2ZEJA

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
177
structure length
157
Chain Sequence
MKLMIVGNTGSGKTTLLQQLMKTVGIDVKDWPILVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat kinase 2
publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 157
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 2zejA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zejA02
1TUEA 2C99A 3AUYA 4Q1CA 4C0AC 4Q48A 1Z08A 1TF5A 5EQTA 3B1ZA 2XXAB 3QY0A 3AKYA 1U8AA 1MKYA 4G5OA 3E1SA 2QM7A 1U94A 4KI0A 2WWYA 1YZKA 4LJ7A 4LJ6A 5DH9A 3HR8A 5LD2B 1O87A 2IYZA 1KMHA 5BN5A 1K8RA 4XSGA 1T3HA 2GCOB 1N2CE 1RJ9A 1W4AA 2W00A 2QP9X 3NIBA 2J59A 3B2EA 4PC3A 4BGDA 3QIAA 4JLAA 2RGNC 3PCRB 1T6NA 3QG5A 3D8BA 1DG1G 2VH5R 1KJZA 1TEVA 4HZUA 3RANA 3W8NA 4RD0A 5DE3A 3V4RA 1IJFA 1T3LA 3A37A 5DHAA 4B3DA 1P2VA 4A9AA 5EP2A 4PAOA 3BFKA 1HUQA 2YWHA 4WA7A 4Z8YA 2FFQA 3THYB 4JSYA 2Q0HA 4DCSA 2ZYWX 5FUXA 3EX7C 1ODFA 3G0HA 1SVKA 3VNVA 2C9CA 4EFNA 1S4QA 5JEDA 1KI3A 4G5GA 3FMIA 5CITA 2CK3D 2VHJA 4WZAE 5C4MA 4HDQB 2N42A 2R2AA 3GD7A 5BYKA 2FX3A 4Q4JB 4OI1A 4CDGA 1DARA 1NN0A 1SXJE 2ODBA 3NEYA 2EFEB 1JJVA 4LYAA 4PZYA 2C8VA 5CYOA 2P6RA 2CBZA 1VHTA 3GLGA 2BHRA 3QXSA 4LY6A 2J46A 1RW4A 3O47A 3QJYA 4XWAA 4PHFA 4HLDA 2QPOA 2F43A 4N0EA 1EESA 4NH0A 4UQOA 4M21A 3EZ7A 2OSBA 3GJ4A 2BMDA 3NBFA 4WZBE 1II9A 3K0FA 4NKRA 3T34A 4WZ6A 2QENA 3AP2A 3DMNA 3MCAA 4TQAA 2C9YA 2VF7A 5CLLA 2JASA 3PUWA 2O8EB 4JZKA 1S2MA 3BOSA 3ADCA 4M9SA 3GLFB 2Y8EA 3U3RA 1N6OA 4URZR 1FW6A 4HLUA 2ZS7A 2WJGA 2CL0X 3WBKA 1A2BA 5JCPA 1HQCA 1SVLA 2YJTD 1C4OA 2J9RA 3L8YA 1KI6B 5E7IA 3RABA 3PEUA 4M4SA 4C0KA 5JJIA 3KJEA 2XGJA 2CK3A 1YVDA 4OHYA 1KK0A 4Q4LA 3REGA 4M9XA 2ZR0A 1BO6A 1KDPA 1Z07A 4BFYA 1TU3A 4E07A 1BOFA 4P31A 2IXFA 4B76A 1F2UA 1EFUA 1AZTA 3SJAA 3TSOA 5KNDA 4WXPA 4P33A 1RC8A 2QBYA 4PFSA 2D74A 4QBFA 1UJ2A 3RDPA 1P62B 2H8KA 4NONA 4G0NA 3VU9A 4KLZA 4LHWA 3SJZA 1FX0B 1WE2A 2PX3A 3V00A 4EDHA 5BW8A 1DO2A 2A78A 4MKFA 3SJCA 1LS6A 2P6NA 3IPYA 3SQXA 2F6RA 1GNRA 3CRRA 3GFTA 4OHXA 1S0UA 2HF8A 5CK5A 2KE5A 4RY2A 2EFCB 3SQWA 1YR7A 3LY5A 5KO2A 2EWWA 1GKYA 1OKKD 1S3GA 2PT7A 4KHZA 1SGWA 5FL7D 1Q1EA 1XMVA 5HKKD 2C9OA 5CM9C 3TR0A 4M1TA 3GLIB 2P65A 4L9WA 2J1LA 2XTNA 3AF1A 4CVNA 5FOSA 1KDRA 4UXJA 2R65A 2QPTA 2RMKA 1KDTA 1Z2AA 3AKCA 1G4UR 3B60A 4Q1EA 1XTQA 4MRPA 4F4IA 2QE7D 3THXB 1OIXA 3LD9A 4DLUA 1CULC 3D7MA 2ERXA 1T3SA 2FSIA 2HLDD 1XF9A 1JPNA 3A1SA 4Q9IA 2XB2A 4PHHA 3GCGA 2W83A 3EZ6A 1ZUHA 3GJ7A 1KSHA 1G7TA 2HJVA 2WVJA 3PVSA 5F98A 2WSSD 1M8PA 2ZJZA 1P2UA 4TN1A 4TMZA 4JVLA 2J45A 1IN6A 4OQNA 4DIDA 2CLSA 1IY0A 3QPWA 4V03A 3U3JA 4XD7A 3L82B 3U44A 1DELA 4TLDA 2C98A 3RSOA 1XMJA 4A2PA 3ZS8A 2O8BA 3D6TB 1G9XA 1ZBDA 4OK3A 3NTUA 2A7QA 3QKSA 5KNCA 1OXTA 1P2TA 1KGDA 4ZV4A 2AL7A 5EUMA 2CHGA 3SOPA 3I32A 3LW8A 5DHFA 2WSMA 3SFVA 3ZDQA 4G01B 2HT1A 4HLCA 5IDVA 2ZS9A 1W0JD 2CCKA 2P5TB 2QE7A 2PMKA 4GDFA 2V55B 3TMKA 2YC4C 4PC6A 3Q7PA 2EFGA 2HLDA 2VP5A 3PUVA 1L4UA 4V0MA 3BRWD 4HYYA 3CNLA 1Z0FA 1GTVA 1IN5A 1G20E 1XTSA 3PG5A 4ZCMA 2NO9A 1XEXB 3EWAA 4Q7JB 1V43A 2A5FA 2ZVQX 3FMOB 1JJ7A 3LLUA 4QXAA 4OHZA 2WSSA 4CW7A 2QMOA 2FSGA 5J47A 2FH5B 5SZHB 1E1RA 5J4HA 1Z83A 3U61B 2BBWA 3GFOA 3R20A 4OHWA 1D2EA 4Q7KA 3I62A 5AJVB 1UF9A 4C2UA 4QJ5A 1NIJA 1ZNYA 3CM0A 4D0GA 4IOLA 3KQUA 1CTQA 2NO0A 2N46A 5KDLA 4BZQA 2VQSA 4G5SA 4NYIQ 3VMFA 2OZEA 3BK7A 5GJBA 2OBMA 3WNBA 1W0JA 2WZQA 3K9GA 3MAAC 1G3QA 1Q22A 1YR9A 3SR0A 4DLRA 3GLHA 4JL5A 2GA8A 3BIFA 5DI9A 4IJMA 3KXKA 4GSYA 3SI7A 1RJ9B 3EZ9A 4GOKA 4QJ3A 4Y0AA 4OI0A 5HPYB 3HPQA 4WVFA 1HQYE 1P9RA 1XXHE 1ZC3A 2HCJB 3CUEF 5DI3A 4EAQA 3AVUA 2F1JA 1EG7A 1E2HA 2VHCA 3TAHA 2OM2A 3QPVA 4A2WA 2QL6A 1E2JA 1SQ5A 2QY9A 2W0MA 3QQ5A 4IDPA 3BH7A 3EPLA 1Q20A 2ATVA 1ZYUA 4JLOA 1NJGA 1OB5A 2ZM5A 4D6PA 2Q3HA 3BH0A 3H0KA 4CYMA 2R6AA 2WIAA 3HR7A 1XPUA 1MV5A 2ZETA 1NMZA 1NL3A 3AF4A 3QF7A 1I4TD 4TLAA 3CZPA 4DVGA 5EXXA 5CM8B 4NYMR 3UG7A 1D2NA 2QZ4A 4BRWA 1ZNWA 2MMGA 2BJWA 3U6KA 2HXSA 4AG5A 2ORVA 3NHAA 3OAAD 2C03A 1E9DA 3IIKA 3PIRA 1R5BA 1XZPA 3GLGB 1MABA 2H5EA 4NCHA 2QTHA 5FPKA 3QG1A 4B34A 3THOA 2F43B 3E2IA 3NWJA 1OIVA 4A8JA 4BFXA 3ADKA 3L0IB 5EE9A 1Z0JA 3K0FB 4S2EA 4QGGA 2GXAA 1E2NA 1GRQA 2G1KA 3VHXA 5K8IA 4M9ZA 5M04A 2YV5A 4HB3A 3Q9LA 1J2JA 2B8TA 8OHMA 1LF0A 1U8ZA 2E1RA 4G5RA 2JLQA 4OJQA 4EPYA 1QG4A 5IRCD 1E79D 2Q21A 4B3CA 1I2DA 2ZRJA 1Z22A 1T5IA 2ZUDA 4WAUA 4JLPA 2AR7A 2HJGA 1LF5A 1OFHA 4IOJA 4LHZA 2VSFA 4PPQA 1KMQA 1KNXA 4D80A 5HR5A 1JQLB 4CEIA 2FPMA 1NY5A 3ZVLA 4GMXA 4NCNA 4MYUA 1AS0A 3OE7A 2BKUA 4BFZA 3NC1C 2PZGA 2H92A 3NKVA 2NQ2C 4LUCA 3CLVA 3TW4A 4A0RA 4B6EA 5GADl 1Z63A 5DLQC 3OAAA 3N2IA 4S35A 2SHKA 1F2UB 4WIAA 3T61A 4DT1A 4RZUA 4LRWA 3KXLA 3C14C 1NIPA 4C0JA 3GP8A 4CF7A 2ZITA 4NYJR 2QBYB 1AS2A 4POAA 1WQ1R 1G3IA 2BKEA 4ZI3A 4AI6A 1A4RA 3VU9B 2ODNA 1D9XA 4FIDA 5CIWA 2OAQ1 3EZFA 2V1XA 5JEEA 3CH4B 4QBIA 3TQFA 4JSTA 3NG1A 3WMFA 3PQCA 1XJCA 2ZRFA 2A2ZA 3GLFE 3PITA 3U7GA 1E79A 2H7VA 2OBNA 1TUIA 1S9DA 2B8WA 4FN5A 4A92A 3LQQA 2Z43A 1OSNA 3UMFA 4DSUA 1ZIPA 4B3GA 2VP9A 2O52A 1Z0IA 1Z6YA 4KYUA 3ETLA 3AF0A 2IYQA 1VIAA 2GRJA 3R8FA 2ONKA 1GKUB 2CL7X 3ECCA 2D2EA 2FOLA 4D4LA 2ZI9A 4B44A 2AN9A 3TE6A 4UXIA 2EU8A 3CPEA 5P21A 4H1UA 4DDUA 2QT0A 1N5JA 4ZDJA 1DAHA 2ERYA 3S1AA 2CXXA 1SVWA 4L5BA 3AF2A 3RRZA 3J81k 3NEJA 1CJTC 2XEXA 1NP6A 1KKMA 3T35A 1E94E 1CLUA 1NVUQ 1ZRHA 2VP2A 1T5LA 2OEPA 2DPXA 2ZVPX 5G3YA 2IWHA 2DY1A 3CRQA 4OK6A 1G19A 4RD3A 3TSWA 1ETUA 5C18A 4Q21A 3QEOA 1P6XA 5H68A 2AD5A 1OHHD 2IS2A 2G6BA 1F48A 4D82A 4DLYA 5KSOA 3FHTA 4MA4A 2W2XA 1VDZA 1SKYB 1P4SA 3GEHA 5JLJA 2IYTA 4YDHB 1S1CA 4NCKA 3CW2A 4U7DA 4YONB 2O8BB 2BWJA 2JJ8A 3QKSB 3P27A 4AD8A 4AYXA 2BMEA 1G17A 3IBYA 4TTRA 1WB9A 1VCNA 4HLUC 1NSTA 3AVVA 2GXUA 4JLMA 2GZAA 4BLOA 1RVDA 1G8YA 3CIOA 1T0HB 4LJ4A 4O2RA 2P0EA 2OO7A 1NN3A 3RHFA 1N0VC 3B9QA 1E0AA 1P60A 2ZQ5A 1BYUA 1OF1A 4D0LB 2PJRA 2WAXA 2QAJA 3QKUA 1G5TA 4F92B 1Q12A 4Q66C 1HE1C 1CBUA 1PZNA 1E2QA 1W48A 3SJBA 2YWFA 2V54A 3PXGA 4HAVA 1WCV1 2DB3A 4BFSA 2I4IA 3SYKA 4US0R 1E69A 2W58A 1OHHA 1YR6A 2IF2A 3QUSA 4MYHA 3ZD7A 1G6OA 4WBSA 3REFA 4PC2A 1N6KA 1K5GA 2IS4A 1EWRA 3GJ3A 3PUYA 2Q9BA 4PQYA 3RC3A 3EWSA 1OXXK 2QTFA 4AIIA 4US2R 2GJKA 2CNWD 3AVXA 1VYVA 1JAHA 1N5IA 1US8A 4KSBA 4TL9A 3WNDA 4HB2A 2V4ZA 5CLQA 4LPSA 1ESMA 3C4JA 3GLHB 1A7JA 3KKOA 4PSAA 2NIPA 4MKHA 5EP4A 4TT3A 1U99A 3T06B 1WRBA 4A1FA 1R7RA 2V7QA 5DI3B 3JZAA 4V0OA 1QHGA 4MGYR 3SFZA 3TK1A 2XZOA 5JS8A 1S3SA 4HUQB 2JAQA 3GJXC 2IC5A 3DVLA 5FPHA 4ZCLA 5JRZA 1W4RA 3ZD6A 2A5JA 2FV8A 5KHOC 2KBEA 1IXRC 3K9HA 1W7AA 5FBVB 3T1OA 2O8CA 3DPUA 3VR5A 1XP8A 2WOJA 4W5JA 1CU1A 2ZSEA 3B78A 5DO9A 1JB1A 1TQ6A 5FI1B 5AJZA 5EXTA 4YMTA 1TX4B 2VHQA 2J87A 4KVGA 4B6FA 2ZE5A 1CKEA 3RWMB 1TTTA 1KK2A 3KQLA 2FFHA 4L9SA 4P4UA 4P4SA 1DBSA 5KPDA 2RKOA 3A4MA 2BBOA 2CNWA 2GCNA 2Z5FA 3BXZA 5HTKA 1E2IA 2IYYA 4LHXA 1LW7A 4MDFA 1JBKA 4B71A 3LXRA 1GL6A 1MABB 2D7DA 1OXVA 3A1UA 3AP1A 1HE8B 1NBME 1VYUA 4U5XA 2QT1A 3BORA 1WF3A 3KB2A 4FMDB 4TLCA 4TWZA 4A36A 1R8SA 2AXNA 3VTKA 1CR0A 4DXAA 2GILA 2B92A 1SVSA 2GEVA 1XPOA 2B6HA 3ZLJA 2DFKB 2P6UA 3TH5A 3IEVA 4RZ3A 2P2LA 1CRQA 4QG7A 4E09A 4R98A 4IVQA 2WOOA 2WJJA 3IO5A 1JR3A 2NTYC 2C77A 3IQXA 2JA1A 4O2LA 1H8ED 4QRHA 4LWZA 3GJ5A 1CR2A 2BM0A 2OESA 4PPNA 4P3YA 5DIFA 2R6DA 3QXCA 2YOGA 3AB3A 4CEIB 1GITA 4LJYA 3RWOA 4M1WA 4PQFA 5EZ6B 1W5SA 1SZPA 1NI3A 2J0UA 1Z3IX 3NBYC 3M0EA 3NHBA 2ANBA 5FI0B 3RS7A 4DCNA 4BPBA 1IY2A 3LFUA 3P32A 2QMHA 1ZUIA 1RZ3A 4PSVA 1N6HA 2ASEA 3W8RA 4B74A 2Q9CA 4IVPA 1QZXA 4RFSB 3VR3A 4DB2A 1J7KA 1KO4A 3R9XA 5F2EA 1PUJA 4BZPA 1XTIA 1MRSA 4FW9A 2CCJA 5JSZA 1COWD 1G3RA 4QNRA 4M1KA 3FTQA 3W3AA 4M1SA 2PJZA 4Q4AB 4KXFB 4DJTA 3ND8A 4FMCB 1KI2A 5CDFA 1YZQA 2GK7A 3Q5DA 3LDAA 4Q7LA 1D8TA 2OE2A 4OL0A 1TF7A 2ZJAA 1YRBA 5KDDA 4MRVA 1EXMA 4Q47A 5DSZA 3HU1A 2FJUA 1RRGA 3UG6A 1XJQA 4NP6A 1VYTA 4DB4A 4AKHA 2FEOA 3KKQA 2ZPTX 3VFDA 5BXQC 4LHVA 4EKDA 1G291 5KDOA 3KJIA 1VCIA 1G5RA 4XIGS 5K8LA 3IIJA 4JBYA 1X1RA 3WYFA 1G5PA 3IQWA 4QBGB 1VHLA 1II8B 3D3QA 5HZHA 3FKQA 3N5CA 3TIFA 4MYTA 2VBCA 4P32A 4ZPXA 5C4GB 3KKPA 4OYHA 1V5WA 3S1AB 5TDHA 2PEYA 4HB0A 1UBFA 1R10A 2P5SA 1HYQA 2CDNA 4BFUA 5DISB 5BQ5A 2XZLA 3K09A 1GG2A 2VO1A 1EFCA 1AZSC 4ZCIA 3BAFA 1COWA 1IHUA 1NNEA 5B58C 3I73A 1XJ0A 4HUTA 4PPGA 5EP3A 3CB4A 4JLNA 4QGHA 4TMKA 4UNQA 4A8JC 2QQEA 1XEWY 1KY3A 2JLSA 2XTZA 1QVRA 4LV6A 4TTQA 2ZANA 4KFUA 3UIEA 4B75A 1N6RA 3SHFA 4Q01A 4DDTA 1UFQA 2CEAA 4OQFA 2OCYC 4R2IA 5KYKA 3K0EA 4C0BA 3EPKA 4QNMA 2REXB 4B3BA 4BWYA 3ZVNA 2G0TA 4M53A 1WXQA 1JPJA 4ON9A 2JGNA 2IK8A 2LWIA 3GJ0A 1EX6A 2BEJA 3KQHA 3QVUA 3W6OA 2H17A 2GESA 4XWKA 4LBYA 3X1XA 1ZU4A 2YWEA 1U81A 1DG3A 1R5NA 4N0DA 3KZ1E 4BFVA 1UAAA 4DSNA 3ZZTA 1I4DD 1R2QA 1TQ2A 4DZZA 3DMDA 4TMXA 1C1YA 1OPXA 1X8KA 2BIFA 2KWIA 2O8DA 2ZUBA 4Q02A 3CF6R 4OQLA 5EUQB 2ATXA 2FPKA 4DLZA 3B7GA 3H86A 3W90A 3A6PC 1DAGA 4KBFA 4TYNA 2R8RA 4UXHA 4LBWA 4B32A 2PT5A 1HY3A 2N1BA 1CR1A 2NZJA 4HDCA 4EJSA 1JEEA 2QSZA 4PZLA 1CS4C 1SHKA 2PCJA 2RHDA 2VHUA 1E4VA 2QA5A 2I1VB 2QPAA 2RGAA 1ZVQA 1Y63A 3WP0A 1E9RA 3LLMA 3ND9A 4D4JA 3I8SA 3AVPA 1UADA 5AK0A 2WTUA 1IXSB 1YZNA 3V9PA 1N0WA 1U0JA 1OH8A 2HXYA 4N3NA 2CJWA 3K0AB 4EPRA 2OILA 1RPZA 3GEEA 3VR1A 2QN6A 2ZRNA 4DCUA 4D81A 1VG8A 3CX7A 2VP6A 1K5DA 3U4QA 2A5DA 2DBYA 1E9EA 3ZGXA 3QENA 3VNUA 1E2LA 3EXAA 1UKYA 1OE0A 1SXJD 4RCZA 4UKDA 5J40A 2AXPA 2QUZA 1XMIA 3FOZA 1NLYA 4QC2A 5CB8A 2NMVA 4NMMA 4UNNA 2ODEA 2XAUA 3MLEA 1OH7A 4JLKA 4XJXA 2X8AA 2ZSAA 5E7JA 821PA 3DDCA 4Z54A 2WICA 2DFTA 2TMKA 3A58B 1C9KA 1UPTA 4M0LA 3W6NA 3M6AA 3DKVA 1D6JA 2QM8A 1NVVR 5JWOA 1I2MA 2CE2X 3TAUA 1JEDA 2ZXUA 2Q3FA 1W47A 4P4SB 3AUXA 3UK6A 4LV8B 2IF0A 1FNNA 2AD1A 1LFDB 4CEJA 2IYWA 1BMFD 1YZUA 1OW3B 4D4MA 2OAP1 1ZM4A 1E2KA 2HF9A 4LX0A 3DL0A 3EIQA 1CIPA 3T12A 5BN3A 4DLTA 1NJFA 2XSZD 2GJ9A 5FTJA 5BWMA 1U9IA 1M74A 4FMBB 2UZ3A 1AS3A 2YINC 1W44A 2ORIA 4I1UA 2BMJA 3R9WA 1SXJA 2YNMA 3CNNA 1UM8A 3WMGA 3ICQB 3G5UA 2ZI7A 4F93B 3BH6A 2JLWA 1OH5A 1S1MA 2XOKD 2IUSA 3SS8A 2YWGA 3NDPA 2IS1A 3K9NA 4R9UC 4NPHA 2G1JA 5L3QA 1CXZA 2IW3A 2HT6A 3EW9A 4CGZA 4KFSA 1OKKA 2O5VA 2JDID 2VRWA 1Z5ZA 5FL7A 4FWIB 5HKKA 4LC0A 1X8JA 4ACBA 2FSHA 4FINA 2QI9C 4L15A 4IXNA 2J0UB 5G40A 4Q9HA 3O8CA 2JLYA 1RRPA 2J0VA 1XRJA 1BMFA 3A1TA 1T0JB 1NN1A 2VHTA 3K9LA 1DE0A 3R8CA 4GBMA 4IOKA 2ZROA 3M4YA 1WBBA 3AVQA 3BWDD 4V0NA 1W1WA 4CRWB 4GMDA 4BLTA 5HCNA 3SBEA 2IYRA 1DAMA 1EGAA 1HTWA 2XSZA 1RKBA 5D3QA 2D06A 3LBIA 5A5GA 4LC1A 2XZPA 4DIEA 4Q18A 1R0WA 2G9NA 4PQRA 5JSZB 2IWRA 1W4CA 2WWWA 4KITB 2ZRKA 2OFXA 1M7HA 1VKJA 2IXEA 1FQJA 2ZRMA 3C5CA 4RZXA 3U3KA 2YKGA 3DM5A 5LDDC 3AEZA 4HAWA 2XOKA 1NMXA 3Q8XB 5EXPA 4IKEA 3DO6A 4BLRA 2MMCA 1W2HA 2FEMA 3LA6A 4X8OA 5JCZA 1NSFA 2RGDA 2V6JA 3EA5A 2JDIA 2PLRA 4JYBA 3W5IA 1NLZA 2VP0A 5FPSA 1QHHA 4LYFA 4F38A 2J0SA 1XWIA 5K8TA 4DKXA 3LRPA 1VTKA 2FF7A 2GCPA 2WJVA 2HCBA 4C0HA 4B33A 1JECA 2Q3MA 3WRYC 1KMHB 1QHNA 4AWXA 3GJ8A 1G21E 1OJLA 1YE8A 2WAYA 4BEBA 2GWHA 3QXJA 1WA5A 4ILEA 2BMFA 4JT2A 4LBZA 4PX9A 4C7OA 1UEIA 2CCGA 2QQ0A 2ZRBA 3HYTA 4PTLA 4EPVA 2O8FA 2JATA 5FUVA 3Q5EA 2X2FA 2ZSDA 3WP1B 4HZUB 2H16A 4NYMQ 4ZDKA 3WYAA 4NTZA 1GL9B 3EPHA 4MUBA 2GF9A 2ZYTX 2JJ2D 3CKLA 1ZD9A 3BB4A 3BB1A 3O8DA 1L7VC 1CF4A 4RJLA 1E2DA 5FOWA 2CHQA 2WJHA 1P3JA 3I4LA 1P73A 5FBQB 3CR8A 4LJ9A 4M1OA 1XBTA 1P2SA 2QORA 5JHHB 1PJRA 1Q44A 4BUJA 3IPXA 3VR4A 4ABYA 2ZIAA 4FXPA 4R7ZA 5JWRA 2OCBA 4JBWA 4A15A 1KDOA 3KX2A 1N6NA 3QBTA 4MRRA 3C7KA 2R9VA 4V02A 1DO0A 3RRMA 1U0LA 4D2IA 2JLRA 4IVRA 1KK3A 5HCIA 2V3CC 4P0TA 3PEYA 4GPTA 1G7SA 1Q3HA 2QAGA 2F1RA 3BBPA 4L16A 1L8QA 5EZ5A 2HEIA 4AYWA 4A0FA 4XTCS 1KK1A 3C15C 5FTNA 2VTKA 1HA3A 3K0SA 2XNDD 1GNPA 3ZVRA 4DEYA 1IBRA 1E99A 3N70A 1G3UA 1NRJB 4Q4HA 4MQBA 4PAMA 2CL6X 2JIZD 4I99A 2WPDD 1OV4A 2WKPA 3U2QA 2AFHE 2O8DB 2BM1A 3LH5A 3R9IA 2MSCB 1QDEA 1Z6GA 1S9HA 2PL3A 2RGEA 1JI0A 1J90A 1LNZA 2R62A 4OI4A 4QHSA 5DYGA 2JJ2A 1M7BA 3AGPA 3UWKA 3ZQJA 2WM9B 2ZU6A 1F60A 2QGZA 4PHGA 1FZQA 2X2EA 1E98A 4HATA 5EJEA 4KAXA 3L2OB 4QJ4A 4C9BA 1H8HD 4NYJQ 4B43A 4EJSB 1E9BA 3B82A 3DM9B 3SEAA 1RRFA 1AIPA 4IFBA 5JZVA 1HH4A 5L3SA 3ONWA 1HURA 2BBSA 1KO8A 2ZR9A 4LSGA 1WBDA 2GKSA 1VIYA 4M1MA 1XD2A 2NZ8A 1CJMA 4XSHA 3U3MA 2IEYA 3FGNA 3GQBA 1EFHA 2CJWB 3O8RA 1XX6A 1T8TA 2ZJ2A 4I4LA 3WBJA 2XJ4A 1AA9A 3TSZA 2BOVA 3CZQA 4LZZA 2H57A 2XNDA 1OIWA 1ZU5A 2EFDB 2OUKA 3I3SR 4G3XA 3B85A 4IDQA 2GZHA 2QTVB 1U2RA 2WPDA 4Q7MB 2Z0MA 4V0LA 5UKDA 1P72A 1QBKC 3U7EB 121PA 3AM1A 3ASYA 421PA 2F55A 2Z83A 3K09C 5JJLA 1ZW6A 3TUZC 3K8YA 1DPFA 1R0YA 2AK3A 3OFND 4A0HA 1R0XA 1XXHA 2FPLA 4QM7A 4U02A 2ZR7A 2Q6TA 5TVKA 4TL8A 1DOAA 4C2TA 1H8HA 4Y0VA 1JAIA 1KJYA 1XB2A 1XEWX 4P4TA 3RNLA 4Z1MD 3HDTA 1P9WA 4CEJB 4EPTA 1MT0A 3CNOA 4BLQA 4AURA 4AG6A 4KU4A 1MR3F 1Q0UA 4DLXA 3JVVA 3H84A 3X1YA 4EPXA 3BFVA 2IYLD 1UBGA 1VMAA 4CT4B 3B13B 2F1IA 3WYGA 4FCTA 1VG1A 4JL8A 4MDEA 5A4JA 2VLIA 3D31A 1N0UA 4A0GA 2AHOA 1E9SA 2CVFA 3OIWA 2A5YB 4II7A 1OT3A 4QHTA 2FGKA 3LVQE 5L3RA 4C4PA 1ZNZA 4CZ2A 4GZMA 4W5WA 4TL7A 2IBMA 3P4YA 3K70D 4B3XA 721PA 4EIWA 2LKDA 3VR2A 5L3QB 2PCLA 5KPJA 1E4YA 2FA9A 2GCOA 3CX6A 3NBZC 3TW8B 3U44B 1PLKA 3PUXA 3LO5A 4JBXA 4FMDF 1MO6A 3FFAA 4JS0A 4W5HA 5DNYB 1KOFA 4AK9A 5D3MA 5JBQA 2RAPA 3KJHA 3GLIE 4M22A 2H1LA 5J4LA 2A5GA 2NO6A 4K46A 4KV9A 2GXSA 4DCVA 4ZDIA 4QOSA 4V0KA 5E7MA 3ADBA 1YJ5A 3THYA 4EJSC 2I3BA 1NMYA 5GJCA 2ZS8A 2PBRA 1Q1QA 2YHSA 1S96A 2OFWA 2FNAA 2D7CA 4OK5A 4ZIRA 4URXR 2FFAA 4FD2A 2QMEA 1II0A 2VPPA 2QU8A 1W36D 4Q4JA 1JNYA 2GNOA 4X8LA 5AJYA 1WMSA 2ZRPA 1Q21A 3CH5A 3RYTC 3KJGA 4DUGD 1AJEA 3MMPA 3VKGA 4QHYA 2G83A 3QKRA 2RGBA 1GOTA 4LHYA 3DOEA 3IIMA 3I1FA 3LBNA 3HWSA 2C78A 3MGCA 1MO3A 3KUDA 3GFPA 1XTRA 1GNQA 4JIMA 4EFMA 4MRSA 4F91B 4FMCF 1MOZA 2DCUA 4FCWA 4AKEA 3GLFA 4W7SA 2RGCA 1G1MA 5KOYA 4AYTA 1L2TA 1PLJA 2GF0A 3UPUA 1LVGA 2ZRIA 1E0KA 4U00A 1CJKC 2V9PA 3KKMA 3WXMA 2ZI5A 4EQ6A 5JFGA 4C7OB 2BC9A 1KI6A 2ECKA 5TARA 5GJWC 4HI0E 3LV8A 3AH8A 1R0ZA 4MGZR 4ARZA 2DR3A 2O8FB 3QBVA 2OHFA 1Z28A 1XD9A 3Q85A 5LBIA 4PR0A 2OXCA 5CK4A 2CLDX 5EP1A 2EYUA 1GVNB 3B1YA 4TMVA 1U9IC 3AV0B 4DUGA 4JVSB 1KAGA 1L4YA 1N6PA 5FOTA 2ZJYA 3QOFA 1ANKA 1F5NA 4TMTA 2J7KA 1MH1A 4QM6A 1SXJC 1TL7C 2QGNA 1QVAA 5GVRA 4R71A 1QG2A 1Z6XA 4URUR 3I92A 1ZCAA 2R44A 3B6EA 4FCVA 4Q03A 1G41A 2VEDA 2X1VA 3LQRA 5IF9A 1KI8A 3BGWA 4HZIA 3F5FA 4MYCA 1N6IA 2QAGB 5KU1A 3SBDA 1SULA 2JLZA 2FGJA 4A8JB 3EIHA 4XVUA 4DDVA 3P26A 3SC3A 1AQYA 4YLGA 2O0KA 4C3ZA 2UZIR 3A36A 3QPUA 3RRYA 1DAFA 2NPIA 1AGRA 4B73A 5EE5B 3SN6A 3THXA 2GEUA 1KTVA 3OIYA 2OG2A 3RS2A 3BE4A 1TU4A 1Z6AA 2GJ8A 4URVR 5KTYA 2HYDA 5AUPB 4TYYA 3VX3A 1A1VA 4HSEA 3ZS9A 5BYJA 1GDDA 3KKNA 3AVOA 1NVXQ 3HU3A 4LJ5A 3IDQA 4OJKA 4A6PA 4JYCA 5CJ2A 3AVYA 4TQUS 4KYIB 4UNPA 2AWNA 1R8QA 1ZAKA 5CB6A 1X1SA 1OYYA 5L3SB 5LB4A 1ONBA 1ZM7A 3ADDA 5BN4A 2WKRA 3L0OA 1XD2B 2GAAA 4DT1B 5GJVC 3GLGE 3QKTA 3EIEA 4LOAA 3K1JA 4KVAA 3U7HB 4OQMA 2IYUA 3W9YA 5DN6D 1NKTA 3BERA 1IAQA 1AM4D 3H4MA 3DEFA 3MD0A 4RKEA 2ZRCA 3LWNA 3EA0A 5G53C 4QFMA 1JALA 2C04A 3T1QA 3TR5A 4ERNA 1GWNA 4RCYA 1NBMD 2OV2A 2GBLA 3RVBA 3RC8A 4GT1A 3A8TA 1H8EA 2ZRGA 4HLQB 2F3TA 5C46F 1XXHB 2O0HA 4I1OA 3B1XA 1BKDR 4HAXA 4LCBA 4PC1A 5FTLA 2B21A 3IHWA 3DZDA 1Z0DA 1U98A 1FOEB 5LPNA 1Z06A 2BJVA 4I1SA 1RIFA 2R6CA 2B7BA 3CR7A 4WOPA 4DRZA 3IILA 2HDNB 4RD1A 3FMPB 4AC9A 2I1QA 4F4CA 5AJXA 4MRNA 4L4UA 4C0QC 1UDXA 1KO7A 3PEWA 4K81B 5J4KA 1KY2A 2QP4A 4JJZA 3JZMA 3A4NA 4KO8A 5TY0A 2GTPA 3RLFA 4BE7B 3MFYA 2L0XA 1MRNA 2QNRA 4IW3B 4CEHA 4E03A 3HYRA 4GFDA 3X1ZA 1OYWA 3QNUA 5DN6A 1G18A 2BCJQ 1NG9A 1IY1A 3ZIAD 3T1TA 2VP4A 3UMRA 2QAGC 4LYJA 2F9LA 2HUPA 4IDOA 4B35A 5JI2E 2BEKA 2GETA 3I8XA 1BYIA 1DAKA 1I4LD 1NBMA 2NGRA 3I61A 1F2TA 3W5JA 1IM2A 1G7RA 4TLBA 1LB1B 1EFRD 5FBLB 3RS4A 3TKLA 4E22A 4L8GA 1MO4A 2GXQA 2ZREA 5DYIA 3MRSA 1SHZA 3RRNA 4JLBA 1A5TA 2ZE8A 5D3MB 1EX7A 4JLJA 3QEJA 4Z8XA 5F9FA 2WBLC 4NCIA 1EFTA 4Q00A 2WV9A 2J3EA 4Q1FA 2C5LA 2BV3A 5JS7A 5FOUA 1IQPA 1FTNA 2JEOA 3CX8A 1KSFX 1G6HA 4RSGA 5IK2D 1IONA 2WMOB 4AKGA 1DTSA 4ESHA 3BC1A 2GK6A 3OEED 1D9ZA 3K0CA 4ZIRB 4C0SA 2ODWA 2PLFA 3W34A 1NKSA 2AKYA 4LBVA 5L8VA 2JCSA 2P67A 3ZIAA 1IN8A 1ZD8A 4BASA 5B64A 1E0JA 2IX3A 2F3RA 1G16A 2FE4A 1VG0B 5FPTA 3TVTA 4MGIR 4LJ8A 3CRVA 3BB3A 3EASA 5JECA 3K70B 2CE7A 3QKRB 3HPRA 2KB0A 4ZKDA 1R6BX 2J7PD 5FPYA 4DDWA 4Q1AA 2UVQA 4A6XA 2V6IA 4BECA 1SKYE 2GEDA 3FB4A 3MWKA 1EFRA 2CLCX 2BBTA 4Q9KA 3ICEA 1XTKA 2IHBA 3KQNA 1TAGA 2NPFA 3H2YA 1F6BA 3MSXA 5A0FA 3B9PA 4XVQA 5FBWB 1SVOA 1PLLA 1US8B 1YZLA 4B47A 4DLWA 4Q9JA 4PAQA 4QGAA 4QGFA 4YMUA 2FG5A 5GVSA 4IFEA 2ZJ8A 1UKEA 4PO9A 4GRAA 2NG1A 4UJ5A 2G88A 5AR1A 1J99A 5IK2A 4N1AA 2G77B 4EQ6B 3CONA 5JRJA 1XCMA 4I1VA 4V0ME 3MWYW 4M8NE 4MUAA 2OXRA 2ZRAA 4YMWA 3L0SA 5KSPA 4ARZB 2PMDA 3OEEA 4OQXA 4TYPA 1YRAA 5EE0A 1NVVQ 2DFLA 4C30A 3MJHA 2GAOA 2AX4A 4RZ2A 5L3VA 2ZSBA 1YR8A 5AJWA 4ZO4A 1T9HA 1W36B 1LV7A 2DFNA 2R6GA 4RVCA 4DLSA 1ZM9A 2D4HA 3E5HA 3EC2A 4LYHA 2V1UA 4NE2A 5ELXA 2O8CB 2YVUA 3LX8A 3LX5A 1DAEA 3R7WA 1RE0A 1G8PA 1H65A 3ZVMA 1CEEA 3MJRA 3Q7QA 2J7PA 4W9MC 4US1R 2IYXA 4M9QA 3L8ZA 1U0HC 1J70A 1Y3AA 3WMEA 4RKFA 5LD2C 3PEVA 4CIDA 3FMFA 2Z6VA 2QG6A 1KIMA 3F0TA 2WWXA 1N6LA 1ZCBA 1ZP6A 4KODA 4B2PA 3U60B 4D26A 4FWTA 4J0QA 4IDHA 4XD7D 2ZJBA 4UJ3A 3GLHE 5SZKB 1XDBA 1E9AA 4JKIA 5E4FA 2VSOA 4A4DA 5TXGA 1KNQA 4I81A 3HJNA 4NBSA 2YOFA 2CHVA 2W6ID 4UNSA 4BZXA 1OLOA 4D4KA 4IEEA 1ZC4A 4LI0A 5G3ZA 3OHMA 1K6MA 4XWOA 1G8FA 3TJZA 4D25A 3WHKA 3GPLA 3UXMA 2VSXA 3T15A 3KB1A 2PZEA 1TQDA 3TLXA 3ZJYA 1GRNA 2EYQA 4JT4A 1MO5A 1U90A 4TSFD 1X6VA 4ZDWA 2C95A 5HE9A 3B8HA 4FI3C 3UMSA 2PZFA 3T1VA 3WY9A 1GSIA 1E3MA 3K70C 3VKWA 4BLPA 5G41A 4KJZA 4H9GA 3AKDA 3VQTA 3FKSD 2YZ2A 1E1RD 2DWOA 4NZYA 1ZUNB 1M1YE 1Z29A 1J8YF 1W4BA 2GJAA 2IHYA 2XITA 2XJ9A 2RB4A 4LJAA 5SZJA 2E87A 2Z4RA 1XTJA 2AKAB 5H1YA 2ZAMA 4B48A 4RD2A 3SYNA 1QHSA 2QROA 2X77A 4KFTA 2W6IA 1A82A 3AF3A 5F9HA 1FTSA 5F3WB 1DADA 3OZXA 2RHMA 4BQSA 1E96A 4NCJA 2NO1A 3HU2A 3TUIC 2AWOA 1BH2A 3EG5A 3G82C 1OB2A 1OFIA 2GVZC 5EE3A 5AUNB 4Q1BA 3X2SA 4NHOA 1OH6A 1TPZA 2W6JD 1JXMA 4QBHA 4TSFA 1CJVC 1KYIA 4K8OA 5ANRB 1W36C 3I5XA 1JXOA 4X8HA 5FOVA 4PC7A 2IYVA 4DSTA 3CWZA 1ZD1A 5FUWA 4O0MA 3SZRA 4BEJA 4DCTA 3Q3JB 3RAPR 2OLKA 3FKSA 3LXXA 4JMPA 3MG9A 1HT2E 2RH5A 3CF0A 4NL4H 521PA 1B23P 1KI4A 3C16C 1WDTA 2C96A 3W6PA 1B0UA 3AGQA 5H8WA 4CEHB 1IN7A 5KUTA 1FNMA 4JLVA 4YXWD 4DSOA 3VR6A 4PPFA 1UBCA 5FL3A 4NDZA 1OFUX 4PO1A 3PENA 3SU8A 3KXIA 3A1VA 4A82A 4F7WA 1Q57A 4QKQA 1E2GA 3FDIA 3CF2A 3CO5A 1G3MA 2QP3A 3KQKA 1Z6TA 2JLXA 1F2TB 2CMKA 2O0JA 2WKQA 5B30A 3ZYCA 1X8LA 3NH6A 3CRMA 3A1WA 1E9CA 1KJWA 2RCNA 3RS3A 1ZMXA 1YZGA 3F3YA 4RFVA 2W6JA 4NYIR 3MUFA 3CBQA 1PUIA 4ZI2A 3U5ZB 3QF4A 2GDJA 4HUQA 1DAIA 1EK0A 5E95A 2IT1A 2ZTSA 2FSFA 4GP6A 5TB5A 1P5ZB 2HYIC 5FTKA 5H70A 1FP7A 2B7CA 4G5QA 3SHWA 3QSYA 1TNDA 4QL3A 1TEXA 3UATA 1KHTA 2IS6A 1T91A 2FDCA 1FUUA 1E32A 3TNFA 1RRCA 2OT3B 5AWFC 4DLVA 2PH1A 3V4FA 2DWPA 2PX0A 3SDZA 4XVRA 3FVQA 4ASUD 2REOA 1AKYA 4HB4A 2VF8A 3OE7D 4MKGA 3CWQA 2BDTA 3EAQA 2F1HA 4LPKA 3X1DA 5E3HA 4YXWA 4BFWA 2HV8A 3H1TA 1Z0KA 1FQKA 3PUZA 3KFXA 4XH9B 5IT5A 2OLJA 2MSDB 2ORWA 1KO5A 2WWFA 3P4XA 2RGNA 2W0SA 3IHLA 3IUYA 5HE8A 1NVWQ 2XNSA 3QI2A 4EUNA 3QXXA 3KTAA 3PR1A 4Q5IA 5B57C 3QE0A 4M1YA 1D5CA 4R2HA 1X3SA 3BD9A 1OXUA 4TTPA 2ONJA 3BFXA 1LTQA 1GAJA 1SKQA 1XD8A 1AN0A 1XNJA 3LBHA 5TV2A 2WHXA 3IGFA 2WWGA 1JR6A 1TADA 2H18A 1Q1ZA 2GBLC 2IEZA 1GILA 4URWR 2X19A 5KSYA 5JJKA 3LAWA 3QXHA 1XPRA 4D0NA 2YC2C 1QHIA 3EARA 5KSZA 1YU9A 1ZNXA 3ZZ0A 4E5UA 2IUTA 1QHYA 2DHRA 2AFIE 4AKIA 1ZINA 2D3WA 3NH9A 2OCAA 1F3OA 4PANA 2KI5A 3AP3A 1XFAA 2WIBA 5J4VA 4ASUA 3U4QB 2FN4A 3DKPA 2J41A 1P7CA 2CVHA 1GFIA 1HT1E 1T4GA 4X8MA 1YZTA 2JIZA 4ZKEA 1HEIA 2GZDA 1FMJA 2QRZA 3FYHA 2JJ1D 2OFOA 5CIQA 3F8TA 2GJSA 1KI9A 3DOFA 4JKYA 2XX3A 1P9NA 3THWA 3R7WB 1BIFA 4M2LA 4RFSA 3U3OA 1PVOA 2QRNA 4MKIA 1XZQA 2V8OA 4GNKA 1UDWA 2WWHA 3BJIC 1UEJA 3RS0A 2EFHB 1VECA 4KCGA 3WHLA 1G64A 4GZLA 2E9SA 1VCMA 4Q4AA 3TBKA 4LGMA 1N5LA 1VPLA 1W0KD 3K53A 5DGXA 1AK2A 4PZZA 4KSCA 2A3RA 5FFMA 1KSGA 1GP2A 4DC9A 2ZYVX 5HZKA 1E2PA 4IXMA 3TGPA 4DEXA 1GIAA 2XXAA 3P1JA 3A4LA 4Z51A 1JQJC 3PJRA 1SXJB 2UKDA 2KSQA 4PHTA 5FUYA 3TRFA 1AKEA 1II8A 2ZAOA 4IOMA 5C2JB 4YQFA 1W2GA 4TYQA 4Q9LA 1OFTA 2DWQA 2Q9AA 3VHLB 2JJ1A 2A30A 3FFBA 1U8YA 1IN4A 1CRPA 1W46A 3UANA 3K0CC 1GRRA 3WRXC 3ZZUA 2ZJOA 2NOAA 1XU4A 4C0LA 3OFNA 3NXSA 3NDBB 4GP7A 5CYPA 5J4YA 1E2FA 1FL9A 1N25A 4RD4A 1KZ7B 4LK2A 4Z1MA 3T5GA 5SZIA 4PSKA 4IHQA 4JJKA 2YYZA 2QSYA 3E70C 3ASZA 3PV0A 4PXAA 2ZE6A 1R4AA 1IJEA 5K8UA 3FPAA 3SNHA 1W0KA 2ZU0C 1UBEA 3PFIA 3CRW1 4BFTA 4DWJA 3B1WA 1O3YA 3KFVA 4JVMA 1KI1A 3C8UA 5EE1A 4YC7A 1ELOA 1E6CA 3IBGA 2QEQA 3GEIA 1E2MA 1ZM3A 1ZJ6A 1D2MA 1RFLA 1E2EA 2F7SA 3T5DA 2C2HA 5C1BA 2DYKA 3KL4A 1YHNA 3C41J 3DHWC 4XOIA 4F4JA 1Q1BA 4HAYA 2VA8A 3NC0C 1IXZA 4WXRA 3EC1A 3JVUA 2J5XA 4WW0A 2NO7A 1GZSA 2G3YA 4OBEA 3CPJB 1JR3E 4TT3D 1FFHA 1LS1A 2IYSA 1QHXA 2EQBA 3AVWA 1KAOA 2V7QD 4O25A 1R5OA 3X1WA 1BS1A 3B5JA 1NG1A 2K5UA 4JLDA 4MITA 3OIVA 2ZYUX 4YMVA 4B2LA 1AGPA 1QHHB 1QRAA 2BVNA 2ZRDA 2ZSFA 1TQ4A 5FBRB 4DBLC 3IEUA 2O8EA 5FR2A 2P3SA 1XMSA 2IXGA 4LV5B 4GOXA 3L0PA 4MGKR 5IHPA 4BRUA 2FWRA 4EFLA 1G7CA 2QMUA 1RYFA 4DHEA 3M1IA 1IOZA 1GUAA 4RD6A 3IKJA 2IUUA 1FP6A 2D62A 3LNCA 3U7FB 2W2TA 1TF2A 2WMNB 4NU0A 1LY1A 2ZJ5A 1ZM2A 1DVRA 2EW1A 4YDSA 4OHVA 3MWLA 4JVNA 3OF5A 1Z47A 2IA5A 2Z4SA 5JHGB 3FHCB 2BCGY 3SE0A 2FU5C 2G0NA 2ZRHA 1EWQA 3VX4A 3OESA 1G4AE 2F9MA 5CDFE 3FHOA 3K0AA 2J0QA 4HDOB 3QVVA 1E9FA 3UKDA 1P75A 1FX0A 1X86B 2ZI6A 1Z0AA 2VYFA 3QF4B 2XB4A 2LCFA 3GMTA 2W2VA 4B2IA 2FZLA 3NBXX 1UKVY 2MSEB 3L43A 4O3MA 1NLFA 2ZEJA 4GOJA 4IEIA 4JL6A 5FOXA 1JR3D 1CJUC 3P20A 3FE2A 5KNBA 1GKIA 2XTMA 4TZ6A 1WP9A 4UNRA 5AUOB 4EPWA 4B3FX 2PEZA 1M7GA 3LVRE 2EVWX 3GLIA 1NY6A 4TQ9A 1KSJA 5B2ZA 4KFRA 4KLNA 2GHIA 3EPJA 1G8GA 4Q1DA 2ZRLA 3TQCA 4HEJA 4Q4HB 2RGGA 5J5CA 4KBGA 3TVDA 5FH9A 1T8UA 3I5YA 4HAZA 3KDSE 1AQUA 2ANCA 2D2FA 2R6FA 3I72A 2VIIA 5FR1A 3MWJA 6Q21A 4TYWA 1KO1A 3EZ2A 4IRUB 3UWOA 1J8MF 4OKSA 2FZ4A 2OBLA 1Z8FA 3KTAB 3Q72A 4AY2A 3ZH9B 2RGXA 3WNCA 1P61B 2ZE7A 1KZGB 4ITRC 1YKSA 1HV8A 2REBA 3IO3A 4IDNA 2IL1A 4BLSA 3AVTA 5JMTA 1QF9A 3VKHA 1XCPA 1TMKA 1Q3TA 4YMSA 2JLUA 3NVAA 1SVMA 1E1QD 3W3ZB 1FUKA 4A2QA 2WWIA 4HAUA 2OCPA 4G1UC 3U6BA 4ESVA 2LKCA 4TZ0A 4CT5A 4Q19A 2JLVA 3OEHD 3ZQ6A 1RYHA 2ZI4A 1VCOA 5CJPA 5TMPA 1FMLA 1A2KC 1N5KA 621PA 1PV4A 4PO8A 1CR4A 1VG9B 2WJIA 1N3BA 2ZI3A 4GI7A 1G8HA 3AQ4A 3VAAA 4TLEA 2FFBA 5AUQA 2AK2A 2EWVA 1XCGB 1DEKA 3RS5A 5JI3E 4ACAA 2KBFA 1Z2CA 3CPHA 3SYLA 4LDJA 2A9KA 1NF3A 3FWYA 2YOHA 1CP2A 2WJYA 4XTRA 1FPMA 5FTMA 3BS4A 3GJ6A 3TUJC 1XEFA 3THWB 3RSLA 4URYR 3N2EA 1KI7A 2KJQA 1KKLA 1YQTA 3LW7A 221PA 1M2OB 4OI2A 2ZUCA 3HP1A 1DS6A 1E0SA 1ZIOA 3OIUA 4MH0R 1NN5A 1XEXA 1UKZA 1W49A 3DZ8A 3C5HA 2GVDC 1GL7A 3B1VA 4H1VA 3AKEA 1ESNA 1E1QA 4GL2A 4TMWA 1W5TA 1M6NA 1OXSC 3KUCA 5EXSA 5JWHA 1S8FA 4TL6A 5LB2A 2VL7A 1GM5A 3OEHA 3O8BA 1SVIA 2FMXA 1M34E
chains in the Genus database with same CATH superfamily
2D0DA 1S1TB 5CB4A 4DTIA 3QTBA 1MKYA 4EL0A 2Q4RA 1TIPA 1HK7A 4GPIB 1XOIA 1K73T 4EW6A 3V2UC 2DD8S 5FXMA 1HQDA 5BN5A 5K3EA 4AZWA 2RHQB 4DSIA 1HQKA 7AT1B 2PS0A 4PC3A 2ZYGA 4C5BA 2ASJA 2MKYA 2VH5R 4M3NA 5DE3A 2IOFK 1IJFA 1T3LA 3F9IA 3KZMA 2GNKA 3RD5A 5J2UF 3M5DA 2GYUA 1IPHA 2DP4E 2NU6A 3EB9A 4AJHA 4R9SA 3CUYA 2EBEA 3DE3X 1Z13A 2N42A 5DGDA 4ILKA 1SIWA 2QRVB 2DIVA 3MM4A 2V6BA 1RW4A 4EVIA 5ETSA 3HXPA 2QPOA 2F43A 1O9BA 3H3XA 4ID5B 2AOXA 4CM4B 1F51E 3GAFA 1WHTA 5COQA 2X86A 1UZUA 4CL8A 4LHEA 2Y8EA 3QE9Y 5FLXY 5IJ0A 1FFEA 2BM9A 3C1OA 1IWBB 1BCSB 1LTKA 3CJSA 3PEUA 4NFLA 1BH6A 3SSMA 1BVYF 3ELBA 3KWLA 3DG9A 4E07A 2YR0A 4Y6SA 4FSHA 1AZTA 3LO3A 3DXBA 3TZCA 1LSJA 4UU1A 5YASA 3SJCA 3VTZA 2P6NA 3CRRA 3D9BA 2RH8A 3OL8A 5C25B 5CFMA 1ODSA 1GKYA 2P2YA 3HVIA 4Q12A 3EOBI 1RQXA 2FPXA 1KDRA 1L3CA 1G4UR 4Q1EA 4QU7A 4YR9A 4EBCA 3LD9A 2VATA 1V1MA 4JI4B 1RWBA 1T3SA 1UJCA 3HSKA 1H6CA 3PRDA 2FN9A 3WLSA 5JXHA 1L0BA 4NAVA 2O3JA 4JVLA 3OBBA 1IN6A 5C9ZA 2R8ZA 3KLBA 1V6HA 4Q39A 3RUEA 1G9XA 5MGNA 2OTJS 1KGDA 3BCUA 1NB7A 1HG1A 4RK5A 3DMGA 5IDVA 1R0BG 1NNUA 1WTCA 1LPBB 2YC4C 1Y8CA 3K9QO 3ZGLA 2XWXA 2QRRA 2GKGA 2C2KB 3RYIA 3PUVA 4HYYA 1L5YA 4O2BB 1QFZA 3RF7A 5EIHA 4QPDA 4CLUA 2XYHA 3VV2B 4FYIA 4DRXB 1RPNA 4DMFA 3S7TA 4DHVA 2YXPX 3DLLQ 1KEWA 2X9VA 5A04A 3D8NA 1EB8A 5BSFA 1YR9A 2MT9A 4AQ7A 4QXPA 2B1QA 2H00A 4IJMA 4M0UA 3SBOA 1RBZA 3VZBA 4IFYB 2PKWA 3PNYA 1P9RA 4IOBA 1JG7A 2NPOA 2ZM5A 1EFAA 2R7NA 3FK4A 2Q3HA 5EWLB 3WWPA 1TKXA 3S2SA 1K8QA 3O8LA 3LOPA 5CFZA 5GAEU 2SXLA 3KWFA 1R27B 4HDHA 3RB0A 3WGYA 5K5MA 1TZ0A 4JELA 1GAWA 2X7XA 4H3KB 1V3QE 1SCBA 3ZWKA 2Q4BA 2G1KA 4WKGA 8OHMA 1U8ZA 4EPYA 5CFOA 2D54A 4RNCA 4EW1A 4HS9A 4MW9A 1E2UA 4NEQA 2I7DA 1GG5A 3KR9A 2I5PO 3GPBA 3FCUB 1G20A 1GX5A 3CJQA 4MYUA 1TA4A 4FBUA 2OR3A 3NC1C 5AW2A 3FJ2A 3U9SA 4YUXA 2QBYB 4TWAA 1WQ1R 1A4RA 4YMLA 4WTOA 3ELWA 2J6CA 1D0SA 2YFYA 4HX9A 2XWBF 4IFIA 3RAGA 3PQCA 5KG4A 3LUGA 1RI1A 3E9MA 5CX1A 4LREA 4KYUA 3LNTA 3SM9A 2GK4A 3Q6NA 3BBFA 1X4AA 4ALJA 4AQYJ 4EUEA 2BUNA 4UNIA 3K2IA 1E9VA 2XEXA 1X7YB 5G4KA 5ES3A 4H7FA 2PUWA 3RC7A 1L6RA 5JU6A 3NDRA 1ZN2A 3QUQA 4J90A 2FETA 4LVNP 1T5DX 5DX1A 3VHRA 2JI9A 4AECA 1DJLA 2O8BB 2QIFA 2WHOA 3A1DA 1YQ9A 1RPTA 1MX9A 2QN7A 4JLMA 1DBRA 3CIOA 3U1NA 3GGJA 2AFIA 4KXYA 2B9VA 1DLIA 1NVBA 2CLLB 4MV8A 4R2XA 3MXHP 1UA1A 3FNBA 3HBLA 1VYAA 1HNNA 3CNHA 3OI7A 1ULUA 2DB3A 2HF2A 1I3NA 4RPHA 4K88A 2FP4B 2DISA 2ZCVA 3ZBQA 4PC2A 1HOXA 1OXXK 2YV4A 3OFEA 1US8A 2ZH4A 1REQB 5IM0B 2HLNA 2OL4A 2VJKA 2CFSA 2UVWA 2PQ2A 5AOCA 3E84A 1JG2A 1VMIA 2L18A 4O4HB 5KHOC 4KQ2A 3K9HA 2O6LA 1SD2A 3E18A 1T9KA 2GM9A 5FI1B 1L9KA 1EXWA 1KK2A 4FF2A 3EEQA 5KPDA 3RARA 4ENRA 1CDOA 4PFKA 1LW7A 5K3BA 3EMKA 3EXCX 4K2AA 1QTQA 4B71A 3D4OA 2D7JA 4QLOA 1KOGA 3A1UA 1VL6A 3D43A 1W29A 3QFRA 2QT1A 3TTYA 3DN9A 4TLCA 2AXNA 3VPGA 3N59A 1NKEA 3W3AD 1SVSA 2QC3A 4X7BA 3L0YA 5LLSA 3C6YA 1ZA1B 2W24A 1ULHA 4NBRA 4TXJA 1XWFA 3AB3A 2QXUA 1W5SA 3WNQA 3HMJG 3H1EA 1A9YA 3NHBA 1P3DA 4OKIA 1IY2A 3DBIA 1ZPDA 4BZPA 1RUSA 3ZV3A 3L05A 4YUAA 4EHKA 1GPH1 5JVGQ 4Q7LA 3RU0A 2VICA 3BO3A 4YJ3F 1MVLA 4RW4A 1XJQA 4NP6A 5BXQC 5EFZA 5KHLB 5KDOA 4F12A 2A1UB 1PK7A 1IKYA 5HZHA 3TIFA 2VBCA 3RYHA 3SIPB 2DFDA 3JQQA 4IDBA 3F56A 4TS1A 6PFKA 3PFOA 3AEUA 4DA9A 3MPDA 3PV8A 3HL0A 1ORDA 2PWPA 1KKUA 2AW3A 4CJXA 4IBOA 1JSRA 5C5EA 1U6FA 5A0YA 2A7XA 1WD6A 4R2IA 2I5JA 4XLTA 3K0EA 4JWTA 3PGJA 1ISJA 2FDNA 3EK2A 4BWYA 1V1RB 4USUA 1N33J 1RT3A 3GJ0A 2DHAA 2GESA 3CBGA 3GT4A 3NS7A 1U81A 3SXPA 4MV9A 4N0DA 3DDWA 1I4DD 2A0WA 1YNSA 2EDAA 2XOXA 2G5CA 2UYHA 2F3SA 3W90A 1HLDA 3W2FA 1RWNA 5CH7B 1F0KA 1U3DA 1E4VA 3N58A 3W63A 1Y63A 1Z5PA 3BPSA 4D4JA 4WNAA 4MV1A 2IAJB 1YZNA 4OFWA 1VOTA 1K97A 2ASDA 3K0AB 3GEEA 3JSRA 4U95A 1PYSB 3BM7A 4UBOA 1IPEA 1PNTA 1NLYA 4CM8A 1WXEA 2FLKA 4IEFB 2ZSAA 1N2CA 1WG4A 4MJLA 4GRDA 1Z4JA 4MYRA 4DF4A 3QT7A 1FT8A 2AD1A 1YWXA 2OXEA 4B9UA 2VXCA 4DMKA 1KNZA 1NULA 3DKIA 2QYSA 1SURA 1CIPA 2IH5A 2KXNB 5FTJA 4NBNA 3JRNA 4FMBB 2UZ3A 3P2KA 3PC8C 2GASA 4EX6A 3KPWA 3P9NA 1BQMB 3K89A 2INGX 2C2YA 4G8DA 3AHPA 1YZ6A 1CUHA 1CXZA 2FZVA 4L6AA 4WZBA 2VRWA 2AGPA 4IG9A 3QX8A 1O95A 3M32B 4M63A 4YLYA 4J7XA 5KG1A 4F3MA 4OX9B 2BUCA 2EZ9A 2ZBFA 3HABA 3IQZA 4FB4A 2TYSB 3ZK8A 3I9V9 1V6AA 4KXWA 1TL1B 1LWNA 4RZXA 3C5CA 5EHHA 5LDDC 1NMXA 3DO6A 1W2HA 4KR0B 3R3WA 1CYEA 3E9QA 3UDEA 2P9TA 4E33A 2E1AA 3AFMA 3FXAA 4IIDA 5DX8A 1JECA 4LOLA 2H4WB 3D7SA 1M2JA 1R0AB 4C7OA 2QQ0A 1EGQA 4UREA 3RKSA 4CUZA 4P36A 2AG1A 4E11A 4MUBA 3NVDA 3BB4A 4AJ2A 2GX6A 2XDQA 1RADB 3MECB 3EEIA 3OL9A 3BCHA 1XBTA 4KC5A 2V74B 2XHEA 4ABYA 3TQIA 1B6GA 1U2GA 4DR6J 2G28A 4FYHA 4B46A 2QD4A 4D2IA 4ADSG 4S1OA 1DAPA 4J37A 4L8VA 5AXMA 1E99A 1A7AA 5ETTA 2AOTB 4YCSA 2JIZD 1YLXA 3DMRA 1Y8RA 1XHEA 1E3SA 2RSQA 1MSWD 2PZAA 3H8SA 2F55A 1O89A 5BYAA 3AGPA 1F60A 4EI9A 2X2EA 4J1SA 3L2OB 1JGTA 4O44A 5DGTA 3F8SA 1VJQA 3K6SB 4LCJA 1SZCA 4B45A 1AIPA 2WTEA 2GQCA 5F51A 1ES9A 4EYKA 3AW8A 1TK5A 1XNRJ 2D74B 2QN6B 1KP2A 2OVFA 2YNIA 2H57A 5D3GB 3R3SA 1QE3A 4QYIB 4RK1A 3ITDA 4HD8A 5E6RA 3T5JA 2FRDC 1DPFA 4RY8A 3OFND 3U4CA 4ZARA 2WYHA 3AM3A 1XEWX 2CXNA 2IYFA 4H0CA 2ETXA 5K0CA 3N0XA 1QGUB 4BZZA 3CW8X 4KU4A 4U2DA 1FK9A 4NF2A 3DAGA 4J1NA 2CVFA 3OIWA 4X65F 4ALLA 2XMGA 3FSGA 4DV7B 4RKYA 4D4IA 3RUIA 1RXCA 1FDBA 3D6FA 2ZYIA 3KJFA 2CV2A 3DHXA 4TN5A 3GZ4A 3TAMA 4UE3S 5B4UA 4KTTE 5F0UA 5HG0A 3IX7A 4I55A 4K46A 3BBLA 4AT1B 2R4TA 3OQ6A 3KT0A 3WL6A 3G6XA 1YJQA 3CWCA 3B38A 4J1TC 4AXJA 3TVKA 3PG9A 1YI0A 4UEOA 3WGIA 1W36D 5DTIA 1AJEA 2LIPA 2WM3A 3BMNB 3WJAA 1VBNA 1GOTA 3T6BA 2OTCA 2TMDA 2FJWA 2F59A 4KPUA 1DEOA 4ZCTA 3N2GB 3E01A 3WG9A 4CIBA 2GVNA 3IMQJ 4XGQA 5LQUA 2RGCA 5JLAA 3LVBA 1M5KC 3PIOQ 2DQ4A 3FWKA 4HH3C 1IBSA 1HI8A 5TARA 4HI0E 2E6KA 5E3AA 3UVJB 5CK4A 1TCVA 1KFEB 4KXMA 1XQ6A 3MELA 1L5LA 1USKA 2C3OA 1QVAA 3RK0A 1HBMB 1VA4A 3JYPA 2R751 3RWBA 4R71A 3OPNA 3VKFA 3TJMA 4J16A 1N6IA 4B4DA 2LPMA 4DDVA 5IDQA 3VZDA 3UT5B 2O0KA 4YR0A 3A36A 1EU1A 1YWGO 3PJXA 4NFSA 2W22A 1QNFA 5HBGA 1P31A 2WTMA 3TO5A 2HYDA 5AUPB 3K8OE 5KYVA 5FIUA 4QLBA 3ZS9A 2RI0A 2DEUA 4JYCA 4ZPBA 4TQUS 1MRZA 4KYIB 5IT9U 1OYYA 5L3SB 3RK1A 1Z5WA 3H2LA 5K0BA 4USVA 5CT8A 5KOIA 1T9CA 1QGED 5D84A 1UBNA 3WX0A 3DEFA 4M38A 4H6XA 1CUUA 2B5OA 4ERNA 1PKXA 4RZQA 4IWXA 5C5JA 5A5VA 5D1HA 1VSTA 1EDEA 4M1ZA 3AD9C 1FVFA 4I1OA 1OFGA 4UM9D 2B21A 4K6KA 4WOPA 5C24B 3ZZOA 4DBLE 5I5GA 4UCFA 5GZ1A 3RLFA 1N5SA 4BE7B 3KTQA 2QNRA 4IW3B 3AXMA 3X1ZA 1GQSA 4JI5B 5HRCA 2BCJQ 5K0FA 2XWYA 4Y1RB 2VP4A 3UMRA 2F9LA 2HUPA 4IDOA 2CYAA 4Q6WA 4B0PA 3MJCA 4GLLA 1IM2A 2VBFA 3FCSB 4JUZA 2H4FA 2BDEA 2ZE8A 1A9XB 5JW6A 4XIIA 2XRFA 3UENA 4LF7J 1NT2A 5FQOA 2E9ZA 1G6Q1 3G02A 2OYSA 4ZIRB 4GKJJ 4EBBA 4JOSA 3ROTA 5B64A 2IX3A 3QX7A 1ADBA 3K70B 1PAEX 4DDWA 1EFRA 3SFUA 1XTKA 2OGTA 2IHBA 3W5BA 2HK2A 1DZIA 1ZX1A 4O4JF 5CFQA 4DLWA 1OTXA 2A67A 1YS2X 4PO9A 2KZMA 3RJTA 5AXNA 2FQWA 3HY4A 2OQ2A 4L5AA 3MWYW 4FWBA 3C8MA 5EE0A 1TV6A 2BQ3A 4FFRA 2ZFHA 3ZOKA 4Y3UA 3EC2A 2VPWB 2O2EA 4RTJA 2FQYA 5LD2C 5DFAA 1XZFA 4BWFB 2XLJA 1ZQ9A 1EVIA 4C8YA 3KV3O 3HDGA 5ECDA 2ZIGA 1RTIB 1TVCA 1Z45A 4NLWA 1AN9A 4UNSA 3PACA 2QRGA 2YYYA 1JHRA 1OFUA 2GH1A 3ZJYA 4KE8A 5F8MA 2DCLA 5THQA 3CXCR 5I9TA 3L02A 2FJ0A 4U9UA 2DBRA 3NEKA 1PSDA 3G8SA 2F1FA 5BN4B 2PTGA 1EX1A 1PG5B 5SZJA 3QJGA 4NARA 4MTPA 1LNSA 3CMMA 1ECFA 1YZFA 2E82A 2K3KA 1O58A 3S29A 3PNSA 2PEBA 2N47A 3WL4A 5FOQA 2WIFA 4HWRA 1W6RA 4C7KA 1A1SA 4FD3A 3I9LA 4MP6A 1FNCA 4ND6A 6NULA 5KG0A 1D6MA 1P6UA 3ZNQA 2DT9A 3I5XA 2Y9MB 2E7VA 1EKRA 4JT8A 4FS1A 1F1BA 3ROKA 2E6UX 1BWEA 1HR0F 1S4EA 1SUEA 1HT2E 1J5EF 4EZ9A 2ECOA 2C96A 3E3NA 3AGQA 3FGOA 3ML1A 4OOFA 2E9TA 4QT0A 3QSIA 3MTAA 1K6JA 2OV4A 5T8KA 3HTXA 2O8NA 1P3Y1 2GLTA 1DJNA 4ETNA 4GYWA 4WKPA 3CBQA 4KNVA 4KXXA 2Z9DA 2VKTA 1APBA 3C3CA 3VGVA 2PRJA 2BE7A 3HWRA 4HB4A 2AE2A 2WHEA 4RMHA 3M9OB 4DC0A 3GJQB 3ZHQA 4CODB 3I1IA 1U2DA 1SK8A 1QYWA 5IT5A 2OLJA 3QLUC 3NQ41 3FNFA 5EA2A 5B57C 1PK8A 1EZ1A 2IXTA 4R2HA 4F3KA 2R1VB 1DCFA 1ECJA 1I2ZA 2OCDA 5L38A 2XMDA 1XTTA 1XMOJ 5TV2A 5HMZA 3BXFA 4NBUA 1UINA 4FS8A 1UPPA 1JN0A 2X19A 3L0BA 2XVMA 3RRGA 1B7GO 2EEYA 1NCLA 1CJCA 5BWBA 4G5FA 5IXJA 1KHVA 4YAEA 1OYDA 1XFAA 3MWGA 4LSZA 4TU8A 2J41A 1MPTA 1I24A 5L9NA 2DTXA 4H0NA 4V0SA 2DNKA 4KKVA 5ED4A 1KR2A 1YJ7A 1BIFA 1RP1A 5MN6A 1FRIA 3WTBA 3FF4A 1FDSA 4RW9B 3W2IA 2P7IA 1IHOA 2A3RA 1M1XB 1IKWA 2BJEA 1DDIA 2H2AA 1IAVA 5CXTA 5J2TA 4MWEA 4PHTA 1JMTA 1VLOA 1SKMA 3BH6B 1T34A 5DULA 2YX1A 1HNIA 5AW4A 3ZZUA 3WRXC 2ZJOA 5LXTB 2AJBA 2NTJA 4ZVOB 3TJ9A 3C3BA 3WVNA 1MJNA 1NI5A 2H3HA 5B09A 5SZIA 3TOXA 3LAMA 5RUBA 3E70C 3GJRB 1AQIA 1Q19A 1R4AA 3FCEA 1H4QA 4KQKA 1UBEA 1RZUA 1IVYA 5B7PA 4YC7A 3IBFB 4LUBA 4P3PA 4AKSA 3HJTA 4F4JA 3NC0C 3ENQA 3SF8B 3ZEAA 4ALNA 2DC1A 3FQKA 4UFPA 3K9BA 1KAOA 2BAGA 1BS1A 3C3EA 3OIVA 4WKNA 4QDOA 5LYJA 1YZ7A 2NVWA 3RYFA 1RQ0A 3DTVA 1ZM2A 5KT3A 3OTOB 2EW1A 4XPIB 3T5PA 3GK3A 1UC8A 4QOEA 1PT8A 5KCZA 3UKDA 1DTQB 2ZIFA 1UK7A 2VYFA 1TM5E 4BNFA 3H97A 3NBXX 3HKDA 3L8CA 2JFZA 4F85A 4ZOSA 2XTMA 4KW7A 1QRTA 2I99A 4B3FX 2I9PA 2H7XA 1AMNA 4R3NA 4FGJA 3IAM6 4Y8VA 4B3TJ 1GUFA 1IZYA 4KWHA 1M2WA 2C2XA 3GU3A 4PO3X 4MVJF 4W1PA 5EZQA 1KDVA 3WNCA 1UETA 4ECUA 4DR2F 1P2GA 2ZE7A 4R05A 2IL1A 3ZX5A 4C20A 1NFFA 1FUKA 4WEQA 3HP7A 2OCPA 2JLVA 1PV4A 3HACA 1VRTB 2WINI 3U19A 4W5NA 3KC2A 1G8HA 2H0AA 3E8SA 4NRUA 5C1PA 4FGLA 2BKOA 1RWQA 4KQFA 1JMVA 4OYAA 1YA8A 1G8JA 2A9JA 4RLFA 1FNOA 1LW2A 1XU9A 1VQ8S 4FE3A 2YUIA 5LA6F 4EUVA 4LRSB 1YIJS 5CCLA 3ICOA 2ZWMA 4IV5A 1BFDA 4KQXA 4Q1CA 3W64A 4M87A 2VK4A 2RIPA 3D3NA 1DIBA 3T7IA 2WYWA 4RW6B 4LJ7A 3DFEA 4UUPA 2FW9A 5DH9A 2O4CA 1DWUA 3KUKA 5FV7A 2P27A 3VC2A 1QFSA 2I2FA 3OJEA 2W00A 2V8VA 2QT7A 4B08A 3T3DA 3ZTTA 2FXIA 4DQIA 5JE8A 2H54A 3M82A 1TEVA 1T24A 4ZODA 5DHAA 5EP2A 2CMGA 1Z34A 3ILXA 4BVAA 4DCSA 1ODFA 1LDBA 2WSEC 2C9CA 2ZVIA 1RYZA 3KZNA 1HBOB 4OI1A 1OU0A 2ODBA 5KAKA 2WABA 1XWLA 2GZSA 1V3RA 4UQOA 3K58A 4ENUA 1RT6B 4NKRA 2ZVDA 3T34A 5J1EA 2G82A 3RROA 4JI7B 4R0NA 2K87A 2CXUA 5ERYA 1OY9A 5BRJA 4KE7A 1MX3A 1BGWA 1T8PA 4X7RA 5E7IA 2CGEA 3V7UA 1YVDA 4V1CI 3JSMA 2N9UA 1IQRA 4BU1A 2IXFA 1YB4A 2EL7A 3QWUA 3TSOA 1X15A 3RDPA 4Q8FA 3ZWOA 3I12A 2HL6A 3P9SA 5BW8A 3DDUA 2RC6A 5KFEA 1OWLA 4GXTA 4EY4A 2PT7A 2XWPA 1MJGA 4D99A 3KMSA 5EPEA 3TA2A 2HA4A 4CVNA 3D6UA 4AN1A 5I3UB 4MVXA 2YBDA 4OM7A 2QE7D 1C0TB 1XQVA 3THXB 1OIXA 3GX1A 3B4MA 1PKEA 2E4VA 2VPYB 5TS3A 1HDEA 1YS9A 2W43A 4Q9IA 1MUUA 1EETB 2W83A 3ZJUA 3VR5H 4N12A 2Z09A 5HJ2A 3RSGA 2OYCA 4ANFA 1TKTA 4OX6A 4RHXA 4CTAA 1ITPA 3M34A 4KO0B 4ZQBA 5HP1B 1XMJA 2BYTA 1UDAA 3UQYS 3JV7A 2PGCA 1PAUB 4INPA 4OP1A 2HAIA 3HJHA 3ZU6A 2NX2A 4B8ZA 1T0TV 3DL4A 1G20E 3PG5A 2PSFA 4OQ4A 3M70A 1L7OA 4M55A 2ZVQX 2R8IA 1TK8A 1C9YA 5J47A 1LEHA 4NULA 3PXXA 4D3HA 5SZHB 1MC1A 2QVXX 3I62A 1HZZC 1KYVA 1UF9A 1JT9A 4C2UA 1ZNYA 2AJLI 4X93A 1P0FA 2X5JO 2YCBA 1JDTA 1SEPA 5DTEA 3SR0A 3GLHA 4R2MA 3O8NA 5D5QA 2FVSA 2VYCA 2JZOA 5KG7A 3BRWA 1E2HA 3V7NA 1DLOA 3R6WA 1X9MA 5HBMA 3L3BA 4KUGA 3H0KA 3PWSA 1MROA 4DV0B 3R1LA 2KT2A 3BF7A 3PX6A 4V19J 3T3GA 2B1JA 2O1EA 1T3GA 1CUBA 4EELA 3IIKA 4QGBA 5CH5A 3H98A 3INTA 4ZK2A 4M5DB 3JSYA 5IVIA 5FPKA 1GPBA 5K8IA 2ZM6J 4UM7A 3IUMA 4ED4A 4C89A 3R0JA 4DR3J 4WWSA 2AR7A 2HJGA 1LF5A 3V3KA 3ISZA 2FZGB 2YWRA 1RTJA 4L5YA 3V55A 2BI4A 3FUYA 4TKZA 3T61A 2Y4OA 4LRWA 3UHPA 2EL9A 1AS2A 5HKBA 3VU9B 3O93A 4FIDA 5JEEA 4TROA 1QOZA 1W581 1EQUA 1E79A 3EFOB 4RW7A 1ZIPA 4FNOA 2W6NA 1UMDA 4IUCS 3JQ7B 2CL7X 4HDMA 4CTOA 5ABPA 2XG8A 4DV6J 2FWJA 3PM9A 3JWPA 3S1AA 5HUQA 5AKZA 3AF2A 4CMIB 3HRIA 2FW6A 5F9LA 3FCHA 1YD7A 2A9FA 2HK3A 2ZVPX 3SPXA 2UUAB 1IB0A 4JU8A 5ALUA 2HS4A 1U4OA 5EMNA 2PC6A 4RH0A 2LV8A 4KB5A 1HNWB 1KGSA 4O4LB 3GA7A 2EG9A 2QLLA 2NXNA 5H59A 3KE9A 4AYXA 4ZRMA 1YU6A 4ICIA 2GXUA 2GZAA 1H22A 4XFKA 5LWHA 1V4VA 4LJ4A 3GGPA 3HWX1 2NSJA 4D0LB 3N9UC 3OWOA 3TL6A 2FHJA 1JDBC 1LX7A 5HK4A 4F92B 4Q66C 1CBUA 1PZNA 3DE4X 3SJBA 4ANEA 2YQ0A 1CZLA 3UI3A 3IQEA 4BFSA 5AVYA 4DX7A 5DB4A 1T6XA 4ZV9A 3ZD7A 1MC5A 1UR5A 2E55A 1FDIA 3OUTA 2XADA 2IS4A 2HRUA 2ZDPA 1J23A 3RC3A 1D09B 5JD5A 4US2R 4BGIA 5JCXA 1H2YA 3BKXA 1JSLA 3NAIA 4BOYA 4MKHA 4LE0A 3OP4A 2DGUA 3ZN2A 3F9RA 2NP6A 3SFZA 3GVXA 3E5NA 3DVLA 2GOYA 3ZD6A 3QWIA 2HV9A 4LYGA 3QLJA 1TAUA 3N8IA 3NT5A 4W5JA 1NEEA 1K5PA 5E33A 2X4LA 4D46A 2ISCA 1K9MT 1YVPA 2CNOB 3H5YA 2KT5A 4PLHA 3UC9A 2VT3A 5TQ2B 3X43A 1YJBA 2WU4A 2DWUA 1M1YB 4OM8A 1WOYA 5AKYA 1CW2B 4MPRA 5ETJA 4DJAA 7YASA 2GILA 2ZD1A 2B6HA 4EJ6A 1EFKA 3O21A 2X51A 1OMSA 2BI8A 2CEKA 4GOLD 4AULA 2C77A 3N6NA 4WOBA 2IDZA 3HVTA 4YCCA 6FDRA 3U81A 1CNEA 4AN0A 1B70B 3M0EA 1PJ6A 3BR8A 4N3AA 5HZGA 2D7SA 4DCNA 4NWBA 1YBVA 3S1TA 2Z57B 2G76A 4IUDS 1TTHA 5F64A 4DJTA 3WS7A 2X5XA 2GK7A 1KRPA 4UVEA 4F3NA 4ND2A 4FDMA 1KAEA 1TF7A 1TKCA 3PJFA 3GYXB 1EXMA 3GJTB 3A2NA 5H3HA 1G5PA 3IQWA 2X42A 2OP0A 1WWKA 2WU1A 5BSKA 3JYTB 1HYQA 4DNFA 3K09A 4MI9A 5KFLA 1SKWA 3HBNA 4B09A 4JV5B 5HDQA 4ZCIA 3BAFA 5D77A 4ZP1A 1XKXA 3EVNA 1XJ0A 4L0DA 2P6MA 3CB4A 1SHTX 1KL7A 1C2PA 3EZGA 1QVRA 1UDBA 1RAFB 1HD0A 2AZ3A 2Q4TA 2RH9B 3D0GE 4DL7A 4AS1A 2XZDB 1MAUA 4B3BA 3P2IA 4K6HA 1WORA 1M6VB 1RFGE 1TK3A 3X1XA 3I52A 2PTHA 3DMJA 4BFVA 4CLWA 1R2QA 1WCIB 2ZUBA 3EQ6A 1XZNA 3JSAA 3A6PC 3RJZA 2R8RA 2PT5A 3EDQA 4S1TA 4FYYA 2OB2A 3W65A 3RUDA 3VAHA 5BWLA 4KAJA 4AL5A 1EG2A 2ROGA 3GAMA 1YQXA 3GRCA 2ZUWA 5F78A 4XE5A 1G5FA 3US5A 1UKYA 3N05A 2JDJA 2QTVA 1VRUA 3GVHA 2GUGA 1S2DA 3PNQA 2ZXUA 3I56S 1JEDA 5CT5A 4P4SB 2HFJA 3W0LB 3W5AA 1BEEA 1R6XA 1LFDB 3GEGA 4YJGA 4D4MA 3H42A 3D6NB 3HI6A 1K4KA 3A05A 3IUBA 1EHWA 1HARA 5D6OA 3O73A 2OPPB 1P5HA 3CRNA 4HGRA 4DIMA 1QV6A 5LZ8A 1ZETA 1YQHA 1SXJA 3PYGA 2JWNA 4N0MA 2JFXA 4N9QA 2PI5A 3DV9A 2GJFA 1KC3A 5FCDA 2O5VA 3KXDA 4GS5A 4FVCA 2DR8A 4ACBA 4URSA 2E7XA 4IXNA 1C3VA 1ZRSA 4IR9A 1WBBA 5CM2Z 1Q81T 4CR8A 5EKUA 5DBHX 1ATZA 3KM0A 2XSZA 3A3YA 1CUGA 3SEOA 3MWBA 5DW3A 1T6YA 4Q18A 4NMXA 2G9NA 2R1TB 2UYYA 3DM5A 4EOGA 3SQGA 3A9WA 4YRJA 2FEWB 1AHNA 3GP9A 3KEMA 1E6UA 2HA0A 1RT4B 5HMWA 1DKOA 3NG8A 2G9VA 1O6XA 2QLTA 3LT0A 4B3RF 2UV8A 3BO2A 1KWMA 3PFCA 2XODA 4QAQA 2JATA 3DHNA 3PF8A 5I9LA 4RJKA 2BKXA 4CG2A 2OK8A 4H4CA 4IQFA 4HQFA 2MKSA 3W7AA 2CDAA 5AO9A 5AI0A 4DR1B 1DEAA 1G7SA 1MW8X 4L16A 1KK1A 2AGOA 1CNFA 1YJ9S 4DMGA 4PAMA 3LALA 1T8WA 4QUKA 5BR7A 1KIFA 4GPEA 5CYGA 2DX7A 1RMTA 1E98A 1XR6A 3AT1B 4HATA 2JL1A 5ERXA 1HBUB 5ICFA 3PYLA 4LF4J 1FKOA 4LSGA 1KDZA 4K9QA 2Y1XA 1WBDA 3D2WA 3OW2R 1D3AA 2IYNA 1GTSA 1K63A 3HLTA 2WTAA 2XNDA 1ZU5A 1ZPVA 1N48A 3A8IA 121PA 3M3PA 3DT6A 3P0IA 3P49B 2XMWA 2OEKA 2ZIEA 1NDUA 5AJ3F 1CP3A 5TVKA 2J9ZB 1KAQA 3EXHA 4HNTA 1G4CA 2YHBA 2UXBJ 5M2RA 4HEA6 4N82A 4EPXA 5A3JA 5AI8A 4LJMA 3AEKA 5EZSA 2AHOA 4ZYUA 3I53A 2QIOA 3I9V1 3Q0TA 3WTCA 1P5JA 3G7NA 2PBLA 2DGWA 1WS6A 3OIFA 4XCXA 1VBFA 1OILA 2VDQB 4QTYA 1UP4A 1TP7A 3IVMA 4QU8A 3FDJA 4AK9A 3R7BA 5JBQA 2PWZA 1QANA 2CXOA 5HM6A 4DCVA 3ADBA 4FT2A 3THYA 5D00A 4DN0A 3TIVA 5GJCA 1O7JA 2YQ1A 1XDWA 1ENOA 4YAGA 1C5KA 3IA2A 1X7HA 3LF1A 5JG7A 2DHDA 4NOJA 1X4FA 1ONPA 4JI3B 3WGLA 2QU8A 1WU7A 4QQBA 2ZWOA 2Y1LA 4BNGA 1EJ0A 1PX0A 2WYIA 3AA9A 2K1RA 3U4MA 3HZZA 3BN7A 3RVRA 5JZSA 4YIHA 4H54A 4XDZA 4P08A 3F5QA 4L9AA 1U3GA 3GLFA 4W7SA 5HX7A 1FFGA 4DUYJ 1QV9A 4J0IA 1ZHFA 4OQZA 4EYIB 4KBIA 2H1VA 4ARZA 2DR3A 2NAFA 4C48A 2IPOA 1Z56C 2Q5LA 3G8CA 5D6GA 1FYVA 1S79A 2QGNA 1XN1A 2P1ZA 2FZEA 1EA7A 1Z6XA 4UARA 2AJ4A 4FHGA 4ND8A 3NRBA 3BGWA 4RAOA 1MNAA 3W06A 2EX4A 4XVUA 3FHLA 3SC3A 2EC5A 3QZ7A 3N53A 3W8PA 2LNDA 1KTVA 4KUHA 5HM8A 3E51A 1TU4A 4EG6A 3IGVA 2MSWA 4RKUC 4OJKA 3RQSA 1FX1A 4ZO6A 2AOUB 4UNPA 3QEAZ 2AWNA 2CKWA 4IDAA 4NL5A 4ZMBA 3PRKE 3CMES 4KRXA 2KM8C 3H9GA 3I0SB 3L0OA 2PMEA 5JH7A 2FPUA 3LFTA 4O59O 5C7YA 2QXYA 4W99A 3Q41A 3A0RB 1DSSG 3MD0A 3KFWX 3EA0A 2IVZA 4DQQA 3OQBA 4LVCA 1JWAB 1GGVA 1XXHB 1MORA 3C3YA 4M99A 4LCBA 1USIA 4RBTA 4UAUA 3TANA 1I10A 3IB6A 3L4SO 2Z98A 1OSCA 2O67A 2V4UA 1ULSA 1AYEA 2RE8A 2EPIA 4K81B 3JZMA 4KO8A 3BGOP 4XARA 3C7DB 5B58T 1RBMA 2FPPA 2PR7A 4HWKA 4N40A 5GGYA 3DVQX 4BB9A 4J7AA 3BGLA 4R1LA 2QAGC 1J9EA 2XGGA 4TVBA 1U80A 4H31A 3TRJA 3EZ5A 3NHKA 1ULRA 1F2TA 1MA0A 3VNRA 2RKBA 5HTOA 5F9FA 4OIMA 4Q00A 4PV7A 2ZB2A 1YH3A 2J3EA 1IWAA 2I67A 4URFA 4XLLA 4E30A 1DBPA 3CJ3A 1E3WB 2RFLA 2SKCA 1ZIXA 3GGGA 1FLDA 5JQGB 4OMCA 1BRTA 3NYIA 3TRKA 3K0CA 2PLFA 1JIQA 1VCTA 1SN7A 4DV2B 3ZIAA 1Y7TA 4EG4A 3DMPA 4TRRA 4BKQA 4QYZK 1R6BX 1BU5A 2UVQA 3BFPA 1NVKA 4ATNA 2V2QA 1Z6ZA 3QIPA 2R8GA 2HU7A 4N7MA 1KS2A 3QUCA 1EQAA 1BW9A 4COKA 2HNYA 2XZTB 1DKMA 1PFUA 2ZDQA 3JQ9A 1PO6A 1V7PC 4ERDA 3KD2A 4OYXA 1IEVA 4UW2A 3OEEA 5F3RA 4TYPA 2JCVA 4G4JA 3HYLA 2ZSBA 2VKQA 1W36B 3S01A 3W7VA 2CJ9A 3E5HA 2JGJA 3MS4A 2B4QA 4UPVA 2VBWA 4EYQA 4ENSA 4YAWA 1EGVB 3P8BB 4E46A 3C6UA 3F0TA 2WWXA 4FWTA 4WGGA 3MB8A 1C8KA 4YMHA 1C9DB 4YY3B 1EK1A 4WE1B 1MAAA 2WVDA 2O5DA 2E1PA 4IEEA 4WCDA 2ZXFA 2AC7A 3JAMY 3UBTA 2PZEA 2DHXA 3TLXA 1FNDA 4JT4A 2HMAA 4B6JA 2OY0A 4FI3C 4PZDA 2PZFA 4LRYA 3STHA 3W78A 3G2IA 4P7FA 1Y3FE 3DEAA 4MX8A 2ACYA 1E1RD 3A13A 4NZYA 4H77A 1J8YF 1W4BA 4BV9A 2AKAB 4QUDA 3E5RA 4RJJA 3ND7A 4KFTA 1YGPA 5KFFA 1FTSA 2ILZA 4IRCA 1CYDA 2H4YB 4FKXA 2CXQA 2GMHA 1OFIA 2GVZC 3ONEA 1JXMA 1WY7A 4ZVQA 1UWBB 4X8HA 2E5IA 5F73A 4KWCA 3W8DA 4DV3J 3CZ9A 3MG9A 4QEKA 3T9FA 4W7HA 2V0CA 2LDIA 3V4ZA 3LC7O 3PGXA 1KQGB 4CQLB 2B4AA 3JQBA 1F3VA 2DHHA 4CO5A 2JZ5A 3BJMA 1N78A 1WLYA 4KO4S 5AXAA 2WIDA 1UBKS 5ALWA 5JFOA 3ZWDA 3INGA 4RQAA 4UM9B 4EVSA 1TFWA 1ECCA 3L5KA 4UMDA 3EVCA 1WQ3A 3VJLA 2AMJA 3GELA 1E32A 2W2OP 1VC2A 1I94B 2BDTA 4I7FB 1CT9A 2CUYA 3KZKA 5JSHA 2ORWA 1YMVA 2FMKA 1LDGA 3OFJA 1GZ4A 1XCBA 4YEAA 2XNSA 4EUNA 1CQZA 3C98A 2A0UA 4GGOA 1RTDB 2VLBA 5B3AA 4MWTA 4LXUA 3SM3A 2MZRA 3WE7A 1F6TA 4HVCA 3QXHA 5CYQA 1E7RA 2APJA 1QBGA 3O9ZA 1QHYA 4PXBA 2CZVC 2WVGA 1F3OA 4PANA 3G2OA 5DHQA 2H9ZA 4JYAB 4IIYA 3DKPA 4ZVGA 3I9ZA 3A3PB 2Y1JA 5AVWA 2QRZA 3ZWMA 5D01A 2JJQA 4PSUA 5KMGA 4NVRA 1M10A 2QRNA 4PTZA 3L8MA 1OX4A 4FQ8A 4KCGA 1ZKMA 4DJEC 5EIBD 1HQUA 4QIWD 1XRSB 2XGMA 2RHBA 3C6TB 1G42A 3LA8A 5BR8J 3OE4A 4Z51A 2F1OA 3PJRA 5FUYA 1USVA 4I2NA 2UUBJ 1O6FA 1YJXA 1QV7A 5AW1A 5IFMA