2V94A

Crystal structure of p. abyssi rps24
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
FMLEMEIKITEVKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGSYKSKGYAKYYYDKDRMLYIEPEYILIRDGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S RIBOSOMAL PROTEIN S24E
publication title Mutation of Ribosomal Protein Rps24 in Diamond- Blackfan Anemia Results in a Ribosome Biogenesis Disorder.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosomal protein
total genus 23
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v94A00
1QVGR 3U1MA 3G8TA 2N82B 5HO4A 2CQPA 3CPWR 2DH9A 2I2YA 2M8HA 2NLWA 2M0GB 1VQ8S 1H2TZ 3S6EA 1UP1A 2X1FA 3P49B 3NNCA 1VC0A 2RT3A 1L3KA 1WI6A 2DNZA 3FEYB 3K0JA 1S79A 2MQLA 2VOPA 1U1NA 1OPIA 1HA1A 3VF0B 3Q2SC 2XB2D 3SXLA 2KYXA 4UY8T 3TP2A 2JVOA 1X5OA 1YI2S 3MUVP 3BS9A 2CPYA 3S8SA 4F25A 2MZSA 1Q82T 4QPTA 2AD9A 1RK8A 2D9OA 2DNOA 2M2BA 2MPUA 1WF2A 2E5JA 3CC2S 5H1SV 2D3OR 2XS7A 1VQMS 3V4MA 3U1LA 2RQ4A 5HL7Q 2J0SD 4M5DB 4PRFA 3TYTA 3P6YC 1X0FA 2F3JA 1DBDA 3N9UC 2ZJRQ 2RRAA 2U1AA 3OW2R 2HGMA 2CPFA 4LJMA 3P3DA 2EK6A 2MMYA 1ZH5A 1X4GA 2AYGA 2X1BA 1N52B 3NS6A 2DGVA 5D78A 1DZ5A 3J7YU 2K8GA 2KM8C 2DISA 2KRBA 3ZZZA 1RKJA 2MSTA 3I55S 1FJCA 2F9JA 2E5IA 4W92B 1WEYA 5DDPC 1VBXA 1A9NB 3UD4P 1VQOS 1KOOA 2DNNA 3NMRA 2KT5A 4CQ1A 5CYJA 2DGWA 2JVRA 1PO6A 1YWXA 1BY9A 2RQCA 2WBRA 3G8SA 1QVFR 3NNHA 2YWKA 1WHXA 1U1PA 1X4CA 5IFMA 2DH8A 3MXHP 4C4WA 5LJ3Y 3CCMS 1XN9A 4TU7A 1A7GE 4PR6A 2QA4S 4YOEA 1JJHA 2YTCA 3MUMP 2DIUA 2KG1A 3CD6S 3JB9k 1Q86T 1IQTA 1S72S 1VBZA 1WEZA 1N54B 3B4MA 4LIRA 1YJNS 5DDQC 1VQ9S 1UAWA 4LMZA 1G2EA 4Z2XA 4C7QA 2RNEA 3CC7S 2DB1A 2J76E 1WG1A 2DHSA 2MKCA 1X4EA 4TLQA 4IOAQ 4ERDA 3S7RA 2L41A 5IM0A 4OZ0A 3CTRA 2VODA 1R8HA 1X4FA 3FEXB 1U1QA 1PGZA 2N3OA 1SXLA 3UWTA 2DITA 2E5HA 5LXRA 4UQTA 2M52A 1M5PC 1FXLA 2G0CA 3TO8A 2MYFA 3THTA 1JMTA 2MZTA 2M70A 1SJFA 3G6ES 3MUTP 1YITS 4ZKAA 3MD1A 2DHXA 2LA6A 1JJ4A 2DH7A 1N88A 2LXIA 2DNHA 2DNLA 1K73T 4QU6A 2ADBA 1U1LA 1N8RT 2KXNB 2CPZA 1URNA 2L9WA 2AYEA 2KRRA 1X4DA 2CQBA 3VALA 1VC5A 2DNYA 3B4DA 2ERRA 3HHNB 2MJUA 1FT8A 1FNXH 1VQ4S 2GO9A 2CQCA 1JJ2R 2KXHA 1Q7YT 5D77A 1M5VC 2DNPA 2HGLA 1B7FA 3MD3A 2DHGA 2PEHA 1ZZFA 3MOJB 1YTYA 1SJ3P 2DNKA 2DK2A 2KU7A 2KG0A 5GMKa 2A3JA 4WF9Q 1F9FA 2UP1A 2CPDA 2FPHX 4FXVA 3THPA 3VAJA 1WG4A 5LSLA 2NZ4A 2O3DA 3DLLQ 2HVZA 2CQDA 1P27B 3G71S 1UW4A 3CULA 4QQBA 2FY1A 2XSFA 3UCUP 2CPIA 2RU3A 2AYBA 1WF0A 2MZRA 2VOOA 3CF5Q 2DNMA 3J7ZT 1WEXA 1H2UX 1YHQS 1OO0B 2MQMA 2HYIB 2RVJA 5JVGQ 2ZJPQ 2CQ3A 2CPHA 3RW6A 5IM0B 3UE2A 2CQHA 2J8AA 2D9PA 2DGUA 2MB0B 4F26A 4OZ1A 5GVQA 3CCUS 4RU2A 2N3LA 2RUGA 4BS2A 1VBYA 2KVIA 2MKSA 2MQQA 1W2BR 3R27A 1H6KX 4CIOA 2KN4A 2M4MA 4WIIA 1CVJA 2MKKA 3PIPQ 2XS5A 2OSQA 1KC8T 3G9CA 1YJ9S 2JWNA 2X1GA 2OSRA 1U6FA 1K8AT 1WG5A 5JVHQ 2DGQA 2M8DB 2DO0A 2G1DA 3G4SS 2KH9A 2N7CA 3CCQS 5LSOA 5GAGU 3IRWP 3CMAS 2XNQA 3D2WA 1NU4A 3CUNA 1KOHA 1D9AA 1YIJS 4F02A 2FC8A 5ITHA 2MQOA 1M5KC 5CXTA 4IUFA 3VAFA 4TU9A 5EN1A 2E44A 2LECA 3CMES 2OJ3A 2Q79A 2LEAA 3IWNC 1HD1A 2V94A 3CCES 1U1KA 3EGZA 2B0GA 2EK1A 2OTJS 2JRSA 3CCJS 1U6BA 3R1LA 5IQQA 1R8PA 5DDRC 1X5TA 1X4BA 5LJ5Y 2KXFA 1WHYA 2MKJA 3R1HA 3MURP 1VQNS 1DRZA 3ZZYA 1WWHA 2MSSA 1VC6A 1AUDA 3BO3A 1OIAA 2YH0A 3MI7X 2U2FA 3P5TL 4C0OC 1SJQA 4WCEQ 1X4HA 2YH1A 1WI8A 2CQ4A 2HGNA 2MY7A 3VAHA 1M90T 4FXWA 3L3CA 2LCWA 2MXYA 1DHMA 2G4BA 1HD0A 2JX2A 1U1MA 4V19X 3CCVS 3DXBA 3PIOQ 3CC4S 2LEBA 3S01A 4CH1A 2BOPA 1X5PA 2MGZA 3RW7A 3BO4A 2CQGA 2KHCA 2M88A 2OIHA 2QFJA 2ADCA 4CH0S 2DHAA 5DDOC 2PE8A 2EVZA 5MLCV 1YJWS 5DM6Q 2DGTA 5BJRA 1P1TA 2DGOA 3EGNA 5CA5A 3BO2A 3ULHA 2X1AA 3LQVA 4IOCQ 2LQ5A 1VQ7S 4PKDB 5DETA 4Y00A 4TU8A 2QEXS 2CQIA 2E5GA 2KI2A 1U1OA 3NNAA 3SDEA 1FO1A 2LYVA 2DIVA 1D8ZA 2RS2A 2K3KA 2DNGA 2J0QD 1WHVA 2MQPA 4WFAQ 3US5A 3NS5A 1OWXA 2DO4A 1H2VZ 2RS8A 2DNRA 5GADU 3Q2TC 1VQPS 2MKHA 2CPJA 3UD3P 2XNRA 1HL6A 4EGLA 2XS2A 2MQNA 5GAHU 2DGXA 3LPYA 2AYMA 2LA4A 1WHWA 1K9MT 2OTLS 2KFYA 3H2VE 2MZJA 1NJIT 2VONA 2CQ1A 1U2FA 1QM9A 1WTBA 2HZCA 1SJ4P 3MDFA 2DGSA 2MZQA 3UCZP 3CCLS 3CXCR 4J5OA 2MJNA 4YUDA 2L08A 3I56S 1VQ5S 2LXUA 2M9KA 4IO9Q 4P6QA 1U1RA 3UCGA 1M5OC 3CCSS 1X5SA 2CQ2A 3CCRS 3SMZA 3G96A 2CPXA 1WELA 1X4AA 2MGZB 3VAKA 2LKZA 4Y0FA 2GHPA 1UFWA 4WFNQ 2MKIA 1Q81T 2RRBA 2MY8A 2MZ1A 3VAIA 1WF1A 2FC9A 1KD1T 1ZZNA 4WKRA 1FHTA 4QU7A 2CQ0A 2I38A 3HI9A 1O0PA 3H2UB 5LXYA 2YKAA 5GAEU 1FJ7A 4W90B 5DM7Q 2FHOB 1KQSR 2CPEA 2ZJQQ 2F9DA 2KM8B 1M1KT 4WFBQ 4ED5A 2M7SA 4U67Q 2SXLA 3SDEB 5FJ4A 4A8XA 1FJEB 1VQLS 4YB1P 2MHNA 1NO8A 3VAGA 1VQ6S 2BZ2A 3VAMA 2CJKA 3BEGB 1VQKS 2LMIA 3EX7B 2DNQA 1SJRA
chains in the Genus database with same CATH superfamily
4X66F 5H9EK 4IRDA 1IJEB 1HNIB 2Z2YB 3ISNC 1RT4B 4NYPA 1VQSA 4WFXA 4NI2B 4UTGA 2G2ZA 4LF9J 1TL7B 4JI0F 2QLWA 2JVOA 4LIWA 2J9DA 2QE5A 2CPYA 3CIMA 2MPUA 4Z37A 2DXEA 3TZYA 3CC2S 1VQMS 3MM7B 2J0SD 2UXDF 1MWZA 3PYGA 1XNQF 3H59A 1PAUB 4ECUA 2LVWA 4KKOA 4HHJA 2FY8A 2V68A 1R6YA 1YX2A 3GCXP 4DV6J 1R0CB 3GFZA 3JSMB 4QYZK 3ISZA 3RAMA 3PY8A 4B3MF 4K4TA 1ZETA 1SBRA 4ZA1A 4U7CA 2Y1RI 1C4CA 3HD1A 5E3RA 1FNMA 4BDPA 3B82A 1SUQA 3FZBA 2IHR1 2J7UA 3IBWA 4OZLA 4LSLA 2XWXA 3HJVA 2QO3A 2UUCJ 1JJHA 1T9TA 2YKNA 4G1IA 1WJ9A 1TKDA 3B4MA 2POKA 1G2EA 3PW0A 3DRSB 2FYXA 4ZPWR 1KHVA 5KG7A 1WG1A 2VG6A 2L41A 1BQNB 5IM0A 3IBFB 3MR3A 2GS8A 4OLOA 1U1QA 3F73A 3DOMA 3D28A 4KV8A 4LRBA 1MWYA 3QQCD 2LXFA 4J37A 5KFYA 5I4MA 1SJFA 2HIYA 4ES3A 4OI6A 1HNWJ 2B9EA 4K5RA 1N36J 5ETTA 2IYGA 4AL5A 1BLUA 5A6PA 4DFPA 1RBAA 1X4DA 2MKYA 3ILLA 2ERRA 1FERA 3KG1A 3E3XA 2AHOB 1IBCB 1SKRA 1AYEA 3NWGA 4P10A 5AE3A 2Y0SD 1F9FA 2BXJA 1BWEA 8ATCB 1CC8A 4EEYA 1RA7A 2HHTA 4USKA 4KYZA 3DFEA 3O6QA 3LW5C 1NRKA 2L9NA 3CF5Q 4CO3A 5HSPA 3PCOB 4RW7B 4ECWA 2P8IA 3ZZRA 4NZ7A 3CWJA 3T9ZA 3GZ7A 5GVQA 2JHEA 5HMYA 4MK9A 5KFJA 3G8QA 3SV4A 3ZZPA 1EKRA 1RCXB 3O5TB 1RAFB 1UVMA 5HBMB 1H3DA 4MFBA 3FBEA 4JI2F 1BQMA 3GJSB 2H51B 4DPOA 2QSFA 4U95A 1RDRA 5H9EJ 3BGRA 5GAGI 4QCLA 4CLPA 4JI1F 4F4AA 1GAOA 3L7OA 1JB0C 1DQ8A 2U2FA 2E7WA 1F9EB 4YY3F 1KDNA 5HANA 4FNHA 2KFNA 4FYYB 1DHMA 3CDBA 2B4OA 1IKYA 4LRAA 4KSEB 3PKYA 5M2RA 1B3TA 2OIHA 1JXVA 5B0BA 1C1CA 1SV5B 1EP4B 4IOCQ 2QEXS 2ZM6F 4DR6J 3A1YG 3DLEB 2IVYA 1QAJA 1AB8A 2ZH9A 3K7RA 2E9TA 4U7UD 2RS2A 4QYZJ 2DO4A 3LGHA 1JQGA 5CHCB 1R89A 2FJEB 2B5JA 1Z4UA 2BA9A 5HP1A 4ICLA 4PXBA 2HNZA 4KIAA 2HFUA 5ETMA 3H2VE 3JAMY 2R4FA 3NGRA 3RAXA 1T8EA 3IWLA 1Q79A 5KFEA 2ZFHA 1EKSA 4RW9A 2MJNA 2R8HA 3RR7A 1PBAA 2RMLA 3ISND 3BGLA 3MEKA 4IRCA 3QSIA 2V2KA 4A8YA 1M5OC 2BOAA 3ZNJ1 3DMJA 1CQNA 2F8MA 2WONB 3M8PA 2I38A 1OS5A 1T7PA 1VRTB 1FD2A 3CJKB 2DR9A 2F8HA 3KUHA 4LR8A 2OAUA 3TW0A 2RDJA 3T19A 2JC0A 1NK8A 2DNQA 2GC8A 2CUYA 4X65F 1QVGR 3U1MA 5DGBA 3BYPA 3GSIA 4FNIA 4DPUA 1XNRJ 2M0GB 4NZ6A 4MYUA 1L3KA 1ZM3A 2JEFA 3PW5A 2Z2ZA 3FEYB 3UFCX 4A8FA 1U1NA 3CJ4A 1FKOB 2CG8A 1RWUA 3JYTA 4QPTA 3ADAC 2VD3A 1FRXA 4HTJA 5E7OB 4YDDB 3IGVA 4K8RA 2ZJRQ 1PSDA 1M0SA 5KG5A 3ZC4A 3NS6A 5C24A 9RUBA 3LGNA 4PYAA 3J7YU 4HI2A 2QMWA 5KFLA 5U47A 2AEFA 3J80U 2YKMB 3NMRA 3V5RA 2KT5A 1G6BA 3IG1B 1U1PA 5IFMA 2P6TA 1O51A 2L9DA 3QJJA 5HK4A 2FVCA 3M6WA 2CJ9A 4ZVEA 2WSFC 2ZZNA 2HS0A 4NRUA 2RJZA 2ROPA 4OX7A 1GNKA 3HVAA 2IDLA 2OPSA 1N34J 4D3GA 4YR3A 4DV1F 3SFGA 4WTYA 1UJ6A 1TAQA 3V2UC 1U8SA 5FD1A 3FQKA 1SH3A 2UU9F 4OJ3A 4JI4F 1HLWA 3MZIA 4LF6J 4KKOB 3M1VA 2A1BA 3MMAA 4F4XA 2W2OP 3VR1A 4QU6A 4P74A 2HURA 4J90A 4NE9C 1R0AA 3PM9A 2AJFE 2KXHA 3RYLA 4GRSA 1F3FA 3EDRB 4Z7CA 3HHLA 4UOCA 1SUQB 1YRXA 4LSLB 4F0KA 2KU7A 2C2RA 1P6TA 3M32A 1YKWA 2YKNB 1JLBB 1EAYC 3N6NA 4WJBA 2FY1A 1TZ0A 3VTIA 1G1XA 4DWIA 2VG6B 4ZJQA 2DNMA 1U24A 4P72A 3DOLA 5JVGQ 5KFFA 1REVA 1GTEA 4NCAA 1KNZA 5IM0B 2OUGA 3DOMB 4RU2A 4BS2A 4KV8B 4ID5A 1H6KX 1Y9OA 5KFZA 2LQ8A 2X1GA 3GSDA 2YPZA 1D8YA 4QW8A 3HKWA 3ZZUA 1B7YB 1N5YA 3CCQS 2D3O1 1SH2A 2LFVA 4B3RF 2FC8A 3RB3A 5J1PA 2R2TA 1TUVA 5EN1A 1D9DA 3D1QA 1F5BA 1HWKA 3R1LA 2V63A 3QBCA 2XGQA 2H54B 2QSWA 1VQNS 4DCJB 3L9ZA 3RB4A 2VA3A 1RAIB 2WHOA 5KFUA 1RHJB 2AX0A 3UN3A 1NK7A 3F41A 1X9WA 4WP3A 4A8OA 2PFFB 2RILA 1IM4A 3DLJA 4W98A 3W2VA 4LF9F 4ZN1A 3RRHA 2H5IB 4HYKA 5HVGA 4KGZB 2IYIA 3KJVA 5MLCV 2DGTA 2IAJA 4YHHF 1OSCA 3HD2A 2HBQB 1RT1B 2E5GA 2FVPA 4WP9A 5CYQA 5J1NA 4MFBB 1BQMB 2CPJA 1N0VC 3FQLA 5D4LA 4DV6F 3OHAA 3BGRB 4DS4A 4KH0B 1NJIT 1JKHA 1SJ4P 4KT0C 4MK8A 4Q8FA 4FYDA 5E2QA 2N4DA 4I2PA 3H40A 1XMOF 4IYQA 1I94J 2FIUA 1V3SA 4JP8A 3PRBA 1U1RA 4BC9A 2ZHAA 1IKYB 1I5OB 3H2LA 1X8DA 2BE2A 2MKIA 1J5OA 2FD2A 5BXIA 1T3OA 1ZZNA 4FF1A 1FHTA 2GAHC 1Q8KA 1C1CB 1BWVA 1QUVA 1QUPA 3QLHA 5J2MA 3O44A 5A2QU 3Q0AA 5B0EA 4LRDA 2ZITA 4NMXA 2B5JB 4NWBA 1HNWF 4RBUA 4ICLB 5HP1B 3S6EA 2X51A 3CDWA 3MPDA 2Z57B 1ZA1B 4K2JA 4RW9B 2XC9A 2VKZG 3Q2SC 2HWHA 4J9OA 3TP2A 1RT6B 4TY9A 2XYPB 4DV5F 3GWCA 1GMWA 3FKBA 1NKCA 3DMJB 1XQIA 2ZHOA 3KLHA 1X9MA 1X0FA 2LDIA 1QAIA 2FGOA 2RRAA 5KFBA 3A8EA 4K0KJ 2ACYA 3Q22A 4DS5A 1QD1A 1OJ4A 1ZM2A 2QMXA 3KMQA 4PWDA 1PO6A 2B4VA 4MJKA 2YQ1A 3H5YA 1HBOB 5KFKA 4EYIB 2QA4S 3C6UB 3CD6S 1S72S 4PYDA 1FKAF 5B0GA 4URQU 4R8UA 2XZTB 4B9TA 3JYTB 3BGUA 1OYDA 2NXEA 2MLXA 2DHSA 1T3NA 5C2GA 3QT8A 3D68A 2W8LA 4OX6A 4ZVTB 2J7WA 3DRPA 3PW2A 4D3HA 5C24B 2UUTA 3TX8A 2G0CA 2IJFA 3MFHA 1F5CA 2I9SA 5AJ3F 4DDFA 2KRRA 2BM0A 3EICA 3DOKA 3VALA 2BMBA 1TQLA 2CJAA 4ELTA 1LV5A 4OJHA 1B7FA 5DG7A 5J2PA 2P6SA 4OZ3A 4O44B 3FJ2A 2VPXB 2VBWA 4GMKA 5ETPA 1G7CB 3HMJG 1RWPB 3EGWB 3RZAA 1SIWB 2XSFA 2BDPA 2OPSB 2YNIA 2IY5B 4OYOA 4DL7A 2RVJA 2A6OA 4DQIA 3LGMA 4WKYA 3FVYA 1WKLA 4F26A 2F65A 2XLIA 5DZ6A 5IV4A 2F63A 2Q1LA 2VFVA 5SZTA 2HQIA 3M1VB 4CWBA 3FNNA 3TEHB 3MMAB 2OSQA 1OMSA 5HQMA 2GGPA 3O8WA 1VIXA 3QRPA 5KT7A 1Y0HA 2BJDA 1SC4B 1FWLA 3G2XA 3RU0A 4F02A 1CQMA 4NMLA 1M5KC 5HJXA 3WQPA 2YPYA 4MYTA 3HHLB 2KYZA 4L73A 3SFUA 1T9XA 4Y2AA 4DF8A 4E98A 2B0GA 4I69A 3KK1A 2HAFA 3O2IA 2B43A 1TL5A 3BQ0A 1PYOB 4ZVUB 4PG7A 3W9JA 4BBYA 3N4WA 2ASJA 1DRZA 3PJXA 3OFFA 3W5ZA 2A18A 3MI7X 6AT1B 4WCEQ 2WW4A 3EMTA 1S1WB 4TY8A 1S57A 3L3CA 1BQXA 3NAIA 3DOLB 2IJNA 1REVB 2QMUB 4DV2J 4KPCA 4ID5B 2IBKA 4MT1A 4ED0A 1D09B 4B3TJ 2KI2A 2ZBPA 2HFSA 2LYVA 1N5YB 2VC1A 4YR2A 1OWXA 1H2VZ 2VH7A 5GADU 1VQPS 2W2QP 1MMLA 1RSCA 1KTQA 1VK3A 1U2RA 2MZQA 4U8YA 2I8EA 4F36A 1B64A 3G6VA 3LAKA 3IN5A 1RLCL 4UUWA 2XMMA 4DV4F 1IM6A 1WOSA 3FCWA 3KK3A 2UUWA 2CRLA 1TAUA 1IKXA 1NLKL 4HL9A 3ZZOA 1YRTA 2LKZA 3W2VB 3IRXA 2OEKA 1RTIA 4TYAA 3RG6A 4N8NA 3KJVB 1NSPA 1N34F 2IAJB 2YKAA 1FJ7A 4W90B 3B54A 1BUXA 2ZJQQ 2KM8B 2D1CA 3FCVA 4LBPA 3FK4A 2RHSB 1DARA 5L46A 2XCPA 5CYQB 2HW3A 1YSJA 3FDSA 1QDUB 5CH7B 2CJKA 3BQ1A 4NLSA 1WC3A 1N32F 5B0AA 4YDXA 3BPSP 2R42A 2I2YA 2HSEB 5DQHA 3H4BA 3P49B 1VC0A 1JKHB 1TV6A 2J5AA 4NZ0A 1S79A 1PILA 4I2PB 1ICEB 3UR0A 4PXEA 3SXLA 4Q2LA 1TUGB 1EJ7L 3MMCA 3H90A 1RU1A 3U1LA 4XPEA 4DR4F 3BDPA 2MDAA 4U9RA 4JV1A 5LM7E 2YQ3A 1RAEB 2H9ZA 2D3ZA 3OW2R 3T5KA 4OZJA 3QLHB 5J2MB 3FSIA 3ZZZA 3QGPA 1TP7A 4KC5A 3DLBA 3LPEA 1Y5NB 2HQFA 4NA3A 1OSDA 1WUUA 2AZ1A 1WHXA 3NGSA 4JV0A 4ZLNA 3J81U 4EYHB 1UA1A 2DIUA 3T41A 3AXKA 3C66A 5A8RB 2R7RA 3D1HA 4B17A 3U27A 2XI2A 1T11A 1H74A 2NPFA 5DO2A 4HH1A 3KLHB 3CTRA 3TA1A 4NLQA 4NLOA 1Q8IA 1EIYB 5M2PA 1WD6A 2KT2A 3E01B 3C14A 2R7SA 1FJGJ 1M5PC 1TELA 4H4KC 3T1HF 2DPIA 1N88A 1U1LA 4YB7A 4RW6B 5F9NA 2CQBA 2BBEA 2DNYA 1GT8A 5B0DA 2EFQA 4USMA 3MD3A 4ZPCA 3TA0A 3QT5A 2KVQE 1UWBA 4R8UB 4QWAA 3KUGA 2XM3A 3AQPA 3MEEA 5IZHA 2BEFA 4AQYF 1XBWA 1H2UX 1NPRA 2CQ3A 3HFZB 4OYZA 1LWEA 1CEZA 1I94F 4DX8H 2BQRA 3BH6B 3R7SB 3LP1A 2AEJA 3DRPB 2RUGA 1B0VA 1NUEA 2KVIA 1H72C 1W2BR 3SQOP 4ECQA 1CVJA 1YJ9S 1Y00A 4MKYA 3W9IA 1WACA 5K14A 5C42A 5CAAA 2UUAF 3DOKB 1RT7A 3WBZA 3HF5A 4FF4A 3OXFA 2BX6A 2DVIA 4DUTA 2E44A 2HZVA 3TOQA 5J2PB 2KJWA 1VIOA 1RAGB 2V4JB 1S0NA 1IKVA 2UXBJ 4NCBA 1HNVA 3BO3A 1OIAA 1PJ5A 2YNIB 3OLAA 3VAHA 1TK8A 2DR5A 4CCHA 2CDQA 3AFGA 4PWWA 4ES1A 4KGXB 1HNZJ 3HO1A 2UXCF 3GYNA 5DG9A 1BD6A 2NYIA 3CDUA 2EBGA 4G3IA 3EZ5A 4X84A 3QZ7A 1RJJA 1HI0P 2RKIA 1BC6A 4LF8J 4ED8A 1PG5B 1S9GA 4YEAA 4RNHA 1ZTTA 2DNGA 3GPAA 1DTQA 4K0KF 4ED2A 5E3QA 2PO4A 2KHDA 1QY7A 1JLFA 4ZITA 4JB8B 3KLGA 2HWTA 3I96A 2OTLS 3KK1B 4OZNA 4R25A 1AZSA 3DHXA 3TVKA 4DQPA 2HZCA 1NSQA 3QZ8A 2FZCB 2GQQA 3HHEA 1NSKL 3NLCA 2LXUA 1NM2A 3OBIA 1TFYA 4TY8B 4I0WA 2M9KA 3FCHA 4IO9Q 1W25A 1S1TA 2EXUA 1XTZA 1X5SA 4G1QB 5HJYA 1GMUA 3ETMA 4UOFA 4DPTA 2OELA 2EFOA 3M2VA 1RAJA 3PFOA 4ED5A 4DX5A 2R7XA 1FDAA 2PI4A 2M5YA 2VA2A 2MHNA 4DR5J 2HQCA 1S97A 1T03A 2LMIA 2HFNA 4GVLA 3WZ0A 2I1RA 2NLWA 4K2XA 2DNZA 1TUWA 1Y3JA 3NGDA 2XB2D 4O4GA 1U47A 2NUUG 1UCNA 4HVZA 1IKXB 1M5SA 1Q82T 3PYFA 3MCMA 4RKUC 1IBKJ 2G13A 3FBCA 4X4NA 1RTIB 3P6YC 3NG8A 1IR2A 2FJDB 4MAKA 2YNFA 4B9NA 2BJ9A 3R9LA 1F60B 3TI0A 2Y3YA 3AXMA 2X1BA 2DGVA 1DZ5A 5D3GA 3GTYX 4USJC 1Z1ZA 2MSTA 1SL0A 1VBXA 5L9NA 2Q3PA 1L3TA 2BM1A 5CYJA 3G82B 2XZWA 5D15A 3CCMS 5LJ3Y 1TV6B 4C2MA 4C8OA 5KG2A 2YKQA 4DL4A 2P5VA 4Y34A 3GG0A 2ZUAA 4K7QA 3QGHA 1XC9A 3MMCB 3GIKA 4DQQA 1ZS6A 2MKCA 3K5LA 4X4SA 1TKZA 5JXSA 2MHEA 2GVZB 3PEHA 2GMJA 4QZVB 4QR2A 2ALZA 2DT9A 3ILIA 1MN7A 4UQTA 2HRUA 3THTA 2VFTA 1R31A 1JXEA 3ITHA 1UEUA 3GV7B 2AYEA 5E33A 4ZPTR 3TAMA 4DV0J 2MJUA 1FNXH 4CTAA 3G6YA 1Q7YT 2EC2A 1NCLA 2J9EA 4Q8EA 1ZZFA 3RJMB 1SJ3P 1RCOB 2QL5B 4Q2MA 2A3JA 3HSGA 1LK7A 2UP1A 3VHQA 1L3UA 1FXDA 1WKJA 1P27B 5CQGA 2QC3A 3QIPA 5ADZA 3DC2A 5F8MA 4Q7AA 3QT6A 3GP9A 5KFPA 3PYEA 3C14B 1B0PA 2AJQA 4DFMA 4X62F 1RP5A 1JXLA 4EO6A 1K0VA 1VCTA 1UJ5A 2VC0A 5JVHQ 4QW9A 3C16A 1FNOA 4EK2A 1D0EA 3QIDA 3ILOA 1FX2A 3M8SA 3HK2A 1RQ0A 2LQBA 2PMWA 3D0HE 3A4TA 3MMJA 5EX0A 3LP0A 4RL1A 4WYWA 1GFWB 3IM9A 2NR0A 2C42A 3MCNA 2R7VA 1OY8A 3W1YC 3CCES 3FSXA 4RNNA 2LLZA 1JJCB 1G3OA 1FRMA 1X4BA 2KXFA 2V5HG 6FD1A 3P5TL 3MEEB 2CKWA 1M90T 4FXWA 2LCWA 4FS2A 1HHSA 2YXLA 3CC4S 1XMBA 4LT6A 1LWEB 3WDOA 2Z0GA 1L5UA 2OEMA 2KHCA 3LP1B 5HQ8A 4NRTA 3EVMA 1H0HB 3V81A 4B3OA 3J7A1 4LFCJ 4KGVB 2AZ3A 4OV6A 1TKXA 4WFZA 3K2YA 5KG0A 4CM2A 2K3KA 1EZZB 1RT7B 4XO0A 1SKWA 5MAOA 3M30A 5KFOA 4NCGA 1YBTA 4J9VA 4X4OA 2B3TB 3W5XA 4ZCLA 4YB5A 2VONA 1IKVB 3D6MB 3IGNA 1U25A 3CNQP 2ZH6A 3UCZP 3CCLS 2FVSA 1HNVB 4KTQA 4P2SA 3MPWA 1C4AA 2NXNA 3THVA 1HI8A 5LMUJ 2AF6A 3HDSA 2FLOA 2J0WA 3R8YA 4DG1A 4K4VA 1Q81T 1RBOB 1U45A 2XMUA 4ZOSA 1KQSR 4GKKF 1M1KT 1LEOA 2RKIB 1S9GB 1VQLS 1NO8A 2I5JA 1VQ6S 3EXYA 3OL7A 4AE5A 1DTQB 1FJGF 4IQMA 2PA3A 1JLFB 1RWMB 4CT9A 2GW8A 5DLFA 3JTNA 3KLGB 2DH9A 3I9V9 1WC1A 4A8MP 2YY3A 4X66J 2W4DA 2H5EA 2B7CB 2RAQA 1T0TV 5F8HA 2HNYA 3GIMA 2EPIA 4FP9A 2KTQA 1S1TB 3H20A 3R5BA 3W62A 1VISA 2GIQA 1S1VB 4AL6A 5BYRA 1OY9A 3M2VB 2KO1A 3N9UC 2OMLA 1QJHA 2IRXA 1UPMB 2UXDJ 3NKYA 1XNQJ 3NBPA 7FD1A 1YBAA 3PTWA 3I55S 2O66A 2Q66A 1F9HA 2ROGA 3UDVA 1Q95G 2DCUB 1HBUA 1T03B 4Y2KA 2GCFA 4V19J 3RUBL 4UT4A 5IT4A 3NNHA 1X4CA 2DH8A 2BANA 2ZBQA 1Q7LB 3MCOA 3VQSA 4B3MJ 3JAMU 1FDNA 5FDLA 2FLNA 5IT9U 1CJUA 4O4GB 1RWXB 2I0XA 4Z2XA 4Y2IA 2Z4PA 4ETZA 2DB1A 1T9WA 1X4EA 4TLQA 1MMDA 4PQAA 2UXBF 4IOAQ 3TAQA 3VZHA 1LW2A 2IRYA 3ILJA 4C8ZA 2GZOA 3LO3A 3TJAA 5HQLA 2E29A 3JS9A 2D7SA 2D74B 2XMJA 2H1YA 1S0VA 1O5JA 2N4CA 2R8GA 1X7VA 2M52A 3TZZA 1GX6A 3TO8A 1WC0A 5D3GB 3MUTP 1TFWA 4RNOA 1NK5A 1FXRA 4B9MA 2B8PA 3HHNB 2MLZA 1B70B 1JJ2R 2PC6A 5LL6d 1VR6A 2RIJA 5D4PA 2MTLA 2FHJD 3D67A 3IO1A 3QJLA 4FXVA 1WG4A 5LSLA 2ZE2A 4ECYA 2HVZA 2CQDA 4LQ9A 2C2ZB 2ABYA 2AMCB 2JOQA 4F4KA 1P8GA 1TKZB 2MQMA 1R27B 3UE2A 1FRIA 1CC7A 2NSCA 2V8PA 2HS4A 3RAQA 2MQQA 2MKSA 2HBYB 3T9NA 4NI2A 4O3RA 4WIIA 1SIZA 2MKKA 2FHMA 2G0IA 4F2SA 2OSRA 2AQ4A 2GIRA 3JXOA 3ITHB 1ZPWX 2DY9A 3KKFA 4Y3CA 2EKYA 4LF5F 1HWJA 3TAMB 3MM7A 3CUNA 1UTAA 2QFIA 4CTAB 2CNKB 3CO0P 1MNEA 1UVIA 4RWXA 4DUYF 4DR5F 1PYTA 2IM3A 4XDDA 4JI2J 3OL9A 4CDIA 4YP3A 1I3OB 2QV6A 4YS2A 4JI3F 3TUZC 3JSMA 1WWHA 5K8OA 1M1HA 2VDHA 3QIPB 5CABA 3S1TA 4AFFA 4P52A 4JI1J 1U1MA 1TMJA 5ETLA 2ZH5A 1RYSA 3NWRA 4WFYA 2NUHA 2ADCA 2BW7A 1WSRA 3QFWA 3LQVA 2XO6A 2R7WA 5DETA 4FYVB 2OD4A 3AJ1A 2ASYA 3A3PB 3C16B 1WOOA 3DRSA 4N47A 3PW7A 1RT5A 3MHYA 3US5A 1NK0A 1EX8A 1BQNA 2H3EB 3LP0B 4KE5A 3MCSA 3RB0A 2JZ5A 4L76A 1SQFA 4S0MA 4OLPA 2WRMA 3J7AN 3VGVA 1WHWA 3LAMA 2OPQA 4K59A 2MZJA 1R43A 4I64A 1QSLA 2X7IA 4FDFA 5THWA 5F9LA 2K7KA 2PEBA 3CJ5A 4UQGA 2FUG9 1XJWB 4JI8F 1UVLA 1S1XA 3CCSS 3CCRS 1X4AA 1F6TA 3SQGA 2MZ1A 1NHUA 5D0HA 3V81B 3PRDA 4B3OB 4DR7J 3PX6A 3GCWP 4H4KA 3IMQJ 1TKXB 4J9SA 1QLNA 4WYLA 3BR9A 4AD6A 3M8ZA 2XYHB 3F56A 2H4WB 3EVWA 1SJRA 2PD1A 2OPPB 2N82B 2WVCA 2O67A 4X4RA 4HH0A 3GYXB 4X65J 3ETOA 3QWUA 4DPYA 4DBQA 4TLRA 2KYXA 4NA2A 3TUIC 1JX4A 3R97A 1S6QA 4DI6A 3ENQA 2E5JA 3BYRA 5H1SV 2D3OR 4OYIA 2VASA 4DG1B 2VQEF 1S0MA 2OEJA 5EX3A 4EZ9A 1RT2A 3OHBA 2Q43A 3FEZA 2M3DA 2VFSA 4Q45A 4GC6A 5HROA 4K4SA 5D78A 3NCQA 5CZXA 2LQJA 2BW2A 4B3SJ 2HMIB 4KY3A 4YR0A 1RKJA 2HHSA 1FJCA 2F9JA 3PX0A 3UN2A 1F5AA 1NHVA 3Q23A 4RW4A 3IR7B 4RPFA 3KG4A 3AD8C 1SV5A 2OGUA 3BBCA 4O4RA 2YKPA 5KT5A 2FQQB 3R2DJ 2C3PA 2B9YA 1T94A 2GIFA 3CJRA 2RF2B 4NLWA 2GQCA 1FD8A 1U02A 2F4VJ 4ERDA 1HBNB 4ECXA 2V2VA 1KVJA 1R8HA 2CJBA 3SIPB 3HP6A 3WIVA 1K1SA 1PJ7A 2Z2LA 3K57A 5KFHA 5KFSA 3NBPB 1TU0B 2WBMA 4JI4J 1JJ4A 3FUYA 2ZVSA 3OD2A 1HBUB 1IXKA 1BXNA 5RUBA 3PHEA 3I5BA 2DRAA 4PXCA 2LEPA 4JUZA 3SYZA 1CULA 3IM8A 4UZCA 3R5AA 5F8JA 2NREA 4ZVQB 2J7KA 4OFZA 3KLIA 2CPDA 1CJUB 4K4XA 2P9GA 3D66A 4FBUA 1CLFA 2W7OA 4C8NA 2ZC3A 1RE1B 1HWIA 1OO0B 4DV3F 1LW2B 5CCLA 4M94A 3CCUS 2NXJA 3BGOP 2N3LA 1RXOB 5LMUF 2RDDA 3R27A 2YWFA 4CIOA 1UW9A 1VRUB 4ZDNA 1HHQA 3R2CJ 3K17A 1FKOA 1WDDA 2EI5A 2DO0A 2E1CA 4DR3F 2VQFF 4Q5VA 3GV5B 3ZTRA 4GKJF 4DSKA 1KOHA 3H7HB 3PJWA 3PVXA 2HNDB 1H38A 4ZS6A 2V94A 1U1KA 3EGZA 4B3RJ 3OV7A 3NL0A 1WNEA 2HHVA 4F04B 2ZE2B 3NMAA 3MAAA 2K1RA 2ZH7A 1DLOA 1XR7A 5EUHA 2CQ4A 3IG1A 3ZNUA 2EBEA 4FVCA 2LEBA 3S01A 4FKXA 2A2CA 3PZPA 1FEEA 3HVRA 2QFJA 3BQ2A 5BJRA 3PO5A 5DLGA 3BO2A 3SCLE 3W2WB 1QE1B 3MM8B 4PKDB 4M5HA 5IXUA 4DR2F 1VJWA 4YHHJ 3B8HA 3KG0A 1VLYA 2W1BA 5L9XA 1DQAA 1TVRA 2DRBA 1ITPA 1U2FA 1GXUA 5D0GA 5HMXA 1NPKA 2G0JA 1N6QB 2LU1A 3AB4B 3M2UA 5IV3A 3FGVA 3PXGa 5KFXA 1B99A 2ZH4A 3MPYA 4ILMA 3CSKA 3K8WA 1UMJA 1XMOJ 2ZZMA 1S77D 3BSNA 2GHPA 2GV1A 3HULA 4R0EA 5L1JA 1KD1T 1JK9B 4M8LA 4JBCA 2DJWA 1JLBA 1T9YA 3L7UA 2V8DA 4IOBA 5D0EA 4CLFA 2CPEA 2F9DA 1NB7A 4UZBA 4WFBQ 2M7SA 4A8XA 1FJEB 1IQZA 1UWAA 1R8BA 1RT5B 4EWTA 4ZP6A 4H4OA 2J9DE 2XMKA 2W7PA 4WTOB 4X4VA 3CPWR 2M8HA 3H5UA 2YWGA 4ZMMA 1H2TZ 2OPQB 1UP1A 4G1PA 3NP5A 4DQRA 1U6ZA 3KLFB 2VOPA 1HA1A 5EHHA 5EDWA 2E1PA 2B51A 1S1XB 3M6XA 1FRLA 3ZO7A 1OPZA 3SQGB 5BYQA 4ALZA 4DV5J 4OYAA 2F3JA 4ZN3A 4KR0B 2CA9A 3CJ0A 1U4BA 5HVHA 3EZUA 4ZVHA 4XAKA 4Q44A 4U7UK 3HPOA 1Q78A 4F7VA 5DDPC 2R9LA 1URRA 3CJ2A 2RQCA 4CH7A 1DJ0A 1BGXT 1RT1A 3PACA 1UZHA 1KWMA 1YVFA 4TU7A 1N4LA 3M8WA 3Q8QB 1EB0A 2BE9B 2XMAA 2PN6A 5G0RA 4AYBD 1IQTA 1VBZA 2P2CB 2DY1A 4DN9A 4HHUA 3GYGA 1S6QB 5B0FA 3CC7S 2IIHA 1KVKA 2ZNZA 3H8YA 1RT2B 3KJQB 2UUBF 4G6VB 1SXLA 3UWTA 1PBUA 1T02A 4USHA 4KJIA 3BKUA 5HROB 4Y2CA 2CJYB 3Q8PB 2Z30B 2Y0BB 4DV7F 3KDNA 1N48A 4Q0BB 2CPZA 4MTPA 3N0VA 3SEOA 1E6YA 1N5VA 2XWYA 4QIVA 4ENOA 4RW4B 4LF2A 2P9CA 2ALYB 5AJ3J 1OQ3A 4Y65A 4KHPF 3M8RA 2RRNA 2PEHA 5IT0A 2OI2A 3Q89A 2KG0A 4NLXA 1CG2A 3NRBA 5JMNA 1WKKA 3EUNA 3J7ZT 1YDLA 1RUSA 4M63A 2G2YA 2Z8QA 2DGUA 3J81j 3M9NB 4KRWA 4I7FB 5IT9Y 3T5JA 1YLXA 3LF0A 1U6FA 4CLTA 1RT6A 5IWAF 2HHHF 2UVRA 1AFJA 3N79A 1L3SA 4DR7F 4OI4A 4KB7A 2CZ9A 4A8KA 3DRXA 1RB0A 4TN2A 1VQYA 3KMSA 2AKWB 1JLAA 1CULB 2C28A 4DSFA 1UFLA 3TVYA 2COLA 3D6TB 4Y6IA 4M5GA 3KLIB 1R8PA 1IN0A 3GJQB 2ZNYA 3ZZYA 4ZP7A 4I6WA 4HR2A 1X4HA 4XPCA 1KSPA 1FFGB 3I0SA 3DXBA 4CH1A 2BOPA 4IKAA 4DN0A 2HAIA 5KG6A 2CQGA 2OPRA 1HBOA 2HPUA 2QIFA 3C6UA 5DDOC 5D0RA 5CA5A 2HHUA 4HLBA 1KR4A 4EBCA 4Y00A 4YMEA 4Q43A 2XLKA 5J2NA 2FJAB 1FO1A 4QYRA 3VZIA 4ZCIA 4F4WA 2F1FA 1X31C 3Q2TC 3MAQA 2UV8G 4PZVA 4B3SF 2XS2A 5GAHU 5A8WA 2GO8A 1LW0B 4ITSA 4O3PA 3BB5A 1CJTA 1RI7A 3MAAB 2K1RB 2L08A 1DLOB 3D1OA 2AP6A 3IA0A 2ZH3A 3UCGA 4CO2A 4DV4J 1JLQA 4N77A 2RRBA 3QT7A 2DYAA 4O44A 4Y2MA 3PFEA 1OY6A 5AXMA 5KFRA 3DN9A 4L3NA 5DGAA 1LWFA 2FHOB 3BM7A 1KLNA 2F4VF 3HSDA 1TKTA 3CVKA 3AD7C 4CLWA 4OYBA 1TL1A 2IBOA 4EFAC 1ZM4A 2QA2A 1HHTP 3HVTA 4RWWA 1TVRB 2HS3A 1VI7A 1VQ8S 4IQXA 3OQ2A 2EC0A 2LQ9A 2HIQA 2XI3A 2G9OA 1N32J 4DSIA 1VJQA 4N8OA 3R5CA 3J7Z5 3M2UB 2XHWA 3BKFA 3PO4A 3KUEA 4IG0A 2AD9A 3C8YA 3E2EA 3MM9A 1HIYA 3V4MA 2HRTA 3UD5A 4MMOA 2A2DA 2ZWOA 1HW8A 3IXQA 1FRJA 3OFHA 3F44A 4IR9A 2DEJA 1HR0F 2WB4A 2VICA 1QSYA 4DR4J 4WK1A 1N52B 3ET6A 1S1WA 3HJFA 4H4OB 1NK9A 1VQOS 1KOOA 4LF4F 2BJ1A 2W24A 4ZIVA 5T41A 2DGWA 3IC1A 5EWFA 2WBRA 3MWBA 2YWKA 4E0DA 2H48B 1FVQA 2UV8A 4ZPAA 4PR6A 4YOEA 2BKNA 4TXSA 1KFDA 1T9UA 3JB9k 4K4ZA 4GO7X 1WEZA 1N54B 2WVDA 4OHZA 2Y1LB 2J76E 3NGTA 5GAEI 1P1LA 4DCOB 2HFZA 2WVEA 1RU2A 1VK8A 2VPYB 3A8IA 3R7BB 1F3VA 2O5DA 4QOTA 3CJ8A 4L75A 4FPRA 1UFKA 3BJYA 5LXRA 5C25B 3MEGA 1JMTA 3HHDA 4CO1A 2DH7A 1RWKB 4PUOA 2OP5A 4ECZA 2KXNB 4QR0A 5K8MA 4LFAF 1N5SA 1P9YA 3H25A 3N28A 4ATNA 3T1HJ 3RBXA 2CQCA 2HRYA 4ZJOA 1JLCA 2HVIA 2JEGA 3GV8B 3OTDA 2R8IA 3JTOA 4ETXA 4CLUA 3RRKA 2DNKA 2GJ2A 5G0RB 2VU5A 4BWJA 2DKOB 4CZCA 3K5NA 3CIZA 4DFJA 3VGSA 4QQBA 4LBHA 1RTDA 3DDKA 3SBMA 3JSBA 3KHGA 1J5EF 1V3RA 2V34A 4FPIA 1FTCA 2C3OA 2J8AA 3CO9A 1SI9A 2PGCA 3KTQA 1I51B 3Q8VA 2J6UA 3DRRA 4AQYJ 3LALA 1UEVA 3MR7A 2QA4G 2M4MA 1D9FA 3IS9A 2E1RA 5KFIA 2M8DB 3OVBA 3JQKA 4C97A 1SL2A 3KLVA 2YNHA 3K5MA 1E6YB 3AAWB 4O3OA 4RR5A 4PCQA 4OL8A 2BKPA 3AD9C 4DPXA 3KJFB 3KLEA 3V6HA 2UUAJ 3Q8UA 4JV5J 2OJ3A 3KHHA 3JQMA 4RUCA 3LA0A 4C3MA 2V4QA 3R1HA 1Q5VA 1VC6A 5L38A 5KG4A 4B9UA 4IDKA 3CDAA 1QAXA 4UW2A 5K8NA 4LSNA 2BJ8A 3RW7A 1VRQC 5I3QA 3QO9A 1H98A 3LUYA 1KHWA 2V9WA 2QL9B 2X1AA 2HFOA 2UXCJ 4NEZA 5A8RA 3SDEA 2FDNA 4CNYA 2ILYA 2J0QD 2BE7D 4IR1A 4OV1A 2DNRA 5E3CA 5BR8J 2XNRA 1JLAB 1FTRA 4BC7A 1PIEA 5KOXA 1HYSA 3LPYA 3E01A 1CS4A 4JYAF 2J0XA 4RW8A 1ZTWA 5GAHI 3AHPA 1REGX 5K20B 3Q86A 4RW6A 2Y8WA 2R7OA 2VBXA 4QIWD 4P2FA 1BE4A 1RADB 1NPPA 2K7JA 2R8KA 2B6AB 1HWLA 3I0SB 3SMZA 3G96A 3HZEA 1IBMJ 2Y9HA 3H4DA 1WELA 5KTQA 2PIIA 1AW0A 1PCAA 2OPRB 4OIXA 5D4OA 3VGUA 2AJ1A 5HI7A 3NCPA 3HI9A 3PW4A 5LXYA 3D0GE 5FLXU 4H54A 2R7QA 4JOUA 2EG2A 5J2NB 4IRKA 2L3MA 2WSEC 3UI3A 2HHQA 3TA2A 3QWPA 1FWKA 2BKOA 1ZM9A 2CFXA 2EWHA 1UJ4A 2Z2MA 3Q83A 3HHLD 5A8WB 2QTWA 2W2PP 3NNCA 4DU8A 2ZWPA 2NZCA 3I32A 3QNWB 2VDIA 1CJTB 2HKEA 2WVFA 1SKUB 5IS2A 1RTZA 3MEDA 2Y1JA 2F4FA 5EGYA 5ETSA 2DPJA 5I42A 1JLQB 2VBZA 4C8LA 1UETA 5L8RC 3OL6A 5JUMA 3LP2A 3KJNB 2E7VA 2V4JA 2U1AA 4LVOP 1LWFB 4LJMA 3LH2S 2GA7A 2PDAA 2FLPA 1TKTB 1MU2A 1OQ6A 3TUJC 1TL1B 1U48A 4O3QA 4W92B 2XMTA 2DNNA 2W9BB 1K1QA 3HVTB 2FZGB 1ROFA 1R0BG 4X4QA 1KLMA 2HHPA 4YN3B 3VV2B 2QLJB 3WC0A 4J9PA 2LP4A 1XN9A 3VCDA 2QL7B 4RO0A 2YTCA 5J1EA 4DR1J 1SJ1A 1F2HA 4IG0B 1B4SA 2YVSA 4CYUA 4EBEA 4DHVA 3KOAA 3MM9B 2ZD1B 1S59A 3D5MA 4CO4A 3OXGA 3TVZA 3T1YJ 2VODA 1X4FA 4RNMA 3I9ZA 4DZ6A 3RBZA 1YITS 3ET6B 2OLWA 1Q8LA 3W5YA 5T7LB 3BBBA 3HX9A 4G1QA 3T5LA 1VQ4S 4M95A 3LANA 1NSAA 1BMQB 3OR2A 2AV5A 5CYMB 5IOLA 2KZZA 4NLRA 3HVWA 2O3DA 4TKTA 5A6WA 3C15B 3SV3A 4DOZA 1YJTA 2MZRA 4ZP8A 5M2UA 1ZA2B 1RYRA 4DQSA 4CI0B 4B9VA 3DHWC 2ZH2A 4WU2A 3SI8A 3T6JA 3I4HX 4MH8A 5ETNA 2V0NA 2BJ3A 1S4EA 3I6PA 4P7VA 3MEGB 2XS5A 2E1AA 3AY0A 2JWNA 4IFVA 4KH1B 2DGQA 4PUOB 2W4CA 1FFWB 1HKAA 4X62J 2ZBIA 2GX8A 2KH9A 1UVNA 3K5OA 4ID8A 4AXIA 1JLCB 2MQOA 1F0XA 3KHRA 4PABA 5CXTA 1M1GA 2J9CA 4USVA 3LTOA 4LFBF 2DHHA 3CJTA 2EK1A 1S0OA 2XY7A 3M8YA 2R2RA 2K2PA 3CCJS 2E1MC 1U6BA 3V6DA 3MURP 1GQEA 3M05A 4EUVA 3KWMA 1GMWD 1WC4A 1T95A 1RTDB 5HVFA 2RB7A 1LQ9A 4YB6A 3G82A 5F8GA 4BCAA 1X5PA 4PG6A 2WOMA 3DRRB 3NAHA 3EZOA 1VS3A 1YJWS 4IH5A 3IS9B 1KKHA 4DJBA 3W65A 5AE1A 3HCXA 5LOQA 4QIGA 2YNHB 3MPVA 3NS5A 1YZ7A 4ZCKA 4KO0A 3KLEB 2JL9A 2GVZA 2F40A 4N5SA 1NH7A 4WZQA 2B8QA 2KDOA 1ELOA 2LA4A 3OXLA 2QN6B 1LNQA 4OHXA 2DD8S 2JLEA 1HARA 1QM9A 2HBZB 2V8GA 1P9QC 2DGSA 4J5OA 4IDKB 3SSSA 2AIRB 3DI6A 4URGA 1V5IB 4ANEA 1HQUB 4PEOA 1UPPA 4LSNB 2QRRA 2BV3A 1UFWA 4I56A 4NLPA 3HSZA 3ONQA 3QO9B 3AOCA 3PJ9A 3GFHA 2H4YB 3V4IA 3EYZA 3SDEB 5KFCA 2F7VA 4DL5A 4GKKJ 1SC6A 4OHWA 5E41A 1HFEL 4C48A 2D3UA 1VLOA 2XZDB 2HVDA 2APOA 1HYSB 2E5LF 3WIUA 1IKWA 2JJ4D 2WB1D 1CS4B 2CYYA 2YWHA 4OI3A 1RABB 3I87A 2FVQA 4RW8B 5L1KA 1WI6A 3AJ2A 4A46A 4X2BA 1NB2A 5IC4B 2VZ9A 2MQLA 3HM9A 1OPIA 3VF0B 1Q4RA 4ECRA 1CJKA 3BH7B 5D4NA 3W3SA 3EWGA 3W61A 1YI2S 3MUVP 3SCKE 3GLJA 2EW9A 4DUZJ 1WF2A 2ZH1A 4NOHA 3MFIA 2RQ4A 1FRHA 3ZZTA 4ED4A 4PXDA 2BACA 5KT3A 1SL1A 3CD5A 1NJYA 1ZOTA 2QLXA 2EK6A 3A3NB 4WBFA 5F8LA 5E5NA 1K47A 3DDNA 1GMVA 3WX8A 2E5IA 4FN5A 2XSJA 1RT3A 1S7IA 1NZAA 3DLGA 4F4ZA 1C2PA 1QVFR 3CE8A 1FCAA 3OTCA 2VG5B 2X3DA 2NQPA 2KG1A 2DEIA 1AA1B 3AA9A 3MEDB 5CZVA 4JV5F 2H5JB 1UAWA 4JI7J 3NY0A 3D6HB 1MMNA 3CCTA 1JWWA 2VG7A 3M2RA 2XMVA 3BPDA 5I42B 3P96A 3LP2B 2QX0A 3CT9A 2E5HA 2AJ0A 4KFBA 2QA1A 1RISA 4OYPA 4WZMA 3GIJA 1MU2B 3R5GA 3MD1A 3DU6A 2W8KA 3SZ2A 1K73T 2F8EX 1N8RT 2UVWA 3G6XA 3VVUA 1URNA 2KT3A 2ASLA 1T05A 1LXNA 3BN4A 2DR6A 1KLMB 3AA8A 4OZ2A 4ILLA 3ENVA 2HG4A 4F3MA 4MIAA 3U7JA 4OYXA 5ETKA 3UR3C 2DK2A 5GMKa 5J1EB 1DURA 5EWEA 2CVIA 5BR8F 3THPA 3DLLQ 2V2ZA 1L3VA 3UCUP 2CPIA 4CYUB 5KFAA 4ED1A 1ZAWA 2YNGA 3AODA 2JEIA 3QGIA 4TQSA 3BSOA 4WIQA 1PJ6A 3H0PA 1DAXA 3UQSA 4U96A 1KRPA 2B4PA 1HPZA 4RU9A 4B9LA 4R0JA 1RWWB 1IBMF 5B09A 1K8AT 2JEJA 1WG5A 2IVFB 4I6AA 4FF3A 4OI2A 5LMNF 2XNQA 1E6VA 3GJTB 1S1VA 3EVOA 4L74A 3OR2B 3CGIA 4LF5J 4IUFA 3VAFA 2WSCC 5KOWA 4R5PA 1R8AA 2DBBA 2JRSA 3ZTOA 2WTFA 3H42A 1J27A 5DDRC 1X5TA 1WHYA 1GXTA 4DUYJ 2IDEA 1S1UA 1YGYA 1SJQA 2G4BA 3C3LA 1RHUB 2ILZA 4L6V3 4JI3J 4N7TA 1V9OA 5E3PA 1ZPVA 4XIUA 1S10A 3EM1A 5G4DA 1N5QA 5KT2A 4CH0S 2DHAA 2LDYA 2PE8A 2EVZA 1P1TA 4QWEA 1N56A 1KVIA 1X9SA 4IFYA 4NL5A 4IFVB 1MN9A 1R7IA 1HNXF 1VFJA 3SSQA 1V5VA 1GEHA 3GR0A 2GNKA 2MQPA 2AJ4A 3OJUA 2VB6A 4WXWA 4J9KA 4EGLA 2MQNA 4DLEA 4U8VA 2KFYA 3UPFA 4E2FB 1UA0A 2AEMA 3CDEA 3I82A 1WTBA 5L39A 3V6DB 2HVHA 4TNOA 2HFVA 4LVNP 1NEEA 2C1EB 4F3QA 2B7BB 4C11A 2A0FB 1XMQJ 3OR1A 3DU5A 1JNRB 2CDRB 2WOMB 4WFNQ 4JI8J 4DR1F 2FC9A 4ZPDA 2IA6A 4QJVA 1A6LA 3H2UB 1IBLF 2OFHX 3DKDA 4N41A 3ZTPA 3RTVA 1N33F 3T1YF 3BDEA 3FC9A 4F3OA 3IR6B 3BSAA 1S99A 3OTEA 2GFFA 4DL2A 5KG1A 4KO0B 2GAGC 4EU0A 5K8PA 4J9RA 2HLUA 5KFDA 1Y3KA 3DDIA 3G8TA 4V1Ak 4OX9J 1WSVA 2KL8A 3MR5A 3AQOA 2RT3A 4DL6A 4EBDA 2HK3A 4QIFA 3DI6B 1N0UA 1VBKA 1XR5A 2BRLA 3BS9A 3S8SA 2DNOA 2RU9A 3Q8YA 4ED7A 3B78A 2QT7A 2FGCA 1NH8A 3TYTA 3KDOA 4LUBA 2CPFA 3FBBA 3P3DA 1H7WA 2VQEJ 2FJBB 3V4IB 1SQGA 5B0CA 3IAS9 1K0TA 1JLEA 2J6SA 4ED3A 1UVJA 3QPIA 3LWLA 2V4RA 3PX4A 2NPIA 4NX9A 5KFMA 4OQJA 3BREA 3E51A 5CCMA 2J8SA 1WTFA 2UUCF 1YWXA 5FLXY 1IKWB 1S7HA 1VDHA 8AT1B 3QATA 4DSJA 1A7GE 1WDTA 4K4UA 3MUMP 1S6OA 2RDIA 3CJSA 3A3OB 5J2QA 1CJKB 3AOBA 2KB2A 2ATCB 4DMZA 4ZVRB 3KXDA 1HBMA 3CW2C 4ECVA 2VL1A 4C7QA 3POTA 2EFVA 3HHKA 3UDLA 2NS1B 4OZ0A 1Q0NA 5HMWA 4CM0A 2WVBA 5ETOA 2N3OA 1WC6A 2IM2A 5CD4A 1YRUA 3MPUB 1N36F 2HNZB 3JSYA 1RBLA 4C98A 3NS7B 2ZC4A 4IH7A 3G6ES 3HLUA 3OL8A 2LA6A 3TZWA 2DNLA 2VHGA 1O6XA 2HHXA 2XSJB 1RT3B 3DLGB 2QLFB 3FBFA 2IC3A 2DR8A 4NEYA 1NKBA 5DQGA 1WOPA 5DRKA 4ZP9A 2DHGA 4UF4A 1YTYA 2VJVA 3M8PB 2OHDA 3OFGA 3C2PA 4NASA 2Z58B 3HFKA 2NZ4A 5LT5A 4ELVA 1IR1A 4DXLA 3HSJA 1U26A 3EGVA 1MW7A 3BKTA 2AYBA 1FK9A 2VG7B 2OPPA 3M2RB 2VOOA 4KHMA 5A8KA 3J7YI 2RUSA 1SB6A 4A8WA 2C22A 4OZ1A 3OFEA 2E7XA 4P75A 2VFRA 4KFBB 4QWDA 4DV3J 3PIPQ 2IA0A 2IPOB 2W7AA 4ELUA 3GQCA 3N6LA 1Q8BA 3WX4A 2CADA 1Y4ZB 2N7CA 3MMBA 1T05B 3VVTA 1NU4A 1D9AA 4M1KA 4DR3J 2VQFJ 5C5JA 2PFDA 1UKUA 3EJMA 5AXKA 3BGFA 2V69A 4GKJJ 3FFIA 4KGMA 2Y1IA 2RH3A 2ZBRA 1HMVA 2VV5A 5H9FK 2HMIA 3SSRA 2MSSA 4C0OC 1WI8A 5A76A 1R8CA 2YNGB 3R6LB 3D7SB 3CCVS 1KFSA 1HPZB 3HT3A 1JIHA 2M88A 4DR6F 4NLUA 3FSYA 4DUZF 3RB6A 4OX8A 3DGPA 2LQ5A 5BYSA 2CQIA 5ETVA 3OT9A 2RF2A 2R3VA 1WHVA 2PMZD 3ZFVA 1E6VB 1NJWA 2YWEA 1HBNA 5E3AA 4DR2J 1HL6A 3GIRA 2WK4A 2WZ1A 4R5PB 2A6MA 4DX6A 1M5HA 1C0TA 4DZDA 4JI5J 2YX4A 4P2MA 2MQ8A 3U02A 2AGOA 1S1UB 2K3IA 3I56S 1UVKA 1T9VA 4C3KA 1V3ZA 2ZUGA 4DPWA 4O3SA 2EEYA 1XIQA 3LOUA 4C9DA 3L4BC 4X4TA 4Y0FA 4CRJA 1R0AB 2OD6A 4RBVA 3VAIA 4M5DA 4WKRA 1FX4A 4JI7F 1FE0A 3IAM9 3BF4A 2CQ0A 1O0PA 3CJ3A 4IFYB 1F1BB 1Z2ZA 2RQMA 3W8GA 3M32B 3PRVA 5FJ4A 1W7WA 2ZKTA 4W4MA 1KEKA 3T5HA 3CCWA 4ZJLA 1XNRF 1GXLA 3BEGB 3VWSA 4YUDA 2W2MP 2OKQA 1TK5A 3UN5A 3I5CA 1RWVB 4HEA9 4RUBA 2BR0A 4PG4A 1VRUA 4FF2A 3U1NA 2AW0A 3ICLA 2IVMA 2VBYA 4C11B 5F3TA 2YX7A 4UUXA 4NYOA 4ZVFA 2CXEA 3OR1B 2HNDA 4KGKA 3GE9A 1WORA 5HL7Q 3G87A 3P8BB 3K5PA 4OHYA 3GONA 2FZKB 4HT5A 4ECSA 3DXSX 3MM6A 3BN7A 2JFKA 3PYDA 3B6BA 3DNCA 4C0BA 1CJVA 1RAHB 3RBEA 2E9ZA 4HDHA 1YK9A 4P73A 1NJZA 3IFEA 3DLKA 4CQ1A 5K5MA 1D3WA 2GJIA 3MECA 1NDLA 2XHCA 5F8IA 3W2WA 1QE1A 2HEKA 3MM8A 5KT6A 3NGUA 1KQKA 4P71A 2JSXA 5AE2A 1K44A 1KN6A 5H9FJ 3UNYA 5DDQC 2AGQA 5AXNA 4LMZA 1EARA 2R2UA 5I3PA 3VGTA 2PMHA 4UOGA 4NLVA 2NXUA 4LF6F 2PT0A 2CIMA 3W60A 4QBUA 3PG9A 4CO5A 2JH3A 1Y7PA 3JQJA 4KHRA 4MIBA 1APSA 1EHWA 1D1UA 3Q24A 2H65B 1CSJA 1N6QA 3MGJA 2M70A 1JLEB 1EETA 2UUBJ 4F67A 3L7PA 2ADBA 4Z7YA 4HACA 7AT1B 3W64A 4ES2A 1Y5IB 4RZRA 1HW9A 4DV7J 2OMOA 4C6AA 3M9MB 4KQZA 4CLZA 2DNPA 2BE2B 1J2VA 1J5OB 4PAAA 3MOJB 3TANA 2JC1A 2BVZA 2ZVIA 4WF9Q 5J2QB 4OJ1A 4KHPJ 1X0PA 3QRRA 3G71S 1NHKL 2WCXA 2CJQA 1HBMB 2EG1A 3P45B 2XY5A 2XEXA 3ENWA 3MAHA 2HLTA 3POTB 4WWSA 2Y8YA 5DZ7A 4WU3A 3OJSA 2ZJPQ 4CNZA 3OTBA 4I4BA 2HQ3A 3T6BA 4HHHA 2BQ3A 1VBYA 1XMQF 5F0UA 2KN4A 3KLFA 1KC8T 1MSWD 5AT1B 4WE1A 4A48A 1FI4A 1FA0A 3K89A 1IWAA 2UVVA 4URSA 2IC3B 5IWAJ 2HHHJ 2AX1A 3OSPA 1YIJS 5ITHA 5KFTA 3Q8SB 4J9LA 4LRFA 3MTJA 2LECA 4EMDA 3CMES 3IWNC 2B9WA 2GJFA 1ZYQA 2QZ8A 5C7PA 4USWA 3P4UB 5LJ5Y 3O3LA 1UL3A 4OX9F 1RTJA 1CBKA 2YH0A 3RBDA 1KP6A 1FK9B 4ZLLA 2HVEA 3M7VA 5A8KB 3TAPA 3CD7A 4M5NA 4A4JA 1U7LA 1JLGA 1KTVA 4ECTA 1DTTA 3TX0A 4PWDB 2B4UA 3P5BP 3EGNA 2DGOA 4XDCA 5DQIA 3ULHA 4NLTA 3W63A 4GVBA 3NNAA 3J80Y 2DXFA 2DIVA 2V9KA 2ZOFA 3MMBB 4WFAQ 2JLGA 3UO0A 3TWZA 3UD3P 5KFNA 1I6JA 2XO7A 2W2NP 2AYMA 4KBIA 3FFIB 1TR0A 4DSEA 1HMVB 2XQCA 3EE3A 3MDFA 2K06A 4KAIA 4I6YA 4A8QA 5T14A 3ELHA 3CXCR 5LSRA 4Q0BA 4X64J 3DM2A 1FDDA 1S9FA 1U09A 4NXMJ 2VUGA 5E0OA 2MY8A 1YJVA 4USUA 3BBFA 3KNGA 1NK6A 4ZHRA 1IVZA 4QU7A 2QYGA 3OTOJ 3DGPB 4U67Q 2FLLA 3T1AA 2GQ2A 1S48A 3HFVA 1SVDA 3VAGA 3M9OB 2BZ2A 4CT8A 2NCKL 2GMHA 5HO4A 2HQGA 1RZMA 4I7FA 1I1GA 5HLFA 1C0TB 1YJRA 3AOAA 3D0IE 4X4UA 3UW1A 2R2SA 4M5MA 3BR8A 3UDEA 2QYCA 2YQ0A 2GGPB 1KS2A 1R3NA 2MZSA 1A0OB 1RK8A 2D9OA 1ULRA 3KFWX 1O8BA 4NA1A 4A47A 4OJGA 4ZVPB 4M5DB 2OO4A 2HBRB 1DBDA 3EDQB 2HGMA 1XERA 1YG0A 5EWGA 2BJ7A 2MMYA 5GADI 1X4GA 3M8QA 4K4WA 4NLYA 3MM5A 4FVMA 1RAAB 2NYHA 2JLFA 1HR0J 4F50A 1A9NB 3UD4P 4YFUA 4USTA 5KT4A 2EFPA 5L1LA 2XCAA 4PG8A 2IM0A 4LF4J 2VPWB 4XTTA 4C4WA 4ZK7M 1FFSB 2VIHA 2BABA 1C0UA 4LIRA 1YJNS 1TK0A 3TRGA 2IM1A 4MKBA 1VQ9S 1FKPA 2ZOMA 3H5SA 1Y11A 1ZAVA 4ED6A 1QAYA 3GMGA 4ER8A 2FJWA 4P2XA 3S7RA 4OHVA 4AT1B 3D9BA 2JNJA 4DL0C 1LW0A 3FEXB 3TJ8A 1HQEA 3Q8RB 1PGZA 2AGPA 2DITA 3FRZA 3MM6B 4K4YA 3A8JA 2MYFA 2MZTA 4OZ5A 1CJVB 3QYYA 1KQFB 1F2GA 1B0TA 2ZEJA 3QAEA 3KK3B 2BUNA 3DLKB 2NXCA 2G1HA 3GIIA 3MECB 4LFAJ 1M5VC 2Z56B 3IRXB 6FDRA 3FZ2A 3EPIA 3FMBA 2C3UA 3VAJA 3QFHA 1NAQA 5HATA 4PPZA 4J9UE 1YQHA 2PSZA 3CULA 2CWXA 1LKZA 2R8JA 2ZKUA 4FBTA 1GTHA 3K8VA 5CD4H 1WF0A 4JI5F 1WEXA 1YHQS 2XMWA 2CPHA 1VHFA 1U2CA 4OI1A 4FYWB 2CQHA 2D9PA 3FRYA 3V6KA 2MB0B 3KHLA 4BHQA 3IWXA 1J5EJ 2MEWA 4NYZA 1SCJB 4ZLPA 5ETQA 3G9CA 1EETB 5A2QY 4ZVOB 2G1DA 2CNOB 3ENAA 4HACB 5HMZA 5KFVA 4CLLA 3CMAS 4WPAA 2N7YA 1S9EA 4L3KA 1LXJA 2BJEA 4HKQA 1NNDA 2OTJS 1TTHB 4NLDA 3GILA 4G65A 1NDPA 5IQQA 4P9SA 4L72B 3VQTA 4X4PA 7FDRA 4DV2F 1AXQA 2YH1A 2MXYA 1AT1B 4RJVA 3FMWA 2MGZA 3TJ9A 1NXIA 2BQUA 4B3TF 5A0YA 5DM6Q 2WW8A 4M5JA 4PQUA 3QSYB 5I3UA 2CZ4A 4WE1B 4CO0A 2V2QA 3O1LA 1VQ7S 2C2EA 1GK8A 1MROA 1RTHA 4B08A 2BYCA 1Q5YA 2RQKA 2MKHA 2C2MB 2VPZB 3MTKA 4PPDA 5C25A 3DRYA 2KFZA 2ZDPA 1S6UA 5HAOA 3TQEA 1SQEA 2FHJA 1RTJB 2EFNA 2I6WA 4JYAJ 3ZXWA 4F4YA 2KKHA 3DLHA 1AFIA 4P6QA 4O0NA 1FF2A 3CD0A 1JLGB 4O23A 1DTTB 4M5IA 4I67A 1Q16B 3BV8A 4M5LA 4JI6J 1W26A 9ATCB 1H7XA 1NKEA 5GAEU 3PHTA 2D41A 3PNIA 5F3ZA 4GVBB 1SH0A 5KFGA 1UWBB 4YB1P 3N01A 4M5KA 4U6PA 3C19A 3N6MA 3W9HA 2VJUA 1U0SA 2DTJA 1VQKS 2WAQD 2GVDA 2XBPA 4ZIWA 2CQPA 3I0RA 2XYGB 1IR0A 3IBCB 2QGFB 1RGVA 2P9EA 1Y5LB 3WHIA 4NXNJ 2ACMA 1Y10A 3F0NA 4RX6A 4CP5A 3DM2B 4LF7J 2QG9B 4I68A 4RNFA 1LWCA 4YQWA 5IQ6A 5K14B 2AT1B 5C42B 2M2BA 2HK2A 3GG1A 3T3FA 2XS7A 4DEZA 2ZBCA 3NOCA 2BRKA 1IUJA 4ZHRB 2R7TA 4PRFA 3IR5B 1XWLA 2ZDOA 3H98A 2K8GA 4HT7A 1ACMB 2ZOGA 4NLGA 4ANDA 3UNGC 1C1BA 1WEYA 2IMOA 1U0HA 2YKOA 2Q6CA 2XLJA 4HTIA 3BZQA 2JVRA 3A13A 1BY9A 3G8SA 4DX7A 3QJPA 5HLFB 2QJ3A 3MXHP 2C2KB 3WC2A 1NDKA 4O3NA 5K9FA 3SCIE 4J9NA 4C8MA 2E66A 1LFPA 5F8NA 3UDCA 4LF1A 1Q86T 3PKMA 3IP0A 4IG3A 2RE1A 1RKIA 1U8WA 1S6PA 2W9CA 2AJ2A 2A10A 5F0WA 1S76D 1ZBTA 5D6GA 4MIWA 4ZVGA 1IWGA 4I2QA 3OPKA 3C6TA 4NPOA 2XULA 2XY6A 8RUCA 4FYXB 3M8QB 3TEGA 1NJXA 1AZSB 3MM5B 4B02A 2ASDA 1S4FA 3N5BA 2V8HA 4H4MA 4ZKAA 3DGVA 4A8SA 2AWZA 2B6AA 2L48A 3R6GB 4OYWA 2NSBA 1PKUA 3AH6A 1NK4A 2OH2A 1FDBA 5D77A 1IJFB 1RHKB 4JI0J 4AL7A 1X60A 3TQ1A 2CG4A 3D4JA 3DCAA 3TNVA 3LWMA 2FPHX 1TL3A 4TQRA 1C0UB 1VGYA 1UW4A 1U49A 1FKPB 3GU0A 3MR6A 1EQMA 1LOUA 2GHWA 4P7TA 4QIEA 2HYIB 3RW6A 3DYAA 3M6UA 3JSRA 2VFUA 2VKRA 4X64F 4RLEA 2FJVA 4FZVA 1HQEB 1VYAA 4NXMF 4FS1A 4LR7A 1DY3A 3GFYA 3UVJA 3NOGA 2HQDA 5JJBA 1XK8A 1XEZA 4N56A 2VF3A 3OTOF 2AU0A 4WXOA 5LSOA 3IRWP 4OYMA 4C8KA 1MG7A 4F2RA 2YNFB 4LFBJ 4E8UA 1Q53A 2B9XA 4RUAA 1Z2LA 1UEKA 1AUDA 1HI1A 3R5DA 2B56A 1HNZF 2W9BA 3EPGA 2HHWA 1SC1B 3CJQA 2C3MA 2V8VA 1HD0A 3KK2A 4LRCA 5HN0A 1FE4A 1RWNB 3A8KA 1GH8A 2EFGA 4AUKA 4CLKA 3D3BJ 4OI0A 1PC4A 3OVSA 3GR1A 3BO4A 2V67A 4GO5X 2V6AA 4LF8F 2X3GA 4J7CA 4LBIA 4MK7A 3W8PA 4TU8A 3OUYA 1AROP 2DR7A 2ZZTA 3QGGA 1EQ0A 2ZD1A 3EXCX 4PWUA 1XR6A 2RS8A 4PG5A 4MKVA 1S9EB 2UZAA 3GJRB 4LQ3A 2RSQA 3KNAA 1RWOB 2DCLA 1K9MT 1HNIA 3J81Y 2XGPA 4F0HA 4DL3A 1FWPA 1RT4A 2CQ1A 3HHLC 2JDJA 1JNZB 1QTNB 3PR5B 1TL4A 4JV2A 2FTRA 3L09A 5B08A 2ATLA 1TL7A 5T7LA 1QTMA 1YZ6A 3CEDA 1CPZA 2PI5A 2G2OA 2CQ2A 1NBEB 2CWKA 2IJRA 3RR8A 2MGZB 3VAKA 5CYMA 3N5FA 2CVEA 4QWBA 2CJXB 2FVRA 3TR5A 3TUPA 5A0YB 5IC6B 2IRUA 5DS7A 5C2CA 5GMDA 4PQUB 5I3UB 3C15A 2SXLA 4Y28C 3RGIA 1MROB 4CLYA 4K50A 4EZ6A 1RTHB 5FIIA 3R5JB 5KFQA 4RBTA 1NZ8A 3VAMA 4IH6A 3EX7B 3D54A 1KONA 4J91A 1VOMA 3M4XA 3ZZ0A 4RUHA 4KPYA 2XTJP 4YY3J 3MR2A 3TZXA 2X1FA 1YBUA 2YBVA 2YX1A 2OFGX 2V50A 3HKZD 4AXJA 4DU7A 2E5LJ 3K0JA 1LWXA 4USIA 4TYBA 1IBKF 3HZGA 4LR9A 4UY8T 1RHMB 1PYSB 2UVUA 1FESA 3I4PA 2C2NA 1X5OA 3ZTSA 4O0IA 3OLBA 5L1IA 2C2DA 4F25A 2FB0A 2F5GA 5GMEA 2ZM6J 1KQGB 2QLBB 3QAUA 4TVAB 4DLGA 1KBRA 4LREA 1ZH5A 2AYGA 1S12A 3I31A 3SCJE 3AT1B 2KM8C 2DISA 2KRBA 1BHNA 3HXMA 4F0MA 4MKAA 3D3CJ 2DXDA 2GVDB 2O1PA 2FHKA 1FRKA 1LFWA 2D69A 3I0RB 1LK5A 5KFWA 3MF5A 5D8HB 1QSSA 2KZMA 4WK3A 4BWMA 1FVSA 4N76A 1ZAXA 1VHIA 1LWCB 3OVAA 3AJDA 2CZVC 2RNEA 3TARA 1MLAA 2ZHBA 3ZTQA 2W9AA 2JFDA 1OYEA 3CMQA 4RW7A 4ZVSB 3M30B 3W7BA 3QMQA 4NCGB 2J6TA 4FKYA 3W66A 3PV8A 4ILRA 1S5ZA 4DCPB 2W01A 1FXLA 4DV0F 4EI2A 1V6HA 2DHXA 5DJBA 2LXIA 4IO1A 2DNHA 4DFKA 1MWQA 1HQUA 3NEKA 2L9WA 1C1BB 3JTPA 4LSZB 5HBMA 1RHQB 4K5SA 4OMFG 1U0HB 1VC5A 5AXLA 3B4DA 1SKSA 1FT8A 1GX5A 4ZCMA 2GO9A 4J9QA 4HI1A 1S49A 1YJUA 2HGLA 4J9MA 1G4CA 4UOHA 1RLDA 3GB0A 2XG8A 3QRQA 1SPBP 4IG3B 4F8RA 3NGKA 1S6PB 2W9CB 2RU3A 1PC5A 2I5JB 4QWCA 3NCRA 2CNLB 3M6VA 3I5AA 4ZLJA 1R6VA 4WP8A 3K58A 3RRGA 4B9SA 3NXZA 4C8YA 4I2QB 3C6TB 3C46A 1AUSL 3MOZA 2ROEA 1EP4A 4H4MB 1DQ9A 4JI6F 2PA8D 3DLEA 1DFDA 4DF4A 3G4SS 3R7NB 2LU2A 1HQ2A 2HNYB 4FXDA 2GMLA 1RHRB 5GAGU 4QR1A 3A12A 3D2WA 2DRDA 1FEHA 4GC7A 4I1TA 1H73A 3CB4A 3PDNA 2CAJA 2CNNB 2GHVC 4TU9A 5SUHA 5LMNJ 2MLYA 2Q79A 2LEAA 1HD1A 4UY85 2IFXA 2FJXA 3V6JA 4DV1J 1TL3B 2MKJA 3KYLA 3H5XA 2UU9J 5ETRA 2HGNA 2MY7A 2W4PA 3G86A 1RAOA 4NXNF 2JX2A 4V19X 3PIOQ 3DYAB 1VMBA 2W25A 4LFCF 4XK8C 4C0HA 4LF7F 2VG5A 2WONA 4EO8A 3X1LB 2BANB 5F41A 5KG3A 4DSLA 1VRTA 2C3YA 3CJKA 3UVJB 3GFXA 1TMMA 1W2IA 5FDLB 5B7WA 1HWUA 1U1OA 1Q1KA 2ZH8A 1D8ZA 4BLGA 3R3TA 4CLSA 3L95X 4QPXA 2KJVA 1HNXJ 3AB2B 2Q6BA 5DG8A 4HDGA 2E9RX 2YWWA 5KAKA 2DGXA 3PEJA 2RHQB 1PAEX 1RACB 3K59A 3CCZA 4ZPVR 1WC5A 1UZDA 3X3UA 2EKNA 2HWIA 2HZAA 1YJ7A 1SC3B 1VQ5S 3D6FB 3KK2B 2O01C 3PR4A 2R7UA 2IMWP 2CPXA 1NMEB 3BSCA 1WF1A 5DM7Q 1N5TA 1NDCA 4C3LA 3OUYB 2C2OB 4ZPBA 3HT0A 1IBLJ 3E8OA 2YKMA 3OSNA 4ANCA 2RD5C 1RA6A 1N33J
chains in the Genus database with same CATH topology
3WZ0A 2I1RA 3HVTA 4RWWA 4X66F 2OKQA 1TK5A 1TVRB 2HS3A 3I5CA 1VI7A 4IRDA 2NLWA 1VQ8S 4IQXA 1IJEB 1HNIB 3OQ2A 4K2XA 2EC0A 4HEA9 3ISNC 2LQ9A 2BR0A 4PG4A 1RT4B 2HIQA 4NYPA 1VRUA 2XI3A 2G9OA 2DNZA 4DSIA 1Y3JA 1VQSA 3NGDA 4FF2A 3U1NA 2AW0A 4N8OA 4WFXA 3ICLA 2IVMA 3R5CA 2VBYA 3M2UB 3J7Z5 2XB2D 2XHWA 4C11B 4JI0F 4O4GA 1U47A 2NUUG 5F3TA 3PO4A 2QLWA 2YX7A 2JVOA 4LIWA 4UUXA 2J9DA 4NYOA 4ZVFA 2QE5A 2CPYA 4IG0A 4HVZA 1IKXB 1M5SA 1Q82T 2AD9A 3CIMA 3OR1B 2MPUA 3C8YA 4Z37A 2HNDA 4RKUC 3CC2S 3E2EA 3MM9A 4KGKA 2G13A 3GE9A 1VQMS 3V4MA 3MM7B 4X4NA 5HL7Q 4MMOA 2A2DA 1RTIB 2J0SD 2UXDF 1MWZA 1XNQF 3H59A 1HW8A 3IXQA 3K5PA 3P6YC 3NG8A 1FRJA 4OHYA 2FJDB 3OFHA 4MAKA 2YNFA 4B9NA 4ECUA 3F44A 4HT5A 2LVWA 1F60B 4ECSA 3TI0A 4IR9A 4KKOA 3DXSX 1HR0F 2WB4A 4HHJA 1QSYA 3MM6A 4WK1A 1R6YA 2X1BA 3BN7A 1N52B 2JFKA 2DGVA 1DZ5A 5D3GA 3DNCA 4USJC 4C0BA 1S1WA 1Z1ZA 3RBEA 3HJFA 3GFZA 2MSTA 4H4OB 3JSMB 1NK9A 2E9ZA 4HDHA 3ISZA 3RAMA 1SL0A 1VBXA 5L9NA 1VQOS 1KOOA 3IFEA 2Q3PA 1NJZA 1L3TA 3PY8A 4LF4F 3DLKA 2W24A 4B3MF 5T41A 4CQ1A 4K4TA 5K5MA 2BM1A 5CYJA 2DGWA 1ZETA 3IC1A 1SBRA 5EWFA 4ZA1A 4U7CA 2WBRA 3MWBA 1D3WA 2XZWA 2YWKA 2GJIA 2Y1RI 1C4CA 4E0DA 3MECA 5E3RA 1FNMA 4BDPA 5F8IA 3B82A 1SUQA 1FVQA 3W2WA 5LJ3Y 2UV8A 1QE1A 1TV6B 3FZBA 3CCMS 2IHR1 4ZPAA 4C2MA 2J7UA 3MM8A 4C8OA 3IBWA 4OZLA 4LSLA 5KG2A 2XWXA 4PR6A 5KT6A 2QO3A 4YOEA 1KQKA 1JJHA 2JSXA 2YKQA 5AE2A 4TXSA 4DL4A 1KFDA 1KN6A 2YKNA 4G1IA 2P5VA 3JB9k 4K4ZA 4GO7X 1WEZA 4Y34A 3GG0A 5H9FJ 1TKDA 1N54B 3B4MA 5DDQC 2AGQA 3QGHA 5AXNA 2POKA 4OHZA 4LMZA 1G2EA 3PW0A 2R2UA 5I3PA 1XC9A 3DRSB 4ZPWR 3MMCB 3GIKA 4DQQA 1KHVA 2J76E 2MKCA 1WG1A 2PMHA 5GAEI 5KG7A 3K5LA 1P1LA 4NLVA 2VG6A 2NXUA 4X4SA 4LF6F 2HFZA 2PT0A 2CIMA 4QBUA 1TKZA 1VK8A 5JXSA 2VPYB 2MHEA 4CO5A 2L41A 1BQNB 2JH3A 5IM0A 3MR3A 1Y7PA 3PEHA 2O5DA 4KHRA 4OLOA 2GMJA 4QOTA 4QZVB 4QR2A 1U1QA 4MIBA 3F73A 3DOMA 2ALZA 3D28A 2DT9A 4KV8A 4FPRA 1MWYA 1APSA 1D1UA 3Q24A 3BJYA 2LXFA 5C25B 5LXRA 1CSJA 4UQTA 2HRUA 3MEGA 4J37A 1N6QA 5KFYA 3MGJA 3THTA 1JMTA 3HHDA 5I4MA 2M70A 1JLEB 1SJFA 4ES3A 1EETA 2VFTA 1R31A 4CO1A 2DH7A 4F67A 4OI6A 1JXEA 3ITHA 4PUOA 1UEUA 3L7PA 2ADBA 2OP5A 4ECZA 4K5RA 2KXNB 4QR0A 2IYGA 4AL5A 1BLUA 5K8MA 2AYEA 5A6PA 3GV7B 4DFPA 5E33A 4LFAF 1X4DA 4ZPTR 1N5SA 3TAMA 4ES2A 2ERRA 1FERA 2MJUA 3H25A 3KG1A 1FNXH 1Y5IB 3N28A 3E3XA 4ATNA 4RZRA 1HW9A 2CQCA 2HRYA 2OMOA 1JLCA 4CTAA 3G6YA 1Q7YT 2HVIA 3M9MB 2JEGA 4KQZA 2DNPA 3GV8B 3OTDA 2BE2B 2R8IA 1J2VA 3JTOA 2J9EA 4Q8EA 1J5OB 1SKRA 4ETXA 1ZZFA 3NWGA 3MOJB 3RRKA 1SJ3P 2DNKA 3TANA 2JC1A 5AE3A 4Q2MA 2BVZA 2A3JA 2GJ2A 2Y0SD 5G0RB 4WF9Q 4BWJA 1LK7A 1F9FA 5J2QB 2UP1A 2BXJA 1L3UA 4OJ1A 1BWEA 4CZCA 1FXDA 3K5NA 1CC8A 3CIZA 4EEYA 1RA7A 1P27B 1X0PA 3G71S 2HHTA 5CQGA 4DFJA 2WCXA 2CJQA 1HBMB 4QQBA 3DFEA 3QIPA 2EG1A 2XY5A 2XEXA 3ENWA 3MAHA 3O6QA 1RTDA 3LW5C 2HLTA 3DDKA 1NRKA 3POTB 2L9NA 3DC2A 5ADZA 3JSBA 3KHGA 3CF5Q 1J5EF 1V3RA 4CO3A 4WU3A 3OJSA 2ZJPQ 4RW7B 4Q7AA 5F8MA 4ECWA 4CNZA 1FTCA 3OTBA 2C3OA 2J8AA 3ZZRA 3CO9A 4I4BA 1SI9A 2PGCA 3KTQA 4NZ7A 3CWJA 2J6UA 2HQ3A 3T9ZA 3GZ7A 5GVQA 2JHEA 3DRRA 5KFPA 3T6BA 5HMYA 2BQ3A 1VBYA 1XMQF 1B0PA 3LALA 2AJQA 4MK9A 4DFMA 5F0UA 1UEVA 5KFJA 2QA4G 4X62F 1RP5A 2KN4A 2M4MA 1JXLA 4EO6A 3KLFA 1D9FA 1K0VA 3G8QA 1KC8T 3SV4A 3IS9A 3ZZPA 1MSWD 4WE1A 2E1RA 4A48A 1UJ5A 5KFIA 2VC0A 5JVHQ 2M8DB 3O5TB 3OVBA 1FA0A 4QW9A 1FNOA 4C97A 1SL2A 3KLVA 1D0EA 1UVMA 3QIDA 5HBMB 3M8SA 3HK2A 1H3DA 2YNHA 1RQ0A 2LQBA 3K5MA 1E6YB 3AAWB 4MFBA 4O3OA 2UVVA 3D0HE 4PCQA 4WZMA 4OL8A 4JI2F 4URSA 2IC3B 1BQMA 3MMJA 5EX0A 2AX1A 3OSPA 3KLEA 1YIJS 5ITHA 3LP0A 4DPOA 5KFTA 2QSFA 3Q8SB 4J9LA 4WYWA 3V6HA 1RDRA 5H9EJ 3MTJA 2LECA 3CMES 2NR0A 2C42A 2OJ3A 3BGRA 3IWNC 2B9WA 3KHHA 5GAGI 1ZYQA 2R7VA 3CCES 4RUCA 2QZ8A 4QCLA 3FSXA 4C3MA 2V4QA 4RNNA 2LLZA 1G3OA 1FRMA 1X4BA 2KXFA 3O3LA 5LJ5Y 4JI1F 1UL3A 3R1HA 1GAOA 3L7OA 2V5HG 6FD1A 1JB0C 1DQ8A 4OX9F 1VC6A 1RTJA 2YH0A 5L38A 3RBDA 2U2FA 2E7WA 3P5TL 5KG4A 4B9UA 4IDKA 4YY3F 4FNHA 2KFNA 3MEEB 2CKWA 1M90T 4FXWA 2LCWA 1FK9B 1DHMA 3CDBA 4FS2A 2B4OA 3CDAA 1HHSA 1QAXA 5A8KB 1XMBA 1IKYA 4LT6A 3TAPA 4UW2A 3CD7A 3CC4S 4A4JA 1LWEB 5K8NA 1U7LA 4LSNA 3WDOA 1JLGA 2Z0GA 4KSEB 1L5UA 1KTVA 3RW7A 1DTTA 4ECTA 3PKYA 4PWDB 5I3QA 5M2RA 2KHCA 3LP1B 3QO9A 1H98A 2OIHA 5HQ8A 2B4UA 1KHWA 3LUYA 4NRTA 1H0HB 3V81A 4B3OA 3J7A1 2V9WA 3EGNA 2DGOA 4XDCA 5B0BA 5DQIA 1C1CA 3ULHA 2X1AA 1SV5B 4NLTA 1EP4B 2HFOA 4IOCQ 2QEXS 1TKXA 4WFZA 2ZM6F 3A1YG 3DLEB 5A8RA 2IVYA 3NNAA 3SDEA 1QAJA 2FDNA 4CNYA 3K2YA 3J80Y 5KG0A 2DIVA 2ZH9A 3K7RA 2E9TA 2ILYA 2RS2A 2V9KA 2K3KA 2ZOFA 3MMBB 2J0QD 4QYZJ 4WFAQ 2JLGA 4IR1A 1RT7B 4XO0A 1SKWA 2DO4A 4OV1A 2DNRA 5E3CA 3UD3P 5MAOA 5CHCB 5KFNA 3M30A 1R89A 2XO7A 2FJEB 1I6JA 2XNRA