2GO9A

Rrm domains 1 and 2 of prp24 from s. cerevisiae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
161
structure length
161
Chain Sequence
MRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKKNFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHLTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and interactions of the first three RNA recognition motifs of splicing factor prp24.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U4/U6 snRNA-associated splicing factor PRP24
total genus 32
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2006-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2go9A02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2go9A01
2LA4A 1HA1A 2F9JA 2OSRA 2YTCA 2FC8A 4YOEA 2MQLA 1WF1A 1H2TZ 2DO4A 4TLQA 4ERDA 1D8ZA 2F3JA 2M4MA 2OJ3A 2L41A 2MQOA 5IFMA 3CCES 2BZ2A 2MZ1A 2KG0A 3G6ES 2CQBA 2JX2A 2CQ0A 1P1TA 3RW7A 1VQ4S 4TU7A 4IOCQ 2KXFA 1X5OA 2E5HA 1X4AA 2MSTA 1SXLA 1U1QA 3G71S 2J8AA 3HI9A 1X4CA 2ZJRQ 1KQSR 1UFWA 1SJRA 2DITA 3R27A 2M70A 1RKJA 4W92B 2ERRA 4F02A 2XB2D 2XNRA 3VF0B 2MPUA 1FJ7A 2RRBA 3JB9k 3UCUP 3MOJB 1M90T 3P5TL 3CCLS 1JMTA 1FT8A 3L3CA 2ADCA 2CPFA 5LJ5Y 3VAHA 1U1LA 2I38A 3UD3P 2E5IA 2DH8A 2CQCA 2HGLA 2DNMA 2DNYA 1FO1A 3BEGB 4Y00A 4P6QA 5HO4A 5LJ3Y 2X1GA 1VC5A 3HHNB 2FPHX 4F25A 2DNLA 1X4FA 1SJQA 3G8SA 2DGSA 3CCMS 2MSSA 3VAMA 1VQMS 3CULA 2CJKA 4TU9A 3MI7X 3MD1A 2YH0A 3I56S 2DNQA 1URNA 2KVIA 2MQQA 2KXNB 2RS2A 2RQ4A 2KH9A 3J7YU 2DB1A 1WI6A 2CPDA 2E5GA 3NS5A 5LSLA 1VQ5S 1WF0A 3N9UC 2AD9A 3G96A 2CPYA 3CC2S 1H6KX 4F26A 2DH9A 2RQCA 1H2UX 2GO9A 2MY7A 4QU7A 3CMAS 2MB0B 3CMES 2X1FA 2MKHA 2VOOA 1YTYA 2HZCA 5H1SV 2J0QD 1KD1T 2DHGA 3EGZA 2OTJS 1M5PC 5LXRA 2Q79A 2LA6A 1XN9A 2CPJA 4WCEQ 1OO0B 2DNNA 1N88A 2FY1A 1ZH5A 2YH1A 1PGZA 2M8DB 3VAFA 3VAKA 1ZZNA 4WIIA 2JWNA 5MLCV 2E44A 2XS2A 2DNGA 4WFBQ 1Q81T 2VONA 2HGNA 2OTLS 2JVRA 3U1MA 1SJFA 2LMIA 1HD1A 1OPIA 3UCZP 3R1LA 1N54B 2AYBA 3Q2TC 2KI2A 2KFYA 2LEBA 5FJ4A 2VODA 4ED5A 1FJCA 2DIVA 3CUNA 3RW6A 4WF9Q 1K9MT 2CQPA 1WWHA 1X4DA 3DLLQ 2BOPA 3NNAA 3CD6S 2MMYA 3S6EA 3LQVA 5GVQA 2XNQA 5GADU 2UP1A 5DETA 3BO4A 2KRRA 3VAGA 1WHXA 4QPTA 2X1AA 2M8HA 1KOHA 3THTA 3MXHP 2I2YA 2LQ5A 1WTBA 4ZKAA 4C7QA 3U1LA 3PIPQ 2DK2A 3UWTA 2CQGA 2FC9A 1WI8A 1YIJS 1VQNS 1WHVA 1WHYA 2M0GB 2DGXA 4LJMA 1X5SA 1WF2A 2XSFA 3VAIA 1HL6A 1X5TA 2M52A 3MDFA 1YJNS 2U1AA 4BS2A 1JJ2R 5CXTA 2LXUA 1OWXA 3SDEA 3CCVS 5DM7Q 1PO6A 2LXIA 2MKCA 4CH1A 1M5OC 2ZJQQ 3CCJS 2OSQA 2N7CA 3BS9A 4CQ1A 4LIRA 1VBYA 1R8HA 5D77A 1AUDA 3P6YC 2MGZB 2CQ4A 4WFNQ 2KM8C 2X1BA 2QA4S 3ZZYA 2WBRA 1KOOA 1H2VZ 4OZ0A 3THPA 2DGWA 1VC6A 4Z2XA 1X4BA 3J7ZT 1VQKS 4UY8T 3H2VE 2D9PA 3CCUS 2CPHA 2NZ4A 1DBDA 2MQNA 4FXVA 2EK6A 5JVGQ 2QFJA 2A3JA 1VC0A 5GMKa 3MUMP 4UQTA 5GAHU 4OZ1A 5DDQC 3SDEB 1VQOS 2D9OA 1X0FA 4IO9Q 2GHPA 2G0CA 3TO8A 2DHXA 1WELA 2N3LA 2SXLA 3V4MA 2CQHA 2MY8A 3TYTA 1Q7YT 1OIAA 2MZQA 5DM6Q 2HGMA 4QU6A 2MKKA 1NO8A 1R8PA 3CPWR 1WG5A 5IM0B 3R1HA 1DRZA 2M2BA 1QVGR 5D78A 2AYGA 1WEYA 2EVZA 2DNHA 3I55S 3LPYA 2CPEA 1N52B 3CCRS 2LECA 2D3OR 3IRWP 2MKSA 2MZSA 2DGVA 2K3KA 4RU2A 2JRSA 3FEXB 2QEXS 1U1PA 2N82B 1BY9A 2E5JA 2EK1A 1O0PA 3VALA 1VQ7S 2KG1A 1YJWS 3B4MA 2CPZA 1X4EA 4WKRA 1NJIT 2M7SA 3Q2SC 3P49B 1Q86T 1WEXA 5GAEU 2MGZA 1K8AT 2MZJA 2CPXA 2KU7A 1U6FA 1L3KA 3UD4P 4PRFA 3DXBA 4J5OA 2G1DA 3CXCR 1M1KT 2LEAA 3K0JA 5CYJA 3FEYB 5JVHQ 1FXLA 2DNPA 1W2BR 2PEHA 2DIUA 1UAWA 4PR6A 3EGNA 4FXWA 2CPIA 1UP1A 2MQMA 1X5PA 1A7GE 1K73T 3S01A 1FJEB 1M5KC 2DHAA 5DDRC 1NU4A 4W90B 1WG1A 1U1RA 3NMRA 2NLWA 2DGOA 2LYVA 1X4HA 2CQ2A 2KHCA 3OW2R 1B7FA 2B0GA 1G2EA 2MJNA 4QQBA 2F9DA 5CA5A 2YKAA 5DDOC 1KC8T 2KN4A 2DISA 5HL7Q 1VQ6S 1VQ8S 3B4DA 2HVZA 2MHNA 2MZTA 2YWKA 3D2WA 1S72S 3H2UB 1SJ3P 1CVJA 2CQIA 2L08A 4LMZA 5DDPC 2DNZA 2RUGA 2MKIA 4CIOA 1YWXA 2ZJPQ 2DGQA 2K8GA 1F9FA 4WFAQ 4YB1P 1VQ9S 2CQDA 2XS5A 4IOAQ 3G8TA 2MYFA 2RVJA 2FHOB 3G4SS 3IWNC 2MQPA 3NS6A 3BO3A 1U1OA 1FNXH 1SJ4P 2U2FA 1U1KA 3CC4S 1IQTA 4PKDB 2M88A 2KXHA 3MURP 4C4WA 4TU8A 2DNOA 2MXYA 2V94A 3P3DA 2CQ1A 2DNRA 2RU3A 2J0SD 1UW4A 1U1MA 3TP2A 1YJ9S 3MD3A 2RNEA 3CC7S 2JVOA 4YUDA 1YITS 2ADBA 3ULHA 4U67Q 2KM8B 2DO0A 3S7RA 1N8RT 2XS7A 5IQQA 1YI2S 2DHSA 3MUVP 5ITHA 3NNCA 1JJ4A 3US5A 2AYMA 2AYEA 1DZ5A 1QVFR 1Q82T 1WEZA 5BJRA 5GAGU 2KRBA 2PE8A 2L9WA 1YHQS 1P27B 5IM0A 5EN1A 2HYIB 3ZZZA 5LSOA 1HD0A 2RT3A 2RRAA 2KYXA 1DHMA 2DH7A 1S79A 3UCGA 1U1NA 1A9NB 2O3DA 2J76E 1RK8A 2CQ3A 1QM9A 1FHTA 1JJHA 3NNHA 3SMZA 1VBXA 2OIHA 1WG4A 2KT5A 1ZZFA 3VAJA 1D9AA 1U2FA 3BO2A 4A8XA 3CF5Q 3CCQS 3MUTP 2LCWA 4C0OC 3PIOQ 3S8SA 4V19X 1WHWA 2MZRA 4CH0S 4IUFA 2MKJA 4EGLA 3G9CA 1U6BA 1M5VC 4Y0FA 3CCSS 3EX7B 4M5DB 1VQPS 2MJUA 1VQLS 1X4GA 2RS8A 2G4BA 3UE2A 2VOPA 5LXYA 2LKZA 3CTRA 2N3OA 1VBZA 2DNKA 2DGUA 2DGTA 3SXLA 2M9KA
chains in the Genus database with same CATH superfamily
4R5PA 1HA1A 1S4FA 2F9JA 2EG2A 2OSRA 4P7TA 2R2UA 3SYZA 4IRKA 3UI3A 3VVUA 4ECUA 3I9V9 1HNXJ 2FC8A 3QMQA 3V4IA 1F0XA 3KUHA 1RCOB 4H4MA 3RB0A 1AZSA 3JSMA 3QFHA 3Q0AA 2DO4A 3MWBA 2B4UA 2XMJA 4F2RA 1RT6A 1R6YA 5A8WB 1R7IA 3SSRA 4WFYA 2Y1RI 1S1XB 4DQIA 2ZBRA 3GSIA 2E29A 2BACA 2L41A 4ZJOA 2C2DA 1W26A 2AJ2A 2R7SA 1CS4B 3K5NA 4NLPA 5HVHA 2BZ2A 1XWLA 2QIFA 2HNDB 4O3QA 1GMUA 2JX2A 1YG0A 2FZKB 3DRRA 4R25A 1IBKF 1NB2A 2CQ0A 4AT1B 1P1TA 4ZVOB 1L3TA 1Y7PA 1VQ4S 1YZ6A 1YK9A 4LF9F 3LAMA 1RU1A 4IOCQ 1E6VA 2KXFA 2VH7A 2FZCB 3RB3A 4IFYA 4NYPA 1X5OA 1SC3B 3D0HE 4HYKA 1HFEL 4KQZA 3QATA 3IO1A 5LM7E 5KFAA 4DZDA 2CWKA 4USJC 1RTJA 1QE1A 1JLAA 1OQ3A 1RT4A 1WC1A 3ET6A 2YKMA 2DT9A 3WC0A 3ZZ0A 4EMDA 3AJDA 2B9XA 4ECTA 2ZHBA 1TP7A 2QSWA 4C3LA 2HNYB 5CYQA 2ZKTA 4JI5J 2ZJRQ 3MCOA 1Y4ZB 2E1MC 1FRXA 2DITA 1ZYQA 4HHJA 2DKOB 6AT1B 2XY6A 2E1RA 2IC3A 2ZDOA 3KK3B 1FJ7A 4ECVA 3JB9k 1P9YA 2WZ1A 2DPIA 3NG8A 1FWKA 2B9YA 4YS2A 5C24B 3H90A 4QWCA 1M90T 3A3NB 3GJTB 1TTHB 3W64A 4EUVA 4F0MA 1RYSA 4P73A 1HNVA 1NEEA 2C2OB 1FKOB 3M32B 2CRLA 2EFPA 1FT8A 3OFFA 3R7NB 2XLIA 2XULA 1A6LA 2ADCA 2KZMA 3HF5A 1FVSA 2CPFA 4HDGA 2JEJA 4LF7J 4MYTA 2F40A 2XLKA 5F3TA 2FVRA 4RWXA 2BW7A 2QTWA 4XAKA 4EU0A 3D3BJ 2K2PA 4C0HA 3HSGA 5K8PA 1E6VB 2DNMA 1FO1A 3RBXA 2PFDA 2RHQB 5IV4A 4P6QA 4N56A 4MIWA 1RP5A 2AZ1A 1VC5A 3KLFB 4HDHA 4K4YA 3QRRA 1CJTB 3GYXB 3W5YA 1XC9A 1X4FA 3IR6B 4CLWA 3PYFA 3CWJA 5AXKA 3VAMA 4JUZA 3ET6B 5KG6A 4N76A 4ZVRB 2Y8WA 5F0UA 2CJKA 2YH0A 3OJSA 4B3SF 4DPWA 5L1JA 4O3RA 1LV5A 4OJ1A 2MDAA 1JLQA 1HWUA 4PG5A 1X31C 4R5PB 4I1TA 1P6TA 3KG0A 3OVBA 1K1QA 3UFCX 5LSLA 4X4QA 3OSPA 1FCAA 3CGIA 1NJWA 4I68A 4UTGA 1GX5A 4XPEA 1HBNB 3EE3A 3D68A 3IR7B 5G0RB 1C1CA 3TI0A 2RILA 1NK7A 2F63A 4I64A 2HHWA 1PSDA 1VBKA 1H6KX 1RAOA 1X8DA 3BH6B 4F50A 1TFWA 1RWKB 4IOBA 1NJZA 1FXLA 4ETZA 2OD4A 3M6XA 4QR0A 2GO9A 2NCKL 3JS9A 4XDDA 4KGXB 2HHQA 3HLUA 3LA0A 4FZVA 3CMES 2OFGX 2AJFE 2OUGA 3EUNA 4FF2A 2YWHA 3EYZA 4CYUB 4I2PB 2HZCA 1YVFA 2PGCA 1J5OB 1D9FA 3DU5A 3EGZA 1Z2ZA 1QAYA 3ZC4A 5CYMB 1M5PC 3AB4B 1TFYA 1RBOB 1XN9A 1IBMF 4WCEQ 3UDCA 1HI0P 4J9OA 3HJVA 1BHNA 1T02A 2DNNA 4DPOA 4YY3F 1WJ9A 5K5MA 1ZH5A 2NXUA 2GX8A 3E3XA 1IKWB 2G0JA 5AJ3J 5T41A 4CLZA 4DV5J 1T03A 2JEFA 2D7SA 2E1PA 4M5MA 1HPZA 1PBUA 2JWNA 2L9NA 1WSRA 4DV0J 1N36J 2VONA 2HQCA 1GH8A 4B3MF 1NK8A 4ILLA 1RTJB 4PG4A 4ZLPA 2JVRA 3I5AA 2VL1A 3NLCA 4L73A 5D0HA 4DQQA 3DRXA 4IQXA 2H4YB 4AFFA 3D1HA 2VJVA 1VRQC 3V6HA 1TK8A 1S0OA 1VHIA 3EPGA 4M5GA 1OPIA 5KFBA 3FZBA 3ITHA 4F4WA 4NCGA 1NNDA 2FVPA 1N54B 4LF8J 4P2FA 3TUJC 3MAHA 4ZDNA 1G3OA 3OL8A 2AZ3A 4OI1A 2LEBA 1H7WA 4DL2A 1KS2A 3OHAA 2VODA 2IM2A 5A0YB 4KH0B 5L38A 3RW6A 1H38A 4CO2A 1IVZA 1CJVB 2EKNA 1ZTTA 1S99A 1FXRA 1QY7A 1OMSA 2GS8A 2MMYA 3LQVA 1S48A 3OR2A 4JBCA 2CNKB 4HKQA 2RQKA 3E01B 3MMCA 3SEOA 5KG1A 3T5JA 3HO1A 2Y1JA 1U49A 5DQHA 2RDDA 3IM8A 1PIEA 3JTNA 1JKHA 1JLEA 4O0NA 2UXCJ 3BO4A 1TKXA 3MR7A 4PG6A 1ZM4A 4LIWA 4UOCA 4L74A 5B0GA 3NAIA 4MFBA 1HW9A 3QJLA 1IKYB 2B5JA 2JFDA 4QPTA 3MR2A 4B3TF 4LF6F 1W25A 3FRYA 3JSRA 2KT3A 1P1LA 1KOHA 1Q7LB 2VFUA 2EWHA 4NLYA 3E51A 4PXEA 1KTQA 3OLBA 2I2YA 5KFLA 1URRA 3WX8A 3WBZA 3CVKA 4ED4A 1WORA 3U1LA 4C7QA 3PEJA 4DU8A 3AODA 1SL1A 5HROB 2DK2A 1VQNS 2UUAF 2XWXA 3OL6A 4FS2A 2C3UA 4LJMA 4NASA 2ZH3A 1RT7B 1WF2A 4ZCMA 3VVTA 3IBWA 2JEGA 1K0VA 5EWEA 6FDRA 2FJAB 3GJSB 2CJAA 3BKTA 4DSEA 3MEGB 3MDFA 4BS2A 2U1AA 4ED2A 4C9DA 4WXOA 2DXEA 1RBAA 2NSBA 2X3DA 3MPUB 1OWXA 4F2SA 3CCVS 5DM7Q 2DJWA 4QPXA 1PO6A 1VK3A 2EXUA 4HR2A 4CH1A 3UN2A 3P4UB 4DSLA 1URNA 1DQ8A 1P9QC 2J9DE 4Q45A 1OY8A 2HBZB 2GFFA 1UA1A 1SVDA 2GQ2A 2VDHA 4ZIVA 4RJVA 3NP5A 2DEJA 3TX8A 1KLMB 1GT8A 5L1KA 1B3TA 5D77A 3P6YC 2XY7A 4X64J 2CQ4A 4QIEA 2FVSA 1IBMJ 2LFVA 4W98A 2HRTA 1JKHB 2X1BA 2K1RB 1S7IA 1XNRJ 2A6MA 1NPPA 2WBRA 1F5AA 1H2VZ 3LGNA 3T1YJ 4KGMA 1XK8A 2UVWA 1SV5B 4OJHA 2NUUG 3KHHA 2VQFF 4UUXA 3U27A 4RNMA 1R27B 1OY9A 1Q8LA 3H2VE 1B64A 2F5GA 2FZGB 4Q43A 5IZHA 4NLOA 5E41A 2ACYA 2OPQB 2NZ4A 1MN7A 4DSKA 1DBDA 3DMJA 4Y2CA 3MEKA 4USMA 4NL5A 5EWGA 2BJ8A 1FDNA 3IP0A 3NCPA 1HIYA 2PO4A 1HARA 3C16B 2ZH8A 1VC0A 3M9OB 3MUMP 2B7BB 2YNFA 3B8HA 3QGGA 1U0SA 4WU2A 3EGWB 3M8QA 3TWZA 5AXLA 4E0DA 2AWZA 4QIVA 5E7OB 3MM7B 4B08A 3HVRA 2CG4A 2P8IA 2CFXA 3IGNA 4TVAB 3TZXA 5AJ3F 2RMLA 4ZVTB 3TZWA 2GHPA 4AXJA 3FMBA 2GHVC 3KDOA 3QT7A 2W25A 2C1EB 1Q0NA 1WELA 1XJWB 2DHXA 5E3CA 4B9NA 4KC5A 4ZPCA 1KRPA 1DQAA 1T05A 4JI3J 5DM6Q 2MZQA 3QFWA 1RAFB 4IG0A 1TMMA 2W9BB 2AEJA 1YSJA 4ZITA 1R8PA 2W2OP 3CPWR 4DFKA 1YLXA 3FGVA 1WG5A 2YKNB 3TNVA 2ATLA 3CD0A 2W9CB 1L3SA 4PWDA 5BR8F 1QVGR 1RTHB 2QLBB 3BN7A 1S6PB 4WTOB 2PDAA 3CJ5A 4IFVA 1RA7A 2DNHA 3I55S 2UUBJ 3LPYA 3LALA 4PQAA 4DZ6A 1RAGB 1T11A 2L48A 3GWCA 2C3OA 2B5JB 4C8NA 3DFEA 3KJFB 1RHRB 3QRPA 9RUBA 3FEXB 2WCXA 3MAAA 3QIDA 2N82B 4PWWA 4J9RA 2E5JA 3NMAA 4WXWA 4CI0B 3NCRA 3SQGB 1S9GA 3RBDA 1AFJA 2CPZA 1X4EA 5SZTA 3HM9A 3ADAC 2KJWA 1NJIT 1ZAXA 1VDHA 2IJRA 4YB7A 2FJWA 2FJVA 1CULB 3OQ2A 3PVXA 1UVIA 2PI5A 3GFZA 2C3PA 2DBBA 3AHPA 1NLKL 3UR3C 1Q86T 3A1YG 3BB5A 2Z58B 3D54A 3SV4A 3AJ2A 1K8AT 4AD6A 4EYHB 1BE4A 2Y8YA 2X3GA 1L3KA 3QWUA 5D4NA 3DRSB 3RUBL 4CO4A 4DX7A 2G1DA 5T14A 2R7WA 1ZTWA 2DPJA 1OYEA 3NKYA 3QLHB 4I0WA 1FDAA 3ZZTA 3FEYB 1N5YA 2VG7B 2WB1D 3DRYA 3A8IA 3MECA 3NEKA 4LR9A 2PEHA 2DIUA 3F56A 2ZC3A 2C2KB 3CJ0A 4PR6A 4R8UA 4LF5F 4C4WA 1S1UB 4C48A 2MQMA 2JLGA 4NZ6A 2YKNA 3PRVA 4C11B 1A7GE 1AXQA 3J7AN 1QAXA 2WBMA 3DXSX 3S01A 3TA0A 1K73T 1S9FA 2DHAA 1N33J 3GR0A 5F9LA 1RU2A 3CCZA 4AQYJ 4W90B 2R2RA 4PYDA 1U1RA 2HURA 5LMUF 2B4OA 2E7XA 4FPRA 3K57A 4IDKB 2XYGB 2DGOA 3H40A 3GIKA 3R5GA 4H4OB 4FF4A 3RB4A 1Y3KA 4LF4F 4M8LA 2ALZA 1VRTB 2EFNA 1PAEX 2HSEB 4Y3CA 2X1AA 4DS4A 1V6HA 2E1CA 1R8BA 1MN9A 2W01A 4MMOA 4UY85 4B3RF 5CA5A 4ANCA 3QWPA 2YKAA 3DDKA 3TAQA 1DTTA 3HHLB 1NSAA 5D4OA 3VV2B 4DX5A 2OPQA 2KN4A 2XO6A 5HL7Q 4NXMJ 3LP2B 4P75A 2HHSA 2HNDA 2BANB 1XNRF 3V6KA 4NOHA 1YRTA 3I96A 4K4WA 3A8JA 1Z2LA 4UT4A 4DV4F 4DR5F 1VQ8S 1QD1A 2MHNA 4JI2J 2H3EB 2YNFB 3OVSA 4NEZA 2AEMA 1S72S 1RWWB 4OQJA 4UQGA 1CVJA 2L08A 1FF2A 2ZH6A 4DS5A 3PYGA 3TJ9A 4XIUA 2NZCA 4ZP8A 1O51A 2RUGA 4KO0B 2ZOMA 1UCNA 1U09A 3M30A 4KKOA 3W2WB 5IT9Y 5FDLB 4O44A 1Z1ZA 4B9MA 3AOAA 4C11A 1AW0A 3BR8A 2AJ4A 1FWPA 1MROA 1UFKA 2OPPB 4OZLA 5CH7B 4YB1P 1IUJA 1JB0C 3V6DB 4QW9A 1FE4A 2I1RA 2MYFA 3M8SA 3UDVA 1YBTA 3VZIA 4DFPA 1K1SA 2CWXA 4L6V3 4B3RJ 2RUSA 2X51A 3IWNC 3NS6A 1MWZA 4DN9A 4NCBA 4RNFA 2W9CA 2AIRB 2VQEF 1FNXH 1IBCB 1T0TV 2ZHOA 1UWBA 3M7VA 2G9OA 2FYXA 3C14B 1NM2A 2GMHA 1YJUA 2M88A 2KXHA 3PHEA 3PHTA 3BM7A 2VKRA 3FCHA 4AE5A 3GG0A 3ILJA 3M2VB 5JXSA 2MXYA 4BWJA 2J0SD 1AT1B 1RKIA 2HQGA 1YJ9S 1G7CB 2HQ3A 3HVAA 1R8AA 3MD3A 4MIAA 5LMNJ 2RNEA 2Z8QA 2P9GA 4K0KJ 3NGTA 4ICLA 2JVOA 3SCKE 5KT6A 1VIXA 4Y2IA 5BR8J 3D0GE 3ULHA 1YITS 5C2GA 4GKJF 1RSCA 2B6AA 4RUBA 4DV3F 7AT1B 1F60B 2E9RX 4G3IA 3FCVA 1NMEB 4X62F 1I94F 3DOMA 5J2PB 3TANA 5H9FK 2GVDB 1FVQA 1QTNB 4QIWD 1U8WA 2DRBA 2PN6A 2RH3A 5E5NA 2IA0A 4DOZA 3GP9A 1KQKA 3US5A 4I2QB 3W63A 4F4ZA 3I32A 3OUYA 2QMUB 3OFEA 3OL7A 1FDDA 2J6TA 2JFKA 5J2NA 4B9LA 3SIPB 2Y1IA 2B4VA 2O1PA 1EIYB 4OI0A 1TQLA 1U24A 5GAGU 1FTRA 8AT1B 2ZD1A 2Z0GA 3ZXWA 5HQ8A 4DR2J 1T8EA 2OI2A 4I67A 1RTDA 2XMKA 4IH6A 1YX2A 3QQCD 5EWFA 1GXTA 3O1LA 2RT3A 3KUEA 2KYXA 1RGVA 3B82A 1DHMA 4NA3A 4JI4J 4O3SA 4AXIA 1XIQA 2HWIA 2BM1A 3GIIA 4ZPAA 2QYGA 3J81Y 4EK2A 2GC8A 1RYRA 1WKKA 2CJYB 1C1CB 1VJWA 3IS9B 1UETA 3JQKA 5A6PA 1MNEA 1N34F 1NSKL 3D67A 3M2VA 2EFGA 4H4OA 5ETVA 3NNHA 1M5SA 4HI1A 1WG4A 2OIHA 3EM1A 2M3DA 4I6YA 2DEIA 4GO5X 5KFRA 2ZZMA 4K2XA 2BKPA 1TKZB 1WKJA 3T3FA 1FKPA 1LXJA 1D9AA 4Y65A 3PW4A 1ICEB 2OO4A 1EKRA 3CCQS 2HHVA 4KBIA 3W2VA 2IBOA 2HAFA 2NREA 2VU5A 3ZTPA 3PIOQ 2HLTA 3DGPA 3NXZA 3RZAA 2HMIB 3N6LA 2RAQA 3OVAA 2QZ8A 1BMQB 3QAEA 4DMZA 3IBFB 4CZCA 3G9CA 2XCAA 1U6BA 3PYEA 1CQNA 1EQMA 1R3NA 4I2QA 4X62J 3EDRB 4K4XA 2JDJA 2XMVA 3DCAA 1NCLA 1RWOB 1H73A 1VS3A 4RUCA 2CVIA 5J2NB 2VPXB 5CD4H 2G4BA 1S4EA 2AF6A 3W2WA 5HK4A 5D3GA 3D66A 3R5CA 2V5HG 4NLQA 4USIA 3D6TB 1RAJA 5KFIA 5LT5A 2DNKA 4IKAA 3BPSP 4CLTA 5J1EA 2WAQD 3CDWA 2OPPA 1LXNA 2LA4A 5FLXU 1H0HB 3SV3A 2ILYA 4FVMA 4KR0B 3QJPA 4ZCLA 2RQMA 5KT7A 4IRDA 1WF1A 1H2TZ 4DR4F 3LAKA 1LWXA 4ZPWR 2DTJA 5U47A 4ERDA 4EBEA 2NQPA 3MM6A 2OJ3A 2IJNA 1TL3B 3KG4A 1Y3JA 2IYGA 2J7KA 2OPRB 3OFHA 5B0BA 5L9NA 2X7IA 3DLHA 5KFUA 4DL7A 2PMZD 2WSCC 4YDDB 4Y2KA 1LOUA 1UMJA 5H9EJ 5JMNA 3W2VB 3F0NA 2R7VA 3NGRA 3GIMA 1NDCA 1RI7A 2PA8D 3DU6A 1CJUB 1WTFA 1BD6A 1FA0A 3RW7A 2GHWA 1Y0HA 2HMIA 2XZTB 1UPPA 3SQOP 4DV1J 1NK0A 1HMVA 2V9KA 4TU7A 4JI0F 4WFZA 4H4KA 1N33F 1SI9A 5E3RA 5HQMA 1UA0A 5GADI 4F3QA 1BWEA 4NLGA 3C6TB 2NYIA 1NXIA 3T9ZA 2C22A 1KFSA 1U1QA 2BEFA 2IDEA 4RZRA 5GAHI 2XMWA 1SL0A 2C2NA 2J8AA 4M1KA 4RL1A 4K8RA 4CH7A 4RU9A 1ITPA 2YNHB 2O01C 2D3O1 1VMBA 3IAS9 1R43A 2QV6A 1HBOB 4QWBA 2QG9B 5DG9A 4ELTA 2CJBA 3B78A 3UN5A 5HMZA 4XPCA 1V3SA 5DLFA 4KTQA 5ETMA 4WFXA 4QYZJ 2I5JA 2M70A 2LQBA 3BN4A 3MM8B 4HI2A 2E66A 5DQGA 1UVMA 4U8YA 2BA9A 1WOPA 2IJFA 2LDYA 5ETRA 3RRHA 3M2RB 4F02A 3FBCA 3VF0B 3K2YA 5DQIA 2RRBA 3H0PA 3NOCA 4UF4A 1ROFA 2CA9A 5H9EK 1FRMA 2FHKA 3DC2A 1IR2A 1S12A 4KGKA 1V5VA 4I56A 4WWSA 4ZS6A 5LOQA 3QZ7A 2XO7A 1IKVB 2NPIA 5KFKA 4KHPF 1BXNA 4TN2A 1SJ1A 2IM1A 2JL9A 3CEDA 1Q5YA 2R8HA 1PBAA 2ASYA 2BQRA 2PMHA 5AXMA 1UZHA 1SQFA 2GJIA 3L3CA 1U2RA 3BGRA 5LJ5Y 3I4HX 5EDWA 4K50A 2I38A 1MLAA 3UD3P 1HYSB 2V8DA 2OPSB 3AD7C 2DH8A 4HTJA 1CS4A 3FJ2A 1HBUB 3GCXP 4OYXA 3LTOA 5IWAJ 3LWLA 4LF1A 2VIHA 1T7PA 1PYTA 2DNYA 2UUAJ 1UZDA 4DPUA 3ENAA 5LJ3Y 2X1GA 1G4CA 9ATCB 2FJDB 2QT7A 3PW5A 2XS2A 1PYOB 3HHNB 4F25A 3C6TA 1VQMS 2UZAA 2DGSA 4WE1B 1B7FA 2HVEA 2KO1A 3CULA 5B0FA 1CLFA 3DMJB 3HT3A 3MI7X 1NH8A 3UVJB 5L9XA 3W9HA 2KXNB 2RS2A 1S0VA 2J9EA 3HVTB 2WK4A 2KH9A 3J7YU 2PEBA 4EO8A 2E5GA 2CPDA 1I6JA 1B70B 5HP1B 2CDQA 1VQ5S 2GZOA 1WF0A 1EJ7L 3TJ8A 4BHQA 1SH2A 2HPUA 1O6XA 2GQCA 1FX4A 3L09A 3N9UC 4KY3A 4IO1A 4DV7J 2DY9A 2W4PA 2AD9A 3W5XA 1N32J 4I6AA 3MPVA 5HMWA 2D3ZA 4DQSA 4F26A 4LF5J 3D6HB 5B0AA 2EFVA 4IRCA 2DR6A 1I3OB 2B43A 1PYSB 2EBGA 4OLPA 4D3HA 2HEKA 1YJVA 3BBFA 3FC9A 2X1FA 2VOOA 4JB8B 1JNRB 3QSYB 4OHYA 4NPOA 1Q79A 1FK9B 3OFGA 4JV5J 3QSIA 4ZLNA 1S9EB 3ENWA 1SCJB 2V69A 3BDPA 3BSAA 3ZFVA 1GFWB 3TAMA 2OTJS 1RT4B 1JLBA 2H65B 2A10A 2Q79A 2LA6A 2YNIB 4LSLA 3SSSA 4LF4J 2IRXA 5CABA 2MHEA 1N88A 1I5OB 4LVOP 1HMVB 1PKUA 3GYGA 4MYUA 4QYRA 2FJBB 1RHKB 2HK2A 3GG1A 1PGZA 4TY8B 2ZH1A 4FN5A 3VAKA 2E44A 3R9LA 1FFWB 3UNGC 4TY9A 3SSQA 4AL6A 1S1TB 2G2YA 4WFBQ 2E1AA 3QIPB 4ZVFA 2HGNA 4ZVEA 1FFSB 2OTLS 2WOMB 2VBYA 2FGOA 1APSA 2RRNA 2YY3A 1S9GB 3HZGA 5H9FJ 5L39A 2LMIA 3CT9A 2QL9B 3BGLA 4WP3A 5I3PA 3HFKA 3R1LA 3M32A 3VGSA 5FLXY 3NWGA 5KFEA 3DDIA 4YP3A 2MLYA 2I5JB 4HT5A 3W62A 4DSJA 3JXOA 2V4QA 2KFYA 2F65A 4AUKA 4AL5A 3QT6A 5KFDA 3GFXA 4ED5A 1GTHA 4NLXA 2FUG9 2DIVA 3DYAB 2PI4A 1C2PA 1N32F 4X65F 2BOPA 1JLCA 4O3NA 4FDFA 5G0RA 3HK2A 2HQFA 2R9LA 3PY8A 5IT4A 3W61A 1FK9A 5IT0A 4A46A 5L46A 1D9DA 3OR2B 4ECSA 1REVB 2F8HA 4QIGA 5A6WA 5FD1A 4DUTA 1R8CA 3E01A 2IM3A 3MMCB 4P71A 2HVHA 1MG7A 3BGRB 4JV2A 4CM2A 1KWMA 4X4RA 3RGIA 5ETKA 3OBIA 3VAGA 3TARA 1RTIB 1GMWA 3BKFA 1U0HB 1HI8A 3CIZA 3MPDA 3Q8VA 4QIFA 4C8MA 5KFVA 5E3PA 3X3UA 2M8HA 1SQGA 3M8YA 4JI1J 2ZKUA 3THTA 1B0PA 4M5KA 5KFQA 4KPYA 4ZPVR 1WTBA 2IMOA 1ZA1B 3VHQA 3PIPQ 3PEHA 2RJZA 2FC9A 2V8VA 3E8OA 3UWTA 4WE1A 4QWDA 2BE7D 4ED3A 5HROA 4URSA 3M6VA 1OYDA 2XSFA 3HSZA 4PAAA 4YEAA 1KDNA 1U2CA 1YBUA 1HL6A 3GONA 5A8KA 4X65J 3HKZD 3SZ2A 4FYYB 3T1HF 4CCHA 4DV7F 2BQUA 3TRGA 1SC6A 3AAWB 2W1BA 1FJGF 2LXUA 3MM5B 4CLPA 2AX0A 2EBEA 5KFOA 4DXLA 1JK9B 5KOWA 4OIXA 2UUCF 1WDDA 2M5YA 2VFVA 1Q78A 2XI2A 3FQLA 3HD2A 3NRBA 4TNOA 2R2TA 2ZJQQ 3CCJS 4DV1F 1M5OC 4QCLA 1YJRA 1NK9A 3CSKA 4BC7A 1CC7A 3RAXA 2QX0A 3BS9A 1F5BA 1SH3A 3A4TA 4AL7A 1N6QB 1CBKA 4LIRA 4PPZA 1H72C 3KWMA 1T03B 3L95X 3ZZUA 1UTAA 4WFNQ 5GAEI 2KM8C 1T9UA 2HLUA 1B4SA 1GNKA 1LW0B 1KOOA 4O4GA 2IRUA 4RBTA 2OLWA 3Q89A 4ZP7A 1NZ8A 3Q8PB 4B3OA 4USHA 4NXMF 2C3MA 2JJ4D 4KGVB 1PILA 3THPA 4Z37A 4MH8A 4ZOSA 4GKKJ 3J7ZT 4NLSA 2Q1LA 3JQMA 1UEVA 4CLUA 1VQKS 4UY8T 1GEHA 2WW4A 1TKXB 3CB4A 4QW8A 2QA2A 3ITHB 2JC1A 1UJ4A 4FXVA 3H8YA 2MLZA 2W9AA 3TR5A 3IR5B 4ZVSB 2A3JA 4FYVB 4ICLB 4RNNA 3H4DA 3HHEA 2VBXA 3R97A 5L1IA 3I5CA 5DGAA 2OP5A 3BPDA 1XR5A 4P10A 3J7A1 1M0SA 2FVCA 1VR6A 4NMXA 2A6OA 4ZVQB 3OR1A 2D9OA 1VQOS 1RT7A 5F8JA 5K9FA 4DR7F 2Y9HA 3MM7A 3GYNA 3PCOB 2R8IA 2GVDA 4NA1A 4EBDA 5B0CA 3FFIB 3OSNA 1HWIA 1U26A 1HHSA 2G0CA 4KT0C 3V4MA 2V4JA 3SFGA 2LEPA 1U48A 1YQHA 2J8SA 1OIAA 3OUYB 4JI7J 3QGIA 1EP4A 3OHBA 2GQQA 1TL1A 1RT1A 3HPOA 4J90A 2D3UA 2B9EA 3R1HA 2ALYB 1DRZA 4KIAA 4ER8A 3RBZA 3N0VA 1I51B 4KB7A 3D7SB 5L8RC 2EVZA 3TX0A 3GFYA 3PKYA 1AUSL 2HS0A 4OYBA 3MR6A 3BV8A 3GFHA 3M05A 4ZPBA 2JOQA 2D3OR 2MKSA 1U0HA 1VLYA 2K3KA 3M2UA 4ZN3A 3A12A 3P96A 1AZSB 1LFPA 3ZTSA 1SV5A 3GJRB 4KSEB 3JSMB 4Y34A 1D1UA 1BY9A 2XZWA 3PX4A 3VALA 1YJWS 3HDSA 4FKYA 2QA1A 4P74A 2VG6A 3D28A 3D5MA 1RTZA 3B4MA 3J80U 1YJ7A 5A76A 2M7SA 3MFHA 2RHSB 5HANA 3MEDB 1IJFB 3FVYA 4LVNP 3FSYA 3OTCA 1EZZB 2HFNA 3GR1A 2ASJA 3IAM9 5K8NA 2MZJA 2O5DA 3K59A 2KU7A 1YRXA 3UD4P 3CIMA 1HNWF 3QRQA 3P45B 4J5OA 5KFJA 1TL7B 2WSFC 3CW2C 1TUWA 3K0JA 5CYJA 2DXDA 5JVHQ 3K8VA 4DF4A 3KNGA 1FNMA 1MMDA 4IFYB 4LFAJ 1W2BR 1HR0F 1UAWA 1QJHA 3EGNA 4N8NA 2ZC4A 3GIRA 4K4TA 2BQ3A 8ATCB 2HFUA 3IBCB 1JLAB 2OFHX 3N4WA 4OL8A 1FXDA 3H25A 4Q8FA 1HHQA 1TR0A 1F9EB 2FHMA 2L3MA 4RKUC 1T05B 4Y6IA 4F8RA 3PV8A 1F2HA 4GC7A 3NGSA 2NLWA 2VF3A 2KFNA 2LYVA 3C16A 2ZBIA 3PW0A 3B54A 5CCMA 2UUWA 4KHPJ 3DRPB 1QDUB 1UJ5A 4LREA 4OX6A 3M8QB 1G1XA 4JI8F 2CIMA 2AMCB 3DLJA 4USTA 1GQEA 1SIWB 1G2EA 4GO7X 1GTEA 5FIIA 5F8GA 3R2DJ 4CLKA 4Z7CA 1QAJA 1N4LA 1X60A 2W4DA 1RE1B 4NRUA 3ZZOA 3NS7B 3K8WA 4B3MJ 5ETQA 1FRIA 3B4DA 3MEDA 3Q8UA 1U4BA 1TKTB 2UV8A 4TYAA 1MW7A 3AFGA 2AW0A 3D1OA 1K47A 4Q0BA 3H2UB 3FUYA 1VCTA 3HSJA 3DLEB 2EFOA 3UD5A 2CADA 4ZVPB 4BC9A 5KFGA 2Z57B 2W7PA 2WONB 2LU1A 3PXGa 3U7JA 2FJEB 2HQDA 2OEJA 4CIOA 1YWXA 2ZJPQ 5I3UA 8RUCA 3FFIA 4O23A 1DTQA 2IAJB 3W9JA 3W3SA 3KLFA 2IM0A 2XSJA 1M1GA 1NK6A 3CJ2A 1HQUA 1S6UA 2R7RA 1VQ9S 4GC6A 4KJIA 1ZOTA 3NWRA 5CD4A 4O3OA 2FHOB 3G4SS 1TL1B 3JSBA 2E7VA 4MKVA 4PEOA 3VZHA 3KK2B 2EEYA 3BO3A 1UFLA 4N77A 4TYBA 4CO0A 2U2FA 4JI3F 1R0BG 1IQTA 1UWBB 3M6WA 2I0XA 4RBUA 1LWCA 1KQFB 4ZN1A 4J7CA 2J7UA 2LVWA 3MURP 3CO9A 2QLWA 2DNOA 3CD5A 1S77D 2V94A 3P3DA 2CQ1A 4IYQA 3ZNJ1 4DCPB 1TV6B 1LNQA 3V6JA 1U1MA 3O6QA 4WYWA 3M8RA 2FHJD 3T5LA 3MR5A 3NCQA 2AQ4A 2IBKA 1BWVA 1N0UA 2UXBF 1IJEB 3EMTA 3QNWB 4JP8A 1EQ0A 2NR0A 2GO8A 4U67Q 1FX2A 2O67A 4DF8A 1RHMB 4OYAA 3T9NA 2XMUA 4KE5A 2XS7A 1FRLA 1WOOA 4GRSA 2BJ7A 2AJ0A 3L9ZA 2AT1B 1XMBA 2DHSA 2FD2A 4G1QB 3JSYA 5J2PA 5I42A 3Q8RB 4ZHRA 3QAUA 3UPFA 4H4KC 2IAJA 3HULA 4L75A 4QZVB 4R0EA 5HJYA 4RWWA 2XSJB 2E5LJ 4X2BA 4WTYA 3K58A 1WEZA 2R42A 5BJRA 5AXNA 3A8EA 3OL9A 3H5SA 5KFHA 4JV1A 3G87A 1C0UB 3G71S 2OKQA 1WKLA 3R3TA 1AFIA 2DRAA 3IWLA 2VC1A 5KFWA 4U7CA 2HYIB 3ZZZA 5EN1A 2IHR1 3D3CJ 4X64F 3MR3A 2NXNA 3RG6A 1X9WA 2DH7A 1S79A 1RJJA 4ZP6A 2BE2B 1RWMB 4DV6F 4ZA1A 3FDSA 5SUHA 1GMVA 4ECXA 2J76E 2HHHJ 3POTB 2CQ3A 4U9RA 2UUTA 4DSIA 1Q16B 4DR3J 1QM9A 2PT0A 4K5RA 4LSNA 1Y00A 2C2EA 1FHTA 4K2JA 1CG2A 4WK3A 1JJHA 1TV6A 1IXKA 3LO3A 2KT5A 1E6YA 1ZZFA 3QJJA 3BZQA 3C14A 5IT9U 1PC4A 3MCSA 2VICA 3LOUA 5BYRA 2XZDB 2CNNB 3I31A 3J7Z5 4USVA 2ZM6F 1F2GA 2QL7B 4USUA 1XEZA 2H5JB 3BO2A 4ECZA 2HFVA 3PTWA 4PCQA 4ZJQA 3M8WA 1ZBTA 2XHCA 4I7FA 5HVFA 3MUTP 4IQMA 2YX4A 5E3AA 4N47A 1S0MA 3IA0A 2BMBA 1QSLA 3NGUA 1NKBA 3HVWA 2AHOB 1KHWA 1WHWA 4N5SA 4CH0S 1C4AA 4WYLA 1BQMA 1F5CA 4DL6A 4DFJA 3DLEA 4UOHA 4PG7A 4X4UA 1LK5A 3RYLA 1RT3B 4M5DB 3GILA 1VQPS 4B9SA 1S59A 2MJUA 2WONA 4DDFA 2RS8A 4A8OA 2ZH5A 5K8OA 3UE2A 4FXDA 3DKDA 1C0UA 3CTRA 3U1NA 2AEFA 4RBVA 2N3OA 3KJQB 4U7UD 2ZVIA 1JJCB 4E2FB 2DGUA 1WD6A 2DGTA 4CT9A 5AE2A 1KKHA 2MLXA 4M63A 2YTCA 5J1EB 5ETSA 1RWPB 4NI2B 5IV3A 5D4PA 3OD2A 4DQPA 1SC4B 2MQLA 2HNZA 3G6VA 4RLEA 4UZBA 1TL4A 5B08A 3TQEA 1D8ZA 5E33A 3M1VA 5A8RA 5HVGA 1AB8A 3C6UB 3NAHA 3PYDA 4QJVA 2BKNA 4IG3A 1YKWA 3DOMB 2MQOA 5IFMA 1Y9OA 2V34A 1BQNA 4G6VB 5T7LA 3D1QA 2MZ1A 3RRKA 2WVEA 4OZJA 2VA2A 3G6ES 2CQBA 3QBCA 4PABA 3HHLC 3HXMA 1FKOA 4C8YA 1J27A 1OS5A 3FK4A 3KDNA 4QYZK 3G86A 1UEUA 2OELA 3T41A 4J9NA 2GJ2A 1FDBA 4J9KA 3RU0A 1X4AA 2ZH2A 1NDKA 2I9SA 2YPYA 3I0RB 4ZHRB 4YY3J 4ED6A 2A18A 3BR9A 2LQ8A 3QT8A 4MK8A 3DM2A 4NLWA 3HI9A 1REGX 1U25A 2JNJA 3ISZA 2I6WA 1CJTA 2HAIA 5HAOA 4ZCIA 1DJ0A 5A8KB 1KVIA 2V67A 1SJRA 3PFOA 2NSCA 4U8VA 5KT3A 4M5LA 1Q53A 4F0KA 4DU7A 5EUHA 1RT6B 5A8WA 1RKJA 2A0FB 3RR7A 2H5IB 3AOBA 3MM8A 5DLGA 4BLGA 2XB2D 4Z7YA 4ZPDA 2XNRA 3G8QA 2BE2A 5LL6d 3TEGA 2MEWA 3T1AA 1XMQF 2ZZTA 1PJ6A 2VFTA 5IXUA 4ALZA 5D6GA 2WSEC 1T3NA 3MOJB 5G4DA 1WSVA 3DGPB 1HBNA 2QC3A 4UUWA 1HBMB 3IRXB 3OXGA 5C5JA 2GJFA 1IKVA 2BUNA 1SQEA 2V4RA 4EYIB 1JMTA 1IBLJ 1N6QA 1JX4A 2POKA 5K20B 1CJKB 1LWFA 3VAHA 4A8WA 1U1LA 4DN0A 2UVVA 3KJVA 2E5IA 1NAQA 4C97A 1LW0A 2CQCA 3A8KA 2YXLA 1PC5A 3H98A 1NPRA 2OAUA 2OPSA 3R7BB 2G13A 4O4RA 2Z56B 2AGPA 2QGFB 4CWBA 1QUPA 3BEGB 1Y5NB 4Y00A 5C42A 5HMXA 1T9YA 5HO4A 2EKYA 2KL8A 4ECYA 2BXJA 4RW8B 3H5UA 1IQZA 1X0PA 1SJQA 2UU9J 1S76D 1ZAVA 4G65A 1H98A 3I6PA 3PR4A 3BF4A 2XCPA 4V19J 4IR9A 1Z4UA 2CZ4A 2ZM6J 1RT2B 1KBRA 3MD1A 1HNIB 2BM0A 4I4BA 4OJGA 3EZUA 4FPIA 2D74B 1F6TA 1DLOB 1T9VA 1WC0A 2KVIA 3BGUA 4QR2A 2RQ4A 4NYOA 2MQQA 5D8HB 5F8IA 5I3QA 2CXEA 1U02A 2DB1A 1WI6A 2HIYA 3MM9B 1TK0A 4LRBA 5ETNA 5DS7A 3CJSA 4P9SA 4DX8H 5KG0A 2AJQA 3R5JB 4ZCKA 1S97A 3H42A 4KYZA 1QLNA 4DPXA 2P9CA 3G96A 2CPYA 1Q5VA 3BBCA 4U7UK 3CC2S 3PX0A 1LW2A 1HR0J 1LK7A 4MAKA 4J37A 4NCGB 4DL3A 4C8LA 4LFBF 3DRSA 4OYPA 2G1HA 3M1VB 3ETOA 4DL5A 2JC0A 2VUGA 3AXMA 2JH3A 4YFUA 3IGVA 1H7XA 4NLDA 3FZ2A 3HHDA 2QLFB 4OI3A 1S1VA 1VRUA 2YX7A 4HEA9 5DGBA 3KLEA 2FLNA 5KFCA 4U96A 1XR6A 3VGVA 5LXRA 1BUXA 2CPJA 4OV6A 4EZ6A 4D3GA 5A2QU 3ENVA 4DPYA 2YNHA 2FY1A 2KHDA 3VGUA 1IN0A 2M8DB 4X4TA 2QLJB 3RAMA 1T9TA 3VAFA 2V2ZA 1WACA 3CJ3A 4IDKA 1ZZNA 3C2PA 4WIIA 3V2UC 1NHKL 5MLCV 1DQ9A 1RAEB 1S6QA 3GE9A 3NGKA 2BJ9A 4I69A 4YR3A 3FRZA 1HNIA 3BH7B 4PYAA 3H59A 2J9DA 1VQSA 4DR7J 2DRDA 2COLA 2G2ZA 2HKEA 3I0RA 2FDNA 5JJBA 1GAOA 4ILRA 4WZQA 3NGDA 3ZZRA 3DM2B 5C25A 5RUBA 2ILZA 3U1MA 4YR2A 2BYCA 3M9NB 1SJFA 3PJ9A 1WC5A 2W2NP 1DFDA 1HD1A 3UCZP 3AA9A 3FQKA 2J0WA 2NUHA 3FCWA 5HN0A 4X4NA 1X9MA 3D0IE 3FBFA 2MQ8A 2ZH4A 3Q2TC 4LQ9A 1H74A 2CDRB 2KI2A 2ASLA 2AJ1A 3PZPA 1L5UA 2IPOB 1RHUB 5FJ4A 4NZ0A 4ANEA 1KP6A 1HQEA 1FJCA 1M1HA 3CUNA 1MMNA 4K4UA 4WF9Q 1K9MT 2CQPA 3DLLQ 3C66A 4LF7F 2B7CB 2JEIA 1F3VA 3K17A 3SCIE 5KOXA 3BDEA 2VD3A 2XNQA 1AYEA 2VDIA 1XQIA 5CYMA 5HJXA 5IC4B 1HBMA 3IRXA 4NLUA 2XLJA 4CLYA 3PW7A 2Y3YA 4FYDA 2L9DA 3FSIA 5DETA 2FGCA 1MROB 4CNZA 4NZ7A 3V6DA 3IM9A 1D3WA 1RWVB 2ABYA 3TVYA 1XNQJ 2PSZA 2XMTA 3IG1B 3I87A 4OYMA 1R31A 4ZP9A 2XBPA 4CM0A 3WHIA 2GIFA 4F67A 3JYTB 2R8GA 1RDRA 3MXHP 2EFQA 3FNNA 3G6YA 4PXBA 2HZVA 1CSJA 4RW8A 3ELHA 4ZKAA 4ID5A 4DJBA 4DV5F 2JHEA 3EDQB 5CQGA 3CJKB 3V5RA 1WI8A 3LH2S 4GVBA 3J7YI 3H4BA 4C2MA 1YIJS 3TUPA 3MMBA 1WHYA 4C8KA 1X5SA 2ZOFA 1RT2A 1ZA2B 3N5FA 4LSZB 4OV1A 4F7VA 2VQFJ 1VFJA 2H51B 1X5TA 2M52A 5I4MA 3Q24A 5ETLA 1FFGB 4NRTA 1WC4A 3QIPA 3C46A 4P2XA 2OMLA 3T6BA 3QT5A 5D0EA 1S1XA 1NZAA 3EVMA 2LXIA 5IC6B 1FRHA 1S9EA 3UN3A 3TOQA 2EC2A 2ZE2B 2ZUGA 3LF0A 4M5HA 1JLBB 4C0BA 2HRYA 4KAIA 2CJQA 4LF6J 4B3SJ 4PUOB 4P52A 3RR8A 1VBYA 3W65A 5CAAA 1KQGB 1RBLA 3KKFA 4MFBB 4JI6F 2MGZB 2K7KA 2ZNZA 4J9QA 2YWGA 1CEZA 2QA4S 3JAMY 1YGYA 1JLCB 4CP5A 3KHRA 4OZ0A 1PCAA 3KK2A 1ACMB 1C0TA 2QO3A 3C15B 3KLEB 2ROEA 4DUYJ 2DGWA 4MT1A 3ENQA 4RNHA 3W66A 4Z2XA 1X4BA 4RW4B 1REVA 1VC6A 4B3OB 2D41A 2C2MB 4NXNF 2F8MA 2XG8A 5LMUJ 4EBCA 3GB0A 2D9PA 4ID5B 3JAMU 3J81j 4K4ZA 1X9SA 1RTIA 3M8PA 1GXLA 2YKPA 1FJEB 2ZBPA 3HHKA 5JVGQ 4NLTA 5HMYA 3Q22A 1S57A 2IC3B 2BE9B 4UQTA 3KLVA 3OLAA 1Q8KA 3ZTRA 5GAHU 2V8HA 3KK3A 2YPZA 4K0KF 3MCNA 1FKPB 1FEEA 3H2LA 2QYCA 4OJ3A 5C25B 1NK5A 4MKAA 3J80Y 2Q66A 1EHWA 2XI3A 4N7TA 4OYWA 5KFPA 1UL3A 4A8FA 3HMJG 3Q23A 5ADZA 3BQ1A 4IO9Q 1U8SA 3N6NA 1SKRA 1VGYA 4NE9C 1V9OA 1RAIB 1S1WB 2YQ1A 4I6WA 4ZIWA 3KMQA 5KFZA 4DUYF 2N3LA 2SXLA 4OZ5A 3TEHB 2UXCF 1BC6A 4PUOA 1ZPVA 1Q7YT 2HFZA 2HGMA 3EICA 4PG8A 4IR1A 3PG9A 5B0EA 2CJ9A 1JLGA 3OV7A 3PO5A 3D4JA 4PQUB 3PR5B 2B56A 2Y1LB 4CYUA 2FLLA 2M2BA 3I5BA 3O3LA 5IQ6A 1NH7A 5F3ZA 3AA8A 1OPZA 3HT0A 1PJ7A 3N6MA 1WEYA 4K59A 4DV3J 3O5TB 5C7PA 2R8KA 1N52B 3CCRS 2ZFHA 1B0VA 1WC3A 4ID8A 1Q8IA 3IG1A 4LQ3A 5IOLA 4ZMMA 3JYTA 3OTBA 2DGVA 5K14B 4OYIA 3D6MB 2R3VA 1RWNB 4OMFG 4DX6A 2GGPA 3EWGA 4HVZA 4YR0A 1JXLA 2JRSA 4LR7A 3P5BP 4DR1F 1U1PA 2VB6A 2EK1A 1O0PA 2W2PP 3MM6B 1WDTA 4JI2F 2GVZB 2IIHA 1SH0A 1VHFA 3CE8A 5HLFA 4A8MP 4PZVA 4ES1A 1WOSA 3HHLA 1LWEA 4KV8A 2NPFA 4Q44A 4DR4J 2HBQB 3Q2SC 5AT1B 3MMJA 2YWFA 1ZETA 3P49B 3A13A 3LP2A 3SI8A 2RD5C 4EI2A 1WEXA 1CJUA 2YQ0A 1KLNA 2ZWPA 1CC8A 1S1WA 2RDJA 1U6FA 4IG0B 4M95A 5AE3A 4J9PA 1VISA 1B99A 3DXBA 3CXCR 2LEAA 1AROP 1RLCL 1RCXB 2DNPA 4RPFA 4H54A 1NKEA 1FD8A 2Q3PA 3R5DA 4FXWA 4M5NA 1UP1A 2BVZA 1X5PA 2MKYA 4IFVB 5L1LA 1Y10A 4F3OA 5CZVA 3RJMB 4DV0F 2NS1B 1N36F 4O44B 4XTTA 3NY0A 4OX8A 4ZK7M 3BQ0A 1KR4A 3EVWA 1WG1A 2Z2MA 3V81A 3R2CJ 3NMRA 3FEZA 1EP4B 3OXFA 1F9HA 4RW9A 1LKZA 3I82A 2PFFB 3IMQJ 3QYYA 2YWWA 3OPKA 3OW2R 2MJNA 4F0HA 3D9BA 4A48A 1UVKA 1NHUA 3C6UA 2F9DA 4CTAA 5DDOC 4JYAJ 4LFBJ 1NBEB 4NA2A 1VI7A 2BJDA 1KC8T 2VPYB 3CJ4A 4GKKF 3M8PB 3N28A 3PRDA 5MAOA 4O0IA 4FBUA 4UZCA 2ACMA 2XEXA 4DEZA 5DRKA 4TQSA 2AGQA 4X4VA 2MZTA 2YNGA 2YWKA 4Y2MA 3ZTOA 2A2CA 2CUYA 4RR5A 2W2MP 3RBEA 3D2WA 3RTVA 5HBMB 4DL0C 1SJ3P 2GAHC 2KYZA 4LMZA 4CLLA 4LRDA 3DNCA 4LFCF 4Q0BB 2O66A 3PACA 3BBBA 3HKWA 1TU0B 2VBZA 3OJUA 4YB5A 4ZVUB 3M6UA 1QAIA 4FF1A 3AT1B 2DGQA 1ZM9A 4ECRA 4MKBA 3X1LB 1WNEA 3K5MA 2BKOA 4Y2AA 3PKMA 4ELVA 1YZ7A 4FYXB 2WW8A 2K8GA 3C19A 3MPYA 4WFAQ 4L3KA 1AA1B 4FBTA 4IOAQ 1TL7A 1MWQA 3G8TA 3M2UB 1HQUB 3SCJE 4JYAF 4RW7A 4J9VA 3UVJA 4Q2MA 2MQPA 1U1OA 1NB7A 4MKYA 1ZPWX 4RW9B 2UV8G 2ZD1B 4A8YA 1KFDA 2V2KA 2PD1A 1S5ZA 2IDLA 4DR3F 2R7UA 3CC4S 2LLZA 3AD8C 3EXYA 2CG8A 4YDXA 3N5BA 4TU8A 1SKUB 2P6TA 2HHUA 4YB6A 4OZ2A 3TJAA 3UO0A 4LFCJ 2WHOA 1R0CB 2F8EX 2C2RA 3GJQB 2CKWA 2GGPB 4A47A 4H4MB 4C6AA 3LP1A 4OZ3A 2E9ZA 2RDIA 1D09B 2LP4A 1HI1A 2ADBA 2BJ3A 3UW1A 4FVCA 1TELA 4Q2LA 2HW3A 2F1FA 2W24A 5HBMA 2KM8B 4ES3A 4EFAC 5HLFB 2DO0A 3S7RA 3ILIA 3L7OA 1N8RT 1Y5LB 1YBAA 5FDLA 2QA4G 4EZ9A 5IQQA 2G2OA 2BJ1A 3MUVP 5ITHA 3T1YF 1I1GA 4ZPTR 3NNCA 2F4FA 1KLMA 2VBWA 4G1IA 4G1QA 2UUCJ 2B8PA 4P72A 3TUZC 4C3MA 2ZHAA 2FQQB 4J9SA 4QWEA 4JV5F 1C4CA 2AYEA 3TUIC 3GV8B 4J9LA 1QVFR 1RQ0A 2WB4A 4X66F 2K1RA 3VCDA 3DLKB 3DRPA 3CJ8A 3BQ2A 1YHQS 1P27B 2IVYA 1DLOA 2R2SA 1VIOA 1S1TA 5IM0A 4FF3A 1RHQB 2ZH7A 4LF2A 2KZZA 2HBYB 4LF8F 3MM9A 1KVKA 5LMNF 3LP0B 5J1NA 3UCGA 5HSPA 1U1NA 1NK4A 1TL5A 2IMWP 1RK8A 3I4PA 2XY5A 3GPAA 5CCLA 2HNYA 5CYQB 3KLIB 2UVUA 3VR1A 4F4YA 3SMZA 1S6OA 2HHXA 1JNZB 3W8GA 4ED7A 2B6AB 3LP1B 3PX6A 1IWAA 1E6YB 4QOTA 3VAJA 3BGFA 1LWCB 1F1BB 3WIUA 1HKAA 3OTEA 1VOMA 2F4VJ 2PC6A 1RAHB 1N5TA 2KB2A 3MEEB 4TKTA 3BSNA 1FD2A 2OPRA 3CF5Q 2RIJA 3BGOP 1DTQB 3JTPA 3BREA 2CYYA 2BRLA 5KG3A 2LCWA 1R89A 2C2ZB 2GIQA 4B3TJ 3S8SA 4DR2F 3FBEA 2LQJA 4KFBB 2MZRA 4LRCA 4V19X 3MHYA 1HNVB 2Y0SD 2MKJA 2DR5A 2GA7A 1JXEA 3AY0A 1M5VC 4Y0FA 2HVDA 3BSOA 3BKUA 4NMLA 3GIJA 1VQLS 1X4GA 1UVNA 1S6QB 1A0OB 2VG5A 1LQ9A 2NXCA 5CZXA 3KNAA 4OYOA 2VOPA 5LXYA 2LKZA 3DOKB 4RX6A 1Q8BA 4YQWA 5J2QB 3O8WA 1VBZA 1QSSA 3KK1B 1S6PA 4JI0J 4DV4J 1T9XA 2B8QA 3F41A 3BYRA 5CHCB 2Z30B 3AH6A 4RNOA 4DR1J 3MMAA 3SXLA 2M9KA 3GLJA 3LP0A 4KPCA 5ETTA 3TW0A 3V4IB 4HT7A 4YMEA 3DLGB 1DURA 4QBUA 3FSXA 1C1BA 2P2CB 3W7BA 4YOEA 3LGMA 2N4DA 3EPIA 2ZUAA 4TLQA 2V68A 3EZOA 3W5ZA 1NJYA 3MOZA 3MAAB 3K5LA 2QFIA 2EW9A 2F3JA 2M4MA 3IN5A 3TA1A 1N48A 2G0IA 3VGTA 5A8RB 2QE5A 3EGVA 4JI6J 3T1HJ 1KVJA 2ZBCA 4IG3B 3L4BC 3CCES 3DRRB 2KG0A 5IWAF 1I94J 2J6UA 2GIRA 2V2VA 3OTOF 4TLRA 2F4VF 3ETMA 4CNYA 4BBYA 4F4XA 2UXDJ 5GMEA 2RSQA 4L72B 1HW8A 1OSCA 4DLEA 2ZITA 1IKXB 4OX9F 4DG1A 5M2RA 3AXKA 2KKHA 1HYSA 3MECB 4PWUA 3OT9A 2EPIA 3DOLA 2R7TA 2V50A 2E5HA 4I7FB 4KGZB 4N8OA 5D4LA 2MSTA 4JV0A 1RISA 1PJ5A 4NEYA 1SXLA 4A8QA 2CVEA 4WJBA 3KJNB 2VPWB 4B9TA 4JI4F 2A1BA 1ZAWA 1GXUA 3M4XA 3VQTA 4NLRA 4LSNB 4DCOB 1Y5IB 3FMWA 2J0XA 1X4CA 4J9MA 4DQRA 5GMDA 1KQSR 3DLKA 1UFWA 1IKWA 1V3ZA 2WRMA 3I0SB 3R27A 4GVLA 4OHVA 5HI7A 5EGYA 4LF9J 1C1BB 3TZYA 4W92B 2FIUA 2ZH9A 1SBRA 4FNHA 3KXDA 2IVFB 2ERRA 1MMLA 1TL3A 3HVTA 3BYPA 2MPUA 3L7UA 1FNOA 4UOFA 5F8NA 3LPEA 4ZLJA 3UCUP 3AB2B 3CDEA 4DPTA 2VJUA 3LW5C 5HQLA 1KONA 1R0AA 3E2EA 4I2PA 5A2QY 4OLOA 3P5TL 4S0MA 3CCLS 1RZMA 4OI2A 3MTKA 4K5SA 3KFWX 4LR8A 1M5HA 2BANA 5EHHA 3QZ8A 3D6FB 3KG1A 5BYSA 1BQMB 3MZIA 1TVRA 4HLBA 4JOUA 4UW2A 3HZEA 1RXOB 3L7PA 2XYHB 1RT5A 1N5QA 3MPWA 3LUYA 1TK5A 3DHWC 1ZM3A 2NYHA 2P5VA 4OI4A 4E8UA 5KTQA 1RABB 5LSRA 2WVFA 2E7WA 4MJKA 5KG7A 2HGLA 4DG1B 1C0TB 5F8LA 2ATCB 2AP6A 3N79A 5KT2A 4FS1A 2B4PA 2V63A 3KYLA 3DOLB 4DHVA 4O3PA 3B6BA 2BX6A 2QMWA 2FPHX 4IH5A 2V9WA 2ASDA 3FBBA 2DNLA 1JLFB 1RACB 3HX9A 3G8SA 3EZ5A 3CCMS 2MSSA 1U47A 2DR9A 4OI6A 3W1YC 1KN6A 4M5JA 3KMSA 5KFYA 4TU9A 1EAYC 2OD6A 2RF2B 2H9ZA 2HNZB 1SL2A 3I56S 2DNQA 2B3TB 2VHGA 2H1YA 3AJ1A 3M2RA 3KLGA 3I0SA 3DI6A 2R4FA 3KK1A 1S7HA 3NS5A 2H4WB 2FJXA 1ELOA 4ITSA 1W2IA 4URQU 2VG6B 4LRAA 3MMAB 3VWSA 4B02A 1N34J 2IRYA 4J9UE 1BQNB 5T7LB 2IA6A 4WPAA 1R0AB 2ZNYA 2K7JA 4L3NA 1KEKA 1P8GA 5DJBA 2QN6B 2KVQE 2DH9A 2RQCA 1S49A 3PDNA 2BBEA 2CZVC 4CLSA 1LW2B 2Z4PA 1KNZA 1H2UX 2MY7A 2N7YA 4QU7A 2KT2A 1NHVA 3CMAS 4F4AA 5K8MA 1WUUA 1KHVA 2WTFA 2MKHA 2MB0B 3QO9A 4OHZA 3PJWA 4DI6A 4A8SA 1J5OA 3J81U 4NXNJ 1IKYA 1J2VA 3VQSA 1YTYA 5H1SV 2J0QD 1KD1T 1UWAA 2BR0A 2DHGA 4UOGA 4RO0A 4QR1A 1SKWA 2Z2ZA 4WK1A 4DSFA 1LFWA 4AYBD 1L3VA 3GSDA 4QWAA 1FESA 2RKIA 2UUBF 1OO0B 4EWTA 1VLOA 2YH1A 1JLFA 1HPZB 3ICLA 5KG2A 2VFSA 4DR6F 1IKXA 1Q95G 3TVKA 1TUGB 4NWBA 3ILOA 3A3PB 3MEGA 4YHHJ 5JUMA 2DNGA 1FI4A 4URGA 1Q81T 1T95A 3CCTA 3PRBA 3GV5B 3IFEA 4USKA 3K5PA 1BGXT 1EARA 2OHDA 4B17A 4DLGA 4LBHA 5B09A 3KLGB 3KHGA 1J5EJ 3HJFA 4ED0A 2J7WA 1RAAB 3OTOJ 2Y0BB 5KAKA 4WZMA 3SFUA 2EI5A 5F8MA 3PFEA 2V2QA 3UNYA 4HHHA 4WP9A 3RRGA 3HFVA 3M8ZA 2AYBA 4PXCA 1K44A 3HHLD 3UDLA 1G6BA 1SB6A 1NJXA 2FLPA 3R7SB 3CD7A 2D69A 3Q8YA 1DAXA 3KJVB 3WC2A 1CJVA 3ZO7A 1N56A 4JI5F 1UVJA 3AQPA 3MM5A 2W4CA 2VASA 4HH1A 2P6SA 4HHUA 1UW9A 1WWHA 1X4DA 4MIBA 3CDAA 3CJTA 5C2CA 2XMAA 3CD6S 2K06A 3NNAA 3S6EA 5GVQA 5C42B 4ZVHA 3GV7B 2PIIA 4KRWA 4IH7A 5I3UB 3LANA 3PO4A 2OEMA 3C8YA 1NRKA 1L3UA 2BRKA 2ROPA 2VV5A 1JLEB 2FTRA 1TVRB 1XMQJ 2UP1A 4Y28C 5DZ7A 1VQYA 2KRRA 2DHHA 4XK8C 2RKIB 2XM3A 3WQPA 4U6PA 1J5EF 5AE1A 2J5AA 1WHXA 2AKWB 2ZBQA 2HG4A 3JQJA 2W9BA 4LBPA 1IBLF 1D0EA 4P7VA 1S1VB 1VRUB 3HSDA 2OH2A 3CDUA 1VYAA 2DXFA 2WOMA 2WVDA 2DYAA 2LQ5A 4HH0A 4DWIA 4PWDB 3PJXA 2HIQA 1IWGA 5M2PA 2CQGA 4K4SA 1T9WA 2KJVA 2VQEJ 1GX6A 3MTJA 1WHVA 3K7RA 2M0GB 2DGXA 4DL4A 1U45A 4YN3B 2HS4A 3VAIA 2RF2A 3DDNA 3MMBB 4Q8EA 1LEOA 2A2DA 1NKCA 5IS2A 1D8YA 1YJNS 1OSDA 1JJ2R 4EO6A 2UU9F 5CXTA 2DD8S 3DYAA 3SDEA 2Z2LA 2HWHA 4EEYA 2HFSA 3CCWA 2LQ9A 2MKCA 3TZZA 4M5IA 4LUBA 4AQYF 2OSQA 1QSYA 5C24A 2XQCA 1RUSA 2N7CA 3R5AA 1SKSA 3OR1B 3R6GB 4OX9J 2UXBJ 4OHWA 4CO1A 1RLDA 2B51A 1CULA 3Q8QB 3ZZPA 1SC1B 1UPMB 2MTLA 4CQ1A 3THVA 1R8HA 5E2QA 4MTPA 2C28A 1AUDA 2V0NA 3QGHA 1FTCA 1TKDA 5M2UA 1Y11A 1XMOF 2QMXA 2HVIA 3FKBA 3ISND 3IWXA 2CAJA 2V8GA 3K5OA 3S1TA 3ZZYA 4BCAA 3I9ZA 4ILMA 1YDLA 4WIQA 1XERA 2Z2YB 3KUGA 4A4JA 2LU2A 3GQCA 4DR5J 1TZ0A 1JQGA 2KDOA 3WIVA 1FRJA 4JI7F 2E9TA 4RW6B 4RW4A 4GMKA 3GMGA 4ZJLA 3SQGA 3CCUS 2JSXA 2CPHA 4LT6A 5F41A 3CNQP 2APOA 2DCLA 4X4SA 1UVLA 3WZ0A 1B0TA 2MQNA 1HBOA 3MAQA 4DCJB 1FRKA 2CNLB 2EK6A 2VZ9A 2R7XA 1F3FA 4WBFA 2QFJA 1KTVA 1MWYA 2QLXA 4CO5A 1HNZF 4C8OA 5GMKa 1HQEB 1JLQB 4XDCA 4OYZA 5BXIA 1JIHA 1HHTP 2DR8A 1EKSA 2VFRA 1VRTA 4OZ1A 4CT8A 2JLFA 5DDQC 4GVBB 3EJMA 3DHXA 3SDEB 1SIZA 5KFMA 2EG1A 1RADB 2YKOA 3VTIA 2VG7A 4Q5VA 1X0FA 1S10A 1XTZA 5EX3A 4ELUA 1RWUA 2C3YA 1S1UA 2GAGC 2HBRB 2HFOA 2IVMA 4KH1B 4LFAF 3H5XA 4K4VA 1N5SA 3NBPA 3MFIA 3TO8A 3WDOA 2HRUA 2YWEA 3RAQA 2CQHA 2MY8A 3TYTA 2CJXB 2QRRA 2BV3A 2W7AA 4QU6A 5J2MA 2MKKA 1NO8A 2ZE2A 1MU2B 4HACA 1HBUA 3LGHA 4E98A 5IM0B 3ISNC 3PW2A 4J91A 3MF5A 4ZLLA 3T5KA 2ZZNA 4G1PA 2W2QP 1HWLA 3DN9A 5KFTA 5D78A 2AYGA 1XMOJ 2GMLA 2DCUB 1HLWA 2CPEA 1DTTB 2PMWA 4TQRA 4RW6A 2XWYA 4FYWB 4NI2A 2LECA 4GKJJ 1V5IB 3OTDA 3IRWP 2MZSA 3W8PA 1BLUA 1HQ2A 2W7OA 5DG8A 5D0GA 3C15A 4RUAA 2JZ5A 4RU2A 3P8BB 2WVCA 5BYQA 3T19A 4ENOA 2QEXS 1EX8A 1UEKA 1XNQF 1VQ7S 2KG1A 2RU9A 4ED1A 2HWTA 4NYZA 3ILLA 4PXDA 5HP1A 1FJGJ 1JWWA 2ZVSA 2OEKA 4ECWA 4WKRA 2UXDF 4KO0A 4XO0A 3NOGA 1HNZJ 3M30B 4KKOB 4X66J 4JI8J 1N5VA 1LWEB 1T94A 4KHMA 6FD1A 4DUZJ 4KFBA 2MGZA 5GAEU 2KTQA 1CPZA 3W60A 2CPXA 3UDEA 1NSQA 3NBPB 1TKTA 5B0DA 5J1PA 3R5BA 5DG7A 3CO0P 3QLHA 1N5YB 4PRFA 5A0YA 1UJ6A 3H7HB 1M1KT 1GK8A 1RT1B 4R8UB 4CDIA 2PA3A 1RWXB 2GMJA 2YBVA 4WKYA 5J2MB 2VG5B 3TVZA 2CPIA 3HP6A 5HATA 4NCAA 3TAMB 3CJRA 3W9IA 4DV2J 1PAUB 2YNIA 1CQMA 1OJ4A 1OY6A 2ZDPA 3A3OB 4LSLB 1FE0A 3H20A 5DDRC 4YHHF 2XC9A 1QTMA 1M5KC 1FWLA 1NU4A 3N01A 3T5HA 4F3MA 2R8JA 3HD1A 5KFNA 3KLHA 1Q1KA 4MK9A 3O44A 1SUQB 2HK3A 4TY8A 3DLGA 3RB6A 2RB7A 1JLGB 2XYPB 3NL0A 3SCLE 1BQXA 1X4HA 2XGPA 2CQ2A 2KHCA 2R7QA 4DV6J 1EETB 1OQ6A 3HCXA 4USWA 1RTDB 2B0GA 1U6ZA 4FNIA 4QQBA 2QJ3A 2WVBA 3UR0A 2I8EA 5F8HA 1SPBP 2DISA 1NUEA 2Q43A 4C98A 4F4KA 2DR7A 4R0JA 1NPKA 1VQ6S 1UKUA 1TMJA 3T6JA 3C3LA 3MGJA 1YRUA 2HVZA 3GZ7A 1X7VA 2IFXA 2NXEA 5KFXA 2BOAA 1RHJB 1HWJA 4HL9A 4LRFA 4P2MA 2OGUA 4WP8A 5THWA 2YNGB 1LWFB 1CJKA 4DBQA 1N0VC 2GVZA 2CQIA 2EC0A 2N4CA 1WC6A 2VPZB 3CJQA 3F44A 4WU3A 5DDPC 4PQUA 2DNZA 2V8PA 4K7QA 2MKIA 3IC1A 2FLOA 2YQ3A 3M9MB 2BABA 5KG5A 3LWMA 4OZNA 4X84A 2UVRA 1RB0A 3GTYX 4TXSA 1FERA 4C3KA 1F9FA 2P9EA 5GAGI 4B9VA 2XS5A 2CQDA 2ROGA 4DR6J 3R6LB 2RVJA 5K14A 3CMQA 4P2SA 2Q6BA 3IS9A 3JTOA 3WX4A 5KFFA 2HZAA 3KLHB 1MU2A 4HACB 4ANDA 2LDIA 4ED8A 2OMOA 2GCFA 3AQOA 1XR7A 3CDBA 3U02A 3UQSA 1SJ4P 1U1KA 2BJEA 3KHLA 2H48B 4F04B 2BDPA 4PKDB 1IR1A 5F0WA 4CO3A 1TAUA 2C42A 1NDPA 2JLEA 3AOCA 5ETOA 4ETXA 1NDLA 3K89A 3BSCA 2GV1A 1XBWA 2XHWA 4KV8B 4OX7A 3G82B 4FKXA 5KT5A 2IY5B 1DARA 2DNRA 2RU3A 1KSPA 1UW4A 3F73A 1H3DA 2R7OA 3PNIA 2V6AA 2HS3A 3POTA 4MK7A 5E0OA 3TP2A 4RUHA 2YKQA 3Q86A 1GMWD 5B7WA 7FDRA 3CC7S 2LXFA 2FVQA 1K0TA 4YUDA 3AD9C 3G2XA 2HHHF 1RT5B 3EXCX 3ZTQA 2J9CA 4PPDA 3ONQA 3QGPA 4KHRA 4CRJA 3TQ1A 5GADU 2FY8A 1IBKJ 5D0RA 2XMMA 5EX0A 5D3GB 1YI2S 1ULRA 1O8BA 2QSFA 1W7WA 3HFZB 5DZ6A 4X4PA 2BW2A 1QE1B 1TAQA 2GW8A 3BJYA 3MCMA 4A8KA 4DFMA 5DO2A 3TAPA 2DY1A 1JJ4A 4BDPA 3KOAA 3V81B 2AYMA 2FB0A 1NSPA 1DZ5A 3ZNUA 1B7YB 2XGQA 1Q82T 2KFZA 2HQIA 1DY3A 4M94A 1IM6A 3IXQA 4O4GB 1IM4A 2KRBA 2PE8A 1RT3A 1U7LA 2L9WA 4M5DA 4W4MA 4ZVGA 2W8LA 3DLBA 1YJTA 5KFSA 1HNXF 1R6VA 1FKAF 5LSOA 4N41A 3DI6B 4CTAB 1HD0A 1RTHA 4ATNA 2RRAA 1V3RA 2J6SA 4B9UA 2ZOGA 1TUVA 1EB0A 2HHPA 3O2IA 2FHJA 2O3DA 4HTIA 5F9NA 4LBIA 1A9NB 2XTJP 4L76A 5ETPA 4OFZA 4CLFA 1SUQA 4FP9A 4RW7B 3SBMA 4ES2A 1O5JA 2AV5A 3G82A 2H54B 4NX9A 5KT4A 2VA3A 1VK8A 3OXLA 1MSWD 1VBXA 2VC0A 3KLIA 1HWKA 1TKZA 1ZM2A 4Q7AA 1EETA 2K3IA 1S0NA 2AU0A 1PG5B 2ZEJA 4X4OA 2HHTA 3QO9B 5KG4A 2IYIA 3QPIA 1U2FA 3TA2A 2QL5B 3G6XA 4ECQA 3R8YA 4A8XA 2DVIA 2E5LF 4U95A 2GNKA 3MEEA 4DUZF 2RE1A 3GCWP 5I42B 2H5EA 1IR0A 2F7VA 1ZS6A 4NLVA 4C0OC 4OHXA 1HNWJ 4JI1F 2Q6CA 2V4JB 2NXJA 4IUFA 4V1Ak 1JXVA 4EGLA 2W8KA 2AGOA 2D1CA 3EVOA 2VKZG 3KTQA 1QUVA 1T3OA 4F36A 3EX7B 3CCSS 1RA6A 2AX1A 1Q4RA 2ZWOA 3Q83A 3GU0A 3Q8SB 4DV2F 3PM9A 2YX1A 3H5YA 5E3QA 3DGVA 2YKMB 2CZ9A 4C8ZA 2CNOB 5D15A 2B9WA 3DOKA 5J2QA 1FEHA 2YVSA 1VJQA 4BWMA 7FD1A 3CJKA
chains in the Genus database with same CATH topology
1HA1A 1S4FA 2F9JA 2EG2A 2OSRA 4P7TA 2R2UA 3SYZA 4IRKA 3UI3A 4ECUA 3I9V9 2FC8A 3QMQA 3V4IA 1F0XA 4H4MA 3RB0A 3JSMA 3Q0AA 2DO4A 3MWBA 2B4UA 2XMJA 4F2RA 1RT6A 1R6YA 5A8WB 1R7IA 3SSRA 4WFYA 2Y1RI 1S1XB 4DQIA 2C2DA 2E29A 2BACA 2L41A 2R7SA 3K5NA 4NLPA 2BZ2A 1XWLA 2QIFA 2HNDB 4O3QA 2JX2A 1YG0A 3DRRA 4R25A 1IBKF 2CQ0A 1P1TA 1L3TA 1Y7PA 1VQ4S 4LF9F 3LAMA 4IOCQ 1E6VA 2KXFA 2VH7A 3RB3A 4IFYA 4NYPA 1X5OA 3D0HE 4HYKA 1HFEL 4KQZA 3IO1A 5KFAA 4USJC 1RTJA 1QE1A 1JLAA 1OQ3A 1RT4A 3SSQA 3WC0A 2YKMA 2DT9A 3ZZ0A 1S0NA 2B9XA 4ECTA 2ZHBA 1TP7A 2QSWA 4C3LA 2HNYB 5CYQA 2ZKTA 2ZJRQ 1Y4ZB 2E1MC 1FRXA 2DITA 1ZYQA 4HHJA 2XY6A 2E1RA 2IC3A 2ZDOA 3KK3B 1FJ7A 4ECVA 3JB9k 2DPIA 3NG8A 2B9YA 5C24B 4QWCA 1M90T 4EUVA 1RYSA 1HNVA 1NEEA 3M32B 1FKOB 2XLIA 2CRLA 2EFPA 1FT8A 3OFFA 2XULA 1A6LA 2ADCA 2KZMA 3HF5A 1FVSA 2CPFA 4HDGA 2JEJA 4MYTA 2F40A 2XLKA 5F3TA 2FVRA 4RWXA 4XAKA 4EU0A 2K2PA 4C0HA 5K8PA 1E6VB 2DNMA 1FO1A 4P6QA 4N56A 4MIWA 1RP5A 1VC5A 3KLFB 4HDHA 4K4YA 3GYXB 1XC9A 1X4FA 3IR6B 3VAMA 3CWJA 5AXKA 4N76A 4JUZA 5KG6A 5F0UA 2CJKA 2YH0A 3OJSA 4B3SF 5L1JA 4O3RA 1LV5A 4OJ1A 2MDAA 1JLQA 1HWUA 4PG5A 4R5PB 4I1TA 1P6TA 3KG0A 3OVBA 1K1QA 3UFCX 5LSLA 4X4QA 3OSPA 1FCAA 3CGIA 1NJWA 4I68A 1GX5A 4XPEA 1HBNB 5G0RB 3IR7B 1C1CA 3TI0A 2RILA 1NK7A 4I64A 2HHWA 1PSDA 1H6KX 1X8DA 4F50A 1TFWA 1NJZA 4IOBA 4ETZA 2OD4A 3M6XA 4QR0A 2GO9A 4XDDA 2HHQA 3HLUA 4FZVA 3CMES 2OFGX 2AJFE 3EUNA 4FF2A 2YWHA 3EYZA 4I2PB 2HZCA 1YVFA 2PGCA 1J5OB 1D9FA 3DU5A 3EGZA 1Z2ZA 1QAYA 3ZC4A 5CYMB 1M5PC 3AB4B 1TFYA 1XN9A 1IBMF 4WCEQ 3UDCA 1HI0P 4J9OA 1T02A 2DNNA 4DPOA 4YY3F 5K5MA 1ZH5A 2NXUA 2GX8A 3E3XA 1IKWB 1T03A 2JEFA 5T41A 2D7SA 1HPZA 2JWNA 2L9NA 2VONA 1GH8A 4B3MF 1NK8A 4ILLA 1RTJB 4PG4A 4ZLPA 2JVRA 3I5AA 2VL1A 3NLCA 4DQQA 3DRXA 4IQXA 4AFFA 3D1HA 1TK8A 3V6HA 1S0OA 3EPGA 1OPIA 5KFBA 3FZBA 3ITHA 4F4WA 4NCGA 1NNDA 2FVPA 1N54B 3TUJC 3MAHA 4ZDNA 1G3OA 3OL8A 4OI1A 2LEBA 1H7WA 4DL2A 1KS2A 3OHAA 2VODA 2IM2A 5A0YB 5L38A 3RW6A 1H38A 4CO2A 1ZTTA 1S99A 1FXRA 1QY7A 2MMYA 3LQVA 4JBCA 1S48A 3OR2A 4HKQA 2RQKA 3E01B 3MMCA 3SEOA 5KG1A 3T5JA 3HO1A 2Y1JA 5DQHA 3JTNA 1JKHA 1JLEA 3BO4A 1TKXA 4UOCA 4PG6A 1ZM4A 4LIWA 5B0GA 3NAIA 4MFBA 1HW9A 3QJLA 1IKYB 2B5JA 2JFDA 4QPTA 3MR2A 4B3TF 4LF6F 1W25A 3FRYA 3JSRA 2KT3A 1Q7LB 1KOHA 1P1LA 2VFUA 2EWHA 4NLYA 3E51A 4PXEA 1KTQA 3OLBA 2I2YA 5KFLA 1URRA 3WBZA 3CVKA 3U1LA 4C7QA 1SL1A 3PEJA 5HROB 2DK2A 1VQNS 2UUAF 2XWXA 3OL6A 4FS2A 2C3UA 4LJMA 2ZH3A 4C8YA 1RT7B 1WF2A 4ZCMA 1K0VA 3IBWA 5EWEA 6FDRA 2FJAB 2CJAA 4DSEA 3MEGB 3MDFA 4BS2A 2U1AA 4ED2A 4WXOA 2NSBA 1OWXA 4F2SA 3CCVS 5DM7Q 2DJWA 4QPXA 1PO6A 1VK3A 4CH1A 4DSLA 1DQ8A 1P9QC 2J9DE 4Q45A 2GFFA 1UA1A 2GQ2A 3NP5A 3TX8A 1KLMB 1GT8A 5L1KA 5D77A 3P6YC 2XY7A 2CQ4A 4QIEA 2FVSA 1JKHB 2X1BA 2K1RB 2WBRA 1F5AA 1H2VZ 3LGNA 4KGMA 1XK8A 2UVWA 1SV5B 4OJHA 2NUUG 3KHHA 2VQFF 4UUXA 3U27A 4RNMA 1R27B 1Q8LA 3H2VE 1B64A 4Q43A 5IZHA 4NLOA 5E41A 2ACYA 2OPQB 2NZ4A 4DSKA 1DBDA 3DMJA 4Y2CA 3MEKA 5EWGA 4NL5A 1FDNA 3NCPA 2ZH8A 2PO4A 1HARA 1VC0A 3M9OB 3MUMP 2B7BB 2YNFA 3B8HA 3QGGA 4WU2A 3EGWB 3M8QA 5AXLA 4E0DA 2AWZA 4QIVA 5E7OB 3MM7B 4B08A 3HVRA 2CG4A 3IGNA 2CFXA 5AJ3F 2RMLA 4AXJA 2GHPA 3FMBA 2GHVC 2W25A 2DHXA 1WELA 5E3CA 4B9NA 4KC5A 4ZPCA 1KRPA 1DQAA 1T05A 5DM6Q 2MZQA 4IG0A 2W9BB 1YSJA 1R8PA 3CPWR 4DFKA 2ATLA 3FGVA 1WG5A 2YKNB 3TNVA 3CD0A 2W9CB 1L3SA 4PWDA 5BR8F 1QVGR 1RTHB 3BN7A 1S6PB 2PDAA 3CJ5A 4IFVA 1RA7A 2DNHA 3I55S 3LPYA 3LALA 4PQAA 3GWCA 2L48A 2C3OA 2B5JB 4C8NA 3DFEA 3FEXB 2WCXA 3QIDA 2N82B 4J9RA 2E5JA 4WXWA 4CI0B 3NCRA 3SQGB 1S9GA 3RBDA 1AFJA 2CPZA 1X4EA 5SZTA 3HM9A 2KJWA 1NJIT 1ZAXA 2FJWA 4YB7A 2FJVA 3PVXA 3OQ2A 1UVIA 2PI5A 3GFZA 2C3PA 2DBBA 3AHPA 1Q86T 3UR3C 3C3LA 3A1YG 3BB5A 3D54A 3SV4A 1K8AT 3AJ2A 4EYHB 2X3GA 1L3KA 3QWUA 5D4NA 3DRSB 4CO4A 1ZTWA 2R7WA 2G1DA 5T14A 2DPJA 3NKYA 3QLHB 4I0WA 1FDAA 3ZZTA 3FEYB 1N5YA 2VG7B 2WB1D 3DRYA 3MECA 4R8UA 2PEHA 2DIUA 3F56A 2ZC3A 3CJ0A 4PR6A 4LF5F 1S1UB 2MQMA 2JLGA 4NZ6A 2YKNA 4C11B 1A7GE 1AXQA 1QAXA 2WBMA 3DXSX 3S01A 3TA0A 1K73T 1S9FA 2DHAA 3GR0A 5F9LA 3CCZA 4W90B 1U1RA 5LMUF 2B4OA 2E7XA 4FPRA 3K57A 4IDKB 2DGOA 3H40A 3GIKA 4H4OB 4FF4A 3RB4A 1Y3KA 4LF4F 4M8LA 2ALZA 1VRTB 2EFNA 4DS4A 2E1CA 4Y3CA 1B7FA 1V6HA 1R8BA 4UY85 4MMOA 4B3RF 5CA5A 3TAQA 3QWPA 2YKAA 3DDKA 1DTTA 3HHLB 5D4OA 2OPQA 2KN4A 5HL7Q 3LP2B 2HHSA 2HNDA 2BANB 1XNRF 3V6KA 4NOHA 1YRTA 3I96A 4K4WA 4DV4F 1Z2LA 1VQ8S 2MHNA 2YNFB 3OVSA 1S72S 4OQJA 4UQGA 1CVJA 2L08A 1FF2A 2ZH6A 4DS5A 4XIUA 4ZP8A 1O51A 2RUGA 4KO0B 2ZOMA 1U09A 3M30A 4KKOA 3W2WB 5IT9Y 5FDLB 4O44A 1Z1ZA 4B9MA 4C11A 1AW0A 3BR8A 2AJ4A 2OPPB 1MROA 4OZLA 4YB1P 5CH7B 3V6DB 1IUJA 1JB0C 4QW9A 1FE4A 2I1RA 2MYFA 3M8SA 3VZIA 4DFPA 1K1SA 4L6V3 2X51A 3IWNC