5L39A

The structure of the fused permuted hexameric shell protein msm0275 from the rmm microcompartment
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
AELRSFIFIDRLQPQTMSYLGTWIKGALPRANMAAQIIEVAPGLDIEGVTDVALKHAEVKAGILVVERQFGYLEFHGETGAVKAAADAALDYLGGDPDAAVRPEILASRIISSIDHQHAFLINRNKIGSMVLPGESLFVLEVAPASYAILATNEAEKAADVKVVDFRMIGATGRVYLSGTEADVRQAADAARDALAVLQGAKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords RMM microcompartment shell protein MSM0275
publication title A Complete Structural Inventory of the Mycobacterial Microcompartment Shell Proteins Constrains Models of Global Architecture and Transport.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l39A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l39A02
5LSRA 3I82A 3FCHA 3I87A 3MPVA 4HT7A 3U27A 5LT5A 5SUHA 3F56A 3GFHA 5L39A 4HT5A
chains in the Genus database with same CATH superfamily
1I94J 2LQ5A 4KGMA 2HQ3A 2QMWA 2KM8B 3UW1A 4M8LA 1DQAA 2WW8A 3B4DA 2PEHA 1NM2A 4JYAF 5HAOA 2JFDA 5D78A 2MZ1A 3M8ZA 4Q0BA 1C4AA 4DR4J 2FVQA 3LH2S 2GJ2A 2CQ3A 3GFZA 1F3VA 2W01A 1HD1A 4QWCA 4CLSA 4KHMA 1O51A 2C2DA 3CJ4A 3HSDA 1ZOTA 2BVZA 4HDHA 2GCFA 2DISA 1WF2A 3BPSP 1VOMA 2YY3A 5KFFA 4EUVA 4ZDNA 4MMOA 3B6BA 4RJVA 1A9NB 1U26A 4Y34A 3AXMA 3M9MB 1YRUA 1NK0A 1PGZA 4MIWA 1UVJA 2XNQA 1VQNS 4Y2MA 1HWLA 4IFYB 2BJ1A 1IJEB 1S9GB 2XULA 2YNHA 3B4MA 2NPFA 3UN2A 1HI0P 4JI0J 2V8VA 1LWEA 3PVXA 2KTQA 2DNZA 5KFXA 2KFNA 4AQYJ 3DRSB 5C5JA 4BBYA 1JXVA 4CLLA 2CJBA 4JV5F 2AJFE 4DV2F 4M5DB 3Q8QB 2KKHA 1C0UB 3PJWA 1TK5A 1XMQF 4KJIA 2DEJA 3H4BA 3ICLA 3TP2A 2NXNA 3QGIA 5J2MA 5B0GA 3UI3A 1P1LA 4DL7A 2M88A 2C2NA 5M2UA 4HI2A 1VK8A 2VQFF 4L75A 1YJNS 4RBTA 3T9NA 5KFCA 3U27A 1SH3A 3BR9A 3HVWA 1OY9A 2PE8A 4WU2A 2RUSA 2EWHA 3VR1A 4O44B 4YMEA 2I1RA 2MXYA 2BBEA 4IG0A 2HIYA 5AE3A 3AH6A 4CDIA 3GYGA 4PWDA 4RWXA 4ERDA 5IZHA 5JVGQ 2KDOA 4OJ1A 3SI8A 3M32B 4AXJA 3PW0A 2OEJA 2J76E 4J9QA 4OHXA 2VA2A 3QPIA 2HBQB 2EFQA 3TOQA 4DPXA 3HPOA 2QN6B 1SI9A 3H42A 3S8SA 4IDKB 4A8OA 3LANA 1EJ7L 4B9LA 2CYYA 2HHHF 2ZE2B 5B0AA 1Y10A 2HSEB 3BQ0A 1HBMB 5A2QU 3FEXB 3RRKA 1FWLA 2WOMB 3TZWA 2XMUA 4W4MA 2HHVA 3NKYA 1IWGA 2LA6A 4B3RJ 1U1NA 3LP0B 1PJ7A 3CC2S 1RAHB 3PKYA 1I6JA 2FHOB 3MR3A 1O5JA 1VRQC 3I87A 2QA1A 4DLEA 2DR7A 1KOOA 4K0KJ 4NXNF 3T5LA 3AD7C 2EBGA 1YJ9S 4FKXA 4JI2F 4CLWA 4AT1B 1PC5A 1S1XA 1J5EJ 5KG6A 4TYBA 1C1BA 3MMBA 4LRFA 3KYLA 3R1HA 5D3GA 4M63A 3NS5A 1N56A 1XNQF 2XG8A 4MT1A 2V8DA 4MJKA 1CEZA 5ETVA 2DH9A 2KG1A 1HLWA 3BO3A 3D54A 1EKRA 3N6NA 4Y3CA 2DCUB 5C2GA 4DUYF 3HD2A 2ABYA 1U02A 2Z56B 1IR1A 4J9PA 4C0OC 4QJVA 2VONA 4EZ6A 5KFVA 4YP3A 1BC6A 3HHDA 2HPUA 1U45A 5HQ8A 1RCOB 3R5JB 3IAM9 2Z2LA 2JC1A 3BB5A 3N4WA 3DMJA 3QNWB 4RNMA 4USWA 4PQUB 5LJ3Y 3MTJA 1TFYA 4CYUB 4M5MA 4OFZA 2ZOMA 2XYGB 1S6UA 1RKIA 4FDFA 3ITHA 1KVJA 3HK2A 2Y1RI 1NKBA 3FQLA 4G6VB 1XC9A 3PG9A 4R0EA 4LR8A 2V9KA 3PYDA 2EFNA 3OSNA 1D9AA 2V34A 2V2ZA 2WVFA 2ERRA 5JJBA 1R0CB 1OSDA 3ZFVA 1S9FA 1SVDA 3W62A 3PW7A 3P6YC 4RW4B 2ZZNA 3CMAS 2Z4PA 4LBPA 4EU0A 3AHPA 3I5CA 1YSJA 1HQUB 2V8HA 5F9LA 1LW2B 3PHEA 4NLTA 3RRHA 3T1AA 4KHRA 4C6AA 4DG1B 4DSLA 1KS2A 3M1VA 1WHWA 4OHVA 1RJJA 2GVDB 2F4VJ 3P5TL 1ZPVA 3V2UC 4ZVSB 1P8GA 3F56A 3OFEA 3QT6A 4USMA 2WVBA 4OZ1A 2FUG9 4DR6J 5DG9A 3RJMB 3LW5C 3TEHB 4CO0A 2D3ZA 4J9OA 5ETSA 1AB8A 2DPIA 3AJDA 1E6YB 4X4UA 1PAEX 2QGFB 1RWPB 2Q43A 2DGOA 2W8LA 4OYMA 2DITA 3GSDA 4X66J 3CXCR 2G0JA 1VDHA 1KNZA 1G4CA 2GZOA 2N7CA 5T41A 1URNA 3LQVA 1Q82T 1IXKA 4H4OB 3ENWA 3PRVA 4K4SA 2ZH6A 2OJ3A 1MU2A 1N5SA 2FHJD 4TQSA 4X64J 1SUQA 4QIGA 1YIJS 3BDEA 2LXUA 5CD4H 4N41A 1MWYA 2V6AA 3GIRA 2MB0B 4RW8A 3WQPA 2LLZA 4DF4A 4KSEB 2MMYA 4BHQA 4U8YA 1KD1T 1FE4A 1OY8A 3WX8A 4P72A 4O4GA 3M8PA 3BYPA 4IRKA 4K50A 4J9NA 1S49A 3HHLC 4I2QB 3HXMA 3T3FA 4RW9A 3TWZA 2UU9J 1VQMS 3D6TB 1HNZJ 3M2VA 2YWEA 4PWWA 2C22A 3TZYA 2KFZA 3DLEB 4ZVHA 2W2MP 4GO5X 3P96A 2G9OA 3Q0AA 4YHHJ 4DX7A 1YRXA 2FJAB 2MKIA 1ICEB 2MZJA 4GVBA 4FVMA 1FWKA 1RSCA 2HBYB 3N0VA 4Q5VA 3FQKA 3GWCA 4CNYA 2JH3A 2GIFA 1TKDA 2Q3PA 4ZMMA 1RAFB 3OR1B 1P6TA 3VHQA 1OJ4A 4W98A 4LF8F 5DLGA 1ZZNA 1ULRA 2E1AA 4NLDA 2LQJA 3GCXP 4M5KA 3D0IE 5JVHQ 4V19J 3AB2B 2QL5B 5A8KA 1MMLA 3F0NA 3M9NB 3QLHA 1HBNB 5IFMA 1HI8A 1BMQB 1LKZA 4XIUA 2KZZA 1S7IA 3V5RA 2MKJA 2R7XA 2OFHX 3BH7B 2M8HA 3CO0P 1IJFB 1U1LA 3K8WA 2CVIA 4XTTA 2MQNA 1FNXH 3AJ1A 3IM8A 1RU2A 4EMDA 4NCAA 1GMWA 4ZLLA 3MD1A 1SC1B 2YBVA 4PAAA 1VK3A 3U7JA 4H54A 1WWHA 2YNGB 5L8RC 5G4DA 1JLAB 3DLJA 2MYFA 4I67A 2ASDA 2I9SA 1QDUB 4C8YA 4ZCMA 1IQZA 1ZA2B 1RHKB 2KVQE 3BBFA 3KHRA 5KT2A 5C2CA 3KLEA 4N56A 4DSJA 2MQOA 5AXKA 2FGCA 5FD1A 2CNNB 4IH7A 1DAXA 2DB1A 3LA0A 4C8NA 1IBKF 3CIZA 4NX9A 3MUVP 1O8BA 3FFIA 1NNDA 2UXCJ 2LU2A 1IBLF 2ZJRQ 3DGVA 4KIAA 4DR3F 1DLOB 2QTWA 1CC7A 2E1RA 4FS2A 1N88A 1Q81T 2DNKA 2W9BB 4OYOA 3DRPB 1VHIA 4JI4J 1JLBB 3MF5A 2MHEA 1OQ3A 3MFHA 2WBMA 4W90B 3UFCX 4HLBA 4KRWA 1RADB 3O2IA 3V4IB 3THVA 5FIIA 5K5MA 4I6WA 4OYBA 2CQ4A 5FDLA 3DLGB 1HNIB 4XAKA 2AJ1A 2E7WA 3FKBA 5GAEI 3MEDB 1RAEB 3ENVA 1N5YB 4RX6A 3M30A 1H74A 2OPPB 2YX4A 4DL6A 2AGOA 1SKRA 2QA4G 1S0MA 1ZTWA 3SCIE 4K8RA 2PEBA 2CVEA 3GJQB 3BJYA 2UUBF 1LOUA 2FC9A 5D0RA 4YR2A 3H4DA 5C25A 3QYYA 3QIDA 3LF0A 3A3PB 1D3WA 4JI1J 2XWYA 2L9DA 4ZS6A 4B3SF 1T9UA 4ZP8A 4A46A 3NG8A 3NCQA 1YJUA 1FKPA 3VQTA 3D66A 1N54B 3AFGA 2RQCA 3G71S 3GR1A 3PX6A 3GV8B 4PXCA 1YBTA 1FVQA 1AUDA 1SB6A 2LQ8A 2BANB 2JOQA 3TNVA 5DQGA 2ZBIA 4CLUA 1NDPA 3W63A 3P8BB 4QWAA 3FBEA 3PY8A 1NPPA 3HHLB 4OV6A 3EGNA 3V6DB 4FN5A 1TUWA 4ZLJA 2BKNA 2PA3A 1WI6A 1T9WA 1I3OB 2M4MA 4RW6B 2GJIA 3PACA 2RD5C 2XLJA 1PIEA 1SL0A 5DETA 4Y2CA 3KLHA 1C4CA 2EG2A 1NDCA 2XGPA 5CABA 3BGOP 3HVTB 2Q6CA 3L7PA 4HACB 1W7WA 2DGSA 4DQPA 4PG6A 3N5FA 4C4WA 3CMQA 4NZ7A 1TL1A 1NK4A 3PYFA 5B0CA 4LSLB 4WP9A 3OHAA 2BMBA 2MKSA 5L39A 2DXDA 4JV0A 1GTEA 4OL8A 1IUJA 2WSCC 1H2VZ 2HFOA 4KFBA 1N32J 2DHGA 3SIPB 3G6VA 4ZPDA 3DOKB 2APOA 4V19X 2F7VA 1S59A 3OSPA 4DQQA 2D9OA 5B0EA 3KLFB 3A8KA 1WG4A 3DFEA 1U1OA 3T5HA 1VQYA 2E5LJ 4R5PB 2AEFA 4B02A 2F65A 1N33J 2LEPA 4ECTA 3R5BA 3AQPA 3GG0A 1APSA 3V81A 4DV6J 1I94F 4JI7F 2R8IA 3E01A 3HF5A 4CLPA 3M8YA 3UDVA 3B78A 2ZUGA 1TU0B 3EPGA 1T11A 2G4BA 4KGZB 4ED5A 4CH7A 4DCOB 2ZITA 5L38A 3J7YU 3D67A 4A8XA 2MKKA 1Q53A 4X4RA 5F3ZA 1WHXA 3FZ2A 3IBFB 2AX1A 4KKOB 1M5SA 2OPQA 4C7QA 2H5JB 3GFYA 5IC4B 2MQMA 3CE8A 1MN9A 3AOCA 4FNHA 2XSFA 3NS6A 1JLQA 1RTIB 5HMWA 2CPIA 5KFEA 2QL9B 1J5OA 4NA2A 4F4KA 2BJ8A 1U09A 4KC5A 2DNGA 3OUYA 2Y1JA 2IC3A 2MZSA 2NS1B 3SXLA 1F3FA 3HSZA 4A8SA 2VV5A 3ENAA 2YQ0A 3AOBA 4DFMA 4YUDA 5F8IA 1IM6A 2KJVA 4USTA 5KFLA 1WDTA 2QIFA 2CQDA 3WZ0A 4KO0B 3IA0A 1SQGA 3OFHA 3VGVA 2HVDA 4N47A 4NLQA 1FRIA 1KLNA 1REVB 3KLGB 2DPJA 2YKAA 2R42A 4DV1J 1DHMA 2VASA 2V8GA 3RAQA 3EVWA 3OBIA 4DSIA 3CJTA 2OEMA 2HHXA 2Y8YA 4C2MA 4AQYF 2R7UA 1DFDA 1WI8A 2J7UA 1PILA 3R5AA 2G2ZA 4MK7A 3G8TA 4WIIA 1C2PA 4L6V3 3UWTA 4CM2A 4B9MA 1CJUA 2EG1A 7FD1A 5T7LA 4BS2A 2E5JA 4ZP6A 5FLXY 1CPZA 4CO2A 1YQHA 3KJVB 1N6QA 4I2PB 4NYPA 5HN0A 4ICLA 4DS5A 1K1SA 5IM0A 1MMDA 3ZZ0A 3M2RB 3LUYA 1WSVA 2IHR1 3EICA 5DDPC 3M9OB 2KH9A 3W8GA 2BW7A 2C2OB 1T05B 1FJEB 2FJWA 3OR2B 4DXLA 3NNAA 4B3MJ 5J2NA 5D0EA 1RT1A 1RABB 3K58A 3E51A 3GMGA 1NSPA 1LW0A 5DGBA 3C46A 1SJ1A 3NAIA 1KKHA 2JJ4D 3CB4A 2MLZA 1L3UA 1VRTB 4RU9A 3KHHA 2FD2A 1VJWA 2HWTA 2LCWA 3NCRA 2QMXA 3JQJA 2FYXA 3VAIA 3FMBA 1S6PA 5DM6Q 1HPZB 1O6XA 3ETMA 4OZ5A 2HLUA 5KFPA 4J90A 2H54B 2N82B 2DH8A 1CULB 3SV3A 4Q43A 4CT9A 4KAIA 2DR6A 4TY8B 3QGPA 2CQPA 2IRUA 4F0KA 4AL7A 3TA2A 3GV5B 2PMZD 1HWKA 3UD3P 3Q8VA 2XZTB 3BZQA 3TJAA 4K0KF 2V50A 1GNKA 4DX5A 3EJMA 1FFGB 1Y4ZB 2G0CA 1J5EF 3DGPA 2C2KB 3NOCA 4MTPA 1T03B 3VZIA 1CS4A 5I3UB 2WBRA 2K3KA 2NXUA 1NH7A 1RHMB 1KDNA 2ZD1B 1FJGJ 4ED6A 3PYGA 1LK5A 4ZITA 2RU3A 2NXCA 2OELA 2YPZA 3ZO7A 2BYCA 5HK4A 2ASJA 3Q8SB 2IA0A 4W92B 4E2FB 1Q7YT 2HW3A 1H6KX 4O3QA 3SDEA 3MM7B 2AYGA 2KB2A 4RUAA 2W7AA 4CI0B 4UQTA 3DOMB 4KV8B 1WKLA 3TANA 4LIRA 1PBUA 4P2SA 1DQ9A 1LWCB 3RBXA 4UOGA 4RU2A 2DRDA 4OQJA 1BQMB 3TVYA 2DT9A 1OYDA 1Q78A 2CQ1A 1LXNA 1UEUA 1RTJA 3KXDA 2DXEA 4USKA 2MQ8A 3DM2B 5A2QY 5K14B 2B9EA 5IV4A 1HFEL 1RHRB 3G9CA 3MOJB 2W2NP 4WXWA 3OL7A 5F3TA 4ZLNA 2CA9A 4IFYA 3RAMA 3JQMA 2O1PA 1SH2A 1S9GA 4IOAQ 4AYBD 2MY7A 2A0FB 4NXMJ 4I4BA 2A10A 4YS2A 2KRBA 1QAJA 3W65A 1VHFA 2P9EA 3M8WA 5LSOA 3DRSA 4FVCA 3N5BA 4R8UA 1DARA 4M5DA 2F4VF 1C0UA 4RLEA 2K1RB 3HI9A 2WSFC 1WACA 2FVRA 3DDKA 2RDJA 4A4JA 3CO9A 1KONA 2MQQA 2EKNA 1IKYB 4DR6F 3K5MA 4ELTA 3PIOQ 2BDPA 2UUAJ 5IV3A 5D0GA 1WOSA 4O44A 2VJUA 1ZM4A 3D7SB 4X66F 2BEFA 4F0HA 5DRKA 1ZETA 1RT5A 2CPJA 2JEGA 2G2OA 1QAIA 2NUHA 1VQKS 2EI5A 4Y2IA 4ITSA 4FF1A 1UKUA 4YY3J 3K89A 3MOZA 4X64F 1NHUA 2PMHA 2NREA 4H4MB 2B7BB 1RWUA 4DL3A 2ZE2A 4NWBA 3W5ZA 4CO3A 1UJ6A 3B54A 3NL0A 2WOMA 3V6HA 1H7WA 3IFEA 3L7OA 4WZQA 2UU9F 4UOHA 1R8BA 3FRYA 4RKUC 1WNEA 2FLPA 1HNZF 4QR0A 3LP0A 2ZH4A 4WCEQ 2BJ9A 4WKYA 3IRWP 2JC0A 2PFFB 1T9VA 2CPZA 3BGRB 3OVBA 1JWWA 3J7ZT 3KJQB 1GXTA 1FRHA 3I4HX 3MCOA 4I64A 1B99A 1JJ2R 2PGCA 1BXNA 3CD5A 3W60A 3R97A 2XHWA 3R2CJ 4O3OA 4QW9A 4DFKA 3H5XA 2YQ3A 2VJVA 3KK3B 4BWJA 2RUGA 1V6HA 3PYEA 4E8UA 4KE5A 4K5SA 5I4MA 1QUVA 2NZ4A 2RS2A 3WX4A 1FFWB 3HFZB 5SUHA 3M6VA 5A6WA 5KFQA 5LJ5Y 2JZ5A 2D3UA 3NGKA 1VR6A 1S7HA 1ELOA 2P6SA 3H20A 3Q86A 4FXVA 3C6TB 2DNOA 1QE1A 3GZ7A 2ZM6J 3PO5A 4LFAJ 4WU3A 3QWPA 4LR7A 2IFXA 2WZ1A 3KK2A 1JQGA 3MR6A 4CYUA 3EZUA 2B4UA 1LQ9A 3CDWA 3ZZZA 3QWUA 1NUEA 2KFYA 4I68A 2AGQA 2XMKA 2BKOA 1VBKA 2C42A 4ZPVR 3EUNA 2NYIA 2ZBCA 3IP0A 3MECA 1KOHA 1XTZA 5THWA 2W2OP 3M8QA 4RW4A 2PI4A 4JP8A 4MK8A 1FX4A 3NCPA 2RH3A 3PV8A 2BR0A 4ZVPB 2XGQA 1LW2A 1YITS 5DZ7A 5A76A 3OTBA 2F8EX 4Z37A 2C2ZB 1JB0C 3QO9B 2ZHBA 1S79A 3AD8C 4USUA 4X62J 1T9YA 1TL7A 5J1EB 2ZFHA 3JTOA 3POTB 1BWVA 1F5CA 3K5PA 3UCZP 2I5JB 4P2MA 3JYTA 2J0SD 1X4BA 2NCKL 1XMOJ 3W8PA 4DFPA 4QBUA 2C2RA 3ZXWA 1NJIT 1HHTP 2CPHA 2W4PA 5AE1A 2DKOB 4AL5A 1CG2A 4B9SA 1S1VA 4JB8B 4OZNA 1TKXB 3HSJA 3SQGB 4F0MA 4ZN3A 4H4OA 3P49B 4NLXA 5G0RB 4O3SA 5KFUA 8ATCB 2WONB 5KFYA 3D9BA 3RRGA 1PYSB 5CCLA 1FT8A 3LALA 4NLRA 3ET6B 5IXUA 1XMQJ 4YFUA 1SPBP 2R4FA 5A8RB 1N4LA 5L1IA 3FNNA 2MQPA 1T3NA 1ZH5A 3HKZD 4G3IA 3ULHA 4NCGA 2POKA 2E1PA 3U1LA 4JI1F 1JLCB 5IT9U 4ANEA 3CC4S 3QBCA 2V2KA 4ID8A 1ZM2A 2CNKB 1T02A 2J6TA 1RU1A 3QJJA 3PEJA 3BKUA 3SCLE 1NB2A 2DH7A 1F9HA 2EC0A 2AEJA 5E3PA 1SV5B 3OLAA 1EHWA 3HZGA 1T95A 2KG0A 2PIIA 3I31A 2NSCA 1HHQA 1PG5B 3M05A 3R6LB 2W8KA 3WIUA 2GV1A 4FP9A 5ETKA 4TYAA 5HP1B 2HHHJ 4ZVTB 3OR1A 4WFBQ 4UUXA 1RQ0A 1R0BG 3A8IA 4AL6A 4DSFA 5K9FA 5CA5A 1HWIA 4A47A 4X4OA 4B9UA 1U25A 3HZEA 3KG1A 1HIYA 1HBNA 4CIOA 4A8FA 3PZPA 4L72B 5ETNA 1S1WB 2KHCA 4BWMA 4KYZA 4K4XA 5M2PA 1XIQA 2J7KA 1N32F 3GYNA 2V2QA 2G0IA 4ES1A 4Y6IA 2EKYA 2A6OA 1U6BA 5GAEU 2A2DA 5A8WB 1RT4A 1CJVB 2CQIA 2WK4A 1IKWA 1XNQJ 1MG7A 2E5LF 2CPDA 4DPUA 1JLAA 4ECZA 1FE0A 2JWNA 2OPRB 4PABA 1N33F 1BY9A 2GX8A 3MAAB 1BQNA 3IAS9 2IBKA 4DV6F 1FJCA 4DUYJ 3MWBA 4PUOA 1EARA 2HBZB 3K5OA 2X1AA 4UOFA 2XO7A 2W2PP 2V0NA 3D6FB 1S10A 2ZDOA 2QL7B 5EX3A 2RHQB 3PRBA 2LXIA 3QAUA 1DLOA 1U6FA 2DYAA 4QYZJ 1ZPWX 2DIVA 1JX4A 2W9BA 4TXSA 3Q8RB 2KZMA 2HYIB 3DRPA 2PFDA 2E5GA 4UTGA 1JLBA 3RAXA 1YWXA 1RT7A 1WJ9A 2Z30B 2VA3A 1K9MT 1U1PA 3ZZOA 3P5BP 4ETXA 3MPDA 1HNWJ 2B6AB 4E98A 3ISNC 4ZVQB 1N0UA 1ACMB 1U1MA 3V4IA 2GJFA 1UFLA 5KFAA 1QSSA 4CLTA 2MPUA 3DLGA 4DMZA 4DI6A 3NOGA 2AV5A 4DV7J 1EETA 4NPOA 4MYUA 2YNFA 4CO1A 2XYHB 2CQ2A 2HNDA 4C8ZA 5KT3A 2BJ7A 5KOXA 4LVOP 3MPUB 3MR2A 1QTMA 4DL4A 3K17A 4KHPJ 3HLUA 2WHOA 3C16B 1AT1B 3EGWB 1YRTA 1RAAB 1WORA 4GKKF 1RKJA 2E9ZA 2F40A 2EPIA 2RDIA 4G1QB 2YTCA 1RT3A 2J9DA 4A8WA 1U1RA 1TMJA 2WB4A 2UV8A 4KH0B 4A48A 2GVZA 4C0HA 3BGUA 5L1LA 2J6UA 4OI2A 3IM9A 3GIMA 3V6KA 2BANA 4PXDA 1CJKA 1F9FA 2LEAA 1UVIA 4BDPA 5L9NA 3G87A 2VG7A 2JEIA 1J27A 3IMQJ 4B3MF 2WB1D 3VCDA 3LP2B 2IM1A 4NLVA 1C1CA 2BRKA 2GHVC 5AXMA 5KFMA 4U95A 2FJEB 2R2SA 1B0TA 4IR1A 2HLTA 4X4PA 2CPFA 4FKYA 4HEA9 1FKAF 3IN5A 3D4JA 3D68A 3HVTA 1MROA 4U67Q 2V68A 2VB6A 3PRDA 5KFRA 1F0XA 1GXUA 2C3MA 3E8OA 3EDRB 1R0AB 3TO8A 1R3NA 4YEAA 3ETOA 3BGFA 2GC8A 2K2PA 4NYZA 2EC2A 2MGZB 4DZDA 4B3TJ 3OT9A 1VQ9S 1FDAA 2DGXA 1JNRB 3AODA 3KLFA 4ENOA 4PPZA 2JLEA 4R5PA 1S1TB 4DR7J 1HQEB 1HBUA 4LF8J 5LM7E 3QGGA 4LREA 1U4BA 1I5OB 3SMZA 5J2PB 2KO1A 1QUPA 3GE9A 4HR2A 1IM4A 1NRKA 3GFXA 3R7NB 2AYBA 2ZH8A 1FJGF 2KI2A 2YWGA 2NQPA 4ZIVA 1SQFA 4HKQA 2EBEA 2BE2B 2AT1B 1EP4B 3HHLD 1VIOA 3M2UA 2HRUA 4ZPTR 4IFVB 2RKIB 3T5JA 3KHGA 1YG0A 4CLKA 3MAQA 4ID5A 4PG7A 2HAFA 3B82A 2VG6B 3ZZTA 1RTIA 2RDDA 2W9CA 1H98A 2G13A 4X4NA 2R7OA 3UD4P 5CYQB 3FSXA 3G4SS 1U48A 4ZPWR 2ZH9A 1RI7A 5LXRA 3FEYB 1A7GE 4EO6A 3D6HB 3SSRA 5E3RA 4R25A 4P71A 1H73A 4TLRA 3SSSA 2OPSA 2V69A 4FF2A 1RBLA 3FZBA 2HFUA 2WVDA 4NXMF 3V6JA 2ZKUA 3MMCB 3KLGA 5HANA 5A0YB 2ADBA 2NLWA 2VDHA 2C2EA 1N52B 4NZ0A 1ZS6A 4LR9A 2BQRA 2BA9A 3PX0A 4ZOSA 2AX0A 3LPEA 4DR1F 2OI2A 5KG1A 1BLUA 1D1UA 2HFZA 2KT2A 2Y8WA 3T1HJ 2AEMA 4URQU 5LMUF 3DRRB 3N28A 4RBUA 4C11A 2IAJB 4GO7X 2HMIA 2EFVA 5IOLA 1UCNA 1LXJA 2F63A 2RS8A 1XQIA 3MR7A 1RBAA 4LF6J 3DLBA 1WEYA 1U8SA 5L9XA 4KGKA 4I2PA 3TUZC 1ROFA 1N5VA 2B56A 1PJ6A 3CJQA 4Q0BB 2QFIA 3ZTQA 2HFSA 2YKNA 5HROB 4OYAA 3MFIA 2K7JA 1HMVB 3OR2A 1SL1A 1D9FA 3NRBA 1W2BR 1T7PA 5C42B 3RW7A 2IMOA 1QD1A 4WE1A 1EQ0A 4IH6A 1BD6A 3IGVA 3FBFA 5KAKA 3T1YJ 2A18A 2B9WA 1QSLA 2DJWA 1VRTA 1SBRA 2XS7A 5DS7A 2JRSA 1P27B 4RBVA 1SIWB 4B3SJ 1LNQA 2H4YB 1N34F 4F26A 4TLQA 5ETPA 1VQPS 3J7YI 1WUUA 3RBEA 1HPZA 4HYKA 2HK2A 4GRSA 3MPWA 2DGQA 4LFCF 3J80U 3BSCA 2YNHB 4B17A 2PD1A 3DOLB 1LWEB 5HSPA 2HIQA 1U0SA 1RLDA 3MZIA 1S0VA 3EYZA 3LGHA 4DV4J 1WC6A 2H3EB 2ZZTA 1TR0A 4CRJA 3I5AA 4DR2J 3CNQP 4DWIA 3UVJA 2KJWA 1H3DA 2B0GA 4DV0J 1M5OC 3ZZUA 1UA0A 4CP5A 2Z0GA 4USHA 1VBXA 5KG2A 1NLKL 1NEEA 4IRDA 2XI2A 4ILRA 4C3LA 2ZBQA 4M5NA 3LGNA 1OQ6A 2AW0A 2H4WB 2YX7A 4NA1A 4OLOA 3R7SB 3EWGA 3CJKB 2V94A 5L1JA 3JSYA 1D8ZA 2ZJQQ 4IG0B 4PWDB 4WTOB 3EVMA 2OTLS 2R8KA 2KHDA 2HQCA 3GB0A 4R0JA 1N0VC 1RT2A 2HNYB 3JXOA 3GPAA 4NI2B 3F44A 2AU0A 2O5DA 4HHHA 3K7RA 3R3TA 3MM7A 5D15A 2R3VA 1F2GA 3CVKA 4CLYA 3IG1A 1B4SA 2OTJS 2QYGA 2JVOA 5H9FK 4DX8H 3K0JA 1X4DA 2VL1A 4LFAF 3NGRA 2KXFA 4OZLA 1WELA 1LWCA 2ALZA 3A3NB 2CWXA 3MM6B 1FF2A 4IQMA 3DDIA 1FESA 4NCBA 3DM2A 5K14A 1FXDA 3GCWP 2KT3A 4Y2AA 3LGMA 3T19A 4ECQA 4JI7J 2JEJA 2CDRB 1U49A 5DQHA 5FLXU 4O23A 3N9UC 2R7QA 1YVFA 3HSGA 3CCWA 2XHCA 4RUCA 2QJ3A 4Q45A 2O01C 4WWSA 1WTFA 1G7CB 1YZ7A 3KK1A 2YWWA 1MW7A 2C1EB 4KGVB 3NXZA 2FVCA 2FQQB 2MZRA 2IM3A 1E6VA 3W9HA 2DNHA 2IBOA 3KJNB 1UMJA 1C1BB 3MMBB 4CCHA 1YJ7A 1VQ5S 5D3GB 4DU8A 2DXFA 2DBBA 2K1RA 4DOZA 2DNLA 4YR0A 1HBOA 2YWFA 2GGPB 2ZH5A 3NGSA 2BRLA 4X62F 3LTOA 5CYMA 1TKZB 3R2DJ 5H9EJ 4I7FA 2JLFA 1S0OA 1SJRA 4F04B 1XMOF 1FXRA 2E1CA 3VQSA 4K4UA 3MDFA 5E3CA 5C24B 3C15B 5B08A 3DRYA 3JQKA 5HMXA 3NWGA 3BBBA 1D0EA 2ZDPA 5EWEA 9ATCB 1RZMA 5DJBA 1O0PA 1HQ2A 4MFBA 1RLCL 1UEVA 3DMJB 3W9JA 4DL5A 2MJUA 1M5HA 2YKMA 2XMMA 3NGDA 1PYTA 3CCSS 4OX6A 2VPWB 1PO6A 1YBAA 3ITHB 5A6PA 3KHLA 1JXLA 1FNOA 4FYXB 1V3SA 4F3OA 2HWIA 2VC1A 2WVEA 4H4MA 4KH1B 4OLPA 1UZDA 1R6VA 1VMBA 4USIA 3WDOA 3ILLA 2W4DA 2HHQA 3RZAA 1RYRA 2QYCA 3EMTA 1OYEA 2CG8A 2I38A 5ETQA 1S4EA 2R7WA 2AQ4A 2W24A 4N8NA 1NDKA 4B3OB 2P9GA 2JFKA 1NJWA 1KQSR 1URRA 3M1VB 2D7SA 1MNEA 3PJXA 3K2YA 3BGRA 4M5IA 1X4CA 5DG8A 5I42A 3I55S 1B7FA 5B09A 2K06A 1SXLA 2GAHC 1DJ0A 4NMXA 4P10A 4ZPBA 3A12A 4EK2A 1RA6A 1UWBA 2GS8A 5J2QB 2AF6A 4ANDA 3KK3A 3GV7B 1KVKA 3I6PA 5KT5A 5LMNJ 4P52A 1CQMA 4ZP7A 1RE1B 4ECWA 2KU7A 2XM3A 4P7TA 4ANCA 1OY6A 3FCHA 5DLFA 5K8PA 4NOHA 2ZH1A 3QRQA 1TL4A 2C3YA 3ILOA 3TARA 1VBZA 3VWSA 2Z2YB 4LRAA 1TVRA 1HHSA 4NMLA 2DGVA 2R8JA 4LUBA 2RNEA 2F4FA 1T9XA 3C6TA 1WKKA 1JJ4A 2DTJA 1X0PA 2VPZB 1SUQB 2CJXB 3O44A 2OMLA 4RW8B 5HLFA 3C6UA 2IJRA 3G82B 2H5EA 2M9KA 5KFKA 4O4GB 2DR8A 3VVTA 4F36A 5IT9Y 5BJRA 1OS5A 5BYSA 1X8DA 3MGJA 3J81j 1KR4A 3M2VB 4IO9Q 1B70B 1RUSA 2J9CA 1RWVB 4M1KA 1DTTA 2JL9A 2J8SA 3IRXA 1Q16B 5IT0A 1RTHA 3KWMA 4GC6A 2LA4A 1HI1A 5KFJA 1NK5A 3DI6B 2V9WA 4P6QA 3OTOJ 2HK3A 4EFAC 1TMMA 5KFSA 4KTQA 1JLFB 3A8EA 1EQMA 2X7IA 2EFOA 3TAQA 1V3ZA 4WFNQ 3HM9A 1VQ6S 2V2VA 3NNHA 2B5JA 5FJ4A 3OHBA 3VAFA 3EGVA 2FHJA 3OXFA 1WC5A 2I5JA 7AT1B 1A6LA 4ALZA 4DFJA 4K7QA 2CPYA 3OJSA 2MLYA 3CCUS 2OP5A 1HNWF 3HJVA 2XLKA 5A8KB 3FCVA 1B0PA 4PXBA 2Z2MA 2IIHA 2XZDB 4DCPB 2P2CB 1CSJA 2M5YA 5HO4A 3MEGB 2DCLA 3HFKA 4URSA 4U96A 3TA0A 3FDSA 1KHWA 2ZWOA 3TW0A 4TVAB 2R7VA 3DXSX 4DV7F 1JLEB 4P74A 2X3GA 2ZZMA 5G0RA 2NPIA 4WTYA 1X5OA 2AP6A 1HYSB 4CH1A 3BDPA 4EEYA 2WONA 1FA0A 2HQFA 3ET6A 1XR6A 4KHPF 2DO0A 4NRUA 4DV3F 4QWDA 3MMJA 3EX7B 3NNCA 4J9KA 3BM7A 2MDAA 1NXIA 4CNZA 2DR9A 1UJ5A 4J5OA 3QIPB 1IKVB 5KFOA 1VFJA 5KOWA 1S1UA 5BR8F 3W66A 1U0HA 2XNRA 3DU6A 3KLEB 1FK9A 4OYPA 5IWAJ 2XLIA 2J7WA 2A2CA 1WSRA 3MHYA 4OI6A 3HHNB 3KOAA 2V8PA 3CD0A 3H5SA 2KVIA 4HTIA 3ZNUA 1UW9A 4XK8C 1GMVA 1N36F 4ZJLA 3OL8A 4DUZJ 2VH7A 2YKQA 2BQ3A 2XY7A 1UZHA 1IR2A 5E2QA 3FC9A 1Z2LA 5AJ3J 2GMLA 2GAGC 2IM2A 3WC0A 2RF2A 3LP1A 3R6GB 4ZLPA 4LRCA 2QC3A 4LF2A 4JI8F 4JI5F 1DTQA 2PT0A 5I3QA 4ZVFA 3OTEA 4F4WA 4ZK7M 3M30B 4CLZA 1REGX 1VLYA 1S1WA 3US5A 4ZHRA 4AUKA 4RPFA 4C0BA 2D9PA 2HS0A 5DGAA 2EK1A 1FERA 4ECVA 2L9WA 4ZJQA 3JS9A 4RNFA 1YBUA 4B3TF 1SKSA 3AY0A 2R7TA 1U2CA 4M5HA 1JKHB 3K5LA 1TUGB 4DPWA 2IPOB 5KG5A 2VKZG 3UCGA 2UVWA 4J7CA 4ED0A 5ETOA 1Y7PA 1H38A 4OYIA 1X4GA 5CYJA 4TU8A 1WF0A 2A1BA 1SJFA 3LOUA 2OFGX 2N7YA 3BBCA 1XBWA 4DF8A 4DR7F 2OPRA 3SYZA 4F02A 3PW4A 3MM8A 4N77A 2BACA 2FZGB 3LAKA 4WJBA 3TAMA 4WPAA 3PIPQ 2CRLA 3HKWA 3I0SA 5B0DA 1ZA1B 2I8EA 3MXHP 4XDCA 2GIRA 5EUHA 1FWPA 3MM9B 2M52A 3F41A 4FNIA 3VAHA 4HI1A 4OHWA 4UT4A 5HL7Q 1U2FA 2VU5A 1Y11A 2QA2A 4F4YA 4DUTA 4F25A 1L3TA 1FRLA 4PG5A 1DZ5A 3GQCA 2AKWB 2AJ0A 1Q8LA 1X4AA 4OV1A 1UTAA 3LPYA 2HZAA 1QLNA 2D74B 3KLHB 1B64A 4EYHB 3CWJA 2AYMA 3W64A 5E33A 1OPZA 3T41A 4DL0C 3W1YC 9RUBA 1FX2A 2RRNA 2O3DA 3ENQA 4QW8A 1Z2ZA 4OI3A 1TL1B 3J7AN 2VQEJ 2Y9HA 1RBOB 4IOCQ 1Q5VA 2ZWPA 1FXLA 2LEBA 2OHDA 4Q2MA 2ILYA 4OHZA 2RQ4A 3DLLQ 4KFBB 1FTCA 3A3OB 3HCXA 2KM8C 2B9XA 1UAWA 2C2MB 5GMKa 1T94A 1VQ8S 5GAHU 4IQXA 4ED4A 5L1KA 1U47A 3C16A 2XCPA 1GTHA 3S01A 4A8KA 3OXLA 3T1HF 5KFGA 4YR3A 3CCQS 1PSDA 4IRCA 3R27A 4FBUA 2DHSA 1RTZA 1M90T 3E01B 4ELUA 2B8PA 1NPRA 2CNOB 2KYZA 3DLKA 1T0TV 4GKJJ 4Z7CA 1CQNA 1VRUA 2EVZA 4LF6F 2A6MA 3X3UA 1S4FA 1F1BB 5IT4A 1YZ6A 4QPXA 2HHPA 4X65F 3I0RB 1NK6A 1RYSA 2Q1LA 2OPQB 4QOTA 1HNXJ 4HT7A 2OUGA 1R27B 4LF9J 2B4OA 3D3CJ 2Y1LB 3J81Y 2ZOGA 3UQSA 3JSBA 2KXHA 2QLWA 2KXNB 4DR5J 3PHTA 5F8NA 2B7CB 4WIQA 1WOPA 3T1YF 1N48A 3OUYB 2Z58B 2IC3B 2YVSA 3HHEA 4ED1A 5F0UA 1QSYA 2YKOA 2MTLA 1TQLA 3S6EA 4O3NA 3NEKA 4I56A 2EFGA 3MAHA 5KFDA 1VYAA 3FUYA 3GU0A 3I4PA 1PC4A 2YNIA 1NCLA 2MZQA 3A8JA 2HKEA 2W7OA 2Z8QA 2UXDJ 5IS2A 5KFNA 3H8YA 1FD8A 1YGYA 4QWBA 1FEEA 5EN1A 5ETLA 1GMUA 3WHIA 5LSLA 3SEOA 2BABA 3BREA 5E41A 1XMBA 4DV4F 4NLOA 1ZBTA 4K4WA 4DR2F 4LSNA 2VG5B 4FZVA 3VGSA 4DV0F 3MD3A 5GMDA 2FPHX 3MMAA 2BV3A 3CGIA 3THPA 2R2UA 1HD0A 2LMIA 4UQGA 3GLJA 5T7LB 3BPDA 3X1LB 2DHXA 1PJ5A 4FS1A 1N6QB 5J2PA 3C2PA 4P9SA 2ADCA 4ICLB 1FFSB 2VIHA 1DRZA 3BGLA 1HNVB 1RAGB 4KGXB 3IBCB 1Y0HA 1NHVA 1QJHA 4OJ3A 3AB4B 3CTRA 4WXOA 2IJNA 1KQFB 5J2NB 2QG9B 3NBPA 3BO4A 5D6GA 1RT1B 8RUCA 3H0PA 2FZKB 1LW0B 2VFTA 4IFVA 2RKIA 4X4TA 4J9SA 4HL9A 1FEHA 4WFYA 5HJXA 1X31C 2IY5B 3L3CA 2ILZA 1GAOA 4WFXA 1JXEA 5ADZA 1GT8A 1AZSB 2ASYA 2U1AA 2R2RA 3KFWX 3KDNA 2OIHA 1S6PB 1TP7A 3DN9A 4RNNA 1X5TA 2W25A 2XMAA 3VGTA 3K8VA 3NWRA 5HQMA 3KUGA 1X4EA 2UVRA 1FVSA 5DDQC 3HT3A 1IBMJ 1X9SA 1HW8A 2NXJA 4OX7A 1VCTA 3J80Y 1DURA 2OMOA 4DN9A 1KN6A 3LAMA 4MAKA 3GJRB 4ZJOA 2JX2A 5ETTA 4IO1A 5GVQA 4YB7A 1R31A 3MMCA 4I0WA 1OO0B 2RT3A 2GHWA 1KSPA 2WTFA 3SFGA 1G6BA 1S99A 4JI3J 4PR6A 2SXLA 5F9NA 5EGYA 3QRPA 3DGPB 5KG7A 3R5CA 1XERA 3MEEA 3DXBA 4ED8A 3DRRA 4DPTA 1CS4B 2B3TB 2IAJA 2XMJA 5CZVA 4ZCLA 3MEKA 3CJSA 5GADI 3RB0A 5D8HB 1RGVA 4ILLA 4PXEA 1EX8A 1Y00A 3K59A 4P73A 1K8AT 3QFWA 4M5JA 1VIXA 4QPTA 4YB1P 6FD1A 1S9EB 3CUNA 5HROA 3KUEA 3SDEB 3IWNC 3GIJA 1HMVA 4LF5J 1M5PC 5C42A 2BM0A 2YQ1A 4I1TA 2Y0BB 5LOQA 3RU0A 1S6OA 4CT8A 1VQOS 2VUGA 5K8NA 4ZVRB 4LF7F 1LFPA 3D6MB 5D4PA 5C7PA 4MYTA 2BOPA 3ZTSA 3CDEA 4OZ2A 4I6AA 1RTJB 3Q8PB 1QY7A 4GKKJ 2RQKA 3H2VE 1RTDB 2I0XA 4O0IA 3OQ2A 5F8JA 4ES3A 4CTAB 1TAUA 3CC7S 3GIIA 1WC1A 2CKWA 2YWHA 3Q2SC 1S76D 2YH1A 1LV5A 2RB7A 2N4CA 2M7SA 3ISND 3DOLA 1T8EA 2MKHA 4K59A 1WHYA 4C8MA 3C3LA 3RB4A 4R8UB 3CCES 4JUZA 3NP5A 2PI5A 1AUSL 2DO4A 4MKYA 3P4UB 2GNKA 4EI2A 3FK4A 3RGIA 4GVLA 4DN0A 2RE1A 5HI7A 1TL3A 4IR9A 2CIMA 4LFBJ 3Q8YA 4J91A 3RB3A 3MM5B 5HBMA 3IC1A 3CJKA 1WC0A 2VPYB 1HA1A 5LMNF 4LF4J 2KL8A 2H5IB 2YX1A 1F5BA 3I5BA 1K73T 2E9TA 4KBIA 3UDCA 2RJZA 2HHSA 3KNAA 1RT5B 1T9TA 4NA3A 2J6SA 2HNYA 1F6TA 4NI2A 2GQQA 3AJ2A 1FRKA 3W9IA 3TAPA 1WHVA 2N3OA 1NK8A 3FVYA 2R9LA 2W7PA 2WW4A 2ZH2A 1FKOA 1NJXA 2HVEA 2GW8A 4LRBA 1S6QB 3W3SA 3MM6A 4CH0S 3QZ7A 4QU6A 1GX6A 3UE2A 1X5SA 3A13A 1KFDA 3ILJA 4BC7A 2VFRA 6FDRA 4H4KA 4NLSA 4DLGA 1IWAA 2H65B 3TJ9A 2Q79A 3C66A 4ZCKA 1F9EB 3ISZA 2RMLA 4DS4A 2OGUA 4C48A 5HATA 4PG8A 5HVGA 3FMWA 4ILMA 4OI0A 2FJDB 1YLXA 3OTOF 1SCJB 4BC9A 2CQBA 2NSBA 3Q24A 4UY85 4LQ9A 5AXNA 5EHHA 1FDNA 2MKYA 1RA7A 1FNMA 4AFFA 2GGPA 3NS7B 3U1NA 1S72S 1RWWB 3OTCA 4OMFG 4U7UK 1R89A 3D0GE 1TKZA 2DGTA 2DNQA 4C3KA 4OJHA 5EDWA 3UR3C 1R8AA 4G1PA 1WC4A 2QSWA 2HVZA 3TQEA 5C24A 1RWNB 5HVFA 3C15A 2VBYA 1OIAA 2ZJPQ 1QE1B 3BV8A 4ECRA 4DV5J 1TTHB 3RTVA 3KJFB 4Q44A 1PBAA 4DDFA 3ZNJ1 3KK2B 2ZHOA 3GP9A 1RWMB 3NLCA 1KEKA 2I6WA 4DR1J 4MIAA 3CW2C 3W2WB 3FEZA 4HVZA 4LMZA 1ZAXA 4F8RA 3JSMB 3T9ZA 3O6QA 5LMUJ 1TK0A 3DYAB 2IYIA 2C28A 3M6XA 3AA9A 3MECB 3L4BC 4AD6A 3DRXA 3M8QB 1X7VA 3BH6B 2UV8G 5LT5A 4NASA 4B9VA 3ZC4A 1NJZA 3G8SA 5IQQA 4PZVA 4OJGA 2PN6A 3H2LA 2C3OA 4FPIA 4LF1A 1B0VA 3L7UA 4B3OA 5M2RA 4QU7A 4Z2XA 1HW9A 5KFHA 1PAUB 5IWAF 4JOUA 3GG1A 3VF0B 1ZYQA 3TJ8A 1NK7A 3DHXA 3M32A 1K0VA 1CJTB 2JVRA 1TL7B 3I32A 4P2XA 2XS2A 3NMRA 2IRYA 2YPYA 1HL6A 4X84A 2UUWA 3GILA 3IGNA 3JYTB 4DUZF 5J2QA 4C8KA 4KB7A 1XN9A 1N34J 4IDKA 2LYVA 2QSFA 4JBCA 4ZVOB 2M3DA 2DNPA 3TVZA 3UCUP 3PW5A 1HBMA 3MUTP 5KFWA 5D4LA 5AJ3F 4LFCJ 4ELVA 1UETA 3R1LA 2QZ8A 3UN3A 1S1VB 4E0DA 4U7CA 3HO1A 3ZZPA 1AYEA 3GJTB 4B08A 3JTNA 4QR2A 4DPYA 1FO1A 2HHWA 3AOAA 3HX9A 3SV4A 4URGA 2RQMA 4AE5A 3ADAC 2Q6BA 5DDRC 1UPPA 2MQLA 2ROEA 5HVHA 5KTQA 4CLFA 4WYWA 1UWAA 2Q66A 4K4YA 1AXQA 3LWMA 1RWKB 3G82A 4NCGB 2DNNA 5LXYA 1DQ8A 2LFVA 4KT0C 1KFSA 1MSWD 5HMZA 2OKQA 2LQ9A 2CG4A 1SJ4P 4XPEA 2QLJB 1UL3A 3D1HA 3HJFA 4X2BA 2JLGA 2EK6A 3OLBA 2BE7D 3GONA 1M1GA 3QGHA 3S7RA 2ZH3A 2VFSA 2GO8A 2RHSB 2WRMA 3L9ZA 3DI6A 3ZTPA 4ECSA 2BZ2A 2E9RX 3R9LA 1FCAA 3NY0A 1JLFA 1CC8A 1WG1A 2CNLB 4PQUA 3TZZA 3SSQA 2XEXA 1KQGB 2F1FA 2MZTA 3PFEA 3VAMA 4FF4A 1NSAA 3QJLA 4XDDA 2J0WA 1NB7A 3UR0A 4IKAA 4F4AA 2VQEF 3EVOA 2D3OR 2LVWA 2V5HG 3MEGA 3TUIC 4MIBA 1FDBA 1VQ4S 2B4PA 2ZH7A 4QIEA 2MKCA 1DBDA 2CJ9A 1HQUA 1JLEA 5KFIA 2MSTA 1TV6B 4C8OA 1HYSA 4DG1A 2OSRA 1QAYA 1RT4B 1D9DA 2GVDA 4YB5A 4LT6A 1IKWB 3IS9B 4ZA1A 2F3JA 1H2UX 2AZ3A 2IRXA 1YJRA 2YXLA 4FYWB 3G8QA 4K5RA 4PYDA 1NKCA 1BQNB 1YJVA 3BYRA 5AE2A 3J7Z5 1R8HA 2DY9A 3QIPA 4A8QA 1IKVA 2E29A 1T3OA 3MTKA 2XMVA 4PUOB 1E6YA 4GKJF 5D77A 4U9RA 3SZ2A 5EWFA 3PM9A 3OJUA 1YX2A 3H5YA 1MN7A 2LECA 4ED2A 1RCXB 1OMSA 4OYXA 2XO6A 5DG7A 4YN3B 2DRBA 1EZZB 3HULA 1HNXF 1CLFA 2ZHAA 4XPCA 3GJSB 2VFVA 4PQAA 3TQ1A 4LF9F 1SQEA 3ZTRA 3CJ8A 2C3UA 4EZ9A 2NXEA 2VODA 3CULA 3IBWA 1RT7B 4DR5F 4OX8A 2HGNA 2XSJB 1AW0A 2J9EA 3EGZA 2FHMA 2ROPA 4ED7A 1R43A 2FLNA 4ECXA 1JIHA 4Q8EA 1SKWA 2H9ZA 2AJ4A 1K44A 3VV2B 3RR7A 1K0TA 4I2QA 2Z2ZA 4KR0B 1EKSA 3HD1A 4ZKAA 4IOBA 4M5GA 3PW2A 4WZMA 3GR0A 1KC8T 3CDBA 1EETB 2U2FA 1R8CA 2YNFB 2ZUAA 3QQCD 3Q8UA 2HNDB 3KMSA 1ZZFA 2CPXA 3DLEA 4P7VA 3QT8A 4C8LA 2UXDF 4O0NA 4DCJB 5KT7A 1MMNA 2DGWA 3IXQA 4HHJA 2HNZB 1GMWD 4PG4A 2AJ2A 3BR8A 1U2RA 3E2EA 4Y65A 5BYQA 2JHEA 2C3PA 4TU7A 2IVFB 3JAMU 1YHQS 1JKHA 3R5GA 3OW2R 2XZWA 2ROGA 2G1HA 1UPMB 4AXIA 2DD8S 4OX9J 1TKTB 4I69A 2M0GB 5U47A 1RT3B 5DQIA 2K3IA 3TX8A 1KWMA 2HS4A 2CJAA 4ZPCA 2NYHA 3UN5A 4DSEA 2GVZB 2I2YA 4EYIB 1WDDA 3W61A 1CJKB 5JMNA 4OYZA 4P75A 2UZAA 4RW7B 2OD4A 2VBZA 2VG7B 1SL2A 3MM9A 3R5DA 3CCMS 4Z7YA 1C1CB 4DSKA 4P2FA 3GSIA 3O1LA 2RRAA 4F2SA 5CCMA 2QV6A 1I1GA 2AD9A 3OVAA 3DU5A 5GMEA 3IO1A 4DJBA 3D5MA 2FVPA 1MROB 4OI1A 2YNGA 1BQXA 5HMYA 5RUBA 1FTRA 2CUYA 5GAGI 2GMJA 2MY8A 4ER8A 3CD7A 1IBMF 1PKUA 3PX4A 4EO8A 1P9QC 3HHKA 1Y5LB 4KPCA 4WP3A 4CWBA 4J37A 2VBXA 2DNMA 2K7KA 1M5KC 3D28A 2X1FA 4K4ZA 3HFVA 3N6MA 4Y28C 4DQRA 2GMHA 5LL6d 3DCAA 4JV1A 2FLLA 4JI3F 1HBUB 2EXUA 3WIVA 1NSQA 2FY8A 1AROP 1G2EA 4NLGA 1V5VA 2B51A 2CJQA 3FBCA 1P9YA 1Q4RA 3PXGa 4QZVB 2R2TA 2UUCJ 4L74A 3QZ8A 3QT5A 1JLGB 2ALYB 2Y0SD 3V4MA 3OFGA 5CD4A 3W7BA 1Q7LB 4DQIA 3M2UB 3CDUA 2YKPA 4ZIWA 1HNIA 4QWEA 3I0RA 3BQ1A 4ZVUB 4IG3B 4DR4F 2VF3A 4CO5A 3MEDA 1OPIA 4YB6A 4ID5B 4USVA 3RW6A 1N5YA 2VFUA 2J8AA 4LF5F 2OPPA 1S77D 2W9CB 3QSIA 2BM1A 2XS5A 4DV3J 4OI4A 1ZTTA 2DGUA 2PMWA 1U6ZA 4LVNP 3HP6A 1LEOA 4IYQA 2D1CA 4YDXA 3FSIA 5BR8J 3KLIB 2M70A 3C14B 1RT6B 3HVAA 1IKXB 4M5LA 2OPSB 4EBDA 1H0HB 2HQDA 4F7VA 2IDEA 1F60B 4RUBA 2J0XA 2L41A 1Z4UA 4JI0F 4ATNA 3BEGB 4NEYA 4NEZA 3H98A 1RP5A 1NZ8A 3EZ5A 3HHLA 5DZ6A 2W9AA 2VG5A 2IM0A 2CQ0A 1N36J 3V6DA 2L48A 4U7UD 4C11B 2HMIB 3DNCA 2HGLA 4RW6A 3W2VB 1EAYC 1YJTA 2ZOFA 3EZOA 3IR5B 2MHNA 1RWXB 3H7HB 4LFBF 3KG0A 2DK2A 3PTWA 2B43A 2XC9A 2H48B 3OL6A 4UY8T 1X60A 2NZCA 4JI8J 3G6ES 4JI5J 4HACA 4LF4F 2YKNB 3CCTA 1HNVA 4Q7AA 3RUBL 1VQLS 2V4JB 5GAHI 4LSLA 2HFNA 1VC5A 4ZVEA 4ETZA 4WE1B 5GADU 4Y2KA 2CPEA 3EPIA 1Q95G 2EFPA 3T5KA 3DOKA 5L46A 3WC2A 3Q22A 1AZSA 2LDYA 1NO8A 2ZVSA 4UW2A 5ITHA 5EWGA 2DNRA 4HT5A 4G1IA 2FJVA 1WEXA 1MWQA 1JJHA 3WBZA 2FDNA 4TN2A 5D4NA 4PWUA 3CCLS 2N4DA 3A4TA 1SJ3P 5DDOC 1HR0J 1RHJB 1R6YA 4B3RF 2HQGA 4WF9Q 1KTVA 2IA6A 2CQHA 3UVJB 1I51B 4KQZA 1QVGR 2VPXB 3ILIA 4OZ3A 3BS9A 2FTRA 4ZN1A 4KKOA 2XCAA 3I96A 1M0SA 4L3NA 1NU4A 1WOOA 3SCJE 1FDDA 3THTA 1YKWA 3FGVA 3J81U 3JSRA 3DDNA 2VBWA 1LWFB 1VQSA 3MCNA 4F67A 5KG4A 4FYDA 2X1GA 2CZ4A 5KFBA 1RB0A 3NGTA 1KRPA 2CFXA 1VLOA 2BE9B 5B0FA 2KT5A 1RT2B 3VVUA 1V5IB 2R7RA 1S9EA 1J2VA 1OSCA 2NR0A 4OIXA 5CH7B 1NDLA 4ECYA 2RILA 3UNYA 3IG1B 1C0TB 4KO0A 1FI4A 1TUVA 4DV5F 4NLUA 3CCVS 2J0QD 3VALA 1KLMB 2EEYA 1REVA 2O67A 4LQ3A 3BQ2A 1NAQA 1Q86T 3I82A 1UEKA 2MEWA 3R8YA 2H51B 4KPYA 2FVSA 5CZXA 1WF1A 3I9ZA 1RTDA 3EDQB 3ZZRA 4ECUA 1FD2A 3CJ0A 5KFTA 2ZBPA 2AWZA 1H7XA 4CTAA 2IVMA 1BHNA 4F50A 3RBDA 4QIVA 1UP1A 4RL1A 3U1MA 3KJVA 1A0OB 4L76A 3I9V9 3J7A1 5B0BA 4C97A 1BUXA 3PR5B 3VZHA 3IR7B 4X65J 3KK1B 3M2RA 5MLCV 3UD5A 1E6VB 4F2RA 1T05A 1LWXA 2AHOB 1LK7A 4QIFA 4RNOA 1RAOA 1HBOB 3G96A 2D41A 2ZC4A 5EX0A 2ZVIA 4RUHA 4Q8FA 4QIWD 2UVVA 5CYMB 4EGLA 3CDAA 3Q83A 4I7FB 3MM5A 4LIWA 2CQCA 2ACYA 3OVSA 4QYZK 3UNGC 3CT9A 2FZCB 2VKRA 3O3LA 5T14A 1IBCB 3M8SA 2HG4A 2X51A 4WP8A 3PR4A 1U24A 3H2UB 1CULA 1M5VC 4MFBB 3CJ2A 1XNRJ 2YKMB 1TAQA 4TY8A 2LQBA 2V63A 1RISA 1L3SA 4C3MA 1U1QA 1VGYA 1RWOB 4TU9A 1B7YB 2E5IA 1V3RA 2UP1A 2DEIA 1SH0A 4UZBA 1UVLA 2MSSA 2IJFA 2QRRA 1S6QA 2F9DA 2E44A 3OV7A 5J2MB 1H72C 1S57A 4F3MA 1TK8A 3FJ2A 3OPKA 4JI6J 1Z1ZA 1Q8KA 3RBZA 1T03A 5E3QA 3VAKA 4WFAQ 5I3UA 1X9WA 4NLWA 5J1NA 5JXSA 2HWHA 2ZD1A 1NJYA 5F8MA 1XWLA 1M1HA 1HWUA 1JJCB 1P1TA 2WAQD 3QAEA 2X3DA 4YHHF 1GEHA 2HURA 5I42B 5ETMA 2AGPA 1UVMA 1QTNB 2P6TA 1QVFR 2ATCB 3DOMA 4KV8A 3CJRA 2HHUA 2CDQA 3AAWB 1WD6A 3QFHA 1UWBB 1PYOB 2F9JA 3G6XA 1SJQA 3QSYB 1BQMA 3N79A 2DNYA 3N6LA 4DX6A 2JDJA 5AT1B 3JB9k 5B7WA 1TVRB 1S48A 1AFIA 5E7OB 3GIKA 1KBRA 2OAUA 1AA1B 3KG4A 3T6BA 3RG6A 2D69A 2GQCA 2OD6A 3JTPA 4NRTA 5ETRA 3BSNA 2QLXA 4N5SA 2DVIA 2ZKTA 1S97A 2IVYA 3G6YA 5HLFB 3C6UB 4UZCA 4YQWA 1S1XB 3QATA 1U8WA 2XBPA 3W2WA 1CVJA 3O8WA 2UXBJ 3JSMA 2MJNA 1L3KA 3DYAA 2ASLA 2BKPA 3FBBA 5K8MA 1WG5A 2VDIA 3CD6S 2LKZA 2PC6A 4TKTA 1IKYA 1UW4A 3TZXA 4RWWA 1DTTB 3IRXB 3G2XA 2W1BA 7FDRA 1RTHB 1G1XA 4JYAJ 5LSRA 1N5TA 3L95X 4WYLA 2XQCA 4EWTA 3PJ9A 5E5NA 4IH5A 4N7TA 2ZC3A 2KYXA 2PA8D 2GHPA 3H25A 3O5TB 4NLYA 1RDRA 2UXCF 2CJKA 1ZAWA 3H90A 4LF7J 2B5JB 1D09B 2BJ3A 1UA1A 3QJPA 5K20B 1CJTA 4FPRA 1X9MA 4F4ZA 2CZ9A 3TEGA 4ZCIA 4GMKA 1SC4B 3Q23A 5F0WA 1TZ0A 4JI4F 1U7LA 2HRTA 4TQRA 4O3RA 2OSQA 5E3AA 1EB0A 2AMCB 3AD9C 2RU9A 4WK1A 4LRDA 4HTJA 2Y1IA 1L3VA 2QO3A 3TRGA 1NZAA 4LBHA 1Y3KA 2W2QP 3AXKA 3N01A 3PCOB 4HDGA 2NUUG 2RIJA 2GQ2A 1N5QA 3CF5Q 2COLA 4JV5J 4DV2J 2YWKA 2CWKA 2M2BA 2MLXA 4Y00A 1JK9B 2W4CA 1N8RT 4MKVA 4F4XA 3EXYA 4XO0A 2ZNYA 4CM0A 2VQFJ 2GIQA 4HH0A 4OX9F 1S1UB 1KQKA 2J9DE 1U0HB 2FLOA 8AT1B 1IQTA 3FCWA 4OZ0A 4MK9A 2VD3A 3M8RA 4C9DA 1FK9B 3CIMA 1ZAVA 5KFZA 1NH8A 3W5YA 4IUFA 2P8IA 4V1Ak 4MKAA 1BWEA 2N3LA 3QMQA 2F8MA 4QCLA 3KTQA 2OLWA 3D3BJ 1MU2B 2V4RA 3CJ5A 4WK3A 2LU1A 3P45B 4DHVA 2XWXA 4C98A 5KT4A 2XI3A 2GFFA 2R8HA 4N76A 3BN7A 1MLAA 3UDEA 3M8PB 2QEXS 2RF2B 3LP1B 4RW9B 2KRRA 2HVHA 3RYLA 1F2HA 5IQ6A 1Q0NA 1DTQB 2LDIA 3KLVA 1Y5NB 1WC3A 3KUHA 2D3O1 1TELA 1WEZA 3M6WA 1X5PA 2BJEA 4BCAA 4ZHRB 2WVCA 1M1KT 1SKUB 3KNGA 1HKAA 1RACB 2F8HA 3G86A 4S0MA 3P3DA 4NE9C 3PO4A 2RRBA 1UFKA 3Q89A 3PFOA 4NXNJ 1MWZA 4GVBB 1TV6A 1SC6A 4JI2J 3CCRS 3CSKA 1W25A 3IR6B 3TR5A 3JAMY 5F8LA 4RNHA 3BKTA 3HVRA 3C8YA 4TNOA 3IWXA 1W2IA 3OXGA 3LO3A 4BLGA 3IS9A 3QO9A 4PPDA 2IMWP 1YDLA 1VBYA 3OTDA 5J1EA 4WFZA 3K57A 4DEZA 2X1BA 3POTA 3HDSA 5F41A 4PCQA 2ZNZA 1VS3A 3MM8B 4UUWA 4EBEA 3TX0A 3TAMB 3I0SB 4DQSA 2E7VA 1L5UA 2J5AA 5I3PA 2UUCF 2E1MC 2FIUA 3QLHB 4ED3A 4UF4A 2HQIA 1NBEB 1NPKA 3ZTOA 2HVIA 4J9RA 3KDOA 1IVZA 3TUJC 1TKXA 3SQGA 1ITPA 4LJMA 4X4SA 2HGMA 3SQOP 3D0HE 4L3KA 2HFVA 2JSXA 1FHTA 3U02A 1Q1KA 2HRYA 4FF3A 3I56S 4FXWA 3MCSA 1OWXA 5A8RA 3MPYA 2XSJA 5SZTA 4GC7A 4ZVGA 2QA4S 1NSKL 4ZPAA 2L3MA 1NHKL 3EE3A 2Z57B 2RSQA 3LWLA 3IWLA 3VAGA 4QQBA 1JLCA 1HARA 2BW2A 2A3JA 3CPWR 1IN0A 2FB0A 1VJQA 2P9CA 2H1YA 1Q5YA 3SFUA 1WTBA 4DV1F 5GAGU 3FFIB 2HNZA 1IR0A 1SV5A 1YTYA 2E5HA 2DR5A 5CAAA 2QMUB 3MI7X 2BOAA 4WKRA 5CQGA 2DHAA 2R8GA 1JNZB 1TKTA 1Y3JA 3PDNA 1YK9A 1VISA 3D2WA 1Q8IA 3DLKB 2VOPA 4JV2A 5HP1A 3VAJA 1VRUB 3KKFA 4B9NA 3TI0A 4DZ6A 3L09A 4F3QA 2LP4A 2XMTA 2EW9A 5FDLB 4RO0A 1K47A 1ZM9A 2AJQA 5H9FJ 1TFWA 2YH0A 3BO2A 3KMQA 3TA1A 4RW7A 5H9EK 2BUNA 4L73A 3TUPA 3E3XA 1UJ4A 2BXJA 5DM7Q 2L08A 3HT0A 3OL9A 2FGOA 1U1KA 1KHVA 1SC3B 5F8GA 5E0OA 2B9YA 1GH8A 1NKEA 3GTYX 1RHUB 3AA8A 2QT7A 4RR5A 1YJWS 1RAIB 5C25B 2GA7A 2M8DB 3MPVA 3FSYA 3K5NA 5A8WA 1KTQA 1W26A 1SIZA 1CJVA 3DHWC 1FKPB 3C19A 4PEOA 2BX6A 1XJWB 4MKBA 3CMES 4J9MA 2YNIB 3HMJG 3MAAA 2XB2D 2OO4A 5HJYA 2QLFB 5HQLA 1HR0F 4DU7A 3OFFA 1S5ZA 2CJYB 5DO2A 3CEDA 4LSNB 3A1YG 3ZZYA 2VZ9A 2HZVA 2CADA 4PYAA 2FC8A 3TYTA 1RHQB 4ES2A 4DL2A 2DRAA 2ZBRA 3MMAB 3RR8A 4HH1A 5MAOA 4O3PA 4LBIA 4NZ6A 4K2JA 1GK8A 1G3OA 3T6JA 2OEKA 4CQ1A 3CCJS 2E7XA 4RZRA 1NMEB 1RXOB 2R7SA 3BN4A 3BSAA 4K4VA 2B6AA 2DY1A 1JLGA 2XY6A 1D8YA 3SBMA 3NBPB 2VHGA 4MH8A 3DLHA 1GFWB 2ATLA 1HWJA 4USJC 2FJBB 1QM9A 2QFJA 4FYVB 3M6UA 4IG3A 3SCKE 1KVIA 2Y3YA 2VC0A 4H4KC 3PKMA 1R7IA 6AT1B 1EIYB 2HAIA 4G65A 3NGUA 4Y0FA 3MCMA 1QAXA 4D3HA 3AQOA 4QYRA 1TL5A 2OH2A 4M95A 2G1DA 3M7VA 4PRFA 1FRMA 1S0NA 3D1OA 2JEFA 1RAJA 2B8QA 1GQEA 4UOCA 4FBTA 1FRJA 5KG3A 3V81B 3Q2TC 1X0FA 3KLIA 3C14A 4K2XA 1RT6A 1LFWA 4G1QA 1ZM3A 1H2TZ 3OD2A 3PEHA 1IKXA 5K8OA 4CZCA 4YDDB 1VC6A 3VGUA 3F73A 3H5UA 4OYWA 1Q8BA 1IBKJ 2HHTA 3TVKA 3EM1A 1RK8A 2L9NA 2HBRB 3QT7A 4DPOA 2UVUA 1IBLJ 1WKJA 4DR3J 4A8YA 2QE5A 3DKDA 3MR5A 4M94A 2HS3A 2FHKA 3NMAA 1CBKA 1UVKA 2PO4A 1JLQB 3LP2A 1JMTA 1DY3A 2K8GA 3MEEB 1J5OB 2JNJA 3UDLA 3W2VA 1UFWA 4LSZB 4FXDA 2KN4A 4EBCA 3B8HA 5IC6B 2UUAF 1Y9OA 3M4XA 4J9UE 5BYRA 5AXLA 2G2YA 2FJXA 3BSOA 4NYOA 4O4RA 2CZVC 2LXFA 3MURP 3H40A 1AFJA 4J9LA 2AZ1A 2HZCA 2XY5A 1Y5IB 2V4JA 1XK8A 1R0AA 3CCZA 3W5XA 1XNRF 4A8MP 2WCXA 5F8HA 3UPFA 5CXTA 3AT1B 3H59A 2UUBJ 2MGZA 4PKDB 4FYYB 3FRZA 3ELHA 1FJ7A 4YY3F 2V67A 3UO0A 2VOOA 1F5AA 2DIUA 2RAQA 5CHCB 1CJUB 4U6PA 2RVJA 3CJ3A 1S1TA 1HQEA 3S1TA 2AIRB 3ONQA 5KG0A 1UVNA 2XTJP 4TY9A 4QR1A 1X4HA 4JI6F 4WBFA 3BF4A 5IM0B 4I6YA 5J1PA 1NK9A 4CO4A 3D1QA 2AYEA 2UUTA 1XEZA 2IYGA 1VI7A 1XR7A 1R8PA 2BJDA 2CXEA 1XR5A 4OHYA 2BE2A 1EP4A 1FRXA 1VC0A 2IDLA 1B3TA 1K1QA 3GFHA 4YOEA 2XMWA 1V9OA 2DHHA 2HEKA 2O66A 4U8VA 2QLBB 3VTIA 2PDAA 1TL3B 3GYXB 1LWFA 4N8OA 2P5VA 2VG6A 4ZP9A 2CAJA 2PSZA 2BQUA 5HBMB 5KT6A 3EXCX 1KP6A 5H1SV 5BXIA 5CYQA 3QRRA 2F5GA 4NL5A 1GX5A 1YI2S 4X4QA 2VICA 2QX0A 2ACMA 3BKFA 5D4OA 4NLPA 1BE4A 2CQGA 2FY1A 2XYPB 4HHUA 3DC2A 3PNIA 5D0HA 1VQ7S 1Q79A 4Q2LA 1PCAA 2GO9A 1C0TA 4X4VA 4KY3A 3R7BB 2ZEJA 2ZM6F 2V4QA 1KLMA 3MUMP 1FKOB 1GXLA 4K4TA 1BGXT 5A0YA 4B9TA 3NAHA 2E66A 4J9VA 1X4FA 4DBQA 3RB6A 5JUMA 2WSEC 1S12A 2UXBF 4D3GA 2B4VA 4OZJA
chains in the Genus database with same CATH topology
4K5SA 5I4MA 1QUVA 2LQ5A 4KGMA 1Z2LA 4IYQA 2NZ4A 2GMLA 2D1CA 2RS2A 2HQ3A 2QMWA 3WX4A 4YDXA 3FSIA 2IM2A 3KLIB 2M70A 3UW1A 3WC0A 2KM8B 1RT6B 2RF2A 3LP1A 5SUHA 4M8LA 4ZLPA 3HVAA 1DQAA 3M6VA 1IKXB 2OPSB 4JI8F 2WW8A 4EBDA 3B4DA 4JI5F 1DTQA 5A6WA 2PT0A 2PEHA 5I3QA 5KFQA 4ZVFA 1H0HB 5LJ5Y 2JZ5A 2D3UA 3OTEA 3NGKA 4F4WA 4JYAF 1F60B 2J0XA 2JFDA 1S7HA 1ELOA 4ZK7M 3M30B 5D78A 1Z4UA 2L41A 2MZ1A 4Q0BA 1VLYA 1C4AA 2P6SA 3H20A 4FXVA 2FVQA 1S1WA 3US5A 3LH2S 2GJ2A 2CQ3A 3GFZA 3C6TB 4JI0F 4ATNA 2DNOA 4ZHRA 4QWCA 1HD1A 1QE1A 3BEGB 4AUKA 4C0BA 3GZ7A 4HKQA 4KHMA 1O51A 3PO5A 4WU3A 3H98A 2D9PA 2HS0A 1RP5A 5DGAA 2C2DA 3CJ4A 2EK1A 1FERA 4ECVA 3QWPA 3EZ5A 1ZOTA 2BVZA 3HHLA 2L9WA 4HDHA 2GCFA 2DISA 1WF2A 2W9AA 4RNFA 2VG5A 4B3TF 2IFXA 2IM0A 3KK2A 2CQ0A 1SKSA 3AY0A 3V6DA 2R7TA 1VOMA 2YY3A 2L48A 5KFFA 3MR6A 4EUVA 4ZDNA 1JKHB 4MMOA 3EZUA 2B4UA 1LQ9A 3K5LA 5KG5A 2VKZG 3UCGA 2UVWA 4C11B 4ED0A 3CDWA 3ZZZA 2HMIB 3QWUA 1Y7PA 3DNCA 2HGLA 1H38A 1A9NB 1X4GA 4RW6A 3W2VB 2ZOFA 1YJTA 1U26A 5CYJA 2KFYA 3IR5B 4TU8A 2MHNA 1WF0A 4I68A 4Y34A 2A1BA 2AGQA 1SJFA 2XMKA 2C42A 3LOUA 2OFGX 2N7YA 4ZPVR 1XBWA 4DF8A 4DR7F 3EUNA 3M9MB 2NYIA 1YRUA 4LFBF 2ZBCA 2OPRA 3KG0A 3SYZA 2DK2A 4F02A 3MECA 1NK0A 1PGZA 2B43A 2XC9A 1KOHA 3PW4A 1XTZA 4MIWA 5THWA 2XNQA 1UVJA 3OL6A 4UY8T 3MM8A 4N77A 3M8QA 1VQNS 2BACA 4Y2MA 3LAKA 1HWLA 4WJBA 3G6ES 4LF4F 3TAMA 4RW4A 2YKNB 3PIPQ 4IFYB 3CCTA 2CRLA 2PI4A 1HNVA 4Q7AA 3HKWA 3I0SA 4MK8A 1VQLS 1IJEB 2V4JB 5B0DA 1S9GB 2XULA 5GAHI 2I8EA 4LSLA 3MXHP 2YNHA 3B4MA 3NCPA 2NPFA 4XDCA 2HFNA 2GIRA 5EUHA 2RH3A 3PV8A 2BR0A 2XGQA 1VC5A 4ZVEA 3MM9B 4ETZA 2M52A 3F41A 4WE1B 4FNIA 1HI0P 3VAHA 5GADU 2V8VA 1LW2A 4HI1A 4OHWA 1YITS 1LWEA 5HL7Q 3PVXA 1U2FA 2KTQA 2DNZA 4Y2KA 2CPEA 3EPIA 5KFXA 2KFNA 2QA2A 4F4YA 3DRSB 2EFPA 3OTBA 4F25A 5C5JA 2F8EX 1L3TA 4Z37A 4BBYA 3T5KA 2CJBA 4JV5F 1FRLA 2AJFE 4DV2F 3DOKA 4M5DB 3WC2A 1JB0C 2KKHA 3Q8QB 1C0UB 3PJWA 3Q22A 4PG5A 1TK5A 1DZ5A 3QO9B 3GQCA 2ZHBA 1S79A 1XMQF 4KJIA 2AJ0A 1Q8LA 1X4AA 4OV1A 3H4BA 3LPYA 5J1EB 3ICLA 2ZFHA 3TP2A 1QLNA 3JTOA 3POTB 2LDYA 2D74B 3KLHB 1NO8A 3QGIA 3CWJA 4EYHB 5J2MA 1B64A 2AYMA 1F5CA 5B0GA 5E33A 3UI3A 1P1LA 2ZVSA 4DL7A 2M88A 3K5PA 1OPZA 4UW2A 5M2UA 5ITHA 3UCZP 2I5JB 5EWGA 4DL0C 3JYTA 4HI2A 2J0SD 1VK8A 2DNRA 2VQFF 1X4BA 1YJNS 4HT5A 4RBTA 2RRNA 4G1IA 2O3DA 3T9NA 5KFCA 3ENQA 4QW8A 4DFPA 2FJVA 1WEXA 1Z2ZA 3U27A 4QBUA 4OI3A 1TL1B 1SH3A 2C2RA 1JJHA 3WBZA 3BR9A 3HVWA 2FDNA 4TN2A 2PE8A 4WU2A 5D4NA 1NJIT 1HHTP 2CPHA 2EWHA 3VR1A 4O44B 2W4PA 4PWUA 4YMEA 3CCLS 4IOCQ 2N4DA 1FXLA 2LEBA 1SJ3P 2I1RA 2MXYA 5DDOC 2BBEA 4IG0A 5AE1A 5AE3A 4AL5A 1R6YA 4Q2MA 3AH6A 4B3RF 2ILYA 1CG2A 4WF9Q 4B9SA 4OHZA 2RQ4A 4PWDA 4RWXA 1S1VA 4OZNA 3DLLQ 1TKXB 1KTVA 2IA6A 4KFBB 4ERDA 2CQHA 3SQGB 5IZHA 1FTCA 4KQZA 4H4OA 3P49B 5JVGQ 1QVGR 2KDOA 2KM8C 2B9XA 2VPXB 4NLXA 4OJ1A 5G0RB 3SI8A 4O3SA 3BS9A 2FTRA 1UAWA 3M32B 5KFUA 4AXJA 5GMKa 1T94A 1VQ8S 3PW0A 4KKOA 2J76E 2WONB 4J9QA 5KFYA 5GAHU 4IQXA 3RRGA 2XCAA 4OHXA 5CCLA 3I96A 1M0SA 4L3NA 1FT8A 1NU4A 3QPIA 2VA2A 3SCJE 3LALA 4NLRA 1FDDA 2EFQA 3THTA 5L1KA 1U47A 3FGVA 3JSRA 5IXUA 3TOQA 2XCPA 4YFUA 3DDNA 2R4FA 5A8RB 1GTHA 2VBWA 1LWFB 5L1IA 1VQSA 3HPOA 1N4LA 1SI9A 3S8SA 3S01A 3FNNA 4A8KA 4IDKB 3OXLA 4A8OA 4F67A 2MQPA 3LANA 5KFGA 3T1HF 4YR3A 1T3NA 1ZH5A 4B9LA 2CYYA 5KG4A 3HKZD 3CCQS 2HHHF 4G3IA 3ULHA 2ZE2B 4NCGA 1PSDA 2POKA 4IRCA 3R27A 4FBUA 4FYDA 2DHSA 5B0AA 3BQ0A 3U1LA 1M90T 1HBMB 3E01B 2X1GA 4ELUA 2CZ4A 2KYZA 5KFBA 4JI1F 1JLCB 3DLKA 3FEXB 3RRKA 2WOMB 3CC4S 2V2KA 1CQNA 4ID8A 1VRUA 1ZM2A 1KRPA 2XMUA 2CFXA 2HHVA 2EVZA 4LF6F 3NKYA 3X3UA 1S4FA 5B0FA 2KT5A 1RT2B 1T02A 2LA6A 2J6TA 1U1NA 5IT4A 3LP0B 3QJJA 4QPXA 3CC2S 2HHPA 2R7RA 3PEJA 1S9EA 1J2VA 3SCLE 1OSCA 3I0RB 4X65F 3PKYA 1RYSA 1NK6A 4OIXA 2FHOB 5CH7B 3MR3A 2Q1LA 4ECYA 1O5JA 1I6JA 2OPQB 2DH7A 2RILA 4QOTA 2EC0A 3IG1B 1C0TB 3I87A 1TUVA 4KO0A 4HT7A 5E3PA 2QA1A 4DV5F 1SV5B 4NLUA 3OLAA 3CCVS 2J0QD 3HZGA 3VALA 1KLMB 1T95A 1R27B 2KG0A 2PIIA 4DLEA 2B4OA 1REVA 1KOOA 2DR7A 2O67A 3I31A 2NSCA 3J81Y 4NXNF 3T5LA 4LQ3A 3BQ2A 2ZOGA 3UQSA 3JSBA 1NAQA 2KXHA 1Q86T 2QLWA 2EBGA 2KXNB 1YJ9S 3M05A 4JI2F 1PC5A 1S1XA 3I82A 2W8KA 5KG6A 5F8NA 4TYBA 2B7CB 4KPYA 1C1BA 2GV1A 3MMBA 3T1YF 1N48A 4FP9A 3KYLA 2FVSA 5CZXA 3R1HA 5D3GA 4M63A 3NS5A 3OUYB 1N56A 1WF1A 3I9ZA 1RTDA 4TYAA 2IC3B 3ZZRA 5HP1B 2YVSA 2XG8A 1XNQF 4ECUA 2V8DA 1FD2A 3CJ0A 3HHEA 3OR1A 4UUXA 5KFTA 4WFBQ 2AWZA 4MJKA 4ED1A 1CEZA 1RQ0A 1H7XA 5F0UA 1QSYA 4CTAA 2YKOA 2IVMA 2DH9A 2KG1A 1TQLA 4F50A 3S6EA 4O3NA 4AL6A 3BO3A 3D54A 4DSFA 5K9FA 3N6NA 3RBDA 4QIVA 5CA5A 4Y3CA 1UP1A 2DCUB 3U1MA 3KJVA 4I56A 2EFGA 3MAHA 3I9V9 5KFDA 1HWIA 3I4PA 1PC4A 2YNIA 4DUYF 3J7A1 2ABYA 5B0BA 4A47A 2MZQA 4C97A 4X4OA 4B9UA 1U25A 4J9PA 3PR5B 3HZEA 4C0OC 3VZHA 2W7OA 4QJVA 3KG1A 2VONA 4EZ6A 2Z8QA 3IR7B 5KFVA 5IS2A 5KFNA 1HBNA 4YP3A 3H8YA 4CIOA 3HHDA 4A8FA 2HPUA 1BC6A 1FD8A 3KK1B 1YGYA 4QWBA 3PZPA 1U45A 3M2RA 4L72B 1FEEA 5HQ8A 5EN1A 3IAM9 1S1WB 2KHCA 2Z2LA 4BWMA 2JC1A 5LSLA 5MLCV 3SEOA 2BABA 1E6VB 4F2RA 3BREA 1T05A 4K4XA 5E41A 1XMBA 4DV4F 4NLOA 3BB5A 1ZBTA 5M2PA 3N4WA 4K4WA 3DMJA 4DR2F 2J7KA 1LK7A 4LSNA 1N32F 4RNMA 3GYNA 4QIFA 4PQUB 2VG5B 4FZVA 5LJ3Y 4RNOA 4ES1A 3MTJA 4DV0F 1TFYA 3MD3A 4Y6IA 1HBOB 2EKYA 3G96A 4OFZA 2FPHX 3MMAA 1U6BA 5GAEU 2D41A 2ZOMA 2BV3A 2ZC4A 2A2DA 5A8WB 3CGIA 3THPA 1RT4A 5EX0A 2R2UA 4RUHA 1HD0A 2LMIA 1S6UA 4QIWD 4UQGA 4Q8FA 1RKIA 3ITHA 1KVJA 2CQIA 2WK4A 2Y1RI 5CYMB 5T7LB 4EGLA 3CDAA 2UVVA 1IKWA 3HK2A 1NKBA 3FQLA 4G6VB 1XC9A 3X1LB 4R0EA 2V9KA 4I7FB 2E5LF 2CPDA 2EFNA 3OSNA 1D9AA 1JLAA 3MM5A 2DHXA 4LIWA 1FE0A 2CQCA 4ECZA 2ACYA 3OVSA 2JWNA 2OPRB 1N33F 3UNGC 1BY9A 2GX8A 3CT9A 5JJBA 2VKRA 3O3LA 4FS1A 2ERRA 1N6QB 1OSDA 5J2PA 3C2PA 1BQNA 5T14A 2ADCA 3ZFVA 3IAS9 2IBKA 4ICLB 4DV6F 1S9FA 3PW7A 1FJCA 3P6YC 4RW4B 3M8SA 2ZZNA 2HG4A 2X51A 2Z4PA 3MWBA 3PR4A 3CMAS 1DRZA 3BGLA 1HNVB 4EU0A 4PUOA 1U24A 3H2UB 1Y0HA 3AHPA 1NHVA 1QJHA 4OJ3A 3AB4B 3CTRA 3K5OA 2X1AA 4WXOA 1M5VC 2IJNA 4MFBB 3CJ2A 3I5CA 1KQFB 5J2NB 2XO7A 3NBPA 1YSJA 5D6GA 3BO4A 1HQUB 2V0NA 1RT1B 2V8HA 2YKMB 1TAQA 4TY8A 5F9LA 1LW2B 3PHEA 2LQBA 4NLTA 3RRHA 1S10A 3T1AA 1RISA 1LW0B 2VFTA 4KHRA 2ZDOA 1L3SA 4DG1B 4DSLA 1KS2A 4IFVA 2RKIA 4X4TA 3M1VA 1WHWA 4OHVA 4HL9A 4J9SA 4C3MA 1U1QA 1FEHA 4WFYA 1RJJA 5EX3A 1VGYA 3PRBA 3P5TL 2LXIA 3L3CA 2ILZA 4TU9A 1ZPVA 3QAUA 1GAOA 4WFXA 1DLOA 1U6FA 1JXEA 2E5IA 3V2UC 5ADZA 1P8GA 4QYZJ 1ZPWX 3F56A 1V3RA 1GT8A 2UP1A 2DIVA 1SH0A 3OFEA 1UVLA 1JX4A 2ASYA 2MSSA 2IJFA 4TXSA 2W9BA 3Q8RB 2KZMA 2U1AA 2R2RA 2QRRA 3KFWX 1S6QA 2HYIB 2F9DA 2E44A 3DRPA 4OZ1A 2FUG9 3OV7A 2OIHA 5J2MB 2E5GA 1JLBA 5DG9A 3RAXA 1YWXA 1S6PB 1RT7A 1TP7A 2VA3A 3DN9A 1K9MT 4RNNA 1U1PA 1X5TA 3ZZOA 3LW5C 4ETXA 2W25A 4F3MA 4CO0A 1TK8A 2B6AB 2D3ZA 4E98A 3ISNC 3FJ2A 3OPKA 3K8VA 4J9OA 2DPIA 1N0UA 1X4EA 1Z1ZA 1U1MA 2UVRA 1E6YB 1FVSA 1T03A 4X4UA 3V4IA 5DDQC 3HT3A 5E3QA 1X9SA 3VAKA 4WFAQ 2Q43A 1HW8A 5I3UA 2DGOA 4OX7A 2W8LA 1X9WA 1UFLA 3J80Y 1DURA 5KFAA 4NLWA 5J1NA 1QSSA 2DITA 2OMOA 5JXSA 3GSDA 2HWHA 4DN9A 3CXCR 1KN6A 2ZD1A 1NJYA 5F8MA 2MPUA 3DLGA 4DMZA 3LAMA 1XWLA 4MAKA 2AV5A 1HWUA 2JX2A 1KNZA 1EETA 4NPOA 4MYUA 2N7CA 5T41A 1URNA 1P1TA 2YNFA 4CO1A 4IO1A 2WAQD 5GVQA 3QAEA 3LQVA 4YB7A 1Q82T 4YHHF 1IXKA 1R31A 2CQ2A 2HNDA 4H4OB 5I42B 5KT3A 4C8ZA 3MMCA 3ENWA 4I0WA 1OO0B 2AGPA 2RT3A 2GHWA 5KOXA 4LVOP 1KSPA 2WTFA 3MR2A 4K4SA 3SFGA 1G6BA 2ZH6A 1S99A 1QTMA 2OJ3A 1UVMA 1MU2A 1N5SA 4DL4A 2FHJD 4TQSA 2P6TA 1QVFR 1SUQA 4QIGA 1YIJS 3BDEA 2LXUA 4PR6A 5CD4H 4N41A 3DOMA 4KV8A 3HLUA 2WHOA 2SXLA 1MWYA 2HHUA 5F9NA 2CDQA 3AAWB 5EGYA 1WD6A 3EGWB 5KG7A 1UWBB 1YRTA 3R5CA 1XERA 2MB0B 4RW8A 2LLZA 4DF4A 4KSEB 2MMYA 4BHQA 2F9JA 3G6XA 1KD1T 1FE4A 1SJQA 4GKKF 1RKJA 2E9ZA 1BQMA 2F40A 3MEEA 3DXBA 3N79A 3DRRA 4ED8A 2DNYA 3N6LA 2B3TB 2IAJA 4O4GA 2EPIA 2XMJA 2RDIA 3M8PA 5CZVA 4ZCLA 3MEKA 4IRKA 4K50A 2JDJA 4J9NA 1S49A 3HHLC 4G1QB 4I2QB 3HXMA 5GADI 3T3FA 4RW9A 3RB0A 3JB9k 5D8HB 2YTCA 1RGVA 4ILLA 1RT3A 4PXEA 2J9DA 4A8WA 1VQMS 1U1RA 1Y00A 3K59A 5B7WA 2WB4A 2UV8A 1TVRB 1K8AT 4A48A 3M2VA 2YWEA 1S48A 1AFIA 5E7OB 2C22A 3GIKA 2KFZA 1VIXA 4C0HA 3DLEB 3BGUA 4ZVHA 2OAUA 4QPTA 4YB1P 5L1LA 4GO5X 6FD1A 2J6UA 4OI2A 3KG4A 1S9EB 3P96A 3T6BA 3CUNA 3GIMA 5HROA 3V6KA 3SDEB 2BANA 4PXDA 3IWNC 3GIJA 2GQCA 2OD6A 3JTPA 2G9OA 3Q0AA 1F9FA 4NRTA 1YRXA 3BSNA 2QLXA 2LEAA 4N5SA 2DVIA 1HMVA 2FJAB 2ZKTA 2MKIA 1UVIA 4BDPA 5L9NA 1S97A 1M5PC 2VG7A 5C42A 2MZJA 2JEIA 2IVYA 2BM0A 4I1TA 3RU0A 4FVMA 4B3MF 1S6OA 4CT8A 1VQOS 3G6YA 2VUGA 5HLFB 5K8NA 2WB1D 3VCDA 3C6UB 4LF7F 3LP2B 2IM1A 4YQWA 3N0VA 4NLVA 1LFPA 4Q5VA 1S1XB 1C1CA 5D4PA 2BRKA 2GHVC 3FQKA 4MYTA 2XBPA 5AXMA 5KFMA 2BOPA