5L39A

The structure of the fused permuted hexameric shell protein msm0275 from the rmm microcompartment
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
b'AELRSFIFIDRLQPQTMSYLGTWIKGALPRANMAAQIIEVAPGLDIEGVTDVALKHAEVKAGILVVERQFGYLEFHGETGAVKAAADAALDYLGGDPDAAVRPEILASRIISSIDHQHAFLINRNKIGSMVLPGESLFVLEVAPASYAILATNEAEKAADVKVVDFRMIGATGRVYLSGTEADVRQAADAARDALAVLQGAKLAAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RMM microcompartment shell protein MSM0275
publication title A Complete Structural Inventory of the Mycobacterial Microcompartment Shell Proteins Constrains Models of Global Architecture and Transport.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Structural protein
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l39A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l39A02
3I87A 3MPVA 3FCHA 5SUHA 3F56A 3U27A 5L39A 4HT7A 3I82A 5LT5A 3GFHA 5LSRA 4HT5A
chains in the Genus database with same CATH superfamily
3CIZA 2FQQB 3QWPA 2J9DA 3M8WA 1D8YA 1GH8A 1NSKL 1YGYA 2E1AA 2HBRB 3RG6A 4HLBA 2XLIA 3A4TA 3MUVP 4NXNJ 2DNPA 2FJEB 3HO1A 4CH1A 4NYPA 2E5JA 2VG7A 2E7VA 2V9KA 5KOWA 3M6XA 3RZAA 2DXEA 2M88A 3M1VA 3CUNA 1GMVA 1U1OA 3BGUA 5T41A 2HQGA 1G2EA 4DL2A 2YVSA 2LMIA 4IYQA 3CCVS 4NEYA 2BJEA 1MU2B 4LREA 3BDPA 2LVWA 3GFZA 2CAJA 1S1XB 5BJRA 4KKOA 4O3PA 4K4SA 5FIIA 1VISA 3NS5A 2E7XA 1TKTB 4W4MA 3PFEA 1F2HA 1PCAA 2FHKA 2Q79A 2G2OA 4NE9C 3AOAA 5C24A 2ZM6J 4WF9Q 4RW8B 5HQMA 1Y00A 4HHUA 5KG4A 1SUQB 3C16B 2DCUB 5KG7A 4ZLNA 3D0IE 3OR2A 1ZZNA 1DARA 2C3UA 4CWBA 1S9GB 1RADB 3K5LA 4HYKA 2YKMA 5GMEA 5HANA 2F4FA 2UV8G 4ECZA 5K20B 1X31C 3FSIA 2FUG9 4QCLA 3KUGA 1B0PA 2YWGA 5LMUJ 3IRWP 1GT8A 3ZNUA 2XZTB 3FZBA 5JVGQ 3PIOQ 4A8FA 2C3MA 3VAJA 4DL0C 3WIUA 2ZZNA 2EG1A 5D78A 2F8HA 4QZVB 3BH6B 4H4MA 2HBQB 5LSOA 4R8UB 3WQPA 2LEBA 1JQGA 4CRJA 2H4YB 3BR9A 4FDFA 5K9FA 1S0NA 2CPZA 1VQYA 2VDHA 1RHUB 2QA1A 1SVDA 3KFWX 4OZJA 2DHGA 1NO8A 1WEZA 2E5LF 2VG5A 1RWNB 4YR3A 2VOOA 4LJMA 4USWA 2GQCA 3DFEA 4DJBA 1SJFA 4MIWA 3GB0A 2R7XA 2AEFA 1KLNA 1HQEB 3D2WA 2JJ4D 1N52B 2QTWA 3L3CA 2OFGX 3NMAA 4O3RA 3DDIA 3PZPA 1MROA 1IKYA 2R2TA 3SBMA 1IN0A 2XBPA 1M1HA 3QZ7A 3NNAA 5LMNF 4FYDA 1EQMA 2WOMB 3O3LA 4O4GB 3R6LB 4C0BA 3PCOB 2H48B 4A8OA 3WIVA 3T1HJ 1YZ6A 1WHXA 2R42A 2JLGA 7FD1A 4F3OA 2HNDB 3P4UB 5KT6A 4DR3J 3JAMY 2V9WA 4O0IA 4PQUB 2E5GA 4I2QA 3T41A 4KO0B 3OJSA 3CC7S 5T7LB 1CG2A 2W8LA 3DLLQ 3TW0A 2DTJA 4RW9A 3V4MA 1M1GA 1SH3A 4DUZJ 3DNCA 5EX0A 1RAHB 3TAMA 2YNFA 3TEHB 3T9ZA 5BR8J 5FDLB 2RJZA 3V6JA 3FGVA 2GAHC 1HHSA 2MLXA 5A8WB 1LV5A 2EVZA 5L1LA 4ZLJA 2KYZA 3BV8A 2B6AA 1Q4RA 5IT9U 3C2PA 5G0RA 4DN0A 1YRTA 4Q0BB 1HWIA 3CDBA 1TAUA 2XY5A 4QWDA 2ALZA 1KQGB 4LUBA 4O44B 1N5SA 5KT4A 2K1RB 1IM6A 4MAKA 2WTFA 4C48A 5L8RC 2EK6A 3HZEA 2RDIA 1JNZB 2UZAA 2OSQA 3MMCA 4JI6J 2PGCA 5M2PA 2BKOA 2GFFA 2B4OA 1EAYC 3OVBA 1LW2A 4KTQA 4DV4J 1KC8T 1WKLA 2D9PA 2NSCA 1WWHA 4O0NA 1DY3A 4RW6A 4N76A 3BO4A 3OHAA 2VODA 1QTNB 3M2RB 2YNGB 5H9FK 2HS0A 5K14A 2GX8A 3CDEA 4MK8A 3HX9A 2GIFA 3MOZA 1U1PA 1FKPA 3SQGB 5D3GB 1M5OC 2BVZA 1S79A 2NPIA 2WONB 3N6LA 4B9SA 1KS2A 2HS3A 3DLGA 1W2BR 2FZGB 3CVKA 3NOGA 1TKDA 1RA7A 3Q8UA 4EZ9A 3P45B 1T8EA 2KB2A 2QSWA 5EX3A 1LKZA 2OSRA 4NLOA 4F0HA 3QMQA 3O2IA 1TL4A 4R5PB 1T9TA 1K1SA 3EJMA 3BBFA 2FJBB 4AQYJ 2VA3A 1VJQA 4I6AA 1WELA 2XSFA 1A7GE 1QLNA 2IBOA 4B08A 2FDNA 1HBMB 1CJVB 4ECWA 5J2MB 5DG8A 3FDSA 3UDCA 2YWEA 5F8JA 1IQTA 2HRTA 4KBIA 5M2UA 5ETNA 2MJNA 2P8IA 2KH9A 3QIPB 4DR2J 1NSAA 3I0RB 3MR6A 1RAGB 5MLCV 4JI5F 3CCQS 1HQUB 3G71S 1PYOB 3HZGA 5KFNA 2M9KA 3CDUA 1L3KA 1K47A 4LSNB 4OI0A 1Y5IB 1NHUA 5GMDA 3IS9B 5D0HA 3PKMA 1G1XA 4OL8A 3TUZC 1C1BB 4DX5A 4ALZA 4HHJA 3KK2B 2FC8A 5D0GA 1JWWA 3MPVA 2HNYB 4PPDA 1V6HA 2MEWA 3B82A 4WK3A 4Y2IA 3W8GA 4LIRA 1RTHB 3H7HB 4ANCA 1IKXA 5CQGA 1T05B 1H73A 3A8KA 3PYEA 2Y8WA 1REVB 5KFRA 1X4EA 2B5JA 1WOSA 2EFNA 1RB0A 2F8EX 3SZ2A 4DUTA 2JZ5A 2HGMA 3EXCX 2NQPA 1S77D 5HN0A 4RU9A 3PW2A 3VCDA 2HWIA 1HPZB 8AT1B 2Y1JA 5AJ3J 1SB6A 2CKWA 2FHOB 4ANDA 3UD4P 4CLZA 3D4JA 1TL3B 3H2UB 1NJXA 3LF0A 1HNIA 1FRKA 1NHKL 2M7SA 5CYQB 5B08A 1E6YA 4GMKA 1GX5A 4OHWA 2UXCF 3MAAA 2BA9A 3G82B 3M7VA 4B3TF 2QYGA 3CDAA 2E44A 3B54A 4DS5A 2PMWA 3R5AA 2AX1A 4DF8A 1HNXF 4UY85 2GVZA 5CH7B 1J5OB 3AB2B 4CLPA 2KG0A 5KFUA 4EU0A 4C0OC 2AT1B 4HI2A 3GG1A 1L5UA 2HFNA 4OX9J 4U8VA 3P6YC 4JI7F 3ISZA 1H7WA 4QPXA 5CHCB 3OL6A 4WFYA 4ZHRB 5B0BA 4ZVRB 1FE4A 2OD4A 1S9EA 4RWXA 4YDXA 1YJUA 4I64A 5AXKA 1RABB 1BE4A 4JI8J 1FEEA 2BMBA 3CCZA 1SJQA 5H9FJ 2CADA 3DRXA 2W7OA 2FLOA 2B56A 2XYHB 2MZRA 2ZITA 2UUBF 3M30B 4LSZB 4MFBA 3MEDB 1HQ2A 2DGUA 3NCRA 2R2RA 2OPPA 2IJFA 3OUYB 1LXJA 1V9OA 3BBBA 2MQQA 1FEHA 1N0VC 4OZ2A 1FVSA 3PRDA 1SJ1A 2QSFA 4DR1J 1RTDA 4DDFA 5KG1A 4GKJF 2GIRA 2HHPA 4DR6F 3HI9A 1Q7YT 3QFWA 1IKVA 1UPMB 2RDDA 2ADBA 2KFZA 3R1LA 2C22A 1L3UA 4NLUA 4A46A 5KFXA 3PR5B 2CQDA 2CJYB 2LQ8A 5HVFA 4FVMA 3GIJA 1X5PA 1T94A 5D4LA 4J9KA 1VQOS 2QL7B 2ZH9A 1CS4A 3VAGA 3RB6A 5KG5A 3J81Y 3GYGA 5MAOA 5DDPC 4OHZA 3MI7X 5CXTA 1T03A 5AE3A 2B9XA 6FDRA 4N41A 2DRBA 1U02A 1ZPVA 2FZCB 4OI2A 5KG3A 5E3CA 3T1YF 5A8KA 4RNOA 1PGZA 3LW5C 3S8SA 5ETSA 4B02A 3CCRS 4ZVOB 1VRTB 5ETPA 4J9QA 2FLNA 4NWBA 2KT2A 5IQQA 3EWGA 2XGPA 2QG9B 5AXNA 4KHPJ 2MKIA 4F7VA 1OQ3A 2MQMA 4OHYA 2RIJA 4WWSA 4Y28C 3R8YA 3T5HA 4YFUA 1VI7A 2W7PA 2HRYA 4ATNA 4G3IA 2YQ3A 3QT5A 3I82A 4KRWA 4ZJOA 3T5LA 3H2LA 1H2UX 2CQHA 4CZCA 4DF4A 4WU2A 4OJHA 4DPXA 1Q7LB 3CCSS 2MLYA 3DLKA 4X4VA 1WEYA 5KFHA 4MKAA 3NBPA 1CJTA 5GAGU 2OD6A 2APOA 2MGZA 2W9BA 2C3PA 1RT3A 2LFVA 3BQ1A 2MKJA 5IXUA 2XNQA 1VQ4S 4UF4A 1FKOB 1B4SA 2GMLA 3LP2A 1S1TA 2PE8A 4CI0B 1UMJA 3DN9A 1FJGF 2C2MB 3DYAA 2J9EA 4NRUA 1I5OB 5IT4A 4KV8A 1IQZA 4YEAA 2R7UA 2VPZB 3HSDA 3FCVA 2BW2A 1KTVA 5HJYA 2G4BA 1VQ6S 2YNIA 3KDOA 4CO0A 2K3KA 3GONA 2RRNA 3CJRA 1IWGA 1U09A 4KC5A 3ZXWA 3M4XA 4LR8A 2DIVA 3RAMA 1SIZA 3T1AA 2QL9B 4G1QA 2MXYA 4IO9Q 2QX0A 1QD1A 2M3DA 1T7PA 1YVFA 3CXCR 1JXEA 1TMJA 1EKSA 2ZEJA 4IR9A 3CO9A 5A2QU 1H2VZ 3KJFB 5F8MA 1U48A 3TQ1A 3TA1A 2KN4A 2U1AA 3E51A 3J80U 3AXMA 2UUWA 2HGLA 4I6YA 1SJ3P 1YDLA 2UU9F 4DSJA 1EETA 3O1LA 3FZ2A 3R5GA 5D0RA 4N7TA 2NLWA 4L3KA 3DLJA 4B9UA 3FFIB 3JQJA 1TL1A 3MEEB 3CC2S 3LPEA 3MR5A 2ZVSA 2E9RX 4DV6J 2Z2ZA 3MECA 4OI4A 2VQFJ 1UP1A 3U1LA 3A3PB 2HWHA 3RBZA 1Y7PA 9RUBA 4LRDA 3BH7B 2PA3A 1VRUB 3CJ3A 1U6ZA 3TJ8A 5ADZA 5C5JA 3NCPA 5FJ4A 4DFMA 1TL7A 8ATCB 4KGVB 5LJ3Y 5GVQA 1FF2A 1IXKA 1T9XA 3IR7B 3CJKA 1FRLA 4EMDA 4R25A 4QJVA 4PZVA 1FNOA 1UZDA 2GGPA 1CLFA 4MYUA 1HYSB 1NB7A 2GW8A 4DZDA 4ZCIA 4MYTA 4L3NA 1R0AA 4JI4J 5L46A 3QO9B 1N34F 4EYIB 1VHFA 2BE2B 1H3DA 2F4VF 3KHGA 4DCOB 2HK2A 2XLJA 2QYCA 1KONA 4F26A 2C2NA 5KFOA 3DI6A 1AW0A 2CRLA 5EUHA 2K3IA 2BUNA 3EGZA 2I0XA 4K59A 1KBRA 4ILLA 3MR7A 3KG4A 1UWBB 1JLEB 1SC1B 4FXVA 2J0XA 1DQ9A 3M8PB 2W4DA 2O01C 3O6QA 3M8QA 1XK8A 3W9JA 4RLEA 5D6GA 3M8ZA 2VFRA 4DV5F 3A8EA 4FF3A 3AJ2A 1Z2ZA 5KT3A 2QLFB 4ZN3A 3OLAA 3CCJS 2YBVA 1SQEA 3MM9A 2DNOA 3HVTA 2W4PA 1UVJA 3VGUA 3VVTA 1N88A 4ZP7A 2L3MA 2JDJA 4QR0A 3D1HA 3MCSA 1I6JA 4ZLLA 1U0SA 2Z2MA 1R31A 3EPIA 1XERA 2CQ1A 3MHYA 5JXSA 4DX6A 2JFDA 2K7JA 1KLMA 3PJWA 5B0CA 5BYRA 2HHHJ 1O0PA 4JI1J 1FWLA 4USJC 3OQ2A 5HQ8A 1UVNA 3IAS9 3GCWP 1FX2A 4ZS6A 1TU0B 2ASLA 4RU2A 2IC3B 5RUBA 1NEEA 4KGXB 4WJBA 4GKKJ 3L7PA 1V5VA 2J8AA 1XMQJ 1Q95G 3I0SB 4CM2A 4YHHF 4CLTA 3OR1A 3PIPQ 5A8RB 2DGOA 3LP0B 4X62J 3AA9A 5DM7Q 2M70A 1WKJA 3EGWB 3TUPA 1RYSA 2O67A 4HH1A 3V4IA 2P9EA 3H59A 2AEMA 4PG8A 5HROA 1F3FA 2YY3A 5ETOA 1KHWA 4B3MF 1J5EF 1HD0A 2B8QA 3K59A 3EZOA 2MKYA 4TYAA 2ATLA 4ED1A 4TU8A 1NDCA 2RS2A 3M2VB 4J9NA 1N32F 2J5AA 3PFOA 3FEZA 1YJNS 4YN3B 3ZZRA 2MY7A 1YKWA 2YKMB 1UFWA 2LDIA 2IM1A 3KNAA 3TOQA 3FQKA 2PA8D 2VPWB 4OZ0A 1MG7A 4NXMJ 3CW2C 2MY8A 2L48A 3D67A 4RZRA 2QFJA 5F0WA 1BQMB 4LBPA 2NYHA 1RWPB 1NSQA 4J90A 4NLQA 2OFHX 1PO6A 1S6OA 4FYYB 1K73T 2A6OA 2J7WA 1VK3A 1T3NA 2ZOGA 4LT6A 3DU5A 4IDKA 2LU2A 3F44A 4D3GA 5C42B 4MKYA 4Z7CA 1RBOB 1EJ7L 1X9WA 2W01A 5ETMA 3K7RA 2PEHA 3UVJA 4CO1A 4A48A 4GVBB 1UW4A 3HKZD 4OYZA 1RWXB 1I94F 5GAHI 3SIPB 5DRKA 2D3O1 3LANA 3QJLA 3SFGA 2HNZB 4ID5A 3IG1A 4TQRA 1Y9OA 3M32B 1CULB 1BQNB 3I32A 2KM8B 3KG1A 2R7WA 3GJQB 5FLXU 3I9V9 1M5PC 3CJQA 5DLGA 2CJ9A 2B4VA 2R9LA 2JEJA 3MGJA 4X4SA 5IM0A 4DV2F 1CC7A 1FFGB 2NUHA 3IRXA 1DFDA 2H54B 4M5MA 1RP5A 2MZ1A 2R7OA 4I2PA 5C25A 3QRQA 4Q44A 4R0EA 2HHXA 3GWCA 4A8WA 1JLQB 3KHHA 1V3ZA 4CLWA 5I42B 3VGVA 3F0NA 9ATCB 1FWKA 3R3TA 4I2QB 2ZH7A 2XB2D 1O8BA 3E3XA 3KJVA 4TY9A 1U1LA 2AZ1A 3FEXB 3IGVA 3NMRA 1AFIA 4JV5J 2YNFB 1SC3B 2PSZA 2HMIA 4LF8F 1J2VA 4TN2A 1H72C 3CJSA 4HDHA 2A6MA 2CWXA 3CD7A 2ROEA 3C8YA 2HVDA 1ZTTA 4K4TA 2HLTA 3DU6A 3DOMB 2UXBJ 3M2UA 1RHMB 2UXDJ 1TR0A 4FF2A 3HD1A 1C1CB 4F4KA 3MM7A 3QSIA 2OELA 3QT8A 4A4JA 3NGDA 4PWDA 1QAJA 2CNOB 4ENOA 2OEMA 1Z4UA 1BMQB 1ZA1B 5HBMA 1HBNA 4NZ0A 1FRXA 5J1NA 1L3VA 2D7SA 1R8CA 2OO4A 1NZ8A 1RT4B 2A1BA 3GYXB 1ZBTA 1CJUB 4Q43A 3MAHA 3MMCB 4O3NA 3NS6A 4RW7B 2HZCA 3CWJA 2J0SD 2VV5A 5J2PA 4C4WA 1RZMA 4YOEA 3QNWB 4RW6B 4ZPBA 2AF6A 3MOJB 3UCZP 2GMHA 4LF4J 2XMAA 3MFHA 3W62A 1S1UA 2Q6CA 4U67Q 1FKPB 1RJJA 1QM9A 2J9CA 4DLEA 1SJRA 4JI3F 2IAJA 4ZKAA 4XTTA 3KLHA 4DFKA 4NRTA 4NL5A 2KT5A 1RGVA 1FJCA 5JMNA 1SKRA 1P9QC 5L9NA 4WE1A 2GS8A 1OMSA 3EGVA 3U1MA 4YMEA 2X1FA 1YBUA 3CB4A 1Z1ZA 1RT5A 3MR3A 3AY0A 2V2QA 2W2OP 3CCUS 2HQFA 1U1KA 3PEHA 2YX4A 3KNGA 1N6QB 4X4NA 3CCMS 4X65F 4YUDA 1AROP 3BKUA 1WC1A 3OFEA 1XNRF 2X3DA 5KFZA 1YRUA 4XPCA 1PIEA 2E5HA 4FXDA 4ZVUB 1U0HA 1EKRA 1TK0A 2KXFA 1VMBA 4A8QA 4OJGA 2NXEA 4MTPA 2HAIA 4DQPA 4YR0A 2OPQA 3SMZA 3TAQA 5J1EB 1F5BA 2Y9HA 2XO7A 4LFAF 3IR5B 4C11A 3JQMA 3FMBA 1IBKF 1RWMB 2VPYB 4DSEA 4ECSA 1JLBA 3IC1A 1Q5YA 4ED6A 5DETA 2ZVIA 4C97A 1X4HA 2V4RA 1YRXA 2X3GA 1Q8KA 4KHRA 1IBMJ 2UUAJ 2V50A 4Y0FA 1OPZA 3PM9A 2V2KA 1NPKA 3THTA 5DG7A 3Q83A 3PXGa 1JLFA 1LWFA 2DNMA 4USTA 2W8KA 5F8LA 3PJ9A 2RRAA 2ZBCA 1K8AT 2E66A 3CJ0A 1S0VA 1IKXB 3W2VB 2XS5A 3E01A 4J9SA 3J7YI 2R8GA 3G8SA 1AZSA 1NK0A 4DOZA 2HFUA 4IR1A 2HYIB 3NGSA 2PEBA 3Q0AA 3MPYA 3R5BA 3WC2A 3ZO7A 4KJIA 3OFGA 5HMYA 2AGOA 3OL7A 2DPJA 3DXBA 1JLCB 2XCAA 2DXDA 1SCJB 3KMSA 2DEIA 3C6TB 2Z56B 2H1YA 2I1RA 1YJRA 4PPZA 1LEOA 2ZKTA 3M9MB 2DR9A 4G1IA 1EZZB 3L09A 3RBXA 3IBCB 4DR7F 3W65A 4DSLA 2BANA 4HI1A 1WI8A 1HNIB 2ZKUA 4C98A 4U7CA 1S1VB 1IKWB 3W5YA 2VB6A 3GPAA 4ECYA 1C0TA 3MAAB 3HP6A 1RT6B 1NDPA 2Y0BB 3MUMP 3UQSA 4NCGA 3BKFA 1F0XA 2MSSA 3RAQA 4YB5A 4F67A 5H1SV 1MNEA 1UJ5A 2VIHA 2VQEF 1CJKA 1TQLA 2GVZB 1T9YA 1Q86T 3JYTA 4B17A 4FKYA 4WFNQ 4LBIA 1Q0NA 2OPRB 3U27A 3D66A 3JTPA 2JNJA 2NYIA 4X64J 5DZ6A 2BACA 1DLOA 2OI2A 4WFXA 4LRAA 4MIBA 2C3OA 4NI2A 2EKYA 3VTIA 2ZH2A 1VQ9S 1X4BA 4Y2AA 2XI2A 3PW7A 2IRYA 2R8HA 3C15A 4U9RA 1F5CA 3CE8A 4RBTA 3ZTPA 1T9UA 1VHIA 2NXJA 4DR5F 5C7PA 1U49A 2C2RA 2KO1A 3ENWA 5IV3A 3SSQA 2RF2A 4C3LA 2HS4A 2W4CA 1UJ6A 2KFNA 2JSXA 4DL5A 2I5JA 5SZTA 4NEZA 1NK9A 1ZETA 1X7VA 1H74A 3WX8A 2IVYA 4OYMA 1J27A 1RTDB 1B0TA 1E6VB 1N56A 1S99A 3TVYA 3NAIA 2DITA 1IKVB 4QR2A 1U8SA 4NXNF 1NM2A 3DLEB 3S01A 2LA4A 5HMZA 2MQOA 3PG9A 1RTJA 4N47A 1ZAVA 4ANEA 4ZP8A 1VLYA 1HI8A 4UUXA 1N54B 5KFJA 2SXLA 2XYPB 4H4KA 4OLPA 4OFZA 3PTWA 1RT1B 4BBYA 1IJEB 4CYUB 2MPUA 3GYNA 4OIXA 1MMLA 5HQLA 2CQPA 4C7QA 3AFGA 2ZH6A 1SL1A 2IRUA 5A6WA 1F6TA 4Q7AA 5A8KB 2LXFA 5F41A 3HK2A 1FK9A 3BN4A 1KEKA 4B9MA 3MM5B 1RDRA 1G4CA 1GXTA 3NAHA 3K2YA 2YH1A 2OEJA 4MKBA 3OXGA 5GMKa 5M2RA 1M5SA 3CCLS 1T02A 3RBEA 1R8BA 3KLGB 2RVJA 4W92B 2VONA 1LOUA 3FCWA 1R7IA 1RAOA 4NPOA 3MF5A 4LF5J 5E3PA 1N5TA 3CJ4A 1MWZA 3H42A 3X1LB 5LMUF 1NK8A 2V4JB 3RR8A 2V6AA 3HT0A 1LWEA 1MWYA 3MMBA 2MGZB 5C2GA 3JAMU 4YDDB 5IOLA 3R27A 3BSNA 5HLFA 1NSPA 3EE3A 1R0CB 3LP2B 1B3TA 1S1TB 2DD8S 1N36J 2YKNB 1JJ2R 3ET6A 1MLAA 1AA1B 2F9DA 3MM8B 3DOLA 1C2PA 1W25A 4KV8B 1NJWA 2CNLB 2EFQA 4OX6A 3K5MA 1JLAB 1RKIA 2V2ZA 2OP5A 3M6VA 2HBZB 1JLGA 1GMWA 2YNIB 2QRRA 4OZ3A 4PUOA 4ZPWR 4C2MA 1EARA 4FS2A 5EWEA 4CH0S 4QU7A 3C14A 4LF6J 4WFAQ 1X5SA 3AQPA 4OHVA 2PN6A 2Y8YA 3BZQA 3HHLA 1L3TA 1SXLA 4ECRA 1XC9A 2B7CB 2AYMA 1F9FA 2YPZA 3UCUP 1YIJS 3OV7A 4LRCA 1UEKA 5F0UA 2LEAA 3R5CA 1NHVA 3QT6A 2W2QP 4OI3A 2CNNB 3SEOA 4X4RA 3NNCA 4B3OB 1R8HA 1WHYA 3D0HE 1URNA 4DR4J 2QLWA 4FPRA 4ETXA 3RYLA 3QRPA 5DM6Q 4WZQA 3J7AN 4MIAA 2P9GA 2EXUA 1GXLA 2F63A 2VKRA 3T1HF 4IRCA 4UQTA 4CO4A 2MDAA 1EETB 3MMAA 4DR3F 1OIAA 2XO6A 4CH7A 5E5NA 2MKKA 5A0YA 1Q16B 1X0PA 1QVFR 3G86A 3IAM9 4LIWA 1X4DA 1HLWA 1LNQA 2E1CA 4DUZF 4WU3A 1FX4A 1NLKL 2KVIA 2AGPA 3SXLA 2IHR1 3MECB 4WKRA 5BR8F 2KHDA 4LVNP 2DGWA 3BN7A 4ED4A 1H0HB 3HXMA 5KFBA 3A8JA 1CQNA 3QJPA 1NPPA 4EEYA 2UUCF 1S76D 4CLKA 1CQMA 4L74A 3ZZZA 4U8YA 3UDVA 4OYAA 1S49A 2MYFA 4J91A 4IG3A 4UOFA 5ETVA 4M5IA 3V81A 1C0UA 4LQ9A 1HBUA 4K7QA 4DWIA 4LFAJ 3N5BA 2AZ3A 1HI1A 1GMWD 1RT7B 4CLLA 1IBKJ 3HSGA 3RJMB 2ASDA 4JI6F 3FNNA 3TI0A 3DI6B 1EP4A 1OY6A 4ZJQA 4QWCA 4ZVGA 3FBCA 3KOAA 3G8QA 4DV4F 1HBOA 3HJFA 4KY3A 1R0BG 1UW9A 4V19J 1NMEB 1HWUA 2LQJA 1KN6A 5LSLA 1G3OA 2YKPA 1S57A 3HFZB 3EPGA 3OVSA 2JVOA 3D7SB 2XCPA 2L9DA 4ZVPB 1TVRB 3M8QB 2KXNB 5HMWA 1R6YA 2XLKA 4KB7A 1NK4A 5L9XA 1NUEA 3KLVA 1SC4B 5EHHA 3MM9B 3PYDA 3PJXA 1UFKA 1N5YA 2AU0A 2ADCA 1Q8LA 2XY7A 1OYEA 3BF4A 5F8NA 4ZPVR 3NG8A 3LAKA 1TUVA 3CO0P 2W25A 4AQYF 1KTQA 3WBZA 3HSJA 1K1QA 1MU2A 1ZTWA 2VU5A 1S1XA 1D3WA 3NS7B 4FYWB 3PHTA 3KK1A 2H51B 3H20A 4DQIA 4LR7A 1UWAA 1X4AA 2FJAB 4X66J 3CJ2A 4LSLB 4U7UD 4K4YA 4ZMMA 2HBYB 1TKTA 4NMXA 2LLZA 2DRDA 4ES3A 4IRKA 4TQSA 5KFMA 1WC0A 1Y3JA 3THPA 3HFKA 1WJ9A 4X4UA 3Q8PB 4DR2F 1VQ5S 4ICLA 1FNXH 2JOQA 2WVCA 4BS2A 3N01A 2EEYA 4K5SA 1SUQA 1HNZJ 3OR1B 4KH0B 3EMTA 2AW0A 3W5ZA 3SDEB 1S9GA 4FNIA 1HKAA 3FSYA 1PAUB 4FBTA 3BM7A 4RUHA 2FHMA 1EB0A 4AXJA 1KOHA 4B9NA 2IJRA 4DPUA 2CZVC 2ZHAA 2VASA 2WK4A 2FJXA 5KFEA 4I56A 4JUZA 4KT0C 3LH2S 1S1WB 2WAQD 5A76A 2RU3A 2NPFA 3MTJA 4YY3J 1WSVA 2ZHOA 3IMQJ 1X4FA 1XMOJ 2DR5A 4R8UA 4PYDA 4WBFA 2Z2LA 4H54A 5KG6A 4RBUA 2VHGA 1AUSL 4P73A 3AHPA 5D8HB 5IV4A 2ZDPA 2BJ3A 4EBCA 4DL4A 2OJ3A 1X5TA 2CPYA 3OT9A 4ZCMA 1RHQB 1RAAB 2VOPA 2W9AA 2J6SA 5AJ3F 4DBQA 1FFSB 2GHWA 2V69A 4FP9A 2ZC4A 4I0WA 1DHMA 3W66A 4FS1A 2CZ4A 4LF2A 2IVFB 1Y10A 1HQEA 3SV4A 4IDKB 2BKNA 3MXHP 2WW8A 2BV3A 3I9ZA 1FRMA 3AT1B 2FJWA 3CTRA 4Y2MA 4A8XA 4E8UA 4IFYB 2YH0A 4L75A 4Y2CA 3ZFVA 2P2CB 2LYVA 3A13A 2EFOA 2YWWA 1AXQA 3DLHA 1HWLA 1LWCB 4G1PA 4USUA 3I6PA 4WTOB 2YXLA 1RYRA 2R7SA 3VHQA 1RBLA 2J7KA 4JV0A 2HLUA 3J81U 4O4GA 2ZH8A 1XN9A 4A47A 3TZXA 2LKZA 2CPDA 2CQGA 4UTGA 4F04B 4ILMA 4NA2A 1SQGA 4OX9F 2O5DA 4KO0A 4HACB 3D54A 5T7LA 4KPYA 4Q8EA 5IQ6A 1GX6A 2L9NA 3K58A 1FVQA 4BCAA 3RBDA 2EPIA 4PXCA 5DQGA 3RAXA 4FF1A 2WW4A 4OYPA 4ED8A 2R3VA 1FFWB 4JI8F 4KYZA 2BRLA 2MKSA 5HMXA 5K8PA 1BQXA 3H8YA 4QWEA 5FDLA 2MHNA 2ZUGA 4OQJA 3EVWA 2FVSA 3E8OA 1T11A 1TFWA 1P27B 5A8WA 2AJ4A 4B9LA 2CVIA 3AD8C 4DPYA 1PSDA 4FZVA 3HULA 4UT4A 3QBCA 3T9NA 2G0JA 2FB0A 1FNMA 3N9UC 1WC4A 2P6TA 3OD2A 1L3SA 2KYXA 3OPKA 1BXNA 3GIMA 5KFIA 4DR1F 2DISA 4QIVA 4CNYA 4O44A 2K1RA 1TFYA 1RUSA 1B7YB 1IR2A 1XR5A 2DNZA 1P6TA 2E9ZA 5L38A 3DMJB 2ZZMA 3LO3A 2RU9A 2AWZA 4ZVQB 3DKDA 3CEDA 2KHCA 3EX7B 4NLWA 5ETRA 2D3OR 3BQ0A 4P2SA 1X9SA 2W2NP 4CLUA 1N5VA 2B9EA 5KFWA 4F36A 2OEKA 1AB8A 1S6PB 2Y1LB 2BE9B 2DNQA 4WXWA 3M2RA 2YNGA 3FBEA 4K2XA 1RHJB 4NCAA 3SQGA 4LF9J 2PDAA 4FXWA 3ZTSA 4JI2J 2WONA 5ETLA 1KQKA 4KHPF 3CJ5A 3PX0A 3N28A 2M0GB 5J2PB 1S72S 1RLCL 4R5PA 4C3KA 1KKHA 1V3RA 5KFFA 2C2OB 1RTIA 1C4AA 2ZBPA 2WCXA 1T0TV 3DOKB 4QYRA 1R8PA 3GFYA 2BJ9A 1HBMA 1CJVA 4NLDA 5J2MA 5AXLA 2G1DA 1Q53A 4AYBD 3KLHB 4DSIA 1JJCB 3BBCA 4NMLA 1DURA 2CPJA 5F9LA 4RPFA 3D6FB 3DGPA 2XC9A 4NYZA 3QIPA 3I0RA 2LXUA 5JUMA 1PYTA 3OTBA 2PT0A 1F9EB 2PFFB 4K8RA 3LPYA 1VIXA 3MPDA 4PG4A 1XR6A 2QMUB 2CUYA 3TUJC 3T5KA 1H6KX 1ICEB 5DS7A 4RUAA 4I1TA 2EG2A 1GAOA 1DTTB 2UUCJ 2B0GA 3VAKA 2BJDA 3OL9A 3IS9A 2OH2A 2DXFA 2RILA 3D5MA 4CM0A 1C1BA 1TV6B 1VR6A 2AJ1A 2IBKA 3IWLA 1GTHA 3PRVA 3HD2A 3V2UC 3KK2A 3QRRA 3F41A 3F73A 3PEJA 1YK9A 2CDRB 3OTCA 1X8DA 3LAMA 4ZPAA 1RTHA 2HW3A 2R8IA 2POKA 2HVHA 5IWAJ 2WVDA 2P9CA 1REVA 3UDLA 4LFCJ 4EI2A 1LW0A 5CZXA 1AT1B 3CJ8A 4X2BA 4IRDA 4DL6A 2D41A 3DRRB 2P5VA 5IZHA 4LFBJ 3MPUB 4LRFA 3PNIA 5B7WA 2ZBQA 3OFFA 4F02A 3A8IA 4XK8C 4HT7A 1R43A 4MJKA 1JXVA 4MT1A 2VJVA 2HHQA 2A10A 5CAAA 1BUXA 1I3OB 4J9PA 1QTMA 3THVA 3E01B 4RNHA 4DI6A 4B9TA 2OLWA 1TL3A 2D69A 4Y34A 4K5RA 1WOOA 3R2DJ 3KG0A 3FBBA 1SPBP 4M94A 1WUUA 1B7FA 4ZK7M 2ZWOA 3UR3C 1NJZA 4EYHB 5J2NA 4FPIA 1FI4A 4DV6F 2XQCA 2XTJP 3ZTQA 3G82A 2HHWA 3O5TB 2VQFF 5B0DA 1OYDA 2OTLS 4OJ3A 1B99A 3OVAA 5KOXA 2N7YA 1QSLA 2Q3PA 1J5OA 3PY8A 3DC2A 4URGA 1GK8A 3SSRA 4ZP6A 1OJ4A 3NEKA 4BC7A 2RAQA 3J7Z5 2BANB 4CO3A 2IA6A 1Q81T 3NXZA 3QT7A 4NLYA 1IWAA 2ZD1A 4ZHRA 3QLHA 3C6UA 1HW9A 2G0IA 2CQCA 3KHRA 2KG1A 3W64A 5E33A 4IH5A 1HR0J 1JMTA 1DQ8A 4NCGB 4Y2KA 1EIYB 1PAEX 4C8ZA 4JP8A 1UTAA 3JTNA 4JI4F 3Q8RB 2KL8A 3UW1A 3UNYA 3R7SB 4QWAA 2RS8A 3KJNB 1N48A 4OZLA 1TZ0A 2NXUA 3V6DB 3M30A 2J8SA 2Y0SD 3K17A 3K5PA 2Y1IA 3MEDA 3LALA 4JOUA 1M90T 3CGIA 2GJ2A 2DNRA 4H4OA 1TTHB 2BM1A 1ACMB 2ZE2B 4NLSA 3KYLA 2XY6A 4EBDA 1U8WA 1FKAF 4DV1J 1HMVB 1K9MT 1M5KC 5HI7A 3W9IA 4DG1B 3IBWA 2JLEA 3L4BC 5BYQA 5ETTA 2ERRA 3AOCA 2MMYA 1KD1T 3QQCD 1PC5A 4AL6A 2QE5A 4P6QA 2V8PA 2BX6A 1ZM4A 3M6WA 2LQ9A 5GAEU 2WHOA 3SI8A 2M8DB 3QYYA 4IO1A 1TUWA 3CMAS 1FRIA 3P5BP 4M95A 2WBRA 2BKPA 2NXNA 1P1TA 4DEZA 1PJ7A 2ZDOA 1FRHA 3POTB 3AXKA 4ZOSA 3DCAA 2CQ0A 1KVIA 1HD1A 1WC3A 1S97A 3QGIA 2XSJB 2I8EA 4DSKA 2HVIA 4IQMA 3BO3A 1FT8A 4M5DB 2HHHF 1S9FA 4JI1F 2FGOA 1VRTA 1N33J 2B3TB 3KLFB 4NCBA 3G6VA 2CJXB 4FNHA 4JI0J 4TLRA 2FHJD 2HURA 5CYMB 4C8NA 3NKYA 1RAIB 4URSA 2FIUA 5DDQC 2ZC3A 4DPWA 2FTRA 4GKKF 3S1TA 2CXEA 2G9OA 4U96A 3D68A 1XMQF 2V8DA 1YJWS 3W61A 1Q8BA 1R3NA 4X62F 1RHRB 1NK5A 4MKVA 1REGX 2CIMA 3HVWA 1FK9B 3QATA 2RRBA 3W9HA 4M5LA 4B3SF 5JJBA 2V8HA 4OZ5A 4ZA1A 2QN6B 4MH8A 5ETKA 4UOCA 3M8RA 1EHWA 2CPHA 3JSBA 3Q8SB 2K06A 2BABA 3FC9A 2BQUA 1FKOA 3TA0A 2GA7A 3GJTB 1ELOA 1MN9A 1K44A 1RWWB 3CULA 4JYAJ 3ADAC 2RH3A 1PG5B 1RSCA 3E2EA 1SV5B 2QA4G 5J1PA 4NXMF 4NA1A 3GILA 5GADU 4PXEA 3TA2A 2RD5C 4LF7J 2XNRA 2JVRA 1WG4A 2JH3A 2F40A 1M5HA 3V6HA 2NREA 1S0MA 2FVPA 4WP8A 4QIGA 2YTCA 4PXDA 2C3YA 3EICA 4J9VA 1WORA 1Q1KA 1UVMA 3J7A1 4CLYA 5HJXA 5HLFB 4MK9A 2FLPA 2M8HA 1SKUB 3UN2A 1IR1A 4GRSA 3ET6B 4KPCA 2U2FA 1V5IB 3NGRA 5LM7E 1YI2S 4A8KA 2IYIA 5KFDA 4DU7A 3ZZOA 2XMVA 4F4ZA 1OS5A 3NP5A 2W9CA 3R1HA 1RU2A 2JWNA 1ZOTA 3I56S 4IG0A 2XMKA 5HSPA 1JLGB 3G6ES 2Q6BA 2HFSA 2KI2A 1QSSA 4PUOB 2AKWB 2CQIA 3OXFA 2VICA 3HHLB 2DHSA 3KLIB 1QE1B 1IR0A 5DGBA 4RO0A 4WIIA 2Z0GA 1YBAA 3FFIA 4J9RA 2MQLA 5HP1B 2J76E 3MEEA 3L7OA 3GJRB 2UVWA 1S5ZA 4EGLA 1Q79A 5KFTA 3OTEA 5CD4H 1PYSB 2GNKA 3DHWC 1DZ5A 2KJVA 1EQ0A 2HWTA 3DDKA 4ED0A 3Q8YA 1S7HA 1VRUA 1FA0A 2DHHA 1GXUA 3HF5A 2WVFA 1RAJA 2VFSA 2XZWA 4KIAA 2N7CA 2G13A 4F50A 2XS7A 7FDRA 2XWYA 2C1EB 3BYRA 2FVRA 3TEGA 2HKEA 3WZ0A 2JRSA 2M2BA 3J81j 4PQAA 2YQ1A 3GIKA 4USHA 3NGUA 1Q78A 4WTYA 2F9JA 3MCOA 1VOMA 4JV5F 2AYEA 1DTQB 1HYSA 3GTYX 1A0OB 1UL3A 1NRKA 4FN5A 2ZWPA 3RW6A 5CD4A 2WVEA 6AT1B 3BPSP 3QO9A 2V8VA 3U1NA 2EWHA 3KK3B 4TY8B 3GCXP 2UXBF 3DM2B 4O4RA 2ZNZA 1BWEA 4RWWA 2UXDF 1F1BB 2B43A 2HZVA 3ZTRA 2PFDA 4WYWA 2RQMA 1PKUA 4EBEA 2PMZD 4O23A 4IG3B 3V81B 1ZS6A 2V67A 1OWXA 2IM3A 1HHTP 3KMQA 1LK5A 2DGSA 2IIHA 4WFBQ 2M52A 2YWKA 4U6PA 1PBUA 3KLEA 2V34A 4N5SA 2XMTA 2MLZA 2ZJRQ 5EWGA 2HPUA 3G2XA 2MQNA 4P7VA 1X0FA 2YKAA 3RUBL 2BJ7A 2IPOB 3TX0A 4N56A 3ZZTA 2CPEA 1I1GA 1TP7A 3TNVA 3UWTA 5L39A 1JJHA 4LF4F 3HMJG 3TR5A 2N4DA 3MEGA 5IC6B 2FVQA 2GV1A 4WFZA 4M5KA 5HVHA 1Y0HA 4OMFG 1D9AA 4N77A 1SKWA 2DO4A 4YS2A 1BY9A 1VBYA 4TU9A 1N5YB 1WD6A 2ATCB 4DV0J 2PI4A 1RTZA 2QT7A 2XMUA 2AHOB 4DV7J 2IC3A 1UVIA 3CSKA 3AA8A 3OTOJ 3BSOA 2DEJA 1FHTA 3M05A 2F5GA 3I0SA 1KOOA 2JHEA 5E3AA 4PXBA 2ZFHA 4J7CA 4FYVB 1X5OA 3TJ9A 1QVGR 5A8RA 3TARA 4ECVA 3LP0A 3TRGA 1S6QB 2R7TA 3KK1B 3MM6B 4CLSA 2AP6A 2RKIB 2C2EA 4S0MA 1B70B 1LFPA 1CBKA 1T9VA 2EBEA 2JC1A 4J9OA 5L1KA 1UEUA 4B3RJ 2HAFA 2I9SA 4DMZA 3WDOA 1KQSR 3CMQA 2DNKA 2QL5B 5GADI 4ICLB 3MUTP 1U1RA 4NZ7A 4QQBA 2VFUA 2K8GA 6FD1A 1FD2A 4GC7A 5J2QB 3M2VA 3LP1B 3M6UA 4I7FB 2ZH5A 2W7AA 4P2FA 3CT9A 2WSFC 1G7CB 2BDPA 4C8YA 3KDNA 3BQ2A 3FQLA 1JB0C 2H3EB 3H5UA 3SCJE 1NH8A 1TKZA 3HVRA 2VBXA 2DVIA 2OUGA 4ILRA 4ZVEA 1T9WA 3F56A 2ZBIA 1KHVA 1OQ6A 1IBMF 3KHLA 2UUAF 3H25A 4OJ1A 2HGNA 2CQ4A 4NZ6A 4Z2XA 3G8TA 2BJ8A 4ZVHA 3W2WB 1BD6A 1BQMA 1Q8IA 3BGFA 3BGRA 4NYOA 2J7UA 3DRPB 2ILZA 2QEXS 1WSRA 2JL9A 2EC0A 2HIQA 2QZ8A 2MKCA 3D1QA 4K4XA 5C42A 4RW4B 3I31A 4FBUA 4OX7A 2X51A 4OYWA 4ETZA 1DAXA 3OBIA 1OSCA 1RAFB 1UFLA 4GVBA 4WP3A 1ZM2A 1Y5NB 4X4PA 4WPAA 4J5OA 4YB7A 1UVLA 3MWBA 3WX4A 2XMMA 2GHPA 2LP4A 3ZZ0A 3D3CJ 2A2CA 2HNZA 4BDPA 2VG7B 4DV3J 1LFWA 3RR7A 2ALYB 3M32A 1CULA 1BQNA 4ID8A 1DJ0A 3VWSA 2HVZA 4F3MA 5C2CA 3M1VB 1XMBA 1IBLJ 1DRZA 2L41A 3EXYA 3Q24A 4CIOA 1XIQA 3N6NA 4P2XA 2XGQA 3RB4A 5LJ5Y 3R6GB 4IOCQ 1FDBA 4OV6A 4N8NA 5GAGI 1RXOB 1HARA 1YSJA 3J7ZT 1UETA 1FTRA 2O1PA 3KTQA 2G0CA 4PG6A 1JLQA 2MJUA 2GVDA 3CPWR 2H4WB 5I42A 3MCNA 2VH7A 4KKOB 4F2SA 2CFXA 4F25A 5THWA 1HNWJ 1O6XA 2R2SA 4B3SJ 3SFUA 4X64F 4KE5A 2KKHA 2CDQA 4IH6A 1N5QA 2HQDA 1WKKA 4IQXA 5C24B 3T6JA 2GIQA 4CTAA 3DRYA 2HHSA 2CNKB 2PC6A 1SL2A 4DU8A 2J6UA 3PDNA 2RSQA 3OR2B 4FYXB 1M5VC 2Y3YA 2DO0A 3VV2B 4NLRA 1U4BA 4KFBA 1V3SA 4OV1A 4ED2A 1XQIA 4C6AA 5LXRA 4DLGA 3DOMA 3CF5Q 3O44A 2D1CA 1UJ4A 1VQPS 1RKJA 4C3MA 2CG8A 2LEPA 2UV8A 4PRFA 2GHVC 1C1CA 1U24A 3Q8QB 1HI0P 4BC9A 1RLDA 2XYGB 3QGHA 1KP6A 1JKHA 2VUGA 1OY8A 1VBZA 2NZCA 3KUHA 4H4KC 3VGTA 3GLJA 1OSDA 3TO8A 2YNHA 4QPTA 4H4MB 1JK9B 5ETQA 2AX0A 1BHNA 5KFLA 5I3UA 1S4EA 1RT4A 2MZSA 2V8GA 3W1YC 2G2YA 2RQKA 1CVJA 1CJUA 3GMGA 4HL9A 4AL5A 1YJ9S 2LECA 4RW7A 2HQCA 4KQZA 3AJDA 1SKSA 3FUYA 3K8VA 3MTKA 4PWWA 3EZUA 4OI6A 1SI9A 2VG5B 2XULA 3SCIE 4R0JA 3LGNA 2GAGC 3LUYA 3ITHA 4HHHA 2CJAA 1JNRB 3B6BA 2P6SA 1TKXA 2GQQA 4CT9A 4DQRA 5CA5A 1W2IA 4LF1A 1LWXA 4HR2A 2QIFA 2CZ9A 2OGUA 1HNVA 1FJ7A 4P71A 2RDJA 1MROB 5LXYA 1IKYB 2VF3A 2ZH1A 4ZVFA 1Q82T 2N3OA 4ZCKA 2JEIA 5L1JA 2DK2A 5CZVA 2Y1RI 3TVKA 3H5YA 1RTIB 1UCNA 2OKQA 3MAQA 2HIYA 1KFSA 1N6QA 3NRBA 4ELUA 2ZH3A 4LF5F 1WDDA 4A8MP 2E1PA 3FEYB 1KSPA 3C19A 4NA3A 2Q1LA 3KUEA 2OMOA 5E3QA 7AT1B 5D15A 4YB1P 3CJTA 2EBGA 3DGPB 4KR0B 4RW9B 4C9DA 1I51B 3CD0A 4K0KJ 3UDEA 4ZPDA 1KQFB 3TAMB 1XEZA 1FO1A 3GFHA 4K4UA 1VLOA 3IA0A 3ISND 2MZQA 5J1EA 4ZIVA 4NX9A 1N36F 2CQ3A 3NY0A 4EUVA 2H65B 1RE1B 3I4PA 4NLXA 2D74B 2XHCA 1RCXB 2B6AB 4U7UK 4PWUA 2E7WA 3SQOP 3RTVA 3MFIA 5G0RB 1A9NB 1D9FA 3VVUA 2JX2A 2VG6A 3HHLC 1FXLA 4DUYJ 3VAMA 3D3BJ 4LF6F 2MQPA 4KGMA 3K89A 2ILYA 3HT3A 4OZNA 3W2VA 4ES1A 2AJFE 1B64A 4OI1A 1LW0B 1LW2B 4QW9A 2EFPA 2IMWP 3K57A 3Q89A 2C28A 2QC3A 2IY5B 2VD3A 4TLQA 3IP0A 1Q5VA 2G1HA 5K14B 3VQTA 3ELHA 1T95A 1JLCA 1D0EA 4DR4F 3C6TA 3ETMA 1KVJA 2W24A 3LQVA 3DLGB 4NLVA 1GNKA 2IDLA 4K4VA 3RGIA 4L73A 3K5NA 3HLUA 1S1VA 1IKWA 3UFCX 2COLA 4Q8FA 3JSMA 2IA0A 2DNNA 5DO2A 1HFEL 1WF1A 5HK4A 5J2NB 1RT6A 2BW7A 3T6BA 1S12A 3QAEA 1MW7A 2VFTA 3HHEA 3JTOA 3ONQA 5IS2A 4N8OA 2VBYA 3EVOA 3QGGA 1S0OA 2BRKA 1QAIA 2J0QD 5B09A 2BBEA 4USIA 3NGTA 2OPRA 2KDOA 2UVRA 2B51A 2BZ2A 3RB0A 4M5HA 2HFZA 1ZH5A 2IDEA 2KZMA 1NKBA 4ELVA 3FRZA 1VDHA 3MDFA 4OZ1A 1D9DA 2ZD1B 3QLHB 4ZJLA 3C6UB 4DCJB 2Q66A 4AE5A 2W2PP 4NLGA 3AQOA 3H4BA 3Q8VA 4DPTA 2DNYA 4ZIWA 2E1MC 4PAAA 2RNEA 2RUSA 4L6V3 1JXLA 1WTFA 4UZCA 3DRSA 4CT8A 3OHBA 1OY9A 3OTDA 1AFJA 1RA6A 4QBUA 2K2PA 3CIMA 4P9SA 4H4OB 1CPZA 2HHTA 3ICLA 2ASJA 2PO4A 2GMJA 4IH7A 4X4TA 3PR4A 5IT0A 3SV3A 4DPOA 1E6VA 4JV2A 4Y65A 2KRBA 2YWFA 1DQAA 2ZJPQ 3MURP 3DLEA 4DX7A 3LGHA 2A0FB 3FMWA 2BOPA 2OTJS 4RNNA 4X84A 3ULHA 1R27B 3KWMA 1RT1A 4D3HA 3W63A 4I68A 2R7QA 2BEFA 4CYUA 3R9LA 2B5JB 2N3LA 3LWMA 2QMXA 1S4FA 5DGAA 2UP1A 1D09B 4USMA 1XJWB 2E5LJ 4DL3A 5JVHQ 3QWUA 1IBCB 4OYBA 4UOGA 1BWVA 3BPDA 2XS2A 4EO8A 2O66A 3KXDA 4L76A 3S6EA 4X66F 3MM5A 2MTLA 4URQU 2YX1A 3GR0A 2ZOFA 1NH7A 1WI6A 4WXOA 1TMMA 1MMNA 5EN1A 4QIEA 1E6YB 2RHSB 1XBWA 5AE1A 2HQ3A 4RJVA 3L9ZA 3MPWA 3EM1A 1PJ5A 3HJVA 5LMNJ 1FRJA 4DZ6A 4K4ZA 3KLGA 3TX8A 3DHXA 1HNZF 2R8KA 2NZ4A 3W8PA 3P49B 1FXDA 4UUWA 5HVGA 2HZAA 4P2MA 2A3JA 8RUCA 3W60A 2GO9A 1KVKA 1GMUA 5A6PA 3T3FA 2B4PA 1FWPA 3HHKA 4ELTA 2J0WA 2V4JA 3ETOA 2Z8QA 3A3OB 3W7BA 1UKUA 2JEFA 2VKZG 1S9EB 2MKHA 3TZWA 3Q23A 3T19A 4YY3F 3JS9A 4NLPA 3AODA 2FD2A 2E1RA 1XMOF 1OO0B 4B9VA 2LU1A 2DIUA 5B0FA 5BYSA 4XO0A 4DCPB 2YKNA 2PI5A 4WZMA 4MFBB 3UNGC 3MM8A 4NASA 4LBHA 1P9YA 3VZIA 4F4XA 3L7UA 3RW7A 2OPPB 3G6YA 2CJKA 1MMDA 1JLAA 5DJBA 2VC1A 5F3ZA 1EX8A 3O8WA 4DL7A 1JX4A 3H40A 4OX8A 1RT2A 3D6TB 4AL7A 5EWFA 2CG4A 2C2ZB 1WEXA 4ECTA 1RU1A 3BB5A 2AJ2A 3P5TL 2V0NA 2ZBRA 1O51A 1RCOB 2DB1A 3M9NB 3NLCA 3ZTOA 1CS4B 2HK3A 4C8MA 2OHDA 2W9CB 1U25A 3VQSA 2Q43A 3KJQB 5E2QA 4DQSA 4HTJA 4O3SA 1T03B 2H5JB 5F8HA 4IG0B 5AXMA 2XZDB 4B3OA 4J9UE 3B4MA 2DNGA 5E41A 1U2FA 3AOBA 3CC4S 1Z2LA 1UZHA 3P96A 3M8SA 3TVZA 2G2ZA 1YTYA 4DXLA 4ED3A 4ZPTR 2RT3A 1S6UA 5H9EK 2QJ3A 2V68A 5KFSA 1VS3A 1R6VA 3BS9A 3MD3A 1OPIA 3CD6S 1WG1A 2HG4A 4RNFA 1VJWA 5GAHU 1D8ZA 2AIRB 1QY7A 2DY9A 5HATA 4ECQA 3I5AA 4ECXA 2KRRA 4KH1B 5IT9Y 3UCGA 1UA0A 4BLGA 3VAIA 1GTEA 1RQ0A 4P10A 2IVMA 4TNOA 3N0VA 5BXIA 3EZ5A 3PV8A 2FVCA 1FERA 3PACA 3DLKB 1XWLA 5KFCA 5E0OA 1ZAWA 5KT7A 5E3RA 3ZZUA 3WC0A 2RMLA 3NBPB 3BSCA 3MD1A 3GR1A 1CJTB 2VL1A 4IFVA 5D4OA 1H7XA 2W9BB 4UQGA 1QSYA 5DDOC 1RT3B 4JI5J 1FD8A 3A12A 4EWTA 3QGPA 2VBWA 3HM9A 4DFJA 2XMJA 5B0EA 1ZM9A 4P52A 4YP3A 2BQ3A 2QFIA 3C66A 3I5CA 1RT7A 3DYAB 1VIOA 1FDAA 2DHAA 2B9YA 2YX7A 1R8AA 2RE1A 2DY1A 2MHEA 2R2UA 2UVUA 3UO0A 3GFXA 2ZUAA 1LQ9A 3P8BB 4LF9F 2AQ4A 1TVRA 3FJ2A 4ZN1A 2YQ0A 4JI2F 1NU4A 4J37A 3B78A 3OL8A 2Z2YB 4QYZK 2JLFA 4G1QB 2NS1B 3KLEB 4OHXA 3PX4A 4ZITA 2V2VA 2B7BB 4LR9A 3UN5A 3HSZA 3HHDA 2KXHA 3FSXA 1N4LA 3VGSA 2IRXA 3G4SS 4J9LA 5AE2A 4WCEQ 2CWKA 3PHEA 3U7JA 1WACA 3WHIA 1YJ7A 3MEGB 3AH6A 1K0TA 4BWJA 2YWHA 2FC9A 3BGOP 3K0JA 3I96A 2LCWA 5DQIA 2EFVA 2V63A 3ZZYA 1KWMA 3CDWA 3GV8B 1PILA 3I55S 1MWQA 4AUKA 1VC6A 3VR1A 4LSLA 4XAKA 2Z58B 1TL1B 2RQCA 1NCLA 2EC2A 3US5A 1RWUA 1AYEA 2JC0A 4Z37A 3HDSA 2XMWA 2UXCJ 3BREA 3NWGA 1IVZA 4B3TJ 2VPXB 4CO2A 3UE2A 3CCTA 2QLXA 1HNXJ 3SDEA 2FZKB 5B0GA 2J6TA 1YG0A 4WYLA 3R97A 1QAYA 4M8LA 4XDDA 1VBKA 1YWXA 1H98A 2E9TA 4JI7J 1TL7B 3GIRA 4EZ6A 1RACB 3CJKB 2EW9A 2CA9A 3H90A 3Q2TC 1S1WA 2FLLA 2GGPB 3I4HX 3QJJA 2AJ0A 3UD5A 2OPSA 1R0AB 2JEGA 1FE0A 2UUBJ 1VFJA 1FESA 1P8GA 2ZHBA 5IWAF 1HHQA 4LFCF 2W1BA 4DFPA 4C8LA 4K4WA 3HVAA 3K5OA 1U45A 1TKZB 2IMOA 5DLFA 3FBFA 1X60A 5IFMA 3ENQA 5H9EJ 4LFBF 1VGYA 2EI5A 2CJBA 4LVOP 1KNZA 4AFFA 5HL7Q 3IM8A 3GV7B 5K8MA 2HFVA 1C4CA 4GKJJ 1UPPA 3GG0A 4DR6J 2RHQB 3R7NB 2NR0A 3BGRB 2MZTA 2H9ZA 4FVCA 5KFQA 2AMCB 2IJNA 2DCLA 1TK5A 4FF4A 5F8IA 1F9HA 3HVTB 2DGXA 4F0KA 1ZZFA 1GFWB 4PEOA 3PX6A 4IFYA 2YKOA 3OFHA 1X4GA 1YJVA 4TYBA 1YHQS 2CJQA 3FKBA 3GSIA 5ITHA 3RRHA 3QFHA 2AYGA 3TWZA 1LWCA 2VA2A 3EDRB 3GV5B 3HFVA 4HT5A 4XDCA 5KTQA 1IJFB 1SIWB 1KLMB 5HO4A 3T1YJ 2R7RA 4LMZA 4C8OA 3J7YU 1LXNA 4F4WA 2PMHA 3LA0A 4F4AA 5D4PA 5I3PA 1NJIT 2V5HG 2AGQA 5K5MA 2ROPA 1U2CA 2WB4A 4HACA 2M4MA 2EKNA 4UY8T 2LXIA 5K8NA 2WSCC 4ER8A 4J9MA 3SCLE 3N6MA 3ENVA 1GEHA 4RW8A 4EFAC 2CPXA 2N82B 1HR0F 3C16A 3DXSX 2BQRA 1VBXA 2KVQE 2VBZA 1VC5A 2QV6A 2GVDB 1P1LA 3IR6B 2QGFB 2FJDB 1CEZA 4HTIA 1D1UA 3V4IB 1U6FA 2FJVA 5HROB 3MCMA 4QYZJ 4W90B 4IOAQ 1RAEB 1B0VA 3FVYA 2DGQA 4RUCA 3LGMA 5KFPA 4DV1F 4KGKA 5F8GA 4CTAB 1Y11A 2FYXA 2GZOA 4G65A 4RNMA 4QIFA 2LQBA 1NZAA 2KTQA 1YX2A 3FK4A 3DMJA 4M63A 4KFBB 1FJGJ 4ED7A 4DQQA 1HW8A 1NPRA 3OSNA 4F8RA 4EO6A 3C3LA 4I69A 5LSRA 2QA2A 3V6KA 1CC8A 3CNQP 4P7TA 2WBMA 3BSAA 1S6PA 4QOTA 1S10A 1JKHB 3H0PA 1TELA 4HEA9 5LL6d 5G4DA 3QZ8A 2E5IA 4DX8H 2YNHB 3R5JB 1APSA 5CYJA 3NOCA 5I3UB 1N33F 2YKQA 4RX6A 4OYOA 1Y5LB 4RL1A 2IYGA 3DDNA 4JI0F 1PJ6A 3UVJB 4AT1B 1M0SA 5EDWA 4ED5A 3G9CA 1YJTA 2F1FA 4GVLA 2DR8A 4BHQA 3LOUA 5IC4B 4DHVA 3PW0A 4CO5A 3IWNC 2WOMA 3V5RA 3BO2A 2Z57B 3EGNA 3ITHB 4PCQA 3DOKA 4ID5B 3IG1B 1TKXB 4Q5VA 1H38A 2VFVA 4Y3CA 2HNDA 2UU9J 2UUTA 3ZC4A 2WSEC 4PQUA 2BYCA 3VZHA 4F0MA 1HNVB 3NCQA 4PR6A 5IM0B 3ENAA 3HHNB 4PYAA 3IRXB 4BWMA 5KFGA 5C25B 4I2PB 5KG0A 3ZZPA 3SYZA 4E2FB 1WHVA 1WNEA 4ZLPA 4JYAF 1A6LA 3UN3A 3TP2A 2BE7D 2MSTA 5KG2A 3R2CJ 1T3OA 4IUFA 1DTTA 3TUIC 3GP9A 1K0VA 2ACYA 3KJVB 4Q0BA 4LF7F 2AEJA 1FJEB 1F2GA 4K2JA 3X3UA 1NDLA 1TV6A 3ILJA 4NLTA 2ASYA 1U2RA 5DDRC 4V19X 2LA6A 2HMIB 1ZPWX 1N34J 3AD9C 2F4VJ 2DHXA 1YLXA 4X4QA 4O3OA 4ITSA 2GC8A 1BGXT 3M2UB 1VQ8S 5A2QY 4YQWA 5EGYA 3AD7C 4I6WA 5CCMA 4PABA 1HA1A 1W26A 3J80Y 3MM7B 4K50A 3N5FA 3DRRA 3MEKA 1G6BA 3GU0A 2KZZA 1YQHA 4PWDB 3IGNA 2VG6B 2DR6A 5LT5A 4PG5A 1ZAXA 4A8YA 2QLBB 4PG7A 4DN9A 3HKWA 5D3GA 4F3QA 5HBMB 1HBNB 3VF0B 4DV5J 3L95X 2B8PA 2HRUA 1W7WA 2L08A 3W3SA 1U1MA 2IM0A 1NKCA 4JBCA 4UOHA 1BLUA 4TU7A 2DH8A 3K8WA 2RB7A 4TVAB 1FXRA 3MMJA 4CDIA 2XHWA 4Q2MA 1S1UB 3H98A 3JXOA 1RHKB 1ULRA 2CQBA 2DPIA 2NXCA 2C2DA 1FDDA 4OYIA 4Z7YA 3T5JA 2CYYA 2PIIA 5F3TA 4Q2LA 1JJ4A 2BR0A 1SH2A 2IAJB 2AJQA 4ZVTB 2VZ9A 3IFEA 3UD3P 3N79A 1XNQF 2FY1A 1RK8A 1XTZA 3VAFA 1ITPA 4CQ1A 4WE1B 3JSMB 3AB4B 3VALA 3IN5A 1ZYQA 2WVBA 1RT5B 1HQUA 4YHHJ 2RQ4A 3D28A 2XEXA 4NOHA 1Y3KA 1NB2A 1R89A 1VQLS 3OSPA 2I6WA 4KGZB 4LSNA 4ERDA 2F8MA 4WKYA 2AD9A 3V6DA 1HIYA 1WG5A 1RBAA 2FY8A 4M5JA 2MQ8A 2DGTA 2NUUG 4P75A 1U0HB 1BC6A 2ZE2A 4B3MJ 3I87A 1VQKS 2Z4PA 1J5EJ 2IM2A 1QUPA 3D0GE 1VCTA 5KFKA 1GQEA 1HMVA 3BR8A 2C2KB 4DG1A 3IXQA 2OPQB 2HNYA 3EVMA 1N32J 3FRYA 3H2VE 3TAPA 3RB3A 2DGVA 1MSWD 1T05A 4C11B 3W5XA 3DRSB 2H5IB 4JB8B 2C42A 4F2RA 1JLBB 1UVKA 3SCKE 2O3DA 2DH7A 2GQ2A 2DNHA 5KAKA 3TZYA 1X4CA 1VRQC 1ZA2B 2HEKA 4CP5A 3POTA 5L1IA 1QUVA 1JLFB 1PC4A 4GO7X 1LWFB 1WC6A 2D3ZA 1HPZA 2VC0A 3IM9A 3JB9k 3EDQB 2XSJA 3BYPA 4CLFA 2XWXA 1YITS 2DR7A 4HH0A 1XR7A 1TUGB 2A18A 4M5DA 1IUJA 1AZSB 2WRMA 4DSFA 3KLFA 4L72B 4EK2A 4DV0F 4LQ3A 4C0HA 5CYMA 2KFYA 2KT3A 5CYQA 1KRPA 1WHWA 1RWVB 4DV7F 1SQFA 1QDUB 3AJ1A 1U7LA 3UR0A 3C46A 4RKUC 3OTOF 2QMWA 3P3DA 2L9WA 4AXIA 2GO8A 1I94J 5LOQA 1H2TZ 1UA1A 1QJHA 1NAQA 3D9BA 2GCFA 4KSEB 3H5XA 1RI7A 2DYAA 4CNZA 1NK7A 5E7OB 2FHJA 4ZPCA 1VQ7S 2HHUA 3HPOA 2DKOB 4ES2A 3A3NB 2KJWA 4ZDNA 4B3RF 4YR2A 4OLOA 2DH9A 4DV2J 3NL0A 2VDIA 2W2MP 2WZ1A 5K8OA 3QAUA 4XPEA 1F3VA 2D9OA 1C0TB 2ZM6F 3PW4A 3H5SA 4DS4A 1Y4ZB 3Q2SC 3N4WA 5I4MA 2CPFA 1CJKB 5KT2A 3BDEA 3JYTB 4ZCLA 2ACMA 3U02A 2XI3A 1SL0A 4MMOA 1SV5A 4M5NA 4KHMA 1M1KT 1DLOB 4YB6A 5D77A 3OUYA 2X1AA 3BKTA 2V94A 4NI2B 4A8SA 3D1OA 3CCES 5AT1B 3TQEA 1DBDA 3C15B 3ZNJ1 4LF8J 2OIHA 4I67A 5T14A 4GO5X 2RF2B 1S59A 3EUNA 4HDGA 3M8YA 5KFVA 1O5JA 2I5JB 3TYTA 1RWKB 2MZJA 2BOAA 3ILLA 2QO3A 1UAWA 1TL5A 2HFOA 2I2YA 1SH0A 1SC6A 5FLXY 1HWJA 1RT2B 2KM8C 3GZ7A 2R7VA 3IWXA 3RU0A 3RRKA 3QSYB 3CMES 5F9NA 4TXSA 3G96A 1RTJB 4U95A 3QPIA 4DV3F 1WC5A 4RBVA 2RUGA 1YZ7A 2HHVA 2J9DE 3KLIA 1QE1A 2CPIA 1IBLF 1U1QA 2I38A 5KT5A 2IFXA 1ROFA 1VQSA 5HP1A 4QIWD 5KFAA 4F4YA 3SSSA 4JV1A 1F5AA 1VQNS 1AUDA 4CCHA 3GIIA 1U26A 1N8RT 4WIQA 3B8HA 3PKYA 1X9MA 1FDNA 2NSBA 2HSEB 2ZH4A 1TAQA 1JIHA 2HQIA 2JFKA 4XIUA 3PRBA 4HVZA 4QW8A 2X1GA 2GJFA 5KFYA 2B9WA 2HVEA 4JI3J 1HNWF 2X1BA 1TK8A 3G6XA 2CVEA 1NBEB 1HL6A 5B0AA 1F60B 1WOPA 2ROGA 5U47A 2BJ1A 3QIDA 3BGLA 1WDTA 3D6MB 4AD6A 3MZIA 1SJ4P 1VQMS 1WF0A 4P74A 3PYGA 1U47A 4USKA 3AAWB 1UEVA 2QLJB 4IOBA 1U6BA 1DTQA 2DJWA 4E98A 1FTCA 3R5DA 1MN7A 3TZZA 4M1KA 4V1Ak 5HAOA 3B4DA 2ZJQQ 3PW5A 3ISNC 2UVVA 5CABA 2VJUA 3GQCA 4X65J 2AV5A 3KK3A 4TY8A 4E0DA 1RWOB 4MK7A 3DM2A 3DLBA 3JQKA 4PKDB 1KR4A 3EYZA 1XNRJ 4GC6A 2E29A 5DZ7A 2EK1A 1LWEB 4C8KA 3MMBB 4QU6A 2AYBA 4IFVB 4TKTA 1KDNA 2F65A 1N0UA 1IM4A 3OW2R 2DT9A 4FKXA 4Q45A 3GJSB 3M9OB 1VC0A 2Z30B 1CSJA 3FCHA 2ZOMA 5CCLA 3D6HB 2MB0B 2B4UA 3PO4A 4LRBA 3DOLB 3RRGA 3NNHA 4P72A 2K7KA 3S7RA 1LK7A 4Y00A 3LWLA 3UPFA 5SUHA 3A1YG 3HHLD 2ZZTA 3ILOA 4QWBA 1NK6A 1NNDA 4UW2A 1KFDA 1PBAA 2FPHX 3C14B 2ABYA 4X4OA 4RUBA 1VK8A 3OLBA 4RR5A 3CCWA 3OJUA 4W98A 2LDYA 2DBBA 3G87A 1S48A 5I3QA 2R4FA 2XM3A 2KU7A 2LQ5A 2CQ2A 2A2DA 2DRAA 3BEGB 1URRA 2BM0A 5DQHA 3CD5A 4USVA 1VYAA 2NCKL 3GE9A 3NWRA 2EFGA 3BJYA 4HKQA 1YBTA 2BXJA 1HWKA 4M5GA 3Q22A 2N4CA 1S6QA 1ZM3A 3MM6A 4O3QA 2OAUA 3MMAB 5D0EA 2RKIA 3PYFA 4Y6IA 3JSRA 3NGKA 5DG9A 4DR7J 5FD1A 4ZVSB 1XNQJ 3LTOA 3KKFA 5A0YB 3JSYA 4G6VB 2X7IA 2D3UA 3GSDA 4K0KF 1S7IA 2YPYA 4ZP9A 1WF2A 5J2QA 3LP1A 4I7FA 1NXIA 2BE2A 2VQEJ 4I4BA 2M5YA 1NKEA 1NJYA 2FGCA 3PO5A 4UZBA 5GAEI 4WP9A 3PVXA 2PD1A 1SBRA 2ZNYA 4KAIA 2OMLA 1UWBA 2R8JA 3HCXA 3MR2A 3DGVA 3TANA 3TJAA 1JLEA 3R7BB 3IBFB 3I5BA 2QA4S 3M8PA 3W2WA 4DUYF 3VAHA 1C0UB 2OPSB 1WTBA 4WK1A 1HBUB 2V4QA 4ECUA 2F3JA 4DR5J 4QR1A 1RISA 3DRPA 3UI3A 1NDKA 1FCAA 2XG8A 4OYXA 1EP4B 1U1NA 2GJIA 3OXLA 2F7VA 4RW4A 3ILIA 3Q86A 3IO1A 2WB1D 2DNLA 5D4NA 1HBOB 2H5EA 3H4DA 1QAXA 4IKAA
chains in the Genus database with same CATH topology
2ZD1A 4ZHRA 4ED3A 3QLHA 3CIZA 3C6UA 1HW9A 3CD7A 3QWPA 2J9DA 2CQCA 2ROEA 4ZPTR 1D8YA 3KHRA 2KG1A 1GH8A 3C8YA 2RT3A 1ZTTA 1YGYA 5E33A 1S6UA 4IH5A 4K4TA 2E1AA 2HLTA 3DU6A 1JMTA 1DQ8A 4NCGB 4Y2KA 3M2UA 4HLBA 4C8ZA 1TR0A 2XLIA 5KFSA 3MUVP 3JTNA 4JI4F 3Q8RB 2DNPA 1VS3A 2FJEB 3UW1A 3BS9A 4FF2A 4QWAA 2RS8A 1C1CB 3MD3A 3HO1A 4CH1A 1OPIA 4NYPA 3CD6S 1N48A 4F4KA 1WG1A 2E5JA 2VG7A 4OZLA 1TZ0A 2HG4A 3MM7A 2V9KA 4RNFA 2NXUA 5KOWA 3V6DB 3M6XA 4A4JA 3M30A 3NGDA 1VJWA 4PWDA 2Y0SD 5GAHU 3RZAA 1D8ZA 3K5PA 2Y1IA 3MEDA 3LALA 4JOUA 1M90T 1QAJA 3CGIA 1QY7A 2M88A 1Z4UA 2GJ2A 2DNRA 4ECQA 3M1VA 3I5AA 4ECXA 2KRRA 3CUNA 4H4OA 5IT9Y 2BM1A 3UCGA 5HBMA 2ZE2B 1UA0A 1HBNA 4NZ0A 3VAIA 1U1OA 4NLSA 3KYLA 1FRXA 5J1NA 2XY6A 1GTEA 2D7SA 1L3VA 4EBDA 1R8CA 2OO4A 1RQ0A 3BGUA 1RT4B 2IVMA 2A1BA 4TNOA 3N0VA 3GYXB 1FKAF 5T41A 1ZBTA 1HMVB 1K9MT 4Q43A 1G2EA 1M5KC 5HI7A 3MAHA 3MMCB 4O3NA 4DG1B 3EZ5A 3PV8A 2FVCA 2JLEA 3IBWA 4DL2A 2YVSA 2LMIA 4IYQA 1FERA 3NS6A 3CCVS 5BYQA 2BJEA 4RW7B 1MU2B 3BDPA 2ERRA 2LVWA 2HZCA 3PACA 3CWJA 2MMYA 3GFZA 3DLKB 2J0SD 1XWLA 1S1XB 5KFCA 2VV5A 5E0OA 1KD1T 1ZAWA 1PC5A 5KT7A 5E3RA 4AL6A 5J2PA 2QE5A 4C4WA 4P6QA 3ZZUA 4YOEA 3WC0A 2RMLA 3NBPB 3BSCA 3MD1A 4RW6B 3GR1A 2VL1A 4IFVA 1ZM4A 3M6WA 5D4OA 4ZPBA 2AF6A 5BJRA 3MOJB 1H7XA 2W9BB 4UQGA 2LQ9A 2GMHA 4KKOA 5DDOC 1RT3B 4O3PA 3UCZP 1QSYA 5GAEU 2WHOA 3SI8A 2M8DB 4K4SA 3QYYA 1FD8A 4IO1A 3MFHA 4EWTA 3QGPA 3CMAS 1S1UA 2VBWA 3HM9A 1FRIA 5FIIA 3NS5A 2E7XA 2Q6CA 4DFJA 2WBRA 4U67Q 4M95A 1FKPB 1TKTB 1P1TA 1RJJA 2XMJA 3PFEA 4DEZA 5B0EA 2FHKA 2Q79A 2ZDOA 1QM9A 1ZM9A 1FRHA 3POTB 4YP3A 2J9CA 4DLEA 4ZOSA 2BQ3A 3DCAA 3C66A 1SJRA 5C24A 2CQ0A 3I5CA 1KVIA 1RT7A 3DYAB 1VIOA 2IAJA 4JI3F 1FDAA 4WF9Q 4RW8B 4ZKAA 1Y00A 1HD1A 3KLHA 2DHAA 5KG4A 1SUQB 1S97A 3QGIA 2DCUB 2B9YA 4DFKA 5KG7A 2XSJB 2YX7A 3D0IE 3OR2A 1ZZNA 1DARA 1R8AA 2C3UA 4NRTA 4NL5A 2KT5A 1RGVA 1FJCA 2RE1A 1S9GB 2I8EA 1SKRA 1P9QC 3K5LA 4HYKA 5L9NA 4DSKA 2HVIA 4IQMA 4WE1A 3BO3A 1FT8A 2YKMA 4M5DB 2HHHF 2MHEA 3U1MA 2R2UA 4YMEA 2UVUA 2X1FA 2UV8G 4ECZA 3CB4A 1S9FA 1Z1ZA 4JI1F 2FGOA 1VRTA 3FSIA 3GFXA 1RT5A 2FUG9 3MR3A 2B3TB 3KLFB 3AY0A 4QCLA 4NCBA 1B0PA 3G6VA 3CCUS 1LQ9A 2YWGA 4FNHA 4TLRA 1U1KA 4LF9F 2AQ4A 1TVRA 2FHJD 3FJ2A 1GT8A 3IRWP 3PEHA 2YX4A 5CYMB 4C8NA 3NKYA 4JI2F 4URSA 3KNGA 1N6QB 1NU4A 2FIUA 4J37A 3B78A 3OL8A 3FZBA 5JVGQ 3CCMS 4X4NA 3PIOQ 4A8FA 2C3MA 5DDQC 2ZC3A 3VAJA 2FTRA 2JLFA 4G1QB 4DL0C 3S1TA 4GKKF 4X65F 2NS1B 3KLEB 4OHXA 2G9OA 4YUDA 1XMQF 3PX4A 2ZZNA 2EG1A 1AROP 2V8DA 2B7BB 5D78A 1YJWS 3OFEA 2F8HA 4QZVB 1Q8BA 1XNRF 3HHDA 5KFZA 1YRUA 4XPCA 2E5HA 2KXHA 3FSXA 4FXDA 1R3NA 4H4MA 4X62F 1N4LA 5LSOA 4R8UB 2LEBA 1NK5A 1TK0A 2KXFA 2IRXA 3G4SS 1VMBA 4J9LA 3BR9A 2CIMA 5AE2A 4WCEQ 4A8QA 3HVWA 5K9FA 4OJGA 3PHEA 1S0NA 3U7JA 1WACA 2CPZA 1FK9B 3MEGB 4MTPA 1VQYA 3AH6A 2HAIA 2RRBA 4DQPA 1K0TA 4BWJA 4YR0A 2OPQA 2YWHA 2QA1A 4B3SF 2FC9A 5JJBA 3SMZA 3KFWX 2V8HA 3TAQA 5J1EB 3K0JA 4OZJA 1F5BA 3I96A 2LCWA 2XO7A 5DQIA 4OZ5A 4ZA1A 4LFAF 2EFVA 3IR5B 4MH8A 2DHGA 1NO8A 3ZZYA 4C11A 1WEZA 4UOCA 3CDWA 3FMBA 3M8RA 2VG5A 3GV8B 1IBKF 2E5LF 1PILA 2VPYB 4DSEA 3I55S 4YR3A 2CPHA 3JSBA 4ECSA 1JLBA 3IC1A 3Q8SB 4ED6A 2VOOA 4AUKA 5DETA 1VC6A 3VR1A 4LJMA 4LSLA 2GQCA 3DFEA 2BABA 4DJBA 4C97A 4XAKA 2BQUA 1TL1B 4MIWA 1SJFA 1X4HA 3GB0A 2RQCA 1FKOA 1YRXA 3TA0A 2V4RA 2R7XA 2GA7A 3US5A 2X3GA 1RWUA 1KLNA 4KHRA 1ELOA 2JC0A 1HQEB 3CULA 4Z37A 3HDSA 4Y0FA 1OPZA 3PM9A 2V2KA 2XMWA 3THTA 3D2WA 5DG7A 2RH3A 3PXGa 2JJ4D 3BREA 1JLFA 1LWFA 1N52B 3NWGA 2DNMA 3L3CA 3E2EA 2OFGX 1SV5B 3NMAA 2VPXB 2W8KA 5F8LA 4O3RA 2QA4G 4CO2A 5J1PA 4NXMF 2RRAA 2ZBCA 4NA1A 3UE2A 3PZPA 3CCTA 1K8AT 1MROA 3GILA 1IKYA 2E66A 2QLXA 3CJ0A 5GADU 1S0VA 4PXEA 3SDEA 3TA2A 2RD5C 2XNRA 1IKXB 2JVRA 1WG4A 2JH3A 3W2VB 5B0GA 2R2TA 2XS5A 2F40A 1YG0A 1IN0A 2XBPA 3E01A 3QZ7A 4J9SA 2J6TA 3NNAA 4WYLA 1M5HA 3J7YI 5LMNF 3V6HA 2NREA 3G8SA 2R8GA 1S0MA 1QAYA 2FVPA 4M8LA 4QIGA 4FYDA 2YTCA 4DOZA 4XDDA 1NK0A 1YWXA 4PXDA 2WOMB 1H98A 4IR1A 2C3YA 3O3LA 2HYIB 1UVMA 1Q1KA 3J7A1 4O4GB 5HLFB 4MK9A 2FLPA 2E9TA 3Q0AA 2M8HA 4EZ6A 4C0BA 3MPYA 3R5BA 3WC2A 4A8OA 3CJKB 1WHXA 4KJIA 2EW9A 2U2FA 3OFGA 7FD1A 2JLGA 5HMYA 2HNDB 2AGOA 4F3OA 3OL7A 2DPJA 3Q2TC 3DXBA 1S1WA 5KT6A 2FLLA 1JLCB 2XCAA 1YI2S 2GGPB 3JAMY 3KMSA 4O0IA 2V9WA 4PQUB 2E5GA 4I2QA 4A8KA 3I4HX 3QJJA 4KO0B 2AJ0A 2IYIA 5KFDA 3OJSA 2OPSA 3ZZOA 1R0AB 3CC7S 2XMVA 2JEGA 5T7LB 3C6TB 4F4ZA 1FE0A 2I1RA 1YJRA 1OS5A 3NP5A 1CG2A 2W8LA 2W9CA 4PPZA 3DLLQ 3TW0A 2DTJA 3R1HA 2JWNA 1VFJA 2ZKTA 3M9MB 4RW9A 1FESA 1P8GA 3V4MA 1SH3A 1ZOTA 2ZHBA 2DR9A 4G1IA 3I56S 4IG0A 5IWAF 2XMKA 3G6ES 1JLGB 3DNCA 4LFCF 4DFPA 2Q6BA 3L09A 2KI2A 4C8LA 5EX0A 4K4WA 1QSSA 3HVAA 3K5OA 1U45A 4DR7F 4PUOB 3TAMA 1TKZB 2IMOA 2YNFA 4DSLA 5DLFA 2BANA 4HI1A 3T9ZA 1WI8A 1HNIB 2ZKUA 5FDLB 4C98A 4U7CA 1S1VB 2RJZA 5IFMA 1IKWB 3ENQA 3V6JA 5H9EJ 3FGVA 2CQIA 3OXFA 2VB6A 4LFBF 1VGYA 2EI5A 1HHSA 2CJBA 4LVOP 4ECYA 5A8WB 1LV5A 1KNZA 4AFFA 1C0TA 3HHLB 5HL7Q 2EVZA 3GV7B 3HP6A 1RT6B 2DHSA 5K8MA 5L1LA 3KLIB 1C4CA 1QE1B 3GG0A 3MUMP 1IR0A 5DGBA 3UQSA 4NCGA 1F0XA 2KYZA 4WIIA 2NR0A 3BGRB 2Z0GA 2B6AA 1Q4RA 2MSSA 3RAQA 2MZTA 4YB5A 3C2PA 1YBAA 4F67A 3FFIA 5H1SV 1MNEA 1UJ5A 4J9RA 2MQLA 2VQEF 2H9ZA 2J76E 5HP1B 3MEEA 4FVCA 3L7OA 5G0RA 1TQLA 4DN0A 5KFQA 1Q86T 1YRTA 4Q0BB 1HWIA 3CDBA 3JYTA 2UVWA 1TAUA 2XY5A 4QWDA 4B17A 2ALZA 4WFNQ 2IJNA 2DCLA 1KQGB 4LUBA 1TK5A 4O44B 4EGLA 2OPRB 1Q79A 3U27A 4FF4A 3JTPA 1N5SA 5KT4A 2K1RB 5F8IA 3HVTB 3OTEA 5KFTA 2DGXA 2NYIA 4MAKA 1ZZFA 5CD4H 2GNKA 2WTFA 3PX6A 4IFYA 2YKOA 3DHWC 3OFHA 2BACA 1DLOA 2KJVA 5L8RC 1X4GA 1DZ5A 2EK6A 1YJVA 4TYBA 2HWTA 3HZEA 4WFXA 2RDIA 1YHQS 2CJQA 4MIBA 2C3OA 3DDKA 5ITHA 4ED0A 1JNZB 1S7HA 3RRHA 1VQ9S 2EKYA 2UZAA 3VTIA 2ZH2A 2OSQA 2AYGA 1VRUA 1X4BA 1LWCA 1FA0A 3MMCA 1GXUA 3HF5A 4Y2AA 2XI2A 3PW7A 2PGCA 2IRYA 2R8HA 1RAJA 2VA2A 5M2PA 2VFSA 3GV5B 2XZWA 4U9RA 4KIAA 1F5CA 3CE8A 4RBTA 2N7CA 2GFFA 2B4OA 4HT5A 2G13A 4XDCA 3OVBA 5KTQA 1IJFB 4DR5F 1SIWB 1LW2A 1KLMB 4F50A 1U49A 1KC8T 5HO4A 4KTQA 7FDRA 2XS7A 2XWYA 2C2RA 2R7RA 2KO1A 4LMZA 2D9PA 2NSCA 2FVRA 4C8OA 3WZ0A 2JRSA 2M2BA 3ENWA 3J7YU 1WWHA 4PQAA 3GIKA 4USHA 4RW6A 1LXNA 3BO4A 3SSQA 4F4WA 2RF2A 3OHAA 4N76A 1Q78A 2VODA 3M2RB 2HS4A 2YNGB 4C3LA 2HS0A 4WTYA 2PMHA 2W4CA 5K14A 2F9JA 2GX8A 1VOMA 3CDEA 5D4PA 5I3PA 1NJIT 1UJ6A 4JV5F 4MK8A 2KFNA 2JSXA 3HX9A 4DL5A 2AYEA 1DTQB 2I5JA 2V5HG 3MOZA 1U1PA 2AGQA 1HYSA 1FKPA 3SQGB 5K5MA 5D3GB 1UL3A 5SZTA 1M5OC 1NRKA 2BVZA 4FN5A 2ROPA 3RW6A 2WB4A 1S79A 1NK9A 1ZETA 3QO9A 1X7VA 2NPIA 2M4MA 2WONB 3N6LA 4UY8T 2LXIA 5K8NA 4B9SA 2V8VA 3U1NA 1KS2A 2HS3A 2WSCC 3DLGA 1W2BR 3CVKA 4J9MA 2IVYA 3SCLE 3N6MA 3ENVA 1RTDB 1B0TA 4RW8A 1E6VB 1TKDA 4EFAC 2CPXA 2EWHA 1N56A 1RA7A 2N82B 1S99A 4TY8B 3TVYA 3KK3B 1HR0F 3DXSX 2UXBF 3DM2B 4O4RA 2ZNZA 3NAIA 2DITA 4RWWA 1IKVB 2BQRA 1VBXA 4EZ9A 2UXDF 1BWEA 4QR2A 1U8SA 4NXNF 1T8EA 3DLEB 2KB2A 2B43A 3S01A 2QSWA 5EX3A 1LKZA 2LA4A 2VBZA 4WYWA 2OSRA 4NLOA 2RQMA 5HMZA 3QMQA 2MQOA 3O2IA 1VC5A 1TL4A 4EBEA 1RTJA 4N47A 2QV6A 2PMZD 4O23A 4R5PB 1ZAVA 1P1LA 3IR6B 4ZP8A 2FJDB 1K1SA 1CEZA 1VLYA 4HTIA 1HI8A 4UUXA 1N54B 5KFJA 1D1UA 2SXLA 3V4IB 1U6FA 4H4KA 4OLPA 2FJBB 4IG3B 2FJVA 5HROB 4OFZA 4QYZJ 4W90B 1RT1B 2VA3A 4IOAQ 4BBYA 3V81B 1IJEB 4I6AA 1WELA 1OWXA 2MPUA 3GYNA 1B0VA 2IM3A 2DGQA 3FVYA 1HHTP 2XSFA 1A7GE 1QLNA 4RUCA 2IBOA 3LGMA 4B08A 2FDNA 1HBMB 3KMQA 4ECWA 4OIXA 5J2MB 1LK5A 5KFPA 5DG8A 2DGSA 4WFBQ 4KGKA 4DV1F 5F8GA 3FDSA 2M52A 3UDCA 1MMLA 4CTAB 2YWKA 2CQPA 4C7QA 4U6PA 2YWEA 3KLEA 5F8JA 1IQTA 4N5SA 2XMTA 2ZH6A 4KBIA 1SL1A 2IRUA 4RNMA 4QIFA 5EWGA 5A6WA 2LQBA 2ZJRQ 4Q7AA 5M2UA 1NZAA 2KTQA 2HPUA 2MQNA 4P7VA 1X0FA 2MJNA 5A8KB 2LXFA 5F41A 3HK2A 2YKAA 2KH9A 4N56A 3DMJA 3ZZTA 2CPEA 1I1GA 1TP7A 3QIPB 4M63A 3TNVA 4KFBB 3I0RB 3UWTA 5L39A 3MR6A 4ED7A 1JJHA 4DQQA 4LF4F 3HMJG 5MLCV 3TR5A 4JI5F 1FK9A 2N4DA 3BN4A 1HW8A 3MEGA 1KEKA 3MM5B 1HQUB 3G71S 3CCQS 4B9MA 3OSNA 4F8RA 4EO6A 3C3LA 4I69A 5LSRA 1RDRA 3HZGA 1GXTA 2QA2A 3V6KA 5KFNA 1CC8A 2FVQA 2GV1A 4WFZA 3NAHA 4P7TA 3K2YA 2M9KA 2WBMA 3CDUA 2YH1A 1L3KA 4MKBA 3OXGA 5GMKa 1Y0HA 3BSAA 4LSNB 5M2RA 1M5SA 4OMFG 3CCLS 1S6PA 4OI0A 1T02A 4QOTA 1S10A 1JKHB 3RBEA 1Y5IB 1D9AA 4N77A 4HEA9 1SKWA 1R8BA 3KLGB 5LL6d 5G4DA 2DO4A 1NHUA 1BY9A 2RVJA 3QZ8A 1VBYA 2E5IA 4TU9A 1N5YB 4W92B 1WD6A 2VONA 1LOUA 3IS9B 4DX8H 2PI4A 1R7IA 2YNHB 2QT7A 1APSA 3PKMA 1G1XA 4NPOA 4OL8A 5CYJA 2XMUA 3TUZC 2IC3A 1UVIA 5I3UB 3MF5A 3CSKA 1C1BB 3AA8A 5E3PA 1N5TA 3BSOA 1N33F 3CJ4A 2YKQA 1FHTA 4RX6A 3M05A 4ALZA 1MWZA 4HHJA 1Y5LB 3KK2B 2FC8A 2IYGA 3X1LB 3MPVA 1JWWA 3I0SA 2HNYB 1KOOA 3DDNA 2JHEA 4PPDA 4JI0F 5E3AA 1V6HA 5LMUF 4PXBA 1NK8A 2ZFHA 3B82A