2ZEJA

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
177
structure length
157
Chain Sequence
b'MKLMIVGNTGSGKTTLLQQLMKTVGIDVKDWPILVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat kinase 2
publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 157
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 2zejA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zejA02
2BBWA 2ASEA 2W6ID 5CJ2A 1WRBA 4IKEA 4JIMA 2PBRA 4KFUA 3SC3A 3W5JA 1SXJB 4GI7A 1CJUC 3P26A 5JHGB 1KYIA 3BIFA 3GEEA 4BFSA 4HDCA 3L43A 3CNOA 4Q1FA 1GITA 2OBMA 1EFUA 2BEKA 2NO0A 2R6GA 1UPTA 5DI3B 2WM9B 2IYSA 1M7BA 4G5SA 1ZD1A 4R2IA 1GSIA 2NIPA 2FZ4A 2GESA 4JLMA 1EX6A 1WQ1R 4KVGA 3FVQA 3FWYA 3NDPA 4PFSA 3X2SA 1QHHB 2DBYA 1T5IA 8OHMA 2GJSA 1S96A 3ZVNA 1FP6A 2EW1A 1U0JA 2HYIC 2GJKA 2G83A 1W2HA 2F3RA 5AUQA 3SDZA 4B48A 4B71A 2QP4A 3HPQA 2HT6A 3CZPA 4P0TA 4DLRA 5JJKA 1HEIA 4DEYA 2WBLC 4HAZA 1DE0A 5F98A 2BOVA 4LC0A 4ABYA 3FHTA 1JEEA 3AVYA 2OFOA 3VR4A 1DO0A 2CE2X 3CPEA 1XBTA 4M9XA 2KSQA 2NO9A 4JL8A 3TQFA 3GLFB 1S3GA 1P9RA 2W0MA 3IUYA 4AKEA 3RS3A 1W4AA 1UKVY 5FPHA 4NYJR 4LV6A 4JSYA 2HF9A 2ZI3A 3TVDA 3IKJA 2WJYA 4C7OA 1IJEA 1UKZA 1YHNA 4HZUA 3EPJA 4DUGA 3HPRA 1HT2E 2O5VA 2VSFA 5A4JA 2J45A 1XTJA 2BBOA 1QHIA 4AKHA 2OV2A 5LB4A 2AWNA 3SHFA 5E3HA 4FXPA 3UPUA 4TZ0A 4MYHA 1B0UA 2Q6TA 4M22A 1DARA 1YRBA 1VHLA 2RHDA 2DR3A 2XGJA 1VTKA 4NYJQ 3CNNA 1ZC4A 2JASA 2BBSA 2IYRA 1P75A 1U81A 2W58A 2OFWA 2FE4A 5C46F 3FFBA 4LX0A 5FUXA 1N0VC 2NGRA 2YWEA 4YONB 4DCNA 1CULC 5FBRB 4V0LA 1S4QA 1BMFD 3AP1A 2F6RA 2HF8A 4QNMA 1ZCBA 5CITA 1UJ2A 1MO3A 1ZIPA 5GJWC 1G17A 4IRUB 4Q7MB 2D4HA 2KB0A 2ZRDA 2QN6A 2YNMA 4QBHA 3KXLA 3EXAA 3OIYA 4I1SA 3UG6A 1KO5A 1MO4A 4FIDA 2ZXUA 1XTSA 3OEEA 2FSIA 3EZ7A 2OG2A 4D0LB 4Q19A 1G7TA 2NPFA 1II8A 3DM9B 4LWZA 1Q1EA 4DLUA 1DG1G 2KBEA 4NCJA 4AYWA 2Y8EA 5E7MA 4OQLA 4PC2A 4B6FA 2EFGA 1N0WA 3RS0A 1ZM3A 1FMLA 1SULA 1QRAA 1XEXB 1IBRA 4NL4H 3VKGA 3KKNA 3O8DA 3PFIA 3LW8A 3SI7A 2A5YB 3M6AA 2AK2A 5CYPA 2RKOA 3P4XA 4MH0R 3IPXA 1D5CA 1OSNA 2A30A 4KAXA 1KI6B 3N2IA 3GJXC 2ZI7A 5TY0A 3TBKA 3UATA 1GNRA 3OEHA 2GCPA 3K70B 2B7BA 2QE7A 4TLAA 2DFTA 1DVRA 3QKSB 4NYMQ 2X1VA 1XMIA 1MV5A 1SVKA 5CK4A 5KU1A 1P2UA 2VYFA 2YWFA 3BJIC 3EIQA 3ETLA 1WBBA 5FOVA 5DHFA 4MYCA 4S35A 2IBMA 4A0FA 3AVWA 2HXYA 4V0ME 4J0QA 4TMVA 2DPXA 4FMDB 3FHCB 3EG5A 1XD8A 3B8HA 3TSOA 4HAVA 3CRMA 3RRYA 4P4SB 4GPTA 4Q48A 1P73A 1KNXA 1MR3F 1WMSA 4OL0A 3TW4A 2HJVA 1EGAA 3QXJA 4H1UA 2DYKA 5CB8A 1JBKA 1KSFX 1Y63A 4DSOA 3AUXA 3B6EA 1E2PA 1KDRA 4FMDF 1KI2A 2FMXA 1E9RA 1R5OA 2XNDA 1P72A 4HUQA 1GKUB 5H1YA 4BFXA 2XTZA 3VU9A 1P61B 1QHSA 1D8TA 1OKKA 1ZU4A 1Y3AA 3GLHE 2QORA 5DLQC 3TSZA 1ZW6A 5FUYA 2QBYB 1LS6A 4IDHA 5TXGA 2VHQA 3RNLA 3A4MA 2NO1A 4G5QA 4MITA 3PQCA 1G8YA 3T1OA 1QF9A 2GF0A 3GFPA 1W2GA 4UNSA 1T3HA 4RZ2A 3BAFA 3W6PA 2QGZA 3EIEA 1M34E 4MGZR 4MKFA 3EC2A 4D4KA 4DB4A 2ZANA 4LBVA 2FEMA 1MABB 2Z4SA 3HU1A 3Q5EA 1ZCAA 3BGWA 2W6IA 3MCAA 3AF1A 1OV4A 3EPLA 5EZ5A 4LPSA 1GL6A 4A15A 5SZHB 1LW7A 2ZR7A 1W7AA 5KNDA 4CEIB 4DB2A 2C5LA 4US2R 2ZJBA 4E03A 5BYKA 1AS3A 4ZKEA 2ZRPA 4DDUA 1E2EA 1YZQA 1NG1A 2GXAA 3QF4B 4CEHB 2OILA 2XXAB 2AD5A 4OI1A 3ICEA 1N5KA 3WY9A 4K46A 1F2UA 4MRSA 2V1XA 1US8B 2WSSD 1NIJA 1F6BA 1L7VC 2IYLD 4RCZA 5FBWB 1DPFA 1X86B 5F2EA 2G6BA 4ZCLA 1JXOA 2FFHA 1OFUX 2R44A 3JVUA 1AM4D 2EFDB 4PPNA 2A7QA 3PENA 5DGXA 2QP9X 4LHXA 1F3OA 3GQBA 3I92A 4D26A 1IN8A 1P2SA 4GP7A 4JLKA 5HTKA 1E1QD 3GFTA 1ZUIA 2PT5A 3V4FA 3MSXA 4AYTA 1JI0A 4N3NA 3VTKA 5EZ6B 3NG1A 3GEHA 2GXUA 2ZSBA 5BN3A 3TUZC 2OBLA 4WBSA 4HDQB 2KBFA 5BYJA 2P0EA 5JCPA 1IJFA 2JA1A 4P32A 2XSZD 4Q1EA 1T6NA 3TR5A 1HYQA 2ECKA 4M0LA 3K53A 3A6PC 4OYHA 2EWVA 2P6RA 3THXA 2ZSFA 4IOKA 5E4FA 3K1JA 4G01B 3FFAA 2O0KA 1D6JA 1G18A 2GNOA 2IYYA 2WWHA 5B58C 1S2MA 1Q20A 1S0UA 4TL9A 3B7GA 3RANA 1KMHA 2BMJA 1NVUQ 2UZ3A 3VMFA 3CF0A 3TQCA 5KOYA 3BE4A 4TLEA 3A1VA 4R71A 1T0JB 5CIQA 1SVOA 1P6XA 4WZAE 2X2EA 1XMSA 3V4RA 3KJIA 5B64A 4BE7B 2UVQA 2IC5A 4MDEA 3B9QA 1W4RA 2OXRA 4HI0E 3FMFA 1DAEA 2MSEB 3C14C 2F9LA 2R62A 3CX8A 4ACAA 3BB4A 3I1FA 1BMFA 2F43B 4LC1A 2F7SA 4BPBA 1Z08A 5AUOB 3I5XA 2J9RA 3SFVA 1GWNA 1NVVR 3H84A 3UMFA 4D80A 4OI4A 4CW7A 4BFZA 3GD7A 3OIUA 3G0HA 5FL3A 4B35A 4D81A 1Z6YA 2AX4A 4B43A 5F9HA 4PO9A 3X1DA 4HLQB 3U61B 1YZLA 1W44A 1SXJD 2F1RA 2VSOA 4PAQA 1Z47A 4JVLA 4OHYA 4MQBA 2UZIR 2V4ZA 3U44A 4MDFA 3U3KA 4RFVA 1XCPA 4KBGA 4A2QA 4RD1A 3GJ3A 1VDZA 4QBIA 3EX7C 4AG5A 2ZR0A 2WJVA 3LDAA 5CIWA 3LXRA 3PEWA 1NVVQ 3KL4A 4IDOA 3GLIE 2DFLA 4JKIA 2G88A 4A82A 1U90A 1JXMA 2GEVA 1E96A 5FOXA 3UIEA 1TQ2A 1W47A 2A2ZA 1E4VA 2VEDA 6Q21A 3AB3A 1AKEA 1CTQA 1J90A 2VBCA 2VP2A 4A6PA 4R9UC 4DJTA 2V8OA 1J8MF 3GJ0A 1R5BA 3QF7A 1D2NA 1PLLA 3BXZA 3DOFA 5D3QA 5AWFC 3KJHA 1G7CA 1G7SA 1G3UA 4D82A 2WJJA 4QOSA 1K6MA 4V0KA 4DLTA 2Z43A 2ZS9A 3LLUA 3QPUA 2Q9CA 2ERXA 2WWFA 4JBWA 3MJHA 4RJLA 1A7JA 4X8HA 3T1VA 5LPNA 5HZKA 3K09C 4PZLA 4YMVA 2PLRA 2JLRA 2WWIA 4KFSA 3R9WA 4RFSB 4UQOA 5AUPB 2WTUA 4KCGA 2J0UA 3CLVA 4DDVA 1AGRA 4B73A 3UMSA 4CIDA 1KMHB 4X8LA 4DIEA 2HV8A 1D9XA 3TW8B 1QG4A 3CNLA 4LOAA 1SVLA 5ELXA 3IEVA 3ICQB 3CIOA 4MGKR 1KI7A 3OFND 2FPKA 2J46A 4GOJA 3TR0A 4I1VA 3RAPR 4XVQA 5G41A 1G8HA 1ZBDA 3GLIB 4F7WA 2IWHA 4C0AC 4AKIA 2O8BB 3T06B 4FWIB 1GTVA 1S9DA 4KLZA 2L0XA 2XZOA 4PSAA 4YXWD 3FMPB 3RS7A 5BN4A 2AKYA 3K0AA 3GCGA 3AUYA 1G8PA 1E0KA 3QSYA 2REBA 2DWPA 2ZYUX 3DKVA 5JSZB 1EFRD 1A5TA 2Z5FA 1Z0IA 2OBNA 2BDTA 4WW0A 2IF0A 4EFNA 4PHFA 4UNQA 2OZEA 2C9CA 1ELOA 2BM1A 4Q02A 5F3WB 2ZS7A 4A92A 4LV8B 1GRNA 2P65A 3UKDA 1KDPA 2E9SA 4XWKA 4Y0AA 4NPHA 3I5YA 1XPUA 3CRVA 4Q4HA 5AK0A 2ATVA 5KSOA 3L8YA 5FTMA 3AF4A 1G5RA 2FGJA 1Z6TA 3BB3A 3C41J 1L2TA 1TNDA 3HWSA 3IBYA 1R6BX 5KDLA 5GADl 5KUTA 3DHWC 2D7CA 4ZO4A 2AD1A 4KITB 4AI6A 4DBLC 4CEJB 1XD2B 4K81B 1MO5A 1NRJB 1K8RA 2FG5A 2C04A 2PCLA 2V6JA 2ZYWX 3AQ4A 1O87A 5DIFA 4CGZA 4NMMA 2WSSA 5JWHA 1PLKA 1ZC3A 4FINA 4KFRA 4DIDA 1FTNA 1SXJC 4PO1A 1BOFA 2VF8A 1M74A 1Z22A 3K09A 3FKQA 4YQFA 1XZPA 2F9MA 5CM8B 2CDNA 4C0LA 4ARZB 5KPDA 2BJWA 3DDCA 3TKLA 3I62A 2IYXA 3LBIA 1GDDA 1H8ED 1E1QA 4JYCA 5D3MB 3SN6A 2RMKA 4ZDJA 2ZRGA 4TYPA 3V00A 1QHNA 4A0RA 3NBYC 2YYZA 2JJ8A 3CB4A 3I3SR 1IN4A 4O2LA 2XSZA 3BRWD 2FZLA 1XJCA 2QTVB 4FI3C 1EFHA 3THWA 4YC7A 3AF3A 3CX6A 3LX8A 1IQPA 3RSOA 4G5RA 4DLSA 4C0JA 3ZZTA 3KQHA 2CE7A 4X8MA 1RJ9A 3A37A 4QJ5A 3LV8A 2G3YA 1ZP6A 4RD3A 4O25A 5G53C 4ESVA 2AXPA 4IDQA 2QPTA 1CJTC 1E2DA 5TV2A 4A2WA 4DLYA 1NP6A 4ZDWA 2LCFA 2J0VA 4BFUA 2I1QA 1VYTA 3IIKA 3S1AA 1KZ7B 1XB2A 1R0ZA 4PQRA 3MGCA 5FI1B 1PLJA 1XCMA 2R9VA 3MG9A 1DEKA 3NC0C 4TMXA 5G40A 2IYQA 4LPKA 1VKJA 2NO6A 4US0R 3VHXA 4QHTA 2C99A 1XXHE 2A5JA 2RB4A 1R0XA 3KKQA 5FL7D 3T15A 5K8LA 2CK3D 1VPLA 2OLKA 1T91A 2PJRA 4Q4HB 2BKUA 4XD7D 5DH9A 2QROA 1GOTA 1YZKA 2QEQA 2FNAA 3A8TA 5HR5A 2W2XA 5JS8A 3RWOA 2Q9BA 4D4JA 2FA9A 4ZI2A 1N6KA 3THYB 2FPLA 1GFIA 4U00A 1SXJA 3H4MA 5KNCA 2O8EB 2VSXA 2IXEA 4Q9LA 1Z0AA 2FJUA 1X8JA 4CZ2A 1ZUNB 1QDEA 1RC8A 2I1VB 2H18A 2RGNC 5KHOC 4FMCF 4CT4B 1PUJA 3PUZA 2CCKA 3EC1A 1Q0UA 3SR0A 3C15C 4JLVA 2CBZA 3HP1A 3IHLA 4LHZA 4TLCA 5TMPA 5DI3A 4EPYA 1SGWA 4PPFA 4A9AA 4IVRA 2BKEA 4HAWA 4JJKA 3LVQE 521PA 2CVFA 3RWMB 1RRFA 1QHHA 2G9NA 2H16A 4V02A 2ZR9A 1VCOA 4AURA 2VP4A 2MSDB 1R8SA 2VF7A 1MO6A 1NJFA 5CYOA 4TMKA 5FOSA 1XP8A 4HZIA 1SKYB 4PQYA 4Q1BA 1CJVC 4U5XA 4I1OA 1W49A 2FSFA 2W6JD 2Z0MA 3CRRA 1T4GA 1XXHB 4BLQA 3RABA 4KFTA 4PR0A 4M1MA 4UNPA 4PC1A 3ND8A 4DHEA 4C4PA 3KQKA 4PC6A 3LH5A 3QPWA 3LW7A 4LHVA 1JNYA 1R5NA 4E07A 5J4KA 3WHKA 4HYYA 2WOJA 2AWOA 5E7JA 1QHGA 4PC7A 1KAGA 3UXMA 4M1SA 2ZM5A 2DWQA 3SYKA 3PUXA 4LI0A 3A4NA 2BHRA 1KOFA 1F2TB 1LY1A 1WDTA 2CHGA 2O52A 1VG8A 2NG1A 4FCWA 4LK2A 3SS8A 3TVTA 4EJSC 2TMKA 3OIWA 3IQWA 5CDFE 3OFNA 1L4YA 2GILA 2JAQA 4HLUC 1AQYA 4M8NE 4DLVA 4E22A 2HJGA 2GAAA 5J40A 4XWOA 4WZBE 4AWXA 1IY0A 3LWNA 5EXTA 2PL3A 2JGNA 1Z28A 4MRPA 1EWRA 1OT3A 4YXWA 4NDZA 4M1TA 3GPLA 5J4LA 3AH8A 4XH9B 2DWOA 4YMUA 1E9FA 2QGNA 2VHCA 1RRPA 4LBZA 2V6IA 3BBPA 3SYNA 1NN5A 1EFRA 2MSCB 3W3ZB 2AFHE 2XB2A 1RE0A 2VO1A 2RGNA 3NKVA 2IS2A 1KHTA 1CJKC 4DSTA 1CR2A 3BH7A 4TTRA 1RVDA 1SHKA 2WAYA 3LY5A 3D7MA 4DZZA 1NF3A 1S3SA 3OHMA 5BWMA 2AK3A 1CRQA 3PITA 3W8RA 1G5TA 2O0HA 4QNRA 5GJBA 2BV3A 4M21A 2JLSA 4MGYR 4QHYA 4TN1A 2OT3B 2WKPA 1G3MA 3X1YA 3LFUA 3W9YA 1DELA 1XF9A 1JR3D 1JEDA 2IT1A 2OEPA 1VG0B 5HE8A 1ESMA 4RKEA 3RLFA 1ZM4A 1VIAA 1AK2A 1OHHD 4HSEA 2F55A 4GMDA 1NNEA 3IILA 4JT2A 4QC2A 2ZJYA 1CS4C 4P3YA 1XEXA 4Q4LA 3A4LA 1U99A 3N2EA 3P27A 4FN5A 1IN5A 4NU0A 5IDVA 421PA 2N42A 4QBGB 3KB2A 1GP2A 2LKDA 2IL1A 2EYQA 2W2VA 3BOSA 3KJGA 3MRSA 5LBIA 1KKMA 1XTKA 3W8NA 1KI6A 3WBJA 5GVSA 5IK2D 5JECA 3EPHA 2GF9A 4QM6A 4Q47A 3QKRB 3M4YA 1H8EA 4C0HA 3QKSA 3T5GA 3K0SA 2BBTA 4C0QC 2ANCA 4PHGA 1QBKC 4EJSA 3J81k 2YINC 2J0SA 3EWSA 1GZSA 5EXPA 2C78A 4ZDKA 4JL5A 5JBQA 1P4SA 2OE2A 1NSTA 3ZQJA 2ODNA 3U60B 4P4SA 4Z51A 5DYGA 2JIZD 2RGDA 3I4LA 3G5UA 3P1JA 1C1YA 3T1QA 4CRWB 4EPWA 2H92A 2WMOB 2D74A 3R7WA 1IXSB 3R20A 1E2KA 3A1SA 3FKSD 1XD9A 1PZNA 4Z8YA 3L2OB 2ZPTX 1T3LA 5KTYA 2EWWA 1K5DA 3VHLB 2FX3A 4DSUA 4OQMA 2BCJQ 4G3XA 1NN1A 4YMSA 4XIGS 4NBSA 3K0CC 1II0A 2ZSDA 2BWJA 2H1LA 1XMVA 3NEJA 4XSGA 1KK3A 1E2JA 1XWIA 1ZUHA 2OESA 1V43A 2Q9AA 5TDHA 4DLZA 4TYNA 2QBYA 3B85A 2GRJA 3K9GA 5E95A 5G3YA 4B2LA 3L0SA 4EIWA 3T61A 4OQNA 2ZRKA 3TRFA 1G4AE 3LVRE 1A2BA 4C3ZA 4M4SA 3RRNA 4DVGA 5FL7A 1E2LA 2CK3A 2XJ4A 2GZHA 1JQJC 1HE8B 3FDIA 4Q9HA 4XD7A 3VR5A 2ZE5A 3UG7A 5JEEA 1MABA 4HAYA 1PV4A 3TJZA 4OJKA 5HKKD 2W0SA 1RRCA 1PVOA 4TL6A 1VMAA 2FN4A 2QT1A 5EJEA 3PG5A 2IX3A 1G1MA 4IHQA 1GL9B 2K5UA 1Z8FA 2GCNA 2ZJAA 4PXAA 3KKPA 3MFYA 4NYMR 3REFA 5FTJA 4CEIA 4B76A 2HT1A 5FPKA 4IFEA 2VP5A 621PA 2H5EA 4ITRC 4QXAA 5H70A 4A8JB 3MJRA 2IF2A 4QFMA 1JAIA 4UXIA 1N0UA 3QVVA 4H9GA 1XEWY 1JPNA 2ZRCA 3QF4A 5EP3A 4CEHA 3LNCA 2RGGA 4PPQA 2XXAA 2XEXA 5FOTA 3K9HA 3ZH9B 1D2MA 3R9XA 1BYIA 1US8A 3Q3JB 4IFBA 4HAUA 3REGA 1UDWA 3HYRA 3ZVRA 1U0HC 1ZD9A 2B21A 1OB2A 3N70A 4LDJA 1E3MA 4C0KA 2CJWB 3QNUA 2QRNA 4LJ9A 5J5CA 3WNBA 3QE0A 2H57A 1P3JA 4EJSB 1ANKA 1OYWA 3CM0A 1I2DA 5JI3E 2W6JA 1KGDA 2ZETA 3K9NA 4BLTA 4B2IA 4RZ3A 1OXUA 4A2PA 1XPRA 1YQTA 2ZROA 3ZDQA 1NG9A 4EAQA 2QUZA 4MGIR 2ZVQX 1EFCA 3SEAA 4DLWA 1ZD8A 2P6NA 2FFAA 4D0NA 5LB2A 2CVHA 1A4RA 1E0AA 5KSPA 3R7WB 4TLDA 3K0CA 4QGHA 5K8IA 2OCAA 2CL7X 3SBDA 3UANA 2G1KA 3DPUA 5DI9A 1KSGA 2AKAB 4E09A 4RSGA 2ORVA 4P4UA 4B3FX 4BGDA 1Z5ZA 5EP2A 3MD0A 4BFTA 2J41A 2A5FA 2NMVA 1CEEA 5EE0A 1KO8A 2QL6A 2ZJZA 1IY1A 4EUNA 2VQSA 1XRJA 2WPDD 3KFXA 1HUQA 1P62B 1NL3A 1TU4A 2DCUA 3CUEF 4PTLA 4ON9A 2C95A 4RD6A 5GJVC 2RGCA 4HB3A 4L4UA 3GJ6A 3PCRB 4NTZA 1NN0A 2O8CB 2EU8A 1GUAA 2RHMA 3CH5A 1AQUA 4BRUA 2CL0X 4L5BA 4KBFA 1HA3A 1UF9A 3NVAA 4M1OA 2F43A 2NPIA 3ZJYA 1CKEA 1KK0A 1FW6A 1OFIA 4LHYA 3HDTA 2D3WA 3GEIA 5CLQA 4B3CA 1R2QA 1M7GA 1Q3HA 1KNQA 4YDHB 3SE0A 3KQNA 4I4LA 2GJ9A 2A5DA 1G64A 5HCIA 2J1LA 5FOUA 1R0YA 3AV0B 1Z6GA 2O8DA 1SZPA 1JR3A 2DB3A 1LV7A 3L0OA 1FUKA 3MMPA 2Q3HA 4F4CA 5A5GA 1OHHA 4PAMA 4L16A 4RD2A 1IM2A 5DHAA 1OIVA 3GLHB 4ACBA 4B3DA 4BQSA 5FR1A 4BECA 2HYDA 2IYVA 2A9KA 1I4DD 4B34A 1DAIA 2N46A 4ASUD 1TL7C 2EFCB 5FPSA 3UMRA 1KAOA 3QJYA 3DM5A 5CM9C 3VX4A 2CL6X 1T3SA 1YZNA 3CF2A 2ZIAA 2ZRMA 4GZLA 3BERA 1G5PA 3KTAB 4AY2A 5IK2A 1OXSC 2IYWA 2VPPA 2YWGA 3Q7QA 2SHKA 2BMDA 3DOEA 3U7EB 2YKGA 1BYUA 3SBEA 1E0SA 2OUKA 3LX5A 4ZCMA 4OK5A 3QUSA 4M1YA 1E9AA 1FOEB 1FX0B 5AJVB 1N5IA 2ZRLA 2P2LA 2RGBA 4XVUA 2WVJA 4BZPA 5C4MA 3OE7D 1FZQA 3LQRA 3PV0A 3LLMA 5EUMA 4XSHA 3QIAA 4RFSA 1L4UA 1Z63A 3IIJA 2QQEA 1IHUA 2JJ2D 1KY3A 1G19A 1JAHA 2JIZA 3U7GA 1GM5A 3AVTA 1A2KC 5FTLA 2ODEA 5J4YA 1F60A 1N6NA 1KDOA 1SVMA 2ERYA 1FQJA 3GJ4A 4JVMA 1JALA 1EX7A 1RW4A 2VTKA 3EA5A 4LY6A 4ZCIA 2JLQA 4KODA 3EZFA 3HYTA 4F93B 5H68A 2OAQ1 5SZIA 3ZYCA 1I4LD 3A36A 2V54A 4TL8A 4B47A 2D2FA 4Z1MD 1OH6A 1UBGA 2XTNA 3OAAD 3C16C 3GLIA 1EFTA 5LD2C 3DVLA 2O8BA 2P67A 2Z4RA 3C7KA 2Q0HA 2C03A 2QT0A 4FCTA 2ZAMA 1W5SA 5TB5A 4QRHA 1MRNA 1FL9A 4TYYA 1GIAA 1QG2A 5L3QB 5JSZA 2BJVA 2ZAOA 5HKKA 3BC1A 4EPTA 4KYUA 4Y0VA 2VH5R 2ZRJA 2CEAA 2ZRIA 3BD9A 1E2HA 1KKLA 2O8DB 3WYAA 1UAAA 1N6HA 2CCJA 1N6PA 2PZGA 2ZI9A 4GRAA 4R2HA 3WP1B 2ZE8A 4DDTA 1MKYA 2WOOA 3C4JA 3Q9LA 3RS5A 4EFLA 4AKGA 2IXGA 2JATA 4FCVA 3KJEA 3AF2A 5EUQB 2P5TB 2NZ8A 3Q5DA 2G0NA 1OLOA 4DCSA 3RYTC 3E5HA 1W36B 4JSTA 3T34A 4KSBA 5JRZA 3SJBA 4CEJA 3AVVA 1XD2A 1T0HB 4QBFA 5GVRA 2GHIA 4A0GA 1RRGA 3I8SA 4B44A 3M1IA 1GKIA 5FFMA 1L8QA 1C4OA 3EAQA 3RSLA 5ANRB 1KY2A 2ZTSA 3DZ8A 1VHTA 1X8KA 2VHJA 4NKRA 3B82A 3CH4B 3SZRA 1N6LA 1NKTA 1Q57A 2IUSA 4ESHA 5SZJA 2EQBA 2RGEA 4ARZA 4QG7A 2G0TA 4ZI3A 1XU4A 3H1TA 3U3JA 2DFKB 4OHZA 5D3MA 2PCJA 3I72A 5DN6D 3KQUA 3AP2A 2XAUA 1NBME 5KDOA 3Q72A 2PH1A 1VCNA 5IT5A 3T5DA 3C5CA 2AL7A 5L3VA 1KIMA 3KXKA 1DAMA 4D2IA 3ZQ6A 2PT7A 5BN5A 4R7ZA 1VIYA 4C2UA 2ZRAA 1W0JD 2ZE7A 4B33A 1QHXA 5C2JB 5L3RA 3SJAA 4ERNA 4TZ6A 4CF7A 3F3YA 5JLJA 4M1KA 1G8GA 1E2IA 1KJWA 1X1RA 4IW3B 2QENA 1XMJA 3RRZA 1EESA 4NCHA 3HR8A 4JYBA 1OYYA 2OSBA 2WPDA 4ZDIA 4JL6A 3A58B 4C30A 1IAQA 2FF7A 3ND9A 2IS4A 5LDDC 4RY2A 1J2JA 1X6VA 2HUPA 3GLGE 1WXQA 5EXXA 2UKDA 2NQ2C 3PIRA 4LUCA 3AVQA 1COWD 3CO5A 3NTUA 3B78A 1E32A 4Q4AA 1HT1E 3U3OA 1VG1A 4Q5IA 1OXVA 5EQTA 3RDPA 2H8KA 3FMOB 2RGAA 1G21E 4FD2A 3U6BA 1GKYA 4GT1A 3EZ6A 4GOXA 2NTYC 1CR4A 1N5JA 1GRRA 2BCGY 4AG6A 5DNYB 2B7CA 1U8YA 4KI0A 4NE2A 4B3XA 1GNQA 1NLZA 2B6HA 1XEWX 2GK6A 3B1YA 1Q21A 4NCKA 4JBYA 4Q1DA 3THYA 3ADKA 1E2GA 4EKDA 2O8EA 2GZDA 2OLJA 4HB0A 1SQ5A 1KJYA 2OO7A 4JVNA 4JVSB 3O8RA 2H7VA 3TUIC 2D7DA 1JJVA 4C0BA 2W83A 2WKQA 2GCOB 2X2FA 3AKDA 3AVPA 1FMJA 3QI2A 1OXXK 1JPJA 2ZI6A 3TUJC 1CR0A 1YVDA 1WCV1 3D31A 3OIVA 2CMKA 4QGAA 3KKOA 4ASUA 4URXR 2QAGB 5AR1A 3I8XA 4BRWA 4Q03A 2R6DA 5KO2A 3F5FA 2XJ9A 5IF9A 1E0JA 4OBEA 4UNNA 1S9HA 2XOKD 2LWIA 4LJAA 3WRYC 4XTCS 3SJZA 2IHYA 1NY5A 4L9SA 3TMKA 3GLGB 4FMBB 4Q1AA 2GKSA 5GJCA 1J7KA 5HE9A 5TARA 1UKYA 3FYHA 4A4DA 4D4MA 1FQKA 2C77A 2C96A 3H2YA 1Z2CA 3K0FB 1XXHA 3QQ5A 3VR6A 5BQ5A 1PJRA 3NH6A 4Q9KA 5HZHA 2CLCX 3OE7A 1G291 2NZJA 5G3ZA 3TH5A 3QEOA 3TSWA 4EQ6A 3TK1A 5LD2B 4KLNA 4N1AA 1YJ5A 2GWHA 4GDFA 2IHBA 2JJ2A 3X1WA 1KI9A 2Q21A 3ZGXA 3LD9A 3K0EA 3Q7PA 1G4UR 4PAOA 3B13B 3BFVA 3NHAA 2OXCA 1Z6AA 4LBYA 1AS0A 2GDJA 5DISB 3ADCA 4U02A 1F2TA 2REXB 1E94E 4KJZA 5EE3A 2IYTA 3E2IA 3Q85A 4IDPA 1WA5A 3ASYA 4H1VA 2J7KA 2J59A 2P6UA 2QMOA 3WRXC 3U3MA 5JEDA 4Z1MA 5JJIA 2AR7A 1TQ4A 2AXNA 3UWKA 4DT1B 1N6IA 4M53A 4BLOA 1ZIOA 3U2QA 3D3QA 3JZMA 2BM0A 1MRSA 4MRNA 3QBVA 3V9PA 4CT5A 4Q4AB 4A0HA 1U94A 3IHWA 4OQXA 4JT4A 1R10A 4B32A 2GXSA 3VX3A 4IEEA 1NMXA 1G16A 3IQXA 5JS7A 4RKFA 2ZI4A 1E79D 1ODFA 3OZXA 4HDOB 2W00A 2RAPA 1BIFA 2ZITA 2ZEJA 2WWGA 4Q01A 1CF4A 2QPAA 1OW3B 2YVUA 4DDWA 2QMEA 5L8VA 2FH5B 4NP6A 2VLIA 1E9SA 1LF5A 1M1YE 1HTWA 3KX2A 121PA 2REOA 3SJCA 3TIFA 4TQAA 2HLDD 1G20E 2KE5A 3CKLA 5AJXA 1IOZA 1RFLA 1ZVQA 1KK2A 4KHZA 1NKSA 4MUAA 3AF0A 4BLPA 1KDTA 1FP7A 1OF1A 1YZTA 2FGKA 2ZU6A 3TGPA 4TSFD 4W5JA 3E70C 5EE9A 5A0FA 4MA4A 4DXAA 2GEUA 1KSHA 3T12A 2WWWA 5J47A 4DCTA 4PQFA 2J7PD 5UKDA 5FBQB 3E1SA 3PEVA 4BFVA 1W4CA 1YR7A 1OIXA 4M9QA 1Z07A 2G77B 1N25A 4HLDA 4B74A 3FPAA 4MUBA 4A8JC 3NH9A 4LYAA 3I61A 4BEJA 2IUUA 3MLEA 3IPYA 3PXGA 3QKRA 4EQ6B 1R8QA 2R8RA 1X8LA 5DN6A 4DRZA 4KYIB 3NHBA 3RRMA 4EDHA 1BS1A 5FTNA 2F3TA 3GMTA 3WHLA 1N3BA 2P3SA 2B8TA 3CW2A 1A1VA 5FBLB 1WE2A 2ZJ2A 4M9SA 3TNFA 3T1TA 4ZIRB 1HY3A 2FV8A 3DZDA 4LCBA 1W0JA 1IXRC 2GXQA 3C5HA 4JLDA 4OI2A 4WOPA 3ZZUA 1QHYA 3P20A 1GNPA 4P31A 5P21A 3DL0A 2QI9C 5J4HA 1DTSA 4R98A 1HE1C 1SHZA 4OJQA 2YOGA 4RVCA 4QM7A 2QA5A 2ZVPX 4Q7LA 4W5HA 2DY1A 4L8GA 3KZ1E 5JCZA 3M0EA 1IXZA 3QG1A 3U3RA 1UADA 2QG6A 2QM7A 1NIPA 1KTVA 3NEYA 2ZI5A 4GOKA 4TMZA 4FW9A 1HQYE 1KI8A 3VR3A 3CR8A 3ZS9A 1U98A 4NZYA 1DOAA 5FUWA 1COWA 4IOJA 5TVKA 1TF5A 3CBQA 2PEZA 2GEDA 1HH4A 1KMQA 4A1FA 2FEOA 3IBGA 4NYIR 5FR2A 1EWQA 3L0IB 3KQLA 2YC4C 3GLFE 2VHUA 1E98A 1LB1B 3AM1A 3LA6A 5C18A 3QPVA 3ADBA 3OESA 3GJ8A 4XOIA 4GBMA 4C2TA 3DEFA 2ZUCA 1DBSA 4B6EA 5JMTA 1IY2A 4KU4A 3QBTA 1XJQA 3RHFA 4DC9A 1N2CE 2IEZA 2VL7A 4A8JA 1HQCA 1W46A 1Z83A 2GAOA 2IEYA 4JKYA 1OB5A 1W36D 2Z6VA 5JHHB 3TAUA 2ZUDA 4NYIQ 1UBFA 3EPKA 4US1R 4EPRA 2FU5C 3MAAC 4LYHA 4OHWA 3WYGA 2CHQA 1H8HD 4B2PA 1T5LA 2W2TA 5FUVA 4HUTA 1TX4B 2JJ1D 3CZQA 2JLXA 2V1UA 1D9ZA 1M6NA 2XOKA 1G3QA 1R0WA 1OIWA 3RS2A 2HCJB 4TTQA 4UXHA 3UK6A 5AUNB 5E7IA 2CJWA 5FOWA 2VIIA 4IJMA 1O3YA 2A5GA 3ZLJA 3PUWA 3C8UA 4KV9A 4MKIA 4P33A 1F48A 3WNCA 1Q1QA 1AKYA 2CXXA 2N1BA 3CF6R 3DKPA 4HLUA 3NBXX 3QEJA 5BW8A 3W34A 2JLWA 3MWLA 1G6OA 3NXSA 1TF7A 1Z0KA 3CWQA 3IDQA 1LTQA 4NONA 1E9EA 1ESNA 2YZ2A 2E1RA 3DMNA 2ONJA 5FPYA 3HR7A 1WBDA 3ZZ0A 1ZAKA 1YKSA 1X3SA 4Q4JB 1W0KD 1XTQA 2WSMA 4IVQA 3B1VA 1IN7A 5AJYA 2IA5A 1UEIA 1G7RA 3FB4A 1M8PA 1OH8A 1XCGB 3TLXA 1T9HA 1JQLB 2QZ4A 4F38A 2J87A 4RZUA 4HLCA 2OM2A 1IONA 2IWRA 1P9WA 4IVPA 2VP0A 4WA7A 4X8OA 2GVDC 4TMWA 3LAWA 4LZZA 2XNSA 1UDXA 1DAFA 3QXXA 4BZQA 1KI4A 1D2EA 3AGPA 2KI5A 2GJ8A 4QJ4A 1TAGA 4BFWA 4O3MA 2QMUA 3RS4A 1U9IC 4PSVA 2ZRFA 3EWAA 3R8CA 1E79A 2JEOA 4LRWA 2O8CA 2XX3A 1ZM2A 1QVRA 4OK6A 2GZAA 1HURA 1DS6A 1G9XA 821PA 1ZNYA 5JZVA 1I4TD 3QKTA 2JLZA 2J3EA 1UBCA 1M2OB 1UEJA 3WNDA 1G8FA 2H17A 2X19A 1Q44A 4V0MA 3L82B 3PJRA 4JLAA 3CWZA 1W4BA 2HLDA 1E9DA 1N6RA 3H86A 4LJYA 1NBMD 1ZINA 1CLUA 4G5GA 4RD4A 3AVXA 2WJHA 2B8WA 3A1TA 3KUDA 2LKCA 3B1XA 1YR9A 4TSFA 3O8BA 3I73A 1PUIA 3AVOA 5AJZA 3KB1A 2V3CC 1U8AA 2D06A 3VR1A 2J7PA 1UBEA 3GLHA 1KO4A 5K8TA 3CR7A 3W3AA 2QTFA 2WICA 4UJ5A 2ODWA 3W5IA 5H8WA 4JMPA 1TQ6A 2IS6A 1SVSA 1T8TA 2QSZA 1OPXA 4Q9IA 4Z8XA 4UNRA 4N0EA 3BFKA 2C9YA 1GAJA 1LFDB 3PUVA 3KTAA 4JLPA 1W36C 1VCIA 3EASA 2ATXA 3LQQA 5AJWA 5B2ZA 1SVIA 1FNNA 4Q18A 3CPJB 4OQFA 1MH1A 3ZS8A 4XWAA 3L8ZA 4M1WA 2YJTD 1YR8A 221PA 3O47A 1FX0A 1G3RA 3IO5A 5K8UA 4P4TA 1VG9B 2O8FA 2C2HA 2R6FA 1LF0A 3T35A 4W9MC 1A82A 3W90A 4MYTA 2OCYC 1Z06A 1GRQA 1XDBA 3TAHA 4C7OB 4HZUB 4LBWA 1ZNZA 2WZQA 1AJEA 3AKCA 1CP2A 1W5TA 1ZNXA 1VCMA 2J5XA 2V7QD 3TE6A 4B3BA 1Z0DA 1T8UA 4V03A 2OCBA 4I81A 1ZU5A 1ONBA 2ZSAA 1OFTA 1YR6A 1U9IA 3ONWA 2QM8A 1Z29A 3WMGA 3VKHA 1KZGB 5CJPA 1RPZA 4BWYA 1E2NA 2FOLA 3DO6A 3B1ZA 2OHFA 3SQWA 4LJ8A 5EP4A 5FBVB 2ZU0C 4ZV4A 1NN3A 2CNWD 3D6TB 4RCYA 5J4VA 1J70A 2ZUBA 4S2EA 1E1RD 4AD8A 2C9OA 2A78A 2I3BA 3CRQA 4F92B 3ADDA 3QOFA 2IW3A 2NO7A 4F4IA 5KDDA 4GL2A 2PZEA 5L3QA 4MRVA 4PSKA 2ZRBA 1TU3A 3VR2A 2GTPA 2ZE6A 2ZREA 1S1CA 2ZJ8A 3K8YA 1V5WA 3ZD7A 1P2TA 2JDID 2XB4A 1II8B 1DG3A 2BVNA 3IIMA 2R2AA 4Q21A 1K5GA 2J0QA 2WIAA 3IO3A 3R9IA 2ZRHA 1II9A 1SVWA 2Q3FA 4OI0A 4EPVA 1KK1A 3VFDA 1J99A 4JS0A 3VQTA 3QXCA 1VYUA 1R4AA 2QU8A 1TEXA 4JLBA 2ORIA 5JWOA 1R7RA 3HJNA 1G3IA 2RCNA 1H8HA 1JB1A 2ZSEA 3LBNA 3SOPA 1NI3A 3MWYW 2JJ1A 4JBXA 2EFHB 5JRJA 1MT0A 3KDSE 2F1IA 4TYWA 3PVSA 2BIFA 5F9FA 4PO8A 4URZR 2O0JA 2QNRA 2Z83A 4EPXA 2PZFA 1AN0A 4KVAA 1E2MA 4CVNA 4GZMA 1WP9A 3EARA 2O8FB 2QP3A 3WYFA 2GJAA 4F91B 5L3SA 3JZAA 1S1MA 4HB4A 1FNMA 1U0LA 4ILEA 4PX9A 2QAGC 4DLXA 2OFXA 1DAGA 1RZ3A 2C98A 3BK7A 4L15A 4LV5B 5FTKA 2JLYA 1ZRHA 4D0GA 3O8CA 4HEJA 1AGPA 1Z0JA 3P4YA 1B23P 3CRW1 3U5ZB 3B5JA 4F4JA 1KO7A 2R65A 4DSNA 4DWJA 3FKSA 1Q1ZA 4JLJA 4UJ3A 3IEUA 4HUQB 4OHVA 2YC2C 4QGFA 1CBUA 4YLGA 1JR3E 1W0KA 2QPOA 4PC3A 1E69A 3VU9B 3GFOA 3W6NA 3DMDA 4LJ5A 2ONKA 1EXMA 1U8ZA 5CK5A 1NJGA 3SHWA 1BKDR 1H65A 3U7FB 4UXJA 4CDGA 4QJ3A 3ZD6A 5FI0B 3NC1C 4NH0A 1KJZA 4URWR 2ANBA 5EP1A 3B9PA 5JI2E 1NVXQ 3X1XA 1G6HA 4QGGA 2IK8A 4C9BA 5CB6A 2BMFA 3QG5A 4V0OA 3EIHA 1DADA 2GETA 3U6KA 3AKEA 1CR1A 1XTIA 3UWOA 3VKWA 1N6OA 4NCIA 1Z0FA 1NVWQ 2WIBA 2R6AA 3R8FA 3LO5A 4PANA 2DHRA 1TMKA 4RZXA 4PHTA 4FWTA 2GK7A 3QENA 5DYIA 1JJ7A 3NBZC 4LSGA 1FFHA 4Q66C 5M04A 1E2FA 1NBMA 1TADA 3GJ7A 5FH9A 2WAXA 1Q22A 1KI3A 3G82C 3AKYA 4LHWA 1KO1A 1EK0A 5EE5B 5JJLA 3GJ5A 2EYUA 4LYJA 3U4QA 5HPYB 2JCSA 1ZJ6A 3A1UA 1DO2A 2GCOA 1F2UB 3PR1A 4AK9A 2ODBA 3PEUA 4TQ9A 3NWJA 4DKXA 5JFGA 3FOZA 2DFNA 1LVGA 4DCVA 2EFEB 4GNKA 721PA 2QAGA 1OXTA 1I2MA 3THOA 4BLSA 3LRPA 3ECCA 5DSZA 5L3SB 1OH7A 1JECA 4ZPXA 2PX0A 3KUCA 1GILA 1SKQA 1CJMA 1WF3A 1RKBA 4IDNA 3NDBB 4BEBA 4NHOA 3GLGA 4LJ4A 4GP6A 2QY9A 1Z6XA 2ZJ5A 5KYKA 2WMNB 4PZYA 3WP0A 4ZKDA 1LS1A 2PMKA 2QQ0A 1CIPA 1OJLA 2RH5A 1YRAA 2AHOA 3AEZA 3BWDD 3K0FA 3LBHA 4KO8A 3W6OA 3ZVLA 1P9NA 2VRWA 2PJZA 3VNVA 3BB1A 3THXB 3NIBA 3LXXA 2V7QA 4D4LA 4LGMA 4DEXA 4AIIA 1BH2A 3H0KA 2HCBA 2P5SA 4WIAA 2OAP1 2QTHA 4TT3D 4II7A 1E4YA 3HU2A 2D2EA 4I1UA 4KSCA 2AN9A 4BUJA 3VNUA 4URUR 3N5CA 4N0DA 2WV9A 3ZIAD 4Q00A 4GFDA 5CLLA 5FPTA 4QL3A 4PHHA 4A36A 3EZ2A 1Q3TA 1RYFA 1FTSA 4GMXA 4DT1A 3AP3A 2RGXA 2CNWA 1IN6A 1E9CA 5EXSA 4E5UA 1E1RA 2HDNB 5JWRA 2ZYVX 3RC8A 4Z54A 5DE3A 2QMHA 1YU9A 2GVZC 1UFQA 2BC9A 5IHPA 4WAUA 1AZSC 1QVAA 2ZRNA 2V55B 3QXHA 4K8OA 4B75A 1VECA 1ZM9A 4M9ZA 1NSFA 4A6XA 2IYZA 1ETUA 4QHSA 3FTQA 2EVWX 4IOLA 3U4QB 2JDIA 1N5LA 1UKEA 2G1JA 2X77A 3U44B 3U7HB 4Q7JB 4PZZA 1W48A 2YOHA 3KFVA 4EFMA 4G0NA 2FWRA 4JJZA 1X1SA 1CU1A 3BS4A 1S8FA 2QAJA 1MOZA 2AFIE 3GP8A 4YDSA 1M7HA 4IXNA 3WMFA 1TEVA 4MYUA 4POAA 4WXPA 3RVBA 2D62A 3B1WA 2IXFA 1XX6A 5C4GB 5DO9A 1AZTA 2MMCA 4KXFB 4V0NA 2BEJA 2JLVA 1JR6A 1UM8A 2BMEA 4TLBA 2FSHA 3L0PA 4M2LA 2WKRA 2WHXA 4TWZA 4TYQA 4BFYA 2R6CA 1WB9A 1XNJA 2GBLC 4XVRA 4MKHA 3Q8XB 3K70D 1RIFA 1W1WA 3BH6A 2E87A 2HEIA 2J0UB 3D8BA 2FPMA 2YOFA 4ZIRA 2ZJOA 3X1ZA 2XITA 3I32A 1Z2AA 4D6PA 4DUGD 1NLYA 1CXZA 1E2QA 2X8AA 1OE0A 2CLDX 3EW9A 1QZXA 5KPJA 1E9BA 3B60A 4TMTA 3RC3A 1DAHA 1Q1BA 3P32A 3FHOA 2YWHA 3OAAA 1NMYA 5EE1A 1KSJA 3BORA 1GG2A 3ASZA 3EZ9A 1AS2A 4YMWA 2CCGA 1GVNB 4WXRA 2VHTA 4OKSA 1U2RA 2NOAA 2IUTA 5KSZA 4QKQA 4LJ7A 4Q1CA 1YZUA 1C9KA 2QRZA 1FPMA 5KNBA 3K0AB 3CPHA 2MMGA 4Q7KA 2KJQA 4JZKA 3SU8A 1SKYE 2PEYA 1RYHA 4O0MA 1GL7A 4B3GA 2C8VA 4W7SA 1FUUA 2XTMA 5C1BA 4IOMA 1AIPA 4TQUS 3PUYA 2GA8A 4G5OA 4RD0A 5SZKB 4DCUA 4MKGA 4XTRA 3OEED 4URVR 1NMZA 1P7CA 2YV5A 4FMCB 1F5NA 1HV8A 2VA8A 1TPZA 3F8TA 1ZM7A 2WWXA 3F0TA 1BO6A 2PLFA 2Q3MA 5CDFA 2FFBA 3EA0A 1KI1A 1TUIA 1NLFA 3B2EA 3KKMA 3WBKA 2A3RA 4AC9A 2FSGA 2WJIA 4LJ6A 2GBLA 1P2VA 2FDCA 2ZQ5A 4JLOA 4O2RA 3CX7A 3JVVA 2JLUA 3FE2A 4C0SA 4G1UC 1YZGA 3CONA 3SFZA 4U7DA 3OEHD 4MRRA 2QE7D 2ZS8A 4BLRA 3MWKA 4BASA 5BXQC 2QSYA 1Q12A 2PMDA 2XZLA 2VP6A 3SYLA 1LNZA 3KXIA 3PEYA 1G41A 1E99A 2XZPA 1TF2A 1XJ0A 4PPGA 4TL7A 4BZXA 4IXMA 1SXJE 3FMIA 1AA9A 5HCNA 1XZQA 4HAXA 2F1HA 4W5WA 4AYXA 1OFHA 2ZYTX 3AGQA 5KSYA 1XPOA 3THWB 4TTPA 2CHVA 3VAAA 3FGNA 5IRCD 1OH5A 3GLFA 1TQDA 1XEFA 1XTRA 1RJ9B 3MUFA 4URYR 1VYVA 4OK3A 2OCPA 1EG7A 1E6CA 4JLNA 4TT3A 1J8YF 2B92A 2ORWA 2XNDD 4IEIA 1ZMXA 3K70C 2IS1A 5B30A 3BH0A 4HATA 4Q4JA 2IYUA 2I4IA 4Q9JA 4I99A 4HB2A 4LYFA 3ZIAA 3ZVMA 4GSYA 4NCNA 3S1AB 2PX3A 1Z3IX 1OKKD 1CRPA 3QKUA 2YHSA 2WWYA 2VP9A 2CLSA 3K9LA 4L9WA 3MWJA 3WXMA 4CYMA 2WJGA 2F1JA 3SNHA 3QY0A 1ZNWA 1ZYUA 1XFAA 1YE8A 2FFQA 2V9PA 1P60A 4YMTA 1TUEA 3WMEA 1DAKA 1TTTA 3QVUA 3SQXA 3NBFA 4WZ6A 3A1WA 3BFXA 3OF5A 3IGFA 2HXSA 1NY6A 3AVUA 4OHXA 4WVFA 3HU3A 4D25A 2KWIA 3QXSA 1P5ZB 4UKDA 4XJXA 5B57C
chains in the Genus database with same CATH superfamily
2VRNA 3EXFA 3PWKA 5LNK6 3A6LA 2E48A 3KU4A 1B76A 3PNSA 1EFUA 2YUIA 7REQB 1R8XA 4ZVPB 4GXRA 4G5SA 1BXGA 1VE9A 1DNPA 4PCQA 2Z98A 3DLHA 4KVGA 1PG2A 3HPQA 1V7QA 1RM5A 4RGYA 2PI4A 5AW8A 3FHTA 1Y98A 4FI3F 4CV2A 1S3GA 2R8ZA 3IUYA 4Q5VA 4MUNA 1YASA 2BFDB 5FUMA 1HNZF 5AVYA 1QHIA 4QUDA 5LB4A 2FVSA 4TZ0A 3N5BA 4FLEA 4J2OA 3EEIA 1FS4A 2ZH1A 3GFQA 3GUCA 1FPQA 2AYMA 1WV1A 2G25A 2W70A 5LMNF 3TIIA 4H7HA 2OBBA 2X9VA 3MNFA 1E2UA 2PYZA 3GJRA 2HF8A 4QNMA 3QO9A 5GAGI 1CZLA 3HHLD 3FDZB 4CR7A 3DGEC 3GDOA 4KY3A 2VNAA 4GR5A 4RE5A 1A7UA 3PKJA 2AOVA 1OJ4A 5I8PA 4Q19A 3I64A 3K0KA 4W99A 4KTTE 2MINA 3WLRA 1PNQA 4EF6A 3HVIA 1N0WA 1XEXB 1E20A 4OJTA 3IVGA 3W77A 3GJXC 3HHKA 2GAGC 2QD1A 4CODB 4B3RB 1MB9A 1X60A 3OT5A 3HDGA 3LECA 3UD4P 1N4DA 5FOVA 1HBNA 2R7VA 2EAUA 2O5RA 3VVMA 2AJ0A 2IOFK 1CNFA 2HXYA 4QBTA 4LSLA 1R64A 1VSUA 2R00C 2HJVA 2ID4A 1OAKA 1KSFX 5BXYA 5IKXA 1FS6A 5FWYA 1CULA 2QORA 4IL5A 2AI1A 1R9JA 4UNSA 3W6PA 4Y2RA 1O03A 1R3UA 3Q40A 3FETA 4YI3A 1EEXB 3TZYA 4FOPA 2J33A 4N5DA 2W6IA 2J7UA 3A1FA 3AB7A 3AF1A 1MJFA 1RWMA 3L4JA 5F8HA 4LWOA 3JWGA 3IAM9 1YDEA 2C5LA 4XB1A 1BJTA 5KYUB 3GT0A 2NUPA 3WY9A 4X62B 1XU9A 3DV0B 5J2NB 3K8WA 2VUGA 2VC0A 5BWNA 2QP9X 1B93A 3ZWBA 3V4OA 1XROA 4NAVA 1XNGA 4HT5A 3M33A 5AXNA 1ADYA 4UQGA 2ZSBA 2PMWA 3LCUA 1U4BA 1JFVA 1EETA 3DYAB 1BVUA 3T6KA 4CTAA 3TX0A 1SUFA 1D6JA 2GNOA 5I01A 1KQGA 4RA6B 3LUJA 3PXCX 2FWPA 4DKJA 4EY8A 1NVUQ 3BE4A 4RVNA 2MSSA 3RFFA 3W4IA 4D42A 4MDEA 2DBBA 2JL9A 5IVKA 3C14C 4LS3A 4O59O 2IM2A 2CGEA 4FZ5A 2CVQA 2BVZA 3JY6A 4K3UA 3OIUA 3LG2A 2IPOB 3AY6A 1TDJA 4X54A 1SXJD 2WRZA 4MQBA 1WZ2A 4KREA 3N0WA 1W85A 1RUSA 3LXRA 7AT1A 1W47A 1AT1B 3E82A 3NOQA 2JFUA 3GJ0A 2VPZA 1MMFB 3TRIA 3Q2KA 4CIXA 2O57A 1MOPA 2AN4A 3MJHA 2HNDA 3T1VA 5HZKA 2GZRA 4XGRA 1N2BA 3DSRA 2Z2YB 1IHOA 4KSYA 4UQOA 3NCPA 4YP7A 3ER6A 1H2EA 1T24A 4ICLB 3HY6A 3TQRA 2ORYA 5ICSA 1XKXA 3NIDB 1EVYA 4A8WA 2J46A 5AI6A 4I1VA 3UFXA 1ST3A 1S9DA 4G24A 3GCGA 1G8PA 4KZKA 5HGJA 1OASA 3WL4A 1Z0IA 1QANA 4MQFA 3SAJA 3PB3A 2KVQE 4JI0J 1QY7A 1AC5A 2LR0A 4C0XA 3L8YA 3AF4A 3AM4A 1QOQB 4D9BA 1IBLF 1DCMA 1L3UA 3UDCA 5GAEI 4IMPA 1WSWA 3UMVA 4AI6A 1MO5A 2PU7A 4MW9A 3SLKA 2ZB3A 5AIAA 4WN9A 2R8BA 3WGIA 3R3WA 2WF5A 5CNJA 3RVOA 5B0GA 3DVQX 4J9VA 5I7HA 3H3XA 2REQA 4UULA 1DQZA 2VJMA 5BJRA 1YIJS 3CO0S 3EVFA 3B48A 4FSHA 3OI7A 1T8SA 4H3HB 4L5YA 3PHIA 3WLHA 4MHOA 4DR7F 4D99A 1HL3A 4WWSA 1X1EA 3B3FA 4D3GA 1N8SA 1YL6A 1ZP6A 3CQ9A 1T13A 1Y7PA 3CNEA 4MW1A 2RE8A 2NT3A 4WYLA 1MZVA 4ED1A 4RAOA 4WKRA 4P5DA 3R3XA 2BKUA 4F5ZA 3KLPX 3IR5B 3OKAA 1UZMA 4YUVA 4XIUA 2B7CB 1S02A 1F3LA 1N6KA 2FPLA 1GFIA 5HIMA 3DBOB 5CDUA 1VJDA 3E22B 3HVWA 3WLIA 5BSHA 2ZUFA 1C80A 4GL4A 3T19A 3DFEA 1Q19A 5DHSA 1TKCA 2V5AA 3DOMA 2DR5A 3K5MA 1E5DA 3DN9A 4DOMA 3WX8A 4ED2A 4E2FA 2VF7A 1VRTB 1MO6A 4ANCA 2D3OR 3S2YA 3HP4A 2AYZA 3PKZA 3HKEA 4U5XA 2ADBA 1VM6A 1K8AT 1O6BA 2Q5CA 5EKDA 3RW6A 4DSFA 4P7BA 3LUPA 4BGUA 4LYGA 4N7MA 3H1GA 3AD7C 4XYLA 3FVYA 1A8HA 1ODTC 2XUAA 2H4WA 1PHPA 3FDFA 4FGKA 4UREA 4WZBE 4BGEA 1Z28A 5HFAA 3WGYA 4F3MA 4XJSA 4AJPA 1NSKL 3SYNA 1EFRA 3ZTSA 1BKSB 4P84A 3LH2S 5K0CA 3AJDA 3C15A 2WG1A 5AQ1A 4PQUB 3W8RA 1QP4A 2FXIA 5KJCA 2G17A 2PSZA 1FNBA 1V2GA 3ONFA 1YTYA 4RHXA 3NGXA 2JGAA 5D78A 2GO1A 4NFHA 4Z2YA 4R01A 3KLFA 3PTAA 1XTKA 1KI6A 2EEPA 2B0GA 2FP3A 4OI3A 3UPFA 3QKSA 3K0SA 4ALLA 1L9KA 2HRTA 1YS6A 3DDUA 3Q7IA 5ILGA 2OECA 1KIAA 1SXHA 1DHTA 4MP8A 2DNKA 4HX2A 4ZVLA 5A3RA 2A9RA 2CLMB 3L4BC 4F67A 2WMOB 2Y1GA 2WYOA 4ZEXA 4F2WA 4KGMA 1F51E 1XA3A 4XAKA 1H6BA 3TE7A 4GYJA 4CH7A 1GARA 2FFRA 5LQMA 5HQ8A 4HN2A 4DLZA 2OG1A 1A27A 1QGED 2GRJA 1SNYA 2HHPA 3T61A 1BTOA 5B1EA 1E6MA 2IYAA 3LVRE 3CG4A 2Z9BA 1ZUD1 3WI7A 4C03A 3CO9A 4HAYA 1PV4A 1M9NA 1NJWA 4QA9A 2PTGA 1U2FA 2OMOA 2P3OA 4UPVA 4F3NA 3PG5A 5F3ZA 5JMNA 2VQFJ 1OU0A 2ZT6A 4NJMA 5HYVA 1AVTA 3EISA 3OOEA 2YJNA 1DV1A 4R9RA 3OXFA 4KNWA 1MVOA 1YGYA 2JKYA 1SCUA 3K9HA 1SB8A 4ARBA 3REGA 3MF5A 1ZJWA 3AI1A 3KALA 2Y1EA 1S99A 1I2DA 3ZBQA 5JCOA 2ZVQX 1GPBA 4GBJA 2QYTA 4PEOA 1RWXA 1QAYA 1JIJA 2IV7A 4BGDA 2AU0A 2X8JA 1H2UX 2ZJZA 1TYAE 2QZPA 1UBMS 2Q1TA 1NL3A 3R3SA 1XAIA 3TTXA 3R7BA 3DBLA 4U2CA 3OHPA 5F2KA 4OLAA 1YDLA 3EZNA 1N6QA 1UA0A 4HDKB 1CKEA 4IAOA 2ZT7A 3L1JA 5CG2A 3ABZA 5C42B 2W7OA 2OHOA 4R9VA 1G64A 4AXJA 3HABA 1N36B 3MB5A 4F4CA 5AP9A 3WQBA 1DFHA 4BECA 4JOCA 4QPDA 4M9RA 2WF6A 3UMRA 3FSXA 1GPAA 3K5WA 4Y2MA 3ANSA 3PJEA 2ZRMA 3BERA 1TJNA 4YNBA 2H54B 1O96B 1ACJA 3DOEA 4IIFA 2D0PB 4UOQA 1LWEA 1MA0A 5FRDA 1NKCA 1DQPA 1KZ1A 2YN4A 2ZVJA 3R1IA 2NCKL 2AOWA 2VUSA 4HKQA 1OX4B 1PR0A 5LU9A 4X90A 1GM5A 3MS7A 4EFAC 3QM1A 1T34A 4WL0A 1YWGO 2ERYA 1U5CA 2FCRA 1JALA 1EX7A 2JL1A 4HDGA 2EWMA 5ALSA 4CMKA 1KPHA 5CB4A 1AB6A 4N7TA 5EWMA 4KN5A 3I23A 3EVMA 2XTNA 1N1MA 5LD2C 3K2IA 2Z4RA 3PRDA 2QVCA 3B2NA 3BHJA 2VPQA 2ZAMA 5JR3A 3DNCA 2V65A 2C57A 2E7WA 4BC7A 5HK8A 3DC2A 5JD5A 2O8DB 2BEUB 3DWEX 1WB4A 4TU7A 2LTAA 3CSUA 1S49A 5IJWA 4IKOA 2G07A 2KT3A 5GVRA 1I2CA 5A8WA 4ZXFA 1L8QA 4HYQA 3VJKA 3W5XA 3OQ6A 2EJVA 3MT8A 1Q57A 2ZC4A 2XMQA 1JWAB 1SC9A 1YE5A 3RUFA 3C6YA 2CPXA 3T95A 2QN1A 3K0BA 2MR5A 3ASVA 4B3SJ 2AJBA 2IP1A 4AJLA 2O54A 1NJSA 1TQHA 1XMJA 1DINA 4C30A 3ND9A 4DBZA 5A3SA 2HAFA 3AVQA 3CDAA 5J2TB 3NDRA 2UDPA 2H3EB 4BNIA 4FNHA 5JVDB 4YP1A 3A8JA 1NLZA 2Y0EA 2HU2A 3TRGA 1L3CA 3N2GB 1JJVA 2JAOA 1TK3A 1V3ZA 4DM4A 2JFGA 3QI2A 4URXR 3OIVA 1WCV1 4OYOA 1JI3A 4AFFA 2QAGB 4WFIA 4BRWA 4W5TA 1RFGE 4HEQA 5K3CA 3JAMY 5F76A 4JYAB 1MFPA 2IIPA 4OJNA 2FLKA 5DLFA 4TRJA 4P08A 2JFDA 4RQUA 1AKVA 1SB9A 1U1RA 1R27B 1PJRA 2F3SA 2NZJA 5G3ZA 3TH5A 2BKOA 1G21B 1YJ5A 4G8BA 4ZT4A 3X1WA 4Z9XA 4MW2A 3GR6A 3H9BA 1V9OA 1H85A 1AS0A 2GDJA 3ADCA 1F2TA 4RX6A 2BACA 3GEBA 5EE3A 1P5JA 2Z1MA 3NM6B 4D3SA 1CLEA 3F49S 3D4LA 4LX8A 2AR7A 3CMES 4P2FA 4M53A 4ZO7A 1P7WA 3QBVA 2Z04A 4H4EA 2YZGA 3EXIA 3GRCA 4IEEA 2IDMA 3K5IA 8GPBA 1FFYA 1QIJA 4OMCA 1WELA 1MIOB 1WUIS 2BABA 2VLIA 1GMWD 4MS3B 3JS5A 1G20E 2FSPA 2CLOB 4R1OA 1YZTA 5A0FA 2XDWA 1UIMA 3K8OE 2OTCA 4WCFB 4JT9A 4WCEQ 4BFVA 3L06A 3PC4A 3NGSA 2G08A 5LMUF 3EZLA 4WOJA 2WAAA 5LLSA 1V5EA 4JI1B 1EJBA 1V4VA 1KQFA 5F8NA 1VCHA 2JC0A 3N86A 2AOTA 2PFDA 1NC3A 3OU6A 1IXRC 2W4PA 2Y92A 4FHDA 2PL9A 4KLRA 5HUHA 2QI9C 1T9VA 3TQIA 3JS9A 1T43A 3KPYA 3FCHA 1AZSB 2VN8A 2BFCB 1A7KA 4DR6J 3PT9A 3MTIA 1RZVA 4U39A 3KZCA 3R0VA 3ZWPA 4JBHA 3G2NA 1NRXA 2PEZA 4MRAA 5HOQA 1ML4A 4AZSA 4NESA 3G2PA 3JYHA 4O4LB 3H4IA 1GXLA 1XQVA 1PQUA 5ALQA 2QJFA 3DEFA 3DGVA 1F38A 5GMKa 1C1BA 3HXMA 1EP1B 4NJEA 2HA7A 1WHTB 4UQTA 1LWCA 1DAOA 2IEZA 1Q1NA 3L4SO 5FWDA 3NYQA 2OBFA 2FU5C 1U7DA 4DW8A 4F4HA 2JLXA 2V1UA 1Y00A 3SF8B 4WACA 3CVUA 2A9PA 3PUWA 4J9OA 3C8UA 2TMDA 3ZZYA 2OC4A 3NBXX 2GN9A 2ES4A 4J0JA 1P3Y1 2W2NA 4NY1A 4KXXA 1Z0KA 4R8MA 1D2HA 3KCNA 3OOYA 3I0SB 4WKNA 1KLNA 2VUIB 4GWKA 3KJNA 2ONJA 3HR7A 2DQKA 3DTNA 4MVJE 1W52X 1YOVB 1GNTA 1XTBA 3OV7A 1CZKA 1VQNS 4DANA 2HMSA 1SZCA 2VP0A 3B2QA 2D5CA 4OQ4A 2PZLA 2KH9A 3SV3A 4JI2F 2R48A 2HIYA 4NBLA 3E9MA 3CZAA 3ROQA 3F56A 3QKTA 4KWEA 2GQQA 4XSVA 3S6JA 1Z34A 2DMRA 1FJHA 3JQ6A 2HLDA 4DL4A 4CIVA 1WMEA 5EHXA 3SG0A 4PG8A 1DC6A 5A6PA 2GCIA 3EIOA 4LF1A 4XGKA 1KBZA 3HHDA 3LF1A 2R7NA 2O6HA 4GUAA 3BSCA 3HB5X 3G85A 4NE9A 3HDSA 2JIQA 4B9UA 1DKQA 3MMAB 4H3SA 3JSXA 1Q95G 2ADMA 1KVUA 2OEMA 4BXOA 2R7TA 1XCJA 3WJAA 1HE5A 1E63A 1QE1B 4B4WA 2EX4A 3P19A 5EHIA 3ISZA 3CLHA 4OX9F 2OPRB 4FNMA 4CKCA 4I81A 3S4YA 1HZZA 3BBFA 1ONBA 3RHZA 2D41A 1VLLA 1C5KA 4F4KA 2H1IA 5CJPA 3OIFA 3I09A 2HFSA 1VMIA 5FBVB 3FPFA 1XN1A 2GZMA 1HL6A 1UC8A 4N7RA 5CCMA 5EMMA 1VGQA 5B3LA 5CVDA 1IBMB 3PC2A 5F5NA 4LECA 2YY3A 4M9CA 4ZVVA 4ETXA 4WESB 1BXZA 3VVLA 1OZHA 4LN1A 4IDGA 4ATNA 1TP7A 3R9IA 2IHJA 4H27A 1J99A 3PHJA 4WTOB 1KDVA 4YVFA 3VO1A 1JB1A 4HY3A 2YXDA 4ZVKA 2RE1A 2OL4A 2QE5A 4NCBA 3GMDA 1AN0A 3X1JA 4CVNA 3LQ1A 3RASA 1VLYA 2A9FA 2AJTA 4NENA 1NJIT 2QAGC 2Z1NA 4LV5B 1IFXA 3GDGA 2QRMA 2VDNB 3V97A 3AK4A 1CNMA 4F4JA 1KO7A 1PW5A 5D01A 4Q24A 2ZE2B 2V97A 4AMUA 3I9ZA 4Y7CA 4LJ5A 4I68A 2CVEA 4IQ0A 2DIVA 1C0IA 5HP1B 1CUXA 3FCEA 4UXJA 1EA7A 2WJZB 3CVOA 1Z4OA 5FI0B 1GCGA 3O74A 2VKZG 5K8VA 4RSHA 1QU3A 2X1HA 1P5RA 2O3RA 3GO4A 5HOEA 3IUJA 5IDQA 5KKCA 4Q44A 3AILA 5KZMB 1FA0A 4YDQA 4OU5A 4PHTA 2GK7A 4E1BA 3JQEA 3C6QA 3L6BA 1J27A 2DP4E 4LYYA 4B6SA 1HNXF 2C00A 4PYQA 4RR5A 4JEIA 1DMRA 2O07A 2PSHA 3FZNA 1D1QA 3FN4A 3D0RA 1F14A 4DMRA 3NDBB 1DFDA 4KAAA 5KYKA 4P8RA 4IINA 3GFZA 1WF1A 2VZLA 5CFMA 3W2IA 1YQDA 4U0JA 4DBVO 4BWVA 4E13A 3USES 3QWIA 1N5OX 1M2KA 3LWDA 3A32A 2CQDA 1U2PA 1NW5A 1HNWF 2PE5A 4II7A 1XUOA 4RVGA 5K03A 4A36A 2PKRA 4UBOA 5E7QA 3HI6A 4RW8A 3HWRA 1HLPA 1NUEA 1NXPA 4RGQA 2Q66A 4CU2A 3G9UA 4EL5A 2KMLA 3U4HA 2KJWA 1GTJ1 4YJ2F 1AZSC 2V68A 3SGLA 1TKZB 4A5SA 5IJ9A 1GFWA 1ETUA 4IOLA 1A9NB 2JDIA 2X5JO 2XY5A 3DE4X 2VZ8A 1MN7A 4GSKA 4R2KA 4G1MB 3FEZA 3WWDA 3GP8A 3BSOA 2V3VA 5BSUA 4F97A 4P52A 3PUHA 4RNDB 2BRLA 4BJHB 1LW2A 2DJIA 1CUIA 3W7AA 4DV0J 4D7AA 1X8XA 1K5PA 2E87A 2HEIA 2LVBA 4OXQA 3HH8A 3QX3A 2Y6VA 5BWCA 1T5OA 4HFMA 4FBLA 3GZNB 3H6KA 4HJXA 1JLFB 1N2GA 4CM3A 4CIOA 1Q1BA 3OPNA 5EE1A 3R6GA 2JFOA 4LVOA 4C4ZA 1CE8B 1PQWA 4AJJA 4KDCA 2VAVA 3HVTA 2Z5GA 3P49B 4GPAA 2KN4A 3ITHB 1TCAA 1Z73A 2TMYA 1RTIA 3P5TL 1P33A 3L7YA 2E5JA 3I45A 3QLJA 1GXSA 3I1JA 3MI7X 1DBQA 2KYZA 2YV5A 1TPZA 2GIQA 3CY6A 3OBIA 5JY1A 3ZY5A 2BEFA 3KKMA 2I3GA 5IFKA 1B1CA 3G2QA 2W90A 2HVDA 4M55A 1YZGA 3CONA 3L1VA 4BASA 3QNWA 5JDCC 2P27A 3VPGA 2B5WA 4ZVUB 2W4DA 1OFHA 1U7UA 5TEWA 1VYVA 3TZZA 3RIMA 1YC2A 5TT0A 3K70C 1PF7E 4Q4JA 5G0RA 4HB2A 2RHSB 5FKJA 1Z3IX 2G1HA 1Z17A 4BS9A 3HRKA 5BVHB 2EFQA 2UXCJ 1WJ9A 4IMJB 1ZNWA 2RGYA 1TUEA 1DAKA 2IKSA 1X1DA 1IG3A 1YJUA 2I7DA 1QNFA 3OZEA 3WLEA 2F9DA 4FF1A 3R3ZA 1B64A 2V7TA 5HJYA 3VU8A 4GI7A 3P26A 4XFDA 3I34X 4HDCA 4NV3A 3IH5A 4OF4A 5DI3B 1J5OA 5TE9A 4W90B 1GSIA 3ICVA 1C3LA 2UUWA 1EX6A 3S2UA 3FWYA 3RVJA 5A0YA 3ZK8A 3RJZA 5JNRA 5CU7A 2FPHX 3OSUA 3ZWAA 2I2BA 1BQNB 4ABYA 4ENVA 1O58A 1RIIA 5DMXA 3GLFB 2W0MA 3Q8VA 4LZLA 1T2NA 4NYJR 1WB6A 4DR5J 3WB2A 1KXJA 4YB8A 1RQPA 2BBOA 4CQLB 1P6TA 1E6KA 2YICA 1KH3A 4MYHA 3FTCA 4Q3CA 4PBTA 4NYJQ 4W9NA 4QULA 4I1YA 4RY8A 2UZ1B 1K0UA 2DGSA 4J4TA 1BMFD 2QU7A 1ZIPA 3BH7B 5BP7A 5JZ9A 4UCWA 1KO5A 1X7ZA 1MQAA 4C05A 2FSIA 3DDZX 3GIRA 1G7TA 2NYHA 3AFGA 4AYWA 3COJA 4QOEA 5E7MA 5TF0A 2AQ8A 2EBWA 3H7IA 3DE6X 2MDAA 2IDLA 3GFHA 1M2GA 1NZFA 4EKNB 1Z4KA 1H7WA 4JXZA 3W3AH 4RL1A 4CL3A 5IS2A 5A4KA 2B61A 5AI0A 3CURA 4MYCA 4Q3NA 3AVWA 1RP1A 1EKXA 4DBQA 2J9YB 3CDWA 3B8HA 3FQKA 4J9SA 4H1UA 1U1MA 3B6EA 2RHOA 1SY7A 1SA0A 4HHHA 2DVMA 1NHVA 4K4TA 2CAJA 3KD2A 1TFYA 4IDHA 5TXGA 5DG8A 1F0XA 1G8YA 1RB0A 4TXHA 1M34E 2IV3A 5C5IA 1B14A 4NOLA 3G2HA 1UAWA 1FP4A 3OA0A 1DJLA 3EPLA 1BGVA 1KH1A 1MCZA 1I5OB 1JLMA 2OD2A 3OO1A 4ZKEA 1PO6A 1N2ZA 3KTFA 2OILA 3SXUA 2B36A 2ZQYA 3E8MA 4JA0A 4GYWA 2OPPB 1AN9A 3SQNA 1QAQA 1D0EA 3GFTA 1ZUIA 4H59A 1DY3A 1PG0A 3TUZC 1V7CA 4BQOA 1YB6A 1AH2A 2XSZD 1T6NA 1W76A 3KHUA 2X0KA 1MU0A 3ORSA 1LJUA 1EWYA 1AA1B 4OZ2A 4F1JA 2FAXA 3SCIE 4ZO8A 2PS3A 2DNMA 3OVSA 1KP6A 4L02A 1KMHA 3VPXA 4MRMB 5BNIA 4KB7A 1T0JB 5LJLA 1E3WA 1MMLA 2DQZA 4RTJA 4HI0E 3VNAA 2IHUA 2X0DA 5KFLA 4FFLA 4R8VA 3I8OA 4E14A 3W7BA 4YR9A 1ZEMA 1T9TA 5AM4A 4BFZA 5GOTA 1B8UA 4B43A 1NM5C 3VZIA 2ZZKA 5KT7A 3QK7A 1G1AA 3GAMA 3U44A 3AU8A 4A2QA 3CKKA 3ORRA 4H31A 3GJ3A 1JHOA 4HADA 4N8NA 3JVEA 1TVEA 2COLA 4NPOA 2HPVA 4IDOA 4V1CA 2P6SA 4BKUA 3OQOA 4O44A 1UANA 3AB3A 1I7PA 1J90A 2IOFA 2HW3A 1AF7A 1CF2O 2YQ4A 1PLLA 1MRZA 1SIOA 3H0CA 2WWFA 2VXBA 1LLUA 2CQ1A 4AP5A 3GRAA 4HN4B 1AGRA 4D3XA 3NP7A 1REVB 3NOXA 1ZMTA 3O8QB 4G0MA 4PLGA 2J3HA 5M29A 3ICQB 1Y9EA 4GOJA 4F9GA 3GH3A 3QVWA 1E1CA 4G09A 1WDDA 1VXRA 3AESB 2YWWA 3O44A 4JMLA 3T9ZA 4ZOLB 4AB1A 3JQBA 4Z53A 3U4IA 2FCAA 2V7PA 2HR1A 5F9MA 5KDLA 1UBKS 3WK5A 1FP2A 4ZCTA 4DBLC 1L8AA 4F2HA 1RSZA 4QG3A 5J43A 5FWXA 4OZJA 3ACCA 4DIDA 1X14A 3A3PB 4C0WA 1HBUA 1L5WA 3AR9A 1JJFA 4DG1B 1ZYQA 2WFLA 4X84A 3V00A 1A9PA 3CH6A 4RTRA 3LHDA 4PXBA 4QYZJ 2M6RA 4H3KB 4FYJA 1B0VA 2HNZA 1L4GA 3KETA 3CX6A 1IXYA 4EG0A 5GMDA 4LRTB 2HHXA 2VDHA 4P98A 1MG5A 4EG1A 5KFHA 2M98A 2HNBA 4YJ3A 2NO6A 3ERCA 3NYWA 1Y7TA 1N33F 4ECXA 5K0BA 2A5JA 4L74A 3KKQA 4BQIA 4IDAA 5ETQA 3T38A 2W6ZA 3TQSA 1YZKA 4TS4A 1U1IA 3A8TA 1XQYA 1S9EB 1RAEA 2FA9A 4KVFA 2OAEA 2VC1A 3F0NA 1XOIA 2GNAA 4DLLA 1EVKA 5KNCA 1IM5A 1Z0AA 4CZ2A 4LK3A 2BD0A 4RS4A 2ZTVA 3D6VA 1LD3A 4E5SA 1SRQA 3IR6B 1FFEA 3EUAA 1NVEA 5ALUA 2PR2A 2ZR9A 1VCOA 4CYUB 4RNCA 4RL4A 3V8BA 2GN2A 5IDWA 4JP2A 2PSJA 4YECA 2DNPA 2C20A 3AIKA 3IQIX 3LMKA 4OGWA 4MV9A 5CYFA 2IH2A 5LQUA 4PRKA 2WCXA 1JNYA 3OWHA 2CKMA 2AWOA 3TEFA 3UXMA 4TV8F 3MW8A 1F5AA 1VG8A 5KCMA 4AJ2A 2YN0A 1W26A 2YKMB 4U2DA 1O0CA 3H5SA 5T8KC 4QVGA 4P6QA 4RL6A 3EBPA 3LHIA 4NDZA 5AW7A 2VZ9A 3FNRA 1N2XA 2W6QA 2H07A 4TTRA 1RVDA 1JG2A 4QXMA 4L27A 3ZKWB 2B78A 1G55A 3KTQA 3TXXA 4KRYA 1CUJA 4BN4A 4DEVA 1XTVA 3U39A 1GT8A 5BR1A 4JFAA 5KYVA 4KRXA 2CNDA 2C8JA 3PX3A 1VG0B 4UOGA 5FDFA 4RKEA 2ACMA 1C0PA 2YJZA 1RYNA 4IFTA 5HHTA 2DHGA 5EXDA 2NVUA 2N42A 4LHEA 1GP2A 3BOSA 1HG1A 1VBNA 5JCJA 1M6YA 3ZWKA 3DGPA 4C3LA 4N01A 1H8EA 4TWIA 3R0JA 4FE7A 4KWCA 4G1IA 4PHGA 4IDFA 5CNKA 3HY4A 3QZ8A 2YINC 1S76D 2EFNA 3UVJA 2I2YA 4ZAYA 1T3GA 3TX6A 5DHQA 5EJ6A 1H6AA 5FQOA 4P4SA 2O2IA 3ZDDA 3MGJA 2ZH5A 2H9IA 2QD5A 1Q95A 4WBFA 2H1LA 1CJKA 4IOBA 3ABRB 1Y3JA 2VSNA 3QOWA 4OQNA 3KZXA 4QO7A 3VTAA 4L72A 4QASA 2UYYA 2I9PA 1XIVA 3RVQA 3QBEA 2O2CA 3U3DA 4IRDA 4DRXA 4R3UC 4RM3A 3DAYA 2ZK7A 3OJFA 3MM8A 5K3FA 5FPKA 4MCAA 2H5EA 1JAIA 3MDFA 5ICMA 3LNCA 2RGGA 2RBKA 2VRCA 3O4VA 4EAAA 4X9XA 2R7SA 2PJDA 3WNBA 1H93A 1Z88A 3M81A 1VJQA 4YWJA 1OXUA 5A6VA 3AHCA 5KTSA 4EAQA 4OKIA 1J5EF 3VGVA 1Y6FA 3IURA 2FDRA 2CJXA 2DWCA 4UATA 4HWKA 5IM4F 5ABPA 3A13A 2WVAA 1WOSA 3KFXA 1TU4A 4RD6A 4NULA 1VHQA 5I7VA 2DO0A 1FRVA 3PCRB 2GFFA 3KSBC 3CH5A 2RHMA 1C4KA 2RD5C 4L5BA 1FTWA 4F3TA 3ZJYA 1BGWA 3T1HF 3U4AA 4QDUA 3MAAB 4I4LA 4IZIA 1NJ8A 4JOQA 5FOUA 1QAIA 3P2JA 4EVSA 5EA2A 4JKOA 1WD7A 2PWBA 4USHA 5DHAA 4H6XA 1UFWA 3DHVA 4D41A 5BR8B 1UQRA 3KS9A 4ZVTB 2CL6X 3SK0A 1FFDA 1EZZA 3IUBA 5MN4A 3VAJA 2ASJA 2JZNA 1CD5A 4ZCMA 2OUKA 2HS0A 2H1VA 1Q8BA 2CPZA 1VRUA 1M2HA 2P2LA 2WUDA 4ZT3A 2Z57B 1I33A 5LP1A 4UQPA 5IV3A 3GJ4A 1MH9A 3T0FA 2JLQA 3T54A 1VMKA 3TSAA 3T7JA 3CIMA 4W5RA 5DF1A 3U4DA 2OUGA 4K5RA 1EFTA 5ALEA 4EO8A 1LOUA 3OPYI 4D6XA 2PI5A 3B4DA 4ZLPA 4YALA 2RRNA 1OD6A 2ZAOA 4JOBA 4QQFA 3H97A 3ZLUA 3RG8A 2E1CA 2ZRIA 3GEDA 1E2HA 4B45A 2VA3A 4R2HA 1YRHA 3WP1B 5FV4A 2ZE8A 2V59A 5DWVA 4BNDA 5DZ7A 3AF2A 3EXYA 2P5TB 4FX5A 3GJSA 3CXUA 3FOBA 4YXFA 1DBPA 3B38A 4Z5XA 3CS3A 3I8SA 2RKWA 2VU5A 1C4OA 1YFLA 1SXPA 3M5DA 3IT1A 4J0IA 3V8NA 1XLTA 2RGEA 2V7EA 1I4OA 3C4VA 3OJXA 2G8LA 2BKLA 1DLJA 2BM8A 4QPZA 1FIUA 5JZMA 4X65F 3MLBA 2X51A 1JEQB 3M3HA 1CRZA 1BWQA 1B26A 3MJDA 4RUHA 1Q16A 1VIYA 3EOZA 3CZCA 4B33A 1Y48E 4ZJUA 1J2UA 1SKSA 1X4AA 3NZEA 4Y1RB 4PXYA 4QDOA 1X1RA 3MCMA 2QJWA 2IHVA 2WYWA 4JIGA 4DMCA 3IT0A 1NV9A 1X7WB 2YZMA 2XNCA 4D1YA 4FJ1A 2OQVA 5KC8A 5JH7A 1T8PA 1Q11A 3U6BA 1T1RA 2IUYA 1CUFA 3GFYA 1W1IA 5JQWA 4FIZA 3T3GA 1ZRSA 2YFQA 3AHGA 5IVDA 1JPJA 3KHTA 3MPOA 2BQ3A 4M0PA 5JXIA 3POTA 3SJ7A 3X3HA 5KO2A 4DCPA 1UPXA 5D00A 3AXKA 4J9UE 2GKSA 5EIBC 5TARA 3EGVA 1N7JA 5GTDA 1UZLA 1YZFA 3M4ZA 2ZUTA 1RCOB 3LDHA 1PD1A 4DL5A 1T4CB 2PIAA 3ZV5A 1X1QA 1N5MA 4OAOA 1G9TA 3ZHYA 1B0ZA 2H48B 1HRKA 4U02A 2OOSA 1LRLA 3CW2C 2QVGA 4TXLA 2QMOA 4FP9A 4NLOA 4DV5F 1M5HA 3CMCO 1YQ9A 1JLAA 5HGXA 1F0PA 4AT1B 2GZ3A 1LX6A 3UH0A 3UR3C 1OW3B 2YVUA 4CQMA 1HE2A 3PQ8A 3TOCA 3S28A 1HTWA 1MLDA 2GZ1A 2DWUA 2RH4A 1WXWA 3F78A 4EEXA 1A9YA 4TSFD 1YFKA 3IWLA 3JWJA 1KFSA 3GE9A 9ABPA 5J47A 2HLUA 4DCTA 4PQFA 5D1HA 5C8YB 4YOEA 2E3JA 1FFGA 4F2DA 2EKYA 5ALNA 3I61A 5AOVA 2ISCA 5DN6A 2C42A 2CNBA 2CLFB 3CD7A 3K71B 2JHPA 4EVQA 2H59A 2H0RA 1X9HA 3TNFA 2XLKA 3L7NA 1E7MA 4RW9A 3OA2A 4MUGA 3G49A 1MU2B 1W0JA 4OI2A 2RHCA 2UAGA 5DX8A 5AW4A 1IXZA 1ZBTA 2QM7A 4HGPA 4NZOA 2W24A 3RTDA 4D98A 1U98A 1P80A 2GEDA 5EMJA 5GIOE 1KONA 4YAFA 3W5DA 4G4JA 4P7FA 4WE3A 2FEOA 1LUAA 2ABYA 5FNZA 3AM1A 2B43A 3O0DA 4MR7B 3ZXYA 3C6UB 3CMMA 3K2YA 1NZ8A 2WU8A 1S1VB 3OL9A 4PAGA 1YTUA 3HSSA 4WNAA 1Z83A 4PF1A 3TAUA 3MAAC 3PIIA 1HG0A 4KPCA 2W2TA 5FUVA 4QFDA 3JQPA 3D1VA 1RU1A 2MGZA 2HY7A 2CJWA 2PKEA 1MQ9A 4OH1A 4EEKA 2XOEA 3DCIA 2N1BA 3T3PB 4FGUA 2IJGX 3SVLA 2OHGA 2V74B 3IKTA 3ON5A 1T9ZA 3IDOA 3A2LA 1WBDA 3NM5A 1UOOA 2K4MA 3FM9A 1R6AA 1G2PA 4P81A 2CJYB 2APOA 3H19A 1YA6A 3CIFA 5AW2A 1XTPA 2KKHA 1JQLB 2OM2A 1XAHA 3LO8A 2AEJA 3JQAB 3EUWA 2W2NP 1AV6A 1WLSA 4CCHA 4QVKA 3MM9B 2QMUA 1U9IC 1JLKA 1VHWA 2X1MA 4X1YA 4XKJA 1UBCA 1OSDA 1E18A 5KTQA 3L82B 4OJYA 2OEJA 3WQSB 1UWAA 2VDKB 2WYIA 4F86A 8AT1B 5EGYA 1Y34E 3RKSA 3II6X 5K8TA 4ZLLA 4CWBA 4OBWA 3PPYA 5E41A 5CR9A 2GCFA 4Y6OA 3TZKA 1BX1A 2WM2A 2QIFA 4UNRA 1MB4A 3PDNA 1AXRA 2X9LA 2BKVA 1NVDA 3WZMA 2P8IA 3J80Y 2YJTD 4KO4S 4ED3A 4GKAA 1IJEB 4HZUB 1FERA 4RPGA 3MEGB 3R0QA 3PC8A 3MMJA 2FVYA 2LUOA 3E3XA 1Y5LB 3SDEA 4HV4A 3DXZA 1R89A 3WQHA 1J70A 3TZ6A 5IC6B 3FD8A 2A78A 4MQLA 2A9OA 5KDDA 4PLVA 5K0LA 4FBMA 1V7PC 3L01A 3CGIA 1GNLA 5AKEA 3C24A 5JATA 1CVIA 4KHPB 4LSZB 1ODIA 2BKPA 3VQTA 3HKBA 1R7RA 3RODA 1LDMA 3S81A 3D1QA 5E2QA 3NASA 5F9FA 1FA9A 4D9NA 1M5RA 3GVIA 4DSKA 4KVAA 4Y28C 4XQ0A 1S1MA 4NOHA 4H2DA 4P3NA 5I9LA 3QEAZ 1T2UA 4HEJA 1Z0JA 2QJ3A 2B6NA 2GPNA 4EY4A 3LYUA 4QGFA 1QPZA 3GT7A 3MFQA 4PE5B 3RC1A 1F12A 4QTUB 1HKAA 1CSEE 3DRPB 3GRUA 4NXNJ 1NDHA 3UTDA 2QPLA 2DR7A 3DMTA 4RNHA 1LWNA 1DADA 2WJ6A 1XTIA 5D0GA 2VQEB 1KBRA 1NVWQ 2Q3CA 4TZTA 4ND8A 2PUAA 2QMZA 3UK7A 3HSKA 3IAFA 2V67A 4WBNF 4S24A 1NJ6A 3EOBI 3RUHA 2P2YA 5HCUA 1JKJA 4LGCA 2H2AA 4ZA1A 5BSKA 1WC6A 1N48A 1K6JA 5HPYB 1ZJ6A 1JU9A 1QQBA 1YBMA 2B4KA 1CC1S 4G85A 3I5UA 2C4UA 2XVZA 4MAMA 3IP3A 4RW6A 4HAIA 3UPTA 4ZVSB 5GIPE 4GP6A 3E35A 1WG5A 3LL4A 4K1XA 3MUEA 2XNRA 3PO5A 3LFTA 1QTNA 3LBHA 1IJFB 3OL8A 4U7FA 3BB1A 4QE3A 4RNFA 2XY6A 2WT4A 4P34A 3P8BB 3O26A 3H9UA 3CUUA 4USIA 4I6AA 1OLUB 3RK4A 4AM8A 3ZIAD 2W2MA 5B55A 3V4IB 2Q1YA 2SECE 3I9JA 1CEZA 4DNXA 5D4LA 3GIWA 3IS3A 2PZJA 1KC1A 3FI9A 3D0IE 2HSEB 1NSFA 4AMVA