2V94A

Crystal structure of p. abyssi rps24
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
FMLEMEIKITEVKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGSYKSKGYAKYYYDKDRMLYIEPEYILIRDGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 30S RIBOSOMAL PROTEIN S24E
publication title Mutation of Ribosomal Protein Rps24 in Diamond- Blackfan Anemia Results in a Ribosome Biogenesis Disorder.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 23
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v94A00
2DNNA 3NS5A 2XNRA 1WI8A 1ZH5A 1U1NA 4TLQA 3CF5Q 3K0JA 3MD1A 2MQPA 3S6EA 2DNYA 3TP2A 2LECA 2DH8A 2AYBA 2CJKA 1X4AA 2CQ2A 1YJWS 5LXYA 4IOAQ 2DNMA 2E5GA 2MSSA 1SJFA 3THTA 2DGSA 4CH1A 5HL7Q 1YJ9S 3CUNA 2MZJA 1Q82T 2MKSA 3U1LA 3DXBA 1DRZA 2KM8C 2OIHA 2CQDA 2LA6A 4UY8T 3ZZYA 4QPTA 1JJ2R 3R27A 1U1RA 2MQOA 1VQKS 1HD1A 3MOJB 4IO9Q 3S01A 1FJEB 2M2BA 1A9NB 1Q86T 2RS2A 1U2FA 1ZZFA 3MI7X 2MKJA 5H1SV 3VAGA 2EK1A 2DISA 1VQ7S 2BOPA 5FJ4A 1VQ4S 1BY9A 4UQTA 2MQNA 3VAJA 2J8AA 3SDEB 3I56S 2MXYA 1L3KA 5DDRC 2MPUA 3V4MA 5LSOA 2FC9A 2CQ0A 2DHSA 2D9PA 1FJCA 5EN1A 2XNQA 2RVJA 3CMES 4C7QA 2KXFA 3VAMA 1X5SA 2CPIA 2OTJS 1VC0A 2L41A 2KVIA 2HYIB 2VOOA 3LPYA 2BZ2A 2DH7A 2ZJQQ 3B4MA 3BEGB 2KYXA 3CCMS 1VQMS 2LCWA 2CPYA 3G6ES 1VBXA 1K73T 2MKIA 1QM9A 3DLLQ 2JWNA 2MMYA 2ZJPQ 1VQ6S 3CMAS 3BO2A 4F25A 2DGUA 2DGVA 4RU2A 1X4GA 3RW6A 1M5KC 2CQCA 1OO0B 2RRBA 1X4BA 2N3OA 1FHTA 2M4MA 2G4BA 1WHWA 1WI6A 1YTYA 2GO9A 3JB9k 2LEAA 2KRRA 1OWXA 2L08A 4WCEQ 3MUVP 1P27B 4C0OC 3N9UC 3NNAA 1X5OA 2M70A 3ZZZA 2KHCA 2KU7A 2FHOB 4WFAQ 2M8DB 1VQOS 4TU9A 2G0CA 4CH0S 1SJ3P 4QU7A 1G2EA 2QEXS 4ED5A 3B4DA 1U1KA 2DNQA 3MXHP 3CCVS 3D2WA 4WF9Q 2DNRA 1R8HA 2YTCA 1FXLA 1WG4A 2JRSA 2YH1A 2J0QD 5DM6Q 2KXNB 3UCUP 3Q2SC 4YB1P 1OPIA 2CQ4A 4Y00A 5GADU 1VQPS 1X4HA 1N88A 2MY7A 2DGOA 5D78A 1Q81T 2XS5A 2X1GA 4ERDA 1O0PA 3EGNA 2JX2A 1KC8T 2HGNA 2WBRA 5DDPC 2E5JA 2AYMA 2DGXA 2J0SD 1DBDA 2LQ5A 4J5OA 3UD3P 1M1KT 2E5IA 2JVRA 2YWKA 2DB1A 3MUTP 3I55S 1WG1A 2PE8A 1VC5A 3FEYB 3J7YU 2HVZA 4W92B 4W90B 1HD0A 2KH9A 1DHMA 2CQGA 2KM8B 1WEYA 2DHGA 1NU4A 3EX7B 2EK6A 2L9WA 3SDEA 3CCLS 2CPEA 1YWXA 2CQ1A 4EGLA 4YUDA 2MSTA 3TYTA 3U1MA 3IRWP 5JVHQ 2DNOA 4LMZA 2DIUA 1URNA 1SJRA 3VF0B 3CTRA 4OZ0A 1SJQA 2DO4A 4IOCQ 3G8SA 3VALA 1N8RT 2KI2A 5ITHA 2N3LA 4WIIA 4TU8A 2F9JA 2X1AA 4LIRA 1RKJA 5GAGU 1Q7YT 3CCSS 2M8HA 3CD6S 3CCUS 2M52A 2MJNA 1P1TA 2RS8A 1VQ8S 2DNHA 4C4WA 3BS9A 2DNLA 3LQVA 2MZQA 3BO4A 1U1OA 2VONA 1UAWA 1HA1A 4CQ1A 2RQCA 2LYVA 2MB0B 2MY8A 1X4EA 5DM7Q 2MKHA 1D9AA 1U1LA 3HI9A 5DDQC 5LJ3Y 2DGTA 2U1AA 1NJIT 1U6FA 2XS2A 3ULHA 2JVOA 3CCQS 1M5OC 1VQ9S 1H2VZ 2LXUA 4PKDB 3P5TL 2LMIA 2E5HA 1M5PC 3MURP 5IM0B 1VBZA 1JJHA 1F9FA 1H2UX 2HGMA 5CA5A 1DZ5A 3IWNC 3VAKA 5JVGQ 1X5PA 1R8PA 2PEHA 4M5DB 4OZ1A 1WF2A 1RK8A 3R1LA 2CPZA 4FXVA 4Y0FA 2KRBA 1U1PA 1SJ4P 1U1QA 2OJ3A 5LSLA 4P6QA 3UD4P 2MZTA 1WWHA 3TO8A 5D77A 2MZSA 1FNXH 2YH0A 3OW2R 3G9CA 4CIOA 2MGZB 1VQNS 2MYFA 3CC4S 3CC7S 3BO3A 4TU7A 1WG5A 1YITS 1B7FA 2DNKA 2CQHA 3G71S 2AD9A 5CYJA 1NO8A 1S72S 4IUFA 3NS6A 2RT3A 3G96A 1SXLA 1M90T 1WF1A 3L3CA 3UCZP 2RNEA 3G4SS 4F26A 3PIPQ 2MZ1A 2DH9A 3UE2A 1WF0A 1K8AT 2FY1A 2RQ4A 2MQQA 1UFWA 3VAIA 5CXTA 3S8SA 1WEZA 1AUDA 2XB2D 2XSFA 1WELA 2D3OR 4BS2A 1WHXA 4F02A 2OSQA 2MJUA 2CQBA 2YKAA 3Q2TC 1JJ4A 2HGLA 3MDFA 1H2TZ 2MKKA 3NMRA 3NNCA 3PIOQ 3NNHA 2XS7A 4U67Q 1K9MT 2CPDA 3G8TA 1U6BA 2D9OA 1UW4A 2LKZA 4ZKAA 2MQMA 1FO1A 5GAEU 3MUMP 2NZ4A 3S7RA 1WEXA 3SXLA 2AYGA 1N52B 4QU6A 2K3KA 3HHNB 5LJ5Y 3P49B 2M0GB 2A3JA 2FPHX 2E44A 2V94A 5GMKa 5BJRA 2CQIA 2I38A 2KT5A 2EVZA 2DHAA 2LA4A 2DO0A 1X5TA 2LXIA 3CC2S 2KN4A 2X1BA 3P3DA 2SXLA 2KG0A 1KOHA 2CQ3A 2VOPA 1W2BR 3CCJS 2NLWA 2ADCA 1U1MA 2M7SA 3CPWR 1FT8A 1H6KX 1WHVA 2F3JA 4PR6A 1YI2S 1YJNS 1D8ZA 4QQBA 2X1FA 4YOEA 3VAHA 1PO6A 2UP1A 1CVJA 5IM0A 3US5A 2DNPA 5HO4A 4WFNQ 2MHNA 2N82B 3SMZA 2DITA 2F9DA 2DK2A 1N54B 3MD3A 2HZCA 1OIAA 2DGQA 2B0GA 2DIVA 1VBYA 2M88A 1X0FA 4V19X 1WHYA 5GAHU 2DNZA 3FEXB 3UWTA 2RRAA 1VQ5S 2O3DA 1X4DA 2KXHA 1X4FA 5LXRA 1S79A 2DGWA 5DDOC 2MQLA 1UP1A 3CULA 1KOOA 2MGZA 5IFMA 1HL6A 1KQSR 3EGZA 5DETA 1JMTA 4PRFA 2ZJRQ 2ERRA 3P6YC 3CCRS 2MZRA 2RU3A 3THPA 2OTLS 3UCGA 1X4CA 2G1DA 2U2FA 1QVGR 1QVFR 2J76E 5IQQA 4FXWA 5GVQA 4WFBQ 2QA4S 2MKCA 2QFJA 2RUGA 1XN9A 1WTBA 4Z2XA 2LEBA 3RW7A 2AYEA 2M9KA 4A8XA 2ADBA 1KD1T 2Q79A 3CXCR 1M5VC 2OSRA 2DNGA 2KG1A 1A7GE 2CPHA 1FJ7A 1IQTA 2VODA 1YHQS 3CCES 2CQPA 1YIJS 2I2YA 4LJMA 1PGZA 3J7ZT 2GHPA 1VQLS 1VC6A 2CPFA 4WKRA 3H2UB 2FC8A 2N7CA 5MLCV 1ZZNA 2KFYA 3H2VE 2CPXA 2DHXA 3R1HA 2CPJA 3VAFA 2K8GA
chains in the Genus database with same CATH superfamily
1UEVA 1S57A 3CF5Q 3K0JA 2CJKA 4F0MA 1NMEB 4FF4A 2JEGA 5AT1B 1RT2A 3PYDA 2R8JA 3RG6A 3N6LA 2VJVA 3QT8A 3I5CA 3MOJB 3S01A 3GV7B 4H4MB 1TL1B 3BH6B 3DN9A 1DQ8A 3K5OA 3RAMA 2J8AA 5F8HA 3W65A 5KG6A 3UR0A 2GCFA 1ZPVA 4MK9A 3H2LA 1XR5A 3KG1A 1FWKA 2L41A 3TUZC 1RT7B 4MKVA 1A0OB 3NKYA 4X2BA 1WUUA 3RB4A 3IGNA 4KC5A 3DLLQ 2C2ZB 1IR0A 3ICLA 3MR6A 4P10A 4I69A 4V19J 2YKOA 1NNDA 4HACB 1UKUA 3G87A 3ZC4A 2ZC4A 2GO9A 2LEAA 2OGUA 5CCLA 4UTGA 3JTPA 4R0EA 3T9NA 1SKUB 1T3OA 1L3SA 2QEXS 2ZKTA 3W2VA 2DNRA 4DHVA 1QY7A 4N47A 2PC6A 3Q2SC 2DPIA 1YZ6A 1O0PA 2R4FA 3PDNA 2DGXA 2EBGA 2E5IA 4OX7A 2MHEA 5CABA 3ZFVA 3D54A 3CIZA 3MAQA 4W90B 1DHMA 4JI5F 1LW2A 2WZ1A 1PYTA 4EGLA 4M94A 3KUGA 3U1MA 2DIUA 1URNA 2XMKA 3MPVA 4OZ0A 2DO4A 3KUHA 1C2PA 4KIAA 2VG7B 4DUTA 3VR1A 4U7UD 5KT5A 1TFYA 1IXKA 5KAKA 1F5CA 2MY8A 5T7LA 2W7OA 4RX6A 1JX4A 4XTTA 1S7HA 3T5KA 1H2VZ 4JV0A 5T41A 4LRBA 3SZ2A 1Q53A 3IWNC 3L7PA 1SQFA 1X5PA 4RUAA 1RK8A 3KHRA 1N5VA 5H9EK 2Z2LA 1U1PA 3OJUA 3IG1A 1T0TV 3EDQB 3I0RA 3Q8RB 4C8ZA 4WFYA 4IFVB 2GQ2A 1BMQB 1LKZA 3A8IA 4KKOA 4ZP9A 3D6FB 4E8UA 2HHQA 4KO0B 5IV4A 4J9MA 1HWLA 1YRUA 4NCBA 5G0RB 4KJIA 2MEWA 1K8AT 1KQFB 5F8NA 3UD5A 4OV6A 4PG6A 3QGGA 3C16B 2BX6A 1QTNB 3BYRA 3ZZUA 4WKYA 3D0GE 5EUHA 1HI8A 3VZHA 4PXCA 2NSBA 4LR7A 4DMZA 2XS7A 4U67Q 4NXNF 3HFZB 4G1PA 5AJ3J 5KT6A 4ZVHA 3DLBA 3FSXA 3SXLA 2CA9A 1Y0HA 2VHGA 3I87A 3DRSA 2K3KA 2AQ4A 3W63A 2KTQA 2G2YA 1EB0A 1P8GA 2W8LA 5K14A 4WXOA 4GC6A 1QE1A 2X51A 2QLWA 5I3QA 3CJ3A 3LO3A 1VIOA 4QYRA 2C3YA 2OO4A 3SI8A 3TOQA 3TJAA 3FEZA 5HROA 3D0IE 2P8IA 3M2VB 3KJVB 4X66F 4J9OA 1VI7A 4OHWA 2DEIA 2PGCA 2F63A 1N54B 1R0CB 2DIVA 3MFHA 2BM0A 2COLA 2HQGA 1C1CB 2IFXA 4H54A 5LXRA 1UP1A 3MHYA 4K4WA 1HL6A 5HP1B 4J9PA 1IBMF 1NPRA 2OTLS 2HFVA 3UCGA 4FXWA 1F1BB 3MCSA 1I94J 3DDNA 3IBCB 2LEBA 5J2NB 3M32B 3S1TA 1KD1T 1KEKA 3A12A 3E01A 1GT8A 3QJLA 3M2RA 2CPHA 1LNQA 5B0CA 3HHLD 2EXUA 4LF7F 3IRXB 1PJ6A 1FFGB 3J81U 2FLNA 3RYLA 2DHXA 2Q43A 2K8GA 2DNNA 3GIIA 4TLQA 3QSYB 4E2FB 2LECA 2J9CA 4DSIA 3QJPA 1LWEA 3MEDA 3CUNA 2MZJA 3PTWA 2GIFA 2ZFHA 4CCHA 1GMVA 1NK6A 4F4AA 4UY8T 4H4MA 2K3IA 4DG1A 2AEJA 2M2BA 4Q45A 1M5SA 3GP9A 1SC3B 3A1YG 3SCLE 4LREA 1VRUB 5G4DA 2HNYB 2CJQA 2FJEB 2D1CA 2HHHJ 1RHUB 1YLXA 3FDSA 2D9PA 5CD4H 1HMVA 2DKOB 2CPIA 2EW9A 5AXNA 2VZ9A 3M6XA 3V5RA 2ZJQQ 2JFKA 3B4MA 2VA3A 4WK3A 4ELTA 2BABA 5EX3A 1YRXA 1MMDA 4HACA 2DGUA 3QPIA 3HK2A 5M2PA 2IBKA 3POTB 5F8GA 1NDPA 2Q1LA 2RRBA 2ASJA 4WJBA 2N3OA 5LOQA 1CJVA 4WP9A 4HT7A 3MMJA 5L46A 2L08A 2W2OP 1P27B 1UEUA 3SV4A 3NNAA 3GJTB 3GJRB 5EWGA 4RUCA 2DVIA 4N56A 2R8GA 3AJ1A 2B8PA 1BLUA 1WKJA 2R7QA 1EQMA 3CCVS 2XLJA 4ECTA 1FXLA 2I8EA 2J0QD 3F56A 3RRGA 2RDDA 2R8HA 1QDUB 3MM5A 5GADU 3C6TA 2BKPA 1WC3A 3GU0A 5DLFA 3NLCA 4JOUA 3KDNA 2WSEC 2J0SD 2PD1A 4D3GA 3UD3P 4GVBB 5D0GA 4DS4A 3JXOA 4JI5J 2BMBA 2RHSB 3A8EA 4NLSA 2HHUA 4L76A 4KGKA 3SDEA 5JVHQ 3DDKA 4OI3A 3PJXA 1R3NA 2VG7A 1S9GA 2WCXA 3TUPA 1XERA 1N8RT 5L1IA 1IKXB 1UL3A 2G0JA 5BXIA 4L6V3 1ITPA 3W3SA 3IR7B 3KK2A 2NXNA 5A2QY 5KFYA 1JB0C 1Q79A 4YY3F 1CEZA 4OYIA 2C2KB 1TMMA 3CWJA 1LK5A 3W8GA 3H25A 2LXUA 3OTBA 4O3SA 1I3OB 3O6QA 4I6YA 5J1EB 2YNIB 3T5LA 1N32F 4DL4A 3FSIA 4ED2A 4J7CA 2RDIA 2FYXA 3AODA 4DZDA 3HPOA 5GAHI 1HNVA 3C16A 2MLYA 3MR5A 1NM2A 2RRNA 4CI0B 1RGVA 2HVHA 2GO8A 1L3UA 2WOMB 2A6OA 2G2OA 2MKKA 3FRYA 3NCQA 1HNIA 3PW0A 4FF2A 3G8TA 3L09A 2MQMA 3IAM9 5A76A 4K4UA 1N52B 2GS8A 2YWGA 1FRIA 5HQ8A 4QU6A 4L3KA 4QPXA 3JSYA 1NKEA 2GA7A 2OLWA 2XSJB 2DCUB 4IFYB 2F8MA 2YWEA 2DO0A 3JQJA 1NBEB 4NYZA 4ICLA 2DR9A 2HAFA 2Z2MA 5IWAF 4DR4F 2B4PA 3P4UB 2ADCA 2LQBA 3UN5A 3BN7A 3KJVA 4X66J 3H98A 2HVDA 4HEA9 3F44A 1T9WA 2E1RA 2BW7A 2ASYA 3ZZPA 1UETA 2DK2A 3GONA 1C0TA 2PT0A 1X0FA 4V19X 1RAHB 1SH3A 2QE5A 5HP1A 2R7WA 3CB4A 1W2IA 1U0SA 4ES2A 2MGZA 1DTQB 3ZZRA 3GZ7A 1NUEA 2ZH1A 2ZJRQ 5MAOA 1TK0A 4DFMA 3QGIA 3ENVA 5F0WA 4QWCA 3FSYA 3EICA 3GFXA 4I2QB 1FTRA 3DLKB 3SV3A 4DFKA 1JXVA 3H40A 2FHJA 1LW0B 4LF7J 4R5PB 1KFSA 1H74A 1XIQA 3MM9B 2I2YA 3IR6B 1XBWA 3MGJA 4ZCIA 3SEOA 3D3BJ 3DRXA 3AA8A 1V3RA 1CBKA 4MIBA 4YN3B 3DRRB 3NS5A 3PR4A 3AJ2A 4ZPTR 1NK4A 4X84A 2RSQA 4FF1A 3HHLB 8AT1B 2JEIA 3UI3A 1LEOA 4P2XA 4MIAA 3HCXA 4BWJA 4QPTA 3D5MA 2XWYA 3M30B 5I3UB 1BWEA 3D6MB 2FY8A 2HNYA 4OYAA 2RS2A 3CD5A 4F4XA 4EUVA 3MI7X 5HVFA 3KJNB 4FNIA 1RABB 1BQNA 2FJWA 3UDVA 2D3O1 1RDRA 4FN5A 4HHHA 1V5IB 1VLYA 4CYUB 2NXUA 2AJFE 4OZLA 3V4MA 2VKRA 4TN2A 1XC9A 1KVJA 1XWLA 3B6BA 1RUSA 2OTJS 1BE4A 3M8YA 4ZLNA 3BEGB 3KLHB 3LWMA 1JLBA 1TVRB 3PZPA 1RYRA 1BD6A 2IAJB 3G6ES 1IBKJ 2FVSA 3POTA 2EFNA 1RACB 4RW7B 5D15A 1NH7A 3OFGA 2WB1D 2EI5A 1B99A 1TU0B 3CDUA 3H8YA 1U2RA 1WI6A 2ZM6F 3ZZZA 3EXYA 2W9AA 3J81Y 2KHCA 4A8WA 3QGPA 4OI2A 4IRKA 2AW0A 3OHAA 1XJWB 2UZAA 4DQRA 4ZVGA 4DSLA 4K59A 2KB2A 1XNQF 3CDBA 3UCUP 4YB1P 2CQ4A 2VG6B 4ELVA 4GVBA 1HNWF 2JX2A 3B8HA 3QMQA 3EGWB 3BGRB 4P7TA 3I55S 4LFBF 4LRAA 1YJ7A 4CWBA 3C6UB 3JTNA 4F3MA 1IKXA 4LMZA 1PIEA 2IDEA 4QW9A 3W66A 1WTFA 2F9JA 2JFDA 2M8HA 3CD6S 1BQMB 2MJNA 3QAEA 2HQ3A 4NEYA 4YY3J 1HNXJ 4W4MA 4QJVA 1TAQA 1UFLA 4RLEA 2WRMA 1S77D 5KTQA 4RW9B 4ED8A 5J1EA 1N32J 4X4RA 3TJ8A 1PBUA 1B0VA 4KE5A 2ACYA 2J8SA 1RTDA 1SCJB 2OFGX 4HH0A 5CH7B 4KQZA 2I6WA 5HMZA 1OSDA 3SFGA 2W9BB 4CLKA 1ULRA 2XMTA 2UUBF 2B9EA 2YH0A 4U95A 5C42A 5KFEA 4A8YA 3CC4S 1LFWA 3W60A 3CC7S 1RWPB 1K1QA 1YITS 3IXQA 1VRTA 3D9BA 4UZCA 4YEAA 2Y0BB 1DY3A 2V2QA 3AB4B 2RNEA 4DI6A 4F26A 2BJ8A 2YPYA 2XMWA 5CXTA 3G2XA 4KPCA 2NS1B 1RP5A 3UDEA 4B3RF 3W64A 4PXEA 3CO0P 4BCAA 1RWVB 1WD6A 3W5ZA 4DLGA 3QWUA 3BSNA 4PQAA 4P2MA 1TZ0A 2P6TA 2XSJA 1SUQB 4IFYA 3KLEB 2CG4A 4K2JA 4NA1A 1IKWA 3P49B 2M0GB 4DR7F 2FPHX 1ZYQA 2R2UA 3JSMB 3OR2B 3KMSA 2R7SA 2MLZA 3QYYA 2VPWB 4DX7A 5IWAJ 4DR4J 5CYQB 1X5TA 4BHQA 1S1UB 2SXLA 2LLZA 3NP5A 2EEYA 3CJKB 5D6GA 3CJSA 4RO0A 3LAKA 3CPWR 3AA9A 4X4VA 1YJNS 4CNYA 3IN5A 4FDFA 2GNKA 2XG8A 2UP1A 4Q7AA 4CO0A 3J7YI 1CJTA 4CTAB 2V9KA 2VIHA 4QCLA 1DTQA 5J2PB 3GJQB 5KFBA 1ZPWX 2KZZA 1KOOA 2XY7A 3LALA 3PYEA 2HFZA 2HRYA 5GMEA 2P5VA 5DO2A 4K50A 1F5AA 4WFBQ 3B82A 3ETOA 5F8JA 3RW7A 1MU2B 2BJ7A 3DGPA 2ZKUA 3CCES 2RAQA 2GHPA 4NLPA 1SC1B 3R7BB 3DRRA 3H2UB 3DOLB 2JL9A 2G0IA 3KLVA 3RR8A 3CT9A 5SUHA 4MH8A 1YDLA 1YRTA 2FD2A 2W01A 2V5HG 1SKRA 4LSNA 2DNYA 1YJWS 2Z30B 2Z58B 2DNMA 2V8VA 5HL7Q 1N0VC 3MAHA 1NJYA 2XMAA 3WX8A 3M30A 4ED6A 4U6PA 5DG7A 1JJ2R 4IYQA 2CNKB 1DTTB 3ZTQA 4CM2A 1JJCB 4RNMA 1Q86T 1WKKA 4CYUA 1SIWB 3KG0A 1D1UA 2ZE2B 2YX1A 3W9JA 2MXYA 1CJUB 3TRGA 2XYGB 2FC9A 4NL5A 3CMES 4PEOA 4DL5A 3BN4A 1TVRA 1TQLA 4IQMA 4PG7A 4EZ9A 2DYAA 2DH7A 3BJYA 1NDLA 2ALZA 4IQXA 5CZVA 4RW7A 2HEKA 4PPDA 2W4PA 2G1HA 2EBEA 1ZETA 1FA0A 1T05B 4DN9A 3CCWA 2KJWA 4A8MP 2ZM6J 4NRTA 5DZ6A 1RAOA 2X3GA 4O3OA 1Z4UA 2JC0A 3PVXA 1OWXA 4DFJA 2VICA 1UW9A 4ZVEA 3M9OB 2M8DB 1XNQJ 5A0YB 2CNNB 4CH0S 3MECB 4EK2A 3D2WA 1HNWJ 2CDQA 1OPZA 2FIUA 1NEEA 1IKVB 1N88A 3BGRA 2B6AB 2I9SA 4LFBJ 1SL0A 4FPIA 2W1BA 1TELA 3FEYB 5LMNF 1G6BA 2D69A 1RWMB 4ZJQA 2KFNA 3CCLS 2XHWA 4YUDA 2H5IB 3MAAB 4YFUA 3MM7B 1RSCA 4YDXA 1O5JA 1ACMB 4DL3A 3G6XA 3H4BA 3BV8A 1TKXA 3LWLA 2BQ3A 1HA1A 5DM7Q 1K44A 2EFVA 3CCQS 4QZVB 1SH0A 2LMIA 4X4SA 3QLHB 1CQNA 1FDNA 2YNHB 3FFIB 1T9YA 2UUBJ 4ZVRB 3AY0A 5KFNA 2CRLA 1WWHA 3DI6B 3HP6A 1DJ0A 3SFUA 1F3FA 1XR6A 3HJFA 3FGVA 2H54B 1S72S 3G71S 1RHMB 3G96A 1SXLA 2Y8YA 1WF1A 3V6JA 2FY1A 1UJ6A 4CO3A 4B3RJ 1RTJB 4DQIA 1EX8A 2PA3A 3AXMA 4PUOB 2KT3A 4G1IA 2UU9F 4QIEA 1R7IA 1NSAA 1Y11A 3R8YA 4LFAF 2A18A 1JLQB 1F2GA 3CSKA 1GX5A 4B08A 4DR7J 5GAEU 1S0OA 3N6NA 4F4ZA 3S7RA 2AYGA 2W4CA 2OUGA 4C11A 2A3JA 4IRDA 3Q89A 1FDDA 4EWTA 3JSRA 1NPPA 2LXIA 4DX8H 1FDAA 2UUWA 4OYMA 3KLFA 2KG0A 3TX0A 2PO4A 4FYDA 4W98A 3RB0A 1H7XA 4LRFA 1YI2S 1PAEX 3US5A 2H4YB 4DPOA 4NI2B 1AB8A 2JZ5A 3FMBA 2B0GA 2HNZA 2BJ3A 5E3PA 2B4OA 4KHRA 4DR3F 2JNJA 4KGMA 5BYSA 4BC7A 5I3PA 3FCHA 1KQSR 1F5BA 1YQHA 1XR7A 2MLXA 3Q8UA 1MU2A 4CO5A 1ROFA 4AXIA 2A2DA 5HMXA 4U7CA 3X3UA 2PIIA 2VODA 1YHQS 3DOLA 4NLTA 4J9KA 3RUBL 4R8UB 3TX8A 2HS0A 1VQLS 1PBAA 2N7CA 2DBBA 2FUG9 5C24A 4K5RA 3I0SB 2I1RA 2XMVA 3PEHA 1U1NA 2FVRA 2MQPA 2ZD1B 4K8RA 4YB7A 5LXYA 2JHEA 3TVYA 3T1YF 1PSDA 3TEHB 2ZITA 3U1LA 3BGFA 3FQKA 4U8VA 3I6PA 4ZITA 3T6BA 4YS2A 4DJBA 4DXLA 1FKOB 4IRCA 1VLOA 1UVKA 3TVKA 3VZIA 1ZZFA 1CJUA 3VAGA 2DISA 1FXRA 2FJDB 2OMLA 1PC4A 5HMWA 4FNHA 1CS4A 2CQ0A 2Z0GA 5HATA 5KG2A 5D8HB 1C1BA 2HIQA 3MMAA 1KWMA 4R25A 2VOOA 1CG2A 2EWHA 1X7VA 1KVKA 1L3VA 3KLIA 2HNDA 5KFUA 2O66A 4IDKA 4MT1A 2R8IA 4Q0BA 2RKIB 3HZGA 2WVEA 1JWWA 1R27B 2V2KA 3G82B 3ZNJ1 3IAS9 1M1HA 1X31C 4WCEQ 4C0OC 2PEBA 3MECA 3QFWA 2KFZA 4YQWA 4P75A 5EWFA 2BRLA 3R5GA 3SQGB 3Q8PB 1R8AA 4ZLLA 2AGQA 3MEGB 1X9SA 1HQEA 1KR4A 4DL0C 2HMIA 3UR3C 4DPWA 1EKSA 1GEHA 5LMNJ 4G3IA 1EIYB 2YWKA 1RU2A 1F6TA 1G4CA 1Q1KA 3MUTP 2V2VA 5KOXA 2RILA 1WEYA 3MAAA 4Y2AA 3HHKA 4G1QA 4QYZK 1Q0NA 2C3OA 2BANB 1FTCA 4ZVTB 2KI2A 5KFAA 4AYBD 5E3RA 2DXFA 3W5YA 1WC1A 4NE9C 2JDJA 4HKQA 3TZZA 3OPKA 1JLEB 2RQCA 2LYVA 1L3TA 3PX0A 2XLIA 4I4BA 2HWTA 2YXLA 2XS2A 1RHKB 1UWBA 2DY9A 1WC4A 4DSFA 1YX2A 3FFIA 1FNOA 3ISZA 5KFHA 2VV5A 4ECQA 3Q23A 1HW9A 4C8KA 5JMNA 2CJAA 1GXLA 3OSPA 2KRBA 4RKUC 5LSLA 1S6PB 5IOLA 5D77A 3SSQA 2VBZA 3UQSA 4UQGA 3G9CA 1RAEB 1VQNS 1VGYA 3VCDA 2DNKA 3NS6A 2V63A 2H48B 2QMWA 5B09A 3UCZP 3G4SS 4RW8B 4PUOA 1Z2LA 2JLEA 4C3MA 2KO1A 3FBEA 7FD1A 4DV4J 3H5SA 1SC4B 1AUDA 4LFAJ 1YGYA 5J1NA 1WKLA 1JJ4A 3MDFA 5DLGA 2D9OA 3KG4A 3ENAA 3M8PA 4A8FA 1CJKA 4DFPA 4JI6F 2J9DA 3ZTOA 1AROP 3THVA 3UDCA 5GMKa 5HJYA 4B9MA 1RKIA 3EZOA 3LPEA 1AUSL 3WHIA 2HW3A 1IUJA 4IG0A 3V4IB 2ZNZA 3T6JA 3SCJE 1JNRB 3DXSX 1S99A 4FYVB 4L74A 2BE2B 1FD8A 3IMQJ 2VPXB 2Q6CA 3LANA 4V1Ak 4GKJF 2FZGB 4LUBA 4NI2A 2F40A 1PO6A 1S97A 2IC3B 3KYLA 1TUWA 4EFAC 4NA2A 3SMZA 4DR3J 1JXLA 1SV5B 3R2CJ 2B51A 3ADAC 4OV1A 4ANDA 4B3OB 2KXHA 1R0BG 1X4FA 4I7FB 2J6UA 3FVYA 1OYEA 3KK3B 1J5OB 3ZTRA 2NQPA 1MG7A 2YWFA 4R8UA 3PJWA 2Y1JA 3EPIA 1G3OA 3RBDA 1U8WA 3PKYA 3I0SA 2VBXA 1FRHA 3VGVA 3DRPB 4I1TA 3D1QA 3ENWA 4P9SA 1WC0A 1E6YB 3A13A 1UA0A 3NCRA 4ZVFA 3W9HA 2XNRA 1S0VA 2X7IA 3T1YJ 4XDDA 3TP2A 2GV1A 3D66A 3KHHA 2KKHA 4NLGA 5CZXA 1U8SA 3NL0A 2ZH2A 4YR0A 3MPUB 2B7BB 1FKOA 1Q82T 5JUMA 3H20A 2CDRB 2Z8QA 1KQGB 1PAUB 2VU5A 4BDPA 3OL6A 4Y34A 2GAHC 3FCWA 5ETVA 5H1SV 2BACA 2FGCA 2EK1A 2FQQB 1ZAWA 1L3KA 1UVIA 3FNNA 3HVWA 5KG5A 3ILJA 3PJ9A 5EN1A 5ETQA 5KFJA 2EG1A 3TAPA 2V9WA 1WSVA 2KVIA 2JLGA 1EETA 4TYAA 2P9GA 2APOA 1ZA1B 3PRDA 3DYAB 3U7JA 4YDDB 1MNEA 4FPRA 3DMJA 3RW6A 1HBOB 3NRBA 4IKAA 1M5KC 4PXDA 3J7Z5 2G13A 1Q8IA 9RUBA 1HBUA 1QSSA 1QLNA 4H4OA 3MR3A 2PI4A 2V8HA 2BOAA 2CXEA 3SQGA 4DUZJ 4WFAQ 3C19A 3HD2A 5HN0A 4TU9A 4ZCMA 2M3DA 3MEGA 1RISA 3BQ1A 4NYOA 4J9RA 1NKBA 2DPJA 4FBUA 2BXJA 2ZBQA 1F3VA 4KFBB 2RE1A 2YTCA 2YH1A 4C8OA 2YX4A 2C2MB 2LDYA 2WVFA 2XS5A 2X1GA 3EGNA 2HGNA 3R6GB 4MYUA 4B3SF 1TL7B 1RWKB 2LQ5A 2H1YA 1EQ0A 3EYZA 2IM0A 5F8LA 3E8OA 4GO7X 2CQGA 3A8JA 4MFBB 2BANA 3E51A 2XYHB 2OMOA 1FWPA 1RQ0A 3HF5A 4RW6B 3TYTA 4CLZA 5M2RA 2GQQA 3AQOA 4F4WA 3VF0B 2IBOA 3PKMA 1RHQB 4ID8A 1DQAA 4EMDA 3HSDA 5D4LA 1LOUA 2CWKA 4LR9A 1IVZA 1JLEA 4IG3B 3D4JA 1P1TA 4QIGA 5BYRA 3LQVA 4HVZA 1S9EB 5D0RA 2CVIA 1S5ZA 1SQGA 1M5PC 3L7UA 4OZ1A 1S6PA 3DM2B 1Q78A 3H90A 4XDCA 2K2PA 3NG8A 3ZZTA 3L95X 1LQ9A 2VQEF 2MZSA 1BWVA 4N5SA 3OW2R 2PMWA 2HK2A 3BO3A 1REVB 4RW8A 4HYKA 1MN7A 2FDNA 3D7SB 1RT4B 4C97A 3NGRA 2MZ1A 5FIIA 5B7WA 1UZDA 2XSFA 3IS9B 1R31A 5ETMA 2NCKL 4LQ3A 3OQ2A 4WYWA 1MLAA 3KLGA 3NNHA 4JI6J 4ZKAA 3O2IA 3K2YA 1NK5A 4XPEA 3IO1A 5LL6d 3V4IA 1HQUA 2EKYA 2BE2A 3QIDA 2L9NA 1RT2B 1TFWA 5E7OB 2VOPA 3K8VA 2IC3A 1QAIA 1FT8A 3O8WA 3OFFA 3RAQA 5IM0A 5HSPA 3GQCA 4B3OA 1IR1A 2EFQA 1NXIA 3PR5B 5AE1A 2AKWB 1UVNA 1X4DA 3LGMA 1S79A 2CNLB 1YBAA 3KK3A 1J5OA 5DETA 5DQIA 2WB4A 2B5JA 4NLRA 4Q2LA 3Q0AA 1D8YA 4K4XA 5F8IA 2J0XA 1WTBA 4GRSA 3PG9A 4DZ6A 2Q79A 4CLUA 2QT7A 2R3VA 4FYYB 3Q86A 1SJ1A 3CCZA 2O5DA 3N5FA 1Y5IB 2IA6A 3T9ZA 2XI2A 5KG4A 4P52A 1WI8A 1ZH5A 5A8KA 4DF4A 3A4TA 1VBKA 2YBVA 4F4YA 5CYMA 3OL7A 3Q83A 1RA6A 4N41A 2IPOB 1HWKA 4ETXA 1MWYA 3R27A 2MQOA 4RJVA 1VQKS 1FJEB 3HKWA 5E33A 1U2CA 4I2PA 5C25B 3HM9A 4URQU 3ILLA 1HW8A 1ZM2A 1MWQA 1LW2B 3VAJA 5DZ7A 2MPUA 2DHSA 3K59A 4MKAA 3D6HB 2WBMA 1ZBTA 2DXEA 5IT4A 3MWBA 4DDFA 2CJ9A 3CCMS 4DV7F 4F2SA 2VD3A 3JTOA 2B4UA 1QM9A 2ZEJA 1VQ6S 3SBMA 3IGVA 1E6VB 1NH8A 3MPDA 4B9VA 2OPQA 4IH6A 3CVKA 1KS2A 3WC0A 1U7LA 2BJDA 4QWEA 4OQJA 2G4BA 1Y00A 3OXGA 4ECRA 3MUVP 2J5AA 3IG1B 3GSDA 1UMJA 2KU7A 4BBYA 4ZP6A 4KFBA 2ASDA 1RLDA 1SJ3P 4KKOB 2AIRB 5B0AA 2DNQA 1IJFB 4X4NA 1WG4A 3HT0A 4B3SJ 2QA1A 3M8ZA 4RWXA 2E5JA 4AXJA 4FVMA 1I1GA 2OAUA 3D67A 3OSNA 4NA3A 4QBUA 3EXCX 2ATLA 4TVAB 1HFEL 5KFFA 1KVIA 5JJBA 4OJ1A 3DRSB 3PX4A 2XLKA 1XQIA 2O67A 4J37A 4TKTA 1REGX 2ROPA 3DGVA 1JKHB 2H51B 5GAEI 1S9EA 3PYFA 1YK9A 1QE1B 2F65A 2R2SA 3BO4A 4CQ1A 5IV3A 4PXBA 2HBYB 5EGYA 5LJ3Y 4WPAA 4GC7A 2DR6A 2OHDA 5HROB 2HWIA 4LF4F 4PKDB 3DDIA 3TWZA 2FVPA 3UNYA 1LV5A 3QO9A 3KUEA 4AT1B 5JVGQ 5LT5A 5KFIA 2J7UA 2QZ8A 3QFHA 2VQEJ 1R43A 4YR2A 5KFSA 1NB7A 2BJEA 1REVA 4DQSA 4P73A 5KFLA 2FHJD 1CPZA 3CIMA 1NHUA 3JS9A 1GTEA 5BR8F 2B56A 2R2TA 4KGVB 4LF6F 2GC8A 3L3CA 4RBTA 1XMOJ 2DEJA 1YG0A 3IS9A 3M2RB 1JLCA 2Q3PA 3LH2S 1WELA 4BS2A 4C48A 3GE9A 4CLPA 2LDIA 3CEDA 4OMFG 4EO6A 4K5SA 3SCKE 1FO1A 3C15A 1R8CA 2ZHBA 4DV1F 4WZQA 5HAOA 5LJ5Y 5KFOA 2W25A 1ELOA 3R6LB 1YJVA 1LWEB 1ZAXA 3ZTSA 3MEDB 4ENOA 2ILZA 1WORA 3R3TA 4P71A 3BR9A 2CQ3A 2LVWA 4DV5F 4DG1B 3EVOA 5THWA 5D0EA 4USJC 2XQCA 2DR5A 1VDHA 1TK5A 2Y1IA 7AT1B 4F4KA 2HHHF 3I9V9 4Y3CA 3RGIA 1C4CA 3PRBA 1VBYA 2M88A 4K4VA 5KG1A 3AJDA 2KL8A 5HBMA 1HMVB 4XO0A 5E41A 2O3DA 2G9OA 4ES1A 4YR3A 4DSKA 3EZUA 2CNOB 2RU3A 3BBFA 5SZTA 2QA4S 4N8NA 3W1YC 2MKCA 2RUGA 4ED3A 5IT9Y 2GVDB 4OJGA 2AJ2A 1X9MA 1M5HA 1S10A 1TP7A 1FJ7A 1PYSB 2CQPA 3VGTA 1NDKA 1Q16B 3CE8A 1JLGA 1CJVB 2OPRA 1FDBA 2YKPA 3L9ZA 3GFYA 2HLUA 4CDIA 1ZM3A 2BJ1A 1D9DA 3W5XA 2BR0A 1GXUA 4OHYA 2C42A 3LTOA 1LWCB 3OVSA 1Q4RA 2QMUB 2VL1A 2E5GA 1SJFA 3THTA 4EZ6A 1JXEA 2MKSA 3MM5B 1KDNA 3C6TB 4LBIA 4M5GA 3NMAA 5C25A 3DLJA 4TYBA 3DOKB 4NWBA 5EWEA 3TA0A 3VGSA 4NCAA 2XWXA 1BY9A 2AX1A 3DLGB 3SDEB 2E29A 4F3OA 3OHBA 1FX4A 6FDRA 3D1OA 3EE3A 3N5BA 3M8WA 1S1XB 1S9GB 2KXFA 3KMQA 1B4SA 1X5SA 3KK2B 4DV7J 3D3CJ 2BZ2A 2KZMA 2KYXA 1E6VA 2LCWA 2CPYA 1VBXA 3MCNA 4JI4J 3GTYX 3BBCA 4C3KA 4QWBA 3OFEA 1GX6A 1H0HB 1RT1A 2Y1LB 3O1LA 1X8DA 2H5JB 1N5QA 3CW2C 1X4GA 2R7UA 3OBIA 1ZS6A 4ED0A 3TQ1A 3NGUA 4NCGB 1FRKA 2PFFB 2IRYA 2CYYA 4USWA 3N9UC 1X5OA 2M70A 3V6DA 3O3LA 1GTHA 2FTRA 4F50A 4USUA 1WC5A 4YP3A 1VQOS 1T95A 4OX9F 4OI0A 4ER8A 4OZ5A 3MXHP 1FI4A 1IKYA 5E3CA 1HNVB 3T41A 1QAXA 1TAUA 1RT5A 4KBIA 2E7VA 2H3EB 2MY7A 4ALZA 2FJXA 3L4BC 1OQ6A 3MMBB 1T03A 2WBRA 1JLFA 4B3MF 5F41A 1SH2A 1U6ZA 3L7OA 2XZDB 4W92B 3RR7A 3OV7A 1JLAA 2D7SA 2J0WA 1HNIB 2HHWA 5F0UA 1NU4A 3EX7B 2L9WA 1AA1B 4LSLB 1J27A 1KSPA 5HQMA 1JKHA 1SJQA 4IOCQ 2QL5B 2F4VF 2W9CA 4WXWA 1IWAA 2B9YA 4JI2F 1FERA 1HBMB 3VV2B 2XGQA 1KNZA 1LWFA 2DNHA 4USMA 2A10A 4ICLB 2QRRA 5K8OA 2MB0B 4HR2A 4LF4J 2VG5A 2DGTA 2ZNYA 4G65A 4EYIB 3ULHA 1HI1A 2E5HA 3M1VA 3RZAA 3GIKA 5B0BA 4DLEA 1C0TB 4HL9A 4UOGA 1RCOB 3BKUA 8RUCA 5E5NA 4ZK7M 1HBNB 2DRDA 1XNRF 5BR8J 2O1PA 4LF6J 2MGZB 1YJUA 2A6MA 1AXQA 1SPBP 2LQ9A 4KAIA 2Y1RI 3HVTB 2CZ4A 1KTQA 1UFWA 3PACA 2IRXA 2D41A 4E98A 4ECXA 1OYDA 4F0KA 4FP9A 1Q8KA 4L3NA 1S4EA 2PI5A 3NMRA 3NNCA 2L3MA 1KRPA 1U6BA 4DV1J 1UW4A 1VS3A 1LK7A 3QZ7A 4LVNP 5AXMA 4A8QA 3FC9A 3AOCA 3BGOP 1U0HA 5BJRA 2I38A 5CCMA 1HR0F 2EVZA 2C3PA 4PZVA 3GFZA 3SSRA 5J2MB 4UUWA 4GKKF 4LF8J 4DV5J 1QJHA 2BBEA 2E1PA 3HFVA 1Y9OA 1CLFA 2NLWA 3LUYA 4ECZA 4A46A 3DRYA 1H6KX 1KLNA 4PR6A 4ECVA 1D8ZA 4O44A 1BQNB 3TI0A 2V4JA 1F2HA 4JYAF 2UVVA 1NSKL 4UZBA 4HI2A 2E9TA 3Q8YA 1RT6A 3UVJA 1FX2A 1EKRA 4JB8B 2ERRA 2UXCF 2I5JA 2GVDA 2OPPB 1JLBB 3OXFA 1IBKF 3BF4A 2J76E 2EG2A 3MPWA 3K7RA 4U7UK 1UA1A 3V6KA 3WZ0A 1RZMA 1N56A 3GCXP 3DU5A 3MCOA 3CMQA 2KG1A 4DX6A 1S7IA 3KHGA 3ENQA 3PXGa 2C2OB 3NCPA 1TL5A 4DPYA 1LWCA 2UV8A 3M4XA 3ISND 1YJRA 3CDEA 3MD1A 3HULA 3A3NB 3MTKA 4DUYF 4KT0C 3K58A 2R7RA 1FFWB 4PWDB 2WAQD 1NPKA 3DOKA 4DV6F 3K17A 1YVFA 3DLGA 3WDOA 2MKJA 3ET6A 2FHMA 2WTFA 1VQ4S 2ZH5A 1S1XA 2MQNA 4ZN3A 4U8YA 5DDRC 2RDJA 2AGPA 2RMLA 4L72B 2XNQA 5A8RA 3R97A 1GMWA 2HVIA 6AT1B 2YKNB 1B70B 3PM9A 5FDLA 3AOAA 4TLRA 2V50A 4H4KC 5E3QA 4ETZA 3PX6A 1HNXF 2HAIA 1RWXB 2VBWA 4KSEB 2YVSA 3D6TB 4RU2A 4NCGA 1RXOB 1CSJA 2N4CA 3PNIA 1RHRB 1RTDB 2VFTA 4OX6A 2RD5C 3AD7C 4OX9J 3DOMA 5IQ6A 4F7VA 4MYTA 1OJ4A 3OTDA 4LBPA 2R7VA 3D0HE 1EAYC 2AHOB 3WC2A 5C42B 4G6VB 1DAXA 1DFDA 1VRTB 3CCTA 1R8HA 1S1WA 2CFXA 3MMBA 1IJEB 1HNZF 3OUYA 3EWGA 1J2VA 4B3MJ 4AL6A 1SL1A 3K5PA 5IS2A 1M1KT 4ZN1A 2J9EA 3M8SA 3BH7B 1AW0A 4LSLA 3QSIA 2KM8B 1HWIA 2BKNA 5L1KA 1KONA 4X4OA 2AZ3A 2F1FA 2F4VJ 2CQ1A 1KHWA 4XK8C 2QIFA 2WW4A 4CT8A 4Y2MA 1IKWB 1HBMA 4JI2J 3CJ2A 2HFUA 3CGIA 2KVQE 2R42A 4WIIA 2PFDA 3PY8A 5M2UA 3A3OB 4WP8A 4X4TA 1TKDA 2VONA 3GG1A 1IR2A 4NRUA 3F0NA 4P72A 4A4JA 4X64F 5H9FJ 5DRKA 5FLXU 2VJUA 1NJIT 1R89A 2OKQA 5GMDA 1RADB 3A3PB 1VQ9S 3T1HJ 1S6UA 2IMWP 1FNMA 1JJHA 3M6VA 1H2UX 2HPUA 5CA5A 2XY5A 1HBNA 1IN0A 1XNRJ 1S0NA 1CJTB 2XO7A 3BYPA 1EP4A 2OJ3A 2AF6A 1PKUA 5CQGA 2V69A 5K8NA 4JI3F 4CIOA 1Z2ZA 3OL9A 5KFXA 3HVTA 2CQHA 4IUFA 3VVTA 5CYJA 3BB5A 2BJ9A 5F9LA 4B3TF 2DH9A 3UE2A 2ZH6A 2FHKA 4JUZA 3T5HA 2K1RA 3WQPA 1U4BA 2IIHA 3DGPB 4J91A 4ES3A 4JI1F 3Q2TC 2UVRA 3PIOQ 1TTHB 2J6TA 2NZ4A 4N77A 4FYWB 4LSNB 3R5CA 1HR0J 5J2MA 4OI4A 4N7TA 2R9LA 1KLMB 4GKKJ 4DV0J 2YWWA 2DHAA 4K7QA 2HIYA 4WTOB 2NXCA 2ZBRA 1Y5LB 9ATCB 3TAMA 2WVBA 4NZ6A 1I5OB 1U1MA 2M7SA 5FD1A 1CVJA 4JYAJ 5DQGA 2CZ9A 2N82B 5DGBA 2B4VA 2HZCA 1DLOA 2DGQA 2IVYA 2CUYA 3OLBA 4C2MA 5C5JA 2UXCJ 5A6WA 2OPPA 5RUBA 1UPMB 1VHIA 2ATCB 2QSFA 2ZBPA 2C3MA 1QVFR 3BKFA 4OYOA 2QFJA 4KTQA 3HFKA 4Y2CA 2ADBA 1M5VC 3DCAA 1ICEB 3BKTA 3F73A 5L8RC 4CH7A 4ZS6A 2MDAA 1JQGA 4DEZA 3H2VE 3IWXA 4ZPWR 3UO0A 1WJ9A 4DUYJ 3KOAA 2DH8A 2AYBA 4PWDA 1HHQA 3I4HX 2VBYA 2H9ZA 4B17A 4IOAQ 4URGA 3PW2A 2VFVA 4DV6J 1H7WA 4CH1A 2VC1A 1TV6A 3Q8SB 2GVZB 5KFDA 2GX8A 4Z37A 2R2RA 2GZOA 3ZZYA 3HZEA 2AEMA 1WSRA 3HJVA 1K0VA 1VMBA 3PW7A 2Y8WA 4ZPBA 1S0MA 1U2FA 2HLTA 4URSA 2FZCB 4LRCA 1NZAA 2YKNA 4C7QA 5JXSA 3Q8VA 3LPYA 4CLWA 1ZTWA 2YKMB 1TKXB 1N36F 4OYPA 4ID5A 5DG8A 5ETKA 4DR1J 1JK9B 4J9VA 5C2GA 4OI1A 3PEJA 1Q5YA 5KFTA 5AE3A 2ABYA 4CLLA 3TZWA 2ZC3A 2QFIA 2Q66A 1Y5NB 3T19A 1X4BA 2HBQB 1FHTA 3JB9k 2B43A 2CVEA 5J2QA 4AE5A 4UT4A 1FRJA 4PWWA 4B9LA 4OHZA 2V6AA 3K89A 4ZIWA 1G2EA 1HNZJ 3RBZA 2ACMA 1M0SA 4PG4A 1GQEA 4MMOA 1W26A 1T11A 1OPIA 3I4PA 4RBUA 2UUAF 4DU7A 2HZVA 1VRQC 3TVZA 2AYMA 2AJ1A 4OHVA 3KK1A 5I42B 1URRA 5LMUF 1F9HA 4Z7CA 4RL1A 3J7YU 4NMXA 2QO3A 1HD0A 3OD2A 4CZCA 3VTIA 2XY6A 5HJXA 3F41A 3BQ0A 4I68A 5DGAA 4C11B 4LF9F 1R0AB 2N3LA 4TU8A 3CCSS 3CCUS 4X64J 3CJ0A 3KLFB 3ONQA 2MKHA 4TQRA 5A2QU 3VWSA 4JI8F 3TUIC 4X65F 2D74B 2W2NP 1FRLA 4PQUA 1U6FA 1Q8BA 4WWSA 3P5TL 2C3UA 3MURP 1VBZA 1F9FA 2HGMA 3VAKA 2HNZB 3FBFA 2VFSA 3W9IA 1APSA 2YY3A 4JI3J 4P6QA 5LSRA 2RH3A 2MZTA 1NSQA 3MTJA 4B3TJ 2AD9A 3VQTA 2HG4A 1NJXA 1UTAA 3MR2A 1VCTA 4J9LA 2DR7A 1YBUA 1P9QC 4ED1A 3FKBA 4O23A 4JI1J 3OR1A 3BQ2A 1WOOA 2LU2A 3I31A 2RU9A 2ZWOA 2OSQA 2MJUA 2CIMA 3SQOP 4WE1B 5C24B 4DWIA 4B9NA 2VC0A 3HO1A 2BM1A 1SL2A 1KLMA 1UZHA 1TKZA 1T9TA 1K47A 1AYEA 2E1AA 2V94A 4ITSA 2ZZNA 1S1VA 2LA4A 1S1TA 1NCLA 2X1BA 3N01A 1WACA 3BPSP 2UXBJ 4OYXA 2IY5B 1U24A 2GHWA 2ILYA 4RNNA 5ADZA 2VDHA 5FLXY 2LEPA 4QQBA 1RE1B 2GMLA 3ZO7A 5H9EJ 1PCAA 1RTHA 3LF0A 2VA2A 5EHHA 3MD3A 4CO1A 1CS4B 3GMGA 2XEXA 2P9EA 3UWTA 4RPFA 1C1BB 1RTIA 4DL6A 3MMAB 3Q8QB 4LR8A 5DDOC 2MKYA 2MZRA 3IP0A 1EHWA 4QOTA 3JYTA 2U2FA 2XMJA 5L38A 1TKTA 3KLIB 2HNDB 4IDKB 3N6MA 3U1NA 2FZKB 3KTQA 4QR1A 4Q0BB 3J81j 3CXCR 4K0KF 2V4RA 2QYGA 1RCXB 2NYHA 4C3LA 5IC6B 2YKQA 3CJ5A 4D3HA 4WKRA 1ZZNA 4FF3A 3V81A 1FJGF 1HKAA 1BHNA 2K7KA 3HVRA 3BPDA 3PV8A 2GVZA 3EUNA 4USKA 1HQEB 5L1JA 3WX4A 3MR7A 2GGPB 2HMIB 2OIHA 1SKWA 1RA7A 3W2WB 2QJ3A 1HLWA 1MWZA 2ZH9A 3QATA 1UVLA 2ZVIA 1FVSA 2FJBB 4NMLA 1YSJA 3ZZOA 1Y3KA 3H42A 4G1QB 1FKPB 5LSOA 1NAQA 4CRJA 1F60B 3LGHA 1T8EA 1S49A 2YKMA 2IYIA 1N36J 4AD6A 3FUYA 4M5JA 1RAGB 3W61A 4EO8A 2LFVA 1O51A 1FRXA 2MKIA 4C6AA 1VR6A 2ZJPQ 2MMYA 3RB3A 4F3QA 2JH3A 5AXKA 4NLVA 1UWBB 1Q8LA 4M5MA 3HD1A 3WIVA 1X9WA 1OO0B 1GMUA 2H5EA 3B78A 3LP1B 2M4MA 3M2UB 4M5HA 2DTJA 3N0VA 3FZ2A 1UJ4A 1JNZB 4JI0F 3DU6A 3SSSA 3AD8C 4Q5VA 2G0CA 2LXFA 4O0IA 4NLDA 2L48A 5EDWA 2UUAJ 4WF9Q 1YJTA 1U09A 2JRSA 3KFWX 2NREA 2VH7A 4Y28C 2NYIA 1KHVA 5I42A 5HVGA 4C98A 4WFZA 3IBFB 4ERDA 5LMUJ 4DV4F 5KFWA 1U26A 1TL1A 2RHQB 4DCPB 3P96A 2HZAA 2EK6A 1FCAA 5ETTA 3M8PB 1CJKB 4LF9J 4B9TA 1R0AA 1K1SA 1KTVA 2DNOA 1QUPA 4ILLA 2CADA 2PN6A 4FVCA 3JSBA 3FMWA 2X1AA 3J80U 1RKJA 4IG0B 4MKYA 1RT7A 4C4WA 1U45A 1ZM4A 1NSPA 1WDDA 2HQFA 2MZQA 4JI8J 4X65J 4LQ9A 2CG8A 4KH1B 2Q6BA 4ZVQB 4U9RA 1D3WA 4CM0A 3C3LA 3D68A 1VOMA 2JVOA 3J7AN 2GMHA 2XHCA 1DZ5A 1R8PA 4M5DB 1UVJA 2OP5A 4ZP8A 3FJ2A 2AP6A 2CKWA 3LAMA 1U1QA 4OYWA 4K4TA 2JEFA 2KJVA 1QSLA 3NEKA 4FKYA 2RQMA 4Y65A 4Y2IA 4HDHA 2W7PA 2WSCC 2WSFC 2P2CB 2AU0A 1FEHA 5KFQA 1N6QB 4OZ3A 4WE1A 4DR6F 4F02A 2IDLA 2BE7D 2W8KA 3RBEA 3MEEB 4ATNA 2LP4A 4DCJB 2CPDA 3AH6A 3OTEA 4DS5A 2ZOGA 3NBPB 4PYDA 4DR5F 4ZHRB 2NXEA 1QD1A 1V6HA 1FXDA 2O01C 4P7VA 3CC2S 3E2EA 2KN4A 4IO1A 4K2XA 5GADI 2V8GA 5K20B 2F3JA 2QLXA 3GR0A 2I0XA 1UCNA 2DNPA 1UEKA 2K06A 2HSEB 3KJFB 1SVDA 3RRKA 2D3ZA 1RAJA 2NPIA 4MTPA 1WHYA 1IBLF 2DNZA 1H72C 5ETOA 2HHXA 4OZ2A 2ZVSA 2RRAA 3NS7B 2UUTA 4IFVA 3X1LB 1EETB 5DG9A 3EJMA 4PG8A 3AB2B 4KO0A 2NZCA 4USHA 3R5JB 4K0KJ 2QYCA 5G0RA 1XN9A 2KDOA 1MMNA 3DMJB 3PW4A 4Q44A 3AD9C 1OMSA 4LJMA 2ZDOA 3J7ZT 3V6HA 1IQZA 3EM1A 1HBUB 1FJGJ 2KFYA 4H4OB 3ZZ0A 1VK8A 3C2PA 4NXNJ 2PMZD 4DUZF 2W2PP 3VAFA 5DJBA 1Q5VA 1KQKA 4ZJLA 2E66A 5B0EA 4B9SA 2NR0A 2GGPA 3TJ9A 1YJ9S 3W2WA 1GK8A 5ETRA 2OH2A 2Z57B 1IBCB 4I56A 1NRKA 4USIA 2GIQA 4NPOA 5KG0A 1HD1A 4IO9Q 3NY0A 5B08A 2ZWPA 5L9XA 2XM3A 1UWAA 1FKPA 3M2VA 2M5YA 4RW4B 3ETMA 4L75A 4IH5A 3BDPA 1FJCA 5HLFB 1C1CA 5J1PA 4EBEA 2AEFA 3MF5A 4I67A 1IBMJ 2AWZA 2CJYB 1PJ7A 2OD6A 1K73T 1SIZA 3BREA 5J2NA 1I6JA 3M32A 3LP1A 5E3AA 1B64A 3NAHA 4LFCF 4FS2A 3M2UA 4O3QA 3NXZA 4MKBA 2AX0A 4JI0J 3IRXA 2C2RA 4JV2A 1YTYA 1VJQA 2EC2A 2HQDA 2ROGA 1RJJA 2CJXB 2ZZMA 2XYPB 2XO6A 3IFEA 4JV1A 1U1KA 2FVCA 2XTJP 3W62A 2XI3A 4RNHA 2VFRA 1QTMA 4HHJA 5CHCB 2QA2A 2DGOA 1Q81T 4UY85 1RWWB 4N76A 1G1XA 1UPPA 3HMJG 1DBDA 2GJFA 3QBCA 2DB1A 1ZAVA 2ZUGA 2BQUA 3IC1A 3WIUA 4OZNA 2KH9A 1IM6A 1V3SA 3KLGB 1VRUA 5KT2A 2OI2A 4J9SA 4C9DA 4WTYA 4QWDA 4U96A 2R8KA 2LQ8A 1Q95G 1YBTA 3HLUA 3QWPA 3CTRA 4A8KA 2VASA 2ROEA 2N7YA 5D4NA 1HQUB 4F0HA 4KGXB 1RWOB 5GAGU 1Q7YT 1KKHA 3T1AA 3UFCX 4UW2A 1FE4A 1SC6A 1WOSA 1X4EA 5ETLA 5KFGA 1HQ2A 2HFNA 2ZH8A 4M5DA 3GR1A 3RRHA 2V4QA 2XMUA 5IM0B 1G7CB 3VHQA 4ZVSB 2BQRA 3QIPB 3UD4P 3AFGA 4KV8B 3EVWA 4X62F 3E3XA 4UUXA 3TR5A 1TR0A 1WG5A 1B7FA 2B5JB 3LGNA 2XMMA 1M90T 2IM2A 3BM7A 1N6QA 1DURA 5L9NA 3VAIA 4DR6J 2QLBB 3PCOB 3MEEA 2XB2D 4DV3F 3RU0A 1AFIA 1WHXA 5C2CA 3T3FA 1SKSA 2IM1A 3NBPA 1VQYA 4ZHRA 4DR5J 1T9VA 2DJWA 4OI6A 3MUMP 3KNAA 1GH8A 3FBCA 5HMYA 5A8KB 1D09B 2WHOA 4NYPA 3ZXWA 1XMQF 3IBWA 2CQIA 5CYMB 1SQEA 3TAQA 5ETSA 1YKWA 4ZCKA 3J80Y 3PO4A 2UVUA 2V8DA 2GW8A 4DV2F 2NSCA 1W7WA 3CNQP 4TY8B 1CQMA 5KFKA 4M5NA 4DF8A 1WHVA 4WIQA 2QMXA 4CLFA 4I2PB 1S4FA 2X1FA 2XZTB 4YOEA 2ZH3A 1IBLJ 3ELHA 4EYHB 2YNIA 2OPSB 1NZ8A 4I0WA 1EZZB 1T02A 1N0UA 1NK7A 2ALYB 4WK1A 3EGZA 1JMTA 4QR0A 3CCRS 3TW0A 4DL2A 2R7TA 4ZLJA 2J9DE 5IQQA 3OFHA 2C22A 4DPUA 3HKZD 3MEKA 5U47A 1QAJA 3TA1A 2GFFA 4NX9A 5HK4A 3KXDA 2RF2B 5HANA 1IWGA 1FRMA 2OPQB 3M6WA 1YIJS 2EFGA 1BQXA 2WOMA 4ANCA 2VPZB 1ZM9A 2HFSA 2HK3A 3HX9A 2CPXA 1F0XA 3KHLA 3K5MA 4WU2A 1ZA2B 2CZVC 2YNFB 3MMCB 4ZCLA 3GFHA 3AAWB 2NUHA 2DD8S 2HS3A 4KYZA 1H38A 4RR5A 1DRZA 3M9MB 1I51B 4XPCA 3M8QB 1NJWA 1RTZA 4RW4A 3QRRA 4ILRA 1VYAA 4LRDA 5HLFA 3DKDA 3QQCD 2QC3A 4I64A 4CP5A 2ZUAA 2BDPA 3H5UA 3DLEB 4M63A 1CULB 4O4GB 2ZBCA 4NLWA 4BWMA 2YQ0A 1UFKA 4WFXA 5KFCA 1Y10A 2HVEA 1V9OA 1VQMS 4UOCA 2HHVA 2A2CA 1MROB 2QX0A 2AJ4A 2VF3A 4LFCJ 2E9ZA 5DS7A 4I2QA 5DQHA 3DLKA 4YB6A 2DT9A 3VGUA 4F36A 1LW0A 5F3TA 4DPTA 4PYAA 4R5PA 4NOHA 3MM9A 3QO9B 3R7NB 1LXJA 4GO5X 3Q24A 4KR0B 2NXJA 4OL8A 2ZHOA 4KGZB 1J5EF 4ZA1A 4QIFA 2QL7B 1FK9B 2H4WB 4QU7A 1AZSB 2Y3YA 4ED5A 1TL4A 2C2NA 2IJRA 1L5UA 3HHLA 3OXLA 2POKA 2KXNB 1XMOF 3D28A 1QUVA 1Z1ZA 1WOPA 1JLCB 3PO5A 4ZOSA 5I3UA 3GILA 5KFMA 1WG1A 4O3PA 5L1LA 4J9NA 2IYGA 1VJWA 1V3ZA 1HHTP 2WVDA 2X3DA 2BE9B 3M9NB 2MSTA 3C15B 3IRWP 2XCAA 3QRPA 1TUGB 2AJQA 3G8SA 3GYGA 3RJMB 3R5AA 2HBZB 5A6PA 5AXLA 3BS9A 4RNFA 3KLHA 2DRAA 1S76D 4AL5A 3FRZA 2DCLA 1T9UA 1U1OA 2AJ0A 4DX5A 4NEZA 2IAJA 2IVMA 2W2QP 3UN3A 4KHPF 4QWAA 1FFSB 3NWGA 4ZMMA 2ZH7A 2MQ8A 3QIPA 1V5VA 2KT2A 2C28A 2EFOA 3R1LA 5K5MA 4LBHA 4KV8A 1KBRA 2GJ2A 4X62J 5HBMB 4HTJA 2Y9HA 1FKAF 4JP8A 3R5DA 1FNXH 3OLAA 1XK8A 2FVQA 2ZBIA 2YNGB 3BGLA 2QSWA 4LSZB 1PILA 1NO8A 2IRUA 4HDGA 2QG9B 2VG6A 4CLSA 2IM3A 4ECUA 1RYSA 2RQ4A 3MCMA 3M8RA 4C8MA 2MQQA 3CDWA 3GIMA 4DV3J 2HRTA 5C7PA 3H5XA 3OL8A 3GIJA 4Y6IA 1WEZA 3QGHA 2YQ1A 1VHFA 3C14B 3KJQB 2QA4G 1RWUA 1JLGB 1GAOA 2YKAA 2E1MC 2OPRB 4MJKA 4R0JA 3AXKA 3C6UA 1XMQJ 4RWWA 5KFZA 3IM8A 1HARA 4DN0A 2LQJA 1PYOB 2RB7A 4KY3A 4BLGA 4DSEA 4AFFA 2KT5A 4Q8FA 2VFUA 2FLOA 4DV2J 1BQMA 1VQSA 2ZZTA 4TY8A 3FBBA 4DR2F 5D0HA 1W2BR 5D3GB 3SCIE 1YZ7A 4M8LA 1GMWD 3I5BA 4RW9A 2BUNA 1FD2A 3I32A 3NGKA 5HO4A 2OPSA 2DITA 1O8BA 2F9DA 4YHHF 3SYZA 3EGVA 3GJSB 3FEXB 2Z2ZA 4PCQA 3R2DJ 3JQKA 2W9BA 2W7AA 2JEJA 4ZVOB 4MAKA 1RWNB 3W7BA 4PRFA 4JI4F 2JJ4D 1QVGR 2E1CA 4Z2XA 1RT1B 5E0OA 4WBFA 2RF2A 3DC2A 3O5TB 5KT3A 2OSRA 2DNGA 2FLLA 1N5YB 2CWXA 2UXDF 1HIYA 3B54A 1W25A 2CPFA 2FC8A 4OHXA 4RZRA 2CAJA 3MMCA 2YNFA 3V6DB 3MM6B 3R1HA 3DHWC 3QJJA 1SUQA 3KLEA 1O6XA 4UOHA 3GLJA 1X4AA 4X4QA 2CQ2A 1N5SA 3JSMA 1IKYB 3OR2A 3LP0B 3R9LA 1DQ9A 5CYQA 1NB2A 4HLBA 1S1UA 3M8QA 4AL7A 1RT5B 2KM8C 1XEZA 3K57A 4OLPA 1T03B 4ILMA 3I96A 2BW2A 2RIJA 3R7SB 3CJKA 1U1RA 1JLFB 4ZLPA 3TZXA 1MN9A 3ZTPA 2IA0A 3ITHB 4IR9A 4RBVA 5HQLA 1H3DA 1JLAB 2DR8A 2YQ3A 4LF5F 3HDSA 4KHMA 3DLEA 2F5GA 1NHKL 3OTOF 1CULA 4O4GA 2B8QA 3I56S 1M1GA 2AGOA 4CTAA 5J2PA 2RVJA 3BSCA 2W9CB 3VAMA 2YWHA 2IVFB 5KT7A 2HYIB 2VKZG 2J6SA 1MROA 1LWFB 1OY9A 1ZTTA 1S59A 4M5KA 2E7WA 4QR2A 1AFJA 4O0NA 2JWNA 3CMAS 3NOGA 2VG5B 4OYBA 3M1VB 1WC6A 3D1HA 2J7WA 3MPYA 3NWRA 1J5EJ 4DBQA 4EI2A 1FK9A 4Z7YA 5D4OA 3UNGC 1NK9A 1U48A 4M5LA 3QNWB 1WHWA 3JAMU 1RI7A 1AZSA 3MM8B 5I4MA 5T14A 3O44A 2JOQA 3NOCA 2QTWA 3EVMA 5DM6Q 2KYZA 1LXNA 1P9YA 3G8QA 1X4HA 3HT3A 1U49A 2UV8G 4N8OA 5D78A 3M7VA 5LM7E 1UVMA 1DTTA 2Y0SD 3PFEA 2JVRA 3P8BB 4XIUA 3QAUA 3HHLC 4PAAA 3CJ8A 3OT9A 3N4WA 2ZE2A 4M95A 4YMEA 2CPEA 1YWXA 2VPYB 3IR5B 1SJRA 1RBLA 2P9CA 1FESA 1U0HB 5ITHA 3FQLA 2RJZA 4LIRA 3K5LA 4F8RA 3HSJA 3CJTA 2EC0A 2FB0A 1VQ8S 4LF8F 2W4DA 2P6SA 4KHPJ 3BBBA 2JLFA 2E7XA 1M5OC 4O44B 3QZ8A 1T05A 2QGFB 1FWLA 4F2RA 3EMTA 2CJBA 4JBCA 2V4JB 2V67A 1Y3JA 5IC4B 1LFPA 1TMJA 2NUUG 2Z2YB 4PG5A 1R8BA 1MW7A 2YNGA 5KG3A 1RU1A 1RT6B 1SI9A 2RQKA 5A0YA 4OJHA 1C0UB 2JC1A 3UVJB 2OELA 4NXMF 4TU7A 2I5JB 3H7HB 3HXMA 4ZDNA 3C46A 2YPZA 4DL7A 2HHPA 2AT1B 3GPAA 1CC8A 1WF0A 2WONB 2NPFA 3RB6A 1IKVA 4ED7A 4B02A 2B6AA 3BSAA 7FDRA 5EX0A 3C14A 4JI7F 2GMJA 3OVAA 2R7XA 3N28A 1OY6A 1HWJA 1SBRA 4QYZJ 3GCWP 1BUXA 4GVLA 3GV5B 1A6LA 2QLFB 1K9MT 5B0DA 4XAKA 5A8WB 2ZOMA 3MM7A 2BA9A 1R6VA 2W24A 3ISNC 4B9UA 4DR2J 4RUBA 4A48A 3PRVA 5D3GA 2J7KA 1FEEA 3M6UA 2UUCF 4AUKA 3CCJS 3BDEA 2DXDA 4DSJA 2OEJA 4X4UA 2ZDPA 2HHTA 4NLYA 5BYQA 3H4DA 3ET6B 4H4KA 4YHHJ 1N34F 1RB0A 1C4AA 1H73A 3M05A 3LW5C 3QLHA 5K8PA 1SB6A 3HSZA 2YNHA 1S6QB 5A8RB 2VQFF 1PJ5A 1XTZA 1OSCA 3DI6A 1T7PA 2WK4A 5FDLB 5IFMA 2HS4A 4C8YA 4WYLA 4HT5A 3FCVA 3BGUA 3GYNA 2H65B 3H59A 1GFWB 4IR1A 1N5YA 2VUGA 2GAGC 1H98A 1RTJA 1P6TA 2UXDJ 2C2EA 1IQTA 5B0GA 4NZ0A 1PGZA 2UU9J 3MM6A 3WBZA 1VC6A 2HBRB 1JLQA 5MLCV 2XGPA 1QAYA 2EFPA 3CD0A 3DOMB 3GG0A 2GQCA 3LP0A 4CO2A 3IM9A 3S6EA 3UDLA 1S1WB 2MSSA 3ILOA 3TANA 3K5NA 3CJQA 3OUYB 3C66A 1X60A 1AT1B 2C2DA 4HI1A 2CQDA 3ITHA 2ZH4A 2Z4PA 1QSYA 4NLQA 4LF5J 1RAFB 3KKFA 1A9NB 4ED4A 3OTOJ 2BRKA 1VQ7S 5FJ4A 1TK8A 4UQTA 1KP6A 1DARA 3GWCA 1TL3B 4TNOA 5KFPA 4FZVA 3QT5A 2XCPA 3OJSA 4ZPDA 5ETPA 2BKOA 4ECWA 5KOWA 3G86A 4ZVPB 2PMHA 3VQSA 4NZ7A 3CO9A 5ETNA 4ANEA 3BO2A 5GAGI 5KG7A 2DRBA 3GIRA 3T1HF 2DGVA 1GNKA 4EU0A 3NGDA 2VB6A 1P1LA 3MM8A 1Q7LB 4EEYA 4X4PA 2EKNA 2KRRA 3SIPB 1EP4B 3A8KA 2IJNA 2ZD1A 2D3UA 4RNOA 3PHEA 2OD4A 3HVAA 4Q2MA 4Y00A 2OEKA 1HPZB 2F8EX 4DOZA 2QN6B 3QT7A 4FKXA 1KC8T 1K0TA 2R7OA 2K1RB 3J7A1 1N5TA 3K8WA 4MK7A 2DY1A 4K4YA 2FJVA 1VC5A 3HHDA 4F67A 2HVZA 1FF2A 3I5AA 4HHUA 3V2UC 2PSZA 4JV5F 1EARA 3TQEA 1F9EB 2XBPA 3VALA 2YX7A 2ZOFA 4TY9A 1R6YA 4DV0F 4CNZA 4KRWA 5F8MA 2M52A 1U47A 2RS8A 3PYGA 4EBDA 2LU1A 2ASLA 4LVOP 1UAWA 4LIWA 4CT9A 3TAMB 1D9AA 3DFEA 3HI9A 3U27A 4P2SA 3IA0A 1Y7PA 3UW1A 2RKIA 4I6AA 4IOBA 2AZ1A 1S48A 1FVQA 1T94A 3G82A 1DLOB 4AQYF 3I9ZA 4FXVA 4Y0FA 1SJ4P 1C0UA 3T5JA 3MZIA 3JAMY 4NXMJ 3TO8A 3UPFA 4KPYA 4ZJOA 3FK4A 2MYFA 3TNVA 4C8LA 1NK8A 2WONA 4C8NA 2BVZA 2RT3A 3QT6A 4JI7J 3PHTA 4DPXA 4DCOB 4ZVUB 4OIXA 1HI0P 3S8SA 3CD7A 4RUHA 2HHSA 1OS5A 1KFDA 1GXTA 1S9FA 1HWUA 1UJ5A 3ILIA 5IT0A 2HGLA 5A8WA 4DQQA 3LP2B 4WP3A 5KFRA 5K8MA 5AE2A 3AOBA 3HHNB 2V2ZA 1NHVA 2E44A 5F9NA 4HH1A 4A8SA 1VFJA 4ZP7A 2UUCJ 1TV6B 2IJFA 5CD4A 1JIHA 3P3DA 4FXDA 3TA2A 3P5BP 2K7JA 4FS1A 2E5LF 3DLHA 1N34J 4ZIVA 3VAHA 2F7VA 4WFNQ 4ECYA 1S6QA 2MHNA 4CLYA 1TUVA 3GYXB 1HHSA 2VQFJ 2WVCA 1OIAA 3TZYA 5GAHU 4CLTA 2XC9A 2V34A 2B9WA 2RUSA 4S0MA 4A8OA 4OLOA 3G6VA 1X0PA 1N48A 2DGWA 2MQLA 5E2QA 5HVHA 2XULA 3RAXA 4ID5B 4Q43A 4DR1F 3THPA 1X4CA 1BC6A 4K4SA 4LF2A 5GVQA 1N33F 4NLOA 4FYXB 3CJRA 2HRUA 4LT6A 2M9KA 3KNGA 4A8XA 1HYSB 2XZWA 4PABA 5IT9U 2QLJB 1A7GE 3P45B 2HKEA 4UF4A 3GSIA 3N79A 4OYZA 1RAIB 1B0PA 5J2QB 1VIXA 1RT3B 4PPZA 4NLXA 2B7CB 4OJ3A 4WZMA 3DNCA 4TXSA 2OEMA 4O4RA 1B0TA 1B7YB 3DHXA 3IWLA 2DGSA 1S12A 2W2MP 1D0EA 3DXBA 4L73A 2LA6A 2HFOA 2A1BA 2AMCB 3OVBA 1XMBA 3KK1B 4GKJJ 5IZHA 1PG5B 2BOPA 1TL3A 1U25A 4MIWA 2PA8D 2L9DA 1SV5A 4IH7A 3W8PA 2WW8A 1RBOB 2C1EB 1VC0A 4I7FA 1N4LA 4C0BA 1T9XA 1BXNA 3AQPA 3HSGA 3TUJC 3PFOA 5KT4A 4M5IA 1EJ7L 4F25A 4QIVA 2F4FA 4PQUB 4I6WA 5H9FK 4NLUA 2OFHX 2CQCA 2KHDA 3GV8B 3R5BA 3DRPA 2FGOA 4BC9A 4FBTA 3GB0A 1E6YA 2FHOB 2V68A 2BEFA 2V8PA 2F8HA 1NJZA 3B4DA 4EBCA 2IHR1 3BR8A 1HPZA 1IM4A 4M1KA 4J9UE 4GMKA 1VQPS 3W2VB 1Y4ZB 4MK8A 3EPGA 3OR1B 4P74A 5DDPC 4J5OA 1D9FA 3AT1B 4USTA 4Y2KA 4CO4A 1VISA 2ZHAA 2PE8A 4YB5A 1WDTA 4J9QA 2JSXA 4KB7A 1NKCA 2DHGA 4JV5J 3CJ4A 1ZOTA 3TARA 4A47A 1TKZB 4J90A 3OTCA 4O3NA 1S1VB 2BV3A 1S1TB 2EPIA 2DNLA 2UXBF 4E0DA 1WNEA 3MFIA 2MTLA 1S6OA 3DYAA 1U1LA 3MOZA 4QIWD 5DDQC 2U1AA 3BSOA 5T7LB 1HBOA 4AQYJ 2E9RX 1RTHB 8ATCB 2PEHA 2GJIA 5F3ZA 1WF2A 3H5YA 3RTVA 2QL9B 1KN6A 2CPZA 2B9XA 3KDOA 2UVWA 2HQCA 1RTIB 4UOFA 3EDRB 2AV5A 1OY8A 3JQMA 4PWUA 1NLKL 1B3TA 3I0RB 4NASA 5CAAA 3JYTB 2BYCA 2PDAA 1TKTB 3KWMA 2GHVC 3PIPQ 1VK3A 1BGXT 3UN2A 6FD1A 4O3RA 2HWHA 1OQ3A 2DHHA 1TL7A 4ZPVR 2D3OR 5B0FA 1RHJB 1T3NA 2CQBA 5IXUA 3LP2A 3NGSA 5L39A 1H2TZ 4KH0B 4MFBA 2FLPA 3QRQA 4ZPCA 2LKZA 2A0FB 3V81B 1U02A 4QW8A 4RW6A 1WEXA 3HHEA 4HTIA 1MMLA 1PC5A 3NAIA 5AJ3F 3AHPA 1NDCA 1MSWD 2HQIA 4IG3A 4P2FA 4C0HA 5K14B 3NGTA 2E5LJ 1KOHA 3U02A 1RAAB 4K4ZA 3I82A 3ZNUA 1LWXA 2Z56B 3VVUA 5K9FA 4TQSA 4WU3A 5HI7A 4DU8A 3EZ5A 2B3TB 3DM2A 4Q8EA 1RLCL 4LF1A 1VQ5S 3LOUA 3TEGA 5D4PA 3FZBA 3RBXA 4OX8A 3CULA 4ZPAA 1N33J 3G6YA 3PW5A 3P6YC 3H0PA 1RT4A 1RBAA 2G1DA 1HYSA 4F04B 4OFZA 2G2ZA 2N4DA 4USVA 2FJAB 4DQPA 3C8YA 2AYEA 2IMOA 2GIRA 3BZQA 1I94F 3LA0A 3CDAA 4ELUA 4RU9A 5KFVA 1FE0A 2VDIA 2V0NA 1NK0A 3Q22A 3E01B 1CC7A 1RT3A 2QV6A 4ECSA 2HURA 4OZJA 2CPJA
chains in the Genus database with same CATH topology
4WU2A 1LWCA 2I1RA 2UV8A 3M4XA 2XMVA 3PEHA 1UEVA 3ISND 1U1NA 2CZVC 1YJRA 2YNFB 3MMCB 3CDEA 3MD1A 4ZCLA 2MQPA 3CF5Q 2CJKA 2FVRA 2ZD1B 3GFHA 4YB7A 3AAWB 3MTKA 4KT0C 4DUYF 3K58A 5LXYA 2R7RA 2JHEA 4FF4A 2NUHA 3TVYA 3T1YF 2JEGA 4PWDB 2DD8S 1PSDA 2WAQD 2ZITA 3U1LA 1RT2A 2HS3A 1H38A 2R8JA 1DRZA 3BGFA 3M9MB 3DOKA 4DV6F 3FQKA 3I6PA 3T6BA 4DJBA 1FKOB 4IRCA 3N6LA 4XPCA 3M8QB 1UVKA 3I5CA 1NJWA 3TVKA 3MOJB 3S01A 1YVFA 3GV7B 4RW4A 3DLGA 4H4MB 3WDOA 1TL1B 3VZIA 4ILRA 1ZZFA 2MKJA 3DN9A 2FHMA 1DQ8A 3VAGA 2WTFA 2DISA 3K5OA 1FXRA 3RAMA 1VQ4S 2ZH5A 1S1XA 2MQNA 2FJDB 2J8AA 5HLFA 5F8HA 2OMLA 4I64A 1PC4A 2BDPA 5KG6A 3UR0A 2GCFA 1ZPVA 5DDRC 5HMWA 4FNHA 3H5UA 2RDJA 2AGPA 4MK9A 2CQ0A 2RMLA 4L72B 3DLEB 2Z0GA 4M63A 3H2LA 1XR5A 5KG2A 4O4GB 2XNQA 2ZBCA 5D8HB 1C1BA 5A8RA 4NLWA 2HIQA 3MMAA 3KG1A 4BWMA 2HVIA 4WFXA 2L41A 2YKNB 3TUZC 4R25A 3PM9A 2VOOA 1CG2A 5KFCA 5FDLA 2EWHA 1RT7B 4TLRA 1X7VA 4H4KC 1V9OA 5E3QA 4ETZA 3PX6A 1VQMS 1HNXF 3NKYA 4X2BA 4UOCA 1L3VA 3RB4A 2HHVA 3KLIA 2A2CA 2HNDA 2HAIA 5KFUA 2O66A 1MROB 4IDKA 3IGNA 4KC5A 2AJ4A 3DLLQ 2E9ZA 5DS7A 4I2QA 2VBWA 4KSEB 5DQHA 2R8IA 1IR0A 3DLKA 4Q0BA 2YVSA 4YB6A 2DT9A 3ICLA 3MR6A 2RKIB 4RU2A 4NCGA 1LW0A 5F3TA 4I69A 4V19J 2YKOA 4R5PA 3HZGA 1CSJA 1NNDA 4NOHA 3MM9A 3QO9B 1JWWA 1UKUA 1R27B 2V2KA 2N4CA 3PNIA 1LXJA 3ZC4A 4GO5X 1RTDB 2ZC4A 3IAS9 3Q24A 4KR0B 2VFTA 4OX6A 2RD5C 4OL8A 2GO9A 2ZHOA 2LEAA 5CCLA 1J5EF 4WCEQ 4ZA1A 4C0OC 4QIFA 3JTPA 1FK9B 3MECA 3DOMA 4R0EA 5IQ6A 4MYTA 3OTDA 3T9NA 2KFZA 4YQWA 2R7VA 3D0HE 3WC2A 5C42B 4G6VB 5EWFA 1T3OA 2BRLA 4QU7A 1DAXA 1L3SA 2QEXS 4ED5A 2ZKTA 3SQGB 1TL4A 1DFDA 1VRTB 3Q8PB 3CCTA 3W2VA 1R8AA 2DNRA 4DHVA 1R8HA 2AGQA 1S1WA 1QY7A 1L5UA 3MEGB 3HHLA 4N47A 2CFXA 3MMBA 2PC6A 1IJEB 3OXLA 1X9SA 2POKA 2KXNB 1XMOF 3Q2SC 1HNZF 3OUYA 2DPIA 1HQEA 1KR4A 1J2VA 3D28A 4DL0C 1QUVA 2HMIA 3UR3C 4AL6A 1Z1ZA 1SL1A 1O0PA 2R4FA 3K5PA 3PDNA 2DGXA 5IS2A 4G3IA 1JLCB 3PO5A 2EBGA 4ZOSA 1M1KT 2E5IA 2YWKA 5I3UA 3GILA 5KFMA 4OX7A 1Q1KA 2MHEA 2J9EA 3MUTP 4KTQA 1WG1A 3M8SA 3ZFVA 4O3PA 5KOXA 1AW0A 3D54A 5L1LA 3CIZA 3MAQA 4LSLA 4J9NA 2IYGA 4W90B 1VJWA 2RILA 1DHMA 2KM8B 1HWIA 1V3ZA 1WEYA 4JI5F 4Y2AA 1HHTP 3HHKA 1LW2A 5L1KA 1KONA 4X4OA 4G1QA 2F1FA 2CQ1A 1KHWA 4XK8C 4EGLA 3M9NB 2QIFA 2MSTA 4M94A 3U1MA 3IRWP 2DIUA 1URNA 4CT8A 4Y2MA 1IKWB 2C3OA 2XMKA 2XCAA 3MPVA 4OZ0A 2BANB 1FTCA 1HBMA 2DO4A 2AJQA 3CJ2A 3G8SA 3CGIA 2KI2A 1C2PA 4KIAA 4WIIA 3R5AA 5KFAA 4AYBD 5E3RA 2VG7B 3PY8A 5M2UA 5A6PA 3VR1A 5AXLA 5KT5A 3BS9A 4RNFA 3KLHA 2DRAA 4X4TA 1S76D 2JDJA 1TKDA 1TFYA 4AL5A 3FRZA 1IXKA 2DCLA 1U1OA 5KAKA 2AJ0A 2VONA 4HKQA 3GG1A 3OPKA 1JLEB 2IAJA 2RQCA 2IVMA 2LYVA 1F5CA 4NRUA 1L3TA 2MY8A 4A4JA 4X64F 3PX0A 5T7LA 5H9FJ 2XLIA 4I4BA 4KHPF 5DRKA 2W7OA 2HWTA 4QWAA 4RX6A 1NJIT 1JX4A 1R89A 2OKQA 2XS2A 1S7HA 3NWGA 1UWBA 3T5KA 1VQ9S 1H2VZ 1S6UA 4JV0A 4ZMMA 5T41A 2ZH7A 4DSFA 2IMWP 1FNMA 1JJHA 3M6VA 3FFIA 1FNOA 3ISZA 1H2UX 1Q53A 2HPUA 2VV5A 3QIPA 3L7PA 5CA5A 5KFHA 3SZ2A 3IWNC 2KT2A 1X5PA 2XY5A 1HBNA 1IN0A 1RK8A 4RUAA 3Q23A 1S0NA 3KHRA 1N5VA 2EFOA 3R1LA 2C28A 5K5MA 4KV8A 1HW9A 4C8KA 2CJAA 1GXLA 2GJ2A 2KRBA 2Z2LA 4RKUC 2XO7A 3OSPA 1U1PA 1EP4A 3OJUA 2OJ3A 5LSLA 3IG1A 5HBMB 4HTJA 1S6PB 2AF6A 1FKAF 3I0RA 5D77A 3R5DA 5CQGA 3SSQA 1FNXH 3OLAA 3Q8RB 2VBZA 4C8ZA 1XK8A 4WFYA 2ZBIA 3UQSA 5K8NA 4IFVB 4UQGA 4CIOA 2FVQA 4JI3F 3G9CA 1VQNS 1VGYA 2GQ2A 2YNGB 1LKZA 1Z2ZA 3BGLA 4KKOA 4ZP9A 2QSWA 3VCDA 4DFMA 4E8UA 3OL9A 5KFXA 3HVTA 2HHQA 2DNKA 1CPZA 1PILA 2CQHA 4IUFA 4KO0B 1NO8A 5CYJA 3BB5A 3NS6A 2IRUA 4J9MA 1HWLA 5B09A 2QMWA 3UCZP 5F9LA 4HDGA 4B3TF 1YRUA 3G4SS 4NCBA 2VG6A 5G0RB 4KJIA 4RW8B 2IM3A 2DH9A 3UE2A 2ZH6A 1K8AT 4ECUA 4PUOA 1Z2LA 2RQ4A 1KQFB 1RYSA 5F8NA 3M8RA 2JLEA 4C8MA 2FHKA 3CDWA 4JUZA 4C3MA 2KO1A 2MQQA 4PG6A 3GIMA 3H5XA 7FD1A 3OL8A 3GIJA 3T5HA 3H5SA 3QGGA 4Y6IA 1WEZA 2K1RA 1U4BA 3QGHA 1AUDA 4ES3A 4JI1F 1VHFA 3ZZUA 2QA4G 1YGYA 5J1NA 1RWUA 4WKYA 1JLGB 3D0GE 1GAOA 1HI8A 5EUHA 2YKAA 3Q2TC 2E1MC 2OPRB 3VZHA 1JJ4A 4PXCA 2NSBA 3MDFA 4MJKA 4R0JA 4DMZA 3PIOQ 2UVRA 5DLGA 2XS7A 4U67Q 4NXNF 4G1PA 3C6UA 2D9OA 3KG4A 5KT6A 3M8PA 4RWWA 4ZVHA 4A8FA 5KFZA 2J6TA 3DLBA 2NZ4A 3FSXA 3SXLA 4N77A 1Y0HA 1HARA 3I87A 4DN0A 2LQJA 4DFPA 3DRSA 2J9DA 2K3KA 2RB7A 4LSNB 3R5CA 4JI6F 2AQ4A 1AROP 3THVA 2KTQA 5J2MA 4OI4A 3UDCA 4DSEA 1P8GA 2W8LA 5GMKa 4AFFA 2R9LA 5K14A 1KLMB 4B9MA 1RKIA 2KT5A 4WXOA 2DHAA 4Q8FA 2VFUA 2HW3A 2FLOA 1IUJA 4IG0A 3V4IB 2ZNZA 4GC6A 1BQMA 3T6JA 3SCJE 1VQSA 1JNRB 1QE1A 2X51A 2QLWA 3DXSX 4TY8A 1S99A 5I3QA 4DR2F 2BE2B 1Y5LB 1FD8A 1W2BR 3TAMA 3CJ3A 4NZ6A 3LO3A 1VIOA 2VPXB 4QYRA 1U1MA 2M7SA 2Q6CA 3LANA 5D3GB 3SCIE 2C3YA 2OO4A 4M8LA 3SI8A 4GKJF 5FD1A 3I5BA 4LUBA 3TOQA 4RW9A 3FEZA 5HROA 2F40A 3D0IE 2BUNA 1PO6A