2ZEJA

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
177
structure length
157
Chain Sequence
MKLMIVGNTGSGKTTLLQQLMKTVGIDVKDWPILVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Leucine-rich repeat kinase 2
total genus 40
structure length 157
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 2zejA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zejA02
2P3SA 1Z28A 2QORA 3OESA 3PEYA 1ZD9A 4TYWA 3LRPA 1E2MA 4B2IA 4O2LA 5FBQB 3KKQA 4W5JA 1SVMA 2DFKB 4IOLA 2YHSA 3M6AA 3CX6A 4Q9LA 4E22A 1GRNA 2QENA 2VP6A 3ADBA 1R4AA 2DPXA 5ELXA 3KQLA 3L0OA 3BK7A 1VHLA 1Z2CA 3ND9A 4U00A 1JJVA 1Z6GA 1ELOA 4Q1FA 1X6VA 4MDEA 4TLDA 5F2EA 5G3YA 2G1KA 4RD0A 5JHHB 3U3KA 3QG1A 1NRJB 4G1UC 1II8B 3LWNA 1CBUA 2FFQA 3IO3A 3WBJA 2H7VA 4ZIRA 2LWIA 1XEWY 2AXNA 3BC1A 1UKYA 2OM2A 2GESA 1FP6A 4JLJA 4QGAA 4B3DA 3THWA 1W7AA 1TAGA 4QRHA 4PX9A 2WJYA 1D2EA 4M9QA 1P2SA 2A5GA 2VTKA 1FNMA 2YZ2A 2VPPA 4OI4A 4CGZA 4X8LA 2WJHA 1EG7A 1NVWQ 2HJVA 2X1VA 3VU9A 1GIAA 4LJYA 4ZIRB 3I5YA 2WHXA 1ZRHA 3X1YA 1G3UA 1Z0FA 1FX0A 4DC9A 2HXYA 1Q1BA 4TMZA 4LBVA 4Q19A 1A4RA 4M1MA 5AK0A 4F38A 2LKDA 2RMKA 4MGIR 4AD8A 4X8MA 2H5EA 4A0RA 4OK3A 2KBEA 1DARA 1FX0B 4YONB 4DKXA 4KODA 3O8DA 3LXXA 3AP1A 1NG9A 5KTYA 2J0UA 2F43B 2FX3A 4CT4B 3U4QB 4L16A 2IUTA 2XJ4A 2WJVA 3KXIA 5JI3E 3SI7A 5LD2B 2SHKA 1XU4A 2XTMA 3EWAA 4TQUS 2C98A 4LPKA 2CJWA 4NU0A 4DCTA 2ZIAA 5JWOA 4QHTA 3T06B 4M9ZA 4HI0E 1T6NA 2ZS7A 1GDDA 4Q01A 1GNRA 4YMSA 3BD9A 3Q8XB 4JL8A 3CRMA 2QT0A 3IQWA 4KFUA 2GETA 5EE0A 1W36D 4JSYA 2GCPA 1P6XA 3DZ8A 3QG5A 1JALA 5CDFA 3AF1A 4JZKA 2NZJA 4BLOA 3AVYA 4LWZA 5TV2A 1E32A 2ZANA 2HT6A 1X86B 2VYFA 3VR4A 3RRYA 1JQJC 3OE7D 4XOIA 3FFBA 1M6NA 3T1VA 2KBFA 5DN6A 4PHHA 1TF5A 3OEEA 3U3JA 1QZXA 1VG9B 2W0MA 3GJ0A 3QNUA 5H68A 2Z43A 4S2EA 3C4JA 4H1UA 4ZI3A 1COWD 1SXJE 1XB2A 4N0DA 1ZAKA 2C9OA 4NYIQ 4Q4HA 2VSXA 3THXB 3ZLJA 2WWXA 3W5IA 2BCJQ 4B3BA 3WHKA 1SVWA 1LY1A 3PFIA 2EWWA 1NSFA 4OHYA 1M1YE 4Z8XA 1TTTA 1R0YA 3GMTA 1TEXA 3CUEF 3K09A 3A4MA 1JECA 3NVAA 4YQFA 3OF5A 1E0AA 2JDID 5FI1B 2FSIA 3B1WA 1J8YF 2FGJA 4M1KA 4LV6A 4TTQA 4JYCA 5FTMA 3ZZTA 4IDOA 5L3SB 1DE0A 1ZNZA 1OFTA 2WTUA 1N3BA 2WWGA 4JBWA 3ADDA 4NYMQ 4PQYA 1D6JA 2QNRA 2XJ9A 1KDTA 3CRRA 2X77A 2IWRA 1MO4A 1Q1ZA 4IFBA 3DMNA 4CEJA 2OSBA 1P61B 3QF7A 4B33A 5C4MA 3GLFB 4HUTA 2ZRCA 4JIMA 3Q7PA 5JJIA 3OEED 3RAPR 1Z0JA 3B1VA 5HCNA 3PUZA 1JPNA 2FFBA 4HAUA 3MSXA 4LYHA 1W4AA 2MSEB 1G1MA 2A5YB 5CJPA 1DAKA 2O0KA 1QBKC 1DAIA 2CL7X 2QMEA 2VP9A 4OQMA 4B47A 3O47A 2D74A 3TK1A 4D80A 4BFYA 4OQLA 1R0WA 5TMPA 1NF3A 2EU8A 4R7ZA 3LVRE 3DMDA 5K8TA 2QEQA 3A1UA 2ZUCA 2GA8A 3KUDA 1H8EA 4DRZA 1DVRA 1WDTA 3A4LA 2FFHA 4C0HA 2CNWD 2ZS9A 1E9EA 2GAOA 4C3ZA 5TDHA 4B71A 1NNEA 2OCPA 2BEKA 1R6BX 5FUYA 3AP2A 3CX8A 3Q9LA 1HA3A 4C0AC 1E2QA 1IM2A 3THWB 1LFDB 3CZQA 1OB2A 1S0UA 2CVHA 2FGKA 4JLAA 3MLEA 5D3MB 2CNWA 2IBMA 1GL6A 1QHNA 4TLEA 1C1YA 3A1TA 2GHIA 1Q12A 3KUCA 1JAHA 3FWYA 2XXAB 4CDGA 4QXAA 3SYLA 3TJZA 1DG1G 5FPTA 5J4VA 1BMFA 1K5DA 3QKSB 3TW8B 2CE2X 4HZIA 4I99A 3IGFA 3SQWA 4BZQA 2HYIC 2ERYA 1E2KA 4W7SA 5EQTA 4BEJA 2OBNA 5FOXA 4N0EA 3IILA 2E87A 4URYR 2QG6A 2QRZA 4WIAA 4EFLA 1OXTA 2OT3B 2ODBA 2V7QD 2GJ9A 3NIBA 5EXPA 1CR2A 4A15A 4FWTA 3THYA 2Q9BA 1GKIA 2VHTA 1AGRA 3KQNA 1RPZA 1M8PA 3AF3A 5KSPA 1X8LA 3T61A 2F1JA 4DDVA 4CEIB 2O8DA 4OJKA 2CE7A 3DKPA 4FINA 5J4KA 5B57C 4WVFA 3PUWA 4Q9KA 5HCIA 1SVOA 4OK6A 4JL5A 3TRFA 3B82A 5CM8B 721PA 1T3HA 3LLMA 1T3LA 4MUAA 2EFDB 4D6PA 4DCUA 1R5NA 3IHWA 1KO4A 2QPOA 4BFVA 4M1WA 5TXGA 2O5VA 4RCZA 4XVQA 2OFWA 1UEJA 3VNVA 1FL9A 2DHRA 2WM9B 2J5XA 5K8UA 4BZXA 1V43A 3A4NA 1CJVC 1T0HB 4P4TA 3K1JA 2BMJA 2OCAA 1K8RA 1T3SA 3IIKA 4R2IA 3VQTA 4PC2A 2DR3A 3RABA 3SN6A 2FEMA 4Q4JB 3B9QA 4C2TA 2VQSA 3RNLA 1PLLA 2F3TA 4HB2A 3RANA 3H84A 2Y8EA 4JVSB 4OQXA 2ZRPA 4C2UA 1Z06A 3NBZC 2FV8A 4DHEA 3M4YA 3LY5A 4ZCMA 1BOFA 1IJFA 3OAAD 5TB5A 3P20A 4Q4JA 3U7FB 3ADKA 1E4VA 4Q4LA 4YMVA 1Q57A 3KL4A 5KU1A 2FDCA 5AUOB 2YJTD 3K0AA 3RWOA 2OLJA 4US0R 1G7TA 1UEIA 1H65A 2BBWA 2BKUA 2C9CA 3ASYA 3AVQA 5HZHA 2JDIA 3FKQA 2OFOA 2W00A 4BQSA 4BRWA 3HWSA 4ZDKA 2IUUA 4C0BA 5B58C 1R8QA 1YZNA 5FOTA 1G20E 1YR8A 2E1RA 1I2DA 4I1UA 2J0UB 3OFNA 3U4QA 3QI2A 2CDNA 3P32A 3QEOA 4ZV4A 1RC8A 2PX0A 4LYFA 3F0TA 2Q3MA 3U60B 4UNSA 1FQJA 2QZ4A 2YVUA 3LX8A 3QF4B 3KKNA 2ORIA 1Y63A 1KK0A 1CU1A 2D2EA 5LBIA 1XMJA 4OQFA 5F9HA 1P73A 3KFVA 3LO5A 2ZSFA 4TMKA 4ZO4A 1ZD8A 3CRW1 1P5ZB 3P4XA 1FMJA 3AVWA 3T5GA 1Z07A 2P6RA 4LV8B 4FWIB 1UKZA 4Z8YA 2KI5A 5IHPA 4EJSC 3I8XA 4PSKA 5HR5A 2Q3HA 4Q1DA 4XTRA 1G3MA 3BORA 3KXLA 3D31A 2P67A 2F43A 4IDQA 4PFSA 2ZITA 4TL7A 5FOWA 4KLNA 1AK2A 2YKGA 4FCTA 3X1WA 2XITA 2NOAA 2QTFA 3R7WA 1EFCA 4NYMR 4PPFA 4PHTA 4Z54A 3WYGA 2WAXA 1GAJA 5KPJA 1QHIA 3CR8A 4B6FA 1FTNA 1XDBA 1EGAA 1XD9A 4GMDA 1QVRA 3T5DA 4AG5A 2OE2A 4TN1A 5EE5B 1AZSC 3MWJA 3GEIA 4JVMA 1W4BA 4V03A 2JIZA 4MKIA 1FP7A 2ZRGA 2R6FA 1ZCAA 1ZM3A 3TSOA 1GM5A 3NKVA 1N5LA 2D3WA 2ZUDA 4OHVA 4JJZA 5F3WB 1QHGA 3MWKA 4PO8A 2ZSAA 1OH6A 4NCJA 1R5BA 1XD2B 5FPHA 1KK2A 5FPKA 2GJKA 3VHXA 1G7RA 2IYLD 3CWZA 3TQCA 1MO5A 2NO7A 1J70A 3C7KA 4H1VA 4PPGA 1KOFA 4Q18A 1E99A 5EZ5A 1M7GA 5GADl 1HV8A 4JYBA 1IN5A 2DYKA 2RGNA 3QXCA 1W2HA 2PEYA 1ZC3A 4Y0VA 2O8BB 1OKKA 4A9AA 3VR5A 4Q03A 1SGWA 5AUNB 3GLIA 5EXTA 2Q3FA 4Q9IA 4IVPA 2BOVA 4QHYA 2NPIA 1RJ9A 1XTRA 1DAEA 1LF5A 1VG1A 1HY3A 4B48A 2XNDA 1Z29A 1KDOA 1P3JA 3EC1A 4PC1A 3W9YA 4MKFA 4R98A 4KXFB 3OE7A 4KVAA 2QPTA 1JJ7A 1VG0B 2CHVA 1VCOA 4HSEA 1KMHA 4QHSA 1G6OA 2REBA 3ZIAA 1Z83A 1E2DA 2CMKA 1FUKA 2ZI7A 2VHJA 3VR3A 1N6HA 3NEYA 3EPKA 1W4CA 5DH9A 1Q21A 3W3AA 1QHHA 4L4UA 1F2TB 2PL3A 1XZPA 1OYWA 2PMKA 5LB4A 4DZZA 4Q7LA 3KKMA 1KMQA 4NCHA 4U02A 5KOYA 5J40A 2QA5A 3IPYA 3KB2A 1XEWX 1D2NA 4QBFA 2ZR7A 3AQ4A 2VHUA 1VCNA 5C46F 4RVCA 5FTKA 1KJWA 2GAAA 2OILA 2OLKA 2RGDA 4RKEA 3TNFA 5L3SA 3AVUA 5KO2A 4EJSA 4TMXA 1Q44A 3B6EA 2HLDD 2RGCA 3V9PA 3C14C 1GVNB 3PVSA 2Q21A 1XEFA 2ZRKA 3IHLA 3QENA 1QVAA 3R7WB 1YRAA 1NBME 2FG5A 4WBSA 5ANRB 3L82B 1TNDA 4FCVA 3U7GA 3P26A 1Q22A 2R8RA 3S1AB 1SXJB 2J7KA 4P3YA 4TL8A 4A92A 1Q1EA 3I8SA 5DSZA 1XBTA 5CK5A 1YZKA 2C8VA 1OH8A 2KJQA 2HLDA 3D6TB 1G21E 2EVWX 4Q47A 4IDNA 1N6PA 2QGZA 4B44A 2W0SA 1YR9A 2IW3A 2R6CA 4HLUA 3AUXA 1BIFA 1XMIA 1WRBA 1IN8A 1NN0A 2QTVB 1JAIA 4G5RA 4HZUB 3UMSA 2EFHB 2ZRLA 3FHTA 3SDZA 4E5UA 5FBWB 3GJ7A 2ZSBA 2CLDX 4LY6A 2CVFA 3I61A 2PCJA 2CK3D 4ZDIA 5L8VA 3NTUA 3BERA 2GXQA 2J46A 1M7BA 1KSHA 1SXJD 4PSAA 1KO7A 2BKEA 2RCNA 1MO6A 3CF2A 2PZEA 1OHHA 3F3YA 4OK5A 1KIMA 2O0HA 3FHOA 4RCYA 3UWKA 1DOAA 2O8BA 1C4OA 4BLRA 4DUGA 3MD0A 4KYIB 3N2EA 2DWOA 1ZM2A 1E4YA 3U3RA 1PLKA 1AS2A 1MH1A 2ZRAA 2XNDD 2DFLA 1G6HA 3GLFE 2JLQA 1GTVA 2EW1A 3WY9A 1IN7A 1I4LD 2UZ3A 3DPUA 4BFSA 3I4LA 2J7PD 1VTKA 2O52A 3BWDD 3WMEA 1YZQA 2D2FA 3EX7C 4R71A 3IIMA 3EAQA 1KSGA 3WYAA 1YZLA 1KI7A 3EZ2A 2QT1A 4RSGA 5HTKA 2FJUA 2YOFA 1PLJA 1A7JA 3AKDA 4DB4A 2OCYC 5K8LA 1CEEA 1DAFA 1HEIA 3LD9A 4G5SA 4JLMA 4JLKA 5FR2A 1XJ0A 2ERXA 4AG6A 3K70C 5LDDC 2JLYA 4MUBA 3IIJA 2QPAA 1MO3A 1BYUA 3K0AB 2ODEA 4IOJA 2G3YA 3KJGA 2HEIA 4RZ3A 1U0LA 1KHTA 2ZJ2A 1XXHE 2QGNA 2XNSA 2V6IA 3BS4A 4EQ6B 5TVKA 5KSZA 3NEJA 1ZM9A 3EIHA 4JKYA 3D7MA 3DL0A 1OH5A 3BGWA 1PVOA 3RLFA 5IK2A 3ND8A 1F60A 2QAJA 4Q9JA 2P0EA 4DLUA 1T9HA 2W2XA 3KTAA 5HE9A 4QNRA 3K0SA 4WOPA 3T1TA 4YDSA 4Q4AB 1XPRA 1Z0IA 3BB4A 4PHFA 3LBHA 5DLQC 4G5OA 1A5TA 3BE4A 1YZTA 4IHQA 3SZRA 2W6JA 1E1RA 3DOEA 2WKRA 5B30A 2VLIA 1G8FA 2YOHA 5LPNA 2HCJB 3DHWC 4YLGA 3UMRA 2R44A 5FOVA 5AUPB 4LC0A 3GLIB 5LD2C 4D2IA 4A0FA 3ONWA 3AV0B 4OKSA 2VH5R 4LHZA 2QAGC 1RVDA 2V9PA 5KNDA 2UKDA 2ONKA 2RHMA 2G77B 2IA5A 2IYQA 2R6AA 3UXMA 4HUQA 1Z08A 1WBDA 1SZPA 1ZUIA 1H8ED 2IF0A 2VIIA 2D4HA 3OZXA 4D4KA 3HU3A 1LW7A 2OBMA 2BWJA 4YMUA 2Q6TA 2V7QA 4XD7D 2OUKA 1XD2A 1OLOA 2AFIE 3MJHA 2A3RA 3THYB 4DSUA 3JVVA 1W47A 2PZGA 1A2KC 2EFCB 4HYYA 1U81A 1CJMA 3EPHA 5FTLA 3EZ9A 3LA6A 5EP3A 1TU3A 2V54A 1S96A 3EW9A 4JL6A 1G8PA 3QPWA 1LS6A 4TYPA 4M0LA 5KDOA 5TY0A 3BIFA 2GEVA 5BN5A 4TTPA 2V1UA 5E95A 5H8WA 4NONA 4DLSA 3MG9A 4Q1BA 4IEIA 1E2LA 1TL7C 3GLGB 3LQRA 2RHDA 3EXAA 4ERNA 4NMMA 4ABYA 5EXXA 3REFA 4O0MA 3EZ7A 1QHYA 4LV5B 4GRAA 2H18A 1U2RA 5DYGA 2NPFA 1VHTA 5A0FA 2IHYA 5DHAA 3VHLB 4AK9A 2BJWA 5E7JA 1Q3HA 2GEUA 2ZU6A 4C0SA 1XCPA 3CM0A 3DM9B 1FPMA 4QJ3A 3ZS8A 1YHNA 1UBEA 4FCWA 4Q7KA 5JWRA 4DEYA 2UVQA 2JLSA 4IOKA 2EWVA 2I1VB 2G9NA 4AKIA 4LHWA 4XWKA 5JSZB 1VPLA 3UG7A 1XXHA 4DCVA 4B32A 1AIPA 2JAQA 3G5UA 2WJIA 2F1HA 2CL0X 1L2TA 1IOZA 2CCGA 3CZPA 4QKQA 1E2EA 2OO7A 1WCV1 4UNNA 4URVR 1GRQA 3N2IA 2JJ2A 3PENA 2WPDD 2I4IA 1J8MF 3QIAA 5K8IA 1A1VA 3MRSA 1ANKA 4MA4A 2IXGA 1G64A 1P9RA 3GJ4A 4ACAA 2J41A 2AD5A 3U6KA 4AY2A 1G8YA 1GL7A 1OXXK 1Z47A 1A2BA 3OEHD 4QNMA 2FFAA 5KNCA 5FR1A 1OT3A 1H8HD 1KO5A 3HYTA 2PLFA 3L0SA 1G9XA 4TYQA 3LLUA 1YU9A 3TGPA 5JJKA 1IXSB 2DFTA 4QG7A 4IVQA 5EP1A 1OV4A 4MRNA 3CKLA 2ODWA 1HH4A 4V0KA 3CNNA 2CLSA 4N3NA 2IEZA 4Q5IA 5FUXA 4OI0A 2PT5A 4C0QC 1PV4A 4DDWA 1MT0A 3CWQA 1N5JA 1N6OA 5JS8A 3EPLA 3MJRA 4HLQB 4DLWA 1WF3A 3ZDQA 2HF9A 1LB1B 5CYPA 1WXQA 2IYTA 4KFTA 4BLSA 5HPYB 1UJ2A 2DFNA 4IXMA 4US2R 1EWRA 2BDTA 2IK8A 3Q3JB 3B2EA 4II7A 2PCLA 3C5HA 4IDHA 5BW8A 5C1BA 1C9KA 4M9SA 4GPTA 1E1RD 4MH0R 3CX7A 3L0PA 2LCFA 5HE8A 2VP4A 5FTNA 1E0JA 4RD6A 1RW4A 4AURA 4FMCF 1LTQA 3O8CA 4AYWA 4ARZA 1E0KA 2QM7A 2ZTSA 1JB1A 2FH5B 3I73A 2F6RA 2QL6A 1N5IA 3L0IB 1DO2A 3WP0A 3WBKA 2JA1A 4DT1B 4QJ5A 2J59A 3CO5A 1S8FA 1F48A 1B23P 3IO5A 2OCBA 3O8BA 4O3MA 2AFHE 3SHFA 2GF0A 2AXPA 1N0WA 3GLGE 1P2VA 2GKSA 1Z6AA 2QM8A 4ITRC 4A1FA 2C78A 4XD7A 4GZLA 3U2QA 3N70A 4RD2A 1P75A 2A5FA 4UXHA 5JZVA 3GFOA 2G1JA 2WJGA 4EPWA 4W5HA 5AJZA 3ZJYA 2JLWA 4GMXA 1DPFA 2HF8A 2JLVA 1GNQA 4Q00A 1EFTA 1XJCA 1XPOA 2C9YA 5DO9A 4DSOA 4Q4AA 5HZKA 3R9XA 4JVNA 2VSFA 1F3OA 4A2QA 2GEDA 1HQCA 4C4PA 1YZGA 2WJJA 2ZRBA 2ZJOA 4GOJA 3WYFA 2OEPA 1KKMA 4CEIA 2FF7A 4HB0A 3H0KA 5CJ2A 1XF9A 5G40A 2VL7A 1SXJC 3QJYA 5E3HA 2IL1A 1SQ5A 2N42A 1XP8A 2CXXA 3T1QA 3KJHA 4KLZA 2HT1A 1P2UA 1G5TA 4Q9HA 3Q7QA 3E5HA 5GVRA 2AHOA 4ZKDA 3NBFA 2GZAA 3QBVA 3P1JA 3QKSA 1AGPA 3A58B 4YXWA 5JWHA 2KB0A 2ZYVX 3QEJA 4E07A 3NC1C 2Q0HA 4IRUB 3NBYC 4JBYA 4LJ4A 1XTSA 1ZYUA 4ZKEA 1NG1A 1JI0A 2O8EB 5HKKA 2XZPA 3ZVRA 1G3RA 1W48A 1W5SA 3I3SR 3T35A 3Q85A 4CW7A 1CRQA 2WPDA 3HP1A 3Q72A 2JJ8A 5FUWA 1E9BA 4NCKA 4I1OA 4GI7A 421PA 5SZHB 2ZJ5A 1ZNWA 1EFRA 1J90A 3PCRB 2YOGA 2YINC 1KGDA 2NIPA 5C18A 4B6EA 3BOSA 3G0HA 1KTVA 5JSZA 2QBYB 2B92A 4IFEA 2J0SA 3SJZA 2PT7A 2R62A 1GNPA 5JFGA 5JLJA 4PAMA 2ZSDA 2O8FA 3FHCB 1L7VC 3D3QA 2PBRA 5CIQA 5EP2A 4EPXA 2W83A 1KZGB 1L4UA 4CEJB 4FIDA 1ZCBA 4TMWA 1S3SA 1WQ1R 3RS5A 3TR5A 1F2TA 2MMCA 3CH5A 5E7MA 3SEAA 4FMDF 2QY9A 2ZUBA 4NH0A 2XX3A 3K0FA 5EE3A 3OAAA 2G0TA 1NBMD 2ZAOA 1AQYA 3TAHA 4M4SA 1GRRA 3GPLA 3QKTA 1DADA 2B7CA 1CRPA 2WWFA 3QKRA 2WKPA 2F1RA 1J7KA 1R0ZA 3CPHA 1PJRA 4BWYA 3VTKA 1NP6A 2REOA 4HAXA 2HCBA 3IKJA 5FH9A 1KSFX 3SHWA 4TMVA 5G3ZA 4A6PA 4HLDA 5SZKB 2AL7A 2JGNA 3AVOA 2YYZA 1PZNA 3KDSE 4C30A 3AKEA 3R8FA 3GLHE 1KKLA 3S1AA 3T15A 3U3MA 4M9XA 1TQ4A 4JLNA 2YWGA 4LDJA 2FZLA 3W8NA 2RGBA 2BBTA 1J2JA 3GP8A 3MMPA 2FSHA 4D81A 1Z22A 4M21A 1SKYB 4C7OA 4KO8A 4QGGA 1CULC 2XOKD 2PX3A 1CKEA 3EA0A 1X8KA 4XVUA 4F91B 2DCUA 2N46A 1E2GA 2JLUA 1ZMXA 2V4ZA 4LBZA 3SE0A 3NXSA 3C15C 3K0FB 4G3XA 3PIRA 4L9WA 2BM1A 1T8TA 2QU8A 5CB6A 4JLPA 1ODFA 4IJMA 1S9HA 4PR0A 4I81A 2IS1A 4POAA 3RS7A 4BE7B 1KNQA 3B13B 3DM5A 4LBYA 1W4RA 2VF7A 4TMTA 2V55B 2QAGA 3PQCA 2ZAMA 4B3GA 1XTKA 4GL2A 1RE0A 2F3RA 3EG5A 5KNBA 2VP2A 4G5GA 3U3OA 2ODNA 4FMBB 1II0A 1RRPA 5J47A 3JZMA 3VFDA 1WMSA 4BFUA 3BJIC 4I1SA 1MABA 2GJSA 4DSTA 1Q3TA 3GJ8A 3AF4A 1P62B 4Z1MD 4BLTA 2ZQ5A 4PZZA 1OF1A 2VF8A 5G53C 1VKJA 4K46A 1SULA 1JNYA 2XOKA 3I92A 2HDNB 4TYNA 4EJSB 4LBWA 4EDHA 2FNAA 5CLQA 3HJNA 5H1YA 3R9IA 3AF0A 3ASZA 1U94A 4RFSA 1VMAA 3VR1A 3ZH9B 4EFMA 3IEUA 1NN5A 4AYTA 2C95A 2V1XA 1KNXA 4Z51A 2P6NA 1HURA 5DI9A 4Q7MB 5JRJA 3PEWA 1LF0A 1N6RA 1US8A 1WE2A 2GCNA 3PUYA 2JJ1D 1SVSA 4B35A 1IXZA 3ZVLA 4URWR 2TMKA 3E70C 3B1YA 4UNQA 2F55A 5DN6D 1SXJA 3WNCA 1NJFA 2L0XA 4B34A 4EFNA 3KTAB 4EPRA 2Z4SA 1LS1A 2AKAB 1F2UA 5E7IA 3CIOA 2A2ZA 3EIEA 3TUJC 2P6UA 3FMIA 4RKFA 3FB4A 1LNZA 121PA 1XXHB 2G83A 1UDXA 4HAVA 3MUFA 3V00A 1D2MA 1DEKA 4MRPA 2ZYTX 2CL6X 4DBLC 5DYIA 2RKOA 3HR7A 4URUR 3ADCA 1PUIA 1JR3A 4CEHA 1ZM7A 1E94E 2IYUA 2OAQ1 2ZI3A 2WWWA 3LW7A 5JCZA 1OXUA 2C96A 2OAP1 3NHBA 3LNCA 3I1FA 3AVTA 4MRSA 3DOFA 5C4GB 4GT1A 1FQKA 2IYVA 4BFTA 5C2JB 5CIWA 1XPUA 1E96A 1U0JA 4QBHA 1BMFD 3CNOA 2J3EA 3RS4A 1JR3E 4ASUA 1QHHB 2ZS8A 3FFAA 3DO6A 4TWZA 3FPAA 3WP1B 1YR6A 2ZJYA 4JT2A 1RRCA 2R9VA 5FOSA 1UFQA 1GSIA 2RGEA 2J9RA 4PQFA 2R65A 1MOZA 1XNJA 1M7HA 2XSZA 5L3QA 4LC1A 1G4AE 1R10A 2REXB 4PQRA 4F92B 2O8EA 1P4SA 2W6JD 2NO0A 3WMFA 4LJ5A 1S9DA 4LJ8A 4ASUD 2C99A 2ZVQX 1I4DD 4LJ6A 5CITA 5JI2E 2R6GA 1ZD1A 3OIYA 3UMFA 4FXPA 5AWFC 2WOOA 2JLZA 3IBGA 1IN4A 4NDZA 2FPMA 2QROA 1L4YA 1CIPA 2Z0MA 3J81k 3A1SA 3BBPA 2BBOA 3TBKA 3GJ3A 1TUIA 1OXVA 2AKYA 3VR6A 2FZ4A 1R0XA 1SVLA 4MGYR 3R9WA 3SQXA 3FVQA 1OXSC 2RGXA 1TF2A 2CEAA 1KMHB 1P2TA 5JEDA 2GXAA 4F4JA 3QXXA 2JJ1A 5BYJA 5KDLA 2DBYA 4ARZB 2P5SA 4GNKA 4M1SA 2IS2A 4BASA 2QN6A 2QUZA 2YWEA 3VMFA 1TPZA 2FOLA 2BIFA 3E1SA 5A5GA 1OIVA 3QXHA 4MKGA 1KI3A 3HR8A 1T4GA 2EYQA 1E9RA 1TUEA 3GEHA 3U44A 3U61B 4Q21A 3W5JA 2WZQA 2ZSEA 4GOKA 4AI6A 2ZRNA 3AVPA 4JKIA 2ATVA 1OPXA 1Y3AA 3SJCA 1TADA 1GL9B 4CVNA 1WB9A 2DB3A 1BS1A 1Z0AA 4R2HA 5DISB 4DLVA 2ZRMA 3OFND 1KZ7B 3SFZA 1U99A 2PH1A 4ON9A 3NG1A 4PPQA 1G7CA 2ZI5A 4KI0A 1G41A 1W0JA 2R2AA 4QM7A 4N1AA 4NHOA 3PJRA 1DG3A 1U90A 3CPJB 4JSTA 1RRGA 5J4HA 4A0GA 3O8RA 2FE4A 4XH9B 1UBFA 1RYFA 5FI0B 1TX4B 1OB5A 1NN1A 1RZ3A 4R9UC 5CM9C 1EX7A 4BEBA 1XTIA 3AF2A 2H8KA 3B60A 4M1TA 4TZ0A 2VEDA 1GWNA 4B73A 1KY2A 3B7GA 2GJAA 3CH4B 3K9HA 3ZVMA 3LV8A 3PXGA 2DY1A 1NLZA 1P9WA 2FN4A 3W6PA 2X19A 1N0UA 3A36A 3AKCA 4FMDB 3TR0A 5KSYA 2O8DB 3QXSA 2ZYWX 3HU2A 2ZRHA 2FA9A 2JEOA 3UATA 2ZU0C 2RGNC 1HE1C 4LYAA 5D3MA 4AYXA 1QHXA 4OL0A 1MKYA 2H1LA 1VIAA 1Z3IX 2B7BA 1IN6A 3VU9B 3U44B 4D0LB 2ZRDA 2ZE6A 3CNLA 4EUNA 1P9NA 1COWA 2EFGA 2ZJBA 4Q1CA 2IS6A 4F93B 1G291 2BCGY 2QSYA 3TE6A 1SHKA 2A5DA 3H4MA 5DI3B 3BB1A 5AJWA 4DUGD 3FOZA 1AKYA 3I62A 4OBEA 4MDFA 4BZPA 3X2SA 4E03A 2W58A 1IY2A 3M1IA 4M2LA 4LYJA 4A6XA 1BYIA 2QBYA 3H86A 1GFIA 3DEFA 4PZLA 4IKEA 2J0VA 3AKYA 2J7PA 3ZS9A 1UADA 4B76A 3IPXA 2CBZA 4ZCIA 3LFUA 4MYHA 1S3GA 2HJGA 3E2IA 3MGCA 3C5CA 3KKOA 4ESHA 4LJAA 1KI8A 1G19A 1G18A 4ZI2A 3ZZUA 2F9MA 1M34E 5AUQA 2GDJA 1SVKA 2AK3A 3QSYA 4EKDA 4RD1A 2WMOB 5JECA 4ZDWA 4B3CA 1T5LA 3W90A 2CLCX 1CTQA 4WZ6A 3PEUA 1UKVY 1N6KA 1XCGB 2V8OA 2VP0A 3C8UA 5FL3A 1UKEA 1ZP6A 4MKHA 4NYIR 3W3ZB 4B3FX 4RD3A 1W0JD 1W46A 3A1WA 1Q20A 1K5GA 3CF6R 4L8GA 4D0GA 4TT3D 4V0NA 1KDPA 2VHQA 4W5WA 4AKHA 2X8AA 3ICEA 1IY1A 4A82A 2WWIA 1OJLA 1DO0A 2LKCA 4AWXA 2O0JA 3EARA 5CDFE 1E9DA 4HDQB 1E0SA 4V0ME 4J0QA 4IW3B 221PA 4OHZA 2YV5A 1RFLA 1KDRA 3G82C 1TQ6A 2ZR9A 3LW8A 2QAGB 4HAZA 4BECA 2B8TA 1Q1QA 1E79D 1SKYE 4LSGA 2NO6A 4DXAA 2W6IA 1ZNXA 2NGRA 4OYHA 4OI2A 3HU1A 4NCNA 4K81B 3U7EB 1NLFA 4KBFA 5KHOC 2QE7A 5KYKA 4HUQB 4KAXA 2B8WA 4HZUA 1G5PA 5FPYA 1UBCA 1X1RA 1N5KA 1JEDA 1N25A 3V4FA 3HPQA 3L8ZA 3I5XA 4CRWB 4BGDA 4I1VA 1TQ2A 3RSLA 2JATA 1E2IA 4NP6A 5EJEA 1OH7A 3AH8A 1OIWA 3GJ6A 1A82A 1YE8A 2J45A 1Z6YA 3ZZ0A 3KQKA 2CJWB 2QI9C 2WWYA 2WBLC 2E9SA 4YMWA 2QMUA 4QGHA 3TMKA 3IBYA 5KPDA 4GFDA 1Z5ZA 2ANCA 4OQNA 2B21A 1W44A 4MYUA 5EE9A 3REGA 4US1R 2X2FA 1N6NA 4ACBA 3HPRA 2IWHA 2QP9X 1EFRD 1ZC4A 4O25A 3RRZA 4PTLA 4TL9A 1D8TA 1KJZA 1VYUA 3TAUA 2AK2A 1GKYA 3BFXA 1T91A 3T12A 3VAAA 4JLBA 2IYSA 2WICA 3ZGXA 1MR3F 3U7HB 3FGNA 3DVLA 5BQ5A 2YC4C 3TLXA 3PG5A 4A8JA 1KYIA 4M1YA 4OJQA 2RH5A 4DVGA 4P4UA 4UXJA 4BPBA 3RRMA 4XWOA 2PJRA 2GBLA 2ZREA 2GVDC 2FU5C 3DZDA 1U8ZA 1EK0A 2K5UA 1DS6A 3F8TA 1QG2A 2OXCA 2WMNB 4WXPA 1NBMA 1W1WA 3LQQA 3AEZA 3B5JA 1HQYE 2BJVA 4B2PA 2WOJA 3IDQA 1QG4A 3BAFA 4HEJA 3RWMB 3SFVA 2FSGA 4DT1A 1MRNA 3K8YA 1E2NA 2J0QA 1NI3A 3M0EA 1CF4A 4C0JA 2JLXA 4Q1AA 1CXZA 2EYUA 1EESA 2C77A 4RZXA 1MV5A 4WA7A 5JBQA 1J99A 1IY0A 3IUYA 2FPKA 2G88A 2QTHA 2XTNA 4KHZA 3THXA 4GBMA 1KJYA 4BUJA 3GD7A 4PAOA 3IQXA 2AWOA 4A8JB 4OHXA 1R2QA 2ZI9A 5FL7D 3V4RA 3CONA 4HLCA 3RHFA 1II9A 2WSSD 3PUVA 3TQFA 2FEOA 1TEVA 3BRWD 3W6NA 4HB3A 4OI1A 1W0KD 3X1XA 4RFSB 2V3CC 2HXSA 4GDFA 4QC2A 2IS4A 1E9AA 4CZ2A 2CK3A 4D4LA 1XTJA 3ZQJA 4HLUC 3RRNA 1ZVQA 4LK2A 1GITA 4Q02A 1HE8B 1Z8FA 3QF4A 4TL6A 2KWIA 2GK7A 3GEEA 2ZRJA 3AVVA 3EA5A 4M8NE 4E09A 4L9SA 5GJBA 1DTSA 4ZCLA 3GFPA 2J1LA 4KBGA 2XEXA 4PC6A 3B1XA 5JRZA 5JHGB 3FTQA 3ZD7A 2P2LA 4L5BA 1KAGA 2QQ0A 2ZVPX 1QHSA 4U5XA 3GLFA 1NY6A 3B85A 1CP2A 3OHMA 2NO1A 4DWJA 2GK6A 3ZYCA 1ZUNB 3WRYC 3H1TA 4KU4A 3F5FA 4M53A 3ECCA 3GJXC 3RC3A 3ZVNA 2QP4A 4DLTA 5GJWC 1WBBA 1AKEA 1GP2A 4F4IA 2OESA 2QE7D 1CJTC 5FPSA 4A36A 5BXQC 2IF2A 3MWLA 4V02A 1BKDR 1OYYA 3P27A 2IYRA 1T0JB 2JJ2D 1SHZA 4KSCA 4XIGS 2JIZD 2QP3A 2GTPA 1EFUA 2Q9CA 3QBTA 3BH0A 1F2UB 1KI9A 1OW3B 2YNMA 2F1IA 1W49A 1X8JA 4V0MA 4YXWD 3SYNA 2DWPA 1YVDA 2GVZC 4KITB 2ZJ8A 3UKDA 3FKSD 1KI2A 3GLIE 3UK6A 3H2YA 1JR3D 4G0NA 4MGZR 3WMGA 5JCPA 2GNOA 1PUJA 4IXNA 3CRVA 2ZJZA 2HV8A 4JJKA 2BMDA 3NDBB 3U6BA 3VNUA 3QUSA 4NBSA 3RC8A 1U98A 2O8CB 5D3QA 3NH9A 1QF9A 1FFHA 4P4SB 4NYJQ 4CF7A 1O3YA 2ANBA 2IXFA 4EPVA 3UWOA 3PUXA 2XSZD 3JZAA 3QVVA 1VYVA 1T8UA 2Z5FA 3T1OA 2V6JA 3UG6A 1JPJA 3EZ6A 2QRNA 1UBGA 4IVRA 4GP6A 4NE2A 3AUYA 4PHGA 3QKUA 1Z6TA 4C9BA 3KJEA 3EWSA 4QJ4A 3W8RA 3GLHA 4YC7A 1IXRC 4ZDJA 1V5WA 1XFAA 3SC3A 2CHQA 5FUVA 2VHCA 5AJVB 1L8QA 2ZE5A 5L3RA 5AR1A 4B43A 1P60A 3TSZA 1US8B 5UKDA 1VYTA 4PAQA 4XVRA 4ESVA 3FMFA 4EIWA 3BH6A 2O8FB 2C03A 3WHLA 2J87A 4D4JA 2FWRA 4S35A 2W2TA 1DELA 3BFKA 1IONA 3FMOB 3WNBA 4JBXA 2D7CA 1G7SA 4MYCA 4TZ6A 1YKSA 4RZ2A 1N0VC 3LH5A 3QVUA 3W6OA 1ZU5A 3UIEA 2ORVA 4JLDA 3NHAA 1KAOA 3FYHA 3K70B 4PPNA 1FZQA 1M2OB 1RRFA 1E6CA 1RKBA 3ICQB 1GG2A 5F9FA 1NLYA 3T34A 2R6DA 8OHMA 3RVBA 3VX4A 1S1CA 1E2HA 3K9NA 3TH5A 3LXRA 2IEYA 4LI0A 4D26A 5CB8A 4P0TA 4DLXA 2ZROA 1Q0UA 1WP9A 4JLOA 4TYYA 4P31A 1NVVR 1CS4C 3THOA 1GKUB 2YC2C 3QPVA 1Z6XA 1AS0A 1GILA 2PMDA 3B78A 3SYKA 3ZD6A 3TW4A 4AC9A 2IHBA 2XTZA 5CYOA 3X1DA 4IEEA 3GLGA 3ETLA 3TVDA 1CR4A 1UF9A 2PJZA 3WRXC 3DDCA 4KSBA 2NMVA 1P7CA 1FW6A 2GCOA 1DBSA 1UDWA 2H57A 1XZQA 4YMTA 3UANA 1AM4D 1G8GA 5EE1A 2QMHA 1M74A 5E4FA 3OIWA 4PSVA 4D25A 4LUCA 2IT1A 2CHGA 4D0NA 4DCNA 1HTWA 4X8OA 5EP4A 1N2CE 4BLQA 4A4DA 1KI1A 2F9LA 5HKKD 2WVJA 3AGPA 4QGFA 2OZEA 4FW9A 2JASA 2PEZA 3VKWA 2VO1A 3MFYA 5B2ZA 2VP5A 1KO8A 2KE5A 3B9PA 3A8TA 4Q48A 4FI3C 4BRUA 2CCKA 1CLUA 5GJVC 3PEVA 5BWMA 5TARA 2FMXA 4TLBA 2WAYA 1MABB 2OFXA 1EXMA 2Z83A 3GQBA 3LAWA 1G8HA 3CLVA 1G3IA 4Z1MA 4QM6A 1GOTA 1NMXA 4EAQA 4UNRA 3TIFA 4NPHA 1Z2AA 1FTSA 1BO6A 4JLVA 1XX6A 3TSWA 4LHYA 2XAUA 2GCOB 2P5TB 2BVNA 3AGQA 4WZAE 2MMGA 4DDTA 1E1QD 4WAUA 4C0KA 3A6PC 4TSFD 4XJXA 4B2LA 4PZYA 2H92A 4MGKR 2P65A 1UPTA 3QY0A 1O87A 1ZIOA 4JT4A 4CT5A 4EQ6A 6Q21A 4FN5A 2QQEA 5JEEA 4BFWA 2IXEA 3KKPA 4OHWA 4DJTA 3RS2A 4Q1EA 4D4MA 4QOSA 3EPJA 3I72A 2NO9A 3LBIA 1IBRA 3CF0A 3LDAA 4WW0A 5KSOA 4Q4HB 5FBLB 4MQBA 4TTRA 4QFMA 3KXKA 1Z63A 2H17A 2ORWA 1TQDA 1NY5A 2B6HA 4KV9A 4URZR 1VECA 4DIEA 3MCAA 3NDPA 1VDZA 4GOXA 2KSQA 3JVUA 2NTYC 2IYYA 5AJXA 5GJCA 1DAMA 2XB2A 3EZFA 1U9IC 1E9SA 1KI4A 1N6IA 2XB4A 4LCBA 4DCSA 2I1QA 5IK2D 3DKVA 4GP7A 4RZUA 3KQHA 1NKTA 3TUIC 1S1MA 3PITA 521PA 2VA8A 4NL4H 1IHUA 4TT3A 1LV7A 1R8SA 4XSHA 2C5LA 2C2HA 2ZI6A 5EZ6B 1NIPA 2HUPA 5IF9A 3SBDA 3SOPA 4AKGA 1TU4A 4TQ9A 5CLLA 4EPTA 3C16C 3Q5EA 1E69A 1AA9A 2WIAA 2MSDB 3K0EA 4KCGA 4QBIA 1IQPA 1XRJA 1ZIPA 5AJYA 2OBLA 3RSOA 5M04A 2PZFA 1RYHA 3SR0A 3GCGA 4DIDA 2WV9A 2GZDA 2IYXA 4UJ5A 1G3QA 3SJBA 3AB3A 4KYUA 4MRVA 4PC7A 2XGJA 3K09C 1TF7A 4X8HA 1UM8A 5FBRB 1FUUA 2PLRA 1II8A 1NN3A 3L8YA 4XSGA 1E2PA 5EUMA 2Q9AA 5CK4A 1KSJA 1KO1A 3QPUA 2GBLC 4TQAA 1WA5A 3D8BA 2GRJA 4JS0A 5G41A 3R8CA 4A8JC 4PC3A 1E1QA 2C04A 2DWQA 1HUQA 4HAWA 4IDPA 2QMOA 2ZE8A 2IYZA 1FOEB 4TSFA 4CIDA 1X1SA 4A0HA 5DNYB 1QRAA 3FMPB 2I3BA 5LB2A 2NG1A 4JVLA 1JXOA 1GUAA 1S4QA 5FTJA 1VCMA 3CW2A 1AN0A 3RYTC 3TVTA 1KY3A 1NKSA 1ESMA 5L3QB 4G5QA 3U5ZB 2ZYUX 1JBKA 2ZR0A 2BEJA 3QOFA 2A9KA 4LGMA 3EC2A 2O8CA 4LHXA 821PA 3SS8A 4B74A 1D5CA 3WXMA 3K9LA 2YWFA 2D62A 3EASA 5IDVA 4M1OA 1I4TD 1ONBA 1G4UR 3NBXX 3KJIA 3BFVA 4LZZA 1W36C 2JLRA 3QE0A 4TLCA 3VR2A 3SJAA 1NSTA 4LPSA 3AM1A 2JCSA 1OFHA 3KB1A 2AN9A 2IYWA 1ZBDA 4NTZA 3C41J 4NZYA 5B64A 1ZM4A 1XCMA 2GXUA 3ZQ6A 4NCIA 1NVXQ 4HAYA 5IT5A 3B8HA 2XZLA 4BLPA 2ZETA 1X3SA 3KZ1E 5EUQB 1NMYA 2WSMA 3W34A 2OXRA 1YZUA 5EXSA 1OKKD 1FNNA 3B1ZA 4IOMA 4Q66C 2BHRA 1G17A 4UKDA 4KJZA 2BM0A 4C7OB 3L2OB 4P32A 2OHFA 4RY2A 3P4YA 1T5IA 4KFSA 4UJ3A 3L43A 4BFZA 1E3MA 1W0KA 4LOAA 1SKQA 1AS3A 3QXJA 2H16A 4PO9A 2ZE7A 4DLYA 4V0LA 2OV2A 1P72A 1U0HC 5FL7A 3CBQA 4FMCB 3FKSA 1ZW6A 4LRWA 3LX5A 4YDHB 2GILA 1BH2A 1K6MA 4HDOB 4NKRA 5A4JA 2RGGA 5FBVB 5DGXA 2AD1A 4B75A 1ZINA 4LHVA 1YRBA 1IJEA 3QQ5A 5IRCD 2D7DA 1KI6B 2AWNA 3GFTA 3TUZC 3OEHA 5KUTA 3OIUA 2ZJAA 4KFRA 3CRQA 3IEVA 1OIXA 3PR1A 1YJ5A 1VG8A 2ZRIA 3KFXA 1Z0DA 1CR1A 4RJLA 5FFMA 2RGAA 4MYTA 4PO1A 3SU8A 3MAAC 1ZUHA 2A7QA 1SVIA 2FSFA 4RFVA 4ZPXA 3BB3A 2RAPA 3KQUA 5F98A 4C0LA 2EQBA 5DHFA 3ZIAD 1XTQA 3CPEA 2YWHA 1D9ZA 5DI3A 4A2PA 2A30A 1E2JA 1W5TA 5DE3A 5JMTA 1TMKA 4Q7JB 1OE0A 4H9GA 2NZ8A 4G01B 4V0OA 2ZEJA 2CCJA 4A2WA 2VSOA 2ZXUA 1GZSA 1E98A 1ZJ6A 3OIVA 3UPUA 4WXRA 3KX2A 1R7RA 2BC9A 1NJGA 4AKEA 3VKGA 1ESNA 1HT2E 5SZJA 2N1BA 4MITA 3K70D 4I4LA 2RB4A 2Z6VA 3RDPA 4B3XA 4Y0AA 4DDUA 3SNHA 4EPYA 1OFIA 2MSCB 1B0UA 1KK3A 4QL3A 3PV0A 3HYRA 3BXZA 4NYJR 2WKQA 4M22A 2GZHA 2W6ID 1XMVA 1HT1E 1E79A 2VBCA 3X1ZA 1NIJA 4UQOA 3R20A 2BV3A 1CR0A 1MRSA 2BMFA 1ETUA 2QSZA 4CEHB 4ILEA 4URXR 1XJQA 1YQTA 2A78A 2F7SA 1XD8A 2ASEA 1XEXB 4TLAA 3TKLA 3GLHB 4HATA 3A1VA 1OSNA 4UXIA 4XWAA 4CYMA 2G0NA 4AIIA 1D9XA 2ZI4A 4HDCA 1RIFA 1QDEA 1U8AA 4LX0A 4DLZA 2GF9A 1CJKC 5DIFA 3NC0C 1LVGA 1E9CA 2HYDA 4JMPA 2IX3A 2ZM5A 1OHHD 3I32A 1DAHA 3SBEA 4XTCS 1VIYA 1E9FA 1H8HA 1XEXA 2WIBA 4P4SA 5L3VA 3A37A 1Z0KA 4D82A 4PANA 1G5RA 4U7DA 1S2MA 3GJ5A 4GZMA 4RD4A 1NL3A 2D06A 5GVSA 1U9IA 1AQUA 3RS3A 1EX6A 1FMLA 1RJ9B 3VKHA 3K0CC 5J5CA 1ZNYA 3K53A 1CJUC 4DSNA 1KK1A 3CB4A 5JJLA 2GJ8A 1W36B 2A5JA 3EIQA 1AJEA 2NQ2C 1G16A 1N6LA 4MRRA 2XXAA 1JQLB 2ZRFA 5J4LA 3AVXA 4KVGA 4FD2A 2FPLA 3HDTA 3LBNA 3QKRB 3CR7A 4L15A 2EFEB 4O2RA 4P33A 4QBGB 5P21A 3FDIA 2ONJA 4F4CA 2GXSA 4UNPA 3NWJA 4LJ9A 4W9MC 1KI6A 2AR7A 2GWHA 2W2VA 3Q5DA 1VCIA 4HB4A 1EWQA 1NVVQ 3VX3A 5SZIA 2IUSA 4LJ7A 4DLRA 3K9GA 1F5NA 2IC5A 4PXAA 2X2EA 1U8YA 1HYQA 2BBSA 3BH7A 1JR6A 1JXMA 3WNDA 2BMEA 2G6BA 3AP3A 1ZU4A 1IAQA 3MWYW 1W2GA 1F6BA 2VRWA 1R5OA 1E2FA 2ZPTX 1NVUQ 3NH6A 3RS0A 4BFXA 2XZOA 4K8OA 1OFUX 5J4YA 1JEEA 1I2MA 3LVQE 5H70A 4DB2A 2AX4A 1EFHA 2WWHA 4WZBE 4F7WA 5BYKA 5BN4A 2ECKA 621PA 1UAAA 2ATXA 3K0CA 1NMZA 5JS7A 1XMSA 1YR7A 3N5CA 4DEXA 1XWIA 5FOUA 5KDDA 3FE2A 2WSSA 2UZIR 1DAGA 2Z4RA 2OG2A 5BN3A 1AZTA 4GSYA
chains in the Genus database with same CATH superfamily
4N5SA 1V7ZA 2VDRB 3LRPA 1RSZA 3IS9B 1S3FA 4BU1A 5IBPA 4KKOA 5ELXA 2X22A 1U7PA 5DGTA 3O3LA 2Q46A 1ELOA 1TZCA 1WSVA 2DUNA 1JXVA 1AHNA 1FRZA 5DG9A 5BR1A 1Q1KA 3T1HF 1NONA 4CGZA 3RRHA 1XGKA 3IUBA 4AT1B 3CCQS 3L7OA 1V6HA 4TMZA 5KG0A 4J1QA 1JMYA 1AZWA 4KWTA 2AJ2A 4GO7X 2YWCA 3VUEA 2G0JA 3E2EA 5A0YA 1KXJA 3O8DA 4Y2XA 5LP6A 1PILA 1E1YA 1FDWA 4I55F 2BOAA 4QHTA 5CFRA 1U1IA 1LZKA 2BFOA 4QPXA 1EWKA 4RW6A 1W36D 1F5SA 2JVOA 1JDPA 1IHOA 3ZCRA 4HL9A 4HQNA 1T11A 5EJ2A 4BV2A 3IL2A 4Y6PA 3R7FA 2DO4A 2AJQA 3C4JA 5ILOA 1RM4A 4NYIQ 3A1YG 4DLEA 4Q4HA 2VJMB 2IQIA 5EC8A 4U7FA 4H3SA 1RHMA 4HFRA 5DHUA 1VFJA 1GN9A 1CPZA 4FOOA 3MMAB 4WYWA 2P6OA 1D6JA 3E3OA 4D9IA 2OSBA 3O03A 4DV6B 3OEED 1KP6A 1NW3A 1S6OA 2A18A 1A9ZA 4HWGA 4IQ4A 2BTOA 2CV0A 4B0PA 3TZKA 1EVEA 1HLFA 3GJRA 3TNLA 2TRSB 1CERA 1NZFA 3SWWA 2ATCA 5JVDB 2GA8A 3R77A 5J63A 5LZ9A 1PD0A 3FVRA 5SZTA 4OP3A 1R6BX 3OCYA 2W8BA 5CVEA 5BT9A 1IZZA 1E2QA 3G2XA 3GWGA 3ZD8A 1E2UA 2CNWA 2PGDA 3O2JA 3IKMB 4P71A 4NXMJ 3SQGA 1OSCA 2QN9A 1MIHA 3QKSB 2OUGA 2XMUA 4WP3A 4JU8A 2RH3A 4L78A 1ZHOA 3K20A 1C0EA 2CPYA 2GNKA 2J6HA 1J42A 5EXPA 4F2HA 4A15A 2Q9BA 2GN8A 3ZJTA 4JROA 1X8LA 4MEAA 5DPMA 1FXLA 4USJC 3HEMA 2YQ3A 4NEHB 4MLPA 4HPJB 4MUAA 4WOBA 1R5NA 1OYVA 3S4YA 4KQ9A 1OMSA 4J7CA 5CTAA 3RFXA 5HZGA 3WL7A 1FNOA 3NDIA 2V03A 2XS2A 4NJMB 2Q1WA 1PL7A 4J9VA 2QX0A 4OQXA 3NWGA 4JOQA 4DS5A 3K17A 1NQWA 3P20A 3CGIA 2UXCF 3IVAA 5AUOB 4NMLA 2OD4A 5DETA 1K7EB 2BKUA 2H2GA 4EKEA 3AOCA 4G36A 1SHTX 3O95A 4BQSA 2D3UA 3O3CA 1YZNA 1G20E 4IIGA 4YP5A 3CLKA 4X5OA 4JAVC 1KK0A 4MYSA 4EAAA 2VNJA 3CULA 4IRCA 1DRKA 3O92A 4I3HA 1DC6A 1XVUA 3B48A 1VRUA 2I6GA 4TL7A 3M1LA 1RA7A 2PGIA 2D2VA 2XVMA 1FZTA 3BXEA 5F0WA 2O66A 2FPGA 2OAGA 1YI0A 2HADA 1NPDA 4B6FA 3C0KA 3LCRA 2OE2A 2EG1A 4LXIA 1Q78A 2ZRGA 4DZRA 2C31A 1QVFR 3SGLA 4XX0A 5BY2A 2Y0DA 2FKAA 5FPKA 1G7RA 2LYVA 4ZAFA 4BB0A 3PL1A 2Z1NA 1XZBA 1CJVA 4ID8A 3GP3A 3M33A 3IUNA 1NNLA 4JYBA 1NJSA 4LJMA 1TEZA 4OLJA 5LN1A 4UBMA 3OTGA 1GUDA 2PMFA 4R98A 5IZCA 1NM2A 3IP0A 1Y7LA 2CHVA 3OM9A 1RHRB 2W2NA 2YY5A 1E2DA 6ADHA 3QEKA 2HQ1A 1O0SA 3T5BA 3P0RA 3H97A 3W3AA 4JB0A 1H2HA 4DARA 1F2TB 2ID4A 3B6JA 1DTEA 1KQGB 3TUPA 1VE6A 2NTJA 1VBXA 1LDBA 5KFDA 1UMBB 2OLKA 4RKEA 4E4RA 5ICMA 5L3SA 3H42B 4CG1A 2JAWA 3N58A 3HFGA 3D2BA 2PUAA 3B4MA 3IHLA 3ETDA 2JSXA 4MFBB 2KKHA 4DQPA 3ZWPA 3EDRB 2A0XA 4N6NA 3CNQS 2HEKA 3KUXA 3A3PA 2EVWX 3N2YA 2J6TA 2W0SA 2IW3A 2GVNA 4HNGA 2QTVB 2EFHB 2FWBA 2R8ZA 3FHTA 1RWNA 5JT1A 4B45A 2ZUVA 3Q8UA 4CDMA 3FTDA 3P2YA 1M7BA 2E29A 2G7MC 1YMVA 1O9BA 3FH0A 1QC5A 4OK5A 1WG4A 3WRYA 1R9NA 1KDZA 1NOKA 5COBA 4JV2A 2FLKA 1ENOA 2PS3A 6YASA 2Q5OA 5TRTA 1Y5NA 5CR9A 3OD5A 5LKRA 1BH6A 5T6MA 4YUYA 5EWMA 2OCYC 1MN7A 5T7BA 1WHVA 2Q7XA 1OA0A 1PWYE 4P54A 1TKZB 3DLGA 1DC8A 2F8TA 3TA1A 2PT9A 3FPFA 1XL1A 2VWGA 2Q5CA 3UAWA 4PHFA 2MCFA 1YZTA 2G07A 3EQ2A 3SZRA 1SCNE 3DDSA 4OJ1A 2CNDA 2YOHA 3HSJA 3UMRA 2R44A 4PSCA 4ND5A 2PRKA 1WD6A 2ZYSA 5LNK1 2AC7A 4FYYA 3MJCA 3D3NA 4Z5XA 1B8VA 4CTOA 3FRJA 3ZGOA 4MPPA 1OQAA 3Q8RB 1H3FA 1CJMA 3A1CA 5FTLA 3F6PA 3LA6A 3G8DA 5CYJA 1CUSA 1N1GA 4TYPA 3FCOA 2O4CA 2PM8A 5D4PA 3Q12A 5D6GA 1A4XA 4AMBA 5DRTA 2VJKA 1JVNA 4GRAA 2HSZA 3VHLB 2AQ4A 3GTYX 3BN3A 2GEUA 4EDFA 4C6SA 2B69A 3WTBA 2D0PB 4QOEA 2F65A 4J2TA 2EBUA 4LECA 5DT2A 1L2TA 1IOZA 2CCGA 2OO7A 3WK8A 4OP1A 1WCV1 1X2EA 3RIMA 1AA6A 3KSDO 4KB7A 3K5OA 4IG9A 3VR4D 2R8HA 1TQ8A 2DFTA 3GE9A 4QG7A 5FLXA 4ZPTR 2VL1A 4MRNA 1UBTS 5AJ3F 4OI0A 3NL0A 1M6YA 4N0PA 4LUBA 2XBLA 3O4JA 1PC4A 1IBLB 2DGWA 4JBNA 2HA3A 5DM1A 1C9KA 4XWYA 2LCFA 5E3PA 2VFAA 2O14A 3PA8A 4ZJQA 1RW4A 1GV0A 1E0KA 4KPUA 2VNHA 3MTAA 4PLPA 1RMYA 1QGUB 3EE3A 4EW2A 4FVTA 2OBBA 1ST2A 4KH1B 4F11A 1UWBA 5KT5A 1DQ8A 4DA7A 5ETKA 2CQDA 1MPTA 1PCXA 2JLWA 1OFGA 1GNQA 2C9YA 5DNDA 2BL4A 1UAWA 1TVEA 4JLSA 3WLRA 2I2YA 1E6KA 2XNQA 1R89A 1KRPA 1C7FA 2N42A 3RG2A 4TGLA 4LQ4A 1POWA 5GVRA 2WZ1A 2AI1A 1JZTA 3W4KA 2VRBA 5J1PA 2IGBA 2PRZA 1L9KA 2BJDA 4DQQA 3T35A 4B8YA 3E3AA 4AUMA 4CW7A 5A5FA 2UXCJ 4QA9A 3F0NA 1OZAA 5FNVB 4BP8A 3EZNA 3FDZA 1JX6A 1VLHA 4IIBA 1O94A 2ZSDA 4OX6A 3VM6A 5IWCA 1CEQA 1L4UA 1UJ4A 2BR3A 4H1WA 3RS5A 3HVUA 1DWOA 1Y9EA 1T34A 1T9UA 3IA0A 3CR3C 1K1SA 1GRRA 1WF0A 3GPLA 2B7CA 4L51A 3UXEA 1OWNA 3QKRA 4N3BA 1JLLB 4XOUA 5K2OA 5KYGA 2HJRA 3KDSE 2H1CA 2DGXA 3U1LA 2YWGA 3CCTA 4RKQA 3PRJA 1H66A 4PQEA 3L4JA 3H7HB 3SE0A 3NXSA 1LW6E 2VDUE 2KQUA 2BM1A 2OTJS 4WU2A 4CH1A 4JLPA 4IJMA 1ICEA 3OTHA 3RS7A 1H1TA 2NZYA 4KMSA 1AY0A 4TMTA 3W7AA 3PW7A 2PRIA 4LRAA 3E7WA 4GS5A 3U16A 2F3RA 2VP2A 3LUDA 2AMJA 5B0BA 1WMSA 4F56A 1ZGHA 3GJ8A 5BQXA 1DC3A 4O8ZA 3MJTA 3MJEA 3P2OA 1N52B 3PQ8A 2A9JA 4GMGA 4IGIA 1MXFA 4CHGA 2XT9A 3IOEA 2AEFA 2V1XA 3W63A 4BP3A 3SR3A 4RA9B 3ZVLA 3ADAC 2F55A 4XJTA 3WNCA 2CIMA 4FILA 2F4VJ 3FF1A 4D4GA 1DEKA 4JY7A 5DYIA 4F9FA 4BNLA 4NBLA 1S01A 1S8NA 3LW7A 4FPRA 2OAP1 3DOFA 5C4GB 2YR0A 4ZTUB 1SOWA 5JS2A 3KK3A 1QOZA 1JR3E 2B4TO 2PAFA 1FLNA 2VTVA 1TK9A 1GSIA 2AGPA 2WIDA 1UBSB 1YCGA 3P2KA 2HQFA 3JTPA 1S9DA 4RZIA 2KN4A 2LA6A 3R2DJ 3WB2A 2JFVA 2FUG9 1U0GA 3BIXA 1XRNA 2R751 3WZ0A 2JNJA 1U3CA 3HPOA 4IQGA 2D2XA 3J81k 1SIZA 2BMBA 2AGOA 5K3FB 1A27A 4OP2A 4Y2GA 2IIBA 2CLKB 1HSOA 2DBYA 1YTUA 4N9QA 4NZ9A 2LMIA 1URRA 4DUZB 4ID5B 4FFBB 4IUBS 4W7IA 4BO1A 4WP9A 3D8UA 3CCJS 3RW9A 5GOZA 1MB3A 1E3WB 5DBIA 4QELA 3OFND 4PPQA 2ZI5A 5JC8A 4R2LA 4QM7A 2BZ1A 2FMKA 2FE4A 1TX4B 3AQIA 3BWEA 3E48A 1RYMA 3T3FA 3LCCA 3ZVMA 1QKJA 3B7GA 5KB3A 3AKCA 2O8DB 2ZSUA 2DG2A 4BVEA 1JFSA 1VL0A 2PUHA 2MGZA 5IFMA 2V9CA 4E5VA 4G9GA 4RJIA 1XRSB 2MU1A 3NAIA 1GY8A 4YREA 2GO7A 1WDWB 1V11A 2V6FA 3S2EA 2R5WA 4UEKA 3GNQA 3OOHA 5PGMA 1WXGA 5B2EA 4N8DA 3EBLA 4G9BA 1G18A 3A4TA 2R2RA 3GDFA 1SVKA 3O38A 5CLHA 3HFJA 4NAHA 5C52B 1GPYA 1UKVY 1OILA 2IY9A 3GK3A 2PFFB 4I2PB 1W46A 3GXOA 4LF5B 1U80A 4L8GA 3RPEA 4K6OA 1TKAA 2VDVE 2Y3YA 3C66A 1IY1A 3WGOA 5FORA 4YJGA 2LKCA 2O0JA 3IVXA 5L7TA 3KKEA 2XNHA 3C3WA 3BHJA 2YZMA 2ZKUA 2CPFA 2I6QA 4KGXB 4Q0BB 5JZ9A 3QIPA 3QMVA 2Z56B 1Q77A 5L1IA 4H4KC 1SHLA 5EI5A 1R0AB 4BQNA 3BZBA 4LMBA 3IWLA 5AHXA 4IVNA 4ZVOA 3QIVA 3IMCA 3RREA 2J4FA 1Y7PA 1XQXA 4ND8B 2EJWA 1XC9A 3OT5A 4C4XA 2EGHA 5KT3A 1EIWA 3NCRA 4OQNA 3Q9NA 3BE5A 1NSQA 4ICIA 5KG3A 4ECUA 2QP9X 3RRZA 1B6GA 5DM7Q 1LWEA 2J3KA 1IZ7A 5AXMA 4AJEA 1YS6A 1IMOA 4UXJA 4YCCA 4UAJA 2WT9A 3QLUA 1DS6A 5E6RB 3JQCA 2DH6A 1RFGE 3MAJA 4YJ2B 3K16A 1ZOPA 4NFLA 4QYIA 3FJ1A 2JLXA 2HIHA 2O7NA 1CZHA 5JBQA 4Y2SA 4ZAXA 3IRXB 4XIJA 2IKQA 5FB3A 3R27A 1Z25A 3V4RA 4R1NA 2QUKA 3VC7A 4HLCA 1X4EA 1W0KD 3IMGA 4CZ2A 2H9IA 1Z8FA 3H0PA 1QTRA 4GWLA 1QIJA 2ZRJA 3EA5A 1SUIA 1JSCA 4NAVA 3B1XA 4LXUA 4HS4A 5T7LA 3OHMA 2ZTHA 3EVAA 4F36A 3PTLA 4KAFA 2RAVA 2QP4A 4DSZA 1PP4A 1HNWJ 2GTPA 2QP3A 1ECGA 4MW4A 5F1OA 5IH3A 4ZEVA 4C6TA 3ETCA 3P94A 4Z2AA 4P53A 3RVQA 2W11A 4FBTA 3M4XA 1KNZA 4ILLA 1W88B 1OX4B 2Z5VA 1E8NA 1U3WA 3QVVA 3I64A 3T1OA 4FYXB 1L1RA 2B34A 3L1KA 4FGJA 1KBOA 1A9RA 1G38A 4EO8A 3N2KB 3VYSB 2RBGA 3RTBA 1ZCZA 5DG8A 4BEVA 5D1HA 4CM3A 3EGOA 3TSZA 4QXRA 3BH6A 1QCZA 4B84A 1KJNA 5DM70 3FMOB 1RR6A 4HDNB 1AUOA 1B7GO 1G7SA 5A4AA 2H3EB 2ECQA 5IKOA 3NNCA 3H90A 5D85A 1AVTA 1KKHA 5CDTA 3UIEA 5KNCD 1DBPA 4HXEB 3KYDA 4PPNA 3IT2A 3ICQB 3R6GA 4IXWA 3RVBA 3AA8A 4NBTA 1ML3A 4UQPA 4ZI7A 4DLXA 2AFRA 4AXBA 1NVVR 3I6YA 1GG9A 1WR8A 2FDNA 3DE4X 2G63A 4R2MA 4BHTA 1DC4A 1UP1A 3BAZA 3RI3A 4YMTA 2H57A 1XZQA 4MZDA 4EB6A 1ATZA 1W5BA 3M05A 1DTTB 4RANA 5ALTA 2JH3A 1NJ1A 3B9PA 1CLUA 2C9MA 5FXMA 3GO4A 3LMKA 4HGNA 2BYCA 4G65A 4U2FA 2BEVA 5B3KA 1XX6A 2FQQA 2BGRA 5AVKA 3BXHA 4YO8A 3FRYA 2E1MC 1KRXA 1AUSL 1EU1A 3G0GA 3N6MA 1FDUA 3ILIA 2FX5A 2VYCA 5DNUA 4BFWA 1QH1A 2IXEA 4UUNA 3OLQA 1VL8A 1Z4JA 3W8FA 1KC3A 1DFDA 4RVHA 3JR7A 2B6HA 4URZR 3FFTA 4QTZA 3O2SB 4HR2A 3V81A 4F7DA 3AI7A 5JPIA 4JJFA 4XSHA 4QUHA 1FS6A 1JQAA 3VNAA 4M9RA 1VGRA 2WVGA 1SJRA 3SBDA 2H2IA 5BP7A 1H1LB 3RAFC 1ZIPA 3E4CA 5EPEA 1CUIA 1V5GA 5F1KA 4KZKA 3GNSA 3WFIA 3CMCO 3SR0A 4UJ5A 3EOAI 2DTXA 5E41A 2ZUTA 4N7RA 2PLRA 3V4MA 4GLLA 4KGZB 1Z7GA 4B09A 4YMLA 3K89A 5EUMA 2ACMA 1C2TA 1FE4A 3UO0A 3ND5A 2PA8D 3NY0A 4ENWA 5G41A 1X7WA 2IYZA 4OLFA 4E5KA 3EFOB 4DJAA 1OUMA 1UL1X 4TX1A 1AUQA 5FEMA 4KKXB 1ZQ9A 2O9JA 5HMYA 5JNRA 1QBGA 5I45A 3QVTA 2E4YA 2XOEA 3PRBA 2A9KA 2RH8A 3A6EA 4LF5J 4UHJA 1RTIA 3IRWP 3AM1A 4EG5A 3L4KA 1YZHA 2IZ5A 3P0FA 2JFXA 3URKA 3DCAA 2NYUA 2RJNA 1GR1A 4G1VA 2HNDA 1FNNA 4GVXA 3L6CA 4X4OA 3WGQA 4CNYA 3ABQB 4BFZA 1Y6QA 4DX5A 1F6WA 5FL7A 4DRXA 2X3UA 4PZEA 2I4MA 2Y2VA 1ULUA 1YRBA 2J4DA 5ETQA 3E9YA 3H2HA 2WQZA 4JUIA 2B7CB 3JX9A 1D6MA 5J1EB 1B43A 2J09A 2B20A 5JFOA 4BCBA 3H3JA 3PD1A 4LOKA 1YTYA 4YAWA 3AONB 5DI3A 3SXUA 1BX1A 4V0OA 4WECA 2ZDPA 2ISQA 3OKCA 3MMAA 4OXKA 3UPUA 4WXRA 1UQTA 1NJGA 4OX9Y 1FFCA 4NG5A 1RXOB 1TL5A 2HUNA 2O3UA 1TAHA 2QXTA 4B3XA 4Y0AA 2XA1A 2H31A 4TKVA 4XWTA 4BQRA 1IIBA 2YQ1A 1M2FA 4F6CA 2HZ7A 1A2OA 1HT1E 3X1ZA 4NL5A 1P8GA 5DZ6A 4IQ8A 2FPIA 2JW5A 3V5NA 4XWAA 3PFWO 5DIFA 4Q5VA 1Z13A 3RH0A 1QX4A 4FFMA 4BP1A 3O3OB 2KZMA 1SU8A 1XRLA 5E3CA 5IMBA 3HO8A 2UYHA 3N86A 3DFEA 3NFYA 4RH1A 2O05A 3D6FA 2WSCC 2YNGB 4AXXA 5LA6A 3UBTA 4DHVA 1J1UA 2HD4A 3NWJA 4H4CA 1BS2A 3D4JA 1UPAA 3TIVA 2F48A 2RBKA 2JK0A 5FOQA 3ZE2B 3IQHX 4E2FB 1NT2A 3DEHA 3V7UA 4Q6BA 1QP0A 4W1QA 1GXSA 4OSEA 3OH8A 1IAQA 4BFXA 1D4FA 3DDUA 5J4YA 1NVAA 1KEVA 2XW6A 2Q0QA 3A4IA 2YXDA 3OT4A 3REQA 3NAGA 4RHCA 1TJPB 4FHGA 3U4MA 3KKQA 3CKYA 4L6CA 1M5OC 2DFKB 3H98A 4OH1A 3PC7A 1R4AA 2E85A 4I3GA 4ZOCA 4B82A 4DSEA 3RC2A 5G3YA 2LFVA 2FJBB 1VDMA 3LWNA 3NHSA 4Z4EA 1ODTC 2BW0A 2U2FA 2QDXA 2I6FA 1A9SA 3T3GA 4CO0A 1NXWA 5KFPA 1EG7A 4L2IA 3GRVA 3AF5A 1G3UA 2HXYA 2BJ8A 2X8LA 3HABA 3EVGA 3HHPA 2CUYA 5AK0A 4MGIR 4AD8A 2ZT6A 2FK8A 3P52A 6AT1A 4EEZA 1CC7A 1ODLA 2B78A 2AB0A 4FR5A 5KYYA 3LFTA 1Y5LB 1MQ9A 3DBHB 2Z9DA 1FWKA 4YJFA 3D3BJ 3F4BA 2EK6A 1I8TA 3HP7A 1MWQA 2K7ZA 2G4BA 1NJZA 2DNNA 4GM4A 2E82A 3ICLA 1J8DA 4EF5A 3N53A 2J0EA 2PWYA 3JD4A 4PHHA 1V9CA 1RI1A 3QNUA 1JEYB 3EQZA 4JBGA 4LIRA 4ED3A 3CJ8A 1NU6A 2HGLA 3QE2A 4L72B 1T03A 2DKNA 1DJMA 2YKMA 2NZCA 4G84A 5BPFA 4IEFB 1NV9A 4B3MB 4Q43A 2I71A 2VKRA 4YBRA 4IDOA 4CIYA 1KL7A 2PHZA 3HEBA 3H25A 4P93A 3DMNA 3V4ZA 3UD5A 4CEJA 2ZHAA 5E3QA 1F6TA 3Q7PA 5BRJA 2XLKA 3PUZA 4PN3A 4OXIA 2ZIEA 4R1PA 2R60A 3MSXA 4Z7CA 2ZT7A 4C76A 4AY5A 3KQTA 1A8UA 4U2BA 4MV4A 4UDNA 1U25A 3RB6A 2QEQA 3NJRA 1S89A 4K2AA 4KHPB 2ZS9A 1T8RA 5DBGA 1E60A 3HXQA 4YK7A 4BNDA 2ZPAA 3FEXB 2J6UA 1K08A 3THWB 1IM2A 2DHDA 3CZQA 1ZSNA 2O50A 5L51A 1V39A 1QFXA 1SPBS 4OA8A 4U7TB 2QIOA 1BMFA 4N76A 2CE2X 4BZQA 4X3PA 3EWGA 5KVQA 4URYR 2V7QD 1S1TB 3BWXA 4DDVA 4CEIB 3AR7A 2CE7A 5JIBA 4P0QB 4JL5A 4GG1A 1T3LA 3CG0A 2HMAA 4DCUA 1A04A 1UVIA 1EHIA 3ED1A 4P72A 3FCWA 3SZMA 1FYWA 1JV2B 3DT8A 4WNIA 4H35A 3IB3A 5KOHB 1Z7YA 1WG5A 1ZJ5A 2AR9A 2PPLA 3EXCX 2VJUA 4JVSB 4N4AA 2Q7OE 3NBZC 4CBVA 2PU7A 1HNXJ 1KXZA 4E70A 2DSNA 5HZHA 3LQFA 3I31A 5F21A 3O73A 4KXNA 1IOWA 4FSDA 2OHGA 4EHIA 4RK1A 1RAHB 2P68A 3KJXA 3ZBQA 4B6GA 1K92A 2QG9A 3RO7A 3KXPA 1P77A 1CU1A 4CCYB 4HNAB 1ZD8A 2QD1A 3L6RA 4BCAA 1UKZA 4Z8YA 3OPYA 2KG0A 4ND6A 5KTNA 5B2FA 3M6IA 3D31A 4MV0A 1HQEA 4KLNA 1AK2A 1QYIA 3ZUPA 1RKXA 5J9FA 2PYIA 5HJ7A 3AM3A 2JI4A 5SYMA 3IE2A 2NVWA 3UT6A 2KHCA 2V5HG 2Y1RI 3NR2A 3MWBA 4V03A 4FE7A 1HYBA 3HZGA 2RHLA 2R96A 1TLLA 1ZGJA 1GMVA 3SC2A 4B46A 3OUUA 1XD2B 3W9SA 3C3LA 2H29A 1BDIA 2JVJA 3TEJA 2AFHB 4FYXA 4HAOA 1ZTWA 3VR5A 1CZOA 5AUNB 1C4AA 3EVOA 2RU9A 4JB2A 1THTA 5INTA 3CD0A 1A6LA 2ZB2A 5D87A 1NXPA 4PCLA 2O1SA 4HSEA 4QHSA 4RGVA 3CNHA 2VUGA 3D59A 4C7MA 1FXSA 1NPYA 4L4UA 2P6PA 1SXHA 2Z8YM 1OSDA 4BFCA 4EYIB 1V25A 1SIOA 3PF8A 3D54D 2C5GA 4OYXA 2EEYA 2Z4PA 1Q44A 5H82A 1AV6A 3N8KA 2R6JA 3VPFA 3H1PA 3ZYZA 2Q21A 1XA0A 4QYZK 2W9CA 3GVCA 3E35A 5AYVA 4U7UK 2Y0SD 3QXGA 1DCFA 4DV4F 1YZKA 1T5TA 3Q0IA 1UQRA 1NNI1 4CMEA 4IDNA 4WESB 4BDPA 5DOVA 4D8VA 1IKWA 3G4SS 5EXEA 1GSOA 4LY6A 3I61A 4RPFA 4KR0A 2YH1A 3AJAA 3CE8A 1OWOA 4NBNA 4NFSA 5JV5A 5BWNA 3F5QA 1K89A 3N2EA 2C22A 3EQ7A 2CJXA 1GTVA 3E81A 2UZ3A 1I6KA 3HKDB 5ALDA 4J0IA 4L50A 3S8YA 2A14A 3MDFA 1YZQA 5C24A 4R71A 2R7SA 3BGOP 4DWWA 1KEEA 1QFZA 2DZDA 4JEUA 5GOTA 1FVQA 1GQFA 3IR6B 3R3WA 1HEIA 1GZ7A 1HBNA 3AUFA 5EHNA 4NA1A 3EMVA 1LSJA 2HPHA 1AKTA 3SXLA 5A5DA 1FS5A 2VHXA 1Q91A 4ND4A 4BJ5A 4DLUA 2OCIA 1OI2A 4ISBA 1UMKA 5DLQC 1A5TA 2KRRA 3TJMA 1ONSA 1YITS 3I01A 5GWXA 3EXHC 4X2BA 3D7SB 2GEKA 3R76A 4RL4A 2IA5A 4RM2A 1CP3A 3OD2A 3OOWA 1T0UA 3H7IA 1UIRA 4MWGA 1XD2A 1OLOA 4HP8A 3MJHA 4CU2A 1V8BA 3LSYA 3EPHA 1WF1A 4MPRA 5KTMA 3HE3A 3EW9A 4AX8A 1YBHA 3I6MA 5C81A 5TY0A 4I67A 4R40A 1MTOA 3LOQA 5E95A 4DLSA 5I5GA 4M9UA 3ZCQA 2E55A 2F4FA 3AJRA 3MOZA 2RARA 1QVZA 1D8YA 3EZ7A 4P3OA 4ZVFA 3KHUA 4AK9A 5JVDF 4YRTA 3QTTA 2B8NA 1TUVA 4C0SA 4UFPA 2XQJA 1XERA 4AUKA 5JADA 2AG8A 4DJDC 1PJAA 3V2UA 4DR5J 3BK2A 3A05A 5BSHA 4URHA 4B32A 3BKFA 2FN8A 2X51A 1AXQA 4LF7F 4UNNA 5FP0A 2X7XA 5F8LA 5KOHA 5K8IA 1MN9A 1JL3A 1U5BA 1RAHA 2JEGA 3WK7A 1F8UA 2RUSA 3QW4B 1KO5A 2PLFA 4RTMA 4DCMA 2XUIA 3OURA 5F3ZA 2V50A 2FHPA 3KM0A 4NH4A 1AZLA 2UUTA 3HCDA 4XXHA 1NHUA 1W4ZA 4PR6A 4XYBA 2C2MB 4HLQB 4OFBA 1EIZA 2E7VA 3TOQA 1JLBB 3GIJA 1M1NA 1BY9A 5ARCA 4RQUA 5BW8A 3SSMA 3R4CA 4TTJA 1PR4A 4DYVA 4WADA 1UZLA 5FTNA 1I33A 1LTQA 1SOAA 3QEBZ 4DF4A 5JDCC 2HQSA 1HBJA 4GYYA 3DMHA 2CVZA 4WE3A 2KTQA 4RD2A 1NUQA 4EPWA 1AE1A 4W5HA 1N2ZA 1RNLA 2DO0A 4YASA 1N48A 1XJCA 1XNGA 4Q4AA 5IX8A 1NQAO 1WM1A 5BQOA 4F04A 1ITZA 1T43A 1MAHA 4ZCPA 3P6YC 2YJGA 2ECPA 1JXQA 1VIVA 4ARSA 4P7KA 1G5TA 2JJYA 4JGIA 3FZNA 4WLOA 3QBVA 3DWIA 4N8OA 5CGQB 5G1NA 2Q0HA 4PGMA 2W7AA 2IBKA 1FFSA 2C57A 3RBVA 1B2LA 2HBYB 1Y0BA 1NQUA 2WPDA 3F3SA 4I1OA 4MKVA 4CXMA 4JEHA 2XUDA 3WFJA 2PT7A 4PAMA 2ET6A 2BMWA 3PC8C 3QGMA 3OQNA 4CEJB 4TMWA 1X15A 1GLVA 1E66A 2GD1O 3EGXB 4O3FA 2MMCA 3SEAA 5FA6A 4M5GA 2EXXA 1DJNA 5L1LA 1Q1AA 4GECA 4J9KA 1MTZA 2BKAA 3HA3A 3GLKA 1SH3A 1D2AA 5CU7A 2H51A 2P4QA 1SBCA 3ZHUA 2M6SA 4FDVA 3Q2SC 1XZEA 4WLEA 3AEXA 4HH4A 5BN4B 1FCAA 1CKEA 3ANTA 1X8KA 3D0IE 1TM7E 1MD9A 1GTG1 2AN1A 4HO1X 4PFJA 4B31A 4MAAA 2XKJE 3I8OA 3KZVA 3ENZA 3ZWAA 3B13B 1NF8A 2WINI 2VF7A 1YB2A 4GEKA 4PWUA 2ASJA 2FB9A 2QJWA 5LDHA 4FDAA 2HR1A 1TV6A 4I5FA 5H9EJ 3WAKA 2PWZA 3UICA 2VF8A 3KHSA 3ZCXA 2DUJA 2XOKA 1GG5A 3KOZA 4LBWA 1JEQA 1CNFA 4RFSA 3ZH9B 3H6GA 4OJNA 4BPRA 1MCZA 1JZSA 3HM9A 1KEWA 4ETIA 1V8FA 2JJ1D 2BQRA 2AJFE 1S1WA 2HNYB 2OBFA 4S2UA 3CO9A 1M8KA 3SDEA 2IHNA 2A2ZA 5P8WA 1CK4A 3F9RA 1VSUA 3L40A 2FN3A 2CL6X 3ADCA 1JR3A 2R7WA 2ZJRQ 3JSMB 4LFCB 3W8DA 4JI4J 5KOXA 1PC5A 3I1FA 3AVTA 5KTSA 4P2SA 1FQKA 2IYVA 4BFTA 5CIWA 1U0JA 1PJSA 1MROA 4IIYA 4JT2A 2P35A 4BKOA 4BWMA 1OT5A 3C70A 2Q2VA 1X4AA 4RW6B 3RFCA 5L7WA 1QZZA 6CHYA 3LM8A 3D54A 1G3OA 3CIFA 1J07A 2HSJA 3UMFA 3FZGA 1GXSB 2GFHA 5KOIA 3RK1A 1X1BA 1QCYA 5E33A 1ZS9A 5DM0A 2AOVA 5T14A 4K86A 2FZ4A 1CV2A 4QPCA 4W1PA 1OXSC 1UA1A 1TJ4A 1P2TA 4JBIA 1CSJA 2YNFA 3A12A 1T29A 4DX6A 4NEYA 1L5GB 2IM1A 1H94A 3TPCA 5M34A 2PUJA 4D96A 3ZI7A 1YB7A 2QR5A 2HCRA 3L5OA 1XZMA 4BQIA 3AVPA 2MHNA 2BQ3A 1E3QA 4M6WB 1XWLA 2FZWA 5B1HA 3MCMA 4UOGA 3T0FA 1S9EA 3AB4B 4AMGA 3FETA 3WA6A 3OU2A 4X85A 4H7KA 1Y3FE 4R9UC 4F3MA 1RHJB 2ZIUB 1NQOA 2DNRA 3Q7EA 1UC9A 3K9HA 2QYSA 2FFJA 4PVDA 1NX6A 1RCUA 1WEYA 2X19A 4J1TA 4PZVA 2OC4A 4DMKA 1IHYA 2Q4RA 1J2RA 2XUAA 2ZRHA 1S9FA 2H00A 2K4MA 2PGNA 3U44B 5ECGC 1N7GA 1IEVA 2ZE6A 3RQSA 4GXRA 5DI3B 3KVOA 3MMSA 4Q3NA 2NLOA 3AHJA 4PSUA 1IY2A 3B5IA 3PDIB 2J0VA 1S7CA 2Z6AA 1VI5A 3UN5A 4ZCIA 3RSSA 4FXDA 1JSLA 2LQ9A 3WO0A 4BNUA 4OZ5A 4RXTA 4RD1A 1MOQA 1CTQA 1P4AA 5DSXA 2PKWA 4B3FX 1MU2A 2FW0A 4EP1A 4X41A 3W77A 4MJ3A 3V1UA 3D9QX 3ICEA 2PD6A 2DQZA 4EHAA 1SRRA 3IQEA 1PJ3A 2VQFF 1O6CA 1ZIDA 2DR2A 4KE5A 1T4CA 4QIFA 4OYHA 4JP5A 5T8KA 4EUKA 5TJHA 3NS7A 4X6XA 4YJHB 4OLBA 2RC5A 1RYBA 1U0TA 3UKOA 3L8ZA 2JI9A 3RSLA 2QD3A 2CPDA 1U2ZA 2E21A 2C7PA 3IQFA 2DKFA 5JNTA 4CQLB 2E9SA 1GGJA 3IBYA 1TL7B 4FHFA 5THQA 5DKFA 1Y4ZA 3ETEA 3I1JA 2ONYA 4ZVRB 4PEOA 2V3VA 3GPBA 2IFXA 3R6TA 2IYSA 4G67A 1RT3B 4RADA 1UFOA 3U7HB 4IWXA 1OVMA 3PIDA 3RUFA 2QD4A 3T19A 2BISA 3EF0A 3KKLA 4BPBA 3EZOA 3Q41A 3DLKB 4ELUA 2HHWA 2RHCA 2XQGA 3GIRA 4BV3A 5KT7A 2RRBA 2BJVA 1JQ3A 1XDDA 3D3WA 1QG4A 4RFLA 3SFVA 1VL6A 1VC2A 2ETVA 3O9MA 4ZA2A 3WNVA 3L7DA 4QGSA 1L5QA 3MM6A 3HZEA 1V1JA 1XTZA 3D0OA 2AVDA 3EVCA 3PDUA 4ARUA 3GRYA 5KT6A 3V1TC 5KYYB 2ZI9A 1G4CA 5LXTB 5EIXA 1J33A 1E20A 5TEVA 4HB3A 3X1XA 1TKXB 2V3CC 1GHTA 3NHZA 3UO8B 2YBEA 4P7GA 1EP9A 4WNAB 3GEEA 1NY6A 2D5BA 4A8QA 3BRCA 5ADZA 5ECWA 1X8DA 1XNQB 4PX3A 3MWEB 4DZ6A 3KLHB 2JJ2D 5AW9A 1E3WA 4LYYA 2ZD1A 4L75A 2ASDA 1W49A 1DHTA 1X8JA 3IEXA 4TPKA 4M8SA 3F6EX 2VPXA 4U8VA 4WD3A 5F3TA 4IXNA 2GYYA 4P4SB 2OXFA 3TOXA 5H3CA 3RAGA 1ESDA 3NXKA 3ZKWA 5TS2A 1WKJA 4DL4A 1BHSA 3PXDA 3RJTA 2BKPA 1HWKA 1P60A 5IVKA 3QKIA 3OEWA 3GCWP 1R00A 2H4XA 4S35A 5IT9U 1CY1A 2B1IA 4Q1VA 1O1YA 3G0OA 1B8NA 4IJVA 2LR0A 3P2MA 4HKTA 1HT3A 4RZ2A 2F4VB 5ARBA 3QVUA 3DMFA 4EHDA 2DY9A 2C9BA 5D1NA 4ES3A 2DNQA 1E6CA 2BSQA 4KN6A 3U1TA 2ZRQA 3TH5A 3U1NA 4EZ6A 3LUJA 4RVUA 1Y4SA 4D3GA 4P31A 4USHA 1QDUA 2VAVA 1RAEA 2IHBA 3FOAA 1FEEA 2Y1JA 4L08A 4GX0A 5ETRA 4HGRA 4LVNP 1R4NB 5D01A 2PJZA 3INRA 2W4MA 5KX5B 3QLJA 3LO3A 2GCOA 3ZU2A 4J90A 4FJ1A 2BTEA 1DMRA 2QMHA 5KFCA 2I7DA 5T3YA 5LVAA 1TJNA 1NNSA 4UOZA 1H4VB 4PNHA 2WAAA 5SY6A 1JH8A 4ZCRA 4DN9A 3WLJA 3PRHA 2PA3A 1FDTA 5KBYA 3OLWA 4UNRA 3MS7A 1JZQA 3O26A 4LHYA 4D4IA 2P5TB 3PTAA 5J1EA 4FCCA 3D4IA 1PYOB 4IDFA 3QUQA 3EEFA 4G24A 3JTEA 4GGPA 1Z4MA 4UHDA 3ITHB 4ANDA 3Q8WA 1YLXA 1U1OA 5T64A 4E32A 1ORDA 1QM9A 4LOIA 2Q2NA 1BWEA 2O0LA 3HDJA 4KV9A 5M2UA 5CM2Z 3K5PA 3UMYA 3LDHA 1RLDA 4Y6IA 1V6CA 3G1WA 3E53A 5AJXA 1N5YA 4NDNE 2XB2A 1XMXA 3W9BA 1YS9A 3R97A 6AT1B 1LBTA 4XE5A 3K2QA 4EARA 3ZDRA 1LV7A 1UMDB 3AL3A 3W5UA 3E5MA 1WWHA 2J9EA 3M6UA 5AJYA 2PE5A 1Z5GA 1FQOA 3IRXA 4DIDA 2C5BA 1WXIA 1QR6A 3SJBA 4YXFA 4KR9A 4M63A 5EJ9A 4KACA 1TF7A 4JXJA 2WK4A 3I09A 2ZKLA 3HGTA 1RTDA 2P4EA 3QPUA 1IBKJ 4TQAA 2XUHA 4JS0A 4XFDA 1EWVA 2OOKA 2PIAA 4BQPA 3GRKA 3V8QA 2COUA 4O4IA 2ONCA 1QFJA 4RVGA 5LB2A 1M2OA 3KLNA 2OLWA 4JNKA 1J5OA 3OPQA 1N2XA 1G6BA 2OFHX 1EHCA