2DB1A

Solution structure of the rna binding domain in heterogeneous nuclear ribonucleoprotein f homolog
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GSSGSSGMMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVELESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA binding domain in heterogeneous nuclear ribonucleoprotein F homolog
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords heterogeneous nuclear ribonucleoprotein F
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2db1A01
2FC9A 2DGQA 3R27A 2RT3A 1WTBA 1WHVA 4F25A 5JVGQ 2UP1A 4YUDA 5IM0B 1VQOS 2OIHA 2G4BA 3CCJS 4PRFA 2N82B 1XN9A 2KHCA 2RU3A 1N8RT 2E5HA 1HD1A 3V4MA 2CPJA 5GMKa 3MUTP 2Q79A 3MD3A 2KFYA 2MZQA 1D9AA 4WKRA 2DNRA 2KXNB 2MKIA 4ERDA 1YIJS 2RRBA 2DNLA 2KH9A 3BO2A 3IRWP 2DNMA 2HGMA 3R1LA 4WFBQ 1X4EA 3IWNC 3VAMA 1IQTA 2VOPA 5HL7Q 1VC5A 1SJFA 3L3CA 3CCUS 2AD9A 4F26A 2VODA 1M5VC 3VAJA 3P5TL 1U2FA 1DZ5A 3CCVS 1ZZFA 2DO0A 2RRAA 5D78A 3SXLA 2J0QD 2MZTA 2GHPA 4QPTA 3U1LA 2J0SD 4QQBA 1YTYA 1URNA 1Q82T 2G1DA 2DGSA 1U1KA 4UY8T 3P3DA 3CCLS 4J5OA 2MQLA 4Y0FA 1UAWA 2CQ2A 4IOAQ 4A8XA 2MQPA 1N88A 2LA6A 1U1NA 2EK1A 3UD4P 2QA4S 1U6FA 3CMES 2XNQA 5GVQA 1VQPS 2PEHA 2DK2A 2F9JA 2LA4A 4OZ0A 3H2UB 1PO6A 3NNHA 2M52A 3VAIA 3J7ZT 1VQNS 3N9UC 3CC2S 1H2VZ 2DNZA 2JVRA 3B4DA 4CH0S 1U1RA 1M5KC 3CMAS 1WF1A 2OSRA 2L08A 2LMIA 2CJKA 3VF0B 3UCUP 2MMYA 3US5A 5LXRA 2CQBA 2QEXS 2EK6A 2DGOA 2M70A 4FXWA 3DLLQ 1N54B 2RVJA 2MZJA 1X4CA 1SJ3P 1NJIT 2DGVA 4YB1P 2JX2A 5BJRA 3VAHA 1JJ2R 2F3JA 2E5GA 2YTCA 2BOPA 2DH8A 4TLQA 3LPYA 4C0OC 2VONA 3NS6A 2KM8C 1KD1T 2DGWA 1SXLA 1YJ9S 3CC7S 1YJNS 4TU8A 4PR6A 1YHQS 3R1HA 1VQ4S 2KXHA 1VQ8S 3P49B 2M88A 3BO4A 3CCQS 4C4WA 3RW7A 3G8SA 1R8HA 3UD3P 3MUMP 2LXIA 1WI6A 1AUDA 2VOOA 2MXYA 5IM0A 1JJ4A 4QU7A 1WG1A 2OJ3A 3TO8A 1X4FA 1X4DA 1M5OC 4IOCQ 5LSLA 4WF9Q 2KG0A 3CC4S 2M8HA 2DHGA 4BS2A 2AYEA 2LEBA 1S79A 2DB1A 4CQ1A 1QM9A 1L3KA 1S72S 3TYTA 3MURP 2HGLA 1SJ4P 1G2EA 1HD0A 2DGUA 2CQ0A 5CXTA 2AYGA 1SJQA 2E5JA 5GAHU 2CPFA 4LMZA 2V94A 4YOEA 1FT8A 2CQ4A 1YITS 4TU9A 2FC8A 1VBXA 5EN1A 1OO0B 2MB0B 1YI2S 5LJ3Y 1WG5A 2CQPA 2RS2A 1R8PA 1VQMS 3CPWR 4CH1A 5DM6Q 1X5PA 2MKHA 3BS9A 2M0GB 2LECA 3EGZA 3CCMS 1VBZA 3S7RA 1KOOA 2D9PA 2J76E 2RNEA 1X0FA 2CPDA 4TU7A 2DHXA 2KN4A 4F02A 3K0JA 3BEGB 3BO3A 5CYJA 3DXBA 3THTA 1U6BA 1FNXH 2KG1A 2LQ5A 3CXCR 2MGZB 3G9CA 4PKDB 2DNGA 2DNQA 2LEAA 2WBRA 5DDQC 2NLWA 3D2WA 4IUFA 2MKSA 4OZ1A 4WFAQ 2MJNA 2X1GA 5GAGU 3NS5A 2KVIA 2M4MA 2LXUA 2DH9A 1VBYA 3VAFA 2DNOA 2MQMA 1DBDA 2CPZA 2MPUA 2RQ4A 2HVZA 3G4SS 1JJHA 2KRBA 2ERRA 3HHNB 1WHXA 1FJ7A 2K8GA 1OWXA 1FJCA 3NNCA 2YH1A 1YWXA 3CCRS 2CQIA 2GO9A 2DNHA 1X4BA 2ADBA 2CQGA 4Z2XA 1RKJA 2KI2A 2MHNA 2MSTA 3MI7X 2MKJA 1NU4A 2KM8B 1X5OA 2MZ1A 2ZJPQ 1BY9A 4WIIA 1VQ9S 2FPHX 3S8SA 1X4GA 3HI9A 1WF0A 2DIUA 2KYXA 1D8ZA 3VAGA 1B7FA 5DM7Q 2MKCA 1DRZA 1U1MA 2MGZA 2O3DA 1H2TZ 4V19X 5GAEU 4IO9Q 1WEZA 2D9OA 5DDOC 2DIVA 2X1FA 1HL6A 4M5DB 3MD1A 4WCEQ 2CQDA 5H1SV 4C7QA 2RUGA 2N3LA 2KT5A 2DGXA 2D3OR 2MQOA 2CPIA 1VC0A 3MXHP 4LJMA 1U1LA 3EX7B 2OSQA 3ZZZA 1FJEB 2M7SA 2XB2D 2N7CA 3EGNA 3JB9k 3NMRA 2FY1A 2MY7A 4P6QA 2XS5A 1X4HA 2MY8A 1PGZA 2MYFA 5MLCV 2U2FA 2JWNA 1ZH5A 1Q7YT 2HYIB 3G6ES 2KXFA 2DO4A 2XS7A 3SDEA 2HGNA 3CF5Q 2KRRA 1K73T 2LYVA 1JMTA 2U1AA 3UCGA 2BZ2A 3H2VE 1VQLS 1FXLA 2DNKA 2AYMA 2X1AA 3FEYB 1WHYA 2PE8A 3MDFA 2NZ4A 1HA1A 3TP2A 1WWHA 5HO4A 2OTJS 2L9WA 2XS2A 1YJWS 3P6YC 3S6EA 4W92B 3G8TA 1QVGR 2MJUA 1A9NB 2CQ3A 2RQCA 2E5IA 2DHSA 3U1MA 1KOHA 2DHAA 1WF2A 1U1PA 3CD6S 1FHTA 1WG4A 1RK8A 3CULA 3CCSS 4UQTA 2CPEA 2JVOA 3SMZA 1K9MT 3UWTA 2DNPA 1VQ6S 2XSFA 4ZKAA 2DGTA 3LQVA 2MSSA 1VQ7S 1ZZNA 2KU7A 3I56S 2YKAA 2DNNA 5LXYA 1SJRA 2ZJQQ 1DHMA 2N3OA 1OPIA 3G96A 1O0PA 4Y00A 5D77A 2X1BA 5DDPC 1WHWA 2ZJRQ 2M8DB 1KC8T 3S01A 1X5TA 3CTRA 2MQNA 2SXLA 5ITHA 1OIAA 3FEXB 4W90B 2MKKA 3PIPQ 2DISA 3NNAA 1Q86T 2M2BA 3OW2R 5JVHQ 1X5SA 5DETA 2AYBA 5CA5A 1QVFR 3Q2TC 4EGLA 1U1OA 3B4MA 5GADU 3CUNA 1M5PC 1KQSR 2QFJA 1M90T 2OTLS 1Q81T 5IQQA 1N52B 3I55S 2CQHA 2DNYA 3J7YU 4WFNQ 3MUVP 2F9DA 2DITA 2ADCA 1CVJA 2B0GA 2I2YA 1UFWA 4U67Q 2MQQA 1FO1A 1P1TA 1H2UX 2HZCA 2FHOB 2LKZA 1H6KX 2I38A 2CPXA 1WI8A 3VAKA 3VALA 3MOJB 4ED5A 1P27B 1W2BR 2A3JA 1UW4A 2YH0A 1U1QA 3RW6A 2J8AA 5DDRC 1VC6A 1K8AT 4CIOA 1A7GE 1X4AA 2YWKA 2MZSA 5LJ5Y 5IFMA 4FXVA 2L41A 1WEXA 5LSOA 1VQ5S 4RU2A 2CQ1A 3Q2SC 2E44A 1UP1A 1WELA 3ULHA 2CPYA 2RS8A 3UE2A 1M1KT 2CQCA 3ZZYA 3UCZP 3SDEB 2JRSA 2M9KA 2XNRA 2LCWA 2DH7A 3THPA 1WEYA 2CPHA 1VQKS 2G0CA 4QU6A 1NO8A 4LIRA 1F9FA 3PIOQ 3G71S 3CCES 2EVZA 2K3KA 5FJ4A 2MZRA
chains in the Genus database with same CATH superfamily
4X4RA 4B3SF 2AWZA 3ILIA 2DGQA 1RAGB 1TR0A 5D0RA 3DOKB 3M8ZA 3CDUA 3MEGB 2F4FA 4YFUA 1T8EA 2OIHA 1SC4B 4ZP8A 2ABYA 3P4UB 1S1UB 2G4BA 1S0VA 1TL7B 3G6XA 1XN9A 1BGXT 1RTIA 1Z4UA 2RU3A 2E5HA 2JEFA 1JXLA 2XHWA 1U8SA 2OP5A 4MJKA 3SV3A 1UA1A 2UU9F 3DLHA 3MUTP 1BUXA 3QGGA 4DG1A 3MD3A 5L1KA 2KFYA 4KB7A 1FKOA 1GMVA 1D9AA 4NYOA 4WKRA 3MPDA 1JLEA 2E7XA 2DNRA 2KXNB 4LF5F 4WZMA 5CYMA 5B0FA 2R2RA 2R2TA 2MKIA 4ERDA 1KVKA 2RRBA 2E1RA 1YIJS 3I6PA 3C16A 2QG9B 3DLJA 3ENWA 4KPCA 2WHOA 2L9NA 3R1LA 2HNDB 4PZVA 2VPXB 4DR2J 2R7VA 3FDSA 1NEEA 2XMMA 2VOPA 1VC5A 1RTDB 2N7YA 1IJEB 3C6TA 3CCUS 2H5IB 1T3OA 3VAJA 3BN7A 3ZTPA 3BJYA 1MWYA 3PJ9A 5HJYA 2DO0A 1T9VA 5C24B 2XCPA 3N5BA 2W9BB 4EEYA 4DZDA 3H4BA 1M5KC 1WD6A 2VPYB 2MZTA 2YXLA 3KG0A 4M5MA 4OLPA 1H72C 3U1LA 2J0QD 4QQBA 3C6UA 1YTYA 4OZJA 2BW7A 2Y1RI 5D4OA 3V4IB 1J5OA 2DGSA 3OLBA 1R8BA 3P3DA 1C4AA 3ADAC 4J5OA 3CCLS 2VQFJ 4A8XA 2XCAA 2R3VA 2MQPA 1HNZF 1IJFB 1QAXA 3LF0A 2GW8A 3UD4P 1X9WA 3W3SA 3J7A1 1U6FA 1FD2A 3CMES 1XK8A 2XNQA 4A8SA 4PQAA 3I5CA 5KFFA 3GR0A 1L3SA 4LF5J 2JFKA 2ZHOA 4BCAA 2B6AA 1GXTA 4ALZA 1U0HA 2FZCB 3FQLA 3IC1A 3H2UB 3OD2A 3RRKA 2JEJA 4ECYA 1V3ZA 3I9V9 1WACA 1P9YA 4RPFA 3CC2S 4ECTA 5GAEI 1U0HB 1X7VA 2F5GA 2DNZA 2JVRA 1BLUA 3SQGB 2C2EA 3V5RA 4R0JA 2CNLB 1YRUA 4LF4F 4FP9A 5C2CA 4RX6A 2XM3A 2F8EX 4FF3A 3CJ2A 3GZ7A 2NXEA 1Q4RA 2K1RA 3OXFA 2FHKA 5LXRA 2CQBA 4LFBJ 2R8HA 2W9BA 1EKSA 1B70B 4Y3CA 2DY1A 3MOZA 5E41A 2DGOA 2JFDA 4LF9F 4FXWA 3JXOA 1IWGA 1Y9OA 1NKBA 4IQXA 1IUJA 2ZZMA 4O4GA 1NJIT 4I7FA 3SSQA 4QPXA 2DGVA 4YB1P 2BQ3A 2HNDA 3OTEA 1ZAWA 4B3SJ 2DY9A 4I2PB 4DR4J 2VBXA 4CYUB 2F3JA 2E5GA 2BOPA 2DH8A 1DY3A 2OELA 4DR5J 3M6WA 3MPVA 2R7OA 4JUZA 3D54A 2C2KB 3MFHA 2QO3A 4ED3A 4ELVA 2YQ0A 1DTTB 3BGLA 3TJAA 2DGWA 2RHSB 1MNEA 1KQGB 4LBIA 2RQMA 5IC4B 2E9TA 2RAQA 4C8ZA 2YNGA 1TL3A 2AX0A 3SSSA 2Q3PA 2X51A 3OFGA 3M9MB 1WUUA 4PR6A 3I5AA 1YHQS 2ZD1B 1FX2A 2QLWA 3MR5A 1OSCA 3BO4A 3CCQS 3C46A 1HBMA 1TP7A 3G8SA 1C1BB 4MK9A 2HEKA 4Z7CA 4KT0C 5KFQA 3TAMA 1GH8A 2RDIA 4CNYA 3NKYA 5CH7B 2V8VA 1PYTA 3CCZA 2AZ3A 2FLOA 4Y65A 1Q79A 1WI6A 1XTZA 1ZAVA 2WVFA 4KGKA 3U7JA 5I3UB 3W65A 3SYZA 2MXYA 2H1YA 1FVQA 1NCLA 2VOOA 4DR3F 5FLXU 1Q78A 1JLFB 2MHEA 4ZA1A 4ZVTB 2AP6A 3DOKA 5KG6A 3TO8A 4IOCQ 2HZAA 2GJFA 3D6FB 5HVFA 1SB6A 2CIMA 3AODA 3CJ4A 5KG0A 2BJ1A 2Q1LA 2XMJA 3GYNA 1FWKA 3NAHA 3VR1A 3ZTOA 4BLGA 1YJRA 3KK2A 1XNRJ 3OL9A 1RHKB 3A3NB 1RB0A 3A3OB 4Y6IA 2D74B 1NBEB 3KFWX 2DD8S 4TN2A 1S59A 2GIQA 1QM9A 1L3KA 2FZKB 3CIMA 4IH6A 3TZWA 4BHQA 3JSRA 3VVTA 4X62F 3HT3A 2DGUA 2CQ0A 2LQ9A 5CXTA 2B51A 3IBFB 4PWUA 2DXEA 3F44A 3N01A 4UT4A 2QX0A 4ZVUB 2CPFA 3PDNA 5HVGA 4C48A 2BJ3A 2R8IA 4J7CA 1TZ0A 4M63A 1CBKA 1HIYA 3VTIA 1S0OA 1IR2A 4M5NA 1ICEB 3QIDA 1YJVA 3PHTA 5MAOA 5DQGA 1VBXA 2DKOB 1HR0J 3CIZA 3DYAA 3I0RB 4ED4A 3N0VA 5J2PA 4LSZB 1HKAA 2HFUA 1HQUA 2KT2A 6AT1B 1PC4A 3GP9A 5KFUA 2CQPA 5HROB 3CDBA 3H59A 3MFIA 3CPWR 1UVIA 5KG1A 4B17A 3OL7A 2QA4G 4LF4J 4UOGA 4RU9A 2PC6A 1SL0A 3R2CJ 3EGZA 3POTB 1C2PA 3VCDA 3PR4A 5AE1A 3K7RA 5AE3A 2VFUA 1MROB 1TVRA 3M9OB 3CDEA 2J76E 4EI2A 2M3DA 1RBLA 2R2SA 2BE9B 2Z58B 4CH7A 3UR0A 3OXLA 4DUZJ 3C14A 3CJ3A 5K5MA 1IBKJ 2G1HA 2RH3A 1T0TV 3OR1A 2AJFE 4TU7A 4A8WA 1YBAA 3A1YG 3W5ZA 2Z2MA 4ANDA 2DR7A 4X4VA 4C98A 4F4YA 2NQPA 1J5EF 3TZYA 4O0IA 3R97A 3KJQB 1FJGF 3K0JA 1N36J 1RWOB 4ID8A 1SKUB 1TKZA 3KLHA 1FNXH 4JV5F 5LM7E 1RYSA 2VICA 3CXCR 4ENOA 2ZWPA 1R43A 1NHUA 1PYSB 1IR1A 4C8MA 1UL3A 5K8PA 1CJKA 1N4LA 2E5LJ 2NLWA 1X31C 5KFXA 2UUCF 4IUFA 3UNGC 3HK2A 1NDPA 3D6HB 4KQZA 4WFAQ 1TL1A 3QO9A 1SKWA 1JWWA 4B3TJ 3D68A 2XO6A 3I0SA 3HPOA 2WONA 1NDCA 4HDGA 3DDNA 3R6LB 4K4UA 2DR9A 2VV5A 4WPAA 3JAMU 2DNOA 3TWZA 1SL2A 3QQCD 4PABA 1LOUA 2CDQA 3T5HA 2MPUA 5AXNA 4NXMJ 2CRLA 2UV8G 3G4SS 1VQYA 2E1PA 4ITSA 4MT1A 1JJHA 1V3SA 1T03A 4QBUA 5KFYA 4KFBA 2W24A 2E7WA 1HYSB 5A76A 2NR0A 4FS1A 2IY5B 2R7XA 3EDQB 4F4ZA 3OTDA 1TK5A 3GCXP 2K8GA 3M8QB 1OWXA 2NPIA 4F8RA 1RUSA 1PYOB 2B3TB 1NB2A 2PT0A 2YH1A 1YWXA 2VPZB 1CG2A 1HQ2A 2VPWB 1WOSA 1FE4A 2O67A 1VRUB 4NLOA 2MKJA 3C6UB 2MZ1A 4KFBB 2ZJPQ 1HYSA 2WZ1A 4ANCA 1Z1ZA 2FIUA 2VG6A 4TXSA 4K8RA 4USHA 1CJUB 1FKPA 3MR7A 1GAOA 1OJ4A 4TYAA 5A0YB 3MAHA 2VF3A 3F41A 2B4UA 4L73A 3FRYA 3RBZA 1Y0HA 2HKEA 4DCPB 1UEVA 4ED6A 3V81B 1H73A 1LWCB 5DM7Q 2MKCA 1RWXB 4MKVA 4DF4A 3TVYA 3DOLA 2ZH3A 1DRZA 1T94A 3D7SB 4PG6A 2AQ4A 3BR9A 2O3DA 3QZ7A 4ICLB 2QZ8A 1FVSA 2KHDA 5KFMA 3OLAA 3KLHB 1WEZA 4DHVA 2Z30B 3MMBB 1YSJA 5DDOC 4F2RA 4ZITA 4K4VA 2ZM6J 4YR2A 4DR7J 1FRJA 4M5DB 3KK1B 3OR2A 4TVAB 3A8KA 1RQ0A 4CCHA 1VHFA 4BC9A 4PUOB 4C7QA 2RUGA 2HHHF 3EGVA 5KT3A 1NSKL 2YWEA 4PWWA 4QIWD 3Q86A 2CJBA 2YNFB 3SI8A 3CCTA 4B3TF 3OT9A 1PIEA 2CA9A 1UMJA 3ZZZA 5K8NA 1UA0A 3DI6A 1U25A 4FPIA 2GJIA 4DL5A 4HHUA 1GMUA 2IJFA 3GIJA 3JQJA 1YVFA 1Q1KA 3D9BA 4P2SA 1FKOB 2Z57B 3GSIA 4URGA 1HNIB 2Y3YA 2W9CA 1Z2ZA 2BKPA 5ETOA 3ZZ0A 2MY7A 2VJVA 3WC2A 1NJZA 3R9LA 1GXUA 3A8EA 4DX8H 3DM2B 2C1EB 4UUXA 5D4NA 2XS5A 3NL0A 3GWCA 4LF7F 3BGRB 2BM1A 1RHRB 5I4MA 1KP6A 5B0EA 1KSPA 2R8JA 1UVLA 3TUPA 3IRXA 3PRDA 4F4WA 1RU1A 1SQFA 3IWXA 2ZH5A 2K3IA 1N33J 1RU2A 2GVZB 2U2FA 3FUYA 5A8KA 4X64J 1ZH5A 2KZZA 1RGVA 2IVYA 3G6ES 3TVZA 4DPWA 1U4BA 2DO4A 4ZJOA 1UJ5A 3TA2A 2A1BA 2EKYA 2HGNA 3ONQA 1S0MA 3O3LA 5HBMB 4L75A 1JKHB 2Y1JA 1JMTA 1CQNA 2UUWA 4KTQA 2W9AA 3H2VE 1Y11A 2GAGC 2OPRB 3O1LA 4RW8B 5E3AA 3M8WA 1JKHA 2WBMA 4CLFA 5KOWA 1JQGA 3ILJA 1WHYA 3Q8QB 2X1AA 3MDFA 2RF2B 3KK2B 1JIHA 4ZOSA 3IR5B 1HNXF 5KG3A 5KFAA 4CT8A 5LSRA 5HO4A 3FBEA 4USWA 1REVB 1H0HB 2Y0BB 4PCQA 2IBKA 1OY8A 4IH5A 4LQ3A 2AMCB 3S6EA 4W92B 5T7LA 2MJUA 4M5HA 4NE9C 1VK8A 3ITHB 1HBOA 4GVBA 1DLOB 2E5IA 4KE5A 2DHSA 3FVYA 3QAUA 2BJ9A 1BHNA 2BKOA 1RABB 1KOHA 3DM2A 3IAS9 3IBWA 4L72B 3W60A 3M7VA 3CD0A 1RK8A 2HQDA 3S1TA 1HWKA 4DV7F 2R7UA 4MAKA 3CULA 1XNQF 2BYCA 3CCSS 3SMZA 4ZN1A 2IAJA 2DNPA 2UUTA 3B54A 4DDFA 2Z0GA 2XSFA 1LK5A 2XULA 4HT7A 2DGTA 1RAIB 4ZKAA 5DG7A 1URRA 5I3UA 1MU2B 2YPYA 4ES2A 3SV4A 3QIPB 4GRSA 2FLNA 2XWXA 4O44B 4OI3A 2RDDA 1NDLA 2JC0A 2HLTA 5SUHA 5HMZA 5KG7A 5BYQA 3QJLA 3IS9A 2DJWA 3QFHA 2ZWOA 3AB2B 1WHWA 1DQ9A 4OJ3A 1NRKA 4WK3A 4K4YA 1HBNA 2CJ9A 2M8DB 2EWHA 3BKUA 4IDKA 3HMJG 2W8KA 1ELOA 2WVCA 2SXLA 2V8GA 2YNGB 4QW8A 5BR8F 4CLLA 1Y5IB 4NLGA 4DR7F 1FRMA 1T9WA 2YWWA 2XMWA 3MPWA 3ZZRA 5HP1B 2QSFA 3MCOA 2HHSA 5K8OA 3OBIA 4NYPA 4UOHA 2DPIA 3EXCX 2EXUA 2HFOA 4DR3J 1UEUA 4LSNB 2PMWA 4E2FB 1S10A 1S4EA 1SC6A 1X5SA 5DETA 5CA5A 2C3PA 4Y2CA 8RUCA 1SKSA 1QVFR 4X64F 3N6MA 5KFHA 3GU0A 5CZVA 3DU5A 1UTAA 3B4MA 2CG8A 1XJWB 2K06A 4KRWA 2QFJA 2PI4A 2IVFB 3EE3A 2R4FA 4O4GB 1CJUA 1A6LA 1FKPB 3FCWA 3LPEA 1S1WB 2OUGA 3R5JB 4I56A 4B9LA 3KLFB 4KGXB 4M5LA 1RTHB 2DNYA 4XPCA 2HQGA 3AD7C 4DUYJ 3TRGA 4C3MA 2AGOA 2WVDA 1IBCB 1TKTA 5L39A 1NK0A 3NMAA 1HNWJ 4U67Q 1EAYC 4ZPAA 5F8JA 4DCOB 4FDFA 3D6MB 1IKWA 1F1BB 2B9WA 3AOAA 1HW8A 1O5JA 1QLNA 2JSXA 4F3OA 2CPXA 1WI8A 2DEIA 1Q8IA 3QJJA 2BVZA 1FNOA 3ZXWA 4USUA 2WK4A 4QCLA 3SQGA 3ISNC 1PC5A 1WSRA 1GX5A 2HQIA 2HQFA 3H0PA 3LP0B 1UW4A 4Y2KA 3RJMB 1S4FA 2HG4A 4I64A 4YHHF 2ZNZA 1F2HA 3W5YA 4DR6F 1ZS6A 2CAJA 1GX6A 3GLJA 4XK8C 5KFIA 1CULB 3UW1A 1A7GE 3GFZA 1SUQB 3Q8PB 4OX8A 4AT1B 1EP4A 3RB6A 1D9FA 5LJ5Y 1TFWA 1LEOA 2EFGA 3MMJA 4NZ6A 1N5VA 2IMWP 4ZP7A 3HFKA 4N8OA 2VZ9A 2BDPA 4U96A 4ZP9A 4F3QA 1TUGB 1HPZB 1WEXA 3AXKA 3BYRA 5LSOA 1VQ5S 1RWUA 1SI9A 1W7WA 2VBZA 3I31A 4HTJA 2EFQA 2OEKA 4M5JA 3TZZA 3H90A 2CNOB 2E44A 4FNHA 4CM0A 4PG8A 5KG2A 1FERA 3UQSA 4J9QA 4I69A 4ECRA 5L38A 1R3NA 1JJCB 2J9DE 1M1KT 1ZTTA 3SCIE 3QYYA 5KFRA 5IT9Y 1MMNA 1QDUB 2LCWA 3FCVA 3M2VB 3C6TB 4IG3A 1CJKB 4WE1B 5EGYA 2VL1A 4LRBA 2GIRA 4DR2F 4I2QA 5J2QA 4OLOA 1WEYA 3K59A 3BGOP 4WFZA 1TKDA 1RTDA 1VQKS 4FF4A 3CO0P 3D3BJ 4QU6A 2ZITA 1UWBA 1F9FA 1Y4ZB 3PIOQ 3LW5C 5HP1A 1KN6A 4FKYA 4IRDA 1FRKA 1X60A 2K3KA 1U48A 4ED0A 2WB4A 4L6V3 3H25A 1WC0A 3R27A 1YKWA 3EM1A 3IAM9 1S9FA 2IA0A 1HHTP 1JLCB 3AD8C 5LL6d 1TL7A 1WHVA 3TJ8A 1N34J 4CO2A 1BE4A 3J80Y 4B3RF 3EYZA 1AUSL 4JI4J 4ILMA 4HL9A 3T6JA 2N82B 1UFKA 2KHCA 4FPRA 5G0RB 1RAFB 4K0KF 3KLVA 3V4MA 1AFIA 3AJDA 4ID5A 1FEHA 1LFPA 1HQUB 3O44A 5CD4A 1RA7A 4CLUA 5KFWA 2MZQA 4UOFA 1EHWA 2BA9A 2CG4A 2IAJB 1D8YA 1UJ6A 3PRBA 2N4CA 2UUBJ 3MTKA 2GNKA 3G87A 3HP6A 3GYGA 4EBEA 2WAQD 3LH2S 2ZH7A 2OPQB 2OPPA 4JOUA 4NLQA 4NA2A 2Z56B 4X65J 1UPPA 4OI2A 1SH0A 2H4YB 3NGKA 3AOCA 3AA8A 3C8YA 3ITHA 1RDRA 2ASYA 1DJ0A 3KG4A 3A3PB 3IG1B 4ZIVA 4RWWA 3BB5A 2JEGA 2JEIA 4ILLA 2J9CA 2VG7B 1NK6A 1S5ZA 2AD9A 2IRXA 2XTJP 1S97A 2WSFC 2R2UA 2YKPA 4DLGA 3W64A 5B0GA 1CJTA 3CCVS 1ZZFA 4DV5F 5HLFB 2F7VA 2V2ZA 3GIRA 4RZRA 5D78A 1MMDA 4F2SA 2VC0A 2E7VA 2GHPA 3KUEA 1N5YA 2J0SD 5D4PA 4PXDA 1Q82T 4JI4F 2G1DA 1U1KA 1YLXA 3M8YA 2BM0A 4UY8T 4NLRA 1RI7A 2FTRA 2MQLA 3UD5A 2IYIA 4Y0FA 2UVRA 2XZTB 2FVCA 1YQHA 4DSFA 2E1AA 1N88A 3K5PA 2MEWA 5HANA 2NUUG 3TAMB 4YN3B 1U0SA 5A8KB 4RNMA 2K7KA 2AIRB 3AJ1A 3DLEA 4TY8B 5CHCB 3BH6B 4WXWA 4AYBD 1T05A 1L3VA 4FVMA 5GVQA 3HLUA 1RT2B 2QYGA 3L95X 2F9JA 1IKVB 2LA4A 1OQ3A 1U6ZA 3D0IE 4Y34A 1VQ8S 4RUCA 2VG5B 4DV2J 4TYBA 2GMHA 1S6QB 3BBFA 3J7ZT 3N9UC 3VAIA 1IWAA 1P1LA 2VDHA 3DRPB 5C2GA 4XPEA 4JBCA 1C1BA 1NMEB 1HNIA 3NWRA 1VHIA 4NLVA 4RO0A 3CD7A 4AD6A 3JAMY 4OV6A 4CTAA 2CJKA 1KTQA 3VF0B 3DGPB 3BM7A 3QATA 3RTVA 3CNQP 2Z8QA 2LU1A 5ETMA 3OFHA 4QYZJ 4NX9A 4FVCA 5DG9A 1TL3B 2JLGA 2EK6A 4P75A 1TV6B 3WX8A 4F4KA 1SIWB 3H5UA 3PFEA 2QA4S 3KJVB 4NLTA 1SIZA 2WRMA 1UFLA 3EZ5A 2RVJA 4P71A 1FXRA 2V2QA 1I6JA 4O23A 2CJQA 1REGX 2YKNA 4LRDA 2PGCA 5J1PA 1SJ3P 1S1TA 2Q6BA 2JX2A 2P6SA 4AQYF 2WVBA 1VCTA 5IWAF 4RBTA 4DQQA 4MKYA 4OI0A 4M95A 3FMWA 3ZTQA 4I7FB 3QT7A 5EX3A 3DRSB 2YTCA 1JJ2R 1XNQJ 4E8UA 3MTJA 1XMOF 1IBLF 3N28A 3HHKA 4Z37A 4A8MP 5T41A 3DOLB 2FLLA 3LPYA 2HFZA 4B3OA 4JI6J 3PHEA 3LA0A 2KM8C 4DR1J 2XY6A 1S1VB 2C3YA 2PA8D 2YKMB 1KD1T 1S9EB 1VLOA 3GPAA 3KLGA 4J9KA 2B4VA 3TQ1A 4P7TA 4ZPWR 1PBUA 3CC7S 3UVJA 3MR6A 3V6JA 1YJNS 1RAEB 2YQ1A 4DSLA 4B9TA 1PG5B 4Y2AA 2XO7A 4ETZA 5J2NB 3P49B 4I6YA 3Q8SB 2BQRA 2W2NP 2ZKTA 3NXZA 3NOGA 4CNZA 3VAKA 4IG0B 3L7OA 5L1LA 4XDCA 2C2NA 2QJ3A 4F0HA 2QSWA 2VQFF 3Q0AA 2JC1A 1JNRB 3QRQA 3N5FA 1RT6B 2XYHB 4KHRA 1YBUA 2B43A 1NPRA 2FZGB 2IBOA 2Z2ZA 3OHBA 2VD3A 1VQ9S 5M2RA 2KO1A 4DPYA 4QWBA 3I87A 4GO5X 2ACMA 1U2CA 4H4OA 3T9ZA 1I3OB 4YDXA 5IM0A 4Q45A 1WG1A 3JSMA 2VB6A 5KFSA 4CLTA 2UUCJ 4V19X 4N56A 4JYAJ 1X4DA 2LXFA 1S1XB 3LP1A 2VKZG 4OYIA 5C24A 2P9CA 4ZLLA 5HJXA 3L4BC 4A8KA 1S9EA 4OI1A 2KG0A 4KGVB 4G1QA 1V5IB 4O3PA 4ECQA 2NREA 4RW9A 2H51B 2AYEA 4BS2A 4PWDA 3R6GB 3GJQB 1UVJA 4JI5F 2GHVC 1S1WA 1I1GA 3IWLA 3MAQA 4B9VA 1LV5A 3MURP 1GTHA 5C7PA 1TUVA 3GCWP 2V4JB 2AYGA 2OMLA 4OYBA 4K50A 1HNZJ 2DRDA 3FQKA 6FDRA 2E5JA 5GAHU 3MM6A 2V94A 1PCAA 1PJ5A 4G1IA 3HFZB 4H4KA 3QWUA 3QT5A 1YITS 4TU9A 1CS4B 4DSKA 3OPKA 3M8PA 1OO0B 1U26A 2HHUA 1XMBA 3BREA 3DGVA 4USIA 3W2WA 4P74A 4WFYA 3IA0A 1YI2S 2UXCF 5IXUA 2QRRA 4Q0BB 3AH6A 1C4CA 3M2RA 5B0CA 3V6DA 4CM2A 3HHDA 2QMUB 3ILLA 4QJVA 2AGPA 3BDEA 1SC3B 3T5LA 1RTJA 1RAHB 4JI8J 1RAAB 2HVHA 2FHJA 1G1XA 1B0TA 2HHVA 2J5AA 2HRTA 2IM2A 3ZTSA 4ZCKA 1KOOA 3HXMA 1U8WA 2RNEA 4DV0F 3D1HA 4DCJB 3HCXA 2CPDA 2HBZB 1G6BA 2YWGA 1DURA 3AAWB 3I4PA 4U9RA 1P8GA 2Z4PA 4R8UB 2DHXA 3JTPA 1YJ7A 1LXNA 1LW0A 1VIOA 2KN4A 3PKYA 1Y5LB 4TY8A 4X62J 5CD4H 1JLAA 2V4RA 2F4VF 1F3FA 5AXKA 1VRQC 2GQ2A 3BEGB 1Y5NB 3UNYA 4WXOA 5G4DA 2NXJA 3BH7B 3DXBA 3MM9B 2BE2A 2FJWA 3O2IA 1XMOJ 2ZOMA 2VFSA 2DRBA 1HBOB 4LF7J 2LQ5A 1WKLA 3DNCA 5BYRA 3G9CA 4PKDB 2CWKA 1NJXA 1LK7A 1SQEA 3MM5B 2BW2A 2DNQA 3WHIA 5I3QA 2DBBA 2WBRA 1MLAA 3PTWA 4NLWA 2IDLA 3EVWA 2V0NA 1WOOA 5F8GA 4F0KA 2MJNA 1RBAA 2W2OP 4P2MA 4C0HA 4N5SA 3H4DA 2KTQA 1T11A 2KVIA 1NPKA 3VVUA 5C42B 1T95A 3CT9A 2ROEA 4V19J 5KFLA 3N4WA 2LQBA 2ZE2A 3BGFA 1NK7A 1SV5B 4IOBA 1UWAA 3PYEA 1MWZA 3VAFA 1VBYA 1QUVA 2ZNYA 1DBDA 3PG9A 1KEKA 5K20B 1R7IA 2RQ4A 2HWIA 1GMWA 1KHVA 2L3MA 2H5JB 3IMQJ 3NCPA 4UF4A 3HD2A 2ZHAA 2VA2A 4C6AA 1LWEB 3RR8A 4DV4J 4HLBA 2BR0A 2EFOA 4R5PB 3GR1A 4WU2A 2G2OA 1KTVA 4FNIA 5GAGI 3HHNB 1WHXA 1IM6A 2KJVA 2DPJA 4GKKF 1FJ7A 4ZVEA 1PJ7A 1N6QB 4DWIA 1RWMB 2K2PA 4XDDA 1NAQA 3KG1A 2XSJA 4OZLA 1SH3A 4USMA 3OVSA 2LU2A 1FJCA 2RQKA 3GONA 1FESA 1K1QA 2RILA 2VKRA 4OZ3A 2CQIA 3CCRS 2GO9A 1FRHA 2R7SA 1X4BA 2W2PP 1J27A 1KWMA 2CQGA 3VZIA 4K59A 2MHNA 3MI7X 3QRRA 2GVDA 5AT1B 3WZ0A 1NU4A 2E5LF 1FD8A 1N48A 2FJAB 3CCWA 5CZXA 4C8NA 3KLIA 4X4TA 3UR3C 1RCXB 2FPHX 4QIEA 3EMTA 2YNFA 1YK9A 2UXDF 3HI9A 4OHVA 4JI1J 2DHHA 2KYXA 4MMOA 1RCOB 3AXMA 1D8ZA 3M1VA 4Q43A 1KNZA 2KFNA 2YX4A 2RD5C 1K0VA 1SBRA 3U02A 5DO2A 1ZM2A 2JDJA 2FYXA 1CC8A 2FGCA 2W01A 1RT5A 4H4MB 4ZVFA 1H2TZ 2W4CA 4TQSA 5HQ8A 1S76D 1S6PB 3M6UA 2ZBPA 2D9OA 4WJBA 1F9HA 3RBDA 1RACB 3V6HA 1ZM9A 2DIVA 4ICLA 1MWQA 3T1YJ 1YJTA 2DRAA 2ZFHA 1S12A 3KLEB 2V69A 3CWJA 5KFEA 1Y7PA 3GJRB 3RBEA 4BBYA 5HAOA 5LOQA 4CTAB 1KVJA 3HVWA 4ZN3A 2XY5A 1H38A 1WORA 3TANA 3MEKA 1M5HA 2B56A 2HIQA 1K1SA 3BBCA 4OHXA 5AXMA 3Q24A 1VC0A 3DDIA 3H98A 4LJMA 4PG4A 1SQGA 4S0MA 5A0YA 3RG6A 3RZAA 1U1LA 1HNXJ 1B0VA 1R27B 2ZH9A 2PFFB 1RSCA 4QR0A 3CJKA 3DMJB 5M2PA 3AA9A 3KUGA 2Y1IA 1ZYQA 2FVPA 3BPSP 2ZKUA 2Y1LB 2HNZB 2BE7D 2N7CA 3N6LA 3PXGa 4IO1A 4DX6A 3QAEA 4ZIWA 4LFAF 3NMRA 2W7OA 2FY1A 3FKBA 4RNOA 4C8OA 3TEHB 3HVRA 3H5YA 1J2VA 4USJC 4JI2F 3ZZUA 1X4HA 5DZ7A 4JV5J 4EWTA 3DRRA 3D4JA 1LW2A 4U6PA 1FFGB 2V9KA 4Q8EA 4DLEA 2AJ0A 5EWGA 3MMCB 5J1EA 4IR9A 2P9EA 5JUMA 2IRYA 3MCNA 1TL4A 2HS0A 2WOMB 1FRIA 2HPUA 2NUHA 2ZBQA 3MEEB 3R5DA 3W9IA 2AZ1A 5C42A 1Q7YT 3TAPA 2XS7A 3SDEA 5IS2A 3C19A 4B02A 5KT4A 2EG1A 3NGRA 4OHZA 4MTPA 1K73T 2A2CA 2EFPA 3V4IA 1RWNB 1NH7A 2U1AA 2BZ2A 4JI6F 3UCGA 3RB3A 5E5NA 4UZBA 3BKTA 1C0TB 1VRTB 4PQUB 2AEJA 3BN4A 3PW2A 2GCFA 1RHMB 2HIYA 1H3DA 1TL1B 2QYCA 1HWUA 1WWHA 1S7IA 2BRLA 2BX6A 1RT4B 3EVOA 3Q89A 1EX8A 5I42B 5E3QA 3TAQA 2OTJS 1NK5A 2L9WA 2XS2A 3P6YC 4ZHRA 2PFDA 1A9NB 4TQRA 2R9LA 4GMKA 2RQCA 2X3GA 1GNKA 2D69A 1W25A 2I1RA 3E51A 1WF2A 4EZ9A 1KFDA 1D09B 2C2OB 3W61A 3W8GA 2IJRA 2JH3A 1BQXA 1JK9B 2RSQA 4EZ6A 5KFBA 1IQTA 1RAJA 2ZVIA 2BANA 3M30A 3BGUA 4MFBA 4UQTA 5AXLA 2IM3A 3UO0A 3PW7A 1K9MT 1RTJB 1IBLJ 1HMVA 1XQIA 2P8IA 3MHYA 4CP5A 3T3FA 3FGVA 4RBVA 4ZVRB 1EIYB 2QL5B 3LQVA 4MFBB 4DG1B 1XMQF 4Q7AA 3LWLA 2VC1A 4RR5A 2W4PA 1QSYA 4FBTA 4Q0BA 1W26A 4J91A 1G7CB 4CO4A 2VJUA 2DNNA 1JLBA 2HVEA 1UZDA 3GB0A 4TNOA 1RP5A 1TAUA 2N3OA 2OO4A 1OPIA 1ACMB 1NSPA 4P9SA 4WZQA 2LDIA 1UWBB 2EFVA 4Y00A 5DDPC 2X1BA 4UTGA 2JLEA 3GG0A 2AU0A 1CS4A 2F40A 2C3OA 2I5JA 4ZP6A 4CO3A 4IG3B 1FNMA 3M8SA 1Q16B 3AJ2A 3HX9A 4F0MA 2MQNA 1SPBP 5ITHA 2GIFA 3T1HF 4YHHJ 1RT1A 2VQEF 3OHAA 3AQOA 1EB0A 3B78A 2J9EA 1EZZB 3I0RA 3ET6B 4KC5A 4P72A 3RYLA 3ZFVA 1Q8BA 2DISA 3DDKA 2EBEA 3PIPQ 2FLPA 1R0CB 2G9OA 2Y8WA 1RZMA 3T5KA 3QLHB 4RW9B 3MF5A 2FDNA 4DQIA 1U1OA 1E6YA 2ILZA 3FK4A 4HACA 3SQOP 4HR2A 4NMXA 1LFWA 3CGIA 4KGZB 5IQQA 1TELA 3OL6A 1Q81T 3AB4B 2OTLS 1Q0NA 3G82B 1WTFA 1AA1B 1HI1A 4ED1A 3C15B 4K4ZA 3JYTB 3J7YU 3GQCA 2J6TA 1JLGA 4M5GA 2R8KA 4I0WA 4OYPA 5C25A 4P7VA 1RT6A 2CUYA 2LEPA 2MQQA 1RT7B 2OKQA 1FO1A 2CZ9A 3LGNA 1P1TA 3PY8A 4E98A 4J9MA 3T41A 5H9FJ 3EWGA 1D3WA 1WKKA 4YB5A 2IC3B 3VALA 4KYZA 4KHPJ 1P27B 4LR8A 4WWSA 5KG4A 4DSJA 2CDRB 3RAXA 2UVVA 2B5JA 1U1QA 4O3OA 1SL1A 3GMGA 4J9OA 1QSSA 4OL8A 1W2IA 1ZA1B 2BRKA 4QZVB 5DDRC 3TQEA 2Z2YB 3ZNJ1 1VC6A 1X0PA 2G2YA 4DV7J 1X4AA 4DF8A 3K17A 2DR6A 3KTQA 2YWKA 4Q5VA 2MZSA 1C0UB 3CMQA 4DPUA 3MMAA 4QIVA 3DI6B 3PR5B 3QGHA 2OEMA 4NEYA 1JX4A 3SEOA 3DRSA 3DKDA 3LGHA 2QIFA 2FVRA 3HF5A 5KTQA 4LFCJ 1CC7A 1Z2LA 4QR2A 1RT5B 4H4MA 2HBYB 1DQAA 2RHQB 4MKBA 1I51B 3QPIA 4DN0A 4LSNA 3GIIA 1MSWD 5DQIA 2XC9A 2W25A 4WK1A 5E3PA 4PPZA 2BJEA 4MIBA 4NXNF 4RNNA 3UE2A 1IM4A 1FJGJ 3MMBA 3UCZP 1R0BG 2QE5A 3DRXA 4UOCA 2BV3A 2JRSA 5KT2A 4DQSA 1H98A 2KKHA 1N36F 5KFZA 2UV8A 3MM7B 4ELUA 4B9SA 3HVAA 3I96A 2FJDB 1U24A 1N32J 4IRCA 3HHLB 1VYAA 2QC3A 4FKXA 2CPHA 2HK2A 3SSRA 1LWCA 2G0CA 3HHEA 3MZIA 2O66A 4KSEB 2PMZD 4KIAA 4DQRA 2HHWA 1TTHB 4UW2A 3CCES 5D0HA 3ZC4A 4CDIA 4NLUA 2IM0A 1EETB 1VS3A 4OHWA 2ZC3A 2PI5A 1KR4A 2FC9A 3D3CJ 5ETNA 4OX7A 1WTBA 1TK8A 2VG6B 1CSJA 1RWKB 3T9NA 4QW9A 5JVGQ 1VJQA 1C0UA 1VIXA 2CWXA 2IC3A 2I9SA 2MLYA 2YY3A 2B7CB 4XTTA 4YUDA 4X4QA 3DCAA 1NK9A 3QT8A 3CCJS 1OYDA 2J7WA 1NDKA 1SJ1A 5KFCA 1HD1A 1RT7A 1YG0A 1NPPA 2CPJA 2MKYA 4OFZA 3G86A 4AE5A 2PDAA 5GMKa 3TX8A 5GADI 2RE1A 5C25B 4QOTA 2NS1B 2RB7A 3AOBA 5FIIA 4CLKA 4JV2A 3NCQA 1TMMA 4KHPF 3G2XA 2J0XA 4DN9A 4X4OA 4X2BA 1REVA 2KH9A 4HACB 3EPGA 3FEZA 2DNMA 2D3UA 2HGMA 3W2VB 3IWNC 4KKOA 4RKUC 1IN0A 3VAMA 4F4AA 5HL7Q 1JLGB 4WIQA 4GKJJ 3EUNA 3QMQA 2BUNA 3A13A 5IV4A 3L3CA 4ECXA 3PJXA 2VODA 1NJWA 3BZQA 3ET6A 2AKWB 1U2FA 3UI3A 4LFBF 4PG5A 3FRZA 2RRAA 4ZVPB 2ZDOA 3AT1B 3JSBA 1O8BA 4W4MA 5KAKA 4ER8A 5JMNA 2J7KA 3DLGA 1AW0A 2GVZA 2VFTA 4QPTA 3SCJE 1BD6A 3CB4A 3SCLE 1FDDA 1YRXA 3LP2A 3MECB 4ECZA 2FVSA 2WB1D 3D28A 1HWLA 2XHCA 3VZHA 2VBYA 4O3SA 2CQ2A 5B0AA 4ZK7M 4IOAQ 1B7YB 4G65A 1N0VC 1FKAF 2NYIA 4HH1A 3HDSA 3C16B 3GG1A 4CWBA 1T3NA 2EK1A 1S48A 1I5OB 2W9CB 1JLEB 1IR0A 1FCAA 1HMVB 1OY9A 3R5BA 2K7JA 3ZNUA 3J81j 3PVXA 1VQPS 1F5AA 2ATCB 3IR6B 1NK4A 2HMIB 4C8KA 1IKYA 4RJVA 2FJXA 5LMUF 2NZCA 3OFEA 5HATA 2M52A 1UVMA 3A4TA 4E0DA 4OJ1A 1PAEX 4CLZA 2HW3A 2V9WA 4OX9F 3NLCA 1MROA 1TVRB 1H2VZ 3RU0A 5ETQA 4HH0A 3B4DA 4CH0S 5A2QU 3QSYB 4NL5A 5FLXY 3V2UC 5HMYA 3CMAS 1U1RA 3RBXA 4DL2A 1N56A 1WF1A 3LAKA 4GKJF 2LMIA 2OGUA 4JI5J 4DZ6A 4ZHRB 1XWLA 3KK1A 2VH7A 4EUVA 2FJVA 4JI3F 3US5A 2ZDPA 3A12A 2AX1A 3NY0A 4LVOP 3D67A 3FSXA 5E3CA 5IV3A 4W98A 5GAGU 1RISA 3PW0A 4U8YA 4Z7YA 3W7BA 2D1CA 3SFGA 4NI2A 2FVQA 3DXSX 4ETXA 5HVHA 1ZM3A 2MZJA 3M32A 1NK8A 3K5MA 2MLXA 5J2MB 1X4CA 4LBPA 4ANEA 2UUBF 1U09A 4X4PA 5F3ZA 5IC6B 4KAIA 3W2VA 5BJRA 4PXCA 1HPZA 3LOUA 3VAHA 2J7UA 2GZOA 3BF4A 1XR7A 3CJ5A 5A8WA 5KT7A 1ZETA 4FBUA 1YX2A 1N0UA 5JJBA 2LFVA 4C0OC 3JSMB 3H5XA 2XMUA 5E3RA 1SUQA 3NS6A 5D0GA 2Z2LA 3BV8A 3EDRB 3PYFA 4HHJA 4X4SA 2W4DA 3M2UA 3KK3B 3KDOA 3RAQA 4OYZA 1SXLA 3DC2A 1XR6A 4D3HA 3OL8A 3H2LA 2WOMA 1GEHA 1YZ6A 1CJVB 1YDLA 4TU8A 1IBKF 2QA2A 3R1HA 1HI0P 1JLFA 1VQ4S 2KXHA 2E29A 1CPZA 3IXQA 2OHDA 4XIUA 2HNZA 1LW2B 2FGOA 4ZVQB 4ZJQA 4CLWA 4N7TA 1PAUB 1RWPB 4JB8B 1F5BA 2GGPA 3PZPA 5KFKA 4X65F 1YJUA 3PYGA 3GIMA 3K2YA 4CLSA 3GSDA 5K14A 2ILYA 2LXIA 1BC6A 1AUDA 2EC0A 2W2QP 2VU5A 3JTOA 4QU7A 1RTHA 5E0OA 5L1IA 1X9SA 4UQGA 1E6VA 2BABA 2WONB 3B82A 3EJMA 4DL3A 1X4FA 3MM7A 3PW4A 2RKIB 5KOXA 3W62A 3R7SB 5LMUJ 2UXBJ 3LO3A 4CRJA 2VBWA 2M8HA 4RW6B 3TNVA 2ZH2A 1S1TB 4FZVA 5B7WA 3VQSA 4DV3J 3MEDA 3PCOB 1S79A 1BQNB 2NXUA 4KY3A 2R42A 3KDNA 4CQ1A 4ZCLA 1IBMJ 2XMAA 2OI2A 3M1VB 2AW0A 2CJYB 1G2EA 5AE2A 1RWVB 4N77A 4FN5A 2WSEC 2ZVSA 4NZ0A 4U7UD 4C11A 2BJ7A 4ZLNA 4YOEA 1R31A 4YB6A 1ZPVA 1E6VB 1M1HA 4NCGB 5D3GB 2FC8A 4C3KA 3LGMA 3CD5A 2GVDB 4OYAA 4QYRA 3OR1B 3TUIC 5U47A 1GFWB 2MB0B 4RW6A 3QNWB 5LJ3Y 3TUJC 4JV0A 3BR8A 3KYLA 2GMJA 4O0NA 1R8PA 2ZBCA 1VQMS 4C9DA 2HAFA 1RE1B 5DM6Q 1X5PA 2MKHA 3BS9A 5KFPA 2QL7B 4WTYA 4K4WA 3TA1A 3L7UA 1WC6A 1IKXB 3CW2C 3TI0A 1RXOB 2LECA 3HULA 3CCMS 3RB0A 1S7HA 4USTA 5H9FK 3TJ9A 2FHJD 1X0FA 2VA3A 2CZVC 1LWEA 3M2UB 4LRCA 3KK3A 2GGPB 1OMSA 3MM8A 2B8QA 3KOAA 3NGDA 4FYDA 2WW8A 4DUTA 5F0WA 4DQPA 2VFVA 3HSZA 5KFNA 2QN6B 4F02A 1Q5VA 1N5YB 2ZE2B 2XGQA 1T02A 2DTJA 4YQWA 1HBUB 1WC5A 3HZGA 3NGSA 1NSAA 2V67A 5CYJA 3N6NA 1U6BA 2HFVA 2V8DA 4F67A 2KG1A 1WSVA 2HZVA 1JB0C 2KDOA 4G1PA 2MGZB 4YEAA 1JXVA 1RLCL 2OPRA 4H4KC 2DNGA 1QTNB 1HI8A 3M32B 4RW8A 2MTLA 3Q83A 3GIKA 2LEAA 2QTWA 4ZVHA 3G6YA 4O3RA 2DCLA 3D2WA 1YRTA 2ASDA 2J9DA 2MKSA 3OQ2A 2KB2A 2YNIB 4U7UK 4DL4A 1RT1B 2D7SA 4LF8F 2M4MA 3K58A 5L9NA 3KHGA 3DLKB 5EUHA 3GFYA 4WFXA 2ACYA 3ZO7A 1FDNA 2DH9A 2MQMA 3KWMA 5RUBA 4NI2B 2W1BA 4LVNP 4JI7F 2CPZA 3BYPA 5L8RC 1UJ4A 2HVZA 4Q2LA 2VIHA 4DV0J 4KO0B 3OJUA 2EBGA 1NM2A 3O6QA 5DLFA 5D8HB 2NSCA 9RUBA 3MPYA 2KRBA 2J8SA 3CEDA 3PEJA 5CYQA 1V9OA 4NA1A 2BANB 3M30B 3U27A 3J81U 3DLBA 5C5JA 3NNCA 3QGIA 1KRPA 2QL9B 1Y3JA 1UVKA 4NPOA 5DS7A 3WIUA 8AT1B 2QA1A 5JXSA 3NS7B 1NZ8A 4DV3F 4C0BA 1DTTA 2B8PA 1RT3B 3FMBA 5DQHA 5DLGA 4KBIA 2ADBA 1RKJA 4IFYB 3DOMB 2HSEB 1DTQB 2MSTA 2CZ4A 3W63A 3CJ0A 1N34F 4FYWB 2OEJA 2UUAJ 3OR2B 1BY9A 4JI8F 3FSYA 3M2RB 2FJBB 4U95A 2QMWA 4CYUA 3S8SA 2PN6A 1NZAA 4Y2IA 5EWFA 3AFGA 1FWPA 1RBOB 2V50A 2OPSA 3HVTB 3W2WB 2DIUA 1B3TA 2J0WA 4A8OA 3MGJA 1FXDA 3SCKE 3D1OA 5HSPA 2W2MP 1U1MA 2R8GA 3DLGB 3W8PA 4DXLA 2MGZA 2ATLA 1J5EJ 3A8JA 4I1TA 3UDVA 2UXBF 2BQUA 2IIHA 4KPYA 2GJ2A 4PXBA 5H9EK 4URSA 3IR7B 4IRKA 1HBUA 4NLSA 2HWHA 3MD1A 3LAMA 3PRVA 4ES1A 1QJHA 2V2VA 2NCKL 3MMCA 5J1EB 4HYKA 1ITPA 1NUEA 1QY7A 3ENQA 1TMJA 1EJ7L 2RJZA 4KKOB 1B99A 3FSIA 1AB8A 3SFUA 3HO1A 3NBPB 1UKUA 4BWMA 4LT6A 4DOZA 2MQOA 2LP4A 3P8BB 2XI2A 3MXHP 3D66A 3ENVA 4OX9J 1IVZA 4RNFA 1Q7LB 1QSLA 2OSQA 3M8RA 5GMEA 2M7SA 4C97A 2B6AB 2ZC4A 4B3MJ 2XB2D 1LKZA 2C2ZB 4YS2A 1D1UA 3JB9k 3ISZA 3MWBA 3CJKB 1WKJA 4K4TA 1FRXA 4CLYA 2FHMA 3N79A 1S9GB 2RRNA 1BXNA 4JI1F 4P6QA 3MAAB 3KHLA 2E9ZA 3OSPA 2MY8A 1HHSA 3F0NA 2G13A 1IKXA 1K0TA 1HQEA 1H74A 5MLCV 4NCGA 3DRYA 3LTOA 4ZPVR 4NCBA 2F1FA 4LRAA 4YR3A 2QV6A 4RW4B 2HYIB 4IQMA 2KXFA 3M6VA 2HNYB 2ZM6F 3KLGB 5L1JA 4GC6A 3QFWA 3T1YF 1OS5A 5F3TA 3CF5Q 1VFJA 4ES3A 4EO8A 1ULRA 5L46A 1F2GA 2IHR1 2B7BB 4UZCA 3NNHA 3Q23A 5D3GA 4MKAA 2CJAA 4MK8A 2EFNA 3UN2A 1VQLS 4JI7J 2EG2A 1FXLA 2WVEA 4C11B 1M1GA 1WJ9A 2ALYB 3BBBA 3KJFB 3R5GA 3KJVA 4A8FA 2NZ4A 5D6GA 1KKHA 2HVIA 1TKZB 2GMLA 2RKIA 3VV2B 4RW4A 1CQMA 2AHOB 2FY8A 1QAYA 2ZZTA 2F63A 2YKNB 1S49A 1YJWS 3KXDA 2JL9A 3LALA 2DCUB 5IT4A 4ED2A 1HBNB 4CO1A 4B3MF 1L3UA 1D0EA 2BMBA 5AJ3J 2BJ8A 1QVGR 3MEDB 4X4UA 1NB7A 2CQ3A 2G0IA 3BQ1A 5HMWA 3VWSA 3BDPA 3C14B 3ZTRA 1TV6A 2XWYA 4HHHA 5F0UA 3U1MA 3MAAA 2C2DA 2DHAA 1FHTA 2P2CB 3QIPA 5IWAJ 5B0DA 3M9NB 3KLIB 4NRTA 2VASA 1APSA 2WCXA 4P10A 2KT3A 3Q8RB 2XSJB 3DGPA 5ADZA 1KDNA 2GV1A 1HQEB 3UWTA 1VQ6S 2COLA 1GTEA 2E9RX 4DPTA 5E7OB 1WC4A 2MSSA 3DLEB 3NGUA 3HSGA 5K14B 1VQ7S 1ZZNA 2VG5A 1JNZB 1SJRA 1DHMA 2XQCA 1N5QA 1IKVA 4LREA 4NYZA 3HJFA 2HRYA 3DYAB 3MR2A 1IBMF 3C66A 4DV1J 2GQCA 4KH0B 4USVA 1T05B 3G82A 2X7IA 1KC8T 2D3O1 3S01A 1X5TA 1O6XA 2HS4A 1LWFA 1V3RA 3CTRA 1VQSA 5A8WB 1OIAA 3FEXB 2FJEB 1CJTB 4B9MA 2CYYA 2MKKA 4W90B 4X4NA 3IGVA 6FD1A 1QE1A 3V6KA 4CO0A 3H7HB 4TY9A 3WC0A 2ROGA 3IBCB 4BDPA 1PBAA 7FDRA 1HWJA 2V68A 2FB0A 1EARA 3OW2R 5JVHQ 1HWIA 3RRGA 4U7CA 4ECSA 2AYBA 2DVIA 2HLUA 3Q2TC 4PEOA 4EGLA 2NSBA 3MM9A 4UUWA 3W66A 3CUNA 1FTCA 2G0JA 3UDCA 2OPPB 2OPQA 3HZEA 3NWGA 4X84A 4A46A 3U1NA 3K5NA 1KQSR 1Q53A 1NKCA 2QLJB 2APOA 2I5JB 3MM5A 1L5UA 2CVIA 5DGBA 4WFNQ 3MUVP 1VGYA 2DITA 2GFFA 4KJIA 4IFYA 2B0GA 5D77A 4EBDA 5SZTA 3KMSA 1UCNA 2I2YA 3J7AN 4R8UA 2C3UA 3JYTA 2AGQA 3CJQA 1TU0B 4ID5B 5F8NA 1JLBB 3FBCA 5T14A 1H2UX 1G4CA 1OYEA 2C42A 2HZCA 2FHOB 3HKZD 4DV5J 3BSOA 3PW5A 3RB4A 1FFSB 2LKZA 5H9EJ 2I38A 2YKQA 4RNHA 2OFGX 5ETKA 2NYHA 2QT7A 2ZOGA 2CKWA 3DOMA 3H5SA 4I68A 3RAMA 2QFIA 1AYEA 4L76A 4OV1A 4EO6A 1PILA 1BQMA 2XI3A 3MCSA 2A3JA 4WBFA 3W9HA 4A4JA 3H40A 3RW6A 3JQMA 7AT1B 2XLJA 3EGWB 5EX0A 3CO9A 4YDDB 1IKYB 4DS5A 1BQMB 4O3QA 1K8AT 2OFHX 4CIOA 2IA6A 1VLYA 5HK4A 5CYQB 3TX0A 1B4SA 1RWWB 3CSKA 3MECA 2HQ3A 4EU0A 5IFMA 4B3RJ 3BPDA 4FXVA 1Y10A 4MIWA 3QJPA 2CVEA 3KKFA 4LIWA 3MM6B 1R89A 1V5VA 1HNVB 2V4JA 4J9PA 5K9FA 2HHTA 2Y9HA 2IM1A 2HHHJ 3M6XA 1DFDA 2IMOA 3PYDA 2CQ1A 2GO8A 2QLBB 4CLPA 2H65B 3LP2B 3FZBA 4HVZA 1UP1A 4F04B 3NG8A 4OZ5A 2L9DA 4NLDA 4L3KA 1WELA 4NOHA 3ULHA 3DLKA 5BYSA 1NJYA 2CPYA 3B6BA 1RT4A 2KJWA 2PIIA 3IFEA 2IFXA 3SDEB 3UDLA 4LF6F 5IT9U 4R0EA 4AFFA 3T1HJ 2HK3A 2XNRA 2HHPA 3MEEA 1C0TA 1VRTA 4PQUA 5HQLA 4GKKJ 2YPZA 2MDAA 3THPA 4CT9A 4TKTA 3LUYA 1CEZA 5KFVA 2RIJA 4RUAA 2MLZA 4KH1B 3TA0A 3MPUB 4J9LA 3PFOA 4WKYA 4LIRA 4PWDB 2PMHA 1FA0A 2A6OA 3MM8B 5ETSA 2H4WB 1YGYA 2HAIA 1SVDA 4PG7A 3WX4A 4AQYJ 1DQ8A 5FJ4A 4OIXA 2OMOA 2RT3A 1M0SA 1ZPWX 1S77D 4IG0A 2M5YA 4F25A 3KMQA 2UP1A 5IM0B 1VQOS 3E2EA 4DR6J 5CCMA 2IVMA 2W8LA 1N5SA 1TL5A 4DR1F 3I82A 4PRFA 5HI7A 1N8RT 3NP5A 1HNWF 8ATCB 4K2JA 3ICLA 3CVKA 4R25A 2YNHA 3Q22A 4DV4F 4C2MA 2Q79A 3KUHA 4ELTA 1TKTB 1VBKA 4WP8A 4MYTA 4DI6A 5A6PA 3NAIA 1J5OB 1SCJB 2Q66A 3FZ2A 2H48B 1F3VA 1VK3A 2YBVA 2VHGA 1FRLA 5IOLA 3T6BA 2ZZNA 3FFIA 1UW9A 1XR5A 4N8NA 1R8CA 2V5HG 3THVA 2DNLA 2P6TA 3BO2A 3IRWP 5CABA 3HSDA 4DV2F 1AROP 1X4EA 4X66F 4WFBQ 3D6TB 2WTFA 1N32F 2AT1B 4WP3A 2WSCC 3WDOA 5EDWA 1MW7A 2MQ8A 4LQ9A 1SJFA 5J1NA 4F50A 2C2MB 4LF2A 3KLEA 5KG5A 1M5OC 4RLEA 4I6AA 2P9GA 4F26A 1D9DA 3EPIA 3Q8VA 2EEYA 4C8YA 1AZSA 1M5VC 1EKRA 3P5TL 1IXKA 3AY0A 3M4XA 3UFCX 1DZ5A 1UPMB 5F41A 2OH2A 2AEMA 4DL6A 5DJBA 3SXLA 3NGTA 1F60B 5LMNJ 2AJQA 4DV6J 2RDJA 1URNA 3CJSA 4FF1A 1RJJA 3EVMA 3GTYX 2XY7A 3IS9B 4RL1A 3IO1A 1KQKA 1DAXA 3OV7A 3GILA 2GQQA 5KT5A 1UAWA 1T9YA 4AXIA 1C1CB 3DRPA 2JOQA 3TARA 2V8HA 4PYAA 4A8YA 5GMDA 2F8HA 2KFZA 3CE8A 4BC7A 2LA6A 1U1NA 1MN7A 4J9NA 1BWEA 1EQ0A 3PACA 1R6YA 1U02A 1U7LA 3PX6A 2GAHC 2YX7A 1L3TA 1EQMA 2R7RA 2NPFA 2VDIA 3E3XA 2IYGA 3MEGA 2PEHA 2DK2A 1VI7A 4OZ0A 3EZOA 1KFSA 1CJVA 2V6AA 7FD1A 4DBQA 1PO6A 1S0NA 3QRPA 4DFJA 4I67A 3MR3A 2B5JB 1VQNS 1T9UA 2ZOFA 1S9GA 2XYGB 3BKFA 1X8DA 3GE9A 1BWVA 1A0OB 2B4OA 4ZDNA 3OTBA 1IQZA 4PXEA 2DEJA 2OSRA 3BSCA 4ZVGA 2L08A 4DPOA 4DPXA 5T7LB 1FE0A 3NOCA 3JS9A 2HBQB 3QT6A 4J9RA 3UCUP 2MMYA 2HWTA 2QEXS 1DARA 4MH8A 3P96A 3KHRA 2ZH1A 4K0KJ 3CDAA 3T5JA 4F7VA 1NNDA 4JI2J 4M5IA 2M70A 4K5SA 3I5BA 4LR7A 3WBZA 4DUZF 3DLLQ 4FXDA 1N54B 3TEGA 3VHQA 2EKNA 2VG7A 1O51A 1SV5A 1HR0F 3FBFA 2LVWA 2V4QA 4NRUA 1YBTA 4BWJA 4LSLA 2CNKB 5A8RB 5HLFA 2BACA 1E6YB 3OUYB 4QYZK 2QLFB 2O1PA 4OZ2A 4B9NA 3SIPB 1P6TA 1VISA 1RHQB 4NLPA 3X3UA 2XEXA 1JLQB 3IGNA 4IFVA 1JLAB 2BXJA 2YKOA 3EZUA 4JP8A 3W9JA 4IH7A 2OLWA 4EK2A 4TLQA 5J2MA 4AL5A 1LW0B 2VONA 2XLKA 3ETOA 3K57A 3M05A 4J9SA 3DU6A 3VQTA 2XMVA 4OX6A 4U8VA 4L3NA 2UU9J 4C8LA 1YJ9S 1ZOTA 3OTCA 2O5DA 2BOAA 4PYDA 5EWEA 2HS3A 3BSNA 1Y3KA 5E33A 5CAAA 4A8QA 4ECWA 2M88A 2C2RA 1NXIA 2JJ4D 1DTQA 3HD1A 3HFVA 4I4BA 4C4WA 1RLDA 3IRXB 5F8LA 3I4HX 5AJ3F 3RW7A 3ILOA 3TVKA 4B9UA 2ZD1A 1R8HA 1TAQA 4RW7A 1JLCA 2POKA 4H54A 4QWCA 3UD3P 1ZBTA 3MUMP 3BQ0A 2G2ZA 3NCRA 5G0RA 1GT8A 2VQEJ 2HURA 2YQ3A 3A8IA 4TLRA 3GFXA 2NXCA 3QWPA 4RW7B 2B9XA 1U45A 2O01C 1I94J 3PO5A 5DG8A 3M8PB 1JJ4A 2IRUA 1GMWD 2XG8A 3CJ8A 4I2QB 2JHEA 3GJTB 5I3PA 1RYRA 2OJ3A 2ZBIA 1KHWA 4XAKA 1XMQJ 4DSEA 1U47A 3P45B 3D0GE 4KO0A 5LSLA 1Q95G 4WF9Q 4KR0B 2AF6A 2DHGA 1Q5YA 3GJSB 3PO4A 3IN5A 5E2QA 2LEBA 2DB1A 5J2QB 4F4XA 4NLXA 5D15A 2R7QA 2E1CA 1JLQA 4IFVB 1S72S 2DR8A 3TYTA 4G6VB 2HGLA 1SJ4P 2L48A 1HD0A 4JI3J 4P52A 1SJQA 1BMQB 1M5SA 3AD9C 2UXDJ 2YNIA 5A8RA 3LP1B 3VGVA 1FFWB 4LMZA 2CQ4A 1FT8A 2E1MC 2XMTA 4K4XA 1RA6A 1QTMA 2ZH4A 1KQFB 1VRUA 5EN1A 3K89A 3P5BP 2B9YA 2N4DA 3W1YC 5B0BA 3OVAA 1CLFA 3V81A 1CULA 3QZ8A 3DRRB 4G1QB 5KT6A 4DL7A 3LWMA 2A18A 1WG5A 2GHWA 4JI0F 2RS2A 1S1XA 3FC9A 1AT1B 1LWFB 2IDEA 3LP0A 4CH1A 4DR4F 4YY3J 2XBPA 2M0GB 4NMLA 5CCLA 2DXFA 4NWBA 3DMJA 4OI4A 2XYPB 1PSDA 1VBZA 2VUGA 2A10A 2HBRB 4P2FA 3R8YA 1IKWB 2D9PA 3S7RA 2AJ1A 3UVJB 2R7WA 2ZHBA 2F8MA 1TKXB 2KVQE 4NXMF 4K2XA 2XZWA 4NEZA 4ZVSB 4Q2MA 3OVBA 2V34A 1S1VA 3M8QA 5KFJA 4DJBA 4LRFA 4EYHB 2HFNA 1U2RA 2BJDA 3QBCA 4P2XA 5ETLA 3RUBL 4B3OB 1NSQA 3HHLA 3EXYA 4OJHA 2H9ZA 2A6MA 2EW9A 4AL7A 3HHLD 2XZDB 4AUKA 2P5VA 5IQ6A 3J7YI 3I0SB 2E66A 3BO3A 1T03B 4LF6J 4KGMA 4Q44A 1C1CA 1S99A 3QO9B 3THTA 2YKMA 4WTOB 1T9XA 1NLKL 4IYQA 4DR5F 2JNJA 4LR9A 1I94F 1RAOA 1ZA2B 4M8LA 4HEA9 4J9UE 1XERA 1U49A 2R7TA 5DDQC 2UUAF 2UXCJ 3VGSA 4OZ1A 4HDHA 4OHYA 1F0XA 3HT0A 3D0HE 1HFEL 2H5EA 2FD2A 2X1GA 3VGUA 2QLXA 1S6PA 3JTNA 3NS5A 3H8YA 1XEZA 1XIQA 3O5TB 2ZUAA 3K5OA 4M1KA 4NASA 4ZPTR 5HN0A 1VDHA 2Q6CA 3HHLC 3Q8UA 5CYMB 1HW9A 2LXUA 2ZEJA 2CJXB 4RWXA 3MMAB 1TK0A 1BQNA 3SBMA 2C3MA 1TUWA 3ZZTA 4GO7X 2V8PA 1GQEA 1V6HA 1QD1A 2YVSA 3R3TA 2HMIA 4LBHA 2PA3A 1NHVA 1VOMA 2CADA 3FFIB 4A48A 2JZ5A 4MK7A 3AQPA 2ERRA 2RU9A 2J6UA 3TZXA 1FDBA 1FEEA 1FF2A 1S57A 2EC2A 2FQQB 2YWFA 4K5RA 4O4RA 4G3IA 1KVIA 5F9NA 4MIAA 3ENAA 3I32A 2YNHB 3T19A 2KZMA 2ZBRA 3PEHA 1XNRF 1MU2A 3DN9A 2DNHA 3G6VA 1KLMA 1FDAA 4GVBB 4Z2XA 1N6QA 4D3GA 1OPZA 2AJ2A 2KI2A 2KM8B 2I0XA 4NCAA 1X5OA 5F8IA 2W7AA 4OJGA 4NZ7A 4WIIA 1LQ9A 4YB7A 5B09A 4DX7A 1X4GA 3KHHA 2QMXA 4LF8J 1OSDA 3OUYA 4IKAA 2JLFA 2LLZA 1WF0A 3NBPA 4QIGA 2A2DA 5FDLA 1DLOA 3UDEA 5HMXA 5J2PB 4LSLB 1ZM4A 1SC1B 2GA7A 1SH2A 3WQPA 5KFGA 3VAGA 1B7FA 3C15A 1MMLA 3E8OA 3Q8YA 4OMFG 5BXIA 5EHHA 4DV1F 2DR5A 3IG1A 2RUSA 1ROFA 2I6WA 5IT0A 4YY3F 1K44A 1SKRA 1RHJB 2HQCA 3D1QA 3TW0A 2BE2B 5GAEU 4IO9Q 4JI0J 4NLYA 4OQJA 5FDLB 4QWEA 4DFMA 3RR7A 3FNNA 1T7PA 3L09A 4CI0B 2X1FA 3E01A 1HL6A 2CNNB 4WCEQ 4YP3A 2CQDA 5H1SV 5F9LA 2I8EA 2AEFA 2YWHA 3ELHA 2ROPA 4DU8A 1Y00A 2N3LA 2KT5A 3R7BB 4RUHA 2DGXA 3DFEA 3PNIA 5A2QY 4ZCIA 2D3OR 1HNVA 1WNEA 1MG7A 4ILRA 1FTRA 2CPIA 2PEBA 4PAAA 3EX7B 5DRKA 2XLIA 2GX8A 1FJEB 3J80U 3PX0A 4DEZA 1LNQA 1F5CA 4URQU 2ZH8A 4DV6F 1QAIA 3R7NB 3EGNA 3GV7B 1RKIA 1KS2A 1RT3A 4KV8A 4WYLA 4ZPCA 3BGRA 2LQJA 5DZ6A 3J7Z5 4DUYF 3V6DB 2Y8YA 5BR8J 3GV5B 1B0PA 1S6OA 3VGTA 1S6UA 3F56A 1HHQA 1FK9A 1FI4A 4A47A 1XC9A 5K8MA 3HM9A 1PGZA 2MYFA 4ZCMA 3OFFA 4ZLPA 3K8WA 1KBRA 1HBMB 3OTOF 4DMZA 2V63A 3L9ZA 4J90A 1WDDA 4OZNA 5ETPA 3SZ2A 2JWNA 2IPOB 2Q43A 4WE1A 4QWAA 3R2DJ 4DL0C 1F9EB 1GXLA 1NHKL 1T9TA 3BSAA 1AZSB 1HLWA 1RADB 4J9VA 2KRRA 2LYVA 2PSZA 4PUOA 2BBEA 4FS2A 3F73A 4M94A 3HJVA 1LWXA 2DNKA 2XGPA 2AYMA 4M5DA 3M2VA 4HT5A 5D4LA 2PO4A 3FEYB 5I42A 2PE8A 4I2PA 1AFJA 1NKEA 1HA1A 2H54B 4K7QA 1OY6A 3TP2A 4AL6A 4N47A 3B8HA 2A0FB 4ECVA 1MN9A 1VJWA 2K1RB 3O8WA 4DU7A 1XBWA 4LF9J 4YR0A 4FYXB 4WP9A 1UETA 3K5LA 3G8TA 4H4OB 5ETVA 3PM9A 4ZS6A 1QAJA 4ED7A 3KNAA 3DHWC 2RMLA 4FYVB 4OYWA 4C3LA 2EPIA 3KJNB 3FCHA 4DX5A 4ZLJA 3TUZC 4NXNJ 1NH8A 4OYMA 4QR1A 4O3NA 3TOQA 3ZZPA 3DHXA 3CD6S 1TKXA 2D3ZA 1U1PA 1LXJA 1WG4A 2HRUA 2OD6A 2Y0SD 4ZPDA 3PKMA 1UEKA 2JVOA 2CPEA 1EP4B 1VMBA 2UVWA 3GFHA 3JSYA 3UPFA 3JQKA 5F8HA 2ASLA 2ZH6A 5J2NA 4IR1A 5A6WA 2V2KA 3G8QA 2HVDA 4JYAF 1WOPA 3H42A 4OYXA 5GAHI 4FF2A 4JV1A 2KU7A 4FYYB 3I56S 4LFCF 2YKAA 4OYOA 2H3EB 5CQGA 2BEFA 5LXYA 2NXNA 2ZJQQ 1UZHA 1ZAXA 5FD1A 4DFPA 3G96A 4HI2A 2F65A 4LF1A 4Y2MA 1FX4A 1O0PA 4J37A 3TR5A 1P9QC 3AHPA 4F3MA 4M5KA 2ZJRQ 3WIVA 4KHMA 1GK8A 3I9ZA 3PJWA 3GYXB 4LFAJ 4EFAC 4GC7A 4DFKA 2BKNA 3IP0A 1X9MA 4Q8FA 2DXDA 2CFXA 9ATCB 1F6TA 5IZHA 1KONA 2AV5A 1EETA 4RUBA 3CJTA 2GC8A 5B08A 1WDTA 1TQLA 2W7PA 4EYIB 2LQ8A 4AXJA 4ATNA 3NNAA 3FJ2A 2LDYA 1Q8LA 1Q86T 2M2BA 2UVUA 3KLFA 2DYAA 3ETMA 1Q8KA 4B08A 1R0AA 1N33F 2B4PA 1YZ7A 2VFRA 3IM8A 5KFDA 3H20A 1H7WA 5HQMA 1R0AB 2HHQA 3QGPA 2J6SA 4K4SA 2AJ4A 5GADU 4DSIA 3PX4A 5DGAA 1R8AA 1M90T 4L74A 2ASJA 1N52B 4X66J 4Y28C 1K47A 4F36A 4CZCA 2UZAA 3OSNA 2CQHA 4I6WA 4IDKB 3I55S 2HHXA 3CC4S 4EMDA 2ADCA 2F9DA 3EICA 1RHUB 3NRBA 4XO0A 1PKUA 4EBCA 1CVJA 2YX1A 3K8VA 3IM9A 4DS4A 1ZTWA 1UFWA 4LUBA 2OD4A 1FK9B 2HNYA 4HTIA 4OI6A 4O44A 5F8MA 5KFOA 3RGIA 3BQ2A 3R5AA 1RTZA 3CDWA 2XMKA 3CJRA 1RTIB 3FBBA 4GVLA 4ZVOB 3RRHA 3C3LA 2KL8A 3OTOJ 1H6KX 3GV8B 4KV8B 1S1UA 4PPDA 5LMNF 1RT2A 5LT5A 1TFYA 3MOJB 4ED5A 3UN5A 5M2UA 1W2BR 2B9EA 2C22A 3MCMA 1S6QA 4QIFA 4R5PA 3J81Y 2YH0A 4HKQA 1KLNA 2X3DA 2J8AA 5ETTA 1UVNA 5KFTA 1PJ6A 3OXGA 1FWLA 3POTA 1M5PC 2D41A 3X1LB 2ZUGA 1VR6A 2GS8A 4WYWA 2HFSA 1G3OA 3W5XA 1WC3A 1HARA 3QSIA 3UN3A 2L41A 4NA3A 3HKWA 2OAUA 3E01B 5ETRA 4HI1A 5HROA 3L7PA 1H7XA 1AXQA 4ED8A 4RU2A 3R5CA 3LANA 3ISND 2FUG9 4MYUA 3Q2SC 4P73A 3PV8A 3C2PA 4UY85 2PD1A 5D0EA 4RBUA 4ZPBA 2RS8A 5THWA 5HBMA 2F4VJ 2QGFB 1WC1A 1QE1B 1QUPA 2CXEA 2CQCA 5L9XA 3ZZYA 2C28A 3KNGA 1N5TA 2RF2A 2WW4A 4V1Ak 2M9KA 3HSJA 2EI5A 3QLHA 4CO5A 4ZMMA 1OQ6A 2DH7A 4N41A 3OJSA 3NEKA 2ALZA 4ECUA 1B64A 1JXEA 3T1AA 4YMEA 1NO8A 3G71S 1R6VA 2KYZA 1KLMB 2OPSB 2DT9A 3HVTA 2IJNA 3D5MA 2EVZA 4WU3A 4QWDA 3ZZOA 4USKA 4ZJLA 4N76A 2MZRA
chains in the Genus database with same CATH topology
4X4RA 4B3SF 2AWZA 2DGQA 1TR0A 3DOKB 3CDUA 3MEGB 4YFUA 1T8EA 2OIHA 4ZP8A 2ABYA 1S1UB 2G4BA 1S0VA 3G6XA 1XN9A 1BGXT 1RTIA 1Z4UA 2RU3A 2E5HA 2JEFA 1JXLA 2XHWA 1U8SA 2OP5A 4MJKA 3SV3A 1UA1A 2UU9F 3DLHA 3MUTP 5L1KA 3QGGA 4DG1A 3MD3A 2KFYA 4KB7A 1FKOA 4NYOA 1D9AA 4WKRA 1JLEA 2E7XA 2DNRA 2KXNB 4LF5F 4WZMA 5CYMA 5B0FA 2R2RA 2R2TA 2MKIA 4ERDA 1YIJS 2RRBA 2E1RA 3I6PA 3DLJA 3ENWA 2WHOA 2L9NA 3R1LA 2HNDB 2VPXB 2R7VA 3FDSA 1NEEA 2XMMA 2VOPA 1VC5A 1RTDB 2N7YA 1IJEB 3C6TA 3CCUS 1T3OA 3VAJA 3BN7A 3BJYA 1MWYA 2XCPA 2W9BB 2DO0A 5C24B 4EEYA 3N5BA 3H4BA 1WD6A 2VPYB 2MZTA 3KG0A 4OLPA 2J0QD 3U1LA 4QQBA 3C6UA 1YTYA 4OZJA 2Y1RI 5D4OA 3V4IB 1J5OA 2DGSA 3OLBA 1R8BA 3P3DA 1C4AA 4J5OA 3CCLS 4A8XA 2XCAA 2MQPA 1HNZF 1IJFB 1QAXA 3LF0A 2GW8A 3UD4P 1X9WA 3W3SA 3J7A1 1U6FA 1FD2A 3CMES 1XK8A 2XNQA 4A8SA 4PQAA 3I5CA 5KFFA 3GR0A 1L3SA 2JFKA 2ZHOA 2B6AA 1GXTA 4ALZA 3FQLA 3IC1A 3H2UB 3RRKA 2JEJA 4ECYA 1V3ZA 3I9V9 1WACA 4ECTA 3CC2S 5GAEI 1X7VA 2DNZA 2JVRA 1BLUA 3SQGB 2C2EA 3V5RA 4R0JA 1YRUA 4LF4F 4FP9A 4RX6A 2F8EX 4FF3A 3CJ2A 3GZ7A 1Q4RA 2K1RA 3OXFA 2FHKA 5LXRA 2CQBA 2R8HA 2W9BA 4Y3CA 3MOZA 5E41A 2DGOA 2JFDA 4LF9F 4FXWA 4IQXA 1Y9OA 1NKBA 1IUJA 2ZZMA 4O4GA 1NJIT 4I7FA 3SSQA 4QPXA 2DGVA 4YB1P 2BQ3A 2HNDA 3OTEA 1ZAWA 4I2PB 2VBXA 2F3JA 2E5GA 2BOPA 2DH8A 3M6WA 3MPVA 2R7OA 4JUZA 3D54A 3MFHA 2QO3A 4ED3A 4ELVA 3BGLA 1DTTB 2DGWA 1MNEA 1KQGB 2E9TA 2RQMA 2YNGA 1TL3A 2AX0A 3SSSA 2Q3PA 2X51A 3OFGA 3M9MB 4PR6A 3I5AA 1YHQS 2ZD1B 2QLWA 3MR5A 1OSCA 3BO4A 3CCQS 3C46A 1HBMA 1TP7A 3G8SA 1C1BB 4MK9A 4KT0C 5KFQA 3TAMA 1GH8A 2RDIA 4CNYA 3NKYA 5CH7B 2V8VA 3CCZA 2FLOA 4Y65A 1Q79A 1WI6A 1XTZA 1ZAVA 4KGKA 3U7JA 4Q44A 5I3UB 2ZH1A 3SYZA 2MXYA 2VOOA 1FVQA 4DR3F 1Q78A 1JLFB 2MHEA 4ZA1A 2AP6A 3DOKA 5KG6A 3TO8A 4IOCQ 5KG0A 1SB6A 2CIMA 4AXJA 3CJ4A 3G6YA 2Q1LA 2XMJA 3GYNA 3KK2A 3NAHA 3VR1A 3OL9A 1YJRA 4Y6IA 2D74B 3KFWX 2DD8S 4TN2A 2GIQA 4IH6A 1QM9A 1L3KA 3CIMA 4BHQA 3HT3A 4X62F 3RTVA 3JSRA 2DGUA 2CQ0A 2LQ9A 5CXTA 2B51A 4PWUA 3F44A 3N01A 2CPFA 3PDNA 2R8IA 4M63A 1TZ0A 3VTIA 1S0OA 3QIDA 1YJVA 5MAOA 5DQGA 1VBXA 3CIZA 3DYAA 3I0RB 3N0VA 5J2PA 1HQUA 2KT2A 1PC4A 5KFUA 2CQPA 5HROB 3CDBA 3H59A 3MFIA 3CPWR 1UVIA 5KG1A 4B17A 3OL7A 2QA4G 4RU9A 2PC6A 1SL0A 3EGZA 3POTB 1C2PA 3VCDA 3PR4A 5AE1A 3K7RA 5AE3A 2VFUA 1MROB 1TVRA 3M9OB 3CDEA 2J76E 2R2SA 2M3DA 4CH7A 3UR0A 3OXLA 3CJ3A 5K5MA 2RH3A 4TU7A 3OR1A 2AJFE 4A8WA 1YBAA 3A1YG 2DR7A 2Z2MA 4X4VA 4C98A 4F4YA 2NQPA 1J5EF 4O0IA 1FJGF 3K0JA 4ID8A 1TKZA 3KLHA 1FNXH 4JV5F 1RYSA 3CXCR 1R43A 1NHUA 4C8MA 1UL3A 5K8PA 1N4LA 2NLWA 5KFXA 2UUCF 4IUFA 3UNGC 3HK2A 4KQZA 1SKWA 4WFAQ 1TL1A 3QO9A 1JWWA 3I0SA 3HPOA 2WONA 4HDGA 3DDNA 4K4UA 2DR9A 2VV5A 1SL2A 2DNOA 1LOUA 2CDQA 3T5HA 2MPUA 5AXNA 2CRLA 2UV8G 3G4SS 1VQYA 4ITSA 1JJHA 1V3SA 1T03A 4QBUA 5KFYA 4KFBA 2W24A 2E7WA 1HYSB 2NR0A 4FS1A 2R7XA 4F4ZA 1TK5A 3OTDA 2K8GA 3M8QB 1OWXA 2NPIA 4F8RA 2B3TB 2PT0A 2YH1A 1YWXA 2VPZB 1CG2A 2VPWB 1FE4A 2O67A 1VRUB 4NLOA 2MKJA 3C6UB 2MZ1A 4KFBB 2ZJPQ 1HYSA 1Z1ZA 2FIUA 2VG6A 4TXSA 4USHA 1VQ9S 1FKPA 3PO5A 1GAOA 4TYAA 5A0YB 3MAHA 3F41A 2B4UA 3FRYA 1Y0HA 1UEVA 4ED6A 3V81B 1LWCB 5DM7Q 2MKCA 4DF4A 3TVYA 3DOLA 2ZH3A 1DRZA 1T94A 4PG6A 2AQ4A 3BR9A 2O3DA 3QZ7A 4ICLB 2QZ8A 1FVSA 2KHDA 5KFMA 3OLAA 3KLHB 1WEZA 4DHVA 4F2RA 3MMBB 1YSJA 5DDOC 4K4VA 4YR2A 1FRJA 4M5DB 3KK1B 3OR2A 1RQ0A 4CCHA 1VHFA 4BC9A 4PUOB 4C7QA 2RUGA 5KT3A 2YWEA 4QIWD 2CJBA 2YNFB 3SI8A 3CCTA 4B3TF 1UMJA 3ZZZA 5K8NA 1UA0A 3DI6A 1U25A 2GJIA 4DL5A 2IJFA 3GIJA 1YVFA 1Q1KA 4P2SA 4URGA 1FKOB 2W9CA 1HNIB 1Z2ZA 3ZZ0A 2MY7A 3WC2A 1NJZA 4DX8H 1GXUA 3A8EA 3DM2B 4UUXA 2XS5A 5D4NA 3NL0A 3GWCA 4LF7F 3BGRB 2BM1A 2R8JA 5I4MA 5B0EA 1KSPA 1UVLA 3IRXA 3PRDA 4F4WA 3IWXA 2ZH5A 2K3IA 2U2FA 5A8KA 1ZH5A 2KZZA 1RGVA 2IVYA 3G6ES 3TVZA 1U4BA 2DO4A 1UJ5A 3TA2A 2A1BA 2EKYA 2HGNA 3ONQA 1S0MA 3O3LA 5HBMB 2Y1JA 1JKHB 1JMTA 1CQNA 2UUWA 2W9AA 3H2VE 2OPRB 3O1LA 4RW8B 5E3AA 1JKHA 2WBMA 3Q8QB 5KOWA 2X1AA 1WHYA 3MDFA 2RF2B 3KK2B 1JIHA 4ZOSA 3IR5B 1HNXF 5KG3A 5KFAA 4CT8A 5LSRA 5HO4A 4J9KA 2IBKA 1REVB 1H0HB 4PCQA 4IH5A 4LQ3A 3S6EA 4W92B 5T7LA 2MJUA 1VK8A 3ITHB 1HBOA 1DLOB 2E5IA 4KE5A 2DHSA 3FVYA 3QAUA 3DM2A 1KOHA 3IAS9 3IBWA 4L72B 3CD0A 1RK8A 3S1TA 1HWKA 4DV7F 2R7UA 4MAKA 3CULA 1XNQF 2BYCA 3CCSS 3SMZA 2IAJA 2DNPA 2UUTA 4DDFA 2Z0GA 2XSFA 1LK5A 2XULA 4HT7A 2DGTA 4ZKAA 5DG7A 5I3UA 1URRA 1MU2B 4ES2A 3SV4A 3QIPB 2FLNA 2XWXA 4O44B 4OI3A 2JC0A 2HLTA 5SUHA 5HMZA 5KG7A 5BYQA 3QJLA 3IS9A 2DJWA 4WK3A 3AB2B 5D77A 1WHWA 1DQ9A 4OJ3A 1NRKA 4K4YA 1HBNA 2CJ9A 2M8DB 2EWHA 4IDKA 2W8KA 3HMJG 1ELOA 2SXLA 2V8GA 2YNGB 4QW8A 5BR8F 1Y5IB 4NLGA 4DR7F 1FRMA 5HP1B 3MPWA 2XMWA 3ZZRA 2QSFA 2HHSA 5K8OA 3OBIA 4NYPA 2DPIA 3EXCX 2HFOA 1UEUA 4LSNB 1S10A 1SC6A 1X5SA 5DETA 5CA5A 2C3PA 4Y2CA 1QVFR 4X64F 3N6MA 5KFHA 5CZVA