41A 2M52A 4MT1A 1H7XA 4ZLLA 3BBCA 1RHUB 2IBKA 3HHKA 5A8RA 4DZDA 1LEOA 3G6ES 3CDWA 3CCRS 2GS8A 4IH6A 2L9NA 3NRBA 1JLQA 4ECSA 3CO0P 2GVZA 3GILA 3DOLB 2H5EA 3RGIA 3MD3A 5KG1A 4OX7A 4DG1B 3BN7A 2FJEB 3H20A 1KVIA 4ITSA 2R8JA 2WVFA 4USUA 4FBUA 2QYGA 5I3UB 2MSSA 1S0VA 4TLQA 1C0TA 1N0UA 3DC2A 3M7VA 3MR5A 3TARA 4C98A 4OI1A 2MJUA 2E5LJ 3VCDA 4PR6A 3M30A 3LQVA 3CCQS 5CZXA 1Z2LA 2VG5A 1ZM2A 3HLUA 2B4UA 3H98A 1OMSA 4UOFA 2FVPA 1GTEA 1F6TA 5KAKA 2IC3B 1T8EA 3GSIA 4DFMA 2WBRA 2E1AA 1RWVB 4K5RA 2E9ZA 4PPZA 3OXGA 3P5TL 3HX9A 2N7YA 2XGPA 4QZVB 1FRJA 3LALA 3K5PA 3W5XA 1NBEB 2CPIA 3MR2A 4TY9A 4DUZJ 3LF0A 5A76A 2NQPA 2AHOB 1HL6A 2X51A 3PZPA 1YTYA 3GMGA 3L09A 4KH1B 1Q5YA 5KFMA 3C6TA 3OSNA 1WC4A 4ZVRB 1T03A 1HQEA 1ZYQA 1KOHA 4TU8A 3CCWA 5LSOA 3ZTRA 2LEPA 1SPBP 4C8OA 2VZ9A 4DV4F 2QL9B 2IMOA 2K06A 2B4OA 5JVHQ 2HVHA 2DGUA 4A47A 1BC6A 3IAM9 1DTTB 1P8GA 1RAOA 5AT1B 3QWPA 1TUVA 4IO1A 3SDEA 4J7CA 1FXDA 4NLDA 1FKPB 3I31A 3CJSA 2CZVC 3SSRA 1P27B 3DRPA 4HHJA 1T9UA 9RUBA 1WORA 2GGPA 3MM6A 3TQ1A 2DR9A 4ZJLA 4I56A 1Q5VA 5F8NA 2C28A 4HH1A 1CC7A 1W2BR 2KJWA 5D4OA 5CD4H 2MJNA 2KYZA 3JQJA 1NJZA 2ZDPA 2HNDB 3SMZA 4O0NA 4LBHA 3OVSA 3TW0A 4J9OA 1JQGA 4WFZA 3PO5A 1SC1B 1B7FA 4CNYA 2QMWA 2EFGA 2M9KA 3MAHA 3ZXWA 4EYIB 3H8YA 3L3CA 3H59A 1FTCA 5M2RA 2ZH9A 4LF7F 3K5LA 2DO0A 4B3OB 1N5YB 1X4EA 2E1PA 3R9LA 2EFVA 4P75A 4UW2A 1HBOB 3MECB 5H9EJ 3IP0A 1FKAF 1TMMA 2DGOA 3NL0A 3L7OA 5D8HB 4H54A 4CLPA 1TK8A 4RLEA 4X4PA 1T3OA 5J1PA 4QPXA 4OYPA 3CC7S 2OSRA 4K4ZA 3JS9A 3N4WA 2YNIA 2QT7A 4QYRA 1FHTA 2DGQA 2B6AA 3KLIA 4M5KA 1HMVB 2C22A 2M3DA 4ZPDA 2HQ3A 2P8IA 3PJXA 1KN6A 3JQKA 1U1QA 1I94J 1QM9A 1WKLA 3EX7B 3NCQA 3POTA 3KK1B 1QAXA 2HHSA 1O5JA 3HHLB 3BSCA 3VVUA 3E8OA 1LWCA 2R2SA 1FERA 3KHHA 2MXYA 1Q79A 1GX5A 1UEVA 5A8WA 2P2CB 1RU2A 4DV5F 3CSKA 3NOGA 3MM5A 2BJ3A 4HDHA 3DLGA 2JLEA 2QFJA 4IRDA 3KMQA 1N5QA 2R8HA 1LWFA 5KFWA 4ED5A 2BJ8A 1K8AT 4KHRA 4PKDB 3W61A 2G1HA 2W9CA 2GMLA 5ETOA 1S7IA 2XWXA 4RW7A 3PDNA 3BB5A 3H5UA 4ETXA 2VH7A 4Y28C 3BS9A 1MSWD 4GKJJ 3V81B 1UP1A 4C4WA 3EM1A 2Q43A 4FKXA 7AT1B 1NCLA 4RW9B 1R0AB 4ENOA 1FTRA 1RTDA 3HVWA 4ALZA 3OUYA 2ZH8A 3PM9A 4JP8A 4QU6A 5AJ3J 4PXDA 1HD0A 3OVBA 2NCKL 4IUFA 3KFWX 3B4MA 3W2VA 5KG0A 3PACA 3FNNA 5HO4A 3T1YJ 4X84A 5F8HA 2UVVA 1SQEA 1I51B 2PC6A 4I2QB 2RE1A 1J5OA 5A2QY 2UUCJ 4V19X 2A2DA 1P9YA 3MTJA 4C3KA 3OXLA 1P1TA 3RBXA 3OV7A 2ZHBA 1RZMA 3PW4A 5KFEA 1T05A 5DDPC 3DDIA 2A10A 1RWKB 2C2KB 4WZQA 4OYAA 3NMAA 3FEYB 2UXDJ 3BO4A 1RBAA 1EP4A 4JBCA 1HNZJ 2DTJA 1L5UA 4C48A 4EYHB 2HFSA 3NGKA 4CWBA 4K2XA 3QO9B 4NXNJ 4O3RA 3Q2TC 3W66A 2OIHA 2V69A 2CQ4A 4CT9A 1C1CA 2D9OA 4WCEQ 5IFMA 1XMOF 3FCHA 4K4VA 3FQKA 3DLEA 1U1LA 3CUNA 2IDLA 3DYAB 2J7KA 2BKNA 3GJQB 4AFFA 2MKSA 3T1HF 1UFWA 3R7NB 5EGYA 2F5GA 2YBVA 3EPGA 1SIZA 4OV6A 2V8GA 3CJ8A 2XWYA 5B0BA 4KSEB 1K9MT 4NL5A 4RW6B 3UFCX 3FBFA 1EQ0A 2XMJA 1BHNA 2W9BA 2DRBA 4PQUA 3H42A 1GNKA 2AJ1A 3R5DA 5CCLA 1JJ4A 5FDLB 2F9DA 1MROB 1HBUB 3ZTOA 2L3MA 2IDEA 1NM2A 4OYWA 1X4BA 3MM9A 2ZH4A 5AXNA 2LKZA 2BE9B 2XLKA 1NK9A 1FJGF 4NLXA 3NBPA 5IWAJ 3RB3A 2VOPA 3M32A 2KG1A 4OYZA 3AD9C 3MMAA 2C42A 3NGUA 4F4XA 3MEEA 3VQTA 2WOMB 2G2YA 5CZVA 5F3TA 1NK0A 4DS5A 2GVDB 3BSAA 2O3DA 1S76D 5AE1A 2B5JB 2X3DA 2HVEA 4FXDA 4C3MA 1JLAB 2CQ3A 2CA9A 1WJ9A 4O3SA 3NWRA 3OR1A 2JWNA 5ETQA 4DUYJ 4XO0A 5ETVA 2HEKA 4KFBA 1X4AA 3CEDA 2IY5B 1G7CB 5KFZA 3CCES 2DNRA 4MYTA 3JYTA 1ZAXA 1XTZA 2FY1A 1N56A
chains in the Genus database with same CATH topology
3DOLA 1RYRA 5C24B 1QAYA 2ZD1A 1RA6A 1YITS 3HO1A 2ZOFA 1SKWA 3FDSA 2HG4A 3R5CA 4K50A 2WSEC 4CO0A 3PX4A 2KM8B 4X4SA 2D7SA 1NK7A 3MGJA 4IOBA 3F41A 5SUHA 2LECA 4DG1A 4Q0BB 4Y65A 2CPHA 1VOMA 4NRTA 4O4GB 1XR7A 3M2RB 3JB9k 2G9OA 2ACYA 4K5SA 3DHWC 4HLBA 3RW7A 4UOCA 4ZPWR 5J2PA 1D1UA 2BJEA 2X1AA 3Q8SB 2FVCA 2C3YA 4KR0B 3MM7B 1DBDA 4YMEA 1K0TA 2DGXA 3MMCB 3FGVA 3UD3P 3ITHB 2KYXA 3E51A 1GXTA 2DB1A 2JC1A 5F8GA 5L1JA 1DAXA 1SV5A 2DVIA 1RTHB 1CSJA 2MKIA 2GX8A 3VQSA 4DR7F 4OMFG 2UUAF 2CQ0A 1CLFA 1U8SA 2RU9A 2YH1A 3M8QA 3NNHA 1IBMF 4KKOA 3ISNC 1U6FA 1WELA 2F8EX 3CCLS 2MHEA 5E3AA 1FXLA 4JV1A 2RH3A 3FFIB 3LGNA 1TAQA 4TY8A 1NKCA 2D9PA 4U9RA 3UCGA 4EFAC 2I5JA 2ALZA 4DQSA 2EK1A 3MCSA 3K5OA 1E6VB 2O66A 4F26A 4A46A 5EX3A 4FF1A 4ZCLA 1MROA 4IFYB 4QU7A 3MTKA 4HKQA 1VJWA 1SKSA 1NKEA 2Z2LA 4DS4A 1ZM3A 3WBZA 1CQMA 3LOUA 2BV3A 2NUHA 4RNNA 5DLGA 2AD9A 5A0YB 4RNMA 3PX6A 2U1AA 3OTDA 4LFCF 3LANA 2RJZA 1TFYA 2VPZB 1RT4B 3M2VB 3KLGB 1HWJA 4QOTA 1J5EF 1IXKA 3KG0A 2UP1A 1LQ9A 4CO2A 2XI2A 4NLVA 1X9SA 1RQ0A 4QPTA 1FJ7A 2V9KA 3CCZA 2DD8S 2IC3A 2YQ3A 1Y5LB 1Y7PA 4RBVA 4X66F 2YNFB 2N7CA 1XWLA 3DOMA 5K8PA 2XY5A 2JC0A 5CYJA 1S6QA 4EO8A 1FCAA 3CIZA 3VWSA 1MWZA 3KK2B 3H4DA 1FDAA 2RDJA 3SI8A 1XBWA 1VQ6S 3V6JA 3IWXA 3QGGA 2GNKA 3H5SA 4Y00A 5M2UA 5F8IA 2IVYA 4AL7A 4ZPTR 2HHHF 4R25A 2V4QA 4KHPF 4RUHA 4OI4A 3TAPA 3H2VE 5KG2A 5F8MA 2HVIA 3SQGA 3DRRA 5F9LA 3D0IE 3NAIA 2ZH6A 4CH0S 5LJ5Y 3C66A 6FD1A 2PI5A 4G1QB 2RSQA 3C46A 4NZ6A 2K8GA 3VTIA 4ZHRB 3I87A 1U45A 2IRYA 3D5MA 4I2PA 2FB0A 2Y1JA 1PILA 4FZVA 2E5HA 5E33A 4LF8F 2RRBA 5I42A 2W4CA 4QBUA 4CO3A 1YJRA 4DFKA 1S48A 2BA9A 3QAEA 1RT3B 2COLA 2OKQA 2CJKA 1UWBB 5G0RA 3D0HE 2UU9F 2BABA 2V9WA 1DFDA 2JJ4D 2XEXA 5L38A 5AE2A 3OW2R 5HMYA 2KJVA 2IA6A 2MDAA 3BQ1A 4OFZA 2CJ9A 2E7XA 2WCXA 5GAHI 4PUOA 5GAEU 5HROA 2X1FA 2BR0A 5IQQA 3QJJA 3KJVB 5F0WA 3VAHA 1SJFA 2XC9A 1VQ4S 1HBMB 2DNPA 2JSXA 3MUTP 1K73T 1VQSA 2UZAA 3HVTB 4QIEA 2YKMA 3DU6A 1S6OA 1S9EA 3DXBA 5DRKA 2BQ3A 4PXBA 2JVOA 5GAGU 2O5DA 2HWHA 3BF4A 3RYLA 1A9NB 4FP9A 2EKYA 4RNOA 5EN1A 3EZ5A 4JI3F 3W2WB 2XMMA 1YGYA 2AYEA 4G1PA 4O4RA 1VBYA 5EUHA 3BGUA 2JOQA 1U24A 1T02A 4M95A 1VQNS 3TR5A 3OSPA 4KQZA 4DMZA 1MW7A 5DQIA 4YQWA 2LLZA 1FKOB 5D3GA 3I82A 4KPYA 2ROGA 4AL6A 2WBMA 1DTTA 1X4HA 1WNEA 1DLOA 3GV5B 5FLXY 4X2BA 1IN0A 1JJHA 2KT5A 4XK8C 3SV3A 2W4DA 2M5YA 1KOOA 2DNMA 1FK9A 4X4OA 3TX8A 4O3PA 5IZHA 1P1LA 4ZPAA 4URGA 2LVWA 4AE5A 3BSOA 4JI4F 2BM1A 1FKPA 1IR0A 1JIHA 3F73A 2AF6A 5KFRA 2HFOA 2J0QD 1S1UB 1T95A 3VAMA 2XY6A 1JK9B 3OTBA 3CMES 3DI6A 2FGCA 1XK8A 2GHVC 1JLFB 4I1TA 1S1TB 2RIJA 3H5YA 2VPYB 3TA1A 1K1QA 1B0PA 1WF1A 2J9CA 2ZVSA 2AWZA 4O4GA 2EFNA 4XIUA 1ROFA 2ILZA 3Q2SC 4A8QA 1VQOS 4X4UA 3IA0A 1HD1A 1WI8A 3KK3B 2ZUGA 2Y1RI 5LMNF 4JV5F 5HQ8A 5D4NA 2QSWA 2XCPA 3T5HA 3MM7A 5A8KB 4B9UA 1YWXA 3JSMB 2HWIA 2PIIA 1VLYA 3VAFA 4OHVA 1Y3JA 3ZZRA 5HL7Q 3QZ7A 4DLGA 2F1FA 2ZC3A 4C7QA 5J2MA 3UPFA 2NPFA 3BO3A 5U47A 2Q79A 2RF2A 2HMIB 2VOOA 1TKXB 2HNDA 3IBWA 1Q8LA 2P5VA 4WFAQ 2XMVA 1HI0P 3OHAA 4CQ1A 2KH9A 4OV1A 3PIPQ 1KEKA 2RD5C 3F44A 5B08A 1JX4A 2OPSB 5LSRA 1RT2B 3K58A 1WHWA 3QIPA 2CVEA 4K4TA 4YP3A 1UEUA 1KQFB 4Y0FA 5L1IA 4JI2F 3G8QA 3N5BA 4EUVA 5HLFB 3KOAA 4L72B 1KQSR 1ZPWX 3WZ0A 1N0VC 3FSYA 3IG1B 3J7Z5 1LWEA 4NWBA 4NZ0A 2KU7A 2DBBA 1JLQB 2YKQA 4CIOA 5GMKa 1N36F 2CQ1A 2M4MA 1VGYA 3CXCR 3PW2A 2FHOB 4P7VA 1UA1A 1VQKS 2K2PA 5DG9A 3Q23A 2POKA 3SCIE 2QIFA 4ECXA 3K8WA 1RT4A 2C3PA 3KNAA 4HEA9 3DLKB 2CPFA 2VKZG 1SC6A 3OL7A 5EHHA 5DS7A 2N4CA 3JTOA 1OQ3A 2CJAA 1WHYA 3KLHB 5CH7B 4BDPA 3TUJC 3MDFA 1QAIA 1QSYA 2ZOMA 4X4QA 1Q86T 2DGTA 2IRUA 1KSPA 4B3OA 4P2SA 3PHEA 1N5YA 1KTVA 1U6ZA 2VFRA 4RW8B 2Q1LA 4QIGA 4HI1A 4U7UK 3DOKB 4C0BA 1KC8T 2MB0B 2MGZA 5CYQA 5A6WA 4CTAA 4NLOA 2J8AA 3UR3C 3MECA 2MZ1A 2FJWA 2HRYA 1C0UA 2ZJPQ 3PNIA 4TLRA 2VG7B 1HHSA 5K5MA 5K8MA 3SYZA 4JYAF 4LIWA 3UI3A 4ECYA 1C0TB 1TL4A 4FYDA 1F0XA 5C42A 3KLEB 4C8ZA 2VASA 4KAIA 3MZIA 4ECTA 2VPXB 2D74B 4NCAA 4FVCA 2MQPA 2FUG9 4FS2A 4I0WA 3TAMB 2E9RX 3OXFA 1X8DA 2PD1A 2C3OA 5IQ6A 3H25A 4NYPA 1KRPA 1A6LA 1O51A 4B9LA 1NK8A 4LFBF 1U6BA 3M30B 5T41A 1L3SA 2FC8A 5KOXA 1HYSA 4OX6A 1GAOA 2WSCC 1VC6A 4NX9A 2VG5B 3MMJA 5THWA 4QWBA 2CJQA 2DNLA 4TQRA 1U1KA 1WF0A 2AYBA 1LFWA 1TVRA 2YH0A 3I6PA 3CIMA 3DCAA 4J9LA 4JI0F 2XS5A 2GJIA 3CPWR 1IJEB 2E66A 5LXRA 4NCBA 1MWYA 1HMVA 2GMJA 2RQCA 1XR6A 1BY9A 2EFPA 2EBGA 1ZETA 2B9WA 1YRXA 3FRZA 1NRKA 1UJ4A 4OZLA 5MAOA 5J2NA 5F41A 3R1HA 4ELUA 1QE1B 1H38A 2VV5A 2KFYA 5F0UA 4LFAF 2ZOGA 2L41A 4DUZF 3MR3A 2KXNB 3RRHA 1C1BB 3I0RA 5F3ZA 4Y2MA 4EWTA 1YRUA 1YSJA 3T5KA 5KFTA 2KM8C 5C25B 4MAKA 2B4PA 2DNHA 1BQNB 4KRWA 3CCMS 2JRSA 3FQLA 3KK1A 5J1NA 3S01A 1N6QB 1S7HA 1RAJA 2JZ5A 1UJ6A 2N3OA 1DQ9A 5D6GA 4RNFA 4RW4B 5KT4A 2OD4A 3R1LA 4WE1B 4F8RA 2FTRA 2RQKA 3HHLA 2AX1A 4C9DA 2RRAA 4ILLA 4A4JA 2OPRB 2CPDA 3HPOA 2KHCA 3OL6A 4PG4A 3I0SA 4FF2A 2KB2A 4OZ5A 3RRGA 1RKIA 3FEZA 1NHUA 1U1OA 1N4LA 4HDGA 2DNNA 1LXNA 1S1UA 2NLWA 2ZFHA 2J0SD 2N3LA 4CI0B 2FJBB 2OFHX 1JLFA 1MMLA 1S1TA 1NZAA 2AV5A 2Z2MA 5G4DA 2ZH3A 2XLJA 4KO0A 1KQKA 4C2MA 2VBYA 3IXQA 1VQ9S 4YDDB 4B08A 2FPHX 3I9V9 4JUZA 2HS3A 2AGPA 5K8OA 4UUXA 2R8GA 1K1SA 4QR2A 1T3NA 2J7UA 3QAUA 4LSNA 1ULRA 5A8KA 3V4MA 2CQCA 3NS5A 4DL2A 5KT2A 1T03B 4BBYA 1HQEB 4PXCA 1LW0B 1RT1A 2NREA 4ZA1A 4B9NA 2BW2A 5I4MA 3E2EA 5J2QA 2DO4A 3HVAA 1SIWB 2LQJA 4DV7F 2ADBA 2X1BA 3QZ8A 2HIQA 1YI2S 3DLJA 1TKXA 3KHLA 1N33F 2WSFC 1KQGB 4EGLA 1Z4UA 1LW2B 3AA9A 3K0JA 4ZCMA 4F2RA 3IRXB 2WONB 4ZMMA 4WF9Q 3JAMY 4DV6F 2MQOA 5HP1B 3I9ZA 4OLPA 3DNCA 1IKXB 2E5GA 2XULA 5KFIA 2U2FA 4DR5F 3QJLA 1GH8A 4I6YA 3PVXA 2B9XA 3OFGA 3MUMP 2GW8A 3ZZTA 3RRKA 1RDRA 1S49A 4DL3A 1YVFA 4DF8A 5HMZA 4C8LA 3IRWP 3U27A 1REVA 1VMBA 3N6MA 5KG3A 3PXGa 2CQGA 2V4RA 3EGZA 2YWHA 3AHPA 4OI6A 4I68A 1TL3B 3J7YI 4OJHA 3TO8A 4J37A 1W2IA 4I7FA 3SDEB 3QYYA 1S9FA 2A2CA 2YKNA 3MPVA 2PGCA 3OFEA 2DPJA 2XMKA 3DLKA 5KFPA 4DFPA 2W24A 3TA0A 3EPIA 1Y5NB 3T6JA 2HNYA 1VIXA 5DJBA 2BRLA 4RUAA 2J6TA 1M1KT 4QQBA 1CPZA 4C11B 2IM2A 3LP2A 1W25A 2GO9A 3QLHA 1DZ5A 3PFOA 2HVZA 3FSXA 4OZ1A 2W8LA 4P6QA 3HJFA 4PG5A 2ZDOA 2R8IA 3MM6B 4ZDNA 1RTJA 5KT6A 1EETA 3C6UA 3PX0A 4NYZA 3V81A 2A1BA 2LEAA 3QGIA 4ZCKA 4CCHA 4ECRA 4R5PB 5EWEA 4P7TA 4RW9A 2N82B 1R0AA 1HPZB 1I6JA 2KRBA 4PXEA 4ZP8A 5D4PA 4ILMA 2KFZA 4OHXA 2DNZA 4PG8A 2AP6A 3O5TB 1MNEA 3JSRA 3GR1A 3PW5A 4DSLA 1FRLA 1U1RA 4A8MP 3BR8A 3MOJB 3LP0A 2ZE2B 3TAMA 3CDAA 2R4FA 4JV2A 3BJYA 1HQUA 5E7OB 1VFJA 2DH7A 2DNOA 4DR4F 1WHVA 1HI1A 1U2FA 3DM2B 2PA3A 4K4SA 4F3MA 1D9DA 3JSBA 1RT7B 1AROP 3F56A 2R7XA 3P96A 2E5IA 2J9DA 4N8OA 3OJSA 4A8KA 2DCUB 4I2QA 2JHEA 3M05A 5DGAA 1D8YA 3SCKE 2FLNA 4DN9A 1TL1B 3O3LA 4WZMA 1NJIT 4OIXA 1PSDA 1N88A 1D9AA 3BGRB 3N79A 4MK8A 3TOQA 4K0KF 2OTJS 4DBQA 2V0NA 1CQNA 3K57A 4TNOA 2L08A 5KFDA 2W7PA 1YHQS 5B0GA 1IQZA 4NLGA 1FNXH 2HHVA 1CC8A 3QIDA 4DR3F 4DR1F 4NRUA 2RMLA 2YX7A 1OSDA 3ETOA 4F67A 3IO1A 4TN2A 1TFWA 1JB0C 5C25A 1H2UX 1BGXT 2FLOA 3GFHA 5AE3A 1HNIB 4DQPA 3M8SA 3N5FA 5E3CA 1D0EA 3KKFA 4OL8A 5E3QA 1U49A 1KTQA 2DR8A 3CULA 3VALA 2F40A 3ONQA 4WK3A 2XLIA 4PG7A 4NA2A 4ZKAA 3I5AA 1RT5A 3TVYA 4D3HA 1FO1A 5KFXA 2OH2A 1TR0A 2QA4S 3VAJA 1JLBB 3WC2A 1IBKF 1MU2B 4X4RA 4MKBA 4IKAA 2XG8A 3AH6A 3C3LA 2W7OA 4ECZA 4IFVB 1YJVA 2QLXA 4BC9A 2PDAA 4NLWA 2VG6A 3AJ1A 4FBTA 3BREA 1I94F 4JI1F 4PWDB 4KIAA 2WB4A 3QO9A 4Z2XA 1B0TA 1MMNA 1FRHA 2NS1B 3AB4B 5KFLA 4LF5F 4O3NA 4B17A 2CPEA 2P9CA 4R8UA 3OFFA 1QY7A 3MURP 2MPUA 2V2KA 2BOPA 2IM1A 1UKUA 2YNIB 4R0EA 1D8ZA 3PIOQ 1JMTA 1URRA 1S6UA 4C97A 2B6AB 1GTHA 2LDYA 3OTCA 1RK8A 2QMXA 3KLIB 1TV6A 5BR8F 5AXLA 3QMQA 3CCUS 3V4IB 3KTQA 3B82A 3NP5A 1RTIA 4WU3A 2XMWA 4XPEA 3ICLA 2LU1A 1LW0A 3P6YC 1X5TA 4DDFA 1FNMA 5DG8A 5B7WA 2W8KA 4B9VA 3HI9A 1CVJA 3SXLA 4Q43A 4DL6A 2JL9A 2O01C 3G6XA 1S4FA 1X9WA 1VRTB 4I4BA 2CQHA 3OBIA 1F60B 3I56S 2V4JA 1X5SA 4OJ3A 2WONA 2OPPA 2MKJA 3N6LA 4KV8A 1JLCA 2RQ4A 4FS1A 2EW9A 5HP1A 1Z1ZA 2HGLA 3POTB 3CF5Q 3DGPA 2HHQA 3MEDA 1B0VA 3U7JA 5E3RA 1ELOA 4NZ7A 1UVLA 2M8HA 3EXYA 3DLBA 5LJ3Y 2OPQA 4RWWA 1T7PA 3PW0A 3G6VA 4GO5X 1TL3A 1VQMS 2BANB 2HNZB 2MZQA 4R0JA 1HNVA 2PO4A 3BM7A 2PI4A 3THVA 4Q44A 1LWCB 1N5TA 3CGIA 1YRTA 3HHDA 1Q1KA 4UY8T 3HKWA 2UUWA 3SSQA 2BQRA 4G3IA 4ZLPA 5IS2A 4U67Q 3V5RA 4Q8EA 3CWJA 4DL4A 5KFAA 2IA0A 1Z2ZA 5JJBA 1UVJA 1HW9A 2WW8A 3MXHP 5LT5A 1NU4A 2YNHA 4RW6A 4LF6F 5A8WB 2IYIA 1UAWA 4DSEA 2MYFA 4X64F 5K9FA 3AQOA 3HZEA 4ES1A 3B78A 4J9KA 3TAQA 3K2YA 1UVNA 3J7A1 1SH3A 3GIIA 2YKAA 4B3TF 1RT6B 3MM5B 2V8HA 5EX0A 1TKZA 3DLGB 5ADZA 2B0GA 4GC6A 2HPUA 3CT9A 5FDLA 2ZH7A 2G4BA 1AFJA 2LA4A 1HBNB 2HAIA 1H0HB 1ZAWA 3LUYA 1JKHA 2F8MA 1BQMB 2F4VF 3RBDA 4Y2AA 1HBUA 2DRAA 3EGNA 2JEFA 2PN6A 1FVSA 5DGBA 2HLUA 2WAQD 5CYMB 5GAEI 1P9QC 2ZE2A 4MMOA 4NCGB 1OS5A 4IG3A 4RBTA 4DL7A 3I55S 1LWFB