The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
68
|
sequence length |
208
|
structure length |
208
|
Chain Sequence |
AELRSFIFIDRLQPQTMSYLGTWIKGALPRANMAAQIIEVAPGLDIEGVTDVALKHAEVKAGILVVERQFGYLEFHGETGAVKAAADAALDYLGGDPDAAVRPEILASRIISSIDHQHAFLINRNKIGSMVLPGESLFVLEVAPASYAILATNEAEKAADVKVVDFRMIGATGRVYLSGTEADVRQAADAARDALAVLQGAKLAAALE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
RMM microcompartment shell protein MSM0275
|
publication title |
A Complete Structural Inventory of the Mycobacterial Microcompartment Shell Proteins Constrains Models of Global Architecture and Transport.
pubmed doi rcsb |
source organism |
Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
|
molecule tags |
Structural protein
|
total genus |
68
|
structure length |
208
|
sequence length |
208
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature | |
pdb deposition date | 2016-08-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00936 | BMC | BMC domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |