2DB1A

Solution structure of the rna binding domain in heterogeneous nuclear ribonucleoprotein f homolog
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GSSGSSGMMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVELESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA binding domain in heterogeneous nuclear ribonucleoprotein F homolog
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords heterogeneous nuclear ribonucleoprotein F
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2db1A01
3PIPQ 1B7FA 1OPIA 2CQPA 3FEXB 3D2WA 2MQQA 2XS5A 1U6FA 1R8HA 5CYJA 3CCUS 3THTA 2MYFA 2DNKA 2DISA 2E5GA 2MSSA 2M4MA 2L41A 2MKIA 1WEZA 1X4BA 2N3OA 1M5OC 1X4GA 1VQ8S 1G2EA 3BS9A 2CPDA 1HD0A 2CPJA 1S72S 3THPA 1NU4A 5DDOC 2XNQA 5LSLA 4TLQA 1WTBA 2OSRA 3HHNB 2CQDA 2I38A 2E5IA 1U1MA 2M70A 2G0CA 2DNNA 2KG1A 3G4SS 1OO0B 1N52B 5MLCV 2CQGA 2L9WA 3UCUP 1X4FA 2MQLA 2KXFA 2DK2A 3DLLQ 2V94A 5GMKa 1H2TZ 2FHOB 3B4DA 2MGZB 2M52A 1YJNS 3R27A 2DB1A 3NMRA 2KU7A 1RKJA 1M5KC 2HGMA 2CPFA 3ZZYA 3NS5A 2MQMA 3N9UC 4CH1A 2HGLA 2CPEA 1X4DA 2UP1A 3NNAA 2MGZA 2DNQA 1VQ6S 2EVZA 2LA4A 3BO3A 4W90B 2CQ0A 2L08A 3P49B 2MXYA 2ZJQQ 2MZQA 2KG0A 1FT8A 2LA6A 2F9JA 2LKZA 1VQKS 3CXCR 4UQTA 2DGOA 4QU7A 5DDRC 3PIOQ 2QFJA 1WG5A 2MB0B 1M1KT 2CQ3A 3DXBA 4LMZA 3V4MA 3MUVP 4IUFA 3K0JA 2K3KA 1U1NA 1VQLS 1URNA 4WIIA 4QPTA 1UAWA 2ZJRQ 4W92B 2MY7A 5DDPC 2DO0A 1IQTA 4C7QA 1KQSR 3B4MA 3MI7X 4OZ0A 1A7GE 1YJWS 2VONA 1U1LA 2RS8A 4RU2A 1OWXA 2HYIB 1U1KA 5H1SV 1UW4A 2LEAA 2K8GA 2DH9A 5DDQC 1CVJA 2LXIA 5DM7Q 3MURP 1YIJS 1H6KX 2DGTA 2KM8B 2F9DA 3CD6S 3VAIA 2LQ5A 3CCQS 1BY9A 1D8ZA 2DHXA 2PE8A 5DETA 1JJ4A 2HVZA 2FPHX 5D77A 5EN1A 1WELA 2RVJA 1Q7YT 3CCES 4WKRA 5D78A 1U2FA 3VALA 1VQMS 4F25A 1VQNS 2E5JA 2AYMA 2RRAA 2MZJA 2DH8A 1NJIT 1QVGR 4QU6A 1KOHA 2CPYA 1H2VZ 2D9PA 3MOJB 2XSFA 1Q82T 5IM0B 4A8XA 1U1RA 2CPZA 2QEXS 2OJ3A 2NZ4A 2CQIA 5GAGU 2BZ2A 1VBYA 1VQ5S 2DITA 2Q79A 3J7ZT 2GO9A 3P3DA 1WHYA 2N3LA 4PRFA 3TYTA 1ZZNA 3U1LA 4ERDA 3CCJS 3G8SA 1X5OA 3VAJA 3BO4A 3EGNA 1VC6A 2RQ4A 2M2BA 3BEGB 2DGQA 2M0GB 1F9FA 1WEYA 5ITHA 1Q86T 3IWNC 4LJMA 2AYEA 4WFAQ 1DBDA 3UWTA 4ZKAA 3SDEA 3US5A 1S79A 1WEXA 2EK1A 4PR6A 2KRBA 2KXNB 2KVIA 5IM0A 2DHGA 1SXLA 3S8SA 2FC8A 2MQPA 2AD9A 2RQCA 2FY1A 4YB1P 1DZ5A 1N88A 2DNGA 3CUNA 2KFYA 5DM6Q 3G9CA 1FHTA 2RNEA 3EX7B 1U6BA 3MDFA 2HZCA 2EK6A 3CCSS 2J76E 1HD1A 2BOPA 2XS7A 3P6YC 2DGVA 1X4CA 2YTCA 4WFNQ 2G1DA 2MZSA 5CA5A 1JJ2R 3S01A 1P1TA 2KRRA 3VAFA 4BS2A 4F26A 1L3KA 1VC5A 3L3CA 1JMTA 1FO1A 4FXWA 3LQVA 3MUTP 4Y00A 2M7SA 1UFWA 4IO9Q 2MKCA 1KD1T 3FEYB 5IFMA 2D9OA 1X4HA 1WWHA 2OSQA 1WHXA 2OTJS 2DNPA 2MPUA 1WG4A 5HL7Q 2CPIA 1VC0A 2DGSA 2KT5A 2MZRA 1NO8A 2M88A 3SMZA 2X1FA 2YH1A 3LPYA 4LIRA 4CIOA 1SJ3P 1RK8A 1VBXA 2JX2A 2ADBA 1WF2A 4P6QA 2ERRA 1VQ4S 1SJQA 5LXRA 5GAHU 1OIAA 4YOEA 1FJ7A 2HGNA 5GADU 2CQBA 2G4BA 2DNMA 1JJHA 2MMYA 3VAGA 5LJ5Y 2DGUA 1M5VC 3MXHP 2FC9A 1PO6A 2CQ1A 2DIUA 2RUGA 2KI2A 2XB2D 2AYGA 1X4AA 5HO4A 4CH0S 2DNZA 3TP2A 3BO2A 2LCWA 2CQCA 4U67Q 3CCMS 3Q2SC 1X5TA 3UCZP 2YH0A 4F02A 2KN4A 1W2BR 2DHAA 3NNCA 4YUDA 2DNOA 2YKAA 1M5PC 4Y0FA 2DNHA 1FJEB 2KM8C 3SDEB 1H2UX 4QQBA 3NNHA 4WF9Q 1K8AT 5GVQA 2X1BA 3CCVS 1VQOS 2VOOA 1AUDA 2ZJPQ 3G71S 3HI9A 2MZ1A 5LJ3Y 3VF0B 3U1MA 3CC2S 2OTLS 2NLWA 1X5SA 3SXLA 3ULHA 2J0SD 1YJ9S 1DHMA 1HL6A 2GHPA 1VQPS 2CJKA 2VOPA 2LXUA 2KHCA 3CC4S 4OZ1A 4CQ1A 3CULA 1WHVA 2MZTA 1WHWA 1VBZA 2MKSA 2O3DA 1WF0A 2CPXA 3CMAS 2A3JA 3CMES 3CCLS 3CC7S 4V19X 2I2YA 1O0PA 2N82B 2RRBA 5JVHQ 2J0QD 4TU8A 4TU9A 2RU3A 5FJ4A 1UP1A 2XS2A 4ED5A 1YITS 2KYXA 4PKDB 2M9KA 1U1QA 3IRWP 2CPHA 3H2UB 2MKJA 4FXVA 4UY8T 1X0FA 2CQ4A 4Z2XA 1X4EA 3G8TA 1Q81T 1K73T 2QA4S 5CXTA 2X1AA 2MY8A 2KH9A 3G6ES 3G96A 4WFBQ 1QM9A 3UE2A 2MJUA 4TU7A 1ZZFA 2DNLA 3TO8A 1WI8A 3VAHA 3UCGA 5GAEU 3JB9k 2J8AA 2CQHA 1N8RT 2X1GA 2ADCA 2N7CA 1ZH5A 1YHQS 4WCEQ 2MHNA 2DH7A 3VAMA 3UD3P 1YTYA 1SJ4P 2M8DB 3Q2TC 1HA1A 2MKHA 2U2FA 2AYBA 2E44A 2JWNA 4C0OC 1M90T 4IOAQ 1U1PA 1VQ9S 1SJFA 4EGLA 1YI2S 3I55S 1KOOA 1SJRA 3J7YU 5LSOA 5BJRA 3I56S 5JVGQ 1KC8T 5IQQA 2F3JA 2MJNA 1FNXH 3UD4P 2MQNA 3CF5Q 1WF1A 1P27B 2JVOA 3CTRA 2OIHA 2JRSA 4M5DB 2B0GA 2RS2A 1WG1A 2CQ2A 2KXHA 3RW6A 2WBRA 3RW7A 1DRZA 3EGZA 2DNYA 2D3OR 2E5HA 1VQ7S 2DHSA 3S6EA 3ZZZA 2DIVA 4IOCQ 2DGWA 2SXLA 3MUMP 4C4WA 3R1LA 1N54B 2VODA 1FJCA 3R1HA 2LMIA 1XN9A 2M8HA 1K9MT 3MD1A 3H2VE 1WI6A 2JVRA 1FXLA 2MSTA 1R8PA 2RT3A 2PEHA 3CCRS 4J5OA 1U1OA 2YWKA 3MD3A 2XNRA 3VAKA 2LEBA 3NS6A 2DGXA 2LYVA 2MQOA 3OW2R 5LXYA 2LECA 1D9AA 3CPWR 2MKKA 1PGZA 3P5TL 2DNRA 2DO4A 1YWXA 1A9NB 1X5PA 3S7RA 1QVFR 2U1AA
chains in the Genus database with same CATH superfamily
4DQSA 3PIPQ 1JLEB 1NSKL 3AB4B 2FJVA 4UY85 1UWAA 5EX0A 1F60B 2F63A 3H4BA 2MQQA 5DZ6A 2EBGA 2RSQA 3MMBA 1R8HA 1NBEB 3GP9A 3NAIA 5HK4A 3PRVA 1IBMJ 3CCUS 3QRQA 3QYYA 2MYFA 2KYZA 4KHPF 2MSSA 2BANA 2KDOA 2ZZMA 3GCXP 6AT1B 4ZVPB 1S97A 3C6TA 3DHXA 2L41A 3T3FA 4KR0B 2BVZA 1C0TB 3BZQA 3KFWX 2N3OA 5AE3A 1M5OC 3W3SA 1OSDA 1V6HA 3FCWA 3FBCA 3WX4A 2UXBJ 3OL7A 1G2EA 4LRFA 2CPJA 4EBEA 1S72S 3K5MA 4PEOA 4TN2A 3R6LB 2CZ4A 1TAQA 2BA9A 3LP1B 4J9OA 1WTBA 1N33F 1RTIB 2A2DA 2FJAB 2YVSA 3FBBA 3J7A1 3UNYA 1U4BA 3VVUA 4LFCF 3CSKA 1BGXT 1R6VA 2W4PA 1J5OB 2E5IA 4J9PA 1VRQC 2HBZB 3G4SS 2NUHA 3LGNA 1UTAA 3OPKA 2OHDA 3DGPA 1JIHA 5MLCV 1C2PA 2WZ1A 2POKA 2CQGA 1GMWD 5JXSA 3MPVA 4I2QB 4ZHRA 3SZ2A 2MQLA 2KXFA 2DK2A 4MK8A 1H2TZ 1MWQA 2H54B 2NYIA 4LSNA 4CI0B 2MGZB 1E6YA 3KJVB 2GGPA 2DR8A 2HHQA 2I1RA 1S59A 1YJNS 4DXLA 2BE7D 2DB1A 4X4QA 4CO2A 1O6XA 3OTOF 1IR1A 2VBYA 1N56A 2UXCF 2UV8A 3QIPB 2DR7A 4FBUA 1T95A 3TVKA 2CPFA 3ZZYA 4CH1A 2MQMA 3W61A 2EFQA 1FJGF 5IT9U 1HW9A 3I4PA 3PW4A 1N6QA 2QSWA 4L72B 4RW8B 4RBTA 1WC3A 1X4DA 2AT1B 3WC0A 3NNAA 2E1MC 4YB6A 3I9V9 2ZBPA 4G65A 4NPOA 3O6QA 3DM2A 4DG1B 2IM2A 2ZOGA 3ZO7A 3A3NB 4W90B 2KKHA 4WP9A 2CQ0A 3OSPA 2KL8A 2L08A 3P49B 2HVHA 5H9FK 3N5FA 4WE1A 2DPIA 4RUAA 3QO9A 2COLA 4USMA 4J7CA 2FHMA 1NZ8A 1XMBA 2ROGA 4I2PA 1AROP 1R8CA 2C22A 4C8KA 2WHOA 3QT5A 3CXCR 3BB5A 3LP2B 4B9UA 1MN7A 2DR9A 1BHNA 2CJ9A 3DXSX 3J81j 3DLBA 2FGCA 1J2VA 3PIOQ 4YS2A 1AXQA 2BM0A 4O3RA 2CQ3A 2X7IA 3UO0A 4LMZA 2WSCC 5KFEA 3OSNA 4DSJA 3LTOA 2J0XA 2BJ9A 3V4MA 4MFBA 4O0NA 4CT8A 1VQLS 2J6UA 4N5SA 3V4IA 2B9WA 1DQ9A 1SIWB 2J5AA 1URNA 1N5QA 1RADB 3MEEA 2PGCA 1UAWA 1RXOB 3MPWA 3AJ1A 1VK3A 4PXEA 1S7HA 3RBZA 1VGYA 2KVQE 3MI7X 4OZ0A 2OMLA 3AODA 2AWZA 1B0VA 1QUPA 2MLYA 3MEDA 4DV1F 4JI5F 4GKKF 1A7GE 1YJWS 2OD4A 3T5KA 1VMBA 5K14B 2DR5A 4KSEB 2GC8A 2RS8A 3HFZB 3H5SA 3ILJA 2NSBA 4OX9J 1JLFA 4Q45A 3IGVA 1FKAF 1UVNA 4OHXA 4Y2IA 4P7VA 1OY6A 3WX8A 4ALZA 1CVJA 2GQCA 4CO1A 1FRLA 3N01A 1S1VB 2EFGA 5DM7Q 3K8VA 3PJXA 2BRKA 1FRJA 3EXCX 2YWGA 3WBZA 1HBOB 5D4PA 5J1PA 3MURP 1SUQA 4WFXA 1YIJS 3H5YA 3PACA 1NK8A 2DGTA 5KT3A 1SC6A 2F9DA 4UTGA 2EKNA 4ZPBA 4ANCA 4DV7F 4ZP7A 2UVVA 3CJKB 1NKBA 4X4VA 2YKNA 1BY9A 4I7FB 2DHXA 2HHXA 5D0EA 5DETA 2JLGA 4HDHA 2BKPA 1A6LA 1T9TA 4NLXA 2HVZA 5F0UA 1MMNA 2ABYA 1KKHA 2J9EA 5F0WA 3OUYB 4M5GA 3KLGA 2IFXA 4CNZA 1WELA 2QL7B 4OZ5A 2XMWA 1DTQB 1NJYA 2QLFB 2BUNA 1U2FA 1YX2A 5FD1A 4ZLJA 5LOQA 3VALA 3O5TB 1SPBP 1WDTA 1NPPA 4NRUA 2QFIA 3R5JB 4Y34A 3RGIA 5GADI 1R0AA 4MH8A 5C2GA 1R43A 2HK2A 3JSBA 5E2QA 1JLQB 2R7VA 4LRCA 1JLFB 2CPYA 2ZC3A 1H2VZ 4ZVEA 2VFTA 4MMOA 1RWUA 2F7VA 2XSFA 3BH7B 3C16A 1Q82T 3ETMA 3GYXB 4DR2J 3QAUA 4ECUA 2CPZA 2FUG9 2HBYB 3QMQA 2KJVA 4L74A 3T1YJ 1UPMB 1U1RA 3W1YC 3DLGA 5GAGU 2XMUA 2OH2A 1VBYA 2PI4A 4E8UA 2XGPA 2NXEA 1NAQA 1ZM3A 2R9LA 2GO9A 3MMAB 5KG3A 4A47A 1RTDB 3AY0A 4DR6F 2MDAA 2E5LF 4PAAA 3U1LA 1QUVA 4YB5A 4FKXA 4TQRA 2GMHA 4K2XA 3OUYA 1X5OA 4QYZK 2XEXA 1FKOB 2W7PA 3N28A 4KH0B 3BO4A 4DPWA 2VASA 1VC6A 1ZYQA 4WZMA 4J9MA 2M2BA 1HMVB 2DGQA 1S1XA 4HVZA 1WC6A 5F8IA 1CC8A 2KHDA 4MK9A 1NK9A 1F9FA 4UOFA 3BV8A 3CD7A 1R0AB 4PQUB 4IKAA 4P2SA 2XY7A 4DR4J 3M6WA 2AYEA 2F4FA 4C3KA 4P9SA 3TWZA 4OZLA 1DARA 3SDEA 3US5A 4DL3A 3BJYA 1WEXA 3HX9A 4ZP9A 4F67A 3GJTB 4NXNJ 4F4AA 2KXNB 5M2UA 2ZWPA 2A10A 2R2SA 4K2JA 3WDOA 2JHEA 3PX0A 4I2PB 5C7PA 3S8SA 3T1HJ 2MQPA 4OI0A 2AD9A 1OY8A 4IG0B 3GB0A 1PBAA 1NKEA 4DV3J 1S1WB 1FXRA 3PYFA 5DLGA 2FY1A 2HHHJ 1C0UA 4JV5F 1PC4A 4I68A 4AL7A 2DNGA 4TXSA 2HAIA 3BKFA 3BSCA 3IA0A 4LQ9A 2KO1A 4DUTA 3TUPA 1FKOA 4ZITA 4YR3A 2RNEA 1FHTA 1U48A 4C8LA 2BJ3A 2OKQA 2QRRA 3ZXWA 4M5DA 2VV5A 1T05B 4NLPA 1EJ7L 4XK8C 2FGOA 4EO8A 3A8IA 5D4LA 2J76E 5KFUA 2GQQA 3MR7A 3P6YC 4MKBA 1LKZA 1X4CA 2WOMA 3DU6A 4B3OA 2B9EA 4QYRA 1KN6A 1NM2A 3RB6A 4RW4B 4J90A 3ENVA 2Z2MA 3QSIA 4DR6J 3GYNA 2P2CB 4Z37A 2B7BB 3VAFA 4CZCA 4X4OA 1TKTB 2HG4A 2JZ5A 3FBEA 1RTIA 1UVKA 2V9KA 4F26A 1HHTP 3BKUA 5B0FA 5A8WB 3KK1B 1G4CA 2VUGA 4R25A 1GH8A 3RB0A 1ZPVA 5IQ6A 3HVRA 4ZMMA 4B3RJ 1U7LA 5KT6A 3OQ2A 1Y4ZB 3MUTP 2OEJA 1HNWF 3K5OA 3OVSA 3X1LB 2M7SA 2MKCA 4C8YA 2G2YA 1HWJA 3IAS9 1YK9A 1RWVB 2D9OA 3QGGA 2AGPA 1I94J 1S76D 9ATCB 2OSQA 1WHXA 1R7IA 3FJ2A 2UVRA 1FE4A 1N5TA 1RHRB 3HHLC 1RE1B 3I82A 4DSKA 2CPIA 3FSIA 5KFDA 3KHGA 2Y1IA 4L3NA 4ILRA 4FS2A 4CLKA 3HD2A 2BM1A 3I0RA 3SFGA 4RO0A 4DPYA 5J1EB 2XTJP 1LWEA 2FD2A 1RK8A 3W8PA 1PBUA 1TR0A 2C42A 3MAAA 3GE9A 4USWA 1VBXA 1KNZA 2DYAA 2B8PA 4A8KA 1VQ4S 2YWHA 4EFAC 2JEGA 1S77D 2YPYA 4OYWA 1IJFB 2A18A 4YOEA 4FVCA 4LSLB 1T0TV 3F0NA 2CNKB 3M2RA 3MEDB 3VAGA 5I3UA 7AT1B 4MAKA 5HANA 2DGUA 5A8KB 3B8HA 1T9WA 2FC9A 2HBQB 2DIUA 3FQKA 4NLVA 5EWEA 3BGLA 3RU0A 4NXMJ 2PI5A 2XB2D 2AZ1A 3CJ2A 3MECB 3ZTQA 4DX7A 3MMJA 4A8QA 3Q8QB 3QJJA 4GKKJ 1XMOJ 4CH0S 2E7XA 4DPUA 3MOZA 5CD4A 3ZNUA 3KHRA 5HN0A 3BO2A 4Q2MA 3BGRA 4DF4A 1HKAA 1S9EB 4NLWA 5EGYA 2P6SA 2LCWA 2BDPA 2E1RA 1RAGB 2GA7A 2CQCA 2HVDA 4WYLA 4I1TA 4U67Q 3CCMS 2Y0SD 4J9KA 1HQUB 3Q2SC 2Z4PA 2FVSA 1SH2A 3IRXB 4LSZB 1GK8A 2YH0A 2KN4A 4HACA 2DHAA 3GPAA 4OI4A 2YKAA 4Y2MA 3C6UA 2DPJA 4GC6A 4ECSA 2V9WA 2BQRA 4DL6A 3MM6B 1HYSB 1FEEA 4DFJA 3C8YA 5FLXU 3D1OA 1EKRA 1FKPA 4CWBA 4KH1B 3CCVS 3A8KA 2Y1JA 5HBMB 3OTCA 2V2VA 3G6VA 5THWA 3U1NA 2ZJPQ 2GMLA 3DI6A 3H8YA 2L48A 4QR0A 3SFUA 4R8UA 2QL9B 4X64F 3Q8RB 3N5BA 3GIIA 4A8MP 3I96A 3W2VB 3VF0B 1SUQB 1VCTA 4FYVB 4C2MA 5AXNA 2LDIA 3PZPA 1U45A 1MLAA 3NOGA 4F4ZA 2J6SA 3SXLA 4IFVB 2VQFJ 1UVLA 1UMJA 5ETQA 2CUYA 4U7UK 1X31C 1EHWA 3T9ZA 2HNDB 3SV4A 2C2DA 1YJ9S 4I7FA 4V1Ak 1F3FA 1TL3A 4ZLLA 2R7UA 1WUUA 2GHPA 2LXUA 3DMJB 1NZAA 2AHOB 3GFZA 2HEKA 3Q8SB 4Y2KA 3AQPA 4U7CA 3QRRA 1NPRA 4RW6B 1T3NA 4LR8A 1WHWA 3MM6A 3BDEA 2MKSA 2E9RX 1S99A 4WK1A 4X66F 1PIEA 2CPXA 4M63A 2EFOA 1N5VA 1UJ4A 1YRTA 3CMES 4USKA 4KPYA 1MU2B 2HIQA 3TAMB 2RB7A 2AJ2A 2CWKA 3CIMA 1TELA 3G86A 2F8HA 5F41A 4LRAA 1BLUA 4CP5A 5GAGI 2R8IA 3V4IB 2G9OA 1XR5A 2ZNYA 3G82B 3O3LA 3AA8A 2H3EB 4ILMA 3AJDA 3BM7A 4X4SA 2QT7A 4Y65A 2N82B 4TU8A 5L8RC 2RU3A 2KT3A 4IRDA 1UP1A 3OFEA 4UZCA 1F6TA 4OX6A 4U9RA 6FD1A 2V8HA 2B6AB 2W24A 4DR1J 3RRGA 4WXOA 5FIIA 2CPHA 3IRWP 3PRDA 1C0UB 1AYEA 1RT3B 4KPCA 4FXVA 4NYPA 1JLAA 2QO3A 1PYOB 4ELUA 5B09A 4JI4J 3DMJA 3VGUA 5HROA 4B3MF 2IM3A 3A13A 3FZBA 1ZS6A 2QA4S 4EO6A 3CJ5A 3KK2A 2V8DA 5E0OA 2W8LA 4GO5X 5D15A 3GU0A 1BQNB 4OLPA 3W62A 1LWCB 3TANA 2MQ8A 2YNFB 3MR5A 1QM9A 2VPZB 2WB4A 1CSJA 2MJUA 4QIWD 3G96A 4J9NA 2B3TB 3RBEA 2B9XA 2P5VA 4OX7A 4ENOA 2Z56B 3KJFB 1MW7A 4MIBA 3TO8A 4FN5A 5DLFA 4FF1A 3VAHA 4OZ3A 5LMUJ 3ADAC 4N76A 3JTOA 5EUHA 2W9AA 3TARA 1ELOA 2CQHA 3G82A 1E6VA 1IR0A 3ISND 1JLCA 4ZVUB 4B17A 1N8RT 4FF3A 2ADCA 2N7CA 3JTPA 2R7OA 1YHQS 3AHPA 1QSSA 3GYGA 2DH7A 5KFJA 2V4RA 4TYBA 3MM8A 4O44B 3RR7A 3MMCB 5CYQA 1YTYA 2Q6CA 2DCUB 2EXUA 1M1HA 2RF2A 3CGIA 3HJFA 1QAXA 1DLOA 5CD4H 2AYBA 2E44A 1CJUA 1R8AA 4PWDA 1X9SA 2LVWA 4LFBF 4WKRA 4IQMA 1Y5NB 1L3TA 2GNKA 2HNZB 5KFZA 5F3ZA 4P73A 1WC5A 1JLGA 4K5RA 3MF5A 1RT2B 3K5LA 2BW7A 1TQLA 4OX8A 1TL4A 1KP6A 3FRYA 4YDDB 1T9UA 1IKYA 3MCOA 3T9NA 5BJRA 5LSOA 4PXBA 2CDRB 3KG1A 2F3JA 2MJNA 3SCIE 2L3MA 2O66A 2WCXA 3EDRB 3H2LA 3DOKA 3KLEA 3D1QA 3PX6A 3EE3A 2MQNA 3TVYA 3GFHA 1WF1A 3TZWA 1CJVB 3NGTA 1IXKA 4X64J 2E1CA 1QJHA 4RWWA 1P27B 3CTRA 3DRYA 2XY6A 3FVYA 3CCZA 4XO0A 2IM0A 3AXKA 3JQJA 2RS2A 3AOCA 2HS4A 1EETA 2KZMA 1HQEB 1FCAA 2DY9A 4LSLA 1B3TA 1DRZA 3EGZA 1F1BB 2DNYA 4RUBA 2E5HA 5J2PA 1M0SA 1U0HA 3S6EA 2HWHA 1HLWA 4WTYA 1QAIA 2W2PP 2BJEA 4KV8A 2DGWA 2VFVA 1C4CA 2R2RA 2YBVA 1TK5A 1UPPA 2BE2B 2P6TA 3KLIA 3D1HA 1OQ3A 4HEA9 3W5YA 2VA2A 4NEZA 2M8HA 1T9VA 5CYMB 3PFOA 4JI3J 1BQXA 2JVRA 1S9EA 1WI6A 1EQMA 2PA8D 2X3GA 3L7OA 4XTTA 2C3OA 1NRKA 2JFKA 3DDKA 4A8OA 2PEHA 3Q23A 4J5OA 3FFIB 3M9NB 4ZPWR 2VHGA 2V63A 5AT1B 1H38A 2WK4A 3KLEB 4ED6A 3LPEA 1SV5A 1UW9A 5HMYA 2DGXA 1AA1B 3L4BC 3CDEA 2DT9A 1D9AA 4FZVA 4GVBA 2ZFHA 2WW4A 3CPWR 3FFIA 3MTJA 4QWBA 3RAQA 1NB2A 3P5TL 3CDBA 2IC3B 3P5BP 1WDDA 4NYOA 2FTRA 1NDKA 2DO4A 1YWXA 4K7QA 1YBAA 2NZCA 2WVDA 2R42A 2EEYA 4EMDA 5JMNA 3QZ8A 1QVFR 4RUHA 4KO0A 4ITSA 2RDDA 5F9LA 4X2BA 2YWWA 2PEBA 3TUIC 4DCPB 1LQ9A 8AT1B 5K8NA 3H5XA 1S7IA 1PG5B 2AEMA 4WU3A 2EC2A 2IJRA 1U6FA 2IDEA 4ZCKA 4EK2A 1OSCA 3THTA 5DQGA 2DNKA 2E5GA 3PYGA 1XTZA 5IT0A 2PD1A 4I0WA 3BSNA 2M4MA 1TKXB 2ZBCA 4OIXA 3W5ZA 2EBEA 4CLWA 1P6TA 4PABA 3UFCX 3Q86A 3ET6B 1W7WA 4DCJB 1VQ8S 1KTQA 1K0VA 1X9WA 3BS9A 2CPDA 4DEZA 1RYRA 4RNFA 2B51A 4OYBA 2DBBA 2VZ9A 2NUUG 5G0RA 1B0TA 4YR2A 2XCPA 4LFCJ 2OSRA 2IJNA 3MM7B 2NYHA 2AEFA 2YNFA 3QAEA 5C25B 5F3TA 2GGPB 5D4NA 1T3OA 1S48A 2I38A 4TKTA 1U1MA 1H7WA 2M70A 2JNJA 2DNNA 4BLGA 2VA3A 5DRKA 5SZTA 5J2NA 3WC2A 1ULRA 4DR3F 1FKPB 1KR4A 4O3SA 2YWEA 2A6OA 2BOAA 4Q0BB 3CWJA 1C1BA 3KHLA 3UDVA 4B9NA 2UUCF 1X4FA 2FHOB 1D1UA 3OT9A 5B0GA 3KLFB 1VLOA 3UW1A 1HBOA 4A46A 5JUMA 3M9OB 4NA1A 4ZVRB 3OLAA 2AX1A 2BYCA 3JYTB 1U47A 2UU9F 5D3GA 2VC1A 3IM8A 3QWUA 2PFDA 4PXCA 3OHBA 1F3VA 4ETXA 5DGBA 1HWIA 2B4UA 4EYHB 1M5KC 2AQ4A 1OYEA 1RT7A 1FRHA 1VISA 2HGMA 2JFDA 3H0PA 4UOCA 3N9UC 4F3MA 3NCRA 1YBTA 2C2MB 3MM9B 2LDYA 4DN0A 5K8PA 4Q8EA 2RDIA 5BYRA 3IR7B 1PC5A 3ILOA 1S1UB 2CPEA 2AJ0A 3CEDA 3JSMA 2OPRA 2FHKA 4J91A 2DNQA 2YPZA 1JXEA 2RQMA 3LP2A 3GMGA 2LA4A 3VTIA 4B9TA 4L3KA 4OI3A 3M4XA 1FFSB 1S12A 3K59A 1F2HA 4DL5A 1IBKJ 1RT1A 3GCWP 2MZQA 2ZD1B 3GR0A 4C3MA 3SEOA 2R8GA 4M5HA 5IS2A 5J2PB 1FT8A 1U0HB 3ILLA 2CIMA 5ETKA 1UJ6A 2LA6A 5C5JA 3DLHA 2HZAA 1SIZA 4LF2A 2IVMA 4KHRA 2HQ3A 4OHYA 4JV5J 2ZM6J 3TW0A 2CADA 2PMZD 1I1GA 3DM2B 3V5RA 3J81Y 3WIVA 3M9MB 3HO1A 2UVUA 2VDHA 1XMOF 2OD6A 2B6AA 2CYYA 2MB0B 1M1KT 3HHDA 4ZA1A 3RTVA 2DVIA 2DRDA 3MUVP 1RT3A 2GS8A 3NMAA 2K3KA 1W2IA 3CJRA 3MAHA 1GFWB 4JP8A 3UN2A 5KT2A 4O0IA 4DV5J 3EPGA 2OEKA 4WK3A 1JK9B 4GKJJ 2ZZTA 3JSMB 5DGAA 1SKUB 4W92B 1IKXB 2QLJB 2QSFA 1IQTA 4C7QA 1S6PB 3CD5A 4M8LA 2IBKA 1AB8A 2UXDJ 3FMBA 3PEHA 2ZVSA 4ZDNA 3QNWB 5ETNA 4NLSA 3SSRA 2XLIA 4RU2A 1HFEL 1OWXA 1UEKA 4K8RA 4DZ6A 1IKYB 1U1KA 5H1SV 1UW4A 2LEAA 3WIUA 5KFOA 4NZ6A 2VDIA 2UUAJ 3HCXA 3MHYA 4I2QA 3O1LA 1TTHB 2CG8A 2K1RB 4H4KA 5D0GA 3VQSA 4HT7A 1DJ0A 5L1LA 4H4MA 4NCGB 1TKZA 4WJBA 1D0EA 4NLGA 5M2RA 2C3PA 2I5JA 3EYZA 3N4WA 2IC3A 4O4RA 3OJUA 3EZ5A 2KM8B 1RTJB 5B0BA 3CD6S 5M2PA 3VAIA 4O44A 3E8OA 2LQ5A 3MMCA 1V5VA 2O01C 3PFEA 4KGZB 4MKAA 1D8ZA 2HLTA 4CLTA 2PE8A 2IRUA 1XNRF 1Z2LA 2WONA 3IM9A 2GIRA 4ZVFA 1LXJA 3VQTA 1JJ4A 3MEGB 2ALZA 2ZDOA 5EN1A 2H9ZA 3AT1B 2AGQA 2WVBA 5D78A 4K0KJ 5ETMA 2FJWA 4LF7F 4F25A 5E3PA 2RE1A 4CLPA 5HMXA 1RTHA 1GT8A 2HNYB 2F8MA 2Y3YA 3BN7A 2FZGB 2MZJA 1SJ1A 4WE1B 2GAHC 1AFIA 2LU2A 2NXJA 4P7TA 3M30B 4J9VA 3FKBA 5KTQA 5IM0B 1DY3A 1IBLF 1LW2A 3BQ2A 3R5AA 1CJTA 4DV4F 3DLEB 1TK8A 1VQ5S 3QJLA 2J7KA 2YX4A 2DITA 1FFGB 4QW9A 2R8JA 1H72C 3P3DA 4PRFA 4IFYA 1RAFB 3NL0A 1RHQB 1N32J 3Q8YA 2VKRA 3M8YA 3CCJS 4ERDA 3KG0A 4DSFA 4GMKA 3MR3A 4ED4A 2ZEJA 1PCAA 3DRRA 4FNIA 1LK7A 3VWSA 2AGOA 1UWBB 2K3IA 4ZVQB 4DV1J 1KEKA 1WEYA 2GJFA 1WOSA 2BACA 3UQSA 4KQZA 4CO0A 5B08A 3E3XA 3MMAA 2W9CB 1YKWA 5CYMA 4WFAQ 1DBDA 1EP4A 3PG9A 4RJVA 3HK2A 4M1KA 5KG4A 1YG0A 2AEJA 3Q22A 1WSVA 3NCQA 2RAQA 1J27A 2Z30B 3J80Y 2KRBA 5A8RA 3RUBL 3JSYA 4AXIA 5KT4A 2KVIA 2RKIA 5IM0A 1SL1A 2KFNA 4DS5A 1LEOA 3EPIA 1LFPA 2HNZA 1HW8A 2H1YA 3L7UA 3MAAB 3MCNA 4FPIA 4HT5A 1S0NA 3R2DJ 4CO3A 4C3LA 1NH8A 2FC8A 2J7WA 2UXBF 4CRJA 2XI3A 3GTYX 3PJ9A 4I6WA 4CM2A 4Q43A 4J9QA 2YKNB 1IJEB 1NDLA 2HMIA 1N5YA 4PG6A 3CUNA 4CH7A 2KFYA 1RKIA 2W2NP 3W8GA 3QSYB 3T5LA 1NK6A 2OGUA 2PN6A 2VF3A 2DD8S 3DYAB 4NI2A 4CDIA 1DQAA 3IG1A 5GMDA 3KLGB 4F4XA 1QTNB 4NCAA 3CJ0A 4QIEA 2K06A 4OZJA 1YJVA 3H90A 3MZIA 1FFWB 1S4EA 4J9UE 2Y0BB 4MT1A 2Q6BA 3LALA 2RH3A 3IO1A 4XPEA 2E7VA 4N41A 2G1HA 4I69A 1HD1A 2B4VA 2BOPA 1UEUA 5D0HA 4TY8B 4LF8J 3S1TA 3OTOJ 3W66A 2UXCJ 1H3DA 5DG9A 4WFNQ 2YX1A 1Y00A 3SSQA 1HNIB 2YKPA 2GQ2A 4F04B 5HLFA 3S01A 2XYGB 2KRRA 4O3QA 1IM6A 4BS2A 3OR2A 4J9SA 5G4DA 1JNRB 2CJQA 5C42B 1D3WA 2RD5C 1TL1A 5KFQA 2BBEA 3P96A 3IS9A 5HSPA 1FO1A 4FXWA 1VC5A 2HVIA 3AQOA 3AOAA 2WVEA 3KJQB 1KS2A 2WOMB 1RHJB 3D54A 1RT1B 1IWGA 1Q78A 1V3ZA 2AU0A 2B5JA 1Q8BA 3RAMA 1AUSL 2ILYA 3HM9A 4ED7A 4C48A 4C0HA 2BQUA 2HRYA 5KFPA 4USIA 2KFZA 1G6BA 1UA1A 1N36F 4PG5A 4CYUB 3PHTA 3ZZ0A 4X4UA 3R5CA 1CQMA 2BKOA 1ACMB 5CHCB 2OTJS 2V8GA 3IP0A 4HI1A 3ENQA 2E29A 1SL0A 4DZDA 5D3GB 1WG4A 5HL7Q 3I31A 2EG1A 2C2OB 2HS3A 1NO8A 2PDAA 2ZKUA 2ATCB 5HI7A 4UOHA 1YZ7A 1N34F 4QCLA 2KTQA 1JQGA 1QSLA 1LW0A 2QL5B 5HLFB 5I3QA 2ADBA 1TZ0A 2VG7A 5T7LA 2HBRB 1NK4A 1IR2A 1R0CB 1SJQA 1SQGA 4ZJOA 1GNKA 3AJ2A 5IT4A 3IWLA 1VRTA 1Q4RA 5LXRA 1FJ7A 1RBAA 1IVZA 3OLBA 2CQBA 2HHSA 1FNMA 3G6XA 4P2FA 3ET6A 4NLTA 1RCOB 3FRZA 3MXHP 3DNCA 2IA6A 2B5JB 2CQ1A 2XMMA 2KI2A 2FVPA 3M32B 1NJZA 1KHWA 3H98A 4KJIA 2UXDF 3TZYA 5HO4A 2VG5A 1RAJA 5HJYA 4NCBA 3CB4A 3NWGA 3VHQA 5KFYA 1FJEB 4XDDA 3C15A 4KGMA 1X9MA 2XSJB 1TFYA 1KLNA 2QIFA 4WIQA 3HFKA 3C46A 3FBFA 1XQIA 1RU2A 4NLQA 4JI7F 3PHEA 4KIAA 1S0VA 2EKYA 4OV6A 5KG2A 1HR0J 1X5TA 1NUEA 4PCQA 4A8YA 3RB4A 4DV7J 2NREA 1O5JA 2E7WA 2ACMA 3PNIA 1VQYA 3CW2C 1F0XA 3OXGA 4URGA 1LXNA 3EUNA 1TVRA 4RNHA 4X62J 1NK5A 1M5PC 3NOCA 5EWFA 2ZITA 3SCLE 4KHMA 4NZ7A 4WP8A 1HNZJ 4C98A 5J2QB 3NNHA 4XIUA 3IFEA 2XMJA 1VOMA 1T9YA 2ROEA 4G1QA 4DWIA 2OELA 1VQOS 3NXZA 1RT6A 3M1VB 1FD8A 2ILZA 1JLCB 1JKHA 1IKWA 4NA3A 4JI2J 1RT4B 3HI9A 5LJ3Y 2LP4A 2WW8A 4EI2A 3E01B 5H9FJ 4NLOA 2HMIB 4RLEA 4AYBD 2XHWA 1RAHB 1XC9A 2J0SD 3D5MA 4KC5A 3I0RB 4MJKA 2IM1A 1HL6A 1S1TB 4HHUA 1PYSB 4HYKA 2YNGB 5AE2A 4G3IA 3NG8A 2HW3A 3QIDA 2FIUA 4NOHA 4OMFG 1HNXJ 3CC4S 4JV1A 3BR9A 3MCMA 3CT9A 1YJRA 4OI2A 1FESA 4IR9A 3R7SB 4DG1A 1BXNA 1S6QA 1XIQA 3GFXA 4W98A 2VC0A 2HNYA 2O3DA 5LMUF 4LQ3A 4FP9A 2ZH4A 1EQ0A 1EP4B 4RW9A 2WBMA 1HHQA 4DUYJ 3CCLS 2OAUA 3BBCA 1OY9A 5CH7B 1F5BA 1RACB 3MECA 3CC7S 2V4JB 1GMVA 2ASYA 2FJBB 2XG8A 4DI6A 1O0PA 1C1CA 2C3UA 3EDQB 1U1NA 5B0AA 4Z7CA 5C42A 2C2EA 3M2UA 5FJ4A 3BGRB 1G1XA 4PKDB 3T1AA 3PR5B 1IKVB 3ZZRA 4IO1A 4DR7F 2M9KA 4GO7X 3I5BA 4IFYB 3LANA 3GILA 1UZHA 3ETOA 2FVQA 5B0CA 2B4OA 1FA0A 3R5GA 2CQ4A 2VPWB 1N0UA 3IBCB 4FF2A 1X4EA 3G8TA 4NCGA 5F8NA 3I87A 2CJYB 1RHKB 4ZVSB 4QJVA 3UR3C 3I9ZA 3MPUB 5CXTA 2GFFA 5F8GA 4UZBA 1OYDA 3W9JA 4IG3B 4F4YA 2KH9A 4ECXA 3G6ES 2R4FA 4WFBQ 4C9DA 2HRTA 1C0TA 4JV0A 2R7XA 4OI6A 4F3OA 3LAKA 1H98A 2AZ3A 2DNLA 3OR1A 4HTIA 5KG6A 4QWEA 2GVZA 3A4TA 1UEVA 4OQJA 5GAEU 1S49A 3JB9k 2QA2A 3H20A 4HH0A 3HZGA 1LWFA 4KB7A 3DI6B 4D3HA 2QMUB 2ZE2B 1W26A 1R6YA 2YNHB 4JI8F 4DFKA 2VKZG 3EXYA 1HBMB 2W7AA 3R97A 3MM5B 4L75A 1NDCA 5GAHI 2N4CA 3MGJA 4KFBA 1NDPA 2KJWA 2QN6B 4JI7J 3CJKA 3UD3P 1SJ4P 2ZH1A 1TAUA 1YGYA 3NGUA 2M8DB 3M6XA 1VHIA 2L9NA 2MKHA 2P9CA 4C0OC 1QY7A 4NEYA 4A4JA 5A2QU 5DG7A 3AD8C 1U1PA 1SKRA 1VQ9S 4IOAQ 2XMAA 2CAJA 4YEAA 2WVFA 4B02A 4EGLA 4CYUA 1YI2S 2UZAA 3I55S 2HQIA 3LP0A 1NJIT 1H0HB 2OPPA 1KOOA 3RAXA 1TMMA 1TL5A 3J7YU 1CULA 3RBDA 5HVHA 1KC8T 2BE9B 3HSGA 3A3PB 4ID5B 4R5PA 1CC7A 1Q95G 4IDKA 4OJHA 4FS1A 1NHKL 2YKMB 4B3SJ 3ZC4A 4BCAA 3OBIA 1YDLA 4USTA 1DQ8A 4JI2F 3PO4A 1N0VC 4JOUA 4Q7AA 1FEHA 4PG7A 2AKWB 4LRDA 4YMEA 1JXVA 1Q5YA 2JRSA 2R7SA 4M5DB 1T05A 2OPQA 5KFBA 3IS9B 2KXHA 1JX4A 4MK7A 2QMXA 3K58A 3LGMA 3FSXA 4WPAA 3RW7A 4EYIB 2IVFB 1H7XA 1R0BG 1Z1ZA 5A0YB 4TVAB 1SKSA 3WQPA 4RNOA 3HMJG 5E41A 4Q0BA 4LF4F 2MEWA 4Y6IA 3K7RA 2RIJA 2YNGA 2SXLA 4USUA 1UZDA 2DRAA 5BXIA 4C4WA 3CMQA 4HI2A 5FLXY 2P9GA 5BR8F 2ZM6F 2C3YA 1MMDA 2GHVC 1CPZA 2XZDB 1IM4A 1HQEA 3CD0A 3H2VE 4K4ZA 2V34A 2Z2ZA 3OVAA 1ZOTA 2BR0A 1FXLA 2MSTA 4LFBJ 2IJFA 3JQMA 3K8WA 3R6GB 2XNRA 2YWKA 3DYAA 1FXDA 1GXLA 2WB1D 1Z4UA 3K2YA 3HVWA 3MD3A 1ZTTA 3NS6A 1T03B 2MQOA 1SC1B 4P74A 3DU5A 1B7YB 3HVAA 2XGQA 1C4AA 3M8ZA 1KDNA 2DKOB 2UUBJ 1HI8A 3ICLA 1A9NB 1Q16B 3MAQA 2IAJA 4DSLA 3RYLA 5I4MA 1PYTA 2U1AA 5J2QA 2JDJA 3FCHA 4PWDB 1EB0A 4LREA 1B7FA 4IRCA 1BUXA 1HNIA 1ZTWA 4YHHJ 2WSFC 3D2WA 5L9NA 3BQ1A 3KLHA 1SQEA 3GWCA 2XS5A 2IY5B 3ONQA 5KFRA 1IWAA 1IKVA 5IOLA 2BJ1A 5CCMA 1U0SA 4U6PA 3NS7B 2I6WA 2DISA 3C15B 5KFWA 1V3RA 2XSJA 5K9FA 1HYSA 5AJ3F 1F9HA 1OPZA 1RAOA 3RRKA 1WEZA 4DSEA 1X4BA 1YVFA 5LMNJ 2IRYA 2HHTA 3LF0A 5KFSA 2DEIA 2GW8A 3ISNC 2MLZA 4FNHA 3PW5A 1HD0A 5DDOC 2C1EB 1NNDA 4TLQA 3PJWA 1IBMF 2CG4A 1UVJA 2ZE2A 2HHVA 3BSOA 1WC1A 3HHNB 2O67A 3PW2A 3D6HB 4BWMA 2QV6A 2YQ0A 3TRGA 4OYOA 2XZTB 2XY5A 2JC1A 2B56A 1SI9A 1OO0B 2A6MA 1N52B 3HJVA 3L9ZA 5FDLA 2V69A 2AJFE 3TR5A 2F5GA 8ATCB 1KHVA 1APSA 4EEYA 1RWKB 2H65B 2FZCB 2L9WA 3IRXA 3MCSA 4IH7A 3UCUP 4X66J 2G2ZA 3D28A 2V2ZA 4ES2A 1RWPB 3EJMA 5GMKa 1XWLA 3B4DA 3DRSA 4XDCA 1VRTB 4KFBB 1S1XB 3KUGA 3DDNA 4DUZF 4NA2A 4AQYJ 2M52A 3K89A 1FWPA 4HR2A 2Z2LA 2FJXA 2KU7A 4DPTA 4CO4A 3W60A 4O4GA 3GJQB 1X8DA 2UV8G 4DDFA 1S9FA 1RJJA 2ZBRA 3VVTA 5MAOA 4ID5A 3SV3A 1HMVA 1GAOA 1REGX 2N7YA 3AOBA 3CCWA 3MEGA 2OI2A 4C8MA 1NK7A 3EICA 4TQSA 2UP1A 3HLUA 3U02A 4DX8H 4QWAA 3D0IE 1VQ6S 2NSCA 1RWMB 1U6ZA 4N8NA 2QJ3A 1V3SA 1KLMA 2OPSB 4QBUA 3BO3A 2FVRA 4RU9A 1GEHA 4LRBA 4RR5A 5ETPA 4QPXA 3IXQA 2MXYA 1ROFA 3ELHA 2KG0A 4KTQA 4K4UA 3CIZA 3BGOP 1SL2A 5F8HA 2W2QP 3NP5A 3VCDA 3IMQJ 3K17A 4JI6F 2VICA 4JI3F 2HHPA 1SBRA 7FDRA 2F9JA 3OVBA 1B64A 1ZAWA 4DU7A 4M5NA 4UQTA 1HBNA 3EGWB 4OLOA 4JUZA 3QGPA 1UJ5A 2BRLA 2Z0GA 1HBMA 5DDRC 3SSSA 2DXEA 2J7UA 3NBPA 3RG6A 1U49A 4E0DA 2GJIA 1XNRJ 2F4VF 1ZM9A 3DXBA 4X4RA 4G6VB 5LMNF 4E98A 3ZZOA 4DHVA 3JAMY 2ZBIA 1XNQF 5A6PA 1DTTB 1IUJA 1VIOA 3M1VA 1NK0A 4QW8A 2GO8A 1L3VA 1N6QB 4QPTA 5G0RB 5EX3A 3G6YA 3Q83A 2UU9J 4X4TA 2ZJRQ 1WJ9A 2YQ1A 2EPIA 4Q5VA 1RYSA 2DO0A 3POTA 3QT7A 4N77A 5A76A 3GV5B 1KQSR 3LA0A 2X51A 3J80U 3AXMA 2XWXA 5GAEI 1OQ6A 3E2EA 2VFSA 1QSYA 5KFTA 1U1LA 4LF6F 3BSAA 3I4HX 1T8EA 1IQZA 2XLJA 3UN5A 4DL4A 1SC3B 3KDOA 3TA1A 3Q0AA 1GX6A 2K8GA 2DH9A 2ZH6A 5DDQC 4B9MA 4NLUA 2H4YB 4CCHA 2RKIB 4RL1A 4PWUA 4UUXA 1N5SA 4FPRA 2FLLA 3H5UA 3PCOB 4WFZA 3T19A 1KFDA 2HWIA 3GR1A 2V2QA 4OZNA 1CG2A 2CZ9A 5IV3A 3PW7A 1A0OB 2JL9A 1H6KX 4FYYB 1LWXA 1VHFA 3W2WB 4LBIA 4N56A 2I0XA 4AE5A 4YQWA 2IVYA 1ZM4A 2VPYB 3CCQS 2BMBA 2NXCA 2NPFA 4CNYA 3KOAA 3M8RA 5IWAF 4IH5A 1EZZB 2BW2A 2DXDA 3MEEB 4Y2AA 5D77A 5ETOA 5K8MA 3GIMA 2OPRB 4DPOA 2AW0A 3T5JA 1TKDA 4JI1F 4ZCIA 4LF7J 2OFGX 4BDPA 1RWOB 3HZEA 3DLEA 3TQEA 1CEZA 5C24A 1ITPA 2D7SA 4LF8F 1RDRA 4HL9A 1S6OA 1XK8A 1CULB 4KGVB 1XMQF 1RCXB 3M2VB 2FLOA 3GG0A 4YR0A 1QVGR 1KOHA 3R5DA 2D9PA 3MOJB 4MYTA 2Y1RI 4PQAA 4LIWA 1KVJA 4NLDA 4K4WA 5IT9Y 3C19A 2HLUA 5KT7A 1K44A 2Y9HA 3D66A 2QC3A 2HFVA 2Q79A 1X0PA 1BE4A 4DBQA 5FDLB 3Q24A 2HNDA 2ZUGA 3PDNA 1ZZNA 1GX5A 2Q3PA 3BGUA 1BQMA 3ILIA 3TA0A 4E2FB 3IC1A 3G8SA 3B82A 2VJUA 2GZOA 1M1GA 5KFCA 2BV3A 3EGNA 2RQ4A 2JJ4D 4GC7A 3H4DA 3BEGB 4HACB 3PV8A 3IGNA 3CVKA 1B0PA 3NEKA 4OHVA 3N6LA 3MM5A 4DL2A 4USJC 5ITHA 2F8EX 1Q86T 3IWNC 5T41A 4OI1A 3VZHA 4DX5A 4DF8A 2C28A 2R2UA 3RZAA 3O2IA 3UWTA 4ZKAA 1PJ7A 2ZH7A 2ASDA 1UVMA 2L9DA 1S79A 4PR6A 2RUSA 3M7VA 4PG8A 1N48A 3V6DB 3F44A 3FCVA 1U25A 5L1IA 1NJXA 2DHGA 1RT5A 1FRMA 4JI0F 4ZJQA 4X62F 2ZUAA 2W4CA 1TK0A 3EGVA 1SXLA 1NXIA 1TKTA 4K59A 1J5EF 2Z8QA 4NE9C 3QJPA 2W9CA 2XMTA 3AAWB 2RQCA 3SQGB 1J5OA 4NLYA 4YB1P 1NSAA 3D9BA 3R7BB 1N88A 4BC7A 5CYQB 1FDAA 2IAJB 3QWPA 5B7WA 5C2CA 3BKTA 2CVIA 1L3UA 1U02A 5CZXA 1L3SA 2HURA 2J6TA 1U8SA 1I3OB 3HULA 4TY9A 3G9CA 1P1LA 2D3O1 1SKWA 2Y8WA 3EX7B 1IBKF 2EFPA 2A1BA 1I51B 3BDPA 1WNEA 4F8RA 4M5LA 3OL9A 2QMWA 4FXDA 1BQNA 1VS3A 1U2CA 1LWCA 3Q8UA 4C8NA 2RDJA 4ZS6A 3POTB 2EK6A 3UR0A 2W1BA 5HQMA 3TUZC 5AXMA 4O3PA 3CCSS 2XWYA 4LVNP 3F56A 2XS7A 2K7KA 2DGVA 1FWKA 4NLRA 3HHKA 1FTCA 1KONA 3SCKE 3ZZPA 4F0HA 1TL7B 2YTCA 4HHJA 3UPFA 2G1DA 1PKUA 3BF4A 1P8GA 1Q7LB 5CA5A 4K50A 4Q2LA 1P1TA 2MZ1A 1L3KA 5SUHA 5KFAA 4LF5J 4PWWA 1QD1A 2H5JB 1EETB 4UT4A 3L3CA 3LQVA 4FYXB 2OEMA 3AH6A 3M8PA 2W9BA 4J37A 3TVZA 5CAAA 4EBCA 1HNWJ 2EC0A 4K4SA 2HSEB 2XYHB 2GJ2A 4NL5A 4YN3B 3ZNJ1 5IV4A 1BWEA 4IO9Q 1UFWA 2PT0A 2M3DA 1NEEA 2B7CB 2J0WA 1KD1T 4LF5F 1I5OB 1UFKA 2AMCB 2ZNZA 3FEYB 3JSRA 3QATA 3Q8PB 3MFHA 4DL7A 1YJUA 2CDQA 3KJVA 4JI0J 4CLFA 1ICEB 2MHEA 5KOXA 4B3MJ 2E66A 5CZVA 1K1SA 3N79A 1NHVA 2AX0A 1REVB 2DGSA 2AJ4A 2IDLA 2KT5A 1VC0A 4NRTA 3A8EA 1U26A 2AIRB 3D67A 5I3PA 1S9GB 3SMZA 1VRUB 1SCJB 1S0OA 1Q8IA 1S1TA 3AD7C 3OXFA 3LPYA 4ATNA 4LIRA 4CIOA 1ZAXA 2YH1A 1SJ3P 2JX2A 5HVGA 3KLHB 4ZCMA 3JAMU 4ZVGA 2ERRA 1HI0P 1T11A 1XR6A 5F9NA 4ED8A 4DJBA 1P9YA 5DO2A 3DHWC 1OIAA 2ZH3A 3BBFA 2HGNA 1CQNA 5GADU 4QYZJ 2G4BA 2YKQA 2DNMA 1N5YB 1JJHA 9RUBA 5HMZA 3MM8B 3HHEA 4DV5F 5LJ5Y 1M5VC 2CXEA 5LM7E 2RU9A 1HIYA 3KXDA 2EI5A 2D1CA 3GIKA 1BQMB 2ZOFA 5CQGA 2H5IB 4WTOB 2VG7B 1H74A 4ZVOB 3UDEA 3HP6A 2AYGA 4EBDA 1D09B 1NB7A 1IN0A 4DU8A 4JB8B 3TP2A 2CNLB 3DRXA 4F36A 2MKYA 2ALYB 3BPSP 3NBPB 3NWRA 1REVA 1EKSA 4M5MA 4LT6A 4OZ2A 2IYIA 2DY1A 3DGPB 4I64A 4LVOP 3HSJA 5ETLA 4DUYF 3D0GE 1NSPA 3C2PA 3KWMA 3V6KA 4ECVA 1RWXB 4Y3CA 2Z57B 5ETTA 4ZIWA 5E3QA 3OJSA 2HK3A 3HKZD 4DR4F 1RT4A 2DEJA 3A12A 3PTWA 1UETA 2V50A 1F2GA 3GSIA 1NH7A 3FK4A 3N6NA 3SDEB 3SI8A 1H2UX 4KO0B 4X65J 2R7WA 4O4GB 4JYAF 1U24A 1K8AT 4WF9Q 1T7PA 3GV7B 3M8WA 1CJVA 4NX9A 3T6JA 3LO3A 1RLCL 1RSCA 3HDSA 4WP3A 4NASA 4PZVA 4URSA 1FNOA 4ZPAA 3TX8A 5KFGA 1O8BA 3SQGA 2LU1A 3CDUA 4CTAA 4LFAF 3A3OB 3DLJA 3U1MA 2NLWA 4B3TF 4WU2A 4DV0J 3T5HA 2ACYA 2FLNA 1BC6A 2AP6A 2RMLA 2CNNB 3I32A 3L95X 4UF4A 1VIXA 3R7NB 2IHR1 2HQGA 3NGKA 1RB0A 2GVDB 5KFVA 3QO9B 3FEZA 3I0SA 5L9XA 3HT3A 1VQPS 1TL7A 3CJ3A 5DQHA 2DTJA 1PILA 1UFLA 2VH7A 5D4OA 2W01A 1DTQA 4ZOSA 4DFMA 2PMWA 3NKYA 1FRXA 1FF2A 4HLBA 4OZ1A 5K5MA 4AXJA 4F4WA 4ER8A 3CULA 4PQUA 2GIFA 4ETZA 4DR5J 3FDSA 3CMAS 1VR6A 3DOLB 4GVLA 2A3JA 3R5BA 5KFHA 3QLHB 1JLQA 1V5IB 1VDHA 2FHJD 3I6PA 4BHQA 3LGHA 2ASLA 4NXNF 1KTVA 2PO4A 3V6HA 2OFHX 1TV6B 5HBMA 1DTTA 4KKOA 2IYGA 4ZVTB 4EZ9A 2P9EA 1E6VB 3DLKB 3LAMA 3ZZUA 4I56A 2I2YA 1PAUB 2RRBA 1RT5B 4OJGA 3BH6B 4M5KA 4N8OA 3W9IA 1FK9A 3TZZA 1AFJA 3H59A 3QBCA 3GV8B 3HSDA 3A1YG 1JLBB 3G87A 3DGVA 1RAAB 3IAM9 4HH1A 2HKEA 2QG9B 4MKVA 2PA3A 3OR1B 2JOQA 2VQEJ 1YRUA 2D3UA 4UY8T 4P72A 1X0FA 1S9GA 1RWWB 4Z2XA 4D3GA 1VYAA 2BJ7A 3FC9A 5H9EJ 1S1VA 3CO0P 8RUCA 1Q81T 2JLEA 2YQ3A 4ZPDA 5CABA 3M2UB 3QFHA 1JLGB 2X1AA 4LR7A 4W4MA 3FGVA 3TQ1A 4K0KF 2C3MA 5E7OB 2MY8A 2XZWA 3UE2A 5I42A 1MN9A 4X65F 1BD6A 3QGIA 4JYAJ 2UUCJ 7FD1A 1ZZFA 3FZ2A 4JBCA 1WTFA 1WI8A 4DV6F 3W7BA 1KQGB 2EG2A 3AA9A 5J2NB 4LUBA 2Y8YA 2CJBA 1FTRA 2LEPA 3GSDA 4USVA 1HPZB 3PRBA 4RZRA 2X1GA 1R31A 5F8JA 3O44A 5U47A 1O51A 2HFZA 3DRRB 3MM7A 4U7UD 1ZH5A 2UUBF 2DXFA 2XBPA 3I5CA 4WCEQ 2MHNA 4WFYA 1MNEA 1G3OA 1HQ2A 1RA6A 2NXNA 4ID8A 4PYAA 3KLFA 2OPPB 2CA9A 2O1PA 5I3UB 1VFJA 1RHMB 3VAMA 2HAFA 5GMEA 2W9BB 3V81A 3SCJE 1NPKA 3HT0A 2CRLA 2LQJA 1ZM2A 2U2FA 4ECQA 5CCLA 5D8HB 4DQQA 2IBOA 1JLEA 1LV5A 2IPOB 1YRXA 3D6MB 2V8PA 1SVDA 1R8BA 2VBXA 4ED2A 3V6JA 1KRPA 3CDWA 3KK2B 3KLIB 1ZETA 1SJFA 4DR5F 3KTQA 2ZHBA 4KBIA 3JS9A 3C6UB 2E9ZA 1R27B 2NPIA 4DFPA 2ZKTA 4O23A 5B0EA 2WVCA 1YSJA 4QIFA 5JVGQ 4HHHA 2XYPB 3MM9A 3PM9A 1T02A 3M30A 1FDDA 4PUOB 2CKWA 2XHCA 3CE8A 5HP1A 3FQLA 2KZZA 1TKZB 1GTEA 5DZ7A 5BYSA 4DV0F 3T1HF 2WTFA 2JVOA 4DPXA 4FYDA 1RBLA 2RRNA 1NSQA 3LP0B 3B78A 2AJ1A 2XMVA 5HAOA 1WG1A 4A8SA 2CQ2A 1IBCB 2FHJA 3KG4A 1WC0A 3DRPA 1RWNB 3ITHB 2ZC4A 2RF2B 2CJXB 4QR1A 3KK3A 1SH0A 1VQ7S 3V6DA 1DLOB 1UL3A 5A8KA 1S5ZA 2V4QA 4XAKA 2V5HG 4QR2A 4IOCQ 3PO5A 2BKNA 4F0KA 1RGVA 4YP3A 4ZHRB 2Q66A 2WSEC 1N54B 3BREA 3W2VA 3ENWA 2HYIB 3MPDA 2LMIA 3W63A 4IFVA 4DR2F 4GRSA 1S6PA 1XN9A 2ZVIA 4ZPCA 2XQCA 2DRBA 1EARA 3CNQP 5D0RA 3LOUA 2VFUA 4KE5A 5BYQA 2RT3A 3IN5A 2GVZB 4IOBA 3EVMA 3CJ4A 2UUWA 3I5AA 4YDXA 4MIAA 3D6FB 4CM0A 1NMEB 5IC6B 4OYZA 3PR4A 5HP1B 1T9XA 1S6UA 2V0NA 4H54A 4KKOB 1CJKA 4OYAA 4ZPVR 3OW2R 2LECA 4TLRA 5KFKA 1WD6A 4ZPTR 1XEZA 5KG0A 2MKKA 3DOLA 2I5JB 1PGZA 3OXLA 3TEGA 2RRAA 1Q79A 2DNRA 3M2RB 2JEFA 4H4OA 3AFGA 4IH6A 1EAYC 3C6TB 2MLXA 4FKYA 3S7RA 3DFEA 4RBVA 3HPOA 1CLFA 3LUYA 1JJCB 2QYGA 2XULA 1OPIA 2CQPA 2DCLA 3FEXB 3NGDA 2IIHA 2VL1A 2Z2YB 4MYUA 3M8QB 3R3TA 4ECWA 5CYJA 1SQFA 1T94A 3MTKA 4KT0C 2HIYA 1HBNB 2ZDPA 1RU1A 1B99A 4ECRA 5IXUA 2FLPA 1JLAB 3TZXA 2MKIA 2WONB 1FRIA 1Y9OA 3FNNA 2YKMA 2ZH5A 1X4GA 2RILA 3MFIA 4AL5A 3THPA 1NU4A 4AUKA 1YZ6A 1S1UA 4F7VA 2XNQA 5LSLA 3K5NA 4GVBB 3SIPB 1RTZA 3TEHB 2LQ9A 4J9LA 3BGFA 1P9QC 4OHZA 2CQDA 2UUTA 3KJNB 2HPUA 1RABB 2FYXA 2G0CA 2LLZA 4CT9A 5K20B 4BBYA 5EDWA 2KG1A 1RZMA 1X7VA 4L73A 3J7YI 1UVIA 3PKYA 1FX2A 1GXTA 1NHUA 4RWXA 4U8YA 4U95A 5L46A 3R2CJ 1LW2B 2GIQA 1LWEB 4KAIA 1Y3JA 4WBFA 2IA0A 3CO9A 5HJXA 1CJTB 2LQBA 3VGSA 3M8QA 1YBUA 3DLLQ 4OFZA 2V94A 4TNOA 1QE1B 5ETSA 4C11B 3UN3A 4R8UB 3GG1A 4X4PA 5LSRA 1JNZB 3R27A 1UA0A 4TY8A 2QE5A 4L76A 1RKJA 3D6TB 1RLDA 4FYWB 5DG8A 2DHHA 3KDNA 2YY3A 2PC6A 3NS5A 4G1QB 1YJ7A 2J9CA 4ICLA 2VQEF 1XJWB 2HGLA 1RT6B 3MPYA 3KKFA 3BBBA 3BYRA 4H4KC 1RAEB 4RW7B 3DOKB 5A2QY 5IC4B 5T7LB 3PYDA 5A6WA 5DS7A 4P10A 2FB0A 1IKWB 2IMOA 4LSNB 4O3OA 2MGZA 2EVZA 5C25A 2VIHA 1Q53A 4DN9A 1TFWA 1RHUB 4F2RA 1FJGJ 4ZVHA 4A8WA 3CJ8A 5KFLA 3QT6A 4DV2J 2ZJQQ 4B9LA 5KFXA 4QOTA 1XBWA 2I8EA 3KK3B 3EWGA 3OFFA 5KAKA 2YNIB 4C6AA 2QA4G 4I6YA 5H9EK 4F3QA 1VQSA 4Y2CA 2LKZA 1VQKS 4NMLA 1MMLA 2NCKL 4TYAA 1OJ4A 2DGOA 4QU7A 2F1FA 2HWTA 2R7RA 4CLLA 3VGTA 4FF4A 3ITHA 1WG5A 3D0HE 3TA2A 5HMWA 2QFJA 3L09A 3P8BB 4ANDA 4LF4J 1WKKA 3J7AN 4IUFA 1RT7B 1Q0NA 3EVWA 3K0JA 3B6BA 4EUVA 3BPDA 4ICLB 4OJ3A 3UD5A 4ES1A 5KFNA 4RW7A 4WIIA 2V4JA 4P2XA 3A8JA 5KFIA 2BE2A 2Y1LB 2HQDA 3LP1A 3V2UC 1S10A 4Q8FA 4DV4J 2VQFF 4IQXA 5KFMA 2MY7A 5DDPC 4K4TA 5J1NA 3W5XA 4P71A 1U09A 4HDGA 3B4MA 1S4FA 3NLCA 3D68A 5L38A 3W2WA 2JLFA 2LFVA 2VONA 4EZ6A 2HHUA 4JI4F 2DR6A 2FQQB 1PJ5A 2W4DA 3I0SB 3EVOA 4Z7YA 1F5CA 3K5PA 1MWZA 3PKMA 2BJDA 1TUVA 2E5LJ 1KSPA 4DQPA 3UVJA 2LXIA 3O8WA 4F50A 4LF9F 5HQ8A 1Y3KA 1XERA 2FVCA 3LWMA 3M6VA 4RNNA 1DAXA 1XR7A 2PIIA 3KNGA 4NZ0A 3E01A 4OYPA 3RBXA 4DOZA 5K14A 3NAHA 1GTHA 1MG7A 4DV6J 3KMSA 2ASJA 3OTDA 4HKQA 2V6AA 4RW8A 4ELVA 2FPHX 5L1JA 3JQKA 4ZJLA 4XPCA 2RVJA 2XO7A 1WOOA 6FDRA 3CCES 4DR1F 4USHA 4I6AA 2V2KA 4DCOB 3PVXA 1Q7YT 4AD6A 4EWTA 1VQMS 1FDBA 3U27A 1TVRB 4JI1J 3KNAA 4ILLA 2PFFB 1RT2A 1HNXF 1RAIB 1S57A 4YHHF 1Q1KA 1VQNS 2W2OP 2JSXA 1HBUA 1Q5VA 2E5JA 2AYMA 3HHLD 5E5NA 2CNOB 1URRA 2FJDB 2DH8A 1M5SA 3QGHA 4PXDA 4QIGA 4S0MA 3G8QA 3UI3A 1F5AA 4DX6A 1HWKA 1R89A 3NRBA 3RB3A 4QU6A 1MSWD 4QWCA 2D3ZA 4ED1A 4B3OB 2AF6A 2K1RA 3OFHA 3D4JA 4KGXB 1C1BB 2YKOA 1HNVB 4H4MB 4OJ1A 4RW4A 4A8XA 2OJ3A 3BR8A 2QEXS 2XLKA 2NZ4A 2CQIA 1TMJA 2BZ2A 4C0BA 1S0MA 4GKJF 3P45B 3TAPA 3J7ZT 2E1PA 4WXWA 2RHSB 2ZH2A 1FWLA 1WHYA 2N3LA 4QIVA 3TYTA 5IZHA 3DRPB 4H4OB 2EFVA 1RA7A 3M32A 3ZTSA 5K8OA 1LNQA 5E3CA 4RUCA 4YY3J 3NY0A 4NI2B 3VAJA 1JXLA 2BJ8A 3IG1B 2VG5B 2GX8A 5DQIA 3NGRA 4ECYA 4LF6J 4ZLNA 3OTEA 4M5IA 4RBUA 3TX0A 1EX8A 2M0GB 3F41A 1J5EJ 4IG3A 4C8ZA 4WZQA 4LJMA 3MR6A 2J9DA 3TJ8A 2YX7A 4FVMA 1TKXA 1I94F 1WORA 1RQ0A 2CJAA 1ZA1B 2EK1A 2B4PA 1FD2A 5A0YA 3B54A 1VRUA 5KOWA 1OS5A 3GQCA 4ZIVA 4IYQA 1SC4B 4U96A 2BABA 2CWXA 4LFAJ 5L39A 3CJSA 4ELTA 3RRHA 1JB0C 2GCFA 2VD3A 4KGKA 2B9YA 4B3SF 3HD1A 4UUWA 3VV2B 1FVQA 5L1KA 1DZ5A 4F4KA 3L7PA 3JXOA 3ZTRA 3PXGa 3FUYA 3RR8A 2BEFA 4ZK7M 4ZCLA 4KHPJ 2JC0A 1N32F 2M5YA 5DM6Q 3PW0A 3HXMA 1Y5IB 3TJAA 2Q1LA 3J7Z5 5D6GA 1JKHB 4R0JA 2QZ8A 1FVSA 3T1YF 4ZP8A 1UWBA 4P52A 1U6BA 4DMZA 3MDFA 4X84A 2OO4A 5HATA 1ZBTA 2HZCA 5A8WA 1PAEX 3KK1A 1S1WA 1Y5LB 2PMHA 3DDIA 3JYTA 3BYPA 4NXMF 2C2KB 2ZOMA 3M8PB 5RUBA 1QAJA 4I67A 5LT5A 3KYLA 1N4LA 3C16B 4IDKB 4A48A 2MZSA 3G71S 4AQYF 2XMKA 4DUZJ 5HQLA 4UOGA 2QLBB 2ZH8A 2GV1A 3ZFVA 1JJ2R 4UW2A 3CDAA 3DLGB 1S6QB 1U8WA 3AD9C 2QLXA 3GJSB 4UQGA 3C14B 3H25A 1CS4A 1JMTA 3HHLA 4MTPA 4AFFA 5J2MB 5EWGA 4IR1A 4JV2A 4G1PA 4ECTA 3D7SB 1KQFB 4K4XA 2H48B 3TJ9A 2R8HA 5KG1A 4CLUA 2LQ8A 4YB7A 2ZD1A 4DQIA 4DR7J 4Y00A 4A8FA 2E9TA 1CJKB 5IFMA 1Y0HA 4DLGA 1X4HA 2G0JA 1K0TA 2VBZA 1WWHA 1QE1A 4C11A 5E33A 3H40A 1GMWA 1VI7A 5AXLA 3QRPA 1DFDA 2D69A 2FDNA 4P2MA 4DQRA 2DNPA 2MPUA 1KVKA 2OMOA 1JWWA 3OD2A 2HQFA 4ECZA 1LFWA 1LOUA 2MZRA 2M88A 4YFUA 4PPDA 5AJ3J 3C3LA 2HFUA 2X1FA 2B43A 3SBMA 3BN4A 4F2SA 2RHQB 2NXUA 2GMJA 1WF2A 3Q8VA 4P6QA 3OR2B 3R8YA 2NS1B 3P4UB 4RKUC 2R3VA 1IKXA 3HF5A 5GAHU 4QWDA 3OV7A 4FBTA 1HBUB 1VJQA 3EM1A 4V19J 4B08A 4N7TA 2MMYA 3G2XA 4ZLPA 2CZVC 2P8IA 3WZ0A 3OL8A 4DLEA 1MU2A 3TAMA 1PO6A 1D9DA 2UVWA 1MROA 2IRXA 2HFOA 2RUGA 4RPFA 1NJWA 4B3RF 2A0FB 3QQCD 2ATLA 1XMQJ 4LBHA 4K4VA 3THVA 1X4AA 3UNGC 3UVJB 2DNZA 4I4BA 3R9LA 2I9SA 3PEJA 3UDLA 5B0DA 3MR2A 4DS4A 4KY3A 3K57A 2RJZA 3W65A 3GONA 2OLWA 2BQ3A 2BANB 2R8KA 4ZN1A 2VJVA 1PSDA 2C2RA 3DOMA 2EFNA 5JJBA 4ED0A 4CLZA 3QFWA 3N0VA 1LW0B 1K1QA 1WKLA 1F9EB 1WKJA 3UCZP 4F02A 1H73A 2B8QA 2Q43A 3H42A 4QZVB 1W2BR 3NNCA 4YUDA 5HROB 4K5SA 1HHSA 2DNOA 2HQCA 3HVTA 2ZH9A 3PY8A 3DKDA 5DJBA 1Z2ZA 2APOA 2ZBQA 2N4DA 4CTAB 4Y0FA 3TI0A 1NLKL 1QAYA 2DNHA 2QA1A 2XI2A 3FMWA 1RTHB 3PYEA 1G7CB 2OPQB 4P75A 3TOQA 2KM8C 1Q8KA 1ZPWX 2X3DA 2R2TA 4QQBA 4R5PB 2OP5A 4M95A 5GVQA 2X1BA 2GVDA 1MROB 1AZSA 4WYWA 2W7OA 4DV2F 1AUDA 4B3TJ 2VOOA 4X4NA 2JEJA 1GQEA 2J9DE 1HPZA 2HRUA 3IBFB 3VR1A 3VZIA 4ZN3A 5KG7A 2W8KA 1SH3A 4DV3F 1HNVA 1FE0A 2BX6A 5HVFA 3OTBA 3E51A 4KRWA 1WOPA 3T41A 1TP7A 2RQKA 4NWBA 4ANEA 5F8LA 1GMUA 4C97A 1WACA 3ISZA 2QYCA 3CC2S 1EIYB 1RTJA 2OTLS 2G0IA 1X5SA 3EZOA 5LL6d 3TUJC 1DURA 3ULHA 1RISA 1TUGB 4CLYA 4F0MA 3TAQA 4LF1A 1W25A 1Y10A 3IR6B 4AL6A 1DHMA 5J1EA 3OL6A 3NMRA 2VG6A 2CJKA 1LK5A 2V68A 1XNQJ 2YNIA 2VOPA 5T14A 1CJUB 2MTLA 2KHCA 5AE1A 4IRKA 2YWFA 4PUOA 3KUEA 3QPIA 1T03A 4U8VA 2QX0A 4CQ1A 1WHVA 1ZA2B 2MZTA 3NCPA 3Q89A 3CJTA 4OYIA 1VBZA 2IMWP 2R7TA 4N47A 2FY8A 3ZTOA 3SYZA 1CBKA 1JLBA 1KLMB 4MIWA 1WF0A 1RUSA 2XC9A 1X60A 2AJQA 3BQ0A 2GHWA 1D9FA 3FSYA 1Y11A 2QLWA 4URQU 4DL0C 1AW0A 4RX6A 1AZSB 4V19X 3M05A 2V67A 1KVIA 4WWSA 2HVEA 2F40A 3GZ7A 5JVHQ 2J0QD 4TU9A 3C14A 3QT8A 3LH2S 3MMBB 4LF9J 2XS2A 3W64A 3OFGA 2KYXA 1YITS 2VPXB 4ED5A 2BXJA 3GFYA 2XO6A 1VJWA 1V9OA 3QLHA 1U1QA 3H2UB 5IWAJ 1HQUA 1RI7A 2MKJA 3M6UA 2XM3A 4PG4A 4MKYA 2HFNA 2ZHAA 1TV6A 4OL8A 2Z58B 2K7JA 2D41A 2XCAA 1QTMA 2C2NA 3AB2B 3F73A 2K2PA 4KV8B 3IR5B 4ZP6A 5AXKA 4RNMA 1K73T 2EWHA 5ETRA 3ZTPA 1N36J 2D74B 3SQOP 2VB6A 5KG5A 2OPSA 3IBWA 1GXUA 1VBKA 1KBRA 1KWMA 1VLYA 3LW5C 3QZ7A 2KT2A 4TU7A 2HFSA 1YLXA 2A2CA 3T6BA 5KT5A 1NKCA 4M5JA 4M94A 3EZUA 2W2MP 3UCGA 1FI4A 4WKYA 2HHHF 2J8AA 5BR8J 1I6JA 1FX4A 1SV5B 4OYXA 4JI5J 1C1CB 2AV5A 1MWYA 1BWVA 2J8SA 3GLJA 2JH3A 4Y28C 3CCTA 3KLVA 2CFXA 2GAGC 4LR9A 4HTJA 4R0EA 1OMSA 2DJWA 1QDUB 5EHHA 3DRSB 1E6YB 1TU0B 1HARA 2G13A 1TL1B 3HSZA 4BWJA 3TNVA 3U7JA 5I42B 3KMQA 4AT1B 3MWBA 4MFBB 2NQPA 3NGSA 1TL3B 1R3NA 1VK8A 2F4VJ 3Q2TC 2JEIA 1HA1A 4OX9F 1FERA 1L5UA 2JWNA 1M90T 2E1AA 4ED3A 2QTWA 2UUAF 2VU5A 4OHWA 4ES3A 3OHAA 4RW6A 5E3RA 1KFSA 1B70B 2ZHOA 2HZVA 1BMQB 3ZZTA 2G2OA 1AT1B 4OV1A 3H7HB 3JTNA 2FZKB 3DOMB 1SJRA 3N6MA 3QIPA 5E3AA 2C2ZB 3GIJA 3ENAA 3I56S 4LBPA 2QGFB 3HFVA 2VFRA 5IQQA 1WC4A 4O3NA 3J81U 1FNXH 4B9VA 3W9HA 4OYMA 4KYZA 5ADZA 1FRKA 3DLKA 3UD4P 4C8OA 1LWFB 2OUGA 2R7QA 3GIRA 3CF5Q 2O5DA 2FJEB 1RBOB 2W25A 1FK9B 2YNHA 5F8MA 2OIHA 1N33J 2B0GA 3EMTA 4CO5A 2PSZA 2HS0A 4JI6J 1CS4B 3HHLB 5J2MA 3RW6A 2VBWA 2WBRA 1B4SA 2WRMA 1KQKA 1N34J 1RTDA 1Q8LA 4PYDA 2H51B 2D3OR 2EW9A 3VGVA 1HWLA 4DR3J 4G1IA 2WAQD 1WSRA 2DHSA 4L6V3 3UDCA 2DIVA 3WHIA 3ZZZA 5A8RB 2V8VA 3PX4A 1UCNA 1UKUA 5ETVA 2NR0A 2VG6B 4BC9A 3MUMP 1HNZF 3X3UA 3R1LA 4Q44A 2VODA 1FJCA 3DN9A 2ZWOA 5KFFA 3RJMB 1HI1A 2ROPA 3R1HA 5C24B 4JI8J 1IBLJ 1U2RA 3GJRB 2ZZNA 3LWLA 1K9MT 4EU0A 1TUWA 3MEKA 3MD1A 1D8YA 4YY3F 1YJTA 1HWUA 3M2VA 1Y7PA 4PPZA 1YQHA 1R8PA 1K47A 2LXFA 4J9RA 3IWXA 3C66A 2H5EA 3CCRS 1HR0F 4RW9B 1U1OA 1FDNA 1SB6A 3DC2A 1M5HA 3VAKA 4NYZA 4CLSA 2LEBA 4B9SA 3KHHA 3CJQA 2YXLA 3M8SA 2LYVA 3HKWA 5LXYA 2F65A 3D3BJ 3DCAA 2H4WB 3HVTB 2HHWA 4IG0A 1QLNA 4NMXA 4FDFA 2KB2A 4K4YA 1NCLA 3V81B 1RP5A 1X5PA 1PJ6A 3D3CJ 1ZAVA 2CVEA 4DSIA 3KUHA
chains in the Genus database with same CATH topology
4DQSA 3PIPQ 1JLEB 3AB4B 2FJVA 4UY85 5EX0A 1F60B 3H4BA 2MQQA 2EBGA 2RSQA 3MMBA 1R8HA 3NAIA 3CCUS 3QYYA 2MYFA 2KYZA 4KHPF 2MSSA 2BANA 2KDOA 2ZZMA 1S97A 3C6TA 3DHXA 2L41A 4KR0B 2BVZA 1C0TB 3BZQA 3KFWX 2N3OA 5AE3A 1M5OC 3W3SA 1OSDA 1V6HA 3WX4A 3OL7A 1G2EA 4EBEA 2CPJA 1S72S 3K5MA 4TN2A 2CZ4A 1TAQA 2BA9A 3LP1B 4J9OA 1WTBA 1RTIB 2A2DA 2FJAB 2YVSA 3J7A1 1U4BA 4LFCF 3CSKA 1BGXT 2W4PA 1J5OB 2E5IA 4J9PA 3G4SS 2NUHA 3LGNA 3OPKA 3DGPA 1JIHA 5MLCV 1C2PA 2POKA 2CQGA 5JXSA 3MPVA 4I2QB 4ZHRA 3SZ2A 2MQLA 2KXFA 2DK2A 4MK8A 1H2TZ 2NYIA 3KJVB 4LSNA 4CI0B 2MGZB 2DR8A 1E6YA 2GGPA 2HHQA 2I1RA 1YJNS 2DB1A 4X4QA 4CO2A 3OTOF 1N56A 2VBYA 2UXCF 2UV8A 3QIPB 2DR7A 4FBUA 1T95A 3TVKA 2CPFA 3ZZYA 4CH1A 2MQMA 1FJGF 2EFQA 1HW9A 3I4PA 3PW4A 1N6QA 2QSWA 4L72B 4RW8B 4RBTA 1X4DA 3WC0A 3NNAA 2E1MC 4YB6A 3I9V9 4NPOA 3O6QA 3DM2A 4DG1B 2IM2A 2ZOGA 4W90B 2KKHA 3OSPA 2CQ0A 2HVHA 2L08A 3P49B 3N5FA 4WE1A 2DPIA 4RUAA 3QO9A 2COLA 2FHMA 2ROGA 1XMBA 4I2PA 1AROP 1R8CA 2C22A 4C8KA 2WHOA 3CXCR 3BB5A 3LP2B 4B9UA 2DR9A 2CJ9A 3DXSX 2FGCA 1J2VA 3PIOQ 1AXQA 2BM0A 4O3RA 2CQ3A 4LMZA 2WSCC 5KFEA 3OSNA 4DSJA 3V4MA 2J0XA 2R7UA 4CT8A 4MFBA 1VQLS 2J6UA 4N5SA 3V4IA 2B9WA 1DQ9A 1SIWB 2J5AA 1URNA 1N5QA 3MEEA 2PGCA 1UAWA 3MPWA 3AJ1A 1VK3A 4PXEA 1S7HA 1VGYA 3MI7X 4OZ0A 2OMLA 4DV1F 2AWZA 1B0VA 1QUPA 3MEDA 4JI5F 4GKKF 1A7GE 1YJWS 2OD4A 3T5KA 1VMBA 5K14B 2DR5A 4KSEB 2GC8A 2RS8A 3H5SA 2NSBA 1JLFA 4Q45A 3IGVA 1FKAF 1UVNA 4OHXA 4Y2IA 4P7VA 4ALZA 1CVJA 2GQCA 4CO1A 1FRLA 3N01A 1S1VB 2EFGA 5DM7Q 3K8VA 3PJXA 2BRKA 1FRJA 3EXCX 2YWGA 3WBZA 1HBOB 5D4PA 5J1PA 3MURP 1SUQA 4WFXA 1YIJS 3H5YA 3PACA 1NK8A 2DGTA 5KT3A 1SC6A 2F9DA 4ZPBA 4DV7F 4ZP7A 2UVVA 3CJKB 1NKBA 4X4VA 2YKNA 1BY9A 4I7FB 2DHXA 5DETA 2JLGA 4HDHA 4NLXA 1A6LA 5F0UA 3ZZUA 2HVZA 4WKRA 1MMNA 2ABYA 2J9EA 5F0WA 3OUYB 3KLGA 2IFXA 4CNZA 1WELA 4OZ5A 2XMWA 1DTQB 1NJYA 5FD1A 2BUNA 1U2FA 3VALA 3O5TB 1R0AA 4NRUA 4Y34A 5GADI 4MH8A 1R43A 3JSBA 2R7VA 5E2QA 1JLQB 1JLFB 2CPYA 2ZC3A 1H2VZ 4ZVEA 2VFTA 4MMOA 1RWUA 2F7VA 2XSFA 1Q82T 3GYXB 3QAUA 4ECUA 2CPZA 2FUG9 3QMQA 1U1RA 2KJVA 3DLGA 5GAGU 2XMUA 2OH2A 1VBYA 2PI4A 4E8UA 2XGPA 2R9LA 1NAQA 1ZM3A 2GO9A 3MMAB 5KG3A 4A47A 1RTDB 3AY0A 4DR6F 2MDAA 2E5LF 3U1LA 1QUVA 4YB5A 4TQRA 2GMHA 4K2XA 3OUYA 1X5OA 2XEXA 1FKOB 2W7PA 3N28A 3BO4A 4WZMA 1VC6A 2VASA 1ZYQA 4J9MA 2M2BA 1HMVB 2DGQA 1S1XA 4HVZA 5F8IA 1CC8A 2KHDA 4MK9A 1NK9A 1F9FA 4PQUB 1R0AB 3CD7A 4IKAA 4P2SA 2XY7A 3M6WA 2AYEA 4C3KA 4OZLA 1DARA 3SDEA 3US5A 4DL3A 3BJYA 1WEXA 3HX9A 4ZP9A 4F67A 2KXNB 5M2UA 2A10A 2R2SA 3WDOA 2JHEA 3PX0A 4I2PB 3S8SA 2MQPA 4OI0A 2AD9A 4IG0B 3GB0A 1NKEA 1S1WB 1FXRA 5DLGA 2FY1A 4JV5F 1C0UA 1PC4A 4I68A 4AL7A 2DNGA 4TXSA 2HAIA 3BSCA 3IA0A 4LQ9A 2KO1A 1FKOA 4YR3A 1FHTA 2RNEA 1U48A 4C8LA 2OKQA 2QRRA 4M5DA 2VV5A 1T05B 4NLPA 4XK8C 2FGOA 4EO8A 5D4LA 2J76E 5KFUA 2GQQA 3P6YC 4MKBA 1LKZA 1X4CA 2WOMA 3DU6A 4B3OA 1KN6A 4QYRA 3RB6A 4RW4B 3ENVA 2Z2MA 3GYNA 2B7BB 3VAFA 4CZCA 4X4OA 1TKTB 2HG4A 2JZ5A 4F26A 1RTIA 1UVKA 2V9KA 1HHTP 5B0FA 5A8WB 3KK1B 2VUGA 4R25A 1GH8A 3RB0A 1ZPVA 5IQ6A 3HVRA 4ZMMA 1U7LA 5KT6A 3OQ2A 1Y4ZB 3MUTP 1HNWF 3K5OA 3OVSA 3X1LB 2M7SA 2MKCA 4C8YA 1HWJA 3IAS9 3QGGA 2AGPA 2D9OA 1S76D 2OSQA 1WHXA 1R7IA 3FJ2A 2UVRA 1FE4A 1N5TA 3HHLC 3I82A 4DSKA 2CPIA 3FSIA 5KFDA 3KHGA 2Y1IA 4L3NA 4ILRA 4FS2A 2BM1A 3I0RA 3SFGA 5J1EB 1LWEA 2FD2A 1RK8A 1VBXA 2C42A 1TR0A 3GE9A 1KNZA 4A8KA 1VQ4S 2YWHA 4EFAC 2JEGA 1S77D 1IJFB 2A18A 4YOEA 4FVCA 4LSLB 3M2RA 3MEDB 3VAGA 5I3UA 4MAKA 2DGUA 5A8KB 3B8HA 2FC9A 2DIUA 3FQKA 4NLVA 5EWEA 3BGLA 3RU0A 2XB2D 2PI5A 3CJ2A 3MECB 4A8QA 3MMJA 3QJJA 3Q8QB 4CH0S 2E7XA 3MOZA 3KHRA 5HN0A 3BO2A 4Q2MA 3BGRA 4DF4A 1S9EB 4NLWA 5EGYA 2P6SA 2LCWA 2BDPA 2E1RA 2GA7A 4WYLA 2CQCA 4U67Q 4I1TA 3CCMS 2Y0SD 4J9KA 1HQUB 3Q2SC 2Z4PA 2FVSA 1SH2A 3IRXB 2YH0A 2KN4A 2DHAA 4OI4A 2YKAA 4Y2MA 3C6UA 2DPJA 4GC6A 4ECSA 2V9WA 2BQRA 4DL6A 3MM6B 1FEEA 4DFJA 3C8YA 3D1OA 1FKPA 3CCVS 2Y1JA 5HBMB 3OTCA 3G6VA 5THWA 3U1NA 2ZJPQ 2GMLA 3DI6A 3H8YA 2L48A 4QR0A 3SFUA 4R8UA 4X64F 3Q8RB 3GIIA 3N5BA 4A8MP 3I96A 3W2VB 3VF0B 1SUQB 4C2MA 5AXNA 3PZPA 1U45A 2LDIA 2J6SA 1UVLA 3SXLA 4IFVB 1UMJA 4U7UK 3T9ZA 2C2DA 2HNDB 3SV4A 1YJ9S 4I7FA 1TL3A 2GHPA 2LXUA 3DMJB 1NZAA 3GFZA 3Q8SB 4Y2KA 3AQPA 4U7CA 4RW6B 1T3NA 1WHWA 3MM6A 3BDEA 2MKSA 2E9RX 1S99A 4WK1A 4X66F 2CPXA 4M63A 2EFOA 1N5VA 1UJ4A 1YRTA 3CMES 1MU2B 2HIQA 3TAMB 2RB7A 3CIMA 3G86A 2F8HA 5F41A 5GAGI 1BLUA 2R8IA 3V4IB 2G9OA 1XR5A 2ZNYA 3O3LA 4ILMA 3AA8A 3BM7A 4X4SA 2QT7A 4Y65A 2N82B 4TU8A 5L8RC 2RU3A 2KT3A 4IRDA 1UP1A 3OFEA 4OX6A 4U9RA 6FD1A 2V8HA 2B6AB 2W24A 3RRGA 4WXOA 5FIIA 2CPHA 3IRWP 3PRDA 1C0UB 1RT3B 4NYPA 4FXVA 1JLAA 2QO3A 4ELUA 5B09A 3DMJA 5HROA 4B3MF 2IM3A 3FZBA 2QA4S 4EO6A 3CJ5A 3KK2A 2V8DA 5E0OA 2W8LA 4GO5X 4OLPA 1BQNB 3TANA 1LWCB 2YNFB