2V94A

Crystal structure of p. abyssi rps24
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
FMLEMEIKITEVKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGSYKSKGYAKYYYDKDRMLYIEPEYILIRDGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation of Ribosomal Protein Rps24 in Diamond- Blackfan Anemia Results in a Ribosome Biogenesis Disorder.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosomal protein
molecule keywords 30S RIBOSOMAL PROTEIN S24E
total genus 23
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v94A00
1U6BA 1X5SA 2MZRA 3CCRS 1P27B 1S72S 2F3JA 1K73T 2MQQA 2DNQA 1WHWA 1WF1A 1WHYA 1X0FA 2M4MA 3DLLQ 3G8TA 2YH1A 2DNRA 4F02A 2RQ4A 1NO8A 2MSSA 2RQCA 2AYMA 1VC6A 2VODA 3UE2A 2LXUA 4CH0S 2CPIA 3MD3A 2DGOA 4YUDA 3S7RA 5H1SV 2DB1A 2MZSA 4J5OA 3G8SA 4PKDB 4LIRA 1U6FA 5DETA 3CF5Q 4P6QA 3US5A 2RNEA 2EK6A 2G4BA 3S8SA 2DGTA 2DNYA 3VAGA 3VAMA 1SJFA 1DZ5A 1VQ8S 2DNKA 1U1MA 2CQ1A 3UWTA 1VQLS 1A9NB 2KH9A 3VAIA 2J8AA 3L3CA 2MMYA 1VQKS 4PR6A 5LJ3Y 2XB2D 2E44A 2L9WA 2HZCA 3CCLS 3U1MA 5GMKa 3NS6A 3THPA 2MJUA 3RW6A 3CULA 2ERRA 2MQNA 5IFMA 4F25A 3FEYB 4FXVA 3FEXB 1FJCA 2PE8A 1JJ2R 5IQQA 5CXTA 2MGZB 1U1PA 1JJHA 2KU7A 4WIIA 3BEGB 3OW2R 3J7ZT 5GAEU 3CUNA 5IM0A 2LEBA 1WWHA 1IQTA 1U1RA 1VQ9S 2CQ4A 5IM0B 3DXBA 3G71S 2KRRA 2DGWA 2G0CA 3PIOQ 2OIHA 3D2WA 2N82B 2MZQA 1G2EA 1PO6A 4TU8A 1KOHA 2JVOA 2MZJA 1X4CA 2M7SA 3EGZA 3IWNC 3Q2TC 2A3JA 2CQGA 1D8ZA 4ED5A 2RVJA 3CPWR 5FJ4A 1SJ3P 2KM8B 2I2YA 2N3OA 2CPZA 2MKKA 1JJ4A 3CCSS 4W92B 1DRZA 2MPUA 4FXWA 2AYGA 1RK8A 2CPDA 1X5TA 1R8PA 2MY8A 2U2FA 2CPXA 2DNHA 5GAHU 1VQNS 2KG0A 1WF2A 2HGNA 2L08A 4PRFA 2F9DA 2DHSA 2GHPA 5D78A 1X4GA 1M5KC 1CVJA 2XNRA 1OWXA 2CQCA 2HVZA 2LKZA 2YH0A 5LXYA 1U2FA 3V4MA 5DM6Q 2DNMA 5ITHA 2MKIA 1WI6A 1WEZA 1N54B 3CMAS 1YITS 2KRBA 1ZZFA 2CQBA 4C7QA 1WTBA 1M5OC 1A7GE 2RS8A 5GVQA 4QPTA 2O3DA 1YTYA 2AYEA 2K8GA 2LECA 2KG1A 5HL7Q 2RS2A 1PGZA 1K9MT 1VQOS 1O0PA 1HL6A 2QFJA 2CQ3A 1Q81T 2J76E 1RKJA 4C0OC 1X4DA 2CPHA 2AD9A 1UW4A 3UD4P 2JVRA 1HA1A 2JRSA 2QA4S 3EX7B 2VONA 2X1FA 2VOPA 3SDEB 1M5VC 3K0JA 1FXLA 2L41A 3MDFA 2LQ5A 2Q79A 2LCWA 3RW7A 2G1DA 4YOEA 2M9KA 1P1TA 1R8HA 1WELA 2GO9A 1D9AA 1H6KX 2LXIA 2HGLA 4RU2A 4YB1P 3ZZZA 3JB9k 3MXHP 2X1GA 2CQ0A 2DO4A 4WF9Q 5D77A 3LPYA 3VAHA 2MYFA 3I56S 1UP1A 3MURP 2MQOA 2EVZA 1X4HA 1X4AA 4BS2A 2MKCA 4TU9A 2ADCA 1WG1A 2OSRA 1BY9A 1L3KA 1YJNS 2OTJS 3B4DA 1AUDA 4CQ1A 2DGUA 2EK1A 1FNXH 1UAWA 3TP2A 3G9CA 5JVGQ 1VQMS 3ZZYA 4UQTA 4IUFA 2MQLA 4ZKAA 1H2TZ 2KYXA 3CCQS 4TLQA 2KT5A 5DM7Q 1KQSR 5DDOC 3SMZA 3U1LA 2YKAA 2BZ2A 1N8RT 2OSQA 3BO2A 1H2VZ 1VC0A 1KC8T 1QVGR 1N88A 2DHGA 3CC7S 4CH1A 5HO4A 2DH8A 3TO8A 4Y0FA 2J0SD 2M0GB 3PIPQ 5BJRA 2DNNA 2VOOA 1X4EA 2KXNB 4EGLA 2AYBA 5DDPC 2J0QD 2YTCA 3BO3A 3NNHA 1B7FA 4WFNQ 2U1AA 3UCZP 2JX2A 4OZ1A 4Z2XA 4WCEQ 1ZZNA 2MKJA 2M2BA 2MZ1A 3MUTP 1FO1A 2CQ2A 3BS9A 2MXYA 4V19X 3R27A 3IRWP 1VBYA 1OPIA 2CPEA 3CC4S 4CIOA 2E5JA 4C4WA 2MKHA 4U67Q 5GAGU 2MSTA 3SXLA 2LEAA 1U1OA 1YWXA 2KVIA 4LJMA 2UP1A 4QU7A 4ERDA 3P5TL 3Q2SC 3G4SS 2DO0A 1VQ6S 2ZJRQ 3CC2S 3NS5A 1X5OA 2M70A 3H2UB 1ZH5A 2DNOA 2DHXA 3MUVP 2M8DB 3VAJA 3N9UC 1Q7YT 5EN1A 1XN9A 4TU7A 2FPHX 2DGVA 2MB0B 1VC5A 5LXRA 2D9OA 1VQPS 2MQMA 1Q82T 3CCJS 4W90B 2M8HA 1VQ4S 3S6EA 3MI7X 5MLCV 3P49B 2MY7A 1SJRA 3P6YC 2KXHA 3UD3P 2NLWA 1HD0A 2D3OR 1YJ9S 1QVFR 1WI8A 3S01A 2XS2A 2DGXA 3HI9A 3P3DA 1U1LA 1M90T 2RRAA 2PEHA 2KHCA 1K8AT 2DNGA 2V94A 4Y00A 2DK2A 3VAKA 1U1KA 4IOCQ 2DHAA 5LJ5Y 1SJ4P 5DDQC 3LQVA 1VBXA 2HGMA 2SXLA 2YWKA 1M1KT 2CPJA 1FJ7A 2FC9A 2RT3A 1WEYA 5LSLA 2QEXS 3J7YU 2LMIA 3MD1A 3CCES 4QU6A 4WFAQ 4IOAQ 1HD1A 1U1QA 1FHTA 2CJKA 2X1AA 5LSOA 2RRBA 2N7CA 2MGZA 1YJWS 2KXFA 3H2VE 2RU3A 2DH7A 2MKSA 3CCVS 3R1HA 2BOPA 2E5GA 3UCUP 2E5IA 1YI2S 3VAFA 2CPFA 2DNPA 1VBZA 2LYVA 1YHQS 2F9JA 3NNAA 2HYIB 2XS5A 3HHNB 2FHOB 3CCMS 5JVHQ 1SXLA 4QQBA 4IO9Q 3I55S 1F9FA 5CA5A 3BO4A 2DIUA 1VQ5S 4LMZA 3EGNA 2M52A 2XS7A 3CMES 2DNZA 3CCUS 1W2BR 2I38A 1X4BA 2RUGA 2FY1A 2KM8C 3NMRA 2MQPA 3TYTA 2DIVA 3MUMP 1WHXA 1NJIT 2LA6A 4F26A 1OIAA 2ZJQQ 1M5PC 1N52B 1DBDA 1H2UX 1JMTA 4A8XA 2M88A 2JWNA 4UY8T 1WEXA 3NNCA 2K3KA 1DHMA 5DDRC 5CYJA 5GADU 2DH9A 3VF0B 2N3LA 2DISA 1X5PA 2KI2A 3G6ES 2DGSA 2MHNA 4M5DB 3THTA 3SDEA 3G96A 3UCGA 1NU4A 2CQHA 2XSFA 3CXCR 1YIJS 3CD6S 1WF0A 2CQDA 1UFWA 4WKRA 2LA4A 2CQPA 3VALA 2WBRA 1KD1T 1QM9A 3CTRA 2MJNA 4OZ0A 2B0GA 1X4FA 4WFBQ 3MOJB 2ZJPQ 1WG5A 1URNA 2OJ3A 1FJEB 1S79A 1KOOA 2X1BA 2DITA 2DNLA 1OO0B 1Q86T 3ULHA 2CPYA 2KN4A 2DGQA 2FC8A 3B4MA 2OTLS 1WG4A 2ADBA 3R1LA 1FT8A 2KFYA 1SJQA 2MZTA 2E5HA 2XNQA 2D9PA 1VQ7S 2NZ4A 2CQIA 1WHVA 1U1NA
chains in the Genus database with same CATH superfamily
3KLEA 3OVBA 2MZRA 3M9NB 4FPRA 2BVZA 3D4JA 4C8MA 2H3EB 2EFVA 2MQQA 2MLXA 1RT2B 1RWNB 1WHWA 2DNQA 2QT7A 3OXGA 2ZOMA 4I6YA 3MTJA 1UPPA 3QZ8A 5KFPA 3R6GB 1I94J 2A6MA 3W2WA 1TL4A 2J7WA 1NO8A 1WJ9A 1LWEB 2Z57B 4ED3A 9RUBA 1UJ6A 4FYWB 2AYMA 2IYGA 4KPCA 1VC6A 2B7CB 2DRBA 3UE2A 2VODA 2LXUA 1T9TA 3RRHA 5J2PA 4DS5A 3MEKA 1Y5NB 5H1SV 2V4JA 2W7PA 1FEHA 2LDYA 2ZEJA 1Y9OA 3CJ5A 3MTKA 4J5OA 4R0JA 2OPSA 1DTTB 4LIRA 2YNFA 5KFWA 2RNEA 1U2CA 1S5ZA 1LK7A 1UMJA 2DGTA 3S8SA 2WONB 3DHWC 3TI0A 1KR4A 3ET6B 3GLJA 2RUSA 1FRIA 3CCTA 3VAMA 1SC3B 1SJFA 2AMCB 5A8RA 2RHSB 2DNKA 1VQ8S 5DG8A 2CQ1A 4B3MJ 4I1TA 3KUHA 4P10A 2HVIA 1A9NB 1U24A 2NQPA 2PC6A 3TZYA 2XULA 2HNYB 2YKPA 1REVB 5IT9Y 1GMWA 2C3OA 1ZPWX 4WWSA 2MMYA 4X4TA 4LF9F 2HW3A 4AXJA 5L38A 1VOMA 3CCLS 2ROGA 3D1QA 2YNIB 3HULA 3M4XA 3KLFB 2FJWA 1PAEX 4L76A 1WNEA 2J5AA 3GR1A 2J7KA 2KT2A 3BZQA 3M6XA 3QFWA 1S9GB 2OAUA 4UOHA 5U47A 3KJVA 3CULA 2IVYA 1HNZF 4F25A 3FEYB 3MEEB 3TVZA 3FEXB 5F8HA 4DV4F 5G0RA 1JJ2R 2F4VJ 2MGZB 2HHWA 2ZE2A 3HHEA 2FJBB 1RBAA 3IR6B 2AGOA 2IMOA 3TUJC 3GPAA 4WBFA 1RA7A 1WDDA 3F73A 5BYRA 2CRLA 2I0XA 2LQ8A 3LTOA 1RLDA 1MN7A 4YQWA 3O1LA 4ZVEA 5AJ3J 2E5LJ 4Q0BB 3BGOP 3BGRA 1T9UA 3I31A 1S6UA 1FK9B 3BGLA 2DXEA 4CTAB 1VQ9S 4B9TA 5CABA 1C0TB 1OY8A 1SKSA 2UUBF 2V8DA 1H38A 3N01A 1PJ7A 1LXJA 3EXCX 1TUWA 2G0CA 1NJXA 2HNYA 1FDBA 3IG1B 2LDIA 3GV5B 3AQOA 2HFUA 3DOKB 4ICLA 3HLUA 3BBFA 2PIIA 3GR0A 5J1EA 1RHUB 2MZQA 4M5HA 4PG8A 1G2EA 2BJDA 3TUIC 2IY5B 4TU8A 1TFWA 1YJUA 4OZNA 2MZJA 2QA2A 3QIDA 1RE1B 2M7SA 2OEKA 1T9YA 5F8LA 4NYPA 4HL9A 2PD1A 5BR8F 2R2TA 2CQGA 4UF4A 1D8ZA 1PYTA 4TN2A 3MFHA 1T3OA 3DHXA 4LF5F 3QJJA 4LFBJ 3LAKA 4ID5A 3IRXA 2ZH2A 1D09B 5D3GB 3C14A 3NY0A 2HBZB 5D4OA 2KM8B 4OI6A 1F6TA 4MK9A 4NLPA 2QMUB 1QSLA 2I2YA 1PBAA 2GGPB 2HRTA 3WC0A 3CCSS 3JQJA 1FESA 2GNKA 3GWCA 5BXIA 3V6DA 1NK9A 3NCPA 4ZP6A 1TKTB 2BJ3A 2UUCJ 3A8KA 2AYGA 1RISA 3OLAA 1EKRA 3OUYB 4PG5A 3CGIA 1SL2A 2OD4A 4U95A 3P45B 2W4DA 1VDHA 1FXRA 2HLTA 2E1AA 2MY8A 5A8KA 4PYAA 3LP0A 4Y2AA 5E3CA 1OSDA 1S4EA 1WF2A 1CG2A 3R5GA 3UR3C 2L08A 1LW2A 2F9DA 2WVBA 2EC0A 2DHSA 1RWMB 1Q1KA 2GHPA 5I42A 2H4WB 3DM2B 3Q8YA 3V5RA 2LKZA 3DLGA 3IBWA 3OVAA 1S0VA 2UV8A 5LXYA 5DGAA 2G9OA 5DM6Q 1CULB 2DNMA 4ECTA 2VUGA 5A76A 3R2CJ 2VZ9A 1WI6A 1XNQJ 2BM1A 2VDIA 4CO5A 4CYUB 2CZ4A 2XC9A 1QTNB 4F50A 2JOQA 2KRBA 1TU0B 1R27B 1ZZFA 2FUG9 4C7QA 2B51A 1MMNA 2ZM6F 2ZUGA 1RTIB 4PG4A 4WXOA 3UQSA 3FCHA 3MR5A 1WTBA 2DYAA 1M5OC 1YX2A 4MAKA 2QL7B 1KSPA 2OI2A 1FE0A 2VKRA 2AYEA 1SKRA 5B09A 2ZDOA 4ZJLA 1O6XA 5DQIA 4RW9B 4ECVA 1PGZA 1S6OA 4NXNF 2JLFA 2AEMA 2RE1A 3GZ7A 2HHPA 2QYCA 2LVWA 3HP6A 3MMBB 3N28A 5CYMA 1X4DA 1EARA 1VYAA 2CPHA 1TQLA 3QNWB 4WP8A 2AD9A 2JNJA 1S1TA 1WSRA 3AXKA 4UTGA 1S6QA 5JXSA 3V4IB 4FVMA 2JRSA 2QJ3A 3JQMA 3KJQB 3LP2B 1K0VA 2C28A 3PXGa 3TX8A 2Z8QA 1AZSA 2JHEA 2VFUA 3SDEB 1ZYQA 1HW8A 2P6TA 4LREA 5ETMA 1T7PA 2YKMA 2ZZTA 3AA8A 1SL1A 1HMVB 1Q5VA 2ASYA 2FQQB 3EZOA 1H73A 3RAMA 4K0KJ 4PQUA 3RW7A 4DR4F 2VG5A 1WKLA 3K8VA 2W2OP 1AT1B 2NZCA 4KGMA 2NUUG 1R8HA 1YGYA 5D4LA 1D9AA 3M05A 2HGLA 4RU2A 5LMNF 3JB9k 3QJLA 2RB7A 4DN9A 3JTOA 3SI8A 2X1GA 2IM3A 2RAQA 1BQMB 2DO4A 3MECA 2Q6BA 1R7IA 3LPYA 5D77A 4ZVFA 3VAHA 2MYFA 2GHVC 3BN4A 3SCJE 4ZN1A 4N41A 1RU1A 5KFKA 4RZRA 2WSFC 5B0GA 2AW0A 3SEOA 2KDOA 2MKCA 5F3TA 1IUJA 3KOAA 2ZNYA 1BY9A 1L3KA 2W25A 3K5MA 1DQ8A 2PI4A 4NPOA 3OVSA 2KZZA 1AUDA 4JOUA 1N4LA 1IBMF 1JKHB 1NPRA 4G1QA 2H48B 4HACA 2W9CA 2DGUA 5EWGA 1SC1B 2F7VA 1FNXH 1IR2A 4Y2MA 2W7OA 2AWZA 4IFVA 1C1BB 5JVGQ 1PYSB 1VQMS 2ZDPA 4DFMA 3ZZYA 2DJWA 4DUYF 3DRRB 2GHWA 2XEXA 1Y7PA 2YQ3A 3MOZA 3CJKA 5C7PA 1H2TZ 1H7WA 4ANEA 5HMWA 4X4OA 2UU9F 2BBEA 1XIQA 4IG0A 2W2QP 4DX6A 5KFOA 3MM5B 5DM7Q 3IBFB 4DSJA 3U1LA 1JNRB 2R2RA 5T7LA 2YKAA 4I2QB 1N8RT 9ATCB 2DCUB 3IGVA 1FTCA 3N6MA 1HKAA 1RGVA 3BO2A 1XR5A 5ETSA 4DFJA 1FX2A 1FD8A 3M2UA 1IKVB 2RF2A 4B3SF 5D0RA 4DL4A 4DX7A 5F8MA 2JC0A 3ENQA 3KJNB 2BE7D 1VHIA 2J0XA 2YNHA 4DLEA 5LMUF 2ZD1B 3D7SB 4QBUA 1KDNA 3B6BA 1S49A 3KLGB 2J0QD 2VL1A 3GG1A 4O3RA 1UVIA 3I0SA 3W60A 3NNHA 1B7FA 2XY5A 4KIAA 1UWBA 1U0HA 2NXUA 2IJNA 2RDDA 2WZ1A 3D68A 5B0DA 4DF4A 4NI2B 2QL5B 2XBPA 4LR8A 1OS5A 1NMEB 4RUHA 3TEGA 2HBRB 2CJXB 4RPFA 2DPJA 4WCEQ 3SV3A 2ZWPA 3VGSA 4NZ6A 1QAXA 3NGKA 4NA1A 2MZ1A 3MUTP 2KVQE 3PKMA 2K1RA 3JSRA 1AYEA 1FRJA 2CQ2A 4MK7A 2MXYA 1QLNA 4K2XA 4X4VA 3A8JA 1S1WB 3MGJA 2CPEA 2NR0A 3CC4S 2DD8S 2HVHA 1FKOA 2HMIB 1FRHA 4CIOA 3UD5A 2VFTA 1R0AB 1NH7A 4CO0A 4KT0C 1Q16B 1N5VA 4U67Q 1VIXA 2HRUA 1B70B 4WK1A 2JDJA 2G2ZA 2LEAA 3SXLA 4A48A 3HJFA 1RP5A 2VJUA 4K4ZA 1UZDA 4LJMA 3DLEA 1CS4A 2QA1A 3OFHA 2HRYA 4ZVOB 3WBZA 4B3RF 1U09A 1X9WA 5IT0A 4DG1A 1FFGB 2ZFHA 2V4RA 4FF4A 1NJZA 1U0SA 3LALA 1U45A 4FS1A 3KLIA 2V2KA 1YSJA 3O5TB 3CJRA 2OD6A 3CC2S 3UPFA 3DC2A 3TZZA 1ZH5A 2CVEA 2DNOA 3EUNA 4M5LA 4A8WA 2M8DB 1MSWD 1TZ0A 1GFWB 1RAJA 1XN9A 4H4KA 4LSLA 4KE5A 2CFXA 2WCXA 1P9QC 4W4MA 2FHJD 1IKXA 5BYSA 2XMMA 1P9YA 5LXRA 3LH2S 4WJBA 3U1NA 5LOQA 4DSEA 1HFEL 4OV1A 4WXWA 3UW1A 1Q82T 3G82A 3TRGA 2AEJA 3PJ9A 3W8GA 2O1PA 4M94A 1RT4A 3G6YA 1SV5B 3H0PA 4I56A 4B9UA 3S6EA 3QT5A 3GFHA 5ETOA 1U02A 1U8WA 4YY3F 3P49B 3OXLA 1YVFA 4BC7A 1XERA 5CYQA 1LKZA 4KR0B 1YDLA 4PQUB 3IRXB 3EYZA 3CIMA 3W7BA 2YKMB 4EMDA 4X2BA 5KFQA 2IRYA 3FUYA 2WK4A 4ZK7M 2ASJA 1WI8A 4Y34A 1EX8A 1IN0A 2XS2A 3C3LA 1M90T 4DV4J 2R8JA 2IMWP 1R0AA 1DTQA 1RJJA 4ZJOA 4P73A 1S1WA 2V8HA 3DKDA 1NZ8A 4X4RA 1K8AT 2ATCB 4C8ZA 3T6BA 2BR0A 3N79A 4DL7A 3FNNA 3RBEA 4Y00A 4G6VB 1U1KA 1FCAA 3NMAA 2HHQA 2E1RA 1RT6A 3OTBA 4LRDA 2J9CA 1VLOA 1HWLA 2C2MB 4KH1B 2OPQA 3EVWA 1SJ4P 2HHXA 1JQGA 2YWKA 3FQKA 4I7FB 4R5PB 1X9MA 2KT3A 1M5HA 3M32A 7AT1B 5FLXU 4OX8A 3RBZA 2ZC3A 5E33A 1H0HB 3HFZB 3K89A 3VVTA 1WEYA 5LSLA 4G1IA 3T1HJ 1FJGJ 1OQ3A 1IM4A 3M2RB 4ZCMA 2PFDA 3NGUA 3K17A 4MFBA 1I1GA 3W1YC 4RL1A 2XZWA 1JLQA 1PILA 2IRXA 5DO2A 1VLYA 4J9UE 3NKYA 3V6HA 5A6WA 4CYUA 1U1QA 1OSCA 2JEGA 1FHTA 3MM5A 2CJKA 2LQJA 3M8YA 3K5OA 4DR5J 2RRBA 2MGZA 5HBMB 3H2VE 2QX0A 2BJ1A 1HPZB 4OYPA 1IKVA 3N5FA 4DFKA 3KJVB 2MDAA 3C15A 3CCVS 5DLGA 1NK6A 3MMAB 2BOPA 4DJBA 2AJQA 2ILYA 2ZD1A 4Q43A 2E5IA 4RUCA 1KQKA 4B08A 5E5NA 5T7LB 4O3NA 5M2RA 4ECQA 2DNPA 5GMEA 5KG1A 1YHQS 3ZTQA 2F9JA 2Q43A 3UO0A 5C42A 2XSJB 2A6OA 3CJSA 4FF1A 3MAHA 2Q1LA 2BM0A 2QMWA 3CCMS 4QQBA 1R31A 5IC4B 4IO9Q 1T05B 4LBIA 5CA5A 1HBOB 1QUVA 1VQ5S 2OLWA 4KHPJ 3M30A 1XMBA 3BH6B 4KAIA 4RW8A 3CMES 4OZLA 4NLOA 3W9HA 2EKNA 3HHLA 4DV1F 1NSPA 1T9VA 1Q8BA 4O4RA 4RKUC 2I38A 1RTHB 2XHCA 2VV5A 3NAHA 3WX4A 2A1BA 1NDLA 2XMUA 4FP9A 4ECRA 2KM8C 2FY1A 4EK2A 2V69A 1SIWB 5K14A 3DLKB 3IA0A 1AUSL 1PYOB 3UDEA 1S12A 2FGCA 1S99A 1WHXA 5EGYA 4F0KA 3X1LB 4I68A 4GKJF 1RAHB 1OYDA 2R8KA 4DSLA 2FHMA 1RHKB 1ZM2A 2GAGC 5HSPA 1N52B 5J1EB 2OHDA 3FEZA 2YWFA 2ZHAA 1D1UA 1UKUA 3DOKA 3GYGA 2HEKA 2Z58B 4K4UA 1EIYB 1JMTA 3ZZTA 5I4MA 2JWNA 3EMTA 3TNVA 3MEGA 1JX4A 4UY8T 2AJ2A 3GIRA 4DR7F 3TWZA 1PC5A 4H4KC 4Y2KA 5GAGI 5HJXA 4P2SA 1NK0A 3MAAA 4GVBA 5CYJA 1NDPA 4EO8A 3KLHA 1QAJA 4J9QA 1BHNA 1NHUA 2ZKTA 5K5MA 3ZNUA 1KP6A 1CJKA 3VGUA 1G4CA 4WFZA 1U7LA 2MHNA 3R5AA 4M5DB 5DRKA 4RUBA 4RLEA 3IAS9 2CQHA 2CYYA 1M5SA 2KB2A 1VRUB 3UCGA 5KOWA 3QIPA 3CXCR 4IR9A 1FF2A 2LA4A 2FLPA 3TA0A 2IM1A 3WX8A 2E1MC 2BJ8A 1FERA 2YKOA 3BYRA 3MR6A 1HNXF 4JI3F 4I0WA 4CP5A 3CW2C 2APOA 5L1KA 1HBMA 4LF9J 1VHFA 3CVKA 1KQFB 1AW0A 4DR4J 5EX3A 1WG5A 3KJFB 2F5GA 2RKIB 4KV8A 1S1XB 3VWSA 1FJEB 3IR5B 2B4UA 3CJ8A 2HS4A 2R2UA 1KOOA 2X1BA 5H9FK 1S77D 3DLGB 4FXDA 2FLOA 5KOXA 1OO0B 1VJQA 2BRKA 3ENVA 4I2PA 5AE2A 5H9EK 1V9OA 1HHQA 3TJAA 4AD6A 3ZC4A 3MM8A 2KN4A 2DGQA 3M9OB 1TVRA 1WG4A 1J5EF 1MMLA 1DTTA 4LRCA 1YRUA 3N6NA 1XNRJ 1HHSA 4NLSA 3FCVA 4RNNA 1R6YA 2NZ4A 1FRLA 2HLUA 5A8RB 4J9OA 1K44A 2UUTA 3BGUA 4GMKA 4CZCA 1HBUB 4LF6F 3K0JA 3KLHB 3ADAC 3FZBA 1U6BA 4DCOB 1T9WA 4NOHA 2QIFA 3MAAB 2Y9HA 3LUYA 1S72S 3DRPA 3SQGB 4P7VA 2EXUA 4NLDA 1WC6A 1IBLJ 2E9TA 2OEJA 5HMXA 4RNOA 4C6AA 1C2PA 2I1RA 3ZTRA 3NG8A 3M1VB 3DGPA 2QSFA 2M4MA 1H74A 2XZTB 1VS3A 4X62F 3JTNA 1WTFA 4LSNA 2BE2B 3GU0A 1BC6A 1HNVA 2LXFA 4ZPCA 4ZCLA 4JI4J 2OELA 3IP0A 3GJQB 2YXLA 4LRAA 5D3GA 2YPZA 1BQMA 2CPIA 3MD3A 3MECB 3VVUA 4C3KA 4YUDA 2VBWA 2QYGA 1XMOF 1BQNA 1S6PB 1LFWA 2MZSA 3MCMA 3CNQP 5KFJA 3G8SA 3UNGC 4YY3J 4J90A 1U6FA 4C3LA 2G4BA 1V5IB 1PJ5A 2DNYA 3M30B 4J91A 3VAGA 3VGVA 2IA6A 2HHTA 4LQ3A 2BQRA 1RU2A 3W2WB 1RWWB 4JV5F 4DFPA 1SH3A 2GJIA 1IVZA 2J8AA 3H7HB 3NP5A 4RWWA 3JAMY 3IS9B 1IBLF 4QWBA 4N5SA 2B4VA 3QGIA 4RR5A 2X7IA 4OJGA 2ZH9A 3IM9A 2RJZA 4F2RA 4NCBA 3I82A 2HZCA 2I6WA 1K0TA 2NXJA 4LUBA 3NS6A 3HT0A 1ZAXA 3S1TA 4URQU 1SQGA 2XTJP 1WC3A 4I2PB 2ALZA 4B9NA 2ERRA 3HSJA 2MQNA 4DPWA 2VG7A 2OGUA 4FF3A 3SV4A 2PE8A 1BXNA 3LWMA 5CXTA 2HS0A 4JI1F 3J80Y 3HVWA 3QSIA 4ZVHA 3V2UC 4CI0B 3H5YA 5GAEU 2NXEA 4CT9A 3CUNA 3OR1A 4EYIB 4DQIA 1HYSA 5KT2A 2UUBJ 3MM7A 4QWEA 1NKBA 2VPZB 3DXBA 3HK2A 3QT7A 3G71S 2D1CA 4DEZA 3Q22A 4KHRA 3D67A 4DV6F 1FI4A 1BQNB 1S6PA 3KMSA 2XY7A 4DV0J 2Y0BB 5CD4A 2M5YA 3N6LA 5G4DA 3J7AN 1FX4A 1SC4B 2CNNB 4KTQA 1UEKA 2AJFE 4ZLLA 3RGIA 1FDDA 1KKHA 2EFQA 2JVOA 2CWXA 4OHWA 1D9FA 1X4CA 2IYIA 3IWNC 1TAUA 3LP1A 4QCLA 2LU1A 3DDIA 2B9YA 3ITHA 1APSA 1GMUA 4RU9A 4FYVB 1MW7A 3QQCD 4L6V3 4IRKA 1S1UA 5KFDA 3CPWR 4E98A 2FTRA 4J9VA 3GIKA 4B3MF 1JJ4A 3BB5A 4O3PA 2ZH4A 4LF7F 1GX6A 5KT5A 3E01B 2MPUA 2NS1B 3PACA 2J7UA 4OYBA 3I4HX 1S4FA 2VFRA 1UCNA 2ZKUA 2Z56B 3ITHB 4FXWA 4ZVQB 2CPDA 2J6SA 3QGHA 2ZBRA 3HKZD 3ZZOA 3T1YJ 2RSQA 4X66F 3HXMA 4DPXA 4E0DA 4FKXA 2U2FA 2CPXA 5F8GA 4QYZJ 3LW5C 5ETKA 4JV0A 4YR3A 1IBMJ 1TELA 3FGVA 5HQMA 1KHVA 1NPKA 4PRFA 3BM7A 1GMVA 1HBUA 4OHXA 1X4GA 4U6PA 1CVJA 3OSPA 1JJCB 1OWXA 4H4OB 1M5KC 3OL7A 1Y4ZB 4GO7X 4CO2A 4MYTA 5I3UA 1QJHA 1RTHA 5HAOA 1EZZB 1U2FA 2QLBB 4BCAA 3DOMA 4KFBB 2EFPA 5ITHA 4ECUA 4UOFA 2IA0A 1CJVB 3CMAS 5HMYA 2CDRB 3J81j 2EBGA 4OX9F 3AFGA 4AQYJ 4KY3A 3DRSB 2QA4G 3DFEA 4ER8A 3PYGA 1HBOA 1A7GE 4LT6A 2H1YA 1N5YB 5C2GA 3CDEA 1PC4A 5GVQA 3OL9A 4DU8A 2CG8A 3BSOA 1RWOB 5D0HA 4LVOP 4Q44A 1ZETA 1NKCA 1FVQA 2J9DA 3DU5A 3R8YA 3T6JA 2HWIA 4RBUA 4DMZA 2D41A 2KG1A 4KBIA 1NPPA 3GV8B 4D3HA 2FB0A 4U7UK 2BANA 2W24A 3GG0A 4F04B 1LW0B 4HH1A 6AT1B 1D8YA 2VQFJ 4PWDB 4N7TA 4MIWA 2ZOFA 1Q81T 1HBMB 2CJAA 4DQRA 4IRCA 2IAJA 1N5SA 2J76E 4W98A 4HKQA 3KHRA 1XMQF 3K7RA 3UD4P 4F7VA 1MMDA 4NA2A 4PWUA 3EX7B 2FIUA 1ZA2B 4U8VA 3VZHA 4MKYA 2RHQB 2XLIA 3RB6A 4Q8FA 2X1FA 2VOPA 1FXLA 1M5VC 5EDWA 3OTEA 4K4SA 5A8WB 4M5KA 1JIHA 1NDCA 3PHTA 2LQ5A 4P2MA 2WW4A 2ZH5A 2Q79A 1F1BB 2LCWA 3ISZA 1LV5A 2FZGB 3NGSA 1J2VA 2LFVA 4A8OA 4A8SA 5LMNJ 4Q8EA 2V5HG 2GO9A 3PEHA 1H6KX 2LXIA 2BEFA 1VRUA 5KFBA 3PM9A 4IG3B 4YB1P 3ZZZA 2DCLA 2XY6A 3MXHP 1GH8A 4DZ6A 2B9XA 1UEVA 5HVGA 1WD6A 4ZPDA 4K4YA 2K2PA 1RTJA 3ENAA 1RTDB 2JZ5A 4DSKA 4WF9Q 4M5JA 3NBPA 4X4UA 3E2EA 5D0GA 1UP1A 3MURP 2MQOA 1HNIA 1XC9A 2GFFA 4GVBB 1ZA1B 4ANCA 1WG1A 1LFPA 3P96A 1FRXA 2HNDA 4IYQA 3RAQA 3A3OB 3NOGA 1YJNS 1B3TA 1RAAB 5L39A 4OI4A 1IKYA 2OTJS 1W26A 1HARA 1EJ7L 3MM6A 2BUNA 4Q45A 4OZ5A 5B08A 2XSJA 4XIUA 4J9RA 4DR6J 2XMJA 4YB5A 1ZBTA 3QWPA 3C6UA 3QGGA 3Q8UA 5KFMA 4ECYA 2WOMA 4G1QB 4HACB 3PJXA 1K1SA 2GCFA 5C24A 4LBPA 3CJTA 3BKUA 2DRAA 2VFSA 3BGFA 4QYZK 1U6ZA 4JUZA 1NB7A 2CG4A 4KH0B 1UWAA 4ES1A 3J7Z5 1JLBB 2GIFA 3FSXA 4UQTA 4NCGA 3RR7A 4P7TA 4IUFA 4EEYA 3WIVA 1AROP 2YVSA 3GP9A 3FDSA 4URSA 1IKXB 5KFCA 2CJ9A 4ES3A 3KNGA 1CS4B 2OEMA 2AGQA 1L5UA 3PX4A 2HHHJ 1KQSR 3EM1A 1S7IA 3NAIA 4KSEB 1RTDA 2ROPA 3W64A 2BZ2A 4LR7A 3FRYA 2OSQA 1N33F 2AGPA 1KVIA 3D28A 1GAOA 4WE1B 5KG2A 1F9HA 3D0HE 1H2VZ 1KC8T 3UR0A 1UA1A 2UUAF 3D6FB 2NYHA 2KL8A 2R3VA 1QDUB 1R3NA 2R7RA 4BDPA 2D3ZA 3RZAA 3DXSX 1RWPB 3RB4A 1X60A 3KK2A 2M0GB 5BJRA 1XK8A 2DNNA 1EKSA 2WRMA 3G87A 1NZAA 3R97A 1X4EA 1S59A 4ANDA 5FDLB 3UN3A 1GTHA 4CLPA 3BQ2A 1C1CB 4U96A 1CJUB 3A3PB 2Z2ZA 1J5EJ 1K1QA 1X31C 5L9XA 3IO1A 4OI2A 3H25A 3JS9A 3Q8SB 3BO3A 4IH6A 4JI8F 1TKDA 4P74A 8RUCA 4WFNQ 4C8LA 1XR6A 2FDNA 2R42A 1RQ0A 4IDKB 3UCZP 3HO1A 4ID8A 4CWBA 4DCJB 4G65A 2JX2A 4CLFA 4I2QA 3FZ2A 4PUOB 1PG5B 1XEZA 3EDRB 3GYNA 2J9EA 3MM9A 2F8HA 2OUGA 2VBYA 3PW2A 2A2DA 5A2QY 4FYDA 2XLJA 4MFBB 3ZZRA 3M6UA 3T19A 4USTA 3G6VA 2H5EA 2FVPA 3BS9A 2JLEA 3R27A 1FA0A 2AKWB 5D15A 3AHPA 1JLBA 4U9RA 3W8PA 2HBYB 1RAEB 1R6VA 3M8RA 1DJ0A 2E5JA 2WVDA 2L9NA 4DUZJ 5MAOA 4C4WA 3KLGA 3MEGB 5CZXA 2W4CA 2IBKA 4GRSA 1HI8A 2FVSA 1RABB 2HNZA 2V34A 3HT3A 3BPSP 4CDIA 4F3OA 2VC0A 3SSQA 3VZIA 3PV8A 4LF4J 2GO8A 4F8RA 2FJAB 4JBCA 4P71A 2L3MA 3W2VA 3W66A 4TXSA 4ERDA 4F36A 4ZLPA 3G4SS 1TUGB 2P9CA 2BW2A 2WHOA 1UVMA 1RI7A 2XGQA 4UZBA 5GAEI 3A12A 3OL6A 2F63A 1C0UA 2O66A 1X5OA 3NS5A 2LQ9A 2VH7A 5GADI 1B0VA 3UVJB 5KAKA 2K06A 1JLFA 1RZMA 2PMZD 4DDFA 1Q0NA 3MUVP 3J80U 4TU7A 2FPHX 3HKWA 2Y1IA 1CSJA 2QLWA 3MWBA 4J37A 1H98A 1T0TV 4WIQA 3J81Y 3GJRB 4RW7A 3RR8A 4O3SA 4OI0A 2HMIA 2CZ9A 4DXLA 4B3SJ 1HQEB 5AXNA 5J2MA 5HLFB 3V6DB 4G1PA 3ILIA 2VQEF 4JI6F 3D3CJ 1VQ4S 5MLCV 1S1VA 4W90B 2VG5B 3AY0A 1SJRA 2AX0A 1KTQA 1OY9A 2KKHA 2VC1A 3DLEB 3DDKA 3EGVA 2L41A 1S1UB 2Y8WA 1S0NA 1HD0A 4DL0C 2D3OR 1JKHA 2OKQA 4UUXA 2BRLA 4L72B 4WU3A 3L7UA 4B3TJ 4OV6A 3OJUA 2LLZA 3LP1B 2BMBA 2PGCA 3PYDA 2PEHA 3C15B 1OMSA 4QIFA 3WHIA 1N34J 2GJFA 4OZJA 3I0SB 4ZOSA 1X0PA 4FPIA 3BN7A 3OL8A 1T02A 1DLOB 1RSCA 1PCAA 2DK2A 4QR0A 1S10A 1E6VB 4KYZA 4IOCQ 4CO4A 2Z2LA 3J81U 2R7SA 4I64A 4A4JA 3NGRA 5HQLA 4P2FA 2VA2A 1VBXA 2H54B 2HGMA 3NRBA 2P8IA 2GC8A 1JB0C 2CPJA 2B8QA 3FSIA 2FC9A 2RT3A 2Y3YA 5JUMA 2BW7A 1U48A 2QEXS 2R7UA 4RNFA 1FK9A 4B9LA 2WTFA 2E9RX 1O51A 4C8YA 2GMJA 4R5PA 2LMIA 5L46A 3A1YG 1KLMB 1TR0A 3Q8RB 1S9FA 2W01A 1DFDA 4WFAQ 2Y1LB 4H4MA 2K7KA 4YR0A 1HD1A 5KTQA 3GIJA 1FWLA 4NI2A 3HCXA 4UOCA 5LSOA 3PZPA 1RWKB 4L73A 2N7CA 4DX8H 1YJWS 3SBMA 2OMLA 1JWWA 2RU3A 5I3UB 4A8KA 4EUVA 2DXDA 2NSCA 4NCGB 1FJ7A 4OLPA 1GK8A 1M1GA 4IQXA 2BJEA 2XZDB 2MKSA 2HVEA 4IH7A 1AXQA 2V8VA 4P52A 3VHQA 2E5GA 4DI6A 4NEZA 1X9SA 4NXMF 1YI2S 4RBTA 2CPFA 1CJVA 1XJWB 4MKVA 5SUHA 1LW0A 1RB0A 1UEUA 2C3PA 4K5RA 4A46A 3DOMB 2IM2A 4KFBA 1B7YB 3KK2B 1T03B 2HYIB 4LFBF 2RILA 2HIYA 4Q5VA 5AT1B 5HROB 1A6LA 1S9EA 2RH3A 3RTVA 5JVHQ 3DDNA 1SXLA 2YNGA 1HNXJ 3DM2A 4J9MA 2DT9A 1MG7A 3C2PA 4J9KA 2DIUA 3CD5A 2GGPA 1KWMA 3H59A 3GTYX 3TVKA 2VPWB 1LWXA 3Q83A 3PDNA 4ZPBA 3Q0AA 2VBXA 2G2OA 3M6WA 3PW0A 3CCUS 2FJXA 1QSSA 3F56A 1W2BR 1U47A 4HTJA 2C2EA 1NK8A 1NSAA 4PXBA 4QW9A 4M5IA 1FNOA 4PQAA 4ZVUB 2RU9A 4B3OA 1TL1A 3MUMP 2AJ1A 2VG6B 4JV1A 3SCIE 3SCLE 4C8KA 2QV6A 2LA6A 1KRPA 4HDHA 2C3MA 1OIAA 2VDHA 4LRFA 3MPWA 4DPTA 2ZJQQ 1IBCB 4F4YA 1M5PC 2W1BA 2HHVA 5BYQA 4C3MA 2W9CB 2UVWA 5A8WA 3DMJB 2GQQA 3AOAA 3CSKA 3NNCA 2B3TB 2BA9A 2BJ9A 2K3KA 3D54A 3MMCA 3R5CA 1B4SA 3RRKA 5DDRC 3PW4A 2HNDB 3PFEA 2WSEC 3OQ2A 1S1TB 2W2PP 3NOCA 4ECWA 1RADB 1AFJA 5GADU 3TQEA 4ELUA 5L1LA 3R5JB 2XMTA 4EWTA 3PR4A 2GMHA 2B6AA 3C14B 4O44B 2N3LA 3RG6A 5A6PA 1J5OA 1WOPA 4Y65A 1X5PA 2KI2A 3HHKA 3OFFA 3GCWP 2XO7A 3G96A 3KTQA 5KFLA 4JV5J 5KFVA 1PJ6A 4Y28C 3C66A 5B0FA 4UQGA 4NLRA 4M5GA 1FRMA 5F9NA 2CNKB 2MHEA 3Q8PB 3OSNA 5HN0A 1SB6A 2E66A 1NHKL 3VALA 2IIHA 5B0AA 1KD1T 4USKA 1RTIA 3MPYA 3RB0A 5ADZA 3AQPA 1X4FA 3JXOA 4F3MA 4F67A 5DZ7A 4ZCIA 1D9DA 4Z7YA 1URNA 3R7BB 3FSYA 2OJ3A 4ILLA 1YRXA 1S79A 4LF8F 5KFHA 2WVCA 2DITA 4CLKA 1IBKJ 1VQYA 2HK3A 4KHPF 1RXOB 4ELTA 2HWTA 4XK8C 2RDIA 4X65J 1HWIA 1RWUA 3B4MA 3GV7B 2OTLS 2EW9A 3NCRA 3FVYA 1HI0P 1RHQB 2BANB 3CDWA 1FT8A 3SSSA 3TA2A 5KFNA 2PDAA 2ADBA 1PKUA 2QFIA 1PSDA 1RT3A 2AEFA 3TAPA 1IKWB 1PAUB 6FDRA 2B5JA 2ROEA 1IJFB 3T1AA 2A0FB 1WORA 5IXUA 1YQHA 1CJKB 1RT1A 3D9BA 3OFEA 5L1JA 2CQIA 4O44A 1WHVA 1JXVA 4HR2A 1U1NA 4J9LA 3TZWA 4NYOA 4Q2LA 3HVAA 5SZTA 1X5SA 4O3QA 4K4TA 3V6JA 4Z37A 3CCRS 1P27B 1TL7A 1UJ5A 4UW2A 1DQ9A 2F3JA 2PEBA 1U26A 4ID5B 4WYWA 4X64J 1K73T 4X4PA 2HURA 3D1HA 5KG0A 5E3PA 1RT2A 4JI0F 4G3IA 1PIEA 1WF1A 1NAQA 1WHYA 1X0FA 5KT4A 3C46A 3DRPB 3JQKA 3GYXB 3G8TA 2DNRA 1TKZB 3MEDA 4F02A 2R7WA 1N34F 1LWEA 3HFVA 3KLEB 4LRBA 4QYRA 3TUPA 3NBPB 3H98A 2BXJA 5DQHA 5B0EA 3DGPB 4CH0S 2FYXA 3D3BJ 1RTJB 3I4PA 2DGOA 2W4PA 3OUYA 2V0NA 2V4JB 3KK3A 2VBZA 4I6AA 1IKWA 3O8WA 1CQNA 2DB1A 3SSRA 2F4FA 3IFEA 3EE3A 4PKDB 3IMQJ 4IKAA 5DETA 3CF5Q 4CT8A 1UA0A 3J7YI 2QL9B 1Q53A 2IJFA 3MM7B 4OX6A 4O0IA 3QJPA 5FD1A 5F8JA 1LOUA 4DSIA 1FKPB 5KFEA 3D5MA 3M8ZA 3MCSA 1C4CA 1VQLS 1NJYA 3HHLD 4BBYA 1BWVA 1H72C 4AT1B 2B9WA 2D3UA 3AJ1A 3QAUA 4DU7A 2ZE2B 1RAGB 4NLXA 1UFLA 2V9KA 4NMLA 3L3CA 1Q7LB 3LF0A 3O44A 1IM6A 4ED2A 2QSWA 2V8GA 4PR6A 3SQGA 4QJVA 2E44A 2ZH7A 3L7OA 1I5OB 3BH7B 4A8QA 2XB2D 3BPDA 3LGMA 5KFSA 3U1MA 1KONA 3MCOA 3MMBA 5CYMB 4TYBA 4YFUA 3OHBA 3BGRB 3THPA 3RJMB 3GIIA 3RW6A 2QG9B 4K50A 2CDQA 1LXNA 4CLUA 4LFCJ 5IFMA 1FJCA 2HS3A 2Z30B 1TKXA 4LSZB 3NGTA 3LAMA 5KFRA 3T1YF 4RW9A 5KFGA 1WSVA 1RDRA 2P9EA 2PO4A 4NYZA 5F9LA 5FIIA 1U1PA 4B9VA 3LOUA 3IC1A 4ILRA 3J7ZT 5IM0A 1KLMA 4PAAA 2LEBA 5DG9A 2HAIA 2FZKB 4IOBA 3HJVA 2XQCA 1U1RA 2ZUAA 3M2RA 2CQ4A 4LQ9A 1T3NA 1MNEA 1HYSB 1Z2ZA 5JJBA 3PVXA 1XBWA 3N0VA 2KRRA 3UN2A 3M32B 1HQUB 1TP7A 1IXKA 2GIRA 2GQCA 4GKKF 5LSRA 1KS2A 1R8AA 2X51A 3KK3B 2EFNA 1ZS6A 5E0OA 3PIOQ 2ZH6A 3HSZA 3D2WA 3LPEA 3EVMA 1WOSA 2G2YA 4H4OA 1AA1B 4PXDA 5LT5A 1N5QA 1NRKA 2V4QA 1T9XA 1DLOA 1JK9B 1PO6A 4UY85 2R4FA 2BE2A 3MEDB 3BKFA 3TVYA 3T41A 2VIHA 3M7VA 3KHHA 3W65A 3EGZA 1SQEA 4TY8B 4PXCA 2CUYA 2P9GA 4AFFA 5T41A 1RAFB 4FF2A 4P2XA 3J7A1 2IVMA 1HWUA 4NLYA 3IN5A 3Q2TC 5LL6d 3PRVA 4RW4A 4M5MA 5GMDA 4DG1B 4N76A 2EG2A 5HVHA 5K8OA 1S97A 2RVJA 1Q8KA 1YJVA 1NSQA 5C25A 4ED5A 2ZNZA 5FJ4A 1F2GA 1S7HA 3HHDA 3ISND 4DUTA 4FYXB 1B99A 2K3IA 4HHHA 1ULRA 1Z4UA 2CPZA 5B7WA 2MKKA 2KYZA 4JI3J 1IWGA 3DLKA 3WIUA 4W92B 2OPSB 2XMKA 1ZOTA 3FBBA 4USWA 3UDVA 6FD1A 3M1VA 5J2QA 1R8BA 2ACMA 4RW4B 3DLHA 1SH0A 1MN9A 1RUSA 5HROA 1FXDA 3HHLB 4XDDA 2LP4A 3G8QA 4JI2J 3QATA 2GJ2A 2JLGA 2AJ0A 1X5TA 1R8PA 2BKNA 4FYYB 2FLLA 2DNHA 4ZS6A 4OYMA 2AF6A 3FBEA 2KG0A 1C0UB 1V3ZA 2ILZA 2Z2YB 4OYIA 5KT6A 4KJIA 3AT1B 4OHVA 3MCNA 2CQCA 2YWGA 4WU2A 2G1HA 2C2NA 1WACA 1E6YB 1FDNA 2CVIA 2N4DA 2XI3A 2YH0A 2YX7A 1BD6A 1N0UA 2YWWA 2B5JB 1Y5LB 2Z4PA 3ENWA 3ETOA 1F60B 3HDSA 2JL9A 3V4MA 2GAHC 1RT3B 4RNMA 2V63A 3TR5A 1HQUA 1FEEA 4PWWA 5A0YA 5K20B 2HWHA 1G3OA 1N54B 2D74B 3DOLB 4DV1J 4F0HA 4DQQA 1YITS 1Q4RA 4IFYA 1RT7A 3CJ4A 4DQPA 3MMAA 2YX4A 4U7UD 1JLAA 2JEFA 3A4TA 4CNYA 1KNZA 4GKJJ 4QPTA 3B54A 2O3DA 5F41A 5DQGA 3EDQB 3MPUB 1JLEA 1U2RA 4P75A 2DTJA 3M8PB 4MKBA 2ZBIA 2K8GA 5CQGA 3W9IA 4DV0F 4CLLA 1NLKL 3CT9A 5C42B 1RBOB 5IQ6A 5HL7Q 8AT1B 1LWFB 1RAIB 3B78A 2RS2A 3TAQA 4CO1A 1T03A 3BDPA 2PMHA 3IGNA 1RT6B 3M8WA 1UJ4A 5KFFA 2CQ3A 2AHOB 2RQMA 3SFGA 3I5CA 5IT4A 2YWEA 3ONQA 3QGPA 1EP4B 3L95X 1RKJA 3KLFA 1SL0A 4HTIA 1RT5B 2NYIA 3HZGA 1UW4A 4RX6A 3KLVA 2Y0SD 2JVRA 4ES2A 1NNDA 2B8PA 3PEJA 4KGKA 3PHEA 2QA4S 4NLVA 3Q8QB 3QIPB 2G13A 4JI5J 2V67A 3T3FA 3TJ8A 3PRDA 4HH0A 2YBVA 2FLNA 2RKIA 2J0WA 4KV8B 1VQKS 4LFAF 2F65A 3KUGA 4ZP9A 3C8YA 1B0TA 4DV7F 2UVRA 1CEZA 2K7JA 5IV4A 3K58A 2G1DA 4YOEA 1S1VB 1WOOA 4ZVSB 3WZ0A 3IR7B 3DCAA 5HP1B 4LVNP 3M6VA 1TMMA 3T9NA 2BABA 3M2VA 3B82A 3R2DJ 3GFZA 5D4PA 3CD6S 1WKKA 1V3RA 3HD2A 1FFWB 4HI1A 1NK4A 1TV6B 2HFOA 2HHSA 2HIQA 3DYAB 3UVJA 2I5JA 1NM2A 3FMBA 3PR5B 4NWBA 1SIZA 1U8SA 2HG4A 4TU9A 2ADCA 2PN6A 1FKAF 1TL3A 1EAYC 2BV3A 4HLBA 2B4PA 4EBDA 3KNAA 2BACA 4QPXA 2H9ZA 3B4DA 1WC4A 1KBRA 3AOCA 3CO0P 2F40A 4LF2A 4OMFG 4KRWA 2AU0A 1YJ7A 2UXCF 1KN6A 1UAWA 3PX6A 2DBBA 3KUEA 1FRKA 1MLAA 2PA8D 1Y3JA 2GVDB 4F4AA 1RLCL 5K8MA 4NLUA 2QE5A 1HBNB 8ATCB 3GIMA 3FKBA 2QRRA 1TL3B 2ASDA 5K14B 2R2SA 3QT8A 3B8HA 3DI6A 3FBFA 4ZIWA 2FVQA 2JC1A 2WBMA 3QWUA 2KYXA 4PG6A 2DR8A 2HFVA 1RCXB 2BQ3A 4TLQA 2UXBF 5IT9U 4DV6J 1ROFA 1YKWA 1MU2B 5DDOC 2QLXA 2XG8A 3RBXA 2XCAA 4K0KF 5HQ8A 4Q7AA 5AXKA 1G7CB 1OQ6A 1Y10A 2IDLA 3JYTA 3CEDA 2CNLB 1D0EA 2UUAJ 4K4VA 4JYAJ 1HNZJ 5EWEA 2VHGA 1UWBB 3MAQA 1VC0A 4ZVGA 1VRTA 3AA9A 1QVGR 1CC8A 1N88A 2DHGA 2HZVA 3CC7S 4CH1A 1JNZB 1U25A 2YX1A 3K8WA 2ZM6J 2OPQB 3TO8A 3C16B 4CLSA 3GFXA 3OR2B 4Y0FA 4MIAA 4YEAA 4F3QA 2VOOA 3Q8VA 3GILA 4EYHB 1MWZA 1M0SA 2Z0GA 4LFCF 1DAXA 1MWYA 4ZIVA 2COLA 4WPAA 3NWGA 1FNMA 2YTCA 5D4NA 1OY6A 3C19A 1FKOB 3TANA 3LP2A 2ZBPA 4NE9C 2VQEJ 2V6AA 3M2UB 3X3UA 4ZJQA 4P72A 1N32F 4DR3F 4DL5A 1J27A 4R25A 1KLNA 2E9ZA 2X3GA 1SKUB 4OZ1A 4ZP7A 4UOGA 1P1LA 4Z2XA 3NL0A 2F4VF 3PX0A 2J6UA 1F2HA 1JLQB 2MKJA 5D0EA 4X66J 4DHVA 4F4ZA 4A8YA 2OH2A 1Y3KA 4R8UB 4FN5A 2AIRB 3LO3A 4IDKA 4MJKA 1KQGB 1B0PA 1ACMB 1VQSA 3DI6B 4LF6J 5HLFA 4V19X 3GFYA 1JLAB 3L4BC 3BF4A 2CXEA 2DR9A 3U02A 2CIMA 1IR1A 4RW6A 2OPRB 2MKHA 3DRSA 2MSTA 1Q95G 4LSLB 4QIVA 3ZZPA 4JI1J 2A18A 3H20A 4LFAJ 1NJWA 1TAQA 2QMXA 3QLHB 2L9DA 3P5TL 3L9ZA 1RT4B 3Q2SC 2RQKA 4U7CA 1UFKA 3KLIB 4DOZA 3TA1A 1VJWA 1VBKA 4B17A 4OI1A 1ZM9A 3VCDA 2C2DA 4ZHRA 3T1HF 4U8YA 2EBEA 1QD1A 3TEHB 2EG1A 7FD1A 4RWXA 2M70A 4ZPTR 1XMOJ 2DHXA 2B56A 1X7VA 3BREA 3N9UC 3NWRA 1Q7YT 2Z2MA 3MMJA 3TARA 2DGVA 5I3PA 5B0CA 1UVNA 1KEKA 4TLRA 2ASLA 4Y2IA 3THVA 1VQPS 1DQAA 5J2QB 4X4NA 1T8EA 2IM0A 3G82B 5HP1A 1Q5YA 3CIZA 3KWMA 2PI5A 5KFUA 4RW7B 5CD4H 1T94A 1KVJA 2ZBCA 1TFYA 3ZTPA 1RA6A 2WVFA 1HR0F 3P6YC 4O4GA 3ZZ0A 5C25B 1F5AA 4ECXA 3D0IE 3PTWA 4OYAA 2XYGB 3JAMU 1YJ9S 3K59A 4IG3A 3S01A 2WB4A 3MM6B 3W5ZA 1SI9A 3HI9A 1QUPA 3C6TA 3P3DA 4F0MA 4USMA 1U1LA 3DLJA 1IR0A 2V2ZA 4FS2A 4DR1J 2KHCA 2YY3A 3TAMB 4DL6A 3KFWX 3UFCX 3M8QB 3MHYA 2JEJA 5DGBA 1VMBA 2DNGA 3GMGA 2V94A 3H5UA 5HMZA 2Q3PA 3ELHA 4J9SA 5M2PA 2YNHB 1TV6A 4EFAC 2DHAA 3W5YA 4GC7A 2Y1JA 2D3O1 3HX9A 2D7SA 1WKJA 4DX5A 3LQVA 3AD9C 4ZN3A 1Y5IB 3FC9A 4TQSA 2CJBA 4J9PA 5E2QA 3HPOA 1YBUA 1S0OA 4XPCA 1N5YA 1UL3A 1FTRA 2J6TA 4WE1A 5D6GA 2IAJB 1LEOA 4FDFA 3QRRA 3H5SA 2I9SA 3MD1A 5FDLA 4CLTA 3TZXA 2RDJA 3CCES 3PW5A 4IOAQ 3WQPA 2HVDA 1MU2A 4DV3J 3K57A 3PJWA 2CNOB 2X1AA 1CULA 4ZITA 1NHVA 3VTIA 2KXFA 2OP5A 1HNWF 1YJRA 4CLYA 2PT0A 2CJQA 3A3NB 5EUHA 4HT7A 2DH7A 3H40A 2XI2A 3DU6A 1CJUA 1I6JA 4FBUA 3RAXA 1QE1A 5KFTA 3HZEA 3MR7A 2OFHX 3VAFA 3DOLA 1FE4A 4XO0A 3TUZC 4L75A 4O4GB 1VBZA 3OR2A 4QIWD 3ZNJ1 3PO5A 3NNAA 2XS5A 3BV8A 2FY8A 1ICEB 1IQZA 2FHOB 4K2JA 3HHNB 3M8PA 3M8SA 1ZM4A 2YPYA 2AJ4A 3UI3A 4ED1A 1GXTA 3OV7A 3DRRA 2XCPA 4JI6J 2F8MA 4KB7A 3I55S 3BO4A 4HHUA 4J7CA 3OBIA 4O3OA 1HNIB 4LMZA 3EGNA 1QSYA 3PKYA 2OPPA 3CJ2A 1SCJB 1UVKA 2QO3A 1WUUA 4KGVB 4B3TF 4LF8J 5KT3A 1XNQF 4A8MP 1W25A 3BSAA 4FVCA 3H4BA 4CM2A 2XMAA 3HF5A 2VF3A 4ZPWR 3H4DA 2RUGA 2EWHA 4C48A 3NMRA 2MQPA 4L74A 3CO9A 5ETQA 1GX5A 1RKIA 2E5LF 2DIVA 3PYFA 3HMJG 4X65F 1NK5A 4KO0B 2VU5A 2CA9A 4S0MA 1W2IA 2DXFA 1GXLA 1R0BG 2H65B 3LANA 1G6BA 3QPIA 4HEA9 2XWXA 4DZDA 4F26A 5K8NA 4J9NA 5HK4A 4ZPVR 5A8KB 4WTOB 2KFNA 3PYEA 3ZFVA 2UZAA 4D3GA 1G1XA 1EQ0A 3EGWB 3AODA 3FQLA 1NUEA 2LU2A 3BSNA 1D3WA 1EQMA 1IKYB 1XNRF 3H90A 3NS7B 4ETXA 4XDCA 4NEYA 2CZVC 4FZVA 4Y2CA 5E3RA 3UDCA 2BX6A 2R8IA 5L9NA 4K4WA 4GC6A 2DR7A 4EZ6A 4FNIA 5H9FJ 3LA0A 2DH9A 2WB1D 3Q23A 3QT6A 2HQ3A 4WFYA 4DUYJ 2O5DA 3DYAA 4DR2J 4ECSA 1L3UA 4DL3A 4Y3CA 5JMNA 4ICLB 2NPFA 1Q8IA 5M2UA 3Q24A 4IR1A 3N4WA 2DGSA 3AH6A 4OFZA 4TVAB 3SIPB 1R0CB 2ZVIA 2F8EX 4NRTA 4DS4A 4LF5J 1NU4A 3CJ3A 1YIJS 1HWJA 3CD0A 4KGZB 2HKEA 2OMOA 1WF0A 4N8NA 4LIWA 2CQDA 2NXCA 5G0RB 4UUWA 5F0UA 3CJ0A 1S6QB 4QIEA 1V3SA 3GSDA 4A47A 4F2SA 2R7VA 5ETTA 2R9LA 3L7PA 3OTOJ 2MJNA 3I5AA 4YDXA 3PCOB 3OHAA 3K5NA 1P6TA 3QYYA 4WFBQ 5L1IA 2NSBA 1XTZA 2CJYB 1EB0A 4I69A 1YRTA 3IG1A 4IH5A 4M1KA 1BE4A 2ZJPQ 3VQSA 3CD7A 5C5JA 4PXEA 4OJ3A 4DR3J 4HI2A 4N47A 3P4UB 1E6YA 2DNLA 1JLEB 2VG7B 3D6MB 1GNKA 1LQ9A 1VRTB 3FMWA 3PNIA 2E29A 4QR2A 4TKTA 3V4IA 1Q86T 1DARA 1WDTA 3ULHA 3GONA 2ZH3A 3EICA 2V2VA 2VPXB 2ZZNA 1Y11A 3KYLA 2FC8A 1FDAA 2AP6A 3RU0A 4H54A 4AYBD 4CM0A 3QZ7A 1SJQA 2KFYA 4KQZA 3CDBA 2YWHA 2NPIA 4DR7J 3I96A 1KHWA 1OYEA 2R7TA 2GVZA 1SUQA 1EETA 1O8BA 2PMWA 1VQ7S 2QLFB 5J2PB 1R89A 1FKPA 5DLFA 2P5VA 2IPOB 2C3YA 1TK0A 3KG4A 4N77A 2YQ0A 2BJ7A 4ED8A 2VASA 2EI5A 5D8HB 3QO9B 3LP0B 4CH7A 2EFOA 4RJVA 2DR5A 4NXNJ 2GQ2A 4C9DA 2DRDA 3PG9A 3V6KA 1NBEB 4MIBA 4JI5F 2MTLA 2A2CA 3D6HB 3O6QA 2JFKA 2FD2A 3G86A 2KJWA 2Q6CA 1F9EB 1RWXB 5C2CA 3DLLQ 2P6SA 2EEYA 1ZAWA 2HFNA 5KT7A 2YH1A 2H4YB 2RQ4A 2HHHF 3I9ZA 4DR1F 2MSSA 1HNVB 2UXBJ 2GS8A 5KG5A 2RQCA 2LQBA 2V2QA 2XMWA 2C2RA 3VQTA 1VIOA 1UPMB 4K5SA 3OT9A 4P9SA 4ZVTB 5KG3A 5F3ZA 4DV2J 2KHDA 1NEEA 3CDAA 3HSDA 3S7RA 3DRYA 4MMOA 3AAWB 4B02A 4DV5J 4OJHA 3R9LA 4JP8A 1Q79A 3LWLA 4F4WA 5BR8J 1U4BA 5KFZA 1VFJA 1TL7B 4NLTA 5HI7A 1C0TA 4P6QA 3US5A 1ELOA 2EK6A 2OPPB 5E7OB 4OHYA 1JLGA 4GO5X 4MK8A 4NMXA 3AB4B 2HPUA 3HFKA 5K9FA 4LSNB 1JXLA 1TKZA 3V81B 1CJTA 2L48A 1DZ5A 1U1MA 3DNCA 3HD1A 3KG1A 2DEIA 3UWTA 2YNGB 1SC6A 3FJ2A 3KDOA 2KH9A 1S9EB 4WTYA 3VAIA 2UUWA 3RRGA 2BOAA 4LR9A 4WK3A 2NREA 1N32J 3IAM9 3MEEA 3FBCA 5E3QA 2VFVA 5LJ3Y 1YLXA 1Y0HA 4WFXA 2L9WA 2XM3A 1N56A 2FJDB 5GMKa 2YKQA 3BQ0A 2MJUA 4K8RA 4C0BA 4I4BA 1XQIA 3RUBL 4FXVA 4DR5F 2MLZA 1TK5A 2RRNA 5THWA 5IQQA 2O01C 2R7OA 2E1CA 3QRPA 2J9DE 1JJHA 4PYDA 3JSYA 2KU7A 3OFGA 4WIIA 3BEGB 3IM8A 1TKXB 4QW8A 4DV5F 2RMLA 4AL5A 2NCKL 3OW2R 1V5VA 3H2LA 1TVRB 4KGXB 4BC9A 4JI7J 4X4QA 1WWHA 2WAQD 3DN9A 3H5XA 4KHMA 1IQTA 1HI1A 2DR6A 1ZAVA 5IM0B 1OJ4A 2IHR1 1N36J 3PRBA 5AJ3F 4QWAA 4MT1A 2DGWA 2WVEA 3F0NA 1VK8A 4V19J 2POKA 3MMCB 1VQOS 3EVOA 3O2IA 4EZ9A 3QFHA 2OIHA 3OLBA 4L3NA 1OPZA 1J5OB 2N82B 4YP3A 1CQMA 2Y1RI 3I6PA 3V81A 1QY7A 3JSBA 2YKNA 2YNIA 2UXDF 2D69A 1KOHA 3ILJA 5AXMA 3EZ5A 1WC1A 2JH3A 3QRQA 1QAYA 1DURA 2YNFB 1XWLA 2GZOA 2A3JA 2HZAA 2JJ4D 3EWGA 3D1OA 4PCQA 4CLWA 1WC0A 5KG7A 3CMQA 1L3SA 1MROA 2QZ8A 1YBAA 4EU0A 3MPVA 1GQEA 4OYXA 4YB6A 3GQCA 2O67A 3KG0A 2FZCB 2DHHA 1SJ3P 4RW8B 2IFXA 2N3OA 2VG6A 4JB8B 2ZVSA 4YR2A 2NXNA 1NKEA 4AE5A 4B3OB 4BLGA 1RHJB 1DRZA 2CADA 5J1PA 2DPIA 1PBUA 1MROB 1NSKL 3MR2A 1RK8A 4C8OA 4DWIA 3DMJA 4LBHA 1HHTP 2UUCF 3CWJA 4M8LA 5GAHU 2QTWA 1TL5A 1VQNS 5K8PA 3QO9A 4UT4A 5AE3A 2HGNA 3BR9A 4KC5A 2YKNB 2CKWA 2B9EA 1LK5A 5D78A 2XNRA 1UETA 2IDEA 3I0RA 3WDOA 1T05A 1TL1B 2XWYA 4MTPA 2UXDJ 1N5TA 2HVZA 1RT1B 2W2NP 4N56A 4NZ7A 1CLFA 1SUQB 2GVZB 4XPEA 4GVLA 3DGVA 5HATA 3ICLA 2MKIA 2B7BB 3OD2A 2W9BA 4M95A 1WEZA 5IS2A 1VCTA 1RBLA 2HQGA 2C1EB 2N7YA 2VPYB 2IJRA 5KG4A 5CCLA 1F3FA 2CQBA 2GW8A 3D6TB 1JLCB 2OPRA 3MM8B 4X84A 2YQ1A 2RS8A 3IBCB 3HHLC 3R3TA 3FK4A 3BQ1A 4DSFA 1BGXT 1CBKA 2AZ1A 3OTDA 5AE1A 2ZWOA 3AB2B 4XAKA 2LECA 3ZO7A 4I7FA 3MF5A 1NXIA 4X64F 1YJTA 1K9MT 3DLBA 3O3LA 3L09A 1O0PA 1HL6A 1TMJA 2QFJA 4C11B 3G2XA 4EBEA 2AV5A 1TTHB 3HSGA 4CNZA 1VGYA 5KFYA 5E3AA 4OYOA 4AL7A 4C0OC 2R7XA 3SYZA 3Q89A 4F4XA 1HA1A 4EO6A 2VONA 3C6TB 1C1CA 2V8PA 4NX9A 4R0EA 5HANA 3T5LA 1H7XA 2HHUA 1S1XA 4OZ2A 3BKTA 4MH8A 4DCPB 2XMVA 5EHHA 3POTB 3MDFA 4OHZA 5EWFA 4TQRA 4K4XA 2XYPB 3JSMB 2DEJA 2OO4A 4ZDNA 3TX0A 2ZC4A 4ETZA 4M5NA 3PY8A 2C2KB 2FHJA 3U27A 2M9KA 1P1TA 1JLGB 4OYZA 4KO0A 2MEWA 4NRUA 3R6LB 3KK1B 1WELA 4F4KA 2LEPA 3HVTA 4QWDA 3Q86A 5IV3A 4I67A 1F3VA 1KVKA 2RIJA 4C98A 1L3VA 4LF1A 3BDEA 4N8OA 4NCAA 3DRXA 4X4SA 3JYTB 4ED7A 1BWEA 4OJ1A 3IWLA 2CQ0A 3AD7C 1RTZA 4PABA 2XHWA 1LWCA 2ZZMA 1RYSA 3I56S 2DY9A 1GT8A 3IWXA 4ITSA 2EVZA 1X4HA 2ALYB 1X4AA 1F5CA 3NEKA 1R43A 5J1NA 1I3OB 5CCMA 2OSRA 4BS2A 2KJVA 2HAFA 1HNWJ 2XO6A 2HQIA 2BKPA 4RNHA 4ED4A 2QLJB 1ZTWA 3OJSA 1C1BA 3W2VB 4YHHF 1RHMB 1Q78A 2VQFF 2ABYA 2FHKA 2IC3B 4I6WA 1VR6A 4USJC 2EK1A 3ZXWA 3AOBA 3C6UB 4CQ1A 3MZIA 1YK9A 2HNZB 1KFSA 3TP2A 2CWKA 3G9CA 2HBQB 2W2MP 3I32A 3EJMA 4RW6B 4ED6A 2BKOA 1HQ2A 4X62J 2UVUA 5J2MB 2VA3A 1UW9A 3RB3A 2MQLA 4ZKAA 1HPZA 1EETB 1WC5A 3OXFA 4DQSA 4YDDB 3TOQA 3NGDA 4O23A 3CCQS 3SZ2A 1I94F 3PO4A 2HK2A 4QR1A 2KT5A 2X3DA 5F0WA 3F44A 4R8UA 4JYAF 4QZVB 1RYRA 3SMZA 4OI3A 4ALZA 5RUBA 4JI0J 3W62A 3TJ9A 3UNYA 3T9ZA 1QTMA 2GX8A 4B9SA 1N0VC 1QE1B 4TY9A 5EX0A 2E7VA 2J8SA 5ETLA 1U0HB 1RAOA 2G0JA 2HFSA 3HVTB 1U49A 3N5BA 3ZZUA 1UZHA 3VV2B 3D0GE 4ZA1A 3KK1A 5GAHI 3R7SB 5HO4A 2Q66A 1BLUA 2DH8A 4DV7J 1DY3A 1XR7A 3FFIA 4KKOB 4QWCA 4DL2A 3PIPQ 1NCLA 5KFIA 2J0SD 3ILLA 3F41A 4PUOA 2CAJA 2AT1B 4C97A 4USUA 2KXNB 4EGLA 1YTYA 2C22A 2AYBA 3T5JA 5DDPC 1AZSB 2KZMA 2M3DA 4NASA 3GB0A 3FCWA 1UVJA 4DBQA 4DF8A 2AQ4A 3R7NB 4URGA 4E2FB 3AXMA 2U1AA 5ETVA 4Z7CA 2F1FA 1HW9A 5HBMA 4JI7F 4ZP8A 2K1RB 3EZUA 4TNOA 1REGX 4BWJA 3BJYA 1F5BA 1Z1ZA 2V9WA 1FWKA 1W7WA 1KFDA 1IWAA 3MM9B 1ZZNA 4JI2F 4EBCA 2M2BA 2UV8G 4C8NA 2B6AB 5LM7E 1P8GA 2V50A 2VB6A 4NXMJ 1FO1A 2B4OA 5CAAA 2PSZA 1EHWA 4QOTA 2W9AA 2GMLA 3IRWP 3MFIA 3A8EA 4DPUA 1MWQA 1VBYA 1OPIA 1SH2A 4JI4F 3FRZA 4PZVA 1C4AA 1VRQC 1IBKF 4DPYA 4ZLNA 1NK7A 4BHQA 4Q2MA 3KHLA 4UZCA 5GAGU 1GTEA 3A13A 2FJEB 4RO0A 2WOMB 4ZMMA 1Z2LA 1U1OA 5F8IA 3KMQA 1JLFB 1YWXA 2IVFB 2W9BB 4NA3A 2KVIA 5CYQB 2IC3A 2QN6B 4OIXA 1RCOB 4IQMA 3I87A 4WP3A 2ZH1A 5J2NA 2UP1A 4QU7A 4DV2F 4FBTA 2C42A 1SV5A 3AJDA 2NUHA 3TAMA 1HR0J 2DO0A 3CB4A 2MKYA 1VQ6S 4IFVB 5C24B 2ZJRQ 4C0HA 2I8EA 3PFOA 3H2UB 1K47A 2QC3A 3VAJA 1IJEB 2C3UA 2ZBQA 5IWAJ 4FNHA 4USHA 2FVRA 5EN1A 4ED0A 4USVA 3GE9A 2MB0B 2H5IB 4Y6IA 5T14A 4ATNA 1VC5A 2D9OA 4JI8J 3TW0A 4PEOA 2MQMA 2EKYA 3K2YA 1HQEA 4OLOA 4JV2A 3CCZA 4NLQA 4B9MA 2EPIA 4OYWA 3ZTOA 5HJYA 1VISA 3CCJS 1HBNA 2EC2A 2M8HA 1TK8A 5CHCB 3MI7X 2I5JB 1FD2A 1I51B 3LGNA 2GVDA 2MY7A 3QLHA 4CCHA 1L3TA 4AQYF 4OX9J 3CDUA 2KXHA 3QSYB 3UD3P 2XYHB 1YZ6A 3KXDA 2NLWA 2VKZG 1QVFR 4ZHRB 3M2VB 2GA7A 2DGXA 5CH7B 5HVFA 4USIA 2RRAA 1RACB 1SPBP 3ZTSA 3E51A 1N6QB 4PG7A 1N48A 2WSCC 1H3DA 1X8DA 1RHRB 1SVDA 3UDLA 2HFZA 3GSIA 5LMUJ 3VAKA 2R8HA 4AUKA 2R8GA 3GJSB 1LWCB 1N33J 1BQXA 3POTA 4H4MB 5ETNA 2ZITA 3W61A 5LJ5Y 1SJ1A 5DDQC 4AXIA 3E3XA 2SXLA 1GEHA 4PPZA 2W8KA 1N36F 3ISNC 4C2MA 1TUVA 1ZM3A 1M1KT 3U7JA 2RF2B 3R5DA 4XTTA 4AL6A 2FGOA 3KKFA 2VJVA 2V68A 4M63A 1UVLA 1JXEA 4NL5A 1O5JA 3MPDA 4ZCKA 2XGPA 1R8CA 1NH8A 3J7YU 3GJTB 4A8FA 1QAIA 4QU6A 3EPGA 4PWDA 2ATLA 1HMVA 1V6HA 4YMEA 4OL8A 3QBCA 1LWFA 1E6VA 3VR1A 2ZHBA 3KDNA 1S57A 3C16A 1BUXA 2MLYA 2AZ3A 3P5BP 5IOLA 5A2QU 5H9EJ 2UVVA 1S76D 3EXYA 1FFSB 2KO1A 3M8QA 4IO1A 4MYUA 4ENOA 2ACYA 3HM9A 1N6QA 1DTQB 3H8YA 3EPIA 3R1HA 3I0RB 5I42B 1XMQJ 1EP4A 5E41A 3T5HA 2HSEB 4O0NA 4K59A 3UCUP 1T11A 2GIQA 3E8OA 2ZHOA 4V1Ak 4E8UA 3MR3A 2W7AA 2LYVA 3FFIB 4KKOA 3TQ1A 1REVA 3RYLA 3OTCA 1YG0A 3LGHA 4IG0B 3W5XA 1RWVB 2HQCA 3SCKE 4GKKJ 2RD5C 3OPKA 1F0XA 5B0BA 4NLWA 2GV1A 1SKWA 2H51B 2UU9J 3OTOF 1Q8LA 1FVSA 3A8IA 2P2CB 1F9FA 3BBBA 3CJQA 1BMQB 3E01A 4EI2A 4IRDA 1LW2B 2IBOA 4CO3A 3JTPA 2WONA 2M52A 5ETRA 1B64A 1URRA 2A10A 3RBDA 4ELVA 2XS7A 2DVIA 3M9MB 2DNZA 4L3KA 5A0YB 2PFFB 5KG6A 2VICA 2B43A 3NCQA 1S0MA 2JSXA 3SQOP 2C2ZB 1X4BA 3I9V9 3R5BA 1GMWD 3BSCA 2AX1A 2DKOB 3UN5A 4YHHJ 3TYTA 4DPOA 1ZTTA 1HIYA 1CC7A 4HHJA 2MQ8A 4HT5A 7FDRA 1NJIT 5FLXY 1FJGF 3T5KA 4RBVA 4NLGA 5DG7A 5J2NB 1HWKA 1SQFA 4CRJA 4YS2A 4ECZA 4PPDA 3JSMA 1DBDA 1H2UX 1LNQA 5KFAA 3K5PA 4A8XA 2M88A 3W63A 4DN0A 2ZOGA 1A0OB 1WEXA 2N4CA 3QAEA 3VGTA 3G6XA 4TY8A 3WC2A 5I3QA 1DHMA 4BWMA 4HDGA 4DR2F 1ITPA 3D66A 2HQFA 2JFDA 1HLWA 2E1PA 5IC6B 4CTAA 4ZPAA 2QGFB 3VF0B 4LF4F 2G0IA 4Q0BA 1ZPVA 1NDKA 5AXLA 1M1HA 1KTVA 2JEIA 1CPZA 2DISA 4WP9A 4DV3F 3OR1B 4KPYA 1AB8A 3I5BA 2C2OB 2WW8A 3G6ES 3QMQA 4HYKA 1AFIA 2BYCA 3BBCA 3THTA 4FKYA 4RUAA 5DZ6A 4YB7A 3SDEA 2UXCJ 2XSFA 2VD3A 4ILMA 4K7QA 3W3SA 1UFWA 2FVCA 4WKRA 2CQPA 2KFZA 3ILOA 1T95A 2WBRA 4OX7A 4ZVRB 1RT5A 1QM9A 3CTRA 5IZHA 3KHGA 4LF7J 1RT7B 1JLCA 3SFUA 4OQJA 4DLGA 4OZ0A 2B0GA 3W9JA 1Y00A 3H42A 3NLCA 1UTAA 5KFXA 2ZH8A 3MOJB 5F8NA 4OZ3A 3HVRA 3IS9A 4TYAA 3IXQA 4ZLJA 1VK3A 2E7WA 4YN3B 5L8RC 1NB2A 4WZQA 3P8BB 4DUZF 3BR8A 1SBRA 1S48A 4DR6F 2E7XA 3PW7A 4WZMA 3NXZA 2CPYA 2HQDA 1VI7A 1YZ7A 2OFGX 3CCWA 3ETMA 2DY1A 3GCXP 5ETPA 3K5LA 2Y8YA 2PA3A 5DJBA 4C11A 3AD8C 4IFYB 2BDPA 3R1LA 4ZVPB 2BE9B 2W8LA 2FJVA 2XLKA 1YBTA 4QIGA 5CZVA 2MZTA 4WYLA 2E5HA 2XNQA 2H5JB 4M5DA 4CLZA 2D9PA 3BYPA 3CE8A 5IWAF 2EFGA 2R7QA 3CJKB 1TKTA 4MKAA 1GXUA 4NZ0A 2IRUA 2BQUA 1CJTB 1FWPA 3AJ2A 1S9GA 4WKYA 4B3RJ 2KTQA 3ET6A 5DS7A 4HVZA
chains in the Genus database with same CATH topology
3KLEA 3OVBA 2MZRA 3M9NB 4FPRA 2BVZA 4C8MA 2EFVA 2MQQA 1RT2B 1WHWA 2DNQA 2QT7A 3OXGA 2ZOMA 4I6YA 3MTJA 3QZ8A 5KFPA 3W2WA 1TL4A 2J7WA 1NO8A 1LWEB 4ED3A 1UJ6A 2AYMA 2IYGA 1VC6A 2DRBA 2B7CB 2VODA 3UE2A 2LXUA 3RRHA 5J2PA 4DS5A 3MEKA 1Y5NB 5H1SV 2V4JA 2W7PA 1FEHA 2LDYA 3MTKA 1Y9OA 3CJ5A 4J5OA 4R0JA 2OPSA 1DTTB 4LIRA 2YNFA 5KFWA 2RNEA 1LK7A 1UMJA 2DGTA 3S8SA 2WONB 3DHWC 3TI0A 1KR4A 3VAMA 3CCTA 1FRIA 1SJFA 5A8RA 1VQ8S 2DNKA 5DG8A 2CQ1A 4I1TA 2HVIA 1A9NB 1U24A 2NQPA 2PC6A 2XULA 2HNYB 2YKPA 1REVB 5IT9Y 2C3OA 1ZPWX 2HW3A 2MMYA 4X4TA 4LF9F 4AXJA 5L38A 1VOMA 3CCLS 2ROGA 3D1QA 2YNIB 3M4XA 3KLFB 2FJWA 2J5AA 3GR1A 2J7KA 2KT2A 3BZQA 3M6XA 5U47A 1S9GB 2OAUA 3CULA 3KJVA 2IVYA 1HNZF 4F25A 3FEYB 3MEEB 3TVZA 3FEXB 5F8HA 4DV4F 5G0RA 1JJ2R 2MGZB 2HHWA 2ZE2A 3HHEA 2FJBB 2AGOA 3IR6B 2IMOA 3TUJC 3F73A 1RA7A 5BYRA 2CRLA 2I0XA 4YQWA 3O1LA 4ZVEA 4Q0BB 3BGRA 3I31A 1S6UA 1FK9B 3BGLA 1VQ9S 4CTAB 4B9TA 1C0TB 1SKSA 2UUBF 2V8DA 1H38A 3N01A 1LXJA 3EXCX 2G0CA 2HNYA 1FDBA 3IG1B 2LDIA 3AQOA 3DOKB 4ICLA 3HLUA 2PIIA 3GR0A 5J1EA 4PG8A 2MZQA 1G2EA 2BJDA 3TUIC 4TU8A 1TFWA 1YJUA 4OZNA 2MZJA 2QA2A 3QIDA 2M7SA 5F8LA 4NYPA 4HL9A 2PD1A 5BR8F 2R2TA 2CQGA 3MFHA 1D8ZA 3QJJA 4TN2A 1T3OA 3DHXA 4LF5F 3LAKA 4ID5A 3IRXA 2ZH2A 5D3GB 5D4OA 2KM8B 4OI6A 2I2YA 4MK9A 4NLPA 1QSLA 2GGPB 3CCSS 3WC0A 3V6DA 1FESA 2GNKA 3GWCA 1NK9A 3NCPA 4ZP6A 1TKTB 2AYGA 1RISA 3OLAA 1SL2A 3OUYB 4PG5A 3CGIA 2OD4A 2W4DA 1FXRA 2HLTA 2E1AA 2MY8A 5A8KA 3LP0A 5E3CA 1OSDA 1WF2A 1CG2A 3UR3C 2EC0A 2L08A 1LW2A 2F9DA 2DHSA 1Q1KA 2GHPA 5I42A 3DM2B 3V5RA 2LKZA 3DLGA 3IBWA 3OVAA 1S0VA 2UV8A 5LXYA 5DGAA 2G9OA 5DM6Q 2DNMA 4ECTA 2VUGA 2VZ9A 1WI6A 2BM1A 4CO5A 2XC9A 2CZ4A 4F50A 2JOQA 2KRBA 2ZM6F 1R27B 1ZZFA 2FUG9 4C7QA 2B51A 1MMNA 2ZUGA 1RTIB 4PG4A 4WXOA 3UQSA 3FCHA 3MR5A 1WTBA 1M5OC 4MAKA 1KSPA 1FE0A 2VKRA 2AYEA 1SKRA 5B09A 2ZDOA 4ECVA 5DQIA 4RW9B 4NXNF 1PGZA 1S6OA 2JLFA 2RE1A 3GZ7A 2HHPA 2QYCA 2LVWA 3HP6A 3MMBB 3N28A 5CYMA 1X4DA 2CPHA 2AD9A 1S97A 1TQLA 2UXBF 2C2DA 1S1TA 3V4IB 5JXSA 1S6QA 4FVMA 2JRSA 3LP2B 1K0VA 2C28A 3PXGa 3TX8A 2Z8QA 2JHEA 2VFUA 3SDEB 1ZYQA 1HW8A 2P6TA 1T7PA 2YKMA 3AA8A 1SL1A 1HMVB 2ASYA 3RAMA 4PQUA 3RW7A 4DR4F 2VG5A 3K8VA 4KGMA 2NUUG 1R8HA 1YGYA 5D4LA 1D9AA 3M05A 2HGLA 4RU2A 5LMNF 3JB9k 3QJLA 2RB7A 4DN9A 3JTOA 3SI8A 2X1GA 2IM3A 1BQMB 2DO4A 3MECA 2Q6BA 1R7IA 3LPYA 5D77A 4ZVFA 3VAHA 2MYFA 2GHVC 3BN4A 3SCJE 4N41A 5KFKA 4RZRA 2WSFC 5B0GA 2AW0A 3SEOA 2MKCA 2KDOA 5F3TA 1IUJA 3KOAA 2ZNYA 1BY9A 1L3KA 2W25A 3K5MA 1DQ8A 2PI4A 4NPOA 3OVSA 1AUDA 4JOUA 1N4LA 1IBMF 1JKHB 4G1QA 2W9CA 2DGUA 5EWGA 2F7VA 1FNXH 4Y2MA 2W7OA 2AWZA 4IFVA 1C1BB 5JVGQ 1VQMS 2ZDPA 4DFMA 3ZZYA 2DJWA 4DUYF 3DRRB 2GHWA 2XEXA 1Y7PA 2YQ3A 3MOZA 3CJKA 1H2TZ 1H7WA 2UU9F 5HMWA 4X4OA 2BBEA 4IG0A 5KFOA 5DM7Q 3MM5B 4DSJA 3U1LA 1JNRB 2R2RA 5T7LA 2YKAA 4I2QB 1N8RT 2DCUB 3IGVA 1FTCA 3N6MA 1RGVA 3BO2A 1XR5A 4DFJA 1FD8A 3M2UA 1IKVB 2RF2A 4B3SF 4DL4A 5F8MA 2JC0A 3ENQA 2J0XA 2YNHA 4DLEA 5LMUF 2ZD1B 4QBUA 1S49A 3KLGB 2J0QD 2VL1A 3GG1A 4O3RA 1UVIA 3I0SA 3NNHA 1B7FA 2XY5A 4KIAA 1UWBA 2NXUA 5B0DA 2IJNA 4DF4A 2XBPA 4RUHA 1OS5A 2DPJA 4WCEQ 3SV3A 4NZ6A 1QAXA 3NGKA 4NA1A 2MZ1A 3MUTP 3PKMA 2K1RA 3JSRA 1FRJA 2CQ2A 4MK7A 2MXYA 1QLNA 4K2XA 4X4VA 3MGJA 1S1WB 2CPEA 2NR0A 3CC4S 2DD8S 2HVHA 1FKOA 2HMIB 1FRHA 4CIOA 1R0AB 2VFTA 1NH7A 4CO0A 4KT0C 1Q16B 1N5VA 4U67Q 1VIXA 2HRUA 3SXLA 4WK1A 2JDJA 2LEAA 4A48A 3HJFA 1RP5A 4K4ZA 4LJMA 3DLEA 2QA1A 3OFHA 2HRYA 3WBZA 4B3RF 1U09A 1X9WA 5IT0A 4DG1A 4FF4A 2ZFHA 2V4RA 1NJZA 3LALA 1U45A 4FS1A 3KLIA 2V2KA 1YSJA 3O5TB 2OD6A 3CC2S 3UPFA 3DC2A 1ZH5A 2CVEA 2DNOA 3EUNA 4A8WA 2M8DB 1MSWD 1TZ0A 1RAJA 1XN9A 4H4KA 4LSLA 4KE5A 2CFXA 2WCXA 1P9QC 5BYSA 2FHJD 1IKXA 2XMMA 5LXRA 3LH2S 4WJBA 3U1NA 4DSEA 1HFEL 4OV1A 4WXWA 3UW1A 1Q82T 3TRGA 2O1PA 4M94A 1RT4A 3G6YA 1SV5B 4I56A 4B9UA 3S6EA 4YY3F 3GFHA 3P49B 3OXLA 1YVFA 4BC7A 1XERA 5CYQA 1LKZA 4KR0B 4PQUB 3IRXB 3EYZA 3CIMA 3W7BA 2YKMB 4X2BA 5KFQA 2IRYA 2WK4A 4ZK7M 2ASJA 1WI8A 4Y34A 1IN0A 2XS2A 3C3LA 1M90T 2R8JA 2IMWP 1R0AA 1DTQA 1RJJA 1S1WA 2V8HA 4X4RA 1K8AT 4C8ZA 3T6BA 2BR0A 3N79A 4DL7A 3FNNA 3RBEA 4Y00A 4G6VB 1U1KA 1FCAA 3NMAA 2HHQA 2E1RA 1RT6A 3OTBA 2J9CA 1HWLA 1SJ4P 2HHXA 2OPQA 3FQKA 2YWKA 4I7FB 4R5PB 1X9MA 2KT3A 1M5HA 3M32A 4OX8A 1FJ7A 2ZC3A 5E33A 1H0HB 5LSLA 1WEYA 4G1IA 1OQ3A 1IM4A 3M2RB 4ZCMA 4MFBA 1I1GA 2XZWA 1JLQA 1PILA 2IRXA 5DO2A 1VLYA 3V6HA 3NKYA 5A6WA 1U1QA 1OSCA 2JEGA 1FHTA 3MM5A 2CJKA 2LQJA 3K5OA 2RRBA 2MGZA 5HBMB 3H2VE 1HPZB 1IKVA 3N5FA 4DFKA 3KJVB 2MDAA 3CCVS 5DLGA 1NK6A 3MMAB 2BOPA 4DJBA 2AJQA 2ILYA 2ZD1A 4Q43A 2E5IA 4RUCA 1KQKA 4B08A 5E5NA 5T7LB 4O3NA 5M2RA 4ECQA 2DNPA 5KG1A 1YHQS 2F9JA 2Q43A 5C42A 2XSJB 4FF1A 3MAHA 2Q1LA 2BM0A 2QMWA