5L39A

The structure of the fused permuted hexameric shell protein msm0275 from the rmm microcompartment
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
AELRSFIFIDRLQPQTMSYLGTWIKGALPRANMAAQIIEVAPGLDIEGVTDVALKHAEVKAGILVVERQFGYLEFHGETGAVKAAADAALDYLGGDPDAAVRPEILASRIISSIDHQHAFLINRNKIGSMVLPGESLFVLEVAPASYAILATNEAEKAADVKVVDFRMIGATGRVYLSGTEADVRQAADAARDALAVLQGAKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Complete Structural Inventory of the Mycobacterial Microcompartment Shell Proteins Constrains Models of Global Architecture and Transport.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Structural protein
molecule keywords RMM microcompartment shell protein MSM0275
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l39A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l39A02
5LSRA 3I87A 4HT5A 5LT5A 3U27A 4HT7A 3GFHA 5L39A 3MPVA 5SUHA 3I82A 3FCHA 3F56A
chains in the Genus database with same CATH superfamily
1U26A 1H38A 4MH8A 1R6YA 3TRGA 2C2EA 1M0SA 4LRFA 3KWMA 4B08A 1WSVA 4OYMA 4EI2A 3RB4A 4DR6F 1LW2B 2J7WA 3HULA 2CPDA 1ZA1B 1Q81T 4LRBA 4K4VA 4ECSA 1NDKA 1NCLA 2DTJA 3P4UB 3W8PA 3LANA 4UTGA 2DGOA 3L4BC 3QT8A 4O3NA 4JI6F 4M5IA 2DHGA 1H2TZ 1V5VA 4IG0B 1O6XA 2ZWPA 1VC5A 3VAGA 1T3OA 1FDDA 3BGLA 3MAAB 2CJKA 1YQHA 1VQ8S 4ZVTB 4LFCF 2HQIA 3BBFA 4F4WA 3MEDB 3KK3B 2J0QD 1HARA 3ILLA 2MKIA 4DV1J 3H4DA 1W2BR 3PO4A 4DQRA 2WVCA 2RDIA 3PXGa 3RW6A 3T5HA 1SVDA 3B8HA 3MMAB 2Y9HA 4QU7A 4O4RA 2QLJB 3UR0A 2B56A 1CULB 2YX4A 3MECB 3NNCA 2BDPA 2JVOA 2V68A 5ETPA 4DV2J 2IM2A 3IO1A 4N8NA 2NXCA 4E8UA 3U7JA 4LRDA 2DHSA 4JI2F 1HNIB 4DBQA 1SUQA 3DOLB 1SPBP 2WHOA 2DRDA 2R7OA 3IWLA 4OI2A 1FRIA 1WDDA 2YQ0A 4U7UK 5JJBA 1CQNA 2W2MP 3E8OA 4X62J 4ATNA 4XO0A 3D7SB 3KUHA 1CJKA 2MYFA 1M5KC 2Z30B 4TNOA 1SB6A 5LMNF 2DD8S 3F41A 4TYAA 2K06A 2D41A 4ED7A 3CJSA 1VYAA 3OL8A 3EDRB 3QYYA 2XI3A 3M8QB 1R31A 4K7QA 5F8MA 1IR1A 1U6FA 1NPPA 1R8AA 3P96A 4FPRA 3CB4A 1U7LA 4B9VA 2HNDA 1AXQA 1FE0A 2BW2A 2GGPA 2KVIA 4ILRA 3VZIA 1U25A 4OX6A 3DMJB 1GH8A 1T9TA 3DCAA 1U49A 4F3OA 3GILA 8ATCB 3M8SA 4LF5F 2ZHOA 2W4CA 3EVMA 4ERDA 4ZP7A 2VOOA 1WWHA 5J1NA 1UVLA 2X51A 5HJXA 2KVQE 1X4CA 3LOUA 2UUTA 4LMZA 2QL9B 4LF4J 1TKXB 1HNVB 1HBNA 3IGNA 2AWZA 3KJNB 2KT3A 3PRBA 4C3KA 1KKHA 4ED6A 4P2MA 3RAXA 2XB2D 1JJ4A 1Q5VA 1L5UA 3CJ0A 4DPXA 4GMKA 4A8SA 1GXUA 2AEJA 3K8WA 3FBBA 5J2NB 4I6WA 2XMVA 2KFNA 2GVDB 3LP1A 1XTZA 3MFIA 5F8JA 4ZOSA 3KG0A 5A6WA 1U2CA 1WKJA 2F65A 2VF3A 2CZ4A 3ENVA 1IBKF 3FFIA 4B3OA 5DM7Q 3K58A 1YJUA 2OTLS 4R0EA 2C42A 2Z2LA 3THPA 4OL8A 4DJBA 4OYIA 2J0WA 4FZVA 4J9KA 2HFUA 2FJVA 1K0TA 3ETMA 4ID5A 1H3DA 4OHXA 2XLKA 1WKLA 2NLWA 3EPIA 1NK7A 1I6JA 4DV3J 5DM6Q 2CPJA 2ZH6A 4CT8A 3K5MA 2J9EA 4UZCA 4QYRA 5C24A 1KOOA 3GJTB 2P8IA 2EFVA 5EHHA 2LEPA 5AXNA 1W25A 3CD7A 4HTIA 1U09A 2PGCA 3R1HA 1RTDA 5ETNA 5I3PA 3UCZP 4OV1A 2EG1A 1OQ6A 2HVDA 2QA1A 2V4RA 4CRJA 4UY85 4NWBA 1OY8A 2E5GA 1Y3JA 1ZAXA 3AD8C 2RDJA 2LFVA 1K8AT 2XEXA 1SC6A 2C3UA 4ZPBA 4C48A 4IO9Q 1SH3A 3H42A 3OUYA 3RB0A 2WVBA 1CS4B 3HP6A 1ZOTA 2B9EA 2KYXA 4JP8A 1A9NB 1AA1B 3HHLD 4DL3A 3EZUA 1VJQA 2V4JB 4O3SA 4FF3A 1WNEA 2ZBIA 4CTAB 3DRXA 4CIOA 2OIHA 1BXNA 1Y5IB 4YDDB 3QJLA 1KTQA 4ED2A 4JI0J 3FZ2A 1AFJA 1GXTA 3S8SA 2VQFJ 1B4SA 1IKXA 1JJHA 3DRPB 3J7A1 3LW5C 2V50A 3C16A 2AQ4A 5B08A 4UY8T 4Y2AA 3FRZA 2MZTA 2BJ3A 1HW8A 4IG0A 4IH6A 5L1IA 2P9GA 3M30A 4L73A 1NKEA 1MWZA 2DR9A 3OR1B 3MXHP 4OJHA 3MTKA 3GSIA 4A46A 1IKXB 3DRPA 3KMSA 2E1CA 2F4VJ 1FXDA 1YZ7A 1MG7A 1WG1A 4FF2A 3G6ES 2XS2A 1LOUA 2HRYA 1F2GA 1L3KA 1S7HA 3M2UA 2RE1A 3R6LB 3M30B 1EIYB 3CCTA 1VBXA 3OTDA 4W92B 2RSQA 1IBLJ 1FXRA 2C2OB 3M2RB 5LSOA 4HR2A 4ZPVR 1QVFR 2EC0A 3R5DA 3M9MB 2VICA 4RNHA 3BO3A 4PRFA 5C5JA 3T1YJ 4X84A 1R8BA 3M8ZA 1JLQB 3C6UB 3MPYA 2HVEA 2JC0A 3P45B 2NS1B 4EFAC 2W24A 4K59A 1J5EF 3M6XA 4B3SF 2L3MA 1FX2A 3UN2A 3W8GA 1M90T 4K4XA 5ETMA 1RU2A 4LF5J 3BSOA 2PEHA 3TZZA 3VAKA 1FE4A 2KJWA 1YBAA 2V2QA 4FYXB 2G2OA 1YHQS 4B02A 3PEJA 3G96A 1T9VA 3IR6B 4F0KA 2SXLA 3EZ5A 1QAYA 5G0RB 2ZM6J 1B0PA 4URGA 5F8LA 5FIIA 1SXLA 2VG6A 3NGUA 3IS9B 2HHSA 1RHUB 5AJ3J 4WP9A 3M8RA 5F8GA 1VRTA 4B3RF 4Y00A 1TK8A 1F9HA 1JLCB 4XDCA 2HZCA 1T9XA 2KN4A 1QDUB 4FF1A 4J9OA 2DNNA 4O3PA 2MDAA 2RHQB 2AD9A 3J81Y 4WE1B 4DSFA 1RWWB 2H5IB 4WZMA 2X1AA 4DS5A 4CDIA 4Q7AA 4TLRA 3GIRA 5K8NA 1OY9A 1SI9A 2GO8A 3H5SA 1CBKA 4WFZA 4Q2LA 5IV3A 1NK9A 1WOSA 3M05A 2GGPB 4OX9F 2B6AA 2G9OA 2CJ9A 3ZTOA 3Q23A 3GFXA 5KFLA 2O01C 2YNIA 2FD2A 4LREA 2HWHA 4DR3F 2MJNA 5HAOA 4YS2A 4QZVB 4ZVRB 4QQBA 4K4WA 1ZA2B 4A8YA 1S9FA 2E9TA 4WXWA 2B5JA 2BE7D 2QLFB 3G6VA 2WVFA 4TVAB 1WC3A 1RHKB 5HN0A 4J9LA 4UQTA 2P6TA 2HMIA 2AIRB 2GQQA 3C3LA 1C0TA 3AHPA 1J5OA 3HDSA 2BXJA 2BR0A 1RYSA 3GQCA 3GYNA 1WHXA 1U45A 1FD2A 2R7TA 2J9CA 3MMAA 5L46A 4PUOB 1UEVA 1VCTA 3K7RA 2GQ2A 4PXEA 2E29A 2KI2A 3NCPA 2HVIA 3VGTA 3M32A 1RTHA 4NA3A 4ZP9A 2UXCJ 2LXIA 7FD1A 1Z1ZA 4YB5A 2FHJD 2DH9A 2DPIA 1TK0A 3BPDA 1VGYA 3LA0A 4M5LA 1IKWB 5CH7B 1G4CA 1RSCA 3TWZA 3ILIA 5KFZA 5GAHI 2MGZA 4KPCA 4JI8J 2Y8YA 2XZWA 3WZ0A 4RUHA 3CMAS 3KLHB 4RNFA 1WOOA 2DGUA 4RW6A 4ECQA 5JVGQ 3RBXA 3CJ2A 1EKSA 1PYTA 4OI6A 3O6QA 5IC4B 3WC0A 2XZTB 3N6MA 2LKZA 1U2FA 3W65A 1LV5A 4MKYA 2W7AA 3G87A 2XGQA 4ETZA 2DIVA 2K1RA 4Y34A 2MJUA 4AL6A 5DGAA 2QG9B 1K0VA 2OD4A 4K8RA 3PKMA 3Q0AA 4DG1B 1CJTB 5D0RA 1SH2A 1NM2A 5FDLB 2HFZA 3AXMA 1A7GE 2V4QA 1SIWB 2C3OA 4YP3A 2GIFA 3EZOA 4HDHA 4M5NA 1HWUA 3R7SB 4B9UA 4X4OA 1F1BB 3CCLS 4PWDA 1GK8A 4Q2MA 4HYKA 1HFEL 2MZ1A 3EXYA 4EZ6A 2L9WA 2XYPB 4EGLA 1S6UA 2MKHA 5GAEI 1U1KA 2UUBJ 1XNQF 2VONA 1SJ1A 1WF0A 5AT1B 2G13A 4WFXA 5E5NA 2VOPA 3K59A 4LBPA 1S49A 2XMUA 1VQ9S 1LKZA 4U8YA 4FP9A 4Q8FA 3TA2A 1HNVA 3EVOA 1VIOA 2IBOA 1XR6A 3NBPA 1IBKJ 5H9FK 4ECVA 2L08A 2WONA 1SJFA 4ELVA 2CJAA 2W7OA 2JL9A 5I42B 1MWQA 5CQGA 3OSNA 1FJ7A 2VBZA 6AT1B 2RU3A 1Q95G 3A3NB 2ZH3A 3P3DA 4ENOA 3W2WA 2DNPA 3LP1B 3VAHA 1DRZA 1I51B 2RUSA 4DCPB 5BYRA 2UXBF 3SQGB 4GC7A 4RU2A 1AZSB 2X1GA 3DGVA 3R2CJ 2DNKA 1U0HA 1RT4B 3WBZA 1TUWA 4RW7B 1RT7A 4X62F 4H4MA 2ROPA 1IWGA 2B8QA 2FHMA 2RVJA 2GJ2A 1R43A 3C6UA 5IFMA 4G1QB 5HQ8A 1BMQB 3CCWA 3PJXA 4FNIA 4JBCA 1I1GA 4DV6J 4URSA 4RW7A 3MHYA 1KVKA 2BE2A 3VCDA 1FVSA 2P6SA 5HJYA 1YTYA 1RT6B 5HQMA 5D6GA 3CCSS 1Q8KA 2YKAA 4ZPAA 4NLXA 3WX4A 3MUVP 2DEJA 2MXYA 3SCJE 4RBVA 2BABA 3UNGC 3KK1B 5B0DA 4RW8A 2HZAA 5KFQA 3DRSA 1S4FA 1BQMA 2DNGA 5KT4A 1Y11A 1SQFA 1R89A 1G7CB 4P7TA 3T41A 3CGIA 3L7PA 5HMYA 5DGBA 3OV7A 2DGWA 2U1AA 3JQMA 3LQVA 4TXSA 5KG1A 3PVXA 4HI2A 2FJDB 3SFGA 2BOPA 1NDPA 1M5OC 2XQCA 1C1BB 1NSQA 4F04B 5HK4A 2WW4A 1U1RA 2RQKA 4WP3A 1S0NA 2X1FA 3H25A 2ZJPQ 4K4UA 3W2VB 2OO4A 2XMAA 1SL0A 3J80U 1MNEA 4I2QB 2HQCA 2OP5A 1S48A 3OJUA 2QE5A 4EO8A 3GE9A 1NKCA 3OJSA 2BM1A 5KFMA 5A8WA 2EEYA 4PQAA 1CULA 4DR2J 2HRUA 2XO7A 5AE3A 2J6SA 1REGX 2DNZA 4DN0A 3EDQB 4EK2A 1NJXA 2QA4G 3D0HE 2KZMA 4O44B 3I31A 3VR1A 4B9TA 1S97A 4KE5A 3EM1A 1DLOA 2VFUA 4C3MA 3D1QA 1HW9A 3IM8A 2FVQA 1ZZFA 1HPZB 2AJ4A 2ZJRQ 3B4MA 4NYPA 2XS5A 1WACA 3NRBA 2Z58B 4KGMA 3QT5A 2MEWA 1RT1A 4QBUA 3GV8B 3M6WA 1FRMA 1HNZJ 1TUVA 1ROFA 4J90A 1B0VA 2EFOA 2W1BA 2AU0A 3TJAA 4NXMJ 1HMVA 3MR7A 1QTMA 2R8JA 3OTBA 4K0KJ 1DARA 3QZ7A 1KTVA 4KHPF 2ROEA 3JTOA 1FVQA 5KFTA 3O3LA 3I55S 4LQ3A 1D8ZA 4I6YA 3TVKA 1QSSA 1SKWA 4LFCJ 2HAFA 2J0SD 1FFGB 3QFWA 2KL8A 2K2PA 2OI2A 2UV8A 3HFZB 4GVBA 4LSZB 2MQLA 4B17A 3CJTA 4PPZA 4F0HA 5D78A 5GADU 4YR3A 5HLFA 1JXLA 3PIOQ 4CNZA 4DI6A 4BBYA 2DH8A 3RZAA 4M63A 3T5LA 2HHPA 2KO1A 4CZCA 4DXLA 1X8DA 1R0AA 2LMIA 4K0KF 2LDIA 1FKPA 2QRRA 4Y2MA 3C16B 2AJ0A 2RUGA 4MFBA 2IA6A 3B78A 3R7BB 3MCOA 4FKYA 5CYMA 3QT7A 4KHMA 3OL6A 1H72C 2PI4A 3OR1A 1KONA 2NXUA 5GAHU 3GCWP 2XMKA 3MEGB 2QL5B 2HWTA 1FRKA 4OV6A 1U1PA 2AGPA 1B70B 2WCXA 3ZZ0A 2R7QA 1TFYA 4ZLLA 1EP4A 3L09A 2KG1A 2HZVA 5FD1A 2JVRA 3W7BA 5C25A 2IMOA 4FPIA 4MAKA 3TZYA 1KVJA 2FLLA 4OMFG 2KG0A 1PAEX 1NAQA 1WC5A 1LWCA 3BV8A 1YDLA 2KXFA 1HWLA 2EG2A 5IC6B 5KFAA 5IT0A 2YPZA 3MAQA 2HBZB 4ID5B 2RQCA 4B3TJ 1TELA 2VU5A 5B0BA 3BGUA 4EUVA 3MUTP 1NU4A 3SSQA 2RS8A 2R3VA 1AZSA 4OHWA 1LK5A 5CA5A 3TEHB 2OEMA 4LF2A 2IC3A 3QRQA 1LXJA 5K8OA 2C28A 5KFIA 3SSSA 5K9FA 2H65B 4R8UB 3Q8RB 2IM0A 1ZTTA 3KLHA 3EMTA 1TL1B 4IRKA 3DOKB 2HLUA 3TYTA 5DG7A 1N33J 5HVGA 3CJKB 1BY9A 2ZD1B 1S1WB 1VRTB 2RAQA 2VD3A 5G4DA 2IVYA 3A3PB 3QGHA 2V2VA 4TQSA 2FVPA 1XNRJ 2QMWA 2BE2B 2RQMA 3A8IA 3H2VE 3IFEA 3BO2A 1R0AB 2DNRA 2VC1A 4WP8A 2VBXA 5L1JA 1HBUA 1S9GA 4YR2A 4ED1A 1X9MA 3CJKA 2RB7A 4NLDA 2UUCF 4ETXA 5J2NA 2HWIA 4IOBA 4F4XA 4LJMA 3BJYA 1FESA 1U24A 1AUSL 2HNYA 3KLGB 1R3NA 4M5HA 3I4HX 3TX8A 3T1YF 2WOMA 4ANDA 2OSRA 2B4OA 4L75A 4CM2A 2YKOA 4ITSA 2WTFA 1XWLA 3QZ8A 3Q8PB 3UR3C 2BYCA 1K9MT 4C0BA 4EYIB 1VBZA 4AUKA 3KMQA 1AROP 3W3SA 1NDLA 1N34F 4C8OA 1ZAWA 4FF4A 2Y1IA 2VG7A 1SJQA 2MHEA 2HQFA 3AQOA 4ZJQA 3LWMA 1F0XA 1HI0P 2CPIA 3MFHA 4DQPA 2F4VF 3BEGB 2YWGA 3DLBA 4ZKAA 2M4MA 2FC8A 2GMJA 2WRMA 3ZZRA 4DSIA 2O67A 2ZOFA 3SCKE 3H2UB 1XMBA 2ATCB 1JLGB 4E98A 3J81j 2Z4PA 1YBTA 2NPFA 2CKWA 2UXCF 3DN9A 2C3PA 2CQCA 3HX9A 2NPIA 3EUNA 3KHRA 1YSJA 1CJKB 1VC6A 2R8GA 4CO1A 2BJ1A 2O1PA 2IMWP 4YY3F 3N5BA 1GXLA 1L3UA 1S1VA 3LWLA 1PJ5A 1V5IB 2K3IA 4CLZA 3D2WA 2ZH9A 3CCVS 3RR8A 4OYPA 1M1HA 2JEGA 3AA9A 4OYXA 1NNDA 1QAXA 2WB4A 4HVZA 4PYDA 1WI6A 4X65J 3PX4A 1CJUA 5J2MB 1FWKA 4DL2A 2XY7A 1RHMB 4AXIA 2MZQA 4N7TA 3M2VA 4KB7A 3S1TA 2QFIA 3OHBA 4DZDA 2WOMB 3QAUA 2BKOA 1TKTB 3FEYB 4M5JA 2YNGA 1CJUB 3E01B 4KV8A 4PKDB 5J2MA 2WW8A 5DO2A 1KQFB 5H9EK 1JWWA 4KSEB 5C24B 3D6FB 1DQ8A 4NCBA 1URNA 3GWCA 1JJCB 2DHXA 4RWXA 3W9JA 2KT2A 5EN1A 3EJMA 2MQ8A 3OT9A 2MKSA 4XAKA 5CABA 1FTCA 2W9CA 1KBRA 3VHQA 5F8IA 3QGPA 4CO5A 3CF5Q 3C6TA 4ED0A 4F02A 2H5EA 1A0OB 3H98A 4CLUA 2W8KA 1XMOJ 1JJ2R 4KRWA 1JNRB 2DKOB 2OFHX 3OUYB 2MSSA 3CUNA 2BEFA 4RW4A 5E3QA 5HMWA 2HLTA 1ULRA 1QVGR 2B3TB 4U67Q 2YVSA 5EUHA 2E1RA 2KM8B 2E7WA 1JLAB 2HFVA 2Z2ZA 3QO9A 3H8YA 1H74A 3O2IA 1URRA 4DPWA 2YQ3A 5HP1A 1FRJA 2BJDA 1SC3B 3MURP 4I7FA 3FNNA 2PA3A 3IC1A 4QWDA 3T19A 5A8KA 2YBVA 4LVNP 2VPYB 4F67A 3C8YA 1U1QA 1EKRA 1ZH5A 4J9NA 2VODA 1G6BA 3HHDA 1AYEA 4FXVA 1TTHB 3N4WA 3IWXA 1RAJA 3L9ZA 3NGTA 3J7ZT 1SJ4P 1RXOB 2HQDA 1X4AA 5ETTA 4IH7A 5CCLA 1YJRA 5HMXA 3JTPA 2E5HA 3FSXA 3AH6A 4QJVA 4J9QA 2V94A 3MMBB 1G1XA 1KLMB 2RRBA 2OSQA 1SJRA 1MWYA 3DLGB 4WFAQ 2R2SA 1UFLA 2HURA 2VQEF 4LF4F 2XMMA 4U95A 1REVB 3AB2B 4PG8A 2LDYA 3BPSP 4AL7A 1FHTA 3UWTA 1I3OB 2COLA 1FFWB 4UF4A 3A8KA 4URQU 2ZC4A 3FRYA 2QIFA 4PZVA 3I0SB 4P75A 4ZP6A 5FLXY 2ALZA 2EW9A 4RNNA 2XG8A 1JLBB 4DHVA 4HHUA 2YQ1A 5L38A 1T03A 1XNRF 1HYSA 3Q8UA 4X4VA 3D1OA 3HM9A 4WZQA 1C1CA 2ZHAA 4BS2A 1Y0HA 1R27B 4JUZA 2BUNA 4IQXA 2DHHA 2V8DA 2IVFB 1C1BA 1LNQA 1WELA 3FJ2A 5HMZA 4ZVOB 4A8XA 5LXYA 2KXNB 3W2VA 3M8PB 4Q44A 3UE2A 1KVIA 3BGRB 1FKPB 1RB0A 1W7WA 5HBMA 4ZVPB 3IR5B 1C4AA 2I5JB 2NCKL 3KNAA 3IM9A 3G8TA 2J6UA 4P73A 1UETA 3H5YA 3MPWA 2DJWA 5CYQB 4WIIA 3HPOA 2HPUA 2DNQA 1Z4UA 2W2PP 4NXNJ 4NPOA 4TY8B 1IN0A 4O23A 3OSPA 1RGVA 2UV8G 1CC7A 4RNMA 1F5AA 4CQ1A 4CLSA 1LWEB 2OEJA 4YB1P 1DLOB 4A8OA 4DX8H 4USHA 3GYXB 5MLCV 4K2XA 5D3GA 5T41A 3W5YA 2QL7B 3LF0A 2XYHB 3LP0B 1JLGA 1HNXF 2EXUA 3MECA 4CO0A 5KT7A 5DDRC 4ELTA 4NASA 5K14B 1KN6A 3AOCA 4ILMA 3BKUA 2R8KA 1DTQA 2ZUAA 2J9DA 3T5KA 1N5QA 1XMOF 5KFOA 2ZH7A 4DUZF 3RAQA 1WORA 1HIYA 2WBMA 3N01A 2E1AA 2KFYA 2KRBA 3KJVB 2R2TA 3HSGA 2DRBA 3QQCD 3UCGA 2DCLA 5DJBA 5DZ6A 1JKHA 1PC4A 1GMWA 2CWXA 4YN3B 2W2NP 5IOLA 4JI6J 4LSNB 1TAUA 2D1CA 2CQIA 2WBRA 2ILYA 3H90A 5HATA 2DNOA 3PEHA 2D3O1 4LF7F 4DPOA 1HL6A 2IIHA 2LVWA 4RU9A 1FT8A 1PG5B 4JI5F 1UA0A 1UVJA 2A6MA 3HJFA 2ZUGA 1XN9A 4A8MP 4ZMMA 5KFHA 3MM7B 2DPJA 4QWEA 2PC6A 1X7VA 1N5VA 2HNDB 1FNOA 2NXEA 2YKPA 4FS1A 2LXUA 3CEDA 5T7LA 1DBDA 3BBCA 4C4WA 2CQ2A 2OGUA 3RJMB 5JMNA 1KHVA 5L9XA 2MKKA 2OKQA 2NXNA 5C42B 1YIJS 3CVKA 1UA1A 4JV1A 3BGFA 1UJ5A 3R3TA 3QATA 3V6HA 4L6V3 2IAJA 2W2OP 3BN7A 3LH2S 5SZTA 4ECZA 3QBCA 4LIRA 4B3MJ 2G1HA 2M2BA 2FHOB 2Y1RI 3FCWA 1RT5B 2AEFA 2W8LA 4DFKA 2Q6BA 4LF8J 8RUCA 2MGZB 3NLCA 2PFFB 2EI5A 2IAJB 3RRGA 3NGRA 5E3AA 3U27A 2YWFA 3HHEA 1IUJA 5IT4A 2LQBA 4DDFA 4C8NA 4PYAA 1J2VA 1PJ7A 2PI5A 2RJZA 5AE1A 4CNYA 3ZXWA 1S59A 4B3OB 2W2QP 3BSAA 3R27A 1S1TA 2JX2A 5L1KA 2LQ9A 2MTLA 4TYBA 4RPFA 4F8RA 3PIPQ 3LGHA 3GMGA 3V6DA 2X3GA 2FVRA 2CZ9A 1VQ6S 2FVCA 1Q1KA 2XCPA 5HLFB 1I94J 2VA2A 3EGZA 2BKNA 3GJRB 3TR5A 3CCES 1GMWD 5D15A 1TKTA 4WTOB 4DV0J 3R7NB 2CVIA 2F8EX 3B4DA 2D3OR 2IA0A 2IRYA 3C19A 1B64A 4FS2A 4ZHRB 1CG2A 2J0XA 4RUCA 2VUGA 5B0GA 4QW9A 1FJGF 2QX0A 1VOMA 2KKHA 2ZDPA 1N48A 2ZZMA 3GP9A 4C8ZA 1LQ9A 1V6HA 2R2RA 5L8RC 3W9HA 2VPWB 2JJ4D 4RW8B 2D3UA 1Y4ZB 4G1IA 1NB7A 4DS4A 2F5GA 3CW2C 4PG6A 2DNMA 4ES2A 3CCMS 3SYZA 2HIQA 2FHJA 3HVTB 4CP5A 1NSAA 2R7SA 4TLQA 3CCQS 5DLGA 3CE8A 2ZOGA 2GA7A 2BQRA 2KFZA 1TMJA 2B7BB 1H0HB 3W64A 3PYEA 1M1GA 5HROA 2HHWA 3QPIA 4N5SA 3MR5A 4AE5A 3Q8QB 1N5SA 1G3OA 1P1TA 4UZBA 4PXBA 4QYZJ 3FZBA 3CJ8A 4NA2A 4YB6A 2DNLA 5DS7A 3S7RA 4KKOA 2CJQA 1RT7B 1RWMB 4DQQA 2M52A 3D54A 3O1LA 2E5JA 1DTTB 1R0BG 1Q7YT 4PG7A 2LU1A 4DCOB 2LLZA 1SKUB 1WSRA 3BQ0A 1XNQJ 2BKPA 2Q43A 3V81B 4F7VA 2N7CA 4QW8A 2XI2A 1X5TA 4M5GA 4PAAA 2GHVC 1LFWA 2ABYA 4K2JA 1X5OA 3KXDA 2L41A 3Q2TC 1NHUA 1UP1A 3LP0A 3OL7A 1JNZB 1YRTA 5B0CA 1BE4A 4J91A 1DAXA 2LEAA 5LM7E 5IQ6A 4N56A 1I94F 4U7UD 1DTQB 3MD1A 5KG6A 4BC9A 4PQUA 3ZTPA 4F50A 1F3FA 4HKQA 4FYDA 3FQKA 3HHKA 1NKBA 3I0SA 4OJ3A 1YJWS 1X4BA 3RB6A 3QMQA 4JI1F 3EXCX 3GFZA 2HNYB 2MLYA 1Q8IA 2MZRA 2G0CA 1HKAA 2DXDA 3POTA 3SSRA 5J1EA 4DFPA 1HI1A 1CS4A 1DQ9A 2WK4A 4PWUA 4P10A 2YWKA 5M2UA 3KLVA 2NSBA 2HIYA 2U2FA 5AE2A 4MK9A 2EK1A 3MM6B 1LWFA 5KG2A 1VC0A 1NB2A 3K5LA 1S1UA 3TUJC 2C1EB 2IYGA 4JV5F 5DQHA 3OXFA 6FDRA 1VBYA 4CLYA 2ZZTA 4ED4A 5M2RA 1OSDA 4ECXA 1VFJA 2FIUA 2AZ1A 4KT0C 4DL4A 1RTJB 2V2KA 2JEFA 4DX5A 1UKUA 2WSEC 3DHXA 3DKDA 3K5PA 5IT9Y 2XTJP 3CDEA 2VG5A 4I2PA 3D0IE 4C6AA 2BM0A 4ZVHA 1Q86T 4Q45A 5DG9A 2DH7A 1K1SA 3IBFB 2LQ5A 4E2FB 4X4TA 3DRRA 4JI7J 5J2QA 4IFYB 2YWEA 2I0XA 3WDOA 1S6QB 4I2PB 4ECWA 1KQKA 4J9RA 4DR7F 3K2YA 3PR5B 1FNMA 4DR3J 4C97A 1N33F 5B09A 4DR1F 4DSKA 3UW1A 2UU9J 1NPKA 1RWPB 3SBMA 1V3RA 2UUAF 2VB6A 4PUOA 4W90B 1HHTP 2R8HA 3D9BA 4TKTA 5KG0A 4RKUC 1IR0A 2R7WA 3AD9C 2R4FA 2BJ9A 3HFVA 3J80Y 1FKOB 4MKBA 2IYIA 4F4ZA 4LF7J 4USKA 5A2QU 1WTFA 2UUBF 4ZS6A 3RRKA 3TNVA 2Y0BB 1YGYA 3CC4S 1U0SA 5DRKA 2YPYA 3TA0A 4NLWA 3ZO7A 5B7WA 3H5XA 4NMLA 1MLAA 2CQ0A 1QLNA 2YNHA 1MROB 4KYZA 3CD6S 1N52B 2IC3B 1B99A 5J2PA 3QT6A 4OI4A 4F4AA 4KGVB 3DI6B 3MEEA 2EFPA 5F3TA 1UFWA 3DOKA 4HH0A 4KFBB 4QR0A 5DETA 4MFBB 1MROA 5CAAA 3SZ2A 2JDJA 2FTRA 4ZPWR 4HLBA 1V9OA 1E6YB 3JSMB 2KZZA 3OXGA 1S9GB 3IG1B 3KDNA 3HF5A 3UCUP 1RT2A 2PMZD 4DV4J 4NEZA 4C8KA 1EAYC 3A3OB 3QGIA 2WSFC 5KAKA 3KLEA 2R9LA 1ACMB 1X4HA 3GFYA 4ZP8A 1UVKA 5C42A 4YR0A 1WEZA 4ECRA 4IOCQ 1HQUB 3M8WA 2ASJA 2DO4A 2EKNA 5I3UA 3M2RA 1TQLA 1BGXT 4X4RA 5HROB 5I42A 2JEJA 2VHGA 2VG7B 4RWWA 1JLQA 4ZCIA 3H40A 1HNIA 4DL6A 1SL1A 5LSRA 4EMDA 5GADI 3IXQA 4X4QA 3ADAC 2JWNA 2FVSA 2H9ZA 5EX3A 4USJC 3MMCB 1XQIA 3CJ4A 3MM5B 2VQFF 2LA4A 1TR0A 1X9SA 4O0IA 2V9WA 4JI0F 3TQ1A 1NEEA 4D3GA 1HR0F 3UFCX 4DL0C 5L1LA 4XPCA 2F40A 3VAMA 2K7KA 1FDNA 2ASYA 2C2NA 4MKVA 2F9JA 4RBUA 2GIQA 3V81A 4ZCLA 3Q89A 3N0VA 2LYVA 3PR4A 4MIWA 3ZZUA 1H7XA 1EX8A 2H1YA 1N36J 4X2BA 5D4PA 5KFGA 2HVHA 2NYHA 3ZNJ1 1Y5NB 3IAM9 5IS2A 2MKCA 3D4JA 4LVOP 4DR2F 2NSCA 1SV5B 2K3KA 5H9EJ 1Q82T 3ISNC 5MAOA 3OTCA 3EGVA 3ZZPA 1JK9B 2HQ3A 1QAIA 4OZLA 3VWSA 4OLPA 4KTQA 3M8QA 5L39A 2MKYA 4Y0FA 2HFSA 2AYBA 1TVRB 2M5YA 4BDPA 2FC9A 1IM6A 3KYLA 1Q8BA 3C15B 5CYQA 4ID8A 3GIJA 2OJ3A 3W66A 2IY5B 4IR9A 3ENAA 2XZDB 3D67A 2HVZA 2V9KA 3GLJA 4WWSA 2XO6A 2V6AA 3QSIA 3QWUA 4KAIA 5D0HA 4CLPA 2NREA 4NXNF 3PYGA 4ZIWA 1QSLA 2C2DA 2V67A 4DFJA 1EQMA 4CT9A 1XK8A 4YUDA 2DT9A 2WB1D 1H2UX 2AP6A 4DPTA 2KH9A 3KHGA 1UVIA 2CRLA 2PD1A 4IH5A 4A4JA 2DGQA 5A0YB 1KNZA 2UUWA 5F8NA 1AT1B 4ZJOA 3OFEA 2HAIA 2RQ4A 1HBNB 1VIXA 4OJGA 5KFDA 1ZM9A 5C7PA 1S6PB 4BLGA 4RL1A 3DOLA 4AQYF 4USVA 2BANB 4J37A 1RK8A 3PHEA 4OX7A 2A3JA 4F36A 3K57A 2MZSA 2J7KA 1Q0NA 1RCXB 1EETA 2QO3A 4ZDNA 1IR2A 1RISA 4B9SA 2CDQA 3RYLA 2V8GA 5H9FJ 4NOHA 3TO8A 1XC9A 1B7FA 3OTOJ 5ETVA 4BC7A 3T1HF 2HHHF 3PV8A 1S99A 4CLLA 4I64A 4HL9A 5SUHA 2E1PA 3HSDA 4LFBJ 1C0UA 2QGFB 3C14B 4JB8B 4P2FA 4Y3CA 2OFGX 4EEYA 1S57A 2MSTA 3J7YU 3PY8A 4OHYA 2UVVA 2QT7A 3M1VB 4R5PB 3QRRA 1ZAVA 3IGVA 4O4GA 1NK6A 3B6BA 2MY7A 2YH1A 1QUPA 3H59A 3M9OB 4OZ3A 3NOCA 3F44A 4OZJA 3JS9A 4PABA 1DY3A 2MQNA 1BQMB 4L76A 5KFJA 3UD3P 1RAEB 3ZTRA 2JLEA 1ZM3A 4GC6A 3SV3A 3HHNB 4ZITA 4YMEA 1PO6A 4Y2IA 4XTTA 3X1LB 5KFFA 4EBEA 2B4PA 2GVZA 2NYIA 2FJWA 1NPRA 2HFOA 2F63A 4LF9F 4C3LA 4X4SA 2XY5A 4MIAA 1S5ZA 4WK1A 3JYTB 1KFDA 2POKA 3MZIA 4I7FB 2E66A 3H0PA 2Z2YB 3V5RA 1YJTA 1VQ7S 4IOAQ 1NLKL 3BF4A 2AYGA 1H6KX 1ZPVA 3EX7B 1TU0B 3FCVA 3PW0A 1FEHA 4CH0S 2PMHA 1DZ5A 3M8YA 1Q53A 3PCOB 2E1MC 3EPGA 4DUZJ 4WCEQ 3MEGA 1RAFB 1WUUA 4UUXA 2DY9A 4DU7A 5HBMB 2HQGA 2VPXB 3CCRS 4EWTA 4QIFA 2HK3A 3NGKA 2ZOMA 5C25B 5KT5A 2JEIA 5D8HB 3TEGA 2FGOA 2OPPB 3BR9A 4DV7F 4PXDA 4DR4F 2CFXA 4PG5A 4AXJA 3M2VB 3PYFA 3CT9A 1HHQA 3H4BA 3TAMA 3ZZZA 1SC1B 2GMLA 4I68A 3H2LA 1UVNA 4KHPJ 2DITA 1S76D 2C2ZB 1XBWA 2N7YA 2JOQA 3JQKA 4CCHA 1PKUA 3DDKA 1FKOA 1IM4A 2RNEA 4J5OA 3LAKA 4LR7A 5KFEA 3X3UA 1OYEA 2EFNA 1K73T 5KFUA 1WJ9A 1VK3A 3DXBA 1XJWB 2BRLA 4FBTA 3QFHA 3VALA 3VQSA 1N36F 1RTIA 3DLKB 3CTRA 4A8WA 2W4DA 4YHHF 3V6KA 1TKDA 1RDRA 3EYZA 3G6XA 3F56A 4NCGB 5E3CA 3I4PA 1N6QA 2LP4A 4ZVQB 3N79A 3T6JA 4IUFA 4RW9A 3M8PA 1RYRA 1NK8A 2MY8A 2HGNA 3D3CJ 2RKIB 3FGVA 2CQHA 4S0MA 2Y1JA 2JC1A 3C2PA 2HKEA 2KYZA 1IKVB 4QPTA 3KLFA 4DV3F 4J9VA 3PZPA 1D9FA 1B7YB 1OYDA 2DK2A 4GRSA 5CHCB 5CCMA 4Q0BA 1VQSA 4AFFA 2Q6CA 5KG5A 1CJVB 2I8EA 1APSA 2GAHC 1T9YA 2CPEA 2B5JB 3I96A 1ZTWA 1U1NA 2CQPA 2IM3A 5LL6d 1YK9A 4B9NA 3RRHA 3NNAA 3TVZA 3CD5A 3FCHA 3AJ2A 3W62A 1EARA 5BR8F 4F4YA 2UUAJ 1PBAA 3CMES 4DR1J 2JFKA 1GNKA 4IFYA 1P27B 5IQQA 2V8HA 4KHRA 3J7AN 4DR7J 4B9MA 4UOFA 2XMTA 3SDEA 3CNQP 1ZS6A 2IJRA 4NZ7A 3JB9k 1RE1B 3NEKA 3GB0A 4ZCMA 3RU0A 3NMRA 2P9CA 4BWMA 1N56A 1XERA 2EFQA 1EB0A 3ZFVA 2ZBQA 5HSPA 2YKNA 3DOMA 5KT6A 3UVJB 4QU6A 2CPXA 2VPZB 3UNYA 1JLEA 1JKHB 3OLBA 1KD1T 2HW3A 1VMBA 3ILJA 2C3MA 4NCGA 3MR6A 1XR5A 5JVHQ 2V0NA 4A8QA 4KR0B 2VDIA 4MKAA 2DNYA 1Y10A 3BM7A 2BVZA 4QCLA 4UOCA 4DG1A 4F4KA 5J2PB 3AAWB 3VGSA 3T3FA 3CC2S 2B4UA 2H54B 1JXVA 3CDBA 2F3JA 4Q43A 4RNOA 5E41A 2GS8A 2ZKTA 1IXKA 2B6AB 2YKMA 5AXLA 4MT1A 3BYRA 4QOTA 1L3SA 4ED8A 3E01A 2E7VA 5E2QA 2R7VA 6FD1A 1S10A 1U2RA 2VFSA 5THWA 1AB8A 4RLEA 4OHVA 4Q5VA 1NSPA 3E2EA 2IVMA 4LR8A 5FDLA 3G8SA 4Y65A 3C15A 1EJ7L 3DM2A 3NBPB 1F3VA 2AZ3A 2BV3A 5KTQA 2VKZG 4XK8C 4F2SA 4JI3J 1VHIA 2EC2A 1W2IA 3AA8A 3ICLA 2ADBA 1D9DA 3RG6A 4JI7F 4N8OA 4CO4A 4KGZB 5KOXA 1HNZF 3HKZD 3HSJA 2HFNA 3KG1A 3M32B 4DUTA 3NNHA 1VK8A 3K0JA 3OBIA 1RWVB 3PFEA 3QO9B 1TV6A 3W1YC 4B3TF 3WIVA 3FMWA 1KSPA 5KOWA 4PR6A 1YX2A 2DXFA 4TU7A 2ADCA 1RCOB 2WONB 5KFNA 5HI7A 3CC7S 1WI8A 3ZZYA 4M94A 1TV6B 4Z7YA 4X66J 2YNFA 2D69A 4WE1A 2FZKB 3PW5A 4XDDA 2E5LJ 1NH7A 4DWIA 4ED3A 3FUYA 4TQRA 4ZN1A 1T0TV 1U4BA 1VQLS 2VBYA 4JV2A 3BO4A 3T1HJ 5HVHA 1M5SA 1S1VB 1UFKA 2W4PA 1DTTA 1BUXA 1S0MA 2BZ2A 4N41A 1HNWF 2Q1LA 2ASDA 3UDVA 1CJTA 3I32A 3ZTSA 1IJEB 4USTA 2XBPA 2ZD1A 3Q8YA 2B51A 4OLOA 5F9LA 1AFIA 2IRXA 4DX6A 1FJGJ 3HO1A 2MKJA 3J7Z5 4LR9A 5IT9U 1YVFA 5IXUA 4RR5A 1GX6A 2YWHA 4DN9A 3QGGA 3MMJA 1CSJA 3RW7A 5DG8A 1RTDB 1U6BA 1G2EA 2V8PA 3HHLB 4HHHA 4KV8B 2J5AA 1D9AA 1RHRB 2AHOB 4YOEA 1JLBA 2GHPA 1N5TA 3U1NA 1GFWB 1KRPA 5E7OB 4C8MA 4C11A 4X4UA 4V1Ak 2AF6A 3TJ8A 3R2DJ 1FDAA 1S12A 2AYEA 2VFVA 4M5MA 1UCNA 3KK1A 2CVEA 2GVZB 2KRRA 3BSCA 3IRXA 1BD6A 4X4PA 1LXNA 5K5MA 4DPYA 4KPYA 2RU9A 1RWNB 3CJ3A 5KG7A 2VH7A 3P49B 3KHHA 4G6VB 3JYTA 3B54A 1FRHA 3IP0A 3AODA 1JLFA 1VQYA 5EX0A 4JI3F 4Z7CA 5HL7Q 3BGRA 3QJPA 4KKOB 5BR8J 1RTHB 1YG0A 4EO6A 5A2QY 1VQPS 4FBUA 1BQNB 5D4LA 4LF8F 2NUHA 4HEA9 4WU2A 1VRQC 2CQ1A 2DGXA 3DC2A 4M5KA 5KT3A 3OVAA 3BZQA 1NZAA 1UPPA 2EK6A 2YTCA 3QWPA 4R25A 1L3TA 4A48A 3FMBA 3G82B 4JI4J 3CO9A 3BN4A 4LFAF 4G1QA 1JXEA 1FWLA 2D9PA 3N6NA 1SUQB 1FI4A 1RACB 2EBGA 2A2DA 3EGWB 4OJ1A 2XSFA 5EWGA 2D9OA 2R7XA 2GQCA 2X1BA 5KFSA 1PIEA 1D0EA 3MM8A 4V19X 3U1LA 1F9FA 3UQSA 4ED5A 2IDLA 1I5OB 1NXIA 1S6QA 3K17A 1N5YA 4DL5A 5LOQA 3W5XA 3PO5A 4DPUA 5BXIA 4FN5A 4Z2XA 3PRVA 3ENWA 3MEKA 2MLXA 4ZHRA 2M9KA 3CCZA 3OPKA 4PG4A 3UN3A 1FK9B 4MK8A 3TP2A 2MQQA 2HG4A 2LEBA 1UZDA 3CIZA 3D1HA 3O8WA 3IBCB 2LCWA 3KG4A 2ZDOA 1TKXA 1NHKL 4IQMA 1VJWA 2J7UA 1YI2S 2W01A 2G1DA 5ETKA 4ZLPA 3IRXB 5EWEA 2ZNYA 4KC5A 4CO2A 5LSLA 2H51B 4JYAF 4DV5J 2AJFE 2XC9A 3AY0A 4GO5X 1KLNA 1JLFB 1U8SA 4ICLB 1SBRA 1QE1A 1WC1A 3VGUA 1ZPWX 1TL5A 3L95X 1P6TA 4KY3A 1QM9A 4OZ1A 4F25A 5F41A 2GO9A 3I87A 1NDCA 5GMEA 2O5DA 1QY7A 1RLDA 3PX6A 2YH0A 4QIEA 2RH3A 2CPFA 2I6WA 4ES3A 2GNKA 4LT6A 3AT1B 3FFIB 4Q0BB 4AL5A 1MMNA 2DRAA 4JV0A 4E0DA 2HHUA 2GFFA 3DRRB 3RBZA 2W7PA 4USWA 1SKSA 1A6LA 2AMCB 3R5JB 1DHMA 5BYSA 1T94A 3EICA 2PA8D 3BBBA 5LT5A 2M70A 3FBFA 4ECYA 1X9WA 5KFKA 4MJKA 1RBLA 1QAJA 4NLSA 2AYMA 1UJ4A 2CNOB 5GAGI 2CJXB 3ET6A 4KJIA 1MU2B 1GQEA 1R0CB 1WF2A 4DV7J 2OPQA 3R8YA 1LWXA 5K8PA 1EP4B 4WFBQ 1T11A 3D68A 4DR5J 1RWUA 2HGMA 3PM9A 1OSCA 3GPAA 3DLEB 2H4YB 3TUZC 1T8EA 2GJFA 3FBEA 3OVBA 2APOA 2VASA 2OPQB 3MD3A 2YX1A 3N6LA 3NY0A 5KFRA 2YNFB 1NRKA 2DCUB 3CSKA 1TL4A 1HBMA 2ALYB 2B9XA 2BJ7A 3POTB 4LRAA 2ZFHA 3M1VA 4R5PA 3OHAA 3W61A 3DLEA 3IAS9 1WEYA 2QTWA 2Q79A 2R42A 1MN7A 2KU7A 2YXLA 3CO0P 4NXMF 4DLGA 2GHWA 2Y1LB 4KIAA 1LFPA 1FJCA 2DBBA 3TZWA 2JRSA 3KK2A 5CD4H 3OFGA 2QZ8A 2Y0SD 4CLFA 2MLZA 5DLFA 4PPDA 5LMUJ 1E6YA 4QR1A 2XYGB 3JSMA 4HTJA 1U1OA 3WQPA 3LP2A 4RZRA 1QD1A 5E3RA 2DR7A 3CD0A 2KJVA 1IQZA 1X60A 3PKYA 2PDAA 3NG8A 4B3SJ 2ZJQQ 2IFXA 3D6MB 3I9V9 2GAGC 3OQ2A 4C98A 4F26A 1RI7A 1S72S 3Q2SC 4AQYJ 1ZBTA 2I5JA 1NJYA 4XIUA 1SL2A 1ICEB 1EZZB 4R0JA 2FJXA 2HYIB 2ZKUA 3MTJA 5DQIA 4QWCA 4Q8EA 1HD1A 1QTNB 5AJ3F 3GCXP 3CJQA 4RO0A 4OFZA 3BR8A 4UT4A 4QWBA 2JHEA 2GMHA 1HI8A 1IKYB 1QSYA 1ITPA 4NLUA 1WHYA 1OPZA 2C2MB 4H4OB 2A0FB 1T9WA 3CXCR 2ZVIA 1RAAB 3D0GE 2VBWA 3K5OA 2OHDA 2L9NA 3NGDA 4NCAA 4WU3A 4H4KC 1RT5A 3IRWP 1HBMB 2Q3PA 3VAJA 1S77D 4FNHA 5GMKa 2UXDJ 1P8GA 4DUYF 4O3OA 4IDKB 3BDPA 1VS3A 4F0MA 3ITHA 3PNIA 3Q22A 1CLFA 2HNZA 2V69A 2HGLA 1IBLF 3UD5A 4OX9J 4M95A 3KOAA 1U0HB 2FJAB 2CPZA 2KDOA 3C66A 3KLIB 1TFWA 3JSRA 2JNJA 1N88A 1Y3KA 2ZBCA 3KK2B 1NJZA 2CQDA 1J27A 4C0HA 1S6PA 3DNCA 3N28A 4DSJA 2OTJS 2B7CB 2GJIA 1NK4A 2HNZB 1VHFA 3M4XA 1UL3A 3OR2A 3MM8B 4ZK7M 3IS9A 4Z37A 1RBOB 4MK7A 3BH6B 4YQWA 3FDSA 4NLOA 4J7CA 4USIA 3GV7B 4B3MF 1F9EB 1TL7B 3HKWA 4W98A 2GC8A 4ZA1A 2CNNB 1X4FA 4ZVEA 2N3OA 1WF1A 1SQGA 1OPIA 3MR2A 2JFDA 1VQ5S 4ECUA 1IKVA 3KLFB 2LU2A 1S1XA 1YZ6A 4L72B 4A47A 4CM0A 3FEXB 1D09B 1CJVA 2AT1B 3HD1A 5A6PA 4X65F 5KFCA 5GAGU 4HT5A 4DOZA 4EYHB 2MMYA 3AFGA 3VV2B 2EWHA 2HBYB 1V3ZA 3IA0A 3F73A 3Q86A 5HP1B 4LBIA 2B9WA 3NAHA 3PYDA 4TY9A 4RX6A 3KDOA 3TUPA 3C6TB 1RU1A 2QMXA 3W60A 3DU6A 5A8KB 1MN9A 1WD6A 3MM9A 3TAPA 3AOBA 4X64J 5CXTA 1TP7A 3MMCA 1K47A 1Y7PA 4IYQA 3FBCA 4OI3A 1RAHB 2DR6A 3G71S 2BOAA 3NS7B 3OTEA 4NLQA 2ZC3A 4ZIVA 3W2WB 5DDOC 2BA9A 3EWGA 3QSYB 1FJEB 1O0PA 3D5MA 4KBIA 7FDRA 1RBAA 2EPIA 2XGPA 4OI1A 5DZ7A 2DIUA 4NMXA 5B0EA 3CJRA 1Q8LA 1JB0C 3HT0A 3BH7B 4PXCA 4RJVA 2GIRA 2KHDA 3LTOA 5CYJA 2VIHA 1RWKB 4FVMA 4ALZA 2F8HA 1X4DA 2BACA 1MU2A 2DISA 2ZBPA 3BKTA 3WC2A 3OXLA 1N34J 4G1PA 4PWDB 1HBUB 1OMSA 1WHVA 2CUYA 2PO4A 2CXEA 3MCMA 2XHWA 4QIGA 3HCXA 4F3QA 4K5RA 1IVZA 2E5IA 3J81U 2IBKA 2UP1A 4L3KA 1VISA 2ACYA 2D74B 3F0NA 1HYSB 4LF9J 1NBEB 1X0PA 4RUBA 5ETRA 3BQ2A 1TMMA 4KH1B 2L9DA 4CO3A 4LF1A 2GX8A 3DRSB 4O0NA 2MZJA 3PX0A 3HJVA 1REVA 1HWIA 2IM1A 1U47A 3OVSA 5LMUF 2C22A 3NP5A 3BDEA 3DI6A 3MEEB 1T05B 2B0GA 2AW0A 3N9UC 4ZVGA 1QE1B 1O8BA 1YBUA 2N82B 3AXKA 1JLAA 2M88A 4HHJA 4DV2F 1LWFB 3QIDA 4LIWA 4GKKJ 2HSEB 4P52A 3QLHB 1UZHA 1SCJB 3DHWC 1UAWA 1NUEA 2HS4A 2KXHA 1UTAA 3NKYA 5GVQA 3LPEA 3BS9A 3RGIA 2Y8WA 5IWAJ 2PN6A 3HZGA 4OIXA 2ILZA 2XS7A 1UWBB 2E44A 1Q7LB 1FCAA 2RDDA 4IKAA 4NE9C 4CH1A 3I9ZA 2E9ZA 1OIAA 4BCAA 2Z56B 3ELHA 5E33A 2QLWA 1F5BA 3DYAA 4O3QA 4ES1A 4WPAA 4ANEA 4USMA 5LXRA 1ZETA 2IJNA 1XMQF 4LSLA 5BYQA 4ZLJA 1RT6A 3TAMB 4YEAA 2VDHA 2FHKA 3TVYA 3HMJG 1J5EJ 1RT4A 3MI7X 2HRTA 3KFWX 1C0UB 3C14A 2VA3A 2I9SA 5DDQC 1LWCB 2OMOA 3MAHA 3SEOA 4IRDA 4DF8A 1BLUA 3KNGA 4CLTA 2QC3A 4KH0B 2CA9A 4QR2A 2OPSB 4FVCA 2MB0B 3KJFB 1PYOB 1N5YB 2ASLA 2HBQB 3G2XA 3JTNA 1D1UA 4ELUA 3KJQB 5RUBA 5IM0A 2CNKB 3VQTA 3MOJB 4DU8A 2XSJB 2XLIA 2VG6B 1YKWA 4NEYA 4AYBD 5LJ5Y 5AXKA 1PC5A 1RAOA 4NZ6A 1SQEA 4RUAA 4MIBA 4ZPTR 4OYAA 2NXJA 1JLCA 3QIPB 4DL7A 3HHLA 3W63A 5K14A 2C2KB 2N3LA 4B9LA 2AV5A 4WKYA 4CTAA 5DDPC 1L3VA 3SMZA 4C11B 4PEOA 2FY8A 4CLWA 2F4FA 2FY1A 2NZCA 3JXOA 3QLHA 3M7VA 2LXFA 1R7IA 1Q79A 3CWJA 1JMTA 4GVBB 4P71A 4WYWA 4GVLA 5F8HA 1NH8A 2C2RA 1ZYQA 2Q66A 4A8KA 3A8EA 5T7LB 1GX5A 3JAMU 1VQ4S 5D4NA 1IWAA 1S9EA 1YWXA 3TX0A 2ACMA 4OZ5A 4TN2A 1FD8A 4DX7A 3SCIE 2XHCA 2ZEJA 5E3PA 1AUDA 1CPZA 1X5PA 2XWYA 2E5LF 2YKQA 1WG4A 1X4GA 2QYCA 1O51A 3J7YI 3R9LA 4ILLA 1C0TB 1VBKA 3AQPA 4YB7A 3V4IA 1TUGB 2B8PA 4ZN3A 4U8VA 1HR0J 3CCJS 3VF0B 5EDWA 3T5JA 2OPSA 1N32J 4K5SA 2HBRB 4WIQA 3ET6B 2DR5A 2YKNB 4LFAJ 1BQXA 4DZ6A 3MM9B 4FYYB 4ZPDA 2XSJA 1T02A 4LF6J 1RA7A 3NL0A 1R6VA 3DFEA 1KHWA 2DGVA 5D77A 4MYUA 3A13A 1HD0A 2EBEA 4JI1J 1C2PA 1SIZA 2CYYA 2VFRA 2GZOA 2RS2A 4IRCA 4NRUA 1EETB 3RUBL 5IV4A 1KDNA 2YX7A 1C1CB 4LSNA 2BBEA 3VAIA 4ECTA 2JLGA 1UVMA 1RJJA 4KGXB 2IRUA 1RP5A 2G0IA 2P5VA 2PFDA 2W9BA 2YY3A 1K44A 1S0VA 2VZ9A 1JQGA 3ONQA 3ZZTA 2RIJA 1GEHA 4GKJJ 1UMJA 1N0UA 3R5CA 3GIMA 4JYAJ 2HHXA 2DGSA 1RAIB 4U96A 1FDBA 4KFBA 1RKIA 1TKZA 3GTYX 1BWVA 4K4SA 1KQGB 2ROGA 5T14A 2OPRB 3HXMA 2J76E 2MHNA 3DDNA 2PIIA 1HQEA 3US5A 2YNIB 3CDWA 3I0RB 3KLGA 3TW0A 2UU9F 5D0EA 3IG1A 3G4SS 4I4BA 3MCNA 3HVTA 3M2UB 1VQNS 5C2GA 1PBUA 3K8VA 1LWEA 1RWOB 4D3HA 3QAEA 2R2UA 3MPDA 2WAQD 1DURA 3KLEB 3I0RA 2K8GA 1WC6A 3MDFA 1J5OB 3Q8SB 3DLJA 4OZ2A 3D66A 3FK4A 4ZCKA 1RT3A 3GIIA 3NXZA 2G0JA 2QSFA 3PDNA 5IWAF 3DOMB 2F1FA 1R8CA 2VFTA 3GSDA 1N32F 4NA1A 4X66F 2FLOA 3OL9A 1FF2A 1HBOB 1UWBA 5A0YA 2UXBJ 1CEZA 1F2HA 1JLEB 5KFYA 2WZ1A 3SXLA 2K7JA 3VTIA 1M5PC 5FJ4A 1S1WA 2KT5A 2J9DE 2J8AA 1RKJA 4IO1A 1R8HA 2P2CB 7AT1B 3DYAB 5KT2A 2BANA 3L3CA 3FKBA 4XPEA 4C8LA 4WKRA 1BQNA 2G2ZA 2IJFA 2M3DA 3R97A 3V4MA 2ERRA 4JI5J 2ZZNA 1KC8T 3U02A 2E9RX 4KO0A 3V6JA 2WSCC 2RF2A 2LQJA 3SFUA 1S79A 1KQSR 3HI9A 1S0OA 1FTRA 2CQ4A 2B9YA 3E51A 5KFBA 1RAGB 3I5CA 1TKZB 4M8LA 3T9ZA 4GKJF 3GR0A 2DY1A 4KQZA 3MMBA 2F8MA 2BMBA 1P9QC 3LALA 2PEBA 5ETSA 1HQEB 1Q4RA 2CQBA 2GW8A 2H48B 3A1YG 2BX6A 1XEZA 1YLXA 3GFHA 4YFUA 4BHQA 3FSYA 4JV5J 5E0OA 3MAAA 4I1TA 4QWAA 3W5ZA 2D3ZA 2BJ8A 2P9EA 2YNGB 2CJYB 3QIPA 4ZJLA 3I5AA 1RA6A 2W9AA 3I82A 1S1XB 3WHIA 3THVA 5I4MA 4OYWA 3KKFA 2B43A 1Q5YA 4IFVB 3N5FA 2ZH8A 3P6YC 1S6OA 1W26A 4FYWB 1NO8A 2VV5A 4J9UE 2CNLB 1FRLA 3E3XA 2ZWOA 1F60B 4P74A 3T1AA 4IFVA 2X3DA 2OELA 5HVFA 1F6TA 3PW7A 4JI8F 4DSEA 4OHZA 3ULHA 2V5HG 2RMLA 2OD6A 2ZVSA 2OH2A 2NZ4A 2JZ5A 5KFXA 3WIUA 4P9SA 1NMEB 3R5AA 4KGKA 4FYVB 3RTVA 2UVWA 5KG4A 3K5NA 2XULA 3NS6A 4NI2B 3HT3A 4KO0B 2QMUB 2QYGA 4OX8A 2ZE2A 3ITHB 1S7IA 4TY8A 4NLPA 2RT3A 3S6EA 3VVTA 1N8RT 4LSLB 3VZHA 4P2XA 1T95A 2ZH1A 4MYTA 4G65A 4CLKA 3SDEB 4LF6F 3LAMA 1U02A 1BHNA 1JX4A 1HHSA 2QV6A 2QLBB 3OW2R 1FFSB 1RT1B 3OR2B 1KS2A 1MMLA 1NK0A 5D4OA 2CG4A 1FK9A 5D3GB 5DQGA 4PQUB 2CJBA 4OZNA 4FDFA 2DB1A 3MOZA 1VQKS 3GG0A 4NX9A 5K8MA 4WTYA 1EHWA 2GCFA 4LFBF 3PG9A 1B3TA 2N4CA 1FA0A 1GAOA 1Y9OA 3DGPA 4UOHA 1P9YA 2YNHB 1E6VA 4Y2CA 4OYBA 1UEKA 2FLNA 3HLUA 1XR7A 1VQOS 3CPWR 1VRUA 1OJ4A 1FERA 2DXEA 3JQJA 4OZ0A 1KEKA 2BQUA 1VLOA 1FWPA 3TA1A 2VJUA 2CDRB 2CQGA 2DYAA 5A8RA 2H5JB 2XMJA 2HEKA 1M1KT 3QNWB 1N4LA 2V63A 1HNXJ 4N76A 5CD4A 1U6ZA 4GKKF 3A8JA 4TU9A 1HWJA 4OYOA 4FKXA 1CVJA 2A18A 2CPYA 2J8SA 2GVDA 5A8RB 5B0AA 4DCJB 5KG3A 3VVUA 2AJ2A 2RKIA 2YKMB 2ZHBA 4DV0F 3HZEA 2CZVC 2FJEB 2ZM6F 2DVIA 2FUG9 2DHAA 4Y2KA 3L7OA 3A4TA 3OTOF 1VQMS 3LP2B 3GZ7A 2Z0GA 2V8VA 4I0WA 4P7VA 3MUMP 4H4KA 1YRXA 3R6GB 1Z2LA 4NLRA 3DRYA 2QN6B 4Y28C 2C3YA 5L9NA 4X4NA 1KLMA 1NZ8A 1SC4B 1FKAF 3GYGA 1DQAA 1DFDA 4IG3A 3JSYA 4ZVFA 3G6YA 1PSDA 5F0WA 2A6OA 1D3WA 4DR4J 2EKYA 4I67A 1VR6A 4QYZK 3PJ9A 1UW9A 1YJVA 5AXMA 4QPXA 2AGQA 1PCAA 1RADB 1QJHA 3TQEA 4J9SA 4K4YA 3ILOA 2Z8QA 4J9PA 4IG3B 4UUWA 2CG8A 1R8PA 4K4ZA 1E6VB 2WVDA 1IKYA 4JOUA 1IBMF 4CYUA 4ZPCA 5F3ZA 4WXOA 1NJWA 1TZ0A 5I3UB 1BWEA 4NLTA 1WOPA 2LECA 1HMVB 1TL1A 1WKKA 5CZXA 5ETQA 2R7RA 1QUVA 1T7PA 4DQIA 2MQMA 1RZMA 1RHJB 4LUBA 1IKWA 5ETOA 5GMDA 1LW0A 2MQPA 1AW0A 2PMWA 2WVEA 5G0RA 2FDNA 3ISZA 2QSWA 3K89A 4HACB 3VGVA 3U1MA 5LJ3Y 1WTBA 2AGOA 4RW6B 3KUEA 1UEUA 2MPUA 1ZM4A 2ATLA 3UN5A 4B3RJ 3OLAA 1RLCL 1H98A 3ENQA 2I1RA 3GONA 3LO3A 1S1UB 3UO0A 5A76A 4YHHJ 3DLLQ 3V2UC 4K4TA 5U47A 1UWAA 4K50A 3BKFA 2FPHX 3R5BA 4TU8A 3NS5A 4CH7A 2G2YA 3VAFA 1TVRA 2MQOA 4I6AA 5CYMB 3HSZA 1VDHA 4YY3J 2M8DB 4UW2A 1TL7A 2VG5B 4CWBA 1S9EB 5JUMA 4DLEA 1EQ0A 2FB0A 3ZTQA 3MPUB 1T3NA 4EBCA 4PCQA 3P5BP 1MW7A 2PT0A 1LEOA 3H5UA 1X0FA 3C46A 3SCLE 1HQUA 4QIVA 3KTQA 2CADA 1HQ2A 4DEZA 3DM2B 2FZGB 3FEZA 4AT1B 2Z57B 2CIMA 3IMQJ 3O44A 2M7SA 3I6PA 2HHHJ 4LBHA 2QA4S 1M5HA 1YRUA 2A2CA 4NYZA 1FO1A 5C2CA 3I5BA 3NGSA 3H7HB 4LRCA 5ETLA 2HMIB 2KHCA 1IBMJ 3TARA 3PTWA 4W4MA 1DJ0A 2EFGA 2CQ3A 1OQ3A 4HI1A 4ZVUB 4N47A 4DQSA 1U8WA 2ZH4A 1SJ3P 1YJNS 2AEMA 2HHVA 1TK5A 3Q83A 1LW0B 1M5VC 1N54B 5IM0B 1U48A 2BE9B 3UDLA 3FVYA 4DV5F 4DV4F 3JSBA 2FQQB 4C9DA 4F2RA 5B0FA 3SI8A 2R8IA 4M1KA 2XWXA 2D7SA 5ITHA 2RF2B 2W25A 4FXDA 1UJ6A 3OD2A 3P5TL 1D8YA 1Q16B 3PRDA 3AOAA 4P2SA 2HS0A 3BSNA 3ZNUA 1FRXA 2FZCB 1RABB 1PJ6A 1RQ0A 3NWGA 4MTPA 2G4BA 3D3BJ 2RHSB 4O4GB 2OAUA 3CCUS 3CDAA 3HVWA 1P1LA 4PWWA 4C7QA 2QEXS 3R5GA 1LK7A 4NL5A 4UOGA 1MMDA 3L7UA 3PW4A 4MMOA 3BB5A 2H3EB 2VQEJ 3GU0A 1ELOA 2QLXA 1RT2B 3DMJA 2EVZA 2OMLA 3Q8VA 2PSZA 2B4VA 2ZBRA 1H7WA 3EE3A 3SQOP 2QA2A 1S4EA 3FQLA 2ZNZA 1NHVA 4FXWA 2DNHA 3MM7A 1XIQA 1RHQB 1T9UA 4P6QA 3S01A 8AT1B 3BQ1A 4DUYJ 3LGNA 1H73A 3A12A 3LUYA 4WK3A 5HQLA 2UUCJ 2R7UA 3IR7B 3MEDA 1BC6A 4ZLNA 1UPMB 3D6TB 1HLWA 1K1QA 4A8FA 2BRKA 2RILA 1RUSA 2I2YA 4WFNQ 1RT3B 1OO0B 1VI7A 2AX1A 2AJ1A 3UI3A 5HO4A 3OFFA 3H20A 4JI2J 4IDKA 3UD4P 1WG5A 2HHQA 3BYPA 1FNXH 1RTJA 1RWXB 1S1TB 3MPVA 1WC0A 1MSWD 2W9CB 1KFSA 4O3RA 4L74A 3NOGA 2XM3A 3KLIA 3FSIA 3V6DB 4I56A 2KM8C 3IN5A 4EBDA 1IQTA 4DV1F 2K1RB 2O66A 3MCSA 3NCRA 5F0UA 5M2PA 3HK2A 2UXDF 2M8HA 3CMQA 4AD6A 3ISND 2VC0A 1WDTA 3DLGA 3DDIA 3HHLC 4H4MB 1Y00A 3DXSX 5HANA 4DFMA 1VLYA 2DGTA 3KUGA 4NLVA 3MWBA 3QRPA 1KWMA 4M5DB 4NZ0A 2FYXA 1GMUA 1GMVA 5KFVA 3IBWA 3THTA 1HWKA 2W9BB 2FGCA 2OPPA 1SV5A 4WJBA 3UDCA 5BJRA 2FJBB 1PAUB 2AX0A 3CULA 1FXLA 1PILA 1IBCB 2LQ8A 3CDUA 2X7IA 5EGYA 4X64F 1Z2ZA 3MR3A 3PW2A 4OQJA 1FX4A 3RB3A 1YJ9S 2AJQA 9ATCB 1CC8A 3CJ5A 4F3MA 2JH3A 1N6QB 3DLHA 2OPRA 4NRTA 4DR6J 1KP6A 3DU5A 1T05A 2IPOB 2V4JA 2LA6A 1ZZNA 1V3SA 4ANCA 1OWXA 5LMNJ 3TUIC 1NSKL 1YJ7A 2A1BA 4Y6IA 4CI0B 2NR0A 2DR8A 5J1EB 3AJDA 3RR7A 9RUBA 3HD2A 3M6VA 3FC9A 1F5CA 5JXSA 3W9IA 3IWNC 4QIWD 3JAMY 1RTIB 4LQ9A 3SQGA 4J9MA 4WFYA 1O5JA 1TL3B 3GJQB 3HFKA 3PACA 1U1MA 3LPYA 1X4EA 1GTHA 4I2QA 4OI0A 2XLJA 3RAMA 5IZHA 2H4WB 3CIMA 1OY6A 4WBFA 4ZVSB 4C2MA 5F9NA 3GV5B 3NCQA 1YITS 1HBOA 4OYZA 3NMAA 2PE8A 2QFJA 1TL3A 4DSLA 4P72A 4ER8A 2XNQA 2YWWA 4IR1A 2HS3A 2UZAA 1UW4A 1JIHA 2OLWA 2ZE2B 4HT7A 3T9NA 2J6TA 3PHTA 5EWFA 2NUUG 3G82A 1NJIT 4M5DA 4L3NA 3G8QA 5J1PA 2IDEA 3GJSB 5GAEU 2ZH5A 1GTEA 2JSXA 4UQGA 3I56S 1U1LA 2KB2A 2IHR1 3G9CA 2I38A 4N77A 3UVJA 3V4IB 2RRAA 3G86A 2NQPA 3BGOP 1HPZA 3TANA 5I3QA 1X5SA 3TI0A 4CYUB 1ZM2A 3BREA 2UVRA 2XMWA 4C0OC 2OEKA 2ZITA 3TZXA 2A10A 3AJ1A 5CZVA 1Q78A 1RTZA 2CPHA 3DGPB 4NLGA 1SKRA 1T03B 4H54A 5D0GA 2KTQA 3WX8A 2AKWB 2BJEA 5KFPA 1WEXA 2VL1A 1WHWA 4USUA 4U7CA 1PGZA 1TAQA 3HVAA 5FLXU 2BW7A 2N4DA 2OUGA 3D6HB 3MF5A 4DV6F 3PJWA 2FLPA 2GV1A 4GO7X 2DEIA 4RW4B 3GIKA 3HVRA 3B82A 2VKRA 5H1SV 4U6PA 1XMQJ 1N0VC 4ICLA 5A8WB 1H2VZ 3MGJA 4NYOA 3TAQA 3MM6A 2F9DA 3ETOA 1KR4A 1C4CA 1FEEA 3O5TB 4RBTA 5J2QB 4V19J 4O44A 1Y5LB 4JI4F 4EZ9A 2HHTA 4C8YA 4WYLA 2V34A 1SH0A 4WF9Q 2F7VA 2XNRA 2RD5C 2Z2MA 4HDGA 5K20B 4G3IA 1GT8A 3NAIA 3PFOA 4BWJA 3TOQA 3UPFA 2ZH2A 3T6BA 2QJ3A 3UDEA 4NI2A 2XCAA 1KOHA 4DF4A 3QJJA 2L48A 4HH1A 2XY6A 2RRNA 2O3DA 3D28A 4I69A 2UVUA 3M9NB 1HNWJ 3AD7C 2E7XA 4H4OA 3EVWA 3KK3A 1X31C 1CQMA 3GR1A 3LGMA 3ZC4A 2BQ3A 2VJVA 2JLFA 4YDXA 1WC4A 2CWKA 4U9RA 2CAJA 3Q24A 3M6UA 2HK2A 3P8BB 1B0TA 3GG1A 4NLYA 4DMZA 4DR5F 3R1LA 2M0GB 1HA1A 3NWRA 2Y3YA 5ADZA 3KJVA 3RBDA 3RBEA 3MM5A 5KFWA 3OFHA 3DLKA 3ZZOA 3TJ9A 3AB4B 1PYSB 2V2ZA 1OS5A 1IJFB 1VRUB 4EU0A 1LW2A 4R8UA 3EGNA 3KHLA 3SV4A 4RW9B 1NK5A 2DO0A 4HACA 3SIPB
chains in the Genus database with same CATH topology
1U26A 1H38A 4MH8A 1R6YA 3TRGA 2C2EA 1M0SA 3KWMA 4B08A 3RB4A 4DR6F 1LW2B 2J7WA 2CPDA 1Q81T 4K4VA 4ECSA 2DTJA 3LANA 2DGOA 4JI6F 4O3NA 2DHGA 1H2TZ 4IG0B 1VC5A 3VAGA 1T3OA 1FDDA 3BGLA 2CJKA 1YQHA 1VQ8S 4LFCF 2HQIA 4F4WA 3MEDB 3KK3B 2J0QD 1HARA 3PO4A 2MKIA 1W2BR 3H4DA 3RW6A 4DQRA 2RDIA 3PXGa 3T5HA 3B8HA 3MMAB 4QU7A 4O4RA 3UR0A 2B56A 2YX4A 3MECB 3NNCA 2BDPA 2JVOA 2IM2A 3IO1A 4N8NA 4E8UA 3U7JA 2DHSA 4JI2F 1HNIB 4DBQA 1SUQA 3DOLB 2WHOA 3IWLA 2R7OA 4OI2A 4U7UK 1FRIA 5JJBA 1CQNA 3E8OA 4XO0A 4ATNA 2MYFA 1M5KC 4TNOA 1SB6A 5LMNF 2DD8S 3F41A 4TYAA 2D41A 4ED7A 3OL8A 3QYYA 2XI3A 3M8QB 1R31A 5F8MA 1U6FA 1R8AA 3P96A 4FPRA 3CB4A 1U7LA 4B9VA 2HNDA 1AXQA 1FE0A 2BW2A 2GGPA 2KVIA 4ILRA 3VZIA 1U25A 4OX6A 3DMJB 1GH8A 3DCAA 1U49A 4F3OA 3GILA 3M8SA 4LF5F 2ZHOA 2W4CA 4ERDA 4ZP7A 2VOOA 1WWHA 5J1NA 1UVLA 2X51A 1X4CA 3LOUA 2UUTA 4LMZA 1TKXB 1HNVB 1HBNA 3IGNA 2AWZA 4ED6A 2KT3A 3PRBA 4C3KA 2XB2D 3RAXA 1JJ4A 1L5UA 3CJ0A 4GMKA 4A8SA 1GXUA 3K8WA 5J2NB 4I6WA 2XMVA 2KFNA 5F8JA 3LP1A 1XTZA 3MFIA 4ZOSA 3KG0A 5A6WA 3ENVA 2CZ4A 1IBKF 3FFIA 4B3OA 5DM7Q 3K58A 1YJUA 2OTLS 4R0EA 2C42A 2Z2LA 3THPA 4OL8A 4DJBA 2J0WA 4FZVA 4J9KA 1K0TA 2FJVA 4ID5A 1H3DA 4OHXA 2XLKA 2NLWA 3EPIA 1NK7A 1I6JA 5DM6Q 2CPJA 2ZH6A 4CT8A 3K5MA 2J9EA 4QYRA 5C24A 1KOOA 2EFVA 5EHHA 2LEPA 5AXNA 1W25A 3CD7A 4HTIA 1U09A 2PGCA 3R1HA 1RTDA 5I3PA 3UCZP 4OV1A 2EG1A 1OQ6A 2QA1A 2V4RA 4UY85 4NWBA 2E5GA 2RDJA 1Y3JA 1ZAXA 1K8AT 2XEXA 1SC6A 2C3UA 4ZPBA 4IO9Q 3RB0A 1SH3A 3OUYA 3HP6A 1ZOTA 1A9NB 2KYXA 3HHLD 4DL3A 3EZUA 2V4JB 4O3SA 4FF3A 1WNEA 2ZBIA 4CTAB 3DRXA 4CIOA 2OIHA 3QJLA 1Y5IB 4YDDB 1KTQA 4ED2A 3FZ2A 1AFJA 1GXTA 3S8SA 1IKXA 1JJHA 3DRPB 3J7A1 3LW5C 2AQ4A 5B08A 4UY8T 4Y2AA 3FRZA 2MZTA 5L1IA 1HW8A 4IG0A 4IH6A 1NKEA 2P9GA 3M30A 2DR9A 3MXHP 1MWZA 3OR1B 4OJHA 3MTKA 4A46A 3KMSA 1IKXB 3DRPA 2E1CA 1FXDA 1WG1A 4FF2A 3G6ES 1LOUA 2HRYA 1F2GA 1L3KA 1S7HA 3M2UA 2RE1A 3M30B 3CCTA 1VBXA 3OTDA 4W92B 2RSQA 1FXRA 3M2RB 5LSOA 1QVFR 2EC0A 4ZPVR 3R5DA 3M9MB 3BO3A 4RNHA 4PRFA 5C5JA 4X84A 1R8BA 1JLQB 3C6UB 3MPYA 2JC0A 4B3SF 2NS1B 4EFAC 2W24A 4K59A 1J5EF 3M6XA 2L3MA 1M90T 4K4XA 3BSOA 2PEHA 3VAKA 1FE4A 2KJWA 1YBAA 1YHQS 4B02A 3PEJA 3G96A 3IR6B 2SXLA 3EZ5A 1QAYA 5G0RB 1B0PA 4URGA 5F8LA 5FIIA 1SXLA 2VG6A 3IS9B 2HHSA 3M8RA 5F8GA 1VRTA 4B3RF 4Y00A 1TK8A 1JLCB 4XDCA 2HZCA 2KN4A 4FF1A 4J9OA 2DNNA 4O3PA 2MDAA 2AD9A 3J81Y 4DSFA 4WZMA 2X1AA 4DS5A 4Q7AA 4TLRA 5K8NA 3PY8A 1SI9A 2GO8A 3H5SA 4WFZA 1NK9A 4Q2LA 3M05A 2GGPB 4OX9F 2B6AA 2G9OA 2CJ9A 3Q23A 3GFXA 5KFLA 2O01C 2YNIA 2FD2A 2HWHA 4DR3F 2MJNA 4QZVB 4QQBA 4K4WA 4A8YA 1S9FA 2E9TA 4WXWA 2B5JA 3G6VA 4J9LA 5HN0A 4UQTA 2P6TA 2HMIA 2GQQA 3C3LA 1C0TA 3AHPA 1J5OA 3HDSA 2BXJA 2BR0A 1RYSA 3GQCA 3GYNA 1WHXA 1U45A 1FD2A 2R7TA 2J9CA 3MMAA 4PUOB 1UEVA 3K7RA 4PXEA 2GQ2A 2E29A 2KI2A 3NCPA 2HVIA 3M32A 1RTHA 4NA3A 4ZP9A 2LXIA 7FD1A 1Z1ZA 4YB5A 2FHJD 2DH9A 2DPIA 1TK0A 1VGYA 5CH7B 1IKWB 5GAHI 2MGZA 5KFZA 2XZWA 3WZ0A 4RUHA 3CMAS 3KLHB 4RNFA 2DGUA 4RW6A 4ECQA 5JVGQ 3WC0A 3CJ2A 4OI6A 1Q7YT 1SL2A 3O6QA 4MKYA 3N6MA 2LKZA 1U2FA 1LV5A 2W7AA 2XGQA 4ETZA 2DIVA 2K1RA 4Y34A 2MJUA 4AL6A 5DGAA 1K0VA 2OD4A 3PKMA 3Q0AA 4DG1B 1SH2A 5FDLB 2HFZA 1A7GE 2V4QA 1SIWB 2C3OA 4YP3A 4HDHA 1HWUA 4B9UA 4X4OA 3CCLS 4PWDA 4Q2MA 4HYKA 1HFEL 2MZ1A 3EXYA 4EZ6A 2L9WA 5GAEI 4EGLA 1S6UA 2MKHA 1U1KA 1XNQF 2VONA 1SJ1A 1WF0A 2G13A 4WFXA 5E5NA 3K59A 1S49A 2XMUA 1VQ9S 1LKZA 4Q8FA 4FP9A 3TA2A 1HNVA 1VIOA 2IBOA 1XR6A 3NBPA 4ECVA 2L08A 2WONA 1SJFA 4ELVA 2CJAA 2W7OA 2JL9A 5I42B 5CQGA 3OSNA 1FJ7A 2VBZA 2RU3A 2ZH3A 3P3DA 3W2WA 2DNPA 3LP1B 3VAHA 1DRZA 2UXBF 5BYRA 3SQGB 4GC7A 4RU2A 2X1GA 2DNKA 1RT4B 3WBZA 4RW7B 1RT7A 4X62F 4H4MA 2ROPA 2RVJA 2FHMA 2GJ2A 1R43A 3C6UA 5IFMA 4G1QB 5HQ8A 3CCWA 3PJXA 4FNIA 4JBCA 1I1GA 4URSA 4RW7A 3MHYA 2BE2A 3VCDA 1FVSA 2P6SA 1YTYA 1RT6B 5D6GA 3CCSS 2YKAA 4ZPAA 4NLXA 3WX4A 3MUVP 2MXYA 3SCJE 4RBVA 2BABA 3UNGC 3KK1B 5B0DA 4RW8A 5KFQA 3DRSA 1S4FA 1BQMA 2DNGA 5KT4A 4P7TA 1R89A 1G7CB 3CGIA 3L7PA 5HMYA 5DGBA 3OV7A 2DGWA 2U1AA 5KG1A 3LQVA 4TXSA 3PVXA 4HI2A 2FJDB 3SFGA 2BOPA 1M5OC 1C1BB 1U1RA 2RQKA 1S0NA 2X1FA 3H25A 2ZJPQ 4K4UA 3W2VB 2OO4A 1SL0A 1MNEA 4I2QB 2OP5A 1S48A 3OJUA 2QE5A 4EO8A 3GE9A 1NKCA 3OJSA 2BM1A 5KFMA 5A8WA 4PQAA 2HRUA 2XO7A 5AE3A 2J6SA 2DNZA 4DN0A 1NJXA 2QA4G 3D0HE 4O44B 3I31A 3VR1A 4B9TA 1S97A 4KE5A 1DLOA 2VFUA 4C3MA 3D1QA 1HW9A 2FVQA 1ZZFA 1HPZB 2AJ4A 2ZJRQ 3B4MA 4NYPA 2XS5A 1WACA 3NRBA 4KGMA 1RT1A 4QBUA 3GV8B 3M6WA 1FRMA 1TUVA 1ROFA 1B0VA 2EFOA 2AU0A 1HMVA 1QTMA 2R8JA 3OTBA 1DARA 3QZ7A 1KTVA 4KHPF 2ROEA 3JTOA 1FVQA 5KFTA 3O3LA 3I55S 4LQ3A 1D8ZA 4I6YA 3TVKA 1QSSA 1SKWA 2J0SD 2K2PA 2UV8A 2MQLA 4B17A 4PPZA 5GADU 5HLFA 5D78A 1JXLA 4YR3A 3PIOQ 4CNZA 4BBYA 2DH8A 3RZAA 4M63A 3T5LA 2HHPA 2KO1A 4CZCA 4K0KF 1X8DA 1R0AA 2LMIA 2LDIA 1FKPA 2QRRA 4Y2MA 2AJ0A 2RUGA 4MFBA 2IA6A 3B78A 5CYMA 4KHMA 3OL6A 2PI4A 3OR1A 1KONA 2NXUA 5GAHU 2XMKA 3MEGB 1U1PA 2HWTA 1FRKA 2AGPA 2WCXA 3ZZ0A 1TFYA 2R7QA 1EP4A 3L09A 2KG1A 5FD1A 2JVRA 3W7BA 5C25A 2IMOA 4MAKA 1KVJA 2FLLA 4OMFG 2KG0A 1NAQA 1LWCA 2KXFA 1HWLA 2EG2A 5IT0A 5KFAA 3MAQA 2RQCA 4ID5B 5B0BA 3BGUA 4EUVA 3MUTP 1NU4A 3SSQA 2RS8A 4OHWA 1LK5A 5CA5A 2IC3A 1LXJA 5K8OA 2C28A 5KFIA 3SSSA 5K9FA 4R8UB 1ZTTA 3Q8RB 2IM0A 3KLHA 4IRKA 1TL1B 3DOKB 2HLUA 3TYTA 5DG7A 3CJKB 1BY9A 2ZD1B 1S1WB 1VRTB 2VD3A 5G4DA 4TQSA 2IVYA 3QGHA 2FVPA 2QMWA 2BE2B 2RQMA 3H2VE 3IFEA 3BO2A 1R0AB 2DNRA 2VC1A 2VBXA 5L1JA 1HBUA 1S9GA 4YR2A 4ED1A 1X9MA 3CJKA 2RB7A 4NLDA 2UUCF 4ETXA 2HWIA 4IOBA 4LJMA 3BJYA 1FESA 1U24A 2HNYA 3KLGB 1R3NA 3I4HX 3TX8A 3T1YF 2WOMA 2OSRA 2B4OA 2YKOA 4ITSA 2WTFA 1XWLA 3QZ8A 3Q8PB 3UR3C 2BYCA 1K9MT 4C0BA 4EYIB 1VBZA 4AUKA 3KMQA 1AROP 3W3SA 1N34F 4C8OA 1ZAWA 4FF4A 2Y1IA 2VG7A 1SJQA 2MHEA 3AQOA 3LWMA 4DQPA 2F4VF 1F0XA 1HI0P 2CPIA 3MFHA 2VOPA 3BEGB 2YWGA 3DLBA 4ZKAA 2M4MA 2FC8A 2GMJA 2WRMA 3ZZRA 4DSIA 2O67A 2ZOFA 3SCKE 3H2UB 1XMBA 1JLGB 4E98A 2Z4PA 2NPFA 2CKWA 2UXCF 3DN9A 2C3PA 2CQCA 3HX9A 2NPIA 3EUNA 3KHRA 1YSJA 1VC6A 2R8GA 2IMWP 2O1PA 4YY3F 3N5BA 1GXLA 1L3UA 1S1VA 3LWLA 3CCVS 2K3IA 3D2WA 3RR8A 2ZH9A 2JEGA 3AA9A 1NNDA 1QAXA 2WB4A 4HVZA 1WI6A 3PX4A 5J2MB 4DL2A 2XY7A 4AXIA 2MZQA 3M2VA 4KB7A 3S1TA 3OHBA 2WOMB 3QAUA 1TKTB 3FEYB 2YNGA 4PKDB 3E01B 4KV8A 5J2MA 1JWWA 2WW8A 5DO2A 1KQFB 4KSEB 5C24B 4NCBA 1DQ8A 1URNA 3GWCA 2DHXA 4RWXA 2KT2A 5EN1A 4XAKA 2MKSA 1FTCA 2W9CA 5F8IA 3QGPA 4CO5A 3CF5Q 3C6TA 4ED0A 4F02A 2H5EA 3H98A 2W8KA 1JJ2R 4KRWA 1JNRB 3OUYB 2OFHX 3CUNA 2MSSA 4RW4A 5HMWA 5E3QA 2HLTA 1ULRA 1QVGR 2B3TB 4U67Q 2YVSA 5EUHA 2E1RA 2KM8B 2E7WA 1JLAB 3QO9A 3H8YA 3O2IA 1URRA 5HP1A 2YQ3A 1FRJA 2BJDA 3MURP 4I7FA 3FNNA 2PA3A 3IC1A 4QWDA 3T19A 5A8KA 4LVNP 2VPYB 4F67A 3C8YA 1U1QA 1ZH5A 4J9NA 2VODA 1G6BA 3HHDA 4FXVA 3N4WA 3IWXA 1RAJA 3J7ZT 1SJ4P 1X4AA 5CCLA 4IH7A 5HMXA 1YJRA 3JTPA 2E5HA 3FSXA 3AH6A 4QJVA 4J9QA 2V94A 3MMBB 1G1XA 1KLMB 2RRBA 2OSQA 1SJRA 1MWYA 3DLGB 4WFAQ 2R2SA 1UFLA 2VQEF 4LF4F 2XMMA 1REVB 3AB2B 4PG8A 2LDYA 4AL7A 1FHTA 3UWTA 2COLA 3CD6S 4URQU 2W9CB 2ZC4A 3FRYA 2QIFA 4ZP6A 3I0SB 5FLXY 2ALZA 2EW9A 4RNNA 2XG8A 1JLBB 4DHVA 5L38A 1XNRF 1T03A 4X4VA 1HYSA 3D1OA 3HM9A 4WZQA 1C1CA 2ZHAA 4BS2A 1Y0HA 1R27B 4JUZA 2BUNA 4IQXA 2V8DA 2IVFB 1C1BA 1WELA 3FJ2A 5HMZA 4A8XA 5LXYA 2KXNB 3W2VA 3M8PB 4Q44A 3UE2A 1KVIA 3BGRB 1FKPB 5HBMA 3IR5B 1C4AA 2I5JB 3KNAA 3G8TA 2J6UA 3H5YA 1UETA 3MPWA 2DJWA 5CYQB 4WIIA 3HPOA 2HPUA 2DNQA 1Z4UA 4NPOA 4TY8B 1IN0A 4O23A 3OSPA 1RGVA 2UV8G 1CC7A 4RNMA 1F5AA 4CQ1A 1LWEB 4YB1P 1DLOB 4A8OA 4DX8H 4USHA 3GYXB 5MLCV 4K2XA 5D3GA 5T41A 3LF0A 3LP0B 1JLGA 1HNXF 3MECA 4CO0A 5KT7A 4ELTA 5K14B 1KN6A 4ILMA 2R8KA 1DTQA 3T5KA 2J9DA 1XMOF 1N5QA 5KFOA 2ZH7A 4DUZF 3RAQA 3N01A 2WBMA 2KFYA 2E1AA 2R2TA 2KRBA 3KJVB 2DRBA 3UCGA 2DCLA 5DJBA 1JKHA 1PC4A 4LSNB 1TAUA 2D1CA 2CQIA 2WBRA 2ILYA 2DNOA 3PEHA 4LF7F 4DPOA 1HL6A 2LVWA 4RU9A 1FT8A 4JI5F 1UVJA 1UA0A 3HJFA 2ZUGA 1XN9A 4A8MP 4ZMMA 5KFHA 3MM7B 2DPJA 4QWEA 2PC6A 1X7VA 1N5VA 2HNDB 1FNOA 2YKPA 4FS1A 2LXUA 3CEDA 5T7LA 1DBDA 4C4WA 2CQ2A 1KHVA 5L9XA 2MKKA 2OKQA 5C42B 1YIJS 3CVKA 1UA1A 4JV1A 3BGFA 1UJ5A 3R3TA 3V6HA 4L6V3 2IAJA 3LH2S 3BN7A 5SZTA 4ECZA 4LIRA 2M2BA 2FHOB 2Y1RI 4DFKA 1RT5B 2W8LA 2Q6BA 2MGZB 3NLCA 2PFFB 2EI5A 2IAJB 3RRGA 5E3AA 3U27A 2YWFA 3HHEA 1IUJA 5IT4A 2LQBA 4DDFA 4C8NA 2PI5A 1J2VA 2RJZA 5AE1A 4CNYA 4B3OB 3BSAA 3R27A 1S1TA 2JX2A 5L1KA 2LQ9A 4TYBA 4F8RA 3PIPQ 3GMGA 3V6DA 2X3GA 2FVRA 1VQ6S 2FVCA 1Q1KA 2XCPA 5HLFB 2VA2A 3EGZA 3TR5A 3CCES 1TKTA 2CVIA 2F8EX 3B4DA 2D3OR 2IA0A 2IRYA 1B64A 4FS2A 4ZHRB 1CG2A 2J0XA 4RUCA 2VUGA 5B0GA 4QW9A 1FJGF 1VOMA 2KKHA 2ZDPA 1N48A 2ZZMA 4C8ZA 1LQ9A 1V6HA 2R2RA 5L8RC 2VPWB 2JJ4D 4RW8B 2D3UA 1Y4ZB 4G1IA 1NB7A