2V94A

Crystal structure of p. abyssi rps24
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
b'FMLEMEIKITEVKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGSYKSKGYAKYYYDKDRMLYIEPEYILIRDGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S RIBOSOMAL PROTEIN S24E
publication title Mutation of Ribosomal Protein Rps24 in Diamond- Blackfan Anemia Results in a Ribosome Biogenesis Disorder.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosomal protein
total genus 23
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v94A00
2I38A 2DGUA 4PRFA 2KRRA 2DNOA 2ADCA 3G8SA 1WEXA 2FC9A 3Q2SC 1X4FA 3G71S 3VAKA 4TU7A 2VOPA 2DO0A 2CQDA 2WBRA 4C0OC 3UCZP 1D8ZA 2SXLA 3B4MA 1HD1A 2RQCA 1YJWS 3S6EA 1VC6A 3FEYB 1S79A 2ZJRQ 1YI2S 4CH1A 3IRWP 2QA4S 5JVGQ 2HGMA 3S7RA 5IFMA 4IOCQ 5FJ4A 3CPWR 2DK2A 2XSFA 2Q79A 3CTRA 3CCUS 2CQ4A 1P1TA 1UFWA 5HL7Q 3VAFA 2YH0A 5LXYA 2KG0A 3NNHA 2FY1A 4CH0S 5LSLA 1M1KT 4C7QA 1R8PA 1WHVA 3THPA 3MD3A 2OTLS 2MGZA 2YKAA 5DETA 3BO3A 1X5PA 2E5HA 2MQOA 2KI2A 3ULHA 1A9NB 1DZ5A 2MXYA 3P5TL 1X4BA 1OWXA 1H2UX 5DDPC 1QVGR 3RW7A 2FC8A 1BY9A 1X4DA 1K9MT 4YB1P 1UW4A 2RRBA 2MKSA 2NZ4A 3CCJS 2KRBA 3CCRS 2CPHA 2JVRA 2DNRA 2BZ2A 2EK6A 2MSTA 3J7ZT 2AYGA 1U1PA 5JVHQ 3MXHP 2LXUA 2I2YA 2XB2D 4TLQA 2KM8B 3P49B 2PEHA 1X4CA 2MMYA 1Q82T 2CPZA 1JMTA 2N82B 2ZJQQ 4IO9Q 2RT3A 2DGVA 2DNPA 2MZJA 1H6KX 5GAGU 2MQPA 2OSRA 1U1NA 2N7CA 3L3CA 5DM6Q 2G4BA 2E5IA 2AD9A 1JJHA 3J7YU 3ZZZA 4Y0FA 2MKHA 4IUFA 1U6BA 2NLWA 1FO1A 1U1MA 3IWNC 2JRSA 2MKIA 3I56S 2J8AA 4F26A 2UP1A 3HHNB 1FNXH 4TU9A 2VOOA 1M90T 1U1RA 1VQNS 2MKCA 2DNLA 2MGZB 2QEXS 1VC0A 3CCVS 2L9WA 2CQ3A 1N52B 2MZ1A 3MUMP 5CA5A 2MJUA 1URNA 1B7FA 1W2BR 2MQMA 2OSQA 3BO4A 2F9JA 5EN1A 3CULA 4A8XA 1VQOS 2D3OR 2XNRA 1SJRA 2J0SD 3CCSS 1L3KA 2MKJA 3THTA 1XN9A 3EGZA 1S72S 2KHCA 2CQIA 4F02A 1YWXA 3BEGB 4OZ1A 4QU6A 2K8GA 3SMZA 1SJ4P 5D77A 4OZ0A 3NNCA 1WG5A 2M0GB 2M9KA 1FXLA 2AYMA 1KOOA 4UQTA 1OIAA 1OPIA 2KFYA 2CQ0A 2CQ1A 2HVZA 3DLLQ 2CPDA 2DNNA 1JJ2R 1YJNS 2LXIA 2GHPA 2LMIA 1RKJA 2PE8A 1YITS 2DGWA 2MY8A 4WIIA 4C4WA 2RS8A 2YWKA 1Q86T 2N3LA 1VQ7S 1X4EA 3UD3P 2LYVA 4QQBA 2MZTA 3VF0B 2OIHA 3SXLA 2DNHA 4CIOA 4PR6A 1M5KC 5BJRA 4P6QA 4YUDA 1Q81T 1IQTA 1DHMA 1UP1A 1VQ5S 1OO0B 2KVIA 3VAHA 2DH8A 3TP2A 2AYBA 5D78A 3VAGA 3TYTA 1NJIT 2DGQA 3VALA 1ZZNA 2RRAA 2CJKA 2BOPA 3CCMS 3RW6A 1X0FA 3MI7X 3ZZYA 2ADBA 1ZZFA 1U6FA 2HGLA 3MURP 4ERDA 1N54B 2DH9A 5H1SV 1CVJA 2LCWA 3DXBA 3CXCR 1WI8A 3CD6S 2MYFA 2J76E 1U1LA 1YHQS 1X5TA 3LPYA 3JB9k 1YIJS 5IQQA 2D9PA 1H2VZ 4EGLA 2RS2A 2E5GA 5CYJA 3TO8A 4Z2XA 3BO2A 3S8SA 1WHYA 2HYIB 2DGOA 2M52A 3PIOQ 3CC4S 1SJ3P 2DHSA 2KT5A 2OTJS 2LECA 2F9DA 3P6YC 3NNAA 3UWTA 2MY7A 1FJ7A 3MD1A 2CPXA 1FJCA 2RU3A 1WELA 3S01A 1FJEB 1WEZA 2A3JA 2MQNA 3HI9A 1QM9A 3VAIA 1M5PC 2DHAA 3CCQS 1Q7YT 4W92B 2RVJA 1NO8A 2HGNA 4M5DB 3H2VE 4F25A 3MUTP 3P3DA 1YJ9S 2DNQA 1NU4A 2MQQA 4BS2A 5DDOC 2KU7A 3K0JA 2KN4A 2KG1A 2X1AA 2LA4A 3R27A 1N88A 4WCEQ 5CXTA 2CQCA 2MJNA 2DNYA 1PGZA 4WKRA 1N8RT 1M5VC 1YTYA 2EVZA 2DGXA 2FPHX 2JVOA 2KXHA 1U1KA 2CQ2A 2HZCA 1G2EA 2M7SA 2DNGA 5GMKa 4LIRA 4V19X 3CMAS 4U67Q 4WF9Q 2KYXA 3EX7B 2E5JA 3FEXB 2MQLA 3MDFA 1VBZA 2KM8C 1VQ8S 5LJ5Y 3PIPQ 3NS6A 1AUDA 1WHXA 1PO6A 2DIUA 3G6ES 1FHTA 1H2TZ 2QFJA 3VAJA 1KOHA 2XS5A 3NMRA 4TU8A 2L08A 1WF1A 4ZKAA 2DO4A 1HD0A 2LQ5A 1VQ4S 2CQBA 2CQHA 1WTBA 1SXLA 2VODA 5GVQA 5MLCV 2U2FA 2MPUA 4UY8T 5GADU 5GAHU 1U2FA 3BS9A 2M2BA 2M70A 3G4SS 4LMZA 3Q2TC 5ITHA 1VQKS 1WHWA 4ED5A 2CPYA 1X4GA 1VQMS 4J5OA 1RK8A 3CMES 4YOEA 2DNMA 2CQPA 3V4MA 2XS2A 2DIVA 2X1FA 4CQ1A 2V94A 1SJFA 2O3DA 2DISA 4IOAQ 2X1GA 2MSSA 1WF0A 3B4DA 2CQGA 1KQSR 1DRZA 2RNEA 2LEBA 4WFAQ 2DNKA 1WG1A 4LJMA 2J0QD 2MKKA 1WI6A 3UE2A 4PKDB 2F3JA 2RQ4A 2KH9A 1R8HA 3NS5A 2ZJPQ 1UAWA 2U1AA 2D9OA 4QU7A 3G96A 1U1OA 2XNQA 2JWNA 2DHGA 1VQPS 5HO4A 3N9UC 2LA6A 2OJ3A 2DITA 2DGTA 2KXFA 2M4MA 3G9CA 1WWHA 3SDEA 4Y00A 5IM0A 1VBYA 5LSOA 2M8DB 3R1HA 1DBDA 3MUVP 3MOJB 4RU2A 1A7GE 5LXRA 3UCGA 1K73T 1FT8A 1X5SA 2LKZA 2M8HA 5DDQC 1M5OC 2X1BA 1ZH5A 3CC2S 2YH1A 2RUGA 1U1QA 1KD1T 2DB1A 2EK1A 2AYEA 1VBXA 1WEYA 4WFBQ 1JJ4A 4W90B 3CUNA 3U1MA 2DHXA 1F9FA 2DGSA 2K3KA 1X5OA 1O0PA 1SJQA 1D9AA 1VQ9S 1WG4A 2E44A 2MZRA 1VQLS 2MZSA 1X4AA 2FHOB 5DM7Q 1X4HA 1HL6A 3U1LA 2GO9A 2N3OA 4WFNQ 2L41A 3I55S 2VONA 1P27B 2G1DA 3H2UB 1HA1A 2MHNA 1VQ6S 3EGNA 3OW2R 1KC8T 5DDRC 5LJ3Y 3D2WA 3US5A 3CCLS 2KXNB 2XS7A 2G0CA 2M88A 2DNZA 5GAEU 2MB0B 3G8TA 3CCES 2DH7A 2CPIA 3SDEB 5IM0B 1VC5A 3R1LA 3CC7S 2CPJA 3UCUP 4FXWA 1QVFR 4FXVA 3CF5Q 4QPTA 3VAMA 2CPFA 1WF2A 1K8AT 3UD4P 2B0GA 3LQVA 2MZQA 2CPEA 2YTCA 2LEAA 2ERRA 2JX2A
chains in the Genus database with same CATH superfamily
2GVZB 1MROB 2CDRB 3CB4A 4DU7A 1KR4A 3O44A 3MAQA 3M8ZA 3P8BB 1I94J 4X4TA 4PUOA 2R42A 1SIWB 4JYAF 2E5LJ 3BSNA 4O44B 1UMJA 4IOCQ 1R6YA 4PZVA 3GV5B 2HQ3A 2R7OA 2QA1A 1P1TA 2B7CB 4I2QA 2YH0A 2KG0A 1HNWJ 3HHLA 5LSLA 4R5PA 3FJ2A 1VRUB 1RP5A 2MQOA 2UUTA 1SC6A 2AQ4A 5D4LA 3BZQA 2EEYA 2ZE2B 2IBOA 1UJ5A 1K9MT 2CIMA 4YB1P 1QE1A 2B9EA 1S6PB 4USWA 4CTAA 2FQQB 4JB8B 2BZ2A 5D0GA 2DXEA 2GJFA 1Q82T 2B3TB 2N82B 2VB6A 4NLTA 4ZVEA 3IS9B 4DUTA 4ES2A 1I1GA 3GV7B 2JLEA 5L38A 3L3CA 4PAAA 5SZTA 1IJEB 4PYDA 4DR6J 3T1AA 2FVSA 4ZOSA 3CD5A 4ZP6A 5EX0A 3KK1A 1HBUB 2Z2MA 3DHWC 3KJVA 2MGZB 2W2QP 3BBBA 2IJRA 2L9WA 4I0WA 4P71A 4TN2A 2VG5A 1YWXA 3D0GE 1S97A 1SJ4P 1LKZA 5ADZA 3QGIA 1KOOA 2J7KA 1QSSA 5HK4A 1SJ1A 5HJXA 3JTPA 4B3RJ 4RO0A 1TR0A 2N3LA 1VQ7S 3T1HJ 4FYWB 3I0RA 2HRYA 2Y0BB 3FSIA 1M5KC 4PR6A 1TL7B 2R7UA 3TJAA 4PXBA 1RSCA 1CS4B 1DHMA 2QYCA 3QFWA 1VQ5S 3VAHA 3DGPB 2QMXA 3TP2A 3I82A 4OYOA 1OJ4A 3P96A 3RW6A 2IBKA 2FGOA 3KLFB 1RYSA 3KUHA 1YHQS 1FTCA 3IBCB 4RPFA 2R8HA 3LAKA 4RNFA 4KGVB 3CW2C 4I1TA 4HR2A 3PJWA 5ETKA 4O3OA 3PIOQ 1SQFA 3OL6A 1WEZA 2BQRA 4J9UE 2KYZA 1HI8A 3DRRA 4ZITA 2AP6A 5HJYA 1KVIA 2LA4A 2CNOB 2KL8A 3RB0A 1SC3B 1F5BA 5C2GA 1YTYA 5D3GB 4LSNB 2Y9HA 3OVBA 4RW8A 2V0NA 3FMBA 5B0EA 3CMAS 3EX7B 1JQGA 4DV5F 3NS6A 4WYWA 3VAJA 2JDJA 2LDIA 3EVWA 1HD0A 3CIZA 1NXIA 1BQMA 3WX8A 2HHHJ 1XK8A 3W2WA 1FWPA 3WC0A 2QO3A 5B0DA 2CPYA 1DLOB 4EU0A 4YOEA 2ASDA 4QBUA 3JSMA 2C1EB 3M6UA 4DQSA 4ZHRB 2WZ1A 4CLZA 1VFJA 5L9XA 6FDRA 4YDDB 3DOKA 3TVKA 5A8WB 1MNEA 4DFKA 3PFEA 3UPFA 2VA2A 3UE2A 4ZP9A 2F3JA 5DZ7A 4QU7A 1NDPA 1Q8KA 3W5ZA 1U1OA 2CVEA 1VQPS 2DTJA 5CCLA 2KXFA 2BE2A 3SDEA 1SKSA 3OXGA 4R8UB 1VRTA 3GIJA 2YNFA 1X5SA 4N8NA 2ZWOA 2YQ0A 1GTHA 2AMCB 2HHSA 4DV1J 2V8PA 2PFDA 3CJ4A 1WEYA 3F44A 1RTJB 3ZXWA 1FX4A 2AIRB 1HI0P 2D74B 2IJNA 1RT1B 1X5OA 4KQZA 4NCBA 3G82A 4DV0J 2MLXA 4RR5A 2OHDA 2L41A 2QA4G 2MHNA 3EYZA 4CI0B 1UA1A 4N5SA 1EAYC 1YX2A 4U95A 1HBNA 4CRJA 1FXDA 1EB0A 3HSDA 3UN5A 5E33A 3CJRA 5HMYA 3QRQA 2ZM6J 2Y0SD 2I38A 1WUUA 3DLGA 4X2BA 3HK2A 1U24A 3W1YC 1WEXA 3Q2SC 3VAKA 2RDDA 4FF3A 2OMOA 5MAOA 2QL7B 2V34A 5M2RA 3TJ9A 3OSPA 2HMIA 4X66J 1KLNA 1E6YA 1TL1B 1XMQF 3D0IE 2EFQA 4FYXB 5J2MB 4XDDA 1LFPA 2R2UA 4ALZA 2F1FA 2HFOA 1VYAA 3OD2A 5LXYA 3MHYA 2IC3A 4U6PA 4OIXA 4ILMA 1C0TA 1A9NB 1YG0A 2F4FA 4CNYA 1TMMA 3J81Y 4F3OA 3ITHB 1UL3A 3UDEA 1UW4A 2YPZA 4B3TF 5IT9Y 4MIAA 3N01A 4NA1A 2ROEA 2WSFC 3KKFA 3BGLA 4RU9A 4GKJJ 3NCQA 1RWNB 2DCLA 4A8SA 8AT1B 2DRDA 2ASLA 5J2QB 3AOCA 4UOFA 1FFSB 4YHHF 4X65J 1NBEB 3Q8YA 2VDHA 1FO1A 1CJKB 4FYYB 2YKMA 3HHNB 3MAAA 3PYDA 1RT7A 3DFEA 2OPPA 2NS1B 2PMWA 3MUMP 4J9OA 2W4CA 2OSQA 1AW0A 1UEVA 5J1EA 3DLJA 5B0FA 3RBZA 3GG0A 3DI6A 1N34J 5KT4A 2ACMA 4JI6F 4JI1F 4KE5A 2BJEA 4J9KA 1J5EJ 1PJ5A 3Q8SB 3GTYX 2LQ9A 4MKBA 3LGNA 4PCQA 5C25B 1NDCA 2FHKA 3VF0B 1ZTTA 4RW4A 3M1VB 3ZZTA 3M2RB 4USJC 5E5NA 3VAGA 3FC9A 4P10A 1GXLA 4R0EA 4LRDA 4OYAA 7AT1B 3MI7X 5JJBA 2XLJA 2WAQD 4ED6A 2DH9A 3QRPA 2PDAA 2BANA 3GP9A 3T1YJ 3CO9A 1JLBB 3OTOF 1N5TA 1AB8A 1WC0A 5BYQA 3KK2B 1B7YB 4FF1A 5AE3A 1BQNA 2Y1LB 2DHSA 1S0OA 4MTPA 3VR1A 2QLWA 3NNAA 2I5JA 1AFIA 4CO1A 3O5TB 1KVJA 1RHRB 1XMBA 4ZVFA 1G6BA 1NO8A 1NK9A 2EFVA 3W5YA 3E01A 1ZAVA 5ETOA 3FSXA 2C2ZB 2NYHA 2KFZA 1IKYA 4WKRA 1M5VC 3TZXA 2KXHA 2CQ2A 4F4YA 1Q4RA 3Q86A 3FBBA 3T41A 1HQEA 3PTWA 2D69A 4DL5A 3RRHA 4KIAA 2KO1A 3PHTA 1WF1A 3RB4A 1ZYQA 1HR0J 3O6QA 1KBRA 3JXOA 3DRXA 2RMLA 2MPUA 4WIQA 1U2FA 4M1KA 2CNKB 4YB6A 2DRBA 1X4GA 3M2UA 3OR2A 3CMES 4WFZA 3V4MA 3QT5A 1TAQA 2BKOA 2RF2B 4JI8F 2QSFA 2Z4PA 3TR5A 2E9ZA 2MSSA 3UW1A 3BSCA 2CJAA 1RT6A 2R7QA 4H4OA 2ZEJA 4KSEB 4UZBA 4JYAJ 2G13A 2NSBA 4A8MP 4PXDA 1I6JA 1FRMA 5E2QA 5LSOA 1JLFB 2NUUG 1T9TA 1LQ9A 3G6XA 1FKPA 1ZH5A 3CSKA 1U1QA 3HSJA 2V67A 1KD1T 4ITSA 3ISNC 3FFIA 1S1TA 4DWIA 3DLBA 4G1QB 1CPZA 2E9TA 3QJPA 3EE3A 4DL0C 1VHIA 1VQ9S 3E2EA 3IR5B 1VI7A 2GO9A 1DQAA 5I42A 3OUYB 3EGNA 3VV2B 1RTHA 4M5JA 1JX4A 3DLKA 3ET6B 1FTRA 3ZZRA 1VOMA 5AXKA 4DPWA 1Y10A 1UVKA 4ECVA 4BBYA 3RRGA 1PBUA 2QL5B 3RB3A 4W98A 4OHVA 4KFBA 2YTCA 3D66A 4HACB 3MMBB 3J7AN 2VFSA 2OELA 3I4PA 2B4PA 3TZYA 3FEYB 3N5FA 3BH6B 4ECZA 5JVGQ 2N7YA 2XMKA 4RW6A 3SSSA 3MFHA 4HH1A 1DTTA 3THPA 4JI7F 2MLZA 2HVIA 3HHDA 4RW7B 1KQFB 2RAQA 5IV3A 3M32A 4ZPDA 5J2NA 3HVTA 2IRUA 2CG8A 3JYTA 1FVSA 3BGOP 4L73A 2DEJA 3OVAA 2HW3A 4IQMA 3FNNA 3FDSA 3QLHA 5G4DA 2VF3A 2EK6A 3EJMA 4QIWD 1TELA 5IT0A 3P49B 2OPSB 4FBTA 3QJJA 3K59A 2ZBPA 2DNPA 2ZZMA 2W2PP 3BDEA 4K0KF 2G4BA 3QWUA 3PV8A 5CZVA 2P6TA 2GHVC 3IWNC 1UCNA 3GIMA 2D3O1 1TK0A 4PG4A 2ABYA 1S1UB 3QJLA 4LQ9A 1Y9OA 2DNLA 1NK5A 2BUNA 1P9QC 4NRUA 2VICA 1URNA 1U0SA 4NA3A 2W9AA 1B0TA 1KLMB 3IRXB 3OQ2A 2V5HG 1VQOS 1SV5B 1XR7A 1NJYA 3LO3A 4AQYF 2XSJB 4DQQA 3AD8C 2ZOFA 2AGQA 4DV5J 2FZGB 1D09B 1EQMA 3QAEA 1FRHA 3EDRB 1HQ2A 4L72B 1DTQB 2FLOA 2B5JB 1PBAA 1N36F 2J9EA 2QLJB 4QQBA 2VBZA 3GPAA 4Y2CA 3D67A 1FDNA 5CYQB 4L75A 1Q81T 2Q6BA 4WU3A 3A12A 1PC4A 2AJFE 2BEFA 2L9DA 1SQGA 4NLGA 2HGLA 3U27A 3F0NA 4C8NA 3O1LA 2M3DA 4JUZA 3JB9k 1Y5IB 1C2PA 1H2VZ 3ISND 3TI0A 1SJ3P 4NEYA 3PVXA 2YX1A 4ECSA 1CQMA 1ZM9A 2ZDPA 4XTTA 3MR6A 1YJ9S 1Y3JA 4PXEA 5F0UA 3ENVA 2KG1A 3BQ0A 2G9OA 4DL4A 4QWEA 2MJNA 3T5LA 3PEJA 1NSKL 4RUCA 4PWDA 5AJ3F 4QWBA 1SH2A 5DLFA 5HLFA 2WOMB 1F5AA 2Z2ZA 3GJSB 8ATCB 4Y2IA 5D4OA 1UZDA 4O4GA 1PIEA 2JJ4D 4TU8A 5M2UA 2CQBA 2V4RA 2IMWP 4KHPF 2M2BA 3IC1A 3CMQA 5E7OB 2XS2A 1YRTA 4BHQA 2O3DA 4R0JA 1BMQB 4G65A 4IRKA 4URGA 5KTQA 5F8LA 1F3FA 2MTLA 1TKZA 5KOXA 4ZLPA 3HHEA 5HMZA 3F41A 3CJ5A 2X7IA 2XMJA 1XMQJ 5K14B 1R8AA 1T94A 2BKPA 1V9OA 3MM9B 2YKNA 4Q45A 1PYOB 3R1HA 3MUVP 3MOJB 4C0BA 4JV0A 2JFDA 5KG3A 3K57A 1WC6A 4U7CA 2AEMA 3GLJA 4WFBQ 3EGVA 4KGKA 4YS2A 2O66A 1H7WA 1I5OB 3F73A 4B3TJ 2POKA 4JV5J 3K8VA 1DFDA 3GSIA 2FHOB 3U1LA 5E3AA 4U7UD 2CG4A 5F9LA 2JSXA 3I55S 2VBWA 2VPYB 3PKMA 4IFYA 1U26A 3OVSA 2NCKL 2W7PA 4F50A 4MYTA 5K8OA 2VG6B 2XS7A 4ELVA 1ZA1B 5AXMA 3RG6A 4YHHJ 1IWGA 2Z2LA 2QV6A 1M0SA 4C8OA 3GG1A 4FXWA 1P1LA 3VAMA 4QPTA 2VZ9A 4DS4A 3M4XA 3KLEB 4NXMF 1U02A 3BN7A 4F8RA 1FDDA 1RYRA 1B64A 5T7LB 2APOA 1RWWB 4NLPA 4IG0B 1URRA 1SQEA 3AFGA 2HG4A 3B4MA 1HD1A 2EWHA 3FVYA 1OPZA 5JUMA 2DR8A 5HL7Q 2O67A 1U2RA 5GADI 3HJVA 3JS9A 1FNOA 3O8WA 1DZ5A 1OWXA 5FIIA 2VH7A 1FKOA 2AWZA 3IO1A 2QA2A 3PJXA 1H0HB 4WE1A 4AE5A 3WIVA 2MSTA 4OZNA 5JVHQ 4ECUA 2XB2D 2YKQA 1TV6A 2ZJQQ 2DGVA 1T02A 3OTOJ 1MN9A 2FHJD 3TQEA 3PKYA 2BJDA 2UV8A 2ZNYA 2VA3A 1RT5B 1HKAA 2MKYA 5CD4H 3PEHA 2LP4A 1FNXH 5CABA 3ICLA 3KNGA 2N4CA 2I6WA 1U1RA 3QGHA 2M5YA 2XY6A 1AZSB 3JQJA 3V6DB 2B6AA 1QSYA 4UUWA 1U09A 5CH7B 2PGCA 4K4WA 2XNRA 4PWWA 1SJRA 2MKJA 2RQKA 3RGIA 5B08A 3GMGA 4QU6A 4CLKA 3RJMB 4RW9B 3VGTA 1C1BB 1FXLA 2ZOGA 2C2RA 4MK8A 4F0HA 2IPOB 1NKEA 1HPZA 2K06A 1D9FA 1XQIA 3EVMA 2MY8A 4XO0A 2RS8A 3H5YA 4OI3A 3KLIB 5EHHA 4A8YA 2E7XA 5K8MA 1DARA 3Q89A 1S0NA 4IQXA 2ATCB 3WBZA 4B3OB 1N5YA 2FY8A 3VHQA 2AYBA 2PI5A 3CNQP 1NJIT 3TUIC 2DGQA 3VALA 3C6TB 1RTIB 3A3OB 1U6FA 3CD7A 5LMUF 3MURP 4JI8J 1NB2A 2P9CA 3RUBL 4F3MA 1JLGA 5IQQA 5DRKA 2RS2A 5IS2A 1D3WA 1MN7A 4IH7A 1JLQB 2HK3A 1KQKA 1HNIB 4OX8A 4IFVB 1LOUA 3QPIA 2CWXA 3PX6A 4ANCA 3D1QA 1L5UA 2H1YA 3RR8A 1SL0A 1YLXA 1UVMA 4DMZA 2RKIB 3MMCA 1F2HA 4NI2A 4C9DA 2LEPA 4C48A 3UDCA 2GO8A 3NWGA 3PDNA 4U67Q 2KYXA 3NXZA 2NPIA 3FEXB 2UXDJ 2H48B 1N33F 2J8SA 3NG8A 2AW0A 3TX8A 2XS5A 5KFAA 1UEKA 2DO4A 1BGXT 1VGYA 3NAIA 3DRPA 1WJ9A 3M30A 2A1BA 3DOLB 4IR1A 5ITHA 1GAOA 4B9LA 3MM6A 2JEFA 1XNQJ 1S0VA 4ZIWA 4EEYA 2VIHA 1XTZA 2HNZA 3MR2A 3EPIA 3PY8A 4RLEA 4Q8EA 2KH9A 3NS5A 5J1NA 2B8PA 3BSOA 4G1IA 5M2PA 4OHYA 1JXLA 2YNGA 2XYPB 3VQTA 2AEJA 1R0AA 4D3GA 1K1SA 4LQ3A 1R8CA 2Q43A 2FJVA 2I0XA 5LXRA 1T05A 2CJXB 3TEGA 4PQUB 4CLPA 3MECB 5DDQC 2YWEA 1CULB 4QWAA 4DX7A 4O0IA 1RCXB 2EK1A 1FK9B 1HNZF 1JJ4A 1R0CB 1SC1B 1ICEB 2EBGA 3W9JA 1VLYA 1D9AA 2GC8A 4X4PA 5LM7E 4A8WA 1IQZA 2GS8A 1TL4A 3C15B 2RIJA 3D6TB 2YXLA 2FZCB 3A8EA 4P2XA 4ETZA 4IDKA 3UN3A 3P45B 1RLDA 4K0KJ 1JXEA 5HP1B 2GMLA 2DNZA 3UD5A 3NBPB 1YZ6A 1VDHA 3H20A 2WVDA 3UVJA 4QIFA 1HYSB 2CPFA 3UFCX 2CA9A 1N5SA 4H4MB 1YBAA 2BX6A 4WK3A 1DAXA 1S6QA 1BUXA 3GJRB 1UA0A 1RXOB 1RAEB 2WBRA 3ZTSA 3LTOA 1VC6A 2R8JA 1NNDA 3NGRA 4AQYJ 2CQ4A 4O3PA 2JNJA 4MYUA 4CH0S 4DS5A 1S9GB 2ZD1A 4ZN3A 1ZA2B 3BO3A 1N36J 1FFWB 2KI2A 4DR1F 1CLFA 3AJ1A 4KJIA 4M5HA 3CJ8A 1A6LA 2ZUGA 5HBMB 1H98A 1RAGB 1UWAA 2GVZA 3GILA 2WCXA 1FCAA 2LXUA 2I2YA 4DOZA 2V63A 3N28A 1Y00A 3MWBA 1RGVA 3ZNUA 3ONQA 4WJBA 3OT9A 2BA9A 1HWJA 2PA8D 1ZETA 2P8IA 3TANA 2MKIA 3QSIA 3I56S 4ZCMA 3JQMA 2MKCA 1BE4A 2HVEA 4OI0A 4OYMA 5A8KB 2W01A 1R3NA 2Q6CA 2W1BA 4USHA 1QJHA 4Y2MA 2QLFB 2RILA 3CCSS 1PKUA 3GYXB 4F0KA 3M8YA 3NGDA 1YQHA 2C2DA 1SPBP 1LK7A 4DUYJ 4ZIVA 4USVA 3GE9A 1YJNS 1P8GA 4AL5A 1LWEB 4ES1A 2XG8A 1Q86T 2LYVA 3HULA 4ILLA 1HBUA 3ZFVA 4KHPJ 3HX9A 4P6QA 1E6VA 4NMLA 4U7UK 2HFSA 5CQGA 3DLEB 1IM6A 1X0FA 3HXMA 4MIWA 2Q3PA 2RDJA 4J9QA 3CD6S 1U1LA 3TAPA 1RHMB 4DV6J 1GX6A 4DPOA 5KG2A 4MKVA 1Y4ZB 3S8SA 1WHYA 2IM1A 2MY7A 3MD1A 1Y11A 2QLBB 2FJEB 5THWA 4KY3A 2HGNA 1RHJB 4M5DB 3CDBA 4OZLA 3X3UA 1RA6A 4DZ6A 3FCVA 2QE5A 2XMAA 2VFVA 5IC6B 3SI8A 2J7UA 4ECXA 2OPQB 3MM7B 3E3XA 3J7Z5 3TOQA 4NOHA 3MCMA 5KAKA 1T03B 1VR6A 3KUGA 2D3UA 2HZCA 3KTQA 1RWUA 2VKRA 3MEGB 1VBZA 1DY3A 1MLAA 4LIWA 2DIUA 4DSKA 3Q22A 3MMAB 3I96A 3W2VB 3N6LA 1WKJA 3BV8A 2KJVA 1CG2A 2CVIA 1VQKS 3I5AA 1QLNA 2VG7B 4LREA 4ETXA 2B4VA 4ZVHA 3HO1A 5D3GA 2C2EA 4NXMJ 4KGXB 2DRAA 4BDPA 4LFBF 1WG1A 2HS0A 2HZVA 2MKKA 5C24B 1NK4A 4LF9J 1VCTA 2GJ2A 4X4RA 3G96A 5U47A 1FERA 5KG5A 3CJSA 1H72C 1S99A 3IGVA 2LA6A 2RDIA 3MPDA 4DLGA 3G9CA 1WWHA 3OL7A 4ZCKA 4LVNP 4E0DA 3QATA 1F9HA 3Q8VA 4F7VA 2RUGA 1DLOA 3HCXA 3OJSA 1Q1KA 4C8MA 4ZHRA 4FBUA 4DX6A 3M05A 4W90B 3CUNA 4ED3A 5IQ6A 3OTBA 2JEJA 5A8WA 1MWZA 5IOLA 1S4EA 4TYBA 2DKOB 3R3TA 1M1HA 3VQSA 2W7OA 1HWIA 3DRSA 1V3ZA 2YNHB 3BBFA 2PC6A 4Y28C 3CDWA 2G0CA 1APSA 1TUVA 4R8UA 1TU0B 4Q0BA 4U9RA 4ZDNA 3G8TA 2FVPA 4NCGB 4CT9A 3FZ2A 2B0GA 2OPRA 5KFYA 5KG7A 1S1XA 2ADCA 3OL8A 2DY1A 1RT1A 3CJKB 2XZTB 5C5JA 3I32A 1C4CA 3AD7C 4WZQA 5KFFA 2E1AA 3QBCA 2IA6A 1UWBA 4URQU 5KFHA 4LUBA 1KFSA 4AXJA 3QQCD 1TKTA 4P52A 1X7VA 2FJDB 2HHQA 3U1NA 3NNHA 1WC5A 4YMEA 5GAHI 2F8EX 3QWPA 2V4QA 3MCOA 1MG7A 4LF7F 1UTAA 4JI0F 2IM0A 3V4IA 4NZ7A 1LXJA 3KWMA 2J6TA 4O3QA 3DOMB 1KEKA 3MEDA 4CCHA 2HLTA 3K17A 3I87A 1HNXJ 5ETSA 4WFXA 1XBWA 3CDUA 3H98A 4BWMA 5LMUJ 2UUCJ 2F63A 3HF5A 2KTQA 2OAUA 4IR9A 4DV3J 1OS5A 1TL1A 1TFWA 4PUOB 2PMZD 2MKHA 1EX8A 4OYXA 3NGSA 2Z58B 3HD1A 4I2QB 1RHKB 4F26A 2FJWA 5E3PA 4X62F 3TA2A 2HQCA 2VQFF 4LSZB 2J0XA 1F6TA 4J9LA 2CJQA 5KFLA 3Q23A 4NLUA 3R9LA 4ED8A 4DL2A 4NXNF 1QE1B 1S72S 4CTAB 3UNYA 5BYSA 1JNZB 1REVA 1U8WA 1WG5A 4K4YA 3E8OA 2B4UA 1N33J 2F7VA 2CQ1A 2HVZA 1C1CB 3FEZA 3MZIA 1HHQA 2H51B 3RAQA 4WXOA 1U45A 3KK1B 2DH8A 3W61A 3FKBA 2FYXA 1A0OB 2RRAA 3KJVB 2H5EA 2VC1A 2VKZG 1RHUB 1XMOF 1REGX 3AD9C 4E98A 3CXCR 1WI8A 3OSNA 3LWMA 4OX7A 4UT4A 3W64A 4DPXA 2OMLA 1YBTA 2WB1D 2OTJS 2F9DA 4A47A 1FJ7A 3S01A 3HI9A 5KFQA 4EFAC 1BQXA 3SSRA 3PW4A 2ZWPA 1JLEA 1GQEA 2ATLA 3R6GB 1EQ0A 2J9DA 2HWTA 3R27A 3PW0A 4O3NA 1N8RT 3HKZD 3HVAA 1Q95G 4X4SA 2HS4A 1CJVA 2FPHX 1R31A 1HNZJ 3BKFA 5CYMA 3A3NB 2P6SA 2LQJA 3PR4A 2GFFA 2CWKA 2UU9F 2UVRA 4WF9Q 1F2GA 1K0TA 3BN4A 1VQ8S 3PIPQ 4N7TA 2OLWA 4P7TA 3KK2A 4GKKJ 3Q8UA 1HW8A 3CEDA 1U0HA 2W9BA 2VODA 5MLCV 3I9V9 1J27A 2ZOMA 5C2CA 3G4SS 2HK2A 3HFKA 1MU2A 1LW0A 2I1RA 3EZUA 2HFNA 2XCAA 4B9NA 3DRRB 4M63A 2BQUA 2X1FA 2Y8YA 3DXSX 4CZCA 3AH6A 3IG1B 1ZAXA 1KQSR 2HRUA 2LEBA 2IIHA 4WFAQ 4Y6IA 1T0TV 4WKYA 2XI3A 2R8KA 2D9OA 1FEEA 3FSYA 1V5VA 2K7KA 4YB7A 1F5CA 1DBDA 2RRNA 2WBMA 3KLVA 1S10A 5E41A 1DJ0A 1FT8A 3V81A 1S48A 3RBEA 2HHWA 2YH1A 1UZHA 2IY5B 2NXNA 3W2WB 4F4XA 2BJ9A 2AGPA 4WBFA 4ZCIA 2ZH5A 4DL7A 4ZK7M 2B4OA 4OLOA 3JSMB 4RNHA 2NYIA 5EWEA 5KFMA 2VPWB 4ZLNA 1WG4A 2E44A 3DOKB 4UOGA 6FD1A 2PFFB 1GH8A 4HTIA 3HFZB 1HA1A 4YQWA 1BC6A 1T9XA 3AXMA 2M88A 3PJ9A 2XLKA 1K0VA 5GAEU 2F4VJ 3SDEB 4F36A 4DR3F 2KDOA 1Z2ZA 2VPXB 1QVFR 2HQFA 1VRTB 4DF4A 4TY8B 2YNFB 3UD4P 5IWAF 1XR6A 2CPEA 3H5UA 5DG7A 2GQ2A 1TUGB 4NYOA 2O01C 3G8SA 1WKLA 3GSDA 1RE1B 2VOPA 3PR5B 3SYZA 4HYKA 2KZZA 2VFRA 3CJ0A 3G82B 2ASJA 4NX9A 4Q2LA 4DBQA 2R2TA 1WKKA 1D8YA 2EG1A 1WC1A 1IKXB 3VTIA 5KFPA 1X5PA 1IN0A 1CC8A 1UETA 1EHWA 3W8GA 3SEOA 5BR8F 2A0FB 1YZ7A 3D28A 2XMTA 2CJYB 2HRTA 2HQDA 2HHVA 3CCRS 4NLWA 4CH7A 4RBVA 3NEKA 5KFOA 2FVCA 2YWGA 3M7VA 5DO2A 2Z8QA 2Y1RI 2DY9A 3ETMA 1GMWA 1TKDA 2HMIB 4LRCA 1E6YB 4LFAF 4IUFA 4KBIA 4J9VA 4AYBD 3PW2A 2IC3B 2G2ZA 4X4QA 1C0TB 5HANA 2JEGA 2CQ3A 4QYRA 1SKRA 3OFGA 3UR3C 5HVHA 4OZ2A 4JV1A 1NHKL 9RUBA 2NSCA 5C7PA 4A8XA 3JSYA 3F56A 5L39A 4DR7J 3BEGB 5H9EK 1IKVA 2BRLA 4DUZF 2CQ0A 3TARA 4HL9A 1JJ2R 4LSLA 7FD1A 5KG1A 4C4WA 1OQ6A 4OHWA 1FFGB 4JI5J 4DR4F 1UP1A 4B9UA 3MAAB 1RT7B 2VFUA 3CJQA 4OI4A 2B7BB 4IKAA 1NSQA 2V2VA 1AYEA 4ID5A 2OEMA 3D54A 5DZ6A 3BGRB 3K8WA 4MKYA 2JC0A 2WVCA 3RU0A 4LFBJ 4KGZB 2JZ5A 3BO2A 1Q53A 1OY6A 3DI6B 4PG6A 4GRSA 3RBDA 1XNRF 4YDXA 2B5JA 2MDAA 1QM9A 1KNZA 2YWFA 4KAIA 1RWPB 3EICA 3CDAA 5DDOC 1FXRA 5CYQA 4O3SA 3LOUA 4PPZA 1CBKA 2IMOA 5CXTA 2CQCA 2DNYA 4GO7X 4JI4F 1NRKA 2OUGA 4KO0B 2BVZA 3J81j 2EFOA 5HQ8A 2P9EA 2KM8C 3KK3A 3ILLA 1TTHB 1CJTA 1PO6A 2A10A 2BANB 2AGOA 4W4MA 1UPMB 5RUBA 3GIIA 1VLOA 1B3TA 3DM2A 3DMJA 2V6AA 2I5JB 4I6AA 3D1OA 3L4BC 2K3IA 1W25A 1Z4UA 4FPIA 4J9RA 2DNMA 4YN3B 4K4VA 1NMEB 3CCTA 5E0OA 2XO7A 2P5VA 3D0HE 2ZKUA 2WONA 1HFEL 2X1GA 1VHFA 2QRRA 3SQGA 2ACYA 2CQGA 2C2NA 4I69A 2MHEA 3HZEA 4XPCA 2UUBF 1FESA 3ELHA 1V5IB 4ATNA 4QPXA 1ZBTA 1FD8A 1HQEB 3BH7B 3D3CJ 2DGTA 4YR2A 1VBYA 4WTOB 3BGFA 1NHUA 3IM9A 4O4RA 1K73T 2GX8A 2ILYA 1W7WA 3W5XA 1U25A 2ZFHA 1M1GA 2QC3A 4UQGA 2DB1A 4KKOA 4LF7J 2EXUA 5GMDA 3Q8PB 4JI0J 4PWUA 3M2UB 3OR2B 3R7NB 1XC9A 2F40A 1RQ0A 2OEJA 3LP2A 4L74A 1R89A 2CUYA 4OYWA 2Z56B 4P7VA 1T9YA 2MZSA 2ZH1A 3MPVA 1HL6A 1RT6B 3J80U 5KFKA 1RWOB 4P2MA 4NPOA 5B0AA 3N0VA 3H2UB 3PYGA 3C6UB 3EDQB 2KHDA 3PYFA 3TNVA 1BLUA 3MM9A 1KKHA 4NLOA 1S9EA 4NA2A 1RU1A 1VC5A 4MJKA 3DCAA 1TVRA 1WF2A 4X62J 3D9BA 5FDLA 2NREA 5I3PA 1IBLJ 2VQFJ 2IJFA 2XWYA 4B3SF 4OJHA 2DO0A 4WXWA 3FFIB 1S1TB 3RR7A 4C0OC 1D8ZA 1WDDA 1S12A 3I5CA 4DL3A 4ZVQB 4OJGA 1YJWS 4NXNJ 1RAJA 5F3ZA 2H65B 3OTDA 3R6LB 2XSFA 3EXCX 3MCSA 3CCUS 2EG2A 2BQ3A 3LAMA 4Y34A 3FCWA 1GEHA 5I42B 2FLLA 2NXEA 4DX8H 2XBPA 1RTHB 3ZZOA 2V2QA 3DLKB 1Q5YA 1H2UX 3N6MA 3SCJE 1QVGR 1PILA 1MSWD 1ULRA 2FZKB 1UJ4A 4WP3A 2KRBA 1FX2A 3ZTPA 4KFBB 2WSCC 2PEHA 2L3MA 1XMOJ 2YNIB 3MMJA 3HVRA 2RT3A 4TQRA 2C3UA 1RAFB 3QO9B 1H3DA 2N7CA 2UXBJ 5F8IA 1TL3A 3OTCA 4RW6B 4GVBA 2NLWA 2DR9A 2CJBA 4PG7A 4X4NA 2J8AA 5KT7A 2UP1A 1L3SA 4TVAB 1IBMF 4ED4A 2QEXS 4K4UA 1VC0A 3MF5A 3KHLA 3M32B 3KJQB 1B7FA 2V4JA 3HVTB 1W2BR 2MQMA 3LP1A 1NDLA 3D1HA 5EGYA 4ZS6A 5EN1A 1N48A 2KHCA 3QLHB 2UU9J 3NNCA 3R2CJ 5C42B 3HMJG 3GIRA 4LFCF 4CLSA 5F0WA 2AEFA 3GIKA 4C8YA 1VBKA 2UV8G 4WTYA 3PX0A 3HSGA 5IC4B 1IXKA 4OX9F 5G0RA 4B3MF 2OIHA 4QIVA 5BJRA 3OFFA 2KVIA 2W25A 3H4BA 4A8KA 1NUEA 1RT4A 2HBZB 1EKSA 3OBIA 2ADBA 2DHHA 3N4WA 3LANA 2RH3A 2W9CA 3D68A 1Q0NA 1C1BA 4Z2XA 4DR2J 1RAHB 2M52A 4MKAA 3ZTQA 2G0IA 3P6YC 4LRFA 3R2DJ 1FDBA 1RBOB 1M5PC 1UEUA 3KLIA 2BJ8A 1ROFA 2V2KA 2RD5C 1LWFA 2Z0GA 4QYZJ 3K5NA 2KU7A 4B3OA 1SI9A 1RT3A 3QIPA 4H54A 5KFEA 5A76A 1HARA 1PGZA 1VMBA 2YX7A 3EZ5A 3C6TA 1RTIA 4ICLA 3SCIE 4N41A 3CT9A 3Q8QB 1S59A 2HFVA 3MDFA 1I94F 3OFEA 5A0YA 3SBMA 1J5OB 3HT3A 2E5LF 4L76A 3GFXA 4ZKAA 4KHRA 4IFVA 2C3MA 4FS1A 1N56A 5KFNA 2HURA 2EFNA 2B8QA 4DHVA 1AROP 2RKIA 4TY9A 3V6KA 4ES3A 1UVNA 4PPDA 1SIZA 4CQ1A 1NZAA 3T5HA 4HDHA 3C46A 4PWDB 5L1LA 2RQ4A 4I56A 4TYAA 2LQBA 4RZRA 4TKTA 5JXSA 1ZM2A 3W7BA 2OJ3A 1V6HA 2B9WA 2PMHA 3MTKA 5D4PA 5IM0A 4NLYA 1A7GE 2GJIA 4ZVSB 4I2PA 2JOQA 4M94A 3CC2S 1IVZA 5L8RC 1NJWA 4DSLA 2ZBCA 5BR8J 4NYPA 2DHXA 3BYRA 3H8YA 4C0HA 1G3OA 1YSJA 1TK8A 3L9ZA 1WDTA 4ZJOA 2VD3A 2J5AA 1TKZB 1LEOA 5LSRA 1UFKA 3D2WA 3M2VA 4LRAA 2I9SA 4KHMA 3T1HF 4LFAJ 4PQUA 4QJVA 2YKNB 3CC7S 1RACB 3AB4B 4DG1A 4I67A 1K8AT 4H4KC 1N0VC 2ERRA 3AJDA 1H38A 2DGUA 4PRFA 2KRRA 3B54A 2CQDA 2RU9A 1HLWA 1QAIA 1KFDA 2OFGX 3LGMA 2W8KA 1O5JA 3CPWR 2CKWA 2NZCA 3NCRA 4JBCA 2BABA 1NKBA 4P2SA 4CLYA 3VAFA 4DUZJ 4RNNA 3KDNA 4OI6A 2IM2A 3TA1A 2OTLS 2LQ8A 4IFYB 5DETA 1Y5NB 1RWKB 2V8DA 4KV8B 1HBMB 2OO4A 3FMWA 3LALA 4FNHA 4H4MA 4DR4J 3M8WA 2P2CB 2HKEA 2MKSA 4V1Ak 3D3BJ 5B0BA 1FI4A 5FD1A 3OFHA 1IM4A 2KJWA 1JLAB 2HQGA 2JVRA 4RNOA 3L95X 2PN6A 2GHWA 1GX5A 1MW7A 1JMTA 4K50A 2MZJA 2D41A 1M5SA 5DJBA 5GAGU 1RLCL 4HHJA 5I3UA 3P5BP 1PAEX 3C2PA 1YVFA 1MMNA 1XNRJ 2H4WB 1S9GA 1EETA 1J2VA 4TU9A 3BPSP 3AJ2A 2VOOA 4G3IA 5F8MA 3N5BA 3TVYA 1N52B 2VQEF 4A48A 5CA5A 3A8IA 2B43A 3KLGA 2ZBQA 1UKUA 1FKOB 5K9FA 1F9EB 2EFPA 4OYBA 4WE1B 4NL5A 3AT1B 4QYZK 5CHCB 2LXIA 3IR6B 2PE8A 2IFXA 2IVMA 3HHLC 1T9UA 3H4DA 4Q8FA 4DPTA 3EUNA 2JL9A 3I9ZA 3CCZA 2QZ8A 2CYYA 2JEIA 3BM7A 1JKHB 1R8BA 1T3OA 1RBLA 1WOPA 4LBPA 1ZZNA 3K2YA 1RISA 2AJ2A 1GMWD 4ERDA 2B6AB 3PW7A 3PRBA 2D9PA 2GQQA 1LFWA 3AODA 1RWXB 3CC4S 1I51B 2YVSA 2UUBJ 2E1MC 3VGUA 2MQNA 1S76D 4Q5VA 1LWEA 2E29A 1HPZB 4ZVRB 4LR7A 5ETTA 2NXUA 1PYSB 4U8VA 2W24A 3ZTRA 4YB5A 3JAMY 5F8HA 4X4OA 1RAAB 4CYUA 3ENQA 1N5YB 3K89A 4P74A 2O5DA 2DJWA 2M7SA 4FDFA 2WVBA 5KFJA 3PHEA 4AUKA 2W2MP 3C14B 4F4AA 2R2SA 1CC7A 2AJ1A 4PYAA 3IAS9 4I6WA 4ID8A 3BKTA 1VQ4S 1SXLA 2W4DA 4UY8T 1X8DA 2ZBIA 1C4AA 3IN5A 2E1CA 4I6YA 3Q2TC 2XY7A 4HEA9 2ZHOA 5DG9A 4WPAA 3DKDA 4BLGA 1I3OB 1VIOA 2ZUAA 3CJTA 4F4WA 2D1CA 4NLSA 4J9PA 2V94A 2XCPA 3CO0P 3FQLA 2XMWA 4NI2B 2Z57B 1CEZA 4MT1A 3LP0A 4PKDB 4P9SA 3OJUA 4GKJF 2VBYA 5E3CA 2XNQA 1FF2A 2UVUA 3KOAA 5EUHA 1S4FA 4C8KA 3H90A 2C3PA 4AT1B 2BW2A 3W2VA 1KS2A 1MWYA 3AHPA 2M8DB 2GIRA 1S57A 4X65F 3U02A 2B9YA 5EDWA 1M5OC 3T9ZA 4RL1A 3DRPB 1JWWA 4HT7A 4XPEA 1JLCA 1TKXA 4KR0B 2FDNA 4GMKA 3MM6B 1KHWA 2EC2A 1UFLA 3VZIA 4USIA 3MM8A 3POTB 2HNZB 3KHRA 5C24A 4J9MA 3HSZA 5DM7Q 3N6NA 4EBDA 5T41A 3ETOA 2G2YA 1P27B 3DDIA 3OHAA 2V50A 5AT1B 2YNGB 4DV2F 1HBOA 2YWHA 2MB0B 2OFHX 4NLVA 1C0UA 1R0AB 3RRKA 4FXVA 1LW2B 4HVZA 1PSDA 5L9NA 2BM1A 2JX2A 3R8YA 3GCXP 3HHLD 1UJ6A 2CFXA 2D3ZA 1FRLA 2IA0A 3G6VA 4YR3A 3CWJA 3GR0A 3UCZP 2FJAB 3BJYA 3MTJA 4I68A 4ANDA 2ZJRQ 4IG3A 2HGMA 1EJ7L 3CTRA 1UVLA 4B02A 4PG8A 3P4UB 2ZBRA 4LFCJ 3MEEA 4NRTA 4B9VA 1RAIB 4ZPBA 4OX9J 3KXDA 5ETNA 3SZ2A 4B3MJ 2HQIA 3KJFB 3BKUA 4ER8A 3CCJS 3WQPA 1RI7A 4GC7A 1S6QB 4HH0A 1GT8A 1HWKA 1U6ZA 4BC9A 4G6VB 3ZZPA 2DR5A 4ZLLA 1NK6A 2Z2YB 1B99A 2E5IA 5A8RA 2CZ4A 1FWLA 2UVVA 3J7YU 2VV5A 2HHTA 2UUAF 3QNWB 3PACA 2ZHAA 3VGVA 1MMLA 1IR1A 1X31C 5D0HA 1WACA 3CGIA 3TVZA 2MJUA 4QZVB 5IT4A 3NOGA 1S0MA 1RB0A 4ED0A 2D3OR 4DFMA 4ELUA 3SMZA 4M95A 3QFHA 1EARA 2HIQA 3BSAA 3UDLA 2M9KA 2HZAA 4B9MA 2DNNA 1R27B 4IH6A 3W9HA 4XK8C 1TAUA 2DEIA 1Z1ZA 2BKNA 2YWKA 1LWCB 3FZBA 4ELTA 4F04B 4DPUA 1NAQA 3OV7A 1ZS6A 1OO0B 2IYIA 5D78A 3GYGA 4NZ6A 4DV4F 1ZZFA 3M8PB 1N54B 1YIJS 3MR7A 4IH5A 3G6YA 3CIMA 1XJWB 4AD6A 2BXJA 1HNVA 3UWTA 2XMUA 4HT5A 1C1CA 1S1VB 3W62A 2AZ3A 4F25A 1RT2A 3P3DA 2XM3A 2K1RB 4QOTA 2HNYB 4OLPA 1FDAA 4WCEQ 2PSZA 2XHWA 4MMOA 2PD1A 1E6VB 2RB7A 2KVQE 4K4TA 4GO5X 3WIUA 4DQRA 4NLXA 3KG4A 3R7BB 1RTDA 3AB2B 1WD6A 4OMFG 2XZDB 3QZ7A 2X3DA 1FHTA 1KOHA 2L08A 2BBEA 4OV1A 3DYAA 3M8QB 3C16B 4TQSA 3W65A 4M5KA 3K5LA 3LGHA 2A6MA 4N47A 2FLNA 2JFKA 2L48A 2J9CA 4CO0A 3J7A1 3LF0A 3HM9A 2W2OP 2GIQA 4IOAQ 2R8IA 4WP9A 2RNEA 3LUYA 4ED1A 4CP5A 1R8HA 4JI6J 2OP5A 3PFOA 4JI1J 4USMA 4EZ9A 3UR0A 1D9DA 2JWNA 1D1UA 1Y0HA 2DPJA 4ECRA 3PRVA 3VGSA 4Y00A 1MWQA 4ZLJA 2QMUB 5LMNF 4C3MA 3VZHA 4A46A 4L3KA 3NOCA 2HPUA 1YJUA 4JOUA 2R7XA 1BHNA 1BXNA 3A1YG 1IKWA 3NAHA 2W7AA 4B9SA 4TLRA 3R97A 2DGSA 1EP4B 4YP3A 3T9NA 1T9WA 3IG1A 1NZ8A 2IVFB 1CQNA 1FRXA 4DF8A 3BDPA 3LW5C 4QWDA 2Y1JA 4WFNQ 3M8RA 3NGUA 3EM1A 3MFIA 1S1WB 5B09A 1RWMB 2I8EA 4UTGA 1IR2A 3K5PA 4IRCA 5J1PA 1QD1A 3H59A 3CCES 3TW0A 1R0BG 5KFSA 2V8HA 2BW7A 4C8ZA 2C2KB 3TZZA 4OZ3A 2HWIA 2UUWA 3BPDA 5K20B 4X84A 2XTJP 5CZXA 4N8OA 2VQEJ 5K5MA 1X4FA 5F3TA 3JAMU 3QYYA 5KT2A 4K2JA 3MM5B 4WP8A 3S7RA 1N0UA 2Z30B 4WWSA 5J2PA 4B17A 4HKQA 1UFWA 2WVEA 4LBHA 3DRSB 4ZVPB 5HATA 1R8PA 3D5MA 2CDQA 3NLCA 4EO8A 2E5HA 3ZC4A 3KNAA 4C6AA 1RADB 1X4BA 4Q0BB 2LDYA 4TY8A 1PC5A 5ETLA 3MOZA 4OI1A 1KRPA 5CD4A 2PO4A 4RKUC 1T7PA 3M6XA 4YY3F 1RUSA 2V8VA 2OPRB 2CPHA 4YFUA 3MXHP 4N76A 3W63A 4TLQA 2EKNA 2KM8B 1S1XB 2H54B 3CJ2A 3H7HB 3KLHB 4NMXA 5DS7A 1X60A 2HVHA 1AXQA 4DN0A 2XI2A 2MQPA 2GGPA 1UWBB 3FGVA 4C11B 5D6GA 2NPFA 1TKTB 1IKXA 2HNDA 1G7CB 1L3UA 4OJ1A 3TWZA 4J90A 3THVA 4WFYA 3A3PB 4S0MA 4DSJA 5KFDA 1GXUA 2FHJA 4ZPCA 3TUJC 3V4IB 2WHOA 3SIPB 2R7TA 3MEDB 4OJ3A 3EGZA 1XN9A 5ETPA 3MGJA 3FRZA 4OZ0A 4BC7A 3ZTOA 2AYMA 2AJQA 3DLLQ 1NK0A 1KWMA 2GNKA 3MR5A 5FLXU 3QT7A 2DGWA 1WC3A 1XEZA 2KKHA 2GZOA 1T8EA 3UO0A 2A18A 1SUQB 1AUSL 2LXFA 4CLWA 2F5GA 3H25A 3FQKA 1FVQA 2ZH4A 3CCMS 3IM8A 4OI2A 3OXFA 3SV4A 2LCWA 1KVKA 1CJUA 4JV5F 4EGLA 2WTFA 2IHR1 1WNEA 2DPIA 1RABB 2BE7D 2ZH7A 1REVB 3HJFA 2RU3A 3S1TA 4JI7J 1EZZB 2ZDOA 3G87A 2MQQA 3NGTA 3NCPA 2KT3A 4ECYA 1N88A 4J9SA 5LL6d 3GB0A 1N6QB 3V6HA 5HQMA 1KDNA 1SC4B 3BGRA 2IAJA 4LIRA 1HQUA 4LF6F 4FYVB 4EO6A 2DXFA 2AJ4A 4FKXA 2C2OB 3HDSA 3G6ES 5D15A 5EX3A 1HMVB 3HFVA 8RUCA 4ZP8A 4EUVA 1L3VA 3R5AA 5HAOA 2C2MB 4LMZA 2M70A 1FA0A 2AHOB 2FUG9 3KG0A 4ED5A 3BBCA 4DV2J 1VQMS 3JSBA 1JLEB 3C3LA 4OQJA 3D7SB 1N32F 1BD6A 4I7FA 3W66A 4BWJA 4KO0A 4LJMA 3AOAA 4GVLA 3R5BA 1CJVB 2HHXA 2XGQA 5CYMB 2QSWA 2U1AA 4L3NA 2EPIA 4B9TA 3Q83A 2ZC3A 4CLUA 4RBUA 4ECWA 3PXGa 3TAMA 3MR3A 3M9NB 1U0HB 2W9BB 2F65A 3OR1A 1MROA 1VK8A 4XDCA 4C3KA 2ROPA 3H0PA 1MU2B 1LW0B 2HBRB 4OYPA 1RTZA 3IGNA 3TA0A 2MEWA 1SJQA 4JP8A 4O44A 2YY3A 3VVTA 3BREA 2O1PA 2E1RA 2KZMA 3PNIA 2B9XA 4MAKA 7FDRA 2EKYA 1VRUA 3PYEA 2X51A 1TMJA 4ANEA 3US5A 3CCLS 1G1XA 4CO3A 2PT0A 2ZE2A 4IYQA 2ZZTA 3R1LA 1H7XA 2UUAJ 5DQHA 3CF5Q 1S6PA 3V81B 3JTOA 2MZQA 2OI2A 3M6VA 5HQLA 5AJ3J 5KG6A 2BR0A 5B0GA 2AKWB 3T5JA 2HWHA 1PCAA 1N5QA 3IS9A 4AL6A 3QT8A 1HW9A 4CH1A 1SB6A 5A2QY 2QA4S 5IFMA 5FJ4A 4HHUA 3Q8RB 3I0SB 2Q79A 4M8LA 3C6UA 3HT0A 5D4NA 2FY1A 1ZTWA 1Q7LB 2EBEA 1FKAF 3E51A 3Q0AA 2MGZA 4G1PA 3TUPA 1TZ0A 1JXVA 4DCPB 5KFGA 2ILZA 1K44A 1OSCA 1BY9A 1KTVA 2HHPA 2GMHA 2QTWA 1KTQA 4DJBA 3D6FB 4DV4J 4HI1A 4F2SA 2BOAA 3UI3A 3CJ3A 2MMYA 4ZJLA 2UXDF 2G0JA 4M5NA 3FBEA 3FBFA 1S6UA 4OZJA 2HVDA 2ZNZA 3L7OA 4XIUA 1TL7A 2DXDA 1CS4A 2GVDB 3DGPA 1RZMA 1M90T 1DURA 1NM2A 1EKRA 2FJBB 3EMTA 3KLFA 1XNQF 1GFWB 2VASA 3BO4A 4I4BA 5KT5A 5HROB 2MQ8A 2J0SD 3THTA 4R25A 1KSPA 5DG8A 4KPCA 2AZ1A 3HP6A 1EIYB 2M0GB 2YNIA 1BWEA 3DRYA 4WYLA 1SL2A 1OIAA 1YBUA 4ECTA 3QO9A 3T6BA 4USKA 1NCLA 1S6OA 1NPRA 3UQSA 4MFBB 3FBCA 3H5SA 3HHKA 3IBWA 2FD2A 5GAEI 4L6V3 4Q2MA 4K5RA 2ASYA 1HWUA 3QMQA 4Z37A 4USTA 4LSNA 4OL8A 2RUSA 3EPGA 3TYTA 2CJKA 3MPYA 2BOPA 1HWLA 2J6SA 4ILRA 1X5TA 2IDLA 1TL5A 1TFYA 1G4CA 1ITPA 5C42A 4ZPTR 3DN9A 4DL6A 2G1HA 1IKVB 1RHQB 4AXIA 3RYLA 4P2FA 1WOSA 3VAIA 1NSAA 2DHAA 1X9MA 3QGGA 4LSLB 2LLZA 3BR8A 3MUTP 1NH7A 5LMNJ 1RWVB 2OKQA 2AX1A 4EI2A 1LXNA 4XAKA 2DGXA 2HEKA 2LFVA 3FK4A 5D8HB 2NXCA 2DNGA 1YDLA 1WSRA 4P75A 2UXCF 4FKYA 4ID5B 4Q7AA 5LJ5Y 3NMAA 3RAMA 3RB6A 1WHXA 3EVOA 3NMRA 3IFEA 3NL0A 1D0EA 4ZPWR 2HFUA 2YKOA 4LF5F 1IWAA 1YRUA 1QDUB 4JI2F 2XO6A 4DV7F 3TZWA 3OXLA 2ZHBA 2C22A 2XHCA 4CLTA 1RTJA 1NHVA 1T95A 5DGAA 4J5OA 1RK8A 2VJUA 3OPKA 3OHBA 4ZP7A 1U49A 3SFUA 4K4ZA 2GAGC 2F8HA 3BYPA 3B4DA 1O8BA 3AQOA 1WI6A 4RX6A 1X9WA 2L9NA 1UAWA 4M5MA 1Y5LB 2XULA 1J5OA 1V3SA 3KK3B 1CJTB 4NLQA 1VQYA 4DCJB 2QL9B 4D3HA 3ILOA 2DD8S 4DLEA 5ETMA 2NUHA 5H9FJ 3CDEA 4NEZA 3DM2B 3DMJB 3KYLA 3TJ8A 3Q24A 4DR5F 1MMDA 3U1MA 5KFUA 4A8OA 2K3KA 1O0PA 3ZZUA 5KFXA 2XYHB 3GJTB 4YY3J 2P9GA 2WONB 5J2MA 2CNLB 3SQGB 4DXLA 1X4HA 3J81U 2VONA 4DUYF 4PABA 2KT2A 5IT9U 2BV3A 3HHLB 2KXNB 3JTNA 4R5PB 1FRJA 3AXKA 5KG0A 3AOBA 4EZ6A 3ITHA 4C98A 2DR6A 5E3RA 4DN9A 3R5JB 2KB2A 4RNMA 2CPJA 1XWLA 4HDGA 5HI7A 1SH3A 3T5KA 4KH0B 1VQSA 1NDKA 3HKWA 1IJFB 2DNOA 4KKOB 3W60A 2FC9A 2FHMA 4DFPA 2JLFA 3M6WA 3BQ1A 2RQCA 3LP2B 5J2QA 3S6EA 4ZMMA 4DV6F 1ACMB 2ZH9A 3EZOA 1CJKA 2H9ZA 1M1KT 1YRXA 1QTNB 2YWWA 2YKAA 4Y65A 5I4MA 4CWBA 1OY9A 5LOQA 1FJGF 1S9EB 3J80Y 2WK4A 2DCUB 1X4DA 3QSYB 2CXEA 1TVRB 1VJWA 3MPWA 1OQ3A 3BGUA 3TRGA 2COLA 2VG5B 5FDLB 4C2MA 2AYGA 1X4CA 3MAHA 1GNKA 4QR2A 4DCOB 4K7QA 1SBRA 3BF4A 3IBFB 3QIDA 5C25A 4C3LA 4HLBA 4UOHA 5B7WA 2XZWA 1W26A 2AD9A 1YK9A 3HVWA 4LR8A 2ALZA 5A6PA 1QUVA 3ZZZA 3M1VA 4Y0FA 3M2RA 1U6BA 4EYHB 4X64F 3I0RB 2R7SA 5K8NA 9ATCB 4KV8A 1HBMA 3H5XA 1VQNS 4WZMA 2MZ1A 1NK8A 3A4TA 1JLBA 2F9JA 1U47A 1JLAA 3ENWA 1FRKA 1L3KA 1FEHA 2HBQB 4NCAA 2K8GA 3R7SB 2XY5A 2PEBA 4LF6J 2HS3A 4LF9F 3ZO7A 1OPIA 1X9SA 3MPUB 2XEXA 1O6XA 1HIYA 1UW9A 3G2XA 5BXIA 3NP5A 1N4LA 1YJ7A 1WC4A 1Q16B 1PAUB 1BWVA 5KFRA 2OGUA 4PXCA 1ELOA 1TL3B 2Q1LA 2E7WA 3I31A 4K2XA 4YUDA 2DT9A 3O3LA 4GVBB 1IQTA 1L3TA 3PCOB 1ZAWA 1UVJA 2E1PA 4J9NA 3N79A 1NH8A 4F67A 1NK7A 1KQGB 1PG5B 1N32J 3OLAA 3ENAA 4RW8B 3B8HA 4M5GA 4P73A 1CVJA 5F8NA 2G2OA 2C3YA 2J76E 2V4JB 3LP1B 2YQ1A 4N77A 2V68A 4RJVA 3NGKA 2HYIB 4KC5A 2J9DE 4EBCA 2ROGA 2KT5A 2LECA 2GQCA 1X0PA 2CPXA 1BQMB 1FJCA 3KHHA 5A2QU 3CCQS 4W92B 4DR1J 4FPRA 3H2VE 2XWXA 2DNQA 2RF2A 4UF4A 1SKUB 3K0JA 5G0RB 3U7JA 1JKHA 2GV1A 2BRKA 2JVOA 1U1KA 1G2EA 4J37A 3KDOA 5GMKa 4MIBA 1RT4B 2GIFA 5KFIA 1XIQA 2BE9B 3IXQA 1GK8A 2V9WA 2C28A 1AUDA 1WOOA 1GXTA 1KN6A 1JLFA 2W9CB 3ISZA 5H9FK 3HZGA 2BE2B 3K5OA 2U2FA 1AT1B 4OHXA 2C42A 4Z7YA 1H73A 1LWFB 2DIVA 4URSA 4G1QA 3I6PA 2NR0A 1SJFA 1RT3B 3QIPB 1HNXF 1PJ7A 5L46A 3GJQB 3OUYA 2E7VA 2UUCF 3C14A 4ICLB 1P9YA 2IM3A 3RTVA 5ETQA 2DHGA 3N9UC 4DV3F 1VIXA 3ET6A 3K58A 1ZPWX 1T9VA 4USUA 5A0YB 2WRMA 3AQPA 1HBNB 3PO4A 3UCGA 3PG9A 4FXDA 4EBEA 3OL9A 4HACA 3B6BA 3MMBA 3LPEA 1VBXA 3HPOA 3DLGB 1F0XA 2BMBA 2NXJA 2PIIA 2AF6A 2RJZA 5LT5A 2AV5A 2N3OA 1KHVA 2G1DA 3I5BA 5KG4A 5LJ3Y 4RW7A 3CE8A 2IYGA 4YEAA 5IM0B 2JLGA 2CJ9A 4I2PB 2FTRA 1M5HA 4U8YA 2CZ9A 4UOCA 3C66A 3BQ2A 2OPSA 3DGVA 3G71S 3DDNA 4JV2A 5KFTA 1KP6A 2OEKA 2SXLA 3POTA 1Q8IA 4E2FB 1Q5VA 1S79A 5F41A 2XQCA 1YI2S 3OTEA 5IXUA 2Q66A 1VRQC 3DU5A 2R4FA 1S1UA 3EXYA 3JQKA 2FVRA 5CAAA 3WDOA 2GAHC 2WVFA 2YKMB 4LF8F 1YJTA 2FGCA 5B0CA 2OPPB 3C8YA 3M2VB 1RKIA 2QIFA 1KLMA 1LW2A 3IRXA 2BJ3A 4DSEA 4NE9C 1SV5A 2RRBA 4DG1B 3ZZ0A 2UVWA 5J1EB 4ZVTB 2XSJA 2DNRA 3V6JA 4A4JA 2QGFB 2WB4A 2OD6A 3SCLE 4RBTA 1CSJA 2YBVA 1XERA 1AA1B 6AT1B 1DTQA 4IO9Q 3WX4A 2DBBA 1H6KX 4FVCA 1U1NA 1F3VA 3D6HB 1F60B 5DM6Q 4GKKF 4MH8A 1JJHA 2ZVSA 2ZH6A 2XMMA 1U1MA 4DQPA 1FD2A 4RW4B 4X4VA 3PW5A 1B70B 4ZN1A 3ZNJ1 4RUAA 3K7RA 4HTJA 5F9NA 3L7PA 1B4SA 2W4PA 4PEOA 4CNZA 2GCFA 3QRRA 2WSEC 4KPYA 1NJZA 5DLGA 2AX0A 2QLXA 3QAUA 2DVIA 1NPKA 5KFCA 4K4XA 4UQTA 4K59A 2UXCJ 1BQNB 1RBAA 1S7IA 3KUEA 1V3RA 2JH3A 1TQLA 4DSIA 3LWLA 1RKJA 2H3EB 1X4EA 3UD3P 5I3UB 4LF5J 3E01B 1OYEA 5KFZA 2OH2A 4LF4F 4JI2J 4DV7J 2HFZA 4LT6A 3AAWB 2ZH8A 1EETB 1IKYB 3MEKA 3O2IA 2WOMA 4OV6A 2XMVA 2CADA 4E8UA 5H1SV 3D6MB 1VK3A 3GR1A 4PQAA 3KLGB 1AFJA 5CYJA 3TO8A 2DYAA 4ZVGA 3KJNB 4GC6A 5L1KA 1FE0A 4FS2A 1LNQA 1FJEB 3AA9A 1F1BB 5IV4A 2PA3A 4DQIA 1LWCA 5HMWA 2GA7A 1NU4A 2ZH3A 3KMQA 4BS2A 4Z7CA 4LVOP 2F4VF 2LU1A 3GWCA 5HVGA 4TXSA 1SVDA 2FIUA 2ALYB 1HI1A 1K47A 4JI3F 3WZ0A 5KFWA 3T6JA 4KB7A 3CCWA 5HN0A 3M8PA 1S7HA 4DR5J 1ZPVA 4V19X 4DI6A 1PYTA 3X1LB 2E5JA 3TX0A 4MK9A 5K14A 5D0RA 1OYDA 2RSQA 4H4OB 5GAGI 3AY0A 3BR9A 1NJXA 2R9LA 2LQ5A 4IRDA 1SL1A 1Q79A 5GVQA 4NLDA 5GADU 1S1VA 2V9KA 1FKPB 2RE1A 1GMVA 2B51A 4DSFA 2VPZB 3PZPA 4DU8A 4BCAA 2K1RA 2HNYA 1PJ6A 2F8MA 5D0EA 4O0NA 4EK2A 1DRZA 4TNOA 3DDKA 4CYUB 3T3FA 4WK1A 4HI2A 4UZCA 2ZJPQ 4ED2A 4ZVOB 5HVFA 3PO5A 2VG6A 4K8RA 1U7LA 4PG5A 2DITA 4EMDA 3SSQA 2EI5A 1QAJA 3M8QA 3C16A 3B78A 4RU2A 2A2CA 3KLEA 2M8HA 2X1BA 4KRWA 5DQIA 3PRDA 2AYEA 5T7LA 4CLLA 2K2PA 4IG0A 1FJGJ 1WSVA 3PX4A 5KFBA 2MZRA 1VQLS 1HHSA 3FRYA 4DR7F 2H4YB 3UN2A 3LP0B 3M9MB 1VQ6S 4RWWA 3OW2R 1KC8T 1KONA 1OSDA 1DTTB 2J7WA 3W3SA 2BJ7A 2DH7A 1QY7A 2CPIA 3FCHA 3RZAA 5J2NB 4X64J 1RDRA 2VL1A 2JHEA 3JYTB 4ECQA 3DLHA 4JI5F 4Q44A 4NASA 4CM2A 5CCMA 1JLCB 1TKXB 5F8JA 4QR0A 5SUHA 1QAYA 2VHGA 1EP4A 2R7WA 2IRYA 3RAXA 3MM8B 5AXNA 3IRWP 3HD2A 4QIGA 4UY85 1TUWA 1RT5A 1S1WA 2VC0A 1NKCA 4NZ0A 4C7QA 1IBKF 1DQ8A 1AZSA 3V6DA 4A8QA 2MXYA 3P5TL 2AT1B 4K5SA 1NPPA 1HBOB 2FC8A 1C0UB 2CAJA 1ZOTA 4U96A 1JNRB 1ZM4A 3WHIA 2NZ4A 1Q8LA 2HSEB 4LBIA 4RW9A 1WORA 1U1PA 2J0WA 3H40A 4ENOA 3ADAC 2CPZA 2QJ3A 2VUGA 1TK5A 3MM5A 2OSRA 3C19A 1YJRA 4ZJQA 4IG3B 2A2DA 3WC2A 1T3NA 4NYZA 2IVYA 2JRSA 1DQ9A 3AA8A 3MEEB 4AFFA 2PI4A 1LK5A 2GMJA 2N4DA 4A8FA 1RJJA 1ZM3A 1IUJA 3CULA 1JJCB 3SCKE 2CQIA 4F02A 4OZ1A 3IR7B 2Y3YA 1JLQA 1S77D 2EC0A 1HNIA 5D77A 3KLHA 3G86A 4DX5A 4UUXA 1HNWF 3GONA 2GHPA 1NB7A 2VBXA 2LMIA 4C11A 3FUYA 4M5IA 4WIIA 1R6VA 4UW2A 4DR3J 5A8RB 2MZTA 3SXLA 2DNHA 2H5JB 1LWXA 5IWAJ 2JC1A 5JMNA 3HLUA 2B56A 5AXLA 1U8SA 3ZZYA 4KGMA 2Y1IA 5HLFB 1YGYA 3DXBA 4CT8A 2MYFA 3LPYA 4DFJA 2FLPA 4O3RA 1W2IA 1NSPA 4O4GB 3GZ7A 4DR6F 1SKWA 3DOLA 1SH0A 4QWCA 1Z2LA 2HHUA 2A3JA 1Q7YT 3A8JA 4EYIB 4WU2A 5F8GA 1SUQA 2YKPA 4ED7A 1UVIA 2X1AA 3H2LA 1R7IA 4DEZA 4C97A 1IBLF 3GCWP 4P72A 2BJ1A 2UZAA 3SV3A 4O23A 4CDIA 4F4ZA 5AE1A 4X4UA 2MQLA 1RCOB 4B3RF 3I4HX 3SQOP 2ZKTA 2CQHA 1WTBA 3J7YI 3KFWX 3MECA 1CULA 3B82A 1HNVB 2QFIA 2QX0A 1FK9A 5BYRA 2YX4A 1RAOA 2LVWA 1RT2B 5GMEA 1RU2A 1T11A 2CNNB 1N6QA 5EWGA 3C15A 1OY8A 4EWTA 2DNKA 1IBCB 4F4KA 1JIHA 1FRIA 4OZ5A 5HO4A 1HMVA 1FWKA 3TQ1A 5HP1A 4FP9A 1RTDB 2YQ3A 2M4MA 4OYZA 3NBPA 4LF2A 2UXBF 2XGPA 4J91A 3L7UA 1HYSA 1Q8BA 3DYAB 2LKZA 3IAM9 4NWBA 1JK9B 5H9EJ 3CVKA 2BACA 2X3GA 1S9FA 4LF8J 1U2CA 2XC9A 3GU0A 2VU5A 3L09A 2QYGA 2D7SA 2R3VA 4N56A 2OD4A 3SFGA 1TP7A 2WW4A 1FE4A 4DPYA 1X4AA 4LF1A 4KT0C 1QAXA 2QT7A 2HHHF 3KHGA 5DDRC 2ZVIA 3TUZC 4Y3CA 4FZVA 4ZA1A 5HBMA 3GFZA 4IO1A 1S49A 3R5GA 2H5IB 5L1IA 3UCUP 3NKYA 2R2RA 3LQVA 4DZDA 3VCDA 2LEAA 4JI4J 3EWGA 3EGWB 2HIYA 3R5CA 3DU6A 3GFYA 1IKWB 4TU7A 4J7CA 2V8GA 2HAIA 3BB5A 1TV6B 2CZVC 3W8PA 3DC2A 2DK2A 3QZ8A 4DR2F 4Y2AA 2ZH2A 4YR0A 4QCLA 1WHVA 3MD3A 1QTMA 2FVQA 1B0VA 4DV1F 5A8KA 3QGPA 3ULHA 4MK7A 2VJVA 2W8LA 4RUHA 5DDPC 3ILIA 3VWSA 4LF4J 3RW7A 2V69A 1Y3KA 5AE2A 4DV0F 4QIEA 5A6WA 3IA0A 3J7ZT 2CRLA 4QW8A 5E3QA 1U4BA 3IMQJ 3NY0A 4C8LA 1GTEA 3K5MA 3I0SA 5DGBA 2A6OA 4OYIA 5J2PB 3D4JA 1B0PA 3DLEA 2ZM6F 4B08A 4FF2A 2V2ZA 3CCVS 4ZCLA 5KFVA 1Y7PA 3UDVA 3KG1A 3KMSA 2QG9B 5T14A 4JI3J 3DHXA 5HMXA 4ZPVR 4Y2KA 1SCJB 4X66F 4FNIA 2VFTA 1JLGB 2ZC4A 3RBXA 3NRBA 2KFYA 2CPDA 2W2NP 4M5DA 2Y8WA 1YITS 1UPPA 2R7RA 3H42A 4CO4A 2GGPB 2QN6B 1VS3A 2GVDA 2OPQA 3MM7A 4OFZA 2EFGA 4I64A 4CIOA 3ILJA 2R8GA 3MMCB 1T03A 1HHTP 5ETVA 2HNDB 3T19A 1VISA 1YJVA 3GQCA 4B3SJ 2AJ0A 3MEGA 2MLYA 5HROA 4CO5A 4IOBA 4KYZA 2E9RX 3MMAA 2NQPA 1QUPA 3DNCA 2E5GA 3G8QA 5HSPA 5KT6A 3TAQA 4CM0A 2DGOA 1R43A 2HAFA 3NS7B 2YPYA 1K1QA 3CD0A 2RHSB 3NWRA 1WELA 3M30B 2VG7A 4MFBA 2RVJA 5L1JA 5EWFA 3IP0A 2ZZNA 1LV5A 3M9OB 2KN4A 3GYNA 4OHZA 1N5VA 4CLFA 1WTFA 4DDFA 2EVZA 5FLXY 4QW9A 3IWLA 2J6UA 2BDPA 1N34F 2XLIA 1NLKL 3LA0A 4OX6A 1IR0A 4RWXA 4FVMA 3QT6A 1J5EF 4F2RA 5KOWA 1CJUB 1H2TZ 1NEEA 2QFJA 2DR7A 2HLUA 4ZVUB 3IWXA 1H74A 5GAHU 3BS9A 4QR1A 1T05B 4KTQA 2VDIA 5IZHA 1IBMJ 3V5RA 1WHWA 5KT3A 4LR9A 3LH2S 2FB0A 4FN5A 2CQPA 4H4KA 3A13A 1QSLA 4HHHA 2RQMA 2QMWA 2DISA 4NLRA 1Q78A 3OLBA 3T1YF 2FJXA 3A8KA 1WF0A 2EW9A 4FF4A 2J0QD 1XR5A 1OMSA 3M8SA 2YNHA 2WW8A 4LRBA 1FNMA 2IAJB 4V19J 1HQUB 4M5LA 4IDKB 2BYCA 1U48A 1VJQA 3W9IA 4NCGA 4FYDA 1GMUA 1IBKJ 5ETRA 3UVJB 3MCNA 4ZPAA 2XYGB 1O51A 2IRXA 3GV8B 3CJKA 3TEHB 3GFHA 2KFNA 1F9FA 1JB0C 3UNGC 2IDEA 2LU2A 4CO2A 4I7FB 2GW8A 1RA7A 4Q43A 2RHQB 4AL7A 2K7JA 1P6TA 4KH1B 2BM0A 3VVUA 1HR0F 4F0MA 3PM9A 1YKWA 1S5ZA 2R7VA 2E66A 5K8PA 2AU0A 4K4SA 4F3QA 2ZD1B 3V2UC 3DOMA 4RUBA 2HBYB 2C3OA 3TAMB 5DQGA 5I3QA 3JSRA 2ZITA 3OR1B 3R5DA
chains in the Genus database with same CATH topology
1H38A 3HKWA 2DGUA 4PRFA 2KRRA 1MROB 1IJFB 2DNOA 3CB4A 4KKOB 3NMRA 1KR4A 1UA0A 2FC9A 2FHMA 3O44A 4DFPA 2JLFA 2CQDA 2WBRA 2RU9A 3MAQA 1QAIA 3M6WA 3BQ1A 4X4TA 2RQCA 3LP2B 5J2QA 1KFDA 2OFGX 3LGMA 4PUOA 3S6EA 4ZMMA 1VC6A 1SIWB 2W8KA 4DV6F 2R8JA 4JYAF 3BSNA 1NNDA 4O44B 1O5JA 1UMJA 4IOCQ 1R6YA 3CPWR 2CKWA 2W8LA 3GV5B 2HQ3A 3NCRA 2ZH9A 4JBCA 2R7OA 2BABA 2CQ4A 2QA1A 4O3PA 1P1TA 2B7CB 4P2SA 1NKBA 1QVFR 3VAFA 4I2QA 2YH0A 4RNNA 2KG0A 4MYUA 3HHLA 4OI6A 2IM2A 4CH0S 5LSLA 4DS5A 2H9ZA 1M1KT 4R5PA 1YRXA 3TA1A 2OTLS 1S9GB 2ZD1A 3FJ2A 2YKAA 4IFYB 5DETA 1Y5NB 4Y65A 1VRUB 3BO3A 1RP5A 5I4MA 2MQOA 2KI2A 2V8DA 4DR1F 4KV8B 3AJ1A 1CLFA 2UUTA 1HBMB 1SC6A 2OO4A 5D4LA 2AQ4A 4KJIA 3BZQA 1FJGF 1S9EB 2ZE2B 2IBOA 3FMWA 1A6LA 3J80Y 2WK4A 3LALA 2ZUGA 2DCUB 4FNHA 5HBMB 4H4MA 1H98A 1X4DA 1UJ5A 1K9MT 2CIMA 4YB1P 1QE1A 2MKSA 1TVRB 1VJWA 3MPWA 1S6PB 5B0BA 4CTAA 1OQ3A 3BGUA 5FD1A 3OFHA 3TRGA 1IM4A 2KJWA 1JLAB 3GILA 2COLA 2VG5B 2WCXA 1FCAA 2JVRA 5FDLB 4C2MA 2BZ2A 4RNOA 2AYGA 3L95X 2PN6A 2LXUA 2I2YA 2GHWA 1GX5A 4DOZA 1MW7A 1X4CA 1Q82T 3MAHA 1JMTA 3N28A 1Y00A 2B3TB 2N82B 4K50A 1GNKA 2VB6A 4QR2A 4NLTA 4ZVEA 3IS9B 2MZJA 2D41A 1SBRA 1M5SA 3MWBA 1RGVA 3BF4A 3QIDA 1I1GA 4ES2A 5C25A 5DJBA 4C3LA 2JLEA 5GAGU 3GV7B 3ONQA 4HLBA 4HHJA 4WJBA 5L38A 3L3CA 5I3UA 5B7WA 2XZWA 2BA9A 2AD9A 5SZTA 1IJEB 3HVWA 3T1AA 2FVSA 1YVFA 2ALZA 3C2PA 4ZOSA 5A6PA 1QUVA 1HWJA 3M1VA 3ZZZA 4Y0FA 2PA8D 1ZETA 1MMNA 3M2RA 1U6BA 3CD5A 4ZP6A 4X64F 3I0RB 5EX0A 3KK1A 1HBUB 2MKIA 4EYHB 3TANA 3I56S 1S9GA 2R7SA 2Z2MA 1EETA 1J2VA 5K8NA 3DHWC 4ZCMA 4TU9A 2VOOA 3AJ2A 4G3IA 4KV8A 5F8MA 3N5BA 1HBMA 3TVYA 3H5XA 3KJVA 1VQNS 2MKCA 2MGZB 4OI0A 5A8KB 4WZMA 2L9WA 1R3NA 1N52B 2MZ1A 4I0WA 2VQEF 2Q6CA 4A48A 5CA5A 4USHA 2B43A 3KLGA 1QJHA 1UKUA 4Y2MA 1FKOB 5K9FA 1NK8A 1JLBA 2EFPA 2F9JA 2RILA 1U47A 1JLAA 3ENWA 4TN2A 2VG5A 3CCSS 1FRKA 1L3KA 3GYXB 1FEHA 1YWXA 4WE1B 3D0GE 4NL5A 3NGDA 1S97A 4NCAA 2K8GA 2XY5A 1SJ4P 1YQHA 2C2DA 2HS3A 1LKZA 5ADZA 1LK7A 3QGIA 4LF9F 1KOOA 2J7KA 1OPIA 1X9SA 1QSSA 5CHCB 3GE9A 1SJ1A 1YJNS 2LXIA 3JTPA 3IR6B 2XEXA 1P8GA 2PE8A 3NP5A 2IFXA 1N4LA 1LWEB 4ES1A 4AL5A 1TR0A 1Q16B 2XG8A 1Q86T 2N3LA 1VQ7S 2IVMA 3HHLC 5KFRA 2LYVA 3H4DA 4ILLA 4Q8FA 3I0RA 1HBUA 2HRYA 3FSIA 3EUNA 3ZFVA 2JL9A 3I9ZA 4PXCA 1ELOA 1TL3B 2Q1LA 3HX9A 4PR6A 2E7WA 1M5KC 3CCZA 3I31A 4K2XA 4P6QA 2R7UA 1E6VA 2QZ8A 4PXBA 2CYYA 2DT9A 3O3LA 4NMLA 4U7UK 4YUDA 2JEIA 1IQTA 1DHMA 2QYCA 3BM7A 1L3TA 1VQ5S 3VAHA 1JKHB 1R8BA 1T3OA 2QMXA 5CQGA 3TP2A 1ZAWA 1UVJA 4J9NA 3N79A 3I82A 1NH8A 3DLEB 3K2YA 1ZZNA 3P96A 4F67A 1X0FA 3RW6A 1RISA 1NK7A 2IBKA 1KQGB 3HXMA 4MIWA 2FGOA 3OLAA 4RW8B 4ERDA 2B6AB 2Q3PA 3KLFB 2RDJA 3B8HA 4J9QA 3PW7A 1RYSA 1CVJA 5F8NA 3CD6S 2V4JB 2C3YA 2J76E 1U1LA 1YHQS 3PRBA 1FTCA 3LP1B 3TAPA 1GX6A 4DPOA 2R8HA 5KG2A 2D9PA 2GQQA 4N77A 1LFWA 3LAKA 4RNFA 1Y4ZB 3NGKA 1WHYA 3S8SA 2HYIB 4I1TA 3PJWA 4O3OA 3PIOQ 3CC4S 4KC5A 2J9DE 4EBCA 2YVSA 2ROGA 2KT5A 2LECA 2GQCA 2IM1A 2E1MC 2MY7A 1X0PA 2CPXA 1BQMB 3MD1A 1FJCA 3OL6A 3E2EA 3KHHA 1WEZA 2MQNA 2BQRA 1S76D 4Q5VA 2KYZA 2FJEB 1LWEA 3CCQS 2E29A 4W92B 5THWA 1HPZB 1HI8A 3DRRA 2HGNA 4FPRA 4M5DB 3H2VE 2XWXA 3CDBA 2DNQA 2RF2A 4OZLA 3X3UA 2NXUA 1RA6A 2QE5A 2AP6A 2VFVA 1KVIA 3SI8A 3K0JA 5G0RB 2J7UA 2LA4A 2W24A 4ECXA 3U7JA 2OPQB 4YB5A 3MM7B 1JKHA 3E3XA 3JAMY 5F8HA 3J7Z5 3TOQA 4NOHA 4X4OA 3RB0A 3ENQA 1F5BA 2GV1A 2BRKA 5KAKA 1YTYA 5D3GB 4LSNB 1T03B 2JVOA 1N5YB 2D3UA 1U1KA 3OVBA 2HZCA 2O5DA 1G2EA 4J37A 2DJWA 4RW8A 3KTQA 2M7SA 5KFJA 1RWUA 5GMKa 4MIBA 2V0NA 1RT4B 2VKRA 3FMBA 5B0EA 3PHEA 4AUKA 5KFIA 3CMAS 3EX7B 3IXQA 3MEGB 1VBZA 2V9WA 4DV5F 2R2SA 2C28A 3NS6A 1AUDA 1GXTA 1CC7A 4LIWA 2DIUA 2AJ1A 4WYWA 3VAJA 2JDJA 3IAS9 4DSKA 1KN6A 1JLFA 4I6WA 2LDIA 3MMAB 2W9CB 3Q22A 4ID8A 3ISZA 3I96A 3HZGA 2BE2B 1HD0A 3CIZA 1VQ4S 3K5OA 3W2VB 1SXLA 2W4DA 3N6LA 1BQMA 2U2FA 4UY8T 1X8DA 2KJVA 2ZBIA 1C4AA 3IN5A 2E1CA 1XK8A 1CG2A 4OHXA 4I6YA 3W2WA 3Q2TC 2CVIA 1VQKS 3I5AA 2QO3A 3WC0A 5B0DA 2XY7A 2CPYA 1QLNA 4HEA9 2ZHOA 5DG9A 2C42A 1DLOB 2VG7B 4EU0A 4YOEA 2ASDA 4ETXA 4QBUA 1VIOA 1LWFB 2DIVA 4URSA 3JSMA 4G1QA 4F4WA 2B4VA 3M6UA 4DQSA 4ZVHA 4ZHRB 3HO1A 2D1CA 4NLSA 4J9PA 2V94A 3I6PA 2XCPA 1SJFA 2NR0A 1VFJA 5L9XA 6FDRA 5D3GA 4YDDB 2C2EA 1RT3B 3DOKA 3FQLA 3QIPB 3TVKA 2XMWA 5A8WB 1MNEA 1HNXF 1CEZA 2DRAA 4BDPA 3LP0A 4DFKA 3PFEA 4LFBF 3UPFA 1WG1A 2HS0A 2MKKA 5C24B 2VA2A 3UE2A 4ZP9A 4PKDB 2F3JA 3OJUA 4QU7A 3OUYA 1NK4A 2UUCF 4GKJF 2GJ2A 4ICLB 4X4RA 2VBYA 5E3CA 3G96A 1U1OA 5U47A 2XNQA 1FERA 1FF2A 2UVUA 3KOAA 2IM3A 5KG5A 2CVEA 3RTVA 1VQPS 2DHGA 3N9UC 2DTJA 1S99A 3IGVA 4DV3F 5EUHA 1S4FA 1VIXA 2LA6A 5CCLA 2RDIA 3K58A 4C8KA 2KXFA 4DLGA 1ZPWX 2BE2A 2C3PA 3G9CA 1WWHA 2BW2A 5A0YB 3W2VA 3SDEA 1KS2A 1MWYA 2WRMA