2DB1A

Solution structure of the rna binding domain in heterogeneous nuclear ribonucleoprotein f homolog
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
b'GSSGSSGMMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVELESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heterogeneous nuclear ribonucleoprotein F
publication title Solution structure of the RNA binding domain in heterogeneous nuclear ribonucleoprotein F homolog
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2db1A01
2K8GA 5LXYA 1WG4A 2K3KA 2DNKA 2XSFA 3MUMP 2CQ3A 2L41A 2JX2A 3Q2SC 2MJNA 2OTJS 1VQ8S 3CCQS 3P49B 2X1GA 2VOPA 2DNPA 2KI2A 1FJEB 2CJKA 2ADCA 2KRRA 3R1HA 3SMZA 1FJCA 2JVOA 1M5VC 2RRBA 1WI6A 2MGZA 3LPYA 3CC4S 3DLLQ 2MQNA 1U6BA 4Z2XA 1Q82T 3CUNA 1KOOA 2JVRA 2NZ4A 2HGNA 3JB9k 5DETA 1PGZA 1PO6A 2YWKA 3VALA 2ZJRQ 1FT8A 2CQ1A 2DIVA 3VAJA 3ZZZA 2U1AA 1VQ5S 2FC8A 2CQIA 1M1KT 3NMRA 2WBRA 2XS7A 2DHXA 3CC2S 2MMYA 2N82B 4ERDA 3G8SA 2XS5A 3THPA 2KN4A 2LKZA 3CC7S 2MQOA 2MB0B 1DBDA 5DDOC 3RW6A 2DGOA 3CCJS 1X4EA 2LEBA 1YI2S 3G8TA 2ZJPQ 2CQ2A 3G4SS 2J0QD 2MYFA 2KVIA 3NS6A 4QPTA 3CCMS 2MKKA 3BO2A 3TO8A 1X4DA 1N88A 1ZH5A 2E5IA 2DGXA 4WCEQ 1H2UX 1YITS 1U1PA 2MKHA 2KM8C 4YOEA 1A7GE 4BS2A 4CIOA 5LXRA 4ZKAA 2MQLA 3MXHP 1VQLS 4OZ1A 3FEXB 1HD0A 4OZ0A 2AYBA 2DGWA 2MJUA 1WF1A 2LA4A 2MZJA 1RKJA 2MQMA 4WFNQ 5GAEU 1OPIA 2M2BA 2CQ4A 2M88A 4UY8T 4Y0FA 1U1KA 2L08A 3CCUS 2MZSA 2KH9A 1YJNS 2MQPA 2CQPA 2FY1A 2DGUA 2D9PA 4U67Q 2RQ4A 3CMES 5GAGU 1F9FA 4F26A 3UCUP 2AD9A 1NJIT 1UW4A 2DH8A 1H2VZ 4LJMA 1WHWA 2MZ1A 3B4MA 2J0SD 4IOCQ 1DHMA 2DK2A 2YH1A 2G4BA 2CPZA 3CULA 1K9MT 4QU6A 2XNQA 1X5PA 2KXHA 1SJFA 1SJRA 2Q79A 1UAWA 1X5OA 5H1SV 1WHXA 2KYXA 4J5OA 3U1MA 3IWNC 2CPEA 1UFWA 1M5KC 3VF0B 2HZCA 5D78A 3J7YU 2CQ0A 2F3JA 2MKCA 3MDFA 2LECA 1VQOS 1X4FA 1VQ7S 1AUDA 3H2UB 1JJ2R 1WEZA 1X5SA 1NO8A 3PIPQ 2HGLA 3R27A 3D2WA 5IFMA 1JJ4A 2F9JA 3NS5A 1K73T 5CXTA 3UCZP 2N3OA 1M5OC 3CTRA 5EN1A 3TYTA 1SJ3P 2ERRA 3MURP 1QVFR 3BS9A 1YTYA 1WTBA 1NU4A 1WG5A 1U1OA 3OW2R 2PEHA 2UP1A 2RRAA 2XB2D 2MY7A 3EX7B 3DXBA 4YB1P 3UD3P 1S72S 5JVGQ 1RK8A 4IOAQ 4LIRA 2KXFA 4TU8A 1WELA 3UD4P 1YWXA 2HYIB 2LEAA 2G1DA 4ED5A 3NNAA 1SJQA 2M7SA 2DO4A 1VC5A 2MSTA 4TU9A 3CCRS 3VAMA 2LYVA 2LA6A 2MKSA 3BEGB 4P6QA 1URNA 4WKRA 2DNNA 1B7FA 2RNEA 3ULHA 5JVHQ 1HD1A 4W92B 2ADBA 3CD6S 4F25A 2RS8A 4PR6A 2DHGA 4M5DB 2MZQA 2M4MA 3I56S 4PKDB 1H6KX 1X4BA 3EGNA 2CPIA 2DHAA 1HL6A 2YKAA 1VQ6S 2EVZA 5HL7Q 3B4DA 2DB1A 3VAFA 3CCLS 3G71S 2CPXA 1L3KA 3VAHA 1Q86T 3G6ES 5LJ3Y 1CVJA 1KC8T 2GHPA 3BO3A 3HI9A 3J7ZT 2M9KA 1R8HA 1WG1A 3CCES 5D77A 3EGZA 2AYEA 1U2FA 1VQMS 2AYGA 4F02A 4WF9Q 2MHNA 3RW7A 3UCGA 5DM7Q 1OO0B 4YUDA 1VQPS 2OSRA 2M8HA 3CXCR 1SXLA 2KM8B 2DNQA 1JJHA 4CH1A 1YJWS 1VQ9S 3N9UC 3P6YC 2CPYA 2JWNA 1KD1T 2F9DA 4RU2A 2OTLS 1WI8A 4LMZA 1A9NB 2MPUA 2CQGA 3BO4A 3SDEB 3CF5Q 2MY8A 3NNHA 2BZ2A 2AYMA 3P5TL 3THTA 3MUVP 2YH0A 1KOHA 4CH0S 3UWTA 4C7QA 2G0CA 2M52A 1W2BR 2M0GB 2ZJQQ 1BY9A 3IRWP 1VC6A 4TU7A 2E5HA 5IM0B 3MUTP 3MOJB 2KU7A 4WFAQ 1P1TA 2MSSA 1YHQS 5BJRA 3CPWR 2DIUA 4A8XA 5GADU 2DNLA 4W90B 2VONA 3CMAS 3TP2A 2YTCA 1HA1A 1U1MA 3H2VE 2DH7A 2D3OR 3MD3A 2QEXS 3P3DA 2X1AA 5MLCV 2HVZA 2PE8A 2FHOB 3UE2A 2GO9A 4FXVA 2CPJA 2MZTA 5HO4A 2MKJA 1VBXA 1X4CA 2E44A 3V4MA 1U1QA 5DM6Q 2DNRA 3CCVS 3NNCA 1M5PC 1D8ZA 3SDEA 2DISA 1FO1A 4WFBQ 3MD1A 3VAKA 4UQTA 2KHCA 4WIIA 3K0JA 2CQDA 2VODA 2LXUA 1DRZA 2LXIA 2RQCA 4PRFA 4V19X 1D9AA 3G9CA 1QVGR 2EK1A 3US5A 2HGMA 3G96A 2B0GA 2CPFA 4C0OC 3MI7X 1H2TZ 3I55S 5IM0A 1VQKS 1WHYA 2LMIA 1X4GA 3FEYB 5FJ4A 1G2EA 1WWHA 3ZZYA 2DH9A 2N3LA 1VC0A 2RVJA 4C4WA 1S79A 3Q2TC 1XN9A 2MZRA 1P27B 3S8SA 5ITHA 1VBZA 2RU3A 2DNZA 1YJ9S 1M90T 1O0PA 2DGTA 2DNOA 1SJ4P 2KT5A 5CYJA 1YIJS 1X4HA 2KG1A 2E5GA 4EGLA 1K8AT 1VQ4S 3S6EA 2OJ3A 2FC9A 1Q7YT 2A3JA 2QA4S 5GVQA 5CA5A 2RUGA 2E5JA 2EK6A 3LQVA 1FHTA 3HHNB 5DDRC 2DNMA 2M8DB 2QFJA 2NLWA 1U6FA 1U1RA 2KG0A 1N8RT 3S7RA 1ZZNA 5GAHU 2MKIA 5LSLA 1WHVA 2XNRA 2CPHA 2DGVA 2D9OA 1UP1A 2DNHA 2DITA 1N52B 2L9WA 2DHSA 2O3DA 1X4AA 2CPDA 2I38A 2BOPA 2X1BA 2KXNB 2I2YA 1R8PA 1ZZFA 2DGSA 3SXLA 2XS2A 1N54B 2M70A 5LSOA 2RT3A 1U1NA 4QU7A 2DNYA 1WEXA 2LCWA 4Y00A 2CQCA 5LJ5Y 3CCSS 3S01A 1QM9A 2VOOA 1FJ7A 2X1FA 2U2FA 1X0FA 2DNGA 2CQHA 1JMTA 1DZ5A 4CQ1A 5DDQC 1U1LA 2KRBA 1VBYA 1VQNS 1OWXA 3U1LA 5DDPC 2J76E 2MGZB 2RS2A 2J8AA 1FXLA 2DO0A 2JRSA 4QQBA 2V94A 4IUFA 4TLQA 4IO9Q 2KFYA 2N7CA 1X5TA 1WF2A 2SXLA 3PIOQ 2MQQA 1Q81T 2FPHX 3VAGA 1WF0A 3VAIA 1FNXH 1WEYA 2OIHA 5IQQA 2LQ5A 3L3CA 1OIAA 4FXWA 5GMKa 2CQBA 2MXYA 3R1LA 1KQSR 2OSQA 1IQTA 2DGQA
chains in the Genus database with same CATH superfamily
4O3PA 1CC7A 3OSNA 1OYDA 1GMWD 2RRBA 2MGZA 1U6BA 1AW0A 3FBBA 1BGXT 4C3MA 2BE9B 3SV3A 2U1AA 5HANA 3AQOA 3G87A 4QWAA 3C15B 4OYBA 3V6DB 1P8GA 3PM9A 1UVKA 4ZVSB 3P4UB 1X4EA 3CSKA 1NK5A 1J5EJ 4R5PA 4IRKA 1F5BA 4C3LA 1NDPA 1RT1B 5D0GA 4WP8A 5FDLB 1YITS 4DWIA 2GZOA 3FNNA 5DG9A 2DR9A 2XLKA 3OTOF 2WHOA 2BE2B 2LA4A 3DLKB 2R42A 3TEHB 4TNOA 1PG5B 3C16A 3L95X 2PFFB 3Q23A 3FCVA 1RCOB 2D9PA 4U67Q 4LF6J 3DRPB 1XNQF 2BACA 3D6HB 4IFYA 2K2PA 3DLEA 1DTTB 1Y00A 3DU5A 2YKQA 4TVAB 3A8KA 3DCAA 3C19A 1MNEA 4WE1B 4X4VA 1FEEA 3H98A 4MTPA 2DR6A 3PIPQ 3KOAA 4CLPA 2ROPA 2CUYA 5L1JA 3O5TB 1XK8A 1YVFA 3KNAA 1P1LA 4KIAA 1S7IA 4CLYA 1ELOA 4C8KA 2YX4A 1JLFA 3K5OA 3TUPA 2YQ3A 4NOHA 1YTYA 4OX7A 3BJYA 2J9DE 4LQ9A 4XTTA 1NK9A 2XB2D 4K0KF 5HQMA 2W4DA 1DQAA 2Q6CA 1FKAF 3NNAA 4ZIVA 4NASA 2UUBF 4NLWA 4NLTA 5BR8J 2JOQA 3HO1A 3DRXA 3ULHA 3KK2B 4LSNB 2HVDA 5B0DA 4DUYF 3SQGB 2AJFE 4ES2A 3K57A 2D3UA 2FZKB 3M6UA 2YKAA 4AXJA 3HZGA 2N4DA 1FFGB 2L3MA 2Y9HA 2KT3A 1VRTA 2JL9A 2C3OA 2EXUA 1IKYB 4WF9Q 1LWFB 2ZZTA 5DM7Q 1VQPS 2M8HA 4OI2A 3UNYA 4DQQA 1FJGJ 3W65A 1D1UA 4Q0BA 1OSDA 1S99A 4FNHA 1TVRB 3D66A 2CNOB 1X8DA 2BOAA 2CDQA 1LNQA 4A47A 4FYYB 4JV2A 4HTJA 3IRWP 5KT4A 1WKLA 2ATCB 4YHHF 3FVYA 2RB7A 2D3OR 5CABA 5MLCV 2OFHX 4RW9A 4ED2A 2MZTA 3KHHA 3JSBA 1ULRA 3EVOA 2E44A 4MK7A 3HHLD 1N56A 3JAMY 2HFZA 1IUJA 4PYDA 2AW0A 5CHCB 4K5RA 1PAEX 1F6TA 3TEGA 1ITPA 3J7AN 5FJ4A 1GMWA 4F67A 2RVJA 4AE5A 5AE1A 3NGKA 1UMJA 2FHJD 3FBEA 3S8SA 5ITHA 2DNZA 3R7SB 4HL9A 4I2QB 3OL9A 2FGOA 4PQAA 3I0SB 1O8BA 1N32F 1WKJA 2NYIA 3SEOA 4OJGA 5GMDA 1BQNB 3D67A 2DNMA 5K14A 1YRTA 4ZN3A 4OZ3A 4UUXA 1IBKJ 3NCRA 2ASDA 2UXDJ 4RUAA 4EU0A 1ZM2A 5HN0A 4NYZA 1U0SA 1U02A 1TELA 2DGSA 1LWCB 1MG7A 4CO1A 3TQ1A 2K7KA 4KAIA 3WC2A 5HBMB 4C11B 2U2FA 3NOGA 1DZ5A 4CQ1A 1VQNS 1SQFA 1YK9A 2KFYA 3CVKA 3EZ5A 4KPCA 2E1CA 1NEEA 1XR7A 4C0HA 1RP5A 3JTPA 5IQQA 1QUPA 4ZK7M 4FXWA 3SCLE 2MXYA 1HI1A 1WOPA 1Y5NB 1HBUA 3MGJA 4KSEB 4HVZA 4WBFA 1V5IB 4PABA 3IFEA 2ZE2A 1YZ7A 1VIOA 1ZETA 1KN6A 2B9WA 3SMZA 3ZZRA 3H4DA 2RH3A 1D9FA 4M5HA 1D09B 1LOUA 2ASJA 3ZTSA 3RBEA 4DFPA 1Z2LA 3OXFA 5E2QA 5ADZA 1VBKA 3OR2A 4NCGA 3BREA 1CJTB 4CNZA 1JLEA 3KK3A 1J27A 2LP4A 1B99A 2NPFA 1TK5A 3PY8A 3BO2A 2ROEA 1C2PA 5C7PA 2C3YA 3ILLA 4PEOA 1R6VA 4ZVGA 2LDIA 2IC3A 1U1PA 3TAPA 3OR1A 1NAQA 1FDAA 4OZ2A 4CM2A 3EDRB 4H4MA 1RAEB 3NY0A 2K7JA 1B7YB 3T1AA 1VOMA 3CEDA 1U2CA 2R2SA 4RWXA 3I5BA 3W3SA 4CLTA 2HFOA 4LJMA 1WHWA 1DHMA 2YH1A 3CULA 1S4FA 3KKFA 1M5HA 3RRKA 1Q79A 2HWIA 4FXDA 1AZSA 4OJHA 3M6XA 1V9OA 1IBLJ 3O3LA 3FCHA 3GU0A 3NS5A 4LIWA 4PUOB 1RTJA 4I6WA 3QGHA 2OP5A 3R2CJ 2PEHA 1U0HB 1B4SA 3SCIE 3BYRA 2YKOA 4Y6IA 4OIXA 4Z7CA 1RAJA 3RBXA 3VV2B 2UU9J 1TKTA 2PFDA 1WOOA 2GIRA 2JNJA 4NZ6A 1HD1A 2AEMA 3MCMA 4J91A 2FHJA 4QPXA 3HD1A 4LSLB 5IWAJ 1HBOB 3SQOP 4PWWA 3GP9A 1MROA 3PG9A 1U2FA 1RACB 4USWA 1S77D 2IM2A 3RW7A 2F4VF 4WXOA 4JUZA 2GHWA 1JKHB 2UV8A 1R31A 3CD5A 4EYHB 4LMZA 2FY8A 2CVIA 2JFDA 3O6QA 4U7CA 2GV1A 1NH8A 5KFGA 1YJVA 2CZ4A 5I3UB 4JV0A 1X0PA 2DXEA 4H4KA 5M2PA 3M6WA 1VC6A 4LF8F 4UZCA 5IM0B 4WFAQ 2AGPA 1GQEA 1U8SA 2F40A 3CMAS 2Y1RI 4M5KA 2YTCA 3H2VE 3NBPA 1NSAA 3T5LA 1T9UA 4RLEA 3TA0A 2MKJA 1SQEA 3CCVS 3ILOA 4DR5F 1CC8A 2XYHB 2OLWA 3QO9A 2Q66A 1WOSA 4P2SA 2DD8S 2V4RA 2OKQA 2VB6A 3EXCX 3V6JA 3I32A 2ABYA 4FYXB 2EK1A 2GJFA 2I8EA 1B3TA 3QZ8A 1UEUA 3NAIA 1NSPA 4Y28C 4F0MA 3CCWA 2QGFB 3W2VA 2HRUA 4X66J 4R8UB 2DH9A 3AD7C 2BE7D 3W9IA 3Q2TC 2MZRA 1VFJA 2IRYA 3KTQA 4IQMA 1GMUA 1X4HA 1C0UB 1HW9A 1RZMA 2AJQA 1K8AT 3DOMA 2RUGA 2Y1JA 2EK6A 2XI3A 4ZJLA 2NLWA 2EEYA 2GIQA 5FLXU 1DFDA 5D8HB 1T95A 4RNNA 1DTQB 4G1QA 2NYHA 5LMNF 3PYGA 1N48A 3OUYB 5AXMA 5J2PB 1PC4A 4M8LA 1DJ0A 5LSOA 4DR3J 1KLMA 4LF1A 2IAJB 3ETMA 1HMVA 1NJWA 3CCSS 2HFSA 2X1FA 2KVQE 3W66A 3D68A 4FKYA 1FRIA 1H7WA 2PA8D 4KFBB 2UVRA 2VFSA 3BN4A 3IG1A 1PYSB 5E5NA 4DBQA 3CJKA 4WJBA 2HLTA 1AUSL 1GH8A 1RAAB 4KTQA 3R2DJ 3W64A 1C1BB 3MEDA 3GPAA 4NZ7A 2CQ3A 3IR6B 3Q2SC 1IM6A 2ACMA 2VOPA 2DNPA 3CJ4A 4CO4A 4DR1F 1QAYA 3J81Y 1KOOA 3G6YA 1GTEA 3KJNB 1I94F 1FT8A 5HJYA 4XDCA 2Y8YA 3U7JA 3D6TB 2M3DA 2N82B 4I7FA 2D74B 3RW6A 4YMEA 3KJVA 3MR6A 1R0AA 5HSPA 2WSEC 4CZCA 1X4DA 2IM0A 6AT1B 1H2UX 4DCPB 3W8PA 3CNQP 2ROGA 2MQMA 3NGUA 3OJUA 3MM6A 2M88A 1WTFA 4RNMA 3E2EA 2BYCA 2CQPA 4JI4J 3F41A 1S4EA 4IOCQ 2UUCF 2V67A 1SJRA 1UAWA 5C25B 3MM9A 5D0RA 1I3OB 1QE1A 3FGVA 3JTOA 3K89A 3LP2B 3QAEA 2J7UA 2XMJA 1S1VA 4F3QA 1K73T 2AF6A 4KYZA 4QR0A 3BDEA 1NU4A 2BM1A 1AT1B 4M5JA 3OW2R 2RKIB 2HNDB 1RWWB 4KT0C 2E1MC 3CJ2A 3RZAA 5H9FJ 3FUYA 1S9EB 4IDKB 4J9SA 2B5JA 1RK8A 4WFZA 1NJXA 4K2XA 1S97A 1Q8KA 2G1DA 4JI6F 2W01A 4CO5A 4CLKA 4DSLA 2HHWA 2GIFA 2YNHB 2VBZA 3GE9A 4X62J 2QLFB 4IKAA 4W92B 1Q5VA 2L48A 1C4CA 3ZFVA 2R7WA 3I56S 1TL7B 1H6KX 1IR2A 2NXJA 4DU7A 4RW8B 5SZTA 4K4WA 1HNZF 2ZWOA 2YPYA 5CYQB 1RA6A 4ECXA 5HP1A 2XO7A 2FZGB 4EBEA 3PYFA 1EETA 5HMXA 1NNDA 1S0VA 1QSSA 3B54A 3OV7A 4CLFA 3MM7A 2VFVA 2JC0A 1Q78A 3PW0A 1SIWB 3NWRA 3R5JB 4C3KA 5KG7A 4LF9J 4TYAA 3SI8A 3KG4A 4ZHRB 3UWTA 4N8NA 1AYEA 2WOMA 1YRXA 1QTMA 1BY9A 3MECA 3MUTP 4L76A 4YDDB 2MSSA 1VLYA 1GX6A 2DNLA 3PYDA 1U1MA 4LF4J 2GVZA 1Y3KA 4F0KA 4A8SA 1E6YA 4CCHA 4LQ3A 3EM1A 3AH6A 3P8BB 2QYGA 4ENOA 3DU6A 3DLGA 1M5PC 2C42A 1X60A 1SKRA 1SKWA 4ZPBA 2CWXA 5HROB 5J2MA 3M32B 1F1BB 1TL4A 1ZA2B 4X4SA 4KGZB 3WZ0A 1OSCA 3ISNC 2CPFA 4KO0A 1HQ2A 4H54A 4K4SA 2LDYA 2ALZA 2B3TB 3MMJA 4C4WA 1SI9A 2C2DA 3QT8A 5IT4A 1M90T 5KFQA 4FVCA 4NX9A 3CDEA 1VQ4S 2FC9A 4KV8A 4ILLA 2OMLA 1GTHA 2JEJA 2VL1A 2A10A 5D3GB 2XI2A 2GJ2A 2IBKA 5GMEA 4FYDA 1BE4A 1WNEA 2X1BA 4NA2A 3W61A 7AT1B 3FQLA 2GGPB 1RT7B 4ZVRB 3JSMA 4ED0A 2LCWA 1UW9A 4QIFA 4IFVA 4ER8A 4OHZA 1SCJB 1JMTA 1BQXA 5DDQC 1N6QB 1X9SA 1RDRA 4ED8A 5DJBA 4YP3A 2WW4A 1TR0A 3N28A 4ED3A 1GFWB 1ZM3A 3NKYA 4IO9Q 1CG2A 3PYEA 4N41A 4DPTA 1FFSB 4OJ1A 2HS4A 1FNMA 1FDDA 4AL6A 4QYZK 3OTOJ 1OS5A 3A12A 1KQSR 2HMIA 2VC0A 3PKYA 3GIMA 2AX0A 4DN9A 3UR3C 3KFWX 2RF2A 2L41A 2XLJA 3U1NA 2Z2LA 3V81A 4HTIA 1XNQJ 3GSDA 4GKKJ 4ZPVR 5A8RB 2XMKA 2Y0BB 9RUBA 2MQNA 4ED1A 4RO0A 1F3VA 1RTHB 4DL3A 3PXGa 1EP4A 5KFXA 4WIQA 2DHXA 2MMYA 4F4WA 5BYQA 3DDIA 1N5YA 2DRBA 3GFXA 2H1YA 2MQOA 2D69A 1E6VA 4N56A 4I56A 1K1QA 1BMQB 4I6AA 2C2NA 1HNVB 4K0KJ 5L9NA 2P9CA 4RW7A 2W9AA 1U24A 4OLPA 4NCBA 3PZPA 1T05B 2Z56B 4I67A 2IDLA 1WC6A 2GC8A 3BGOP 2W2OP 4C98A 4DV2J 2UUBJ 4ZDNA 2BJEA 1Q5YA 2VFRA 3VGTA 2LQ8A 4DUYJ 1UW4A 2R7XA 1J2VA 5AE2A 3K59A 2L9NA 4RUHA 2X3GA 1FE0A 4DUZF 1AFIA 5KFJA 1KONA 3L9ZA 4F0HA 4F04B 3J7YU 3V4IA 4RUCA 2HQDA 5DLFA 1VHFA 2HGLA 3ET6A 1KVKA 1DAXA 1ZBTA 2QLWA 3NS7B 3R6GB 3MEGB 2UVVA 2IJRA 3DFEA 4B3OA 2XWXA 4K50A 3CD0A 2EFOA 2GA7A 5IZHA 1ZAWA 2CRLA 4ZPTR 2HHUA 2B51A 3EX7B 2DYAA 4IH6A 4NYOA 3MCSA 2FD2A 4ICLB 2YNGB 2EKNA 3D1HA 2LEAA 1L3UA 2W9BB 5CCMA 5KFPA 1SJQA 2W2NP 5DRKA 1TAUA 1Z2ZA 2HHQA 4TU9A 2YWFA 3D6MB 4DV1J 4F25A 1HPZA 1VGYA 3HFVA 4OL8A 2DHAA 5CCLA 3B4DA 3BV8A 2I5JB 3V6HA 4WYWA 3AQPA 1Q86T 2QFIA 2W9CB 4OV6A 5FIIA 2XZWA 4OZ5A 3L4BC 3I0RA 3GJTB 5THWA 1OO0B 4EFAC 2OSRA 3Q24A 3BGRB 3QRPA 1F9HA 5D4OA 5KG1A 3JQKA 3MEEA 7FDRA 3KLEA 4IG3A 4CYUB 1IKXA 2IVMA 1F3FA 4IR1A 2BZ2A 1BQMA 3MFIA 4O0IA 3DLHA 2M52A 1N32J 1TKZB 2M0GB 2POKA 1EIYB 2E5HA 5BJRA 4K7QA 3JXOA 1JLAB 3TI0A 2FHOB 1WORA 3FZ2A 2O1PA 2GCFA 2BJ9A 2QA1A 4RW4B 3EGVA 2WCXA 3SDEA 3CDUA 3P45B 4KPYA 3K0JA 2CQDA 3C6TB 5KFZA 3CDAA 4GKJF 1JB0C 3AT1B 3FEYB 3IN5A 3WBZA 5KFTA 4GVBB 5F8MA 3J7Z5 2AJ2A 1NLKL 1VBZA 2Q43A 2ZZNA 4DR4F 1P9QC 4J9UE 3MR7A 1YIJS 4Y34A 2A3JA 1N4LA 1TL5A 1HBMB 3AAWB 2YWGA 2J9CA 3ZZTA 4WFYA 4DR7J 1MWQA 5A76A 2CPHA 2F4FA 4F36A 3UI3A 2PI4A 2XY6A 3QPIA 1T03B 3T5JA 3R5GA 1QY7A 2VDHA 4BC9A 3DRRB 4V1Ak 2A1BA 2DNGA 1HHQA 1S1UA 4W98A 1YBTA 1QDUB 4UQGA 1KTVA 2KTQA 3RRGA 3KK1A 3MMAA 3NGSA 1SV5A 4KKOA 4ECZA 3HX9A 1PIEA 5J2NB 3CCTA 3TZZA 2SXLA 2O5DA 4ELUA 3VAIA 4JP8A 3FFIA 3L3CA 4M1KA 2ZM6F 2PN6A 3T9NA 2J6TA 2VKZG 5K20B 2WONA 1ZTWA 1VK3A 3ICLA 2K8GA 1RYRA 1ROFA 3M8RA 2FLOA 4QR1A 3M8PA 5GAHI 2JX2A 3CCQS 2A18A 1JLQB 3KWMA 2OEKA 2BANA 3MMBA 2CJYB 1RCXB 5F8HA 4O4GA 1WI6A 3CC4S 3TJ9A 1FRXA 5J1EA 3DOLB 1PO6A 2P2CB 4DJBA 2HFUA 1TUGB 2YPZA 3NMRA 3M2UA 2OUGA 2CJQA 2KL8A 4RBUA 1UA0A 2M5YA 3THPA 2KN4A 2VPXB 4A8FA 2HPUA 3N01A 4LF2A 1FVSA 1T9TA 2LU2A 1R7IA 4AQYJ 2RJZA 4DPUA 3E51A 3D28A 4YOEA 2YBVA 3SSRA 4PWDB 4K8RA 1CJVA 3PX6A 2G13A 2HFNA 5EWFA 2HK2A 3SFUA 2MZJA 1C1CA 1N0UA 1RWUA 5JXSA 1FRLA 1UTAA 3EVMA 2KH9A 2PMZD 5B0GA 3Q8QB 3CMES 5ETLA 4U6PA 3PW5A 2DH8A 1T9WA 3M1VA 1NH7A 3EJMA 2BRLA 3JAMU 2G4BA 4YS2A 5KFYA 2UVWA 1UETA 1SQGA 1H74A 3DOKA 3U1MA 2CPEA 3VF0B 2HZCA 5D78A 1RTZA 2ZBPA 1VQOS 1VQ7S 3BGFA 2F4VJ 4ZPDA 4DSFA 3HT3A 1UZDA 2CAJA 1XTZA 2XLIA 4C8MA 2IPOB 5IFMA 2E1RA 2VQEF 4YFUA 3UCZP 2N3OA 3AOAA 2BQRA 2DTJA 3MURP 1IVZA 4I4BA 2YX7A 2MY7A 3OLBA 4PXEA 1ICEB 4LF8J 1JXLA 4F2RA 2GQ2A 2EFQA 4IRCA 1VHIA 1X9WA 2CG4A 1UJ6A 4LSZB 1UWBA 4NXNF 3QNWB 2OPRB 4EO6A 2MZQA 2HHHF 4PKDB 5KFIA 2C3MA 3QGGA 2CYYA 3W63A 3CCLS 4DR5J 4UY85 4OMFG 4DPOA 4DQSA 3DYAB 3CCES 2BM0A 1IXKA 3M2VB 5DG7A 3W60A 4B3SF 2W8LA 5D4LA 3KLHA 4HT7A 2WAQD 2IRXA 3NRBA 4OZLA 2OTLS 3BO4A 3R5DA 3HHLC 2XYGB 1T3OA 4LRDA 4OI0A 1JLCA 1IR1A 5T41A 1N34F 2ZHAA 2G0CA 2FLLA 1U26A 2XSJB 1YSJA 1S0NA 2NZCA 4MK8A 5DQHA 2ZVSA 2NSCA 2PO4A 3LF0A 1JK9B 2Z4PA 3OTEA 5HJXA 2X1AA 3JQMA 2HVZA 4J9OA 3K8VA 3GCWP 2P8IA 5LMNJ 4DV7F 4ED6A 4WZQA 3OTBA 4LFBF 1PKUA 1D8ZA 3PRVA 2DISA 4WFBQ 4FF4A 4JI8F 3G8QA 2CJ9A 2FTRA 4UQTA 1S1WB 2AQ4A 2RAQA 3CIMA 3H25A 1Y5IB 4CLZA 2AZ3A 1RHMB 3ZZPA 4KGVB 2VG5A 1X4GA 4FS2A 3ZZYA 4ZP8A 3UD5A 4BC7A 4DV0F 4WE1A 1KBRA 2DNOA 2C2ZB 4EGLA 1RTDA 2B7BB 3T41A 4ED7A 3DGVA 5DDRC 1KVJA 1FD8A 2EPIA 1G3OA 4A8WA 1RYSA 5ETNA 2R3VA 2CZ9A 2DITA 4DR1J 2Z30B 3MTKA 2GW8A 1MN9A 5KG2A 3UN3A 5EDWA 3N79A 1N54B 5EWEA 2XBPA 2WW8A 5I4MA 3KK2A 1ZA1B 4LSNA 1HYSB 2C22A 2HRTA 3S01A 3Q8PB 4F50A 3W1YC 2KRBA 2HNYA 2MGZB 3LALA 2RS2A 3MR2A 2XGQA 4CRJA 3G86A 4U8VA 1MSWD 1RJJA 4ES1A 3JYTA 1TV6B 1GAOA 2C3PA 4LBHA 2D1CA 2ILZA 3RTVA 4GMKA 3DLBA 3VCDA 1NSKL 4LVNP 2LQ5A 4B3MF 3C6UB 3WX8A 4ED4A 2CQBA 3H4BA 3BH6B 1TK0A 1NDLA 4ZVTB 4U95A 2OSQA 2V0NA 1FKPB 3PO4A 3OLAA 1QTNB 3N6LA 4B3RF 4R5PB 2C2KB 1SH0A 5M2RA 1T7PA 3GIRA 3SCJE 1EAYC 4JI0F 2QTWA 3SCKE 4EO8A 3DLLQ 3IP0A 5D15A 5ETSA 2UUCJ 5HMYA 3M8WA 3C16B 4QYRA 4JI1J 4N76A 5U47A 1Z4UA 2FJDB 3OVSA 4IO1A 4WZMA 2ASYA 2N4CA 2XEXA 5C5JA 1YG0A 2EBGA 1WDTA 4ZCIA 1BC6A 1KQGB 4IFYB 4O3SA 3DLEB 4DSIA 2G9OA 3AA9A 4P2FA 3FZBA 1KFDA 4KH0B 4F3MA 5L1LA 3POTB 2PI5A 4A4JA 1A7GE 2JDJA 1SB6A 1CQMA 2HBZB 2DGWA 4JI6J 1I5OB 3HVWA 2FQQB 1JLFB 4I2QA 2EFGA 2MZSA 3I0SA 1SPBP 2MQPA 2B9EA 5F9LA 1BQNA 2Y0SD 3PR4A 4ILMA 2O66A 1HNZJ 1J5OA 3AXKA 1A6LA 2DRAA 5KG5A 2R7TA 1UJ5A 3B82A 4BCAA 2QA4G 1MU2B 4QIGA 4JI5F 4O4RA 3JQJA 1SVDA 2VPYB 1X5SA 3Q86A 3HJVA 2F5GA 1I6JA 3CJQA 3FBFA 3D1QA 2MKYA 5HBMA 4ITSA 1QVFR 2GAGC 1VRTB 5KG6A 3WX4A 3OTDA 2GVDA 4M5LA 4ATNA 3UD3P 4USMA 1VISA 4LIRA 1KQKA 5HMZA 2C2MB 3IRXB 3C2PA 3UPFA 3QT7A 3VAMA 2HHSA 1RI7A 3BDPA 3CD6S 3IGVA 1O51A 2WZ1A 1X4BA 2E5LF 3GMGA 2J8SA 3RG6A 1RWNB 4DF4A 4CO0A 1CVJA 2GHPA 1QLNA 4K59A 5KFEA 1WSRA 2AYEA 4MKAA 3ISND 4RW9B 3HSGA 1RT3B 1SXLA 2GMLA 1OQ6A 2KM8B 4UUWA 3DNCA 2ZH4A 3A8JA 2NCKL 1N36J 4MJKA 2V68A 2CNKB 1VJQA 4R0JA 4ZCLA 2W7OA 4WK3A 4L6V3 3Q0AA 1W2BR 2E9RX 3HVTB 1URRA 3BN7A 5KFCA 5A2QY 2DEIA 4A8XA 2FB0A 2JH3A 3DM2A 4JV5J 2BMBA 1KLNA 1CJUA 2VD3A 2BJ8A 5HO4A 2IM3A 1NB7A 5DM6Q 2DNRA 1FEHA 5ETKA 5KT6A 2HHXA 5K14B 2OAUA 4A8YA 1ZPVA 3CDWA 2QJ3A 4M5MA 4NZ0A 1U48A 2RQCA 2QL9B 2RQKA 4O3NA 1VQKS 3KJQB 2GQCA 2JEIA 2ZBQA 3W5XA 1Y11A 1WC1A 2YQ0A 2XC9A 1RT6A 1VQSA 2OJ3A 2E5JA 3E3XA 1FXDA 2RE1A 5KG4A 2B56A 4DI6A 2V8DA 3T1YF 3B6BA 4F4KA 1N52B 3HJFA 3IM9A 1HBUB 5F41A 2D3ZA 2QX0A 2BUNA 5JJBA 4DX5A 3MAAB 2FVSA 1U1LA 1IN0A 4C9DA 3J80U 1TMJA 1RLCL 3F56A 3MWBA 1FX2A 2VQFF 1KS2A 2DJWA 4HI1A 3UFCX 2B9YA 4Q43A 2YXLA 3X3UA 1RAGB 3GYGA 1AROP 2X3DA 2W24A 3OR2B 4NCGB 3AHPA 1JKHA 2V50A 4Q8FA 1JLEB 1OQ3A 2DNKA 3M05A 1O5JA 5C42A 2QYCA 2G2ZA 4DDFA 2IC3B 3HULA 1LXJA 1W7WA 2ZUGA 5D0EA 2UZAA 3OR1B 1CQNA 3G2XA 3A8EA 1HLWA 4DUZJ 2MQ8A 4H4MB 4KHPJ 2ZJRQ 2IFXA 4YQWA 2I0XA 2MEWA 3IAS9 3BPDA 2C2OB 5CQGA 1FA0A 1JJCB 2LKZA 2B4OA 2CQ2A 2J0QD 3ZC4A 3QGIA 2KVIA 4U9RA 5SUHA 5E3AA 5IC6B 1EJ7L 1NPKA 1AZSB 2MKHA 3RYLA 4R8UA 1XIQA 2PDAA 4EYIB 3T3FA 4WFNQ 3DDKA 1RTJB 1U1KA 3BBFA 4L75A 5A0YB 2HS0A 1RBOB 4P2MA 2GO8A 3E8OA 1BWEA 2NR0A 3AJ2A 2HRYA 1S48A 3GIKA 1AB8A 4WTOB 5IT0A 2C28A 4FBTA 4RPFA 3AD8C 1X5OA 4WKYA 4J5OA 1DTQA 1TKTB 1M5KC 4OHYA 3A3OB 4TKTA 4OYPA 5LM7E 3KLFA 2EG1A 4TY8A 5A8KA 1JJ2R 2FHKA 3HZEA 4X2BA 3KLIA 4YY3J 4KQZA 2BJDA 2Y3YA 4YEAA 1NK7A 1MROB 4GO7X 2ZKTA 4KGMA 4CM0A 1K0VA 2RU9A 4J9KA 1S72S 2QIFA 2R9LA 3GFYA 1UA1A 4NLQA 3M2RB 1APSA 2C1EB 1HIYA 2HWTA 1VRUA 3VZIA 2HQGA 4KR0B 2IA6A 3BEGB 1H73A 4WKRA 5JVHQ 3EGNA 4FF3A 4HH0A 4NMLA 2DB1A 1CEZA 4JYAF 2WVEA 3MAQA 1I51B 4MYUA 5DQIA 3DXSX 3GIIA 5F9NA 3OL8A 5C24A 3W5YA 2HVHA 2NXUA 3UVJB 4GKJJ 3CXCR 1MW7A 4QWCA 2IYGA 4A48A 5E3CA 3PFEA 4OI1A 3RB4A 5KFDA 1RT4A 1B0PA 1S6OA 1XJWB 2QSFA 1Q1KA 2BBEA 3QO9B 3NNHA 4DR4J 2YH0A 1UEKA 4TU7A 2YX1A 3W2VB 3BKTA 3CIZA 5AE3A 3ZTOA 3KNGA 2OPQA 4HLBA 3NMAA 3T5HA 4MKVA 1FNOA 1ZPWX 5ETPA 4ZOSA 4I2PA 1J5EF 1SUQA 3R3TA 3NNCA 5IT9U 1HR0F 2MTLA 1RADB 3W2WB 1FDBA 2D41A 4KGXB 5A6PA 4V19X 1RXOB 2FVRA 2EC0A 1LQ9A 4NLSA 2KB2A 1KLMB 3EE3A 1HMVB 3HXMA 2RU3A 2IHR1 2LVWA 2KG1A 4LF5F 1L3VA 2E5GA 2DCLA 2ZM6J 1BXNA 1SJ1A 2NXEA 3C66A 2ZOGA 3UO0A 3IG1B 3TAMA 1RA7A 1ZAVA 4IDKA 4K4ZA 4OYIA 2XNRA 2ZITA 3O2IA 2W1BA 3PDNA 2C2EA 2YNHA 4FKXA 1H0HB 2H9ZA 3MEDB 3Q8YA 3R6LB 2VBXA 4USTA 3GV8B 1R0CB 5KG0A 2FJXA 2CWKA 3BSOA 5KG3A 4RW8A 1OWXA 3RAMA 2J76E 4XAKA 4YR2A 1CJKA 2PD1A 5G4DA 2V94A 4ZVQB 1QJHA 1X5TA 1WF2A 2MQQA 1LFPA 1WEYA 4BWMA 4NLDA 4LFCJ 4I7FB 1HHTP 1RGVA 1IQTA 3KJVB 5LL6d 1VK8A 1S1XA 1R0AB 4DV3F 4ZHRA 3RUBL 4Y2CA 4P72A 2QG9B 5KFHA 3N6NA 4NA3A 2XULA 4C97A 3P49B 1UPPA 4FF1A 4Z37A 4JI2F 2EC2A 4Z2XA 3CUNA 3HD2A 3LUYA 2EW9A 2FZCB 3JB9k 4MIAA 1PCAA 2CQ1A 1RWMB 1YJ7A 1YDLA 3RBZA 5KFMA 2JJ4D 5HVFA 2MB0B 2Z2MA 3J81j 4ZPAA 2VQEJ 3CCJS 2VFUA 3MF5A 4RX6A 3IM8A 5F8NA 4DV6F 3MM9B 2LQJA 1QE1B 4YR3A 4WCEQ 4DUTA 3OVBA 2R2TA 1FXRA 3AOBA 4E2FB 4OZ1A 3FEXB 1HD0A 2XGPA 4DU8A 3PJXA 4K4XA 2AEFA 4RUBA 2ZVIA 3Q8UA 1YJNS 1F9FA 3QJLA 1L3SA 6FDRA 4JI7F 4GC6A 2HHHJ 1RT5A 2B5JB 1VYAA 2V8VA 4ZMMA 1RBAA 3UW1A 5DG8A 4PQUB 2FJAB 1XNRF 2W2MP 5D3GA 1UVJA 3QIPA 5KOWA 1D3WA 1YBUA 2F3JA 1NK8A 4Y2AA 5L46A 1S10A 4GC7A 4QWEA 4PXDA 4B3SJ 3TJ8A 1FKOA 2K1RB 4QZVB 4IRDA 4DEZA 3FMWA 3L7OA 3CTRA 3QT5A 3I5CA 2QLJB 4QJVA 4C8ZA 5HP1B 1WTBA 2VH7A 1N34J 4UZBA 2B8PA 5J1PA 1EETB 2CIMA 4DPXA 3RBDA 4DG1A 3UDLA 4B9MA 4PPDA 1VI7A 3HFZB 4XDDA 2MKSA 4PAAA 5B0AA 2DNNA 1B7FA 4YN3B 2FLPA 2WOMB 2CPIA 4DV7J 4URGA 3H59A 1VQ6S 2EVZA 5HL7Q 4LFBJ 1YZ6A 4WU2A 2HHVA 4JI8J 1Q53A 2KJVA 3MOZA 2ILYA 4LR9A 3MR5A 2Y1IA 4CO2A 1JLBB 4F02A 1RTHA 2F8MA 2BEFA 1KHWA 1EARA 5EUHA 1HNXF 4Q2MA 3TRGA 4DV0J 3DLGB 5FLXY 3D7SB 2YY3A 3ONQA 3GV5B 3RJMB 2ZH6A 3H5YA 2H48B 2UV8G 1R8CA 3A3NB 4LUBA 2BQ3A 3MOJB 5E3QA 1KR4A 2AP6A 1DY3A 2QC3A 1FD2A 3P3DA 4HYKA 1QAJA 5HQ8A 1HWKA 4QWBA 3P96A 1T05A 3PX4A 1X4CA 4KV8B 2FGCA 2OGUA 4DFJA 3KJFB 1S59A 3CDBA 2HBRB 2OEJA 2CXEA 2EFVA 5C2GA 3MPDA 1LV5A 3BB5A 4ID5A 4DR2F 2HGMA 3G96A 1XR6A 4CDIA 3IBFB 1Z1ZA 1LK7A 4FF2A 4UW2A 3TVKA 2VUGA 1VC0A 5B0CA 3MFHA 1S79A 3HFKA 1NKBA 1NK6A 1RLDA 2BW2A 1TL1A 1YJ9S 2WTFA 1U47A 5GVQA 2QL5B 4KC5A 2A2CA 5DO2A 1HWUA 1O6XA 2XMVA 2JC1A 4B3RJ 5IV3A 2RDIA 3V5RA 5MAOA 3AFGA 3UN5A 3PJ9A 1SL1A 1RAHB 1RHQB 3CJ3A 2AIRB 4K4UA 3NL0A 3ENAA 2W9BA 2R7RA 5EX3A 4ETZA 3LW5C 1CULA 3DC2A 2HMIB 4EBDA 2RF2B 4QU7A 3DN9A 3ZNUA 4JOUA 1REVA 4TQRA 2CQCA 3V81B 3D0IE 1QM9A 4OQJA 1VR6A 1HW8A 3BQ2A 1GMVA 4Y2MA 2ZWPA 1U45A 2I5JA 3LTOA 5KOXA 2W9CA 2QLXA 4CNYA 1UVNA 4TLQA 2VA3A 2YKNB 1EZZB 2HK3A 2XHWA 4ZVEA 2DT9A 5KT5A 3T9ZA 1NUEA 1R27B 4EBCA 1JLGA 2AT1B 2ZKUA 4DR6F 4J9RA 3EPIA 5E3RA 3GYXB 4B3TF 3IA0A 5GAGU 4P10A 2V8HA 1E6VB 1ZM4A 4ZP6A 2BXJA 2VG6B 2P5VA 2KZZA 3QFWA 1VQYA 3W62A 3QGPA 2EKYA 3HHLA 4X84A 4G65A 4RW7B 3KDNA 3KG0A 3K5PA 2IA0A 5DETA 4QIVA 2YWKA 3B78A 2ZH1A 1JLAA 2QL7B 1XC9A 3GJQB 3GWCA 3OFFA 4JI5J 1C0TB 3CC2S 5HK4A 4RW4A 3EZUA 4RL1A 2CJXB 5CYMA 4Y3CA 2MLXA 4QW8A 1U6ZA 3QWUA 2XCPA 4B02A 2YNFA 4DS4A 1FRJA 2Z2YB 1T94A 4ELVA 3CO9A 4WU3A 3BM7A 1KWMA 3BQ0A 1ZH5A 3C14B 1PYTA 2OELA 1S49A 3DMJA 3V4IB 3G82A 2W2QP 3KHGA 2MQLA 3ET6B 3MXHP 2FVPA 2AHOB 1G4CA 1U4BA 5T7LB 5GAEU 4C8OA 3GR1A 3SYZA 1D9DA 2V6AA 4FDFA 4UOFA 3MZIA 3UCUP 1H2VZ 5B0FA 1WSVA 1UL3A 2E5LJ 4NEZA 4TN2A 2MZ1A 3BR9A 1ZAXA 2E9TA 5H1SV 3HP6A 1WHXA 3QBCA 3IWNC 3CJSA 2WSCC 4DMZA 5F8JA 1S1TA 5CD4H 1T03A 3JSYA 2R7OA 3H90A 2F8EX 2CADA 1X4FA 3VQTA 1HPZB 1MWZA 2ZBRA 1WC5A 5EGYA 3TANA 3R27A 3D3BJ 3VQSA 3NXZA 2MLZA 5K8NA 1SC1B 3DRRA 1KFSA 3BS9A 2YKMA 4EWTA 1U1OA 4NLUA 3MPYA 3I0RB 4DL0C 2PC6A 4CI0B 3HKWA 5J2NA 3MEEB 3KLEB 4NLPA 1FTCA 4ES3A 2FJWA 5ETRA 2LYVA 1IKXB 1BQMB 5HATA 4MIWA 5IS2A 3M8ZA 4DN0A 4ZVPB 2V69A 3VAFA 2CPXA 3MR3A 2RSQA 5G0RB 1KC8T 3GJRB 3J7YI 2M9KA 1YQHA 1R8HA 3LP0A 5D77A 2WRMA 2Z57B 2RDJA 1LXNA 1CSJA 1BD6A 3AB2B 1U25A 3MM8B 2DNQA 2IRUA 4NA1A 4PXCA 3GILA 4ECYA 4P7TA 3HHDA 3SDEB 4WP3A 2AYMA 1KOHA 3IWXA 4K4VA 4MYTA 1IKVA 5I3QA 2IVYA 2AGQA 4J37A 4LRFA 2AWZA 1SH2A 4OX9F 3KYLA 4IR9A 4ELTA 1P6TA 3TZWA 3T1YJ 2XMAA 4F8RA 3CGIA 4X4OA 4DZ6A 3ENQA 1MN7A 4ZVHA 1NKCA 4RBTA 5H9EJ 2AJ0A 1BHNA 4NMXA 1WD6A 5D4PA 2BJ3A 3BF4A 3RGIA 5H9EK 4EUVA 2YKPA 3US5A 2D3O1 3VWSA 4B9VA 3D4JA 2VQFJ 4JI4F 1SC6A 5CAAA 2V4JA 4NLOA 2RDDA 2F8HA 3LPEA 1DLOA 1HI0P 1HNIB 2VC1A 5CA5A 3BGUA 3LQVA 3MMAB 1SV5B 1EKSA 3FRZA 2BVZA 3C46A 1Q16B 3FK4A 4D3HA 2BKOA 3FRYA 1KQFB 3FFIB 2L9WA 3HK2A 3T5KA 4MFBB 2CPDA 1LW2A 3GONA 4DCJB 2WONB 3TVZA 1HQEB 1VRQC 4P2XA 1HWLA 4TLRA 2OPRA 4I0WA 2HNZB 2IDEA 4LF7J 4HHUA 2VOOA 1RHUB 1HQUA 2BANB 3MMBB 4O3RA 4O4GB 2MHEA 5J1EB 3D1OA 4P74A 3DYAA 4X62F 2V34A 3VR1A 2JEGA 4R0EA 4CH7A 1Q81T 4NE9C 1W26A 4U7UD 3M2UB 2GAHC 5KFKA 3KLGA 1OMSA 1LKZA 3MEKA 1EB0A 1X5PA 2DR7A 3QZ7A 3OHBA 3UDVA 2VASA 2W7AA 2X1GA 2KI2A 2ADCA 2YQ1A 2JVOA 1D0EA 2W2PP 3LPYA 1CJVB 2IMOA 5A6WA 2B4PA 3FDSA 1PGZA 4PPZA 4UOGA 2C2RA 3K58A 2GS8A 2HZAA 3BBCA 3G8SA 1CS4A 3F73A 4A46A 1H38A 4IYQA 3M1VB 3G8TA 2GMHA 1S6QA 3C8YA 3NS6A 3CCMS 3TAQA 3DOKB 5D6GA 4WTYA 3QATA 3PNIA 1WF1A 1R43A 2B6AA 3D0HE 4H4OB 2JFKA 4WXWA 3AB4B 3M4XA 4F26A 3B4MA 2NQPA 1FCAA 3D9BA 4QU6A 1KHVA 4KBIA 4S0MA 3AODA 2XO6A 1FK9A 4JYAJ 4LBPA 4HACB 4KJIA 3ZO7A 1F0XA 1UFWA 2BDPA 3NG8A 5LT5A 1NZAA 1PBUA 2I1RA 5C2CA 3NP5A 4ECVA 1HYSA 2HHPA 2HG4A 3TYTA 2ERRA 3KHRA 1UJ4A 3GTYX 1RAOA 4EZ6A 1R6YA 3VZHA 5EWGA 5JVGQ 5J2QB 1V3SA 5D0HA 1TV6A 4M5GA 2MLYA 5DZ7A 4DX7A 4ED5A 3AOCA 3KLHB 4ZVOB 5LOQA 1HWJA 4ECTA 3WC0A 2J9DA 3HT0A 1JLCB 3C6UA 3IBCB 2RS8A 2DHGA 4NCAA 2QRRA 1FKPA 2M4MA 2KKHA 5AXNA 4QOTA 3QYYA 1H7XA 3QWPA 2BX6A 3IS9B 2WK4A 1HR0J 2AKWB 4N8OA 3BO3A 4G3IA 3IXQA 3OHAA 1WG1A 2OPSB 3EGZA 4KRWA 5T14A 1RABB 2VG7B 4RBVA 2F9DA 2XZTB 4BWJA 2MPUA 2CQGA 3CJ8A 4GKKF 4I1TA 1NCLA 3BR8A 4NLYA 2HBYB 4ANDA 4M5DA 1HBNA 4LF5J 1XR5A 5KFVA 3E01A 1ZS6A 3FSIA 3IAM9 4ZA1A 1P1TA 1VIXA 2VG5B 4URSA 5K8OA 2FDNA 3POTA 5GADU 1GXUA 3VVTA 3N0VA 3VHQA 2ZNYA 2R8GA 1T8EA 3EXYA 5ETTA 3ZZUA 4QYZJ 4FXVA 3EWGA 4F4AA 2A2DA 1RTDB 3V4MA 2UUTA 1NJYA 4C8LA 4JB8B 2VHGA 4Q2LA 4ECRA 3DRYA 2NXCA 1OY9A 3TZXA 2LXUA 3DRSA 5LMUF 3T19A 3A8IA 3H5UA 2B0GA 3KUEA 3OD2A 3MI7X 3CD7A 1JNZB 4DV2F 3I5AA 1T3NA 2OPPB 1MU2A 3NGTA 1C4AA 1IJEB 4X64F 2ALYB 1PBAA 4QW9A 4B17A 1ZYQA 4DSJA 1RB0A 1YLXA 2HNYB 2EFPA 2QA4S 3ZZOA 2HLUA 3TZYA 3HHNB 3ISZA 2HQCA 4DV3J 5HAOA 3JYTB 2KG0A 1N8RT 1ZZNA 3ZXWA 1WHVA 4YB7A 1R8AA 3T1HF 3IR5B 5KT7A 2Q1LA 4JI2J 3IRXA 3OT9A 3CJ0A 1QD1A 2I2YA 4N77A 2XS2A 1OY6A 1T0TV 3CE8A 2PSZA 2GQQA 5HLFA 3ZZ0A 3TWZA 3QSIA 3UN2A 2P6TA 4J90A 3J7A1 4LREA 2Z58B 4DV1F 4MMOA 2N7CA 3MMCB 4DV6J 2ZD1A 4R25A 4B9NA 2FPHX 3CJRA 1CPZA 4ZVFA 1RT3A 2OIHA 1KDNA 2LQBA 3LA0A 4L72B 1BWVA 1UWAA 4P7VA 4ZLJA 2JSXA 1IKWA 2G0IA 2Q3PA 1JNRB 1RTIA 3R9LA 4TY9A 1T9XA 2ZH3A 2V9WA 1XWLA 2LEPA 2I6WA 2K3KA 1VLOA 2XZDB 2OMOA 4RNFA 1Q0NA 4F3OA 4JV1A 3PACA 3PR5B 2WVDA 3HVTA 4JI7J 1VDHA 5ETOA 3DDNA 3LP1A 2JVRA 2DPIA 3CB4A 2BW7A 1XNRJ 2E66A 2Q6BA 1NRKA 2FC8A 2CQIA 4RZRA 2VKRA 4YHHJ 3A13A 4KB7A 3D3CJ 3Q8RB 1UEVA 3BH7B 3OSPA 2VJUA 2DGOA 4ZS6A 3ITHA 3WIUA 2C3UA 1J5OB 4QPTA 2Y1LB 2DR5A 2ZC3A 3M8SA 1KTQA 1LW0B 2DGXA 3NAHA 3UQSA 4PG4A 5KFWA 2AGOA 4CIOA 1Q95G 3LGNA 2BR0A 4RW6A 3DI6A 3VGSA 4BHQA 5FD1A 4J9VA 4NXMF 3W9JA 3M9NB 3ETOA 2OHDA 4CTAA 2GVDB 2GNKA 3H42A 2HBQB 2CJAA 2PEBA 1QAIA 2KYXA 3BBBA 2OD6A 2A6OA 3EICA 5AXLA 3MAHA 1JQGA 3GFZA 4P73A 1H98A 4NEYA 3UDEA 3RAXA 3FEZA 2BABA 2BQUA 1TKXA 3MAAA 1HNXJ 4HR2A 4DR7F 4AXIA 1SJ3P 1FWPA 1WG5A 4AD6A 3CJ5A 2IMWP 4AT1B 3MPWA 3EGWB 1RT2B 4MKBA 4F7VA 4UTGA 1OJ4A 3O44A 1NKEA 1MMLA 1IBMF 2AMCB 1ZM9A 1LWXA 3LWLA 3F44A 1PILA 1N5VA 4ZN1A 3TX8A 4PR6A 1U49A 2UXCF 2W7PA 2ZH9A 1IWAA 1HL6A 3M8QB 4DPWA 4YB5A 1HWIA 3GZ7A 5F0WA 4ID8A 2V8PA 4B9TA 2Z8QA 3DM2B 3M30A 1G6BA 1VQMS 2MHNA 3X1LB 1CJUB 4DR2J 2HQFA 4CH1A 1YJWS 3N9UC 3QQCD 4M5IA 1V6HA 3PEHA 1TL3A 4DFMA 2HW3A 2HQ3A 3LWMA 1S12A 4USIA 1M1GA 1YJRA 3EYZA 3I9ZA 2ZJQQ 3MCOA 1N33F 4OYXA 4J9LA 2KU7A 3QIDA 4OYZA 4NI2B 2QMXA 1HKAA 2PE8A 1RT6B 2E7WA 1LWEB 1U1QA 4LRAA 2CDRB 4AQYF 1YKWA 5A0YA 4DL2A 4U96A 1H72C 5L39A 1FO1A 2FIUA 3DKDA 4OZNA 2LXIA 2NPIA 4PRFA 3JTNA 1D9AA 1TFYA 4KH1B 4C0OC 2KFZA 4BBYA 3WIVA 1UFKA 5A8WB 4DXLA 1XMQF 3T6BA 3QLHA 4AL7A 5EHHA 1TTHB 4X65F 2DGTA 2BJ7A 5K9FA 4DR6J 2AV5A 3I82A 2F65A 4J9PA 1S0OA 4NRTA 4B3TJ 2F7VA 1M5SA 1SKUB 2KHDA 1KRPA 5BXIA 2LXFA 2E1PA 3PW4A 2R7UA 4OJ3A 1RWXB 4DL7A 2MKIA 3KUHA 2D9OA 3M2RA 3DGPA 4N7TA 4OYWA 2JZ5A 1FDNA 4K4YA 1RHKB 3OFHA 4NPOA 3O1LA 2BA9A 2J7KA 3I87A 1PAUB 4OHVA 5C42B 4DQRA 5IQ6A 3A3PB 5F8IA 2COLA 3CW2C 3TR5A 2KJWA 3BGLA 2FHMA 3D5MA 4O44B 1FXLA 4L3NA 1SL2A 3CCZA 3RU0A 1S6PB 3UDCA 5F3ZA 1WF0A 3UVJA 3VGUA 3GCXP 2A0FB 3NCPA 3TOQA 1RU1A 1EKRA 1NMEB 2XYPB 3M8YA 1WG4A 1XMOF 1GXLA 2OTJS 2J7WA 4Y2KA 5E41A 3K8WA 1NJZA 3QRQA 1YX2A 2HWHA 2E9ZA 2NUHA 3M7VA 1FFWB 4IG0A 4KGKA 1FTRA 1NDCA 1S9GB 2HGNA 4ANEA 4Q5VA 1VQ5S 5AT1B 2R8JA 1U2RA 4AUKA 1UCNA 2ZH7A 2XS7A 4ZJQA 3PRDA 5IOLA 5I42A 5DDOC 1YI2S 3W2WA 2ZJPQ 3QRRA 1B0VA 2OI2A 2HURA 3MM5B 1UKUA 2HSEB 5HVHA 3SFGA 3KLFB 1RBLA 2HIYA 4TY8B 5HI7A 4C8NA 5A8KB 4BS2A 2ZOMA 1FRMA 1N5TA 2FJEB 2OEMA 4FPRA 3KLIB 4OZ0A 4DLEA 1FI4A 3IR7B 4HT5A 5CD4A 3WDOA 2RIJA 1TMMA 3C15A 3V6DA 1NJIT 1WC4A 4ZVUB 3HKZD 4A8QA 1TAQA 1NXIA 1SJFA 4WFXA 2Q79A 3PHTA 1HFEL 4CLSA 4F2SA 1VRUB 1FERA 1RT1A 3N4WA 3DLJA 1FVQA 4GO5X 3OQ2A 5FDLA 3PO5A 1BUXA 2JLFA 1K0TA 3HCXA 5RUBA 3QMQA 1NO8A 5IXUA 3AA8A 4EEYA 1KVIA 4GVLA 2P9GA 2BE2A 5ETVA 3DLKA 3H40A 4RNOA 2YNIB 4P9SA 2DRDA 1PYOB 3N5BA 4YR0A 1DQ8A 2W8KA 2UP1A 3DRPA 5C24B 1HNWF 3DXBA 3LAMA 4YB1P 2V2KA 4OX9J 3OBIA 1DTTA 3PX0A 1RT4B 2M7SA 4P71A 4CP5A 2R7VA 4EZ9A 5B7WA 1TK8A 2ZHOA 4RU9A 4QIWD 3RR8A 5EX0A 2QN6B 3I4PA 3TUZC 1GXTA 3D0GE 1T9VA 2QV6A 1WC3A 4CT8A 4FBUA 1Y7PA 2H5JB 4DCOB 2ZOFA 2PMHA 2R4FA 1UVMA 5BYSA 5LJ3Y 1YBAA 1UVLA 2OD4A 2OPQB 3LO3A 5DGBA 2AYGA 1EHWA 1K47A 3UCGA 3OFGA 4YUDA 2HZVA 4I2PB 1GEHA 4OLOA 1SUQB 1VQ9S 2AX1A 3P6YC 4ZLPA 2VF3A 4TQSA 2EWHA 1I94J 1Q8IA 3SQGA 3F0NA 2ZDPA 4DL6A 4JI1F 3Q89A 1T11A 4YDXA 3VGVA 2BKNA 2VONA 1IJFB 4PYAA 2QEXS 1AFJA 1IKYA 1LWFA 2GO9A 3J80Y 2XM3A 4CLLA 4QR2A 1SIZA 3FQKA 4ZLNA 2NSBA 1TVRA 1FX4A 2HVEA 3TAMB 2IYIA 1QVGR 3TA2A 1VCTA 1UPMB 5H9FK 3TJAA 4PQUA 2CNLB 2VBWA 5KFAA 4F4YA 5KFOA 1Q8LA 1EQMA 2AZ1A 4FVMA 2K1RA 4M63A 1P9YA 3EVWA 3V6KA 1CJKB 3ZTPA 3BSNA 1U6FA 2CA9A 4DSKA 3G6VA 5J1NA 4PCQA 2B4VA 2DNHA 3AJDA 3NWGA 2D7SA 1KKHA 2Z2ZA 3IO1A 3I31A 1X4AA 4DX8H 5ETQA 3SXLA 5L9XA 1S1XB 2RT3A 1H3DA 3B8HA 4QWDA 2CQHA 3L7PA 1NB2A 5DDPC 2JRSA 4X4UA 4QQBA 5B0EA 2WVCA 4W4MA 1JLBA 2HS3A 1FNXH 1PSDA 2KDOA 4NLVA 2H51B 3OJSA 4B9SA 1V3RA 2EG2A 1LWCA 2XSFA 4ZLLA 2P6SA 2E7XA 1VQ8S 2V63A 4C11A 5DQGA 1HHSA 2KRRA 1U8WA 1Q82T 5L1IA 3LAKA 1N36F 2V8GA 3TA1A 5B08A 3H7HB 3HLUA 1LFWA 3BQ1A 3TUIC 3VAJA 1YJUA 2HEKA 4Q0BB 4DV4F 4U7UK 5BYRA 3HSJA 1L3TA 4ERDA 3I96A 1RT5B 2IBOA 3PRBA 2Z0GA 5HMWA 3FC9A 4AL5A 3WHIA 2MKKA 4JV5F 3WQPA 3QIPB 1RU2A 1W25A 4M95A 3RRHA 1FE4A 1VQLS 2AYBA 4ZIWA 1FKOB 2HAIA 4ECQA 5M2UA 3M9MB 1OPIA 3ZTRA 4Y0FA 1NDKA 2RHSB 3NGRA 2CFXA 2XQCA 3W8GA 1REGX 2WB4A 2MDAA 1S0MA 1R3NA 1RHJB 4C8YA 3HSDA 2DXDA 2DKOB 4DSEA 4DG1B 3TARA 3PFOA 1CJTA 2XNQA 4LFAF 2KXHA 4XIUA 4F4ZA 4QCLA 3AJ1A 3KHLA 2XMMA 2ZH8A 3H2UB 1WEZA 4NYPA 4OYOA 1B64A 3D2WA 2ASLA 3J81U 3JSRA 1TKDA 2OH2A 1M5OC 2PA3A 5EN1A 4ECSA 4E98A 4OI3A 3MPUB 5KFLA 1Y9OA 4Q44A 3SSQA 4M94A 4TU8A 3K5MA 3Q83A 1WELA 2JHEA 2YKNA 3UD4P 5IV4A 1F5CA 5IT9Y 4ZITA 3R97A 1WKKA 3ZNJ1 1VC5A 2CJBA 3PJWA 2LA6A 1OYEA 6FD1A 3HDSA 4MT1A 2LU1A 2H3EB 4OHXA 3THVA 2VG6A 4PUOA 4I69A 2YWEA 2VV5A 1YRUA 3HI9A 1NM2A 1FESA 2VICA 1U0HA 4P52A 5LMUJ 1U09A 2V2QA 1IM4A 2HIQA 1JJHA 3BSAA 4CLUA 1DARA 2KT2A 4RNHA 2NUUG 4IOBA 4RU2A 1TUVA 1C0TA 2ZC4A 1A9NB 4X64J 3C3LA 3OPKA 3CF5Q 2XHCA 3P5TL 3MUVP 4Q7AA 2ZE2B 5K5MA 3PCOB 4ID5B 2PIIA 3FJ2A 8RUCA 4A8KA 4KHPF 4LSLA 3H20A 2R7QA 1EX8A 1YHQS 2DIUA 3C14A 1HBOA 4W90B 1HA1A 2QZ8A 1TL1B 3T1HJ 3RB0A 2DEJA 1NHKL 1R8BA 1RWPB 1BLUA 4DF8A 2BKPA 5AJ3F 5T7LA 5JUMA 1VBXA 1KSPA 5ETMA 3GJSB 2QLBB 3UR0A 1X31C 1NBEB 3SBMA 1NPRA 3D54A 3MD1A 4EMDA 2UXBF 3KK3B 4XO0A 2KHCA 5I3UA 1RWKB 3K17A 3ZTQA 3G9CA 3PW7A 4D3GA 4G1PA 4B9LA 4N5SA 2WVBA 5IM0A 1CULB 2IJNA 4LVOP 1WWHA 2N3LA 4PG8A 4ANCA 3HVRA 3GB0A 1XN9A 1W2IA 1REVB 4DLGA 2K3IA 5CYJA 2L9DA 1VMBA 2VBYA 4Y2IA 1SL0A 1K1SA 1OY8A 4GRSA 3CJTA 4FPIA 4ZPCA 2QMWA 4HHJA 1GT8A 3S1TA 3IBWA 3U02A 5LSLA 4JI3F 2DGVA 1UP1A 1JLGB 4YY3F 2NXNA 2A6MA 1Q8BA 2I38A 2BOPA 3OVAA 2JLGA 2J0WA 4URQU 2M70A 4Q8EA 1U1NA 4RWWA 1S57A 1IBCB 4NLRA 2UVUA 1C0UA 3HHLB 2DCUB 2Y8WA 2LLZA 2VJVA 5G0RA 2HKEA 2X7IA 3G6XA 3OXLA 1Y10A 3LH2S 3PIOQ 1R89A 3K7RA 3MM8A 3P5BP 3NLCA 3GSIA 5CYMB 3M9OB 3NGDA 5GMKa 4J9NA 2AEJA 4OFZA 4PG7A 2ATLA 3OUYA 2QSWA 2YNFB 2HFVA 5J2PA 5LXYA 2UUAF 2IAJA 2MJNA 1GNKA 3IWLA 4NXMJ 2J9EA 3DMJB 3SV4A 1AXQA 3G82B 1M5VC 4FN5A 4USVA 1F9EB 2FVQA 4KFBA 4DV5F 4X4PA 3ILIA 1M1KT 3TUJC 2WBRA 1ACMB 2AJ4A 4DOZA 3R7BB 4G6VB 4USJC 1DBDA 2XG8A 2LEBA 3G4SS 3BYPA 1C1BA 5B0BA 3GV7B 1NPPA 4OV1A 3TO8A 5F3TA 3BZQA 1S1TB 2KM8C 2DR8A 3MTJA 3NBPB 3RAQA 2DBBA 3HMJG 3EMTA 5GAGI 2V4QA 3H2LA 2HVIA 1IBMJ 2M2BA 5KFSA 2CQ4A 3D6FB 3FBCA 3PV8A 1XEZA 2YKMB 3Q22A 2DGUA 2FY1A 1HNIA 2UXCJ 4ZPWR 4HI2A 1I1GA 1K9MT 2FYXA 4OYAA 5I3PA 2IIHA 2J6SA 4J9QA 2CQ0A 3CMQA 4MFBA 3MDFA 2LECA 2ZH5A 3CO0P 8ATCB 1HQEA 2F9JA 3DOMB 3UNGC 1TQLA 2HNZA 2RMLA 2GJIA 5KFFA 2V2ZA 2H5IB 4IQXA 3LP0B 4WPAA 3HPOA 3RB6A 1N33J 4G1QB 2KXFA 1RSCA 2HYIB 5GAEI 3FCWA 5C25A 3PW2A 3HHEA 2DO4A 2R8IA 4LF6F 3AY0A 2VIHA 3LP2A 2ADBA 2ZHBA 1IWGA 2V5HG 2WVFA 4PWUA 1IKVB 2EI5A 2XMTA 2O01C 1RUSA 4USHA 1ZOTA 2XY5A 3G71S 1L3KA 3G6ES 3MCNA 1RAIB 3L09A 2GMJA 3J7ZT 1V5VA 4LFCF 2JEFA 1PC5A 2RKIA 2HNDA 1T02A 2VPZB 1S9EA 3CJKB 2FUG9 5F8GA 2CPYA 2G1HA 1S6UA 4OYMA 1XMQJ 2ZEJA 3N6MA 5KTQA 2MY8A 2R2RA 4X65J 1Y3JA 2RRNA 1TL7A 3RR7A 4B9UA 4ALZA 2G2YA 4N47A 4BDPA 3R5AA 3KMQA 2VA2A 5CYQA 5DGAA 5BR8F 3VVUA 2V4JB 2BV3A 3A1YG 2CPJA 4G1IA 1DLOB 1R0BG 3Q8VA 3DHWC 1HI8A 9ATCB 2JLEA 4H4OA 2DHHA 2H4WB 1U7LA 3VAKA 1FWLA 1DRZA 1Y0HA 3DHXA 4UT4A 4HACA 4LR7A 1FJGF 1LW2B 4P75A 4RKUC 3MM6B 4FP9A 1HQUB 2KT5A 5CH7B 4PXBA 3S6EA 4OI6A 1FHTA 1SC4B 2KZMA 1S7HA 1IR0A 1PJ7A 1U1RA 2EBEA 1N5SA 1XMOJ 1NHUA 5HROA 3M32A 5J2QA 1GK8A 3KLGB 4DZDA 3ADAC 1X9MA 2YWWA 2VZ9A 2ZFHA 1V3ZA 1S1VB 1RKIA 4ECWA 4UOHA 2ZBCA 2PT0A 4NLXA 2DNYA 4OI4A 5F0UA 4Y00A 4KHMA 2GHVC 1VBYA 3U1LA 4BLGA 1Q4RA 4USKA 4NXNJ 3EDQB 3IMQJ 3IS9A 3W5ZA 3I9V9 2IVFB 2QA2A 5L1KA 2OPSA 1RE1B 1MLAA 2IY5B 3VAGA 2AJ1A 2VG7A 3V2UC 4WWSA 3K5LA 3K5NA 2NREA 1CS4B 4UF4A 1T9YA 3R1LA 3PKMA 1RHRB 3Q8SB 2DGQA 2GGPA 1S6QB 2J6UA 1Q7LB 3H5XA 1JX4A 1RT7A 3BKUA 3BKFA 4X4RA 1IBKF 3W7BA 2UXDF 1FJEB 5E3PA 2FLNA 1N6QA 4LT6A 2NS1B 2G0JA 2NZ4A 1UFLA 1F5AA 1JIHA 3MM7B 2B6AB 3VALA 2DIVA 3LANA 2RILA 3ZZZA 2WB1D 1F2GA 4H4KC 3FMBA 2IJFA 2V2VA 4OHWA 4MAKA 2ZZMA 2XY7A 2J0XA 1FK9B 3MECB 2MYFA 1KP6A 1Y5LB 2E5IA 1GX5A 4WK1A 3SZ2A 3GYNA 3OL6A 1HNWJ 3FKBA 5A8RA 4DFKA 4ZKAA 2OPPA 2GVZB 2CVEA 1S5ZA 3K2YA 4DQPA 2MJUA 3ELHA 1KNZA 1E6YB 3GR0A 2XCAA 4UY8T 1NHVA 2L08A 5HVGA 5JMNA 3CCUS 2R7SA 3TNVA 2AD9A 5J2MB 3SIPB 2APOA 2BRKA 2B8QA 4DL5A 3EPGA 2PMWA 4L73A 2XTJP 3NCQA 3A4TA 4KO0B 2ZUAA 8AT1B 3OL7A 2KFNA 1XQIA 2VPWB 1HNVA 2MKCA 4ECUA 3H5SA 1PJ6A 1JXEA 1NK4A 5CXTA 1QAXA 4I6YA 3O8WA 4FNIA 1B0TA 4OX8A 2R8KA 4IOAQ 3MMCA 4QIEA 4WYLA 4KHRA 3OXGA 4HDHA 2MSTA 1F60B 3CCRS 1VJWA 4J9MA 3JSMB 2VFTA 4M5DB 4ZCMA 1HBNB 4RR5A 4IFVB 3TX0A 1TP7A 3E01B 2B7CB 5KAKA 4B3MJ 1G1XA 5E33A 1QSLA 1RWOB 3MEGA 4XPCA 1IBLF 4ICLA 2G2OA 2W4PA 4JI0J 2YNGA 4OZJA 4FS1A 1AA1B 1DQ9A 1TFWA 1UVIA 2CNNB 1KD1T 4XPEA 5L8RC 1WI8A 1PJ5A 1NZ8A 2XMUA 4ZP9A 3KMSA 3DRSB 3T6JA 5KT2A 2DY1A 4USUA 1KEKA 4RJVA 2ZNZA 3ENWA 1L5UA 1XMBA 4C0BA 1LW0A 2UU9F 2GX8A 1WUUA 2H5EA 3TP2A 1RQ0A 2HQIA 2P9EA 3MD3A 2ZBIA 1N5QA 3GG1A 2VDIA 3UE2A 3EUNA 2E7VA 1EP4B 4J7CA 4X4NA 3GIJA 3BGRA 2ACYA 4E8UA 1N5YB 4FZVA 4HHHA 4CLWA 5IWAF 4U8YA 4CYUA 1UZHA 3EZOA 4C6AA 4A8MP 1VS3A 4DS5A 2E1AA 4WIIA 3QT6A 4NLGA 1TKZA 3PHEA 3I55S 2LMIA 1G2EA 4CO3A 4XK8C 4FYWB 3GFHA 2H54B 2F63A 2XMWA 4F4XA 1P27B 5HLFB 2LQ9A 4UOCA 4E0DA 4FYVB 4AYBD 2OO4A 1XBWA 2V9KA 5GADI 2E29A 2ZD1B 2K06A 1RT2A 2FJBB 2DXFA 5GAHU 3KXDA 5LSRA 3C6TA 4IH5A 2W4CA 2DHSA 5B09A 2IM1A 3OFEA 2O3DA 2ZDOA 3HVAA 3CT9A 1ZZFA 1IKWB 1EQ0A 1RTIB 3LOUA 1SBRA 3AD9C 2HHTA 3NEKA 5K8MA 2DY9A 4GVBA 4DV4J 2RHQB 4NWBA 5LJ5Y 4B3OB 1FJ7A 2QO3A 3H0PA 3M8QA 1HBMA 1FRKA 1FF2A 3JS9A 5KFNA 4X66F 3LP1B 1FRHA 2QT7A 3GLJA 4IUFA 1LEOA 1RAFB 3ILJA 1MMNA 1MMDA 4JBCA 1N0VC 1OIAA 1ZTTA 3ENVA 1NSQA 2XWYA 2B4UA 2R2UA 4HEA9 3FSXA 3ITHB 3QFHA 4ILRA 3MUMP 4PG6A 1TU0B 3QJJA 3QAUA 1WC0A 2CJKA 4L74A 4CT9A 3R1HA 1FJCA 2YVSA 3H8YA 2QMUB 4I64A 1QUVA 4NI2A 2KYZA 4LFAJ 4RW6B 3DI6B 1D8YA 4DR3F 2N7YA 4LR8A 4IG3B 1G7CB 3HM9A 2QE5A 1LWEA 4CTAB 2XS5A 5E0OA 1TUWA 3CC7S 3U27A 4QBUA 3LGHA 2RUSA 4IH7A 1N88A 4O23A 5K8PA 1JLQA 2B9XA 5LXRA 3DOLA 5A8WA 1TKXB 1RKJA 3KDOA 4Y65A 2LFVA 2X51A 2RQ4A 1CLFA 4X4TA 2J0SD 1WACA 2DK2A 2CPZA 1TZ0A 3QJPA 3SSSA 3TW0A 1SC3B 1LK5A 5KT3A 2OFGX 1AUDA 1B70B 4PWDA 5E7OB 3R5BA 3KG1A 1JJ4A 4MIBA 3LGMA 4Z7YA 4PG5A 1SH3A 5IC4B 4KY3A 4Q45A 1MWYA 4ETXA 5L38A 4K4TA 4O3OA 2RRAA 3M30B 1WJ9A 4O44A 2CZVC 3TQEA 3KUGA 1M0SA 2KO1A 1QSYA 1S6PA 1YWXA 1RWVB 4O0NA 1K44A 1TL3B 4A8OA 4LF7F 5KFBA 7FD1A 1URNA 4P6QA 5KFRA 2RNEA 2O67A 1X7VA 4C48A 4LBIA 1YJTA 2J5AA 5AJ3J 4ZP7A 4B08A 3MPVA 1S1UB 1A0OB 1FWKA 3PVXA 1SKSA 3VAHA 3FSYA 3KK1B 4KKOB 2UXBJ 1DURA 2PGCA 2BJ1A 4MH8A 3IC1A 1S9GA 3N5FA 3L7UA 4DL4A 2FJVA 4DPYA 4HKQA 4WP9A 4DX6A 2JWNA 5DS7A 4K2JA 3IGNA 4L3KA 5CZVA 3THTA 3M8PB 4CWBA 3CWJA 4CH0S 4HH1A 4C7QA 1CBKA 2R8HA 1M1HA 4TXSA 4DQIA 3MM5A 2ZH2A 3PTWA 3CPWR 1YGYA 2WBMA 2DH7A 3W9HA 3I4HX 3QLHB 4JI3J 1WDDA 1NK0A 4ZCKA 3M2VA 2H65B 1S9FA 4YB6A 3BPSP 2B43A 3VTIA 4C2MA 4AFFA 5DZ6A 2VODA 4V19J 3AXMA 4NL5A 2XSJA 3DGPB 3NOCA 4I68A 1H2TZ 1WHYA 2RQMA 1OPZA 2GFFA 2DPJA 4MK9A 2I9SA 1S76D 4LF9F 1C1CB 4HDGA 4KE5A 3HF5A 1O0PA 4O3QA 1SJ4P 3M6VA 2W25A 2YNIA 3R5CA 4LRBA 1Q7YT 3KLVA 5F8LA 1JXVA 2CKWA 5KFUA 2M8DB 2QFJA 2RD5C 2DVIA 3RB3A 2UUAJ 1JWWA 3S7RA 1RISA 3R8YA 4LF4F 1S1WA 4LRCA 4MKYA 2CG8A 2EFNA 3BSCA 1F2HA 3TVYA 4NRUA 3HHKA 3PEJA 2KXNB 3GQCA 1R8PA 2VU5A 5A2QU 4DV5J 2FVCA 3OTCA 3I6PA 2YWHA 4M5NA 2H4YB 1WEXA 2HAFA 4DHVA 4EK2A 1X0FA 4ZJOA 2J8AA 4PZVA 4IG0B 5DLGA 2DO0A 2AU0A 3GG0A 4K5SA 5D4NA 4OX6A 1Y4ZB 4EI2A 5CZXA 1HARA 4X4QA 4TYBA 3QSYB 2UUWA 2WSFC 1XERA 5HQLA 1IQZA 5AXKA 3R7NB 3HSZA 1UWBB 2F1FA 5I42B 3MHYA
chains in the Genus database with same CATH topology
1E6VB 1ZM4A 2K8GA 1RYRA 4ZP6A 1ROFA 3M8RA 2XSFA 4O3PA 2FLOA 4QR1A 1CC7A 2BXJA 3M8PA 2P6SA 2VG6B 5GAHI 2JX2A 3OSNA 2P5VA 2KZZA 2E7XA 1VQYA 1VQ8S 3CCQS 3QGPA 4C11A 2A18A 1JLQB 2EKYA 3KWMA 3HHLA 5DQGA 1HHSA 2BANA 2KRRA 3MMBA 5F8HA 4X84A 2RRBA 4O4GA 4RW7B 1WI6A 2MGZA 3CC4S 1U6BA 1Q82T 5L1IA 1AW0A 1FRXA 3LAKA 1N36F 5J1EA 3KG0A 2V8GA 3TA1A 1BGXT 3DOLB 2IA0A 3K5PA 4C3MA 5B08A 5DETA 3HLUA 3SV3A 4QIVA 2YWKA 1PO6A 3B78A 2ZH1A 1LFWA 1JLAA 3BQ1A 3TUIC 3VAJA 1YJUA 4DJBA 2U1AA 4Q0BB 4DV4F 4U7UK 3AQOA 3NMRA 1XC9A 3GWCA 3OFFA 4QWAA 1C0TB 5BYRA 3CC2S 3M2UA 1L3TA 2CJQA 3V6DB 4RW4A 3EZUA 4RBUA 1P8GA 4ERDA 5CYMA 2M5YA 1UA0A 3I96A 3THPA 1RT5B 2IBOA 2KN4A 2VPXB 2HPUA 3PM9A 4Y3CA 1ZTWA 1UVKA 4A8FA 3PRBA 2Z0GA 3N01A 4QW8A 1U6ZA 3QWUA 1FVSA 4B02A 1X4EA 5HMWA 2XCPA 2YNFA 4DS4A 1FRJA 3CSKA 1NK5A 4R5PA 1T94A 4ELVA 2LU2A 1R7IA 3CO9A 4AL5A 2MKKA 4IRKA 4JV5F 1F5BA 4C3LA 2RJZA 3BM7A 4WU3A 3E51A 1RT1B 3BQ0A 3QIPB 1ZH5A 1W25A 1S49A 3D28A 3DMJA 5FDLB 4M95A 1YITS 3V4IB 4DWIA 4YOEA 3SSRA 3RRHA 1FE4A 4PWDB 3FNNA 3KHGA 2MQLA 5DG9A 3PX6A 2DR9A 3MXHP 1VQLS 2XLKA 2G13A 3OTOF 2HFNA 2WHOA 2AYBA 2FVPA 2BE2B 5EWFA 2LA4A 1U4BA 3DLKB 1FKOB 2HAIA 4ECQA 5T7LB 4TNOA 2MZJA 3SFUA 1C1CA 5M2UA 1N0UA 1RWUA 3M9MB 5JXSA 1FRLA 1OPIA 3L95X 5GAEU 2PFFB 3Q23A 4C8OA 3GR1A 4Y0FA 3SYZA 1D9DA 2CFXA 2KH9A 2PMZD 2D9PA 5B0GA 4U67Q 3Q8QB 2WB4A 3CMES 2MDAA 3MZIA 3UCUP 3DRPB 1XNQF 4U6PA 2BACA 3PW5A 1S0MA 2DH8A 1R3NA 1H2VZ 5B0FA 1UL3A 4IFYA 4C8YA 4TN2A 2MZ1A 2K2PA 3M1VA 1NH7A 2BRLA 4DSEA 2G4BA 3DLEA 5KFYA 3BR9A 4DG1B 3TARA 3PFOA 1DTTB 2XNQA 1Y00A 3DU5A 4LFAF 2KXHA 1ZAXA 4XIUA 2E9TA 5H1SV 2UVWA 1UETA 3HP6A 1WHXA 3DOKA 3U1MA 3IWNC 2CPEA 4F4ZA 2YKQA 3VF0B 2HZCA 2WSCC 5D78A 4DMZA 3DCAA 5F8JA 4QCLA 1S1TA 5CD4H 3AJ1A 1T03A 3JSYA 2R7OA 1MNEA 2F8EX 3KHLA 1VQOS 4WE1B 2XMMA 1X4FA 3VQTA 1VQ7S 1HPZB 3BGFA 1FEEA 1MWZA 3H2UB 3H98A 4MTPA 1WEZA 4ZPDA 4NYPA 3HT3A 3PIPQ 2XLIA 1XTZA 5EGYA 4C8MA 3KOAA 3TANA 3R27A 1B64A 3D2WA 5IFMA 2ASLA 2E1RA 2ROPA 5L1JA 2VQEF 3O5TB 1XK8A 1YVFA 3JSRA 3VQSA 4YFUA 1TKDA 1P1LA 2OH2A 4KIAA 3UCZP 3KNAA 2N3OA 1M5OC 1ELOA 2PA3A 5K8NA 4ECSA 3DRRA 4E98A 2YX4A 2BQRA 4C8KA 5EN1A 4OI3A 1JLFA 3K5OA 2DTJA 3MURP 1KFSA 4I4BA 2YQ3A 2YX7A 5KFLA 4NOHA 3BS9A 1YTYA 4OX7A 2YKMA 1Y9OA 4EWTA 1U1OA 3BJYA 2J9DE 4LQ9A 4NLUA 3MPYA 3I0RB 1NK9A 2XB2D 2MY7A 4DL0C 4K0KF 3OLBA 2PC6A 4CI0B 2W4DA 4Q44A 4PXEA 3SSQA 1DQAA 4M94A 2Q6CA 4TU8A 3K5MA 3HKWA 1WELA 2JHEA 2YKNA 3UD4P 5J2NA 1JXLA 4F2RA 1F5CA 1FKAF 3MEEB 3KLEB 4NLPA 3NNAA 1FTCA 5IT9Y 2GQ2A 4ES3A 2FJWA 2EFQA 1VC5A 2UUBF 2CJBA 4IRCA 4NLWA 3PJWA 2LYVA 4NLTA 1X9WA 2LA6A 1IKXB 2CG4A 6FD1A 2JOQA 3HO1A 3HDSA 1UJ6A 3DRXA 3ULHA 1UWBA 4NXNF 1BQMB 3KK2B 4LSNB 5B0DA 2OPRB 4EO6A 4DUYF 2LU1A 2MZQA 4MIWA 5IS2A 2HHHF 3SQGB 4PKDB 2AJFE 4ES2A 4OHXA 3K57A 2D3UA 3THVA 3M6UA 2YKAA 4AXJA 5KFIA 2C3MA 3HZGA 3QGGA 2CYYA 4DN0A 2VG6A 4PUOA 3VAFA 4I69A 3CCLS 2CPXA 2N4DA 2YWEA 2L3MA 3MR3A 2RSQA 2VV5A 5G0RB 1YRUA 2KT3A 1VRTA 4UY85 1KC8T 2JL9A 3HI9A 3J7YI 4OMFG 4DPOA 2C3OA 1FESA 2M9KA 1YQHA 4DQSA 1R8HA 3DYAB 3CCES 3LP0A 5D77A 1IKYB 1U09A 2BM0A 2WRMA 4WF9Q 1LWFB 1IXKA 5DM7Q 2RDJA 1LXNA 1CSJA 1BD6A 3AB2B 1VQPS 3M2VB 2M8HA 4OI2A 4DQQA 5DG7A 1U25A 4B3SF 3MM8B 1IM4A 2DNQA 2HIQA 1JJHA 3BSAA 2W8LA 1D1UA 2IRUA 4NA1A 5D4LA 4PXCA 4Q0BA 3GILA 1OSDA 1DARA 2KT2A 4ECYA 4P7TA 1S99A 2NUUG 4FNHA 2WAQD 2IRXA 3HHDA 3NRBA 4HT7A 4IOBA 1TUVA 4OZLA 4RU2A 1C0TA 2ZC4A 1A9NB 1TVRB 3BO4A 3R5DA 3SDEB 3HHLC 3C3LA 3OPKA 1T3OA 1X8DA 3CF5Q 4OI0A 1JLCA 5T41A 2AYMA 3P5TL 1N34F 3MUVP 1KOHA 2CDQA 3IWXA 2ZHAA 4Q7AA 4K4VA 2ZE2B 4MYTA 2G0CA 5K5MA 4A47A 2FLLA 4JV2A 1U26A 1IKVA 5I3QA 2XSJB 2IVYA 4HTJA 1YSJA 4ID5B 4J37A 2AGQA 1S0NA 3IRWP 2PIIA 5KT4A 3FJ2A 4MK8A 2AWZA 4A8KA 1SH2A 4OX9F 5DQHA 4LSLA 4KHPF 3H20A 2R7QA 3KYLA 1YHQS 4IR9A 2ZVSA 2DIUA 4YHHF 4ELTA 1HBOA 4W90B 1P6TA 2NSCA 3FVYA 2PO4A 3LF0A 1JK9B 2RB7A 2Z4PA 1HA1A 2QZ8A 2D3OR 3OTEA 2X1AA 1TL1B 5MLCV 2HVZA 3RB0A 2OFHX 4J9OA 1R8BA 4RW9A 3K8VA 1BLUA 4F8RA 4ED2A 3CGIA 4DF8A 5AJ3F 5T7LA 4X4OA 2MZTA 3KHHA 5JUMA 1VBXA 3JSBA 1KSPA 1ULRA 3ENQA 2E44A 4MK7A 3HHLD 4DV7F 4ZVHA 4ED6A 1NKCA 3OTBA 4WZQA 3UR0A 4RBTA 4LFBF 5H9EJ 2AJ0A 1N56A 3JAMY 2HFZA 1D8ZA 1IUJA 2DISA 3D54A 4WFBQ 1WD6A 3MD1A 4FF4A 5D4PA 2AW0A 5CHCB 4JI8F 3BF4A 2UXBF 3G8QA 3KK3B 2CJ9A 2FTRA 4XO0A 4UQTA 1S1WB 2KHCA 4K5RA 5I3UA 2AQ4A 4EUVA 3CIMA 2YKPA 3G9CA 3H25A 1Y5IB 3US5A 3PW7A 4D3GA 4G1PA 4B9LA 3VWSA 3ZZPA 4N5SA 4B9VA 5IM0A 2VG5A 1X4GA 5FJ4A 2IJNA 4LVOP 1WWHA 4FS2A 3ZZYA 4ZP8A 4BC7A 2N3LA 4F67A 4PG8A 4DV0F 2RVJA 4JI4F 1SC6A 4AE5A 5AE1A 3NGKA 4WE1A 3HVRA 1UMJA 3GB0A 1XN9A 2FHJD 1W2IA 3S8SA 1REVB 5ITHA 4DLGA 2DNZA 2V4JA 2K3IA 4NLOA 2DNOA 4HL9A 4I2QB 5CYJA 3OL9A 2FGOA 4PQAA 2F8HA 1VMBA 2L9DA 2VBYA 3I0SB 4EGLA 1DLOA 4Y2IA