2ZEJA

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
177
structure length
157
Chain Sequence
MKLMIVGNTGSGKTTLLQQLMKTVGIDVKDWPILVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Leucine-rich repeat kinase 2
total genus 40
structure length 157
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 2zejA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zejA02
4OL0A 4DLRA 2W6JA 1AJEA 1TAGA 4UJ5A 5B30A 4HAWA 3B8HA 3NXSA 4PANA 2IUTA 4OKSA 2C04A 4PAOA 1A2KC 3RRZA 4B2LA 4DCUA 1S3SA 3LX8A 4MDFA 421PA 3B13B 5FTKA 3H0KA 3DEFA 3U44B 3LX5A 4JL8A 3GQBA 5B2ZA 2GEVA 4BFSA 4DB2A 2ODWA 2KBEA 4V02A 3IHLA 4MKGA 2Z4RA 1II0A 4N3NA 3AM1A 3K0EA 3RWOA 2ZRKA 4AIIA 5LD2B 2F1HA 2ZXUA 5HE9A 1OHHA 1XTRA 4EJSA 2BEJA 3AVQA 3EWSA 1J90A 1UAAA 1EX7A 1QVAA 1VCNA 3VMFA 5DGXA 2I3BA 4DLZA 4XVRA 5EXPA 2FFAA 4D80A 4KYIB 2B21A 1I4DD 2R6AA 5F9HA 4D0LB 2LKCA 2BBOA 1UF9A 3BB3A 4TYQA 1KMHA 4XD7A 4KI0A 1A5TA 5KO2A 4IDPA 1TMKA 1Q1EA 3PUYA 1T0JB 4LUCA 4KODA 1LTQA 2O8DB 2FMXA 3JVVA 3CRRA 5FBLB 4YXWA 3NBXX 2IYLD 5FOUA 5CDFE 5JZVA 3W6PA 3GCGA 3PUWA 1ODFA 1N3BA 1NMZA 1P4SA 2I1VB 1I4TD 3V4FA 3KKOA 1TU3A 5C4MA 4FMDF 4LPSA 1ZAKA 2QP3A 1G64A 1KGDA 4JJZA 4TT3A 1RRGA 3E70C 5L3VA 2V7QD 4DLSA 4XSGA 5DO9A 1QHHB 2CHQA 2VBCA 1F2UA 1RRFA 1MO5A 1US8A 2FPKA 5L3SB 5GVRA 3TSOA 5JRZA 4E09A 5CLLA 4JZKA 3Q8XB 4YQFA 3A1VA 1HA3A 2HF8A 5HPYB 1TF7A 3ZJYA 1RC8A 3EPJA 1MRSA 1GITA 3QI2A 2C9YA 4RD0A 3H2YA 1LFDB 2AXPA 5D3MA 1RVDA 2PMKA 1Z06A 3R7WB 4C4PA 1EXMA 4BQSA 2JJ2D 1N5IA 5FPYA 2ZYUX 3QBTA 1E0SA 4W5WA 4BRWA 5CITA 4IFBA 2MSCB 3R9IA 2QE7A 4AC9A 1TEXA 5B57C 2Q6TA 2XOKD 2QBYB 3WP1B 1G5TA 4O0MA 5AJWA 1UBFA 2UZIR 3BFKA 1Q20A 2MMCA 1E9FA 1E1QD 4QGHA 2YC2C 3X1WA 2LKDA 5TARA 2IS6A 1HE8B 2PLFA 1P61B 2DR3A 2W6JD 1WP9A 3SOPA 1H8HD 4GPTA 3UWKA 4B76A 1AQYA 2A7QA 3QNUA 4Q03A 3T1TA 4JT2A 2CL6X 1IN4A 4TMKA 3KUCA 1E2IA 3W6OA 2NO1A 4QXAA 2WWWA 4D0NA 1P3JA 3K0CA 3OIWA 2YWFA 3SFVA 4P3YA 2XZLA 1G19A 4M1KA 3TUZC 5EE0A 2RCNA 2HUPA 2VO1A 4DLUA 3GLFB 2RGNC 2YWHA 1QDEA 4JKIA 3U44A 4DCSA 2XJ4A 1EK0A 4MRVA 1UJ2A 4TT3D 4Q7LA 4PPFA 3Q9LA 2WWGA 4LJ9A 5K8TA 2EFHB 5LDDC 1W0KD 1CKEA 1F6BA 1FZQA 3QF7A 3UATA 4MGIR 3WMEA 4F4IA 2QSYA 1X8LA 3GLGE 4YXWD 2YWEA 2ONKA 1P2UA 1ZRHA 2OV2A 4OQNA 3VNUA 2ZJOA 3SS8A 1FMJA 2C2HA 2WWIA 2ZU0C 3U3KA 3GLGB 3T1OA 1SVIA 2XAUA 4ARZA 721PA 4Y0VA 1OH5A 1P9WA 3QPUA 4HUQA 3OEHA 4LHZA 2ZETA 2IK8A 5H70A 3GJXC 2EFCB 1VIYA 3HYTA 2ZITA 3TQFA 1N0WA 5CK4A 3JZAA 1N5LA 4G0NA 1Q3TA 2AHOA 3P27A 5EE5B 2FX3A 3LNCA 4D2IA 4EPRA 1ZNZA 2WJGA 2ZYWX 5CM8B 2F9MA 3EIHA 1FQJA 3HU3A 4B74A 2HF9A 1VTKA 1X86B 4MKHA 1DAIA 5DH9A 3W5IA 3RSLA 2IS4A 1KI7A 4LBZA 5E7JA 3GEEA 3QVVA 4AG5A 1G4UR 3GPLA 1ZUIA 4HI0E 2GXAA 1YZTA 2QT1A 1JJ7A 3NHBA 4IRUB 1E2QA 4TQUS 1BS1A 2VP4A 3KJIA 4MDEA 3QIAA 1M7HA 2ZE5A 1G8FA 3SI7A 2B6HA 1ZINA 1TF5A 3QOFA 4PAMA 1U8ZA 3C5HA 5L3QB 4WXPA 1J8MF 4M1OA 3EC2A 4PC6A 4EJSC 1XD2A 3AVUA 4G3XA 2Q9CA 1FP6A 3AKEA 4PO9A 4GFDA 3FFAA 4H1VA 4R2HA 3SHWA 1SVWA 2RGNA 3CWQA 3ND8A 4NL4H 4TSFA 4V0MA 1SHZA 3X1ZA 3NBYC 3SJBA 3BGWA 2NPIA 3CM0A 3TW8B 2GZDA 3PEUA 2E1RA 4Q19A 4R2IA 5FOXA 5DYGA 3EX7C 2CCGA 1TX4B 3CRW1 1YZLA 4JLPA 1OXVA 3M6AA 3K09C 2H8KA 2WJJA 1KI2A 4HUTA 2ZE6A 1KIMA 1VHTA 3IO3A 4B35A 2BIFA 3TW4A 2GAAA 2R65A 1VG1A 3CRMA 1DVRA 1VDZA 2JIZD 1DADA 1DO0A 2WSMA 2FDCA 2XB4A 4EJSB 1TQDA 1E9EA 3A8TA 4TWZA 2FF7A 4DIDA 3DMDA 3I73A 3GJ5A 2O52A 1P75A 4BZXA 1KOFA 5FOWA 1U2RA 1GIAA 4IHQA 3QXSA 5AWFC 1GUAA 1C1YA 2J0QA 2G1JA 1WXQA 1Z83A 5FI0B 4DT1B 1EFTA 1Z5ZA 3P1JA 1NBMD 5JS8A 2QE7D 4Y0AA 4DDUA 1ZCAA 1RIFA 3FMIA 2O8BA 4DSOA 4DCVA 2OCPA 5JHHB 1E9RA 2GJAA 2FV8A 2IUUA 4LYJA 4YLGA 4D0GA 1QHGA 1D2EA 1HURA 4HUQB 3SR0A 2DFNA 4MA4A 3B78A 1PLLA 1SXJC 3OE7D 4LHVA 2F43A 1AK2A 1D5CA 4AYXA 2C95A 4K46A 1E0KA 3LLUA 4A0FA 1L4UA 6Q21A 2EYQA 2OG2A 2N1BA 2IC5A 4KO8A 1T8TA 1M74A 3OIVA 3TVDA 4MRRA 3I8SA 3DOEA 1OHHD 1U8AA 3IO5A 1PZNA 2ZR0A 4CF7A 1J8YF 3PFIA 4CT5A 5CB6A 5F9FA 4DCNA 4HATA 2JDID 5JI2E 1OIWA 3THOA 2QSZA 2VSFA 4URWR 1GNPA 1VCOA 2Z6VA 2ZRCA 3KKNA 1IY2A 2ZRNA 4Q1FA 1AN0A 4AY2A 1P62B 3NG1A 2PEYA 1Z28A 2G6BA 4LPKA 4QBFA 1LNZA 1X8KA 1YR7A 2V55B 2W58A 2OESA 2ORVA 4B3CA 5KDDA 1FPMA 3ZVLA 1C4OA 3RC8A 4S35A 1E4VA 1H8EA 3P20A 3I5XA 4FWTA 3I8XA 3LVRE 4PC1A 3C14C 3SN6A 5BN5A 4EQ6A 4ZPXA 2YC4C 5KSZA 3TVTA 4IOJA 4P4SB 5JS7A 3SJAA 5KYKA 2G9NA 5HKKD 1F48A 2Z4SA 2VRWA 3AQ4A 1W46A 2R9VA 3UMSA 1RRCA 1QHNA 2PZFA 3TK1A 4PC3A 3U3OA 2NGRA 4NCIA 1N6PA 2D7CA 3HR8A 5JRJA 4KBGA 4OI0A 1OF1A 1RZ3A 3VNVA 5FOSA 1MABB 3TUIC 3IHWA 3T15A 2C03A 3ZD6A 4G5OA 3A37A 2ODNA 1KO1A 3CKLA 5JJKA 1BO6A 2GESA 1DELA 4BLQA 1MRNA 4A8JC 5K8IA 221PA 2QM7A 2ZJ2A 3KFVA 2O8EA 4QOSA 1B23P 2JLUA 5LPNA 2R62A 3SFZA 3Q5DA 2WMOB 4XH9B 1IOZA 4Q00A 4FCTA 3U7GA 1JPNA 1FMLA 1QG4A 4ZDWA 1N6HA 3CNLA 2B8WA 2RKOA 2BV3A 4GP7A 4JLDA 3AGQA 1CXZA 5CK5A 5SZKB 1R8SA 2CE7A 4ERNA 2PJZA 3SDZA 2FEOA 3F3YA 2VHQA 5FUXA 1CRPA 1KSHA 2BKUA 3ICEA 1W4CA 2PT5A 1R10A 5KNBA 1H8HA 1U99A 1X3SA 2ZRIA 4EPTA 3QKUA 1SXJE 4I1UA 4G5QA 5EP3A 1IHUA 4CEHA 1O3YA 3RDPA 2WWXA 2ZE8A 5D3QA 3TLXA 4GDFA 1P73A 4BLTA 3KTAB 1ZD8A 3I3SR 1AZSC 3X1YA 3AF4A 4JLMA 4L16A 2WSSA 1UKVY 3TBKA 3SYNA 1W1WA 4QNRA 4XJXA 5E7MA 4D25A 1E99A 3QPVA 3GLIA 4GRAA 1W36D 4XVQA 1LF5A 3J81k 4A0HA 4D6PA 1K5DA 4M1WA 4UNPA 5JJLA 3LWNA 4MGYR 1U90A 1GKUB 1OKKA 2AFHE 1N6OA 1CF4A 1CR1A 3MWLA 4LJ7A 4KSCA 3SJZA 4QFMA 2W2VA 1YQTA 4KFRA 4CW7A 1JAHA 2ZQ5A 2V9PA 3IDQA 3WXMA 2E9SA 1UBEA 1VPLA 3QKRB 4EQ6B 2OM2A 4V0NA 5J40A 1GKIA 5KDOA 4NBSA 2NTYC 1Z6GA 2CLCX 3T1VA 4YC7A 4S2EA 3U5ZB 1ESNA 3OHMA 2AX4A 4MKFA 4KXFB 4GI7A 3V9PA 4QGGA 4CZ2A 3SE0A 4B3DA 1GILA 1UDWA 4DJTA 1CLUA 2IF2A 4RKEA 2P5SA 2PZEA 3CPJB 3GJ4A 1KO8A 1F2TA 2P5TB 1NLFA 2ZJ8A 3QF4B 5TDHA 1MABA 1GL7A 4B6EA 3O8RA 3QKSA 1X6VA 2QRNA 2CK3A 1AS0A 1HQCA 2WSSD 3K0FA 2V8OA 3WBKA 3DO6A 3DVLA 2V6IA 2PT7A 4RZXA 4PHHA 2F9LA 3FKQA 1ZYUA 1E1RA 1EWRA 1P2SA 1YKSA 1YZNA 2VF8A 3H1TA 3MFYA 4M9ZA 1S2MA 4RFSA 4RD1A 3NH6A 3Q72A 1E2LA 2PEZA 5FBQB 1KKMA 2F43B 3CZQA 1E96A 3PUXA 4JYCA 5ANRB 1BH2A 4GOKA 3T1QA 4DLYA 2AWNA 5CB8A 1KY2A 4QBHA 3GP8A 3GJ6A 1IN5A 2F6RA 2XITA 4AKGA 3MRSA 1FX0A 4FINA 2ZANA 2JCSA 2J41A 3LVQE 1E2KA 3ZZ0A 5LB4A 2QG6A 2BBTA 5CJPA 4EKDA 3FMFA 4BFVA 1J7KA 3LLMA 2D3WA 3N2IA 2D62A 2Z5FA 4TMZA 4KCGA 1NN5A 2ZJBA 5TB5A 4RVCA 3ZDQA 3ECCA 5IF9A 4ON9A 2JLVA 4RZUA 4PC7A 2CVFA 1Z29A 1G7RA 4IVQA 5LD2C 3L43A 2FFQA 5KDLA 3UWOA 1E2HA 5DISB 3O8DA 1C9KA 2Q3MA 5C46F 2OFOA 1FW6A 5H1YA 4Q7KA 1JNYA 4OK5A 1T3LA 2A78A 2F1IA 4LHXA 4IJMA 2P65A 3BK7A 1CJKC 3B1VA 2WTUA 3PIRA 4RCYA 2Q9AA 4U02A 2MSEB 2OT3B 2ZS8A 4R98A 2QPTA 2VLIA 5FBVB 4UKDA 1AZTA 1XPRA 3S1AB 1NJFA 4LJAA 5CM9C 1KMQA 4BECA 1HT2E 3LQQA 3NC1C 4JLVA 1XMIA 1YRAA 1XZQA 2BM0A 2IXEA 2QY9A 1Q1ZA 1F2TB 3QE0A 2W2TA 1L8QA 1G4AE 1N6IA 4IDQA 4QJ5A 4NPHA 3ZH9B 4KU4A 1E69A 1G17A 1G3IA 1NG1A 1NN3A 2J7PD 1FUKA 1KSJA 3FDIA 5TXGA 1K8RA 3LW7A 3P32A 5CJ2A 5L3QA 1JQJC 5H8WA 1X1SA 4Q9JA 1O87A 2OZEA 3C5CA 1XMJA 3WHLA 3LV8A 4IW3B 4PAQA 4LV8B 4QRHA 5IRCD 1XCPA 3PQCA 3BOSA 3DKVA 2ZRJA 4UQOA 4KLZA 4US2R 1W4RA 1ZM9A 4W9MC 2J46A 2F3TA 5K8UA 5DN6A 1OXSC 3EZFA 4DLWA 4GZLA 1ZNYA 1KNXA 1AKYA 4Z54A 2BCJQ 4JVLA 4W5JA 2DB3A 3UPUA 1FL9A 3B9PA 3UANA 1M6NA 2WMNB 2AN9A 3M1IA 1DG1G 1UFQA 2BVNA 5CIQA 1M2OB 1UKYA 2W0SA 2WJVA 1EFCA 2ZSEA 3EZ7A 1VKJA 4LBWA 621PA 2ZS7A 3GJ8A 1DTSA 2BKEA 4P4SA 3U3MA 3KKPA 3U7HB 2IHYA 1JBKA 2RGCA 3LDAA 3OESA 4TN1A 5BYJA 4A6XA 2QBYA 1GM5A 1CR4A 1A82A 2WJHA 2IBMA 2PL3A 1CS4C 3CPHA 5DSZA 3RRNA 2BCGY 5JJIA 1XRJA 2BJVA 2GVDC 3SYLA 1P6XA 4DZZA 1E2GA 1M7GA 1G8PA 4XTRA 5DI3B 4DVGA 2AK2A 3Q3JB 4JBWA 4N0EA 3K70C 1OH6A 3QXHA 5GJWC 4XD7D 2QUZA 4ACAA 4B3GA 1DAHA 4OI2A 3U7EB 4CDGA 3RNLA 4M1YA 1WRBA 1CBUA 3SNHA 3O8BA 4TTQA 1UKEA 3GMTA 3I92A 1G1MA 4OBEA 3T12A 2IXFA 1VIAA 3CW2A 4IXNA 2J9RA 1Q1BA 2ZTSA 5GVSA 3DKPA 4Q4AB 3MWKA 2HDNB 4CGZA 4IVRA 3OAAA 5KTYA 4X8HA 4URYR 3IPXA 1MOZA 4P4TA 2W6ID 3T5GA 2UVQA 3PUZA 1TQ2A 4BEBA 3PUVA 2C5LA 3S1AA 4FCVA 2ZEJA 3WNBA 4B48A 2QROA 1TUEA 3RLFA 3T34A 2RHMA 3K70B 3W9YA 1Z0JA 2ZRMA 3LD9A 4I1SA 4HSEA 3FWYA 4ABYA 2F1RA 2YJTD 1S9DA 3X1XA 4FMCB 3BRWD 1Z6XA 3C8UA 1XZPA 2GKSA 3EPKA 1Z07A 2ORIA 5B58C 2J7PA 4IXMA 2IYZA 1XTJA 4JS0A 1E1QA 3THYB 1U81A 4WBSA 3Q7QA 4MGKR 1W5SA 2CLSA 3K0FB 3KXKA 3AVOA 3K9GA 1SVMA 5DYIA 4EDHA 2IEZA 3ZYCA 5EQTA 3NHAA 1W0JD 4D26A 1KO4A 2ZR7A 5UKDA 1GRQA 1XFAA 4QHSA 4ZKDA 2O0JA 5DE3A 5FPHA 2EFGA 3DDCA 4N1AA 3WYAA 3LXRA 3KKQA 4EPVA 1DG3A 1OT3A 4F92B 5FL3A 1KTVA 4LJ5A 1II9A 2N46A 2ZREA 3K8YA 3SQXA 4HLUC 2WAXA 4HLCA 2OCYC 1S9HA 2ONJA 1IAQA 2YNMA 3BAFA 2GDJA 2CCJA 4Q47A 1UBGA 1XPOA 1XD8A 3BH0A 1GZSA 2CEAA 2KWIA 3Q5EA 1KI1A 4N0DA 1ZC4A 3F0TA 3SZRA 4NKRA 1W36B 1T5IA 1LS1A 1V5WA 1W47A 4A2PA 1OFUX 2RGXA 1F3OA 2GCNA 3CUEF 1QHSA 1E9BA 2O0KA 3AVTA 2PZGA 4LYFA 1EESA 5H68A 1SULA 3HR7A 2ZJZA 3ZIAA 4XTCS 1XDBA 1ZNXA 4AKEA 3C15C 1YR6A 1YZKA 1Z0DA 2BEKA 2VF7A 4W5HA 2F55A 1N0VC 3OIUA 4DLTA 1ZU5A 4QHYA 4F4JA 2D7DA 2ERYA 4IEIA 2QRZA 3RS0A 1HYQA 4YMSA 4GNKA 2JDIA 2BJWA 2YHSA 4Q48A 1EFUA 5EXTA 3QG5A 5P21A 2V6JA 3DPUA 1Z0AA 1BMFA 4A8JA 2H92A 1YVDA 3EZ2A 2XTMA 4NHOA 4TL7A 1KI6B 1KI3A 2VA8A 1PLKA 2XSZD 2DWQA 1G8HA 4TQ9A 2JIZA 2R44A 1R2QA 1NKSA 3MWJA 4RCZA 5JFGA 3SYKA 5EP4A 2G83A 4DEYA 1KDOA 4NYIQ 1KK2A 3TH5A 4BRUA 1VHLA 3OF5A 2CE2X 1EWQA 1GDDA 1NMXA 2FSFA 2FH5B 2KI5A 1BKDR 3QXJA 2FSIA 2VP6A 1COWD 4Q1EA 4HLDA 3GLFA 2G77B 1TQ6A 4GOXA 3FHCB 4MH0R 3TAHA 2ZSDA 2IS1A 2W2XA 1NY5A 4KFTA 2DBYA 4TLDA 3N5CA 4WXRA 1S96A 5FL7A 4ARZB 4BUJA 5JEDA 1AIPA 4DDTA 2YKGA 3NC0C 4IOLA 3ZQ6A 3W3AA 4FI3C 3ZIAD 2VQSA 3FTQA 4HLUA 1GFIA 3GFTA 4P31A 2IEYA 3U4QB 2GWHA 4A8JB 2FGKA 1WF3A 3Q7PA 4LSGA 5HCNA 5FFMA 3VKWA 1YRBA 4AWXA 1Q12A 2EFDB 3DM9B 4PSKA 1T3HA 2FPMA 4UNSA 4C0HA 4FMCF 3U4QA 3EW9A 2LWIA 1MO4A 2YZ2A 4LC1A 2XSZA 4BWYA 1IY1A 3T5DA 3Q85A 4B71A 4MQBA 5IK2A 1KJYA 2X8AA 1U9IC 1BMFD 1NSFA 4I1VA 2C99A 3WRYC 2DCUA 2ZM5A 3FGNA 3EIEA 4NE2A 3QKSB 1OSNA 4X8OA 2HT1A 1COWA 4LK2A 4OHXA 2OEPA 3NKVA 1DOAA 3G5UA 2Q9BA 4KVAA 5KNCA 2YVUA 3JVUA 1F60A 1WCV1 2X2EA 3LY5A 5FL7D 4LDJA 4LV5B 3LXXA 3I61A 4Q9IA 2QTHA 1TNDA 2QAGB 3GJ7A 4L8GA 1P5ZB 2G3YA 1L4YA 2WAYA 2Q3HA 4V0ME 1SXJA 2H16A 2XTNA 4MYTA 2KE5A 4OHYA 4IDNA 4FD2A 3VHXA 3BWDD 4YONB 2R6CA 4P32A 2JEOA 3QEJA 2ECKA 2BMFA 2NO0A 5EZ5A 5JWOA 3CX7A 2IHBA 4URUR 1E79D 2H1LA 3GLHA 3KXLA 2VHTA 3UMFA 3LBHA 3VFDA 4LJ4A 1T0HB 2PBRA 4B33A 2ZI5A 4AKIA 2VH5R 1R0ZA 2ZI4A 1AS3A 5J4KA 3W5JA 5AUNB 3CB4A 4B3BA 3FHOA 4E03A 3MCAA 2IYWA 2QMHA 4I4LA 2WWFA 2QAGC 1UBCA 1W0JA 4X8LA 3AVYA 4BFTA 2WICA 5GJCA 4WOPA 3BFXA 4JLNA 1Z6AA 2QQ0A 1K5GA 4Q9LA 3CRVA 2CHVA 1R7RA 3A1TA 4EFMA 1NP6A 4E22A 3MD0A 5E3HA 1T5LA 3FFBA 1ZIPA 3EZ9A 4TL9A 2FPLA 5TVKA 3O8CA 3IPYA 1GOTA 1IJFA 3BS4A 1OFIA 2GXUA 2ZRPA 4Q1BA 1CRQA 2PMDA 4I1OA 1FX0B 1AS2A 5SZHB 4PTLA 1NN1A 4R7ZA 1SVOA 4Z1MD 3GLGA 3C16C 1CU1A 1JPJA 2ZSBA 3GLIE 3QXCA 2QPAA 3EXAA 4DDWA 2OILA 2D06A 2NO7A 1RE0A 5CDFA 3H86A 1Q0UA 1KAOA 3QENA 4D81A 3W90A 4HB3A 3LRPA 3NTUA 2RGBA 1DAMA 1FUUA 1II8A 1NRJB 5EZ6B 3ZS8A 2NG1A 2C96A 1XCGB 2IYTA 1GP2A 1QHXA 2AR7A 1D6JA 2CBZA 3B6EA 4BFZA 4XWOA 2N42A 4QKQA 3K9NA 1JEEA 2GCPA 2JAQA 2ZR9A 1KK3A 1OKKD 3KUDA 2DWOA 1KDPA 3PITA 5KOYA 2J87A 4RY2A 1KJZA 1UKZA 4PQFA 4YMTA 3GD7A 1UEIA 2CHGA 3A1SA 4OQFA 3CR8A 3BH7A 2OBLA 4P33A 3SEAA 2GBLC 4KV9A 2NPFA 2W00A 3CONA 1ZC3A 1ZIOA 5CIWA 1S0UA 3OE7A 2P6RA 4JLAA 4TLEA 2HT6A 1WA5A 3TMKA 1Z6YA 2RGEA 4RFSB 1PVOA 3MJHA 1R0YA 4IEEA 1ZUHA 4BLOA 1DAKA 3TE6A 1PV4A 1IN8A 4Q7JB 1T8UA 4OI4A 1DBSA 4NYMR 2C9CA 3LFUA 1KDRA 4IFEA 5AUQA 3BJIC 2XGJA 2IYRA 3I4LA 4KFUA 3CH4B 2V1XA 4GMDA 3IBYA 2ZRBA 2DFTA 2ZRDA 4HZIA 3L8ZA 2WKRA 2ZU6A 1N6LA 2XNSA 4A82A 5JI3E 4A1FA 1VYVA 2GJ9A 2BC9A 4WAUA 4DC9A 1XMSA 4R9UC 2WVJA 1U8YA 2QP4A 4GSYA 5AJVB 3VX4A 2AFIE 1R5BA 3ZVRA 1E2EA 2D2EA 2FJUA 3IILA 3K0CC 4MYUA 5FPSA 4D4MA 2OFWA 3PENA 4MUBA 4ZCIA 3VKGA 5FOVA 2O8FB 3NEYA 4C30A 3IIMA 1DO2A 4YDHB 4B43A 1SHKA 1JECA 1Q57A 4EPWA 2OAP1 3KKMA 4P0TA 3FYHA 4B73A 3DOFA 2V3CC 2REOA 1OH7A 1IXSB 1J70A 2W6IA 2JLQA 5EXSA 4QM6A 4DSNA 2GJKA 1G3RA 4M8NE 5JEEA 3FVQA 3BFVA 5IDVA 3TAUA 3W6NA 2DYKA 2A5JA 2Z43A 2C8VA 3OFND 4L15A 1XD9A 2NOAA 5IK2D 1JR6A 1W2HA 2O8EB 1VG9B 4F38A 3CRQA 2SHKA 4LYAA 4OI1A 4AD8A 5JECA 5DI9A 4HLQB 4A6PA 2XZOA 1HUQA 3B5JA 1M7BA 3E1SA 4Z8XA 4C0LA 4KYUA 2QN6A 4POAA 4CYMA 3KTAA 4TZ0A 2ZI7A 4OJQA 3CBQA 3RYTC 1MV5A 2ZYVX 1N25A 4KJZA 2B8TA 4MRSA 2V4ZA 3LW8A 4D4KA 3VU9B 1S1CA 1F5NA 1BOFA 1YR8A 1VG8A 2J0SA 3TJZA 5HZHA 1OXXK 3U60B 2O8FA 2GTPA 3WP0A 1W4BA 4OQLA 5EE9A 4EUNA 4CEIA 2EU8A 1E6CA 3BORA 3L0OA 3MG9A 2CL7X 3LH5A 4ZKEA 1Z0FA 1ZM3A 4Q02A 4U00A 4BLRA 1XJQA 4HAXA 3PV0A 3QUSA 2GZAA 3HP1A 4OK6A 4M9XA 1R5OA 5JLJA 1OB2A 4C7OA 1WQ1R 1LVGA 4C0BA 3PEYA 5SZIA 4DLXA 2I1QA 3WMGA 1XXHB 1Z8FA 2KJQA 2ODBA 3MLEA 4UJ3A 3TIFA 3T61A 1E2NA 4EPYA 3KQNA 4QBGB 5FPKA 2LCFA 3EAQA 4Q18A 5J5CA 3VTKA 1XTKA 3CNOA 1NI3A 1IXRC 3WHKA 5F98A 2QI9C 2IUSA 1XEWX 2UZ3A 4JYBA 4K8OA 4PFSA 2G0NA 1OXTA 2IA5A 3U2QA 1YU9A 3AUXA 4HDQB 4TSFD 4MYHA 4HB0A 2WWYA 5FOTA 2GEDA 3ASYA 3JZMA 2QMUA 1IXZA 1P2TA 5DHAA 1IONA 1DAFA 3KL4A 1QG2A 4M4SA 2HJVA 4Q66C 2L0XA 4B3XA 1SVKA 4G5RA 2ZE7A 2P6UA 1S4QA 3GLHB 4LC0A 4HB4A 2A5GA 3WYFA 3B1XA 1OH8A 2QGNA 3VHLB 4V0KA 1KO5A 1KKLA 2VP5A 1KJWA 5FTMA 1N6NA 4BLSA 4H9GA 2VEDA 1AA9A 3AP2A 4OYHA 1SVSA 4QHTA 2TMKA 2QL6A 2K5UA 2WWHA 4DLVA 2X1VA 3GJ0A 1S1MA 1TL7C 5D3MB 1GNRA 4V03A 2OLJA 2X19A 4URXR 1W36C 5TV2A 2AWOA 4B75A 4KBFA 1R4AA 5AUPB 5A0FA 1ZM2A 1FOEB 1YZQA 3BBPA 4CRWB 5BWMA 4PHFA 2WPDD 4RJLA 3L82B 4LHYA 3QKRA 4UNQA 3LO5A 1HH4A 3IGFA 2GAOA 2ZI3A 4Q1AA 3AVWA 3P4XA 5SZJA 2AXNA 2HJGA 3AKDA 4B3FX 1SKYE 5HE8A 2ZYTX 3BE4A 3OFNA 5J4HA 1E1RD 3O47A 5KU1A 3PEVA 4V0LA 2RB4A 4DRZA 1U0LA 3EWAA 2QNRA 4XWKA 1E2MA 4NTZA 2VHJA 1OW3B 4AURA 4URVR 4ZIRB 4JKYA 4PHTA 4Z1MA 3RS5A 1E2DA 2RHDA 5DI3A 2JLYA 1N5JA 4Q1DA 2PJRA 3A36A 4F7WA 1XTIA 1MO3A 1TPZA 1L2TA 4PO8A 5HZKA 4CEJA 2WKPA 4OJKA 2XNDD 1G8YA 4LY6A 3AF0A 2HCJB 1ZM4A 3B9QA 5GADl 3BIFA 4DWJA 5IHPA 2P6NA 1GVNB 1NF3A 3EPHA 4JVMA 2ZSFA 3CZPA 2QEQA 2J59A 2RGAA 2VSXA 1DEKA 3HU2A 2NMVA 4QJ4A 3U3RA 3K9LA 3NBZC 4FMDB 3WNCA 3GFOA 2CL0X 3ETLA 3ONWA 1OIXA 3AGPA 3W34A 3W8NA 3HJNA 3DMNA 1MT0A 2H7VA 3F5FA 3KDSE 2Y8EA 1DAEA 2FZLA 3VR3A 3M0EA 3D8BA 1KSFX 3TNFA 1GG2A 4ESVA 1DS6A 4JLJA 4ASUD 4HAUA 4HDOB 2YOGA 4YMVA 3IEUA 1EFHA 1ZU4A 1MH1A 5F3WB 3RHFA 1U0JA 2OBMA 2OXCA 2Z83A 5EE1A 4DEXA 2GF9A 2IYSA 4KITB 1GSIA 5HKKA 1G3UA 2RGDA 2JJ1D 3U7FB 1IN7A 2JASA 3GJ3A 4HAZA 4F93B 4MKIA 5L3SA 3UG7A 3ZZUA 2H18A 2NQ2C 1QHIA 2IYXA 2ZAMA 4C0KA 2XOKA 5AK0A 1E9SA 1SGWA 1HE1C 5GJVC 2QT0A 4JLKA 3WY9A 1ZCBA 5F2EA 2MSDB 1QVRA 3KJEA 1OJLA 2R6FA 4NDZA 2AD1A 2OFXA 4JBXA 4TQAA 3RRMA 4A0RA 4TYNA 3KXIA 5FH9A 1ZNWA 3VR6A 2ZIAA 4Q5IA 4U7DA 1JJVA 1DAGA 5L3RA 1G16A 4C0QC 2ZROA 1SKQA 4YDSA 1LW7A 2KBFA 2ZUDA 1T91A 3C7KA 2ATVA 1PUJA 5BYKA 4GL2A 4CEJB 3B1YA 1RJ9B 2QMOA 4TMWA 1YHNA 1ANKA 1G3MA 1F2UB 1GNQA 4A9AA 2ERXA 1EFRD 2AK3A 2QGZA 5FR1A 5ELXA 1E9CA 3VKHA 3GEIA 5AR1A 1HTWA 4ITRC 4UNRA 1OB5A 4A2QA 3IEVA 1XEXA 3KFXA 5FTLA 1Q22A 1CEEA 1UDXA 3CX6A 4EAQA 1SXJD 2P67A 4GMXA 3HWSA 4RZ2A 3IIJA 2JLWA 1Q21A 1KHTA 1Y3AA 3AEZA 5FUYA 3I1FA 2JLZA 3CX8A 3BC1A 3E2IA 1VCIA 4PR0A 2WHXA 4DKXA 2HV8A 4WZAE 3MJRA 4PXAA 4DXAA 3VX3A 2JJ2A 3K53A 2GRJA 1Z63A 3LA6A 2XJ9A 4PQRA 4CT4B 4CEIB 3RS7A 2WKQA 1HQYE 3X1DA 1G5PA 1LB1B 4Q1CA 3OZXA 5EUQB 2P2LA 1GAJA 2HLDD 2ASEA 2H17A 2VP0A 1W44A 121PA 4BZQA 2HXYA 4V0OA 3B60A 1RFLA 1N5KA 1NKTA 5G41A 1Q3HA 4FXPA 2R2AA 4DBLC 1VG0B 2XXAA 1CJTC 4EFNA 5HCIA 3RABA 4KFSA 4Q4AA 1RRPA 3AB3A 3AVPA 3THWA 2W83A 4DT1A 1OE0A 1UM8A 2C77A 3EZ6A 5JSZB 1PLJA 1UEJA 4LGMA 5EJEA 1G5RA 1NMYA 2IYYA 1X1RA 2Q0HA 1A2BA 2FZ4A 1M1YE 2FA9A 3CIOA 4PZYA 3TGPA 4RKFA 4TLAA 1DPFA 2Q21A 2J1LA 4ASUA 1VMAA 2X2FA 4W7SA 2QM8A 2F7SA 4TZ6A 4MRPA 1XEFA 1QF9A 2J45A 4M9QA 2JA1A 4G1UC 4JT4A 2F1JA 2GK6A 3AKYA 1QBKC 2MMGA 2YYZA 4ZI2A 2R6DA 2FNAA 4JMPA 1W7AA 4AI6A 2BDTA 3CLVA 1Z0IA 2D74A 4IOKA 2ATXA 1ZW6A 2FOLA 2QZ4A 4DIEA 2VYFA 2ZRLA 1JXOA 1TF2A 4A15A 2CDNA 4RSGA 1OIVA 4FN5A 1G21E 5G53C 2GCOA 3QY0A 3FOZA 1FTSA 4PPGA 2VPPA 1TUIA 4NYJQ 3REGA 3ZZTA 4CVNA 4ACBA 4ILEA 1Q1QA 1L7VC 3BERA 1XTSA 2OLKA 1XD2B 4DCTA 1XXHE 2EWWA 2PCJA 3CF0A 4TL8A 4CIDA 2FEMA 5M04A 2FFBA 5LB2A 1XJ0A 1SKYB 4LYHA 5FBWB 2EQBA 2ZRAA 3GLFE 5C2JB 4JL5A 3AF2A 3TSWA 3RS4A 4WVFA 4GP6A 3K09A 1E9AA 2IX3A 1P9RA 4XVUA 2A2ZA 4KAXA 1DARA 5JMTA 1I4LD 1ELOA 4K81B 1Z22A 3U3JA 3ICQB 3QPWA 5LBIA 2REBA 3NVAA 3TR0A 3KQUA 3K1JA 1KZ7B 4ZCLA 5IT5A 8OHMA 3LBIA 2XX3A 2WIAA 1EX6A 1DE0A 2R8RA 1Q44A 2CJWB 2YOHA 3EASA 3IBGA 5DHFA 3FB4A 4MUAA 4ZDJA 2IS2A 2O8CB 1PJRA 3ZVMA 5A4JA 1CJUC 1CJMA 2REXB 2AKAB 2HCBA 2E87A 1KK0A 1OFHA 3HPRA 3KB2A 1E94E 4B2PA 2FWRA 2EVWX 4JIMA 2W0MA 4JVSB 2BBWA 1KI9A 4M1SA 4MITA 1T9HA 2KB0A 3R8FA 3WNDA 4DSUA 1G9XA 5FPTA 3D6TB 2YINC 2D4HA 4PQYA 2VL7A 2BHRA 4TTPA 4WZ6A 1P72A 1IJEA 5KUTA 1MO6A 2AKYA 1Z47A 2ZAOA 2OCAA 2P0EA 1R5NA 2J0UA 4Q4HA 4TLBA 5E7IA 3A58B 4D4JA 2IW3A 3QF4A 5KSYA 1ZMXA 2X77A 3DL0A 1AGRA 3VQTA 4BGDA 1KI8A 1U9IA 2G1KA 3A4NA 1V43A 3FMOB 1BIFA 2AL7A 4Z8YA 3TR5A 2YOFA 3BH6A 3PVSA 4JLOA 4LOAA 4QGAA 3CF6R 4BFXA 3KQLA 4Q4JA 4B6FA 1IN6A 4BLPA 4R71A 2GF0A 3H4MA 3MWYW 3EC1A 3VR4A 4PZZA 1OPXA 1N2CE 5FI1B 3THXB 1XEXB 1GRRA 4HYYA 5BW8A 3R20A 2FSHA 4C2TA 2CMKA 5CLQA 4AYTA 5CYPA 4H1UA 3TQCA 4HEJA 4C0AC 5HR5A 3F8TA 1T6NA 1S3GA 3T06B 1KY3A 1QHHA 2I4IA 3TUJC 1FP7A 2BWJA 3MUFA 3KQKA 4RD3A 1KYIA 4RD2A 1NVXQ 2BBSA 3ADKA 4TMXA 3SBDA 2WJIA 4TMVA 5J4VA 2EW1A 1R0XA 1VECA 1JEDA 1OYYA 3KB1A 3L2OB 5C1BA 4WZBE 3THYA 5J4LA 4RZ3A 2FG5A 2IXGA 3NEJA 2ZRGA 1JB1A 1QZXA 2OSBA 1G18A 2D2FA 3K9HA 4IDOA 4M21A 2BMEA 4DHEA 4KLNA 2QU8A 1E2JA 4IVPA 3QXXA 1K6MA 4QC2A 3FPAA 5HTKA 4HZUB 4ZCMA 3PCRB 1Z08A 1E4YA 1WMSA 4LI0A 2V7QA 1ZJ6A 5TY0A 2B7CA 3B1WA 2WOJA 3UK6A 5KHOC 1HY3A 2IF0A 5TMPA 1Z6TA 2GHIA 4LX0A 1KMHB 3IUYA 1XXHA 1ZVQA 1KSGA 2G88A 3QG1A 2GK7A 1PUIA 2QAGA 3QEOA 5KSPA 2A9KA 4L4UA 2ODEA 2DPXA 1W2GA 5E95A 2J3EA 4MGZR 3OAAD 1VYUA 1XU4A 1UADA 3X2SA 4PZLA 3IQWA 4LBVA 4LJ6A 3EPLA 1HEIA 1E2FA 1ZBDA 2IL1A 1KO7A 1JR3A 3U6KA 4AG6A 4O3MA 4B44A 1NBME 1J2JA 1NIJA 5B64A 3GLIB 2WOOA 3P26A 2FSGA 2NO9A 1G7CA 2JLSA 2RH5A 1R0WA 2PX0A 3A1WA 4GT1A 2CNWA 4QGFA 3ZGXA 4B2IA 1E2PA 3RS2A 4Q4LA 2QORA 1JXMA 3I62A 2O8BB 3OIYA 4MYCA 2CJWA 3AV0B 2O8CA 3AF1A 4M0LA 4P4UA 1AM4D 5J4YA 5BQ5A 4LWZA 3AH8A 3UKDA 2GJSA 3ASZA 3C41J 1GL6A 2V54A 4U5XA 4OHZA 4UNNA 1M34E 2WBLC 3NWJA 3OEEA 3VAAA 4WW0A 1KI4A 3AF3A 2BMDA 3IIKA 4HB2A 4UXIA 3AUYA 3UMRA 5JWHA 1CULC 4UXJA 1E0JA 2CXXA 2OXRA 4QBIA 3ZLJA 3ZQJA 2O5VA 3SC3A 2ZVQX 3HDTA 3ZD7A 1VYTA 4GBMA 2OUKA 2JATA 2CK3D 3R7WA 4A36A 1MR3F 1XMVA 2V1UA 4NCNA 3IQXA 5EE3A 4BE7B 2BOVA 4Z51A 4BEJA 4DDVA 3AKCA 2EFEB 3N2EA 4RD4A 4TMTA 4JSTA 2RGGA 1CJVC 1Y63A 4PSAA 1WDTA 1HV8A 1NVVR 4PX9A 1D8TA 3UIEA 3DHWC 2XZPA 1KZGB 3G82C 2ZRHA 1XB2A 3DZDA 1TADA 3B1ZA 1W5TA 1A7JA 1G41A 2YV5A 1A4RA 2ZI6A 4IOMA 2CCKA 2WV9A 4BZPA 5FTNA 1GKYA 2QTVB 1JR3D 4PO1A 4MRNA 1TU4A 3WBJA 2B92A 5KNDA 1E98A 4QNMA 2AD5A 3A4LA 3LAWA 3RRYA 5AJXA 1E32A 2DHRA 4L9WA 4B34A 3QKTA 2GEUA 5C4GB 3RSOA 2XEXA 1SZPA 2VP2A 1XJCA 2HEIA 2A30A 4M1TA 1BYUA 5EP1A 1W0KA 5A5GA 4C2UA 3FHTA 5AJZA 4A4DA 4Q4JB 2JJ8A 1I2DA 4JLBA 4JL6A 4IDHA 1W48A 3EA5A 4KSBA 1OV4A 2VIIA 3W3ZB 1G20E 3DZ8A 1IQPA 3SQWA 1NVWQ 1NLZA 2PH1A 1ZD1A 4WA7A 5DLQC 1MKYA 4C0JA 1WB9A 3VR2A 4A2WA 1FTNA 2GXSA 3K0SA 1XCMA 3MSXA 4E07A 1GRNA 2ANCA 3KQHA 2O8DA 5FUVA 4QG7A 4PHGA 5C18A 1XEWY 2ANBA 3H84A 3D3QA 1EG7A 1SQ5A 1VCMA 2VHCA 2XTZA 4LBYA 1NJGA 2QQEA 2GILA 5EXXA 1P60A 4FW9A 1E79A 3CH5A 3ND9A 4PPNA 4DUGD 3PR1A 1YZUA 4NZYA 3E5HA 3TSZA 1BYIA 3VU9A 3RC3A 1AGPA 2KSQA 4TLCA 3PG5A 3V00A 3DM5A 4NONA 3W8RA 4XSHA 3SU8A 1TQ4A 2ZJ5A 4NCKA 3ADDA 2XB2A 3KX2A 1LY1A 4NH0A 2WM9B 2ZUCA 3A4MA 2GVZC 1P7CA 1IM2A 1FNMA 2CVHA 1A1VA 3AP3A 2QP9X 1KAGA 2GNOA 1EGAA 1ZM7A 3U61B 1NG9A 4AKHA 1E9DA 5FBRB 1NY6A 1U0HC 2IYQA 2PLRA 3RS3A 1W49A 4QJ3A 5FTJA 4G5GA 1QHYA 3CNNA 2VHUA 1GWNA 2GZHA 3HYRA 4LJ8A 4LV6A 1KI6A 3RAPR 3V4RA 2ZJAA 1CIPA 4ZO4A 3AP1A 4LHWA 5DIFA 4ZV4A 1E3MA 1N6RA 3GLHE 3QVUA 2NZJA 2DFKB 1T4GA 3KZ1E 2XXAB 2OO7A 3CR7A 2EWVA 2P3SA 2A3RA 3QSYA 2WJYA 3KJHA 4G5SA 2FU5C 1XPUA 1II8B 4OK3A 2IT1A 3HU1A 1WBBA 4PC2A 1S8FA 1TTTA 4O25A 3M4YA 2JLXA 2QMEA 2A5DA 2XNDA 3CF2A 1G291 3QBVA 4X8MA 1IBRA 2DWPA 2UKDA 3B82A 4TYPA 1NVVQ 2VSOA 4JVNA 5KPJA 5JCPA 3G0HA 2JLRA 1E0AA 2J7KA 5G3YA 4TL6A 4LCBA 4Q9KA 5G40A 1NBMA 1ETUA 4L9SA 2CNWD 2HXSA 4II7A 1XX6A 2F3RA 1EFRA 5EP2A 4J0QA 4Q01A 1CR0A 1I2MA 1P2VA 4LJYA 4ZIRA 2DY1A 4PSVA 2WZQA 1XNJA 3WYGA 4M22A 2Z0MA 5BXQC 1W4AA 3B7GA 3SJCA 3QQ5A 1SVLA 4ESHA 4C0SA 5DNYB 1OFTA 1G6OA 1YR9A 2JGNA 3GFPA 1NSTA 2QPOA 4OQXA 4XIGS 5AUOB 1XP8A 3BB1A 4Q9HA 2PCLA 2ZJYA 5L8VA 4ZDIA 4A92A 2EYUA 4DB4A 1RPZA 3MMPA 1NIPA 1OLOA 1YE8A 2ZSAA 4NCJA 4CEHB 3CPEA 4I81A 3WMFA 4M2LA 4M1MA 4C9BA 5GJBA 4FIDA 3BB4A 3REFA 2HLDA 3BD9A 2NIPA 1NL3A 3NH9A 4NYIR 1GL9B 4G01B 4PPQA 4HZUA 2CLDX 4DSTA 4YMUA 1D2MA 4M53A 3FKSD 1Z2CA 5CYOA 2J0VA 2PX3A 3KJGA 4NMMA 4NU0A 1P9NA 1AQUA 3K0AA 4E5UA 1ESMA 1CP2A 1JALA 2GJ8A 3RWMB 1FFHA 2IWHA 3UXMA 1U94A 1JAIA 4XOIA 2HYIC 1XTQA 1JR3E 1RYHA 2QAJA 1Z3IX 1JQLB 3MAAC 2QTFA 2NZ8A 4BFWA 1IY0A 4O2LA 3WRXC 2OHFA 1J99A 1NN0A 5FR2A 3GEHA 3RVBA 4BFUA 4URZR 1UPTA 5K8LA 2RMKA 5JWRA 1D9XA 1ZD9A 3D7MA 2Q3FA 3EA0A 1FNNA 1US8B 3EARA 1H8ED 1G8GA 1KDTA 4HAYA 1CTQA 1JI0A 2QENA 4FWIB 2IYVA 1RJ9A 2HYDA 2C98A 2R6GA 2ZI9A 3QJYA 3K70D 1RYFA 2BMJA 3AVVA 3LQRA 3L0PA 4D4LA 2J5XA 3OEED 4NYJR 2ZUBA 2IYUA 4DUGA 4EFLA 1WE2A 4O2RA 5JSZA 4M9SA 4OHVA 3PXGA 1FQKA 1H65A 3L0IB 2QA5A 3FMPB 3NIBA 3MGCA 1D9ZA 3NBFA 2FE4A 1G6HA 1M8PA 1XBTA 2A5YB 2B7BA 1KNQA 821PA 5DN6D 3FKSA 4KVGA 4HAVA 2DFLA 3L0SA 5J47A 2FN4A 2GETA 2OCBA 2FFHA 5JBQA 3RANA 1D2NA 4QL3A 4EPXA 2YWGA 3AVXA 4B47A 4OQMA 3SBEA 1G7SA 4FMBB 2C9OA 5FUWA 4D82A 1T3SA 2JJ1A 4TYWA 2G0TA 3EIQA 1SXJB 2OE2A 3C4JA 3THXA 4UXHA 4GZMA 4OHWA 3ZS9A 3SHFA 5KSOA 1LV7A 4AYWA 4C7OB 4US1R 4BFYA 1XF9A 2H5EA 2GXQA 3ADCA 4JJKA 4TYYA 2H57A 3I72A 2OBNA 4BASA 1CR2A 3K0AB 1YZGA 1LS6A 3CWZA 2VP9A 4GOJA 4Q7MB 2VTKA 4C3ZA 4IKEA 1B0UA 4BPBA 4ZI3A 1WBDA 4F91B 3FE2A 2A5FA 3NDBB 1YJ5A 4RFVA 4A0GA 5JHGB 4US0R 4FCWA 4RD6A 1R6BX 3R8CA 4KHZA 3U6BA 1OYWA 4NYMQ 3A1UA 4JBYA 3PEWA 1N0UA 2C78A 2RAPA 3ZVNA 1AKEA 3TRFA 1NNEA 4YMWA 4LZZA 3N70A 4F4CA 2ZVPX 3A6PC 3OEHD 2GBLA 5EUMA 3NDPA 1R8QA 3CO5A 2O0HA 2GA8A 3B2EA 5BN3A 3HPQA 521PA 4EIWA 2OAQ1 3VR5A 1G7TA 3UG6A 5JCZA 3T35A 4WIAA 3R9WA 2ORWA 3EG5A 3BXZA 1QRAA 4B32A 3L8YA 2ZPTX 4Q21A 1G3QA 1NVUQ 1XWIA 4I99A 5E4FA 1ONBA 3R9XA 4NCHA 3ADBA 4AK9A 2ZRFA 3P4YA 1U98A 3IKJA 1LF0A 3I32A 4L5BA 3PJRA 1X8JA 4TTRA 5G3ZA 1Z0KA 2NO6A 1NLYA 1TEVA 3LBNA 2WIBA 1KK1A 2WPDA 4HDCA 1HT1E 5BN4A 4JSYA 1N6KA 3D31A 4ZDKA 5AJYA 1RW4A 2GCOB 3VR1A 1ZP6A 2J0UB 1RKBA 4Q4HB 2ZS9A 3THWB 4XWAA 5KPDA 1Z2AA 1ZUNB 3TKLA 2BM1A 2FGJA 4QM7A 1GTVA 3B85A 4LRWA 1OXUA 3I5YA 4NP6A 2IWRA
chains in the Genus database with same CATH superfamily
4DSKA 1AJEA 2EFPA 4OKSA 3KLEA 4UMEA 3X2EA 3ZCPA 4CLEA 1Q91A 5FTKA 1RP5A 4NK4A 3RBXA 4PNEA 2V65A 4MQUA 3VTIA 4QPJC 1NLKL 5MGBA 2P9YA 1HT0A 2C4HA 4UY8T 1SB6A 2FI1A 3L6OO 4DG1A 4ALNA 4N82A 2J33A 1RT4A 2FSSA 5EDWA 4P4NA 5D1HA 4URQU 2KXHA 3N2NA 4D80A 3DFMA 2H3EB 4NR0A 2C2RA 1EXVA 2A67A 1NF2A 2QG4A 1WAMA 2VKTA 1T8SA 1LXJA 1ADGA 3WZLA 2J07A 4IRCA 2DQZA 5KG6A 1V5IB 2PBLA 4JJZA 4BJHB 1PZMA 1CLFA 5L3VA 3QLTA 3CC8A 4DR1J 3T4XA 5KWIA 4U9HS 5IUKC 3NHLA 4EGQA 2Z57B 2C0PA 2YTZA 5FA5A 3I58A 8RUCA 2XNJA 2PYZA 3JTOA 4BRWA 5CITA 2DNGA 2WIDA 3USCS 2QBYB 1H38A 1PGNA 3V7UA 3Q0IA 2XDWA 4FSHA 2PLFA 3H7HB 4N0MA 2ZJ4A 2V9KA 3KJFB 1ENOA 4B6PA 1E2IA 5AVWA 3F97A 5K3EA 1UC9A 1YGPA 1WXFA 4EELA 4B3HA 4EENA 2PZBA 3NIDB 5KFPA 3QF7A 2UYHA 2PO5A 5ER6A 2P6TA 2BE9A 3IPLA 1GAXA 3NIWA 721PA 1Y5NB 1GT91 4LZJA 1PP4A 4LFAB 3GRAA 5CK4A 3E9YA 4GVBB 1Q3TA 1IWBB 3JQDA 2RCYA 5J59A 1WC0A 5CDTA 5C8XA 1X86B 3W5IA 2HFZA 2Q5IA 4M0PA 4WF9Q 1QRUA 4XFJA 5A6VA 1H6AA 1GGEA 3SI7A 2C2OB 3ENWA 4WKYA 1GAOA 4JASB 1O0PA 1HRDA 2F8MA 1FP6A 2XXJA 4I2VA 1E1DA 3SHWA 3X3UA 1EARA 3DZFA 4ARSA 2P4SA 2P27A 2E1RA 4R2IA 1QG0A 4WSOA 4L3NA 3I12A 4KLRA 1TX4B 1TYZA 2YH0A 2F17A 3R6GA 1SAYA 1B6SA 2R65A 1P1TA 3TSAA 2X1LA 4TWZA 3V9AA 4LQ4A 4IJKA 1QX3A 4KQWA 5AWFC 1C1YA 4DT1B 4O4HA 2NUTB 4A8TA 4BYMA 1PFWA 2GN0A 2KLHA 2IUUA 3G86A 1DRVA 1D5CA 2DR0A 4IQGA 1VHFA 3HZRA 2EGGA 3LUHA 3G8SA 3BMOA 3OO1A 4MJLA 5HZGA 1O6GA 1OY1A 3HXPA 5K6RA 3ISJA 2W2QA 4NOHA 1WUKS 3VU3A 1WTCA 4BNTA 1OY6A 1QMGA 3GG9A 3WFJA 1F0YA 2QF7A 2HM7A 1YBHA 1YIJS 3I9KA 5I42B 1N5MA 4IR7A 3UB3A 1FUYB 3HA3A 5JVHQ 4CU5A 3F7NA 1F51E 4EYSA 1M2VA 2C03A 1TK2A 5JJKA 1P80A 4FHCA 1D1SA 4EY8A 4IUBS 4KRYA 3L18A 4NG4A 4EY7A 2YWRA 2R62A 3SFZA 5C81A 2F1OA 5LA6B 2WMOB 4HWRA 1JPNA 5JH7B 3QJ5A 2W7PA 2AYZA 1UXOA 1T9DA 1Q16B 1R8SA 3K1AA 2V4MA 2I9KA 1NA5A 5KNBA 1WUTA 2GDZA 2XGGA 4I5GA 3RIHA 4F6RB 3BPSP 3WLKX 3ZD9A 1DMRA 3OXGA 1U0SA 1JG7A 1H0HB 4O6VA 5DDQC 2FP3A 4GYYA 2WCXA 1T6YA 4UNPA 5JBNA 2W22A 2VDMB 1PDWA 4QFMA 3IQFA 1IG0A 2QTRA 2XQJA 4I4TB 4DTCA 2ZR8A 2NTYC 4I36A 2PFKA 3GVIA 4MKXA 4WFYA 1T2NA 4NSNA 4B3DA 2MXYA 3ISNC 3G8DA 1FVOA 3MILA 5FWYB 5F33A 3V3TA 2AX0A 1Q15A 3JSYA 4G24A 3W8EA 4G56A 3NOGA 1J21A 4DWOA 3BT7A 3W1EA 4RZXA 2CDRB 4ZZ0A 4QU6A 7ABPA 5AKGA 3CW8X 2AWNA 4D44A 1X0PA 1EAYA 4PBSA 1QAQA 2J41A 1OROA 1VL5A 5C51B 4RXUA 4K87A 3G2HA 3QVGB 1I3KA 3P45B 5ARCA 3LLMA 3EIUA 4ON9A 1JZTA 1C1XA 1G7RA 2QSWA 5KG5A 3L6EA 2HSEB 4QDOA 4AROA 1V26A 1JNYA 3O90A 4LWOA 1PX0A 3VZBA 4CPDA 4Y28C 3G8TA 2Y93A 4AXBA 5GOTA 2QN2A 2LU1A 1KAEA 2BOPA 3S68A 1L8QA 4DADA 3U17A 3V46A 4KU4A 2XCSB 3W2TA 1L5MA 1KSJA 3TO8A 1MVLA 3QOYA 4P36A 1JQJC 1BEUB 2AOVA 4OP3A 4X66B 2AI3A 5LFAA 2ZH1A 4BNDB 1QYCA 1MX3A 4YAIA 4W5JA 1M6NA 1UWKA 3MN1A 2W0SA 2BUBA 4WKOA 1R6DA 2HCTA 1S1TB 1VLMA 1R0SA 1JBKA 1C9NA 4BVKA 3B6ZA 3CPHA 3B54A 2BCGY 1NJ8A 4DV6F 3JVIA 2OMOA 2ZC4A 3K70C 1QY7A 3OUYA 5CHEA 4I4TA 1DAHA 3DTVD 1NRIA 5KOIA 4DAOA 4TXSA 4F5WA 4ZZ1A 4OBEA 4F5YA 4NRTA 1Q1BA 1FE8A 3B5EA 3G2PA 5I9MA 4JBNA 3D3WA 3UR0A 2HW3A 1UOQA 1LXCA 3EULA 2EK6A 4UM7A 2GIRA 2ZEJA 3BSFA 5D7NA 3FWYA 4EUKA 3TX6A 4PF1A 1Z6XA 2AT1B 2C61A 1CNFA 2ZUGA 3EE6A 3THYB 2YZ7A 1H2VZ 3L01A 5IC6A 3K9GA 4EDHA 2G8NA 4KHPB 1V9CA 1XFAA 5EOVA 2EFGA 4EMSA 3LXRA 3WWDA 3GAMA 2B7CB 3P2EA 3LQ1A 3FVRA 1NVFA 3J81j 2DAPA 4YT5A 4E5DA 1KI1A 2B8QA 3ENKA 1ORRA 4A2PA 2YQZA 2RGXA 2IZ1A 2RHLA 4MR7B 5EI5A 3F6CA 1GT6A 2L9DA 1U7ZA 2ZJZA 1U0TA 3F49S 5IM4F 2A2CA 1YR6A 4W5HA 3ROZA 3UC9A 2NZYA 1LDYA 1NOKA 4BXOB 2H54B 4RKRA 2QOEA 1JB0C 1NJWA 5HBMA 4KO0A 3MWJA 2C2KB 4CMEC 1M6VB 3ANSA 2OD6A 3R5SA 3TLKA 5CVEA 5FWAA 5B1EA 2CHUA 1JA1A 2KI5A 3W9JA 4UBOA 1W9MA 4DMHA 1QSGA 4RJTA 3N5CA 4TRMA 2M9MA 1W2WB 2IEDA 4DJDC 2WVAA 2FW8A 3N8IA 2OWEA 1FS6A 1YRBA 2VYND 4GDMA 3IA7A 3HCXA 2VJMB 1PQPA 3Q85A 3A0RB 1YZYA 1I9GA 2C9ZA 2JAUA 3A06A 2FTRA 4GKJB 2HT1A 2G5CA 5A4MS 1SCAA 5B6IA 3ONVA 3MHTA 5ALRA 2JFBA 4XPEA 2PNJA 2G3YA 3DAPA 4U6SA 1P5JA 4D97A 4Z49A 1FDOA 3RB4A 4AQ7A 2V97A 3CX7A 1TUGA 1ZESA 5IMSA 2VHTA 5FJJA 3NCTA 2V6BA 1E4EB 2NZCA 3LZDA 1X7ZB 3T3HA 3MCAA 4J07A 4RK0A 3MMJA 4ZRDA 1UWCA 4OV1A 4PQUB 3M1VB 1UBCA 4DV7B 1QR2A 5C25B 4BFTA 4XR9A 1Z6AA 3N3BC 3NASA 2QQ0A 1TL1A 1SXPA 1MFZA 5E2IA 4MUIA 2GYYA 1ZIPA 2A0YA 4PG7A 4LXXA 3RTGA 1GPDG 5AKHA 1YBMA 1S0VA 4C29A 1PJLA 2BKAA 4MV7A 2MQOA 1S1VA 2L82A 2E82A 2OCLA 3GY0A 1UL3A 4YR2A 4WKGA 3LDGA 3NYIA 4JR0A 2OKCA 4RORA 1T5SA 3GIWA 3NTUA 1S6QA 1KHWA 4L6CA 5CH3A 2IYTA 1D6JA 3HP4A 1IHOA 1KYTA 1JEEA 2CNNA 1UA0A 4DQ0A 3OPXA 1MEJA 4NBNA 4F4YA 2F40A 5IFKA 2EKBA 1MPTA 2CPYA 4HTJA 3KJNB 1ZJJA 3UD3P 2W4QA 3MT7A 1PVOA 4XK8C 5IFLA 3TA0A 1NAIA 1ITZA 3BE8A 2HFKA 1AUPA 3NT4A 2R7XA 4OREX 2Z58A 3M82A 1VYVA 2GO1A 3ZVRA 4D4MA 2IXTA 2FRVA 1ECCA 4M46A 1D8YA 4EAAA 5AKLA 3PNLA 4B43A 5I7RA 3TMYA 4D96A 3D3KA 1J70A 2I2DA 5EXSA 3FVQA 4HNSA 1ZGCA 1MMLA 1CY8A 4YFVA 3OZWA 1W2HA 4DQUA 2NWQA 4KKOB 3PNMA 4HV4A 2XY7A 2AMJA 4G2NA 5C1OA 2HQFA 4JI1F 1F5NA 5BOSB 5K20B 4YCLA 2QG9A 4QBTA 4BLRA 5AK5A 3RF6A 3FMBA 2CPDA 2A5LA 3TLJA 2I1QA 3T61A 2M6LA 3ZGVA 4EPYA 5A4DA 4ZA2A 1MGPA 2OPSB 2ZBIA 1V4BA 3TZZA 1NI3A 1ZWKA 3WHKA 3Q83A 4JYBA 5SYMA 1OXTA 1ABEA 1HDXA 1GGVA 3TNJA 3BN3A 4DA4A 1PO7A 3RU0A 1MAUA 2ONCA 3LP8A 3F6PA 2MQQA 1KO5A 2VP5A 2JG3A 1RVV1 3WX4A 4DKJA 1ISGA 5HQLA 5LMZA 2KLBA 2Y27A 4OB6A 3L82B 3LKBA 2RONA 2YNHA 4B7XA 1ODSA 3L0YA 4IGFA 4BDPA 3OPMA 2CDBA 2BR5A 3WC2A 4RTPA 4XWKA 4JKYA 2Y0BA 1T6BY 2RHDA 1HSZA 1QD1A 3ORHA 2WHPA 2P79A 4CEJA 4OJKA 4H1WA 1Y7LA 4KJIA 1V16B 2AG0A 3R9LA 2CJBA 4HADA 1CUCA 4IGKA 1YBTA 4YR3A 1NF8A 5BR1A 4DMGA 1GFWA 4ASUD 4J16A 1V5EA 1TU0A 3AD8C 5F3WB 5KWJA 3DBIA 4LSNA 1G3UA 4B4DA 3HE3A 2EIHA 2DNRA 2ZAMA 5AK0A 5CG1A 3I6IA 4TQAA 4B9MA 2ZIAA 4Q5IA 2FEPA 4JOCA 1JJVA 4WKCA 4K4UA 5IASA 2QW1A 3ICPA 4KQEA 4UU1A 4HDNB 1WUJS 1T91A 3C7KA 3DR3A 1R8HA 4LF6J 2JFXA 4RZIA 4UVIA 5C8ZA 1FKPA 2QLJB 2JLWA 1JHZA 3RU2A 4R3WA 2WUVA 1M8JA 2NREA 3MJRA 4DSLA 1OX6A 4MW4A 1OFVA 5IZ4A 3RS7A 2WKQA 4HOYA 4IS2A 4J03A 5JC8A 1Y4SA 5BR8F 5FNVA 1T05A 1DJLA 4MIEA 3RIGA 1YB4A 4QR1A 1CNEA 4F2HA 1KQFA 3PY8A 4RNNA 4R8RA 1FY2A 2IYYA 2RJOA 5L6MB 1PJQA 5T7LA 4FDTA 4IG9A 1Z4QA 4W7SA 1YDEA 5C80A 3VF0B 2QV6A 1QF9A 5D5HA 2P8SA 2X5KO 1DCMA 5A2QU 4P8RA 3HT3A 4ZI2A 2FHKA 4JP1A 3FNFA 4DIEA 3WGGA 3AQPA 5G53C 4BNMA 4HQNA 13PKA 4F0MA 2EP5A 3HSZA 2Z58B 5IJXA 3QNWA 3K6RA 4H3VA 3W66A 2EWWA 1Y00A 1PAUA 3Q5GA 1XJ0A 3WGHA 2B1JA 3KQVA 3AF2A 3SX0A 4PTZA 2JCGA 2W4MA 1RHRA 1FJCA 2HADA 3H5TA 2HVZA 1WCIA 3M8ZA 3QPWA 3S28A 4D8YA 1HQ2A 1NZDA 1Q44A 3EGDA 5F4BA 3VWSA 1WOYA 4D5EA 2E87A 2DGDA 2ZAYA 4HFNA 2EVWX 1V25A 4Q3KA 2QL7A 3K15A 3PQ7A 3WE7A 3ROPA 2WZ1A 2HQ3A 3EEBA 5AXCA 3GUCA 3HN2A 5E7IA 1LTHR 3VQTA 1AGRA 2CNKA 2N82B 3PVSA 3QVLA 3W04A 4FEAA 5D4LA 2G8LA 4NOLA 4TV9B 2CPJA 3MWYW 3GJRA 1OVGA 2I4IA 1S7HA 2RIRA 2BWJA 3ZW7A 3W8FA 5I9SA 1KYIA 4J0FA 2DRAA 3UCXA 1J0BA 4D3ZA 2F67A 2WRMA 4F4WA 4QDZA 2BMEA 4CZCA 3HBNA 1SB8A 4QC2A 3FPAA 5HTKA 1RPNA 3QOWA 5GQSA 1M5SA 1K1SA 1Z4MA 1O6BA 2DT8A 1ZJ6A 2BH2A 3AC0A 1G0OA 5KSPA 4PKDB 2J3EA 2R66A 5CDSA 3EPLA 2X4LA 1ID1A 3A7EA 2XYHA 1T2DA 1GG8A 3UFXB 2K6GA 2AZ1A 2WOOA 3C8HA 1C3OB 1UFKA 1B8UA 3SKVA 4Q4LA 4B80A 2QORA 5HOQA 2F65A 4BEWA 1KVUA 5GZ6A 4O4HB 3ASZA 3DFUA 1GL6A 1RTHB 2QX0A 3H75A 4OP2A 3TSYA 2O2IA 3SYTA 3HDTA 4X64J 3IFSA 1XMVA 2B82A 2V1UA 1OX5A 1HDEA 5AVXA 3KK3A 3OTOF 1TUBB 3E9RA 3WJAA 3WGJA 1UPBA 4UPVA 1T9VA 1AOXA 1A4UA 1VLQA 4CTOA 1WDTA 4HL6A 3PHJA 5DX1A 2GLXA 4YV2A 5F7XA 1EEXB 2WKSA 2I6UA 1XN9A 1UBKS 4G67A 3MTAA 3SC4A 1DQRA 2I6WA 1R0KA 3MRTA 5IH3A 2D0DA 3HKWA 2DEUA 4OV6B 2O2SA 1XJCA 2F4VF 1BYUA 1H2WA 3GUUA 1FSSA 2D3UA 3O9ZA 3EFBA 3EEQA 3QPIA 1RTKA 4L0QA 3FOEC 5I4CA 4Q37A 1U0FA 3OJFA 3CQ9A 1P60A 3UQZA 4E5YA 3PR1A 4MCIA 1JLBA 1BYIA 5E9QA 2Q5EA 2M32A 4X6LA 2K2WA 3NS7A 3OM9A 3AUKA 2VDOB 1GPWB 4MV3A 1UMCA 2B9EA 2ZWVA 4RNCA 3ESAA 3RTDA 3H8JA 4UDYX 1TKDA 3RC7A 4B3SB 1S7CA 1RAEB 1SNYA 2Y3YA 1BS9A 1T8RA 2PMEA 3KUHA 3CNNA 5J2PA 3MWDB 2O54A 3AAWB 4RWZA 4IDDA 3V7YA 4LHWA 4R83A 3JQGA 3GNSA 3QVUA 5DJBA 2R4UA 1ORVA 4ECVA 1V37A 4BVAA 3AONB 3Q8QB 4TLQA 3F1KA 1WDMA 3PP8A 1L4NA 3O6VA 3ZV5A 3UJNA 3B1KA 5KPJA 1NDQA 4F60A 3NALA 3N6NA 3IVAA 4ICIA 4UUNA 2OSQA 3G2OA 3MRXA 2DD8S 3OUZA 1XX6A 4C03A 3WYGA 2ZYHA 4WTOA 4QDTA 3L41A 3TINA 2XF8A 1W75A 4Q9HA 3HKCB 3LT1A 1EIYB 3R2DJ 4A92A 2VFUA 1RPZA 1C1BA 1JLMA 1PX2A 2X3UA 1B0TA 1UPMB 4EK2A 2OVBA 5JROA 2GHRA 3RVPA 3CSDA 2ZOGA 1UKAA 5DLGA 1YUMA 3I5CA 2I7CA 4YP0A 2R4FA 2AFHB 2AOXA 3GQBB 4DXHA 4A27A 2DBQA 4MH8A 4XAKA 2O3RA 4MEAA 4MI6A 4MQEB 2VC1A 3FTNA 3EBOA 4EG5A 4DEZA 3VR0A 4EMBA 5SY9A 5JUMA 1SBYA 1OY9A 2AQIA 4HPXB 1F6TA 1QE1A 3IDSA 4WJLA 4DUGA 3UPDA 3TB6A 4M9SA 4NLLA 2YQ4A 5FPQA 1KZ9A 4Z4HA 2PBZA 4S1OA 1KNQA 4M5IA 1JQGA 2MSKA 1FO1A 5HLFA 2WFLB 2VJBA 1U6KA 4XWGA 1IDN1 2Q6LA 1JDBB 1B15A 3M6IA 3AM4A 5CFOA 1FRQA 4U2GA 4B8WA 4DV3B 2HLNA 1X7XB 5DRTA 2X8BA 1U2QA 1DKQA 3ZIDA 2WDZA 3PC8C 2E29A 3ZDCA 4R7GA 3WGMA 2G1DA 3EQ6A 1GPJA 3R8CA 4IIEA 4ZMSA 2RAPA 3LRXA 1AKEA 3PDHA 3A6PC 1HNWJ 2GBLA 4MULA 2MSTA 4UHEA 1NWCA 2DERA 2H7XA 4JQCA 3CO9A 2GVNA 1QGYA 3UAZA 1C7RA 4MGHA 1RLMA 2QRVA 5KINB 1KVRA 1ZK2A 2QD5A 1G3QA 3W7BA 2A1IA 2PX2A 3LW5C 2CA9A 3ANXA 4L5BA 4DSEA 2EKYA 1X8JA 2C5GA 1S97A 3PGMA 4WUVA 5L9AA 3TXYA 3BJZA 2X4IA 4PZVA 2I2CA 2IWRA 4KR9A 4JYAF 4OL0A 2QMUB 1J8FA 3I6PA 4QX6A 1XU7A 2DXFA 2PS3A 2O9JA 1ESDA 2Q46A 4A7PA 1QG6A 2KBEA 1L6RA 4GS5A 1II0A 1KOOA 4Q3OA 5TT0A 1AY0A 4Q4CA 1VJGA 4RV9A 1BQNB 3D0RA 5DM0A 2QTCA 5CA5A 1KLMB 2HHJA 2L17A 1B64A 3OTWA 4GICA 1ZMOA 1AT1A 2Q45A 1SEVA 4DFJA 3VVCA 2IM0A 2RF2B 4KQFA 4LWQA 1P17A 2Z5GA 3UUEA 1RQPA 2GT1A 4CMCA 2G76A 3F96A 3JWHA 2EDAA 2NTEA 4RK6A 3PUWA 4ZOEA 1NMZA 4DJEC 1FKOB 2VBCA 1F2UA 4ZAGA 4P0QB 2WIFA 4BKMA 1K1QA 1LFDB 2DKFA 1U0GA 3TNVA 4GE3A 1H2HA 4OBWA 2I54A 1N5IA 4TTSA 1E0SA 4W5WA 4OTZA 3B3FA 1WXHA 2HNKA 4OYLA 3RV3A 3HHEA 4K6KA 3WP1B 2JZOA 4O0MA 5AJWA 2GGPA 3ZHRA 2VZEA 4J9KA 1HE8B 4DQVA 1T3TA 4QUIA 4GPTA 2E4UA 4Q03A 2XG8A 3H1AA 2I2BA 2I3DA 4DRYA 2FW7A 1XAIA 1CJKB 4YTEA 1EFAA 1IPHA 3TSCA 2D1FA 2DC1A 1WMFA 1XN4A 4NCAA 4ECTA 4PPFA 4RWXA 4C6SA 1ISFA 4FZ3A 4F4IA 2QSYA 4CIWA 2X1AA 4L72A 5GY7A 1EB9A 1P1JA 4ES1A 1XALA 2NXEA 1AK1A 3CE8A 1LWOA 3P27A 2NSDA 5EE5B 3CH7A 5DBGA 3CVKA 3C1OA 1FS5A 1I2ZA 4LBZA 2CW5A 3NYQA 4NZ6A 3H59A 5EMHA 3KJIA 2FSVA 3UJAA 2FW6A 5L38A 1NVGA 5CLGA 1U8ZA 4U2BA 3EZOA 3G6KA 3DR5A 3EC2A 1LWXA 5IANA 3OTEA 4Q6BA 4H54A 3NATA 4EHKA 1Y11A 5H9EJ 1X1DA 2DGOA 3VYWA 3WGQA 3EX7C 3CRW1 4JLPA 3DDIA 4KK4A 1KI2A 2JZCA 3BYPA 4DN6A 2OHGA 2JFZA 1E7YA 2OHVA 3JYTA 1KOFA 1GIAA 1MV8A 4Y00A 5EPEA 1RI4A 3M9LA 3P1JA 1NBMD 4OZ0A 4JUIA 5AJ3F 4BC0A 2Z08A 5CZVA 4YCMA 1LC0A 3OOYA 1N33F 1BMQA 1D9AA 2ASLA 2IEBA 1NQXA 5J2MA 1AK2A 4K46A 4F3TA 4H1HA 6Q21A 2GR9A 1VFNA 3LP1B 2PO7A 2VDNB 2VL1A 3C6XA 2VG6B 3I8SA 2DRDA 3IO5A 5IARA 3STHA 4MHOA 2E7XA 4ZQEA 2Z6VA 3ID6C 1IJKA 2P6SA 2YQ5A 2QYSA 5CX4A 5JCXA 2RQKA 2DU8A 2BFMA 5DOVA 5JS7A 2BMBA 1VHDA 3PFNA 1TJPB 4WVLA 2B0JA 1FIUA 5CMLA 3ZZZA 4D92A 5H4HA 5CBKA 1J2RA 1SH7A 4MW6A 5K0EA 1WG1A 2RHRA 4Y7CA 3AWIA 1BO6A 2GESA 5E0OA 2I87A 3C3XA 1RKXA 4I46A 3Q5DA 3KJVB 1QG4A 3SCKE 3VDQA 2VZ8A 3QZUA 5EJ7A 4HBGA 1TK0A 1P1KA 5JU6A 3SDZA 5L95A 2BKUA 4EGAA 1ZOSA 2KX7A 1B8NA 1GPH1 4CEHA 3TLXA 1CVRA 4GDFA 1XYVA 1P73A 3CISA 5JDCA 4YQWA 1QB7A 3JYNA 2WSSA 1N3YA 3J7ZT 1L7PA 5E7MA 3Q3IA 1UXKA 4F26A 2V2ZA 1CF4A 2VRCA 1GZ7A 2EI5A 2O5DA 4QODA 4YN3B 2J4FA 4CO1A 2CLCX 2JK1A 3E0QA 2BGKA 2XMCA 3BUSA 3L02A 3V9PA 1W1IA 3R5XA 4DJTA 1DPGA 2R8KA 2A35A 3MTKA 4NXNJ 1GL7A 3KMSA 4R05A 1KGSA 3U16A 2DBRA 3OKAA 3T5KA 1P2SA 2Z3VA 3SF8B 3MFYA 4WPGA 3J7AC 2HZCA 1U1QA 4PWUA 1LWCA 1RXYA 4IIJA 4R8VA 4IY1A 4LRYA 4LXHA 5AI6A 3QT7A 1OWNA 1YJUA 4BFVA 4DLBA 2P3LA 3OH8A 1XNGA 1YTUA 4IVQA 3CVJA 1EPUA 1ZY2A 4HWSA 1JLQB 3NVKI 2PR7A 1WC3A 1P7VA 4PWYA 4CCAA 2ZYAA 1FTYA 1AZTA 4UREA 2CJFA 1H66A 2ZHOA 2QY9A 1UZLA 1RWUA 5K8OA 2VQEF 2PVSA 4TYBA 2BF7A 4FGWA 4R1NA 3RTEA 2H5JA 3C5CA 2LQ5A 2B83A 3EJMA 4RW8B 4O3QA 3N9IA 5J1PA 2P0AA 2NUBA 3OR1A 1OXSC 1Q0QA 1JHRA 5B09A 1FL9A 3PT5A 2H9IA 4F46A 4GPZA 3MCWA 5KHAA 621PA 3U48A 5K0SA 4QU8A 3GP5A 4TOIA 3VVBA 5ED0A 2PGOA 2BJVA 2R8BA 4YACA 3BIWA 1QV7A 3UOGA 1JBEA 1W4LA 1VQMS 4JBWA 3M7VA 5GONF 3E01A 3BFPA 1DRZA 1MH9A 2Z9DA 3O8BA 4HQ0A 2IHUA 1FDVA 1TAUA 3QBJA 5T8KA 3GCDA 5FNZA 2SCUA 1F14A 4PBTA 3IPXA 3ZXYA 5DG9A 3PUVA 3WL3A 3K70B 4RPJA 4I1SA 1D0VA 4XRRA 2LFVA 3OY2A 2HG4A 4GZ3A 4BCCA 3BRWD 4IFVA 3H2GA 1HE3A 1W73A 2JHCA 3DEHA 5I6DA 1PGJA 4HDMB 3T5AA 4OOEA 2IEZA 5E3IA 2LVWA 3HBLA 4H0NA 4Y1RA 1Z5UA 8ATCA 4F92B 4KIWA 2WAXA 4TKMA 4OYXA 3SQMA 4EB8A 1MROB 1PG0A 3SD7A 1YB1A 5JIBA 3NNDA 1VOMA 4Y9RA 1HDRA 5DTIA 1TMMA 3A3PB 1P9QC 4RUKA 3ZIAA 3QAUA 3C15C 3JTPA 4CV2A 3CDWA 3LCVB 5BMVB 1SIWB 2HWUA 4Y2PA 4RZHA 3TTVA 4KEAA 3BS9A 4HXEB 2CQPA 3MAGA 1MZVA 1RQ0A 4TL7A 2P7IA 3PB3A 1DQPA 2ASJA 3OQIB 2R47A 1KBOA 1OFUA 1KDOA 3WRWA 1V71A 4A8PA 3JQ9A 3KLIB 4GOXA 4MH0R 4S1TA 4QUHA 2RK6A 1NY5A 3T3IA 4DXLA 4BVGA 1U28C 3PPVA 2BFDA 4GWKA 3FTQA 1KYVA 3OCUA 2JF0A 1WHTA 1I0LA 4MPPA 1WXIA 2W6OA 4KH1B 1WZNA 1KJYA 4NCGA 2V7VA 1K47A 4NNOA 3GPDG 3K2BA 4F0HA 2JCXA 5EKTA 4PZ0A 2EEPA 5TJHA 4R2MA 1C7EA 3TZBA 4V0ME 2H16A 4OHYA 1BNCA 1N36J 3OZAA 1QBGA 2JEOA 3QEJA 3FSIA 2UVUA 2BM8A 2ZDQA 1TZBA 3S8YA 1CY0A 3HJUA 1KYXA 4ED5A 2QM3A 3PW4A 3CSKA 5I8PA 5F23A 4MWEA 2FR8A 4QJIA 5H1SV 1JTFA 4S12A 3GSIA 4F6RA 3QSIA 3KQPA 5KTTA 3M2RB 1R7RA 3S2GA 3OSNA 3RSZA 3JSRA 2YNMD 5E3HA 3AIMA 2HDWA 5FXMA 1PSZA 5J2TA 2PXAA 2KZZA 3C15A 2ROPA 1E64A 1ORWA 2HK3A 5JXIA 4JI7B 3C16C 1Y8CA 3EGOA 4WZZA 3U37A 1OTXA 3DQQA 3GLIE 3CEPB 1C50A 4DDWA 4FNAA 1O89A 3VYUB 2TMGA 4ITSA 4YO8A 1DAMA 3ITEA 5JUWA 3ZZOA 3UDLA 5KOYA 5LMUB 1KJZA 4Y9UA 1UEIA 2QFIA 5LQAA 3K0HA 4X62J 4OQFA 2GK3A 1Q7BA 1EZZA 3SFUA 1Y5MA 5KFIA 3IUMA 1FSPA 1JYFA 2YYAA 3DBLA 4BJ5A 1EJ6A 4DL4A 2RILA 2W9BB 4ED2A 1KDRA 2QIPA 3MB8A 3U9SA 5IP5A 1PR3A 4LTNA 2CQIA 2WD8A 1D1TA 4J3JA 5CCXA 5AJVB 5KKCA 2DBVO 2XMQA 1B8VA 1ADBA 1URPA 3WWCA 4ZHRA 1WV1A 4P74A 1PW7A 2V3CC 1SJ4P 3M34A 1WC5A 3DRRA 3VAJA 4MVJM 4QOEA 4CFSA 1UBNA 3FYCA 5EJFA 5CUQA 1N2JA 2O8EB 3RJTA 3WMWA 4IVNA 4OI1A 2MWMA 4DV2J 5EINA 2H51B 5J58A 3KTAA 2VRBA 5JVDF 4G4SO 4QUKA 1XN1A 1VG8A 2SXLA 3G9TA 1T4DA 2FTKE 2Z04A 4LXGA 1FP2A 1RZMA 5BNWA 1UWBB 3NTVA 4KLCA 1Y89A 1OZAA 2XI4A 4FHGA 3ER8A 1P39A 1MHTA 5JLJA 3RQSA 3PQDA 3HL4A 4Y6IA 1UVJA 4DQSA 2KJQA 1PU2A 3BGSA 5J5CA 3GRZA 1XTKA 3NYRA 3SS9X 1IVYA 3FRZA 3AG5A 3KTDA 3A8IA 3MJCA 1E2BA 1K92A 3MMZA 1NCLA 4Y2QA 1MB9A 4R1QA 4BB0A 1YXMA 1QG2A 4ZN1A 4RY8A 1BDMA 3WYFA 4LC0A 2YXDA 4NZMA 4EI8A 4H18A 1MP0A 1AA9A 4OYHA 4EKGA 1LX7A 2X42A 5KFMA 1U0BB 4URXR 1LPMA 2VPQA 3GZJA 5AIAA 1E6MA 5JAMA 4NJMA 2JD2A 2A1TR 1UBOS 3OSUA 3OFNA 2RB4A 1NB2A 2X3YA 5IZCA 1A9RA 3V1MA 4RR5A 1MO3A 1Q5VA 5HGXA 3AG6A 2BAGA 3HCEA 3JQJA 3AF0A 4DWJA 1TKAA 1KC3A 1MENA 4YBZA 1UFRA 2BJEA 3DZJA 2H06A 4J9PA 2HA6A 2FSPA 1V45E 3W8NA 5EIHA 2W6MA 4FSXA 1YRQA 4JXKA 2X15A 3VR3A 1WZ2A 3M0EA 4JUZA 3PQ5A 3FNNA 1EFHA 1T9ZA 1ZU4A 4BNLA 4DILA 4DNFA 3TE7A 3EXIB 4ZK6A 5HKKA 3OVBA 2JRCA 1WB6A 4KUEA 4R0MA 1FYDA 3U7FB 3W8DA 5FKJA 3CULA 1UVNA 2UV8G 4KXVA 2RHBA 5HX7A 3K31A 4BQPA 1C1BB 4ZD6A 2HMIB 3N6VA 3BQNB 1VI2A 4AQDA 3P4UB 1ANKA 2QGZA 3E05A 1HTWA 2DHSA 2FPPA 3IIJA 3E8MA 2CMDA 3N53A 1KONA 4YV7A 2JLZA 3CX8A 1T2UA 1XLVA 2Q1SA 3PPIA 3IIIA 4IOAQ 3ZDXB 2MDAA 1NASA 1RC1A 2WVBA 1GAJA 2Y68A 4DA0A 2DH7A 2Q5HA 2ASDA 4ZZIA 2VFSA 3PYFA 3JQAD 2NYVA 2GN1A 3TCXB 4OX9F 1CJTC 4EFNA 2DHGA 2ZH7A 2ACVA 4OHMA 5K14B 1MWZA 2BQRA 3SFGA 1EWKA 3DCNA 2FA9A 2Q21A 2F2TA 2QM8A 4G25A 1YHQS 5A8WA 2GK6A 4YN3A 1RAEA 5B08A 1CERA 1DUSA 1W7AA 3E9NA 2XYPB 4BB5A 4HMPA 4CNZA 1C7JA 2D1TA 2VDQB 2BEWA 1P27B 2KHCA 2ISCA 1HMPA 2J09A 4ZVNA 1FDUA 3D6HB 4DMMA 4G5FA 2C4TA 4X20B 4TSKA 1RJGA 4YV1A 3R0QA 1EM6A 4FVCA 4IDBA 1JG1A 2IZ7A 1EHYA 2ZQYA 3WL4A 4I9GA 2DETA 1Z22A 3NG8A 2JGIA 3SDEA 5KYNA 2WEKA 2HCBA 1A1SA 3HJGA 1E94E 1YDLA 4JVSB 5EHGA 3T5HA 4DSUA 3A13A 4OMDA 4I8IA 2RJ3A 4Q4HA 2J0UA 4DR2B 3QF4A 4Y34A 3HEMA 3FMOB 3RYIA 2BH9A 4INOA 2IUYA 2EL9A 2FK8A 3NBAA 3I1IA 3ITKA 3K4HA 3SCZA 4FUTA 2UUBB 2Z2KA 3ZLVA 1BJKA 1PEKE 3T06B 4JT9A 2CDAA 2ZG6A 3G7SA 2XRFA 4ONEA 2ZVDA 4HWKA 5CFMA 2ZJRQ 1P3DA 1RS0A 5CB4F 1X80A 1VQ4S 4BNHA 4FP9A 4IXWA 2I5PO 1MLDA 1OYYA 3L2OB 4TWRA 5CFQA 2D1RA 4F6CA 2C92A 4L27A 4U7PB 2QVBA 3T7DA 3ZX4A 4TT8A 1Z08A 5DX8A 1YS6A 3PHEA 2RF2A 2P1DA 1ZVQA 5K8CA 1Y8RB 1T9CA 4CU2A 1M76A 3IRXA 3H7IA 4YOEA 1UZDA 2R8OA 1YUBA 3M8KA 4LBVA 2AI2A 5GMDA 4IUFA 3ZR4B 3C2QA 3MR3A 1B0AA 5KJEA 4I2QB 4LQCA 3GK3A 4NBKA 3RS2A 2ZULA 2CJPA 2RGWA 1RLJA 3OZDA 5DTEA 3FCEA 3AV0B 2RBGA 1FJ2A 4XQGA 3BKWA 2RVJA 1DLOB 3AF3A 5ILOA 2FPUA 4P3OA 2O5VA 3MPVA 2MTBA 4P86A 3PEEA 2V34A 1M9NA 4DR1B 3AKCA 1NUUA 3A9CA 3W3AD 3ZG6A 1CJVC 2YY6A 1GNVA 3ZU3A 4CLRA 3VZCA 1GSAA 5KFEA 1DAPA 3GVHA 2DNZA 4GR5A 1L5KA 3V1TC 3W1VA 1ZAWA 4GPD1 1KDZA 1JR3D 1GTJ1 3WBJA 4KXQA 4CMEA 1JMVA 4QNMA 2GZOA 3IR7B 4XO0A 3AFMA 2XUOA 3TR6A 1YK9A 2DHEA 3ASVA 5KOHA 4B7UA 2ZPAA 2QRPA 2HHXA 2HHUA 4LGVA 4QU5A 1WPQA 1OV4A 3TQQA 3QELB 1ZD1A 2RUSA 4F9EA 3OBIA 2G63A 2UVPA 3BKXA 2ZBQA 4RMIA 3Q9NA 3QNWB 5EXXA 3CH5A 2J9ZB 5I7UA 1L3TA 3MR7A 5A5VA 1ZJWA 4XSHA 3KYDB 2RHCA 4LDRA 4ZI7B 4PLPA 2D69A 3DD1A 2QRHA 5HDBB 5LQCA 4RF4A 1C29B 1XVUA 1RADB 5DDOC 4QJ3A 2J9CA 1Q79A 5L9XA 4LV6A 3NLCA 2FRDA 3NCRA 4CQMA 2V4UA 1X4FA 5JJ5A 3K2YA 1T15A 3MM8B 3KZ1E 2OO7A 3CUKA 1QH8A 3QSYA 2J7WA 1APBA 2F8SA 1RK8A 3OLYA 1O77A 3WV4A 2VXYA 1L5NA 1XOIA 3L40A 1IOVA 4ZVHA 1S12A 2HW8A 2W9BA 16PKA 5GAHU 2JH9A 1NBMA 3WLQA 4KH0A 1W5AA 3VDMA 3U49A 3NETA 4EUHA 4N3AA 2DY1A 1PR5A 4QDKA 1JLKA 1UWLA 1FFXB 4ZO8A 4ZIWA 4FIZA 3AHJA 2FLVA 2IPOB 1LQ2A 4IRKA 4OXQA 2XCOA 3FR7A 5JFOA 1YZ3A 1A2QA 1JS1X 4NCJA 3SZ3A 4XLTA 1CZKA 2FEKA 1VE7A 3IEKA 2CLDX 4U2EA 5ALHA 3KHSA 2FGCA 1K7FB 1GCOA 4Q4DA 1H5QA 5KOWA 1FWPA 2NUAA 2P5YA 1WC4A 1J6UA 1TR0A 3FZYA 1H4VB 1FCJA 3CLRD 4KGZB 3EZUA 1D9XA 4P08A 4B3JA 5KTQA 1G6KA 2C98A 2O19A 4W5OA 2BR3A 4LSWA 4OL9A 5JSZA 4GI2A 3Q6NA 3AQOA 2IJRA 4IRMA 2AW3A 2CXQA 3AFHA 2QX7A