2ZEJA

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
177
structure length
157
Chain Sequence
MKLMIVGNTGSGKTTLLQQLMKTVGIDVKDWPILVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Leucine-rich repeat kinase 2
total genus 40
structure length 157
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 2zejA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zejA02
2ZREA 1XXHE 2ZRFA 3H84A 2D3WA 4DKXA 1MO6A 1A2BA 2NQ2C 4JKYA 4IOLA 1KNQA 1GTVA 1XTRA 1ZD1A 1FPMA 1U8YA 1N2CE 3LY5A 3T12A 2V7QD 1RYHA 3UATA 1L8QA 3QIAA 1WF3A 4IDHA 3X1DA 1Z0AA 3SHWA 1S3GA 3GLHB 3LBIA 1F2UA 2IS1A 3WNBA 5JS7A 4PC7A 3UKDA 2DBYA 3TRFA 2J7PA 3K70B 3SU8A 4AYTA 4M21A 2QTHA 1NKTA 5FPHA 1T3SA 2Q9CA 1WP9A 3U44A 3RC8A 1Z22A 2ZRHA 4Q9KA 1U2RA 3GLFE 4OHVA 1VG8A 4G5QA 1KI6B 1RE0A 1LW7A 2V54A 5CM9C 2IYQA 3FFBA 4LUCA 4QM6A 5CIQA 3CNLA 3KQNA 4D80A 3LW8A 5TV2A 2PLRA 3TIFA 3U3OA 4GNKA 5FUXA 3U60B 4YMWA 2CNWA 2V1XA 3PFIA 4PFSA 1M1YE 5CLQA 2D4HA 5EXTA 3TW8B 1EK0A 3RS4A 2ZRNA 3KL4A 3P4YA 5DNYB 3OEEA 3OZXA 5E4FA 3PEYA 2PBRA 3LLUA 4TMTA 3ZD7A 4TT3A 2ZRPA 3KB1A 4Q00A 2QL6A 2CXXA 3CW2A 1R6BX 3MJRA 4NMMA 4OJKA 4BASA 2OSBA 5K8IA 3QF4A 1RC8A 1Z47A 3OF5A 1IY1A 3ZLJA 1Z5ZA 5G3ZA 4NHOA 4E03A 4BQSA 1XZPA 2XJ4A 1VHTA 2NO9A 3ETLA 1U0LA 4UNNA 3U4QA 2GAOA 3ZVNA 5EXPA 2Q0HA 3B6EA 4IXNA 1JR3E 2N42A 4FMCB 4HLDA 2V7QA 3EZ2A 3F0TA 1W36D 1CF4A 2GEVA 2YWGA 1TL7C 1OJLA 1D8TA 3A4LA 3BXZA 4NTZA 1G8GA 4OQFA 3ONWA 5CITA 1E2NA 4Q4AA 2Q3FA 3U6BA 4OHYA 4B76A 4DLZA 5KDLA 3BERA 2WWWA 1VG0B 5EZ5A 3RABA 4P4TA 1G4AE 5CK4A 1TAGA 2XOKD 4R98A 3VKHA 4AYXA 1S4QA 1Q22A 5DIFA 4FWIB 1I2DA 4B47A 3CNNA 1KSJA 1DAGA 2WV9A 2CMKA 5HE8A 1KJZA 3VR5A 4JVMA 4V0OA 3P26A 4JL5A 4LZZA 4E07A 4EAQA 1N5LA 1T3LA 4I1UA 5KO2A 1N5KA 1ZAKA 2KBEA 1KK2A 1ZUIA 4FCWA 4DLWA 1LY1A 4DXAA 4C9BA 4UXIA 1ZC4A 4Q7JB 3JVUA 3TSZA 2IT1A 2WWXA 3A1TA 5DI9A 4YXWA 1JBKA 2FH5B 2WJJA 4NDZA 1OFIA 3UPUA 2DWOA 3UG6A 4N0DA 4B2IA 1N0WA 3OE7D 4KO8A 3I8XA 2BCGY 2VP4A 1SHZA 4TTPA 2YWHA 4MKGA 4EPVA 4Q9JA 4C0QC 4RFVA 2YKGA 1XTIA 3EZFA 4URYR 4FW9A 2RGEA 3AVVA 5G3YA 4D26A 1QRAA 2ZJ5A 1JALA 4ON9A 2ZQ5A 1JECA 2ZRKA 3A4NA 1XMJA 1YR9A 5UKDA 1G8YA 3QI2A 3MJHA 2QI9C 3EAQA 4ZO4A 2XXAA 3BORA 1RYFA 4EIWA 1FP6A 4FI3C 2FF7A 3ZH9B 1Z3IX 3IGFA 4GOJA 1OE0A 1FZQA 1Q1ZA 3IO5A 4TL9A 1CRPA 2R8RA 1FNMA 3PJRA 2GAAA 5KNCA 3DM5A 3H1TA 3LXXA 4KBFA 1YZUA 2OBNA 2R6CA 1QG4A 3KQUA 1F2TA 3SE0A 1CEEA 2OO7A 1H8EA 3KKOA 2XX3A 3RNLA 1G7CA 1Z0DA 5AJWA 4LBVA 5DYIA 1IQPA 1E1QA 1ZM9A 2XSZA 4RCZA 5CLLA 2XZPA 5KPJA 4CRWB 2JJ2D 4M2LA 4XSHA 3EARA 1M8PA 3DEFA 4ZI3A 5HZKA 4JLOA 3FMFA 4F91B 4TYYA 4B3CA 2RCNA 5F98A 2RH5A 4R2HA 4BFYA 3W6OA 3LDAA 4MH0R 4AKEA 4DEXA 4UKDA 2R6DA 1ZVQA 2JEOA 4Q7KA 5TDHA 3IUYA 1GZSA 4A92A 3K70C 3AKYA 3NEJA 1E4YA 2FA9A 1X1RA 2GEDA 4DDVA 3K0FB 1DG1G 4OQXA 1E0JA 2V6IA 2V55B 2W83A 3TVTA 1GG2A 3DKPA 3QF7A 4YMVA 3QXXA 4BFSA 3U2QA 2A78A 3GPLA 4QFMA 1HE8B 1Y3AA 1COWD 2SHKA 4JVLA 5D3MA 5EUMA 1CIPA 2F7SA 4RZUA 2BKEA 5FBWB 4ASUA 3BB3A 3CONA 2XXAB 3AF3A 3QKSB 3ZVRA 5BN5A 4HZIA 3QPVA 3W3ZB 4C0AC 4TZ0A 3BE4A 5CK5A 1MABA 3W9YA 2A3RA 3NBFA 1YZNA 2FGJA 2P6RA 3Q7PA 4PC6A 1J8MF 2ZR0A 5KOYA 1GAJA 3A1SA 1Z07A 3CNOA 4IDQA 1A1VA 3U6KA 2CL6X 2ZJAA 1JJ7A 4Q01A 2IEZA 4DIEA 4KLZA 4QGHA 5DN6D 1L2TA 3NVAA 5L3QA 1E9CA 1Z6GA 1IY0A 5JWOA 2O8BB 4JSTA 5DGXA 4DLTA 3A6PC 1JXOA 3HPRA 1NIPA 1NN0A 1VDZA 3W8RA 3LXRA 2VYFA 3TKLA 1G7TA 2ZJYA 4NBSA 4URUR 4DIDA 3THYA 2O8FB 1MO4A 3QENA 4MGYR 3BJIC 3TUZC 221PA 3D3QA 2BMEA 2PX0A 1CU1A 3GLHA 4EFNA 1KK0A 3QY0A 4Q4HB 4HI0E 3TQFA 3GQBA 2QAJA 2BV3A 1G8HA 1IXSB 2GVDC 4KYUA 3VHXA 3PUVA 2YWFA 3NWJA 4F93B 1YZLA 4I1VA 4KFUA 4RJLA 1EWRA 3QKTA 3K1JA 2O0JA 1PUIA 3C5HA 3P20A 2CCJA 4PO9A 4V0ME 4X8MA 4ZKEA 2OCAA 3N2IA 3MGCA 2OXCA 4LV5B 3S1AB 3K53A 1N6KA 3P32A 4PSKA 3UMSA 4BZXA 1ZW6A 4TLCA 1LS1A 4JIMA 3K0FA 1E1RD 5KSYA 2MMGA 2IUUA 4HAVA 3R8CA 2QROA 2WSSA 1FUKA 2JJ1A 4LC1A 3I32A 5H70A 1ZM2A 4TLDA 2J87A 3EWSA 4HLCA 5B57C 3U7FB 2JDID 4HUQA 3VU9A 4A6PA 1OKKA 3MD0A 1ZMXA 4WA7A 2O8EB 2RGAA 2QPOA 4Z1MA 1OXXK 3K0EA 5BWMA 1G16A 1Q0UA 521PA 1VTKA 2B92A 2ECKA 2YNMA 4GP6A 5L3RA 2VLIA 4W7SA 4XVUA 1XEWX 1PLJA 3ZDQA 2VTKA 1GP2A 5KDDA 3CF2A 2XOKA 4ZV4A 3BB1A 3QXJA 4C3ZA 5J5CA 4CIDA 2J7KA 5KTYA 1ZIOA 4B73A 2WIBA 3GLGA 1DAHA 2ZU0C 2ZXUA 4J0QA 1R8QA 4KBGA 2W0SA 1F60A 4QBIA 1GNQA 3CR7A 3HDTA 1OB5A 4R7ZA 4D82A 2JLSA 3U7HB 2HF8A 4IXMA 5CDFA 3T1VA 4B2PA 1OXUA 3AVOA 4Y0VA 2IWRA 2F43A 4EDHA 3SQWA 4V03A 4YLGA 2HCJB 3HU2A 4LHXA 1M34E 2ZRBA 1NMZA 3IHLA 4MYTA 3AKDA 3CKLA 1U0HC 2FU5C 3LW7A 3QVUA 3W5IA 4HUTA 3SFVA 5LPNA 5KNDA 4MRNA 1FX0A 1PLLA 4X8HA 5EE0A 1PUJA 3T1OA 4E09A 2ODBA 1C9KA 1IOZA 3RS2A 3ZZTA 1ZU4A 3MWLA 2JCSA 2LKCA 4D0NA 4MYHA 2Z6VA 4D4MA 2O8BA 4ZKDA 2IHYA 2CHVA 3PUWA 2H16A 4BUJA 4DHEA 1HT2E 2GTPA 4IOMA 5AUPB 3NHAA 3U61B 2VL7A 2R9VA 3RS7A 1P3JA 1ZNYA 4ZCIA 1RZ3A 2R6AA 3MUFA 4OK5A 3CWZA 4BLTA 2JLWA 3HP1A 4UNPA 1GVNB 1N0UA 2ZSBA 4WAUA 3AP2A 1T8TA 2Q9AA 1WRBA 4FMCF 2B8TA 3SYNA 3BRWD 5H68A 1KNXA 4EUNA 1A82A 5A0FA 2W6JA 2YZ2A 1CJTC 3NC0C 3W34A 1RRPA 2OT3B 4QJ4A 2FPMA 1GITA 2IBMA 4BFUA 4KJZA 2X8AA 3W5JA 4LY6A 3K9HA 3BS4A 1IAQA 1E9EA 4C30A 2YOGA 1CJUC 3QVVA 5JHHB 2QGZA 4LYFA 1KDOA 1NN1A 1NJFA 5FL7D 3CX8A 1U99A 4MUBA 1AZSC 1TQ4A 2WM9B 2OZEA 3CPEA 2I4IA 1DS6A 1GIAA 3GJ3A 1FFHA 2ZJOA 4Q9LA 4CT5A 1OH6A 2CDNA 3LRPA 4DLSA 2J7PD 5L3SB 3G5UA 2BEKA 3SDZA 4XWOA 2WOJA 1UEJA 1KAOA 1BS1A 3GLIE 4LV8B 4KHZA 1S1CA 3GJ5A 5KSPA 2G83A 4B75A 2JA1A 3IEUA 2ZM5A 3FGNA 1T0JB 1ZCAA 5ELXA 1XDBA 2QORA 4MITA 4TQ9A 4HATA 2FSHA 1UM8A 4K8OA 2WICA 2WKPA 4GI7A 1LTQA 1OXVA 1XD2A 5DI3A 1X6VA 2H17A 3N2EA 1E6CA 1W36B 1WQ1R 4XVQA 1AQUA 5JMTA 3GEIA 3C4JA 3H0KA 3RRZA 5FI0B 2OLJA 1J2JA 4QG7A 4Q1AA 1JR3D 1VCMA 4ZPXA 1M7GA 4RSGA 3AF2A 1XRJA 3CR8A 4KFSA 5KSZA 2DYKA 4TLBA 2FFQA 2R44A 1NBMA 5L3VA 1OH8A 2HV8A 1U9IA 3KUDA 2ZPTX 1UBCA 2BCJQ 1S1MA 1WCV1 5ANRB 2WWYA 4ARZB 1VCIA 4YXWD 2ZROA 3HU3A 3REGA 4ZDIA 4F38A 3AEZA 1H65A 4DB4A 3IPYA 4ITRC 4HEJA 1K5DA 4F92B 2QTFA 1RRFA 2PZFA 4LPKA 1KJWA 4C2UA 1KMHB 1MO5A 2D06A 1WA5A 1ZD9A 2D74A 5F3WB 3KKPA 3W8NA 4JLBA 1E9DA 4JS0A 4TT3D 4RD4A 3MLEA 1KSFX 1XNJA 4JLAA 1Q57A 5BYJA 1OIWA 4JT4A 2YVUA 4B3GA 2F1IA 1CJMA 1OV4A 3I3SR 3A1WA 3TSWA 3BH6A 5FPSA 4Q7MB 2GXAA 1ETUA 4LJ6A 4TYPA 2GCOB 2ZRJA 4GP7A 5KDOA 1G5TA 4LBWA 4C0KA 4QGAA 4BGDA 2YOHA 1ZUNB 5EE9A 2D2EA 4B35A 1P62B 1XTQA 2QP4A 5C4MA 4NE2A 3WNDA 1EX6A 4P31A 1ELOA 1Z83A 2IF2A 3SJAA 1LFDB 1XD2B 3LNCA 4CGZA 4ABYA 3I62A 1CULC 2JJ1D 3B5JA 3DOEA 1AS3A 1GNRA 2B7CA 4DT1B 1CJVC 2ZS8A 5C46F 5KU1A 1AA9A 1MOZA 3CRVA 3EPJA 2WMOB 2XSZD 4GMDA 2JAQA 2IC5A 1N0VC 4MGKR 2PT7A 1KTVA 3B8HA 1KI3A 4E5UA 1V5WA 4GZLA 2ATXA 2JLUA 4M1OA 2WPDD 4LCBA 3FFAA 4DLXA 8OHMA 1XCGB 4G5OA 5J4KA 3R9WA 2YC2C 4L9SA 1AQYA 2C99A 1X8KA 2VEDA 2EYUA 1HE1C 4P4UA 2DPXA 1R7RA 3TLXA 4HAXA 2C03A 4CEHA 3SJCA 1ZP6A 3LX5A 4ARZA 4DSUA 2Y8EA 1TTTA 3JVVA 1ZU5A 2XGJA 2IW3A 3CLVA 4RKEA 5EP3A 3U4QB 1UADA 3L2OB 5F9HA 1FOEB 1P9NA 2CNWD 3L0IB 2VIIA 1M74A 1KI9A 5FBQB 1E0AA 2WKRA 3GCGA 4IFBA 1LS6A 4RD3A 1KO4A 1N5IA 3UMRA 4LV6A 4TYQA 1RKBA 3X2SA 4CT4B 5M04A 1ESNA 1P9WA 2OILA 4JYCA 3FVQA 1JR3A 2P67A 3IDQA 1YJ5A 4HAYA 3DMDA 1Q1EA 1G19A 1NIJA 1JAIA 2V8OA 3THYB 1AKEA 1GRNA 4GOKA 4KITB 3LX8A 5G53C 2IYTA 1Z6AA 1SZPA 4ZIRA 2G9NA 4MRVA 2ZJ2A 2HT6A 4ACBA 2GF9A 2I1QA 3GD7A 3Q7QA 2YOFA 3LVRE 1EXMA 2AWNA 2XB4A 1SXJA 4HLUA 2BJVA 4PHTA 4DVGA 3B82A 4QNRA 4QBFA 5HKKD 4QBGB 4URWR 3AM1A 1MKYA 3SYLA 1XPOA 5FR1A 1E0KA 4CEJA 5HPYB 2OAP1 2FX3A 2R6FA 2FV8A 3WYGA 3WP1B 1VG9B 1N6LA 4UNSA 1R10A 2Z43A 3TAHA 5LDDC 1JEDA 4EQ6B 4TSFD 3B1YA 4Y0AA 5FBVB 3QPWA 4DSOA 5BXQC 2ODEA 1GRQA 3M4YA 2Z83A 4PZLA 5FFMA 1N6PA 2RMKA 1SKYB 4PSVA 2GRJA 2RHMA 1CS4C 2ZYWX 3HR8A 4IOJA 3T06B 2QUZA 1HTWA 1KYIA 5B2ZA 1KZGB 1U98A 3AVYA 2JIZD 1G8FA 4O0MA 5FPYA 2H57A 4LRWA 3T15A 3RVBA 2A5DA 1W4RA 5H8WA 4BECA 2IL1A 1DARA 1XMIA 2BMDA 5E7MA 3CX7A 5H1YA 4D25A 5JJLA 1FMJA 4F4CA 1E2JA 4NYIR 3NC1C 4XWKA 5P21A 2GWHA 3AGPA 2HEIA 4HDOB 4LJ4A 4YDHB 4JYBA 1U8ZA 2FSFA 2W2VA 4G1UC 4RFSA 3DZDA 4F7WA 3FDIA 3VHLB 3KTAA 1BKDR 1NVUQ 4KSBA 2QAGA 1WMSA 4WBSA 3SBEA 5IHPA 3TAUA 4LHYA 1HEIA 5TY0A 2J0QA 2F9LA 4MDFA 4PC1A 1KGDA 4CEHB 4XD7A 3CZPA 4CW7A 2GEUA 4W5WA 1DADA 1NMYA 4M1WA 1SXJB 2IUTA 5JCPA 4O2LA 2CL0X 3B1ZA 2GXQA 4JBYA 2P5TB 2I1VB 2ZUDA 3B60A 1NVVR 4BLRA 4G01B 3LBNA 2QBYB 1NP6A 4D0LB 2F3TA 1W0JA 4O2RA 1OFTA 3RWMB 3G82C 3NG1A 4NYIQ 3NBXX 4G5GA 2ZAOA 4ERNA 2N1BA 5SZJA 2UKDA 4TL6A 2DFKB 1CBUA 1P4SA 3U3MA 1UKZA 2DCUA 1QHHA 1E9AA 3NBZC 1SQ5A 3ND8A 2NTYC 2BVNA 3AKEA 4DLVA 5HE9A 4B34A 4JLNA 2AHOA 3FKQA 4OQLA 2JLXA 1E79A 3RC3A 1T91A 2C78A 3ADKA 3DDCA 2B8WA 5DYGA 4F4IA 4URVR 4DC9A 1OH7A 2VQSA 1JI0A 4BLSA 1G5PA 2R65A 4OBEA 4Q4JB 1T3HA 1GILA 1KI4A 1CR1A 1FQJA 1G17A 2EQBA 2J59A 2NPFA 1G1MA 2ERXA 3KFVA 3A36A 4B3BA 1OW3B 3C7KA 4KXFB 3PR1A 4EQ6A 4Z1MD 3FMOB 2J0SA 5AJZA 1PZNA 5KUTA 2VO1A 1E96A 2X2FA 2Z4SA 1E98A 3KUCA 1DG3A 3QXHA 2JDIA 1XJQA 4MYCA 2OM2A 1UDWA 2XZOA 1N5JA 1N6OA 3UXMA 3A4MA 1MV5A 1GDDA 2WSSD 2C9CA 3OAAA 2PZEA 1VPLA 1G18A 2GZDA 2GCNA 3P27A 2ZRAA 3EC1A 4BEJA 1G7SA 2V4ZA 1Y63A 2F55A 2G3YA 1CTQA 2MSDB 3THOA 3IKJA 3ZS8A 3CBQA 4LDJA 2ZR9A 2QMEA 5C1BA 1KY2A 4RY2A 3R7WA 4EFMA 3THXA 2QPAA 1IN7A 2C98A 4KSCA 2HCBA 3VFDA 2GETA 4BRWA 1G21E 4IKEA 1EFRD 4A2PA 1GL9B 5JHGB 3B1WA 4RCYA 3GLHE 3BB4A 1Z0KA 1M7HA 3CZQA 2NGRA 4R9UC 4RD0A 4DCUA 1BYUA 2CJWA 1ZIPA 3BOSA 3OESA 1JB1A 2WPDA 1II9A 1HQYE 1TF7A 2FG5A 3DO6A 2X77A 3ZD6A 1BMFA 3ZGXA 1KHTA 3DHWC 2XAUA 2VP2A 2QMUA 4KFTA 4LHWA 1N6HA 4M1MA 4GSYA 1GKYA 4DCVA 2BM0A 1KI1A 1IY2A 5GVRA 3UANA 2JLYA 3AQ4A 2GXSA 4BWYA 3FOZA 1NNEA 1Z0IA 2OESA 3P1JA 2IYWA 3WBJA 3WMGA 2WTUA 4YQFA 3KQHA 2GCPA 4KFRA 4UQOA 2QE7A 4C0SA 5FBRB 4EPYA 1I2MA 5JFGA 2ZRDA 1EG7A 2ZVQX 4M53A 4PQFA 3O8CA 2DWQA 2IYSA 1GSIA 3PENA 1MT0A 2IS6A 3TSOA 5CDFE 2BBSA 4D81A 2OAQ1 1QHXA 1NLFA 5DLQC 2IUSA 4FINA 1Q3HA 1AS2A 2HXYA 1TUEA 1EESA 4IVQA 4XSGA 4D4LA 5IT5A 3E5HA 2GBLA 2ODNA 5DSZA 2FEMA 1BIFA 3AVQA 4NONA 5LB4A 2NZ8A 4Q1DA 4H1VA 3GLFA 2GA8A 1VIAA 4NCIA 3L8YA 1M6NA 1HH4A 2IXGA 1UEIA 4N3NA 4TSFA 1QHSA 1X86B 2REOA 3K0AA 3AVPA 3KJEA 2CCGA 1XMSA 1EX7A 2FFHA 2J0UB 1SXJD 1WDTA 2IYZA 3LAWA 1OKKD 2AFHE 3RSOA 4AG6A 2JIZA 2WJHA 3GJ7A 4KVGA 2QP9X 4HLQB 4LWZA 1YKSA 2G1JA 4Q1BA 1AS0A 1UFQA 5AUQA 5TXGA 1MRNA 4WXRA 1B0UA 1R0YA 2O0KA 3AH8A 4M9SA 4DDTA 1KKLA 2QMOA 4DEYA 3T1QA 3I92A 4JMPA 5EQTA 1P5ZB 3IQWA 3B78A 2FZ4A 2K5UA 3LQRA 4JLDA 2J45A 1OYYA 3PIRA 3U7EB 5DO9A 1NSFA 1RFLA 2ZTSA 2FFAA 1Z6XA 3ZVLA 3TR0A 4XTCS 3ADCA 1KI6A 3W3AA 4M1TA 3IILA 4NU0A 4B48A 5F9FA 3FYHA 4JJKA 1QZXA 4ZCLA 2IX3A 1QBKC 4PTLA 3BH0A 1P72A 2PCJA 4HAUA 3UIEA 4Q9IA 4TTQA 2DFNA 1E1QD 3JZAA 5D3MB 4PANA 4US1R 4HB2A 4TMZA 5LD2C 2AD5A 2OEPA 5LBIA 4LGMA 2GNOA 3B9QA 3J81k 2GJKA 3CH5A 1OYWA 1U90A 2C8VA 3OIUA 2OXRA 4HYYA 4EPTA 1IONA 5FH9A 821PA 5IF9A 1WB9A 2GXUA 4TMWA 4PO8A 2C96A 3C16C 1IN8A 4RD1A 1CRQA 1W48A 4B3XA 2ZIAA 2GILA 4A8JA 1J99A 4A2QA 1KJYA 1H8HD 5DHFA 1GNPA 2E87A 5DE3A 4H1UA 4D4JA 2ZSAA 2ZE6A 2BMJA 1TEVA 4XD7D 3LH5A 1E2DA 4QHYA 1ZM4A 2VP9A 4US0R 4PC3A 3W6PA 3HWSA 1TUIA 3U3RA 5JSZB 2REXB 2G0NA 1CKEA 1II8A 3CF0A 4AI6A 1G5RA 1DELA 4DSNA 3I4LA 3AF0A 4ZDWA 2JGNA 1C1YA 3DZ8A 3MCAA 4DCSA 5J4YA 2EU8A 1KO7A 2MMCA 1SVWA 2B7BA 2ONJA 5EP4A 4U5XA 4Z8YA 1KK1A 2ZSDA 2ZI6A 2KWIA 4TMKA 3VR1A 1AN0A 3AVXA 1MRSA 2QBYA 1NBME 2BHRA 4ASUD 1GUAA 2HDNB 4B32A 2RGDA 4IOKA 1DAEA 1EWQA 3RS3A 3RAPR 1SKYE 1G291 4POAA 1P2SA 5FTMA 1HURA 1ZUHA 3V4FA 4GRAA 2O8FA 1U81A 4P0TA 2IS4A 4NYMR 4URZR 3U5ZB 1YZQA 2BWJA 4LI0A 3ZQJA 2PJRA 1NLZA 2B21A 5FTNA 5GADl 3GLIA 1Q3TA 3C14C 2UZIR 4UXJA 1KDRA 3QF4B 4LK2A 2VF8A 3NDBB 2OHFA 1VKJA 2ZU6A 1E2PA 5EXXA 1G20E 2XJ9A 4ZDKA 3QKRB 1PVOA 4FMDF 3T5DA 1XD8A 3NKVA 3X1XA 2OFWA 4UJ3A 2XNDD 4LJYA 3ZIAD 2BM1A 1DVRA 2H8KA 2JLVA 3GEHA 2WMNB 4M4SA 2WWFA 2YWEA 2J5XA 3X1WA 4ACAA 3OEHD 3GLGB 1TADA 1NJGA 3IHWA 4GL2A 3K0AB 5CIWA 4U02A 1W36C 4ZCMA 1KAGA 4PSAA 4QM7A 2AR7A 3RLFA 4EJSB 3CH4B 2V3CC 1SVSA 1J7KA 1XJ0A 1XEFA 3HYTA 3PV0A 3B2EA 2P6NA 1KDPA 1CP2A 1TMKA 2D7DA 2AD1A 4M9QA 5J40A 1E0SA 2ZJBA 2HT1A 2Z5FA 4X8LA 1SKQA 4A82A 4V0LA 1W46A 2OCBA 2O8DA 4M0LA 1G64A 5FOSA 2F1JA 2ZI4A 1EFHA 2QMHA 4IJMA 3KX2A 4LHVA 2ZYVX 4UNQA 5GJBA 4LBYA 4MYUA 1HY3A 2J46A 1LF5A 2PEZA 2FSIA 1S9DA 1YR6A 3AUYA 3EA5A 3PUXA 3VX3A 3KKQA 3BAFA 4BEBA 5BN3A 3CRMA 3KQKA 1FP7A 2Q3MA 4NZYA 2NOAA 4TWZA 1DAFA 3DPUA 4ESHA 2QM7A 3WP0A 3WY9A 2ORWA 3TK1A 4MA4A 3QEOA 5BYKA 2QZ4A 1W2GA 2QRNA 3E1SA 2WHXA 1Z08A 3BIFA 1DE0A 1II8B 2ANCA 3MWYW 3ZS9A 4CF7A 1FL9A 2F43B 3SI7A 4EPWA 2RGGA 1OFUX 4TZ6A 3PUYA 1SVOA 1M7BA 4XWAA 3B85A 5CB6A 2O8CB 3ADDA 2AK2A 2QN6A 1GKIA 4B44A 2AX4A 4LYAA 1UKEA 4BFWA 2YINC 2WZQA 4WXPA 2VP0A 2BBTA 4Q02A 1YR7A 2IF0A 1G3RA 1AGPA 1W44A 4V0NA 4QJ3A 1XF9A 1A4RA 2VHCA 4EFLA 3OFND 2EW1A 4C0BA 3GLGE 1OT3A 3GJXC 4OHZA 1ZM3A 1E9BA 1XWIA 4P3YA 1IXZA 1YZTA 3C5CA 2BKUA 1Z06A 5EUQB 3QG1A 4B33A 1IN5A 1NVXQ 2CBZA 1YRBA 4TTRA 4PHGA 1HYQA 4S2EA 2G88A 3FPAA 1II0A 2ZI7A 5IDVA 4QOSA 4A15A 1P61B 1ODFA 5JI3E 2NMVA 2CLCX 1OF1A 3TNFA 1F2UB 5K8LA 4D0GA 1R5OA 1SHKA 2BJWA 2QP3A 2CVHA 3C15C 4D6PA 4KI0A 1O3YA 1VCNA 4W5HA 3MMPA 3T1TA 3QPUA 2OFXA 5L3QB 5JBQA 1SVLA 1BH2A 2IXFA 1E94E 3SR0A 4A0FA 5E7IA 1E99A 5IK2D 5AK0A 2VHQA 3K0CC 1NN3A 4YMUA 2GESA 4FD2A 5JLJA 5AJXA 4KYIB 4PZZA 2FMXA 2ZI9A 3EASA 3CRW1 2J9RA 5F2EA 5FL7A 4C0LA 4I99A 4U00A 1OB2A 3RSLA 2YJTD 3NXSA 2ZI5A 4U7DA 5AUNB 3AKCA 2EFDB 2ZE8A 4LBZA 4FIDA 1C4OA 4MRSA 2W2TA 2P0EA 1H8HA 3QEJA 2CL7X 1QG2A 1XCPA 421PA 3IIJA 5EP1A 1NY5A 2P6UA 1GFIA 3IIKA 3KKNA 1OFHA 5K8TA 3CX6A 3BGWA 1OIVA 2W00A 2IYLD 1KI2A 2QPTA 4Q48A 2CCKA 2BDTA 3K8YA 4JVSB 4M9ZA 4EKDA 5J47A 3K0CA 2XB2A 1G6HA 3BD9A 4P4SA 1E2KA 2RGNA 2FFBA 4LC0A 3X1ZA 3R9XA 1WXQA 1DO0A 1JPNA 1OLOA 3U3KA 1S96A 5FPKA 1XXHB 5A4JA 1VYUA 2HF9A 4Q4AB 3ADBA 4K81B 3QKSA 3EPHA 3B1VA 3TMKA 2QAGB 1OXSC 2FGKA 2FN4A 2CK3D 5J4LA 1W47A 3VR2A 3ND9A 4AURA 3SZRA 2FZLA 4C0JA 4C4PA 1UJ2A 2ZRCA 1TU4A 1VG1A 3MFYA 2C2HA 2IXEA 3EZ9A 2ZUCA 3K70D 1HUQA 3Q9LA 2DFTA 2FEOA 4MQBA 4B6FA 2OCPA 2C9OA 3BK7A 4DZZA 3ZJYA 5FI1B 4IFEA 2FOLA 4DCTA 3NH6A 1FNNA 3O8BA 3X1YA 1S0UA 1ZRHA 3PEVA 2C5LA 5FOTA 1KSGA 1G6OA 4OQNA 1G4UR 1BMFD 4HB0A 3AF4A 2JATA 4LJAA 3TUJC 3ECCA 1SVMA 1KZ7B 3AV0B 3ZVMA 1KO8A 1T4GA 4DLYA 2IA5A 2W6JD 5D3QA 3WHLA 2E9SA 4AY2A 3OIWA 3VKGA 3EIQA 4LYHA 2JLRA 5CJ2A 3FHCB 3WMFA 3FHTA 5HTKA 2F3RA 3CB4A 3EIHA 2GVZC 2ZI3A 1AKYA 1Q12A 3QXCA 4PO1A 1N6RA 2YC4C 5BW8A 4KAXA 3ASYA 5K8UA 3PITA 4LSGA 2V1UA 5HCIA 3A58B 1E2QA 6Q21A 2IYUA 1RW4A 3O47A 1FUUA 4BFZA 2D7CA 3QG5A 3VNUA 4HB3A 3T5GA 1KDTA 1OXTA 1FW6A 2CE2X 5KSOA 2OLKA 4LYJA 1OHHD 3NEYA 4DLRA 1RPZA 3QOFA 2O8EA 4JL6A 2AXPA 1EFCA 2QEQA 3BBPA 4M22A 4Z8XA 1E2EA 3R9IA 2AWOA 2FE4A 2HJGA 2W0MA 2QENA 3IPXA 3EWAA 2OCYC 2C77A 3ICQB 2ZYUX 2EFGA 2ZJ8A 121PA 5FPTA 1DPFA 1ZBDA 1KOFA 3K09A 3WHKA 5AUOB 5JCZA 1AZTA 2BEJA 2AKYA 1IJEA 3TR5A 1ZNZA 2XTNA 1EFRA 2WVJA 3WXMA 4YDSA 1QHGA 1HV8A 5DN6A 2R2AA 1L4YA 3SYKA 2ZAMA 4PAMA 1TF5A 1DAIA 1OPXA 2KI5A 4TMXA 4OI2A 2F1RA 4YMSA 4AKGA 1R0WA 3H86A 4IVPA 4I1OA 2QRZA 3I73A 4JLMA 2A7QA 2OV2A 2IYXA 1XZQA 3D6TB 1G9XA 3QQ5A 3RRYA 1N6IA 1JPJA 1TQ6A 1K5GA 3IIMA 3OAAD 2KE5A 3WMEA 2OFOA 2AK3A 2XITA 1Q44A 4DUGD 3N5CA 2PEYA 2GZAA 2GZHA 2DB3A 2CLDX 4TL7A 4TYWA 4DLUA 2LWIA 4PX9A 5AJYA 2YHSA 1OIXA 3KXKA 2ZRMA 3K09C 2G1KA 1VIYA 4NH0A 4AK9A 1T5LA 3WYFA 2FJUA 3DVLA 1E1RA 2LKDA 2QGNA 2TMKA 1GOTA 4TN1A 3Q5EA 5CB8A 4GT1A 1XD9A 3OE7A 2JLZA 3K0SA 1J90A 3LVQE 2GHIA 2ZE5A 2FPKA 5JWRA 2WJYA 1JQLB 3VR4A 1KIMA 2G77B 3W90A 1M2OB 1MABB 4GPTA 5FOWA 4XVRA 5KYKA 4OK3A 3I1FA 4LJ5A 4DCNA 5FUYA 5IK2A 2BBOA 1X8JA 5TMPA 2ONKA 3T34A 3UG7A 5LD2B 4JBXA 1KMHA 4TMVA 1E69A 2FSGA 3KJIA 2QY9A 4NP6A 1P6XA 5JRJA 1YU9A 2O0HA 2ZS9A 3R20A 3FKSD 4D2IA 4G0NA 4E22A 3L82B 4Q19A 1DEKA 2VHTA 4W5JA 5DHAA 1W2HA 3LQQA 4LX0A 5J4VA 3KDSE 1Z28A 1NL3A 2EFCB 3KTAB 1W4AA 1Z2AA 2PL3A 4JVNA 1QHHB 3I61A 2ZITA 5JJIA 1QHYA 2QTVB 1KI8A 2XTMA 2ERYA 3RDPA 4DUGA 2ZS7A 2EVWX 2ZJZA 2Z4RA 2DR3A 4PQYA 1TEXA 2X1VA 3A37A 3CWQA 1HT1E 2X19A 2A5JA 4FMBB 4V0MA 3KZ1E 1KK3A 1XTKA 5GJVC 3SQXA 3N70A 1RRGA 4NYJR 2B6HA 2Q3HA 3IBGA 1NG1A 5C18A 3AF1A 2JJ2A 1IM2A 4LHZA 4ZDJA 1D6JA 1HA3A 2IHBA 1NMXA 4A1FA 2C95A 2VA8A 3O8DA 5CJPA 3OIYA 3PG5A 1D5CA 3QXSA 1Z6TA 2RHDA 3IBYA 3B13B 4CDGA 1W5TA 1X3SA 2FPLA 2WIAA 3BWDD 4Q4HA 1S2MA 3AP3A 1KO1A 2P3SA 3EA0A 1MO3A 2OE2A 2CK3A 3NIBA 4JL8A 3UWOA 4WIAA 3RS0A 4DBLC 5JEEA 1VMAA 4EJSC 4HAZA 3V00A 2E1RA 1S8FA 4M9XA 1U94A 1R5BA 2RGNC 2CHGA 2ODWA 1R4AA 5GJCA 1VHLA 2VPPA 1YVDA 2ZYTX 3HJNA 5EE5B 5AR1A 1ZC3A 3PEWA 2QU8A 1JEEA 4UJ5A 2CLSA 3LLMA 1L7VC 3B9PA 4B3DA 4OQMA 4AIIA 1MH1A 4CYMA 1E2IA 1Q1QA 2GBLC 2VP5A 3LA6A 4GMXA 3TVDA 5FL3A 1NKSA 4K46A 4NCHA 4L16A 2HLDA 4FMDB 5JSZA 1UKVY 2GJSA 2GCOA 3EZ7A 1R2QA 3M1IA 1TQDA 3L8ZA 3V4RA 2NO0A 3QBTA 4DWJA 3TQCA 1B23P 2W6IA 2YV5A 1XPUA 2JLQA 1R5NA 1XMVA 2ASEA 1FX0B 1RRCA 1IHUA 1ZNXA 3FB4A 4ZI2A 1IXRC 2GKSA 5G41A 4OI0A 3GJ4A 2XNSA 5G40A 1VCOA 4JT2A 4TQAA 3U3JA 2O52A 5KPDA 4AYWA 2ZSEA 4LJ8A 2AKAB 2WJIA 3MWJA 1W7AA 4NYMQ 2Q6TA 2W2XA 1A7JA 4RZ3A 3FTQA 4A8JC 4W9MC 1JQJC 4N1AA 5LB2A 2JASA 3MSXA 4M8NE 3EPLA 3AGQA 1R0ZA 2CEAA 2R6GA 3REFA 1Z0FA 5FOXA 3V9PA 4LJ9A 4X8OA 4QBHA 1W49A 1OSNA 2V9PA 1DOAA 1ZJ6A 4H9GA 2IYRA 1YE8A 1TU3A 3SBDA 3U7GA 4I81A 4R71A 2IYVA 1D9ZA 5HZHA 1JJVA 2HLDD 4EJSA 3I5XA 5FTKA 1E9RA 4IDNA 4AKIA 3W6NA 3D7MA 3QUSA 2HYDA 5DH9A 3M6AA 5AWFC 2CHQA 4RVCA 2O5VA 2FDCA 2IK8A 5EP2A 3IQXA 3SJBA 2BBWA 4RFSB 2Z0MA 4OI1A 1Z2CA 4XTRA 3D31A 1QF9A 4A0GA 1XBTA 2JJ8A 3A1UA 2EFEB 1SULA 2WAXA 2BMFA 1KMQA 2WBLC 4MDEA 3I8SA 2EWVA 4MRRA 3K9LA 4G5RA 5TVKA 4KCGA 1D2MA 1KI7A 3KJGA 2OG2A 4BLOA 2H92A 4NL4H 1T8UA 3EPKA 3SN6A 5JRZA 1F5NA 4LPSA 1RJ9B 1BOFA 1W1WA 1YHNA 4MGIR 3NDPA 1XPRA 4BZPA 2PT5A 2OBLA 4MKFA 5JWHA 1P7CA 4HZUA 2PX3A 1SGWA 2H7VA 4PXAA 4B6EA 2RGBA 2VBCA 5EZ6B 4PPQA 4TYNA 1GKUB 3WNCA 3ZZ0A 2ZVPX 3FHOA 4BFVA 1NI3A 4FXPA 1KY3A 1GM5A 4O25A 2VSFA 4C0HA 3UK6A 3RRMA 4KV9A 3VR6A 3SC3A 4Q47A 3WRXC 2QM8A 4WVFA 3KFXA 2UZ3A 4IRUB 3OEHA 1BYIA 5BN4A 1V43A 2GK7A 1D9XA 3F3YA 5TB5A 3ASZA 1X1SA 2N46A 4MGZR 3GFOA 2AFIE 4QHSA 1BO6A 2IWHA 1DO2A 2I3BA 1Z6YA 4JLPA 4OJQA 4Q03A 1NSTA 1E2MA 4QL3A 1TX4B 2WWGA 4QC2A 2VSOA 4AD8A 5FR2A 2RGCA 4A36A 1S3SA 2A5YB 3QJYA 3WRYC 1R0XA 1UBEA 1YZKA 3T61A 3VMFA 4B3FX 1LNZA 3T35A 4NKRA 3SJZA 2DFLA 2ANBA 2GF0A 4KLNA 4PHFA 1W4CA 2WJGA 3KXLA 4G5SA 3PXGA 4HB4A 1T9HA 1YRAA 1XTJA 3THWB 5B64A 1F48A 1W0KD 5SZKB 1CXZA 2AN9A 2LCFA 4NCJA 1UBGA 4CVNA 1FTSA 4DT1A 2WOOA 1Q21A 4IDPA 2R62A 5HKKA 2F6RA 1UPTA 5DI3B 5HCNA 1AJEA 3AUXA 3TH5A 2J1LA 3AVWA 3THXB 1P2TA 1W4BA 3L0OA 4C7OB 4G3XA 1E9FA 2ATVA 1ZM7A 4TLEA 5JI2E 2VHJA 4UNRA 5B58C 1N6NA 3FMIA 5EE3A 1X8LA 5E95A 4XOIA 4BLPA 3OFNA 3RYTC 3RRNA 3GJ6A 4PHHA 1IN4A 1LF0A 2ZSFA 3UWKA 2CVFA 2XEXA 2EWWA 3L0SA 1G3UA 3CRRA 4URXR 2QSZA 2P65A 4A4DA 3NTUA 2KB0A 3Q72A 3OEED 3HU1A 2IYYA 4KODA 2QQEA 2CE7A 4GZMA 3RS5A 3SEAA 2NZJA 4L4UA 4WW0A 4QXAA 3O8RA 1LB1B 1CR2A 4I1SA 3EG5A 3D8BA 1KSHA 1FQKA 3PQCA 4JLKA 4OHXA 2PMDA 4Q7LA 2PZGA 3TJZA 2FWRA 3I5YA 1XXHA 1SVIA 4NCKA 2VF7A 4NYJQ 1DAKA 4TL8A 2KBFA 5CM8B 2Q21A 3VTKA 2QG6A 2HYIC 4JLJA 4B2LA 1E9SA 2ZUBA 4DB2A 3LO5A 5JS8A 1Q1BA 4HLUC 4A0RA 3RHFA 4BZQA 3THWA 3G0HA 4TLAA 1ONBA 3DOFA 3VAAA 2J3EA 4A0HA 4L15A 2IEYA 1VYTA 1D2EA 2GJ8A 4S35A 3U44B 2A9KA 4RD6A 5JJKA 1E2GA 1I4DD 1OHHA 1AM4D 3CF6R 2GK6A 4RKFA 2RKOA 2P2LA 3CM0A 1F6BA 3LV8A 1RVDA 1SVKA 4Q4LA 3AVTA 3VQTA 3R7WB 3GP8A 3F8TA 1I4LD 1P75A 3LD9A 1EGAA 4JSYA 1TNDA 1G3QA 1NRJB 3EW9A 4DJTA 1COWA 4DDWA 2QT1A 3E70C 5FUVA 4AG5A 2NG1A 1ZYUA 4Z54A 5B30A 2H18A 4C2TA 2A5GA 3LBHA 1GL6A 3B1XA 4PQRA 5EJEA 721PA 1TF2A 3DKVA 2QT0A 1XTSA 3ZIAA 4WOPA 1LV7A 1P2VA 4B43A 4IHQA 2PH1A 2EFHB 4Q1FA 4CEJB 1YZGA 1GWNA 1DTSA 2C04A 1NBMD 3F5FA 3OHMA 4FWTA 1JAHA 3GJ8A 1XEXB 1ZCBA 1QVAA 2ORIA 3C8UA 3NBYC 3NH9A 1O87A 4C7OA 4B74A 1QVRA 4QGGA 4II7A 3K9GA 4PR0A 5TARA 1P60A 2QSYA 2H1LA 5E7JA 2PCLA 1GL7A 3DMNA 1W5SA 3ICEA 2WJVA 3CIOA 5KHOC 3HPQA 4Q21A 1G41A 1I4TD 3VX4A 2XTZA 5C4GB 3ZQ6A 5IRCD 4L9WA 1NG9A 3A1VA 2WWHA 1WE2A 3KJHA 4QHTA 2WAYA 2BC9A 4XIGS 2QA5A 1G8PA 2PMKA 4Q66C 4OHWA 3IO3A 2GJAA 2OBMA 1G7RA 1PLKA 3QBVA 4M1YA 621PA 3GEEA 2ZRGA 4P33A 2KSQA 1H8ED 3BC1A 1JNYA 4TQUS 2ZETA 3MG9A 1A2KC 2NO7A 1CJKC 3Q3JB 1XJCA 4DDUA 5HR5A 2H5EA 3SFZA 2W58A 4A2WA 4LOAA 4JBWA 2AXNA 3B7GA 3ZYCA 2REBA 1XEWY 3H4MA 5EE1A 3GMTA 4ILEA 4WZAE 2J0UA 4IEEA 1D2NA 4PPNA 4PPFA 2BIFA 3OIVA 1ANKA 3EIEA 2AL7A 5BQ5A 1XFAA 1WBBA 2QNRA 1DBSA 5FTJA 3BH7A 4M1KA 4MKHA 5JZVA 1T0HB 4A9AA 1R8SA 4O3MA 2C9YA 1P73A 3LFUA 1RJ9A 3CPJB 3HR7A 1NVVQ 4V0KA 4BE7B 2VSXA 4GFDA 3I72A 1NF3A 2QE7D 2X2EA 3WYAA 1UKYA 1TQ2A 1YR8A 4BFTA 1SXJE 4Q4JA 1NLYA 2UVQA 3Q85A 1E32A 4BLQA 1VYVA 1UF9A 5CYOA 5FUWA 4QJ5A 4EPRA 4MUAA 4JJZA 2HXSA 4QGFA 4RZ2A 2NIPA 1XB2A 1CR0A 1XCMA 4HUQB 3VU9B 4BPBA 3VNVA 1F3OA 3KKMA 3PCRB 4BFXA 3EC2A 4N0EA 1ZINA 2EYQA 1E79D 4KU4A 3VR3A 4CEIB 4R2IA 2WSMA 1U0JA 1PV4A 3HYRA 1AGRA 2YYZA 3TBKA 4F4JA 1KO5A 4AKHA 3L43A 1LVGA 4US2R 2G6BA 1WBDA 2KJQA 1PJRA 2WWIA 1US8B 1AK2A 3BFKA 3ZZUA 1UDXA 4QNMA 1IN6A 4I4LA 5JEDA 4OI4A 1UBFA 3MAAC 1U8AA 4YONB 3GFPA 1K6MA 1VECA 3GJ0A 4JKIA 3TW4A 1MR3F 2Q9BA 2VHUA 1J8YF 4P4SB 3CUEF 5AJVB 4Q5IA 3PVSA 3TGPA 3FKSA 4QRHA 1E3MA 1ZD8A 1N25A 2ZRIA 2HJVA 1XU4A 4NPHA 4KVAA 3FE2A 4Q1CA 2DWPA 4AWXA 1Z8FA 2ORVA 4IVRA 4ZIRB 1W0JD 2VRWA 4YMTA 3LWNA 3DM9B 2O8DB 4PC2A 1P2UA 2VH5R 5DISB 3WBKA 1K8RA 3JZMA 4MKIA 3H2YA 4M1SA 1OH5A 2RAPA 3CRQA 1QHNA 3QKRA 4HZUB 1GRRA 3AVUA 1IJFA 1IBRA 3P4XA 4PZYA 1JXMA 3PEUA 4HDCA 3M0EA 2GDJA 3SHFA 4FCTA 5C2JB 4AC9A 3SS8A 1YQTA 3TUIC 1XP8A 5KNBA 2PLFA 4Q1EA 4Q18A 3BFXA 2F9MA 5CYPA 1E2HA 2D62A 3RWOA 4L8GA 2OUKA 1G3IA 2MSEB 1KKMA 5GVSA 3R8FA 2RGXA 1QHIA 4CEIA 4RD2A 1JR6A 2A5FA 4A6XA 3Q5DA 2NPIA 5GJWC 1NY6A 3CPHA 4RZXA 5SZIA 3MWKA 2F1HA 4IW3B 1CLUA 2DHRA 3GLIB 3KXIA 1DAMA 2QAGC 2D2FA 1T5IA 1FTNA 2A2ZA 5L8VA 3AP1A 3GLFB 2V6JA 3K9NA 3EXAA 4XH9B 4UXHA 1F2TB 1U9IC 2WKQA 2ZANA 4WZBE 1US8A 4XJXA 4PPGA 3IEVA 3KB2A 4P32A 3Q8XB 2J0VA 2XZLA 4OKSA 2NO1A 2ZR7A 1EFTA 2ZE7A 4WZ6A 4IDOA 4Z51A 4D4KA 4GDFA 5L3SA 1E2FA 2CJWB 5EXSA 4MRPA 1EFUA 1TPZA 2ZRLA 2NO6A 1P9RA 2DY1A 2L0XA 3TE6A 4OL0A 4PAOA 3GFTA 4JZKA 3PUZA 4L5BA 4DSTA 3UMFA 3QSYA 2J41A 1FMLA 4Q9HA 4GOXA 1A5TA 1N3BA 2VP6A 4HAWA 4JLVA 5FOVA 5A5GA 3FWYA 4GBMA 3FMPB 3RANA 1Z29A 2A30A 4YC7A 2PJZA 2GJ9A 1L4UA 1Z0JA 4BRUA 1W0KA 3SNHA 4HDQB 2FNAA 2RB4A 3S1AA 1G3MA 1E2LA 4ESVA 3AB3A 4EPXA 4NCNA 2P5SA 3QKUA 4HSEA 5FOUA 4FCVA 4LJ7A 4V02A 1NVWQ 1Z63A 2IS2A 2G0TA 1AIPA 3CO5A 1RIFA 5FTLA 4CZ2A 4OYHA 3EZ6A 4DRZA 1UAAA 5J4HA 1S9HA 3MRSA 3BFVA 4FN5A 3C41J 3KQLA 4PAQA 1CR4A 4B71A 5JECA 3VKWA 1SXJC 3A8TA 3E2IA 2ZEJA 1XX6A 1NN5A 4QKQA 1E4VA 2W6ID 2MSCB 5FBLB 3QE0A 1T6NA 1ESMA 3QNUA 4OK6A 4IEIA 2O8CA 1J70A 1HQCA 2HUPA 5SZHB 2QQ0A 4A8JB 5E3HA 1ZNWA 2BOVA 3L0PA 1QDEA 1Q20A 3NHBA 3DL0A 3SOPA 3EX7C 2XNDA 1XEXA
chains in the Genus database with same CATH superfamily
3Q0AA 2BRLA 3L0ZA 1NUSA 1XA3A 4IOLA 3FH0A 3OLCX 1ZK3A 4K3UA 2C2MB 1U3TA 4B0PA 2NYAA 2D41A 3O9VA 4OB7A 3ZYZA 4JXJA 3OO0A 4GRSA 2ZVJA 1U2RA 1NTRA 5BR8J 4OMUA 5EWLA 5CM9C 3FFBA 4J9UE 1BE6A 5I7OA 2I87A 1TE2A 1J33A 4DQUA 1D7OA 1FNBA 2NX2A 3RS4A 3WL3A 3KB1A 2J5RA 1R6BX 3W5DA 1GGVA 5HFJA 2JWNA 1SCKA 2IA6A 1XRNA 4IDDA 2EBUA 3V5RA 1W36D 2Z56A 1GPJA 3RSCA 4F5EA 1M0TA 3ONWA 3E4DA 3FSEA 1GDTA 1AMNA 3ANSA 2AJ8A 2WRZA 2IEDA 3FCUB 2ZTMA 1JQEA 3DZJA 3ZZOA 3CCJS 2EX4A 2JFFA 2RKIB 1PZHA 3PHIA 1ZUIA 3HYLA 4DLWA 4GICA 1ZOPA 3BPSA 1WO8A 5GONB 3TSZA 2WWXA 1Q81T 1T5OA 3JS9A 1U9YA 3UPUA 1AQNA 2OIHA 2VQEB 2AOTB 1K9MT 4HBGA 3CURA 4ZXPA 2WHPB 1XBWA 3WLMA 4CT0A 4ZJYA 4S2UA 3NBKA 9LDTA 4D45A 4W9NA 2DXFA 8ADHA 3SF8B 1KH2A 4AZ0B 2YZMA 3K1ZA 3EQ6A 1Z12A 4IEFB 2AF6A 1JUDA 5LCXA 4LGYA 4JH0A 3DHXA 1QIJA 2O20A 4ZALA 1NUEA 3BD7A 3TZWA 3HA3A 1TVCA 1T4CA 3H1TA 3TEJA 4CKCA 4OZ1A 3EGEA 4ZOBA 2QPLA 4MR8A 3H2VE 4DM4A 3DU6A 4PQUB 2IODA 4RCZA 3KOOA 4M2LA 5IEJA 1U0HA 4PCUA 5A0YB 5HZKA 2LQ5A 3FMFA 2GEFA 5AVRA 2PYIA 3H4TA 4WOJA 2DH5A 2IFTA 1NR7A 4Q7KA 4DS5A 3PFOA 2GEDA 4RX6A 3JATB 3U2QA 5AHXA 3X1MA 4QQRA 5EUMA 4WN9A 4ZFNA 2FSSA 4C4WA 1H4TA 3WGIA 4BNDB 5IBQA 3BE4A 3O8OA 4C08A 2B2XA 1DRUA 4D5EA 2PVCA 2JCGA 5HJ2A 2AG0A 4DGQA 1V9CA 4L0QA 1N7HA 4AD6A 1IY0A 1B70B 1EWTA 1W5FA 4JYZA 2BGUA 1A5SB 4Q4HB 3QY0A 3TQFA 1XZAA 4MUEA 1JHUA 1C0IA 4UTNA 1YZLA 4L3OA 4EYKA 4L51A 2K87A 4BDSA 4DXHA 4ZJZA 3K53A 1G42A 3GNQA 4F9FA 2J07A 4WCFC 4HAVA 2VJCA 4LVOP 2XLKA 4DPOA 1XYYA 3DXXA 3HCXA 3MD0A 5ALOA 3MN1A 3PDIB 2CG4A 4ZI7A 5L3RA 1SZCA 2JEYA 4KLCA 4DCGA 3TJ8A 2OFFA 4BNJA 2BM9A 2VDQB 2XY7A 1WC6A 4CIDA 4ZVSB 3F90A 2F8MA 3FZEA 4ZO9A 4LMAA 4Q7QA 4DV3F 2X22A 5JS6A 1X1AA 1U3FA 5KTTA 4UEKA 3DLEA 5IC6B 5K0JA 3UQSA 1L5UA 3ZFVA 3AKDA 3O95A 1E8NA 4JI8B 5HANA 1FX0A 1PLLA 2BZ1A 4ED7A 1ZU4A 2LKCA 2Z6VA 4OXXA 4WZZA 4D4MA 2CHVA 5ADVA 3GO4A 4Q05A 2WZBA 1BX1A 3X44A 1PO7A 2GQ0A 1T8TA 2UP1A 4NXNF 1O5JA 4EUNA 4ITVA 4RVNA 1EJ6A 2IBMA 1FKOA 4JWTA 1X7DA 2R8YA 5DNAA 1Z36A 4IOAQ 4LYFA 1K75A 4YH1A 2WM9B 1NU4A 2OZEA 2OUIA 4UBKA 2SXLA 3T3MB 4FONA 1C2TA 1SKBA 2Y1FA 1SO8A 2KZZA 4R8MA 1W581 4V1Ak 4RPFA 4LKRA 3ZDCA 2CZCA 3U80A 3GYGA 3OZSA 1RLOA 1SQ0A 4ETZA 4CH0S 3PX0A 2ZWVA 3C4JA 5FWYB 3EOAI 4WDQA 1VYHA 3TWOA 5EEGA 1UMKA 3LC1O 1T9VA 3HKZD 3OFFA 1JKHA 4Y34A 4JEMA 3GAAA 2VXOA 2WYWA 1O9GA 3REGA 4F11A 3JPYA 1Q0PA 1GCUA 2IP1A 4F92B 2D3TA 1ADFA 1NJ8A 4QOEA 3C87A 1KMHB 4TT3D 1PZXA 2WAAA 3I39X 5FPSA 2PLNA 4Y6LA 5A7FA 1VE3A 4FUQA 4TYPA 1V3TA 2TSYB 3RAJA 2YVAA 2D2EA 3MWFA 3OTHA 4ZODA 1IHOA 5BNFA 3AAWB 1GNRA 4W4MA 2WMOB 3R6WA 3GXBA 3JZIA 1KI3A 3QFTA 5J43A 4N48A 2IHTA 1RPJA 4L9SA 3I45A 2IDJA 3O4GA 4WNAA 3IP0A 3I0NA 5EQDA 1ZD5A 1G6BA 1R7IA 1MLDA 2FPPB 1L7PA 4LRXA 1XNQB 2VIIA 4C6TB 2P8JA 2WKRA 4DY6A 4KHPB 2J9ZB 1N5IA 3GT4A 4GW3A 1JR3A 3Q8VA 2P67A 3IDQA 4NOKA 2AJCA 1GFWB 4Y1EA 3H4VA 3LX8A 5K0BA 1EVLA 2G9NA 4IR7A 1OMOA 3IP8A 4FZ5A 2IMOA 3OECA 4JI0B 1RTDA 3H87A 1RWNA 1JLCB 4NLXA 1XPOA 3B38A 4OHRA 2HO4A 3CCMS 1PZMA 2IAJB 5M2UA 4E0BA 3KD2A 3UW1A 2PS0A 5FFMA 2XQJA 2G07A 4ZU6X 2HQDA 3OT9A 4QW8A 3RT9A 4NICA 4RNHA 1U98A 4FS3A 3SZMA 3R3VA 3B7WA 4CO4A 3UT0A 4F4CA 3G96A 3RB4A 2O2CA 3JTPA 1J56A 4XWKA 5D4NA 2BKVA 5JZBA 4QJIA 1YULA 2C88A 5DCUA 5KG5A 3B3JA 5A0VA 2QFJA 4MDFA 2IRWA 4Z49A 1MHPA 2BR4A 1SQFA 1SEVA 2CDAA 2O2SA 1V1MB 1GSOA 4ARBA 3SMQA 4JI7J 4WERA 1ZAYA 1I13A 1YRTA 5JAMA 2H48B 3NBZC 1F4LA 3ZCSA 3SDSA 1VQ1A 1RJJA 3A06A 1Y6FA 1J6UA 1QUPA 1QAIA 4Q4JB 2VFVA 4ZMBA 5KUTA 1QFMA 3EYWA 4ALMA 3LQYA 1AMOA 3TOQA 1GEHA 2GB4A 1W19A 5CHCB 2JHCA 2FIUA 4EYEA 1FC0A 3DNMA 3NVDA 4BEJA 1G7SA 4ZPVR 2F55A 2PEHA 5BO5A 4YP5A 4ES6A 4XDCA 4LDJA 1H3FA 4EFMA 1WAMA 3BWCA 3FOFC 3VFDA 4H3SA 4Z4QA 1C81A 2C3PA 2BAGA 2X2PA 4FDVA 4XAQA 3VAYA 5EIEA 2NUUG 1QO0A 4M5DA 1SC4B 2OECA 5ILQA 5EN1A 4U96A 2X42A 1BTOA 2QL9B 1BQ4A 3DAHA 4UNIA 4BWYA 3KU1A 4C5BA 4M60A 2C2ZB 3UJCA 3WDSA 4KFRA 4LYEA 3G6KA 3IBCA 1FDIA 1T8RA 3PICA 1GSIA 3N0XA 4WKYA 3UJ3X 3DGPA 4O3NA 1ZD2P 4QPTA 3ZHYA 2IP4A 2IUSA 3QK7A 3HCCA 3WX4A 3F4KA 4H1VA 4I55B 3M6XA 2GA8A 1QAYA 2B36A 4S0XA 1L5KA 3HD1A 1UEIA 1MW9X 1WDLA 4XGKA 5ALTA 5IJXA 4P0QB 2DNLA 2FFHA 3RSOA 1T05A 3I6MA 3M3HA 4LWZA 3OO1A 3KLGB 1NZFA 1YKSA 3TLAA 4C4AA 2O0KA 3WLFA 2BH9A 3QLTA 2GHWA 2DT8A 2WOMB 1V16B 1IYZA 2B82A 4OBBA 1NV8A 1P6TA 4M5KA 3E84A 2X1LA 1XK7A 3CWCA 3SHTA 5BV7A 1CP3A 4MW1A 1M1XB 4WE1A 4BNIA 1G98A 4UOCA 2WSLA 1BHO1 5ECWA 3CLTD 821PA 2XV1A 5KCMA 2E21A 2C2KB 4PZAA 1MAWA 1QG0A 1S9FA 4I50F 2Q1LA 4WBXC 1P7PA 3ESCA 1C4CA 1UPMB 3UFXA 3EGDA 5E3PA 3JAMA 4F8EA 1YKWA 3A11A 3ZY2A 3M32B 3E5RA 1SVWA 3OP1A 1BKYA 4U5XA 4IOBA 3TZLA 2ERCA 2KWIA 2XWPA 3DDWA 3FPGA 3E03A 3Q7SA 1J5XA 4MGHA 3HXKA 3DDNA 5D0EA 2C22A 4Q82A 2LW7A 4M6WB 4LJMA 1VDHA 2PPLA 3SSRA 2PUJA 3AINA 5T3YA 2Q6KA 1MJHA 4XQ0A 3GG0A 2XVYA 3NETA 1KKUA 1ZIYA 3GVCA 2L9DA 3K71B 1PVOA 1H6CA 2R7OA 4WFZA 5KIAA 4UEQA 3CINA 4JI2J 1NVGA 4ACAA 4G1EB 3PX6A 2POCA 4EJSB 1IKXB 2P6NA 4IJUA 2AD1A 1AK9A 3HDGA 1SKQA 3AEQA 3REQB 1TJ4A 4YS6A 1G64A 4AL7A 2SKEA 4RADA 4UMFA 2RS8A 2WU4A 2NXJA 1LF5A 1UW9A 3U31A 1H9CA 5AM0A 2E4ZA 3FJOA 2UUPA 3IUNA 1NHGA 2WDPA 1YBUA 5CUQA 4C4ZA 3FGOA 3E1SA 3C45A 3GT7A 3FUYA 3WYEA 4BMXA 3MELA 3VTAA 2BTQB 5KHAA 2DXEA 4BFWA 4B0OA 2VP0A 2DSTA 3JQ8B 2EP7A 2H1RA 5KJEA 1WBJB 4C0BA 4S1PA 3FGVA 1GAEO 1ABBA 1IY8A 1KZ9A 1Z06A 4RF5A 2KFYA 2ZI7A 3U0VA 2NMVA 4EFDA 2B9WA 5AHOA 4IQFA 3RU7A 2QP3A 3HFGA 4D6PA 3P3DA 4UOGA 4W5HA 3KUHA 3FM9A 2HIGA 4MR8B 3K0CC 5JLJA 2D6FA 1QZZA 5EUCA 1S6PB 2YMPA 3KHGA 4KXQA 4I50A 4FEGA 4B6SA 1ZL2A 3QPAA 1XCPA 421PA 1UQTA 5EP1A 1GFIA 2WVGA 3OJLA 2VJOA 5TEWA 4Q48A 2GYVA 2AOXA 2GTIA 4Z4FA 2DTDA 3CEMA 4OHPA 2HF9A 3EVNA 1FK9B 4K81B 4WN9B 2FUNB 3HCNA 2RD5C 2MT9A 4F2WA 3ILYA 1JF8A 1QR6A 4D46A 2ZUFA 2J9DE 1VIDA 3TNYA 1X87A 4UOQA 1UJCA 4MR7B 4N82A 1G4UR 1DKRA 2JLGA 1SVMA 4RGVA 5FA6A 3V4LA 4CYUB 4EF4A 5D3QA 3VGVA 4EHLA 3B12A 3DZHA 1IC6A 5IP5A 5CJ2A 5GQSA 1H2FA 4CFZA 3AIOA 1X39A 3C6UB 2HFOA 1O6XA 2OMOA 4FKZA 3W2IA 1KXJA 1I3NA 2PL9A 3VYUB 3VZRA 3VJRA 5KWJA 1VI5A 4LCJA 4ZVMA 2CE2X 4JQSA 5IEBA 1OHHD 5DJ5A 1DOHA 1KVTA 4AJ1A 3DHNA 3H2JA 5K0CA 1VJQA 1NZ8A 2CLEB 4FOOA 4M8SA 4EHKA 3NGKA 4TLRA 1BU5A 1XDGA 3K09A 4LDRA 2UYGA 1NQAO 2BEJA 3VRHA 1WXHA 4IMPA 4OLBA 2CXQA 4PLHA 3DL4A 3JX9A 4TMXA 4WQMA 2F1RA 3AY0A 3H86A 4L27A 4DPYA 4WFKA 3D6TB 3ZD8A 2G0CA 4RV5A 1E6UA 5BMOA 5KTPA 4QWEA 1U8FO 2CQ4A 2NVUA 1E7MA 1NSYA 4YRMA 3WKEA 4X3CA 2NW6A 2XMQA 1O08A 1GZVA 1Z4OA 3K94A 4KPUB 3K0SA 3AOEC 2HZBA 1H6DA 3DQZA 1M2OB 3TQTA 1MABB 2AW0A 4GC5A 2OB2A 3GQVA 5KFRA 1P6XA 1T43A 4FHCA 4YP9A 1V26A 1E4EA 3QPCA 2AFIB 3QQPA 1HNXJ 3FBTA 5CG1A 4DR7B 4ZT6A 2QLFB 4C4OA 2Z4RA 3ILVA 1TEXA 4ICLA 4BHQA 1GPKA 4MUFA 2XMUA 3CEPB 3UVEA 3Q9SA 4OP3A 5EKDA 4IZHA 4R81A 2P2YA 4I6AA 4MW6A 2RHDA 1ZMBA 3AG6A 4YHHB 1A9QA 1UODA 3NIBA 1EH5A 2H1CA 3VPXA 1UJ6A 1UFWA 3VBEA 4HAZA 4MVWA 2CHGA 1R4AA 1OX6A 1ZC3A 1JN0A 2VC0A 1PJ7A 2DHHA 5IUNC 2HWTA 3RJZA 4KRFA 1UKVY 16PKA 5JARA 2D5IA 4RHTA 1RRCA 3ZO7A 5JY1A 4ZI2A 1ICEA 3RC9A 1YX2A 1QOZA 2W11A 3DCIA 3H8YA 3FZQA 5GOTA 3TEHB 3PC4A 5FOXA 1OTHA 1DOAA 5JUMA 1CNFA 2BACA 1TU3A 3SBDA 2VF2A 1KJ9A 1X7ZA 4I81A 1IZ9A 4RHYA 1PL0A 3O4VA 2DHXA 2PIDA 1BWPA 1DI0A 2A0XA 3IQXA 3PUIA 2QF7A 1RXWA 4HRAA 2EFEB 3CCZA 4MJKA 1S0OA 1EUDB 2PVSA 1DBPA 3B54A 1SCJB 1F20A 1RJ9B 1BOFA 4EI9A 2P62A 5BQ3A 4I9NA 1IDOA 4HZUA 3L8CA 3ZDAA 3DMRA 2RI6A 3FDFA 4C4TA 4HMOA 1U1MA 2DJIA 3TARA 1QVGR 2JGFA 3JAWA 3OEHA 3R6GA 2WONA 2XQGA 2VG5A 4G07A 1D9XA 1ENPA 3ASZA 1ILEA 3FNBA 1Q1NA 1ISGA 2ZSJA 2VUIB 3GBVA 2ROGA 2Q0XA 1R0XA 1XI2A 3VMFA 1FKPA 1SD1A 1RXYA 4DG8A 5IMBA 3THWB 2E4XA 3OKPA 2C97A 3EBOA 1H42A 3PYGA 1FTSA 4EW3A 3LVFO 2VDRB 3P2YA 3S4YA 2HIQA 1U7TA 3CLRC 2HQBA 1M2GA 1DL5A 4XTTA 3LY8A 1FNDA 2OTCA 1O5OA 3KEOA 1QQ6A 2ZSFA 4NWIA 1G3UA 2AOTA 1NVBA 2AZ1A 2AA3A 3IP9A 1B8NA 1V3UA 3OEED 4V2UA 2B3TB 2CE7A 1CR2A 3EG5A 3WB2A 3ZBQA 1T0IA 1PNOA 4J76A 3K6RA 3NWGA 4W1RA 1XCLA 2D7JA 5KVQA 2PGDA 3C74A 3SOZA 3DOJA 1UC8A 1U7XA 2D5CA 4K0RA 1JQKA 4UEJA 1OZAA 3Q24A 2P2LA 2PQ2A 3IT2A 2AMYA 1WUUA 2FDXA 4NENB 1P75A 1NRJB 1O6ZA 1ONNA 4DDWA 4AMVA 3E70C 2F40A 4AG5A 2GIQA 1CDOA 4Y2IA 1SKSA 4QPXA 4RYLA 4YCJA 2DX7A 3VGPA 2BJ1A 2JRSA 2IGBA 4FKYA 4GO5X 5TARA 2JD0A 1NVKA 2JAXA 5KVVA 3O8OB 3H59A 1ECGA 2OHDA 3NP7A 2P3OA 2WWHA 3KJHA 2ZT8A 5GOZA 4B3JA 1M2KA 2KRRA 1PLKA 2B3DA 621PA 2CNBA 3D54D 4ZT2A 5F73A 1HBJA 1BFKA 1AA1B 1Q50A 1E1NA 1F5SA 4P35A 3DDUA 4AJHA 3EGNA 2AEJA 4LOAA 4WFXA 5HRAA 4OM8A 5A8WB 1H0SA 3MCVA 4TSRA 3GFZA 1SM4A 5L9AA 5ICFA 3R6DA 2JAWA 1DBSA 4BO6A 4KRWA 2PUBA 2C9YA 4G1CA 1U2QA 2UUWA 4DSFA 4GFDA 5A05A 4AUEA 2ZBRA 3CLSC 2U1AA 1HNWJ 4GKKF 3FNQA 4M9CA 2O67A 3MM5B 4WTOB 2RE1A 4WJLA 3DZCA 3T1YJ 3VR3A 3R7NB 5EJ7A 3W2HA 2G6BA 2VWPA 4OG2A 2CY0A 2W2NP 5EMLA 3ZZUA 1IN6A 5JEDA 1Y0HA 1JLFB 1XU9A 1YQGA 1AZSA 2ZRIA 3TIVA 2K1RA 4NPHA 1V9OA 3MJDA 5BQXA 4J9RA 5DYTA 1DQZA 2EK1A 1CJSA 4RHXA 2CPYA 4PGHA 1QSLA 3ICVA 4IV8A 4MKIA 4M1SA 2FR8A 4HZUB 2DTEA 2B51A 3WJ2A 3D6MA 4D9BA 4PAWA 4KIGA 2LMIA 1T8SA 4AROA 4NU8X 1RT3B 1X1DA 4LT6A 5DO2A 1LFAA 2QIOA 2W6MA 3RKRA 3UJAA 4M0DA 4C8OA 3R6GB 4F9GA 2X41A 1RAJA 2A5FA 1RYYA 1E4OA 2Q3BA 3GLIB 2QAGC 1M6WA 5FBKA 3K5LA 2CF5A 4F5WA 4WZBE 4XJXA 1EFVA 2H4YB 4RWXA 5JUWA 4CZCA 3F67A 1FYDA 4WZAB 1A8UA 4BNKA 4MJLA 2ZRLA 3IAS6 1EA7A 3AEQB 2PSZA 4BMPB 4L5BA 3HJFA 3DT9A 4DSTA 4NA2A 5IASA 1U80A 4QYXA 5GPBA 3SNHA 1VMDA 3T4PA 4JB3A 1FWLA 2C2BA 4LJ7A 4V02A 3A2NA 3R5XA 3TX6A 5EIBD 5IKEA 3C1UA 2MTBA 2ZJQQ 1VHDA 4N49A 4O1MA 1CR4A 2XMSA 2O4UX 5KFYA 3A8TA 5K9ZA 4UY8T 2PKCA 2BTQA 4UASA 2GBGA 4A8JB 4BBYA 2YPZA 2G1DA 4O4JA 4G5HA 3MS2A 4UT4A 1DC7A 3DBRB 4H7KA 3H84A 4ALKA 1T4MA 1C8BA 1KAHA 4QREA 3OHPA 2A7XA 2QD5A 5K0ZA 1EX8A 2G6TA 4FYXB 1QZ3A 3PGVA 1Y8CA 4IH4A 1D1SA 3PFEA 2JGKA 3GH1A 4OHVA 2BHTA 1P1CA 3PVCA 5INTA 2H3EB 4QTYA 3I4PA 1P5FA 5C7IO 5CPBA 1S99A 2IITA 4YY3F 2NPOA 3TIFA 1S1VB 3S8SA 5CEJA 1FVFA 2WYIA 1RQ7A 1VC5A 2B4KA 2BE7A 4BLWA 1X0XA 4OJKA 5JO0A 3D7KA 3P49B 4NF2A 1T9CA 1D6MA 3OR2B 3ANLA 4BQNA 4JOBA 3ZVNA 3GGJA 3WLHA 3B6EA 5ILGA 2GEVA 4H2DA 3PS9A 3EDRB 1CFJA 4J90A 3K5OA 1M1UA 1XKTA 1MV8A 2PIIA 1CK4A 4PEVA 4CKEA 2XR1A 3HI9A 4TVSA 1ZH5A 3ZK9A 4TV9A 4E07A 4EAQA 1ZAKA 4PLWA 5B12A 3RB3A 3BGIA 2ECQA 1VKRA 3ZTRA 1E8DA 3TSAA 4DCPA 2QSJA 3DOMB 3PR5B 3CUTA 6AT1B 1CDDA 4G1BA 5AM5A 1GUDA 4F4ZA 4XVCA 1ZGZA 3ZHVA 2QVZX 5DQIA 5C42A 2A9QA 3AD9C 1JECA 2ZRKA 3QFWA 1USGA 5TPWA 1I14A 3QSGA 4OD0A 2QI9C 3I9KA 4RXUA 5CVTA 1RQGA 3DLLQ 3BXHA 3EUWA 1X7WA 4Z0NA 3IP5A 4G0MA 3E3NA 4PNPA 1XYGA 1PWYE 5DGTA 4OSOA 2AJ4A 3QHAA 3T3EA 4E14A 1JYSA 1ZM9A 3R5JB 2FF5A 4H18A 2NTJA 1JPVA 2YRXA 5C24B 1HBOA 2OMEA 2A0KA 1BUXA 1ADBA 3MBIA 3A3NA 3OURA 3SQDA 1M1KT 3TVTA 1LV8A 1EB0A 4BFSA 4URGA 2A78A 3CY6A 3MR6A 1XRRA 4TTAA 2PX2A 2OC9A 3FUCA 3SV4A 1FFWA 2SHKA 4JVLA 2BKEA 4ASUA 4E08A 3KPJA 4MPDA 3D4PA 2ZBEA 4MAAA 3UNXA 5NULA 2AYZA 1MABA 2VK4A 4C0OC 2FGJA 1TT7A 1VQOS 5IDWA 1VOTA 1LI5A 4R2JA 1JJ7A 3INYA 4EHNA 1BU8A 4Z0PA 3QNWB 2CFCA 4MV0A 3LBYA 4A5OA 4JI5F 4FB4A 2MYNA 1CU1A 2GLUA 2UVDA 2LTAA 5COAA 2JIPA 3T3NA 1G8KA 2FGOA 1IXSB 4C4XA 5L40A 1DRWA 3IOEA 4V0ME 3IL2A 4LV5B 3IRXB 3ZV5A 2C20A 1V2HE 2QHXA 2C2ZA 3TAXA 1I94J 5HFAA 3ZW9A 2N7CA 2HKEA 3EWSA 4PCVA 1TUWA 1HW9A 1GN9A 2RGAA 3AR3A 2RI0A 5IDYA 1VTKA 4U8VA 3H5AA 4EKGA 2HGLA 1ESDA 2VUUA 4ED1A 3V7UA 1H2TZ 4KP7A 3EODA 4JI7B 1XRMA 2RGUA 4QSMA 1GRVA 5K05A 3D5MA 2ID7A 5MN5A 5AVSA 3ZHXA 4BMNA 3PKJA 4KQ9A 5JDCA 4V03A 1RLTA 4O8CA 1N6QA 4E2ZA 4HUTA 4MW9A 1I7QB 1RZMA 2R4QA 1N2SA 3MWLA 1S48A 2B99A 2XNHA 1YWXA 4EFAC 4ZCIA 1ZNYA 3UT5B 3UV6A 3MUFA 4OK5A 4MTCA 4UNPA 4AL5A 2D3UA 4DEVA 2C5SA 1I01A 3LI2A 3BWXA 2D1YA 4I1RA 4IH7A 1GPNA 3UCUP 1SQGA 5JMWA 1H1LA 3I2GA 5KVSA 2BF4A 1EFLA 2ZJOA 5E0OA 3H5VA 3MAAA 1VYAA 3IDZA 4V3BA 4BQPA 4Q45A 4RGBA 4HLBA 5TNXA 2INGX 1NDUA 3DE1X 3JU3A 3FGNA 4JUIA 1L8LA 2FMIA 4HYEA 5FBZA 3P45A 3KSRA 2DJWA 1W36B 5EOVA 1I6KA 1QR2A 5I8ZA 1BQXA 2OBYA 4LR9A 2XLJA 4ZO8A 2FFQA 3I4HX 3DVAB 1SBZA 3L3BA 2FPXA 3QGMA 1K0VA 1KJWA 1EB9A 4NEGA 4V19X 3KKPA 4LIWA 3V81B 2RGYA 5TPWB 1NUHA 4Q7MB 1I0IA 3KVVA 5CZXA 3FKJA 4BP3A 4BLGA 1URNA 3ZZMA 3LGHA 4FR2A 4JQZA 3G6WA 5D0HA 1IBMJ 3SJAA 1Y9JA 4MI9A 4IDCA 2Q41A 2ZH8A 5FTWA 2CW5A 1TCUA 2JAQA 1RD4A 2IC5A 2G67A 4CTKA 2ATXA 4OL9A 2RT3A 2WPDD 2XWQA 4JJIA 3SQGA 1X8KA 2VJMA 5DBOA 1M1YA 4FX2A 3KEQA 4W8HA 1H5UA 5ESWA 3KU4A 4RKEA 4WXOA 1P9NA 1U5BB 3KLEA 4HXYA 1BMQA 2IHNA 4IQGA 3Q7QA 2FG6C 2A1UB 3DJYA 3ANXA 1EXMA 2ISCA 4DVGA 1JG2A 2ZNZA 2Z1MA 5E9WA 1E0KA 3QBEA 4LQLA 4RW9B 5HPYB 2FV8A 1N6LA 1JEDA 1VHFA 4WF9Q 1I9CA 2I54A 1GRQA 1U0OC 1HE3A 3MD1A 2GRJA 4XD2A 3GDWA 4ZVLA 4ZA2A 1MENA 2IPOA 1C9MA 1KY4A 1RHKB 4C2AA 3W6ZA 2A5DA 2X1AA 4HVAA 2OHXA 3TA1A 1XMIA 3ZG6A 4KLRA 4XR9A 1KC3A 3I05A 5HM8A 3I04A 5P21A 2GWHA 3PWSA 5CYMA 1SNYA 4G1UC 3I5AA 3UM9A 4D42A 2IXAA 3X1LB 2QT9A 4LHYA 2YRWA 4Z9FA 1ZESA 2CLFB 2XVXA 3NOGA 5JCPA 4MIOA 3ZE9A 1TKAA 4Z1OA 4FBGA 2FHJA 1ODTC 1GQYA 3DLIA 1N77A 3ZV4A 5M5BA 2PTHA 4ID5A 2P9ZA 4PFJA 3W3SA 3NXKA 3VAIA 5EHZA 2EJTA 2NTYC 5A5DA 4ZVPA 2JLXA 2ZB8A 1JR2A 3ENNA 3UCFA 5CDGA 1I0ZA 3IVGA 4B5LA 2D54A 2R65A 1H74A 2XYPA 3ZDXB 2F7VA 1RACA 4BB6A 5SV2A 2QX7A 2HLHA 4JHLA 3DE7X 4YAUA 2Q8QA 4IIXA 1R8XA 2XH8A 3B6JA 3JD3A 2CA9A 1CEYA 2QMEA 5DLFA 1PF7E 3DAGA 3PV8A 1WL8A 3HGTA 4RCYA 3PQDA 1BH6A 2PN6A 1WU8A 4HR7A 3SC2A 2Q43A 4ZA1A 3GC6A 4EW6A 4LNAA 5A4DA 3ZGXA 1HNXB 3J7AC 1NVDA 3C6YA 4QRIA 1U5CA 4WFBQ 1N6HA 5KT2A 4TWIA 1QBGA 3JVEA 2J5KA 3UNYA 4Q3LA 4IV0A 4UC0A 3CKKA 3W2FA 4B02A 1P6UA 4TVOA 5FBRB 1U2GA 3HVHA 1UL1X 4X7RA 5CDFE 5C53B 1YIOA 1CB0A 4PG7A 1NFFA 3STWA 3GMIA 1RXUA 4MAMA 4DIDA 3ZE8A 3U7RA 3O4JA 1J8FA 2G17A 3LQ4A 1SXJD 2WJHA 2ZKLA 2HQFA 5F35A 4F1KA 1NR5A 1IE3A 1B0UA 2HHLA 1KKLA 3JYHA 3C24A 2C5AA 3LSTA 4MIWA 3QE4A 4JLDA 1OYYA 1P39A 4B9MA 4G56A 4AJ9A 4IQ4A 3NPMA 3NBMA 2X40A 2ZIGA 4DMZA 5IH7A 2IX3A 3SHVA 3MINA 4B3HA 3H9GA 4N03A 3U7QB 3VVLA 5JD5A 3GZTB 3M5WA 5BUCA 3D6UA 2GD1O 3KTFA 3RIMA 2YXEA 4RHUA 4TMZA 1Q0SA 2OEPA 3R5KA 2ACVA 2JARA 1UCNA 3OIUA 3I8OA 3IMKA 2GXUA 4I4BA 1M34A 3GARA 4WKNA 2OO5C 2Q07A 4BN0A 4A8JA 1J99A 3MS7A 2BMJA 4XD7D 2D7SA 4ZLJA 4YPVA 3BHIA 2EBHX 3SDBA 2VP3A 4DSNA 4RX1A 3EZOA 5ETPA 2BH2A 2VK1A 1LDNA 2LV8A 4H16A 1YQXA 4ED6A 1KJQA 2I4OA 3QZ7A 4BPRA 3T94A 2RGDA 3KYCB 4B79A 1NW7A 4EVSA 2JZOA 1EWQA 4NBVA 1P2SA 5JYEA 4AXBA 3GAMA 3NIFB 3BN4A 5F1KA 2Q6VA 5FTNA 1NRIA 1Q3TA 3TOVA 4KPCA 3GUZA 4P58A 2G9ZA 3LTEA 4MV6A 3EFEA 4KVFA 2XJ9A 3BDAA 4K9PA 5I47A 5DG7A 4JBGA 1W1UA 2R48A 1LQTA 3Q23A 2AOWA 3IHWA 4G4JA 2QTTA 4ZCMA 4DQLA 4M0CA 1SUSA 5CVJA 1RHJA 4EW2A 2GEJA 1CEXA 1C7QA 2ZYVX 4EYGA 1YBHA 3RV3A 3Q3VA 4YJ3F 3AXSA 2HF2A 4MA4A 3DDIA 3W1YC 1W2GA 2R3SA 2BW7A 5HBMB 5H82A 1E63A 5E3IA 1X0FA 5EIOA 1KDZA 1ZRSA 3VR0A 2D1RA 3VVTA 1NPPA 1UKEA 2M6LA 2WZQA 4TPKA 4OYAA 1Y80A 4ALJA 2BBTA 1W44A 2JAUA 2RC5A 3VO9A 2EW1A 1MC4A 1MQAA 1TUGB 4JIGA 5LR6A 1MTOA 3FUUA 3G2XA 2G88A 1VR6A 3UCZP 2GM5A 1F2UB 4NOMA 1U2CA 1Y3KA 4N8EA 4D0GA 2AGQA 4B3MJ 4QA9A 4LZWA 3RUCA 3OQ6A 3DEJA 4YTEA 4LFAF 2D0PB 1BVUA 1IBCB 1E1CA 1ITZA 4DLPA 1S1WB 4KZKA 4XB6B 2AV6A 5F2EA 4ERXA 5B0EA 4G1FA 5IKOA 2C5GA 1FNXH 4D3FA 3MLAA 2YFYA 5IVKA 3CVJA 2VVTA 1OXBB 2ECPA 2BFFA 2XB2A 5LXTA 2YWXA 2ZC3A 1DLOA 1IAVA 3AF6A 1XXHB 2WIFA 3U37A 1WMEA 1PQWA 2FLPA 4IHJB 5JVDB 4RK6A 1ZVJA 1AOXA 5BR7A 2H2AA 3WNZA 2ZBCA 1ZH8A 1ODKA 1ATIA 1UJ2A 3N2GA 5KFBA 1U02A 2X3FA 4RPCA 3L6EA 1GUZA 2WTEA 2C9OA 1E18A 2HAFA 4Y00A 3Q3IA 1ZRHA 3FCAA 3QNWA 2ASLA 1UBKS 2C5LA 1J25A 1KSGA 3KKEA 1UOPA 2ZH7A 3DULA 3O3NB 1WC4A 2JFUA 1T7PA 3PNIA 5LOVF 4EX6A 3MIIA 3MM7A 2FI1A 2ZD1A 1FXUA 3CB4A 2ZI3A 4QUKA 2UXBB 1IVNA 2MJNA 1NYRA 2XAAA 2XYGA 4NZ9A 3FFIA 2D7CA 2W4IA 3PNMA 1GTEA 3ZDEA 3LDGA 3PTZA 3QWUA 3CC4S 2W93A 1FFEA 2JC0A 4Z8XA 1B8OA 2JA2A 5LYJA 2EFPA 3T9EA 1SKRA 2HHPA 1DURA 4YAJA 3ZGOA 1LVUA 1HYGA 2FMKA 5BSUA 4CN9A 3KQSA 3MTJA 5EMHA 1NMSA 2C2OB 4QOHA 4F3NA 2OV2A 2HURA 3QQ5A 4PYKA 3VC7A 5AMXA 3KJQA 1CX9B 4UTVA 1FCAA 1ZCJA 3VYRB 5B3KA 2LWIA 3WBZA 2YHSA 5CURA 4DA0A 1N5QA 1A77A 3OTDA 4GT1A 4P10A 1SXHA 4FT2A 2HNKA 3V3TA 3IKTA 2BSQA 1U28A 3D4OA 4FDFA 3KOZA 2H9YA 2QJOA 4FW8A 2RS2A 4KGVB 4DUTA 4XX1A 3I37X 4ZVTB 4XDDA 1WOMA 1RKQA 1WU7A 4B80A 4BIIA 4K4XA 2BQRA 3ESAA 2C4TA 1UWBB 4UVEA 1FRNA 2P79A 3HDYA 4LVUA 4AT1B 3P9KA 4AJOA 1KP6A 3PEFA 1RDFA 2ERYA 3RU0A 1RM4A 4DUGA 1QF6A 3ZC3A 4L08A 4PQYA 2X1VA 3A37A 3CWQA 1VKZA 5GJVC 1JQDA 1T1GA 4X64J 4WPAA 5FLXA 4JP5A 4KDEA 5KAMA 2IHBA 2JIQA 3NPAA 1ZJYA 5AFSA 4N8NA 3EIFA 3LY7A 4CQNA 3KPVA 4FFWA 2PSJA 4OZLA 2GA7A 1J8VA 3I12A 1T3GA 5NLLA 5K6RA 3PQ5A 1EFVB 5LJIA 5GJCA 5AR1A 1K4YA 1ZR2A 1FPQA 2JJYA 1DHMA 4XWYA 3ZTYA 4HQRA 3SCZA 1Y00A 5JCJD 1RT6B 3TQCA 4Z0TA 1U48A 3VAZA 3GJ4A 2XNSA 3K8WA 1NYTA 1U2DC 1CZKA 1VCOA 1J9ZA 4K6HA 4ECVA 4DLBA 1GAQA 1DIHA 3RUEA 4MHOA 4DC0A 2CPIA 4BQOA 2XO6A 5E3RA 4KR6A 2EJBA 4TWBA 1WJ9A 2QRJA 3ISJA 1O0SA 4UVGA 1YE8A 2JIDA 1FTRA 4U2KA 2PM8A 1X7GA 1XZHA 5IYZB 4Y6QA 3CNEA 2FEXA 1DBIA 1J5OB 1A7KA 4WI1A 5AKXA 4IHJA 2GBFA 1N7JA 1HYSA 3EXCX 1VKOA 3DZGA 1AH2A 2WBLC 4MDEA 5AM3A 2QD1A 2H92A 2XVAA 2Q5HA 4Y98A 2IPNA 1RLIA 4LF5F 3OQ2A 5HF5A 1PCXA 3I30X 4RH3A 2JLFA 1FVQA 3C2PA 4FXPA 3MMJA 3IP1A 3M6WA 4UTZA 1SUEA 3SC3A 3N6XA 4LJKA 2OD6A 4MLDA 3R5AA 2P41A 4MUIA 4LOJA 2GK7A 4WCEQ 2N46A 1UFLA 4JLPA 4Q03A 2HNAA 2FR1A 4G8CA 5K8JB 1HBMA 3WRYC 3AB2B 4RZQA 4DQKA 4HB4A 4I6YA 2LCFA 4YT8A 1U26A 4FYYB 2JANA 3NAZA 4KFCA 2ILTA 2R62A 3UN2A 3ABZA 3WYNA 3CT6A 5H4GA 3H90A 3PD1A 3T1HB 5IXSA 3BK1A 3STUA 4J0DA 3EXHA 3OFNA 1ESEA 2IFXA 2WHQA 4BC1A 3ZEIA 5KG3A 2EWWA 3CRRA 4XEHA 1N3LA 5LP1A 4MKRA 4G36A 2PT0A 1E3SA 3HHNB 1QSSA 3MM8B 3IJEB 4Y2AA 4GZMA 2MKHA 2C4NA 4L4UA 1YQWA 5TC4A 2C83A 4ANDA 2VDMB 2FWRA 2Q2WA 4DOMA 1I33A 3VO1A 4NYJQ 1DAKA 3IJRA 1LQ9A 1NW5A 3VTKA 2Y99A 1EG2A 3THWA 3DOLA 1ONBA 5A02A 2Z95A 5JZ9A 2P0YA 1D2EA 1NJZA 2GJ8A 2LXNA 3CZ9A 3M1AA 3CF6R 4Q4LA 4I8XA 4YJKA 1UPBA 2R7XA 2V4JA 1P4JA 2H29A 3OETA 3RW7A 2EKPA 2J8AA 1X3LA 3QO9A 1E6YA 2X0DA 5DTMA 3BSYA 3NM4A 1MB2A 1H0RA 1M6EX 4HHJA 4M87A 1JAHA 1LW2A 1IMOA