The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
177
|
structure length |
157
|
Chain Sequence |
MKLMIVGNTGSGKTTLLQQLMKTVGIDVKDWPILVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Leucine-rich repeat kinase 2
|
publication title |
Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb |
source organism |
Homo sapiens
|
molecule tags |
Transferase
|
total genus |
40
|
structure length |
157
|
sequence length |
177
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
pdb deposition date | 2007-12-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08477 | Roc | Ras of Complex, Roc, domain of DAPkinase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |