2V94A

Crystal structure of p. abyssi rps24
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
FMLEMEIKITEVKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGSYKSKGYAKYYYDKDRMLYIEPEYILIRDGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation of Ribosomal Protein Rps24 in Diamond- Blackfan Anemia Results in a Ribosome Biogenesis Disorder.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosomal protein
molecule keywords 30S RIBOSOMAL PROTEIN S24E
total genus 23
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v94A00
2CPIA 1VQKS 5GVQA 2HGMA 1X5TA 1M5VC 3SDEB 1VQ7S 2CQ0A 2G0CA 2NLWA 2HYIB 3NS5A 1L3KA 1Q86T 1SJRA 1H6KX 1WI8A 4TU8A 3CCQS 4C0OC 2MZRA 3MUVP 5D77A 2CPDA 2KM8B 1U1LA 2KXFA 2DNLA 1WHXA 3DXBA 3EGNA 2DB1A 2FPHX 4WIIA 2ZJPQ 1S72S 1JJHA 1WI6A 4WFNQ 3CC7S 3P6YC 3Q2TC 2FHOB 1M5PC 1YIJS 2LCWA 3G9CA 2RRBA 3G96A 3MI7X 1D8ZA 1D9AA 2ERRA 1VQLS 1G2EA 5IM0B 1FHTA 3P3DA 2RS8A 3CF5Q 1CVJA 4IUFA 1U1QA 2RT3A 1WTBA 1VQOS 3VAHA 4C4WA 2MSTA 2L08A 3J7YU 2N7CA 3LQVA 4RU2A 2XS7A 3TYTA 3VAIA 3BEGB 2HGNA 1FT8A 3UD3P 3CCJS 2J8AA 2A3JA 2KG0A 5DDPC 1HD0A 3G71S 1JJ4A 1HA1A 3CCUS 5DDOC 2EK6A 5LJ5Y 2CJKA 1WHVA 2QA4S 1P1TA 4F26A 2DNNA 2M88A 5MLCV 4CH1A 3VAMA 1OPIA 4TU7A 1DRZA 3EGZA 3MOJB 1P27B 2JRSA 2LEAA 3P5TL 2M0GB 3EX7B 1X5SA 4WF9Q 2CQDA 2KM8C 1Q7YT 5CA5A 1U6BA 1VBXA 3OW2R 1PGZA 3CCSS 2O3DA 2JVRA 5DETA 2X1GA 2MKCA 4M5DB 2KRBA 2LMIA 2XNRA 2DNGA 3K0JA 2LQ5A 1N54B 2RUGA 2MHNA 3CC4S 3SXLA 1UFWA 1VQ8S 1VQMS 1OO0B 5DDQC 2CQIA 1DBDA 4FXVA 3ZZZA 5GAHU 1U1OA 1M5OC 2V94A 5IFMA 1PO6A 2DIUA 3D2WA 1X5OA 1NU4A 2X1AA 2MJUA 2OSRA 2AD9A 5HL7Q 5D78A 1JJ2R 5FJ4A 2KYXA 5LJ3Y 1X5PA 1M90T 3NNCA 3TO8A 2M52A 3B4DA 1VC0A 3MUMP 1X4EA 2MKHA 2CQ4A 1FJ7A 2MQOA 3TP2A 4CIOA 2ADCA 2VODA 4QU6A 1KC8T 1R8PA 1X4AA 2B0GA 2MKIA 2DNZA 2N3LA 3CD6S 2DNHA 2KXNB 2F9DA 1OIAA 2MZ1A 3CCRS 4YOEA 1URNA 3VAFA 2MZSA 2J0QD 3UD4P 5LXRA 3LPYA 1SXLA 3N9UC 5LSLA 3PIPQ 1YJWS 2DHAA 1VQ4S 1N88A 2MQQA 1FJCA 5JVHQ 1U1NA 1VC5A 3CULA 2D9PA 2JVOA 2MGZA 3CCLS 2VOPA 2RQ4A 2N3OA 2D9OA 2G4BA 2DIVA 2MKSA 2DH9A 4C7QA 1S79A 2J0SD 3CMAS 4ED5A 2UP1A 2DGOA 2MQMA 1DHMA 2LECA 2E44A 1W2BR 3L3CA 4U67Q 1RK8A 2FY1A 4BS2A 2NZ4A 4ERDA 2D3OR 3IWNC 3JB9k 2DO4A 3IRWP 2MKKA 1VC6A 1WWHA 2RQCA 1NO8A 3G6ES 2XNQA 2MZQA 1M5KC 4V19X 2MYFA 2ZJRQ 3S6EA 3MD3A 1U1KA 1X4CA 2EVZA 2DGVA 1R8HA 3BO4A 1A9NB 1H2UX 1U6FA 2LKZA 1HL6A 2ZJQQ 5DM6Q 2M9KA 1YWXA 2MQLA 5H1SV 4J5OA 4LJMA 4YUDA 2N82B 1WEZA 3HHNB 5GAEU 2CQ3A 5LSOA 1WG4A 1WF0A 2YH1A 2KVIA 4QQBA 4IOCQ 1N52B 2LXIA 5GAGU 1K8AT 2LYVA 4QPTA 2MQNA 2DNRA 2EK1A 2KH9A 1SJFA 4F02A 2SXLA 2DGUA 1VQPS 3RW6A 2DNQA 3U1LA 2OTJS 2OIHA 2MXYA 2CQ2A 1OWXA 3NS6A 3R1HA 2DHGA 1FNXH 1X4HA 1KD1T 1X4FA 1U1RA 3UCGA 1H2TZ 2DGXA 2MKJA 2MGZB 1ZZFA 2J76E 4WCEQ 2DH8A 2M70A 3P49B 2MB0B 1YI2S 3THPA 3CTRA 1KOOA 2K8GA 3S8SA 3R1LA 5CXTA 2GO9A 4W92B 4PRFA 4Z2XA 1SJ3P 3CUNA 4Y0FA 2JWNA 1KQSR 2HZCA 4FXWA 2XB2D 1YITS 2MY8A 2M8DB 3MDFA 2VONA 1X0FA 1WF1A 2XSFA 2RS2A 3B4MA 3G8SA 3CCES 1VQ6S 5HO4A 2AYGA 1U2FA 2DISA 4F25A 1ZZNA 3CC2S 1NJIT 1VQNS 2DGQA 1SJ4P 2WBRA 2ADBA 4LIRA 3UE2A 3BS9A 1M1KT 1UW4A 3US5A 2CQHA 2L41A 3NMRA 2DITA 2FC9A 3S7RA 1YJNS 1K9MT 3NNAA 3Q2SC 2OSQA 5IM0A 2G1DA 3UCUP 1AUDA 3I55S 3UWTA 4OZ1A 2LEBA 1ZH5A 4ZKAA 5CYJA 2E5IA 3I56S 4W90B 3CCVS 2E5HA 2KI2A 3S01A 2DGWA 4YB1P 3ZZYA 4WFAQ 2OJ3A 2Q79A 2MJNA 1QVFR 2M2BA 5JVGQ 2LA6A 5GADU 1QVGR 1JMTA 2GHPA 1IQTA 1FO1A 2MPUA 4WKRA 2DH7A 2AYEA 3RW7A 2X1FA 2FC8A 1X4GA 2HVZA 2HGLA 2F3JA 4IOAQ 1SJQA 2CPJA 2CPYA 3NNHA 2DHSA 2MZJA 3HI9A 2DK2A 2DHXA 3VF0B 5BJRA 1FJEB 2KHCA 2CPFA 2MSSA 2CQ1A 2KT5A 1KOHA 3R27A 4PKDB 2LA4A 2YH0A 2DNYA 2YTCA 1VBZA 3DLLQ 3CPWR 1WEYA 2JX2A 5IQQA 1U1MA 4OZ0A 2OTLS 1N8RT 2DGSA 2CQPA 3J7ZT 2X1BA 1X4BA 2CPEA 4CH0S 2QFJA 2CPZA 3THTA 3VAKA 1UAWA 2DNPA 2E5JA 1VQ9S 3SMZA 2PE8A 3VAJA 1A7GE 2YKAA 1WHYA 2RU3A 4TU9A 4UY8T 2AYMA 2U1AA 1K73T 1BY9A 2DNMA 3H2UB 3SDEA 3MD1A 1UP1A 5LXYA 2DNOA 2MMYA 2KXHA 3CCMS 1HD1A 2AYBA 1F9FA 4A8XA 4LMZA 2U2FA 1WELA 1WG1A 1WHWA 2KN4A 2DGTA 4QU7A 3MXHP 1YJ9S 3FEXB 3G8TA 2RNEA 2KRRA 3MURP 4WFBQ 2KG1A 2VOOA 3UCZP 3U1MA 3MUTP 3PIOQ 4UQTA 2I2YA 2XS2A 1XN9A 4PR6A 5ITHA 1H2VZ 5DDRC 3H2VE 2RRAA 2BOPA 2BZ2A 1WG5A 2CPHA 2LXUA 3CXCR 2M7SA 2M8HA 3V4MA 5DM7Q 2PEHA 3ULHA 2YWKA 4IO9Q 1X4DA 2E5GA 1YHQS 2QEXS 3BO3A 4Y00A 5EN1A 2K3KA 4CQ1A 3G4SS 2DNKA 5GMKa 1YTYA 4EGLA 2I38A 3VALA 1WF2A 2KFYA 2DO0A 2CPXA 2XS5A 1B7FA 2MZTA 3BO2A 1VBYA 4TLQA 1Q82T 1QM9A 3CMES 2CQCA 1RKJA 2MY7A 1FXLA 2CQBA 2F9JA 1O0PA 3VAGA 1Q81T 3FEYB 2M4MA 4P6QA 2MQPA 1WEXA 2KU7A 1DZ5A 2CQGA 2RVJA 1U1PA 1VQ5S 2L9WA
chains in the Genus database with same CATH superfamily
4BC9A 2NS1B 1HNZF 5GVQA 3IBFB 2WAQD 4NA2A 4JI3F 1GMWD 1MWYA 2RMLA 1PCAA 2ZH6A 3RBXA 4J9PA 2FVSA 1MU2A 1JLQA 4OYMA 3ZZ0A 2G0CA 2B56A 2J0XA 3AB2B 4LF5F 4Y34A 1L3KA 5T41A 3KLFA 2VKZG 3ZTRA 3GILA 2AP6A 2GIFA 5HVHA 4H4KA 3ISNC 3UI3A 3EGVA 3GB0A 3KDNA 2FJVA 2K1RA 3TX8A 1LQ9A 1BHNA 2LQBA 4K4ZA 3PV8A 3AQPA 2KXFA 4I6AA 4KY3A 1MN7A 2RHQB 1WHXA 5CYMB 4ZHRA 4QIEA 4C97A 3RAMA 1SH0A 3CNQP 5HBMB 2G9OA 1GQEA 3R5JB 2DB1A 2FPHX 1VQ6S 5EUHA 4R25A 3P6YC 4IFYB 1FRKA 1Q16B 3MEGB 4ZS6A 1NNDA 3EICA 4ZPDA 1EQMA 2FY8A 3TRGA 1HNVB 4CP5A 1JXVA 3V81A 3MPWA 1KBRA 4FYDA 2ZC4A 3NG8A 1CG2A 2HHPA 1SVDA 4PEOA 4ZLLA 4X62F 4G1IA 2GHWA 1QUPA 2YNIB 2HMIA 3MR3A 2XMVA 1FERA 3ET6A 1D9DA 5D0GA 1PIEA 1ZM3A 3EDRB 3OR2B 3RTVA 4KYZA 1SH2A 4MIWA 3SV3A 3FK4A 4NRUA 3SCIE 1CC7A 1OS5A 5CH7B 3KDOA 3FDSA 2XQCA 1W7WA 1NUEA 3Q83A 2W9CB 3M8QA 4A8KA 2C2DA 2W8LA 4J9QA 2HHHJ 3HHLC 3V4IB 4DWIA 3PEJA 3GIMA 1ZYQA 1CVJA 3OSPA 1TAUA 3R7SB 1WTBA 4IKAA 2QSWA 3KHHA 3E3XA 3VAHA 2UXBF 4UZBA 2CJYB 2HBZB 2BDPA 3DLEA 1L3VA 3MF5A 3I82A 4ZLJA 1TKTB 4GKJF 2K06A 1RAHB 1ZS6A 3HX9A 3LQVA 5HROB 3E8OA 3DGPA 3CDAA 2Q6BA 2ROEA 4DR1F 4Q0BB 1NSAA 1XJWB 3PW7A 3EUNA 4USIA 3TVKA 1N48A 3H0PA 3UD3P 2YKPA 2P9CA 3Q8VA 1IR0A 1NPPA 3CIMA 2UXCF 4ILLA 5GAHI 5DZ7A 3ITHB 1GNKA 4LREA 5KFQA 4OMFG 3OTDA 2BM0A 2EKYA 4L3KA 3N6MA 1VQSA 2GVZA 3MAHA 3DHWC 3DKDA 2X3DA 3FCVA 1WHVA 2B4OA 4PPZA 4M5IA 5LJ5Y 1RSCA 2BQRA 1P1TA 1N34J 1CLFA 4DV3J 1HHSA 1H3DA 3W5YA 1K44A 4FYWB 2HVHA 2CJ9A 2HFVA 3R5BA 1IKVB 4LBIA 4F3MA 3JAMU 4OX9J 3T19A 1RUSA 4TU7A 2DJWA 3MM9B 1CS4A 1ZAXA 3KLEA 2FHJD 4ED4A 2VUGA 3CJRA 2QMXA 5IC4B 5D3GA 4YR0A 1U25A 2Z2MA 3CB4A 3P4UB 4OYWA 3WZ0A 5E3RA 4A8SA 2HHVA 1SC4B 1X5SA 1O6XA 2ASYA 4WP9A 2AGOA 1EZZB 2CQDA 3TAMB 1TKDA 1U6BA 2IJNA 2VD3A 3I96A 5AJ3F 2JVRA 4E0DA 4C3LA 3M2UB 2X3GA 4TY9A 4R0JA 4EBCA 2V67A 4FN5A 2DNGA 1FWPA 1FESA 3EXCX 4LFAJ 5EWGA 3THVA 1NM2A 2E7WA 1RTDB 4B3RF 4HT7A 1N54B 2RUGA 2MHNA 4DQPA 1NB2A 5E3PA 3DLJA 4DV7J 2UXDJ 1S5ZA 2XGPA 2QYGA 2Z57B 5GADI 3ENQA 3CJTA 1RA6A 4J37A 3DDKA 1AROP 2CQIA 2QLBB 3K2YA 1OQ3A 4JI5F 5K8NA 2VU5A 4RKUC 3MEEB 1HI8A 1KDNA 4UQGA 3NRBA 4FXVA 1UCNA 1KLMA 3LGNA 4HLBA 4USTA 4LSLB 3UDLA 2V94A 2O1PA 5DLGA 4ZVPB 3J80Y 2EKNA 3KHLA 3W3SA 2AX0A 1HMVB 3I4HX 3AAWB 3OR1A 4AD6A 1YX2A 4P75A 2LECA 3RB4A 2FLNA 1CJTA 5JUMA 1IR1A 2HLTA 5FD1A 1IM4A 4NCGB 2AD9A 1JJ2R 2KYXA 3KK1A 2PFDA 1LKZA 1RHUB 4RNFA 4TKTA 2FYXA 5J2MA 3MUMP 1X4EA 2MKHA 2EBEA 5KT2A 1C4CA 1Q8IA 3HVWA 1VI7A 2MQOA 1RA7A 2DHHA 3TP2A 5HSPA 4WZMA 2WONA 1QAJA 3DN9A 2QFIA 1R8PA 1RLDA 2Z2LA 3OTCA 4DL4A 1LEOA 4WYWA 1X9WA 2DNHA 5EHHA 2OGUA 2CVEA 3SIPB 3IS9B 4F0HA 2MZ1A 2H48B 2KXNB 1PC4A 3KLVA 3CCRS 1QAIA 4YOEA 4NA3A 5IT0A 2XI2A 2OPRB 3MPYA 1N33J 2CNNB 3UD4P 3NGSA 2VG5A 5LSLA 3GFHA 1VQ4S 1AXQA 4M5JA 4M1KA 4DX6A 2MQQA 4XPCA 2FLOA 3CDWA 3NEKA 5RUBA 1NK8A 1IBKF 4ICLB 3HXMA 1OMSA 2AEMA 1CJVA 2AIRB 3CCLS 1HNXJ 3DLBA 5L1JA 2EWHA 3GIIA 1LWEA 5CYMA 4MFBA 3RAQA 2DH9A 1OY8A 4UOGA 2VG7B 1RWOB 3OFHA 3SCLE 2J0SD 1Y5IB 3RUBL 2HNZB 2JC0A 3PACA 4RWWA 4CWBA 3HO1A 4NCAA 1YJVA 1UVIA 2BKNA 2FTRA 3KKFA 3CMQA 1U48A 3NBPA 3Q23A 1A6LA 4HL9A 1VRTB 4H4KC 4FBUA 2ZE2A 3V6DB 1G1XA 2CJAA 3Q0AA 5JXSA 2YWWA 2B4VA 4LQ3A 1JLEA 2VFUA 3M8PB 2MKKA 1LWFB 2W7OA 4ZVGA 3W2VA 5DZ6A 1FTCA 2BRKA 2OPQA 1F5CA 5ETVA 1NO8A 2XYHB 3PKYA 4I7FB 1HBOB 2CWKA 2XNQA 3BB5A 3NKYA 3I9ZA 2PIIA 4PCQA 4V1Ak 2QLXA 4XDDA 3DM2A 2RD5C 2PO4A 4ED2A 5A0YA 1EETA 1FEEA 3W7BA 4NXNJ 1HQ2A 5D0HA 5HAOA 3DI6A 1SIZA 4ZPWR 1WNEA 3DLKA 3AJDA 3ETOA 3F0NA 1GXTA 4DU7A 1A9NB 1VBKA 1FK9A 1U6FA 5BR8J 3QJPA 2AJQA 1SBRA 3OTOF 1IVZA 3TEGA 3MFIA 3FC9A 1G3OA 4IG3A 1FFGB 2OLWA 1S0MA 1YWXA 2BKPA 3TJ9A 1Y4ZB 1JWWA 5F8NA 4WP3A 2AJ4A 2B9EA 1U0HB 3MOZA 3QLHB 4ZJOA 2GV1A 4I2QA 2N82B 1UTAA 4GC7A 4JI1J 3MMCA 3UDEA 3KXDA 2H4WB 4CYUB 3M8WA 3IO1A 4UUWA 2YH1A 4ELTA 3I6PA 2HK3A 1OYDA 2XTJP 2KVIA 1LK5A 3TA2A 4KGXB 4NEYA 4Q45A 2YPZA 1SKUB 2HFZA 5T7LA 1SL0A 1S0NA 3VGVA 3CDUA 2UUTA 2R7OA 3LGHA 2RF2A 3FQKA 4OV1A 3GCWP 4A46A 3WC0A 5ETSA 1IXKA 2V2QA 2ZH4A 2VQEF 3G6VA 4OYXA 2HNDB 3PRDA 1VC6A 3KK3B 1R0AA 4DV7F 2R2UA 1WDDA 2JH3A 3GR1A 4R8UB 1RT3B 2V2KA 3M6VA 1J27A 2CJXB 4ZA1A 3SBMA 4CO4A 1GX5A 4F67A 4K4XA 4JI2J 5ETPA 5EX3A 5K20B 2MXYA 2CQ2A 2XM3A 4F4WA 1KVKA 2GHVC 3IR5B 3NS6A 5F8LA 2RQMA 2LQ8A 3N5BA 3M9NB 2DHGA 1S1TA 2K3IA 2LLZA 4LSZB 5AE1A 1KD1T 4ZIVA 1H2TZ 2DGXA 2EPIA 2PD1A 2WOMA 4RBUA 5E7OB 2MGZB 1HR0J 4WCEQ 3PKMA 4OZJA 4USWA 1YBTA 1CEZA 4JI7J 1RLCL 1R0BG 3BKUA 3CJ2A 2YKMB 1BQMA 1UPPA 4I6YA 2LXFA 2HFSA 4Q0BA 5LMUJ 2CIMA 2YNFB 4PPDA 4PQAA 3THPA 4DSKA 1KOOA 5AT1B 3UFCX 3JS9A 4NXNF 3CE8A 1RT3A 1B0PA 1U8WA 5ETNA 1I3OB 2AZ1A 2RILA 3BV8A 4W92B 4PRFA 4M94A 2HHSA 1IR2A 2IYIA 2W2NP 1IBLJ 4Y0FA 9ATCB 5KFJA 1NKCA 1MROA 2DR5A 4DBQA 4LFAF 2NZCA 1JLGA 4FXWA 4HH1A 1YJUA 2XB2D 1NK7A 2VONA 3QIPB 2NYIA 2K1RB 3EM1A 3RZAA 1M1HA 2G0JA 3T9ZA 4CTAA 5KAKA 3G8SA 2AYGA 3UQSA 3ILOA 4HVZA 3KK1B 3CC2S 1IKXA 1S4FA 1QY7A 2DGQA 2I5JA 4L3NA 3VTIA 5DG8A 1NJIT 3W65A 5J2MB 1TUVA 3DNCA 3P96A 4UT4A 4ED1A 2E5LF 2HHTA 4LIRA 3BS9A 3KG4A 1UW4A 3EDQB 3PJWA 1T11A 3PCOB 4K5RA 2ZJRQ 1FRLA 1DLOA 1AFIA 2LDIA 4DR4F 1ZAVA 2FC9A 5L1KA 3HHLD 3IM9A 2V2VA 2Z2YB 1KONA 4RW7B 3S7RA 1YJNS 1XC9A 2R7SA 4X4QA 3NNAA 4X4UA 4KBIA 4FF3A 4C11B 1C0TB 1HLWA 2OUGA 4DFKA 3HSZA 4RW8B 3I55S 1EARA 1XMQF 2CDQA 3NCPA 2ZHOA 4GRSA 5I3QA 3UVJB 3BQ0A 1HI1A 2LEBA 3V5RA 2E9TA 1Q5YA 3D4JA 4ZKAA 4IH6A 2BKOA 3OTBA 4Q2MA 1ZAWA 3MM7B 1Y11A 1WTFA 3I56S 1RTHA 1UEKA 5E3QA 4W90B 3MM8B 4NI2A 1CJVB 1TP7A 1FRJA 1H38A 4DV5F 3RB0A 5M2UA 3E01B 4IH7A 2YX1A 1U49A 3B54A 5KFWA 4ZPVR 3PO5A 2PSZA 2AQ4A 2OP5A 3PRVA 2XMMA 3GE9A 1T7PA 1HYSA 1S1XA 3D3BJ 3HJFA 2OJ3A 3BBBA 1S9FA 1ZOTA 3DRSA 1VFJA 2HAFA 3NS7B 4I6WA 3L95X 2J8SA 4LF6F 5F0WA 4CLWA 3C19A 1JNZB 4ECUA 2FVPA 5GADU 1WOOA 2V8GA 2AHOB 3PX4A 4AXJA 1FO1A 2HRTA 1OYEA 2MPUA 4ANDA 2DH7A 2AYEA 1J5OB 2E1PA 3FGVA 5KFLA 3T1HJ 2HGLA 2F3JA 2WSFC 5KG1A 4DUYF 4OHYA 1SJQA 4LR7A 2CPJA 2CPYA 1LXJA 4MKAA 2MZJA 4DS4A 2BQ3A 5LM7E 3HI9A 2B7CB 2DHXA 2DK2A 3BN7A 3JQKA 3VF0B 1FJEB 4ZVQB 3PXGa 2CQ1A 2VB6A 2IC3A 4OFZA 4P74A 4IRDA 1RHJB 3DYAA 1K1SA 3A8JA 1RTIB 1FE0A 3AJ1A 4ES2A 1VBZA 2ILZA 4N8OA 3HHLA 2K7KA 3MCOA 5D4NA 3L4BC 2MLYA 3MMBA 4DSJA 3UPFA 1FXRA 1T02A 1WKKA 3W8GA 2OPSA 1RHKB 4OHXA 4WJBA 5KFZA 4XAKA 2V9WA 1V3SA 4CH0S 2IAJB 2DCLA 4LF9J 3HFVA 3UNGC 3THTA 3VAKA 4OZ3A 1S9EB 4A47A 2DNPA 3D54A 5KFNA 3K59A 3ZNUA 4KHPF 4KV8A 4O23A 2F7VA 3NY0A 4X66F 4Y3CA 3C6UB 2RU3A 4WTYA 3AXMA 1FCAA 1ULRA 3I0SB 4Q8EA 2U1AA 2HBYB 3AY0A 4JI0J 3AQOA 2P9EA 2IYGA 3ENVA 3MD1A 3AB4B 4O44B 1YG0A 3TJAA 1Y5NB 4DPTA 2DNOA 3SFGA 5KG0A 3OJUA 3NLCA 1UVNA 3OTEA 2DR9A 2FHMA 2R42A 4A8XA 3ITHA 1XIQA 3MECA 3TOQA 2OH2A 1CBKA 1WELA 2IAJA 2GQCA 4LFBF 2KN4A 4J7CA 3KLGA 4YFUA 3I9V9 3OXFA 4KO0A 2RNEA 2KRRA 1UWAA 4ZLNA 3G8TA 3DDNA 4RW6A 2APOA 2IM0A 4ZOSA 3B6BA 5SUHA 4E2FB 5IT9U 3W62A 2I2YA 1NDPA 3FSYA 4FP9A 2OO4A 4Y2IA 5HN0A 4B3MF 1S4EA 2QE5A 5I42A 1I51B 4PR6A 2YQ3A 2AJ0A 2Q1LA 4Y2KA 3TZYA 3B82A 4RJVA 2HHXA 4JB8B 2LU2A 2G0IA 1GMWA 2ALYB 3RU0A 2LXUA 3OSNA 5FDLB 4X4OA 5H9EJ 2M7SA 3V4MA 2G13A 5DM7Q 5A2QY 4R5PB 3CIZA 3N6NA 3KLHB 3CJ0A 1EP4B 3L09A 2ZVIA 4I69A 4IG0B 1UJ6A 2WBMA 3K17A 4QIGA 3QZ8A 4DR6J 4XO0A 3J7AN 3R3TA 2QLWA 2E5GA 2HWHA 2KO1A 2QEXS 2Y8YA 1MN9A 3R97A 2K3KA 3LP0B 3Q2TC 2WRMA 4C0BA 5GMKa 1YTYA 5HROA 5CYQB 4S0MA 1S99A 1T95A 1RTJB 2HBQB 5HVGA 1LXNA 3W1YC 2L48A 2CNKB 4B9SA 2I5JB 2YWEA 3X3UA 2CG8A 4ETZA 4NLGA 2H5EA 3UN2A 4HTJA 4CO5A 4ECSA 3D67A 3BO2A 1YSJA 2VPXB 2O5DA 4YB5A 5D15A 1I94F 4M8LA 4M5MA 4NLRA 4QYZJ 4ZVEA 4C8MA 4ECZA 3R5DA 2YNGA 1T03B 4B3MJ 2BACA 1HBUA 1PILA 2M4MA 2MQPA 4L76A 5AXKA 3P45B 2KU7A 4Z7CA 4Q5VA 1HWJA 4RW9B 2B6AA 4QIFA 3U02A 2V9KA 2HRUA 2YNHA 1VJQA 5A8KB 5HP1A 3W9IA 1VQ5S 5GMDA 1PAUB 1WSRA 1LWXA 1XR6A 2VC0A 3I5CA 4F0MA 3PX0A 1ZETA 1LW2B 4X84A 2LP4A 1VJWA 3FBCA 3MTJA 5F8JA 4OJ3A 3MAQA 1VCTA 1T05A 1X5TA 3V81B 3IBWA 2JFDA 3OFGA 1NDCA 1TV6A 5KG7A 4EFAC 1MROB 1R27B 2HYIB 3NS5A 4K50A 1RT5B 2EFPA 2F63A 1Q86T 1H6KX 1WI8A 4DL5A 5DRKA 2P8IA 3CCQS 3R5AA 2E1MC 1U7LA 1TQLA 4NL5A 1Y7PA 3PX6A 1H7XA 4YS2A 2IMOA 3QQCD 1RGVA 5J2PA 5I3UB 4TQSA 1N4LA 3EGNA 4NLOA 2P6SA 3QLHA 4ZVTB 4DR3F 2PN6A 4ICLA 3SI8A 2XSJB 2V5HG 4WIIA 1IBKJ 1AB8A 1RQ0A 3CC7S 3S1TA 4DPOA 3LAKA 1OQ6A 3UW1A 3D6HB 1B0TA 2EW9A 1FTRA 3BSNA 4DSIA 1KHWA 4WIQA 1CULB 3MMAA 2LFVA 2ZBQA 3FZ2A 3VGSA 1YIJS 3B78A 3RB6A 4B3OB 2GMLA 2VA2A 3WIUA 1HMVA 3G9CA 3C3LA 4HHHA 3QRRA 3PY8A 1K47A 3ZZOA 4F04B 4AQYF 2QLFB 1D9AA 1FRIA 4X66J 3NBPB 5D4LA 3M30B 4DFJA 2C42A 5IZHA 5IM0B 2PGCA 2P6TA 1KEKA 3RR7A 4N7TA 4EWTA 2DXDA 2ZH7A 2BABA 4C48A 3CF5Q 1U1QA 1IWGA 2COLA 2RT3A 2FD2A 2WCXA 2CRLA 4CRJA 4F50A 1S76D 2CXEA 4OYAA 1Q1KA 3I0RA 2ILYA 2L08A 4I7FA 2GS8A 1FNOA 2CUYA 2DTJA 2UV8A 4PUOB 4QWAA 3AA8A 3VV2B 1VLOA 2AEJA 2OPRA 1IKVA 2Y1LB 3GYXB 3TYTA 3VAIA 1HPZA 1NXIA 3GCXP 4LF6J 4DR7J 2A2CA 4J9SA 1UFKA 1IKWB 4NPOA 3CCJS 2J8AA 2B4UA 2FQQB 4Y28C 4GC6A 2A3JA 1R8AA 3M30A 5KFBA 4FBTA 4O3SA 4I67A 4C0HA 4MIBA 3CWJA 5F0UA 3G71S 4KRWA 4DX7A 1JJ4A 1HA1A 5DG9A 5DDOC 4A8OA 2HZAA 2EK6A 1BLUA 4DX5A 4CO3A 1R0CB 3OHBA 2DR7A 4M95A 5F3TA 4CLFA 1QAXA 1IBMF 1UFLA 1TAQA 2DNNA 2M88A 5CZVA 4ZCMA 5MLCV 4DSEA 3D6FB 3GWCA 4DX8H 4DZDA 1XNQF 2WB1D 5L9XA 3M8RA 4DF4A 4CH1A 1GMVA 1RABB 3VAMA 3GJSB 1ZTTA 4TY8A 5JJBA 2XGQA 3KUHA 2KTQA 2LEAA 3BDEA 2JEGA 2ZDPA 3P5TL 2FJWA 2M0GB 4X64F 3DYAB 5A2QU 3TUZC 4KH1B 4WE1A 2HLUA 2OAUA 3BH6B 5F8IA 5CA5A 4J9KA 1Q8LA 1ZPWX 4AYBD 1BUXA 2Y1JA 1VBXA 5BR8F 3OW2R 4Y2AA 4QWCA 2W7PA 2UXDF 5DETA 3VWSA 2KKHA 1PG5B 1NJWA 1F5BA 1UMJA 2HG4A 3KJFB 2KRBA 4B3RJ 2LMIA 2XNRA 2X7IA 1Y3KA 1RI7A 3N4WA 4ILRA 2B7BB 2QL9B 4PYAA 4J9NA 3K0JA 3QRQA 1FXDA 4KHMA 2YKOA 1RT2B 4ITSA 1RT4A 2V34A 4C6AA 4KV8B 2C3PA 2ZWPA 4WXOA 1JKHA 3MGJA 4F2SA 4ZJQA 4K4WA 1LW0A 2OKQA 3FFIB 3H5UA 1VQ8S 1YK9A 4WXWA 1OO0B 5B0AA 1F6TA 3OR2A 4ZP6A 3BSOA 3DMJA 3DRRB 3TJ8A 5D3GB 4PQUA 2ATLA 3ZZZA 5GAHU 1M5OC 2AJ1A 3DOMB 3T5HA 2KVQE 2B8PA 3D2WA 1VIXA 1TVRA 4LQ9A 3TAMA 3RR8A 3MR5A 2X1AA 1E6VB 1SH3A 1S6QB 1T9UA 5FJ4A 1S1VB 4F4KA 4AUKA 1X5PA 4P7VA 2RAQA 4TN2A 1U26A 2M52A 3B4DA 4DQQA 1UJ5A 1VC0A 4JI7F 2XLKA 1I1GA 3BGUA 2ADCA 3GIKA 1UEUA 4NMXA 2XMUA 2KT3A 2J7KA 3GTYX 1HNXF 2VQFJ 2ABYA 3CD6S 3GU0A 4DV0F 2ZZNA 5HQLA 4G1QB 3VVUA 4I1TA 4LRCA 1E6YA 5K14A 4OJHA 4JI2F 2D74B 3D6TB 4QW8A 2J0QD 3OJSA 4QWDA 2FJXA 2K7JA 3D0GE 3GSIA 3EWGA 5B0FA 2ZH5A 2H65B 3LPYA 3N9UC 3Q8UA 3KLHA 1YJWS 5J1EB 2FHKA 2G1HA 4P2FA 4USMA 1HBMA 3FNNA 1TL7B 3N6LA 3N28A 3BQ1A 5F9NA 3RRGA 4C9DA 4QYZK 5B0BA 2UXBJ 3NGDA 2V69A 3O1LA 4C11A 1R7IA 3AT1B 3MPUB 4F7VA 5IOLA 1XMOJ 2JVOA 1VC5A 4QCLA 1XQIA 2Y0BB 3NL0A 3RBEA 2VOPA 1RWNB 4TXSA 3MPVA 2B9WA 1XEZA 3QT6A 5KT3A 2DIVA 5DG7A 3KG1A 4C7QA 4I56A 4UOCA 5I3UA 3A8KA 2HHWA 2R2RA 3CMAS 2C2KB 4OLOA 4YP3A 2DRDA 2QYCA 2F8MA 2RKIA 4BWMA 1DHMA 4DF8A 2IBKA 2HQCA 3MCMA 5ETKA 3ZTSA 1R6YA 3QATA 1W2BR 2IHR1 3LA0A 1TKZB 3VQTA 1TL4A 1U1OA 1RWVB 4KQZA 1KTQA 1S6PA 1X9MA 3KUEA 1RP5A 4U67Q 4BS2A 1MSWD 4IOBA 2D3O1 2B9XA 4DXLA 4XIUA 3I31A 3PW4A 1HYSB 1FK9B 3H8YA 4RL1A 1S6UA 1T8EA 5KTQA 3LALA 2V4JA 3FVYA 4JI8F 2HNYA 3IRWP 4ECYA 3H20A 4H4OB 2L9DA 4NLQA 5HP1B 4L74A 2VFRA 4B3SF 1J5EJ 3E2EA 2F4FA 3M8QB 2R8HA 3H5XA 3C16A 2XHWA 5K9FA 3TA0A 1M5KC 3AD8C 3WHIA 4CYUA 2XO6A 1RWPB 3UDVA 4V19X 2FGCA 2UUWA 2V2ZA 4LBPA 2GQ2A 2GFFA 2WVBA 1X4CA 4KO0B 3SQOP 1LV5A 3DHXA 5EDWA 4WFXA 2BMBA 2VIHA 1LK7A 3BO4A 3PO4A 1MMDA 1WKLA 2CADA 1GK8A 1H2UX 2LKZA 2XULA 3NXZA 3D9BA 2UZAA 1RE1B 4CI0B 2L9NA 4FYVB 2Z8QA 3CJKB 3QT5A 2AMCB 4KB7A 5HMZA 1HNZJ 2M9KA 5D4PA 2XCPA 3C15A 4J5OA 3PVXA 1Q4RA 3GP9A 4KIAA 3TVZA 4CLPA 4YUDA 2VFSA 3W64A 4AL6A 2EC2A 3EPIA 5GAEU 3VQSA 1WC0A 2CQ3A 2WK4A 1Y0HA 1FRXA 3D68A 2C22A 2FHJA 4ID5A 4DL7A 1WF0A 2CVIA 3SEOA 4Z37A 2L9WA 7AT1B 2E1CA 2O66A 4QQBA 3ZZUA 3WC2A 4IOCQ 4KPYA 2JEIA 3ADAC 2CKWA 3MCSA 1VR6A 4DN9A 2ZWOA 2BRLA 2LYVA 2GO8A 1HARA 1WC1A 2MQNA 4IFYA 4DZ6A 3ENWA 3MM6B 2QLJB 3N01A 2LQJA 2EK1A 3EZOA 3KWMA 4OYIA 4OYOA 4USHA 4BLGA 4DG1B 1SJFA 2SXLA 1KFDA 2GAHC 3SSQA 1F3VA 5HJXA 2DNQA 2H1YA 4OYZA 1WC3A 2QZ8A 2ZEJA 3VZIA 5CD4A 2UUAF 2D7SA 4UW2A 1RKIA 1S97A 3NP5A 3DLGB 1Q8BA 4IG3B 4F8RA 1FNXH 2B43A 1X4FA 1U1RA 3M2UA 5HJYA 1U6ZA 1O8BA 1HQUA 2WB4A 4KHPJ 2J76E 2DH8A 4ER8A 1RAEB 2GVDB 2VFTA 2F65A 5IXUA 1RTDA 3BKTA 1MMNA 4X64J 3P49B 2DY1A 4N41A 5LMNJ 3OUYA 3HSGA 4PXEA 2K8GA 2E29A 3R1LA 1VRTA 2GO9A 4KPCA 4EYHB 2VBXA 4OZ5A 2FJDB 4WFYA 4YEAA 5C7PA 4CZCA 3PR5B 4DLEA 4FF4A 1VRUA 4M5HA 2XCAA 2F40A 4ZN1A 3DMJB 1FI4A 4NLWA 2HFUA 2HNDA 2QJ3A 5C2GA 2JWNA 5KFVA 1CJUB 2IDEA 4ZK7M 2HZCA 4PQUB 1RT5A 2HQGA 3LPEA 3MWBA 3NWGA 3SYZA 1R3NA 5CAAA 1T0TV 3IBCB 2XSFA 3GSDA 3KLIB 3LWMA 2Q66A 5HO4A 1CPZA 1U2FA 3D66A 1F2GA 2VFVA 3HLUA 2EXUA 1ZZNA 3LTOA 3JYTB 1QTMA 2H5JB 3DI6B 4CT8A 2KB2A 4LT6A 1VDHA 2OPPB 2YWFA 1DTQB 2WBRA 4CM0A 4CH7A 2ALZA 1RWUA 3FCWA 5AE2A 3KMQA 4IFVB 1WKJA 4LUBA 3US5A 1T3NA 2CQHA 2V8DA 2KL8A 2QG9B 3POTA 5I3PA 1RWWB 3R7NB 3SCKE 4CLUA 1OY9A 3G6YA 2YNFA 1D0EA 2AU0A 4MKVA 3J7Z5 4BC7A 1K9MT 4I0WA 3Q2SC 2OSQA 1IQTA 2UVUA 1JLBB 4HHJA 4C3KA 2HKEA 3QBCA 1VISA 1OPZA 2YY3A 2N7YA 5AXNA 5CYJA 2GJ2A 2E5IA 4XK8C 4NZ7A 3DXSX 4UZCA 4WWSA 3EVWA 1JXEA 1DTQA 2LVWA 4OI6A 4YHHJ 3CCVS 3OVAA 3R5GA 3QT8A 2RF2B 1KNZA 4XDCA 4KGKA 1U0SA 3W9HA 1IKXB 2VPWB 3KK3A 1R0AB 4NYZA 4I4BA 1R43A 4ZCIA 3S01A 1GXUA 2DGWA 2UV8G 4YB1P 4N56A 2DY9A 4ECRA 3R9LA 2AJ2A 4LR8A 4X65J 1NBEB 2G2OA 3UN3A 1YJTA 1JLBA 4ELVA 3K89A 3W60A 4DN0A 3FQLA 2MJNA 1QVFR 3G86A 3VR1A 4DCOB 2R9LA 1KVJA 2XMJA 1HBNB 2M2BA 3MFHA 4KKOA 4JI0F 7FDRA 2ZH9A 2LA6A 3W2WB 4F2RA 2WZ1A 3RRKA 1JNRB 1QVGR 2C2NA 2XG8A 2EC0A 1JMTA 2GMJA 1SC6A 3DDIA 2J7UA 1TZ0A 2I6WA 1TU0B 3RW7A 2X1FA 1TMJA 1X4GA 3AOCA 1VK8A 2Y9HA 4GO7X 4OX8A 2VDHA 4QZVB 1RT1B 3NNHA 4B9VA 2DHSA 1HQEA 2LEPA 3M9OB 1RU1A 4OV6A 2D3ZA 3K5NA 4U95A 2CPFA 4QPXA 4JI6J 1T9TA 3D0HE 2JEJA 2UVVA 3R5CA 3R27A 4OYPA 1RHMB 2J7WA 3DLKB 3LO3A 2Q3PA 2A6OA 1KHVA 4JYAJ 1RWKB 3ET6B 2ZD1B 3TEHB 3ZZTA 1RU2A 4PKDB 1RAGB 2YTCA 2DNYA 4A8WA 3DLLQ 2HPUA 4CTAB 3AFGA 4B9LA 1OJ4A 2BUNA 1U1MA 3WBZA 3TR5A 4P7TA 3J7ZT 1C0UB 1FF2A 1S57A 3BKFA 5KFIA 2B3TB 4BBYA 3MMCB 3CW2C 3FZBA 3BN4A 5HMXA 2QFJA 4F4AA 3Q22A 3AD7C 1BMQB 4DL0C 5LL6d 4YY3F 1DLOB 1VQ9S 1QSSA 3M2RA 1UVJA 4ECQA 1ZPVA 3QSYB 3HD2A 2YKAA 4F4XA 3OT9A 1GAOA 2RSQA 1IJEB 1WUUA 3BQ2A 2BE2B 2XZTB 1U02A 2Y0SD 4MMOA 1N36J 2UU9F 4NCBA 2NSBA 1K73T 1Y3JA 3HVTA 4KR0B 4XPEA 3SDEA 4ILMA 1TL3B 3O6QA 4G3IA 1WORA 1N36F 1HHTP 4H4OA 5LXYA 4DG1A 1FX2A 4ZPBA 1KR4A 2KXHA 5KFAA 2BQUA 2MHEA 4R8UA 2ASDA 1BC6A 4JI3J 4B17A 4TYAA 5E41A 1F9FA 2ZH2A 4K0KF 2P2CB 1GTHA 3SV4A 2QRRA 1FDNA 1FWLA 2GC8A 2KHDA 2V8PA 5KFPA 3M2VB 5J2NB 2RH3A 2RQKA 3DRXA 1XMOF 2DGTA 1I6JA 2PI4A 3MXHP 1YJ9S 4QU7A 2V63A 3MURP 1ACMB 4NASA 1MLAA 3IS9A 3VHQA 4WFBQ 2VOOA 3ILLA 5U47A 3UCZP 1AZSB 3IFEA 4JYAF 1A0OB 3LW5C 4DL2A 4UQTA 3QFHA 1SC1B 2BE2A 2A18A 4PXCA 2HSEB 5KT6A 3Q8QB 2AGPA 1S9EA 1FDBA 1H2VZ 1NHUA 3TWZA 3BM7A 4LBHA 2RRAA 3QJLA 3OHAA 1RAIB 5LMNF 2HMIB 2QMWA 1FJGF 1WG5A 2HVEA 4HDHA 1OSDA 2CPHA 2AEFA 3CXCR 2VDIA 2M8HA 4B3TJ 1FEHA 3H90A 3HCXA 3OTOJ 1S9GB 3QO9A 3QRPA 4NLDA 4DL6A 4DR4J 3LP1A 2C2ZB 1LWCA 3JYTA 4WU3A 1FRHA 2F5GA 4P71A 1YHQS 5DS7A 5EN1A 3U1NA 3G8QA 3GIRA 3OL9A 2DEIA 2QL7B 5T14A 1NJYA 1PAEX 2VBZA 3KLGB 3D5MA 3KNGA 3VALA 1W2IA 2GX8A 1PKUA 2AX1A 3HJVA 3HVAA 2P5VA 3VZHA 2HWIA 4IR1A 2YKNA 2NXEA 4LFCF 1JLCA 1FFWB 4RW4A 4CNZA 4ES1A 5L46A 2KFNA 2BJ1A 2GQQA 2YWHA 2EFOA 1Q82T 3BF4A 3CMES 2CQCA 1JLEB 1KP6A 1RKJA 5I42B 1FXLA 5HMWA 1K1QA 1QAYA 4K59A 4Q8FA 1VQYA 4F3QA 4DR1J 4DSLA 3VAGA 1BQNA 4ZIWA 3FEYB 3I32A 2XZWA 3A8EA 4M63A 4P6QA 4QOTA 1B0VA 2IM1A 3EYZA 2CQGA 4YB7A 1RBLA 2PFFB 3DU5A 1CJKA 1U1PA 1H72C 3QMQA 4PG4A 1WI6A 2QN6B 2CPIA 1DJ0A 1RTHB 5K8MA 3CT9A 2G2ZA 4J9MA 3GV7B 3JSMB 4WE1B 2HQ3A 3FRZA 2IM2A 1S7HA 3M6WA 1RTJA 3RJMB 4DI6A 3E01A 3L9ZA 5B0DA 2KT2A 1VQ7S 4Y2CA 2NLWA 3I87A 4IQXA 2W8KA 4LF4J 3BR8A 2YXLA 1U0HA 4JOUA 3PYEA 4TU8A 1URRA 4BWJA 3UNYA 4CLZA 1N5VA 5SZTA 1QDUB 1F2HA 2HS4A 3QNWB 4HT5A 5D77A 2KM8B 4DS5A 2C2RA 3T1AA 2VA3A 2F8HA 4ZCLA 3RYLA 4NLPA 3DXBA 3J80U 3MMJA 4UY85 5KFMA 2VBYA 3PW2A 3W63A 4RR5A 1D1UA 2ZJPQ 3IN5A 4K5SA 2R7UA 4P10A 1REVA 4MKBA 4WFNQ 2HZVA 2FHOB 2AV5A 1GT8A 3VCDA 1APSA 4DCPB 1S1WA 1TFYA 2HHUA 1U47A 2EFNA 2LCWA 1FRMA 5F3ZA 3MTKA 4JI1F 5J1PA 3H7HB 4ZN3A 1YZ6A 2ASJA 1IKYA 1JLQB 3R7BB 1D8ZA 1FWKA 3MEDA 3IGVA 1P8GA 1KLMB 2XY7A 3MM5B 4FYYB 1G2EA 8ATCB 1FHTA 3QWUA 4RW8A 3P3DA 1REVB 2NXJA 2DBBA 2VPZB 4ATNA 1SIWB 2PDAA 3KK2B 1PSDA 4U9RA 2AW0A 2DVIA 3MMBB 3KLEB 1YJRA 2ZKUA 4ALZA 4ZHRB 2ZM6J 1M0SA 2WVDA 5KFUA 2W9BA 4I64A 2YX7A 3C16B 3M05A 2XY5A 3UD5A 1DURA 2GW8A 4FDFA 4DLGA 1VIOA 3J7YU 3CDEA 1L3TA 2QMUB 4ZVFA 1NSKL 2BOAA 2CJBA 4A8QA 1FT8A 5KFFA 2E5LJ 1UWBA 4Y6IA 2OFHX 3K8VA 4CDIA 3OUYB 3KHGA 2QGFB 1TL7A 1UEVA 4OI4A 5DQIA 2XHCA 1CC8A 2YWGA 2XI3A 4KE5A 2L3MA 1HD0A 3G6ES 4DR6F 1FA0A 1HWKA 2IJRA 2W9AA 5DQHA 2FVQA 1OY6A 3A4TA 4PAAA 4BHQA 3GFZA 2QA4S 3KNAA 1YBUA 5IQ6A 4OI3A 5AXMA 5A8WA 1IBLF 4C8LA 3V4IA 3GZ7A 5E5NA 4JI4J 1B70B 3QPIA 2XC9A 4V19J 2I9SA 3TNVA 1Q0NA 1OPIA 4Q2LA 4RNOA 1DRZA 5KG4A 3MOJB 3QGHA 1P27B 2JRSA 1XMBA 3I0RB 2IFXA 3A1YG 1XK8A 3KLFB 2CZ4A 2QC3A 3K57A 1P6TA 4WP8A 1T9WA 3EX7B 1SV5B 1Q7YT 4DUYJ 2NXUA 1CJTB 1MG7A 3KFWX 1FNMA 2FJEB 1TUWA 4FKYA 1EHWA 4OLPA 3UDCA 3PHEA 1PGZA 2DPJA 2O3DA 1AW0A 3TQEA 3QIDA 2OPQB 3BJYA 5C42A 1DY3A 5KFKA 1QLNA 2GZOA 1VS3A 1FD8A 2W7AA 2XYGB 3HKWA 4UTGA 4AXIA 2LQ5A 3GV8B 4F0KA 3QYYA 2ROPA 2WSCC 2WSEC 3ILJA 3BYRA 4DV6F 4YN3B 1GFWB 1S77D 2ZZMA 3SXLA 1S10A 2YQ0A 1UFWA 4IO1A 1U45A 4C8ZA 1HBOA 4CLSA 4O0NA 2PC6A 1IQZA 3DOKB 3PG9A 2KJWA 4X4RA 3HT3A 1K0TA 2EBGA 2OHDA 1QTNB 3JSBA 4N47A 5ADZA 1BQMB 4JI8J 3OVBA 1DBDA 3W5ZA 3H5YA 3V6HA 4X4SA 5CHCB 1JLCB 1PBAA 4EBEA 4KTQA 2ZDOA 1PO6A 2DIUA 4ANEA 2DPIA 1NU4A 3DC2A 1QE1A 3IWXA 4NWBA 4WK3A 4A8FA 2OSRA 1L5UA 2VG6A 4KAIA 5D78A 5ETQA 5ETOA 5HI7A 4NMLA 4TLRA 3FRYA 2HK2A 2CQ4A 1G6BA 3DOKA 4LF8J 2AT1B 3KLIA 5KFYA 1IWAA 3MR7A 2VQEJ 2BJ3A 1KC8T 1NH8A 2YNHB 4DUZF 4K7QA 1FVSA 1HHQA 3FJ2A 1ICEB 1Y00A 3FSXA 1IKWA 1OIAA 3K5MA 1FD2A 1U09A 1BQXA 1XWLA 2YBVA 3HDSA 3L7PA 4LIWA 4JV1A 1URNA 4FKXA 2XBPA 1WC5A 2MZSA 2ZKTA 4GO5X 4AT1B 3KOAA 1AFJA 4QW9A 1SUQB 3OQ2A 3H5SA 3W8PA 5LXRA 1SXLA 1TR0A 1NK4A 4DQIA 3PIPQ 3HKZD 1TL1A 2FZCB 4DJBA 1D8YA 2QA2A 1L3UA 4B9UA 3SQGA 1FJCA 2BE9B 2A2DA 5A6PA 4LF4F 3ZZPA 1U1NA 3CULA 3WDOA 2X51A 2V8HA 2UUCF 4DPXA 2MGZA 1QD1A 4FNIA 3TAPA 1Z2LA 2RQ4A 2YKMA 4EUVA 2N3OA 4K4SA 1D09B 2D9OA 3MM9A 1S1TB 3FBEA 2G4BA 3MR2A 4MIAA 1S79A 5KFHA 2AF6A 4AL7A 1N0UA 5A8RA 5H9FJ 5CCLA 4PG8A 4DR5J 4ED5A 1C2PA 2DGOA 2QIFA 3LP2A 2CZ9A 2MQMA 4GVBB 4DV3F 3A8IA 4GKKF 2VL1A 3GFYA 2BE7D 4LF2A 3DOLB 4CO1A 3M2RB 3NGTA 4DV2F 1HKAA 4QWBA 3PW0A 2FY1A 1DTTA 4K4UA 2DKOB 5CD4H 3H42A 4ERDA 1WACA 5ETMA 2IRUA 2GIQA 2VQFF 3IWNC 3IGNA 4PYDA 4MK8A 1IKYB 4L6V3 2AGQA 1G7CB 1XR7A 1NSPA 5GAEI 1R31A 3LGMA 5J1EA 3Q8SB 3QGIA 3AOAA 1C1BB 1S1UB 4NLVA 3TA1A 2RQCA 3FSIA 5T7LB 3VVTA 6FDRA 4X62J 2MZQA 4MKYA 3QIPA 4WFZA 1T3OA 1F9HA 3AH6A 1AT1B 2ACMA 2MYFA 3IWLA 2DD8S 2MLXA 4FZVA 2J0WA 3S6EA 4DU8A 5IV4A 5DQGA 2WTFA 1U1KA 2KZZA 2JDJA 5A6WA 4TQRA 2FIUA 3HPOA 2ZNZA 1RT1A 2EVZA 3PDNA 2DGVA 1R8HA 3QSIA 3O44A 4DUZJ 4U7CA 3T5KA 2VBWA 4N76A 4DL3A 1HNWF 2W2QP 3IA0A 2RIJA 1C0TA 1RAOA 1UZDA 4KT0C 4WPAA 5FDLA 2EFGA 3TZWA 5IS2A 1T05B 2IRXA 4WZQA 4OIXA 1NZAA 3P5BP 3CD0A 3BSAA 3OL6A 5DM6Q 2DYAA 3NWRA 3NOGA 4R0EA 4RBTA 5H1SV 2GIRA 4B9MA 3OFFA 1S59A 4ECTA 1WEZA 3A12A 4J91A 4OZNA 4LVOP 2DEJA 2M3DA 3OR1B 4ZP7A 1RDRA 2JJ4D 3HHNB 2Q6CA 2UUBJ 2NPIA 1VMBA 4DDFA 4DV1J 5LSOA 1WG4A 4M5LA 3UVJA 1N33F 3W2VB 4OJ1A 3OD2A 2H4YB 4MK7A 1N52B 4QR1A 5HATA 5A8WB 1TUGB 1SL2A 3AHPA 2NQPA 1EQ0A 4G65A 4DCJB 3KYLA 4QPTA 3TUJC 1SPBP 3JSRA 3TZZA 2W24A 5B0CA 2KH9A 4F02A 3TZXA 5B08A 3KHRA 2DGUA 4P2SA 4ECVA 3RW6A 3U1LA 2OTJS 2ZHBA 2GA7A 2ZBPA 5LT5A 2ZH3A 2OIHA 2WW8A 2HRYA 3HVTB 1OWXA 1VYAA 4RW9A 1XERA 4ANCA 2HFNA 1P9YA 4P2XA 4O3NA 2ZH1A 4UOFA 1LWEB 2JFKA 1X4HA 2B9YA 2PMHA 1BQNB 2M5YA 3C15B 3E51A 1N5SA 4M5NA 3UCGA 4ZP9A 2MKJA 2WVCA 4EI2A 4YY3J 1OSCA 2W4DA 2AWZA 4HACA 4X4TA 3C14A 4JV2A 1HNWJ 4KGVB 5FLXU 1Q53A 3CCWA 3GLJA 1DQAA 2BJDA 1CJKB 2BV3A 1S6PB 1HWIA 1X60A 4JP8A 4KGZB 5IV3A 3UR0A 3CTRA 5KT7A 4ED3A 1YI2S 4PWDA 3S8SA 1GTEA 4RNMA 4LSLA 3CD5A 1VRQC 1NK5A 1RZMA 2ZITA 3EVOA 2R7RA 1SJ1A 3LANA 2B5JB 2GCFA 4DV6J 4U8YA 1SJ3P 4A8YA 1N6QA 3C6TA 2NSCA 5M2PA 1P9QC 4PXDA 1KQSR 1L3SA 4LF9F 2PA8D 2JEFA 4E8UA 1YITS 2MY8A 1XTZA 3MDFA 3QGGA 4WBFA 2M8DB 4K2XA 2YPYA 4X2BA 2FZGB 4LFCJ 2RS2A 2QSFA 3B4MA 3ZTQA 1HNVA 4ED7A 4F25A 2VJUA 1VQNS 2R8JA 3IC1A 4ZP8A 1YRXA 1S0VA 3K7RA 2HBRB 4ZVOB 1HWLA 4WKYA 1SJ4P 1UPMB 2A10A 2YNIA 2ADBA 1H98A 2GGPB 2OEMA 3UE2A 5D8HB 3LP0A 2B4PA 2GVDA 4WK1A 4YHHF 2C3MA 5A0YB 3DRSB 1N6QB 5H9EK 1ELOA 3HULA 3M9MB 5EGYA 2QL5B 1M5SA 2HEKA 2A0FB 2DITA 4YR3A 2ZM6F 2BEFA 4LF8F 3NMRA 2KFZA 4B3TF 4RZRA 1PJ7A 5B09A 3T5JA 5IM0A 4F3OA 4NX9A 2EFQA 4DPUA 1F5AA 4WU2A 2E1AA 1AUDA 5G0RB 2XO7A 3NMAA 3BZQA 1YBAA 3D1HA 4OZ1A 1RHRB 3RBZA 1D3WA 2MQ8A 3L7OA 1TL1B 3TANA 1ZH5A 2FB0A 2BXJA 3W5XA 2QA4G 4DPWA 3Q86A 1YLXA 3HF5A 4FPRA 1NDLA 4DEZA 2ZBRA 1Q8KA 4MH8A 1S6OA 4KSEB 4HTIA 3CEDA 3DGPB 3ETMA 2E5HA 1MU2B 1FDAA 4BDPA 1SQGA 1W25A 2KI2A 4B08A 3HVRA 2UVRA 1KN6A 4U7UD 4ID8A 1JKHB 4DV4J 4K4YA 3ZZYA 3U7JA 1VHFA 5BYRA 4WFAQ 2V6AA 1YVFA 4MTPA 1UVLA 4LRFA 2D41A 2J9DA 2HS0A 2NYHA 3DRRA 3I5AA 3MR6A 2ZC3A 3G6XA 4MAKA 4K4VA 1UETA 3FBBA 1LFWA 3N79A 5KG3A 5KOWA 3K58A 4DV5J 5JVGQ 4UOHA 2OPSB 1LOUA 4OZ2A 2DCUB 4A4JA 2FUG9 4O0IA 4DV1F 1DQ9A 2GHPA 1SCJB 2UU9J 1HW9A 3UR3C 2F4VJ 2Q43A 5IT9Y 4I68A 1EP4A 2I0XA 2EFVA 4K8RA 3CVKA 3NCQA 4QWEA 1RAFB 3EXYA 3NGUA 5K8PA 1KS2A 3K5LA 4RW4B 1KFSA 2J6UA 1V9OA 2IA0A 2N4CA 3BPDA 4HI1A 1S0OA 2Z4PA 4ZLPA 4NEZA 3HP6A 1SUQA 5E3AA 3KJVB 4OX9F 3BREA 3N0VA 5KFDA 3M4XA 5I4MA 2KT5A 1KOHA 1JXLA 2QTWA 2ZOGA 2J5AA 4FNHA 5G4DA 4DMZA 1HBUB 1UKUA 4RNHA 4OI1A 3HFKA 3QZ7A 4DV0J 3T5LA 1WEYA 2JX2A 5IQQA 2VG5B 4CO2A 3KJNB 2OTLS 1N8RT 1KRPA 2CAJA 1V3ZA 3HSJA 3Q8YA 1FKPA 3QT7A 4KKOB 4RW6B 1KQFB 4JI6F 4CLYA 4PXBA 2E9RX 2V8VA 4LF5J 2ZBIA 4N77A 2RRNA 1HNIB 2CPZA 1R6VA 2B6AB 1F9EB 2LDYA 3O2IA 1QUVA 4PZVA 1N32F 2ASLA 4OJGA 1UAWA 2E5JA 2HS3A 4H54A 3TW0A 1R8BA 2PE8A 5J1NA 2FLLA 1DTTB 1V3RA 3R8YA 3JSYA 4EO6A 3SCJE 2MLZA 3DOMA 4PWWA 2BR0A 3EZUA 2AYMA 4GMKA 3A3PB 3GJQB 3L7UA 5ETTA 2D69A 2VC1A 1SKWA 3RG6A 3WX8A 4ZVUB 2DXFA 4AL5A 4IG0A 4DR5F 2IC3B 5KG2A 2HVIA 2LQ9A 2MMYA 4RW7A 5L1IA 2NREA 1HD1A 1V5IB 3ILIA 2BW7A 4YB6A 1BGXT 2WOMB 1KQGB 4P73A 1REGX 2VZ9A 3M32B 1N32J 2OMLA 2R7XA 1HNIA 2MTLA 5CYQA 3LAMA 2W01A 2Z56B 4J9LA 2Z58B 1YZ7A 2H54B 2IA6A 2W2PP 2KG1A 1CULA 3MMAB 2BANA 1NHVA 3H2LA 4KH0B 1GH8A 2C3UA 2R3VA 2RHSB 3EVMA 4TYBA 5HANA 4U7UK 5BXIA 5KFTA 5EWFA 5D0EA 1RAAB 2HW3A 1DAXA 3GONA 2OELA 4Y65A 3ZXWA 6AT1B 4A8MP 4WYLA 1J5EF 2XS2A 2Y8WA 4USKA 4RPFA 1BXNA 2XMTA 4F4YA 1TK8A 1JLGB 2BOPA 4P9SA 1TKXB 2IRYA 2PMWA 3ZC4A 1CQMA 1NAQA 4B3OA 4ZPAA 1HI0P 1SV5A 4B9NA 2B5JA 2F8EX 3ULHA 4RU9A 1FDDA 4O44A 3SSSA 4CNYA 4IO9Q 4H4MB 4I2PB 4RO0A 5D6GA 1T9YA 1F0XA 1B99A 1X4DA 2NUHA 2BANB 2XMKA 4FS1A 3RRHA 1XNQJ 4Y00A 4ELUA 4CQ1A 2JZ5A 4F36A 4CCHA 3G4SS 2DNKA 3B8HA 4P2MA 4DOZA 3BH7B 1J5OA 4P52A 3C66A 3G2XA 4EGLA 2I38A 3V2UC 4EMDA 3AA9A 1X9SA 5KFEA 3DLEB 3ENAA 4DR2F 1WC4A 4GKJJ 2CWXA 2WVEA 2YKQA 4NLTA 4NXMF 2MZTA 1M1GA 1C4AA 4TLQA 1AUSL 2ZOFA 2Z2ZA 3MM6A 1KLNA 2KZMA 2CQBA 4RLEA 1KSPA 4WTOB 4NXMJ 1S12A 1EJ7L 2F9JA 3JQMA 4ES3A 3PRBA 1O0PA 4OZLA 2Y1RI 3GJTB 3D0IE 4NA1A 3J81Y 2BJEA 5THWA 3IAS9 1RTIA 3DGVA 3GV5B 2W25A 3N5FA 4ED8A 1DZ5A 4NYOA 2YQ1A 4HEA9 2ZUAA 2RE1A 2DR6A 4KFBB 2XEXA 2GVZB 1FFSB 1S1VA 2RVJA 5KFSA 1N5YB 3G96A 3IMQJ 3M8SA 2H51B 2J9CA 3NGKA 1VQKS 4ZVSB 2Y3YA 4KGMA 3NOCA 4QR0A 1HQUB 1X0PA 2HGMA 3D1OA 2GMHA 2V4RA 4O3RA 2H3EB 2RUSA 3MEKA 3GQCA 1M5VC 4ZITA 3SDEB 4AQYJ 2BVZA 2HIYA 4NYPA 4QIWD 1S48A 1VGYA 2CQ0A 2GJFA 3TX0A 4IR9A 2FJBB 4O4GA 1ITPA 3BGRA 2FGOA 2ZVSA 1SJRA 1NCLA 4XTTA 3W61A 5L39A 5F8GA 1RJJA 4C0OC 2QT7A 2MZRA 5C25B 4IDKA 4EO8A 1VRUB 3MUVP 3MZIA 4USVA 4URSA 2CPDA 3RB3A 1U1LA 2CG4A 2DNLA 2IBOA 5HVFA 1RT2A 2DRBA 4J9VA 1RT7A 1HBNA 1QJHA 2PMZD 2R8KA 2PI5A 2ZFHA 1F3FA 3TVYA 1Q95G 2NCKL 4NLYA 1S72S 1JJHA 1IBCB 2W4CA 3MCNA 4HH0A 4J90A 3H4BA 4C8NA 3HMJG 4GVLA 1GMUA 4QR2A 1M5PC 2FLPA 1ZM4A 2OD6A 1UA0A 1WSVA 1HIYA 3ELHA 1HQEB 3ZTOA 2Y1IA 2CNOB 3EMTA 3IG1B 3TAQA 1JK9B 5IWAF 3IM8A 3T1YJ 1RCOB 4O3QA 2RRBA 1E6VA 1SQFA 3MI7X 1TV6B 2K2PA 1NK0A 1N5TA 3T3FA 3LP1B 1NK9A 4IRKA 2C3OA 2OFGX 3M8ZA 2ERRA 1HR0F 1U2CA 1VQLS 3UN5A 2D1CA 4C8OA 3QFWA 2V4JB 2RS8A 1YDLA 3U27A 4D3GA 4IUFA 1ZA1B 3AOBA 4NOHA 2HHHF 3A13A 4NCGA 2IM3A 2JLGA 1VQOS 1FKAF 4C4WA 2IY5B 1FKPB 4AFFA 2MSTA 2YKNB 3MM7A 1UJ4A 3PJXA 4ETXA 3DRPA 3ZZRA 5LOQA 3H40A 3IR7B 4OI2A 1UVMA 1D9FA 3T6JA 5FLXY 2B51A 3HZGA 8RUCA 2VF3A 2N7CA 3HFZB 4RU2A 2XS7A 3BEGB 2HGNA 2ACYA 4ED6A 2E9ZA 1TFWA 4PWDB 2IIHA 3OV7A 5HQMA 3W9JA 3Q8RB 1S1XB 4HDGA 5DDPC 2KG0A 3TUPA 3H25A 3MECB 3V6KA 2EEYA 1UVKA 1U2RA 2JNJA 3CJQA 5GMEA 1XR5A 1C1CA 2QA1A 3CCUS 3CO0P 1F60B 1AA1B 1RT4B 1NDKA 5F8MA 2CJKA 2C1EB 4M5GA 4M5DA 3CCZA 3MAAA 3LOUA 4F26A 5A8RB 4A48A 1CQNA 1NZ8A 2RKIB 2HWTA 2J9DE 2KDOA 1O5JA 5AJ3J 4YDDB 4PABA 2ROGA 1RB0A 3KK2A 1XNRF 3EGZA 3D3CJ 1UA1A 3AJ2A 1KVIA 1IBMJ 2HQFA 4O3OA 2RB7A 5HK4A 1B4SA 2VICA 4WF9Q 2ZUGA 2KM8C 5HLFB 4QIVA 4Q44A 2C28A 2AJFE 3G82A 4N8NA 4JUZA 4O4RA 1Q78A 3CCSS 5J2QB 4DV4F 4C8YA 1RXOB 3OBIA 2X1GA 2MKCA 3IRXA 4M5DB 4OL8A 4NZ0A 4ZVRB 1NEEA 4RNNA 3GIJA 2XSJA 1FE4A 2VHGA 3EPGA 3QWPA 3GR0A 4K4TA 5ETRA 1GEHA 3ISZA 4D3HA 3SSRA 1RYSA 2FVCA 2NUUG 3CC4S 2NXNA 3BGFA 4H4MA 4I2PA 1MMLA 3T41A 4FXDA 1K0VA 1PYTA 3FBFA 1VQMS 1NB7A 1S7IA 3MEGA 4DUTA 3D7SB 5DDQC 1SB6A 3OL8A 5HLFA 1RISA 1QSYA 1JQGA 5E3CA 1BD6A 3PJ9A 2H5IB 1JLAA 5A76A 3MEDB 5KFXA 3KTQA 5KG6A 3IRXB 2YNGB 3IXQA 5L38A 3BBCA 2VH7A 4DV2J 5IFMA 3V6JA 4FF1A 1EIYB 3EGWB 1YJ7A 1X5OA 1NJZA 4FF2A 1NPRA 2BX6A 2GNKA 4MJKA 1WJ9A 2C2MB 2IVMA 2MJUA 2WHOA 5CCMA 5HL7Q 2MKYA 3C46A 2O01C 5LJ3Y 4YDXA 1X7VA 3J7YI 1PJ6A 4O3PA 1M90T 3NNCA 3TO8A 4X4VA 2IJFA 2XZDB 3TARA 1P1LA 1FJ7A 1ZM2A 3EZ5A 1VLYA 4CIOA 2VODA 4X65F 2GJIA 4CT9A 4QU6A 5KT4A 1X4AA 2B0GA 2MKIA 4YQWA 3HK2A 2DNZA 2N3LA 3T6BA 5C2CA 1N5YA 5K5MA 5D0RA 2F9DA 3K5PA 4AE5A 1UL3A 4PG5A 3ZNJ1 2GGPA 3VAFA 4EZ9A 1NLKL 3BBFA 1IM6A 3I5BA 4LR9A 4RBVA 5EX0A 5M2RA 2V50A 4RUHA 1RACB 1HW8A 5AXLA 2C3YA 1LWFA 4B3SJ 2DHAA 3CGIA 1N88A 3TUIC 4B9TA 2G2YA 4RUAA 3WIVA 3BGRB 3PNIA 4QBUA 5JVHQ 5LMUF 1RBAA 3OFEA 1BWEA 2B8QA 1B3TA 2D9PA 2RDDA 1UZHA 3CD7A 2GAGC 5G0RA 5KFCA 3I4PA 1EETB 3O3LA 1RAJA 4RUBA 4HYKA 1TL5A 2HQIA 3LH2S 5C24A 1RWMB 1M5HA 1RT7B 2MKSA 3P8BB 4TY8B 2HAIA 1Y10A 2XWYA 5L9NA 2PA3A 1H0HB 4C3MA 2UP1A 3AXKA 3I0SA 5F41A 3H4DA 4P72A 3UO0A 2E44A 3H98A 4PG6A 3IP0A 3HZEA 3L3CA 2BBEA 4NZ6A 3HHDA 3BGOP 1T94A 2BW2A 4PG7A 1RK8A 2ZNYA 3AD9C 1FKOB 1TMMA 3JTOA 4EU0A 3FMWA 1VQPS 2NZ4A 3CJ3A 3J7A1 5H9FK 2D3OR 1U24A 3DRYA 4RUCA 3O5TB 3JQJA 4BCAA 3QGPA 2V0NA 3PW5A 3JB9k 2DO4A 1MNEA 3R6GB 2E66A 2UUAJ 4U8VA 1MWQA 1UW9A 1WWHA 5CZXA 1T03A 1CSJA 3K5OA 3OLBA 4QJVA 4URQU 4JI5J 4DQSA 4PUOA 2PT0A 1X31C 3PHTA 2HVDA 4IH5A 4L73A 3MD3A 1NH7A 4JI4F 2WW4A 2I1RA 5KFGA 1XMQJ 1RTZA 3EJMA 3GYNA 3RGIA 3SZ2A 4DR3J 1NRKA 1VK3A 5B0EA 1N56A 3FFIA 4ZJLA 1NPKA 1YRUA 2IPOB 4Z7YA 1HL6A 2ZJQQ 1T9XA 1KQKA 1XBWA 3HT0A 9RUBA 4C8KA 1S9GA 2JOQA 3QO9B 2VG6B 1JLFA 4OX6A 4LF7J 2MQLA 1YGYA 2CJQA 2RDIA 1B64A 4LVNP 3QAUA 2XMWA 5B7WA 4LJMA 2QV6A 2HFOA 5GAGI 1HWUA 2VJVA 3FEZA 2AZ3A 3M6XA 3ISND 1NKEA 4EK2A 4MT1A 3M6UA 1JX4A 3Q8PB 3DU6A 2JC1A 4G1QA 4OX7A 1FVQA 4LRBA 2LXIA 5GAGU 1FJGJ 1K8AT 5DO2A 4PWUA 4HACB 3M1VB 2XLJA 2DNRA 3OXLA 3R6LB 1CJUA 3PR4A 1HBMB 2ZBCA 3F41A 3HSDA 3VGTA 1E6YB 3NAHA 3ONQA 4M5KA 5K14B 4I2QB 3R2CJ 2XYPB 1RWXB 3WX4A 2NXCA 3J81j 3SFUA 2AKWB 2FJAB 1TL3A 3R1HA 1SKRA 2HHQA 5EWEA 4MK9A 2ZZTA 3FMBA 2A6MA 3MM5A 4DR2J 1ZA2B 3DCAA 1BWVA 1LW0B 1PYOB 2BJ7A 1LW2A 3DRPB 1ZZFA 3GPAA 3M32A 4CLKA 4J9RA 2EG1A 5C5JA 3OVSA 2IDLA 2VPYB 1ROFA 4N5SA 1ZM9A 2M70A 1TKZA 3BGLA 2OD4A 4C2MA 5DLFA 2C2EA 2V68A 1S49A 2MB0B 2LU1A 2VG7A 2POKA 1XNRJ 2R7VA 5CXTA 3LWLA 2IVYA 2HNZA 4UUXA 1R89A 2OEKA 1TVRB 2VKRA 2R7WA 1ZTWA 4Z2XA 3IAM9 4R5PA 3CUNA 4JV5J 3JTNA 3C2PA 4RWXA 2JHEA 5FIIA 4UF4A 3NGRA 3HD1A 4DQRA 3OL7A 1YKWA 3KUGA 4FVMA 2EI5A 4O4GB 1TKXA 4ZCKA 2BYCA 2ZE2B 3V6DA 2OMOA 4FYXB 1X0FA 3WQPA 1WF1A 3A3OB 1NSQA 4CLTA 4ED0A 1EX8A 1IUJA 2BJ8A 3CCES 3HHLB 4W4MA 5F9LA 2ZHAA 2DISA 1RT6B 3LUYA 3BDPA 1WC6A 4OHVA 3BR9A 2UUBF 5KFOA 4Q43A 1V5VA 1SI9A 4USUA 2J6TA 4DR7F 3FKBA 4Q7AA 3RAXA 4HHUA 1U8SA 3HHEA 1M1KT 3C14B 4DPYA 4LFBJ 4JV5F 1SC3B 1LNQA 3G82B 4FVCA 3X1LB 1GXLA 3PYGA 2L41A 4ZPCA 1Z2ZA 2C2OB 3C6UA 1JJCB 1SKSA 2PEBA 3KG0A 3OLAA 3UCUP 2R8GA 2G1DA 2MEWA 4YMEA 1PC5A 2JLFA 3F73A 3GJRB 2F1FA 3CDBA 3PM9A 3M2VA 3UWTA 1V6HA 3Q24A 5J2NA 3OPKA 3D6MB 3CJ4A 4ID5B 1DARA 4ZDNA 2QX0A 4NLSA 2FVRA 3SQGB 1J2VA 2W9CA 2Z30B 2P9GA 1AZSA 2Z0GA 3A3NB 3PFEA 4ZPTR 3OXGA 4OQJA 1U4BA 3D28A 3FCHA 3Q89A 5L8RC 5JMNA 1SQEA 2I8EA 4IQMA 1N5QA 4KFBA 4K2JA 5KT5A 3NAIA 2MDAA 2KYZA 2HIQA 2O67A 3MEEA 3F44A 5CABA 5IT4A 2V4QA 1LFPA 2D3UA 2OI2A 3PYDA 4ECWA 1Q5VA 2NPFA 1RADB 1TKTA 2R4FA 4EYIB 3JSMA 1NMEB 4LF1A 3POTB 3O8WA 1RCXB 2Q79A 3DLHA 4IRCA 4DSFA 2BM1A 3DOLA 3ZFVA 1F1BB 2ZH8A 1JIHA 4ENOA 1NK6A 4MYUA 4LSNB 3IR6B 4C98A 1ZBTA 5HBMA 2E1RA 1C0UA 1TTHB 5E0OA 1DFDA 4U96A 1Q79A 1EAYC 3NCRA 3MM8A 4IDKB 4NI2B 1B7YB 1H7WA 1KWMA 1QE1B 1WDTA 3DM2B 4Y2MA 2R8IA 5DGAA 4WKRA 2HVZA 1FX4A 1T9VA 2FC8A 2VASA 4IOAQ 2XMAA 2NR0A 4E98A 3GFXA 2N4DA 3T1YF 2EG2A 1C1BA 1S1UA 3AODA 3HM9A 3MAAB 4LF7F 2R7TA 1Z4UA 4F4ZA 5BJRA 2E7VA 2JSXA 2KHCA 4KC5A 3T1HF 2MSSA 7FD1A 2J6SA 4ECXA 1BE4A 1O51A 3F56A 1CS4B 2FDNA 4HR2A 2F4VF 4RX6A 2UXCJ 5HQ8A 4LSNA 2YVSA 1NJXA 1KTVA 4LRAA 2DRAA 4EBDA 1PBUA 5C42B 1MW7A 4J9UE 2QO3A 2LA4A 2YH0A 3W66A 2VV5A 2IVFB 6FD1A 2KJVA 2R7QA 5KFRA 1TELA 3CPWR 3BPSP 1IJFB 4OZ0A 1JLFB 5C24B 5J2QA 2DGSA 3ICLA 2HQDA 2CQPA 2W4PA 3GG1A 3R2DJ 3W2WA 2RJZA 2X1BA 4X4PA 1X4BA 2CPEA 3M7VA 2CYYA 4L75A 4YR2A 3PFOA 1I5OB 5CQGA 1HFEL 2BJ9A 3RBDA 3JTPA 4TVAB 1HPZB 1X8DA 3ZO7A 3SMZA 4K0KJ 4NRTA 3VAJA 1A7GE 1FKOA 1H74A 1G4CA 1Q7LB 1WHYA 2W9BB 4USJC 5BYQA 4TNOA 1TK5A 4TU9A 4UY8T 1PYSB 3HHKA 4IFVA 4CO0A 8AT1B 4KHRA 3M1VA 5E2QA 1BY9A 3QJJA 2DNMA 3PYFA 3H2UB 3H59A 3M8PA 3DLGA 5HMYA 1S6QA 1NKBA 2RU9A 1JLAB 1UP1A 3CCMS 3CO9A 3MHYA 2AYBA 5ETLA 2CDRB 3VGUA 5E33A 1N0VC 4LMZA 1YQHA 4CLLA 3CCTA 3CSKA 1VHIA 2CNLB 2U2FA 3T9NA 1WG1A 3EE3A 1WHWA 4ZVHA 5J2PB 3FEXB 1H73A 5B0GA 4QYRA 1NHKL 1PJ5A 1S1WB 4IYQA 5IWAJ 4EZ6A 1VOMA 2JL9A 2ATCB 3IG1A 1AYEA 2YX4A 1WOPA 3PTWA 1R8CA 3U1MA 3PIOQ 4JBCA 3MUTP 2R2TA 5AE3A 2WONB 4JV0A 2XY6A 2XLIA 1WD6A 3BSCA 4FPIA 1JB0C 1XN9A 2OEJA 4DFPA 4KJIA 5ITHA 5K8OA 5DDRC 3H2VE 4NLXA 4OYBA 2BZ2A 5IC6B 4OHWA 5MAOA 3PZPA 3DFEA 1SL1A 3FUYA 1RYRA 2UVWA 1YRTA 4FS2A 1GX6A 2W1BA 2W2MP 2FZKB 2PEHA 2WVFA 2YWKA 2A1BA 3C6TB 3CJKA 2RDJA 1TK0A 4CM2A 2CFXA 5A8KA 2W2OP 4U6PA 3C8YA 3GG0A 2CA9A 4HKQA 3MPDA 2OPPA 4NE9C 3BO3A 5L1LA 4J9OA 4GKKJ 4L72B 3GYGA 3LP2B 4GVBA 2HURA 3TQ1A 1EKRA 1N34F 1Z1ZA 1RBOB 1RT6A 2J9EA 2IMWP 3KJVA 1RHQB 1WOSA 3ZTPA 4MFBB 1QSLA 1WF2A 2KFYA 2E7XA 4OI0A 1EKSA 2DO0A 2XWXA 2CPXA 4G1PA 2DXEA 4G6VB 2XS5A 1MWZA 2DT9A 3GMGA 3K8WA 3JXOA 4W98A 3CJ8A 3JAMY 1VBYA 2UUCJ 1B7FA 3LF0A 5KOXA 1QM9A 5KG5A 3QAEA 2MY7A 2CZVC 4OHZA 2HNYB 1UWBB 3J81U 1C1CB 2BA9A 4MYTA 4NLUA 3BYPA 1Y5LB 1KKHA 2JLEA 5D4OA 5DJBA 3KMSA 4EEYA 3TI0A 3CJSA 1IN0A 4DHVA 1Q81T 1EB0A 3D1QA 3KJQB 4URGA 2DR8A 2ZD1A 4LRDA 4ZMMA 1DQ8A 5C25A 5F8HA 5LSRA 2R2SA 4DFMA 1WEXA 3CJ5A 4HI2A 1W26A 3PEHA 4X4NA 3M8YA 1I94J 5DGBA 3G87A 4B02A 2ZOMA 5BYSA 2H9ZA 1Y9OA 1LWCB
chains in the Genus database with same CATH topology
4BC9A 2NS1B 1HNZF 5GVQA 2WAQD 4NA2A 4JI3F 1MWYA 2RMLA 2ZH6A 4J9PA 2FVSA 1MU2A 1JLQA 3ZZ0A 2G0CA 2B56A 2J0XA 3AB2B 4LF5F 4Y34A 1L3KA 5T41A 3KLFA 2VKZG 3GILA 2AP6A 4H4KA 3ISNC 3UI3A 3GB0A 2FJVA 2K1RA 3TX8A 1LQ9A 2LQBA 4K4ZA 3PV8A 3AQPA 2KXFA 4I6AA 1WHXA 5CYMB 4ZHRA 4QIEA 4C97A 3RAMA 1SH0A 5HBMB 2G9OA 1GQEA 2DB1A 2FPHX 5EUHA 4R25A 3P6YC 4IFYB 1FRKA 1Q16B 3MEGB 4ZS6A 1NNDA 4ZPDA 3V81A 3Q2TC 3TRGA 4FYDA 1HNVB 3MPWA 2ZC4A 3NG8A 1CG2A 2HHPA 4X62F 4G1IA 2GHWA 1QUPA 2YNIB 2HMIA 3MR3A 2XMVA 1FERA 1D9DA 1ZM3A 3OR2B 3RTVA 1SH2A 4MIWA 3SV3A 4NRUA 3SCIE 1CC7A 1OS5A 5CH7B 3FDSA 2W9CB 4A8KA 3M8QA 2C2DA 2W8LA 4J9QA 3HHLC 3V4IB 4DWIA 3PEJA 3GIMA 1ZYQA 1CVJA 3OSPA 1TAUA 1WTBA 4IKAA 2QSWA 3KHHA 3E3XA 3VAHA 2UXBF 2BDPA 3DLEA 1L3VA 3MF5A 3I82A 1TKTB 3HX9A 3LQVA 5HROB 3E8OA 3DGPA 3CDAA 2Q6BA 2ROEA 4DR1F 4Q0BB 3PW7A 3EUNA 4USIA 3TVKA 1N48A 3UD3P 2YKPA 2P9CA 1IR0A 3CIMA 2UXCF 4ILLA 5GAHI 3ITHB 1GNKA 5KFQA 4OMFG 3OTDA 2BM0A 2EKYA 3N6MA 1VQSA 3MAHA 5LJ5Y 3DHWC 2BQRA 1WHVA 2B4OA 4PPZA 1P1TA 1CLFA 1HHSA 1H3DA 2HVHA 2CJ9A 3R5BA 1IKVB 4F3MA 3T19A 4TU7A 2DJWA 3MM9B 1ZAXA 3KLEA 2FHJD 5D3GA 2VUGA 2QMXA 4YR0A 1U25A 2Z2MA 3CB4A 3WZ0A 5E3RA 4A8SA 2HHVA 1X5SA 2ASYA 2AGOA 2CQDA 3TAMB 1TKDA 1U6BA 2IJNA 2VD3A 3I96A 5AJ3F 2JVRA 4E0DA 4C3LA 3M2UB 2X3GA 4TY9A 4R0JA 4EBCA 4FN5A 2DNGA 3EXCX 1FESA 5EWGA 3THVA 2E7WA 1RTDB 4B3RF 4HT7A 1N54B 2RUGA 2MHNA 4DQPA 5E3PA 3DLJA 2XGPA 5GADI 3ENQA 1RA6A 4J37A 3DDKA 1AROP 2CQIA 3K2YA 1OQ3A 5K8NA 4RKUC 3MEEB 1HI8A 4UQGA 3NRBA 4FXVA 1KLMA 3LGNA 4HLBA 3UDLA 4LSLB 1U1OA 2V94A 2O1PA 5DLGA 3J80Y 3KHLA 3W3SA 2AX0A 1HMVB 3I4HX 3AAWB 3OR1A 3RB4A 2FLNA 5JUMA 2HLTA 5FD1A 1IM4A 4NCGB 2AD9A 1JJ2R 2KYXA 3KK1A 1LKZA 4RNFA 4TKTA 5J2MA 3MUMP 1X4EA 2MKHA 2EBEA 5KT2A 1C4CA 1Q8IA 3HVWA 1VI7A 2MQOA 1RA7A 3TP2A 3RB3A 4WZMA 2WONA 1QAJA 3DN9A 1R8PA 3OTCA 2Z2LA 4DL4A 4WYWA 1X9WA 2DNHA 5EHHA 2KXNB 2CVEA 1S10A 3IS9B 1QAIA 2MZ1A 4B9VA 3KLVA 1PC4A 3CCRS 4YOEA 4NA3A 5IT0A 2XI2A 2OPRB 3MPYA 3UD4P 2VG5A 5LSLA 3GFHA 1VQ4S 1AXQA 2MQQA 4M1KA 4XPCA 2FLOA 3CDWA 1IBKF 1NK8A 4ICLB 3HXMA 3CCLS 3DLBA 5L1JA 2EWHA 3GIIA 1LWEA 5CYMA 4MFBA 3RAQA 2DH9A 2VG7B 3OFHA 3SCLE 2J0SD 1Y5IB 2HNZB 2JC0A 3PACA 4RWWA 3HO1A 4NCAA 1YJVA 1UVIA 2FTRA 3KKFA 1U48A 3NBPA 3Q23A 1A6LA 4HL9A 1VRTB 4H4KC 4FBUA 2ZE2A 3V6DB 1G1XA 2CJAA 3Q0AA 5JXSA 2B4VA 4LQ3A 1JLEA 2VFUA 3M8PB 2MKKA 1LWFB 2W7OA 4ZVGA 3W2VA 1FTCA 2BRKA 2OPQA 1F5CA 3PKYA 1NO8A 1VC6A 3G6ES 4I7FB 1HBOB 2XNQA 3BB5A 3NKYA 3I9ZA 2PIIA 4PCQA 4XDDA 2QLXA 3DM2A 2RD5C 2PO4A 4ED2A 5A0YA 1EETA 1FEEA 3W7BA 3DI6A 1SIZA 4ZPWR 1WNEA 3DLKA 3ETOA 1GXTA 1A9NB 1FK9A 1U6FA 3QJPA 2AJQA 1SBRA 3OTOF 3MFIA 1G3OA 4IG3A 2OLWA 1S0MA 1YWXA 1Y4ZB 1JWWA 5F8NA 2AJ4A 3MOZA 3QLHB 2GV1A 4I2QA 2N82B 4GC7A 3MMCA 3IO1A 4UUWA 2YH1A 4ELTA 3I6PA 3TA2A 2KVIA 1LK5A 4Q45A 2HFZA 5T7LA 1SL0A 1S0NA 3CDUA 2UUTA 2R7OA 2RF2A 3FQKA 4OV1A 4A46A 3WC0A 1IXKA 2ZH4A 2VQEF 3G6VA 2HNDB 3PRDA 3KK3B 1R0AA 4DV7F 2R2UA 2JH3A 3GR1A 4R8UB 1RT3B 2V2KA 3M6VA 4ZA1A 4CO4A 1VQPS 4F67A 1GX5A 4K4XA 5EX3A 2MXYA 2CQ2A 4F4WA 2GHVC 3IR5B 3NS6A 5F8LA 2RQMA 3N5BA 3M9NB 2DHGA 1S1TA 2K3IA 2LLZA 1KD1T 5AE1A 1H2TZ 2WOMA 2PD1A 2DGXA 2EPIA 4RBUA 5E7OB 2MGZB 3PKMA 4WCEQ 4OZJA 1CEZA 3CJ2A 2YKMB 1BQMA 4I6YA 2LXFA 4Q0BA 2CIMA 2YNFB 4PPDA 4PQAA 3THPA 4DSKA 1KOOA 3UFCX 4NXNF 3CE8A 1RT3A 1B0PA 4PRFA 2RILA 4W92B 4M94A 2HHSA 2IYIA 4Y0FA 5KFJA 1NKCA 1MROA 2DR5A 4DBQA 4LFAF 1JLGA 4FXWA 4HH1A 1YJUA 2XB2D 1NK7A 2VONA 3QIPB 2NYIA 2K1RB 3T9ZA 3RZAA 4CTAA 3G8SA 2AYGA 5KAKA 3UQSA 4HVZA 3KK1B 3CC2S 1IKXA 1S4FA 1QY7A 2DGQA 2I5JA 1LWCB 4L3NA 3VTIA 5DG8A 1NJIT 5J2MB 1TUVA 3DNCA 3P96A 4ED1A 2E5LF 2HHTA 4LIRA 3BS9A 3KG4A 1UW4A 3PJWA 4K5RA 1FRLA 1DLOA 1AFIA 2LDIA 4DR4F 1ZAVA 2FC9A 5L1KA 3HHLD 2R7SA 4RW7B 1KONA 1XC9A 3S7RA 1YJNS 4X4QA 3NNAA 4X4UA 4KBIA 4FF3A 4C11B 1C0TB 4DFKA 4RW8B 3I55S 1XMQF 2CDQA 3NCPA 2ZHOA 5I3QA 2LEBA 3BQ0A 1HI1A 3V5RA 2E9TA 4ZKAA 4IH6A 3I56S 3OTBA 4Q2MA 1ZAWA 3MM7B 1WTFA 4W90B 1RTHA 5E3QA 3MM8B 1TP7A 1FRJA 1H38A 4DV5F 3RB0A 5M2UA 3E01B 4IH7A 2YX1A 1U49A 5KFWA 3PO5A 4ZPVR 2PSZA 2AQ4A 2OP5A 2XMMA 3GE9A 1T7PA 1HYSA 1S1XA 3HJFA 2OJ3A 1S9FA 1ZOTA 3DRSA 1VFJA 4I6WA 3L95X 4LF6F 5F0WA 1JNZB 4ECUA 2FVPA 5GADU 2V8GA 3PX4A 4AXJA 1FO1A 2MPUA 2DH7A 2AYEA 1J5OB 3FGVA 5KFLA 2HGLA 2F3JA 2WSFC 5KG1A 4DUYF 4OHYA 1SJQA 2CPJA 2CPYA 1LXJA 4MKAA 2MZJA 4DS4A 2BQ3A 3HI9A 2B7CB 2DHXA 2DK2A 3BN7A 3VF0B 1FJEB 3PXGa 2CQ1A 2VB6A 2IC3A 4OFZA 4IRDA 3DYAA 1K1SA 1RTIB 1FE0A 3AJ1A 4ES2A 1VBZA 2ILZA 4N8OA 3HHLA 2K7KA 5D4NA 3MMBA 3UPFA 1FXRA 1T02A 2OPSA 4OHXA 4WJBA 5KFZA 4XAKA 2V9WA 1V3SA 4CH0S 2IAJB 2DCLA 3UNGC 3THTA 3VAKA 1S9EB 4A47A 2DNPA 3D54A 5KFNA 3K59A 4KHPF 4KV8A 4O23A 2F7VA 4X66F