5L39A

The structure of the fused permuted hexameric shell protein msm0275 from the rmm microcompartment
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
AELRSFIFIDRLQPQTMSYLGTWIKGALPRANMAAQIIEVAPGLDIEGVTDVALKHAEVKAGILVVERQFGYLEFHGETGAVKAAADAALDYLGGDPDAAVRPEILASRIISSIDHQHAFLINRNKIGSMVLPGESLFVLEVAPASYAILATNEAEKAADVKVVDFRMIGATGRVYLSGTEADVRQAADAARDALAVLQGAKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Complete Structural Inventory of the Mycobacterial Microcompartment Shell Proteins Constrains Models of Global Architecture and Transport.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Structural protein
molecule keywords RMM microcompartment shell protein MSM0275
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l39A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l39A02
4HT5A 5LT5A 4HT7A 3F56A 5LSRA 3GFHA 3I87A 3I82A 3FCHA 5SUHA 5L39A 3U27A 3MPVA
chains in the Genus database with same CATH superfamily
2XS7A 5KFJA 1J5EJ 1JJCB 3NS6A 4JI2J 4PWUA 3MMCA 1H2UX 1WG4A 4ED7A 4RBVA 2R2RA 5F3ZA 1N5SA 2CNOB 4TVAB 4L3NA 4ZS6A 4CT8A 3K5LA 1PBAA 1YLXA 4CP5A 4GRSA 2BQUA 3M4XA 2GVDA 1F3FA 4OLOA 4WKYA 3M9OB 3QRQA 3I55S 1WF0A 2MSTA 2LEBA 2AJ1A 2D74B 2ROGA 4OHYA 5KFRA 3KHHA 2DR7A 4HVZA 4A47A 2KXHA 3B6BA 3ZNUA 1J5OB 3ELHA 2W7OA 3CMAS 1XR5A 4WXWA 5ETNA 1CS4A 1XNRF 3EM1A 1NDLA 4B9NA 4DV5J 3MEEB 4FBTA 4KGVB 4MKYA 3FSXA 4N76A 4I1TA 4LMZA 1SC3B 2ATCB 3DYAA 4UOFA 4DV3J 1G3OA 1I3OB 4DQSA 2CYYA 1OPZA 2A1BA 2FJBB 4O3QA 3JTPA 5DDPC 1M1GA 1CJUB 4R5PA 4Q45A 4DF8A 1PC4A 2N3LA 2YTCA 3FKBA 3AB4B 2V68A 4DV1F 1S1UB 1G4CA 1XQIA 2DEIA 2DXFA 1K1QA 3POTA 2VV5A 1HBNB 4IG3A 4PPZA 3OSNA 1RWVB 1S59A 2XB2D 4A8FA 3UDLA 3CCLS 4FXWA 3KOAA 4KGMA 4RO0A 3QFHA 3U27A 2UV8G 4ZVHA 4KHPJ 1AYEA 5IT0A 3ZFVA 1GH8A 2XCPA 4DV6F 4TQSA 5F9LA 2LDYA 5KG0A 4Q8EA 3BO3A 3D4JA 2DPIA 4M5NA 3UVJA 2MLYA 3DRXA 3IRWP 1P1TA 1PIEA 1HQEA 2UXDF 1U09A 3HZEA 3O3LA 2NREA 3WZ0A 2FLNA 4I56A 3QJJA 4MK7A 2XGPA 3SYZA 2HIQA 3EDRB 1RT1A 5BJRA 2E9TA 2HAFA 3DRSB 1S1VA 1JJHA 2OD4A 4EWTA 1GK8A 4KGXB 4NI2A 3I31A 4ZPDA 3W5YA 3PG9A 1X5TA 2FQQB 3OPKA 3PJXA 3MEGB 2J0WA 3W64A 3KNGA 3VGTA 2GIRA 2OPSA 5J2NA 4ED6A 2E9ZA 3CJ3A 4K0KF 1NHUA 1Q78A 3CIMA 4A8YA 2BJ1A 1NPKA 3NL0A 1YJRA 3DRYA 2CFXA 1H2TZ 3MM8A 3MAHA 5A0YA 1ZH5A 1WF1A 1KQGB 1FDNA 3B4MA 4RX6A 4USMA 3M2UA 2YWWA 3ENWA 4RW9B 4V1Ak 1TL7A 1DTQB 4CLUA 1HBMB 4CT9A 1TV6B 1D9AA 2KVQE 2O3DA 1WC4A 2QRRA 3GU0A 5F8JA 3MEGA 1Q8BA 4DU7A 1B7FA 4DPUA 3E51A 2PEHA 3MMBB 3VV2B 5H9FJ 5CYJA 2RQCA 2KO1A 1U47A 3SSQA 4ANDA 4ECWA 2BJ3A 2IY5B 1AB8A 1VQLS 4DV0J 2BW2A 5GAEI 4HH0A 1S0MA 3EMTA 2UVWA 2W4PA 4DCPB 5F8IA 4FS1A 4IRDA 1FESA 1T11A 4LF9J 2I0XA 4XPCA 2DB1A 3P5BP 1GAOA 2FVCA 4F4XA 3QJLA 2FGOA 3VAJA 3MM5B 5HK4A 1CQMA 5I3UB 2AJFE 3JQMA 3OVAA 1UW4A 3MMBA 2W4CA 1BMQB 4NYOA 5KFIA 3SDEB 2GMLA 4W4MA 1RTIA 5C25B 3VZIA 3CC7S 1MSWD 2WVEA 2HHTA 2DJWA 3IFEA 1WKJA 1PC5A 2V9KA 3UCUP 2DNGA 4X4NA 2MY8A 5IC6B 3W5ZA 1F9FA 2Z56B 3FQLA 5HMXA 2YNHA 5KAKA 1RTHB 2H1YA 3ZTQA 1SJ4P 3M32B 1Q16B 2GMHA 2YNFA 3VQTA 3HFZB 4I2PA 2MHNA 2CJQA 2VG6B 4ZDNA 3Q22A 3IS9A 2Z2ZA 4DV3F 1PO6A 4ELUA 4TNOA 1K0VA 2G13A 5KG7A 3JSMB 2XY7A 4A4JA 3DI6A 2BEFA 1AUDA 1QSLA 1NRKA 4JI0J 2BE2B 3H2LA 4KB7A 3SCIE 1RTJB 3F44A 3T9NA 4U9RA 1UTAA 2DNRA 4RUHA 5DLFA 1ZZNA 3MM6A 4NCAA 1RWWB 3FK4A 4B9VA 1GX5A 3FRZA 4A8QA 3PY8A 4OI6A 1TL3A 4M8LA 2ZDOA 4LQ9A 2RRAA 8RUCA 1G7CB 4FKYA 1F5CA 4B3TF 2YNIA 2OPPB 1LWEA 3ICLA 2C2NA 2YKQA 4DN0A 2PI5A 3LTOA 3KJVA 2WB1D 3H2UB 4ZPVR 1U0HA 3DMJA 4ZJLA 3THPA 3WQPA 4CDIA 3V6DA 4NXNF 1JMTA 2XM3A 1U1KA 3KJNB 1RA7A 2J5AA 4G6VB 2HYIB 1LWCA 5IC4B 1NB7A 1LWFA 1LV5A 3P8BB 4QIWD 1SC6A 1YJTA 4XIUA 4DFJA 1JB0C 4JB8B 5IM0B 1MNEA 1RLCL 3QO9A 3W7BA 1HBUB 2W9CB 4B3MF 5KG3A 2FJDB 3BBFA 2CAJA 2JLGA 1WACA 2B9WA 2HNDB 2VHGA 2O01C 4CO1A 2E7VA 5AE2A 2CWKA 2V69A 2XHWA 5GMKa 3OTOJ 4QOTA 4F26A 2OI2A 2HBQB 2ZNYA 2FB0A 2LLZA 3DLJA 3FCVA 4ECXA 1KSPA 1XR6A 2DNOA 3G8QA 3RAMA 3E3XA 4YDXA 1N8RT 1C1BB 3Q23A 4HL9A 1LW2A 4O0NA 1S6PA 2LQBA 3BJYA 2ZJPQ 3D66A 4OI4A 1EQ0A 3OR2B 2B4OA 1TR0A 4ZVPB 2WVFA 3OLBA 2XZDB 1QAIA 3HT0A 2YWHA 4DQIA 4WFNQ 1HPZB 2HFSA 2NLWA 3J80Y 2W2NP 4TKTA 1SIZA 1BLUA 2R7QA 4LBPA 1PYTA 2GVZA 4I6YA 1MLAA 1WHXA 3NMAA 3IBWA 2FDNA 3D3CJ 4AUKA 3RUBL 4J9KA 4DV7F 4RW7B 3VVTA 2BX6A 3H59A 1FRJA 1SCJB 2NPFA 5SZTA 4TU7A 4LFCF 2QYCA 3DRPA 1CBKA 4JI1F 3LP2A 3I5CA 5J1EB 1NZAA 1RE1B 3LP1A 5LT5A 5KT3A 1ZM4A 5DG9A 4RW4A 2K7KA 4DJBA 2BRLA 1KDNA 5GAGU 4FS2A 2DGXA 3V81A 1UL3A 4OI0A 1U6FA 3JXOA 3B4DA 1U49A 2EG2A 2RE1A 3CO0P 4B3RF 2WTFA 2DT9A 5BYSA 4MJKA 1YRXA 2B8PA 1WC5A 1UVMA 3D6TB 2OAUA 3U02A 3CNQP 4NZ7A 2J6SA 4KO0A 3SIPB 2UZAA 1VLOA 3PIPQ 3PTWA 4RKUC 2R7XA 4KJIA 2CPXA 3R3TA 3P96A 3M8QB 4YS2A 5EX3A 4MKAA 5K8OA 2WCXA 3PHTA 3CD0A 3SCJE 2AEFA 2AZ1A 4X62J 3ZZRA 3C19A 4RL1A 1Y5NB 4ZN3A 2W7PA 1PJ5A 3HFKA 1X4DA 4D3GA 2N82B 3K5NA 3HVTB 1BGXT 2OUGA 4KO0B 3MM7B 4RUBA 1PYOB 1R8BA 1YI2S 1D1UA 2GHWA 4J9PA 2LEAA 4NRUA 4OJ1A 4PAAA 2N4DA 3H98A 3CDAA 4DV4J 3M30A 1NU4A 3K58A 4NX9A 2IBOA 1WEYA 2XG8A 3BEGB 1WSRA 3GG0A 3O5TB 5J2PB 2JLEA 3PW2A 2AGPA 1YBTA 1JXEA 3IM9A 3KK3A 3NGRA 2UUWA 1ZPVA 2IRYA 1SJFA 4TQRA 2Z30B 3K5OA 4CM0A 3V4IB 3KKFA 4DV4F 2MZTA 4NRTA 2ZITA 4JI1J 4W92B 3ZO7A 2V4RA 2OH2A 4DV7J 2UXBJ 4DL7A 3BPSP 3HHLC 4PG7A 3UR0A 2ADBA 1IBMF 2ZE2A 4DCOB 4DPWA 3TJ9A 3LUYA 1T7PA 3MMCB 4JOUA 4M94A 3TOQA 8AT1B 4YB7A 5A0YB 4L73A 3UNYA 4ANCA 2JFDA 2U2FA 2B3TB 1S7IA 4B3SF 3HJVA 4F36A 2MKKA 3DKDA 4KSEB 5JJBA 1N36J 2NQPA 1QM9A 5H9FK 4JV2A 4WFAQ 2CNNB 5EN1A 1XERA 2QL5B 3I0SA 4B3RJ 3BN7A 1G6BA 3DLGA 4NCGA 2K8GA 2YPYA 4F0KA 2QYGA 3TZZA 5BR8J 4JYAF 1TUGB 1NK7A 5DDQC 1KQKA 2E1RA 3D6HB 3HDSA 2BJ8A 1H72C 1FXLA 1WNEA 2OTJS 1YGYA 5KFBA 3EGVA 1XWLA 2XI2A 2POKA 3I0SB 2ZOMA 3JSYA 1RT7A 5EWGA 4PG4A 2BUNA 1HKAA 4DDFA 3BSAA 1MG7A 4X4QA 1NNDA 2OD6A 3CSKA 4OYOA 5DM7Q 1OS5A 2AEMA 2XYPB 1BQXA 2J7UA 3BGUA 3QBCA 1HFEL 2WOMB 2WONB 3AQPA 3KTQA 1RWUA 3QNWB 2B4PA 4Y6IA 2Z2YB 2YH0A 4CYUA 4WIQA 1ZAVA 3BYRA 4ZCLA 4BWJA 1R3NA 2AZ3A 3LGMA 3POTB 1NH8A 3DOKA 4HACB 4LREA 2G2OA 3SV4A 3O2IA 4YR3A 1X9WA 2VF3A 3BV8A 1NHVA 1VQSA 2ZKUA 3ITHA 5D15A 2L9WA 2DR8A 1VQ6S 3HK2A 1FXRA 2FZGB 1UWBB 2OKQA 2B4UA 2QL7B 2F3JA 1NH7A 3HULA 3KUHA 4HH1A 2FC9A 4K59A 5D4NA 2KN4A 2XLJA 1O8BA 3UDCA 5AJ3J 3EPGA 2VJUA 4TN2A 2EK1A 1V5IB 1XMBA 3GR0A 1VQ4S 1QLNA 1LWFB 4PQAA 3RAQA 3QPIA 4ETXA 3H5UA 3JTOA 2MSSA 4ED3A 2Z8QA 4PWDA 2XMVA 3M8SA 2OEKA 3MCMA 1XR7A 1BC6A 2MZRA 2FVPA 2PEBA 4FP9A 1CSJA 1SXLA 2DHSA 2DNYA 4CZCA 2KB2A 4OYWA 1T05A 4MIBA 3ENVA 4KH0B 1E6VB 2WSEC 3NCQA 4TLQA 3KLEA 2R8HA 1JJ4A 2D3UA 1OIAA 4DX8H 2IM1A 3AY0A 4I68A 1HI0P 1O6XA 5ETRA 4KV8A 3RB3A 3OQ2A 3GP9A 1G1XA 4H4KC 2X1AA 1K73T 1U4BA 3DGPB 4N7TA 1V3ZA 1YJ7A 2B56A 3CJ5A 4I0WA 3UCGA 2YKAA 3GYNA 2BDPA 1LNQA 4DSLA 1T9UA 4IO1A 1TV6A 4KT0C 3L4BC 1W7WA 5A8RB 3OVSA 3D2WA 1FWKA 3G6ES 1VC5A 4C3KA 2F1FA 4NCBA 2MGZA 1SIWB 4J9MA 2W2MP 2ZE2B 5KOXA 3G2XA 4DV2J 1PBUA 1D3WA 3Q8UA 5I42B 4DR4J 4F02A 2HHWA 1PILA 1N34F 3THTA 1VQ9S 2AQ4A 1LFWA 1Y5LB 1GXLA 2DIVA 3I5AA 5JUMA 4DHVA 4RUCA 4HTIA 4XPEA 2JC0A 1N5YA 1F2HA 3CJ4A 6FDRA 2L9DA 4UQGA 1Y10A 2R7TA 1IWGA 1TTHB 5LSRA 1OSDA 3FBBA 1X31C 2PO4A 2C3YA 4FXVA 1U6BA 3HO1A 2JH3A 4K5SA 3SDEA 3WX8A 4QWDA 5I3UA 1FJ7A 3SFUA 1DTQA 1ITPA 4CLKA 3M2VB 4USWA 4HI2A 4LF8J 1TU0B 3WIUA 1OWXA 1UKUA 1LW2B 1KQSR 1YBUA 1TAUA 5IV3A 4ES3A 1O0PA 1S79A 3T19A 4ZKAA 1QE1B 3T5JA 2FHKA 2YQ1A 4NLUA 4OQJA 1RLDA 4KKOA 1FKOA 3UDVA 3IO1A 1R8PA 2HGLA 3DRRB 2DR5A 4RNFA 4K4UA 1XJWB 2B0GA 2GJ2A 4MK8A 2VPWB 3HZGA 1NB2A 1JKHB 3J81U 4AQYJ 1XNQF 1GXUA 3J81j 4LFBJ 4Q0BA 3DOKB 4KBIA 3CCWA 3VWSA 5C5JA 3MFHA 3MR6A 4XAKA 2BOAA 3GV5B 4X66F 1E6YB 1PAUB 1FE4A 2CZVC 2WW4A 1X7VA 2OMLA 4J9UE 1YIJS 1CQNA 2MQ8A 1EJ7L 4DL0C 3OJUA 1VK3A 2D9OA 3SXLA 1AT1B 3CCRS 5K9FA 1EX8A 2Z0GA 1X5SA 1JLGA 2ZOGA 2NXEA 3SEOA 2D9PA 4X4UA 3MZIA 1IM6A 4FNIA 1ZA1B 4J7CA 3E8OA 4IRCA 3TVYA 4P2FA 4NASA 2PFFB 3L95X 4C97A 3A13A 1XN9A 4QQBA 3GTYX 1JJ2R 1FE0A 3W3SA 2XYHB 4F4KA 1F0XA 3QWPA 5AXKA 1CJKA 3JAMU 4PXEA 2C22A 2NUUG 1GNKA 3SCLE 3R7BB 3W1YC 2DHAA 3OV7A 4PG6A 2HHQA 4QW9A 1HWUA 3KK1B 4DSKA 2BKOA 5D4LA 4Y2IA 5DLGA 3NS5A 3AD9C 1X0FA 1D8YA 1RHUB 2UV8A 4C98A 3HJFA 4ATNA 2RDIA 4JBCA 3BDEA 3PR4A 3LWMA 1S9GA 4F3MA 1NPPA 1NPRA 2K3KA 2ASLA 2BQ3A 2W9BB 1NK6A 3JTNA 2LFVA 2QE5A 2QJ3A 3QO9B 4L74A 3LANA 4I4BA 4QZVB 3KYLA 4YN3B 2R4FA 4OYXA 1U1MA 3GIJA 5L9XA 4ZOSA 3J7YI 1RTZA 2JEFA 2GZOA 2V5HG 3KK3B 3FBCA 3PJWA 1VFJA 2V2KA 3BKTA 5T7LB 4U96A 2ZH1A 2VG5A 4NZ6A 1TFWA 1Z4UA 5HVHA 3ET6A 4NA2A 2VQEF 2WVCA 3H7HB 3CULA 3F56A 2GVDB 4LSLB 4YQWA 3JYTA 2FZCB 1X0PA 5MAOA 2WZ1A 5A8WB 3UNGC 3C2PA 4KHPF 5DJBA 3EPIA 4MTPA 2XMAA 2E1MC 4R25A 2QMXA 2GJFA 5HVGA 1WKLA 2J76E 1KLMA 1EHWA 2FJVA 3OL6A 1MROB 4M1KA 3KHGA 3PNIA 5KFZA 2B43A 3DOMB 1FVQA 3Q8RB 1RT6B 4DV1J 3SQOP 2EG1A 3MEEA 4O3NA 2B9XA 4PG8A 1YJNS 1NSPA 5IWAJ 2OPRB 3MECA 1S1TA 4NLTA 3N5FA 2J9DA 4B3OA 3N6LA 2QG9B 3ISNC 3Q2TC 4Q43A 1U2FA 2FGCA 1S6QA 2VH7A 4ED2A 2VA3A 2OEMA 3M8RA 2E66A 3H42A 3I9V9 4M5IA 2GQ2A 3BN4A 4USUA 3B78A 4DV5F 3QSYB 3V81B 2JEGA 4FYYB 3DU6A 5J2QA 1FRLA 1KRPA 3CJ2A 2V8HA 3K57A 2Y0BB 3LW5C 4K7QA 4X65F 3NRBA 3DM2A 3PXGa 4QWAA 5D0GA 2AP6A 1TKDA 2OTLS 3GJTB 1EP4B 1VOMA 4LBHA 1CPZA 1Q7YT 4FYDA 4RPFA 2GNKA 2XLIA 4ZPCA 4K4VA 1IKWA 4ID5A 4QYZJ 1K44A 1DURA 3T6JA 1BQMA 3R5CA 1R8AA 4DG1B 2NSBA 2E1PA 4WK3A 2YX1A 5HMYA 1FKAF 4C8NA 1T02A 1U0SA 2V2ZA 2AMCB 2W8LA 2ZD1B 3TAMB 5HMZA 1Q82T 1IN0A 1VBKA 2BOPA 1QUVA 2DH8A 3RB4A 4ZPWR 2R2UA 1N48A 1VS3A 4GKJF 3DHXA 4HDHA 5LMUF 1HI1A 4FF2A 3A8IA 3I5BA 5ETLA 4ECQA 3T1HJ 1FO1A 3KMQA 3A8EA 5IFMA 2YKNB 3EYZA 3P4UB 1HBNA 3AODA 3R7NB 2NXJA 3WX4A 3PKMA 5K5MA 5IT9Y 2HBRB 2RQ4A 3MPWA 4OX6A 2GAGC 1NJXA 3KDOA 3N79A 1RACB 3QLHB 5E33A 2HZCA 3M6XA 1QUPA 5HLFA 2W25A 2V67A 2NXCA 4DSEA 2DXDA 2ZBRA 1FX2A 2BANA 1UA1A 1HL6A 2OSQA 2BACA 2L3MA 2VG7B 5C24B 3IWNC 1DAXA 1SJ1A 4X84A 3HFVA 2ZVSA 4ED0A 2CDQA 2MKHA 4LFAF 5A76A 1HHTP 1IVZA 2DNLA 4OZ2A 2MMYA 4ZK7M 4MYUA 1RBAA 3SI8A 4ZIVA 2CPFA 4WPAA 2QMWA 1VQMS 1SJ3P 2AYBA 4M5LA 1AA1B 2EKNA 5HL7Q 1RGVA 2Z58B 4B3TJ 1X4HA 2F4VJ 1TVRA 4ECSA 3QYYA 2ZC3A 4TYAA 1VIXA 1RHJB 3NGDA 3LA0A 2IDEA 3UD4P 2DO4A 2I5JA 2YWEA 1HNXF 4FF1A 3AH6A 3HVRA 2HG4A 3CCJS 4OYBA 1IJEB 4HR2A 1S0VA 3AHPA 2R7VA 2PFDA 2ZWOA 3IWLA 2FC8A 1R8CA 4NLYA 2Y9HA 1IBKJ 3N01A 3ENQA 2E5LJ 5G0RB 5KG2A 1L3VA 3HP6A 3G6VA 2L41A 4KGZB 2IRXA 4QPTA 2KH9A 2R2SA 3OLAA 1JLQB 2CA9A 2C2RA 1U25A 1VQNS 2DKOB 5IWAF 3GWCA 3OT9A 1S6QB 1V6HA 1RTHA 1S6OA 3C6UB 4C8LA 5C24A 1C4AA 1IR1A 1QAYA 2YNHB 2H48B 3A3NB 2BVZA 3GV8B 2GO8A 2K1RB 4OZ1A 2IDLA 4WFZA 1HNVA 2HNYB 4QIVA 1N34J 4C8OA 4ENOA 1FNOA 3C16A 3HSJA 3L9ZA 3VGVA 4ER8A 4F3QA 1FRMA 1TL4A 1AZSA 4RLEA 2AWZA 3G71S 1NEEA 1VHIA 1OSCA 2XMTA 3BKUA 3KLIA 3M8ZA 1XTZA 3R6GB 2C2OB 1BQMB 4YR2A 4IKAA 4A8KA 2ZBIA 4CTAA 2EWHA 4DV0F 1YRUA 3PJ9A 1FDDA 2RUSA 4NXMJ 1HLWA 3BGLA 3J7ZT 5F8LA 1PGZA 1FKPB 3D0IE 2C42A 5J2MB 1KONA 3R9LA 2CQCA 4UZCA 2PGCA 3O6QA 4YY3F 1S0NA 2HHHJ 1MU2B 1XIQA 1OMSA 2VUGA 2X7IA 1DLOB 1M5PC 1SL2A 1CS4B 2HQ3A 3BGFA 1FRXA 1AFJA 4EMDA 2MHEA 2ILYA 1VC0A 4PWWA 3KLEB 3K0JA 1EETA 5D4PA 4KTQA 1NK8A 3NOGA 3KNAA 1RWXB 3QLHA 5KFLA 3V4MA 1XMOF 4P9SA 4CNZA 2W2QP 1S72S 1NDCA 1VLYA 1S4EA 4GO7X 4BHQA 1VQ7S 2HRTA 5L9NA 1O5JA 1TUVA 3M1VB 2CPYA 2WK4A 3OD2A 4L72B 4L3KA 2V2VA 2V4JB 3K89A 2PI4A 2R42A 5J1PA 4NLOA 1HR0F 2HQIA 1D09B 5CAAA 2I2YA 2PMZD 1L5UA 2JWNA 2ALZA 2Q1LA 1FWPA 3TI0A 2ZD1A 3TAMA 2LU2A 3HPOA 1C1CA 1NCLA 3M2UB 1BQNB 1FEHA 3KG4A 5KOWA 3PW4A 3EVWA 3IG1B 5AXLA 2NZCA 2Q43A 3UWTA 4FXDA 3MTJA 5C42A 3M7VA 3VAGA 3F73A 3G96A 1N0VC 2LXUA 4C11B 1T05B 3DHWC 3Q86A 4DN9A 5EGYA 5IQ6A 5CD4A 3PO5A 3A3OB 2XNRA 2M0GB 2CNLB 2XMKA 1MN9A 1RU1A 3BF4A 4DUYJ 2AD9A 1WTBA 1WG5A 1GFWB 3IN5A 3TO8A 2MQPA 2AT1B 4RW8B 3AXKA 4ECTA 3K8VA 3VAFA 2CDRB 2C3MA 2LQ9A 2RNEA 3WC0A 2UXCJ 2CJAA 1SV5A 1UW9A 2MQLA 2VC0A 2Q3PA 5KFXA 1GMWA 2W7AA 3DC2A 1B99A 5C42B 3MR7A 3DOLB 5H9EK 3MM5A 4G1QB 4O3SA 5LJ5Y 3GCXP 5K8PA 4N56A 5A6WA 5KT2A 3R5GA 4DR1J 2LA4A 3X1LB 2FVQA 3DRRA 4D3HA 3S01A 4MKBA 3TZXA 4LSZB 5L8RC 3RG6A 3I32A 1FDBA 4B02A 1SB6A 2J9DE 5CYMA 4JV0A 5E3AA 2YBVA 1RT4B 1YK9A 2CQ1A 2F65A 2H4YB 3CJTA 4IYQA 5DQHA 2KM8C 3OUYB 1L3UA 4M5DA 4P73A 4WU2A 4DSIA 3H5XA 1KOOA 1X4FA 2YKOA 4CO5A 4WTOB 4U8VA 3I96A 3W60A 5GAHU 5IS2A 3BDPA 4OHZA 2MQMA 2OMOA 5ETOA 1TUWA 2B8QA 1Y9OA 2AW0A 4AT1B 4ZLJA 5ITHA 1WEZA 4LRFA 3I56S 1I94F 5HBMA 4R8UA 2AU0A 3QFWA 2XSFA 2XMJA 4WFBQ 2QFJA 1S97A 2XYGB 2IA6A 4DF4A 3J7Z5 1MU2A 1OY9A 1RWPB 2O1PA 3E01B 1AUSL 1T95A 1S1XA 3D28A 3KUGA 1HW9A 4M5KA 5DO2A 3BSNA 4F2SA 1IR0A 4PKDB 1I94J 1TKXB 1F3VA 1JLFA 2BABA 2BW7A 2FHJA 3MM6B 3ZTSA 3QZ8A 5IXUA 1NSKL 3I0RA 2XLKA 2CQHA 1YTYA 1VRUA 2AV5A 3GJSB 1RISA 3ONQA 3RZAA 3T1AA 3GFYA 3WDOA 5LXYA 4DX6A 4ELVA 4CLWA 3R2CJ 3US5A 2YNIB 3KMSA 1QVFR 4F8RA 2ZBQA 2DHXA 3A3PB 4NA3A 4ZVFA 2CADA 3CXCR 3S1TA 3M8YA 4NPOA 4Y2CA 3H2VE 5GADI 3NWRA 3L7PA 5EHHA 4LVOP 1WG1A 3PEJA 4A8SA 4MT1A 3PYEA 4XO0A 2MZSA 4YHHJ 3Q8QB 4Q5VA 4FDFA 4DQQA 4CO4A 4DPYA 1S1VB 2YKMA 3BSOA 3QMQA 1DTTB 3NNAA 4ILRA 1CVJA 4DCJB 2ZDPA 3ZZTA 2K2PA 2VBWA 3BKFA 2KU7A 3GILA 5E3QA 2B6AA 1VC6A 4JI7F 2O66A 2DGOA 4IFYB 4C2MA 3LH2S 1TL1B 5A8WA 1FERA 1FHTA 2E5IA 5FDLB 1TKZA 1RT6A 2KDOA 1FEEA 3CJQA 1PJ7A 4JI5F 2QC3A 2IM0A 4Z7YA 4MYTA 4NA1A 3HT3A 3ENAA 1H7WA 2OP5A 2QO3A 4XDCA 1MROA 3H4BA 1GEHA 4OX8A 2VC1A 1WD6A 3CCMS 1NHKL 5GADU 3W2VA 1YBAA 1X8DA 3DNCA 2OHDA 3RBXA 3X3UA 2UUCJ 1N52B 1DQAA 3OJSA 2M8DB 4PXCA 2V4QA 1TKZB 3Q8SB 2QA4G 4CLZA 4WF9Q 2LA6A 2RAQA 3OR2A 1TL1A 3MMJA 3I4PA 4KAIA 1S6PB 1FJCA 4ZHRB 4OI1A 4CYUB 3HI9A 3MPDA 3DFEA 2VASA 4M5MA 5I4MA 4UW2A 4ZITA 2W9CA 2QLXA 2RVJA 1FK9A 2FPHX 3JS9A 3PYFA 4DEZA 5ETQA 3MHYA 4C3LA 2ROPA 2Q6CA 5D8HB 2EFNA 3ZTOA 3QWUA 3GE9A 4P7VA 3QIDA 5B08A 4WCEQ 3OSPA 2KZZA 3RTVA 2CWXA 4LIRA 3CJSA 1URRA 2MXYA 3PIOQ 4X64F 1JLAB 1UVLA 2RF2B 4FYWB 1HW8A 3QT7A 4N8NA 4F4AA 1RCXB 1W2BR 3U1NA 1UPMB 3BGRB 1DARA 3QZ7A 3VF0B 3SZ2A 4DR1F 1R0AB 2HRUA 4NLSA 2A6MA 3QGPA 4TU8A 4NLXA 2CPEA 4A8MP 2FLLA 4OZ5A 1WF2A 4F04B 1SL0A 1NSAA 2FYXA 3OVBA 2DHHA 3D3BJ 5D3GA 4TU9A 2DPJA 2AGQA 4OYZA 2JX2A 1NKCA 5THWA 2W2OP 2ZUGA 1CEZA 3FCWA 2P5VA 5HAOA 3UO0A 3AFGA 2AYMA 2FY8A 1MWQA 2MB0B 3JSMA 5LMNJ 4X4VA 3N6NA 1GMUA 5LL6d 3GJRB 2ZBCA 3H25A 2D3O1 4KPYA 1SQGA 5D77A 1HYSA 4OI2A 1QE1A 1ZPWX 2IC3B 4CWBA 1VDHA 4EYIB 3CDEA 2FLOA 3W66A 5IZHA 1DY3A 5M2UA 4KFBA 4C8YA 2OFHX 4HTJA 2XS5A 2I1RA 3IC1A 1YVFA 3MMAA 3NP5A 4K4WA 2ZWPA 3CJKB 3MGJA 4KRWA 5K8NA 3M9NB 3G9CA 3KLHA 1IKXA 1SH2A 1V5VA 3TVZA 1IR2A 1WHWA 2Y1LB 4USHA 5A8KB 5K8MA 5ADZA 3IWXA 4DL6A 1Q79A 2JLFA 4F0HA 5KT6A 3T3FA 1N5YB 3VAKA 2Y1IA 1PSDA 2KXFA 4GVBB 2R8KA 3K8WA 5HSPA 4RU9A 3MMAB 1T9WA 2RQMA 1RWNB 4C7QA 5MLCV 2MJNA 2Z2LA 2G2YA 2FUG9 1B7YB 2K3IA 2ZNZA 5L1JA 4N41A 2COLA 5B0DA 3P5TL 4KY3A 5HMWA 4ZPTR 1XMOJ 2DGSA 4CH7A 5A2QU 2JSXA 5AE1A 3PRBA 2XWXA 3NY0A 1RT4A 3HX9A 3FRYA 3HF5A 2VG7A 2RIJA 3MTKA 5ETTA 5F8GA 2H3EB 2MY7A 2GQCA 2M3DA 3NS7B 2W2PP 4CM2A 3P49B 2DY1A 1VQKS 2EK6A 2XMUA 6AT1B 3QT6A 3TQ1A 3NGUA 4G3IA 1B64A 1Q1KA 1XMQF 3ILOA 3T41A 2HHVA 2RS8A 1GX6A 1RWOB 2BBEA 3FJ2A 4RW9A 2CQDA 2QMUB 3U1LA 2JEJA 4XK8C 4PQUB 1GXTA 1BE4A 1K47A 5LSLA 2E44A 4DZDA 1AZSB 1QY7A 3PHEA 2XSJB 2ZBPA 1N32J 2ADCA 1U1PA 1U1OA 1V9OA 3RB0A 3CCZA 4E98A 2BXJA 2DH7A 2RDJA 1RABB 3M2RA 4UT4A 2H51B 3WC2A 5CD4H 3MD3A 3G86A 3PM9A 4CO3A 1RWKB 3MEDA 4DR7F 5KFWA 2E7XA 3GCWP 1RT3A 4GMKA 5CYMB 5LSOA 2E5JA 3GV7B 4J9QA 3DLHA 3QT8A 3NCPA 4B9SA 1EARA 1MWZA 3AT1B 2DGUA 3IS9B 2UUAJ 4NLRA 4ID5B 3CCTA 1AXQA 5L1LA 4LF6F 1NKBA 1EETB 1FTCA 1Y00A 3UFCX 2HWHA 4HHUA 3MM9B 4MIWA 5KFEA 4UF4A 2LDIA 4UOGA 1RB0A 2GW8A 4P2MA 4WBFA 1T03B 1NJIT 3EICA 2SXLA 4ED1A 1RJJA 2CPJA 3PX6A 3W2WB 4Q44A 1FK9B 3QT5A 6FD1A 4EYHB 4TY8A 4FPRA 1IBKF 2FLPA 3CJRA 1LXNA 2XO6A 4XTTA 2EEYA 1HIYA 3V6KA 1HWKA 1HQEB 4O4GA 4UQTA 5L38A 3MUMP 2IAJA 2ZOFA 3KLFB 2CJXB 3C3LA 1HMVA 2DNHA 3GB0A 3MF5A 1QSYA 1RUSA 4LRAA 5DGAA 2GHVC 3NGKA 2RH3A 5I3PA 3D1QA 2E9RX 2CQPA 4M5HA 2XMWA 5C7PA 4F3OA 1X9MA 4ZVSB 2HW3A 3PRDA 4FBUA 1RTDA 4JI0F 2FHOB 4QJVA 1BQNA 3RYLA 4EO6A 4IQXA 3VTIA 9ATCB 4NI2B 3OHAA 3OTCA 4HYKA 4ECVA 4LVNP 4ZPAA 4RJVA 4LRCA 3KHLA 4P2SA 4AE5A 3LGNA 4N8OA 1SBRA 3L3CA 5D0EA 1EKSA 5L1KA 1TL7B 1FD2A 4EZ9A 2GHPA 1UJ4A 2LQ8A 4IDKA 2JC1A 1M0SA 4CH0S 3WHIA 1U7LA 2HBZB 1K0TA 3N5BA 3HHDA 1IKVA 2AJ0A 1C0UB 3Q2SC 4ES1A 1QDUB 5CQGA 4F25A 3BZQA 2GVZB 2HMIB 2ZZTA 1HNIA 3J7A1 1RDRA 2MQNA 5LMUJ 2CQ0A 5FLXU 3CCSS 4W98A 2KJVA 4IDKB 3U7JA 2IPOB 2QA1A 3L09A 4NEYA 7FDRA 3OW2R 4OX9J 1N32F 1UFKA 2HNDA 3BH7B 3CGIA 4Y28C 4JP8A 5CZVA 2FY1A 3J81Y 1PG5B 3HM9A 3PZPA 3JSBA 5HP1B 3Q8PB 3G6XA 2MKJA 1T0TV 4OYAA 2O67A 2NS1B 2P6TA 2QFIA 2QLWA 4C3MA 1NK0A 4P52A 3W8PA 1QAXA 4IFVA 3C6TA 4OI3A 2Y8YA 3IR6B 1JIHA 2V34A 3LAKA 4KYZA 4QR2A 3H5YA 3ISND 2RHSB 2NXUA 5K14A 4CCHA 1SVDA 5BXIA 1NK5A 1VQPS 3EGWB 4PG5A 3MUVP 4X65J 4B9LA 5HP1A 4RR5A 5B7WA 1ZTWA 3LF0A 4K5RA 2KFZA 2LEPA 2M5YA 3GSDA 4FZVA 4G1QA 1KFSA 8ATCB 2VKZG 2QA4S 4PUOA 4C4WA 1UVJA 2J9EA 1HQ2A 2DXEA 4ANEA 1BY9A 2RMLA 3EE3A 5CCLA 1SL1A 2BE7D 1CJKB 4R5PB 3TZYA 1JLQA 2VOOA 2OPQA 2HNZA 3PACA 5K14B 1BUXA 2R2TA 1RT5A 2E5HA 2E7WA 1S1WA 2BJEA 2JJ4D 1NDKA 3LP1B 2E1CA 4F50A 3D7SB 1RTJA 3OL8A 4EBCA 4M5JA 3LWLA 3K5MA 1JNZB 4CLPA 1HARA 2BQRA 1RADB 3KLFA 2QLJB 1ZM9A 5FLXY 1OJ4A 3MURP 4OV6A 3B82A 3FZBA 4BWMA 2FJXA 4K0KJ 1CULA 1JLCB 1IBCB 3NKYA 4ED4A 3CMES 3CB4A 4ZLPA 5HROA 3RB6A 4LQ3A 4RNHA 4DFMA 1JWWA 1CC7A 2VQEJ 4DS5A 2X1GA 3TAPA 4B9UA 4TYBA 3TP2A 3MPUB 2W9AA 2YWFA 4C0HA 1VIOA 1L3KA 2H54B 3TJAA 1VCTA 3CPWR 2B7CB 1U1RA 1W25A 4CNYA 4ZLNA 5HQLA 3KK2A 1R43A 2HLUA 2CQ3A 4QIEA 1D9FA 5E3CA 1FJGJ 3BB5A 2ZM6J 2KRBA 3MCNA 4DL3A 3TARA 2VPXB 1B0TA 1R27B 3H20A 2KG1A 1U8WA 1EKRA 1WDTA 1Y0HA 5ETMA 3VVUA 1FXDA 4ZLLA 3OXFA 5AE3A 4PQUA 4DUZF 2IRUA 3OXLA 4WIIA 1ZM2A 1LKZA 1TZ0A 2P9CA 1T9YA 2CIMA 1UP1A 1RKIA 2YX4A 4IO9Q 3UN5A 5EUHA 4YDDB 1CJTB 5CHCB 3V4IA 3AQOA 4YEAA 3GPAA 2WVDA 1WELA 3BQ0A 2LXFA 1HBOB 5B0BA 3BO4A 4F4ZA 4EBDA 1NKEA 4BC7A 3RW7A 2BE9B 4MFBB 3T5LA 1HD0A 2LVWA 3KUEA 2MZJA 2VB6A 3M8PA 4ZN1A 4O0IA 3RGIA 1HA1A 1FNXH 2C3OA 1YQHA 2WW8A 5KFOA 2WSFC 1U26A 2VL1A 2XZTB 4J9OA 1QD1A 2M4MA 2VODA 5T7LA 4ELTA 2VBZA 3IBFB 4J91A 3GMGA 3VAMA 2OELA 4X66J 1S10A 2XHCA 2VBYA 2J6UA 2L9NA 4XDDA 3NMRA 3M05A 3W2VB 3CCES 2WONA 1RU2A 4DR5F 1Q81T 1FKPA 2XTJP 3VCDA 3OTDA 3DCAA 4ZMMA 4RBTA 9RUBA 2M9KA 3TA1A 3KLGA 4NLPA 2RSQA 3TA0A 2DO0A 3FCHA 4IG3B 1F9HA 3ITHB 2G0CA 1S1UA 2DGWA 4OJHA 2BRKA 4OHWA 2W4DA 5FD1A 4JI3J 3FGVA 3GYXB 4DG1A 4JI4J 3IGNA 1UVNA 1YRTA 5KFCA 4R0JA 4KHMA 1HNIB 4KQZA 4B9MA 1CJVB 2HFVA 4U8YA 2IMOA 4GC7A 2VIHA 2XY6A 1ZA2B 2KFNA 4B3OB 1LOUA 7FD1A 1SJRA 4JI7J 5B0AA 1T9TA 2NYIA 1KQFB 4LF4F 4EU0A 3TJ8A 1J27A 3SQGB 3W9IA 4PEOA 4ZVGA 4ETZA 5HJXA 3PV8A 1JLEA 4MKVA 2AJ4A 3ISZA 3CMQA 4F7VA 4A46A 2A6OA 2UVUA 2CZ4A 3D0GE 1TKXA 2Y8WA 2F9JA 4I2PB 1M1KT 2VG6A 3FBFA 2DK2A 5HN0A 1RAJA 1T94A 4LRBA 2RKIB 3Q83A 4AL6A 3IG1A 3RBEA 2DNZA 1HHQA 2HRYA 1UA0A 4B9TA 1TAQA 1N33J 2JDJA 2FJWA 2UVVA 2YWGA 4DV2F 2BJDA 2IM2A 2NCKL 2H5EA 3DRPB 3DDNA 4USJC 1S7HA 4WE1B 2LECA 2CQBA 3BM7A 3D9BA 3H5SA 1SC4B 1SQEA 4H4OB 4YMEA 5A8KA 4P72A 1K8AT 1KS2A 1SUQB 2QZ8A 3LP0B 2A2DA 2HVZA 4Y2AA 2EBEA 4WZMA 3D1HA 1ROFA 1AFIA 2VFRA 2C3UA 5G4DA 1ZZFA 4X4OA 3M1VA 1SKRA 1B4SA 1VQ5S 2AF6A 4X4SA 3FUYA 4JV5J 4Y34A 3TUIC 2VOPA 3RBZA 2VKRA 2I38A 2IHR1 1J2VA 4NYPA 1HD1A 3NXZA 2IMWP 1RAAB 2DITA 2ZHBA 3FEZA 4DSFA 1RZMA 4WYWA 4FYXB 1RQ0A 4QWCA 1UETA 3DDKA 3KG0A 2CJYB 2BANB 3MR3A 5HJYA 4YB5A 2XI3A 3UQSA 5HQ8A 4U7CA 1Z2ZA 3RAXA 2RT3A 1Q8IA 2IIHA 4IH6A 4ZVRB 3MR2A 4F4YA 1YZ7A 3AJ2A 2ZUAA 3N28A 2OO4A 3WIVA 1ZETA 2QEXS 4WYLA 5IQQA 3HHNB 4I67A 1JQGA 2DD8S 2LYVA 2F9DA 2GIQA 2W1BA 2D3ZA 1XEZA 3LPYA 3TX8A 2A2CA 4G1PA 4IRKA 1PAEX 1TK5A 1TL3B 1Q5YA 3GSIA 5KFKA 1MWYA 2W01A 4X4TA 2YKMB 3DLEA 4PYDA 4DR2J 2HK3A 3BR9A 3DDIA 3TANA 2WRMA 3VZHA 2C2KB 3AD7C 4EEYA 4YB6A 2A10A 2YKPA 3W62A 3JAMY 2GQQA 2V50A 3KJQB 3H4DA 2CQ4A 2HQFA 3IAM9 2VZ9A 2ZJRQ 4DWIA 4GKKF 1WI6A 3AOAA 2UUAF 3HHEA 1U1QA 2BR0A 2N3OA 2PE8A 2C2DA 2BYCA 1CULB 1JLCA 3PCOB 1RAHB 5E0OA 5DG8A 5KFHA 5HROB 5L1IA 2L08A 1HWJA 3KJFB 2R7WA 1CJVA 4ID8A 4AL7A 2H65B 2YNFB 1EP4A 4L75A 3G8TA 4C8KA 3QGGA 4A8WA 2B4VA 1T9XA 2IJRA 4P74A 2DGQA 1PYSB 3MPVA 3OFHA 4UTGA 3BSCA 4H54A 4O4GB 4DXLA 4QPXA 1RYRA 2NXNA 2MZQA 1GT8A 2R8JA 1NLKL 3A12A 4URSA 1FTRA 2KKHA 3QAUA 5CZXA 4ZP6A 2R7SA 3R1HA 3RR7A 5BYRA 5HQMA 3HHLD 3IRXA 3V6HA 2GIFA 4CQ1A 5F8NA 2V94A 3GJQB 1LQ9A 4N77A 5HBMB 1VRQC 3LQVA 3MFIA 3Q0AA 1HR0J 1HNWJ 3TW0A 1XMQJ 5ETPA 1IBLJ 2U1AA 3CDUA 3NAIA 4P71A 3G82A 2NSCA 4EGLA 3KLGB 4ZCIA 4Q8FA 2VD3A 1C1BA 1PKUA 1S12A 4RW6A 2IC3A 4ZVQB 5B0GA 3VALA 3ZC4A 1IBMJ 1TFYA 1TP7A 3LALA 1HQUA 2RD5C 2WB4A 1S99A 1IUJA 2ABYA 3ETMA 1LWCB 1M5SA 1RAFB 2X3DA 5BYQA 2CVEA 1SH0A 3Q8VA 2EKYA 2J0XA 2F40A 4USKA 2OGUA 3JYTB 2ZH8A 2V8GA 4DI6A 1RT2A 3I87A 3TNVA 4RW6B 1H0HB 1QAJA 1UWBA 4ZJQA 2PMHA 3G82B 3SCKE 1IXKA 4MIAA 5LOQA 4ECUA 2EPIA 3CWJA 4FPIA 1H7XA 3FFIB 4ZP9A 1HNWF 2GAHC 2GMJA 3KXDA 2DNKA 5JVHQ 4WZQA 4NCGB 1T3OA 2J8AA 4PPDA 2QLBB 2W8KA 2RRNA 3AXMA 1ZOTA 3F0NA 4OZ0A 1C0UA 1SV5B 2EXUA 2J8SA 3O8WA 1UWAA 2KRRA 1FFGB 2HMIA 1X5PA 4Y65A 5E2QA 2H9ZA 3T5HA 4ZP8A 4UOHA 1VRTA 2IVMA 4ZPBA 4DX7A 4DLGA 1KTVA 1IM4A 2QIFA 3VR1A 2MZ1A 1OPIA 1QTNB 2CQGA 1M5OC 3RU0A 1ZM3A 4KFBB 2F7VA 1U45A 1M1HA 4QWEA 1EZZB 2YX7A 4LSNB 3GFXA 2HWIA 1H98A 4W90B 1FI4A 2MLZA 3K5PA 1JLAA 5H9EJ 1UMJA 4FKXA 4RNOA 5JMNA 1ACMB 2HGMA 2RU9A 3A4TA 2FJAB 1HPZA 3M32A 5IT9U 4OIXA 2C28A 1A6LA 1TK8A 1SKSA 2KZMA 4E2FB 2QV6A 3OUYA 4DR2F 3R6LB 3CEDA 3SQGA 3CCUS 2EC0A 3RRGA 1FF2A 2E5GA 2YY3A 2HVDA 3CIZA 1IKYA 4KE5A 2CRLA 4RW7A 2ZH2A 3RRHA 2QX0A 4KKOB 5CYQB 4BBYA 4DX5A 4DR6F 1YWXA 1RA6A 4LFCJ 1EQMA 5B09A 2X1BA 2RU3A 4NZ0A 5F0WA 1X4CA 3B54A 2CKWA 1FRIA 1JKHA 3KHRA 1U02A 3UCZP 2XS2A 2Q66A 1W26A 1WC6A 5KFSA 4K4TA 4NYZA 2R8IA 3FVYA 3CT9A 3GFZA 1A0OB 2HNZB 2DVIA 3D0HE 1RP5A 4RUAA 1IJFB 5EDWA 5KFGA 1F2GA 1R89A 1UCNA 4C48A 1IQTA 1FX4A 2F4VF 4DFKA 2UVRA 4IFVB 4IH7A 1YG0A 2MKCA 5C2GA 1UZHA 2AGOA 1RAOA 4ERDA 1C2PA 2H5JB 2M8HA 2QSWA 2HURA 2RB7A 3ET6B 2LKZA 2ASYA 3M30B 3UDEA 4JI6F 3G6YA 1ZS6A 3PYDA 3J7YU 1KHVA 1U2CA 1I6JA 2UUCF 4IG0B 4RNMA 1TK0A 1Y3KA 3PR5B 2GS8A 1VQ8S 3OTEA 1FT8A 3R27A 4DL2A 1U1LA 4JI4F 1BWVA 2ROEA 1I1GA 3KK2B 5KTQA 3EVOA 3ZZYA 4EFAC 2B5JB 3C14A 2W9BA 4DR3J 3LPEA 4WE1A 3HD1A 1Q53A 4MH8A 4OYPA 4JI8F 4AXIA 3KJVB 3SV3A 2QA2A 4OYMA 2O5DA 2VFTA 5CA5A 3THVA 1S5ZA 4NXNJ 4U67Q 1WOSA 2C2ZB 3DGVA 5IT4A 2XBPA 5JVGQ 4J9LA 1X4EA 3R97A 3I0RB 5DQIA 3EZUA 2V9WA 1GMWD 4WU3A 2HGNA 3BGOP 4NE9C 2JNJA 4YHHF 1VBYA 2IBKA 2J6TA 1Y11A 3BPDA 1VBZA 1ELOA 4UUXA 3W61A 4LF5F 1SKUB 3UI3A 1RSCA 4I7FB 1X4AA 4KC5A 5H1SV 1ZYQA 2UU9J 2HIYA 3H0PA 3C46A 2HK2A 4DPXA 1FKOB 1KLMB 3R5BA 3CF5Q 4QU6A 2Y0SD 3M6VA 2V8DA 3GZ7A 1MMLA 4O3RA 3BH6B 2NZ4A 3TEGA 1QSSA 3CDBA 1X4GA 4MMOA 2DR9A 3MDFA 3PKYA 4DLEA 4O44B 3NG8A 5FIIA 2HS3A 4U95A 3MAQA 4DR6J 1L3TA 4DR5J 3BQ1A 4E0DA 1S9EA 2VPZB 3OR1A 3VHQA 2HKEA 4P75A 2HEKA 2HVIA 2ZM6F 2WOMA 3HSZA 4PYAA 1JLBB 1VGYA 1WEXA 3ZTPA 1WSVA 3Q24A 3M8QA 1FJGF 1WWHA 3NAHA 4J5OA 2IVYA 4WP8A 1FVSA 2AX1A 2P9EA 3CD5A 4O44A 5L46A 3M2VA 5KFFA 3CUNA 3GR1A 1NJWA 5J2MA 2MTLA 4C9DA 4X4RA 1U8SA 4GVLA 2Z2MA 3ZZOA 1QVGR 1Q8KA 2ILZA 4KGKA 4DUYF 3A1YG 1M5HA 2JOQA 1FNMA 2ZH7A 4K4XA 1CJUA 5RUBA 4HKQA 4M5DB 4P7TA 3EXYA 4RW4B 3TX0A 4LSNA 1JLEB 3W63A 3MEKA 3PVXA 1ZTTA 3MEDB 3BREA 1SI9A 4LF7F 4J9VA 2CQIA 2J0QD 4P10A 4WP9A 2OIHA 4PCQA 3QATA 3HHKA 4N47A 2RS2A 2MYFA 3EX7B 4DL4A 2NR0A 1UJ6A 1S48A 3W8GA 1HWLA 2CG8A 2GFFA 2L48A 2OPQB 3MPYA 1D0EA 2UP1A 1U6ZA 2ACMA 4BC9A 1DJ0A 3GG1A 2HHPA 4DUZJ 1H2VZ 1SKWA 3E01A 4I6AA 3N0VA 1HI8A 2C1EB 2V4JA 4BS2A 3MXHP 3FQKA 2GO9A 2G1DA 3IR5B 1Z1ZA 1NK9A 1UVKA 2YKNA 4ZCMA 3CCVS 1C1CB 2VFSA 1RT1B 2DCUB 4P6QA 5D0RA 5DDOC 5E41A 3NBPB 4LF2A 4YP3A 7AT1B 3QIPB 2X3GA 2ZH3A 1U2RA 2EFVA 1KLNA 3G4SS 2FVSA 4DPTA 1FA0A 2EFPA 2G0IA 4TY9A 3VQSA 4F0MA 2RHQB 5F9NA 4K4YA 3DGPA 1NBEB 3IAS9 1WOOA 3LAMA 2GA7A 1R0BG 4BDPA 3Q89A 4NLGA 3HKZD 3MAAB 4HT5A 1KVJA 3EGNA 2BJ7A 2ZJQQ 1YJ9S 1FRKA 1RYSA 1F5AA 3IGVA 5J2PA 2VONA 2KI2A 4I6WA 4C11A 3PFOA 1RXOB 3CJ0A 1S77D 2DBBA 3D68A 2HHHF 4NEZA 4IR9A 1LW0B 1FD8A 1S4FA 2UUBJ 4JYAJ 3D6FB 4NMLA 1LWXA 3C66A 3IMQJ 4KHRA 4WK1A 5CH7B 5KFVA 2XY5A 4O4RA 3R7SB 1MMDA 2MPUA 4HLBA 3PW7A 4Q0BB 1UAWA 4RNNA 2UXDJ 1LK5A 1F60B 4OX9F 2B6AB 2VU5A 1G2EA 2HZVA 2HS4A 4LFBF 2EBGA 4K2JA 3RBDA 3OTBA 1R31A 1SJQA 3GIRA 5CYQA 2EI5A 5KT5A 1IKXB 1R7IA 2DY9A 3LO3A 4FVCA 4EI2A 1Y4ZB 2EVZA 2JVOA 2C3PA 1RKJA 1A7GE 5DS7A 1H74A 3W65A 2ZVIA 1TMMA 4LSLA 1KOHA 4AYBD 1N0UA 1DHMA 4KR0B 2R7OA 3DI6B 4GVBA 3MOJB 4JUZA 5GMDA 5KFAA 5A2QY 3C6UA 2XC9A 2ZH4A 4Q7AA 4LF8F 2FD2A 1NM2A 2M2BA 2IM3A 3NOCA 4Y2KA 1H38A 4DQPA 2C2MB 1FFSB 4ILLA 2XEXA 1UEVA 4A8XA 4PZVA 2JVRA 3DXBA 1JXVA 1YHQS 2RDDA 3DLGB 4YY3J 1NJZA 1EB0A 4V19J 2QLFB 1RK8A 4OV1A 3V2UC 3M2RB 4WFXA 1VMBA 2GJIA 1R6YA 4NXMF 3R1LA 4C0BA 2HVEA 2R3VA 3ULHA 2AX0A 4NLVA 4LF1A 1XNRJ 2DRAA 1HNZF 1KHWA 1TKTB 1WUUA 2P9GA 4Y0FA 5L39A 1B3TA 2B7BB 3RR8A 4OJGA 5DRKA 1VK8A 2B9YA 4IG0A 3UW1A 1N56A 2PA3A 1HNXJ 4URQU 4DR4F 1VR6A 2CG4A 1OY6A 4RU2A 4F4WA 2YVSA 4K2XA 2HHXA 3G87A 1R8HA 1JLFB 5ETVA 3MD1A 2BZ2A 4PRFA 1KFDA 1R6VA 2B5JA 3C14B 3M8PB 3UN3A 1FJEB 4JI2F 4HT7A 3W2WA 4N5SA 4V19X 3R8YA 2XSJA 1UFLA 4UOCA 3PW0A 2APOA 2R7UA 2D41A 1U1NA 5KFNA 3H90A 3ILLA 4ZCKA 3IR7B 4LFAJ 2VPYB 3CCQS 1HQUB 3TRGA 3I82A 4K8RA 1S57A 3O44A 1X60A 3IXQA 3V5RA 2V63A 3QSIA 2E5LF 4FF3A 3OXGA 2KL8A 2CZ9A 3AA8A 3SSRA 4ECZA 1S1TB 2WAQD 4ZVTB 2MDAA 2PT0A 2HQGA 1S76D 4OHVA 5KT4A 2KVIA 1ZAXA 3PX0A 2AJ2A 2IJNA 2C2EA 3I9ZA 3OFFA 4JV5F 2OEJA 1LFPA 4KH1B 2HHSA 1SUQA 1U0HB 1W2IA 3DMJB 1N33F 2X51A 3D1OA 2ZHAA 4QU7A 4ED5A 3CJKA 3OHBA 3UD3P 5LJ3Y 1N6QA 2CJ9A 5IM0A 2D1CA 1N4LA 1F6TA 2AEJA 3ZNJ1 2PDAA 3SFGA 1HNZJ 3KK1A 3N6MA 3D6MB 3KWMA 2V0NA 5E3PA 4GC6A 1FCAA 4DOZA 1ULRA 1DRZA 2OJ3A 1XBWA 2YPZA 4CI0B 2J7WA 3B8HA 2FTRA 3LGHA 5J2NB 1REVA 1BXNA 3FSYA 3FZ2A 2BMBA 1WDDA 3DN9A 4RW8A 3NEKA 3FC9A 1NSQA 4LF6J 5B0CA 3FMBA 5ETSA 3EDQB 5E7OB 2VQFJ 1N5VA 3EXCX 2PN6A 3AJ1A 5C2CA 1B70B 5EWEA 4DR7J 3TYTA 2AHOB 3DU5A 4Q2MA 2CPHA 3JQKA 2PIIA 4OHXA 2YH1A 2ATLA 3P3DA 1R0CB 4ZIWA 1WJ9A 1YITS 2ALYB 3DM2B 2DEJA 3L7OA 2RF2A 1VJWA 1REVB 1KD1T 4GKJJ 5KFDA 5J2QB 1OYDA 5IOLA 4B17A 1VRTB 2EC2A 1H3DA 4TXSA 5E3RA 1WC1A 1DFDA 4FNHA 2WBMA 3CTRA 3S8SA 4QBUA 4DFPA 4WP3A 1WI8A 1FFWB 2Y1JA 4E8UA 4LRDA 5HANA 3ZZPA 3A8KA 2BKPA 1F1BB 1H73A 2JFKA 3AA9A 3BGRA 4ECYA 4A48A 1R0AA 2UUBF 2CNKB 2HSEB 3LOUA 4ITSA 3EJMA 5K20B 2VJVA 4F67A 2HFUA 3DLKB 5T14A 2EFQA 2CUYA 3PW5A 3AD8C 3J7AN 2XQCA 2DNMA 2G1HA 5KT7A 4U6PA 4PWDB 3OFGA 1RTIB 5C25A 4CIOA 3MWBA 4ES2A 4EZ6A 1Q5VA 2UXBF 4DQRA 2Q79A 2D7SA 3D5MA 4ZP7A 1XC9A 3KFWX 3DLBA 2XULA 5LMNF 4URGA 4ECRA 2FHJD 3I4HX 4QW8A 3RRKA 3LP0A 3FSIA 3AAWB 2ZH6A 1T3NA 4IOAQ 2N7YA 1Y5IB 2VFVA 3FEYB 2K7JA 3IM8A 4QYRA 5KFUA 1LW0A 3P45B 3CVKA 3R5JB 3KLHB 1JX4A 2IA0A 1RBLA 2CJBA 2VICA 4HEA9 3BQ2A 2QGFB 1NK4A 4ICLA 1Z2LA 3HMJG 3HHLB 1KVIA 3FEXB 3QGHA 5GMEA 4USVA 1KNZA 2CPDA 2B9EA 1KVKA 1NAQA 1VJQA 2HFOA 3Q8YA 3H8YA 2ZZNA 2WHOA 3WBZA 2R8GA 4HHHA 2JZ5A 2OPSB 3HD2A 1RHRB 3MCOA 1BWEA 4LF7J 3T1YF 2HQDA 3E2EA 1VHFA 3MOZA 2IVFB 5HVFA 2K1RA 5DGBA 4DBQA 3QJPA 1UVIA 1LWEB 4M63A 4U7UK 3ZZUA 2OLWA 4LIWA 4QR0A 4IFYA 3V6JA 4JV1A 2J9CA 4NLWA 3ZZ0A 1HWIA 2VG5B 3D67A 2G0JA 4WJBA 4FVMA 2DHGA 4HHJA 3JQJA 3HVAA 3GLJA 2VA2A 1B0PA 2B51A 4CLYA 1YJWS 1SPBP 1LK7A 2IJFA 3CE8A 4CH1A 5G0RA 1WC0A 2BA9A 2P2CB 2KFYA 4LJMA 4J9SA 2CPIA 4WTYA 2DRBA 2KTQA 1RHQB 2RUGA 2LMIA 3BYPA 2QTWA 2AIRB 3R5AA 3R5DA 4EBEA 3K7RA 4C8ZA 3ILJA 5M2PA 2KXNB 3AJDA 2KHCA 4LR7A 4NL5A 2M7SA 1GTEA 5D0HA 2UUTA 5IV4A 5KG1A 5DQGA 3TQEA 3CD6S 1TMJA 2NYHA 4X64J 2KT2A 4Y00A 2KT5A 2DH9A 2F4FA 4J90A 4QYZK 3FMWA 3EVMA 4C6AA 2UU9F 2WVBA 4DSJA 1PJ6A 4G1IA 3RW6A 1T03A 1RT2B 1D8ZA 2XGQA 2CXEA 3NGTA 1RAEB 1UZDA 3M6UA 5DDRC 4LF5J 4H4MB 1VBXA 2IYIA 3TZWA 4UY8T 3NWGA 4QR1A 4RBUA 2YNGB 1LXJA 4LUBA 1RT7B 5ETKA 4CLSA 4P2XA 4YR0A 2HBYB 3W9HA 4ZA1A 4YFUA 3DXSX 1N88A 4IUFA 4ZJOA 1P9YA 2AYEA 1ICEB 3EUNA 1OQ3A 2F8MA 3DLKA 4AQYF 1RCOB 1XNQJ 3U1MA 1OY8A 3IP0A 4DMZA 1AW0A 1UEKA 4MFBA 1Q95G 3W5XA 5KG4A 2N4CA 3DYAB 4JI8J 3HVTA 4DR3F 4B3MJ 4HACA 2YNGA 4NMXA 3EGZA 3MR5A 1DLOA 2PA8D 4OLPA 5AT1B 2N7CA 1JLBA 3OL9A 3QQCD 1IKWB 1S9FA 4L76A 3PDNA 3EZ5A 1Q86T 5D3GB 1NMEB 1FRHA 1RAIB 3GONA 2HFNA 3IBCB 1ZAWA 2HPUA 2HNYA 2NUHA 2VBXA 3QIPA 4I64A 3MCSA 2XZWA 3JSRA 5JXSA 2MKSA 3CD7A 4LT6A 1MN7A 3QAEA 3S6EA 2G4BA 1BD6A 1WC3A 2OSRA 4JI6J 2MKIA 3OL7A 2RKIA 4OFZA 4R8UB 5AXNA 3KLIB 3FDSA 1VQYA 2E1AA 2DYAA 1C4CA 2EFGA 3MM8B 4QIGA 5LXRA 2LXIA 2KM8B 2R9LA 2J0SD 4QWBA 1E6VA 2Y1RI 2LCWA 4CLFA 2HHUA 4USIA 2MQOA 1FDAA 4ED8A 3ZTRA 2DISA 2JL9A 4OJ3A 3EZOA 1UJ5A 2F8EX 2M88A 2V2QA 4ZVOB 3M9MB 3K59A 4IOCQ 1APSA 3UE2A 2MEWA 2G2ZA 2E29A 4LR9A 1VRUB 1I5OB 1OYEA 1SH3A 1GQEA 1YJVA 2KHDA 1K9MT 3UPFA 2ZZMA 2LU1A 1RHKB 5U47A 2PMWA 1XK8A 5EX0A 1T9VA 2PSZA 2QSFA 2Q6BA 1RWMB 1M90T 1CC8A 1P8GA 4EK2A 4IR1A 5AJ3F 2DIUA 1F9EB 2FJEB 3T9ZA 4DPOA 2MGZB 4RWXA 5T41A 2RRBA 3C15A 4AXJA 4ILMA 5A8RA 1TVRB 2JRSA 5CXTA 1X4BA 3CO9A 3PYGA 1U48A 1N6QB 1TL5A 1T8EA 3M6WA 2ERRA 4PXBA 1JNRB 1N5QA 3AB2B 1KTQA 1GMVA 2V6AA 3PEHA 5EWFA 4YB1P 1RTDB 5FJ4A 2F5GA 1Y3JA 4LBIA 3M8WA 3TUZC 3W9JA 2ZC4A 2I5JB 3T6BA 2QT7A 1SC1B 1IKYB 2DNQA 3BS9A 4I7FA 1V3SA 2K06A 1YJUA 4Y2MA 3UN2A 2RILA 4NWBA 1WHVA 5KFQA 3TAQA 3MI7X 2GGPA 2VFUA 3PRVA 5D4OA 1CJTA 2EW9A 3TUJC 1I51B 3ILIA 3QGIA 1L3SA 5DM6Q 4Y3CA 4CTAB 4PXDA 4CO2A 4OZLA 4LF9F 2PD1A 3TR5A 3MM7A 1UEUA 2BKNA 4AD6A 2QN6B 4EO8A 3F41A 2IFXA 1KBRA 2G9OA 1Q4RA 4B08A 2Z57B 4H4MA 2W24A 1UFWA 1YZ6A 5KG6A 4DUTA 3HXMA 3NNHA 2DRDA 1A9NB 1IQZA 4PR6A 4C8MA 4FF4A 4OZNA 1HNVB 5I3QA 4QCLA 4QIFA 1KN6A 2H5IB 2H4WB 1P1LA 1O51A 2RQKA 1WORA 1MW7A 2KT3A 1DQ8A 3EWGA 1P27B 5F8MA 1X5OA 3FBEA 2YWKA 4AFFA 2OPPA 4UZBA 1RT3B 3VAIA 3CC4S 4B3SJ 1S6UA 3DOLA 4I69A 4WKRA 2DR6A 3OBIA 3GYGA 5KFTA 3ETOA 2UXCF 3TVKA 1WHYA 1WKKA 5F8HA 4RWWA 3CDWA 4F2RA 1E6YA 1NZ8A 4CLTA 1EIYB 5GVQA 4R0EA 3UVJB 1S1XB 5GAHI 3GQCA 3PO4A 1IWAA 4K4ZA 3KDNA 1JLGB 2BE2A 4OZJA 4O3OA 1DZ5A 2CVIA 4ZVEA 2AYGA 2WSCC 2ASJA 1CG2A 1NO8A 2YQ0A 2AJQA 3DLEB 1WOPA 1CLFA 1TKTA 2MLXA 3NGSA 5A6PA 3G8SA 2CJKA 1IBLF 4S0MA 2I6WA 1S9EB 3OR1B 5BR8F 3HLUA 4AL5A 2I9SA 2BV3A 2YXLA 5B0FA 2F63A 2D69A 4PUOB 1NJYA 2HVHA 1HMVB 4PABA 3SBMA 3T5KA 3PX4A 2IAJB 1N36F 4UUWA 4GO5X 2GC8A 1H6KX 1PCAA 2Z4PA 3DOMA 4H4KA 2D3OR 5F0UA 3TA2A 4USTA 4Z37A 2R7RA 1S1WB 1KKHA 1V3RA 2KYZA 2EFOA 3AOBA 1TQLA 2AKWB 3HSDA 3HSGA 3O1LA 3FNNA 5F3TA 2CQ2A 1JK9B 1NUEA 1WTFA 5M2RA 4DV6J 3V6DB 4FYVB 3T1YJ 3VAHA 2M70A 4Q2LA 4TLRA 3MM9A 1YKWA 2A18A 5FDLA 3SSSA 3N4WA 1UPPA 4WXOA 2VDHA 3IRXB 2V8VA 4GKKJ 3P6YC 1HBUA 3L7UA 4RZRA 4IH5A 4X2BA 3J80U 2ZHOA 4TY8B 3A8JA 1HYSB 1S49A 2XWYA 2DGVA 4O3PA 3ZXWA 3C6TB 1KP6A 4HI1A 2MKYA 1KEKA 3N9UC 3I6PA 5HATA 5AXMA 3LP2B 5KFPA 1RHMB 5HO4A 4WFYA 1F5BA 4Z2XA 4MAKA 1IKVB 3NLCA 2GX8A 3VGUA 3GIMA 3KG1A 4DS4A 2HLTA 2CPZA 3NBPA 2I8EA 3NCRA 4UY85 1OO0B 4ALZA 2OFGX 5KG5A 5I42A 2FVRA 2P8IA 4ZVUB 2ZEJA 2F8HA 5HI7A 4X4PA 3BBBA 4DU8A 1LEOA 1NXIA 1Q0NA 4DZ6A 5LM7E 3FFIA 3TUPA 4X62F 2ZKTA 4NLDA 3KLVA 1YSJA 2Y3YA 1RI7A 2BM0A 3TWZA 3GIIA 4CLLA 1S0OA 5F41A 4BLGA 2XMMA 5SUHA 1URNA 1P9QC 5DZ7A 5J1NA 5B0EA 2GCFA 5DG7A 5D78A 1N5TA 2XNQA 3H40A 1J5EF 4BCAA 4KV8B 3NNCA 2DNPA 4WWSA 1M5KC 4IQMA 2V8PA 1P6TA 1Q7LB 3DRSA 3TEHB 2DCLA 3IA0A 3UD5A 2IYGA 2DNNA 3CW2C 3GFHA 1RAGB 4M5GA 1OQ6A 5DETA 4ZHRA 2M52A 4O23A 1KWMA 5CCMA 1JXLA 1QTMA 4M95A 2GGPB 4I2QB 4OYIA 3JB9k 5J1EA 1Q8LA 3BR8A 2ACYA 4U7UD 2JEIA 2J7KA 3C8YA 1C0TA 2HWTA 1RBOB 4NLQA 2VQFF 1Y7PA 3R2DJ 1KC8T 1RT5B 2ZFHA 4HDGA 3VGSA 4A8OA 1U24A 2VDIA 2HFZA 2DTJA 3HKWA 1X9SA 1K1SA 1VI7A 1VISA 2KJWA 2P6SA 3D54A 3UR3C 3BO2A 4JI5J 2DGTA 4LF4J 4KIAA 4H4OA 2KYXA 1HBMA 1DBDA 1ZBTA 5KFYA 2ZH9A 1GTHA 4LR8A 2GV1A 3HHLA 1D9DA 4G65A 1KR4A 1C0TB 3C15B 3RJMB 2XO7A 2X1FA 4EUVA 2A0FB 2LQ5A 4I2QA 2FHMA 2LP4A 3HCXA 2MQQA 4OMFG 5DZ6A 3AOCA 4CO0A 3CJ8A 2FZKB 4YUDA 4DL5A 5HLFB 5CABA 1YX2A 2MJUA 3BBCA 2KG0A 3MUTP 4CRJA 4Z7CA 1FWLA 3ZZZA 2XCAA 3QRPA 1BHNA 1YDLA 1AROP 2HS0A 2HAIA 1HBOA 1EAYC 2RJZA 3K2YA 1B0VA 1REGX 1DQ9A 3OTOF 2ZH5A 3OFEA 3K17A 2A3JA 1N54B 2NPIA 4NOHA 4OZ3A 1NDPA 2HQCA 5KFMA 1TELA 3ADAC 4IOBA 5E5NA 2PC6A 3CC2S 4JI3F 4C0OC 5D6GA 1S9GB 1VQOS 4OL8A 4K50A 4OX7A 1DTTA 3S7RA 4L6V3 2FIUA 1HHSA 2BM1A 2LQJA 3GIKA 2QL9B 3T1HF 4FN5A 4J9RA 1M5VC 3QRRA 4ICLB 1MMNA 3SMZA 4MK9A 3MAAA 2OPRA 3MECB 5GAGI 1SQFA 4KPCA 4J9NA 4K4SA 2JHEA 2ASDA 2BJ9A 2WBRA 3C16B 2YQ3A 3PFEA 5GAEU 4J37A 1VYAA 1J5OA 3HVWA 3DLLQ 2HZAA 1QJHA 4YOEA
chains in the Genus database with same CATH topology
2XS7A 5KFJA 3NS6A 4PWUA 3MMCA 1H2UX 1WG4A 4ED7A 4RBVA 2R2RA 5F3ZA 1N5SA 4ZS6A 4L3NA 4CT8A 3K5LA 2BQUA 3M4XA 4WKYA 4OLOA 3M9OB 3I55S 1WF0A 2MSTA 2LEBA 2AJ1A 2D74B 2ROGA 4OHYA 5KFRA 3KHHA 2DR7A 4HVZA 4A47A 2KXHA 1J5OB 2W7OA 3CMAS 1XR5A 4WXWA 1XNRF 4MKYA 4B9NA 4FBTA 3MEEB 4N76A 3FSXA 4I1TA 4LMZA 3DYAA 1G3OA 4DQSA 2CYYA 1OPZA 2A1BA 2FJBB 4O3QA 3JTPA 5DDPC 4R5PA 4Q45A 4DF8A 1PC4A 2N3LA 2YTCA 3AB4B 4DV1F 1S1UB 3OSNA 1K1QA 3POTA 2VV5A 1HBNB 4IG3A 4PPZA 2XB2D 4A8FA 3UDLA 3CCLS 4FXWA 3KOAA 4KGMA 3U27A 2UV8G 4ZVHA 1GH8A 5IT0A 3ZFVA 2XCPA 4DV6F 4TQSA 5F9LA 2LDYA 5KG0A 4Q8EA 3BO3A 2DPIA 3DRXA 3IRWP 1P1TA 1HQEA 2UXDF 1U09A 3HZEA 3O3LA 2NREA 3WZ0A 2FLNA 4I56A 3QJJA 4MK7A 2XGPA 3SYZA 2HIQA 1RT1A 5BJRA 2E9TA 3DRSB 1S1VA 1JJHA 2OD4A 4EWTA 3I31A 4ZPDA 3PJXA 1X5TA 3OPKA 3MEGB 2J0WA 3KNGA 5J2NA 2GIRA 2OPSA 4ED6A 2E9ZA 3CJ3A 1NHUA 1Q78A 3CIMA 4A8YA 3NL0A 1YJRA 3DRYA 2CFXA 1H2TZ 3MM8A 3MAHA 5A0YA 1ZH5A 1WF1A 1KQGB 1FDNA 3B4MA 4RX6A 3M2UA 3ENWA 4RW9B 1DTQB 1HBMB 4CT9A 1TV6B 1D9AA 2O3DA 2QRRA 5F8JA 3MEGA 1Q8BA 1B7FA 3E51A 2PEHA 3MMBB 5H9FJ 5CYJA 2RQCA 2KO1A 1U47A 3SSQA 4ECWA 1VQLS 2BW2A 5GAEI 4HH0A 1S0MA 2UVWA 2W4PA 5F8IA 4FS1A 4IRDA 1FESA 2I0XA 4XPCA 2DB1A 4F4XA 1GAOA 2FVCA 3QJLA 2FGOA 3VAJA 3MM5B 1CQMA 5I3UB 2AJFE 3OVAA 1UW4A 3MMBA 2W4CA 4NYOA 5KFIA 1MSWD 3SDEB 2GMLA 3CC7S 1RTIA 5C25B 3VZIA 2HHTA 2DJWA 3IFEA 1PC5A 2V9KA 3UCUP 2DNGA 4X4NA 2MY8A 1F9FA 3FQLA 5HMXA 2YNHA 5KAKA 1RTHB 1SJ4P 3M32B 1Q16B 2GMHA 2YNFA 3VQTA 4I2PA 2MHNA 2CJQA 2VG6B 4ZDNA 3Q22A 3IS9A 4DV3F 1PO6A 4ELUA 4TNOA 1K0VA 2G13A 5KG7A 3JSMB 2XY7A 4A4JA 3DI6A 1AUDA 1QSLA 1NRKA 2BE2B 3H2LA 4KB7A 3SCIE 1RTJB 3F44A 3T9NA 4U9RA 2DNRA 4RUHA 5DLFA 1ZZNA 3MM6A 4NCAA 4B9VA 1GX5A 3FRZA 4A8QA 3PY8A 4OI6A 1TL3A 4M8LA 2ZDOA 4LQ9A 2RRAA 1G7CB 1F5CA 4B3TF 2YNIA 2OPPB 1LWEA 3ICLA 2YKQA 4DN0A 2PI5A 3KJVA 2WB1D 3H2UB 4ZPVR 3DMJA 3THPA 4NXNF 3V6DA 1JMTA 1U1KA 1RA7A 2J5AA 4G6VB 2HYIB 1LWCA 1NB7A 1LWFA 1LV5A 4QIWD 1SC6A 1YJTA 4XIUA 4DFJA 1JB0C 5IM0B 1MNEA 3QO9A 3W7BA 2W9CB 1HBUB 1QJHA 4B3MF 5KG3A 2FJDB 2JLGA 1WACA 2B9WA 2HNDB 2O01C 4CO1A 5AE2A 5GMKa 2XHWA 4QOTA 4F26A 2ZNYA 2FB0A 2LLZA 3DLJA 4ECXA 1KSPA 1XR6A 2DNOA 3G8QA 3RAMA 3E3XA 4YDXA 1N8RT 1C1BB 3Q23A 4HL9A 1LW2A 2ZJPQ 1S6PA 2LQBA 3BJYA 4OI4A 3OR2B 2B4OA 1TR0A 3OLBA 1QAIA 2YWHA 4DQIA 4WFNQ 1HPZB 2NLWA 3J80Y 4TKTA 1SIZA 1BLUA 2R7QA 4I6YA 1WHXA 3NMAA 3IBWA 2FDNA 4AUKA 4J9KA 4DV7F 4RW7B 4LFCF 3H59A 1FRJA 5SZTA 2NPFA 4TU7A 2QYCA 3DRPA 4JI1F 3LP2A 3I5CA 5J1EB 1NZAA 3LP1A 5LT5A 5KT3A 1ZM4A 5DG9A 4RW4A 2K7KA 4DJBA 2BRLA 5GAGU 4FS2A 4OI0A 2DGXA 3V81A 1UL3A 1U6FA 3B4DA 1U49A 2EG2A 2RE1A 4B3RF 2WTFA 2DT9A 5BYSA 4MJKA 1YRXA 1UVMA 2OAUA 3U02A 4NZ7A 2J6SA 4KO0A 2UZAA 3PIPQ 4RKUC 2R7XA 4KJIA 2CPXA 3R3TA 3P96A 3M8QB 5EX3A 4MKAA 5K8OA 2WCXA 3CD0A 3SCJE 3ZZRA 1Y5NB 3K5NA 2W7PA 3HFKA 1X4DA 4D3GA 2N82B 3HVTB 1BGXT 4KO0B 3MM7B 1R8BA 1YI2S 1D1UA 2GHWA 4J9PA 2LEAA 4NRUA 4OJ1A 2N4DA 3H98A 3CDAA 3M30A 1NU4A 3K58A 4NX9A 2IBOA 1WEYA 2XG8A 3BEGB 3GG0A 3O5TB 5J2PB 3PW2A 2JLEA 2AGPA 1JXEA 3KK3A 2UUWA 1ZPVA 2IRYA 1SJFA 4TQRA 3K5OA 3V4IB 3KKFA 4DV4F 2MZTA 4NRTA 2ZITA 4W92B 2V4RA 2OH2A 4DL7A 3HHLC 4PG7A 3UR0A 2ADBA 1IBMF 2ZE2A 3LUYA 1T7PA 3MMCB 4JOUA 4M94A 3TOQA 4YB7A 5A0YB 2JFDA 2U2FA 2B3TB 4B3SF 2MKKA 4KSEB 5JJBA 2NQPA 1QM9A 4JV2A 4WFAQ 5EN1A 1XERA 3I0SA 3BN7A 1G6BA 3DLGA 4NCGA 2K8GA 1NK7A 5DDQC 1KQKA 2E1RA 3HDSA 1FXLA 1WNEA 2OTJS 1YGYA 5KFBA 1XWLA 2XI2A 2POKA 3I0SB 2ZOMA 3JSYA 1RT7A 5EWGA 4PG4A 2BUNA 4DDFA 3BSAA 4X4QA 1NNDA 2OD6A 3CSKA 5DM7Q 1OS5A 1BQXA 2J7UA 3BGUA 1HFEL 2WOMB 2WONB 3AQPA 3KTQA 1RWUA 2B4PA 4Y6IA 2YH0A 1ZAVA 4ZCLA 4BWJA 1R3NA 3LGMA 3SV4A 3POTB 1NH8A 3DOKA 3O2IA 4YR3A 1X9WA 2DR8A 3HK2A 1NHVA 1VQSA 2ZKUA 3ITHA 2L9WA 1VQ6S 1FXRA 1UWBB 2OKQA 2B4UA 2F3JA 1NH7A 4HH1A 4K59A 2FC9A 5D4NA 2KN4A 2XLJA 1O8BA 3UDCA 3EPGA 4TN2A 2EK1A 1XMBA 3GR0A 1QLNA 1LWFB 4PQAA 3RAQA 3QPIA 4ETXA 3H5UA 3JTOA 2MSSA 2Z8QA 4PWDA 2XMVA 3M8SA 1XR7A 1BC6A 2MZRA 2FVPA 4FP9A 1CSJA 1SXLA 2DHSA 2DNYA 4CZCA 2KB2A 1T05A 4MIBA 3ENVA 4TLQA 1E6VB 2WSEC 3NCQA 3KLEA 2R8HA 1JJ4A 2D3UA 1OIAA 4DX8H 2IM1A 3AY0A 4I68A 1HI0P 4KV8A 3RB3A 3OQ2A 1G1XA 4H4KC 2X1AA 1K73T 1U4BA 1V3ZA 2B56A 3CJ5A 4I0WA 3UCGA 2YKAA 3GYNA 2BDPA 4DSLA 4IO1A 1TV6A 4KT0C 5A8RB 3OVSA 3D2WA 3G6ES 1VC5A 4C3KA 2F1FA 4NCBA 2MGZA 1SIWB 4J9MA 5KOXA 2ZE2B 1D3WA 4F02A 5I42B 2HHWA 1PILA 3THTA 1VQ9S 2AQ4A 1LFWA 1Y5LB 1GXLA 2DIVA 3I5AA 4DHVA 4RUCA 4HTIA 4XPEA 2JC0A 1N5YA 3CJ4A 6FDRA 2L9DA 4UQGA 2R7TA 5LSRA 1OSDA 2PO4A 1U6BA 2C3YA 4FXVA 3HO1A 2JH3A 4K5SA 3SDEA 1FJ7A 4QWDA 5I3UA 3SFUA 1DTQA 3M2VB 4HI2A 1OWXA 1UKUA 1LW2B 1KQSR 1TAUA 4ES3A 1O0PA 1S79A 3T19A 4ZKAA 1QE1B 3T5JA 2FHKA 4NLUA 4OQJA 4KKOA 1FKOA 3IO1A 1R8PA 2HGLA 3DRRB 2DR5A 4RNFA 4K4UA 2B0GA 2GJ2A 4MK8A 2VPWB 3HZGA 1JKHB 1XNQF 1GXUA 4Q0BA 3DOKB 4KBIA 3CCWA 3VWSA 5C5JA 3MFHA 3MR6A 4XAKA 3GV5B 4X66F 1E6YB 1FE4A 2CZVC 1X7VA 2OMLA 1YIJS 1CQNA 4DL0C 3OJUA 1VK3A 2D9OA 3SXLA 3CCRS 5K9FA 3SEOA 2Z0GA 1X5SA 1JLGA 2ZOGA 2D9PA 4X4UA 3MZIA 4FNIA 4IRCA 3E8OA 3TVYA 2PFFB 3L95X 4C97A 4QQBA 1XN9A 1JJ2R 1FE0A 3W3SA 4F4KA 1F0XA 3QWPA 5AXKA 4PXEA 2C22A 2NUUG 1GNKA 3SCLE 2DHAA 3OV7A 4PG6A 2HHQA 4QW9A 1HWUA 3KK1B 4DSKA 5D4LA 4Y2IA 5DLGA 3NS5A 1X0FA 1D8YA 2UV8A 4C98A 3HJFA 4ATNA 2RDIA 4JBCA 3BDEA 3PR4A 3LWMA 1S9GA 4F3MA 2K3KA 2ASLA 2BQ3A 2W9BB 1NK6A 3JTNA 3QO9B 2QE5A 3KYLA 4QZVB 3LANA 4I4BA 1U1MA 2R4FA 3GIJA 5L9XA 4ZOSA 3J7YI 2JEFA 2V5HG 3KK3B 3PJWA 1VFJA 2V2KA 5T7LB 2ZH1A 2VG5A 4NZ6A 1Z4UA 4NA2A 2VQEF 3CULA 3F56A 4LSLB 4YQWA 3JYTA 1X0PA 5MAOA 5A8WB 3C2PA 3UNGC 4KHPF 5DJBA 3EPIA 4MTPA 2E1MC 4R25A 2QMXA 2J76E 1KLMA 2FJVA 3OL6A 1MROB 4M1KA 3KHGA 3PNIA 5KFZA 2B43A 1FVQA 3Q8RB 1RT6B 2EG1A 3MEEA 4O3NA 2B9XA 4PG8A 1YJNS 2OPRB 3MECA 1S1TA 4NLTA 3N5FA 2J9DA 4B3OA 3N6LA 3ISNC 3Q2TC 4Q43A 1U2FA 2FGCA 1S6QA 2VH7A 4ED2A 2VA3A 3M8RA 2E66A 3I9V9 2GQ2A 3BN4A 4DV5F 3B78A 3V81B 2JEGA 1TFWA 3DU6A 5J2QA 1FRLA 1KRPA 3CJ2A 2V8HA 3K57A 3LW5C 4X65F 3NRBA 3DM2A 3PXGa 4QWAA 2AP6A 1TKDA 2OTLS 1EP4B 1VOMA 1CPZA 1Q7YT 4FYDA 2GNKA 2XLIA 4ZPCA 4K4VA 1IKWA 4ID5A 4QYZJ 1DURA 3T6JA 1BQMA 3R5CA 1R8AA 4DG1B 2NSBA 5HMYA 4WK3A 2YX1A 1FKAF 4C8NA 1T02A 2W8LA 2ZD1B 3TAMB 5HMZA 1Q82T 1IN0A 2BOPA 1QUVA 2DH8A 3RB4A 4ZPWR 2R2UA 1N48A 1VS3A 4GKJF 3DHXA 4HDHA 5LMUF 1HI1A 4FF2A 3I5BA 4ECQA 1FO1A 3KMQA 3A8EA 5IFMA 2YKNB 3EYZA 1HBNA 3WX4A 3PKMA 5K5MA 5IT9Y 2RQ4A 3MPWA 4OX6A 1NJXA 3N79A 3QLHB 5E33A 2HZCA 3M6XA 1QUPA 5HLFA 2W25A 4DSEA 2BANA 1UA1A 1HL6A 2OSQA 2BACA 2L3MA 2VG7B 5C24B 3IWNC 1DAXA 1SJ1A 4X84A 4ED0A 2ZVSA 4LFAF 2CDQA 2MKHA 1HHTP 2DNLA 2MMYA 4ZK7M 4MYUA 3SI8A 1VQMS 2CPFA 2QMWA 1SJ3P 2AYBA 5HL7Q 1RGVA 1X4HA 1TVRA 4ECSA 3QYYA 2ZC3A 4TYAA 1VIXA 3NGDA 3UD4P 2DO4A 2I5JA 2YWEA 1HNXF 4FF1A 3AH6A 3HVRA 2HG4A 3CCJS 1IJEB 1S0VA 3AHPA 2R7VA 3IWLA 2FC8A 1R8CA 4NLYA 3N01A 3ENQA 5G0RB 5KG2A 1L3VA 3HP6A 3G6VA 2L41A 2IRXA 4QPTA 2KH9A 2R2SA 3OLAA 1JLQB 2C2RA 1U25A 1VQNS 5IWAF 3GWCA 1S6QB 1V6HA 1RTHA 1S6OA 3C6UB 4C8LA 1C4AA 1QAYA 2YNHB 2BVZA 3GV8B 2GO8A 2K1RB 4OZ1A 4WFZA 1HNVA 2HNYB 4QIVA 4C8OA 1FNOA 4F3QA 1FRMA 1TL4A 4RLEA 2AWZA 3G71S 1NEEA 2XMTA 1OSCA 3KLIA 1XTZA 1BQMB 4YR2A 4IKAA 4A8KA 2ZBIA 4CTAA 2EWHA 4DV0F 1YRUA 1FDDA 3BGLA 3J7ZT 5F8LA 1PGZA 1FKPB 3D0IE 2C42A 5J2MB 1KONA 2CQCA 2PGCA 3O6QA 4YY3F 1S0NA 4JYAF 1MU2B 2VUGA 1DLOB 1M5PC 1SL2A 2HQ3A 3BGFA 1FRXA 1AFJA 2MHEA 2ILYA 1VC0A 3KLEB 3K0JA 1EETA 5D4PA 4KTQA 1NK8A 3KNAA 3QLHA 1XMOF 5KFLA 3V4MA 1S72S 4CNZA 1VLYA 4GO7X 4BHQA 1VQ7S 5L9NA 1O5JA 1TUVA 3M1VB 2CPYA 2WK4A 4L72B 2PI4A 2V4JB 5J1PA 4NLOA 1HR0F 2HQIA 2I2YA 2PMZD 1L5UA 2JWNA 2ALZA 2Q1LA 3TI0A 2ZD1A 3TAMA 2LU2A 3HPOA 1C1CA 3M2UB 1BQNB 1FEHA 3KG4A 5KOWA 3PW4A 3IG1B 5AXLA 2Q43A 4FXDA 3UWTA 3MTJA 5C42A 3VAGA 3F73A 3G96A 1N0VC 2LXUA 4C11B 1T05B 3DHWC 4DN9A 5EGYA 5IQ6A 3PO5A 2XNRA 2M0GB 2XMKA 3BF4A 2AD9A 1WTBA 1WG5A 3IN5A 3TO8A 2MQPA 4RW8B 4ECTA 3K8VA 3VAFA 2C3MA 2LQ9A 2RNEA 3WC0A 2CJAA 1SV5A 2MQLA 2VC0A 2Q3PA 5KFXA 2W7AA 3DC2A 5C42B 3DOLB 3MM5A 4G1QB 4O3SA 5LJ5Y 5K8PA 4N56A 5A6WA 5KT2A 3X1LB 2LA4A 2FVQA 3DRRA 4D3HA 3S01A 4MKBA 5L8RC 3I32A 1FDBA 4B02A 1SB6A 2J9DE 5CYMA 4JV0A 5E3AA 1RT4B 2CQ1A 2KM8C 4IYQA 3OUYB 5DQHA 3H5XA 4DSIA 1L3UA 4M5DA 4WU2A 1KOOA 1X4FA 2YKOA 4CO5A 3I96A 5GAHU 5IS2A 3BDPA 4OHZA 2MQMA 2OMOA 5JUMA 5ITHA 1Y9OA 2AW0A 3I56S 1I94F 1WEZA 5HBMA 4R8UA 2AU0A 2IA6A 2XSFA 2XMJA 4WFBQ 2QFJA 1S97A 4DF4A 3J7Z5 1MU2A 3E01B 2O1PA 3BSNA 1T95A 1S1XA 3D28A 5DO2A 1HW9A 4F2SA 1IR0A 4PKDB 1TKXB 1JLFA 2BABA 2FHJA 3QZ8A 3MM6B 5IXUA 3I0RA 2XLKA 2CQHA 1YTYA 1VRUA 2AV5A 3ONQA 1RISA 3T1AA 3RZAA 3WDOA 3GFYA 5LXYA 4ELVA 3US5A 2YNIB 3KMSA 1QVFR