2DB1A

Solution structure of the rna binding domain in heterogeneous nuclear ribonucleoprotein f homolog
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GSSGSSGMMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVELESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heterogeneous nuclear ribonucleoprotein F
publication title Solution structure of the RNA binding domain in heterogeneous nuclear ribonucleoprotein F homolog
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2db1A01
2RT3A 2GO9A 1WG5A 2K3KA 2XB2D 2CJKA 2DGTA 3US5A 2M4MA 4TLQA 5IM0A 4WIIA 1YJNS 3H2VE 2MKJA 3CCSS 2KYXA 1CVJA 2QA4S 3J7ZT 2M0GB 5GADU 2RQ4A 4U67Q 1QVGR 4IOAQ 3MOJB 2D9PA 2LA6A 2JVOA 3DLLQ 3UCZP 1VQOS 2MKCA 2YWKA 4RU2A 2DO4A 4TU8A 1D8ZA 5MLCV 2KH9A 2OJ3A 2DISA 1VC6A 2DK2A 4WFAQ 1W2BR 2MZJA 5DDQC 2OSQA 2M88A 2KXFA 2KXHA 4YOEA 2J76E 3PIOQ 4LJMA 2HGNA 3NS6A 3NNHA 3P6YC 4OZ0A 2DNRA 5DDPC 2DB1A 3VAJA 2OIHA 1VQ5S 1VQKS 4C4WA 1WI8A 2CPFA 2CPZA 5HO4A 1X4HA 1U1RA 2RNEA 1K8AT 1ZZFA 2DNGA 2J8AA 1M90T 2CPXA 2MSTA 1VQ8S 2ZJQQ 2KU7A 2MPUA 1K9MT 1P1TA 3VAFA 3THPA 4IOCQ 5LXRA 2CPDA 1L3KA 2L08A 2F9DA 1YWXA 2HVZA 3I55S 2KXNB 2ERRA 3CC2S 1FJCA 3MUTP 2MZQA 1FXLA 3H2UB 1IQTA 2MMYA 3VF0B 1X4BA 1URNA 2AYGA 2RQCA 5IQQA 2RU3A 4W92B 2MQOA 1N52B 4WFNQ 1DZ5A 2M2BA 2WBRA 2DGWA 1R8PA 2LEBA 3Q2TC 3CCLS 3ZZYA 2KRBA 2NLWA 4Z2XA 1X4EA 3SMZA 2CPIA 3CCJS 2DNKA 2RUGA 1PO6A 1H2VZ 4CIOA 2X1FA 2F3JA 2FPHX 2A3JA 4F26A 1FJ7A 2M8DB 2CQHA 2FC8A 3CCRS 3B4DA 5D77A 1U1MA 1FJEB 2LQ5A 3SDEB 4FXWA 1HD0A 2E5JA 2KT5A 5BJRA 3I56S 1KC8T 2X1BA 2DHXA 3MI7X 3IRWP 2AYBA 4J5OA 3UE2A 3CCMS 1YI2S 2U2FA 3HI9A 1SJFA 2XS5A 1S72S 1D9AA 5D78A 4CQ1A 3N9UC 2DNNA 2LMIA 2LEAA 3U1LA 3R27A 3CF5Q 2FY1A 2OSRA 2OTLS 1X5TA 3CC4S 4LIRA 4QU6A 4ED5A 1VC0A 3R1HA 1WWHA 3TP2A 2E5GA 1X4CA 4EGLA 1SXLA 2MJUA 1U1NA 1QM9A 2CQPA 2EK1A 3MD3A 2U1AA 2VOOA 2DGQA 2MKHA 2MGZB 4IUFA 3NMRA 1H6KX 1M1KT 2MZ1A 2F9JA 3CTRA 1VBZA 3UCUP 1UP1A 2CQBA 4TU7A 1H2UX 1YJ9S 1VBXA 2DGXA 3J7YU 3CPWR 2X1GA 5LJ5Y 1WHXA 2CPJA 1F9FA 2G0CA 2EK6A 1ZH5A 1B7FA 2N3OA 2LA4A 1NU4A 3MDFA 1N8RT 1AUDA 2MQLA 2DITA 2DNOA 4PRFA 4V19X 3BS9A 5ITHA 4IO9Q 5HL7Q 3V4MA 1DRZA 1PGZA 3CC7S 3MD1A 2M52A 2EVZA 3VAKA 4TU9A 3IWNC 3G8SA 2KVIA 4WFBQ 3B4MA 5DDRC 2MHNA 2XS7A 3UD4P 1U1PA 1FNXH 1WF0A 3THTA 1UAWA 3MXHP 1UW4A 5CXTA 1Q7YT 2OTJS 1VQ4S 2CPEA 2X1AA 1U2FA 2MQMA 3FEXB 2MZRA 3CCVS 4UY8T 3G9CA 2MKSA 1U1KA 3MUMP 2LECA 2CQDA 2XSFA 1A9NB 1WTBA 2JX2A 2DNLA 1XN9A 1O0PA 5GVQA 2DHSA 4Y0FA 1Q81T 1HA1A 3G4SS 3MUVP 4YUDA 1VQMS 1HL6A 2CQ4A 2MJNA 1A7GE 3VAHA 2MGZA 3NS5A 3BO4A 1WEZA 2N7CA 1BY9A 1JJHA 1HD1A 4QQBA 4F25A 3NNCA 2O3DA 3S7RA 3G96A 1VBYA 2LXUA 1NJIT 2HYIB 2DHAA 3EGNA 1OO0B 2CQ0A 1YITS 5IM0B 5LJ3Y 2NZ4A 5JVHQ 1OIAA 3VAMA 2KRRA 1YIJS 2CPYA 1M5KC 2DNYA 1WG4A 2KG0A 2BZ2A 1WHYA 3ZZZA 5DDOC 2LCWA 4PKDB 2GHPA 1M5OC 1P27B 2MKIA 3CMAS 4OZ1A 1YJWS 2MYFA 2PEHA 2D3OR 3RW7A 2RRAA 2E44A 2KM8B 1FHTA 1ZZNA 2RS8A 1WEYA 2MZSA 2RVJA 2LYVA 1X0FA 3CULA 2YH1A 5GAHU 3R1LA 2FHOB 1WF1A 4YB1P 3CCQS 2QEXS 2VODA 3DXBA 1FT8A 1H2TZ 1X4FA 1FO1A 3SXLA 5DM6Q 2MXYA 1YHQS 1RK8A 2YTCA 1NO8A 2HZCA 1RKJA 3VAIA 1WELA 3P5TL 1Q86T 1QVFR 2PE8A 5LSOA 1WI6A 1JJ2R 4BS2A 4ERDA 4M5DB 3UCGA 5DM7Q 1KOHA 1WG1A 2MY8A 1U1LA 3K0JA 2XNRA 3BO3A 3LQVA 1R8HA 2MY7A 1WHWA 1WHVA 3BEGB 3FEYB 4FXVA 1WEXA 1KQSR 2DGVA 2DNMA 2DNQA 2QFJA 5FJ4A 3OW2R 3S8SA 2SXLA 2VONA 2DNPA 2DNZA 1Q82T 3UWTA 3EGZA 4P6QA 5DETA 5LSLA 3ULHA 2MKKA 2YKAA 2V94A 4W90B 5CYJA 1U6FA 3TYTA 2MSSA 2E5IA 3L3CA 1VQ7S 2I38A 3SDEA 3TO8A 3CMES 4A8XA 1X5OA 1DBDA 2XS2A 1JMTA 2DH8A 2LKZA 2KN4A 2M7SA 2CQGA 1UFWA 1VQPS 3MURP 2BOPA 2M8HA 4WKRA 2DIUA 4QU7A 5GAEU 4F02A 1X4AA 1X5SA 2DIVA 4LMZA 3Q2SC 5CA5A 2E5HA 2DHGA 2ADCA 1JJ4A 1X4DA 2J0QD 1N88A 2CQCA 1M5PC 2K8GA 2HGLA 1G2EA 1X4GA 2AYEA 5LXYA 2CPHA 1YTYA 3UD3P 4QPTA 1DHMA 2KG1A 3S01A 4CH1A 3EX7B 1U1OA 1S79A 2B0GA 1VQ6S 2JRSA 2VOPA 3G71S 3CCUS 3RW6A 3P3DA 3S6EA 2DGSA 2CQ3A 2L9WA 3CXCR 1VQ9S 2M70A 2G1DA 2CQ2A 3D2WA 5JVGQ 3JB9k 3BO2A 2Q79A 4Y00A 2MQNA 3P49B 2N3LA 2DGUA 2DO0A 3LPYA 3VAGA 2ADBA 2KI2A 3HHNB 2DH9A 3PIPQ 5H1SV 2LXIA 1M5VC 2I2YA 2XNQA 3U1MA 1VQLS 1SJ3P 2D9OA 5IFMA 2ZJPQ 1SJQA 2AYMA 1OPIA 2CQ1A 2CQIA 3CCES 2M9KA 1X5PA 3G6ES 2MB0B 4PR6A 4CH0S 2ZJRQ 2J0SD 1U1QA 2N82B 2G4BA 2KM8C 1SJ4P 2DH7A 1OWXA 1KOOA 4C0OC 4WF9Q 2YH0A 2RRBA 1N54B 1VC5A 2DNHA 5EN1A 2HGMA 2KHCA 2JWNA 2DGOA 1VQNS 2UP1A 3NNAA 2KFYA 2MZTA 4C7QA 3CUNA 5GAGU 3G8TA 2L41A 1K73T 1KD1T 1U6BA 5GMKa 2FC9A 2JVRA 4WCEQ 3VALA 2RS2A 3CD6S 4UQTA 1WF2A 4ZKAA 2MQPA 1SJRA 2AD9A 2MQQA
chains in the Genus database with same CATH superfamily
2RT3A 3US5A 2LU1A 3F56A 2YX7A 3PX4A 2V8DA 3IR5B 2W4CA 4ZPDA 4OZNA 4NA2A 4NRUA 3MOJB 3RR7A 3ZTOA 1TAQA 5D0RA 4JI3F 4AT1B 4DV1F 2K1RB 3R6GB 2HBYB 2BXJA 3GQCA 3R8YA 3DRRB 4LJMA 5KFAA 3QT8A 3W5XA 3E01A 3TVKA 2JZ5A 1UVMA 1WNEA 2HHUA 4KE5A 3PYGA 3L95X 4ZVPB 5KFVA 2EBGA 1IBKF 3RUBL 1FX2A 4DV0J 4M5MA 1VJWA 1D8YA 3IR7B 3MWBA 1JJCB 4ATNA 2Z2MA 4GVBB 5D4LA 4C8ZA 1FJCA 3LANA 3NRBA 2VG7A 2F8MA 3M6XA 5ETVA 1HBOB 1MNEA 1NJYA 3IG1B 1N5VA 4OLOA 3Q2TC 3TARA 2YXLA 1X4EA 2BDPA 3KUHA 3ZZOA 2ZBCA 1FJ7A 2CQHA 2ZOGA 2H3EB 1OPZA 4M94A 5DGBA 2YWEA 2ATLA 3CDWA 5THWA 3LAKA 2KDOA 4AD6A 4KAIA 3FFIB 3ISZA 4FXDA 4X4RA 2QIFA 3SFUA 4ZIWA 2E5GA 1X4CA 1SXLA 1VOMA 2F63A 1FFWB 3GV5B 2U1AA 4DUZJ 1HLWA 3CDEA 5SZTA 2D3UA 4L76A 2CPJA 3GIRA 3M6VA 4ZIVA 2I5JA 4ECXA 1F2HA 1FRLA 2N7YA 2F8EX 2FHMA 3MD1A 3SQGA 1NK5A 3CJ8A 3GV7B 3UD4P 3THTA 8AT1B 2XI3A 1ZETA 2Q6BA 3AXMA 4IKAA 4JV0A 4Q0BA 1HNXJ 1QSSA 4I67A 2MQ8A 3PM9A 3OFHA 2FGCA 5GVQA 1K1SA 4HH0A 2QZ8A 4E2FB 3PW4A 5IS2A 1D0EA 1A7GE 1JXLA 1WEZA 4P2FA 3GB0A 4LFAF 1T02A 1VBYA 2KJVA 2FY8A 1MMDA 4LVNP 4DBQA 5J2MA 1HNVB 4F3OA 1WG4A 3UO0A 2FTRA 3IS9A 3RRGA 1LK7A 1M5OC 4ZPCA 2XM3A 2FLNA 2GNKA 4CP5A 4FKXA 4F0MA 3KK3A 3R1LA 3SSRA 4DR5J 3M8SA 3KFWX 3E01B 1X8DA 3MPUB 5F8NA 1U0SA 1H2TZ 1NO8A 1TELA 4I69A 1CC7A 1UFLA 3OR1A 2OKQA 1TK8A 5HQMA 3DLGA 1CEZA 3QQCD 4YFUA 2LQ9A 1R8HA 1NSKL 1T95A 3JYTA 2VG7B 4DR4F 2DNQA 1ZA1B 2IDEA 2VPYB 4IRKA 2F65A 2GHWA 3FSIA 5D15A 4W90B 3KLEA 4FPRA 3Q0AA 1DBDA 2M7SA 2CQGA 2HLTA 2V2ZA 3QT5A 4ZVGA 2W7PA 2AZ1A 1SPBP 3UR3C 3GIJA 4B3OA 3IWXA 2G2ZA 2QYGA 4QR2A 1T03A 2CPHA 4DX5A 1YTYA 4YS2A 1DHMA 1OSDA 4ZMMA 4DN9A 4K59A 3CCUS 3HD2A 2WONA 2HNZA 2I5JB 3HHNB 2DH9A 3FQKA 5T41A 2ZH4A 3SQGB 3FZBA 2PA3A 2ZH6A 3H25A 5K8PA 4DPTA 4DQRA 2QJ3A 2PMHA 4DL0C 3F73A 4MKVA 5AE2A 4OZ3A 2KFYA 4CLUA 1NZ8A 1KD1T 3PFEA 4F0HA 4F7VA 2ZM6F 2EXUA 1YSJA 5DGAA 2BVZA 1JKHA 4KV8A 3BPSP 5IWAJ 2M4MA 4O3PA 2PMZD 1FVSA 2HNYA 4JI3J 3MM7A 4DV1J 4LSNA 1AFIA 2HQDA 3R3TA 3U27A 5J2MB 2RQ4A 5KFPA 1NB2A 2XYHB 4RW4B 2JVOA 3DNCA 3IS9B 4YN3B 3KJVA 1RCXB 1IBKJ 3LW5C 2OSQA 2OPQB 5KTQA 1U8SA 1F60B 1REVA 1N34J 3KK3B 4AUKA 4CZCA 3F41A 1M1GA 3NNHA 3RRKA 2DNRA 2ZZNA 2CPFA 3KNAA 2RNEA 2J8AA 1JLQA 1RAEB 2KJWA 3AA8A 4FBTA 1Q5VA 3IBWA 2B3TB 3CE8A 5HJYA 4I56A 2M3DA 2CDQA 3OR1B 1ZPWX 1N5QA 4W4MA 4Y2MA 4HACA 3DLGB 1WJ9A 2E1AA 4DWIA 1M1HA 3JYTB 2I9SA 2B6AA 2DRAA 1W2IA 3IBCB 3CCLS 5U47A 4X62F 2BMBA 2CPIA 4UT4A 3ELHA 1H2VZ 4CIOA 2R7XA 1A6LA 3DMJA 4Q45A 3KUEA 3KLEB 5LMNJ 2COLA 5L1IA 2KT5A 3BGOP 1FE4A 1Z4UA 4ZVHA 2U2FA 3PG9A 3UR0A 3N9UC 2QG9B 1VHFA 5A8WA 4B3OB 4F4ZA 4JI7J 3M2UA 1HQEA 1KVIA 1T03B 2EK1A 4M5JA 2DGQA 2HFUA 4IUFA 2V67A 2F7VA 2BW2A 3GLJA 1BE4A 4RW7B 5CHCB 1B0PA 2N3OA 2V50A 1P9YA 2HNDB 2HNZB 4ZJLA 3BS9A 3I87A 1OQ6A 4USHA 4J9NA 2M52A 3AJDA 2R7SA 1R8AA 3UFCX 1FNXH 3MXHP 4LRDA 1Q7YT 4X4TA 4PXDA 3J81Y 3G8QA 4DX7A 3N01A 3IN5A 2HHHJ 2ZH7A 3ICLA 3HSJA 2CQDA 2JEGA 4LFAJ 1GEHA 1O0PA 1L3TA 3Q8VA 2B56A 3ILJA 1UJ6A 1GX6A 1T9YA 4YY3J 1JKHB 2VFUA 2YQ0A 4KV8B 1IBCB 3RB4A 1HBMA 2VD3A 1RWOB 1S9FA 4OQJA 2HNYB 1OY9A 3PHEA 3MM7B 1YIJS 1U6ZA 1WKLA 4LSNB 4MKYA 1KBRA 3ZZZA 2Z0GA 3VCDA 2ACMA 4O23A 1Q8IA 2Y0SD 1FHTA 4KYZA 2RS8A 3KJVB 1X0FA 3CULA 4EI2A 1REVB 3GCWP 1U8WA 4HVZA 3QLHA 5JXSA 2CXEA 4NX9A 4GKKF 5HN0A 5A8KA 3PYFA 2HZCA 1RKJA 4JI6F 1JLQB 4HT5A 1WELA 3QJLA 3P5TL 3TRGA 5B0BA 4BS2A 1IVZA 4J90A 4ZVEA 4C8YA 1RHRB 5BYRA 3C8YA 3QFWA 4HACB 2V8PA 3M32A 1P1LA 2DNMA 4HR2A 2XGPA 3HVTB 3UWTA 1HARA 2B6AB 2DR9A 1B70B 3FRYA 1C0TA 1KS2A 3EVMA 3BSOA 1X5OA 3DMJB 4F0KA 1VQPS 1J5OA 3NP5A 3PR5B 2FUG9 1S0MA 2NCKL 3T9NA 1JLGA 3Q2SC 2OEKA 3UN5A 3OFEA 1BWVA 3M2UB 3WDOA 1VIOA 1HQEB 4KHPF 4G1QA 2ZD1B 3DU6A 2QA4G 3TWZA 2F5GA 4R5PA 1N32J 1KLNA 2R3VA 2HHXA 2RHSB 2E9ZA 3P49B 1OYEA 4ANDA 3GFYA 1RLCL 3U1MA 2JOQA 3K5MA 4BLGA 2JEJA 4PG7A 3OTEA 4LF9J 2GMJA 3U02A 3OFGA 3W3SA 4FNIA 2ZJRQ 1WDDA 1SJ4P 2HHWA 1FTCA 3HX9A 1BQXA 1YRTA 3ZO7A 5EN1A 4F4YA 2UP1A 7FDRA 2L41A 2MQPA 1XBWA 2X51A 2DGTA 2ROEA 2HHSA 1HBMB 4ES2A 1BQMA 1QVGR 2V2VA 4ECUA 5F9LA 3R5BA 3DOKA 2YWKA 3N5BA 1D8ZA 2MTLA 4YDDB 1RA7A 2KXFA 4UF4A 2QL9B 3CD0A 3PIOQ 3NS6A 2ZFHA 5IT0A 3HPOA 1YX2A 1UA0A 3SV3A 3QLHB 2MSTA 1KR4A 5A8KB 1AYEA 1NJXA 5DQIA 1S1WA 1JLEA 3J81U 1HQ2A 2Z30B 3O2IA 2ERRA 2J9DA 3MUTP 1XIQA 5IT4A 3D1QA 1X4BA 4P75A 3M32B 3MCNA 3U1NA 2B4VA 4Z2XA 5K8OA 2YQ1A 1S12A 1C0TB 4EEYA 2V2QA 4GMKA 4WE1A 5C42A 3NXZA 1YI2S 2F4VJ 1JLGB 4ZVSB 1VC0A 2FDNA 4QIWD 3LP2A 2J9CA 2VDHA 4AYBD 1GMWD 4G1QB 2FJDB 4LF6F 3W66A 1FWKA 4R5PB 1ZAXA 1KHVA 2HMIA 4KR0B 1IBMF 2MQLA 2NXUA 4I68A 4R0JA 1VBKA 1NSAA 1SKUB 2FD2A 2C3YA 1NRKA 1WF0A 4CCHA 1VQ4S 4O3NA 3SI8A 2BUNA 4JI4F 4D3GA 1OY8A 1RT3A 5HATA 5LSRA 2XSFA 4U7CA 2GVDA 5DG7A 3MUVP 4DV6F 3DLEA 4FYYB 1RT2A 1R43A 1JJHA 2ZUAA 2UVVA 2VQFF 4B9LA 4LF5F 4L75A 3ITHA 1NK9A 2C2DA 3M8ZA 5KG3A 1BQMB 4XPEA 2AEJA 2QLWA 3ILIA 1U2CA 3DOKB 2ZDOA 3JTNA 4DPWA 2NYHA 4RNOA 4GKKJ 2MZSA 3CCZA 2YH1A 3I31A 2YX4A 3PCOB 4LR7A 2O1PA 1I51B 4J9PA 4B9NA 2XMAA 4F50A 3SXLA 5DM6Q 2RMLA 1LNQA 2DXEA 5G0RA 3ZZTA 4IH7A 3WIUA 1S1WB 4F4AA 4NYOA 4F67A 1JLEB 4NPOA 3WHIA 3K7RA 1RWWB 5KFEA 1N5YA 3SSSA 4USIA 2IYGA 2H65B 2DBBA 2H5JB 3I82A 1IBLJ 2KKHA 3FNNA 5KT3A 2E5IA 3TEGA 2IRXA 3LO3A 1TMMA 1T0TV 1MN9A 4WE1B 5C42B 2V4JA 4OI3A 4DR1F 3BBFA 3JSYA 4KHPJ 2RHQB 2J0XA 3CIZA 3V6DB 3CMQA 5EWFA 3BH7B 1LWFA 2CQCA 2C2NA 4IRDA 2VKZG 1CULA 3ET6A 2KG1A 3LP2B 3IM8A 4RWWA 4OV1A 2JRSA 1CQMA 5IC4B 3TI0A 2CVIA 3SEOA 1U0HA 2CQ3A 2XG8A 4Y00A 2HMIB 4G6VB 1GXTA 3UDLA 5KFJA 2VFSA 1RADB 2QLBB 3ADAC 3IC1A 2IC3A 1FDBA 1PJ6A 4EWTA 4CH0S 1G3OA 2EFQA 5KFMA 4B9MA 3O5TB 1Y4ZB 4C0OC 1VC5A 4DV2J 3MPWA 4QJVA 3P45B 2ZNZA 2UU9J 4FVMA 4K7QA 4PQUB 1RT3B 2W9BA 4CT8A 1HYSB 4EZ6A 1UZHA 4RJVA 4B3MF 3DLEB 2HRYA 1UVLA 1RT2B 3EZUA 3BF4A 4CLLA 1L3VA 3U7JA 3JSRA 4M5KA 1VQYA 1F9EB 3BSAA 5LL6d 4IOAQ 1MW7A 3QPIA 3UCZP 1NAQA 4RU2A 3FCVA 5HJXA 4I1TA 4JOUA 4DPUA 2P6SA 4OI2A 4WTOB 1FFGB 1D3WA 2VICA 4H4KC 1RJJA 2OIHA 3FJ2A 1U1RA 4ZVQB 1ZZFA 1GAOA 3QATA 3PW7A 5AE1A 5G0RB 2DXFA 3SBMA 5J2QA 2H4WB 1EIYB 4JI1F 4OYZA 2XWXA 2W8KA 5HROA 3VVUA 2WBMA 1C2PA 2IMWP 4NLYA 1N5YB 2FJEB 4ZN3A 1O5JA 4YP3A 4EUVA 2ASDA 2F3JA 2QSFA 2M8DB 2VFTA 1FJEB 2WOMA 2WW8A 4GC6A 1N0UA 3PFOA 3OT9A 1IR1A 2AJ4A 3VVTA 5J1NA 4TY8A 3ZNJ1 2CZ9A 2V4JB 3CCTA 1FTRA 1X9WA 1TK5A 3K8WA 3GYGA 4WP8A 2R2UA 1LWFB 4FYDA 4ELTA 2Q6CA 1RISA 3PHTA 2J9DE 3EDRB 3GIKA 2MGZB 5DQHA 4WZQA 1CULB 3H2LA 1H2UX 4CLWA 4DN0A 4DSIA 5LJ5Y 1UWAA 5AXMA 1U0HB 4TN2A 5HQ8A 1N8RT 4NRTA 3QWUA 3MM6A 2V8VA 4LSLA 4IO9Q 3A3OB 5RUBA 3D28A 3D5MA 3ZZ0A 3J7Z5 4KGMA 2HRUA 4LF4J 4NZ7A 2IC3B 2R4FA 5DQGA 4DPXA 5LOQA 1CQNA 3B78A 3IGNA 2K06A 2E5LF 4DV6J 4MIBA 5KAKA 3CCVS 2WW4A 1T05A 2HQIA 1PSDA 3AQOA 1FVQA 3OHBA 3I96A 3O44A 3MCSA 3H40A 1YK9A 2VQFJ 2WCXA 4LF5J 2CUYA 2W9BB 4PG4A 1UFKA 1FNOA 3CJSA 3HKZD 3NNCA 1I94F 2UUCJ 3S1TA 3R2DJ 5LJ3Y 2PDAA 4WPAA 5D4OA 2CPYA 1DQ8A 2D1CA 2P5VA 1RWPB 5KFWA 1H73A 2UXBF 3TANA 1S9EA 5D6GA 2KM8B 4DU8A 1XMQF 1RHKB 1ZA2B 3ILLA 3CDBA 2IMOA 2Y3YA 1TUWA 4URQU 2C2KB 2DT9A 1RWMB 4NLVA 3FSYA 3ZXWA 4ELUA 2NXCA 4ECZA 2Y1IA 2D41A 3Q8PB 4ERDA 2DR6A 5DM7Q 3MEEA 5J2QB 4QWEA 2J6SA 2WVCA 2CYYA 3GFXA 5F3ZA 3GIIA 3K0JA 1V9OA 2GFFA 2Y1LB 3K17A 5EWGA 1UKUA 3AOAA 1KQSR 2DGVA 2J7UA 5HROB 2VQEF 2VA3A 1D09B 3HF5A 4NLTA 1CLFA 2GZOA 1NXIA 2E1MC 4EU0A 3QFHA 4QR0A 4DR1J 5CYJA 2FVSA 3DLHA 5F41A 2WOMB 3KG4A 2HQFA 3KNGA 2C3PA 1X5SA 4TY8B 3MMJA 4LMZA 3RR8A 1T9TA 1X4DA 2GIFA 1C4CA 2HGLA 5LT5A 2FGOA 2HW3A 4AXIA 2FZKB 4L74A 3BV8A 1VISA 2IY5B 1Q4RA 2YKMA 1SL1A 4XAKA 1EQ0A 4F3QA 1BUXA 3OQ2A 2L9WA 3D1HA 4QIVA 3JB9k 2Q79A 4RW6A 2Q43A 1N33F 2DO0A 4L73A 2ADBA 1RWNB 3MM6B 3PIPQ 4LSLB 2DY9A 2D9OA 1U2RA 2IPOB 4TY9A 3H5XA 5F8JA 3CCES 4ZPAA 3O8WA 1WSVA 2NS1B 1V3RA 4Z7CA 1OWXA 1YBTA 4B3MJ 4DV7F 1T05B 3KLGA 4NCBA 3CT9A 2VHGA 3VALA 4DR7F 1U02A 4NLRA 4NYPA 3HDSA 5ETPA 5IM0A 2VBWA 1NNDA 1KFDA 1S4EA 2MKJA 4LIWA 2QA4S 2W2MP 4WBFA 3J7ZT 2ABYA 2M0GB 4U67Q 5HLFA 2ZBQA 1M5HA 3PW0A 2XHWA 2CVEA 1Y3KA 3N28A 2LP4A 2DK2A 3TUIC 1W2BR 1S9EB 4NXNJ 3MR3A 5KFYA 2CIMA 3LF0A 1N5SA 2MKYA 3MM8B 3TVYA 4C4WA 1WI8A 5AJ3J 1Q7LB 2GW8A 4ZCLA 3HHDA 3I9ZA 2CFXA 3MFHA 4WYWA 3I55S 1M0SA 1X31C 4PG6A 2PEBA 3MEEB 1U09A 1SI9A 2MMYA 1JX4A 2PD1A 4HDHA 5IQQA 2BACA 5I42A 1WKKA 3DI6A 4NE9C 1RCOB 1BMQB 4B9TA 2NLWA 4HTIA 4LVOP 3RBZA 1U26A 2FZGB 5D77A 3PJXA 3QZ7A 1EP4A 1YBAA 3UN2A 4L6V3 4YB7A 2I0XA 5J2PA 4CTAA 1GX5A 2BRKA 1WWHA 2MJUA 2AGQA 4DV4J 3CIMA 2YKMB 2FLPA 2BJ9A 3MR2A 4WWSA 1AUDA 1OQ3A 4RW6B 5LM7E 3CWJA 4FYVB 4BC9A 2VASA 2EFVA 1WKJA 2E5LJ 1UVKA 1UW4A 2QE5A 5IC6B 3OVSA 1U2FA 1S4FA 3FQLA 5CH7B 4A46A 1NHUA 2AWZA 2MZRA 4F8RA 3KOAA 2GMHA 1FKAF 2MKSA 1RTIA 3C66A 2OO4A 3EDQB 3KLGB 2FZCB 4UTGA 4WYLA 2JC0A 4NASA 2RB7A 2V9WA 4JV5F 1AB8A 1JLBA 5IV4A 4M5GA 2HFVA 4PABA 1FXDA 5KFDA 2UXBJ 2R7OA 5IM0B 4LF8J 4KGVB 3BQ0A 2Y1RI 3VAMA 4UUXA 2FJBB 4OV6A 1XMQJ 3QSYB 4NLWA 5ADZA 4DOZA 5HLFB 3MPVA 1B4SA 2IA0A 2FHJD 4OI1A 3AA9A 4ZCKA 2XULA 5GAHU 1WC5A 3OTBA 3KHLA 4ITSA 1RTZA 3PNIA 1I3OB 5KFHA 2IBOA 2KT2A 2F40A 1FO1A 3HVWA 2MXYA 3OVAA 2YTCA 1Q95G 1FJGJ 5D3GA 4JYAJ 2VQEJ 3GILA 1GTEA 2VG5A 3ENQA 2ALYB 1NDLA 3JXOA 1WC0A 5FJ4A 9RUBA 5I42B 5HP1A 3DI6B 1F5CA 1RYSA 3M2RA 2B4OA 1HHQA 2H5EA 2HZVA 5E5NA 2A2DA 3GJTB 3FK4A 2AKWB 4I6AA 1EP4B 2LU2A 1X4AA 4R8UA 1EB0A 4IDKA 3DC2A 3MCOA 4OJHA 4DPYA 4PYDA 3H5YA 3DLKA 2J8SA 2B7CB 2GQQA 4CTAB 2GGPA 1S59A 2K8GA 1X4GA 5LXYA 4MMOA 4NLSA 2AP6A 3Q8UA 2YPZA 4C8NA 4HKQA 3PKYA 2E1PA 3KDOA 2R7TA 4IR1A 1HHSA 2DGSA 3ZC4A 3GP9A 4FKYA 4YR0A 3DU5A 2N3LA 1Q0NA 2AX1A 2DGUA 3LPYA 2I2YA 1QSLA 4KGZB 3W5YA 1VQLS 2AYMA 2H5IB 2YWFA 5JJBA 3PRVA 3N5FA 3MMAA 3HP6A 4ZDNA 1S48A 3V2UC 4DS4A 2LDYA 4I2QA 1HWUA 4WF9Q 2YH0A 5AXLA 1YBUA 5FLXY 2UXCJ 2KHCA 2HFOA 1JQGA 4B17A 1RTIB 1UZDA 2NYIA 2ZHAA 1BGXT 5HI7A 1SC1B 2MEWA 1O51A 4DXLA 2VA2A 1RABB 3C3LA 1JLBB 1FI4A 4XDDA 3MF5A 2QFIA 3NGUA 2H51B 1VQSA 5GADU 4CM0A 3GV8B 1ZBTA 3K5LA 3DLLQ 4M5HA 3GG0A 4TU8A 2N4CA 4LQ9A 1IKXA 4B3SJ 1HNWF 4MYTA 1VQKS 2DR8A 2CPZA 3KK2A 2W2PP 3UI3A 2CPXA 4UY85 1VS3A 3A8JA 1FDDA 2L08A 5D3GB 1NDPA 2AX0A 2OUGA 2KXNB 4L3KA 5I3PA 2NXEA 2AHOB 2VG5B 3H2UB 4ED1A 3QIDA 2PMWA 3AOBA 3ISNC 4J37A 2RU3A 4ZPWR 3V81A 2M2BA 2RE1A 5H9EK 1HNIA 5E41A 5HP1B 4OL8A 2O5DA 1FDNA 3M2RB 1NBEB 3L7OA 5BJRA 4DSLA 3KYLA 5KT7A 4DL4A 4WFYA 4FYXB 4R8UB 4IDKB 4LR9A 3DLKB 2DXDA 2GGPB 3CJ5A 2XCPA 2JFKA 3MD3A 1MLAA 3DN9A 2MKHA 3N0VA 3R2CJ 5DG9A 1UP1A 2CQBA 1RP5A 5C24A 4IR9A 2X1GA 1RB0A 2R42A 4TVAB 1NU4A 4MIAA 3B8HA 2EVZA 2HIYA 1X9MA 4Y2AA 5HVHA 1U1PA 2DR5A 3KDNA 2OTJS 3HM9A 3MEGB 3MMAB 4BCAA 1F0XA 3PDNA 4PXEA 3Q8QB 4I2QB 4JV5J 2PO4A 1JWWA 4JI0F 3NCRA 5CQGA 2FVRA 4UQGA 4U8VA 4Y2KA 1RHQB 3DCAA 2YNHA 4CNYA 4PG8A 4LF1A 4DSJA 2XMJA 3BO4A 1SUQA 3LGNA 2CA9A 1TL7A 1RT7B 2HPUA 2HQ3A 4ZITA 4DZDA 2DY1A 2FQQB 3D6FB 1WC1A 3BM7A 4J9QA 4YHHJ 4HLBA 2E44A 2BOAA 1ZZNA 4OYBA 4K2XA 4U8YA 4ED3A 1IKXB 5L46A 4QW9A 3CCQS 4DJBA 2QEXS 1S1XA 3TAPA 2FVQA 1RK8A 2FJAB 2GQCA 3KK2B 3ZTRA 3BH6B 5C2GA 3BB5A 2P2CB 5FLXU 2C2MB 2P9EA 3GSIA 2VPXB 1FESA 3OTOF 2QV6A 1WHVA 4ZJOA 1L3SA 4X4UA 4ED2A 1IUJA 1UPMB 2QFJA 4FF2A 2VPWB 3S8SA 3RBDA 4GKJF 2FYXA 3D0HE 3V81B 2K7JA 2XCAA 2QMWA 2QC3A 3WC2A 5DETA 5LSLA 1HNIB 1NHKL 1LW0A 2GC8A 5KFBA 1UEUA 1SKRA 2BOPA 3MURP 2V69A 2HVHA 4O44A 3KHHA 5FDLA 2B4UA 3JSMA 1PYOB 2DHGA 2BX6A 3W61A 2ALZA 4PEOA 4CH1A 4S0MA 2J7KA 1XC9A 4OZLA 5C24B 2J7WA 4DV0F 4JUZA 3FBCA 4F2SA 4LF7F 3ONQA 3VAGA 4X66J 1M5VC 2W1BA 2D74B 2POKA 4A8OA 4PUOA 2L3MA 2B9YA 4LUBA 5B0DA 1NHVA 4O4RA 1TFWA 4D3HA 1DJ0A 3DOMA 3TUZC 5D0HA 1VQNS 4C7QA 3MECA 4WTYA 2RUSA 3Q8RB 3I0SA 3OLBA 1WF2A 2VUGA 2YNHB 2ZVIA 2HRTA 1DTQA 1Q79A 5CD4H 3Q8YA 1SUQB 3H2VE 1D9FA 1TL7B 4USTA 2UUTA 4KO0A 4DUYF 4HDGA 3UPFA 3K2YA 4URSA 1SH0A 2HIQA 4NWBA 2LA6A 1YLXA 2VC1A 5D0GA 1H7WA 4ECSA 3OR2A 1WOOA 3QGHA 2DISA 4WFAQ 4ZP8A 3OVBA 1QAXA 2G1HA 1S1TA 1SKWA 5DDPC 3MTJA 4PCQA 3BKUA 1VQ5S 2OPPA 4I64A 1DAXA 4ICLA 2XO7A 4ZVTB 1S1XB 1NEEA 4K4ZA 2ZJQQ 4USVA 3W2VA 1CPZA 3A12A 1NMEB 4NEZA 1FF2A 3L4BC 1HNXF 3FVYA 2GQ2A 2IA6A 2O01C 4MKBA 2BQ3A 2CWKA 3CSKA 2RQCA 5KFZA 3OUYB 4QZVB 1SQEA 3IFEA 2IFXA 5H9EJ 2P6TA 3ZZYA 3TA1A 2RUGA 4USKA 3D6MB 2HBZB 4FYWB 4CO1A 3MGJA 3B4DA 3PV8A 4P2XA 1HD0A 1IJFB 1Q16B 2ZWOA 3UQSA 3DRRA 2J6UA 3J7A1 4K4SA 3HI9A 4DSEA 4O44B 4OYPA 3IAM9 5FDLB 1YRUA 2VPZB 1BLUA 4DS5A 4U9RA 1WDTA 3K5NA 2DEIA 4E98A 2W9CA 2HVEA 4DX8H 2F9JA 2W25A 1UW9A 1JLAA 4FF1A 3CPWR 1WHXA 4EZ9A 5H9FK 4DL5A 1HBOA 4ECWA 5A76A 4DSKA 3VAKA 3EXYA 4WFBQ 2UVRA 5DDRC 3P8BB 3V6JA 3W2WA 1UAWA 3BGRB 2Y1JA 1WORA 4PUOB 1JXVA 1RE1B 4C11A 4QYZK 3X1LB 2PGCA 3D7SB 4J9UE 4CYUA 2RQMA 3H7HB 1S7HA 2NSCA 3DOMB 2ZOMA 3BQ1A 2DHSA 2RJZA 3MECB 2IJRA 3I0SB 3I9V9 5KG0A 1VQMS 2MJNA 3GTYX 3NGDA 4I4BA 2KT3A 2DVIA 2N7CA 7AT1B 1PJ7A 4KGKA 1NLKL 4F25A 4HT7A 3W8GA 1DTQB 1QTNB 3FRZA 3BYPA 3EGNA 3I5BA 3PYEA 3EZ5A 3HFZB 2OPSA 2DNYA 4LRBA 4KO0B 1EKRA 2BEFA 2KL8A 1YJUA 3PTWA 2MKIA 3VZHA 2RRAA 1RAIB 2K3IA 3OR2B 1TTHB 1GXLA 4F4XA 4KFBA 4QWCA 2YX1A 1WF1A 1CSJA 3A1YG 1D1UA 2OPRB 3R5CA 1Y5IB 1S1TB 4YEAA 1DY3A 3BR8A 2OPPB 3P4UB 4ICLB 2V63A 4ECTA 1R6VA 5C25A 1JLFA 4OHZA 3W2VB 4OYMA 2BE9B 3MAAA 4GKJJ 1T3NA 5C2CA 5CYQA 2JEFA 2V0NA 1RHMB 2R9LA 2R7RA 2QMUB 1XJWB 2MDAA 4ZP6A 3I5CA 3OW2R 4X64F 5C5JA 1HNVA 3EGVA 1K0TA 2E7WA 1CC8A 2BBEA 4NLPA 4DV5F 2V94A 1CS4A 1S0VA 1VQ7S 4YB5A 5IWAF 3MM9A 1E6YA 2XS2A 2DH8A 4DDFA 1NM2A 2LKZA 1NH8A 2D7SA 4UUWA 2HFSA 4A8SA 4QU7A 1IKVA 3FZ2A 2DIVA 2ADCA 5ETMA 1LWCA 5KG5A 4PXBA 4QPTA 4BWMA 2Z58B 2OD4A 4LF7J 1N34F 1XK8A 2W9CB 1PC4A 1P8GA 4YB6A 1JLAB 4RWXA 3A8EA 3OL7A 4CLPA 1ZTTA 4IYQA 2DTJA 1NDCA 3MCMA 2VZ9A 3NEKA 3ZTQA 3W2WB 2EG2A 3NY0A 2NUUG 1H98A 3LUYA 2N82B 1S10A 4M5LA 2KM8C 4PZVA 4C11B 4U7UK 3ILOA 3HXMA 2HAIA 3G86A 2QLJB 1C4AA 1SL2A 4X84A 4O3SA 4CYUB 4KSEB 1EQMA 3GWCA 5CYMA 3NNAA 1AFJA 1TV6A 4QWDA 1U6BA 5LMNF 3BGLA 2JVRA 1K44A 1RYRA 3L7UA 4DUYJ 3AB2B 2MQQA 3M05A 1B0TA 3NGRA 2WZ1A 1R0AA 4TLQA 4WIIA 1YGYA 4JI7F 5KFOA 2HVIA 2OPSB 4DFMA 2D9PA 1UCNA 3MPDA 2AJ0A 1HNZF 1TL4A 4U95A 5F3TA 3RAQA 2BABA 1HW9A 2XMKA 2WB1D 3EZOA 4QIEA 4KFBB 2DB1A 2R7UA 1HMVA 1V5IB 2PFDA 1SC4B 1K8AT 4DV3J 1WUUA 1HIYA 1VQ8S 2PFFB 3PRDA 4Q2LA 2DJWA 5KFLA 1S9GA 5C25B 3OHAA 1Y5LB 1SH2A 1JLFB 2HVZA 4ANCA 3MAAB 1HR0J 3E8OA 1NH7A 2WAQD 4NI2A 2HHHF 1DTTA 4LFBF 3NAIA 5CYQB 1QSYA 2CNLB 1URNA 2AYGA 1FRXA 4W92B 1DZ5A 2A6MA 4O4GA 2GJFA 2XMVA 2IM3A 2X1FA 4RW4A 3OTCA 4KH0B 3RU0A 3KJFB 4YY3F 1CS4B 3PW2A 4RUBA 3MM9B 3I56S 2OPQA 3ISND 1E6YB 1TKTA 2OMLA 1EHWA 2BA9A 2FVPA 4FS1A 3R97A 1IKVB 1QUPA 2F8HA 2V5HG 4DQIA 1WACA 1ACMB 3SQOP 2HURA 3GONA 1U1NA 3Q8SB 1LWCB 3RB3A 3KG1A 1X9SA 4NZ6A 5BXIA 4K2JA 3WX4A 3T5KA 5H9FJ 2AV5A 4EFAC 3HT0A 4PRFA 1HQUA 4IRCA 3CGIA 2YPYA 4BC7A 2XS7A 2BYCA 1VHIA 1PILA 1FCAA 2DKOB 2CWXA 2HZAA 1FXRA 3IM9A 4BBYA 4MIWA 3T5HA 3V6HA 2BRLA 3WBZA 3KLFB 1YVFA 3OD2A 5CYMB 1QTMA 1NPRA 1TV6B 1HA1A 3KK1A 3R5JB 5ETOA 3HHLA 1S6QB 2NSBA 1BY9A 4ILRA 1R0AB 4RW7A 1OIAA 3LGHA 2HNDA 3JQMA 5DJBA 2ROPA 4LRAA 4N56A 4ZLJA 4MT1A 1N32F 2BJ7A 1XQIA 2YWWA 2HHVA 2FHOB 4C3MA 5CAAA 4FS2A 1OS5A 1FT8A 5JUMA 1TP7A 1X4FA 1HMVB 3H20A 4USMA 5KFTA 2HEKA 1IKWA 5L1JA 4LF9F 5EHHA 4ZCIA 4C8KA 3CJQA 2VL1A 4X64J 1Q5YA 1S9GB 2Y0BB 3UCGA 1DQ9A 2Q1LA 4K0KF 4DV5J 1IWAA 5DS7A 4DR2J 4NI2B 3MR6A 1WHWA 1DTTB 2YWGA 5HANA 4G3IA 4LBHA 4OLPA 3DDIA 4NLQA 4O4GB 2ZUGA 4I7FA 1UFWA 4KB7A 1PYSB 1U24A 2R2SA 1TKTB 4F02A 1RZMA 3H4BA 4KRWA 4OYWA 4X2BA 4X4QA 4HTJA 4IOBA 2AGPA 4TQSA 3ZTPA 1JJ4A 2J0QD 1G2EA 2UUBF 3FMWA 4EO6A 5KFSA 1VQ6S 2C2OB 1RSCA 2HQGA 3TR5A 3VGSA 2OGUA 3MR7A 4Z37A 2V9KA 2UVWA 2ZC3A 3LGMA 2EPIA 3HVTA 4K4WA 1HQUB 3W9HA 4OYOA 3GIMA 1SJ3P 3OSNA 5GMDA 2CQIA 3NKYA 1SL0A 1KSPA 3MOZA 4RW9A 2KTQA 2CZ4A 3GMGA 1CBKA 1YJTA 3IGVA 3AAWB 4RX6A 1N54B 2DNHA 2HGMA 2DGOA 1PBAA 4JI2J 1SCJB 1LV5A 2GJ2A 5A2QY 3THVA 2GX8A 1KQGB 3FEZA 2AD9A 4E0DA 4XPCA 2NR0A 3A13A 5E3RA 3KK1B 1S57A 2ZD1A 3HHLB 4OX8A 4RNMA 4DFKA 3T6JA 2ZEJA 1GMVA 1TUGB 3PX0A 2F4VF 2FJWA 1URRA 4FVCA 1HNZJ 3G6YA 1Y0HA 4Q8EA 4ER8A 1TQLA 4C3KA 1B99A 4AXJA 3HVRA 1EETA 1RT5A 2KXHA 4OX9J 4TQRA 2Q66A 1J2VA 1X4HA 3W60A 3DDNA 4XK8C 3BSCA 2UV8G 4LFBJ 3FGVA 4M5DA 4B3TJ 4JI8J 5LXRA 1IKWB 1TU0B 1YWXA 2DPJA 5KT4A 2XZDB 1VK3A 1G1XA 2MZQA 4ZN1A 1UVJA 1HFEL 2ZH5A 4PWUA 3W9JA 2HS0A 1TKXB 4OIXA 2DGWA 2VJVA 3J7YI 3D6HB 2E7VA 2WHOA 5KFRA 4FXWA 5ETNA 4R0EA 4I7FB 1K1QA 1ZM2A 3IRWP 3CB4A 4PQAA 3EE3A 2V8HA 2FIUA 1AUSL 4KY3A 5D78A 1VJQA 3CJTA 3LA0A 3KUGA 3CF5Q 2WVDA 1SV5A 1FD2A 4NLXA 2RAQA 3GR0A 3ENWA 3QAEA 1M1KT 5EX3A 3LP0A 2AU0A 3HJFA 1S6UA 5B0EA 3PYDA 3BN7A 2CJXB 2DGXA 3W5ZA 3TZZA 1XTZA 3MDFA 2DNOA 1ZM3A 4OHVA 3W63A 3CC7S 5FD1A 4CLTA 1MROA 2XLIA 3G8SA 5EUHA 1UVNA 1TMJA 5IT9Y 1EAYC 1X7VA 2KVQE 3WQPA 1S6PA 2X1AA 4N5SA 4ED8A 3TUJC 4RW9B 1GFWB 2XBPA 2DR7A 1IBLF 4K4YA 4LBIA 4RUHA 1FE0A 1BD6A 1CJKA 5BR8F 1U49A 4WXWA 2JFDA 2UZAA 3VQSA 3G96A 2HYIB 2H54B 1VI7A 2W2NP 2K2PA 4C98A 1VCTA 1Q78A 1EARA 2KG0A 3DYAA 3TZYA 2HK3A 1LQ9A 3EPGA 1RGVA 4MK7A 2PEHA 1RAGB 2ZBPA 5M2RA 1EETB 2CNKB 1FK9A 5HQLA 1RT5B 1EZZB 1T11A 5KOWA 1KLMA 5B0FA 1J27A 4CLYA 4OZ2A 2AW0A 3DLBA 3LTOA 1GTHA 3R7NB 3RAXA 4K0KJ 1Y3JA 5AXKA 3BDEA 1R6YA 5GAEI 1T9XA 2XY6A 2QYCA 4M5DB 4C0BA 1F6TA 4ES3A 2XQCA 4Y3CA 1VMBA 1RU2A 4DV2F 2UU9F 3FEYB 2VJUA 4DUTA 1PCAA 4N41A 3R7BB 3WZ0A 1YJRA 5A2QU 3NGKA 3EGZA 1GK8A 2K7KA 2OP5A 1U6FA 3TJ8A 2E29A 3CJ3A 2UUBJ 1KWMA 3BN4A 1SV5B 2ASYA 4F3MA 2FJXA 1SVDA 1MG7A 4PWWA 5KFNA 4K50A 4AFFA 3RW6A 1R8BA 3P3DA 3EJMA 3LP0B 2XSJA 1RXOB 4NCAA 2G1DA 3BR9A 3T1HJ 4NLUA 3FBFA 5JVGQ 3NL0A 2MQNA 4ED6A 3GZ7A 2IVFB 2QSWA 2Y8YA 1RLDA 1SJ1A 2J5AA 1MROB 4ZP9A 2BW7A 2CQ1A 4U6PA 3PO4A 1NZAA 2G0IA 3AB4B 4DL3A 3TZXA 1MMNA 4B9VA 1S6PB 4ED7A 2QL7B 1TUVA 2DH7A 5F9NA 2V4RA 4LR8A 4W98A 2ILZA 1KOOA 3DOLA 4CWBA 3V6DA 4RZRA 2MZTA 3CJ0A 5BYSA 2JC1A 1K73T 1MWYA 2EC2A 1CJKB 4DL2A 1X0PA 3TNVA 1HHTP 3SV4A 3TX0A 4ZHRA 2ILYA 3HULA 1DLOA 2ZH3A 4KIAA 3M8WA 1T3OA 3QRPA 1SBRA 3DYAB 3GJSB 1B3TA 4A47A 1NCLA 2E7XA 1RAAB 4NXMF 2M88A 1XMBA 4JV2A 3MMBA 4X4OA 1LWXA 5F8LA 4ZP7A 1FK9B 1VDHA 3N6MA 4AL7A 2XLKA 1KLMB 4OYXA 5IT9U 4MYUA 1R8CA 5B0CA 3MAQA 4LF4F 3EUNA 2BJ1A 4PQUA 2QLXA 1HYSA 1NSQA 5GAHI 2ZZMA 2Z2LA 2APOA 3K5OA 1G7CB 3SZ2A 1IQTA 4J91A 3OXGA 1JNRB 2QMXA 4Q2MA 1R8PA 4ZVOB 1PO6A 1V3SA 2RILA 1DQAA 5J1EA 3DGPA 6AT1B 3ENVA 2UUCF 3WC0A 3R9LA 3MI7X 2HHPA 4CQ1A 4I0WA 2W4DA 1PBUA 3R27A 1UJ4A 1ZTWA 2FY1A 3M9OB 2OTLS 1M5SA 3HCXA 4EGLA 2W7OA 2CQPA 5EGYA 3KJNB 5HAOA 4QIFA 3D0GE 2R8IA 1FRHA 1VBZA 4LFCJ 2CZVC 1VBXA 2OLWA 4I6WA 2HWTA 2XSJB 3K89A 3OXFA 1YJVA 2ZNYA 4V19X 4EBCA 1TFYA 5HSPA 4ILLA 1KVKA 1S49A 3B4MA 5LMUJ 3AOCA 1ULRA 1NJZA 3H5SA 1PAEX 1NSPA 3AD9C 4DCPB 4ZS6A 2FLOA 4ECRA 3FEXB 5I3QA 1F5AA 5BR8J 3M9MB 3D68A 3OJUA 3HZGA 3DOLB 4L72B 4KBIA 2KZZA 4ELVA 1IM4A 2MGZA 1EKSA 3QSIA 3BREA 3RYLA 2IRYA 4JI5J 4N77A 5L9NA 4C48A 4ZHRB 1YITS 1DLOB 2JLEA 5JVHQ 3JSBA 3K5PA 3GG1A 3MPYA 2GAHC 2QTWA 2HFNA 4OZ1A 1NUEA 2P9GA 2NPIA 3D66A 4ZVFA 2LYVA 4LQ3A 2LEPA 3MMBB 2AMCB 4HH1A 5E3QA 5GADI 4B3RJ 2ZDPA 4Y28C 4Y6IA 3EGWB 2A18A 5IZHA 4QR1A 4KTQA 2J6TA 3DDKA 2PE8A 3VQTA 1SIWB 4RLEA 4FN5A 2C2RA 1JJ2R 1WC3A 3RAMA 4CNZA 2W2OP 1NK7A 1FKOA 2C28A 2WVEA 4ED4A 1BQNA 2XLJA 3PR4A 2I8EA 2B43A 3T5LA 3H8YA 2SXLA 2AJFE 5B09A 2UV8A 3ZTSA 1JK9B 1Y7PA 2YBVA 1LWEA 5J1EB 3DGPB 1JMTA 2XZTB 1FEEA 3NLCA 1YZ6A 2EI5A 3K59A 2M8HA 2P8IA 3C6TA 2P9CA 1Y10A 3V5RA 1C1CA 3LH2S 2A10A 3V4IA 2JEIA 3X3UA 1T7PA 2AYEA 2HHTA 3BPDA 4MH8A 3I5AA 4H54A 4NXNF 2AJ2A 4FDFA 1GH8A 4RL1A 1ZYQA 3Q22A 4IH5A 4WJBA 5AJ3F 3DRYA 4RNHA 4Z7YA 4M63A 3BO2A 2XY5A 1XWLA 5CD4A 3POTA 5KFQA 1KTVA 3KG0A 1RACB 4FBUA 3UDVA 3AQPA 5A6WA 1U1QA 2YVSA 1RDRA 3C19A 1MSWD 4GRSA 4ALZA 2RRBA 2QT7A 2BKOA 2HS4A 1BXNA 1WOPA 4O3RA 4N76A 1OMSA 3T5JA 4B9UA 3E2EA 3T1YF 1AXQA 2VU5A 1HW8A 2BKPA 1YJNS 2HHQA 3PEJA 4NXMJ 2IIHA 1HWKA 2BM0A 3C46A 4DV4F 3RJMB 5MAOA 2MKCA 4Q44A 4DMZA 2IVMA 4HHHA 1ICEB 1RUSA 1NK0A 2ZH8A 2QN6B 2PA8D 3OJSA 4C3LA 4PPZA 3D9BA 2WSEC 1UVIA 3ENAA 3NGSA 1AA1B 1M90T 1V6HA 2KU7A 4TKTA 3NBPA 3B82A 1UEVA 3SCJE 2EKYA 2AT1B 3RTVA 1FEHA 4MTPA 3TUPA 4PG5A 1S76D 1Y5NB 1FKOB 4RU9A 1R27B 1BQNB 1N52B 1XR5A 2YNFA 1E6VA 4OYAA 1RTHA 4NA1A 4F26A 3M4XA 3VZIA 2FC8A 1F2GA 3V6KA 3HJVA 5ETRA 4KHRA 1LWEB 3IO1A 3OV7A 4LF8F 2W4PA 4YQWA 1FFSB 4Q0BB 3UE2A 5F0WA 1SJFA 2XS5A 3C6TB 5BYQA 4FP9A 2LMIA 1C1CB 3MM8A 5L1LA 1X5TA 2HVDA 3V4IB 4RO0A 2CNOB 4DFJA 5CABA 4KPYA 3T9ZA 2CADA 3A8IA 2YNGA 3KLHA 3J7YU 3D3BJ 1K0VA 2BJEA 3H4DA 1Z1ZA 1ZH5A 3MAHA 1B7FA 2LA4A 3GFHA 3JQJA 2DD8S 3QWPA 5KG2A 1FJGF 3MZIA 4CT9A 3QGIA 4GO5X 5ETSA 4WU3A 4N7TA 1PGZA 1YRXA 4JYAF 3DRPA 3QO9A 3QBCA 3TQ1A 3OL6A 3POTB 1U25A 1P6TA 1GT8A 1LFPA 2QL5B 1YKWA 3W64A 1T94A 3T1AA 1IQZA 5M2UA 2LQ8A 2B51A 1JNZB 1U1KA 1UA1A 1WD6A 1PC5A 3O6QA 4F4WA 2V34A 2ZWPA 3G4SS 2V4QA 4C0HA 2EBEA 1ZPVA 1HL6A 3SSQA 1U48A 3EVOA 1VRTA 1I1GA 1HBUA 5DZ6A 4ETZA 2OFGX 4IFVA 4RR5A 1FRKA 4JV1A 4URGA 4F36A 3NOCA 4C8MA 1IWGA 2RU9A 3NS7B 3B54A 2W01A 2IAJA 5C7PA 2G0JA 4ZPBA 3LP1A 2DEJA 2E1CA 3D67A 3IAS9 3M30A 2D69A 1S7IA 3RZAA 2B4PA 5D8HB 2W7AA 1XNRF 4FF3A 1TZ0A 3CJKA 2ZH2A 3KTQA 1DURA 1GMUA 1DARA 1VK8A 2R7QA 4C6AA 3NBPB 3TQEA 2WONB 2YKOA 1IN0A 2E9RX 1GQEA 1QD1A 2FHKA 3MMCA 2NPFA 2UXCF 1QDUB 4RBVA 4P2SA 4TXSA 1REGX 2ASJA 4OJGA 2YNFB 1E6VB 1R3NA 3GJQB 3PKMA 1RTHB 2OAUA 3CMES 1RKIA 1EX8A 2RSQA 4WKRA 1RBLA 5GAEU 1NPKA 1F3FA 3KLVA 1VRQC 4RKUC 4KT0C 1SIZA 3AD7C 2GIRA 3TVZA 6FDRA 4NLOA 3ETOA 4WFZA 1Q8LA 1SQGA 2Z2ZA 4B3SF 3S6EA 1RU1A 3HMJG 5GAGI 2YNGB 3NMAA 2AEFA 3CXCR 2CQ2A 4P7TA 3KLHB 1S1UA 4KH1B 3BZQA 1NB7A 1RAHB 2LLZA 2MLYA 3NWGA 3DRPB 1SJQA 3QO9B 3FMBA 4IG3A 5HK4A 1OPIA 3OLAA 5DRKA 4DEZA 4DZ6A 3GE9A 2PN6A 4ID5A 1KQFB 3T1YJ 2YWHA 2CRLA 5E33A 1AROP 3CD7A 3HSZA 2DCLA 4P74A 1Q53A 5F8IA 3P5BP 3CUNA 4DR4J 3KMSA 2CKWA 4K4TA 2FC9A 4TLRA 3C14A 4WCEQ 2RS2A 1MMLA 1SJRA 2YKQA 4HI1A 4DF8A 5KFGA 5KFCA 2MLZA 2BANA 4M1KA 1VRTB 2H48B 5DG8A 1HBUB 2VBZA 4IFVB 3MM5A 1DFDA 3W62A 5HBMA 3KLIA 2C22A 2FB0A 2IM2A 2B9WA 1H0HB 2Z57B 5MLCV 3M8QA 2IAJB 5KFUA 2G9OA 2MZJA 3PJWA 3LP1B 3IXQA 1RWVB 4Y34A 3P6YC 1MU2A 3M30B 5A8WB 2KZMA 1RTDA 1R31A 3CJKB 1TKZA 1RI7A 3UW1A 1ELOA 4MK8A 3BSNA 1N36F 1RHUB 2ACYA 2G2YA 2F9DA 4KC5A 1JIHA 2XGQA 3QNWB 3G6VA 2BE7D 3MMCB 1NDKA 2LEBA 1NK8A 3FBBA 4DQQA 1XEZA 2DNKA 1FERA 2FPHX 2XMMA 3FBEA 4X4PA 4EMDA 2HWIA 2CG4A 4LT6A 2ZM6J 3KMQA 2D3ZA 4X65F 2DHXA 3EWGA 2AGOA 5SUHA 3ZZPA 1WSRA 1RT4A 1D9AA 1NK4A 3U1LA 4OJ1A 3CC4S 4ZLNA 1CJVA 1KONA 3ZNUA 4YHHF 4IH6A 1QE1A 3TP2A 2PSZA 1KQKA 4O3QA 1H6KX 1N4LA 2MZ1A 3P96A 1VRUA 4QW8A 2EEYA 1YJ9S 3EPIA 1OSCA 2ZE2A 2XMWA 2G0CA 3I32A 3HHLC 3H98A 2ZKUA 1RT1A 1S1UB 4IQMA 4F2RA 4PXCA 2HLUA 2R2TA 4DL7A 2OEJA 4AL6A 3QGGA 4J9OA 2XHCA 2R8GA 5CXTA 4IG3B 2GVZA 2VFVA 3MEKA 5D4NA 1FA0A 4J9MA 5HMZA 2EFOA 1C1BA 4ID5B 2B8PA 2HFZA 3MUMP 3HHKA 3DHWC 2VV5A 4GVLA 1JB0C 2JSXA 1Q81T 4X62J 3CDAA 3C14B 2KO1A 2Y8WA 3UDEA 2ZBIA 2O3DA 2LXUA 2BANB 4DCJB 2NZ4A 5EX0A 3MM5B 5F8HA 3AJ1A 5HBMB 3KLIB 3MHYA 2W9AA 2LCWA 1G4CA 4PKDB 2GHPA 1RWXB 1LW2A 2D3OR 1XNRJ 1FWPA 4DI6A 1PIEA 3M8QB 1EJ7L 1J5OB 2CDRB 5HMXA 3MEGA 1VYAA 2EW9A 4YB1P 1W26A 4X66F 1IXKA 2VODA 4ECQA 1MU2B 5HMWA 3JTOA 1YHQS 1RTDB 5CCLA 3O1LA 3CO9A 3DGVA 3FKBA 5KFFA 1TKZB 5ETLA 5LSOA 1S0OA 1VLOA 2HKEA 3UDCA 3GCXP 1MWQA 3FC9A 1KOHA 1ZM9A 4UW2A 2HG4A 1RT7A 1WEXA 3VHQA 1B7YB 4J9KA 3B6BA 3QRRA 2VONA 2DNZA 1BWEA 2B9XA 2KHDA 4MJKA 2DYAA 3QGPA 3ZFVA 3TAQA 4P6QA 1MWZA 3GSDA 3CDUA 2MSSA 4A8XA 3KXDA 2V2KA 3M1VA 2KN4A 3IBFB 1APSA 3SCIE 1Q8BA 1SQFA 1OY6A 3UN3A 4DLEA 1KP6A 1RT4B 2ZH9A 1Q8KA 1KN6A 1CJVB 5FIIA 4K5SA 3DLJA 1QE1B 1U1OA 1UMJA 2ZH1A 1VRUB 1W25A 1VQ9S 1HWJA 2YNIA 2GO8A 2ZE2B 5EWEA 3N6NA 1RT1B 2KI2A 3OL8A 5H1SV 5CZVA 3RB6A 4JI6J 3GPAA 1RHJB 4A8YA 2ATCB 2M9KA 3VWSA 3G6ES 2BM1A 4CLKA 2GVZB 2GJIA 3DKDA 4V1Ak 1HWLA 2H9ZA 4R25A 2ZC4A 3EVWA 4N47A 2CAJA 3AT1B 1NKCA 2JWNA 1C1BB 5D4PA 2JJ4D 5GMKa 4MFBA 3D54A 2E66A 2FVCA 3TZWA 4I2PA 2XB2D 3FUYA 3SCLE 2MLXA 4AL5A 3SYZA 4RNFA 4EK2A 5F8GA 2B5JA 1QAIA 1VFJA 2RDDA 1NKEA 4OYIA 3L7PA 3EXCX 1LW2B 5DDQC 4WFXA 1UTAA 3VTIA 2HGNA 3HVAA 4UZBA 1N36J 4OZ0A 2AIRB 4FPIA 2FLLA 3FDSA 1QAJA 1VLYA 2MPUA 3GJRB 2JH3A 4AE5A 2XEXA 4IOCQ 1LXJA 2XMTA 4N8OA 4CI0B 2D3O1 4GO7X 1SKSA 5KT2A 2ROGA 4F4KA 4X65J 2XY7A 4Q43A 4OX6A 3I4PA 1U1MA 2LQ5A 1ZS6A 1XMOF 1F1BB 2WVFA 3M1VB 2RD5C 4AQYF 2AYBA 4J5OA 4Y2IA 2IRUA 2DNNA 3AJ2A 1FRJA 4DX6A 4QU6A 4ED5A 4RNNA 3BKTA 2GVDB 4QCLA 1QM9A 1RTJA 1O6XA 4G65A 4RW8A 4LRCA 3AODA 3LWLA 2GS8A 1JLCA 1IR2A 2VH7A 3ITHB 2YNIB 1T9WA 4UZCA 3OUYA 5HVFA 4C9DA 2QX0A 3NCQA 5HL7Q 3V4MA 1DRZA 9ATCB 3IWNC 4M5IA 1GMWA 2BJDA 3LWMA 1ZM4A 3ZZUA 2IM1A 1TR0A 4KQZA 4UY8T 3G9CA 2WRMA 2NUHA 1XNQF 3C6UA 2DHHA 2DNLA 2BJ8A 1BHNA 3CJ4A 1L5UA 3UVJA 4M8LA 4Y0FA 5DZ7A 4C97A 4MFBB 4U7UD 1FKPA 1UWBA 2XWYA 3RBEA 3NS5A 1S0NA 2W8LA 5B0AA 4I2PB 4BWJA 3QT6A 3Q86A 3M7VA 4NOHA 3D0IE 1RBOB 2KRRA 3I4HX 1M5KC 1KNZA 2B5JB 4A8QA 1WHYA 2PT0A 5DDOC 2XI2A 2CJYB 3CMAS 2UUAF 3VV2B 3RW7A 4WP9A 3BGRA 1WEYA 3VGUA 5KOXA 2EFNA 4K8RA 2Z4PA 2RDJA 3DXBA 1VIXA 4LF6J 2PI5A 1NK6A 4I6YA 3H0PA 1IBMJ 3ET6B 2ZKTA 1QVFR 1WI6A 4CO0A 2RRNA 4LRFA 1U7LA 2HWHA 1UETA 4O0IA 3LQVA 5B0GA 3PZPA 1ZAVA 3BEGB 4QOTA 3CCWA 2X3DA 3IMQJ 2DNPA 4G1PA 2VC0A 4JI4J 4P9SA 3M9NB 1N6QA 2MKKA 5CCMA 1KFSA 3L3CA 3GR1A 4HL9A 3SDEA 4J7CA 1D9DA 1QY7A 1TL1A 2GHVC 1WC4A 2XC9A 2OPRA 4N8NA 3DRSA 2HBQB 3N6LA 1N88A 1I6JA 4NLGA 4NL5A 2JLFA 1RTJB 1Y9OA 4RW8B 2VFRA 1PKUA 3WIVA 2NXNA 2UXDF 1U45A 5I3UA 1JLCB 2OD6A 4DV3F 2YY3A 4UOFA 1Y00A 2EC0A 4EBDA 2Z2YB 4DR3F 2JL9A 4OHXA 1HR0F 3BQ2A 4QBUA 5T7LA 2G4BA 3JAMY 4QPXA 5IOLA 3N4WA 4DSFA 3Q24A 1UJ5A 3IR6B 5GAGU 3G8TA 4DR6F 3NGTA 5E3PA 3C6UB 4B9SA 2C1EB 3AH6A 4TNOA 3CD6S 2RF2A 4DLGA 3UVJB 2PIIA 5AE3A 1FKPB 1UWBB 3H90A 2LVWA 2CJKA 4ANEA 1H72C 1QJHA 5IXUA 3QT7A 4WXOA 1CVJA 4ZLLA 2RDIA 1TKDA 1RWKB 3QJJA 5AXNA 3ZZRA 1VQOS 2NZCA 1I5OB 2WB4A 3CO0P 1PG5B 1VC6A 3M8RA 4FNHA 1RAJA 1ZOTA 3JQKA 2JHEA 3PY8A 3HHEA 1J5EF 4JB8B 4K4UA 4OZ5A 4P72A 5HO4A 2DNGA 5KT6A 2R7VA 4WU2A 1CJUA 4PYAA 2CPDA 2ZZTA 1L3KA 3PXGa 2A2CA 3CC2S 2DRDA 3PRBA 1NKBA 2QLFB 2VG6A 4Q8FA 4ED0A 3N79A 3NCPA 4KGXB 4RBUA 5A6PA 2HK2A 4OX7A 4WFNQ 4DHVA 5B7WA 1XMOJ 3D4JA 4USUA 4AQYJ 1WOSA 3CCJS 2I6WA 4EYIB 2A3JA 3H59A 4DQPA 1N6QB 2X3GA 4XTTA 3UD5A 1VR6A 3SDEB 4P71A 3NOGA 4LSZB 1TL1B 2EG1A 4DF4A 1YG0A 4OFZA 3SCKE 1S72S 1HWIA 1FRIA 4P10A 3DRSB 2EFPA 3R1HA 5ETQA 4OMFG 4DFPA 3NMRA 2GIQA 1H38A 3KHGA 3CTRA 5DO2A 2EKNA 1N56A 1QLNA 1R89A 1F9FA 3M6WA 5DLFA 5I3UB 1TVRA 1PAUB 2C3MA 2DITA 3DRXA 2IM0A 4RPFA 3CJ2A 3AHPA 2KB2A 2KYZA 4M5NA 2MHNA 4DR2F 3I0RA 1XNQJ 1RAFB 2CPEA 1YZ7A 3HHLD 2WTFA 3BKFA 3OBIA 4YMEA 5T7LB 4ZPTR 1R7IA 3RBXA 3TAMA 4JI1J 1LXNA 5IV3A 3F44A 3BJYA 1A9NB 1WTBA 1XN9A 3QYYA 2V68A 5K14A 3JS9A 3BGFA 3R5DA 3MR5A 2GCFA 2RF2B 4PPDA 4FF4A 3DFEA 4QWBA 4ZK7M 2UUAJ 2OHDA 1OO0B 2EWHA 2CQ0A 2HBRB 2CJAA 2L9DA 4ECYA 1FDAA 1LOUA 2HAFA 2LDIA 3OPKA 2VIHA 2MYFA 5D0EA 1L3UA 4GC7A 4G1IA 4ZCMA 2NXJA 4MK9A 2R7WA 4JBCA 3T6BA 3KLFA 1AZSA 1RAOA 4CH7A 1RA6A 4A8KA 3EICA 4DPOA 1UEKA 3QIPA 1IR0A 3VAIA 2N4DA 3JAMU 1Q86T 3K58A 4YR3A 2OELA 3TEHB 1CJUB 1K47A 1S6QA 4NMXA 4HI2A 2OFHX 2XNRA 3BO3A 1F3VA 3M8PA 2IYIA 2VG6B 3CNQP 4JI2F 3MFIA 1TL5A 1SC3B 5KG7A 4O0NA 2YKAA 1HKAA 3TYTA 1JXEA 2PI4A 2I38A 3TO8A 4F04B 2DPIA 4OI6A 1FX4A 4NMLA 4A8FA 2PC6A 3FSXA 2BV3A 3W9IA 2VBXA 1I94J 4CRJA 4A8WA 2UXDJ 2E5HA 3DXSX 4ECVA 3AXKA 3AY0A 3UD3P 3AFGA 5L8RC 4IO1A 2V8GA 4Q5VA 1S79A 3RB0A 3MEDA 4C8LA 4OX9F 3G71S 2LQBA 4DR3J 4P2MA 6FD1A 1TVRB 2J9EA 4DL6A 4B3TF 4JI8F 1S77D 3W1YC 2XNQA 4B08A 5ETKA 5KFIA 5M2PA 3K8VA 3BBBA 2F1FA 4PR6A 3I0RB 3NAHA 5K9FA 2J0SD 4DR6J 4OHYA 2B7BB 3M8YA 1ROFA 4X4NA 3J80Y 2A6OA 1CG2A 3TAMB 5ETTA 1B64A 3PACA 1U4BA 1AT1B 4KKOA 5KFKA 2JNJA 3M6UA 4WZMA 2W2QP 5K14B 4ZKAA 1QUVA 4KPCA 2GO9A 2XYPB 1YDLA 3A3PB 2ASLA 2CJBA 3IA0A 3C2PA 4DCOB 4QWAA 3CCSS 5CZXA 4FZVA 3PVXA 3I6PA 3H42A 2OEMA 3AD8C 5F8MA 2UVUA 2VF3A 4OHWA 5GMEA 3HFVA 1J5EJ 5A8RA 2KH9A 2ZOFA 2OJ3A 4HHUA 1IKYA 3OFFA 5G4DA 5J2PB 4QYZJ 1N0VC 5HMYA 1AZSB 1OYDA 1N33J 3R6LB 2IJFA 4OZJA 1GNKA 1P1TA 3VAFA 3THPA 3EMTA 3QIPB 4KJIA 3PJ9A 1SB6A 3NWRA 1PYTA 4CDIA 4BDPA 4RBTA 4K4VA 3VF0B 1TK0A 4WIQA 3M8PB 1U47A 3G6XA 5A0YA 2MQOA 3T41A 2WSCC 2WBRA 2E9TA 2VBYA 4M95A 4DV7J 3SMZA 3HD1A 2WVBA 3TX8A 2CJ9A 1Y11A 2Q3PA 2QRRA 4DR7J 5KG4A 4XO0A 4ZPVR 2L9NA 3HK2A 4DG1A 2LEAA 1SH3A 5E2QA 5K5MA 2OSRA 4LIRA 1IM6A 5E3CA 4UOHA 3PW5A 2AQ4A 4TU7A 3MEDB 2ZITA 4EO8A 3D3CJ 4WKYA 3PO5A 4TYBA 3Q83A 3QAUA 3LAMA 3G87A 3K57A 5ITHA 1TKXA 3EYZA 2JDJA 1XR6A 2F4FA 4BHQA 2CNNB 2H1YA 3HFKA 3TJAA 3QJPA 4ID8A 5KT5A 5E0OA 1PJ5A 2IHR1 1LKZA 4HYKA 1S6OA 2ZBRA 4CM2A 2MQMA 1RWUA 4USJC 1TAUA 3JTPA 2JX2A 4EYHB 4ZJQA 3HZEA 4KKOB 5T14A 3LPEA 2YKPA 2B8QA 4V19J 2GMLA 3ETMA 1ZAWA 2R8KA 1HD1A 4A4JA 3S7RA 2A0FB 2DHAA 1HPZA 4CO5A 1P9QC 4JP8A 1Z2LA 2HSEB 3D1OA 5F0UA 4ZOSA 1B0VA 5L1KA 1HBNA 1FNMA 2G13A 1H74A 4IQXA 7FD1A 5K8MA 1G6BA 5A8RB 2RQKA 2BJ3A 2RVJA 5J2NA 3T1HF 4E8UA 3MTKA 4MKAA 1IKYB 4LREA 2C2EA 3G82A 1H7XA 1T8EA 4WP3A 3TOQA 3OXLA 2H4YB 2JLGA 3GYNA 3NG8A 2XZWA 2FHJA 3OL9A 3J80U 1FRMA 3SIPB 3BYRA 2MY8A 2MY7A 4RUCA 2DRBA 3HSGA 1Q1KA 1HI8A 4FXVA 8ATCB 2ZHBA 2AEMA 1N48A 2O67A 2XYGB 2RKIA 5A0YB 4RUAA 4CO2A 3UNGC 3R5GA 4XDCA 4B02A 4CLFA 4OJ3A 4C8OA 1KVJA 2R8HA 2AJ1A 4DQSA 2C42A 5HVGA 4DG1B 4ZA1A 1NPPA 3RG6A 2YKNA 2WSFC 2AF6A 2Z8QA 4ILMA 1BC6A 3CD5A 1O8BA 2ZHOA 3S01A 3Q89A 4H4OA 2GV1A 3OTDA 2B0GA 2QA2A 4TYAA 3DM2A 2A1BA 4U96A 4P7VA 1MN7A 4NLDA 4C2MA 5DLGA 4NCGA 4PAAA 3TW0A 1S5ZA 4QYRA 4YR2A 1KEKA 3HO1A 1S97A 1VGYA 4ZVUB 2ZJPQ 4EBEA 4ETXA 4LF2A 1XERA 2LQJA 3R5AA 5I4MA 2MB0B 5EDWA 2CJQA 2B9EA 2AZ3A 4MAKA 4P52A 2HS3A 4Q7AA 1RT6A 2VKRA 4HEA9 3GU0A 4XIUA 4QIGA 4UQTA 2R2RA 1W7WA 4X4SA 3GFZA 2O66A 2OH2A 1WG5A 2K3KA 3HLUA 2KYXA 1HPZB 3CEDA 4O3OA 1R0BG 4Y2CA 1C0UA 1V5VA 3KWMA 1TL3A 3J81j 5J1PA 1LFWA 4H4MA 4LFCF 2DO4A 4K4XA 2ZVSA 1HBNB 3FCWA 2DCUB 3O3LA 4ZVRB 4J9LA 3C16A 2BE2A 4YOEA 2QO3A 2J76E 3CW2C 5J2NB 3VAJA 3G82B 1KKHA 3G2XA 4NA3A 3RGIA 3R7SB 5LMUF 3BGUA 3QRQA 1K9MT 4CLSA 4CO4A 3RRHA 4ENOA 1FXLA 3EM1A 5L38A 2QGFB 2NREA 1LK5A 1AW0A 2KRBA 3E51A 2RKIB 4LBPA 3OSPA 3CCRS 4JI5F 3WX8A 1LEOA 1UL3A 4H4KA 4HHJA 4ZLPA 1KC8T 2E5JA 3FCHA 2CG8A 2X1BA 4IFYA 2C2ZB 4PWDA 3CCMS 2XMUA 4X4VA 2YQ3A 4J9RA 3H5UA 8RUCA 3KKFA 3D6TB 2OMOA 4NYZA 2OI2A 2YKNB 1F5BA 3HSDA 2VOOA 3VGVA 3T3FA 1F9HA 5E7OB 4H4OB 2MHEA 4B3RF 3UCUP 4J9VA 4UOGA 3L09A 4WK3A 2EK6A 2RH3A 1CJTA 2EFGA 1X60A 3DM2B 4DUZF 1HI1A 3CVKA 1HNWJ 4NCGB 2Z56B 4OI0A 2XTJP 4P73A 4TU9A 1KHWA 5B08A 2KVIA 4KHMA 3C15A 2UUWA 1YQHA 2BKNA 3BBCA 1HI0P 3TA0A 3M2VA 2LFVA 3PEHA 3TA2A 1H3DA 1S1VA 2LECA 2KFNA 2WK4A 3HT3A 5KG6A 2M5YA 3IRXA 4IG0A 4A48A 3SFGA 1YJ7A 4OI4A 2C3UA 1RT6B 2BQUA 4YUDA 2CQ4A 3VAHA 1RQ0A 2V6AA 5K20B 4Y65A 4QQBA 1KDNA 1RBAA 3PX6A 4NEYA 1NJIT 1OJ4A 4UOCA 5JMNA 2LXFA 4ES1A 2GAGC 3CJRA 2BZ2A 1C0UB 2VB6A 1TL3B 1LW0B 2L48A 2VDIA 3Q23A 3UNYA 2K1RA 4H4MB 1P27B 1YJWS 2G2OA 1ITPA 4NZ0A 5L9XA 3C16B 2BE2B 4K5RA 5E3AA 3A8KA 3JSMB 1N5TA 3W65A 4YDXA 4DR5F 1FD8A 2IVYA 5KG1A 3L9ZA 1NJWA 4GVBA 4DU7A 1WTFA 1A0OB 1WG1A 1U1LA 3E3XA 4J9SA 2IDLA 4L3NA 2RIJA 3IG1A 1R0CB 4WK1A 2GA7A 1QAYA 5KFXA 1Q82T 2QA1A 4JI0J 3ULHA 1T9UA 2X7IA 1GXUA 5L39A 1Z2ZA 3A4TA 1KRPA 3IP0A 4CO3A 4IFYB 2DIUA 3FFIA 2NQPA 3LALA 4PWDB 4USWA 3KHRA 5CA5A 2BR0A 3QMQA 2XO6A 1M5PC 2C3OA 1UPPA 3GYXB 3EX7B 3VGTA 2KFZA 2VOPA 3VR1A 1WC6A 2I1RA 2IBKA 2M70A 2Y9HA 1T9VA 2AJQA 3W7BA 5IQ6A 3D2WA 1FWLA 1IJEB 1CJTB 1SC6A 2R8JA 2W24A 3A3NB 2LXIA 3HKWA 5IFMA 5K8NA 2E1RA 2J0WA 4CLZA 1S99A 1X5PA 3C15B 3QZ8A 3BDPA 3T19A 1V3ZA 1XR7A 3M2VB 1KTQA 3OTOJ 3TJ9A 1S1VB 3DHXA 3F0NA 3W8PA 4A8MP 5AT1B 3KJQB 3J7AN 3IRXB 3LOUA 4IG0B 2FJVA 3IWLA 2HQCA 2IJNA 2BQRA
chains in the Genus database with same CATH topology
2RT3A 3KK1B 5E3RA 2ZD1A 3HHLB 4I2PA 4NLRA 2XB2D 4NYPA 3HDSA 4OX8A 4RNMA 4DFKA 3SCLE 3US5A 2LU1A 3F56A 3T6JA 2VBWA 5IM0A 4AL5A 1NNDA 3SYZA 2YX7A 1KFDA 3PX0A 2F4VF 2MKJA 4LIWA 2FJWA 1URRA 4RNFA 3PX4A 4FVCA 2V8DA 5F8GA 1Y0HA 3G6YA 3IR5B 4Q8EA 2QA4S 3J7ZT 2B5JA 2W4CA 4ZPDA 4OZNA 1QAIA 1VFJA 4NA2A 2ABYA 2M0GB 4U67Q 5HLFA 4NRUA 1TQLA 1NKEA 4C3KA 3MOJB 3RR7A 1M5HA 4AXJA 3PW0A 1TAQA 3L7PA 1EETA 2XHWA 3HVRA 2CVEA 4JI3F 1Y3KA 3EXCX 4DV1F 3N28A 2K1RB 2DK2A 1LW2B 3TUIC 1W2BR 1RT5A 5DDQC 2BXJA 3GQCA 1S9EB 4WFXA 2KXHA 3DRRB 3VTIA 4LJMA 2HGNA 3HVAA 5KFAA 3E01A 3TVKA 2JZ5A 3MR3A 1UVMA 5KFYA 1WNEA 4OZ0A 2CIMA 2HHUA 3LF0A 4KE5A 1N5SA 4TQRA 3L95X 3MM8B 2FLLA 3TVYA 4C4WA 1WI8A 2EBGA 5KFVA 1IBKF 2Q66A 3FDSA 1J2VA 1X4HA 3DDNA 4XK8C 3BSCA 1Q7LB 2UV8G 1QAJA 1VLYA 1VJWA 2MPUA 1D8YA 2GW8A 3IR7B 4ZCLA 2JH3A 3FGVA 4AE5A 2XEXA 3HHDA 4M5DA 3I9ZA 4IOCQ 2CFXA 1IKWB 3MWBA 5LXRA 1LXJA 3MFHA 4WYWA 1YWXA 2XMTA 4ATNA 3I55S 2DPJA 5KT4A 1M0SA 4N8OA 4CI0B 2Z2MA 4C8ZA 5D4LA 4PG6A 1FJCA 3LANA 1VK3A 3MEEB 1U09A 3NRBA 1G1XA 2MZQA 1SI9A 4GO7X 2MMYA 1JX4A 2VG7A 1UVJA 1HFEL 2F8MA 3M6XA 1SKSA 2PD1A 2ZH5A 1HBOB 4HDHA 5KT2A 4PWUA 5IQQA 2ROGA 1MNEA 2BACA 5I42A 1NJYA 4F4KA 2HS0A 1TKXB 3DI6A 1N5VA 3IG1B 4OIXA 4OLOA 3Q2TC 2DGWA 3TARA 4B9TA 2NLWA 1X4EA 2XY7A 2BDPA 3J7YI 3ZZOA 4HTIA 2ZBCA 4Q43A 1FJ7A 2CQHA 4OX6A 2ZOGA 4LVOP 3I4PA 1U26A 5D77A 1U1MA 2WHOA 3PJXA 5KFRA 2LQ5A 1OPZA 4FXWA 4M94A 5DGBA 4R0EA 4I7FB 3QZ7A 1EP4A 1XMOF 1K1QA 2YWEA 1YBAA 1ZM2A 2ATLA 3IRWP 3M1VB 2RD5C 4AQYF 3CB4A 4PQAA 2AYBA 4J5OA 4L6V3 2V8HA 3CDWA 4YB7A 5THWA 3LAKA 2FIUA 4Y2IA 2I0XA 2IRUA 2KDOA 4KAIA 5D78A 5J2PA 2DNNA 3AJ2A 3FFIB 1FRJA 4CTAA 3CF5Q 1SV5A 1GX5A 3ISZA 4FXDA 4X4RA 2QIFA 2BRKA 3SFUA 4QU6A 1FD2A 4ED5A 4RNNA 1WWHA 4QCLA 4NLXA 2E5GA 1X4CA 1SXLA 2MJUA 1VOMA 1QM9A 1RTJA 3GV5B 2AGQA 2U1AA 3GR0A 3ENWA 4RW8A 3QAEA 1M1KT 3LWLA 3CDEA 5SZTA 5EX3A 3LP0A 2AU0A 3HJFA 1S6UA 3CIMA 2D3UA 5B0EA 1JLCA 2YKMB 3BN7A 2DGXA 2FLPA 2CPJA 3M6VA 2VH7A 2I5JA 1XTZA 4ECXA 3MDFA 1FRLA 3ITHB 2YNIB 3MR2A 1AUDA 2N7YA 2DNOA 2F8EX 1ZM3A 1OQ3A 4OHVA 4RW6B 3OUYA 4C9DA 3NCQA 5HL7Q 3V4MA 1DRZA 3CC7S 3CWJA 5FD1A 1MROA 2FHMA 3MD1A 3SQGA 4BC9A 2VASA 2XLIA 1NK5A 3IWNC 3G8SA 5EUHA 2EFVA 3GV7B 1UVNA 1UVKA 3UD4P 5IT9Y 3THTA 1UW4A 2QE5A 1X7VA 2BJDA 3LWMA 2XI3A 1ZM4A 3ZZUA 1ZETA 1S6PA 2X1AA 2IM1A 1TR0A 4N5SA 2Q6BA 4ED8A 3TUJC 4RW9B 4IKAA 3OVSA 1U2FA 4JV0A 1S4FA 3FQLA 5CH7B 4Q0BA 1QSSA 4A46A 4I67A 1NHUA 4KQZA 2AWZA 2XBPA 2MZRA 2DR7A 4UY8T 1IBLF 3G9CA 4F8RA 3KOAA 2GMHA 2WRMA 1FKAF 2MKSA 4K4YA 1RTIA 3PM9A 2NUHA 3C66A 1XNQF 2OO4A 3OFHA 3C6UA 2DNLA 4RUHA 2FGCA 5GVQA 1FE0A 1BD6A 3KLGB 1K1SA 3CJ4A 1L5UA 4M8LA 4Y0FA 4HH0A 2QZ8A 4C97A 3PW4A 5IS2A 4MFBB 4WYLA 1D0EA 1FKPA 2JC0A 1UWBA 5BR8F 1U49A 1A7GE 2XWYA 4WXWA 1JXLA 2RB7A 2V9WA 4JV5F 1JLBA 3RBEA 3NS5A 2JFDA 1WEZA 2UZAA 3VQSA 1S0NA 2W8LA 5B0AA 3GB0A 4I2PB 4BWJA 4LFAF 1T02A 3G96A 1VBYA 2HYIB 2KJVA 1FXDA 5KFDA 1MMDA 2R7OA 4NOHA 5IM0B 4LVNP 3D0IE 4DBQA 1VI7A 3BQ0A 2Y1RI 5J2MA 3VAMA 2KRRA 3I4HX 1HNVB 4F3OA 1M5KC 2K2PA 4UUXA 2FJBB 4C98A 1KNZA 1Q78A 1WG4A 4NLWA 2B5JB 2KG0A 3DYAA 5ADZA 4A8QA 2FTRA 1WHYA 2PT0A 4DOZA 5DDOC 5HLFB 1LQ9A 3IS9A 3EPGA 1LK7A 3RRGA 2XI2A 1RGVA 4MK7A 3MPVA 4ZPCA 3CMAS 1M5OC 2UUAF 2PEHA 2FLNA 2GNKA 3RW7A 2IA0A 5M2RA 1EETB 3BGRA 1WEYA 2FHJD 1FK9A 3KK3A 4OI1A 5KOXA 2EFNA 3AA9A 1RT5B 4ZCKA 2XULA 5KOWA 5GAHU 3OTBA 3R1LA 3SSRA 3KHLA 1KLMA 4ITSA 5B0FA 3M8SA 2Z4PA 3PNIA 3KFWX 3E01B 1X8DA 2AW0A 2RDJA 3DLBA 5KFHA 5F8NA 3DXBA 1GTHA 2IBOA 2KT2A 1VIXA 1H2TZ 3RAXA 2F40A 4I6YA 1NK6A 1FO1A 3HVWA 2PI5A 2MXYA 3OVAA 1Y3JA 5AXKA 2YTCA 1NO8A 3BDEA 4I69A 1CC7A 1R6YA 2ZKTA 5D3GA 1QVFR 1UFLA 5GAEI 3OR1A 2XY6A 2OKQA 1WI6A 2QYCA 4CO0A 2RRNA 4M5DB 4C0BA 1TK8A 3GILA 1U7LA 1GTEA 2HWHA 3DLGA 2VG5A 3ENQA 1UETA 4ES3A 1CEZA 4O0IA 4YFUA 4Y3CA 2LQ9A 3LQVA 1R8HA 1VMBA 5B0GA 3PZPA 1ZAVA 4DV2F 1T95A 3BEGB 2UU9F 3FEYB 4QOTA 2VG7B 3CCWA 3JYTA 4N41A 4DR4F 2DNQA 3WZ0A 1YJRA 5FJ4A 2VPYB 4IRKA 2GHWA 3FSIA 5I42B 5HP1A 2DNPA 4G1PA 3DI6B 3NGKA 2VC0A 3EGZA 1F5CA 2K7KA 2OP5A 3M9NB 1N6QA 1RYSA 2MKKA 3M2RA 4W90B 1U6FA 3KLEA 5CCMA 2B4OA 1KFSA 4FPRA 3L3CA 3GR1A 3Q0AA 4HL9A 3SDEA 2H5EA 1DBDA 5E5NA 1D9DA 2A2DA 1QY7A 1TL1A 2M7SA 2CQGA 2GHVC 4I6AA 2HLTA 1EP4B 2E29A 4ZVGA 2W7PA 2XC9A 2LU2A 3UR3C 3CJ3A 1X4AA 4R8UA 4IDKA 2OPRA 4N8NA 3DC2A 3GIJA 4B3OA 4OJHA 3DRSA 3IWXA 3H5YA 3DLKA 3BN4A 2B7CB 2GQQA 3N6LA 1N88A 2GGPA 4QR2A 2K8GA 4CTAB 1I6JA 1SV5B 1X4GA 5LXYA 1T03A 2ASYA 2CPHA 4NLGA 4MMOA 4NL5A 4F3MA 4NLSA 2FJXA 2JLFA 1YTYA 1DHMA 1OSDA 2AP6A 5KFNA 4K50A 4C8NA 4ZMMA 4AFFA 4DN9A 3PKYA 4HKQA 1RTJB 4K59A 1Y9OA 4RW8B 2VFRA 3CCUS 3RW6A 2UXDF 1R8BA 2R7TA 4IR1A 3P3DA 3LP0B 2WONA 1U45A 1HHSA 2DGSA 2XSJA 4NCAA 5I3UA 2G1DA 1JLCB 3BR9A 2OD6A 4NLUA 3ZC4A