2GO9A

Rrm domains 1 and 2 of prp24 from s. cerevisiae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
161
structure length
161
Chain Sequence
MRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKKNFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHLTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U4/U6 snRNA-associated splicing factor PRP24
publication title Structure and interactions of the first three RNA recognition motifs of splicing factor prp24.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 32
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2006-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2go9A02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2go9A01
4PKDB 3R27A 1M90T 2CQ4A 4YOEA 2FY1A 3UE2A 1VBZA 1VQ7S 2KI2A 3NS6A 4TU7A 2YH0A 2HGLA 3MUMP 3MD1A 1DRZA 4U67Q 3TP2A 2DGSA 1VQ8S 2XS5A 4QU7A 3I56S 2XSFA 4WFAQ 2JX2A 3P49B 2DHGA 1UFWA 4LJMA 1FXLA 2HYIB 3IWNC 2M8HA 2DB1A 2MPUA 3UCUP 2MZQA 3H2UB 1KD1T 3R1HA 2BOPA 1SJRA 2DNKA 2MQQA 2DK2A 4WCEQ 1R8HA 3CMAS 2M4MA 1Q7YT 5GAEU 4Y0FA 3CCSS 2M88A 2RRBA 2RS2A 2MQOA 4ED5A 3Q2TC 1PGZA 1R8PA 3UWTA 3MI7X 2A3JA 2AD9A 2QEXS 1X4EA 5IM0B 2KVIA 5DDQC 4Y00A 3SDEB 2B0GA 1VBXA 2RUGA 2N82B 1WF2A 3ZZZA 5DDRC 3VAFA 2AYBA 1A7GE 2CQCA 5GMKa 3J7ZT 2G0CA 2DNOA 3Q2SC 5IFMA 2NLWA 3CCES 1VQLS 3DLLQ 1H6KX 2MZJA 1W2BR 2CQPA 1YI2S 3VALA 2DHSA 2PEHA 5DDOC 2DH9A 2AYGA 4IUFA 2D9OA 2LEBA 1YWXA 4F25A 2MZ1A 4LIRA 4PRFA 1WWHA 1HD1A 1U1KA 2DNYA 2DGTA 2KXNB 4YUDA 1VQ5S 2DNGA 1H2TZ 1N52B 2J0SD 1WG5A 2LA4A 2JWNA 1UAWA 3HHNB 1WHXA 4F26A 3R1LA 1VC0A 1WTBA 2G4BA 2LKZA 2DNMA 1QVGR 3ULHA 1FJEB 4QU6A 3G6ES 3VAGA 2DITA 3CULA 1OPIA 1Q81T 2K3KA 2KXFA 1OIAA 1M1KT 4UQTA 1N8RT 2MKKA 2DGXA 2VONA 2O3DA 2XNQA 2RS8A 1YTYA 2F9JA 2N3LA 1WEXA 1VC6A 1NU4A 5D77A 5DETA 2RQCA 1FHTA 5GAHU 3CCMS 1KC8T 4W92B 2MSTA 1WHYA 2OSQA 2YKAA 1L3KA 4Z2XA 4IOAQ 2X1FA 2OTLS 3CXCR 2LA6A 1CVJA 1DBDA 1X4DA 1X5TA 2MSSA 3BO2A 1UW4A 3HI9A 1X4FA 4TLQA 2DO0A 2MZSA 1WHWA 1X4BA 5H1SV 2D3OR 2CQIA 2MKCA 3CUNA 3CCLS 5DM6Q 2RNEA 3PIOQ 2KG1A 1VQ4S 1WG1A 3S8SA 2MHNA 1VQNS 1KOOA 5CA5A 1WI8A 3RW7A 1FJ7A 1WELA 3TO8A 1N54B 1JMTA 3CC4S 1NJIT 2CPHA 2KH9A 2MXYA 2CQBA 2MMYA 3FEYB 4WFNQ 4W90B 2MQLA 4LMZA 2K8GA 2U1AA 3CTRA 3EX7B 2E5HA 3N9UC 1JJ2R 3G8SA 2HZCA 3VAMA 2KYXA 4A8XA 3MXHP 1M5VC 3G8TA 1X4GA 1U1NA 2VODA 1OWXA 2E5IA 2F3JA 4WKRA 3CF5Q 2MZTA 1JJ4A 1X5SA 1HA1A 1Q82T 1S79A 2MJNA 3BEGB 3D2WA 4J5OA 5LXYA 3PIPQ 1SJFA 3S6EA 3CCVS 1VQPS 3MUVP 2RRAA 3EGZA 1ZZFA 1FNXH 1BY9A 2MKHA 4TU8A 4C4WA 2YTCA 3RW6A 1VQ6S 1X4CA 3BO4A 5GADU 3K0JA 3S01A 2J8AA 3VAIA 4EGLA 3J7YU 5LJ5Y 1U1RA 2E5JA 3DXBA 1ZZNA 3H2VE 2MY8A 1N88A 1VBYA 3THTA 1VQMS 1U6BA 5LSLA 3S7RA 4QQBA 3CCQS 3JB9k 1PO6A 1X0FA 4CQ1A 3MURP 3NS5A 2JRSA 2LMIA 4OZ1A 3U1LA 2DH7A 3NNHA 1K9MT 5MLCV 2KM8B 2M8DB 2CPZA 5LXRA 1VQKS 2N7CA 1P27B 3EGNA 1SJ4P 3VAKA 2V94A 2DIVA 4CH0S 2KU7A 1S72S 1P1TA 2PE8A 2MKIA 2DGWA 2VOOA 3MUTP 2CPYA 2DHAA 4QPTA 2ZJQQ 1URNA 2AYMA 1YIJS 4M5DB 1U1PA 3TYTA 2KFYA 2HGMA 1QM9A 2G1DA 2DISA 2DGQA 2LXIA 2HVZA 5JVGQ 1F9FA 5CYJA 1G2EA 2RVJA 2KHCA 3G4SS 3FEXB 1YJWS 2DO4A 2MJUA 2DNZA 2CPDA 3BO3A 3CPWR 2L08A 1O0PA 5GVQA 5LJ3Y 1U1OA 3L3CA 2LCWA 1FO1A 2L9WA 1X5OA 1WEZA 1WI6A 2E44A 2FHOB 2LEAA 2QFJA 2ADBA 1U6FA 2DGOA 3SMZA 1SJ3P 1D9AA 2NZ4A 2WBRA 5BJRA 2CQ0A 3UD4P 1Q86T 5DDPC 2I2YA 2D9PA 2MYFA 1KQSR 2ADCA 3CC7S 5D78A 2CQHA 2I38A 2X1GA 1ZH5A 3LQVA 3VF0B 1U1LA 1D8ZA 2CPEA 2DNPA 1A9NB 3OW2R 2XS2A 1SXLA 2YWKA 3CC2S 1DZ5A 1H2UX 3U1MA 1X4AA 1K73T 3CCRS 1H2VZ 2KRRA 4YB1P 3CCJS 4C7QA 4ZKAA 4ERDA 2CQ1A 2EK6A 2EK1A 3UCZP 4WF9Q 3VAJA 1U1MA 3G96A 3ZZYA 1U1QA 2M9KA 4CIOA 2X1AA 2M70A 2DGUA 1JJHA 1WF1A 2M7SA 2KG0A 5IQQA 2LECA 2DNHA 2MGZA 2VOPA 3VAHA 2CPXA 3MDFA 2RU3A 5DM7Q 1VQOS 1YHQS 2CQDA 2X1BA 1U2FA 4F02A 1VQ9S 1NO8A 1KOHA 2OIHA 2OJ3A 1K8AT 2GHPA 5CXTA 3MOJB 2MQPA 2M2BA 2OSRA 1HD0A 2DGVA 2DNNA 2CPIA 2KT5A 4V19X 2UP1A 2CPJA 2XNRA 5EN1A 1XN9A 4OZ0A 3THPA 1B7FA 3I55S 3NNCA 3B4DA 2HGNA 1VC5A 1DHMA 2RQ4A 2CPFA 2DNQA 3IRWP 2ZJPQ 4UY8T 1OO0B 2MZRA 2E5GA 2XB2D 2MY7A 3V4MA 4TU9A 3BS9A 3CCUS 2SXLA 2CQ2A 2QA4S 1YJNS 3P6YC 1M5KC 1YITS 1X5PA 4FXWA 2J76E 2N3OA 2ERRA 4IOCQ 3CMES 1M5OC 1YJ9S 1WG4A 3UD3P 2GO9A 1FJCA 2KXHA 4PR6A 4FXVA 4RU2A 3G9CA 2XS7A 3P3DA 4WIIA 5HL7Q 1M5PC 4IO9Q 2KN4A 4WFBQ 1RKJA 2JVRA 1QVFR 1HL6A 2DH8A 3NNAA 3NMRA 5HO4A 2YH1A 5ITHA 3P5TL 2LYVA 1UP1A 2MKSA 1FT8A 5FJ4A 2U2FA 5IM0A 5LSOA 2MB0B 2Q79A 3LPYA 3SXLA 2JVOA 1IQTA 3SDEA 2MQNA 2AYEA 2LXUA 3B4MA 2CJKA 3G71S 5JVHQ 2DIUA 1WF0A 4P6QA 4CH1A 1SJQA 2CQGA 3CD6S 4BS2A 2EVZA 2ZJRQ 2F9DA 2FC8A 2FPHX 2BZ2A 2M52A 1WHVA 2CQ3A 2KRBA 2FC9A 3MD3A 1WEYA 2LQ5A 2MGZB 3US5A 2KM8C 2DNLA 2MKJA 2DHXA 2M0GB 5GAGU 2MQMA 4C0OC 2OTJS 1RK8A 1AUDA 3UCGA 1X4HA 2J0QD 2L41A 2DNRA 2RT3A
chains in the Genus database with same CATH superfamily
4PKDB 4QIWD 4OYBA 2P9EA 1OPZA 1HW9A 3PRBA 1FERA 1NK6A 3PHTA 4ZVQB 1LOUA 3BZQA 4LF9F 3RBXA 3DLKB 4PG6A 1RHRB 3CJ5A 3U1NA 5B0EA 4B3RJ 1RU2A 3TRGA 6FDRA 1URRA 4KQZA 2B0GA 4CO1A 3VTIA 2V8GA 4DSJA 2N82B 2OFGX 4LRAA 2E1PA 3FCWA 4JI0J 2CQPA 5K8OA 3OTDA 5CD4A 5DG9A 2GVZB 4RW4A 2GQ2A 2MZ1A 2GO8A 5LM7E 2GCFA 4H4KA 4ZP7A 3Q22A 1VK3A 2LA4A 3A12A 4ZLLA 2D7SA 3R1LA 4OX7A 4ECZA 3CDAA 5CQGA 2DGXA 4IQXA 2WONA 4OI1A 4RW9B 3K8WA 1PC5A 1E6YB 3HD2A 1RI7A 4RU9A 4LSNB 3D0HE 3PX0A 2V9KA 2CWXA 4KPCA 3CXCR 3CVKA 2MSSA 2DY9A 1X9MA 1GNKA 2VFSA 1FFWB 4KH0B 4C8YA 5A8RB 3LGNA 1VJWA 4M5DA 1YX2A 2A2CA 1N54B 3CC4S 4MTPA 2G1HA 5L38A 4J9UE 1T95A 4X4OA 1S1TB 1X5SA 2I6WA 3LTOA 2ZWPA 2VG7A 4I7FA 3V6DA 1TFWA 2RRAA 1IKWA 2B7BB 4DZ6A 4OYZA 4UTGA 1YJVA 3MMAA 2CNLB 2XYPB 3W5ZA 1FX2A 1N88A 1TKTB 1VQMS 3H8YA 4F0HA 5D4PA 3N28A 2W7OA 3T6BA 3QSIA 2DH7A 5IV3A 5C2CA 2FJVA 1V3SA 1S6PA 4FXDA 1SJ4P 3EZ5A 3G6VA 1S99A 4QWDA 1EARA 3DOKB 2Q66A 1KHWA 2VG6A 1RWXB 1URNA 3TVZA 3G87A 2EFOA 1F5CA 1S77D 4C0BA 2AJ2A 4LFCF 2QYGA 4DV0J 5E0OA 2HFVA 3QT5A 5CABA 5C42B 3CDWA 4RNMA 3DLGA 3L4BC 1EX8A 2A6MA 1X5OA 2ASYA 1V5IB 4K0KJ 4USIA 7FDRA 1U6ZA 2FZCB 3MTKA 5M2RA 2G9OA 2EFQA 4YMEA 5D78A 5ETOA 2BE7D 2YNGB 2VQEJ 2VUGA 1I94F 1CULB 4HL9A 1RGVA 4I2PB 3NP5A 4Y2AA 4JBCA 3U1MA 2FLNA 4KO0B 1TP7A 2CVEA 3VZIA 3FVYA 4C8LA 2EK1A 1U0HA 4DUZF 1TKZB 4AL5A 3OTOJ 4N56A 4DR1F 3T1AA 1JLGB 3EXYA 3JS9A 1Y00A 1KBRA 1NPPA 2WW4A 3CJ0A 3D67A 4DN0A 1GX5A 2W24A 1KFSA 1KRPA 1RTDB 4A8MP 2NXUA 4HT5A 1XEZA 2IM0A 3GIKA 2V50A 3KHLA 4OI0A 1M1HA 1AZSA 2LEPA 1Q4RA 3V4IB 3UW1A 1JB0C 4RW6A 3N6NA 4O3SA 1FFSB 2YWWA 3B78A 3FSXA 4LF6J 3IG1A 1C0UA 1D1UA 2B6AA 3UDCA 4QR1A 5HVGA 1JLFA 2JVRA 4L75A 3QQCD 4ITSA 2BABA 3BQ0A 5KAKA 3ISNC 4ECSA 2O01C 2Y0BB 1CEZA 1CQMA 4EWTA 2LXUA 4BS2A 3LAMA 1B0PA 4M5JA 2KHDA 4J9LA 2L48A 2KM8C 4YHHF 2L41A 4JP8A 3MFIA 3I4PA 2DRAA 3PX6A 2X51A 4FKXA 1EIYB 2XS5A 3RBDA 2IDEA 1K47A 4ED0A 2XO6A 1EAYC 2LP4A 2UUWA 2HYIB 2RUSA 2B4OA 4EO6A 5U47A 4MT1A 2HMIA 1QTNB 3NMAA 1X9WA 3KMSA 2AP6A 1PGZA 1JLBB 1X4EA 3NAHA 3OSNA 2V5HG 2B4UA 3SDEB 4DFJA 5HBMA 2RUGA 3ZZZA 5DDRC 3BKFA 4X4UA 4LQ3A 1NKCA 5J1EA 3TA1A 3C15A 3CEDA 4KRWA 1N34F 4UF4A 1NRKA 1WOPA 1Q8BA 4CLLA 3QAUA 3HVTA 4X4PA 2I5JA 3ET6A 4ZVOB 4JI7F 2JWNA 1WHXA 2C2DA 4LBPA 1ZS6A 2DITA 1WNEA 1JNRB 5L8RC 1PILA 2XQCA 2ZH6A 2UVUA 4MIWA 4JOUA 1WEXA 3W63A 2C2KB 3BYRA 4I2QA 4PG5A 5D77A 1C4AA 4ED6A 5HROB 1WHYA 3OQ2A 3R7SB 4DQSA 4K4SA 3PVXA 1YZ6A 1AB8A 2A18A 1JLCA 3PM9A 5C25A 1XNRJ 3KLEA 3ILOA 2Y1JA 1VQ4S 4FN5A 3R8YA 1C2PA 3VVUA 1UPPA 4PABA 2PMHA 2ZUGA 4FYXB 5CYQA 3CD7A 4O3NA 4W90B 2U1AA 3UR3C 4QR2A 4FKYA 1JLEA 2HK2A 3OLAA 5BYQA 2F3JA 2AJ0A 5KOXA 1OQ3A 2D1CA 3CCVS 2BJ8A 1YKWA 4DG1A 4XDCA 3EGZA 2KTQA 1PYSB 5T14A 2WW8A 3S01A 5HQMA 1WC3A 1QLNA 3MM5B 3EJMA 6FD1A 3M6UA 5GMDA 4GKJF 1JXVA 1EZZB 3B54A 3M30A 2V68A 1X0FA 3OFFA 2R9LA 1IBLF 1Y3JA 4U7CA 5KG2A 2QMUB 4Y34A 3EXCX 1TV6B 1KNZA 2NZCA 3GYNA 3HHLD 4C3MA 4WYWA 3T1HF 3MUTP 5DRKA 3SFGA 5D8HB 1TQLA 2WBMA 2PN6A 3PYGA 1S0OA 4X4RA 4ES2A 4B9NA 3SI8A 4AYBD 5LL6d 3TWZA 1DJ0A 1U2CA 4KY3A 1B99A 4EZ9A 3PEHA 1P6TA 1SIWB 2HVHA 1KVJA 2VBZA 1HW8A 3J7Z5 4ANDA 3FBFA 2ADCA 5T41A 1SC1B 4HVZA 1ZH5A 3I0SA 5L46A 1NJWA 1CJTA 2XLKA 3EZOA 2HURA 2YQ0A 2CJYB 1U1QA 1V3RA 1W7WA 2V8PA 1CLFA 2MKYA 3NEKA 1UEVA 4CO3A 5DM7Q 4ZPBA 2GVDA 2ZOMA 4WZQA 3LF0A 1S1VB 1H3DA 4IG0B 2KT5A 4RUAA 4NZ6A 4NASA 4MIAA 4KKOA 2Z4PA 1PJ7A 1E6VB 3IA0A 2MZRA 3H0PA 5D4NA 2XB2D 1NZ8A 1VIXA 2KB2A 3BGOP 3DGPB 1MU2A 1M5KC 2N3OA 3CGIA 1PKUA 1RWNB 1XR5A 2LQJA 3N6MA 2CNKB 2XTJP 5BYRA 1H0HB 5T7LA 1FVQA 3NMRA 2YH1A 2BM0A 4LR8A 1FT8A 3RYLA 2MB0B 1RT1A 5E3QA 1UVIA 2OD6A 1HPZB 5JVHQ 1T7PA 4B3MJ 2AJQA 1UEKA 4OX9J 3BPSP 4O3QA 5GAEI 2AT1B 4C0OC 4X62J 5ETPA 3UCGA 2UVRA 1X4HA 3P45B 2H1YA 2EC2A 2DCLA 4CO0A 2NXEA 1VLYA 5KFHA 3NS6A 3E01A 2IA0A 4QU7A 2RAQA 2OPQA 4IOBA 4WFAQ 2JX2A 3ITHA 3P49B 3NGSA 1FXLA 3POTA 2IC3B 3M8ZA 4GRSA 2D74B 2MPUA 3UDLA 2F4VF 5KG4A 1HHTP 3D6FB 4YFUA 4J9MA 3CJQA 2LQ9A 3JQJA 3THVA 3CMAS 3AQOA 2MQOA 4ZCKA 4USWA 1R8PA 1DY3A 5IM0B 3UNYA 4UOHA 1N33F 2N4DA 2BE9B 3LGMA 5DDQC 2RDJA 2PMWA 3IXQA 2GNKA 3J7ZT 1S1WB 4HH0A 2DVIA 4NLGA 3MEGB 5DDOC 2ZBRA 1IM6A 2CIMA 3T5JA 3GV7B 3IBFB 5HP1B 2A0FB 2H48B 4J9PA 2Z8QA 4MAKA 1B64A 1N52B 1WSVA 2G4BA 2LQ8A 3CULA 1ZA1B 3HKZD 4OZ3A 2VONA 2FJXA 3EWGA 1NBEB 2QE5A 2MSTA 3ENQA 3QRQA 1L3KA 2K3IA 4N5SA 2YX7A 1NM2A 3MCMA 1FXDA 1UPMB 1VI7A 1N0UA 3BSCA 3I31A 1Q79A 4NPOA 3MMJA 2W4DA 2DEIA 3RW7A 2VL1A 4OZJA 2VC1A 1P1LA 1NJIT 3BSOA 4JI1F 4RW4B 3N9UC 3G8SA 3QBCA 1RCXB 2BA9A 2J9CA 2MJNA 3VR1A 1T3NA 4X4SA 3MUVP 3PJXA 1TZ0A 1BY9A 4QW9A 3EE3A 4LVNP 3BO4A 5GADU 2ASLA 2J8AA 4F3QA 2PDAA 2WONB 3ZNJ1 3KHHA 2VDIA 2F4FA 5KG3A 1RAHB 4RX6A 3PR5B 2I0XA 2HNDA 4CM2A 2V63A 2GAGC 4CQ1A 2R42A 2AKWB 4IO1A 2ZM6J 2FLLA 3NNHA 4OI2A 3GFYA 1MMDA 4B3OA 1FKAF 3I4HX 3JYTA 3BSNA 3W61A 3C14A 3AOBA 2HHUA 1HNWJ 1UWAA 2XMTA 3Q8VA 3BQ1A 3AJ1A 4M5DB 4P2FA 2G1DA 4JI8F 2Z2ZA 3OFHA 4EO8A 3G82A 4B9MA 4NZ0A 2VG7B 4I7FB 3V6DB 2QFJA 1IKWB 4I6AA 4MK8A 4CYUA 4X65J 1D9AA 4KB7A 3SCJE 2WBRA 2B5JA 1ELOA 2Q1LA 4LUBA 2WVFA 3MMAB 4MKAA 3BV8A 3PV8A 3BYPA 2E29A 2GQQA 3C19A 3SCLE 3OW2R 4BC7A 2XO7A 2W8KA 1KONA 1S6PB 3M2RA 4KGXB 1JJHA 2DHHA 2WB4A 1Q7LB 2HQIA 1UJ6A 2VG6B 4JV1A 1HNXJ 3Q8PB 4C8ZA 1FXRA 4A47A 2HHWA 1VK8A 1DLOA 2B9YA 3J81Y 2CPJA 5BXIA 1I51B 3DLGB 3AOAA 2Z2YB 3IP0A 1Q8KA 2GFFA 3BS9A 3CCUS 4DV6J 5KFXA 2RIJA 5KFKA 3JTPA 3N5BA 2J7WA 1YITS 3QFHA 1M5OC 3PHEA 4C3LA 4FF2A 4CP5A 2C2OB 4O0IA 2U2FA 2ZHBA 4KFBA 3QFWA 4ETZA 3R5GA 4DR6J 4E2FB 1IR2A 1R6YA 5L1KA 4P6QA 4CH1A 1NK9A 4YDDB 1U0HB 3FQLA 3M8QA 3CJ3A 1RWWB 2FC9A 1F5AA 4DFMA 4RZRA 2DXDA 3MTJA 3BB5A 2DBBA 1X31C 2R8HA 2AX0A 2IYIA 4JUZA 4O3RA 2A6OA 3FNNA 4MYUA 5DS7A 3Q83A 1VBZA 3IC1A 1NHKL 1RDRA 3MUMP 5I42A 2UU9F 4ILRA 5G4DA 4ZVUB 1AZSB 2YWGA 3P8BB 4RW6B 1DQAA 2FYXA 1T11A 3IG1B 3QGGA 3R7NB 1C0UB 2YQ3A 2B6AB 3JSYA 4O3OA 1JLFB 1K0VA 4ED5A 2CJ9A 3MI7X 1FNMA 4NEZA 2FJDB 2KVIA 4LSLA 3LP1A 5GMKa 5FLXY 4DL4A 3UN3A 4O0NA 1R0CB 2VICA 3H5XA 2GQCA 4DR4J 3VWSA 4QOTA 4F26A 2AGPA 4HTIA 3TUJC 2ZH8A 1QVGR 3DRSA 5K9FA 3QT6A 2PA3A 3JAMY 1H72C 1OYEA 2AJFE 5E2QA 4ED2A 5KFZA 3LP0A 1T05A 3T19A 3BDEA 2HMIB 1SH0A 2D3UA 2V8DA 4USMA 1S0MA 1R3NA 5KFMA 3CJKA 5L9XA 3HPOA 3QRPA 5H1SV 4P2XA 2FD2A 4YS2A 2MKCA 4LF5J 4OQJA 5HBMB 3Q8RB 4B9LA 2NXCA 4ZLJA 5KFIA 5KFLA 5J1EB 4I0WA 2BVZA 2DYAA 4WFYA 2W2PP 3C15B 2K8GA 2ACMA 2E5HA 2ZH2A 2XEXA 2EBEA 1RAJA 4K7QA 3HVTB 4LR9A 2I5JB 3ET6B 4LREA 1R8CA 4BLGA 3PIPQ 3PW2A 1R8AA 1QSLA 1RWPB 3C46A 3O1LA 2IIHA 1VOMA 3J7YU 4DOZA 4LF2A 2E5JA 1H74A 1S7HA 3W2VA 1VBYA 4I2QB 1U6BA 2FQQB 3JB9k 2BRKA 2NPIA 3AJ2A 3HVRA 4QWEA 1I5OB 1K9MT 5D0GA 3HFKA 3MHYA 5LMNJ 3D5MA 4HH1A 1S59A 4JI5J 3C3LA 1JLCB 1RP5A 2W2NP 2Z2MA 5C25B 1IM4A 2XMWA 3D68A 2BJDA 3KLEB 4OJHA 3Q24A 2FB0A 4NCBA 1TL3A 4OZ5A 4F04B 2LXIA 3DLHA 4FYYB 5CYQB 5A2QY 4NLVA 1BGXT 4ECXA 2G13A 1JLEB 2DPIA 1CJUA 2EKYA 3L3CA 1IKXA 2Z56B 4EYHB 1BHNA 4DG1B 3OV7A 2B4VA 4K4YA 4J90A 1S1UA 3DI6A 3VGTA 4UW2A 3EGVA 4CZCA 2MYFA 5D15A 2P6TA 2X1GA 3R5AA 1T9TA 3AA9A 4C48A 4IRDA 3EVWA 3M30B 1F2HA 2DNPA 4EYIB 2DR5A 3R9LA 4LRFA 3CC2S 4P74A 1LFPA 2BMBA 1ZPWX 4N8NA 4ERDA 1ZBTA 2V0NA 1QAXA 3KWMA 3LA0A 2M70A 1LK7A 2DNHA 2MGZA 4J9NA 2P8IA 5H9EK 4PYDA 2DJWA 3ELHA 1KOHA 3OVBA 5IV4A 2CVIA 2GHPA 1EETA 2OKQA 4BDPA 1IR1A 5CYMA 5EN1A 2BJ3A 3PDNA 2CPFA 9RUBA 2VBYA 3AD7C 5F0WA 4OI6A 2JOQA 3D66A 4FBTA 3ZTRA 4Q5VA 2J76E 4KE5A 4DV2J 3VHQA 4WBFA 1YJ9S 1FJCA 4RU2A 3TEHB 2HLUA 4WIIA 4I56A 1RT5B 3AXMA 4DS4A 4DV4J 4J9RA 3I0SB 2ALYB 1GXLA 1RTHA 1Y7PA 1CJTB 1SKRA 4ED3A 1SJQA 1Q8IA 3A1YG 2H5EA 2ZWOA 2BZ2A 2Y1IA 1WKLA 2MLZA 4Y2CA 2F8HA 2MKJA 2BYCA 2W01A 2QT7A 3TR5A 5A8WA 4HDHA 4I67A 1UCNA 4DL3A 1WC0A 3T1YJ 2GVDB 3LANA 1NPKA 2DNZA 1Y5NB 2IBOA 1RUSA 1FTRA 3QWUA 3TW0A 4KKOB 4F4WA 4IQMA 1GTEA 3NBPA 2VBXA 4KIAA 3NGTA 5KFRA 4ZPWR 1MU2B 4USKA 4AUKA 3H4DA 1U09A 1HFEL 2VA3A 4QIEA 4CH7A 5HJYA 5BR8J 3EMTA 1TL7A 5T7LB 3Q2TC 2IRYA 1R43A 2VC0A 4AXIA 1GXUA 4L74A 4O44A 1WOSA 1RT1B 2Z58B 3VV2B 2HWIA 4LF4F 1TUVA 2UUBF 3IS9A 3CMQA 4DV1F 4LF8F 1FI4A 1HD1A 2R7RA 3KDNA 4JI4J 2DNYA 1YLXA 4YUDA 2IMOA 5HK4A 2HS4A 2ZHAA 3E01B 3PG9A 2OPQB 2WB1D 2PEBA 3ITHB 2O3DA 1RT4A 3O8WA 3POTB 2F9JA 3J7AN 5KG6A 2ZITA 2PI5A 3H5UA 4ZVGA 1KC8T 3BQ2A 3F0NA 4Z2XA 1Y11A 1Q1KA 2B9EA 3TI0A 3MR5A 3HSZA 2VHGA 4TLQA 2XLJA 5J2PA 5D6GA 2UXDF 5H9EJ 2VFVA 2B3TB 4Y28C 4NYPA 4GVBA 1K1QA 2CAJA 5CCMA 2XHWA 4DR7J 1KVIA 3W60A 3UVJA 1JMTA 4ZCMA 2PFDA 3CTRA 4J9SA 1M5VC 1X4GA 3KXDA 1TAUA 2YWFA 3GIRA 1Q82T 2UXBJ 3BM7A 1S6QA 4C4WA 4URSA 4F2RA 3VAIA 5KFPA 3EPGA 1ACMB 2IJRA 1S5ZA 1PYTA 3HHLC 3TARA 1VRTA 3HM9A 5L9NA 1PO6A 4QQBA 1BD6A 1SPBP 1NK5A 4DI6A 3ZZRA 5F8LA 1S1XA 5M2UA 3KDOA 1YDLA 3D1HA 4DPYA 2WSEC 2BUNA 4DPUA 1Y3KA 2ZJQQ 4HEA9 4DR3F 1FJGF 5CH7B 4WPAA 4ZOSA 1XWLA 3RRKA 2VH7A 2K7JA 4K50A 1U48A 3K5OA 5IT9Y 1RE1B 4YY3J 3JQMA 1FO1A 1U0SA 3K17A 2VPZB 4NMXA 4OHZA 2AEMA 4ED8A 3ISND 3UR0A 1RHKB 3QAEA 4EZ6A 3JQKA 3ICLA 1BUXA 1XMOJ 2LVWA 4DV3J 2GV1A 4TQRA 4DN9A 2HNDB 3Q23A 1QAYA 3CO9A 1X0PA 1F9EB 3R5JB 3MZIA 2CNOB 4B3OB 1TK5A 4N47A 3MMBA 4G1PA 2X1AA 3JYTB 1RT6A 2HBYB 1XC9A 1DTTA 2V2KA 4DV3F 4RW7B 4CI0B 9ATCB 5HMWA 5DQGA 2HQFA 3C8YA 2LFVA 3R6LB 4ECWA 3CJRA 1HBOA 2R7XA 1JKHA 1FCAA 3FBCA 1KR4A 1RABB 4MK9A 3G82B 1W26A 2BX6A 1VRUA 3THPA 2DCUB 2J5AA 2HGNA 3GILA 3DHXA 3MM6A 3JSBA 4JI2F 1TL5A 5GAGI 4NLUA 3V4MA 2Q6BA 2WCXA 3B82A 4CYUB 4A8YA 1X5PA 4FXWA 2NQPA 2E9TA 2B5JB 4FPRA 3GJTB 3QNWB 2OGUA 2NPFA 3HF5A 4IO9Q 4DSEA 4WFBQ 3N79A 2UUAJ 2LYVA 1UP1A 4MJKA 3PTWA 2Q79A 2H65B 5AXMA 3M2UA 5D0HA 3DOMA 3M2RB 1WHVA 3P4UB 2ROPA 3US5A 4A4JA 4LFBJ 4FS1A 2XY6A 1PG5B 1RQ0A 5ETSA 3HMJG 2AV5A 1M90T 2G2OA 2HGLA 3R2CJ 4PQUA 4B3TJ 4C98A 1UEUA 2GMLA 4LJMA 1YGYA 1TELA 3IBWA 4A48A 2BOPA 2MLXA 2I9SA 4K5SA 2BW7A 3IR6B 3K57A 4CLPA 2QSWA 4F4XA 3M6VA 2HIQA 5AT1B 5ETTA 5IC4B 1NEEA 4UT4A 2XCPA 4FYVB 1M0SA 2AD9A 4KFBB 4DLEA 5DGAA 3SQOP 3OHBA 3U7JA 5GAHI 4OYWA 4Y3CA 3M8QB 2KFNA 1U2RA 5J2MA 4OYXA 1UZHA 2XMJA 3QO9A 3AOCA 3PYEA 3CD0A 2KZMA 2VFUA 1F5BA 3J80U 2KXNB 1B0VA 4ZPCA 2DNGA 2NR0A 4B9TA 4DV5J 2FJAB 1O5JA 5I42B 2WRMA 1G7CB 2OPPA 1Q5YA 3GIMA 1R6VA 5KT2A 2ZD1B 1KLMA 3HX9A 2G0IA 1TK0A 1MN7A 2E9RX 4X64F 4ZVRB 5KT3A 2CNNB 3M8YA 4GMKA 1HR0J 2BJ9A 1IBMF 5E7OB 2LA6A 1DBDA 1X5TA 3HI9A 1UVLA 1WC1A 3NG8A 2E5LJ 1FF2A 5CZVA 3CUNA 4LSLB 3LP1B 2KG1A 4O3PA 3GYXB 4QWAA 1VR6A 4A8QA 1NUEA 4UOGA 5LOQA 4WFNQ 2GJ2A 4X4QA 2UV8A 1SC4B 4U95A 4FF1A 4KGKA 4OV6A 1SJFA 2RQMA 2VQFF 3CT9A 1QSSA 3M32A 3DRSB 1UA1A 3RW6A 4WXWA 3QGPA 1UFLA 4ED4A 2UUCF 3HXMA 2ILZA 3M6WA 4DBQA 3LP0B 3HO1A 3OUYA 2NCKL 1T05B 4OI4A 2LMIA 1BE4A 2KO1A 3DOLA 3KJQB 2W25A 4DR2F 2CPZA 1IQZA 4CT8A 5LXRA 3CJKB 1ZM3A 4MIBA 2DIVA 4CH0S 3DM2A 1P1TA 4XIUA 4CLSA 2QZ8A 2CPYA 4ID5A 4L72B 1X9SA 1HNIA 2ZVIA 1CC7A 1UL3A 3TYTA 2KFYA 2VASA 3TJAA 3MR6A 2DGQA 1ZAWA 2J7KA 1KWMA 2BKPA 1PJ6A 1AYEA 3M9MB 2ZNYA 4TY9A 1NH8A 2CUYA 4KR0B 1L3VA 3O44A 4DX7A 4NA3A 5F8NA 2XMVA 5L1JA 1VIOA 4ECVA 3SBMA 2BANA 1NH7A 4ZS6A 2R3VA 3BDPA 5DDPC 2QL5B 3NXZA 2Z0GA 3CC7S 1ZAXA 2GJFA 3SSSA 3W2VB 4NLRA 4M94A 4PYAA 4LFAJ 1IWGA 5D3GA 2IA6A 1D8ZA 4WP9A 3MM9A 3ADAC 1H2VZ 1N5SA 3CW2C 2MDAA 2HFSA 4DLGA 4DF8A 3VAJA 4ZVEA 3MEEA 2ACYA 3MEDA 2KG0A 3KKFA 4X66J 3FDSA 4CO5A 1YHQS 2X1BA 4Q44A 1U2FA 3KLVA 1K8AT 4NLTA 2EKNA 1TL3B 4CLYA 3H90A 4U96A 3DLEA 1ZM9A 2OEJA 2PC6A 2DNNA 3H42A 2FVPA 2XNRA 4P2MA 4ELTA 4OZ0A 4W98A 1EQ0A 1YJ7A 2WAQD 4HHJA 1CJUB 2E7VA 1IKXB 4XAKA 3P6YC 1ZTTA 5KFYA 5K5MA 1XNQF 4JI3J 4F36A 1EKRA 2C42A 2YY3A 1S1UB 3DI6B 3NY0A 1K44A 5IWAJ 4DV7J 4XK8C 2KT2A 1HL6A 1FDNA 1FRHA 4JV5J 2W9BA 2OELA 4WTYA 1M5HA 1REVB 4B3SJ 3PY8A 2X3GA 5C7PA 4LSZB 1YBAA 3IM8A 1VFJA 5EWFA 3TVYA 2MGZB 1RSCA 1X60A 2H5IB 5IT4A 2M3DA 2XZWA 3W65A 3JXOA 4JV2A 3N4WA 1XBWA 2C2RA 4RNHA 1EETB 1UVMA 3UN5A 2IVFB 2KI2A 5CYMB 3SV4A 2YH0A 4ZP8A 1AA1B 4V1Ak 2ABYA 4Q45A 3GONA 4JI6F 3MPWA 1Q78A 2HNZA 4HI1A 3HFVA 5KFCA 3ISZA 3T9ZA 1K1SA 3TAMA 2CG8A 2HZVA 3HZGA 3NRBA 3ZTOA 3DDNA 5HMYA 1Q7YT 3CCSS 2JH3A 3GR1A 2QEXS 1RTHB 2OI2A 3G86A 4IR9A 2ILYA 4DEZA 1H6KX 1Z4UA 3HK2A 1ITPA 3K5NA 2P6SA 3TX0A 1C0TA 4HLBA 2HLTA 1WWHA 5A8WB 4PUOA 3HJVA 2J0SD 2L3MA 1RHMB 2DNMA 3G6ES 1TU0B 2OHDA 2BJ7A 1BWEA 1YJTA 3NBPB 3OVSA 2PT0A 1FE0A 2G2YA 1RHUB 5I3UA 2HK3A 2KFZA 1UVKA 2GIFA 4LQ9A 1TL7B 3CJ8A 2VBWA 3K5PA 1X4DA 4P73A 2BRLA 2JFDA 4O44B 3V6HA 2C28A 2WZ1A 4AQYJ 4L3NA 1NHUA 2RNEA 2ZNZA 3PFEA 3TO8A 4PPDA 3M9OB 4ZJLA 3IS9B 4CLKA 4NRTA 3DCAA 3EX7B 1JJ2R 2BKOA 5IS2A 2N4CA 5KFBA 1NKBA 4KSEB 1C1BA 3CF5Q 4DSLA 2ZC4A 2FZKB 3F73A 1RT4B 2OFHX 1ZZNA 3H2VE 4N76A 3W2WA 4E0DA 3CCQS 4RR5A 4MKYA 2XI2A 4OZ1A 1RWVB 2FHJD 4GKKJ 1JK9B 1N48A 1VLOA 2HS0A 5ADZA 2KM8B 2B43A 5J2PB 5I3QA 4GVBB 2R8GA 2XGQA 3KLFA 4G3IA 2AYMA 5HLFA 1QM9A 1SCJB 3UVJB 1QE1A 3CWJA 1WDTA 5AXKA 2R7TA 1WTFA 5CCLA 2JFKA 3TAQA 3BO3A 3FCHA 3MOZA 1WEZA 1ZYQA 3MFHA 1WSRA 1CBKA 4A8OA 4JYAF 1S6QB 2UZAA 5BJRA 3E2EA 1Q86T 1U7LA 4LF9J 3BBBA 2EPIA 4C8NA 1VRTB 2CPEA 1KP6A 2ZDPA 1X4AA 2GC8A 4OHYA 1T94A 1F3VA 1S1XB 5KFSA 4Q43A 2J6SA 3UCZP 5K14A 3G6YA 1YBTA 2RU9A 3C66A 4OLOA 3ZZYA 4KAIA 2ALZA 3GB0A 1R89A 3VAHA 3QSYB 4YP3A 4U8VA 5A76A 2OUGA 3R97A 2QA4G 4WYLA 1MNEA 3OXFA 2CJAA 1VHIA 2F8MA 3W5YA 2A2DA 2HWHA 2EG2A 5LMUF 4OFZA 2SXLA 4QW8A 2C3OA 4CTAA 3HP6A 1R0AA 1SVDA 2I8EA 3M9NB 3K2YA 4NLQA 4IOCQ 3FZBA 4HDGA 3AB4B 1SJ1A 4NCGA 5KT6A 4MYTA 3PKYA 4NLXA 1T8EA 1QVFR 3BREA 3P5TL 3ILLA 4FP9A 2E1RA 2RSQA 1UETA 3M2VA 3OL6A 2CJKA 2C22A 4EK2A 2FY8A 2BACA 3MMBB 4DL5A 1RT6B 3TZXA 4NZ7A 2JLGA 2POKA 3OXLA 4PG8A 4QYRA 1AUDA 2XMKA 4KYZA 1HBOB 1JKHB 3KG1A 3N0VA 4KPYA 2HBRB 4OYPA 1VQ7S 1RBOB 2RH3A 1NB7A 4TU7A 2W4PA 1VRUB 4OJ3A 1VQ8S 3LALA 2D41A 3C16A 4TLRA 5MAOA 1RB0A 3MM6B 2NXNA 2ZH1A 4WU3A 4R5PA 1T9UA 4RNOA 1RADB 4MFBA 4ER8A 3OTBA 2HWTA 1R8HA 2M4MA 4H54A 4QWCA 2XZTB 3D6HB 4J9QA 1I3OB 3KTQA 1KN6A 4R8UA 4RLEA 1WDDA 3M2UB 4DXLA 2B4PA 3DOMB 1ZM4A 1FRLA 2G0CA 4FYDA 3Q2SC 1RYSA 1CQNA 1TMJA 2DHSA 1B4SA 3ZZUA 3RAMA 5A6PA 3MM8A 4AXJA 1N5TA 1QJHA 1UZDA 4LFCJ 4I1TA 2IAJA 2HQCA 3BGLA 2CDQA 1PAEX 2HVEA 3HHNB 1XMQF 1OSCA 2KL8A 4HKQA 5D4OA 2J6TA 4PQUB 4QIVA 3A8JA 4TKTA 2ZOGA 4KH1B 5G0RA 1RAFB 1XR7A 5KG1A 4DL0C 4ZJQA 5JMNA 5LSRA 4EI2A 3CCZA 4BWJA 2JC0A 1I94J 2HRYA 3M8PA 4BWMA 3IBCB 2Y8WA 1QAIA 4MMOA 4ZCLA 3UPFA 3M8RA 4Y2MA 3RTVA 3OTCA 5DM6Q 2JEJA 4DUZJ 4PWWA 4DR1J 2HNYA 2MMYA 4KV8A 4PAAA 4ZVFA 5J2MB 3QO9B 1AW0A 2VIHA 1O8BA 2XWXA 2JZ5A 5F3TA 2E5IA 3ZZ0A 2COLA 3TAPA 5ETRA 2PGCA 2KJVA 1AXQA 2PSZA 2P9CA 4HYKA 1B3TA 1VQ6S 2OPPB 2AHOB 1NDCA 2NUHA 2FHMA 5LJ5Y 1KLMB 2RKIA 3NKYA 4ZPVR 4NCAA 4G1QA 3H98A 2JHEA 1LEOA 2WSFC 1FFGB 4MKBA 2PE8A 2DGWA 1KTQA 3UNGC 4ENOA 4L76A 3GFZA 2R2RA 3MM7A 1DQ9A 3FQKA 4NI2A 1S10A 1OY6A 4KTQA 4R0EA 4YHHJ 3W64A 3RAQA 2Z2LA 2DKOB 1L5UA 1RKIA 4FDFA 8RUCA 3HVAA 5KTQA 3EUNA 1D3WA 3M32B 2J9DE 1WC6A 2NZ4A 2HHQA 2NYHA 2ZE2A 3TJ9A 4DF4A 5F3ZA 5C24A 4K4TA 2AGOA 1JQGA 5DZ7A 1NXIA 3WZ0A 1QUPA 2ZVSA 2UXCF 3VZHA 2W1BA 2IYGA 3W3SA 5KT7A 3OUYB 3ZZTA 2YWKA 2HFNA 1PYOB 3L95X 1TR0A 1GH8A 1K73T 3DOLB 4KHPF 1SQFA 1RA6A 1GMWD 3RUBL 1A0OB 3DM2B 3PX4A 4WP3A 1MROA 1RT3A 2CPXA 4ID5B 5KFOA 3IN5A 4F8RA 2OJ3A 1D0EA 2VB6A 2YNFA 1PJ5A 3R5CA 1LWEA 5CXTA 3MOJB 1N34J 4DU8A 1NNDA 3SSQA 2DGVA 3LOUA 4F4KA 4V19X 3CIMA 4NX9A 4RW8A 2FVQA 5B08A 4I2PA 1GK8A 4JI7J 1EJ7L 4B9SA 4J9VA 3U27A 2UV8G 3HHLA 4KO0A 2PFFB 4OYAA 3NCPA 4J37A 3GG1A 1T9XA 2R7UA 2BANB 3DRYA 5EHHA 2Q43A 1Q53A 2XSJA 3P3DA 4H4OA 4CDIA 5D3GB 2AW0A 5FJ4A 4H4MB 2FJBB 2F1FA 2AYEA 3MM9B 4YB7A 2XY5A 1DTQA 5F9LA 2IRXA 1ZETA 2ZJRQ 3MEEB 1OQ6A 2FPHX 2ZBPA 2HFZA 3MEDB 2IMWP 1C4CA 2WOMA 4U7UK 5B0GA 3OVAA 3OBIA 3A13A 1RK8A 2MHEA 3FBEA 1KQKA 2J0QD 4IDKA 2D3ZA 1XIQA 2RT3A 1SKUB 2H9ZA 5EWGA 2WTFA 2AJ4A 3KK2A 3BJYA 4C3KA 2DGSA 5AXNA 1BQNA 2BE2A 3PJWA 3AT1B 4S0MA 2DHGA 2XLIA 3IR7B 1FD2A 2FHKA 5KFTA 4KT0C 2MZQA 3ENVA 4EBDA 1YRXA 4GKJJ 3HHKA 4IRCA 1NSQA 3H5SA 3A3NB 3JTNA 1S9FA 2KDOA 4Y0FA 3QJPA 2RRBA 3VGVA 1IBLJ 2XY7A 2NYIA 4FF4A 1VBXA 4IFVA 1SIZA 2GGPA 4OZLA 3HT3A 3ENAA 1RISA 3T1HJ 2ASDA 5B0DA 3T6JA 1JXEA 1YI2S 4HI2A 2QX0A 4QCLA 4UZBA 1U1KA 5D4LA 2V9WA 5HVFA 3DDKA 2FGCA 4NXMF 1YG0A 5F8IA 1ZPVA 3Q8SB 1WTBA 4ZHRA 3ZTPA 3VAGA 1F0XA 2K3KA 2JC1A 2Y9HA 4CNYA 1PC4A 2RS8A 2HNZB 1YTYA 4CWBA 2VU5A 4Y2KA 3MCSA 2OSQA 1U8WA 2EC0A 4AL7A 3HHDA 3KJVA 4IOAQ 3GR0A 3LP2B 4IKAA 1YJUA 5GADI 1JXLA 2QFIA 3DRRA 2WSCC 3PFOA 4YEAA 1HWIA 2DO0A 1NSAA 1WHWA 3WIVA 1SQEA 2XC9A 2ZZMA 1WELA 2BKNA 2FIUA 2HFUA 2MXYA 2CQBA 4G65A 1RTIA 3GV5B 4K4XA 2W8LA 1TL1A 3MXHP 1JLQA 4LR7A 5A0YB 3AQPA 4IH5A 4PUOB 1HA1A 3SFUA 1FEHA 1ZZFA 2YTCA 1HYSA 2VKZG 4F4YA 3ZTQA 1QY7A 3L9ZA 4A8FA 4LRCA 1U1RA 2F65A 5I3UB 4NLDA 4DX8H 2DRDA 1RAIB 2HBZB 2CDRB 2R7WA 2DR7A 1O6XA 5I3PA 1NPRA 3EGNA 3VAKA 2V94A 2CXEA 2V69A 3TJ8A 4F2SA 1EHWA 1HARA 5I4MA 2OPSA 2NREA 3LWMA 1UFKA 2EEYA 3G8QA 3D7SB 1ZOTA 2CWKA 2GHVC 2L08A 4RBTA 5LJ3Y 3TQEA 2DY1A 2IJFA 4DSFA 2NSCA 2ZH4A 4PWUA 3SMZA 4NYZA 3N01A 1EP4A 4YDXA 5KG7A 1VDHA 1XERA 4NLPA 1AFJA 1HKAA 4FVMA 2F4VJ 1RWMB 2D9PA 3EVOA 4IRKA 2QLWA 3W2WB 2OMOA 5DO2A 1F6TA 2YKNA 1U02A 3CCRS 2H51B 1N33J 3M4XA 2FZGB 4C7QA 4ZKAA 4KHMA 1NCLA 3CE8A 2RB7A 1P9YA 2M9KA 5HJXA 5IT0A 1ZAVA 1FK9A 1X8DA 2DR6A 1D9FA 3KLFB 3IFEA 4F02A 1R7IA 1NO8A 2OIHA 5HLFB 1TUGB 1Q5VA 1RU1A 3NGDA 1QE1B 2XYGB 2JEIA 1HHSA 2ZKUA 4YR0A 4O23A 2RQ4A 2DNQA 4NYOA 3KNAA 2A1BA 1Z2ZA 2HRUA 2CQ2A 2X3DA 1RAGB 4DPTA 3CMES 3GJRB 4F3OA 1SV5A 2HFOA 2KXHA 3LUYA 1M5SA 5AJ3J 3JSRA 2GA7A 2B8QA 4HT7A 3DYAA 1GAOA 1SL2A 4A8KA 1RT2A 2MKSA 2GW8A 2JVOA 1RCOB 5J2QA 3FJ2A 4Q0BA 5HATA 2DIUA 3I5BA 4BBYA 1YK9A 5K14B 1U4BA 3H59A 2AGQA 2A10A 5AJ3F 5ETKA 1DAXA 4N77A 2B7CB 3SSRA 4PQAA 2ZHOA 1YZ7A 4JI1J 3EDRB 3A8IA 3T5LA 4C11A 3OFEA 5HN0A 2HG4A 3K8VA 1RHJB 1SQGA 2FJWA 4HR2A 2V4JA 4MK7A 1I6JA 4CTAB 1R0AB 3IWNC 3D6MB 2AIRB 2IVYA 3OJUA 4NCGB 2L9DA 4C8OA 4RJVA 1NLKL 4XO0A 4ELVA 2RS2A 1HWUA 1RTJA 3HZEA 5A6WA 1N56A 3T5KA 2E1AA 4M5NA 1U25A 4OI3A 3PR4A 3M2VB 4LIWA 1NB2A 3SIPB 3CJTA 2XCAA 1WF2A 4TN2A 4C8KA 4IFYA 3T41A 4F7VA 2HSEB 2MZJA 7FD1A 1XMBA 2K06A 2PEHA 4HTJA 5DQIA 2CZ4A 3H7HB 4JI8J 3GTYX 4LIRA 1WD6A 4EFAC 4DX5A 4OL8A 2R7VA 3AJDA 1WJ9A 1VC0A 4DPWA 1FJEB 2R7OA 4WK1A 3TUPA 1M1KT 2HHTA 4M5LA 2XNQA 2HHHF 4R5PB 2R2TA 2E1CA 2J8SA 3ONQA 4MFBB 4CCHA 3JSMA 2OTLS 2HVIA 4HHHA 4USTA 2QA2A 4KGMA 3HVWA 4TYAA 1IBKF 3J7YI 2C3MA 3FZ2A 4R8UB 2D3OR 3M8WA 4WFZA 3QT8A 2LLZA 4AFFA 1KOOA 3K58A 1AT1B 3OT9A 1IJFB 4ZVTB 4UZCA 3MM8B 1TVRA 4PWDA 1T0TV 4ES3A 3SCIE 1HQEA 2IAJB 1R27B 1S79A 3KOAA 4J5OA 2YBVA 5LXYA 2B51A 4OX8A 3PW0A 4DU7A 1VJQA 4KGZB 2RF2A 1FTCA 3GV8B 1HI8A 4P10A 5CD4H 2HQGA 3MAAA 5K8MA 3C2PA 5G0RB 3BN4A 1WKKA 1S7IA 4B3RF 1J5OA 1IR0A 3NGUA 3D3CJ 5THWA 1MN9A 3M8PB 3CSKA 3MEKA 2R7QA 2N7CA 2HBQB 3TOQA 4QYZK 2Y1RI 4JI0F 3MPVA 2WVEA 3GG0A 2CRLA 4RL1A 1KQFB 1KLNA 2DISA 2HNYB 5C2GA 5EX0A 4KV8B 3TUZC 1G2EA 1FDBA 1BLUA 3PRVA 5B0BA 4OZNA 4ED1A 3ILIA 3QT7A 3RB0A 2OO4A 4L6V3 2UU9J 1WI6A 4DR5J 1SKSA 1HNVA 3ENWA 4DHVA 2DGOA 2XMAA 2B8PA 3IR5B 2AWZA 1FRXA 1YQHA 4Q8FA 2C2EA 1BMQB 3LQVA 2RKIB 3D1OA 3V6JA 4QWBA 4G1QB 4DR5F 2DPJA 2HQDA 5KOWA 1NHVA 2F7VA 5J2NA 4PXBA 4ECQA 3MWBA 3R5DA 3MM7B 2WVDA 4ZP6A 4NI2B 3K7RA 3PW5A 3DKDA 3BPDA 1YRUA 1MWZA 2D3O1 3IRXA 1HBNA 2EWHA 3B4DA 1RAOA 1S12A 1U8SA 4ECUA 1LXJA 1U49A 1YJNS 2HQ3A 3FEZA 1SB6A 3UD3P 2ZE2B 5C24B 4CO4A 3QRRA 2XS7A 3CB4A 2ZZTA 3AD8C 2DH8A 4TXSA 3IM9A 4F3MA 5ITHA 3SQGA 1AFIA 4DFPA 3B4MA 3GLJA 3GP9A 3G71S 2J0WA 1XQIA 3PRDA 2AZ1A 2QV6A 3ETOA 3MGJA 5EWEA 1MROB 3IO1A 1RT3B 2IFXA 1VCTA 4ILMA 2YNFB 3W8PA 4DV0F 4NL5A 4Z37A 1LWEB 2O67A 4K59A 4DL6A 2ZH3A 3KUGA 2FY1A 4RW8B 4YR3A 2HHXA 2K1RA 1DRZA 2LQBA 4U67Q 2O1PA 2W2QP 3HHLB 2QLJB 4RUCA 4Q7AA 3A3OB 4K0KF 3GSDA 3I87A 3O6QA 2ROGA 2FGOA 2M8HA 1FRKA 2DB1A 5E41A 3LO3A 4C8MA 2VQEF 2XSJB 3ETMA 8ATCB 2DK2A 3EYZA 4H4OB 1G4CA 5E3CA 1UKUA 4QYZJ 4QIFA 2GAHC 2OMLA 3D6TB 1JIHA 2YKQA 2GHWA 4P7VA 1SC6A 1DTQB 1N6QA 3OTOF 2CJXB 4K4UA 3M8SA 3FKBA 2CJQA 2NLWA 4WP8A 3ILJA 1MWQA 1TK8A 2WOMB 2DH9A 1FX4A 5LT5A 3T5HA 3CNQP 4PRFA 4G6VB 3W9JA 1IWAA 4IDKB 3QGIA 5A8KA 4NA1A 4WFXA 4ZMMA 2LKZA 3KK2B 3ULHA 3AODA 1LKZA 5KFGA 2IRUA 1BQNB 4D3GA 2BE2B 1OIAA 2MKKA 3QWPA 3FCVA 1QD1A 3BBCA 2VJVA 3IAS9 4LF6F 4P72A 1VC6A 1NU4A 3WQPA 3X1LB 2RQCA 1RAEB 3H40A 5DGBA 4DJBA 4BCAA 4DL2A 5E33A 3GPAA 2ZC3A 1CVJA 5KT4A 3KHGA 3WC2A 1J5EJ 1X4FA 4RWXA 1X4BA 4IFVB 3CCLS 1WKJA 2EFNA 3PIOQ 2GGPB 2JNJA 1MMNA 3UI3A 1OS5A 1CPZA 5CA5A 5SUHA 3UO0A 3GYGA 3EICA 3FEYB 2Y8YA 2AZ3A 3E8OA 4HACA 3PW7A 4A8XA 4DWIA 1J5EF 3G8TA 3QIPA 1VMBA 1RA7A 4YB5A 3J81U 1IKVA 3RU0A 1VQPS 2GIRA 3KLHA 1L3UA 2CZ9A 4ZHRB 1XTZA 3KUHA 2XMMA 1FA0A 5ETQA 1X4CA 5AE2A 5HVHA 3MCOA 6AT1B 2QRRA 3KYLA 4GO7X 1MSWD 1N5VA 3MURP 5K20B 3FRYA 3A4TA 3BN7A 4EEYA 4DX6A 3KJVB 2C2MB 1TFYA 3DRRB 1CJKA 1H73A 2LDYA 1ZM2A 3H20A 1EB0A 3O2IA 2FUG9 4ES1A 4M5HA 5HANA 3NOCA 3TX8A 4DCPB 3OFGA 5JVGQ 5KFJA 5HQ8A 1RTIB 3FEXB 4PCQA 1TL1B 1JLQB 2DO4A 4WIQA 1O0PA 3DHWC 1EKSA 3HLUA 2LCWA 2L9WA 2E44A 5ETNA 2ZZNA 4NLOA 3TANA 2LEAA 2W9AA 4C2MA 1VYAA 1HYSB 3H4BA 3GJQB 5GMEA 1UW9A 1L3TA 1RXOB 2RJZA 1NK8A 1R8BA 2WVBA 4I69A 2OLWA 5KFDA 4LT6A 3EM1A 1A9NB 4J9OA 3PW4A 3BSAA 3GQCA 2R2SA 4K4ZA 3DDIA 2CQ1A 5EDWA 1XNRF 1U1MA 4RWWA 1NK7A 4CIOA 1RT7A 3RBEA 3QZ7A 1FWLA 4PXCA 3WX8A 4LF4J 5FLXU 2UUBJ 4AT1B 1ZTWA 2OPSB 4ECRA 4DV1J 3F41A 4LF8J 2V2VA 2EFPA 2M2BA 3ZNUA 3I82A 3FGVA 1FKOA 4N7TA 4ALZA 3L09A 4M5MA 2E5GA 3UFCX 3OD2A 4TU9A 4M95A 4CNZA 2O5DA 3JAMU 2J7UA 1TAQA 4URQU 1EP4B 2PD1A 4E8UA 1VISA 3OHAA 1M5PC 2EFVA 1S0NA 1FRJA 4QIGA 2YKNB 4TNOA 3MAQA 4OX6A 2UXDJ 5KT5A 3GJSB 1RAAB 4O4GA 3DC2A 3M1VA 1FD8A 1GMUA 3VVTA 1FK9B 2LQ5A 2BOAA 4P7TA 1SKWA 1RT5A 1SH2A 3B8HA 1H7WA 1FEEA 3QJLA 3R27A 1GXTA 4OIXA 3WX4A 5JJBA 3MD1A 4PXDA 5E3AA 3GE9A 3HHEA 4IYQA 4NXNJ 4FYWB 2IBKA 5B7WA 4QZVB 1UTAA 1VQYA 1UFWA 1HBUA 3VQSA 1TKDA 2JLEA 2JLFA 2YPZA 1Q8LA 4M8LA 4A8WA 2XGPA 3R1HA 3BKTA 1S6OA 1SV5B 4N41A 4RBUA 2APOA 5JXSA 3B6BA 1OMSA 2M88A 3CDBA 3DYAB 1RT2B 4NXNF 1RZMA 3BGFA 4ICLA 4G1IA 4EBEA 1CC8A 5J2QB 3WC0A 3BH6B 2E66A 4Q0BB 1XJWB 4ZN3A 3VAFA 2AYBA 1A7GE 4X4TA 2DXFA 3S1TA 2HHVA 1W2BR 1TMMA 3VALA 1CS4A 3I5AA 4DR3J 3DMJA 2YX4A 1FJGJ 2IPOB 3FMBA 4CM0A 1NDKA 5KFUA 1JLAA 2CG4A 2M5YA 2PO4A 5A2QU 4JV0A 4ILLA 2DGTA 1SUQA 4C11B 1LWCA 3CDEA 5E5NA 3WIUA 1OPIA 3EPIA 1MG7A 1IUJA 1XK8A 1TKXA 1DURA 4U6PA 3LH2S 2GZOA 4CLTA 2V4JB 2E7WA 5KFNA 2DR9A 2N3LA 1D8YA 2RILA 4K4VA 4LBHA 5DETA 4W92B 3NWRA 4YR2A 4KC5A 3VCDA 2AQ4A 1UW4A 1RTJB 4PZVA 2VF3A 4NE9C 1LW2A 4B3MF 2CQIA 3HSGA 5KFFA 5EUHA 2XM3A 2XHCA 4I68A 4OX9F 4IFYB 1P8GA 1FDAA 3PO4A 2QLBB 4XDDA 4X62F 1LWFA 2CFXA 2WHOA 1WOOA 3HKWA 1HBMA 4ZJOA 4WKRA 3KLGA 2MZTA 3ZXWA 1YRTA 1JJ4A 2RD5C 3I96A 3C14B 4JI2J 1GEHA 4EGLA 4CLUA 3I32A 2OEKA 4DUTA 3KK1A 2MY8A 2BW2A 4WTOB 4RNFA 1WACA 3H5YA 2RMLA 2G0JA 1WC5A 1NKEA 3NS5A 1D9DA 3MECA 3U1LA 3JSMB 1FKPA 2EFGA 4WU2A 1Z1ZA 4F4AA 4WZMA 3RAXA 1N36J 1VQKS 3QLHA 2YNIA 1UJ5A 1S72S 3ZZPA 5J1PA 3OSPA 2DHAA 2QLFB 1WUUA 3Q0AA 3RZAA 5KG0A 1YIJS 2R8IA 1Y5IB 4RPFA 1SH3A 1QAJA 1FWKA 4WK3A 1F2GA 4DMZA 2GS8A 1TVRB 4PWDB 1YJWS 3CO0P 1N36F 1HQEB 2BQ3A 4ECYA 4DS5A 4CLWA 2Z30B 3P96A 5GVQA 4I64A 1Y0HA 5FDLA 1S97A 3UD4P 2RF2B 2QLXA 3MAAB 1KQSR 2I38A 2VD3A 1QUVA 1DLOB 1J5OB 2DTJA 3PZPA 1DZ5A 1KTVA 2MEWA 4Y65A 1VRQC 3OJSA 4U8YA 4ZCIA 1P9QC 2QJ3A 3MR7A 1VQOS 3MDFA 1U26A 2CQDA 4CLZA 1V5VA 2FVSA 2Y0SD 4OYIA 4I6YA 4LRDA 5KFQA 1PIEA 2OSRA 1HD0A 2W9CA 2CPIA 3D28A 1XN9A 4ZP9A 1B7FA 4B17A 4ZLNA 1GFWB 3WHIA 1JJCB 1VC5A 2ZJPQ 2CA9A 2OPRA 4WE1A 1HNVB 1Q0NA 5F8MA 3OR1A 2ERRA 2FLOA 2YQ1A 4RW7A 3TZWA 1N5YA 1T3OA 1WG4A 4W4MA 1LXNA 4PR6A 4FXVA 4X64J 4LVOP 2C3UA 1RKJA 3GWCA 3BR9A 3NNAA 2ZM6F 4UOFA 2HZAA 1IBMJ 1BC6A 3LPYA 2MQNA 3PYFA 1PBUA 3ZC4A 1WF0A 4K8RA 3OL8A 2HVDA 1YSJA 4OLPA 4ANEA 1HNWF 1HMVA 2FC8A 2CQ3A 2KRBA 5J2NB 1WEYA 2DHXA 4A46A 4M63A 1S0VA 5BYSA 2DNRA 5JUMA 1RLCL 4FNHA 5AE3A 3IRXB 2BV3A 1HBNB 2OH2A 5F0UA 3A8EA 1HQ2A 1RWOB 3O5TB 2VQFJ 1S4EA 1HNZJ 3D54A 4X65F 3OR2A 2ASJA 5DLGA 4NLYA 2UUCJ 1S76D 3FSYA 4EU0A 1KD1T 3D1QA 1HI0P 4ECTA 1FDDA 1UVJA 3KG0A 5GAEU 3CJSA 3QZ8A 1TUWA 3SQGB 2A3JA 4ZPDA 1HNZF 4K2JA 4DR2J 1IXKA 3PJ9A 2NXJA 3NOGA 5IFMA 3CCES 4WKYA 3KFWX 1HNXF 4C9DA 3MMCA 3RBZA 2AYGA 4RNNA 1YWXA 4DZDA 2CKWA 1LW0A 3QPIA 3KK3A 5IT9U 1UAWA 2DRBA 1KDNA 2K1RB 5KFEA 1QDUB 4DV6F 4MKVA 2IM2A 4HHUA 1NDLA 2GX8A 1HLWA 5H9FK 4ANCA 1S4FA 1SL1A 3MR2A 4TVAB 3CCMS 2JDJA 2AEJA 3I6PA 5K8NA 2QC3A 3D0GE 4IG3A 1UMJA 1C1CA 3Q89A 2UUTA 4DR6F 2CJBA 1V6HA 2MZSA 2FJEB 3C6UA 3IGNA 5IOLA 2ZOFA 1N6QB 3Q8UA 1WG1A 1MMLA 4ZVPB 3OL7A 1WI8A 4J7CA 3K5MA 2ZD1A 3PACA 3KLIA 4LMZA 4ZIVA 2YNHA 3GU0A 1UA0A 2CZVC 2E9ZA 1OWXA 2V2QA 5A8KB 2EW9A 1TL4A 1FWPA 4USVA 3S6EA 4EUVA 3GZ7A 3V6KA 1FRIA 1KS2A 4WJBA 3TZZA 2R2UA 3K0JA 1XNQJ 4DUYJ 3F44A 5CHCB 2VPWB 3V81A 1UWBA 3U02A 1HQUA 1MWYA 3RB3A 1LWXA 2JRSA 3KUEA 3L7OA 4DDFA 1ULRA 2J6UA 1BQXA 1S9EA 3Q86A 3PKMA 2F8EX 4F50A 4OYMA 4DUYF 3RB6A 1SC3B 2AEFA 2HRTA 4QPTA 3OL9A 2V34A 2KT3A 2FLPA 1REGX 3SYZA 2BBEA 1U1PA 4NLWA 1KEKA 3MPDA 2RHSB 4IH7A 4DQQA 3G4SS 2WK4A 4HACB 2Q6CA 4RBVA 4DR4F 3UDEA 1VS3A 3R5BA 2EXUA 2CPDA 3QIPB 3DU5A 1IKVB 2Q3PA 2IM3A 5C5JA 2YWHA 3KLHB 2LU2A 1F3FA 1SJ3P 4YB6A 4JI6J 2CQ0A 2ZUAA 4FF3A 2FTRA 4TY8A 5F8HA 2VPXB 3P5BP 2G2ZA 2GJIA 2P2CB 2X7IA 1HHQA 4D3HA 4ZPTR 2KRRA 5ETLA 2AF6A 1CJKB 4LF5F 3G96A 2W7AA 2M7SA 1F1BB 5EX3A 3FBBA 4DPOA 2VOPA 2QMXA 3E3XA 4P2SA 2OP5A 3TQ1A 2FHJA 3GMGA 4YQWA 2ZKTA 4DQPA 3QMQA 4BC9A 3RB4A 3NNCA 3IRWP 5H9FJ 1S9GA 3HSJA 2ZBIA 7AT1B 4H4KC 5IXUA 2JL9A 1KKHA 1T03A 2XI3A 3DN9A 3AAWB 4KGVB 2DT9A 5ETVA 4BHQA 5HO4A 5CZXA 1J2VA 2QG9B 5LMNF 2BJEA 3NCRA 3SXLA 3QJJA 2JEFA 4K4WA 3BGRA 1DQ8A 4JI5F 3V2UC 3QIDA 4DSKA 3TA2A 2XWYA 2F9DA 1RT7B 3J7A1 1Y5LB 3CCWA 3OLBA 3MAHA 1RWKB 5AXLA 4PEOA 5L39A 4DCJB 5HMZA 3AHPA 2IHR1 1IKYA 5L1IA 3HT0A 4YOEA 5DZ6A 2ZEJA 4LF7J 1RWUA 1FKOB 1UVNA 1REVA 2IDLA 3I56S 4ATNA 1MW7A 2YKMA 2C2NA 1S6UA 2O66A 1W2IA 4L3KA 2BR0A 3I9ZA 3L7PA 1B0TA 3AB2B 2MQQA 4WCEQ 3DRPA 4LF7F 3MF5A 3UWTA 2XMUA 1MLAA 5B0CA 4Y00A 4PXEA 1H98A 2ZDOA 3RGIA 4O4GB 2QO3A 3ZZOA 3M1VB 2XYHB 1Q16B 3SZ2A 1L3SA 1ZA2B 3NLCA 4DSIA 2D9OA 3ZO7A 1NJZA 3QATA 4F4ZA 5KFWA 4QU6A 4C97A 2E7XA 1W25A 3K5LA 4ZVHA 4JYAJ 4DV2F 1HBUB 3IMQJ 2W2MP 1FRMA 1RTZA 2VKRA 3TEGA 1M1GA 4DV4F 4X84A 3KG4A 1IVZA 1RBLA 2ATLA 3HDSA 1OY9A 1K0TA 2H5JB 3DRXA 3UQSA 4IR1A 3FRZA 2HAIA 4X2BA 4ETXA 4ICLB 2DEJA 3W5XA 2KZZA 3IWXA 3T9NA 3FFIA 1N0VC 3HSDA 3LW5C 1OY8A 1CS4B 4NWBA 3DMJB 3HD1A 4PG7A 2NUUG 3T1YF 4P71A 3UDVA 3H25A 2HZCA 2KYXA 1JLAB 1PCAA 2Y1LB 3NCQA 4NRUA 1SUQB 1T9WA 3D2WA 5LMUJ 4E98A 1LWCB 4P9SA 2MKHA 4TU8A 1HWLA 2Y3YA 3BR8A 4J9KA 1TKXB 3AH6A 2UVWA 1CG2A 3DXBA 3PCOB 2W4CA 2KVQE 5BR8F 4XPEA 3GFXA 1HIYA 4I4BA 3EZUA 3AA8A 4JB8B 4NOHA 2L9NA 2BQUA 4M5GA 1AUSL 3D4JA 3AD9C 5F8GA 2BXJA 3V5RA 3I0RA 1Q95G 2IY5B 1IBCB 2KU7A 2MKIA 1LW2B 4UUWA 4PPZA 2HPUA 2HGMA 4UUXA 3BKUA 2YPYA 2NSBA 2XZDB 5KFAA 4JI4F 1LWFB 3J80Y 2KHCA 3D3BJ 5L1LA 4KHRA 5DG7A 1HBMB 3KNGA 5HI7A 3KLGB 2BJ1A 2YVSA 2ZFHA 3D0IE 2FHOB 1DTTB 3JTOA 1GX6A 2VG5A 4AD6A 1B7YB 3O3LA 2I2YA 4OMFG 2VFRA 4OV1A 3KK1B 2CQHA 3NL0A 3VF0B 4ZIWA 4XPCA 1U1LA 3N6LA 3K89A 3MECB 4WWSA 1FKPB 3C6TA 3CCJS 1CJVA 4WF9Q 3QLHB 2P9GA 1BQMA 2YNIB 2DGUA 2V8HA 1WF1A 1FE4A 5IQQA 4DR7F 5CAAA 3RRGA 1KVKA 1HWKA 4ZVSB 1OYDA 3MPYA 4ZITA 2VZ9A 2UVVA 4USUA 4Y6IA 1NMEB 2XG8A 4M5IA 3X3UA 5HQLA 2BM1A 2UP1A 2UXBF 3DLJA 1XMQJ 3RR8A 2C1EB 2F5GA 5FDLB 1LV5A 3M7VA 1PSDA 2KJWA 3DLKA 1QSYA 1VBKA 3G9CA 4R0JA 3D9BA 3HCXA 2HS3A 3CJ4A 3GIIA 1IQTA 2QL9B 1OSDA 2ZH7A 4URGA 2CQGA 3CD6S 5FD1A 4WXOA 1KSPA 1OJ4A 5IQ6A 4OZ2A 2DNLA 2GVZA 2OTJS 5F8JA 4M1KA 2W7PA 3PO5A 3SEOA 3PEJA 2J0XA 1J27A 2W9CB 1GMWA 3LAKA 4YY3F 2VDHA 4OHWA 1WORA 3R2DJ 2XSFA 3HFZB 2OPRB 4WE1B 3FSIA 2FVRA 3TA0A 4RW9A 3OR1B 1XMOF 3H2UB 1E6YA 2MQ8A 1APSA 1N5YB 4LSNA 4ZA1A 1U45A 1SJRA 4OHXA 3KHRA 2YKPA 4Q2MA 3VQTA 3SCKE 3PXGa 5A8RA 3NAIA 3IWLA 2GIQA 4UOCA 1FVSA 2DNOA 3GFHA 1HMVB 1VQLS 4IUFA 5B09A 3WDOA 3GCXP 2GMHA 4F25A 1S1TA 3OTEA 1T02A 3IAM9 2JJ4D 5DG8A 5DJBA 3PYDA 1U47A 3ZTSA 1AROP 1V3ZA 3DXSX 4RUBA 1Q81T 4Q8EA 1R0BG 3CIZA 2H54B 1LK5A 1TTHB 3DGVA 3OR2B 3W62A 2ZBCA 3EDQB 2DR8A 1TKTA 4C0HA 4ZK7M 2UXCJ 4QBUA 1YJRA 2YKAA 3VGSA 2PA8D 4USJC 1D09B 2UUAF 1BWVA 3BGUA 2X1FA 1SL0A 2DXEA 2R4FA 4KHPJ 3TUIC 3DOKA 1CSJA 3HULA 4UY85 4XTTA 3S8SA 2R8JA 1FJ7A 3FC9A 4LFBF 1G1XA 3MMCB 2KH9A 2MQLA 3UD5A 4Z7CA 5J1NA 5C42A 3VAMA 2AJ1A 1RJJA 5EGYA 3QGHA 1NJYA 4ZDNA 2ZBQA 1HI1A 4ZLPA 1LW0B 2I1RA 3W1YC 3KK3B 2HEKA 2MTLA 2RRNA 4B3TF 4QJVA 3BH7B 1LFWA 4F67A 1FNXH 3TZYA 4FBUA 3FUYA 1HNIB 5DQHA 4NLSA 1NSPA 1G3OA 2OAUA 4B08A 2YNGA 3THTA 1DARA 3A3PB 3S7RA 1CULA 3M05A 2QL7B 4CLFA 2NS1B 4IG3B 2QTWA 1C1CB 2XULA 2M8DB 2V4RA 5E3PA 2K7KA 2C2ZB 1TKZA 1N32J 5HMXA 4V19J 4FPIA 3C6UB 3N5FA 2AMCB 2IVMA 1JLGA 2FDNA 1FNOA 4GC7A 1N5QA 2JEGA 2AX1A 4X4NA 4EMDA 3KLIB 2IM1A 5CYJA 4U9RA 1RTDA 4Z7YA 1S48A 2YNHB 2MJUA 2RHQB 1N32F 2ZH5A 3G6XA 3CPWR 4DV5F 4R25A 4IH6A 1U1OA 1LNQA 3GIJA 3V4IA 1HWJA 1KQGB 3LGHA 2ADBA 1U6FA 2EBGA 1WC4A 2HIYA 1RYRA 2V8VA 1F9HA 5D0RA 2GMJA 3V81B 1UWBB 3DLEB 1FESA 1HR0F 2CYYA 1UJ4A 2QN6B 1HQUB 2VV5A 4GO5X 1NZAA 1SXLA 2PI4A 4J91A 1H2UX 2PIIA 4TYBA 2E5LF 2EK6A 5AE1A 1S9EB 2YX1A 3R7BB 4ED7A 2RE1A 2V6AA 3OXGA 1VQSA 1ROFA 1RBAA 2RU3A 3UN2A 1GMVA 1NK4A 4NMLA 3OPKA 2MQPA 3I9V9 2W9BB 4FVCA 3RRHA 3A8KA 5ETMA 5KFVA 3W9HA 1VHFA 2ROEA 3E51A 4NXMJ 4M5KA 1F60B 3EVMA 1DHMA 4UY8T 3GSIA 1OO0B 5KG5A 2F63A 1Z2LA 1DFDA 3KJNB 3VGUA 2DD8S 2KYZA 3AXKA 2HHSA 2GO9A 3Q8YA 4TY8B 2B9WA 2IJNA 3R3TA 1QTMA 1GQEA 3F56A 5HAOA 1JLBA 4P52A 5B0FA 4UQGA 5LSOA 1V9OA 3SDEA 1T9YA 1RLDA 3K59A 5DLFA 4U7UD 3W66A 2EI5A 1PAUB 2M52A 3NGRA 1IN0A 4GC6A 4AL6A 4K2XA 3TAMB 5GAGU 1Y9OA 1RHQB 2Z57B 3AFGA 4CRJA 1N4LA 2LXFA 2QYCA 4B9VA 4DFKA 3LPEA 2CQ4A 3UE2A 2VA2A 4ZN1A 4H4MA 5FIIA 3TP2A 4B02A 1S9GB 2F40A 2H4WB 3CCTA 1R31A 3UCUP 1YBUA 2AU0A 1C0TB 2QSFA 5HROA 1T03B 4DL7A 2DNKA 3R6GB 4LFAF 4GVLA 1XR6A 4LF1A 2J9DA 2QMWA 4USHA 3BGRB 2CADA 3W9IA 3TNVA 3GCWP 4Q2LA 4AE5A 2JSXA 2CQCA 2QGFB 4X66F 3DLLQ 2B9XA 3LWLA 3QYYA 3L7UA 1NK0A 2B56A 4N8OA 1YVFA 2LEBA 1NJXA 4FS2A 3MR3A 1IKYB 2VPYB 1VQ5S 1H2TZ 1WG5A 3TVKA 4RUHA 1I1GA 3DFEA 4NEYA 2PMZD 2KXFA 4QPXA 4UQTA 1N8RT 3CD5A 3MCNA 4JI3F 3MM5A 4P75A 2HW3A 2YKMB 3NS7B 5IWAF 4B9UA 4DV7F 3W8GA 1FHTA 2J9EA 5F9NA 5GAHU 3CJ2A 4JV5F 2YXLA 3DRPB 1C1BB 3J81j 3BO2A 4I6WA 4B3SF 1TV6A 3HJFA 4F0MA 2H3EB 4FNIA 3RG6A 5D0EA 4A8SA 2MHNA 1VQNS 2LDIA 2RDDA 2QIFA 2H4YB 4DPXA 4KJIA 1LQ9A 4RO0A 2K2PA 2R7SA 2CPHA 2FVCA 2ZH9A 4ID8A 4CT9A 8AT1B 4DCOB 1T9VA 1U1NA 2VODA 3LP2A 3Q8QB 3BEGB 3W7BA 2VJUA 1JNZB 4QR0A 2RDIA 2ATCB 3DLBA 2V2ZA 4KBIA 1KFDA 4LRBA 1VGYA 3CDUA 3ZFVA 5SZTA 3I5CA 3DNCA 5LSLA 3DU6A 4X4VA 4ZPAA 5RUBA 1S57A 2BEFA 4OJ1A 5A0YA 4C6AA 2BQRA 5MLCV 3BF4A 4PG4A 1JX4A 1P27B 1GT8A 1EQMA 2C3YA 1KHVA 1NAQA 4L73A 4O4RA 2HAFA 2HHPA 2VOOA 1G6BA 2LU1A 3FFIB 1GTHA 1X7VA 2QA1A 1H38A 1H7XA 3NWGA 2HVZA 1F9FA 3PNIA 1S1VA 2V4QA 4IG0A 2RVJA 4OYOA 5K8PA 1S49A 1E6VA 1O51A 2OEMA 5B0AA 4DQIA 3DGPA 3EGWB 4ELUA 1SBRA 5IZHA 2EG1A 1BXNA 4MH8A 4OJGA 4EBCA 2YKOA 3SV3A 5F41A 3FK4A 2XS2A 4NA2A 3RJMB 2BDPA 1SI9A 4Y2IA 1HPZA 2V67A 2E1MC 1B70B 4YB1P 3RR7A 4AQYF 3I0RB 4OHVA 1Y4ZB 2LECA 2XBPA 2VFTA 4F0KA 4CO2A 2KKHA 1NDPA 1A6LA 1VQ9S 1PBAA 4K5RA 3WBZA 1RACB 5IC6B 2D69A 3FMWA 4YN3B 2R8KA 2MLYA 1ICEB 3M6XA 4TQSA 1Y10A 3I55S 1U24A 3IGVA 2W2OP 2HKEA 2MY7A 4RKUC 3G2XA 1NSKL 2IC3A 2WVCA 2QA4S 2RQKA 5M2PA 2VG5B 5E3RA 2OD4A 2HHHJ 5HL7Q 2KN4A 2C3PA 3T3FA 5HSPA 1JWWA 4LBIA 4GKKF 2P5VA 3BBFA 5IM0A 3MPUB 1IBKJ 3C16B 3C6TB 3KJFB 3AY0A 3NGKA 1CJVB 4FZVA 2EVZA 1BQMB 1S1WA 4DQRA 3MEGA 3MD3A 3KMQA 1IJEB 5HP1A 2M0GB 2MQMA 2N7YA 2YWEA 3H2LA
chains in the Genus database with same CATH topology
4FNHA 2H9ZA 4PKDB 5EWGA 4QIWD 5AE3A 1Y5NB 2P9EA 3IRXB 2IBOA 2BV3A 2WTFA 1HBNB 1OPZA 1HW9A 2AJ4A 3PRBA 3KK2A 3BJYA 2OH2A 4C3KA 5F0UA 3A8EA 1FTRA 3QWUA 3TW0A 2DGSA 4KKOB 5AXNA 1FERA 3O5TB 1BQNA 1NK6A 2BE2A 4F4WA 4IQMA 3PJWA 1GTEA 3D54A 4X65F 3NBPA 1LOUA 3BZQA 2DHGA 2VBXA 3OR2A 2XLIA 4KIAA 5KFRA 4ZPWR 3IR7B 2ASJA 1FD2A 5DLGA 2FHKA 4NLYA 1MU2B 4AUKA 5KFTA 1S76D 4LF9F 3FSYA 4KT0C 2MZQA 4EU0A 1KD1T 3H4DA 3ENVA 1U09A 4EBDA 1YRXA 1HFEL 3HHKA 4QIEA 4CH7A 2VA3A 3DLKB 4PG6A 4IRCA 3D1QA 1HI0P 3CJ5A 3U1NA 4ECTA 1FDDA 3H5SA 5B0EA 3JTNA 1UVJA 1S9FA 3KG0A 2KDOA 5GAEU 4Y0FA 3QJPA 5T7LB 2RRBA 3QZ8A 3Q2TC 2IRYA 3SQGB 1R43A 2VC0A 2A3JA 4ZPDA 3TRGA 4AXIA 2NYIA 1GXUA 2XY7A 4O44A 6FDRA 1HNZF 1RT1B 1URRA 4FF4A 4KQZA 2B0GA 4CO1A 1VBXA 3VTIA 4IFVA 2V8GA 2HWIA 4DSJA 2N82B 1SIZA 1IXKA 2OFGX 2GGPA 4OZLA 3HT3A 1RISA 4LF4F 1TUVA 5IFMA 2ASDA 2UUBF 3CCES 4WKYA 3KFWX 5B0DA 3T6JA 3IS9A 1JXEA 2CQPA 1YI2S 1HNXF 5K8OA 4C9DA 3MMCA 4HI2A 3OTDA 4DV1F 5DG9A 4LF8F 2AYGA 4RW4A 4RNNA 4QCLA 1YWXA 2GQ2A 2MZ1A 1HD1A 2R7RA 2GO8A 1U1KA 5D4LA 2V9WA 2GCFA 2DNYA 2CKWA 1LW0A 3DDKA 4H4KA 4ZP7A 2FGCA 3Q22A 3QPIA 4YUDA 3KK3A 4NXMF 2IMOA 1VK3A 1YG0A 2LA4A 2D7SA 1UAWA 1ZPVA 5F8IA 3Q8SB 3R1LA 1WTBA 2HS4A 4ZHRA 2DRBA 4OX7A 2ZHAA 1F0XA 2K1RB 3VAGA 4ECZA 5KFEA 3E01B 2K3KA 3CDAA 2JC1A 4DV6F 4CNYA 2IM2A 2OPQB 1PC4A 2WB1D 5CQGA 2DGXA 2GX8A 3ITHB 2O3DA 4IQXA 2WONA 1RT4A 3O8WA 3POTB 2RS8A 4OI1A 1S4FA 2HNZB 2F9JA 1YTYA 1SL1A 3MR2A 4RW9B 5KG6A 2ZITA 2PI5A 3H5UA 3K8WA 4Y2KA 1PC5A 1E6YB 4ZVGA 3CCMS 1RI7A 2JDJA 4RU9A 4LSNB 3I6PA 5K8NA 1KC8T 3MCSA 3BQ2A 2OSQA 2EC0A 4Z2XA 3D0HE 3PX0A 3D0GE 2V9KA 4AL7A 3HHDA 1Q1KA 3KJVA 4IOAQ 4IG3A 1UMJA 3GR0A 3LP2B 1C1CA 3CXCR 4IKAA 1YJUA 5GADI 3TI0A 1JXLA 3CVKA 3DRRA 2MSSA 3MR5A 2UUTA 4DR6F 1X9MA 1GNKA 2CJBA 2VFSA 2WSCC 1V6HA 3PFOA 4YEAA 4TLQA 2XLJA 1HWIA 5J2PA 2DO0A 5D6GA 2UXDF 5H9EJ 2VFVA 2MZSA 1WHWA 4C8YA 2FJEB 2B3TB 3C6UA 4Y28C 3IGNA 5A8RB 4NYPA 3LGNA 2ZOFA 1K1QA 1SQEA 5CCMA 1N6QB 1WG1A 2XC9A 2XHWA 1MMLA 1VJWA 1KVIA 3OL7A 1WI8A 5JUMA 4M5DA 2ZZMA 1WELA 2A2CA 1N54B 3K5MA 1JMTA 2ZD1A 3CC4S 4ZCMA 2FIUA 3PACA 4MTPA 3KLIA 2MXYA 2CQBA 1RTIA 3GV5B 4LMZA 4K4XA 3CTRA 5L38A 2W8LA 1T95A 4X4OA 1TL1A 1S1TB 2YNHA 4J9SA 3MXHP 1JLQA 1M5VC 1UA0A 1X4GA 2CZVC 2E9ZA 1TAUA 2YWFA 1OWXA 5A0YB 5A8KB 2EW9A 3AQPA 1TL4A 4IH5A 4PUOB 1X5SA 1HA1A 1Q82T 3SFUA 2VG7A 4I7FA 3S6EA 3V6DA 4EUVA 1TFWA 1FEHA 3GZ7A 3V6KA 2RRAA 1FRIA 1ZZFA 1IKWA 3BM7A 2B7BB 1KS2A 1S6QA 2YTCA 2VKZG 4WJBA 4C4WA 1HYSA 2R2UA 4URSA 4F2RA 4F4YA 3K0JA 3VAIA 1QY7A 4A8FA 5KFPA 3EPGA 1YJVA 3MMAA 1U1RA 3F44A 5CHCB 2VPWB 3V81A 1UWBA 3HHLC 3U02A 5I3UB 1N88A 3TARA 1TKTB 1VRTA 3HM9A 5L9NA 1VQMS 3H8YA 1HQUA 4NLDA 1MWYA 4QQBA 1PO6A 1BD6A 5D4PA 4DX8H 3N28A 3RB3A 2JRSA 1NK5A 2W7OA 3T6BA 2DH7A 3L7OA 4DDFA 1ULRA 2R7WA 3ZZRA 2FJVA 1V3SA 5F8LA 2DR7A 1S1XA 5M2UA 2J6UA 1S6PA 5I3PA 1BQXA 4FXDA 1S9EA 3EGNA 1SJ4P 3VAKA 2V94A 3EZ5A 3PKMA 2F8EX 3G6VA 4F50A 1S99A 4F2SA 3D1HA 4DUYF 3RB6A 4QWDA 3DOKB 2Q66A 2WSEC 1KHWA 1HARA 4QPTA 3OL9A 2BUNA 2KT3A 2VG6A 5I4MA 1Y3KA 2ZJQQ 1URNA 3TVZA 4HEA9 2OPSA 2FLPA 2NREA 3SYZA 2EFOA 4DR3F 2BBEA 1U1PA 1F5CA 3LWMA 1FJGF 5CH7B 4C0BA 4NLWA 1S77D 1KEKA 4ZOSA 4LFCF 3G8QA 1XWLA 5E0OA 3RRKA 2VH7A 4IH7A 2K7JA 3G4SS 4DQQA 2WK4A 4RBVA 2Q6CA 4DR4F 4K50A 1U48A 3K5OA 1ZOTA 5C42B 1VS3A 5IT9Y 3R5BA 3CDWA 2GHVC 4RNMA 2CPDA 3DLGA 3QIPB 2L08A 4RBTA 3DU5A 5LJ3Y 1IKVB 2Q3PA 1FO1A 2IM3A 5C5JA 2IJFA 4DSFA 1X5OA 2YWHA 3KLHB 2ASYA 2VPZB 2LU2A 4OHZA 2NSCA 2ZH4A 4PWUA 1SJ3P 4USIA 7FDRA 3SMZA 4NYZA 4YB6A 1U6ZA 4ED8A 3ISND 3MTKA 3UR0A 5M2RA 2CQ0A 3N01A 3QAEA 1EP4A 4YDXA 5KG7A 2G9OA 4EZ6A 1XERA 4NLPA 1AFJA 4FVMA 3ICLA 2EFQA 4YMEA 2D9PA 4FF3A 2FTRA 2LVWA 5D78A 4IRKA 2QLWA 4TY8A 2YNGB 5F8HA 2GV1A 2VPXB 4TQRA 2VUGA 3W2WB 4DN9A 2OMOA 1I94F 2GJIA 2HNDB 3Q23A 4HL9A 5DO2A 1RGVA 4I2PB 2YKNA 1QAYA 3NP5A 3CO9A 4Y2AA 4JBCA 4D3HA 4ZPTR 3U1MA 1X0PA 3CCRS 2KRRA 2FLNA 4KO0B 1TP7A 3M4XA 4C7QA 2CVEA 3MZIA 3VZIA 4ZKAA 2AF6A 3FVYA 4KHMA 4C8LA 2EK1A 4B3OB 4LF5F 1TK5A 3CE8A 2RB7A 4N47A 3G96A 4DUZF 1TKZB 2M9KA 4AL5A 3MMBA 4G1PA 2X1AA 2W7AA 3JYTB 1RT6A 2M7SA 4N56A 5IT0A 1ZAVA 5EX3A 1XC9A 1FK9A 1DTTA 1X8DA 4DPOA 2V2KA 4DV3F 2VOPA 4RW7B 4CI0B 1D9FA 4DR1F 3T1AA 2QMXA 3E3XA 1JLGB 3KLFB 3EXYA 4P2SA 2OP5A 3IFEA 5HMWA 1Y00A 3TQ1A 4F02A 5DQGA 1R7IA 1NO8A 3C8YA 2OIHA 5HLFB 4ECWA 3CJ0A 3NGDA 2FHJA 4DN0A 1QE1B 1HBOA 2R7XA 3GMGA 1JKHA 1GX5A 2JEIA 2W24A 1KFSA 1FCAA 1HHSA 2ZKUA 1KR4A 4MK9A 4YR0A 1KRPA 4YQWA 2ZKTA 1RTDB 4DQPA 4A8MP 2NXUA 3QMQA 4BC9A 1VRUA 4O23A 3THPA 2DCUB 4HT5A 1XEZA 3RB4A 3NNCA 2J5AA 2IM0A 3GIKA 2HGNA 2RQ4A 2DNQA 4NYOA 3IRWP 3GILA 3KNAA 5H9FJ 3DHXA 3MM6A 3JSBA 4JI2F 2A1BA 1TL5A 5GAGI