2DB1A

Solution structure of the rna binding domain in heterogeneous nuclear ribonucleoprotein f homolog
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GSSGSSGMMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVELESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords heterogeneous nuclear ribonucleoprotein F
publication title Solution structure of the RNA binding domain in heterogeneous nuclear ribonucleoprotein F homolog
rcsb
source organism Mus musculus
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2db1A01
1X4AA 3EX7B 1U1LA 3G9CA 3CCLS 1YJWS 2GO9A 1U1KA 2F9JA 3SDEA 3G4SS 3US5A 2UP1A 1U1RA 3NNHA 1WI8A 5LJ3Y 3VAJA 2MZQA 2HVZA 3CUNA 1VQPS 5CA5A 1QM9A 4CH1A 3Q2TC 3HHNB 2J0QD 4OZ0A 4ZKAA 3R1LA 2MJNA 2ADBA 3SMZA 5IM0B 3Q2SC 4PRFA 2KM8B 5DDOC 2KI2A 2RU3A 4PR6A 2CQCA 2OSRA 2RT3A 2O3DA 3TP2A 2X1GA 1WELA 3CD6S 2J0SD 3ULHA 2X1BA 3G8SA 2MGZA 3I55S 4QU7A 3S01A 2JX2A 1ZZFA 4WIIA 3MUMP 3NNAA 3VAMA 3CPWR 2RS2A 4EGLA 2M0GB 3ZZYA 3CCUS 1VC6A 3VAGA 5D77A 2DNNA 1N52B 2DITA 1F9FA 3V4MA 3CF5Q 2OJ3A 3SDEB 3BS9A 1M90T 1H2VZ 2E44A 2DGOA 5HL7Q 3G71S 4V19X 1YJ9S 1HD0A 2LEBA 4TLQA 2BOPA 5DDQC 4WF9Q 1FJ7A 1Q86T 1Q82T 2RS8A 2F9DA 1X5PA 3R27A 3UD4P 2N82B 2FPHX 1X0FA 2EK1A 1YHQS 2DGVA 2J76E 3PIOQ 3S8SA 2N7CA 1KOHA 1P1TA 1R8PA 2DNOA 5GAGU 2LYVA 3PIPQ 1SJ4P 2DNKA 1DZ5A 2MY8A 2MKKA 1YWXA 3FEXB 4WFNQ 1M5PC 1NJIT 2DGSA 3S6EA 2MGZB 2MXYA 3CMES 1X4GA 3L3CA 5GMKa 3BO3A 1K8AT 1VBYA 2RUGA 2MKCA 1K9MT 1QVFR 2KXFA 5DM7Q 2DNLA 2LMIA 1VQMS 2E5HA 4BS2A 2ZJQQ 2YKAA 2M8HA 1W2BR 2MSSA 1UFWA 1FJCA 3MUVP 4IOAQ 3VALA 4F25A 4LIRA 1VQ7S 1URNA 2DHGA 2DGWA 2E5JA 2HGLA 4WFBQ 2XS5A 2RVJA 3UCZP 1WHYA 3MD3A 4YOEA 2ERRA 2MQNA 2YH0A 4W92B 3VAKA 2G0CA 1CVJA 2HGNA 2MKIA 1WG5A 2CQBA 2N3LA 3CTRA 1U1MA 2CPJA 2CQ3A 2QFJA 2MZTA 1PO6A 1A9NB 2JRSA 2KYXA 2LCWA 2KM8C 2MZRA 3J7ZT 2NLWA 2MY7A 2MSTA 3CCJS 1FO1A 2KXHA 3HI9A 1U2FA 3UCGA 3UE2A 3MDFA 1VC0A 3NS6A 2DH8A 4WFAQ 2I38A 2LQ5A 5DDPC 2E5GA 3THPA 2MQPA 3P3DA 2CPIA 3UWTA 2CQ1A 2HZCA 3VAIA 3J7YU 3CCMS 2NZ4A 1JJHA 1XN9A 1U1QA 2DIUA 2DGQA 2BZ2A 3H2VE 2DHXA 2F3JA 2HGMA 2DGXA 5GADU 2PE8A 3FEYB 2L41A 2X1FA 2SXLA 2MZJA 3MUTP 3TYTA 1VQ6S 2XNRA 1WF2A 2DNMA 1B7FA 4TU9A 1WHXA 2M4MA 2DNGA 1WHWA 3MURP 4C4WA 1HA1A 3LQVA 2DISA 2G4BA 1A7GE 3P6YC 2KHCA 4F26A 3N9UC 2XSFA 1OPIA 3R1HA 2CPZA 3TO8A 5GAEU 1SXLA 1O0PA 2DGUA 2MMYA 2FY1A 2WBRA 2MZ1A 2A3JA 1WEYA 3DXBA 5BJRA 3MD1A 2YH1A 1N54B 1SJRA 1OWXA 2G1DA 3RW7A 1N8RT 2VOOA 1S79A 2ADCA 1ZH5A 2LECA 2XB2D 1U6BA 2D9OA 1DRZA 4U67Q 4TU7A 2KRRA 2KXNB 3CCSS 4UY8T 1D8ZA 2FC8A 4TU8A 1WG4A 2LEAA 2YTCA 3NNCA 1G2EA 1OO0B 5JVHQ 2MKJA 2KG1A 3CCES 2DK2A 1X4BA 2LXIA 2LA6A 1U1NA 4WCEQ 1RK8A 3VF0B 3IRWP 2JVOA 1S72S 1FNXH 1KD1T 4OZ1A 2KRBA 1HD1A 3P5TL 1VQ4S 2EVZA 3CXCR 2D9PA 2MQLA 2VONA 3B4DA 2ZJPQ 3MI7X 3UCUP 2CQIA 1X5TA 2CPXA 3OW2R 4LJMA 4Z2XA 3VAFA 3CC7S 1WF1A 2M88A 1D9AA 4FXVA 2MQQA 1X4CA 5IFMA 2D3OR 2HYIB 2M9KA 2M8DB 3MXHP 1VQKS 2CQPA 2MKSA 3CULA 1WEZA 2OTJS 1P27B 4CIOA 3UD3P 2U1AA 4QPTA 5CYJA 4C7QA 2KU7A 2MQMA 2YWKA 3CCRS 5FJ4A 5IM0A 2CPFA 2I2YA 3DLLQ 2DNHA 2LXUA 5D78A 2XNQA 2CQDA 1SJQA 1UAWA 3CC4S 1DBDA 2B0GA 2MQOA 1WI6A 1YITS 1YIJS 1FT8A 4IO9Q 2OIHA 1BY9A 2CQHA 1X4FA 1X5OA 2QA4S 2ZJRQ 1YTYA 1X4DA 1KQSR 2CPYA 2M2BA 1H6KX 2DH7A 2DH9A 4IUFA 3D2WA 2KN4A 3K0JA 2CQ0A 3JB9k 2RQ4A 3EGZA 1AUDA 2KT5A 2DB1A 1VQ5S 5MLCV 2MPUA 4YUDA 2KH9A 3G96A 1M5OC 3NMRA 2RRBA 2DNRA 2N3OA 1Q7YT 3U1LA 1N88A 1HL6A 5JVGQ 2L08A 2V94A 2RQCA 2MZSA 5DM6Q 1PGZA 1FXLA 1M5VC 4ERDA 2J8AA 4A8XA 2OSQA 5DETA 4ED5A 4IOCQ 2DO4A 3CC2S 1VBXA 3MOJB 1JJ4A 2E5IA 5CXTA 1VQNS 2AYGA 1OIAA 1H2UX 3S7RA 2K3KA 5GVQA 5LJ5Y 3CCVS 5LXRA 1FHTA 2QEXS 3U1MA 1JJ2R 1UW4A 2DHSA 1SJFA 2DNYA 1U6FA 5H1SV 4J5OA 2KVIA 2FC9A 2DNQA 3I56S 1DHMA 2CPDA 3NS5A 1NO8A 3G8TA 3IWNC 5IQQA 2AYBA 2PEHA 1VQLS 2MHNA 2L9WA 1VQ9S 4CQ1A 1H2TZ 3BO2A 2MYFA 2DHAA 1Q81T 2MJUA 2KG0A 4YB1P 1NU4A 2AYMA 1RKJA 3LPYA 3CCQS 3BO4A 1R8HA 2M52A 4FXWA 1SJ3P 2EK6A 2CQ2A 3VAHA 2CPHA 2CJKA 5HO4A 1U1OA 1WG1A 1YI2S 1JMTA 4RU2A 2GHPA 2MB0B 5LSOA 3H2UB 2VODA 3THTA 1WEXA 3B4MA 1WF0A 1X4HA 1M1KT 2OTLS 2RNEA 2JWNA 4F02A 2DO0A 2CPEA 2AYEA 2CQGA 1L3KA 2JVRA 2Q79A 5GAHU 2CQ4A 2DGTA 3CMAS 1U1PA 1X4EA 2XS2A 5ITHA 1ZZNA 3SXLA 1X5SA 1K73T 4QQBA 1VQ8S 2LA4A 1WHVA 2XS7A 1FJEB 2DNPA 1QVGR 3BEGB 2M70A 1IQTA 2LKZA 4WKRA 4C0OC 1WTBA 2M7SA 5LSLA 2FHOB 1KC8T 2DIVA 2DNZA 2AD9A 3RW6A 4PKDB 1VQOS 5LXYA 1YJNS 1VC5A 4LMZA 4W90B 1M5KC 2KFYA 1VBZA 4QU6A 3G6ES 1WWHA 2RRAA 2U2FA 1UP1A 1KOOA 3EGNA 4Y0FA 5DDRC 3P49B 4Y00A 2K8GA 5EN1A 3ZZZA 2VOPA 2X1AA 4M5DB 4P6QA 4UQTA 4CH0S 2MKHA
chains in the Genus database with same CATH superfamily
4RNMA 3V6DA 2GO9A 4ILLA 1S76D 3GCXP 1NSQA 2MLZA 4JYAJ 1N5QA 3CUNA 2W9BA 1FXDA 1QM9A 2R7QA 4CH1A 3NWRA 3HHNB 1TP7A 4N7TA 3UNGC 4F2RA 3G2XA 1NK6A 5D4OA 4DCOB 2HHSA 3JTPA 1IR2A 1C0UA 4O4GB 2HBRB 2H3EB 3CD6S 2V2QA 4M95A 2AU0A 4M1KA 5ETRA 1GMVA 5B09A 4J9OA 1FRIA 3ZC4A 7FD1A 4KC5A 1H2VZ 2IHR1 4ANEA 1HD0A 1GT8A 4CP5A 4B3SF 1EX8A 1H7XA 2I9SA 4DSLA 2G2YA 1X0FA 4DU8A 2CDQA 4F0HA 3S8SA 2IC3A 3QT6A 2DEIA 5GAGU 3DM2B 4UOGA 2QX0A 5JUMA 1V5VA 1RHRB 1K8AT 3PRBA 2ZH7A 2HBYB 3I31A 2OI2A 4AL6A 4Z37A 3PXGa 3KUHA 5BYQA 2D69A 1E6YB 3EPGA 2CJ9A 3FFIB 3PJWA 4OV1A 1LQ9A 1HNWJ 4ES2A 2VFUA 4Y6IA 5A2QU 1XC9A 2RH3A 1WC6A 4DR7F 1FDAA 3L95X 2FVCA 1SVDA 4CO0A 3K58A 2MZTA 1AA1B 2KM8C 1OPZA 2C22A 3P5BP 2XSJB 1FFSB 3GFXA 5L1IA 4PUOB 1F3VA 1JWWA 3D9BA 3MCMA 5DDPC 2CPIA 3VZIA 3SV4A 3H42A 4FS2A 4MYTA 2F3JA 2DGXA 5GADU 2JFDA 1SKRA 3M32B 4KBIA 2DNMA 3WBZA 5D3GA 2NXCA 3FSXA 4RBTA 3N9UC 1FKPA 4R25A 1FE4A 3W60A 4ZPCA 2X3DA 3MR3A 1RT6A 2W2PP 2YH1A 1RYSA 4TY8A 3ZO7A 1S79A 2D9OA 1DTQB 4RW8A 3TARA 2F4VF 1LW2B 1YZ7A 2NXJA 3RRGA 5T41A 2HQIA 2QJ3A 2EFNA 5IV3A 1XMOJ 3OL8A 4B3RF 2E7WA 3D3BJ 4LBIA 3TQ1A 3G6YA 3N01A 1T9YA 3EICA 5HMYA 1XEZA 2ZNZA 2HBQB 3KJVB 3U7JA 2D3OR 2NR0A 3H8YA 3UD3P 1VFJA 5FJ4A 1S48A 2PI4A 1PBAA 1X0PA 1EZZB 5JXSA 4GKKF 1MMNA 3AOAA 2QA4S 2BOAA 4K7QA 5G4DA 5ETVA 3F56A 3HK2A 4DPYA 3V81A 2H51B 3I82A 3ENWA 1AUDA 4J9SA 2BKPA 3R2DJ 2V8GA 1HHSA 4O23A 4ILMA 2UU9J 4WYWA 5JVGQ 2L08A 2V94A 2GGPA 2KZMA 1UFKA 4WJBA 5A2QY 3CC2S 3BGFA 4PQUA 2AYGA 2K3KA 1NPPA 5GVQA 3TVKA 2BABA 1IKXB 2XQCA 5A0YA 5IQQA 2GAGC 3DGPB 3MCNA 2FY8A 4DL7A 2XZWA 4R5PB 4ITSA 3ETOA 1IUJA 3SQGB 2NSBA 4JI4F 5ETSA 2JNJA 1TFYA 3R7SB 2YNGB 1FX2A 2DD8S 2GHPA 1HQUA 2FVRA 1MN9A 4CM2A 1XBWA 2OTLS 2Q79A 3CJ3A 4PG7A 1RP5A 2AEJA 3H4BA 4QWAA 3SBMA 1ZZNA 2IYGA 1GQEA 3TA2A 1M5KC 3G6ES 1EHWA 4QIVA 1IBKF 4I4BA 4P6QA 3S1TA 1U4BA 3NG8A 3A3OB 1AT1B 3G4SS 4DL3A 1REVB 2B9WA 1RCOB 2UP1A 3MPVA 3I87A 1RU1A 1JLAB 1DQ8A 5FIIA 1QSLA 3GSIA 2Z2ZA 4OZ0A 3PW5A 1KP6A 2KM8B 2NPIA 2VBZA 1DFDA 4PR6A 1PAUB 1V3SA 2CQCA 1B64A 3MM5B 5D0GA 1PG5B 1RBOB 2MGZA 1QLNA 2M3DA 4C8LA 2JX2A 4UOFA 2XGQA 4K5SA 2RS2A 1FE0A 1UA1A 3SDEB 3BS9A 3VGTA 4YY3J 4NI2A 2RJZA 1QUPA 3CJSA 4QIFA 1KWMA 2KO1A 2OKQA 5IWAF 2P6SA 4OLPA 3T1YF 2BVZA 3JXOA 1J27A 1SJ4P 4ZMMA 3IG1B 2OFGX 1WKLA 2XCPA 3OFFA 3ZTRA 2W01A 2Q6CA 2UUBF 3MEEA 4NLWA 4I2QB 1QSYA 4WE1A 3VR1A 1MLAA 4ID5A 4ZLPA 4DR4F 1KQFB 2HZVA 4C11A 3MPUB 2DGWA 4RJVA 3G86A 2Y0SD 1L3VA 3KDNA 4DFJA 4R8UB 1WC0A 1T9TA 4ZVSB 1TVRB 2IJRA 3FZBA 2UZAA 4DFMA 3EPIA 2WRMA 3OXFA 4KHMA 2VV5A 5ETQA 1UTAA 3D0HE 4URQU 2L41A 4KH0B 1BWVA 2BR0A 1B99A 5HAOA 1RTIB 5K8MA 2ZH4A 3DLEA 3RTVA 2NYIA 3PVXA 4ED6A 3LGNA 2OPSB 5DLFA 1RAGB 4HACA 3CJTA 1SJRA 2B4VA 3PJ9A 2CVEA 3R8YA 3Q89A 2RHSB 1RWOB 1L3UA 2IBKA 2XY5A 5HJXA 1FJGJ 2XZDB 1ZM9A 3LANA 1R8CA 2JFKA 2ZM6F 3IRWP 4NCGA 5LM7E 1S6PB 4DV3J 3QIDA 4D3HA 1ZOTA 3JYTA 3FCVA 3LP1A 2KHDA 1DURA 2DT9A 1N33J 1C4CA 3HF5A 2M9KA 2YVSA 4FBTA 1HNVA 2CQPA 2MKSA 1WEZA 2E29A 4QW9A 5J1EB 4AD6A 3OHAA 2YWKA 1XMQF 3KLIA 2E5LJ 2WBMA 1H73A 1LWCA 1UAWA 3GONA 3UO0A 5D15A 1YITS 4IO9Q 1S1VB 4QYZK 5F9NA 1VK3A 5MLCV 1LWEA 3UDEA 4NOHA 3RGIA 3F41A 1Q8LA 4L73A 4Q8FA 1M5HA 2WSCC 4ED2A 1CPZA 2OSQA 2XMUA 1TUGB 3RBEA 5DETA 1ZM4A 1AFJA 3QSIA 2LDIA 1X9MA 1YK9A 3DGVA 4DR1J 1YG0A 3MR5A 5G0RA 2YKQA 4OYWA 3GG0A 2PSZA 1MWYA 1NM2A 1X31C 3AH6A 2L9WA 1VQ9S 3FRZA 1SI9A 1CJVA 2MJUA 1AZSA 3LAMA 1UW9A 3UR3C 1ZAWA 3G6VA 4BDPA 5J2PB 1JXLA 4LF7J 2JEGA 1JMTA 4H4OB 1JLCB 2BJ7A 2VU5A 1S7IA 2L9NA 4ZITA 2VODA 3IR7B 3SI8A 3J7AN 4LT6A 1S59A 1M1KT 2RNEA 5CZVA 2MHEA 2IYIA 2CQ4A 2BYCA 4F4AA 3HP6A 3D6FB 1FFWB 3E2EA 1OY6A 2W7OA 2XMMA 5J2QB 5A6WA 4WKYA 3QGIA 1N56A 1SC6A 1HBNA 3KLEA 2CYYA 4UZBA 4DUZJ 2C2RA 1D9DA 2BUNA 3OSPA 5J2MA 2ZOFA 3OTDA 4DUYF 4N77A 2P9GA 3DLKA 4LSLA 3ZTPA 3DRPA 4TYAA 1FRLA 1FA0A 1WI8A 2V0NA 5C2GA 1AB8A 3CDBA 4CDIA 1FVSA 5IC6B 4P2FA 2CJYB 4L76A 1JLFA 4Y34A 4OI3A 1OQ3A 2XWXA 1LKZA 3IC1A 1FRJA 1WELA 4KQZA 2UVWA 2FLOA 1RYRA 4JI6J 5KG6A 4KB7A 3M05A 2M0GB 1NK4A 5KFGA 3DHWC 3K5OA 1ROFA 3J81Y 3I4HX 2KB2A 1WC1A 2UXCF 1EARA 3HSDA 3ET6A 2BOPA 2RS8A 1X5PA 4WZQA 1V9OA 1MW7A 2UVVA 4B9UA 3PFEA 1YHQS 3PACA 2FYXA 3TJ9A 5K9FA 3GFYA 1GXTA 2Y3YA 1WKJA 4YHHJ 4M5JA 3DNCA 2AV5A 3I0RA 3X1LB 4EBEA 4O4RA 3LTOA 4L74A 4E8UA 1LK7A 2AP6A 3R9LA 3DLBA 1W2BR 1SV5B 4DR3F 1NK0A 2VD3A 3R3TA 3OFGA 3L4BC 3BSNA 4HR2A 1WHYA 3Q8UA 2MQNA 2YH0A 2UVUA 4LRFA 1RT3B 3LP0A 3UPFA 4BLGA 3ENQA 2MQ8A 4HTJA 4K0KF 4OQJA 3J7ZT 2MY7A 2WK4A 4CTAB 1IQZA 1RHKB 2I38A 3UQSA 4K4TA 3HFZB 4I2PB 1HQEA 3RRHA 2CNKB 4JV0A 2WHOA 3T3FA 2R8KA 5F8MA 4OI6A 1FKOA 2EFVA 3PEJA 1L5UA 2SXLA 3MUTP 4ANCA 2XNRA 2KT3A 2VKZG 1NDLA 3N5FA 5L46A 3R1HA 2F5GA 1F3FA 4K4VA 1S12A 2A2CA 3KDOA 2PFFB 4O3NA 2HQFA 2KZZA 3Q8SB 4YR3A 4RW6A 1QDUB 3ZTOA 1Y3KA 2ADCA 1XR5A 4OYAA 2OPQA 1T9VA 2OEJA 4DPUA 3TVZA 1T7PA 5J2NA 1WG4A 1JK9B 2ASJA 4PXBA 2BE2A 5JVHQ 2CFXA 2DR6A 3KLGB 3LAKA 1KBRA 4F4KA 4C3LA 2DRBA 1IKYB 2MLXA 2Z58B 4W98A 1S4EA 2KJVA 4EMDA 1VQ4S 4RUHA 5HQLA 3AOBA 1NSAA 3G87A 4DCJB 3OV7A 3IS9B 3OW2R 3PW4A 1TKDA 3CC7S 4OYIA 2M88A 5IFMA 1NKBA 2JH3A 4P73A 1B0VA 3IGVA 4ZCIA 2M8DB 4UOHA 4DV1J 3MEKA 2VG7A 3UN3A 5D6GA 4NLPA 5KFOA 2F4FA 3LPEA 2ZH9A 4F7VA 2DNHA 4Q2LA 4URGA 1WI6A 1YIJS 1UEKA 1VHIA 2CQHA 4NLXA 2HLTA 2OEMA 4X4PA 1IR1A 4KIAA 2M2BA 4DX5A 2C2MB 5HMWA 2HNDB 3H2LA 1GMUA 1NDKA 2KT5A 1EETA 1VQ5S 4DPTA 3NGKA 3K5MA 1TK5A 3DLHA 1TL3A 2APOA 2ZITA 3E01A 4ZPTR 4K4UA 1DQAA 4NLSA 4KSEB 3KLVA 1M5VC 4IOCQ 1JJ4A 5CXTA 4WBFA 3MTJA 2QA4G 4C0BA 5LJ5Y 1FHTA 5CCLA 4J5OA 1HARA 2H5JB 1DHMA 2CPDA 3M1VA 1BLUA 3NS5A 5KFJA 5B0FA 4RNHA 2VJUA 3SCIE 1TTHB 1RTDA 3CJ5A 4WP9A 3BGLA 3UN5A 4USWA 3KHGA 3ZTSA 3FRYA 1FESA 2QLWA 3I0SB 2JHEA 5DG7A 1Y5NB 1TK8A 3POTA 2MB0B 4M5KA 3THTA 4HYKA 3QLHA 2DO0A 2VG5B 2ZNYA 2AYEA 1O51A 5SUHA 2CIMA 1VRUA 5ITHA 1KEKA 2DXEA 3C14A 4QQBA 3W2VA 2O67A 3ILLA 2DBBA 1I94J 1QAXA 5LSLA 3VGSA 2HVHA 2CXEA 2BJ9A 3M2VA 4IFYA 2C2DA 4EEYA 2U2FA 1SL2A 4KT0C 3T5JA 4N41A 2HAFA 2Z0GA 3VV2B 2GJFA 2RDIA 4CO3A 1N36J 3ZZZA 2VOPA 1S1UB 1N5YA 5HVHA 2QRRA 1S99A 2R2RA 1MROA 3P96A 3US5A 3ICLA 4NYOA 3BR8A 3JS9A 3D28A 1HIYA 2J0QD 1Q8BA 3HHLC 3MR2A 2IJNA 4CO2A 2F1FA 4LFAJ 1RHMB 2AF6A 3FCWA 2O3DA 1UETA 3IBCB 3PV8A 4KRWA 2KFZA 4KO0A 2HQCA 5U47A 4N56A 1WUUA 2VB6A 3DRXA 2C1EB 3BGUA 4KAIA 2XLIA 3M9NB 1Q82T 4LSZB 2F9DA 2N82B 2YWEA 1KTQA 4DX6A 1J5OB 4I67A 2ZC4A 5B7WA 3N28A 2N7CA 1YJUA 2FD2A 3PIPQ 5IZHA 5LT5A 4KHRA 1LW0A 4WFNQ 3QZ8A 3QJPA 5DGAA 3AQOA 1ZA2B 4PZVA 1QVFR 3K7RA 1JXEA 4YDDB 2PD1A 1VRTB 4IG0B 3U27A 4IR1A 1FF2A 2WONB 2M8HA 3UNYA 2QLXA 2H1YA 4IOAQ 2DHGA 4DV7J 3SCKE 5LL6d 1UVNA 2ERRA 4W92B 4O0NA 1YQHA 1BQNA 4LF4J 1U45A 1PO6A 1NDCA 3EYZA 2B6AB 3HI9A 3RB0A 2EEYA 1VC0A 2Y0BB 2PC6A 3ENAA 5HQ8A 3P8BB 2CQ1A 1JJHA 1UVKA 2DGQA 3UVJB 2RF2A 4X4QA 2KDOA 3G82B 4JI5F 2Z2YB 4M5NA 3PYFA 5CYMA 4TU9A 1WHXA 2VASA 3GV8B 4RUAA 4F26A 5DGBA 2XSFA 3TO8A 4BC9A 1RAAB 3K5LA 1R8BA 2BBEA 2DGUA 3JQKA 4KPCA 2F40A 1WEYA 3DXBA 2VPWB 1N8RT 1NJZA 3TAPA 2LECA 2YWGA 3RBXA 2Q1LA 4M5MA 5ETLA 3R7NB 3CIMA 3CCSS 4YB6A 2LEPA 4B9LA 4A8WA 1RTJB 5EGYA 1BQMA 5BR8J 2QLBB 2JL9A 3RB4A 5GAGI 2KRBA 1HD1A 1EP4A 3CEDA 2MQLA 2FZKB 1U26A 4F67A 3KFWX 3T9NA 1FX4A 4Z2XA 4FDFA 3C6TB 1FEHA 4FXVA 3T5HA 1JLQA 2VA3A 3BYRA 1NH8A 2HYIB 4NXNF 4U7UD 4K59A 1NHVA 2VF3A 2XLKA 4CIOA 3SCJE 3I9ZA 1JLBB 4QPTA 3KLHA 4ECXA 2E1AA 1RT4A 1BXNA 4NZ7A 2IM2A 2LXFA 3DXSX 3HHEA 3KJNB 2OIHA 2W7PA 1PJ5A 4A8KA 1O6XA 2B5JA 3ZTQA 1NXIA 4EZ9A 4PXEA 1C0TB 4KH1B 4MK8A 4I7FB 3PR5B 1VISA 1RGVA 4B9TA 3MMJA 3LGHA 4OYBA 2RQCA 1FRXA 3FSYA 2ALYB 1G4CA 5GADI 3KUEA 1T03A 4X4RA 5B0DA 2JLEA 3H5YA 2HQ3A 3AAWB 3CVKA 3A8IA 3MM6A 1U0HB 5HLFA 2VKRA 3TQEA 4NLDA 2YX7A 4H4MA 3MPYA 4LBHA 2R7UA 3BO2A 4JUZA 1GH8A 4KY3A 2QFIA 1Z4UA 3BPSP 4NRTA 2EK6A 1YX2A 3OTBA 1YI2S 3HVAA 4XPEA 2WOMB 4ETXA 4HKQA 2AT1B 7AT1B 3NAIA 4JI0J 2JWNA 3QMQA 4KGVB 3W8GA 3A4TA 4ZVGA 1Y10A 1VQ8S 1TKZB 2LA4A 3HHKA 4RUBA 1FJEB 3HVTB 3KJQB 3RW6A 2HHUA 3PR4A 3DI6B 2OELA 2DKOB 4ZP7A 1TFWA 1XERA 1C4AA 2RKIB 1Z2LA 4HHUA 2AJFE 1YJWS 3R5JB 3OTEA 4RW9B 1S10A 5LJ3Y 3FBBA 3OVSA 3K89A 2BE7D 3DRSB 2CJAA 2DRDA 3NRBA 3A8EA 4X4TA 2XI2A 3H20A 4JI1J 3GE9A 4M8LA 3DM2A 2RU3A 3OT9A 3ULHA 2DHHA 3OJSA 2E66A 2F65A 3TZYA 3TJ8A 1E6YA 4JV5J 2WVCA 3FFIA 3KUGA 1Q86T 3QQCD 2VUGA 5L9NA 2IMOA 3GB0A 2G1HA 3KK2B 1T95A 3DDKA 4I6YA 3W9HA 3ZFVA 4LQ9A 2LYVA 5E5NA 4DS4A 4PWWA 2UUTA 3HJVA 1NEEA 5M2RA 3MM9B 1FNMA 4F8RA 2R7RA 1IKWB 1VI7A 4PUOA 1P1LA 4D3GA 1K9MT 3CJ2A 2DNLA 2HQGA 1FRMA 4FYYB 2Y9HA 1RWWB 4V19J 1TUWA 5C24B 4G65A 2WVBA 5DJBA 4EZ6A 5HANA 2YKPA 4ED3A 3CTRA 1ZM2A 2HVEA 2YKMB 3NCQA 4JP8A 5E41A 4DJBA 8RUCA 2MSTA 2LQ5A 2RMLA 3P3DA 4ZDNA 3JTOA 4J9RA 1DTQA 1OYDA 2ZH2A 4ZK7M 4Q0BB 2EG1A 2DHXA 3BPDA 3Q24A 1N0VC 1LW2A 3DOMA 4B17A 4RUCA 4NLVA 3BB5A 2E1PA 2FUG9 4B3TF 3QJLA 2XG8A 4X64F 2RQMA 3QAEA 1D0EA 1HNIA 3KJVA 2XB2D 1KVIA 3K59A 4ZPWR 4UY8T 3RRKA 4ZHRB 2VQEJ 2C2OB 5I3UB 4KV8B 3CCES 2DK2A 5HSPA 2LA6A 4DZ6A 3VF0B 4RNNA 3GYNA 4ELTA 1Q5YA 3P5TL 3R2CJ 4DV0F 1X5TA 1BWEA 2VL1A 3ILOA 4NA2A 2LQJA 2BE9B 3DMJB 4DHVA 4IO1A 4PABA 2OHDA 4OYOA 1TU0B 5HBMB 4OJ3A 4PG8A 5EWFA 4PXCA 2MQMA 3ENVA 4QR2A 2QT7A 1RHQB 2CZ9A 4NLTA 3PTWA 2XNQA 3CC4S 2D3UA 3W5ZA 5FDLB 4CWBA 4PEOA 1IKXA 3O5TB 2R42A 4KGZB 2ZBRA 4IOBA 3L7UA 3W62A 4R0JA 2OAUA 4FXDA 3D2WA 1QE1B 4DV4F 3MM7B 2RQ4A 1QAJA 4R5PA 2CJXB 2E7XA 2V4JB 2ZBIA 2GIRA 1PGZA 2YNGA 3HULA 4GMKA 1B70B 1CJTB 4H4KA 3EVWA 2UXDJ 3FQKA 2KVIA 2FC9A 2R4FA 4ZA1A 2AYBA 3CDUA 5BYSA 5EUHA 3DCAA 2B9XA 1HI0P 5B0GA 4CT9A 4ATNA 4DU7A 1RKJA 4DSFA 4CZCA 2DPIA 4C8MA 4FXWA 5K8OA 4KTQA 4QWCA 3FCHA 3DYAA 4XK8C 3BGRB 2W9CB 2UXBJ 1N32J 1RQ0A 2JVRA 2ACMA 4DDFA 5HMZA 4LR9A 1REVA 4ED1A 3M8RA 5KFZA 4J9KA 1JLAA 3FUYA 5GAHI 3PKMA 2HHTA 1IQTA 2GVDA 4DV6J 1SUQB 4AT1B 3OTCA 1RA7A 2GC8A 4USTA 1YJNS 3A8KA 2UVRA 1GAOA 4WXWA 2BQRA 2H65B 4G1QB 3C2PA 2LQ8A 1X9WA 2K8GA 1VQSA 4PWDB 3IN5A 4CH0S 4CH7A 4DN9A 3KG0A 3SDEA 1U1RA 3MAAB 1HWUA 1C2PA 3D0IE 4V1Ak 4LBPA 2GQQA 5DDOC 1ULRA 3TRGA 1JLEB 2F8EX 1DAXA 2X1GA 3I55S 1VLOA 3WC0A 4LF9F 4I2QA 3CCUS 1OS5A 1F5BA 3OL9A 2V8DA 1N52B 5L8RC 3CF5Q 4TLQA 2RU9A 3TJAA 2ZH3A 3HD1A 2EK1A 3D6HB 1N34J 2ASLA 1DZ5A 3HFVA 4ZVOB 5CH7B 1TVRA 2UUCJ 3W61A 2CUYA 2RDDA 1KKHA 4B3MJ 4ENOA 2EXUA 2LFVA 1PCAA 2PN6A 1FJCA 4I1TA 4X65F 4OI4A 2FZGB 2E5JA 4ZJLA 4CLUA 2AEMA 2ILYA 4MYUA 3PRDA 3W66A 2LU2A 1WOOA 1KQKA 2ZOMA 1RTIA 1HI8A 5IXUA 1Z2ZA 2JRSA 4P71A 3TUJC 4J90A 1WSRA 2OPSA 3MDFA 3BQ1A 4A8OA 5IT9Y 4DQSA 2R7VA 2ROPA 4QR0A 2UUWA 3KYLA 4K5RA 3DLGA 1U1QA 3ETMA 2HGMA 4YFUA 2BQ3A 4A8QA 2DNGA 5D4NA 4LRCA 1OPIA 4P52A 3TX8A 1FNOA 3TEGA 2HRYA 2YX4A 1URRA 2YBVA 2X7IA 5BJRA 4EYHB 2F8HA 4LF5F 2B7BB 1D3WA 3AJDA 1U6BA 3QGPA 4TU7A 5C42B 4K2XA 4C8YA 2H54B 1KLMB 1C0UB 4HH0A 2GVZB 4O3PA 1I6JA 3QRRA 3DDIA 3NLCA 4ED4A 1HBOB 2JLFA 1G6BA 1S1VA 3M8YA 1TL5A 3LW5C 3OBIA 2JOQA 1UPMB 1YGYA 2D1CA 1HW8A 4ZVPB 4NMLA 1XR6A 4K50A 3RB6A 3M4XA 2PMZD 1FWPA 2OGUA 1HKAA 5HK4A 4IQXA 1S5ZA 2KU7A 4E98A 1MU2B 4JBCA 2CPFA 2I2YA 1NMEB 5AE1A 2QLFB 4ECUA 2E1RA 3NCRA 1Q8IA 3PZPA 4RNOA 1IBLF 1VHFA 2FJBB 1H6KX 2DH7A 1KQGB 2HURA 2Q3PA 2ZDPA 4GKJJ 4N5SA 2DNRA 1Q7YT 1NSPA 4IFVB 4PYAA 5J2PA 2AGPA 3Q0AA 4LF6F 4BWMA 4BBYA 1RWXB 4H4OA 1B0TA 1JLCA 5KAKA 3NGDA 1H2UX 2WSEC 4JYAF 4WIQA 3CD5A 2G0IA 2IVYA 5J2QA 3K17A 3HPOA 1JX4A 4R0EA 1QTNB 3J7Z5 4QYZJ 2WW8A 2Y8WA 4OHWA 4DLEA 3PCOB 1Q8KA 3CD7A 1S6UA 2M52A 2CQ2A 4KHPJ 1RBLA 1JB0C 3A8JA 5L1KA 1VDHA 2CPEA 4K8RA 3AJ2A 1KHWA 3JAMU 4TY8B 4DEZA 3DLJA 3SYZA 1ZAVA 4IR9A 5A8KB 2HNZB 2XBPA 2JZ5A 3EM1A 4AQYJ 1WTBA 4QJVA 2IRUA 4Q8EA 3NXZA 2KFYA 4C3KA 2EKYA 4C3MA 1XNQJ 4X4SA 1CEZA 2RD5C 3D54A 2P8IA 2X1AA 1VK8A 5JMNA 2PIIA 4ALZA 2ZBQA 5L39A 2QG9B 1S1WB 1FI4A 5K8NA 1KONA 2G13A 3CNQP 4TXSA 2DYAA 1FD8A 1HNWF 3NNHA 4CM0A 3HSZA 3BSOA 3GLJA 4FZVA 3U1NA 1PIEA 2VBXA 4Q7AA 2ADBA 2C3MA 2V50A 5RUBA 1S6QB 1NJXA 1DTTA 4NRUA 4L75A 4E0DA 4RBVA 4EYIB 4M63A 3FSIA 3LP2B 3GIKA 4DR6J 1S0OA 3TANA 1C1BB 1MWZA 3BN4A 2DR8A 4YB7A 1NJWA 2DGOA 5DZ7A 3WDOA 1SV5A 1NZ8A 5DDQC 2VPZB 1JKHB 3RB3A 5LSRA 2GGPB 1WSVA 2IMWP 1YJ7A 4B9VA 4ID8A 1Q53A 5HATA 3UDLA 1R0AB 1FKAF 4HI2A 1T9WA 3Q86A 2DGSA 5I42B 2XY6A 1X4GA 3LF0A 4CTAA 1VBYA 5AXLA 4OI2A 4I2PA 4HTIA 4MMOA 4DN0A 5F3TA 1DQ9A 2HG4A 2XZTB 2HHPA 4J9UE 1N5SA 4HEA9 3MD3A 4X62J 1XMOF 4KFBA 1HQUB 3KMQA 1GK8A 4AL7A 2XCAA 4K4ZA 4NX9A 3HVWA 4HHJA 5F8GA 3FVYA 3JAMY 3EZOA 1SJ1A 3JSMA 1HBMB 4P75A 5D4LA 1UPPA 3WC2A 4DMZA 3H2VE 2NCKL 4F04B 3FEYB 3W1YC 4IDKB 3BJYA 1WHWA 3MURP 4C4WA 2ZDOA 5DQIA 3GQCA 1IKYA 3NY0A 3ZZPA 1WORA 2RDJA 2B4OA 1ZPWX 4OX7A 4LFBJ 5KFIA 4ANDA 4OYMA 1O0PA 1Y9OA 2B9EA 2FY1A 2O66A 3IS9A 3JQJA 3OR1B 3PM9A 4OX9J 2G1DA 3QRQA 2I1RA 2UU9F 4HDGA 2R2SA 2XMVA 1ZETA 2XWYA 3QFWA 2CDRB 5CYQB 5T14A 2LEAA 4OV6A 2L9DA 4ZP6A 1YLXA 2OPRB 1RSCA 1X4BA 4WCEQ 5H9FK 2CWXA 5HP1B 5D8HB 4F4ZA 3M2UB 3CXCR 1HR0J 2F63A 1FTCA 5DZ6A 3UCUP 2CQIA 1YVFA 3H40A 1UEVA 2HNDA 4NLRA 1RWPB 4YR2A 2GQCA 4NLGA 4M94A 1NJYA 3KMSA 4DV2J 3CULA 2I5JB 1VOMA 2FLLA 1XIQA 3PW7A 2IFXA 3OR2B 2CG4A 3GV5B 5T7LB 3D1HA 3MCSA 3H7HB 3J80U 1DBDA 5KFVA 4CO1A 3MEEB 4DFKA 1SH3A 1X5OA 4WE1B 2VQFJ 3D6TB 1IM6A 4DBQA 5AE2A 2VBWA 2DH9A 1QAIA 1L3TA 4LSNA 2V4QA 2DB1A 3M7VA 4O3RA 2MPUA 1NB2A 3NMRA 1F9EB 2RRBA 2N3OA 3I0SA 3U1LA 2XEXA 2VDHA 3MCOA 4WK1A 2Z30B 2J8AA 1RKIA 1VMBA 2XGPA 1YKWA 4F0KA 3CO9A 3THVA 3GJTB 3S7RA 1A6LA 2DEJA 4DSJA 4EBCA 3OLAA 1UW4A 4ZPDA 1VRQC 3ITHB 3PEHA 5DQGA 2NSCA 5BXIA 1DLOA 5CHCB 3T5KA 4NXMJ 3MAHA 2KG0A 4HHHA 1NCLA 1NAQA 1PC5A 2HFUA 4FNHA 5D4PA 1WG1A 3DLEB 3DOLA 4FS1A 1LNQA 2DXDA 1S1UA 4F50A 3N5BA 2HK2A 1F2GA 3QPIA 4YY3F 2ASYA 8AT1B 2IPOB 4F3MA 3HFKA 5AJ3J 1QVGR 1RHJB 2J7KA 2FHOB 3OXGA 1IKVA 4NYPA 4Y2KA 3FBCA 4C48A 4NCGB 4QOTA 2FIUA 5DDRC 2IBOA 3BREA 3KK3A 3MEDA 3T1AA 3TW0A 2FJXA 2W2QP 3LP1B 3CCLS 4X4UA 1U1KA 4NCAA 4ZJQA 3C3LA 1UVLA 3N6LA 1CS4A 3NKYA 1J5OA 4N76A 2A18A 3R1LA 3QIPB 1LWCB 1ZTWA 3OTOJ 4O44A 4S0MA 3O6QA 5DRKA 2OMOA 3DOKA 4N47A 3J80Y 2OMLA 4FF4A 3Q8YA 2H5EA 1SC4B 3WIVA 4C8NA 2DITA 3QAUA 4EO6A 4LIWA 2WONA 1QUVA 1J5EJ 4YEAA 3K57A 3QJJA 5CABA 3H0PA 2DNOA 4IG3A 1NKCA 2MY8A 3HCXA 5J1NA 1N5VA 2B6AA 1LK5A 3IM8A 1U47A 1AW0A 2MKCA 1CJUB 2KXFA 1K47A 3L9ZA 4Y28C 2ZWPA 1CJVB 4I68A 2BA9A 1FJGF 3W2WB 4ES3A 1Y7PA 3G82A 4LIRA 1EQMA 3UDCA 5CZXA 2J0WA 2N7YA 2B9YA 4CLFA 1LFPA 2G0CA 4DV3F 4U7UK 1W25A 1EB0A 1WG5A 2N3LA 2CQ3A 1YBAA 3AHPA 3AT1B 3EMTA 3HDSA 2XMJA 4USJC 4UT4A 3KLFB 2KXHA 3GV7B 2A0FB 4LR8A 4NPOA 3UE2A 1N33F 5KFQA 1TL7A 4P2XA 3LWMA 3J7YU 2KKHA 3CJKB 4XDDA 4PWUA 3QNWB 1HBNB 1RAHB 3KLEB 2E5LF 1RTJA 2PE8A 3N4WA 4OJHA 1QY7A 4X4NA 2M4MA 3CE8A 3CGIA 2RE1A 5AXNA 3IXQA 2MKYA 1FDBA 1TELA 1R3NA 1HNXJ 2V9KA 4JI3J 1NKEA 3DRPB 2W25A 3C6TA 1S57A 3KTQA 4NA1A 2LDYA 3M2RA 2FC8A 1XTZA 4OL8A 4ELUA 1JLBA 4U6PA 3BDPA 4CLTA 2KG1A 3M8QB 2BMBA 2R8IA 5M2UA 4N8OA 4WFYA 1U0SA 1Y0HA 1U6ZA 2OP5A 4DR1F 4PG5A 5KFKA 3L09A 2D9PA 2ALZA 5L9XA 3Q8RB 4ZLJA 2C2KB 3VAFA 1RAIB 1C0TA 4I7FA 4DPOA 2FLNA 1RT1B 2DJWA 1FDDA 4LF7F 3V6JA 5AT1B 2B8PA 4C7QA 4DX8H 1U02A 3FK4A 4J7CA 5IM0A 1UZDA 1JQGA 1O8BA 1SKSA 4MFBB 4PPDA 3N79A 4TQSA 1FT8A 1U0HA 3HSJA 3FDSA 2VDIA 1X4DA 3M30B 3A13A 4DF4A 1KVKA 5ETOA 4UF4A 4KGKA 4YUDA 5HJYA 2AQ4A 4DUZF 2IRYA 4DS5A 2ZFHA 4JI8J 4WK3A 2RAQA 1VQNS 2WOMA 3ELHA 4J37A 1NUEA 4OZNA 2QEXS 2DNYA 3BH7B 2GQ2A 2FHKA 3I56S 1HQEB 1TKZA 1PYSB 1U24A 2PEHA 4I56A 3HVTA 1P9QC 1FKOB 2AYMA 2PI5A 4RW4B 5HVGA 5DO2A 3E51A 4JI6F 2YPYA 4RU2A 5LSOA 2RKIA 4CLKA 2HHHJ 4ZVTB 4QWBA 5CD4A 2VFSA 2HVDA 3HJFA 3RBDA 2OPQB 1UKUA 3IAM9 4RW9A 2NUUG 2QMXA 1NDPA 1WHVA 2QYCA 2LKZA 1Y3JA 4AFFA 1VC5A 3B6BA 3G8QA 1EQ0A 4EFAC 2RRAA 2GJ2A 4X66J 1P6TA 4YHHF 1JNRB 2V8PA 2CZVC 4UY85 2YXLA 1BD6A 3VTIA 3G9CA 2R7SA 2R8JA 4DR5J 3TZWA 3VAJA 2NXUA 3QWPA 2HMIB 3KK2A 1Y5IB 3A1YG 3DU6A 2XYHB 1N6QB 1KR4A 3LALA 4XDCA 3MM9A 3DC2A 3KNGA 4DOZA 4QU7A 4LR7A 2LU1A 3VAMA 3CPWR 4O3SA 4FF1A 5IT0A 1BHNA 1BE4A 2E44A 3ZNJ1 2JDJA 2ILZA 1H7WA 4GO7X 2VFRA 4TQRA 4ZN1A 4LFCJ 5C24A 2R8HA 2YNHB 2ZBPA 3ILJA 2DNKA 1S1XA 2QSWA 1N4LA 4IQMA 1SL1A 4C8OA 1NJIT 2IDEA 1U8WA 1LWFB 4MAKA 2WB1D 3M1VB 2JEJA 5A8RB 5I3PA 2HK3A 2X3GA 3A3PB 4BS2A 5A76A 2HIYA 3RR8A 2K06A 1GTEA 1SPBP 2ASDA 3BV8A 2MSSA 1S49A 1G3OA 4DQIA 4Q0BA 2VIHA 1URNA 2HGLA 3QO9B 5KFMA 2GHVC 1FVQA 3SZ2A 2E7VA 4LF8J 4J9VA 1VIOA 4OHYA 3T19A 3NGTA 2VJVA 4RL1A 4UTGA 2HHXA 3PHEA 2NLWA 2VC1A 5JJBA 3W2VB 3DN9A 4A8YA 2E5GA 4OMFG 3EVMA 3THPA 4DV1F 4CYUB 5E3PA 2H4WB 3VAIA 3UI3A 2WSFC 4F0MA 2FJAB 4ZHRA 2BZ2A 2B56A 3OL6A 5I3UA 2MZJA 4KV8A 2J5AA 5KFDA 3FQLA 4ZIWA 1TL4A 2XM3A 5F0UA 4MK9A 4ZVUB 4FVCA 2V2ZA 5GAEU 4RZRA 3LO3A 1RDRA 1SXLA 2AJQA 4USKA 3RJMB 3GG1A 3E8OA 5AXKA 3DMJA 1TL1B 2FHJA 2WW4A 2KXNB 2KRRA 4DL2A 2MKJA 3LA0A 1M5SA 1Y00A 4ZCMA 4ZPAA 1KN6A 1UCNA 4ES1A 4Q2MA 4RU9A 4YS2A 3VGUA 1IM4A 1S97A 3MM7A 3U02A 1BQXA 1PC4A 2POKA 5I3QA 2V4JA 4PAAA 2QC3A 2WB4A 2OTJS 2CJQA 2AJ0A 2V2KA 3F44A 5F3ZA 2LXUA 1CJTA 1SJQA 3NGRA 3M9MB 1PJ7A 2B0GA 3O44A 3GYXB 2AHOB 1PJ6A 4IRCA 2ZKUA 3TUZC 4WTOB 3EWGA 4ED8A 3W3SA 3MPDA 1D09B 1I94F 3R6LB 2KTQA 1UVMA 2BRLA 5KFAA 3K0JA 3EGZA 3PYDA 4NASA 3H98A 1S9EA 5LMNJ 2LQ9A 4C6AA 2UUAJ 2MZSA 1N36F 3OSNA 2AZ1A 3AB4B 4WFXA 2W9CA 2GFFA 4G3IA 1U6FA 4ZJOA 2IIHA 4WU2A 4YDXA 4ZS6A 2YNIA 1NK7A 1NH7A 1F5CA 9RUBA 3I9V9 1WOPA 1SUQA 2FHJD 3QGGA 1X9SA 4LFAF 3W63A 1SJ3P 2CPHA 3GR0A 4G1QA 3RYLA 3UW1A 1T8EA 2ACYA 4IYQA 1E6VB 1RAOA 2YWHA 4QR1A 4PWDA 3CW2C 3K5NA 2CQGA 4EO8A 2G0JA 1QTMA 3CMAS 4K4WA 4NEYA 4MKVA 4RLEA 2GV1A 1MG7A 3OVBA 4MIWA 1PILA 5LXYA 4W90B 5IOLA 1JLEA 1IWGA 4Y0FA 2FJDB 4Y65A 3J7A1 1T3NA 2E9TA 3PX0A 4OI1A 3OQ2A 3Q8PB 3EX7B 1U1LA 2HS4A 1NHKL 3I5AA 1JLQB 4NLUA 3T1HJ 3TAMA 4DV7F 5MAOA 1S1TA 3H90A 3QZ7A 1CC8A 1R0CB 4K4SA 3W9IA 4FPIA 4ZVQB 4LF4F 4ECWA 3HM9A 2E1CA 5KFLA 3W65A 2X1BA 2R7XA 1TKXA 4URSA 4BWJA 2B5JB 1WC4A 4Y2CA 3CJQA 1UZHA 1OQ6A 4V19X 1WNEA 1RTHB 2CJBA 3D0GE 2QIFA 4K2JA 4WF9Q 1YRXA 3R27A 3C16B 4CCHA 1T03B 4HVZA 2V69A 4P2SA 1JNZB 1P1TA 2ROEA 4OZ5A 2F8MA 3S6EA 3L3CA 5GMKa 1SQEA 2XLJA 4XTTA 4H4MB 2LMIA 2E5HA 1D9FA 1UFWA 4MTPA 5BR8F 2NS1B 2HFSA 1F1BB 1XQIA 3MMBA 1VQ7S 2UV8A 3IRXB 1KFDA 2XS5A 2DVIA 1AFIA 1CBKA 4XAKA 1M0SA 2AWZA 3BQ0A 5H9EK 1CJKA 4NZ6A 3UCGA 1I1GA 2BEFA 4QW8A 3L7OA 3NGSA 4N8NA 4A8MP 4Q45A 2DRAA 2JEFA 2FGOA 5C42A 3DDNA 3I6PA 4KKOB 1S9FA 3HO1A 3HD2A 1TQLA 5LMUJ 1U25A 3NOCA 1KLMA 2ZD1B 3AXMA 3ISND 2C2ZB 1ZBTA 1T9XA 2GVZA 1UWBB 1Q1KA 3NP5A 4AL5A 1HBOA 4H4KC 2J9DA 4QCLA 2MZ1A 2R8GA 5KG2A 4ZOSA 4MKYA 1OWXA 1R6YA 2VOOA 4KGXB 1ZH5A 5KFFA 4K4YA 2HKEA 3GJRB 3D67A 3MOZA 1D8ZA 1Q16B 4DG1B 2HWHA 3OVAA 1MU2A 3O3LA 2GZOA 2F7VA 4JI7J 4OZ1A 4KJIA 3ISZA 2EVZA 3IBWA 4LRAA 4LQ3A 2ZJPQ 1RAJA 1HBUB 3H5UA 3TOQA 1TV6A 1WD6A 1EKRA 2MQQA 1X4CA 4LRBA 3ONQA 3HT3A 2EW9A 3UN2A 5KFUA 1P27B 4IFVA 4CRJA 5CYJA 4JV1A 5CAAA 2D3O1 1H38A 3H25A 4QYRA 1VBKA 2PGCA 4JI0F 2XC9A 1N48A 3DLLQ 4OYZA 4ZVEA 3V4IB 5ETKA 2CNNB 4J9MA 3R6GB 5B0EA 2IDLA 4Q5VA 3CJRA 3F73A 4A46A 1XWLA 1T05B 4DR2J 3PJXA 2E9RX 1FRHA 1H98A 4OHZA 2B3TB 2K1RB 4AYBD 4A8XA 4DL5A 3SSQA 2IM3A 2HHVA 3AA9A 2N4CA 2ZH8A 4DL6A 2A6MA 4ECYA 5K14B 3QATA 3MMAB 4B3OB 1I3OB 2VICA 2COLA 5LXRA 3IO1A 1JJ2R 2IVFB 1ICEB 3MMCB 4J9LA 2PA8D 2AJ4A 3HKZD 3T41A 3FZ2A 2QL5B 3DRRB 5A8KA 4RPFA 2HNZA 3IWNC 2VG6B 4UQGA 3MM8A 2MHNA 3HMJG 5KFPA 3WQPA 4JI1F 3DOMB 5F8IA 1MMDA 1RA6A 4MKBA 7FDRA 1R8HA 5A8WA 5ETMA 1RT2B 3MFHA 1Q7LB 1IBMJ 1S9GB 1U1OA 2HW3A 1XNRJ 4FYDA 1IR0A 4JV5F 4F02A 1S1WA 1HNIB 1LV5A 1U1PA 1X4EA 4IH7A 1K73T 4C0HA 3BGOP 2HQDA 3PKYA 2M70A 1WDTA 1H3DA 4UW2A 2DIVA 4DSEA 4A48A 2PMWA 2HNYA 3MTKA 3Q23A 3FJ2A 1S6QA 4P9SA 3PNIA 1DARA 5EN1A 3LP2A 4DV5J 3O2IA 1RTZA 2CWKA 2ATCB 3T9ZA 1C1BA 4QZVB 2FJWA 2FQQB 1OMSA 1JKHA 5CA5A 1S4FA 5C25B 1AYEA 2BJ8A 3Q2SC 4OX6A 4L6V3 4KGMA 4EK2A 1R0AA 4JI2J 4W4MA 3BSCA 3G8SA 5I42A 2Y1JA 1Y5LB 4ELVA 1CG2A 3W8PA 3KWMA 2MDAA 4WYLA 3VAGA 3V4MA 2OJ3A 4NMXA 4DQRA 4LF2A 2GCFA 4USVA 2B7CB 2AX1A 4B9MA 2B4PA 3JTNA 3ZNUA 3G6XA 2EC0A 3CWJA 4B08A 2HRTA 1FEEA 1LFWA 3W5XA 2RRNA 1HNZJ 3CMES 5KOXA 1IBCB 2XULA 5THWA 3I5BA 1V6HA 4DL4A 1HBMA 2MLYA 2VQEF 4DLGA 2BACA 2XO7A 3M8PB 2GA7A 1CULB 5F8LA 3VGVA 1TR0A 4IDKA 3DYAB 3IBFB 1V3RA 3UCZP 4JV2A 1G7CB 5B08A 2ZVIA 2J7WA 4L3KA 2QTWA 3GYGA 4DQPA 1CLFA 3OR1A 4CNZA 3NS6A 4FVMA 1UL3A 5KG7A 1WC3A 2MQPA 3NS7B 2GVDB 4HT7A 4JOUA 1VR6A 2NZ4A 5CYQA 3VWSA 4OJ1A 4B3SJ 2X1FA 3MECB 2OPRA 1WF2A 4CLWA 1HA1A 1HI1A 3RAXA 2G4BA 5HP1A 2L3MA 2HIQA 3M2UA 3UFCX 4RKUC 1T94A 5IC4B 5CQGA 1FERA 1FDNA 5D0RA 1FK9A 3DFEA 1VS3A 3MD1A 3P45B 3QRPA 3FKBA 1HPZB 1DRZA 2OPPB 4XO0A 3SSSA 5ETPA 4B9SA 3HHLB 2I5JA 3Q83A 1KDNA 1GFWB 3OR2A 4PCQA 1V5IB 1RJJA 5T7LA 2UXDF 2JVOA 2AX0A 1FNXH 1KD1T 4RW7B 1WDDA 1H74A 5DLGA 2EBEA 4ZLNA 3QYYA 4DR7J 4RX6A 2BW2A 1RADB 1H72C 4Y2AA 1UJ4A 3B82A 3M6UA 2KYZA 4U95A 2V6AA 3T6JA 2UXBF 1RAFB 1N32F 3BM7A 3RG6A 2ZHBA 2OFHX 2H5IB 4HLBA 4O4GA 1RLDA 1X4FA 3ITHA 2VZ9A 4O3OA 5KT4A 4CI0B 4OFZA 4X84A 5H9FJ 4M5GA 4DV6F 4P10A 3OJUA 2CQ0A 3MEGB 4FYWB 2DY9A 1M5OC 1MSWD 3WZ0A 3J7YI 3GR1A 2I8EA 2FVQA 2W2NP 2DY1A 1BUXA 2OO4A 1Y4ZB 3D3CJ 4L72B 2F4VJ 4UUWA 2DO4A 1VBXA 1RU2A 5F8NA 1F9HA 1F60B 3CCZA 3EXCX 4WP8A 2FTRA 2QE5A 4USUA 1PYTA 4B3RJ 3O8WA 3DLGB 2BQUA 4NCBA 4WPAA 3R97A 2MYFA 1Q81T 2CADA 1NU4A 1PSDA 4X4OA 4I64A 3BDEA 4FYVB 4CT8A 3TAQA 2XMTA 4X2BA 1YRTA 1T02A 2QL7B 3W64A 1WEXA 4FKYA 2V4RA 3BR9A 4GKKJ 2WZ1A 5GAHU 2ABYA 4DWIA 2RUSA 2YQ3A 5E2QA 2XS2A 2XSJA 1LOUA 3SXLA 4U7CA 2XS7A 2L48A 2IAJB 4KE5A 3BEGB 1N34F 1RHUB 3BKFA 1VQOS 1U2CA 3QIPA 1WWHA 3VCDA 3M32A 2UUCF 2V2VA 1HMVB 3MGJA 1B4SA 3PG9A 2Y1IA 1H0HB 3GILA 1PBUA 3J81U 4QIGA 1TKTB 2HWTA 2YY3A 4B3MF 2W24A 3VVTA 2F9JA 2IRXA 2C42A 1BGXT 3UR0A 3D1QA 2R2TA 1WTFA 2HZAA 4QBUA 1RT5B 4ICLB 4A4JA 3T6BA 2FJVA 5AE3A 1QAYA 3GMGA 2W8LA 4JI4J 4FF2A 1RT7B 2D41A 1CJUA 3OD2A 4DSKA 3ZZYA 2W4DA 2VHGA 3AY0A 1M90T 2BW7A 2YX1A 2LEBA 3W2WA 1KFSA 4YQWA 3C15B 3IR6B 3OLBA 2PDAA 2DGVA 2WVFA 2GX8A 4OHVA 3PIOQ 5KG5A 1KOHA 1KSPA 3V6HA 5IV4A 1YWXA 4P72A 4H54A 2NUHA 1M5PC 2BJDA 5HROB 1Q5VA 3KLFA 2BJ1A 2C2EA 1IBKJ 2DCLA 3N0VA 1SQGA 2YKNB 1NNDA 4MJKA 2ZJQQ 4WP3A 3CJKA 3MUVP 3CT9A 1HYSB 4RO0A 4EU0A 1CVJA 4LVNP 3HVRA 4I69A 2HGNA 1TMMA 1U1MA 1SL0A 3TVYA 2V34A 3PO5A 5D0EA 5KFHA 2O01C 3C6UB 2QYGA 2ZE2B 4WFAQ 4F2SA 1ZS6A 1F5AA 3ZZRA 3CCMS 3ZZOA 3DGPA 2AMCB 5E0OA 3KXDA 2IA6A 5KFTA 3R5BA 3M8QA 2ZZMA 4UZCA 3SQGA 5IWAJ 2DTJA 2HPUA 2V9WA 2R2UA 3T1YJ 2DISA 3EGWB 3GTYX 3BF4A 1CSJA 4ZVRB 1SH2A 3KK1B 5E3QA 5E3AA 3WIUA 4GKJF 8ATCB 1UMJA 4DXLA 2UUBJ 4UUXA 3ADAC 1RT1A 3CJ0A 2CZ4A 4DR4J 5F41A 2J9DE 1DTTB 2B4UA 3EE3A 4MFBA 3LOUA 1S72S 1OY9A 5KFXA 2DR5A 3B54A 1Z1ZA 3KOAA 3M30A 2JC0A 3MI7X 1ITPA 2HFOA 3K8VA 4NE9C 2WVEA 2BANB 1O5JA 2CPXA 1S6OA 3EGVA 1D9AA 3NBPB 1B7YB 3SFGA 4OJGA 1X8DA 3CB4A 4HT5A 4KHPF 2IJFA 2HAIA 5CD4H 3IGNA 2JLGA 3H4DA 2U1AA 4U9RA 3CCRS 4WFZA 3OUYB 3QT8A 1VIXA 5L1LA 3NEKA 5D78A 5KTQA 2C3YA 2K2PA 4OYXA 1BY9A 4TKTA 3MM5A 4TY9A 3W9JA 4XPCA 4WXOA 4WU3A 1KQSR 3IR5B 4QIWD 4J9PA 2CPYA 3IM9A 2CVIA 4FYXB 3OFHA 4ECRA 3C46A 4DFPA 4MT1A 1C1CB 4AQYF 1RISA 4GVBB 1K0VA 1DJ0A 2Q6BA 3W7BA 1R27B 2OLWA 4USHA 1HWKA 4OYPA 4I6WA 2Y8YA 1XNQF 4RW4A 1FXLA 4AXJA 3MAQA 4KFBB 4TLRA 1S7HA 2CNOB 1NLKL 4C2MA 1I51B 2E5IA 2RB7A 1HLWA 3TA0A 3IG1A 1WKKA 3U1MA 4HL9A 2DHSA 2ZM6J 1SJFA 5F9LA 5GAEI 1JLGB 4Z7CA 2Y1RI 4OZLA 5HVFA 3JSMB 3I4PA 1T11A 2DPJA 1XMBA 1H2TZ 2DHAA 2J6TA 1KHVA 3GFZA 4LF1A 4ZVHA 1T3OA 4CLLA 5HMXA 2YNFB 1FRKA 5HO4A 3GJSB 1T9UA 2Z2MA 2I0XA 1SIZA 3CD0A 1WC5A 1L3SA 1MWQA 3GIRA 4DR6F 1XMQJ 3OFEA 2V68A 3H2UB 2VFVA 4NZ0A 4QIEA 4R8UA 2IM1A 3VQSA 2H9ZA 2R7WA 2GMLA 3RU0A 2A2DA 2GMJA 3C8YA 3BQ2A 3QT5A 3TUIC 1X5SA 2W4CA 2P9EA 3TR5A 4EI2A 2HMIA 2M7SA 1KC8T 5HI7A 2MTLA 1R0BG 1SC3B 3I96A 2QSFA 4QU6A 1UP1A 1N6QA 1IXKA 5B0AA 4XIUA 4M5DB 5KG4A 3UD5A 1VLYA 4A47A 1X60A 4Y2IA 1NBEB 3CDEA 1ZPVA 5IT4A 3MPWA 1U7LA 3BN7A 3SIPB 1ZTTA 2GW8A 1IN0A 2HVZA 3AD8C 2BJEA 1QSSA 2MEWA 4X62F 3T5LA 4ZKAA 2YNHA 5F0WA 3R5CA 2QGFB 2OSRA 5K5MA 1S0MA 1LWFA 3HX9A 1S6PA 3V6DB 5A8RA 1VC6A 1CQMA 4LSNB 2ZWOA 2V8HA 1UVJA 1F9FA 4Y2MA 1YJ9S 4GO5X 1EIYB 1FJ7A 1A0OB 2ZKTA 1GX5A 1M1HA 2GIQA 2W9BB 1ZA1B 1RE1B 2C2NA 2Q66A 1RWNB 2J6SA 2PFDA 4DX7A 3QO9A 3NGUA 3TWZA 1D1UA 5J1EA 4LFBF 4G1IA 2BM0A 4OHXA 3FEXB 3F0NA 1WACA 1GX6A 2XO6A 1DLOB 4FF3A 2EI5A 2QA1A 4OX9F 3V5RA 1YRUA 1NZAA 3NOGA 2XMAA 5ETNA 3GP9A 1NPRA 1HW9A 4CLZA 5L38A 4CYUA 2YKAA 1QD1A 4DUYJ 3OL7A 1GXLA 4LVOP 4O3QA 3MR6A 3LGMA 1UFLA 4TVAB 2B8QA 3DOLB 2IC3B 1KNZA 3EJMA 1RWMB 4Q43A 4GC6A 1HR0F 2CQBA 2VPXB 2PEBA 2QFJA 2MZRA 2ZHAA 1YJVA 4I6AA 3MHYA 5KFWA 1HFEL 2RILA 4DV2F 1ELOA 4RBUA 1TL1A 1VJQA 2HZCA 1ACMB 3TZXA 3M6VA 3BBCA 1GNKA 1IKVB 1XN9A 2W2MP 3IWLA 2UXCJ 3TYTA 1VQ6S 3O1LA 2GJIA 2PO4A 3KK3B 3LWLA 1A7GE 2VQFF 3MEDB 1SQFA 2YKOA 2GAHC 2R7TA 1J2VA 2I6WA 1T0TV 2A3JA 2PA3A 3D4JA 1KS2A 3HT0A 1CS4B 2D74B 3A3NB 2ZH5A 3CMQA 5D0HA 1N5TA 4O44B 4DR3J 2QL9B 3DOKB 2LXIA 5D3GB 2HFZA 1B0PA 1U1NA 1R31A 4YB5A 5EX0A 4WZMA 1FKPB 3CCWA 1SIWB 1Q79A 2EBGA 1RBAA 4NXMF 1GXUA 4K0KJ 1RT6B 4LJMA 3HHDA 2HWIA 4HI1A 4FBUA 1ZAXA 1W26A 3FBEA 1VJWA 4RW8B 1VQKS 2A6OA 2W1BA 4DQQA 4IG3B 3P4UB 3V6KA 2XHWA 2RIJA 2QN6B 4Y3CA 3C19A 1V3ZA 3JSBA 3NAHA 4DPXA 1WOSA 1K1QA 5AJ3F 3VQTA 1NK9A 1IVZA 3G96A 3Q8QB 2NREA 1S0NA 3M8WA 3ZXWA 1BC6A 4I0WA 4NLYA 4ED5A 1IWAA 1E6VA 5CCMA 3OXLA 1NB7A 1TL7B 4FN5A 4B9NA 2KL8A 3V81B 2Z4PA 4ZPVR 5AXMA 1RWUA 4RWXA 3OTOF 2BKOA 1SKWA 1TMJA 1CC7A 2CJKA 1Q0NA 3C66A 4PQUB 1RT3A 2EFQA 3TZZA 3R5GA 3AD9C 2NYHA 5A0YB 1J5EF 3PHTA 3IP0A 3M2RB 1YBTA 3KJFB 3GIMA 4ETZA 4WKRA 4GVLA 1VGYA 2DNZA 2AD9A 4LMZA 2EC2A 3RUBL 3WHIA 4P2MA 1JXVA 1RZMA 2X51A 5J1PA 4Y00A 3FNNA 1JJCB 4ED7A 3D5MA 4IRKA 2R7OA 4CO4A 1G1XA 4YR0A 1RTHA 2GO8A 2W9AA 3VHQA 2AJ2A 3C16A 1HQ2A 5KG3A 1XR7A 2MJNA 5IM0B 2WVDA 4FNIA 4PRFA 2Z8QA 3SEOA 3GIIA 3D66A 3RAMA 2RT3A 3KLGA 1R8AA 3D6MB 3S01A 1ZZFA 4WIIA 3MUMP 5IS2A 1FTRA 2HBZB 3GFHA 3GPAA 3NMAA 3FMBA 4K4XA 3QBCA 3CDWA 5C2CA 5HL7Q 4A8SA 3PW2A 2XYGB 1Y11A 3UD4P 5E7OB 2LVWA 5B0BA 3K5PA 2NXEA 3IRXA 2J0XA 5EWGA 3UDVA 2KFNA 3QT7A 4WTYA 3GZ7A 1R8PA 1FFGB 5ADZA 3EZ5A 2WTFA 4OZ3A 1SCJB 2MKKA 5KT5A 1HNXF 4JI3F 1R6VA 2MGZB 2MXYA 3N6NA 4EUVA 3GCWP 2P6TA 3BO3A 3R5AA 2EFOA 2WAQD 1VQMS 1YJRA 2KT2A 5GMDA 3MF5A 1UVIA 1RXOB 2BJ3A 3KNAA 4NI2B 3CO0P 4KKOA 3VALA 3A12A 4ECQA 4KPYA 4WFBQ 4YMEA 2ZD1A 3FMWA 3ILIA 2GIFA 2QMWA 1UWBA 2ZOGA 5KT7A 2MKIA 3D1OA 1A9NB 3PY8A 1FO1A 5F8JA 2DH8A 4ID5B 2CAJA 2DIUA 4C11B 2JJ4D 4DG1A 2C3UA 1PKUA 3MFIA 1WJ9A 5KFEA 1YBUA 2V8VA 2GNKA 3P6YC 2XMKA 2YQ0A 4IH5A 2VBYA 4P7TA 2MMYA 1HBUA 1RI7A 1OSCA 2VG5A 3ZZ0A 1GEHA 1N54B 5H9EJ 4ZIVA 1Q4RA 3NL0A 2ZH6A 1R43A 2IM0A 4QWDA 4AUKA 4NLOA 3SV3A 4JI8F 2YTCA 1G2EA 1XK8A 3L7PA 3KG1A 3IWXA 3V4IA 2BKNA 2EFPA 3CIZA 2EPIA 5EWEA 5KG0A 4F4YA 2YQ1A 2C3PA 3BBFA 4J9NA 3GSDA 4DUTA 3PYEA 1T05A 4HACB 3IAS9 5KT3A 4NEZA 4J91A 2K1RA 3RAQA 1S1XB 2HHHF 2DXFA 4JI5J 5K14A 3MMAA 1BMQB 4B3OA 4CLPA 4Q44A 3MMCA 1FD2A 3FGVA 3DRRA 5FLXU 2K7JA 2V67A 2VG6A 3JYTB 4IUFA 2KN4A 3HSGA 2N4DA 3PO4A 1HHTP 4IKAA 2IY5B 1LXJA 2ZUGA 3JSRA 4X66F 1JIHA 1HNVB 1N88A 4FPRA 1RT2A 1FWLA 5DS7A 4ECTA 1RACB 1S9GA 2Y1LB 3KLIB 2AIRB 3OPKA 3ISNC 3I5CA 2QA2A 1YJTA 3D7SB 2HRUA 1W7WA 4DR5F 4G6VB 2P5VA 4L3NA 3CCTA 2DNQA 3EVOA 1NO8A 3E3XA 2OD4A 1LXNA 1VRTA 4IG0A 4DF8A 1IJFB 5DG9A 1LWEB 1RABB 3HZEA 3CCQS 1NHUA 4NXNJ 3SQOP 4FP9A 3N6MA 4ED0A 1HHQA 4OX8A 2OH2A 3CJ8A 3BZQA 3B4MA 5LOQA 1X4HA 2ZZNA 4NWBA 5G0RB 1FWKA 4ILRA 4IRDA 5HQMA 4IH6A 4LFCF 2DNPA 5C25A 4C9DA 2HS3A 3X3UA 4PKDB 1AZSB 4Z7YA 3TNVA 3HKWA 3UVJA 1QJHA 2K3IA 1TAUA 1KOOA 4TN2A 3PYGA 4U8VA 5KT6A 4C8ZA 1K0TA 1MN7A 2PMHA 3IFEA 4B02A 3RR7A 1PYOB 2A1BA 4ZCKA 1SBRA 2MZQA 5DQHA 3Q2TC 4LF8F 3SMZA 4TYBA 2ZZTA 3CJ4A 2G2OA 2KI2A 3BH6B 3WX8A 1YDLA 2KJWA 5J2MB 2EFGA 2HEKA 5E3CA 4F36A 4EGLA 3BKUA 1ZM3A 2NZCA 5D77A 2ZVSA 5FLXY 4ECZA 3DLKB 2J9EA 1U2RA 4LSLB 2OUGA 3M8PA 1S9EB 1CULA 1APSA 4M5LA 2CG8A 2XY7A 1MMLA 2FGCA 2J76E 4C8KA 1EJ7L 1JLFB 2Z57B 4OZ2A 4CO5A 2YPZA 2DR7A 6FDRA 3DKDA 1XJWB 5IT9U 1TAQA 5KFYA 3GU0A 2E1MC 3KHLA 2YNIB 4C98A 5DM7Q 4LUBA 3K8WA 5C5JA 2OEKA 1RUSA 3QSYB 2C28A 4RWWA 3ET6B 1D8YA 1U09A 4F25A 2D3ZA 3MECA 2RVJA 2NXNA 2B43A 2V5HG 1IJEB 2AEFA 3CSKA 3RBZA 5KFSA 2VA2A 4JB8B 2QO3A 2A10A 5F8HA 3CCJS 1ZYQA 1U2FA 3I0RB 5K20B 3TUPA 4UOCA 4CLYA 3Q8VA 2ZC3A 1HPZA 4MH8A 2OPPA 2VH7A 3HHLA 2AGQA 4USIA 3GIJA 3ZZUA 4AE5A 2GHWA 1NRKA 2XHCA 2RSQA 2O5DA 5HN0A 4J9QA 4RW7A 3LP0B 2KHCA 4HDHA 3AJ1A 1NPKA 2CPZA 3VVUA 1FXRA 5K8PA 4LRDA 3AXKA 2WBRA 2CRLA 1REGX 2VC0A 4ZVFA 1UEUA 3TAMB 1AXQA 3RW7A 1S1TB 2ZBCA 2HSEB 2NQPA 5LMNF 2UUAF 2EKNA 3M6WA 4TU8A 3NNCA 2LP4A 4TNOA 3AB2B 1OO0B 2QV6A 1AUSL 3CDAA 1RWVB 4OIXA 3DI6A 2YWFA 6AT1B 4RR5A 1VYAA 1TKXB 3FEZA 2HFNA 2KVQE 3B4DA 2FB0A 3DHXA 4NA3A 1YSJA 1TUVA 3JSYA 3I32A 3HXMA 4RW6B 3MEGA 5KOWA 2EG2A 3NCPA 5J2NB 4FKXA 1AROP 4F4XA 4DPWA 1PAEX 2BE2B 3DRSA 1Q78A 2JC1A 4NLQA 3EZUA 4P74A 3PX4A 2FDNA 2ZEJA 3KHRA 2CQDA 4YN3B 1SB6A 3FBFA 4ECVA 2MQOA 2K7KA 2HLUA 1MNEA 4NYZA 1YTYA 4B3TJ 2JSXA 1X7VA 1YZ6A 4X64J 2M5YA 1F6TA 1UA0A 1M1GA 3MMBB 2KH9A 2G9OA 5SZTA 1CQNA 3EXYA 3HHLD 3R5DA 3RZAA 1P8GA 2D7SA 2VG7B 4ERDA 2H48B 3FC9A 3DRYA 4U96A 1VCTA 1K44A 1CJKB 1OIAA 3QWUA 2RHQB 3M9OB 2ZUAA 5KFBA 3T1HF 1I5OB 1DY3A 4DV0J 2XYPB 1IKWA 9ATCB 3D68A 3M6XA 2FZCB 5BYRA 3JQMA 2GS8A 1B3TA 1EETB 2IAJA 5A6PA 1TL3B 3E01B 1FCAA 5B0CA 3LUYA 4ECSA 4ZPBA 3H5SA 3HLUA 1HMVA 1U49A 4DL0C 2HHWA 4MIAA 1GMWA 2FLPA 1TKTA 4U8YA 1WF0A 2YKMA 1LEOA 3EDQB 2DGTA 1GTHA 4DI6A 2WCXA 4QPXA 4RNFA 1RTDB 4KR0B 3R7BB 4AXIA 4C0OC 4DV4J 1RT5A 4ICLA 3EDRB 4OI0A 1VBZA 2Z2LA 3J81j 3EGNA 4P7VA 1HWIA 2HVIA 3POTB 3P49B 2IVMA 2BXJA 5E3RA 2J8SA 2AGOA 4F4WA 4UQTA 1RT7A 2EWHA 3AOCA 2MKHA 3QLHB 1X4AA 2IA0A 3GJQB 1TV6B 2BX6A 1R89A 1VRUB 4CNYA 5GMEA 3C14B 2CA9A 3BSAA 5DG8A 3HZGA 1VQPS 1P9YA 3C15A 3SSRA 1W2IA 1UJ6A 5KG1A 2HHQA 3M2VB 4IFYB 4GRSA 1KVJA 3WX4A 4MKAA 3TP2A 1OY8A 2J0SD 5KFNA 3AQPA 1OSDA 5HROA 2AZ3A 1N5YB 3NNAA 2CKWA 1MROB 2YKNA 3KG4A 2DNNA 1UWAA 4KYZA 1HWLA 3G71S 2W4PA 2OD6A 2LLZA 3KKFA 1NSKL 1EAYC 2R3VA 5LMUF 3H5XA 4PXDA 5KFCA 1HYSA 2FPHX 2FVPA 1LWXA 2BDPA 5HBMA 1RLCL 4ZP8A 2VPYB 1EKSA 2ROGA 1GMWD 3PRVA 1F0XA 4KO0B 5FDLA 2XMWA 2DR9A 4F3OA 3C6UA 1U48A 2ZE2A 2RUGA 2BRKA 3MM8B 4HH1A 2J7UA 5KFRA 4EWTA 4WWSA 1QE1A 3OHBA 2P2CB 3BKTA 5A8WB 2Z56B 1NK5A 4JI7F 3MR7A 2HS0A 3BBBA 4YOEA 2FHMA 3VAKA 4NL5A 3DU5A 4BCAA 1LW0B 2CPJA 4LREA 5IQ6A 2FVSA 4YP3A 2LCWA 2KYXA 2PT0A 2ZH1A 1Q95G 1F2HA 3KK1A 1KRPA 4LF9J 2UV8G 3B78A 3GWCA 1HWJA 3UWTA 1KTVA 2BM1A 3PDNA 4F3QA 2DCUB 2HNYB 4ZP9A 2YWWA 1B7FA 2R9LA 2HFVA 3LQVA 5EDWA 1TK0A 2J9CA 1NK8A 1BQNB 3H59A 2ATLA 4ZCLA 1KLNA 2V63A 4DSIA 2CNLB 3BGRA 3Q22A 4PPZA 4X4VA 4DR2F 2QMUB 3QFHA 2G2ZA 2BANA 1N0UA 3PX6A 2P9CA 3QGHA 3NBPA 3W5YA 2AJ1A 4U67Q 2AKWB 5KT2A 2RF2B 4GC7A 3AD7C 5FD1A 5C7PA 4PYDA 5CYMB 3OUYA 4X65J 1RK8A 3AA8A 1SKUB 1OJ4A 2LQBA 2NPFA 2VONA 4PQAA 2AW0A 2ZHOA 3KHHA 1C1CA 4GVBA 1WF1A 3AODA 6FD1A 3EUNA 5E33A 4ZN3A 2O1PA 2QZ8A 3MAAA 3MXHP 2W2OP 5I4MA 1OYEA 3LH2S 1IBMF 4USMA 3BYPA 2W7AA 3PFOA 5ETTA 1XNRF 1BQMB 2H4YB 4MK7A 2C3OA 1UJ5A 3IMQJ 3B8HA 5L1JA 1EP4B 3AFGA 1JLGA 2ZJRQ 1U8SA 4DZDA 3ZZTA 2RQKA 1RB0A 2BV3A 3TA1A 4CLSA 3JB9k 1VQYA 1RCXB 3PW0A 1RAEB 1S77D 2VFTA 4LF5J 3SFUA 3TI0A 2E9ZA 1HL6A 5M2PA 5DM6Q 4BHQA 3KLHB 2YNFA 3V2UC 2J6UA 1S0VA 1RT4B 4DV5F 3MOJB 3NWGA 1SH0A 2GMHA 5EX3A 3CCVS 5H1SV 4A8FA 4OLOA 3M8SA 3G8TA 3MZIA 4M5HA 4MIBA 1VQLS 3TX0A 3SCLE 5EHHA 4G1PA 4CQ1A 4C97A 2W8KA 2FJEB 4YB1P 4PG6A 4DCPB 3VZHA 3LPYA 3BO4A 4JI2F 3M8ZA 3VAHA 2B51A 3K2YA 2Q43A 4M5DA 3TEHB 1K1SA 1R7IA 1RWKB 3MWBA 4E2FB 3MM6B 1FK9B 2XTJP 5HLFB 1L3KA 4BC7A 4ZLLA 1IBLJ 1TZ0A 4PG4A 4QWEA 4M5IA 4ER8A 4OZJA 3IA0A 1HNZF 2XI3A 4LF6J 1SC1B 4EBDA 4O0IA 2JEIA 2QLJB
chains in the Genus database with same CATH topology
1Z2LA 4A47A 4RNMA 3V6DA 3VTIA 4Y2IA 3G9CA 2AJFE 1YJWS 2R7SA 2GO9A 4ILLA 2R8JA 1S76D 3CDEA 3OTEA 1ZPVA 5IT4A 3MPWA 1U7LA 3BN7A 4RW9B 1S10A 1ZTTA 2GW8A 5LJ3Y 3VAJA 1IN0A 2HVZA 1N5QA 2NXUA 3CUNA 2W9BA 2BJEA 3QWPA 3OVSA 1FXDA 1QSSA 1QM9A 2R7QA 3DRSB 4X62F 4CH1A 3KK2A 3T5LA 2HMIB 3HHNB 1TP7A 2CJAA 1Y5IB 3A1YG 4ZKAA 3NRBA 3UNGC 3DU6A 4F2RA 3A8EA 4X4TA 2YNHA 2XI2A 3H20A 5F0WA 3GE9A 3R5CA 4M8LA 1NK6A 5D4OA 3DM2A 2HHSA 2RU3A 1N6QB 1KR4A 3JTPA 3LALA 2OSRA 4XDCA 1C0UA 4O4GB 3MM9A 3DC2A 5K5MA 3CD6S 3KNGA 3ULHA 1S0MA 1LWFA 3OJSA 4DOZA 4QU7A 3HX9A 2E66A 2LU1A 3VAMA 3CPWR 4O3SA 4M95A 1S6PA 2AU0A 4M1KA 4FF1A 5IT0A 3V6DB 5A8RA 1VC6A 1CQMA 4LSNB 5B09A 4J9OA 1E6YA 2V8HA 1UVJA 1FRIA 1F9FA 3FFIA 3ZC4A 7FD1A 4KC5A 4Y2MA 1H2VZ 2E44A 2IHR1 1YJ9S 1HD0A 4GO5X 1GT8A 1FJ7A 4B3SF 2ZKTA 1Q86T 3DLHA 2JDJA 1GX5A 2GIQA 2ILZA 2VUGA 2W9BB 5L9NA 1H7XA 1H7WA 2Q66A 2IMOA 2I9SA 2VFRA 3GB0A 4GO7X 4TQRA 4DSLA 2J6SA 3KK2B 1X0FA 1T95A 3DDKA 3QO9A 4I6YA 5C24A 2R8HA 2CDQA 3ZFVA 1D1UA 2YNHB 3S8SA 2IC3A 4LQ9A 5GAGU 2LYVA 5J1EA 5E5NA 4LFBF 4DS4A 2DNKA 3DM2B 1S1XA 2QSWA 1N4LA 2UUTA 4IQMA 4G1IA 2BM0A 4OHXA 1SL1A 3FEXB 1NEEA 5M2RA 4C8OA 1WACA 3MM9B 1GX6A 1NJIT 1FNMA 5JUMA 1LWFB 4MAKA 1DLOB 4FF3A 2WB1D 2EI5A 2QA1A 4OX9F 3V5RA 2R7RA 4F8RA 1YRUA 1K8AT 1NZAA 3M1VB 3PRBA 1IKWB 1VI7A 2ZH7A 2JEJA 4PUOA 1P1LA 3I31A 4D3GA 4AL6A 4Z37A 1K9MT 3PXGa 1HW9A 3CJ2A 5A8RB 2DNLA 5I3PA 2X3GA 5BYQA 5L38A 4BS2A 1E6YB 3EPGA 2CJ9A 3FFIB 3PJWA 2YKAA 3RR8A 1GTEA 2ASDA 3OL7A 1FRMA 4OV1A 2MSSA 4V19J 1S49A 1G3OA 1LQ9A 4DQIA 4Q0BA 1GXLA 1URNA 4LVOP 4ES2A 4O3QA 3MR6A 2VFUA 3LGMA 2HGLA 4Y6IA 3QO9B 5C24B 1UFLA 5KFMA 2GHVC 1FVQA 3SZ2A 5DJBA 3DOLB 1XC9A 2IC3B 4EZ6A 1KNZA 4Q43A 2RH3A 4GC6A 2YKPA 4ED3A 1VIOA 4DR7F 4OHYA 1FDAA 3T19A 3L95X 1HR0F 2CQBA 2VPXB 2FVCA 3CTRA 1ZM2A 2HHXA 2YKMB 4CO0A 3K58A 2QFJA 2MZTA 3NCQA 5E41A 3PHEA 2KM8C 1OPZA 2MZRA 2NLWA 4DJBA 2ZHAA 1YJVA 2C22A 2MSTA 4I6AA 2VC1A 3MHYA 5KFWA 2XSJB 3GFXA 5JJBA 5L1IA 4PUOB 1JWWA 1HFEL 3W2VB 2RILA 3DN9A 4A8YA 2LQ5A 5DDPC 2E5GA 4OMFG 3THPA 4DV1F 2RMLA 4DV2F 1ELOA 3P3DA 4ZDNA 2CPIA 5E3PA 3VZIA 4RBUA 1TL1A 3JTOA 4J9RA 1DTQA 2HZCA 3VAIA 3SV4A 3UI3A 2WSFC 3M6VA 2ZH2A 1GNKA 1IKVB 1XN9A 4FS2A 4MYTA 3IWLA 2FJAB 4ZHRA 4ZK7M 4Q0BB 2BZ2A 2EG1A 2DHXA 2F3JA 2DGXA 2B56A 5GADU 3Q24A 1N0VC 2JFDA 3OL6A 1LW2A 5I3UA 3DOMA 1SKRA 2MZJA 3M32B 2J5AA 4KBIA 4KV8A 3TYTA 4B17A 3O1LA 4RUCA 2DNMA 4NLVA 3FQLA 3WBZA 2GJIA 5KFDA 5D3GA 3BB5A 1TL4A 2PO4A 3KK3B 3LWLA 5F0UA 1A7GE 2VQFF 4MK9A 3FSXA 4RBTA 2FUG9 3MEDB 3N9UC 4B3TF 1FKPA 2YKOA 4FVCA 2R7TA 4RZRA 5GAEU 1J2VA 4R25A 1FE4A 3QJLA 2XG8A 3LO3A 1RDRA 1SXLA 4X64F 4ZPCA 2AJQA 2RQMA 3QAEA 2A3JA 3MR3A 1RT6A 2PA3A 1D0EA 2YH1A 3GG1A 1HNIA 1RYSA 1KS2A 4TY8A 3E8OA 1S79A 3KJVA 5AXKA 2D74B 2XB2D 3DMJA 2ZH5A 1TL1B 2FHJA 2D9OA 1DTQB 1KVIA 3K59A 4RW8A 3TARA 4ZPWR 2KXNB 2KRRA 4UY8T 3RRKA 4ZHRB 1N5TA 2F4VF 4DL2A 2MKJA 1LW2B 4O44B 5I3UB 4KV8B 3CCES 2DK2A 3DOKB 2LXIA 5D3GB 2HFZA 3RRGA 1B0PA 2LA6A 5T41A 1M5SA 1U1NA 1R31A 2HQIA 3VF0B 4RNNA 1Y00A 4YB5A 5EX0A 4ZCMA 3GYNA 4WZMA 2EFNA 4ZPAA 4ELTA 1KN6A 3OL8A 3P5TL 1FKPB 3CCWA 1SIWB 4B3RF 4DV0F 2E7WA 1Q79A 2EBGA 4ES1A 4Q2MA 3TQ1A 3G6YA 4RU9A 1X5TA 1GXUA 3N01A 4NXMF 1RT6B 1BWEA 4LJMA 3HHDA 1IM4A 2HWIA 4HI1A 1S97A 3MM7A 3U02A 4FBUA 1BQXA 5HMYA 2VL1A 1XEZA 1ZAXA 2ZNZA 4NA2A 3KJVB 2LQJA 1PC4A 3DMJB 3U7JA 4DHVA 4IO1A 2D3OR 2NR0A 1VJWA 4RW8B 2POKA 5I3QA 2V4JA 1VQKS 2WB4A 2OTJS 3H8YA 4OJ3A 4PG8A 2CJQA 5HBMB 3UD3P 2AJ0A 4DQQA 2V2KA 1VFJA 5EWFA 4PXCA 2MQMA 1S48A 3F44A 3ENVA 4IG3B 4QR2A 5FJ4A 2PI4A 2QT7A 1X0PA 5F3ZA 2LXUA 4NLTA 2XNQA 1SJQA 3V6KA 3M9MB 3CC4S 2D3UA 5JXSA 2B0GA 4GKKF 3O44A 3GYXB 2XHWA 2RIJA 5FDLB 1MMNA 4IRCA 4Y3CA 1IKXA 2ZKUA 3O5TB 3TUZC 2QA4S 1V3ZA 3JSBA 3NAHA 4ED8A 5G4DA 3W3SA 4IOBA 3F56A 1K1QA 3HK2A 5AJ3F 1I94F 4R0JA 2OAUA 3V81A 2KTQA 4FXDA 3D2WA 1UVMA 2BRLA 5KFAA 1QE1B 4DV4F 3K0JA 3MM7B 3I82A 2RQ4A 3ENWA 1AUDA 3EGZA 4J9SA 1QAJA 3VQTA 1NK9A 2V8GA 4R5PA 3G96A 3Q8QB 1HHSA 3H98A 2NREA 4O23A 1S0NA 2E7XA 4ILMA 2V4JB 2ZBIA 1S9EA 2LQ9A 4WYWA 5JVGQ 2L08A 2V94A 2GIRA 2MZSA 1PGZA 1CPZA 2GGPA 1BC6A 4I0WA 1N36F 2KZMA 4NLYA 2YNGA 4ED5A 4WJBA 5A2QY 3CC2S 3BGFA 1E6VA 5CCMA 4PQUA 2AYGA 4GMKA 4H4KA 2K3KA 5GVQA 3TVKA 2BABA 3OSNA 2W9CA 3AB4B 4WFXA 1IKXB 2GFFA 3OXLA 1NB7A 1U6FA 4G3IA 3FQKA 4WU2A 2KVIA 2FC9A 4YDXA 4ZS6A 2R4FA 4FN5A 2YNIA 1NK7A 5A0YA 4B9NA 4ZA1A 5IQQA 3V81B 2AYBA 1NH7A 3CDUA 2Z4PA 5BYSA 5EUHA 4ZPVR 1F5CA 3DCAA 2B9XA 5AXMA 1HI0P 5B0GA 4CT9A 4DL7A 1RWUA 4ATNA 3I9V9 2XZWA 1SUQA 4R5PB 2FHJD 3QGGA 4RWXA 4ITSA 3ETOA 1X9SA 3OTOF 1RKJA 4DSFA 4LFAF 1IUJA 3SQGB 4CZCA 2DPIA 4C8MA 2NSBA 1SKWA 4FXWA 4JI4F 1SJ3P 5K8OA 4KTQA 2CPHA 1CC7A 4QWCA 2CJKA 1TFYA 3GR0A 4G1QA 3RYLA 3FCHA 3DYAA 3UW1A 1T8EA 4XK8C 2ACYA 2YNG