2ZEJA

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
177
structure length
157
Chain Sequence
MKLMIVGNTGSGKTTLLQQLMKTVGIDVKDWPILVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Leucine-rich repeat kinase 2
publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 157
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 2zejA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zejA02
1CLUA 2C9YA 2NO7A 4MGIR 2AWNA 1FQKA 2VH5R 1NVVQ 1ZJ6A 3THYB 2NQ2C 1AS2A 1OSNA 3FKQA 3SC3A 1E9DA 1YZQA 3BJIC 3VX4A 4X8MA 5AR1A 1AKEA 1KJZA 1KDRA 4BWYA 1ZM2A 4IVPA 4EKDA 4R7ZA 1Q1QA 1E2DA 4LI0A 4PC3A 3N5CA 4G1UC 4D4KA 4GOKA 4DEXA 4LHYA 4B2LA 1D2MA 4BZQA 1U0JA 3MGCA 4F92B 2OESA 1ANKA 1RC8A 3ZYCA 2BBTA 4KHZA 5DHFA 3THXA 4YQFA 2ONJA 5BQ5A 5FH9A 1PV4A 4M9QA 4QGGA 5EE3A 3PFIA 2QPTA 1T0JB 3AVQA 3A8TA 3LD9A 1SHZA 4CGZA 1KK0A 4OI1A 4C7OB 2NG1A 4AK9A 2QM8A 3B2EA 2PEYA 2JJ2D 4DCVA 5J4LA 3TGPA 4MDEA 1MOZA 2ZU0C 1UF9A 2YOHA 3QQ5A 3R9WA 3A1WA 1TF7A 1Z5ZA 1T3HA 1VTKA 3BD9A 3MLEA 1CP2A 1E32A 2AKYA 1QHHB 3UMRA 3EX7C 1OXXK 3GLFA 3RLFA 2XTMA 1WBDA 1BKDR 2VF8A 2PL3A 3SR0A 1N3BA 5CLQA 1DBSA 3EZFA 1II8B 2ZR7A 4WBSA 4OHYA 3AVOA 1KIMA 4D82A 3VKHA 1W46A 1QF9A 1XEWY 3ONWA 4A15A 2O8FB 2W00A 1II9A 1KKMA 1XNJA 1U8ZA 1EX6A 2WWGA 3U4QB 4LHZA 4MRSA 5HKKA 1P72A 1YZLA 3SJCA 4ZCIA 3U6BA 1ETUA 2ZUCA 2WIAA 1KI4A 2ZS7A 3LO5A 1JXMA 2WWYA 1XEXB 4JLBA 3LQQA 3AP2A 4JVLA 4MH0R 1P6XA 1IONA 5JHHB 4GPTA 3R9IA 2QRNA 2WV9A 4RZ2A 2G1JA 4KXFB 1J99A 1RJ9B 4EUNA 2BBSA 3QG1A 3A36A 3C15C 3H84A 4CEIA 4PC2A 4Z1MD 2H92A 1MR3F 3FMPB 1K6MA 1JB1A 4P4TA 1E9RA 1ZUIA 4F91B 2XOKD 1PJRA 1OFHA 5JSZA 1E9CA 1TPZA 3T34A 4OI0A 1KDPA 1XD2A 4HLUA 3I8SA 4NCKA 4E07A 3LX8A 2PZGA 3QXCA 2H1LA 3OZXA 4ZDIA 1N6OA 2CJWB 3KKQA 1NIPA 2J59A 4TLBA 1XZQA 3L43A 3NHAA 4QGAA 1E2KA 3GJ6A 5EZ5A 3QBTA 2IYSA 3P4XA 3IQWA 1FUKA 2N46A 2BCJQ 3B78A 5JFGA 2GVDC 1NL3A 3KB2A 4AKEA 2GK6A 4IW3B 4A0HA 2GAOA 3BOSA 5DO9A 1BMFA 1RRCA 2IXEA 1R0ZA 1JEEA 1BOFA 1VYTA 2FSFA 2GK7A 2PH1A 3IDQA 3K9NA 3GMTA 5EP4A 2R62A 3X1XA 5BW8A 5CM9C 1X1RA 4B34A 2QA5A 2WVJA 1GILA 3AUYA 1IXRC 4JIMA 4M9ZA 4NTZA 2ATXA 3X1ZA 5JECA 3AVYA 5LD2C 1FFHA 3NBZC 1P61B 2PMKA 3RS2A 1W36C 4MUBA 2NOAA 3OEED 1DAHA 1DAFA 4D0NA 1H65A 2BJVA 2ZITA 4LDJA 4URUR 1AS3A 2DWOA 4MYTA 3W6NA 5L3QB 1R8QA 1AZTA 5K8LA 4NMMA 1XPRA 1G9XA 1EFRD 1XMSA 2QROA 5HR5A 4FW9A 1EK0A 4B3CA 4Q1FA 4TMZA 1E96A 1JI0A 2XJ4A 3SOPA 2PZFA 1RYHA 1WXQA 2A5GA 4M4SA 3KQUA 2D3WA 3ECCA 3PUWA 4UNSA 3IEVA 4OYHA 3WYGA 4Q1AA 4TMTA 621PA 3EZ2A 1XD9A 4ITRC 5JEEA 1SZPA 4IDPA 3K1JA 4US1R 2FPLA 3U7EB 1N6KA 1XFAA 5HTKA 3A1TA 3M6AA 4L4UA 1Z3IX 1VG9B 4DWJA 3B60A 4RJLA 3GQBA 2V1UA 2XXAA 1Z0DA 3KKMA 1CKEA 1T8TA 3SNHA 1GOTA 3VR6A 3I5XA 2QRZA 1C9KA 2VIIA 2OCBA 3SFVA 3UIEA 2CLSA 3SYKA 3FKSD 3ASZA 4A8JB 1NBMD 3ND9A 4TTPA 4C2UA 2V55B 1Z0IA 3L0IB 3X1YA 4MGKR 1QHGA 4UJ5A 1KO5A 2ZE6A 2ZRAA 4PPGA 3WP0A 1VCOA 1SXJC 2ZQ5A 2IHYA 3B8HA 3Q5DA 4WZ6A 4EAQA 2OV2A 3S1AA 5LBIA 3LW8A 3N2EA 1KI9A 2GWHA 4D4MA 1XXHA 3OIVA 4DUGA 2WJYA 3EIQA 3I32A 3QJYA 2VPPA 4NCNA 2KE5A 1E0AA 5C4MA 2ZAOA 1IN5A 1CJVC 2H8KA 3W5JA 5CIQA 3H4MA 4AIIA 4O0MA 3O8BA 4RFSA 4PZYA 3SQWA 2GDJA 3U3KA 5J4VA 4F93B 1NVUQ 3TLXA 821PA 2XTZA 2VHTA 1GL6A 4L8GA 1OXTA 3K09C 3I8XA 2DFKB 1CRPA 1XTKA 2IS4A 2O8DB 1NN3A 4DZZA 4HAUA 1FP6A 2C03A 1VCMA 3IHLA 1ZNZA 1F60A 1SULA 2VQSA 2FPKA 1VHTA 3GLGA 1N5IA 3RS0A 1S9HA 1K8RA 3G82C 1DAKA 1R6BX 3CNLA 3WY9A 1DG3A 2WKRA 4IOMA 4N3NA 2AN9A 1LF5A 5AJYA 3VR5A 1Z47A 1UKZA 2NO1A 4BRWA 2RKOA 3HPRA 4QRHA 1KI1A 5CB6A 2DB3A 1VIAA 2CHQA 4WOPA 3IKJA 1CTQA 2XSZD 4Q9HA 2QZ4A 4IFBA 2HUPA 2J41A 3UANA 2WJJA 1N2CE 3HR7A 1QVAA 2I1VB 5KOYA 1OFIA 4GL2A 3PQCA 3ZVRA 4OK3A 1C4OA 4GDFA 2BV3A 3K0EA 4UXIA 4LHWA 5FI1B 5FOWA 3VQTA 3ZVMA 4LBZA 2JA1A 4DCNA 2IT1A 1WE2A 1U94A 1U0HC 4TMKA 2WM9B 3U60B 4HLCA 4JLKA 1Z2AA 4CT4B 1MABB 1G8HA 4NKRA 2CLCX 2IL1A 4Q1CA 4FWTA 4PHTA 3BRWD 3K0FB 2ZRHA 3DM5A 4I1UA 2NPFA 2IX3A 2KI5A 1S8FA 1Z28A 2Q3FA 3V9PA 4ON9A 1E98A 1IN6A 1KI3A 2W6IA 2CNWD 2AXNA 1DO0A 3TQFA 3WNDA 3Q8XB 5ELXA 4O25A 1T4GA 3FFAA 2GRJA 4MUAA 2GCPA 1FL9A 3AF0A 4F4CA 5FL3A 3BH6A 4DSTA 1GKIA 1EWQA 2EFGA 3OE7A 1X1SA 5KTYA 1V43A 1G21E 3FMIA 2VP0A 1F2TB 2H57A 2QAJA 4P4SA 2VHCA 3CX6A 2C9OA 3CB4A 2DWPA 5F9HA 1UKYA 1SVKA 3ZQJA 2R6DA 4OQFA 4QHYA 3DZ8A 4Q7KA 3A1UA 2WJIA 3NH9A 1LB1B 4FMDF 1FNNA 1AA9A 4B76A 4URVR 2YOGA 4DHEA 1OYYA 2ZPTX 3KTAB 4LWZA 1KO1A 1KDOA 1XPOA 1E2QA 2E9SA 3QF4A 1J90A 3K09A 2OAQ1 3P1JA 1S3GA 2GXUA 4HUQB 4X8HA 1T91A 3AVXA 1XTRA 4JJKA 3SN6A 1FUUA 1YZKA 3WMEA 4CEJA 2OILA 3U7HB 5JEDA 2BMFA 2CVFA 2AD5A 2WWWA 2CBZA 3NEYA 3U3OA 4C0LA 4IHQA 2X77A 2BEKA 3B1WA 3F3YA 1N0WA 3HPQA 3JVVA 3I92A 4LHVA 5J5CA 3UMSA 2P5TB 4BFTA 3LRPA 5M04A 5KHOC 4IOJA 4RCZA 3NVAA 2ZUBA 1HY3A 5FOXA 5BYJA 4IVRA 4BFUA 4LJ4A 1W4AA 2HLDD 2OEPA 1EG7A 3B82A 1YRBA 3AGPA 4KSBA 3RSLA 2C5LA 1N6RA 2FU5C 1P9WA 2G83A 2KJQA 5FUXA 4FCTA 1OKKD 2IYTA 5E7JA 3AM1A 5L3VA 3ZS8A 4WXPA 3IBGA 4POAA 2NGRA 4W5WA 4CW7A 2EFCB 2GJSA 3WNCA 1ZU5A 3GFTA 4XD7A 4AKIA 3H0KA 1MO3A 2YC4C 1JPNA 5SZKB 4EDHA 1JJ7A 1E79A 4OBEA 1UFQA 3EPLA 5KSYA 4LYJA 3CONA 3T5GA 4XSGA 1W5SA 4UXHA 1TUEA 1KMHA 1KOFA 4B3GA 2ZSEA 3B6EA 4O2RA 4PXAA 1II0A 1P2TA 3TQCA 2O8BA 2BDTA 1DE0A 2QMHA 2XEXA 3DMNA 2XNSA 1ZINA 2F1IA 5IK2A 1NVVR 4B2IA 1U9IC 1WB9A 4A9AA 4MYHA 4OHWA 2JLVA 2FV8A 1NMXA 2AK2A 4Q4JB 4DC9A 4URWR 1KI7A 4G3XA 1T0HB 1RYFA 5K8IA 2JLYA 1G3RA 5IDVA 2C95A 1C1YA 3W6PA 3A4NA 2J9RA 1HTWA 3MJHA 4HAXA 3WHLA 5CDFE 1F48A 2EWWA 2HF9A 8OHMA 5SZIA 4DSNA 2RGNC 2J0UA 1EFUA 1G7SA 5HE8A 3GJ3A 1M1YE 2ODEA 5EQTA 4NYJQ 4PSVA 3LDAA 2ZSAA 2DY1A 2MSEB 3GPLA 3IPXA 5J4HA 5JHGB 3KFXA 1XB2A 1RRPA 3MAAC 4LZZA 2WOOA 3AF3A 3DO6A 2OG2A 1YZUA 1G7TA 2ZRBA 4PX9A 3VAAA 4DVGA 1WBBA 1ZD1A 2AHOA 3AF1A 2D2FA 3B5JA 1MKYA 5FFMA 4LGMA 5KPDA 4AYWA 1E1RA 2JCSA 1KI6B 2G6BA 3AP3A 2RB4A 4IEIA 1YR8A 3GJXC 4M9XA 3RS5A 1JR3D 1YZGA 1KO4A 2QORA 4AWXA 4ZIRA 4LUCA 2NO0A 1E0KA 4FCVA 3A6PC 2IYWA 4A92A 1W7AA 2KWIA 1ZC4A 1L4YA 1VG1A 1N6IA 3GJ5A 1US8B 3BE4A 1NF3A 4OQLA 5C2JB 1MO5A 1CIPA 5KDDA 3MJRA 4QNRA 4OHXA 3VU9A 4CEHA 2IXGA 4DBLC 1J8YF 1NVXQ 4Q9IA 4CF7A 1S3SA 4NU0A 5BXQC 2YC2C 3KFVA 1R7RA 1T3SA 4DB4A 1XX6A 1X6VA 1CJKC 1E69A 2IK8A 2QP4A 3NDPA 2W58A 2VSFA 4DLTA 2BOVA 1U8AA 2L0XA 3UMFA 3CIOA 1NI3A 3B9PA 1YU9A 4NYIQ 1S1MA 2CXXA 1YHNA 2GCOA 3WXMA 1TF5A 4RKEA 2ZRGA 1KSJA 2ZRNA 1NN1A 2I4IA 4LC1A 3EA5A 5FUWA 3ZS9A 3CRMA 4FD2A 2Q6TA 4TMVA 4II7A 3M0EA 2NTYC 1G64A 3Q7QA 1P4SA 3GLIB 2RGGA 4V0MA 3EAQA 4IKEA 2FSHA 3LQRA 1E9FA 1R4AA 3T61A 4HB2A 2QTFA 1A5TA 4EJSC 1E9AA 2ASEA 3IQXA 1KJYA 4Q1DA 4HDOB 3EC1A 1GITA 1E2IA 2V6IA 5BN5A 3H1TA 4MRNA 2YWHA 2OBNA 1U9IA 3REGA 3K70D 1F5NA 2WZQA 4YDSA 3ZZTA 1MRSA 4M1SA 2P6RA 4QHSA 4B2PA 2AR7A 4PZLA 4KODA 4NP6A 4AYXA 2ZJOA 2QT1A 4RY2A 4GOXA 4MGZR 1TMKA 4OJQA 1AK2A 3EIEA 1U99A 1Z6XA 3SJZA 1RKBA 2F43B 1VYVA 2X2EA 4IXNA 2O8CB 4D0LB 2PT5A 1OPXA 2A5YB 2C96A 2F3RA 3MWYW 5FTJA 5A4JA 1E1QA 2N42A 2RGNA 4BLSA 4FMCF 1Q0UA 4HLQB 1QHXA 5GADl 4TQ9A 4YONB 1G5PA 1ZYUA 2Z4RA 3C41J 3SZRA 4LPKA 4FWIB 5FBWB 4YXWD 4HB4A 1JECA 2VRWA 3P4YA 1W0JA 2AKAB 4IJMA 1TU4A 3K70B 1N6NA 2WKQA 4DLUA 4V03A 1W4RA 2ERYA 2OFWA 3FHOA 2RGEA 4Q9JA 2CK3A 4GZMA 3MMPA 4ASUD 1T6NA 1TL7C 3DKPA 2ZRMA 3F0TA 5CYPA 4JVMA 2CCKA 3KQKA 2OLKA 3LFUA 2FDCA 1UM8A 4C9BA 4B44A 1YQTA 2IYQA 5CK4A 2RGBA 5TARA 3C8UA 4ABYA 1A82A 3QXHA 5G40A 3BIFA 1QHNA 3J81k 2GKSA 3N70A 3B9QA 3MD0A 1IY2A 3NBFA 5EP1A 5CYOA 4BFVA 3TAHA 2ECKA 5L3RA 1MH1A 2B92A 4ARZB 2GEDA 3RS3A 5L3SB 3KUDA 4I1OA 3AVPA 1ZW6A 3OIYA 2ZREA 2Q21A 4L9WA 3ZVNA 4DLZA 1ESMA 2VL7A 2J7PD 2ZVPX 1NP6A 4M22A 4D80A 1E3MA 1NY6A 2GJ8A 4MRPA 4P33A 1AJEA 2ZAMA 1E9SA 2W83A 5FOSA 1YR7A 3NXSA 4CEIB 5DISB 5B58C 3LX5A 4AY2A 1FX0B 4LRWA 3LXRA 4ZO4A 3EIHA 5TB5A 3THOA 2CE2X 3E2IA 3HWSA 1NLZA 5FI0B 5IRCD 2D4HA 5K8UA 1VKJA 1KKLA 4P3YA 4C0JA 4DT1A 3TUZC 2XGJA 1AN0A 1KSFX 3OEHD 3LY5A 4EJSA 2HEIA 1Q3HA 3BK7A 2J7KA 4QBIA 2ZETA 1NJGA 4IOKA 2RCNA 3K0SA 5CB8A 4EPYA 1F3OA 3LH5A 3SJAA 3ADKA 4JS0A 4HLUC 4JSYA 2FWRA 1E2NA 2C04A 3GEIA 1ESNA 2E87A 3CX7A 4H9GA 2LKCA 4A2QA 2F9MA 4OK6A 2D7CA 2C77A 3LA6A 3I61A 1VG0B 4V0LA 4EQ6B 3IPYA 5TXGA 1JAHA 3DHWC 2NMVA 4E5UA 4DEYA 3AQ4A 1KI8A 3CR7A 4HYYA 5EXXA 2CHGA 3PV0A 3P27A 4JL6A 3VNUA 1NIJA 4BFZA 4ERNA 1Z63A 2GF9A 2PCJA 1PLLA 4KSCA 4A36A 4Q48A 2VP9A 1Q20A 5KYKA 2ZI4A 2QBYA 5DN6D 5HCIA 3U61B 2GILA 3KL4A 4HAZA 1UEIA 4XOIA 4PC6A 4MYCA 1G4AE 2CCGA 4FI3C 1Q1EA 4B35A 3R7WA 1J8MF 4Q9KA 3IBYA 4LJ7A 2REXB 3NBXX 5E3HA 3HU1A 3T1OA 2ZROA 3LW7A 2QI9C 1RW4A 4M2LA 4BLPA 1YZNA 3ZGXA 1G3IA 2KBEA 1YKSA 3QEJA 4GFDA 3PUXA 4HDCA 2JDIA 4PSAA 2ZVQX 1KO7A 3A58B 2R9VA 3X1DA 2HYIC 3TSOA 3TVTA 4DLRA 3KUCA 2WKPA 1XTJA 2AK3A 3PUZA 2KBFA 1JNYA 1IHUA 4QBGB 3HU3A 3LVRE 3VR2A 2GJAA 3QKRB 4I81A 1QZXA 2ZI9A 3FGNA 4BFYA 1OIWA 1BO6A 1OYWA 2EFDB 5KSOA 3I62A 1G7CA 2ZJ2A 4M1OA 3DPUA 2A3RA 4MGYR 3UATA 2J0QA 4PC7A 2ZSDA 4EPRA 3PCRB 3KZ1E 4TT3D 2R6AA 4WIAA 3BFXA 3HP1A 5DGXA 4LBYA 3OFNA 3UG7A 1P5ZB 1PZNA 2DWQA 2FFAA 3AUXA 1XBTA 2RH5A 3D31A 4G5RA 4WW0A 4Z8XA 2HT6A 4JLDA 3THWA 4V0ME 3Q9LA 5B57C 2ODBA 4Q4AB 3KQNA 3WRYC 4NBSA 4DLSA 2RAPA 4LOAA 2V8OA 2C78A 4XVQA 3L0OA 5GVSA 3SJBA 1XJ0A 5C1BA 1MO6A 2NZJA 2RGXA 2IYXA 4TLCA 3V4FA 3UPUA 5JS7A 1SVSA 1JXOA 3QOFA 2PMDA 4FCWA 4Q7LA 1DAIA 1XMIA 5AJVB 5FUYA 4LSGA 5G41A 6Q21A 1FZQA 3M1IA 4EPWA 4IVQA 5CITA 3A4LA 2KSQA 3PUVA 2E1RA 4TSFD 4OI4A 2UZ3A 5EXPA 4A6XA 5C46F 1OIXA 1G18A 3LVQE 1P2SA 5HPYB 1BYIA 1KZ7B 3BH0A 3HR8A 4LX0A 4ZCMA 1SQ5A 1TEXA 2CHVA 1S1CA 1R5BA 3ETLA 4CIDA 4KFTA 2WSSA 4ZDKA 3W9YA 4OQMA 2QPAA 5A0FA 1FMJA 3W90A 3THYA 2YINC 4HZIA 5K8TA 2JIZD 2V9PA 4JZKA 5E7MA 1ZCBA 3L2OB 4GMDA 1OB5A 121PA 1XRJA 4QJ3A 4JVSB 4LY6A 3MUFA 4NCIA 1E9BA 4I4LA 2PLRA 1W0KD 4RD3A 1Z0JA 2GAAA 4XIGS 3KXLA 2V7QA 5AK0A 2G9NA 4BECA 3WBKA 2N1BA 1TNDA 1X86B 4US0R 4LBVA 2VTKA 3FWYA 1SXJD 4C0HA 1NNEA 2IHBA 3C16C 4LJ9A 1N25A 2FH5B 2OUKA 2P65A 3RANA 3SBEA 3UG6A 4MKGA 3ASYA 4AD8A 3LV8A 3HJNA 4DXAA 5KUTA 4FINA 1QVRA 1WMSA 2CE7A 2J87A 2ZSFA 4C7OA 4TMWA 2B21A 5IT5A 3NH6A 5B64A 1ZM3A 4NL4H 4Q9LA 4LYHA 4DLVA 1FP7A 1KZGB 5H1YA 3I5YA 4E03A 2WIBA 2HV8A 3TH5A 5FBLB 1QHHA 4HATA 3KJHA 5EE9A 4DDUA 2ZTSA 1SXJB 1RFLA 3VR4A 4A2PA 5JI2E 3RVBA 3JZAA 3PENA 2DPXA 3SE0A 4DSUA 1II8A 2ZM5A 1DAGA 4TMXA 3T1VA 3U5ZB 4UNQA 3DMDA 1TF2A 2GNOA 4HAVA 4B3XA 1MRNA 2FZLA 2Z83A 2O8FA 5SZJA 2ODNA 4W5JA 5CDFA 2ZSBA 2JJ2A 2LKDA 2HCJB 3LLMA 4PHFA 4YMWA 3T1QA 2F55A 3U4QA 2GJ9A 2HXSA 4BRUA 4QHTA 1GNRA 1H8ED 3GLHB 2IYUA 2IEYA 1UBCA 4KI0A 1XEXA 1CRQA 2WICA 4BFSA 3FPAA 3SS8A 3K0AB 1ZP6A 1Z07A 4NYJR 4M1MA 1TQ2A 3MWLA 3Q3JB 4KVAA 4LJ6A 1DARA 3PVSA 4NZYA 2OO7A 2SHKA 4RD2A 5KU1A 1OH5A 3L82B 4QJ4A 1Z8FA 2JLXA 1I2DA 1RJ9A 4ACAA 1XD8A 2ZJZA 3C5CA 3NC0C 4XD7D 3GLIE 4DB2A 1VIYA 3DEFA 5FTLA 1CR1A 4A8JC 4FMDB 3WMGA 3D3QA 1E79D 3QKSB 1IY1A 2H5EA 2IWRA 2AFHE 4V02A 5FPTA 1IJFA 2OLJA 4DLYA 1W5TA 3GEEA 3P20A 3PJRA 3CH4B 3DM9B 4URZR 2F9LA 1EXMA 3PR1A 3RS4A 4D0GA 5IK2D 4FXPA 1ZIOA 2B7BA 1N6PA 2CJWA 1QG2A 2NO9A 5GVRA 1G3QA 4MA4A 1IXSB 4IDQA 4LK2A 4OQNA 4US2R 4BFXA 4PQYA 4I1SA 4TYYA 4HZUB 2ZYWX 1TU3A 2B8TA 1KK1A 1LW7A 3CRW1 3CM0A 521PA 1AQUA 1ZUHA 4TL8A 3IO5A 1XPUA 1P75A 2QM7A 4KBFA 4MRVA 4JSTA 2DHRA 4QNMA 4TLDA 3TIFA 3U44A 2XOKA 4NYIR 2IUSA 2MMCA 1WCV1 2ZRCA 1FPMA 1OXUA 2J1LA 3JVUA 4Q1EA 4U02A 1FTNA 1HT2E 3BGWA 1F2UA 2G3YA 4HLDA 4N1AA 1OFTA 3SBDA 2QSYA 3U6KA 2J0SA 2Z4SA 2ATVA 1AGPA 4W7SA 2VP5A 1WQ1R 3NWJA 4BLRA 4YMTA 2ORWA 3CZPA 5DI3B 3ADBA 4NONA 1GKUB 2O5VA 2P6NA 1LF0A 3TE6A 4P0TA 4B48A 1CJTC 1DAMA 2F3TA 3TK1A 4GI7A 3U3JA 3CPJB 4XTCS 5JRJA 4TZ6A 3F8TA 5L3QA 3ZD7A 1Z29A 2V3CC 5DYIA 2B8WA 3QENA 2PCLA 3RHFA 2CLDX 3TSZA 5E4FA 2YNMA 2VHJA 3BFVA 4LYAA 3PEVA 2NPIA 1X8LA 2X19A 2ZU6A 2FEMA 4CZ2A 4Q47A 5JWRA 3TAUA 1QBKC 1R8SA 4D25A 3QBVA 1AGRA 3ZJYA 2MSDB 3BC1A 1OW3B 5FOTA 4G5SA 1M74A 1FOEB 4JLNA 4P32A 1DEKA 3OEEA 1MV5A 1SGWA 3CLVA 1HQYE 4JLVA 2GJKA 4C0KA 4HB3A 1IN7A 4C3ZA 3AP1A 2DYKA 2Z5FA 4WAUA 2QNRA 2HCBA 4XTRA 1TQDA 1EFRA 1OV4A 4JT4A 3RRMA 1RRGA 2ZI5A 1A2BA 1ZNYA 4HAYA 2P5SA 2EQBA 4A1FA 4GMXA 3BB4A 4ILEA 5JWOA 4A8JA 3GJ8A 3Q72A 2P6UA 1T3LA 1CJMA 1NY5A 4Z51A 1KO8A 2PT7A 3VR3A 4CEHB 2W2TA 2C8VA 3AF4A 3TSWA 3QKTA 2YWGA 3VKWA 1W2GA 3DOEA 2W6JD 2ZE5A 3KXKA 1Q22A 2Q3MA 3HYTA 4QG7A 1M7HA 2AWOA 2Y8EA 3VR1A 4TLEA 5GJCA 3U3MA 4MRRA 2GF0A 1GUAA 2GVZC 5E95A 1SKYB 1Q44A 1W2HA 1G8FA 4AG6A 1UKVY 2QAGB 3QY0A 3T15A 4IDOA 4Q1BA 3KQHA 1CF4A 1E2LA 1HE8B 3T35A 4N0EA 1XMVA 3FKSA 4NCHA 3U3RA 2VO1A 4BE7B 3Q5EA 2NZ8A 1YR6A 4RVCA 2ZS9A 4E22A 3C4JA 1W4CA 1E2FA 2YV5A 2BIFA 4BGDA 5C4GB 2WBLC 3ZQ6A 4BQSA 2BMJA 3DZDA 2DFTA 2GEUA 3B13B 3DL0A 2O8DA 2F6RA 3OAAD 4PO9A 2RHDA 4IFEA 5DI9A 4A2WA 2YZ2A 4XWOA 1UDXA 5L8VA 2EU8A 2REBA 3BAFA 1EX7A 1R0YA 1JQLB 2ZRDA 3GJ4A 4KFSA 1OH8A 1DTSA 4NHOA 3NDBB 1GIAA 1IM2A 1UBGA 3B85A 4U5XA 4TYQA 2X1VA 1G8YA 5JI3E 1Q57A 3CO5A 4JVNA 2P0EA 5J47A 2R2AA 2WPDA 1VDZA 3QVVA 3OIUA 2ZR0A 1RZ3A 5DIFA 3DKVA 3JZMA 2ZS8A 1IN4A 1KSHA 4A0RA 5KNDA 3AKEA 2PJRA 4BASA 3Q85A 3TNFA 2PX0A 4WXRA 1PLJA 1XMJA 1GNQA 2F7SA 4YDHB 4Z54A 2OCPA 2PJZA 4QM7A 2NIPA 1HYQA 2JLRA 1ZNXA 5FOUA 1YZTA 2DFLA 5JCZA 4LJAA 4B74A 1MABA 1CULC 4W5HA 3QE0A 1XCGB 2QUZA 5DHAA 3VMFA 4CDGA 3LBHA 2XSZA 1COWD 3PXGA 1PVOA 3K0FA 2ZYUX 3CZQA 1IJEA 2Q9AA 5G3YA 1ZAKA 5FBQB 1W49A 2ODWA 3B1XA 3Q7PA 3QI2A 4JJZA 5DLQC 2WJHA 1J70A 3EARA 4UKDA 1E2JA 4RD6A 1XTIA 4QBFA 1PUIA 3T1TA 1T5LA 3ZVLA 4ZI2A 4GT1A 3GEHA 4LV5B 1AKYA 1KK2A 3QVUA 4KFRA 2BCGY 2OT3B 1F2TA 3NBYC 2WJGA 3P26A 4HAWA 2QTHA 5H8WA 1HE1C 2QENA 1HT1E 2JLQA 3LNCA 3K8YA 2D74A 3V4RA 1Z6TA 3EC2A 4P4UA 4OK5A 1O3YA 3BWDD 5EE1A 3VFDA 4F38A 1GSIA 2H17A 1K5DA 3SFZA 2XZPA 2VSOA 3ZDQA 1G5RA 1ZNWA 1Z83A 1TAGA 2CNWA 5JCPA 4XWKA 3CF6R 1ZCAA 5D3MA 4DT1B 4JKYA 4LCBA 3CF0A 4ZDJA 2BKUA 2FGJA 3IUYA 4HUQA 4YMSA 2CDNA 2EVWX 4PC1A 1GRNA 3KDSE 4XJXA 1ZBDA 1FTSA 4OL0A 4IXMA 2XZLA 4K46A 1L8QA 5JRZA 1I2MA 4JYCA 4PFSA 3M4YA 3W6OA 3CPHA 3OESA 5FL7A 5GJVC 4EFMA 4PHHA 2WWHA 3KJEA 5GJBA 2UKDA 1DVRA 1J2JA 1F6BA 5LB2A 3WMFA 3QG5A 3VHXA 5KPJA 3AF2A 1TTTA 1Y3AA 3RYTC 4URXR 1U0LA 1P9RA 3AVVA 1IAQA 3AH8A 3THXB 2OXCA 2FJUA 4AG5A 2BM1A 2IF0A 4M8NE 5E7IA 1G16A 2ZJBA 1MT0A 1N6HA 2A5FA 3FYHA 5J4KA 2WWIA 2ZI7A 4Q66C 3ZH9B 2GXSA 4FMBB 3UWKA 3IEUA 2YYZA 3FTQA 4EFNA 3EPKA 2PX3A 2W2VA 4MQBA 4D26A 4PPNA 1EFHA 4ESHA 2ZYTX 2O0JA 1NKSA 1U90A 2QG6A 4PO8A 5HKKD 3A1SA 3T12A 2HLDA 1GL9B 2V6JA 1NG9A 2JJ1A 5AUPB 2ZEJA 1W1WA 2C2HA 1SXJE 4PANA 3GLFB 4HB0A 3PITA 4DRZA 1A2KC 2XNDA 4OI2A 1R0XA 1M7BA 3WHKA 3N2IA 5TMPA 1G41A 1T8UA 4Y0AA 4TL6A 4BUJA 2G0NA 4JL8A 4S2EA 4YC7A 1P2VA 3KJIA 4JBXA 1E2GA 1H8HA 3IIJA 3K0CC 4R98A 1HURA 2DR3A 1KTVA 3ICQB 2G88A 2HJGA 1R2QA 5EUMA 2D06A 3WBJA 1UEJA 2ORVA 3B7GA 4H1UA 3EZ7A 1QHIA 3WNBA 4V0KA 3V00A 4B43A 5CK5A 1UBEA 1G3UA 3W8RA 2ZIAA 4BEBA 1SHKA 1YJ5A 1LNZA 4AI6A 4D6PA 2ZRIA 2WSMA 3ICEA 1L4UA 1X8JA 1NLYA 4RZXA 3QXXA 1NSTA 1WF3A 4KCGA 4DDTA 2FPMA 1OT3A 1FMLA 2ZE8A 1GG2A 4RD1A 4Q5IA 4B6FA 1T9HA 3CNOA 4DLWA 1VHLA 3K70C 2ZRLA 2IBMA 4M1YA 1OHHA 3EZ9A 3FVQA 1OB2A 4G5OA 1PLKA 3QIAA 1NBME 4V0NA 2QE7A 2FFBA 2IS1A 4JBWA 1KI6A 4A0FA 1IY0A 2XX3A 3UWOA 5KO2A 1LTQA 4PZZA 3AVTA 1BMFD 1WDTA 5HZHA 4BLQA 2BM0A 1SVMA 2CEAA 4JYBA 1P7CA 4GSYA 2OFOA 2WSSD 5JSZB 4KV9A 3KJGA 1QHYA 1UADA 4F4IA 1VECA 1XD2B 2QL6A 2ZRPA 1VPLA 3RC8A 1KYIA 4OJKA 1YRAA 1E2EA 5KDOA 2QP9X 3EZ6A 4QFMA 4ZPXA 4Q4HA 1BS1A 2IEZA 2DCUA 3MCAA 5F9FA 3CUEF 2XB4A 5FTKA 1UDWA 2HJVA 4EFLA 5FBRB 2GZHA 1Z06A 1ODFA 2V7QD 2YWFA 2X8AA 1Z6GA 3NC1C 2D2EA 2G0TA 4WA7A 4Z8YA 5EE5B 4TYPA 2H16A 1I4TD 2IYLD 1R5NA 4NH0A 3NIBA 5KDLA 4A4DA 4P31A 2ZRJA 2HYDA 3EPHA 1S0UA 1VMAA 4C0SA 1S2MA 5IF9A 3CRVA 3AGQA 4UQOA 2C9CA 1XWIA 1E2PA 1P3JA 3QKUA 3GLIA 5F2EA 1WRBA 3K53A 2IS2A 1JQJC 2FZ4A 2I1QA 3QPVA 4KLZA 2A30A 4Q18A 3FB4A 1SVIA 3QEOA 4PO1A 5AUQA 4A82A 1FW6A 4ZDWA 4DIDA 1Q1BA 2ZRFA 4TLAA 2FSIA 4AC9A 3GCGA 3WYAA 5LB4A 3BFKA 3OF5A 1M34E 3ND8A 4ZCLA 2OM2A 2ZI3A 2ANBA 3AVWA 4KVGA 4LV6A 4I1VA 3ADDA 1VCIA 1D9ZA 3K0CA 5FR1A 2BBWA 3WYFA 2JLWA 2IF2A 3PG5A 2BVNA 5CLLA 4B73A 2ZR9A 3AKYA 3CWQA 2QGNA 2O8CA 2GZAA 2F43A 2FA9A 1CR2A 5J4YA 2IA5A 1UAAA 5HE9A 2VBCA 4L15A 2JLSA 1E0SA 1XU4A 2BMDA 3EWAA 3H2YA 5EXSA 3SYLA 2Q9BA 4BLOA 1HQCA 3NKVA 3QUSA 4RZ3A 2WTUA 1AQYA 4G5GA 5JJKA 1DPFA 4TZ0A 4B75A 1MO4A 3GD7A 1LV7A 1AZSC 5FPSA 4DUGD 3CRQA 5FR2A 1AS0A 3LBNA 4R2HA 1GTVA 2J5XA 3E70C 3F5FA 2XXAB 1S9DA 4M0LA 4C0BA 4C0AC 3IGFA 2I3BA 4HDQB 4PHGA 2VYFA 2QEQA 2EYQA 4LBWA 4DCSA 2CL0X 3PEYA 2X2FA 3KKOA 1ZC3A 1GRRA 2FN4A 4LV8B 5FTMA 2O8EA 1P2UA 3MSXA 2VA8A 1CU1A 4GBMA 4EPXA 5BN3A 1E9EA 3R20A 4B71A 4WZAE 5CM8B 3W3AA 3S1AB 4M9SA 4YXWA 1E0JA 4DSOA 4DDVA 1G7RA 2P3SA 5EUQB 5BN4A 1W48A 1G1MA 1XXHB 5JS8A 3OHMA 4NYMQ 4ARZA 1XTQA 2JLZA 2G1KA 5HZKA 3TW4A 5L3SA 2VHQA 1SKYE 2CVHA 3CNNA 1GAJA 3OIWA 5CJPA 1OE0A 1DG1G 2GXQA 1W36D 1SVWA 1S96A 4K8OA 3B1ZA 4ASUA 4PSKA 3HU2A 1KSGA 1KMQA 4KYUA 3D6TB 1W4BA 3U2QA 2QGZA 2VHUA 2IUTA 4RFSB 3IIMA 4D2IA 5FUVA 1TEVA 2LWIA 3EA0A 2QMUA 3BH7A 1ELOA 1NMZA 4CVNA 5KNCA 3I73A 1G8GA 1ZVQA 4BZPA 1FX0A 1S4QA 3L8YA 1YR9A 2FEOA 4QC2A 3X2SA 4C2TA 2A7QA 4J0QA 3H86A 4Q03A 4QL3A 2GCNA 4MKIA 3GJ0A 5J40A 1NG1A 2YVUA 1P60A 1D2EA 2OZEA 3LAWA 5LD2B 3BB3A 3MWKA 5TVKA 5JLJA 3GLGB 4IDNA 1XZPA 3SQXA 1W36B 3TMKA 4UNPA 1YE8A 2XZOA 2EWVA 4QGHA 3O47A 3CF2A 3ZZUA 1P62B 4U00A 2J7PA 3KKPA 2C98A 4A0GA 4PPFA 3LLUA 4Q7MB 2FFHA 1BYUA 1D8TA 1U98A 1ZRHA 2OAP1 4Q7JB 4KFUA 4XVUA 3AKDA 4AYTA 3ZIAA 2WWFA 2WAXA 3RC3A 4EPTA 1KAGA 4B3FX 4QJ5A 4EQ6A 2R6GA 1X3SA 2W6ID 1E99A 3AV0B 1PUJA 3U44B 2GESA 4TTRA 1P9NA 4CYMA 2V1XA 5EZ6B 3VX3A 2WWXA 3RAPR 3OEHA 1F2UB 3AVUA 3TJZA 4IEEA 2QMEA 2PLFA 2W0SA 1CEEA 3OE7D 1ONBA 3BORA 5DSZA 2R44A 4BEJA 1JEDA 2V4ZA 4CT5A 1Y63A 1Z08A 2VEDA 4G0NA 2ZRKA 4JLAA 5TV2A 3RSOA 4F7WA 1NVWQ 1KK3A 2HDNB 221PA 4QOSA 5JJIA 4B33A 4JLMA 4QKQA 1Q12A 4EPVA 1DO2A 1KDTA 2GETA 4FN5A 1ZD8A 2QN6A 1R5OA 4XVRA 5LDDC 2Q0HA 1UPTA 2MMGA 2FF7A 2B7CA 5FPKA 3R8CA 4DJTA 2QMOA 1AIPA 1G20E 3T06B 4MKHA 421PA 4CRWB 3O8CA 3BB1A 3BS4A 2REOA 3FE2A 3QPUA 4JBYA 1G17A 2ZJAA 3E1SA 2VP4A 4NCJA 2VP6A 1TUIA 4A6PA 1E4VA 2V54A 4XWAA 4PAMA 2ERXA 3X1WA 4P4SB 1OXSC 4M1TA 2YWEA 3K9HA 4S35A 2XJ9A 4KO8A 5DH9A 2H7VA 1GVNB 3VNVA 5C18A 5DN6A 2GTPA 2Q3HA 1G6OA 2YJTD 1QDEA 3U7GA 1QRAA 2J0VA 1IBRA 3NEJA 3QKRA 1NN0A 3FHCB 4Q00A 1KHTA 3QNUA 1OF1A 1FQJA 4M21A 2IWHA 5AUNB 1JR3E 3QF4B 1P73A 4NPHA 2J46A 3SEAA 3KQLA 2AL7A 4UNRA 3W34A 1RVDA 2B6HA 4Q19A 2BJWA 1JAIA 2IC5A 3KXIA 3ZD6A 3EG5A 3C5HA 4CEJB 3FFBA 4HSEA 4M1KA 3SDZA 3I3SR 2RMKA 4QM6A 1GFIA 2ZJYA 2QQEA 1RPZA 4BZXA 4Q4AA 2OBLA 1NN5A 1ZU4A 4DLXA 4B3BA 2WOJA 4KYIB 1V5WA 2KB0A 2OXRA 1KJWA 1G291 2TMKA 4MKFA 4LHXA 1KNQA 4X8LA 3CWZA 4N0DA 2ZYVX 1G3MA 2FFQA 3K9GA 3PEUA 4GOJA 4PAQA 4DDWA 1A7JA 2ZJ5A 3TBKA 4TT3A 2WMNB 1N5JA 1Z0AA 2YOFA 3QXJA 5FPHA 2K5UA 1DS6A 2FX3A 3NHBA 1DELA 2J3EA 3BBPA 3NG1A 2WPDD 3I72A 2QPOA 1IQPA 1SKQA 4RFVA 4Z1MA 5KNBA 2JATA 1AM4D 3AEZA 5DYGA 4R9UC 3PUYA 2AFIE 4TYWA 3MRSA 3BXZA 3RS7A 2JJ8A 3I1FA 4C4PA 3VTKA 1G8PA 2FOLA 1KMHB 4V0OA 4MDFA 4DIEA 1ZM7A 4Y0VA 1B23P 1XJQA 2O8BB 2JEOA 2HXYA 4XH9B 2XB2A 3SU8A 3GLFE 1N0VC 2ZJ8A 4Q21A 2IUUA 1SVOA 1ZD9A 2BEJA 1E2MA 4GRAA 4H1VA 1Z2CA 2A9KA 4M1WA 2RHMA 4ZV4A 2P67A 2F1HA 1LS6A 4Q01A 1RIFA 2BKEA 4JLPA 1RE0A 1E1RD 4TSFA 1G4UR 3QSYA 1BH2A 1IN8A 5KSZA 5EXTA 4OQXA 3I4LA 3EW9A 2J0UB 1CR0A 1ZUNB 2ONKA 3FHTA 3IILA 5DNYB 1IXZA 3LBIA 1N0UA 4E09A 3VHLB 3U7FB 1RRFA 1LFDB 4PTLA 1TQ6A 3RWMB 2OCYC 4BLTA 2BWJA 1VCNA 3B1VA 2JIZA 3GJ7A 5H70A 4D4JA 4LPSA 5JJLA 5AJXA 5EJEA 5UKDA 4ZI3A 2WAYA 2IYZA 2FNAA 3IO3A 4L9SA 4M53A 1K5GA 1W0KA 1CS4C 4TQUS 3UK6A 5JZVA 1E94E 4UXJA 2EFEB 3MWJA 2QTVB 1Q21A 5CIWA 5BYKA 3HYRA 2OFXA 4YMVA 5A5GA 1Q1ZA 1R0WA 3CBQA 4ZIRB 1SXJA 5EP3A 4UNNA 1EWRA 1TX4B 5CJ2A 4Q02A 3UXMA 4WVFA 3LWNA 1EGAA 2GBLC 4O2LA 3CRRA 2ZANA 4PQFA 1N5KA 3ZZ0A 3NTUA 2BC9A 4KLNA 4MYUA 2QP3A 4Q4LA 1HA3A 3RWOA 3VU9B 1N6LA 4TN1A 3B1YA 5JWHA 3G0HA 4B3DA 3QXSA 5FL7D 5BWMA 4JKIA 5FBVB 4QXAA 2O0KA 2YHSA 2ZUDA 3GLHA 5F98A 5D3MB 2D62A 2GCOB 2ZE7A 1KGDA 2RGCA 1DOAA 3C14C 3CR8A 3K0AA 4NDZA 4BPBA 1D6JA 4AURA 1QG4A 4URYR 2PBRA 4UJ3A 1OH6A 5JBQA 2O52A 1CJUC 1U2RA 3CPEA 1NMYA 5ANRB 2Q9CA 5DE3A 3TW8B 2BBOA 1NBMA 1WP9A 1E1QD 4ZKDA 3K9LA 3UKDA 1Z6AA 5B2ZA 1DAEA 1HV8A 1ZM9A 2ANCA 5G3ZA 3DDCA 3L0SA 1R10A 3W8NA 4YLGA 3QKSA 3EWSA 3FMOB 3DOFA 2UZIR 2Z43A 3PEWA 2O0HA 1GDDA 1W0JD 1EFTA 1H8EA 1L2TA 2AXPA 4AKHA 5AJWA 1U8YA 3GP8A 2JJ1D 4O3MA 3RRYA 2IW3A 5FPYA 2OHFA 1Z22A 2CK3D 2EYUA 1GWNA 2G77B 2XNDD 2VP2A 1LVGA 1NRJB 2HF8A 3D8BA 4OKSA 1XP8A 3IIKA 4KITB 3R8FA 4NE2A 1A4RA 4G5QA 1LS1A 1GNPA 1H8HD 2CL6X 2HT1A 4QGFA 1FNMA 1G6HA 1XDBA 4D4LA 3FMFA 2QAGC 4HZUA 1EESA 4ACBA 2P2LA 2XTNA 1GKYA 5GJWC 2R65A 2EFHB 2WJVA 4GZLA 1E4YA 1OIVA 2BMEA 3HDTA 4GP6A 3SHFA 2Z6VA 3EXAA 4BFWA 4PR0A 3RNLA 4TQAA 3RDPA 1M2OB 4PPQA 1X8KA 1KNXA 4GP7A 4PAOA 2WMOB 2JLUA 4LJ5A 1Z0FA 1XEFA 3WP1B 1D9XA 2A78A 1OHHD 1CBUA 3CX8A 5DI3A 4X8OA 2IXFA 2OSBA 2A5JA 2GZDA 4PQRA 2QE7D 4FMCB 4G01B 5D3QA 4B32A 2W2XA 1SVLA 4DCTA 4AKGA 3TUIC 3P32A 2Z0MA 2C99A 2GBLA 3C7KA 2D7DA 3O8RA 3REFA 4LJYA 4RSGA 5H68A 3DVLA 2DBYA 1XXHE 3E5HA 3ADCA 1N5LA 3W5IA 2JGNA 3TRFA 2DFNA 3A37A 3CW2A 3W3ZB 3KB1A 1ZIPA 1UBFA 3L0PA 1I4LD 2F1RA 4K81B 2F1JA 1JBKA 4IOLA 4RCYA 5SZHB 2IYRA 2QT0A 3RRNA 5FOVA 1IOZA 5AJZA 1VYUA 4JLOA 2FE4A 2OCAA 1W47A 1JALA 1M6NA 5JMTA 3KTAA 2PEZA 4ESVA 2FGKA 4IDHA 3A4MA 2PZEA 3FDIA 3O8DA 2R6CA 2QSZA 4QBHA 4RZUA 1VG8A 2ORIA 3GFOA 3KKNA 3GLGE 4EJSB 1Q3TA 2QU8A 1D2NA 1B0UA 3SHWA 4L16A 2XITA 3TUJC 1NLFA 1G5TA 4Q4HB 2VLIA 1QHSA 2VSXA 3SI7A 3RRZA 4XSHA 4MITA 2JAQA 2OBMA 4F4JA 5P21A 1OJLA 4ZKEA 2QQ0A 3D7MA 4KBGA 4HUTA 2FG5A 1I4DD 1CR4A 2W0MA 4NYMR 3L8ZA 2XAUA 2A2ZA 2AX4A 4GNKA 2QAGA 1HUQA 1GL7A 1KAOA 2GEVA 5AUOB 1OH7A 1TQ4A 1HEIA 4LJ8A 4TTQA 4TL9A 2A5DA 5TDHA 5B30A 1GRQA 2LCFA 4KAXA 3T5DA 4U7DA 1DADA 1XF9A 1XTSA 1UKEA 1Z6YA 4C30A 4L5BA 4RD4A 3TR5A 5FTNA 2FMXA 3CH5A 5G53C 5IHPA 2JDID 2W6JA 1E2HA 3TVDA 1BIFA 3A1VA 1YVDA 4HI0E 4C0QC 2QBYB 1UJ2A 5TY0A 5F3WB 2CCJA 3TR0A 1JR6A 1T5IA 2MSCB 4KJZA 1ZM4A 721PA 3R7WB 3SYNA 2CL7X 4RD0A 1J7KA 1L7VC 1TADA 3AKCA 4JLJA 3MFYA 2VF7A 4D81A 4YMUA 1NSFA 2JASA 2NO6A 3EASA 1WA5A 3R9XA 1OXVA 1ZMXA 1OKKA 2WHXA 1NKTA 2QY9A 4Q4JA 1Z0KA 3OFND 3EPJA 2IYYA 4HEJA 3GFPA 3QF7A 4B6EA 3OAAA 1CXZA 4DCUA 1KY3A 2GHIA 1G19A 1GZSA 1XCPA 1EFCA 2UVQA 4IRUB 3BERA 3VKGA 4W9MC 5AWFC 3CKLA 2ZXUA 4B47A 1E6CA 4LYFA 1GP2A 3GLHE 2CMKA 4FIDA 1A1VA 1XCMA 5EP2A 4JT2A 4TWZA 2R8RA 4I99A 4KU4A 1XEWX 4R2IA 3FOZA 1LY1A 3PIRA 2AD1A 4LC0A 5KSPA 3LXXA 2O8EB 1D5CA 2GA8A 1W44A 2EW1A 2YKGA 2RGAA 4JL5A 2RGDA 1OFUX 4OHZA 2IS6A 4OHVA 3THWB 3IHWA 1O87A 1HH4A 3ZLJA 4DKXA 2BHRA 2OE2A 1GM5A 4WZBE 1M7GA 4TYNA 3KX2A 4R71A 3RABA 1U81A 1M8PA 4TL7A 2J45A 5EE0A 1US8A 4RKFA 1JPJA 3WRXC 1KI2A 2FSGA 3QPWA 2ZI6A 3TKLA 1COWA 4JMPA 3G5UA 2H18A 2GXAA 1JJVA 3ZIAD 1OLOA 5HCNA 2R6FA 1XJCA 2IYVA 3AB3A 3MG9A 1KY2A 1JR3A 4EIWA 1NJFA 5LPNA
chains in the Genus database with same CATH superfamily
5DBFA 1P5JA 1UVNA 4X4QA 3EM1A 2ZT7A 3DO8A 2X8BA 2FPHX 3H5OA 2FWNA 2XUJA 4BQRA 2ZH4A 3NMRA 4LHYA 3ICPA 3FB1A 3CSDA 1OOEA 4BZQA 3HXKA 1YQQA 3PHIA 4ARUA 3KLOA 4IXDA 4IKAA 4M9QA 4LMBA 1T9WA 4AMGA 1N9KA 3D6AA 4YQYA 3Q0IA 1B2LA 1QF7A 3Q6IA 3HCRA 4O2AA 4UQGA 1RT7B 2YOHA 3AQPA 1DUVG 3KUXA 2CLKB 1CP2A 1LJLA 4EHKA 4DPYA 2GCGA 3EIFA 3OP4A 1FFWA 1PR0A 1XNJA 2BFBB 3CDBA 2WWGA 1LSOA 2GFQA 2R87A 1LXNA 1IHOA 2WIAA 2VWHA 2R6R1 1FMCA 3F8SA 1CG2A 5CHEA 5JHHB 3OR2B 3SCKE 4II2A 5CDGA 4DLBA 2X1GA 1ICEA 4KHRA 1HNZJ 1AXGA 3CNQS 1XD2A 4OLOA 3V6KA 3D4PA 1V11A 2R8GA 3GJ6A 5JFGA 2HMIA 4N03A 4HDMA 4IW3B 4AJ4A 1QJ4A 2GK7A 3VGSA 3GMTA 4RDHA 3EXIA 1PP4A 4F56A 1TZ0A 1W36C 2NOAA 5E3PA 2REQB 4ZOLB 1NPYA 1XMSA 4FW9A 1PEKE 2AN4A 5IDXA 4UOHA 5F3ZA 2BQUA 2PZFA 5A0VA 4AO6A 2H9AA 3V8NA 3RRKA 4UNSA 3KPUA 4CFYA 3FTFA 1ZISA 4ZYTA 1N6KA 1B0TA 1CQPA 2IYPA 1Z0DA 3COZA 3UIEA 1O95A 3VTFA 5AW8A 2IRYA 4RU2A 1W93A 3L0IB 5DZ6A 1BROA 4YRCA 5TGZA 2BP7B 5I48A 1SXJC 2W2MA 5FNVB 1GQYA 4GPBA 5LBIA 3T99A 4MI6A 3FFWA 4D4MA 4CFSA 1MMDA 4AY3A 3I32A 3A27A 4N40A 3SZ3A 2BE9B 2D1SA 1W85A 1GXLA 4EI8A 3KQSA 3ENWA 4RPGA 3K09C 1XMOF 3CA8A 4R81A 2IS4A 4XX0B 5AJTA 1U3CA 1K63A 1WZUA 4G23A 1CJTB 3ONDA 3IKJA 1TL1A 3A70A 3MDFA 3FKBA 2P9YA 2X9QA 4DPXA 2ZYRA 4RELA 1N5VA 3TINA 3EAFA 2YMLA 4GHWA 4JLKA 2SNIE 1WUYA 5AW4A 4DANA 2XA2A 2IX3A 3VDMA 1IPHA 1SUPA 2XNKA 1DO0A 3NASA 1YIAA 3IPRA 4O25A 4L7VA 4F4HA 2B37A 1NM2A 2QKYA 3BH6A 3DDHA 5JPCA 1ZCZA 5MAOA 3BN4A 5F9HA 1MDBA 3PI7A 2L9NA 4EW1A 2AZ4A 1YMQA 5KWEA 2A4KA 3D0RA 4QPTA 2R751 2XZDA 4AYBD 2OILA 4LBHA 3GNQA 1TU0A 2X77A 2HI0A 1N5SA 2DXDA 2I8LA 5EWMA 1JDBB 1W4AA 3VHXB 2Y05A 1CDOA 5I3PA 3NGSA 5FV4A 1EDDA 4GW3A 3M33A 1T2VA 3WYEA 3IBGA 1Z7EA 1PAUA 3ND7A 1MWQA 1T15A 2YC4C 5SZKB 4HQ6A 3AO0B 4HVZA 2V45A 4JNKA 3V2UC 2N4DA 3FWHA 4B3RJ 5DTEA 2XEXA 3W5HA 1WB9A 1PEAA 1OWXA 1U9IC 2CVOA 4O4HF 4A27A 4Q4JB 4MVJE 4MIAA 4DR6B 3HWX1 2FMTA 5K14B 4IHJB 1HTWA 5JNVA 1SUCA 4MYDA 4EL5A 3LL7A 3GJ3A 1BD6A 4CIXA 3NYIA 2NSJA 3LSYA 2DY1A 3IPXA 3EVFA 4YHBA 4F4XA 2J6UA 3D59A 4KO2S 5FFMA 2RE1A 1PR2A 4QGBA 2X1HA 2WSEC 3WK6A 1WDKA 1MMNA 4CEHA 3ERCA 1QLWA 1TCUA 4Y2PA 2HQDA 4PZVA 1OI2A 3WLLA 4JI7J 2IBSA 2XV1A 5DYWA 3UWDA 1Z37A 2ZRGA 5G1NA 2QU7A 3A06A 2P35A 3OTIA 3SIRA 2E9RX 2QTFA 4DOZA 4Q1DA 4ZLJA 2IOHA 2KW5A 3ZZRA 1F5NA 1ONSA 2NUUG 3IAEA 3FNIA 2QT1A 3BMQB 1Z6XA 4FDUA 1RKBA 5KWVA 3GRAA 4KN6A 1H2UX 3CS3A 4BLSA 2C2ZA 4LAFA 3U56A 3FCHA 3G2QA 1NM5C 4FDAA 3CC8A 2WTXA 5TJHA 2H00A 4U1RA 5DHQA 2RGEA 4G1BA 1UK9A 4NBTA 3LUBA 3CMMA 2JLCA 2GNAA 3OECA 3ZWCA 3BS9A 2YCLA 2RQKA 3LCMA 2HB6A 5BN3B 2P62A 4TVKA 3J81k 1F8GA 4LNHA 1IY2A 1BE6A 1P7WA 5CYOA 3TAHA 4DL3A 2Q43A 4JR0A 2OMLA 3T0FA 2F4NA 1ESMA 1NP6A 4FD3A 1E9SA 5CW1A 4CEIB 1E77A 5DISB 4DSKA 1BJKA 1PTJC 5IS2A 3FIUA 5E4JA 4Y1RB 4MQLA 2ZYAA 1K7CA 4IIVA 3BK7A 3U3DA 4G9BA 2BKPA 4IOKA 4AJ1A 4TRRA 3I39X 1LU9A 4D3ZA 4H7KA 1Y0BA 4PXEA 2NZXA 1UMDB 1X4CA 4YY3J 2X22A 3JVEA 4R2LA 4D79A 1ADCA 4E94A 1QAIA 4FYWA 1X2BA 4JL6A 3M2TA 2K2PA 3H90A 2VAPA 3AXMA 1NXPA 2M6RA 3AZOA 4IUBS 4Q48A 4OYXA 2ZI4A 3H6HA 5DN6D 2OB2A 2OQIA 3HU1A 2Z3ZA 2BANB 1RW4A 1DWQA 1JDUA 1YZNA 3ZGXA 8RUCA 1EK2A 1OGIA 1S97A 4WN9B 4QWBA 4ENVA 3BSYA 1QLHA 2HSEB 3TSOA 1FDNA 2V6BA 4U9UA 3PUZA 4M0CA 3NOOA 4NC9A 5HROB 4AKSA 1BFDA 4J4HA 4NLLA 4N41A 3T4EA 5KKNB 3IBSA 4PC7A 2Q1SA 1Q0TA 1EFAA 3PT5A 2A94A 4PYMA 1TLLA 3WGUA 3SJBA 3UAZA 4IIBA 1M0EA 4LSGA 3QV1A 4U6PA 3OR1A 5B3KA 2W71A 5DP1A 4K9PA 3MURP 4OYYA 2V3VA 1BYIA 2OD9A 5KVVA 2RHOA 4LFBB 4DMGA 2JEGA 2DMRA 2NUTB 2FVPA 4GGMX 1FC0A 1U24A 4NMLA 1P80A 4H2DA 3PICA 2XTAA 2LXFA 2Q0XA 2WW8A 1M2GA 5A02A 3W66A 3CMAS 4ZLNA 1N33J 1IU9A 5C2CA 4Y6IA 3IP7A 3X1LB 3PIOQ 3C4VA 4MA0A 4MKGA 4ZO7A 3W62A 4I6GA 4DXAA 4YMIA 4CODB 5KHLB 4TMWA 5IT5A 1RWUA 2DNRA 1ZAYA 4B4VA 5JD6A 5LCXA 3DP7A 2DCMA 5E3QA 1B26A 1T0UA 5KFSA 1CPZA 1Z68A 2GZ1A 2GIFA 2DPXA 5LN1A 1MRNA 5SZJA 3ZUGA 3H1PA 4NBLA 4PHFA 1BG6A 3T5PA 2XVXA 2YXEA 1NYRA 1NDCA 5CB4A 4YXFA 4DLLA 3K1ZA 2IEBA 1P2DA 3PVSA 2SHKA 4PWWA 1RJDA 3RQIA 1SJ9A 1FVOA 3PX0A 3WMGA 3DD1A 6REQA 3B12A 4MNTA 1ZOLA 2CMGA 5E2AA 2XGGA 1QYDA 3MUEA 3PJRA 4BOYA 2QRGA 2IAJB 4F4KA 5AYVA 2ZOMA 2RHJA 3VI3B 4XI9A 4HUJA 3RZAA 4E98A 3UJ7A 1KDVA 4ZOLF 1KK1A 4HSGA 1NJ6A 1UMBB 2QM7A 2D7SA 2DHRA 2HRZA 5ADWA 1U1CA 2G0CA 3JQ7A 3NO4A 4F3MA 5D8DA 3CIMA 3KEMA 3BGWA 4XQCA 2V9CA 3AD8C 2ACVA 2QAIA 2CWXA 3AU9A 2BUBA 1LV5A 4DFKA 2NTJA 1R66A 1HWYA 4P0TA 3GA0A 4XTCS 3OTBA 1S4MA 3ZUPA 1OVGA 1AUPA 2Q46A 5AXDA 3OOHA 4M8KA 3SQOA 4Q47A 3SZOA 2X8JB 1BGXT 1A0OA 3JAKB 4UEQA 1QQAA 2J9DA 1CE8B 3BC1A 4X90A 5FNVF 1M74A 1DRVA 2R25B 3OEEA 4KJIA 2DKNA 2JF0A 3AP1A 3K96A 4J1NA 1HL3A 2NZWA 3LFTA 4REOA 1WOOA 3DEKA 4MWZA 1ZMRA 1WC0A 3ND5A 3KBOA 3VR3A 4PG6A 1C9DB 3AF4A 3TSWA 5I9IA 2Y4OA 2XY5A 3KXKA 3U81A 1IQZA 4DLNA 1I0ZA 4DPLA 5A3QA 1I7PA 2PIDA 2B56A 1HWLA 1UKVY 1X7GA 3DHNA 3MNFA 3V80A 4H54A 1YR1A 2KZZA 4BLWA 4OLJA 1FCAA 5FXMA 3C3WA 4P53A 2W8ZA 3KE9A 1KYQA 5COAA 3VVMA 2CG4A 3EUEA 4LIWA 5H4HA 3RHZA 2JFPA 3JQGA 2DNOA 2AYMA 2J4CA 4JOBA 4ZHSA 1CUBA 3D1VA 2X1VA 5JI3E 1MROB 2A9FA 1I9GA 1M1ZA 2LDXA 5EIEA 2LXUA 3HM2A 1J8FA 4BO9A 4J9SA 3KKLA 1R9NA 4WXRA 1ORRA 5DYTA 3SVTA 3T3IA 5FPPA 3PKJA 3AY3A 2ZWOA 3OPVA 3VMFA 4CDGA 3O8OB 2C7VA 4LNUB 3LTNC 4DV3J 1ULUA 2W4IA 3SXUB 1BH6A 4E15A 4YRKA 3GEHA 4LV5B 4S05A 3HLKA 3ZV3A 1KQGA 3LPLA 4HAWA 1HE1C 4EX6A 4BNMA 2JLQA 4BX8A 5ICEA 2D74A 2Y2VA 1S7IA 3QLVA 1XZKA 2NAFA 4BV3A 2VT7A 4ZGWA 3AFGA 3AA9A 4JP2A 5COBA 1U2QA 2XZLA 3ITEA 3UWTA 1EP2B 4NFHA 5FL7A 2XMVA 5GJBA 4N5SA 5EMJA 4ARVA 4IIDA 4HTAA 4KKXB 3AH8A 3EG9B 2VK4A 5IT4A 5CA0A 5BUQA 1IBCB 1N6HA 2PUGA 4DR6F 3HBAA 1U47A 5KT6A 3ZH9B 3LW5C 4IHJF 4WRRA 3F9RA 3SVLA 2ABYA 1L4EA 4EKNB 4XYBA 5GZ3A 1Y1RA 3R6TA 2B8PA 1ZKMA 2HLDA 2HBZA 1WTFA 1QO0D 2FEKA 4M1EA 1WD7A 2HRUA 4G97A 3OO0A 4PSUA 2DR3A 3ICQB 4KDCA 3B7GA 4FF3A 1K9SA 4F8EA 2ZIFA 4FGLA 2WI8A 5AW0A 3K7EA 4RUAA 4KMRA 1BXGB 3K31A 2APOA 3UVJA 4MS3B 1M6HA 3KJQA 3L7IA 2X40A 5IYZA 4Z4HA 3PFGA 2BHLA 3OQIA 2R7XA 2C0CA 5EHZA 3K9QO 1VR6A 1PLKA 2ZTVA 5G0WA 2B5OA 3D81A 1Q0RA 2QE7A 1M83A 2ILTA 2SCUA 1DIHA 3DUFA 1SVMA 4A16A 5G0UA 4RFLA 3D54D 4YBRA 3S4YA 1YRAA 4ZPXA 3DOOA 4Z0TA 3MCAA 1NW3A 3H9GA 1J24A 3B9RA 5FBRB 4C3OB 4HX2A 4LZWA 2D2EA 2QA4S 3HXQA 2ALJA 1FQWA 2I3ZA 3BHIA 3RBVA 4ER3A 3K53A 2PTHA 1HTTA 4UAGA 2A30A 1G0OA 5LB4A 3BFKA 3ND8A 2OO4A 2WG0A 3GEPA 3IOEA 3ROQA 3G0CA 3CWQA 4Z4FA 5J4YA 4ZAFA 2IXDA 3PC2A 5KFIA 4X3OA 3PNYA 2W9XA 1TC1A 1PZHA 3S81A 3STXA 4B75A 1AZSC 3H1EA 3U7RA 3JQEA 5DHRA 3NEKA 4BLUA 1K2WA 1F0XA 1TE2A 4C2BA 5E6RB 4NDAA 2CXSA 2O8EA 2W4DA 4LYGA 2QMZA 5EJ5A 3BX1A 4NMHA 4ZN1A 1SL0A 1W36D 1DURA 2IUTA 2HGLA 1SBZA 1YI0A 1ZVQA 1S4QA 3L8YA 2FEOA 4NOKA 3C3LA 3RUIA 2EKPA 4Q03A 3OOEA 2B8NA 1WAMA 4OLHA 4LF5J 1V3ZA 1F60B 2YVUA 4KE9A 5WRFA 1D7OA 3BQ2A 2KX7A 3NLCA 3VAFA 3NIWA 5JCJA 4YJGA 3CEMA 3W2TA 3DMJB 4PQUB 1BE4A 4QWMA 2QUBA 4AJLA 1S1UB 3A6LA 1ONNA 4YOEA 1VRVA 4X4NA 4HEA6 3IERA 2OD2A 1ROFA 3GFSA 2P6MA 3ONQA 1HDOA 4CMJA 1KEZA 1XRMA 3E1SA 3QGIA 2VP6A 1Y3DE 3QPIA 3AJ2A 3NWOA 4LQLA 2DHAA 4ETXA 3RRXA 4BBJA 3T5AA 3O73A 2J6TA 4MPJA 1G0NA 1HNVA 1C2TA 4IIFA 1DY3A 2ZQZA 4M21A 4QYSA 3TW0A 4ILLA 5J1PA 4NCAA 4O4LB 3C6TA 4L6IA 5HJ2A 1QVZA 4QM6A 3CH7A 1ETHA 2IIQA 1EDOA 1RAGB 4OAQA 2CXTA 2LBPA 4LFBF 5CLHA 2WE8A 4F36A 4EQZA 3UYLA 1I1GA 2FZWA 5THQA 2ZYVX 4OV6B 2ORYA 4PZAA 3R3SA 4GOMD 2HVHA 3NG1A 1LWEB 2F40A 4GC5A 2FQWA 1L6IA 1CQIA 3SG0A 5BRJA 3U62A 1N88A 3RC9A 3P9NA 3ILYA 4C4PA 4Y30A 2FOLA 1HA1A 1IBLF 4ZD6A 4MR9A 4BN5A 4BQQA 5HP4A 3H2HA 4H1VA 1Z2CA 1RWMB 3W65A 3A6DA 3FDZB 1SWWA 2WOMB 2HMSA 3FAZA 1OLXB 1NE2A 1J00A 3IGVA 3HO8A 4IDCA 3U7FB 3B1VA 3CXRA 3ROKA 1VJWA 4ZT4A 1KJIA 5JZVA 3SFUA 3JSXA 4B45A 2RDDA 2OFXA 3OZFA 1YFLA 1SXJA 4Q05A 1S2IA 3UXMA 1IDN1 4WVFA 2G76A 1V25A 4O2LA 3V7WA 3ILOA 2V67A 4DMMA 2VPQA 2BFDB 1YZFA 4JGBA 2YTCA 5AW3A 3KXDA 4WCEQ 4BPBA 1BQMA 3TN7A 2JVJA 3FY4A 4DLAA 2J3HA 3FETA 4J1TC 1RMQA 5F33A 3UXEA 4Z9YA 1VL0A 4XUGB 3L0SA 4RJVA 3EWSA 3DOFA 5BUCA 2NUHA 2UZIR 3VNSA 3GI1A 1W0JD 5GMKa 1RQ7A 5J2PA 3OQNA 1SL2A 1GTG1 2XNDD 5HVFA 1BHSA 1S79A 1MJFA 2WEKA 4KDFA 3AKZA 2CPYA 4D4LA 3P9QA 3LPCA 1R4ZA 5B7QA 3R3VA 1NMEB 1PRYA 2H63A 2JVOA 2XTJP 2K3KA 3EXAA 2JGLA 3TQEA 3Q8KA 1ICIA 1UETA 1R00A 4FUTA 3OZRA 1GCAA 1QX3A 4KGVB 5I3QA 3SSSA 4G01B 3VKUA 4AKGA 4MEBA 3DC2A 1U2DA 3FNNA 3TECE 3JYOA 3PE4A 4DY6A 5TSDA 3VU1A 5DTIA 1PYTA 2QLMA 1CLFA 3F2IA 2GPWA 1NBEA 4H0FA 4INOA 3ZJUA 4RADA 4DUTA 1ZVVA 1EUDB 3OPYA 4IDHA 4Y1FA 3R6LB 3WQPA 3UN1A 3TGWA 3KDOA 5D6GA 1XIQA 3CZCA 1TVRB 2G70A 5JFOA 4BNVA 4IMJB 1NSYA 4WZAA 3RRZA 1JHUA 4TQGA 5M2PA 1UQTA 1G8AA 2JAUA 2N82B 2ASJA 1CW2B 3WGNA 1I4DD 1NWHA 3PQ8A 2QAGA 4ER8A 4R6WA 4FFBB 1KHWA 2F4FA 2A5DA 3HYNA 4RD4A 1RHKB 2C1ZA 3JYQA 4QR0A 4R8KA 3OQBA 3TVDA 1BIFA 4ZPDA 5F3WB 4J7UA 1KLNA 1ZAVA 1E58A 3MXHP 4EKEA 5LSAA 4RORA 4WY2A 1WQ3A 3T7RA 4ED0A 2Y1JA 5D2CA 3DKKA 2ZUGA 2FRXA 4MK7A 1PX2A 2YWXA 2IV2X 2BEUA 3H5XA 4NK4A 1RYBA 1KY3A 3CLSC 1GZSA 1L3VA 3P45A 3CKLA 2EOAA 3ZWVA 3EZUA 4WCVA 3NWBA 4IWYA 3Q8YA 2GKGA 1NDPA 3KG4A 2VA9A 1EEXB 5E9QA 4EKYA 4Z7CA 4CFZA 3FWNA 1YI8A 3DPIA 5F2KA 4NA2A 3ZO7A 2H9YA 2QYTA 2GXAA 3FVVA 1N34B 5CURA 5A5DA 1JR3A 1K86A 4CLTA 5AVWA 5LWHA 5KYYA 1XTUA 1TO6A 4DBVO 2A0XA 2DG2A 3BJIC 4BWJA 4YRFA 1AKEA 1O5OA 2QA1A 3WG9A 1W29A 5LMUB 3F3KA 5JC8A 5TC4A 5A0YA 2FTRA 2A35A 4X4UA 2UVPA 4UUAA 4F92B 2O66A 5EHIA 2OCXA 3N6RA 1U8WA 1FFXA 3EEQA 4TXNA 4A46A 4EY6A 4K03A 4H4KA 1AXRA 1KK0A 5TNXA 2FUG6 3DU5A 1Y5LA 2MIIA 2IQ5A 4ARSA 2NZYA 4H3HB 1ESEA 2DHSA 2CFOA 4KQEA 1MN9A 3P9XA 3Q8SB 4JVOA 3JYNA 3MMXA 3MM6A 1WBDA 3OVBA 5LDHA 4W5RA 4B40A 3FWKA 3OQVA 1PHRA 1UVIA 3BWXA 5C35A 2AGVA 4C7MA 4Q4DA 2B99A 3DLCA 2ZS7A 3LO5A 4RIIA 5KJFA 1S7GA 3M8YA 3WGJA 3N5BA 3WB9A 3GDFA 3WZ0A 4RZ2A 5KOXA 4KXFB 1I3CA 2WDPA 3M70A 3D43A 1CQNA 1AQNA 4Z1MD 2VDIA 2Q1UA 1O95C 1V8PA 2GRAA 4UU8A 5A2GA 5J1SB 1U2FA 1VXOA 1ZUIA 1JAXA 2HSDA 2CFCA 3K2IA 2Z04A 2NU8A 5IZ4A 5IJXA 1CZRA 3GARA 4DNFA 3P71T 2UVUA 2CJWB 4FJ1A 3PEJA 4NXNJ 1X42A 2XQJA 1N8SA 4ENUA 1ZJYA 4LZAA 1Y8RA 5FWNA 3KB2A 3K32A 3WB0A 4A0HA 2I03A 3FSXA 3E5NA 3K9WA 1C41A 1YB5A 4PIVA 4J3FA 2Y8YA 4B34A 2C22A 1RTJA 2FWBA 3D68A 4LR7A 2ZT8A 2IDEA 4EGAA 1V2HE 2NU7B 2PMKA 3GLUA 1AGXA 1JZTA 3O4JA 4WV3A 5KCZA 1AZTA 1FSZA 4CLWA 1EFRD 3N8GA 3BA1A 1IG3A 1FF9A 3GLSA 4FYVB 1E96A 3VVLA 1K47A 5DM60 2YBEA 5K0BA 4LC9A 3L77A 4R8SA 2GQCA 1YUBA 3A12A 3SFVA 2DQZA 1AQJA 1YU6A 3ND9A 4DR5B 1USGA 3KU4A 1NDKA 2MTLA 3PUHA 1T36B 1MUUA 3ZLVA 4JB2A 4DA6A 1OROA 3ROGA 1I1QB 2ZAOA 3EQ9A 2FUNB 4CLFA 1FWPA 5AOCA 1Q91A 1VZ3A 5JZBA 3UR3C 1NVUQ 821PA 3OLQA 3I8XA 3JYTA 4PAGA 1C1XA 4HRYA 4OGWA 1JWAB 2QHXA 4RKQA 2IU0A 4DV2J 2VQSA 1ZL0A 4N5NA 3SR3A 4BWMA 4BMNA 1FVFA 2AA3A 2F8EX 3GUCA 5ETOA 4C6SA 3M05A 5CLIA 3RADC 1N2CE 4YP1A 4OK3A 3WSVA 5I3UB 3NWGA 3H6KA 2MZRA 3VQTA 4XIFA 2EBFX 4DBZA 1TT5A 1NHGA 1FXWA 2R8OA 5AOVA 1MABB 2VYQA 3K0JA 1S1WB 3WK7A 2DT5A 2F9FA 2CJQA 1RKXA 2PWAA 3K0FB 1IKYA 4URHA 2KI5A 1F0YA 2XMKA 1IN6A 1MW7A 3PXDA 2XYPB 3NAGA 4KW7A 1HYSB 4UM8B 1WX1A 2EFGA 4O4LF 4KGMA 1VS3A 1F2TB 2H57A 2VHCA 1K7FB 4BYGA 4OQFA 1ODJA 1RAHB 3I01A 4Q7KA 1XALA 3T19A 3AF6A 4QDOA 1JR4A 4R1PA 2YOGA 4DHEA 3OOSA 2GQQA 4F86A 3IMGA 3DGVA 5FLYA 2AD5A 1UDRA 4C03A 2R42A 4HGQA 2A86A 5ER6A 3JVVA 4ECUA 2M3DA 1G2EA 3FDJA 4BFTA 3MD1A 3K57A 2ZUBA 4C5AA 5C25A 2OZPA 4YRDA 2QFJA 2AF4C 5ALQA 5LQRA 2FU5C 3UAOA 4RV4A 2G83A 3JZDA 1W1UA 1HFWA 3ZS8A 4KHPB 1XC7A 2Q2WA 3PC7A 1JPNA 4KTTE 3FRYA 1JJ7A 2B6AA 4E5VA 4EABA 1FA9A 2CQ3A 5HK8A 5HJYA 4HGNA 4OHWA 2JLVA 5GAHI 4TVOA 1NMXA 3ORHA 4KMOA 4X4RA 4DC9A 3F5MA 2CT8A 4OGKA 1C1YA 4DSAA 3PYFA 4GYWA 4USKA 5C51B 1KJ8A 1DJPA 2GC8A 2I6QA 4KQFA 2YQ0A 4PSVA 3T9NA 1FDTA 3DR5A 4M6WB 3BK2A 1WP4A 2WWVD 4ER5A 3GJRB 1TIKA 3MM7A 2XQVA 4WZMA 4EF5A 1WJ9A 4CH7A 1KQSR 5C53B 1E2UA 4EHAA 2W22A 2FSVA 1NF3A 4AXBA 2CRLA 2V0CA 3BUSA 1PS0A 2PUTA 2X86A 4G0ZA 5ETMA 1A04A 3KFVA 4GBED 4GR9A 1T5BA 3VJLA 3Q1KA 1KSJA 4R2MA 3R3JA 1CEZA 4S1NA 5ED0A 2CPDA 1QP4A 1IBKB 2V9ZA 5IANA 3PR2B 3QE2A 5B5SA 5ADHA 1WKJA 4B2PA 3FA2A 4IOBA 3DHYA 3KYLA 1NX6A 3ZDZB 3G2JA 2ZJOA 2XNHA 4PBTA 2F3RA 3W5YA 3Q4GA 3EISA 1SVUA 1E59A 2P1ZA 1ACJA 5F7ZA 1APSA 4R6XA 4B5LA 2P9ZA 4Q9JA 2GPNA 4XPIA 4P08A 1PS9A 4G4SP 3X1KA 1UDBA 1QH0A 3ET4A 5B3LA 3M4JA 3QXHA 4J4BA 4RPJA 3JTOA 3NBFA 3WYCA 2VRCA 2MQQA 5BN4B 1T26A 2UYGA 3KIPA 4OLFA 3KUDA 1BMTA 1YHZA 4UU7A 1N4DA 5KFPA 4RVUA 4RUCA 4LRWA 3LXRA 2O7QA 4HQRA 3THOA 1FUEA 1X87A 4UW9A 1JEJA 4K3UA 4DT1A 3EVOA 3OPKA 2XO7A 3EIWA 5BSMA 2GEKA 3ZNNA 3I5UA 4CM1A 3IODA 3C3EA 2J7KA 1DTWB 4KWHA 4FILA 3NDJA 4HLUC 1SC6A 3MFHA 2E87A 5T6BA 4H9GA 3RVLA 5CFRA 5HI7A 3I61A 2OZLA 4V0LA 1H7XA 4JI5B 2E4VA 2MYTA 2X3DA 2I3AA 3LC2O 3R8XA 5CYMB 3E27A 5DTJA 3F44A 2ASYA 5A3SA 1IXYA 3GHYA 4JP5A 5ERXA 1JFRA 1T2UA 1JLHA 1ZL2A 2QN6B 4EG0A 3IBYA 3L93A 1R8JA 1B74A 3CVXA 1XZBA 3COYA 1QSSA 2UZ0A 3A3PA 4WSOA 2C9MA 2W2PA 3LLCA 4M2LA 4RHYA 1RPJA 5LZ8A 3QEJA 4Q3LA 3DMHA 4N0PA 4B7CA 1HLPA 4EKGA 3PQ5A 4D1YA 3CTPA 1TL3A 3GDWA 4TT3D 1XYGA 3WLRA 3T7IA 3EGXB 3WZMA 4TTAA 4WTYA 3CUNA 1N34F 4ZFNA 3AJ8A 3IR6A 2Q3JA 3B4DA 4JY7A 4LOAA 2RI0A 3U1NA 4M5DB 4NLSA 2MKYA 3ZEIA 2JGAA 1MO6A 5ETVA 5JS7A 4E5YA 4FCWA 2FXIA 4IS2A 4H59A 3UFXA 2YQ5A 5LMUF 1ZQ9A 4C0XA 4JAVC 5HPYB 1SQ5A 2CJAA 1LPMA 4RXMA 1XLUA 3ETJA 3I2KA 1K0VA 4LRDA 3UD5A 4NICA 2VAXA 3TFOA 4C2MA 4LJSA 4RD3A 1WHYA 4PBRA 4GD3Q 3TCXB 1X86B 2CJ9A 2L48A 5AO9A 2Z2KA 3MLAA 5KFZA 3LV8A 1XR6A 3AESA 4WKCA 3E9YA 2J87A 1HQEA 2B21A 3L7JA 3JD1A 3HJTA 5EEHA 5DHTA 2CXNA 5ALHA 5H1YA 3I9OA 1N2IA 1WNFA 1UPPA 4L3NA 1HBUB 3LPMA 1RT6A 3LU1A 4KK3A 5ED4A 2ACYA 1GMUA 4MVJA 4ZCSA 4Y6PA 1KLMB 4RVDA 2ON6A 2GNOA 2ZSIA 2VG6A 3CNQP 4ES3A 1MHTA 3LLMA 1UM9B 4F21A 5C4IA 1EAYC 1GYPA 1CRQA 3VGVA 4U3JA 3VYSB 1ARZA 1TQ2A 5BO5A 2WMDA 1DKRA 2VPYB 1KP2A 5L45A 3QW2A 2UXCJ 2YQ1A 2XMCA 4KIWA 1S5PA 4JUAA 4L07A 1ZH4A 1EXMA 4DUZJ 1WSVA 3ISZA 1KVUA 1W88B 1QG2A 3FR7A 1C4WA 2FMHA 2GN0A 3PW4A 4TYYA 4JR2A 5KKCA 5DYYA 3QWUA 5JQGB 2F9DA 4OV1A 1GLVA 2RHGB 3NAHA 1HPZA 1WCYA 1XQXA 1G38A 1ABBA 3QATA 1M2NA 1M5PC 4WBNA 1GKUB 1LF0A 4TYAA 4WUVA 4O8CA 2VBFA 2F3SA 4E4YA 4BHQA 3USES 1NB7A 4JXZA 1N7HA 5JWRA 1RT5A 4DR5F 2DM6A 2FW7A 4D25A 4DIMA 3SIWA 1SGWA 3H5NA 2GJKA 4C0KA 4C3ZA 1E5VA 4JI1B 2DYKA 4WAUA 2HCBA 1RRGA 4QEKA 1TFRA 4ZMSA 2HLNA 3KZOA 2Q6VA 1NY5A 2PJDA 3JASA 1BN6A 4JV2A 1Q22A 3HYTA 3B48A 5DF1A 5IXYA 4YP3A 2KVQE 1D8YA 3IBFA 4I4IA 5CMLA 1ST3A 4B85A 3AEQB 4R2JA 2YWBA 1CSJA 3U3RA 4I7EA 4MVJM 1T1EA 1WO8A 2FY8A 4F2GA 5FJJA 1IR2A 2DFTA 3OAAD 1P5FA 3VPHA 1TZ2A 4P54A 2EC0A 2RD2A 3D6FA 3HP6A 3HKZD 2ZRDA 2FW0A 1MC1A 2QK4A 4EY7A 2Z57A 2AH5A 2WF7A 2NADA 5A1JA 2H0QA 4AWAA 1PT8A 3OH8A 1ULTA 1MO2A 2HHLA 2NUAA 3J80A 3H1FA 4H7IA 1F7UA 1PO6A 3IP0A 2Q4DA 2ATLA 3N2GA 3KLFB 3B6IA 3BL6A 2PAAA 3UFCX 2O14A 3VR6H 2ZYUX 4ZLPA 2R8ZA 3VH1A 1BDMA 1VC2A 3L7MA 4DHVA 3CJTA 3LYHA 4E6PA 4PYJA 2ZPAA 3KKZA 3OJFA 1O4WA 3VI4B 1K9MT 4FVCA 3U49A 2CZCA 4XO0A 1KZHA 1Z83A 4J1TA 1MC5A 4B4KA 3OHBA 2P2YA 3G9CA 3VAZA 4RTRA 3D3NA 3EMVA 4KHPF 1NH7A 2BSXA 3GGPA 5IKEA 3P6YC 2IA0A 4LFCJ 4YP9A 4ZJQA 2M70A 3FKJA 3KJEA 3F71A 3M1YA 1A27A 3ETOA 5KPJA 4E6EA 3WLIA 3AVVA 3PW7A 3QGPA 3C6QA 3R7NB 2FJUA 3TS1A 3FYHA 2ZI7A 1TMYA 3FCOA 2PX3A 2W2VA 3GFYA 2NXCA 1T02A 2QYSA 3EEFA 2CPIA 4P38A 1U90A 3VR2D 3FCWA 4CIAA 3L6UA 3JQ8A 3N2IA 1P4HA 5J2QB 4BUJA 3ZWQA 4D02A 5EUMA 2KI2A 2EC5A 4BEBA 3LX4A 4TTJA 1XMQB 3A14A 3HXTA 5EWFA 4KCGA 5BUSA 3K70C 2IDZA 2PKWA 1WB4A 4JXKA 2CWKA 5EMHA 1JVBA 2UUOA 2D41A 2CEAA 2OMOA 3R5FA 4ZVMA 1W25A 1UADA 4YUVA 4HPXB 1CRLA 3OMLA 2P2CA 1IBKF 2NXJA 3ZTRA 4Y9RA 5F9FA 2I22A 5DQHA 2AJLI 3BDVA 2ISSD 2XB4A 1ODFA 4MV5A 4TV9A 3A1NA 4C6TA 4Y2CA 1R9MA 2J5RA 3WGMA 4CIBA 2DETA 4REMA 4WZQA 4A4DA 2IYFA 3KK2A 4FSDA 1E2BA 3OU2A 3AWDA 4EG1A 1KH2A 2FFJA 4USMA 4W9RA 1E2PA 2O50A 3VUFA 3FPHA 3L7KA 3A6JA 3HLUA 2YWRA 3FB4A 4HWRA 4RMGA 1OY8A 2ID7A 4X4TA 3HBNA 5B0CA 3DDSA 3PQ4A 3K0CA 4UQLA 3C6XA 3EWAA 1WY7A 3KJNB 4MQEB 3B5EA 4CT0A 1X7ZB 4YIHA 3E70C 1GADO 4PHGA 5KMGA 3AB2B 4UVGA 3LOUA 1OMSA 1EUCA 1S7HA 2UUCB 1JJCB 3SQDA 1E62A 4OJ3A 1XTQA 1KORA 3IM8A 3OIWA 3UCEA 1OJ7A 2PFFB 2GVDB 4PSKA 4KYUA 3U2QA 4X1YA 2Q3PA 3P9YA 2ZHBA 2JFYA 4QA9A 4BTLA 1FX0A 2GFHA 4QC2A 3D7SB 3H86A 3KSMA 3M7IA 4UHCA 5J40A 4JI5F 5C5EA 2QG4A 3PXCX 1ISSA 3H5WA 3GO4A 4I1IA 4W82A 1XVIA 3HHNB 2H65A 2QZ8A 2ALZA 1P3Y1 3IIIA 4IDEA 2BFWA 3WBZA 4LZOA 2R6GA 5EKDA 4IL5A 2YXDA 4KE7A 4Q7EA 3VX3A 3AVUA 2W0SA 3R1IA 4F72A 1KFEB 2ECQA 2AF3C 3K9BA 3MEEB 4R54A 4USTA 2H5LA 5JJIA 1HNWB 3U48A 4YI3A 2C61A 1T4MA 1VQ5S 1G98A 2Q0HA 2KTQA 3HACA 2GN1A 5C52B 4CCHA 4RNOA 4PAMA 4P4SB 3BZUA 1H3DA 2RHQB 2Z8ZA 2GTPA 3V5RA 1Q2UA 3FHCB 3IG1A 3GIWA 1OF1A 4MYSA 2B6HA 4IUCS 1LWOA 2ZDPA 3ZDBA 4RACA 4Y1GA 3TZZA 1O0CA 3LP5A 1M8FA 2PX2A 3N2NA 3UHFA 1N1DA 2V2VA 3DOKB 2BXJA 5FFFA 4CUJA 2DK2A 1Q8KA 1RIIA 5DOVA 1U1LA 3K9GA 2FZCB 2GA9A 4MWCA 2POQX 4AT1A 2WMYA 5EHHA 3DTYA 4EYQA 3AEZA 2NCKL 2Q8QA 1K8ZB 4BQPA 3AZPA 3W60A 1E64A 5AQ1A 1Y8QB 4BFLA 4V0OA 1YCDA 1ZD9A 4GRAA 4MJLA 1Q15A 3JWPA 2MKIA 4HXGA 1O51A 1PJ6A 1S49A 1FD2A 4O1IA 3LALA 1IXKA 1IMOA 1T0TV 5I45A 1V6SA 4X5OA 5EPOA 1N0UA 3BMOB 4E09A 3RSQA 3AR9A 1LW0A 4WCDA 2MTBA 4GU5A 4D4JA 3OLYA 1VE6A 1JKXA 3W8DA 2OV8A 3HB4X 1Y89A 4RQAA 4ZIRB 5ETSA 1CRZA 4V3CA 1SOMA 1KEUA 1N5KA 1SG0A 1X9SA 1V1RB 1U2DC 4Q9AA 3FXAA 3GFVA 2A1IA 3WL8A 3PR3A 5JWHA 4L4ZA 2N7YA 3ITNA 2HTEA 5BWMA 1A72A 4FUQA 4DV7J 4BNZA 2CPEA 1WU8A 4C4TA 2DQSA 3QFHA 3OLBA 2RGCA 3K0AA 4NDZA 3GY0A 4URYR 3FOFC 1NMYA 1U6JA 4OHOA 3L8EA 5DE3A 4LR8A 3AHEA 1DOHA 5B2ZA 1QVVA 1YS7A 1WXFA 1Y9ZA 3MEDA 1N2ZA 5JQGF 3RF7A 1L2TA 1SUEA 4CNZA 3PZBA 3D8BA 3WC2A 3Q0EA 2IY5B 4XASA 1USVA 2PX6A 4C0OC 3G8CA 3FMFA 2QAGC 2RH4A 3JSYA 4IINA 1EM8B 1QNLA 5GJWC 2XRZA 1YA6A 3KG1A 5LP1A 3MAAB 5DQGA 1E3WB 1RM0A 1ORDA 1JHOA 2E0IA 4QBTA 3BILA 3HEMA 3P2IA 3RB8A 1O96B 1DOZA 1MQ8B 3GLJA 4JI1F 2Y71A 2ZM6B 3M3DA 3O8RA 2B43A 3FBGA 3PRBA 1DBDA 9ATCB 3BXEA 4YUDA 4I6WA 1U2GA 2JFHA 3B5IA 3W3ZB 3QQPA 5FRDA 2RT3A 1JBKA 3ETDA 2DGXA 1P4AA 1ZTWA 2G1AA