2DB1A

Solution structure of the rna binding domain in heterogeneous nuclear ribonucleoprotein f homolog
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GSSGSSGMMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVELESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA binding domain in heterogeneous nuclear ribonucleoprotein F homolog
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords heterogeneous nuclear ribonucleoprotein F
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2db1A01
4TU9A 2M8HA 2DNMA 1VQLS 1UAWA 1WG1A 2M2BA 3TP2A 1NO8A 2E5IA 4PR6A 2MZ1A 4W90B 5CXTA 1QM9A 3CPWR 4QU6A 5IFMA 2CQHA 2L9WA 2MQMA 3P6YC 4UQTA 2OSQA 2NLWA 3CCQS 2AD9A 1VQKS 3H2UB 1KQSR 1URNA 2DHSA 2LMIA 2CPIA 3MURP 5GAGU 3OW2R 2XS5A 1U1NA 1SJ3P 4PKDB 1WG5A 2VODA 1YJ9S 1QVGR 2KXFA 1WWHA 2L08A 3CULA 2DGUA 2VOPA 1FNXH 1FXLA 2GHPA 2LXIA 2N7CA 1BY9A 4M5DB 4A8XA 3CCLS 4LMZA 1X4FA 2RS2A 2DNNA 1X4HA 2LKZA 1D9AA 3G9CA 1X4AA 1WHXA 1U1OA 2M70A 2DGVA 1L3KA 4P6QA 1X4CA 2MKSA 2HVZA 2DGSA 2MGZB 2DIUA 1U6BA 3MDFA 2CJKA 2U2FA 2KT5A 2ZJPQ 3VAGA 3NMRA 4WFNQ 2SXLA 3H2VE 4U67Q 3EX7B 1VC0A 1U1LA 4CH1A 1N54B 1Q82T 1P1TA 3CD6S 2OSRA 4QU7A 2M4MA 4PRFA 1CVJA 4F26A 1FHTA 1VQ5S 1WF1A 2FC9A 3VAIA 1X5TA 2FC8A 1SJ4P 1K73T 1R8PA 3MOJB 3THPA 3G4SS 2KYXA 4FXWA 2MKHA 5GMKa 3P3DA 5MLCV 1X4GA 1UW4A 2KFYA 5IM0A 1WEZA 3NNAA 4WKRA 2HZCA 2CQ1A 1WI6A 3I55S 2HYIB 2MKKA 3G8TA 1VQ8S 1XN9A 2LYVA 4WIIA 5DDQC 5DDOC 3U1MA 2DIVA 2MSSA 2J8AA 1KC8T 4YOEA 2M88A 2FPHX 1U1PA 3G96A 1M5OC 3CCMS 1H2TZ 4YUDA 3VAJA 2OJ3A 2M8DB 4ED5A 1WELA 1OIAA 1YTYA 3SXLA 2DITA 4TLQA 1WHYA 1WHVA 3MI7X 1UFWA 1YHQS 3V4MA 3SMZA 2YKAA 3B4DA 2DGWA 3JB9k 1YIJS 2K8GA 2DO0A 3CCVS 1SJRA 2DGXA 4WF9Q 4WFBQ 2K3KA 3UCUP 2RS8A 1A9NB 3ULHA 1SJQA 3CF5Q 1OWXA 2CQ3A 1HD0A 3G6ES 4J5OA 2CPZA 2DNZA 1U1KA 2VOOA 1VQOS 1WHWA 2DGTA 2HGNA 5DDPC 5BJRA 2OIHA 2VONA 2LXUA 2CQ4A 1VC5A 2RUGA 3EGNA 2DNPA 2AYGA 3LQVA 1W2BR 2KVIA 2LQ5A 5JVGQ 2CPJA 1VQ4S 2YH0A 4F02A 1VBXA 2AYBA 4C7QA 3R27A 5IQQA 2RNEA 2M9KA 1FJEB 4ZKAA 3B4MA 2LEAA 2YH1A 5D77A 2X1BA 3SDEB 1G2EA 3MUMP 1U1RA 1KD1T 4QQBA 2D3OR 2HGMA 3CCRS 4YB1P 2ERRA 2UP1A 3IWNC 3LPYA 1N88A 4TU7A 1K8AT 2J76E 2KXNB 3EGZA 3CCES 3L3CA 4Y00A 1JJHA 3K0JA 2DGQA 5H1SV 3CTRA 2OTJS 2DNKA 1RK8A 1U6FA 2MXYA 2F3JA 2KHCA 4IOAQ 1H2VZ 2RQ4A 2RQCA 3VAFA 5LSOA 1SJFA 3IRWP 3UD4P 4ERDA 3THTA 5D78A 3U1LA 2LA4A 2EK6A 1OPIA 3MUTP 1WI8A 1WTBA 4CIOA 3BO3A 2MPUA 1X4BA 4OZ0A 1A7GE 4EGLA 1N8RT 1OO0B 1VQPS 3R1LA 1QVFR 1FJ7A 3MUVP 2DNHA 2E5GA 2OTLS 1WEXA 3CC7S 5HL7Q 3CUNA 2DNQA 5LXYA 3BO2A 5DM7Q 1VQNS 2MMYA 5GADU 2EK1A 2MQQA 2D9PA 2RRBA 1HD1A 4FXVA 2X1FA 2DH8A 2ADCA 2JX2A 2MYFA 3MD3A 3DLLQ 3UE2A 4C0OC 1IQTA 2MKCA 2MB0B 3S6EA 3Q2TC 2QFJA 2M0GB 2KM8B 2MZSA 2MQLA 3CC4S 1DZ5A 2MKIA 2AYMA 2CQ0A 3CCUS 1U1MA 2DNLA 1M90T 1VBZA 2O3DA 3PIPQ 2L41A 2QA4S 2DK2A 4F25A 2GO9A 1HA1A 2MZQA 2CPEA 4LJMA 2XNQA 4CH0S 3BS9A 2M7SA 2KXHA 2MY7A 5DETA 5LSLA 2DH9A 2JVRA 1Q81T 1PO6A 1B7FA 3MD1A 3D2WA 3N9UC 2KU7A 4UY8T 2A3JA 4V19X 3RW7A 3UCGA 2MZJA 3R1HA 1DBDA 3J7ZT 2PEHA 1VC6A 3CC2S 2X1GA 1YJNS 5ITHA 1RKJA 2BOPA 1M1KT 1X5PA 1X5OA 4Z2XA 2DO4A 3S01A 3UWTA 2KM8C 4QPTA 2XNRA 2BZ2A 2B0GA 3CXCR 3UD3P 2XB2D 2MQPA 4IUFA 2F9DA 2MGZA 2G0CA 2J0QD 2I38A 1UP1A 2AYEA 1R8HA 1FO1A 1X4EA 2ZJQQ 3TO8A 5LXRA 2KH9A 3VAKA 2MJUA 3S8SA 2N3LA 1S72S 2DB1A 2N82B 4IO9Q 2CPHA 3VAHA 5IM0B 3MXHP 1M5PC 1YWXA 3NNHA 2EVZA 2X1AA 1X5SA 3NS5A 1WF0A 3TYTA 2CPDA 2NZ4A 3S7RA 2J0SD 5EN1A 3DXBA 2V94A 2XS7A 3Q2SC 2CQGA 2HGLA 2DNRA 2N3OA 1PGZA 2F9JA 2DHXA 4WFAQ 1NJIT 1YITS 2G4BA 1DHMA 1N52B 2JWNA 2CPFA 2MSTA 2ZJRQ 1O0PA 1VQ9S 2CPYA 2YTCA 2XSFA 5HO4A 3HHNB 2KG1A 1WG4A 2CPXA 1X0FA 2DHAA 4CQ1A 2U1AA 2RVJA 2CQBA 2JRSA 3PIOQ 1YI2S 2LECA 1JJ4A 2RRAA 3UCZP 1H6KX 1NU4A 2KG0A 3SDEA 3I56S 5JVHQ 2CQDA 3J7YU 2G1DA 2M52A 4C4WA 5DDRC 1Q7YT 1VQ7S 1VBYA 2MQNA 2DNGA 3NS6A 2LEBA 2JVOA 2KI2A 5LJ3Y 2CQ2A 3ZZYA 2MQOA 2KN4A 3P5TL 3BO4A 3BEGB 1P27B 1ZZFA 1X4DA 3FEYB 1SXLA 2MZRA 1K9MT 3NNCA 1WF2A 5GAHU 5CA5A 1M5KC 1S79A 2QEXS 2DGOA 2YWKA 2I2YA 4LIRA 4W92B 1HL6A 2DH7A 5FJ4A 2PE8A 2DHGA 3VALA 3VF0B 5DM6Q 5CYJA 2KRRA 4OZ1A 3VAMA 2FY1A 3RW6A 3CCJS 1AUDA 1WEYA 1FJCA 3CMAS 1ZH5A 4RU2A 2CQIA 5GVQA 1JJ2R 1JMTA 1Q86T 3G8SA 2RU3A 2MY8A 1YJWS 2ADBA 3CCSS 1U1QA 1U2FA 2DISA 4BS2A 1D8ZA 3US5A 2KRBA 2DNOA 5GAEU 3CMES 2LCWA 2MHNA 3ZZZA 2XS2A 1KOHA 1ZZNA 1DRZA 2FHOB 2Q79A 2MKJA 2LA6A 3G71S 2MZTA 1VQ6S 2DNYA 2CQCA 2D9OA 1H2UX 3FEXB 2MJNA 2WBRA 4IOCQ 1VQMS 2E5JA 1FT8A 4WCEQ 1KOOA 1M5VC 3HI9A 4Y0FA 3P49B 2E5HA 2RT3A 1F9FA 2CQPA 5LJ5Y 4TU8A 2E44A
chains in the Genus database with same CATH superfamily
2LDYA 2QRRA 2RE1A 4TU9A 4UQGA 3GYGA 1VQLS 2B8PA 5HVHA 1UAWA 1WG1A 2M2BA 2QTWA 4UOHA 1DAXA 1NO8A 2HQ3A 1IBCB 2NSCA 4B17A 4XPCA 4DQRA 4E98A 2FVRA 4W90B 2AHOB 3CCZA 3EM1A 2VUGA 3GFYA 2VZ9A 4DPXA 4CRJA 1FRJA 2AX1A 2L9WA 2HK2A 2OPQA 3JSMB 2B3TB 3GIJA 1N0UA 3DI6A 4CT8A 1HNZF 2OEKA 3CNQP 3ZZPA 1VQKS 2HMIA 1CEZA 1T94A 1ZAWA 2HWTA 3H2UB 3PYFA 1NK6A 3OTOJ 2HHHF 3PW2A 2NXNA 2C2NA 2CPIA 4IO1A 3ZZTA 1FX4A 3J7AN 3OW2R 4C98A 4WBFA 3HVTB 3K5NA 3CCLS 2H4WB 4DL5A 3TA0A 1RHMB 1C1BA 1M5SA 1RTDA 4CLLA 4O0NA 1XMQF 4U6PA 4ZIWA 1QVGR 1T03A 2QLFB 2KXFA 3BPSP 4NLTA 5E0OA 4ZCLA 5CABA 1FEHA 2FGCA 3DLHA 4WU3A 3CULA 4YDXA 1ZBTA 4PCQA 3UW1A 2GHPA 3IN5A 4M5DB 1GT8A 3FGVA 3IXQA 1YQHA 4QYRA 5HJXA 1U7LA 1S1UA 4U9RA 4UZCA 4CTAA 5B0BA 4NCGB 3ZTQA 1TVRB 1X4FA 2AEMA 2LKZA 1Q16B 5HQ8A 2IM2A 1TK5A 5A6WA 3TOQA 2DGVA 1L3KA 2KKHA 4KKOB 4KRWA 4P6QA 5F8MA 5B09A 3IAS9 1ZTWA 2AJ4A 4LFBJ 1X0PA 2DIUA 1MG7A 3W9IA 2VG6B 3BDEA 1M1HA 2YKPA 1GXUA 4FBUA 3JQMA 4R5PA 2B43A 2QE5A 2VFSA 2Y0BB 1KBRA 2VC1A 3L95X 1LWEB 2RDIA 1MN9A 1S1WB 3T1HF 1HHQA 3VAGA 3NMRA 4TY8B 4NYOA 3MAHA 4X66F 2W9BA 1FK9A 5D0EA 2ZOMA 1SUQA 3C14A 2Y0SD 4CH1A 1N54B 4DFMA 1YBAA 2ZD1A 4TLRA 1SKSA 2BE2A 2MLYA 1PIEA 2OKQA 4LF8F 4QU7A 2KJVA 2AF6A 4UF4A 4F26A 1Y11A 1FHTA 1X7VA 3GE9A 3UQSA 3WZ0A 4X62J 1UWBB 2D7SA 4ZVGA 3GTYX 3VAIA 4JV5F 1TL1A 2BABA 4MKAA 2HHXA 2FC8A 4KHRA 2BE2B 3UN5A 1K73T 3K89A 4L3KA 1IR2A 3NRBA 2MKHA 3W61A 3NCQA 4LF4F 5GMKa 1JLFB 3KUHA 5K20B 3FEZA 3AOAA 4DX8H 1HMVA 5MLCV 4WYWA 3Q24A 4CLUA 2CJQA 1LK7A 1X4GA 4IFYB 1PKUA 2FHJA 2KT3A 4YHHJ 1UW4A 3NNAA 2GHWA 1U2RA 2HZCA 2VC0A 3WX4A 3BZQA 3FDSA 3V6KA 1WI6A 1EP4A 1IKWB 2F1FA 1TTHB 2V63A 2YKMA 4L76A 2E1MC 4S0MA 2WSFC 2GVDA 5DO2A 3PW0A 5G0RB 1XC9A 3OL9A 1K0TA 5IT9Y 1XN9A 2XLJA 2UUCF 1HBNB 3GQCA 4QIWD 2Q1LA 3GU0A 4CO5A 2DRAA 2W7OA 4IG0A 1YRXA 3IM8A 5IC6B 3FRYA 2M88A 2FPHX 2YVSA 1UWAA 3PEJA 3RBZA 3MECA 3TAMB 1MW7A 2WVDA 2K7KA 1V5VA 3SEOA 2BV3A 4ZCIA 4OX9J 3MM8B 4JI5F 4J7CA 4FF3A 1YTYA 4V19J 4FVCA 4WP9A 1VYAA 4ZP8A 1FFGB 2RD5C 3FNNA 2FJXA 2EFPA 4F2SA 5G4DA 1CPZA 3MECB 5L1LA 5HI7A 2FJVA 2YPZA 1OY6A 3DOMA 4UOGA 3TEHB 1VGYA 3V4MA 1F9EB 3KLGB 2VA3A 3KTQA 2DGWA 1YIJS 2UUCJ 2EBEA 3CEDA 2VBWA 3EJMA 2LQBA 4UTGA 5IWAJ 3N79A 2RH3A 2AT1B 3W1YC 1VIOA 2L48A 5J2QA 1IBLF 4TQSA 4LQ9A 1T95A 3G6ES 3M2RA 3M7VA 2DNZA 1Y9OA 3QATA 5D15A 4F3QA 2DGTA 3VZIA 1NHKL 2ZBIA 2K3IA 5KG5A 3G6YA 4FYXB 2WK4A 4PAAA 2L9DA 4PWDA 2QLWA 2HQDA 5ETRA 5AXLA 3L7UA 4OYMA 2PA3A 1FNMA 2C2KB 1S6QA 2DNPA 2IJNA 2ZBRA 3HFVA 3JQKA 1OQ6A 3LQVA 2AYGA 5JVGQ 5KTQA 2B4PA 2YH0A 3A8IA 3CT9A 3SCKE 4EU0A 4F02A 1OJ4A 1VBXA 3DRXA 1QE1B 2J7UA 4C7QA 2RNEA 2BJDA 2ZHOA 4PPZA 4PZVA 3JYTB 2V5HG 3SQGA 3VV2B 4ZITA 2FHJD 4ZKAA 1HW8A 3K8VA 1EIYB 2XWXA 3MCNA 3OD2A 2VDHA 2VH7A 4Y34A 3BGRA 3AQOA 2CNKB 3DOMB 3MPYA 3MF5A 5KFLA 4JI7F 5CAAA 2Z2LA 1RWPB 1WUUA 4K7QA 1FRMA 1U1RA 1BD6A 3KJNB 5LL6d 3SQGB 3CO0P 1JLGA 4JV1A 3AHPA 4QQBA 2AGOA 1B0TA 2J7KA 2CDRB 3D1QA 5L1KA 5T41A 2B9EA 2ERRA 4OJHA 4UY85 1NKBA 1KLMA 1WC0A 3LPYA 3KOAA 4KH1B 3HT3A 4NMXA 2J76E 4F0KA 3TUZC 4Y2KA 5FLXY 2EC0A 5E3QA 2UVWA 2KT2A 4J9NA 4NZ0A 3K5LA 5J2MB 4EO8A 1FJEB 1TMJA 3J80U 4PWDB 5H1SV 4NWBA 2DNKA 3MAQA 4LUBA 5T14A 2YX4A 4DX7A 4JI2J 1WKLA 1RT4B 2F3JA 1H2VZ 1FKPA 2F7VA 2HURA 2XWYA 4MK7A 4N77A 4NLRA 5BYSA 1SJFA 3SZ2A 3IRWP 3UD4P 1FX2A 3O3LA 4LBHA 4A8MP 5HP1A 1FRHA 4NLYA 2OPRA 4LQ3A 1TL3B 3TJAA 1CG2A 1S0MA 3HJFA 4ECSA 2B7BB 5HMXA 4TY9A 1IR0A 4P9SA 1Q78A 4I2QA 3OT9A 4AYBD 2J7WA 1WI8A 3SFUA 3ADAC 3W66A 1IJFB 4DCPB 3OVSA 3KK2A 1F9HA 2W8LA 4LFBF 4CIOA 3BO3A 4ZS6A 3PO4A 3IFEA 2CKWA 2WB4A 1RAFB 4A48A 1N8RT 2BQUA 2B51A 2XZWA 3H59A 4X2BA 3IS9A 4CLYA 1D9DA 3DU5A 4RUAA 2UZAA 4YMEA 2HAFA 4DV0F 3R1LA 4GKKJ 1BC6A 3DC2A 1IKXB 1JLGB 1XK8A 4GO5X 4EWTA 2DR5A 5F0WA 3EXCX 2WRMA 3I32A 3QNWB 4RW4A 1WEXA 4EMDA 3R8YA 1IKYA 5HL7Q 2DNQA 3H90A 4DV4J 1U47A 1DTQA 5E7OB 1HNWJ 4JI0F 3B82A 1OSCA 2G9OA 2JC0A 3JSBA 3K5OA 3N01A 4G1IA 4X84A 3SSRA 4HDHA 3V5RA 5I3PA 5JXSA 3Q8UA 2MMYA 2GIQA 3KJFB 4RBVA 1N6QB 3I0SB 2ZH5A 4ZIVA 3TQ1A 3B6BA 1QAIA 1UVLA 2GAHC 2ZOGA 4DU7A 2D9PA 2LVWA 4DV1J 4ES1A 3HVRA 2LXFA 5K5MA 4FXVA 3LH2S 3HPOA 2DH8A 5KFAA 2J0WA 3NGRA 4RO0A 4W98A 1F5BA 1FD2A 1IKVB 5HBMB 2VG7B 5KFVA 1PJ7A 4DSEA 4M5MA 1TKXA 1Y5IB 2F8EX 4C0OC 2GS8A 2ILYA 4LREA 3OTOF 2V68A 4HHUA 2GQ2A 4ZPAA 4DQIA 3S6EA 1QLNA 2E7WA 2GW8A 1RT1B 2M0GB 3I5CA 1F3FA 5F0UA 2MQLA 1N34J 3EDRB 4OHXA 3UR3C 2HS4A 2MKIA 2HNZB 2PSZA 3CE8A 2GNKA 3VVTA 3CCUS 2Y1IA 3R2CJ 1FERA 2DNLA 4ZVQB 4CLZA 4EBDA 2CWKA 3P4UB 3BV8A 3WQPA 1VCTA 1FWKA 4L73A 5KFXA 3PIPQ 1VRTB 3HT0A 2BJ3A 3IR5B 5DZ7A 4ECWA 3I82A 4X4TA 2DK2A 3EVOA 3N4WA 1Q8LA 3QO9A 2GO9A 4OX6A 1F1BB 7AT1B 3LALA 1L5UA 4DUYJ 3CJ3A 3H4DA 4F8RA 1XNRJ 2XGPA 2XNQA 1XIQA 2HNDB 3Q8QB 1J5EF 1KKHA 2BX6A 2OPPB 1QUPA 1RAEB 2XMVA 3BS9A 2MY7A 3GLJA 3I0SA 2NXEA 4ED1A 4K5RA 2CVEA 4G65A 4NLQA 5FDLB 5L38A 5DGBA 1ZTTA 4DR6F 5J1EB 2Q3PA 1B7FA 1VISA 4F36A 4ELVA 3AY0A 1XQIA 3PXGa 3NGDA 4DPOA 4UY8T 2V4JB 5GMDA 1Z4UA 3SIPB 3GWCA 4WP8A 4B3SJ 1HPZB 3PCOB 1N32F 5K8OA 4QIGA 3NWRA 1Y7PA 4MIWA 1LEOA 2AJ1A 2HG4A 4WP3A 4DPUA 4UUWA 5ITHA 2IA6A 4CP5A 2JJ4D 2ZM6F 1B64A 1GK8A 3Q0AA 1BMQB 3NGTA 2W4PA 2DO4A 2PMZD 1DURA 3D6MB 4QPTA 5C25B 2XNRA 2B56A 3DRSA 4F4KA 1CULA 1FKOB 1VHFA 3OTEA 3AD7C 4H54A 1IM4A 1ACMB 3KG0A 2XB2D 1SV5A 2MQPA 4FF2A 2ILZA 2OPQB 4IUFA 4ZPVR 4KFBA 3Q23A 1S9FA 3TAMA 3ZNUA 3IWLA 3TZZA 2EG2A 4JI3J 1D09B 4NE9C 2HNYB 4EFAC 3GSDA 3RGIA 3NG8A 2KB2A 4ENOA 4K4WA 4J37A 4C8ZA 3TO8A 1NDLA 4I68A 4LF1A 1RAJA 1OQ3A 5LXRA 1QSYA 2MJUA 3H5YA 3DDIA 2NYIA 4RNFA 3HM9A 2ASDA 4NZ7A 4BC9A 2N82B 4KGXB 1F5AA 1TAUA 1M5PC 1Z2LA 1WJ9A 3NBPA 4NCBA 1KWMA 1YWXA 1IBKJ 4JI5J 2OO4A 2J9DE 1WORA 3T1HJ 3ZTPA 3Q86A 3LW5C 3ZO7A 3AOCA 3G82A 1WF0A 3C66A 3TYTA 4HR2A 1RDRA 2B8QA 2CDQA 4DR7J 2O66A 3KKFA 4ANEA 2PGCA 2V94A 3PDNA 4OJ1A 1V3ZA 5KG7A 4M95A 1HI8A 2CG8A 2FLLA 1J5EJ 1S48A 2CNNB 1YLXA 1YITS 2VG6A 2ZEJA 3A8KA 3G6XA 4RW9A 2CPFA 2MSTA 4OL8A 2HHUA 2C3UA 3D1HA 3FBFA 2RDJA 3W5ZA 4JUZA 3IWNC 3QFWA 4OI3A 1NSPA 3GV7B 2V8GA 2BQRA 3K2YA 3GIIA 1S6QB 4IH5A 2H3EB 4B9MA 2ZUAA 3DOLB 3AB4B 2KG1A 4DUZJ 5EX0A 5C2CA 4X4PA 2Y9HA 4X65F 3K17A 3QRPA 1RAOA 2KJWA 4KR0B 2AZ3A 3FQKA 3ET6B 2YWHA 5CZVA 5D4PA 4TXSA 4DDFA 1MN7A 3DNCA 3L9ZA 4O23A 5K14A 3HCXA 2QLJB 3N6MA 4FN5A 1Q7LB 4AQYF 1H6KX 1NU4A 3EGWB 4GVBB 4NL5A 1OS5A 3UCZP 5D8HB 4PQUB 3I56S 1YJ7A 3D7SB 5J2QB 2XCAA 4F50A 3QIPB 3M1VA 5FD1A 1R7IA 4WTOB 5A2QY 2QGFB 1BUXA 3J7YU 4DF4A 2G1DA 1B4SA 3WHIA 4O3PA 1I94F 4LF9J 4C4WA 5DDRC 4JYAF 3S1TA 1VQ7S 2QA2A 3FMBA 3QWUA 1MU2B 3NS6A 1U8WA 1JXLA 4GVBA 5JUMA 1KS2A 2Z58B 4KV8B 4R8UA 2LQJA 4PPDA 2JVOA 2KI2A 4LFCJ 2DY9A 5KT4A 1BQMA 3QQCD 3GZ7A 2HQCA 2ROEA 1KHWA 4OV1A 3ZZYA 2BR0A 3QBCA 2VA2A 4FF4A 1P27B 1ZZFA 1U8SA 4IG3B 4ERDA 1RI7A 1X4DA 3R3TA 1EARA 1K9MT 1IWGA 1HBNA 2F65A 2I1RA 3NNCA 2NXCA 3M8YA 1WSVA 1WF2A 3D6FB 5GAHU 4K59A 2BQ3A 2ZWPA 4IG0B 1C0TA 4Q2MA 4CO3A 2VICA 2EBGA 4CLKA 2E7XA 3M8QB 1BQNB 4O3QA 3T3FA 2QEXS 2DGOA 2H1YA 3G8QA 3M6VA 3DLGB 3RB6A 4DV5F 5HLFB 2I2YA 3H5SA 3MM8A 4HI2A 4Y3CA 1XBWA 2L3MA 1FFWB 3VVUA 5L1JA 3CDUA 4OI4A 4RBTA 4ZVTB 4EUVA 1VQSA 4JYAJ 1YZ7A 5F8JA 4DLGA 2IM1A 1WSRA 4U96A 2RF2B 2A0FB 3ICLA 3VF0B 3VR1A 2A18A 2W8KA 2ZH8A 4HYKA 2QFIA 3TUPA 4JBCA 1RP5A 2CJ9A 2C22A 1HI1A 3GSIA 2JOQA 4KBIA 4LSLB 2FY1A 2D1CA 3EDQB 3VHQA 4DR4J 3MM6A 1UKUA 3MCMA 3MTJA 4QR1A 1T05A 4I56A 4KAIA 1ZH5A 2QT7A 4ER8A 1RUSA 5AXMA 1M1GA 1T7PA 1SC6A 2XSJA 2HFNA 2WCXA 3HF5A 5E3AA 1UVIA 2JFDA 1FEEA 3GV5B 5H9EJ 3NMAA 2RU3A 4LF6F 1YJWS 3HK2A 3C19A 4LSNA 3JSRA 3HP6A 4X65J 4ZLPA 3GILA 3NCPA 3PX0A 2UXBF 2IBOA 3FSIA 1F5CA 2KRBA 1R3NA 1R89A 3V6DA 2DRBA 1K0VA 2ZFHA 3J81Y 3ETMA 4OHVA 3CIZA 3CMES 4HT5A 5DLFA 4DSFA 4P10A 3LP0A 3UN2A 4ANCA 4L3NA 2PN6A 4OZ5A 3X3UA 1GEHA 1GMWA 2FHOB 4O44A 2Y8WA 2QX0A 2ROPA 2AJ0A 2MZTA 5KFKA 3J81j 1HWLA 4DZ6A 2A6MA 3RJMB 1VQ6S 1N5TA 2I6WA 4WTYA 3TW0A 1RWXB 2H51B 5L9NA 1RABB 2WBRA 4OZNA 5D0GA 1XMOF 3QRQA 2E5JA 2HFVA 3KK1B 1FT8A 3ZZUA 4U95A 3FSYA 1KEKA 5EWFA 1GNKA 4WCEQ 1SQFA 2LU1A 4JI8F 5GAGI 4DS5A 1RTJA 1AUSL 2APOA 2WVEA 3RYLA 1GTEA 3J7Z5 4IRCA 1S9GA 4OX8A 1G3OA 1FNOA 2HBZB 4DU8A 1CJKB 2IYIA 4C6AA 2W9CB 2BVZA 2CQPA 1C2PA 2DXEA 2XMKA 4ECZA 1HARA 1ZS6A 4N8OA 1YJTA 2M8HA 5M2RA 2DNMA 2XSJB 4K4XA 3MPDA 2E66A 3MPWA 3HULA 3UI3A 1AFJA 5HMYA 1LNQA 5BR8J 1TAQA 2WONB 3DRRB 5JMNA 4LF7J 2X7IA 1H98A 1LWXA 2K7JA 2MQMA 1S6UA 3V6DB 3OR1B 2AD9A 3PFEA 1KQSR 4O0IA 2XMMA 1AZSA 1TK8A 1JLQA 1D1UA 2DHSA 4ZA1A 3MHYA 4ED4A 3PR5B 2XHCA 3MURP 5F9NA 2UUAJ 5GAGU 3MXHP 3HXMA 1KTVA 1DY3A 2J5AA 4OLOA 2CG4A 3LGMA 2OPRB 4ZDNA 4PKDB 1JLAB 2V2KA 1HPZA 3ZTRA 1SL2A 4ILLA 2DR8A 1HIYA 1CQMA 4OHYA 2ZE2B 4DV1F 5D3GB 1NJXA 4B3RF 1UCNA 4FNHA 2Q66A 2UUWA 1IBMJ 1EZZB 3RBXA 1RTIA 3IRXB 1UZHA 4P71A 1FXLA 1HNVA 3ZTSA 1WDDA 5HMWA 1CS4A 1S9EB 2N7CA 3OLBA 1NMEB 4YP3A 1KTQA 5KFZA 4A8XA 4KC5A 1GMUA 3GR1A 3LF0A 3CDWA 4N7TA 5HSPA 5KFQA 1Q4RA 2YQ3A 1X4AA 2W7AA 1WHXA 3E01B 2R2UA 1X4CA 1WKKA 1HNVB 2HVZA 2MGZB 5FDLA 4B3TJ 1U26A 3KLHB 2IHR1 3H20A 3MDFA 2CJKA 2LQ9A 2ZBQA 4TVAB 4Q44A 2KT5A 5HMZA 3R2DJ 4ECQA 2WONA 3DRRA 3H2VE 2AJQA 2W9AA 1VC0A 1C1CB 3B54A 3QO9B 1UETA 1XR6A 2GIRA 1FXDA 2VPZB 1O6XA 1Q82T 1P1TA 1AZSB 3FKBA 4H4MA 4OZ3A 3M2UA 4U7UD 2PT0A 4CTAB 1WC1A 3K57A 3BQ2A 3JQJA 1J5OB 1W2IA 3M8SA 1HBOA 2EI5A 2RQMA 4ZPBA 2KZZA 4XO0A 1FRLA 3M2VB 1X5TA 2FLOA 4UOFA 1WOPA 3PJ9A 1W26A 2W2QP 3N6LA 3NGKA 1RT1A 2PIIA 3MOJB 3CJKA 3THPA 5C25A 3G4SS 1BWEA 2KYXA 2YNIB 3BJYA 4ECTA 1RWWB 3EWGA 3KHLA 2UUBJ 4AL5A 1TELA 4IH6A 5J1EA 1RCXB 5BYQA 4Y2MA 4YB5A 1YRUA 3CJSA 3JXOA 4WXOA 4WKRA 2VG5B 4X66J 2CQ1A 3I55S 2R8KA 3SSSA 1V5IB 5HQLA 1GMWD 3DYAA 3HLUA 4UW2A 5ADZA 2MKKA 4NMLA 4BS2A 3KLHA 2DCUB 4B08A 2NYHA 9ATCB 2JH3A 4OYBA 1GAOA 4MT1A 2J8AA 1IR1A 1D8YA 2X3DA 4NYZA 1U1PA 4M8LA 4CLTA 1M5OC 2IDEA 2Z8QA 4CO4A 4FVMA 1Z2ZA 1H2TZ 3EE3A 3IBFB 4WFYA 2FD2A 3VAJA 4L75A 2VFTA 2IIHA 2IRUA 3L09A 1OIAA 3HHLD 3SXLA 2KYZA 3J7YI 3OUYA 5IZHA 2FVSA 1RT5B 2IAJB 4LIWA 3LWMA 2HQIA 4TLQA 4DZDA 4B9LA 4PWUA 3HKWA 1WHVA 5KFWA 3MI7X 1S4EA 2K1RA 5I3UA 5FLXU 3SMZA 5ETTA 4USTA 4F3OA 5LMNF 1ZM9A 4RUCA 4KFBB 1VRUB 3JB9k 2DO0A 4DPYA 2H4YB 3HX9A 1SJRA 2ZD1B 3CCVS 4KB7A 2DGXA 4WFBQ 2K3KA 3UCUP 4X64J 4URSA 2RS8A 3PRVA 3UN3A 3ONQA 4KO0B 2LDIA 3ULHA 1A9NB 2HVDA 2YKNB 2R7VA 2Z57B 3EZ5A 4C3KA 1IXKA 1GX5A 2V4RA 1NAQA 1DARA 2W24A 2VOOA 1JWWA 1Y0HA 3L7OA 1NH7A 1CULB 1PYTA 2JEGA 2HGNA 1VI7A 4DR2F 1U45A 5BJRA 2OP5A 3CB4A 1UZDA 2AWZA 2O67A 2CXEA 1T8EA 3OFEA 2R7WA 2VONA 1FK9B 4OQJA 3NKYA 1HYSB 3BKFA 3ISND 5A0YA 4A8YA 2HHPA 3BN4A 2RUGA 3D68A 4RW9B 3LAKA 2W4DA 7FDRA 2VQEJ 3GFXA 3V6JA 1R8BA 2ZNYA 1XMOJ 4QOTA 1W2BR 4QYZJ 4JI1J 3C46A 4B3TF 4FPRA 3BREA 3ZZ0A 3DHXA 3MM5B 2PI4A 1EP4B 2YKMB 4MYUA 2EXUA 4RWWA 5HROA 3R27A 1W25A 1TV6B 2JNJA 3ISNC 3G86A 3O8WA 1TKZB 1EX8A 3QAEA 5IQQA 2BKNA 3PEHA 1RTHA 4CNZA 4NLWA 3FRZA 1REGX 1ZOTA 2HAIA 4QIVA 1S1TB 2RHQB 3MMBB 2YH1A 1S1VA 5D77A 4NXNF 2GMLA 3FFIB 3D3BJ 4MTPA 3AQPA 4PQUA 1DLOB 2UXBJ 4ZVFA 1X60A 3JSYA 4MKVA 4Z37A 1LK5A 3I96A 4F2RA 2MKYA 3CCRS 1P6TA 3BBCA 1QY7A 4YB1P 4D3HA 1C0TB 2AZ1A 1HQEA 1IKWA 1CJUA 4KO0A 3SQOP 5IV4A 3Q8PB 3M9MB 2UP1A 3WX8A 1JLCB 1PC5A 3AAWB 3QT7A 3POTA 5HAOA 4KPYA 1DQ8A 2UUAF 2EWHA 4CLSA 1RT6A 1JJCB 3JAMU 1JQGA 1LWFA 2BE9B 4U8YA 4Y00A 1K47A 4DPTA 5IWAF 3L3CA 4ED0A 3TX8A 3JYTA 1PBAA 2FLPA 2V34A 2BRLA 3NP5A 4NLGA 3LP0B 4WWSA 4ZVOB 1FESA 1MWYA 4NA1A 3R5GA 2MXYA 5K8MA 1U6ZA 4KV8A 2RRAA 3WDOA 1R0BG 3VAFA 3QJLA 2DY1A 2ZC3A 2I9SA 3JTNA 3PHTA 4R25A 2V8HA 3LGHA 3BGLA 3JAMY 4QWEA 5D78A 1CBKA 2FYXA 4LRAA 4DL3A 1JLEA 1ZAVA 2LFVA 1HR0F 3QRRA 4I2PA 3KLGA 1KONA 4EYIB 2LA4A 2EK6A 2VBYA 3FBCA 5A8WA 3MUTP 2VBZA 2YNGA 3HSJA 1OMSA 1WTBA 3LP1B 3FVYA 3UDEA 2QA4G 1UW9A 1X4BA 1RA7A 1A7GE 1RACB 1LXNA 3L7PA 1QTMA 2RIJA 3UDLA 1GMVA 3CCWA 2BE7D 2QZ8A 1PJ5A 4MK8A 1NK0A 4P2MA 4K5SA 1QVFR 5A2QU 2OMLA 1CJVA 2DJWA 2DNHA 3DMJB 3NXZA 4OMFG 3ZTOA 1VJWA 3P5BP 4CNYA 3CUNA 4DV5J 2ZKUA 4OYAA 2YNHB 3LTOA 3PR4A 4B9SA 1XTZA 2HW3A 2GA7A 3OR2B 3R97A 2C42A 1JLCA 1YRTA 3GB0A 1VQNS 3UVJA 3MCSA 3CDAA 1AFIA 1VOMA 1N5QA 1RISA 3DRPA 2ATCB 2RJZA 2R7TA 2NXUA 4USUA 4PG4A 4A8SA 3OHBA 1T05B 2RRBA 4R0EA 4RNMA 3UVJB 4ZN1A 3UO0A 2GHVC 3FC9A 5A8RB 3V81B 1AW0A 5KFOA 3RG6A 3CWJA 3Q8RB 1IN0A 1S7HA 1RE1B 1LW2B 3CSKA 2HWIA 3QJPA 1M0SA 3DLLQ 4G1QB 1IQTA 3I4HX 1L3UA 2V9WA 5A8RA 1FVSA 1EKRA 2VQEF 3V81A 1HBMA 2MB0B 3Q2TC 3ZNJ1 2W2NP 3DDKA 3CDEA 4M63A 4DG1B 5C24B 4DV7F 1LXJA 5F9LA 4MKYA 2OPSB 1DZ5A 1SQEA 1SCJB 3T19A 2AYMA 3H42A 4X62F 2CQ0A 1RA6A 1O51A 3BYPA 3TA1A 1F6TA 3Q89A 1VBZA 1YGYA 4MAKA 4AT1B 4LFAF 1RWUA 3RR7A 2ZHAA 3DLEA 2AJ2A 3I9ZA 1XMBA 3N6NA 2CZ4A 4RW8B 1UPMB 3D5MA 1TQLA 2HPUA 2YX1A 3I9V9 2YNFB 4ED8A 2UXCJ 1HA1A 2MZQA 4ES2A 4OJGA 4LJMA 1RBLA 2R7OA 1ZM2A 2JSXA 2B6AA 2HSEB 4HH0A 4ZK7M 3UDVA 5L46A 2R7XA 4RW6A 4DR7F 3O5TB 2ZE2A 3BN7A 1CJTB 3PYEA 4ZHRA 1RWVB 5LMUF 2OI2A 3FCWA 4Q7AA 4WYLA 1HNWF 2CIMA 2N7YA 3K7RA 4GRSA 1Q79A 3K8WA 1HNIB 1T02A 3W2WB 4AFFA 4K0KJ 4ZPDA 4RUHA 3OHAA 1AYEA 3D2WA 1CS4B 5EGYA 3TAPA 2QMWA 4FDFA 5SUHA 1WOSA 5D6GA 1JLQB 1S4FA 2KU7A 5KFDA 2G2OA 2R4FA 3EXYA 3R5BA 1X9WA 4DCOB 2V0NA 3RW7A 1EHWA 2RQKA 4HEA9 2BKPA 1YSJA 4USIA 2XO6A 3TARA 1PYOB 2BEFA 4ZJLA 2MZJA 2Y1LB 1IM6A 2A10A 3I31A 3R1HA 1URRA 1DBDA 4NX9A 4I4BA 1ULRA 4J9PA 5D3GA 4R0JA 2F4FA 2C3MA 3Q8VA 2VV5A 2UV8A 4ED2A 3CC2S 1VC6A 3CGIA 4CZCA 1YJNS 4CLPA 3KXDA 4PABA 3PG9A 5HBMA 3BB5A 3KG4A 3TUJC 2H54B 3V4IB 5IT9U 5DG8A 1S9EA 4ITSA 5CH7B 3D6HB 3S01A 2XHWA 3UWTA 5K8NA 4RZRA 1F3VA 4ECYA 4C8LA 1U0HB 1TUWA 2D3ZA 1RWNB 1Q1KA 2BZ2A 2R42A 3UDCA 3CXCR 4OI0A 4OI2A 2YNFA 1R27B 2MGZA 4G1PA 4OYIA 1PILA 2BBEA 1REVB 5CCLA 3DGPA 1N4LA 4CYUA 3NLCA 1O5JA 2K2PA 2R2TA 3H98A 3PRDA 2AYEA 1R8HA 3KLEB 4KQZA 2IVYA 4QIFA 2WVCA 5A8KA 1OPZA 1DJ0A 2KH9A 3S8SA 1IVZA 2JL9A 2GJ2A 2BJ7A 1YZ6A 4KGMA 3DKDA 2HHTA 2P2CB 2KFZA 4IO9Q 5KFPA 4PWWA 1DTTB 2CPHA 4YS2A 3ZFVA 2AX0A 3GV8B 2ASJA 1J5OA 3AJ1A 1UEUA 4KT0C 4K4TA 3EICA 1T9XA 2OH2A 1IKYB 3NNHA 1GXTA 4YDDB 2EVZA 1SL1A 1HI0P 3FBEA 3KWMA 5IXUA 1J27A 1FDNA 3CD5A 4V1Ak 1O8BA 2CPDA 2ZDOA 4DX5A 2HBQB 4YN3B 1FTCA 1T9TA 2J0SD 3CJKB 1S7IA 1HR0J 4MH8A 3TVKA 3Q2SC 1D0EA 2CQGA 4F4YA 1PGZA 2YKOA 5B7WA 4WFAQ 1P9QC 1SH2A 2DHXA 2I5JB 3RRKA 3KHRA 1T03B 2W01A 2G4BA 2QLBB 3QMQA 1MMDA 2QSFA 3MPVA 3KYLA 2WB1D 4WFZA 1O0PA 5A0YB 3F0NA 2VHGA 3TANA 3A1YG 2VG5A 4DX6A 5KFCA 1S1XA 2WZ1A 4NZ6A 5HO4A 2WHOA 3TA2A 3TNVA 2ZM6J 4ES3A 4C8OA 1SIWB 1U02A 1RQ0A 4TNOA 3NBPB 3SCLE 4C8YA 2HZVA 4C0BA 2K1RB 1RYRA 3KG1A 4WE1B 5HROB 4DR2J 2WSEC 3JSMA 2DVIA 5F3TA 2RVJA 3PIOQ 1YI2S 4DXLA 1JJ4A 2IBKA 1NB7A 2PD1A 3LGNA 5DG7A 3M9OB 1V3SA 4NRTA 4A8OA 2YWGA 5HVFA 3SDEA 4LF5F 1SH3A 2IM3A 3FFIA 3PACA 3HVTA 3PTWA 5KFMA 4Q0BA 1SL0A 5KOWA 1S0NA 4KY3A 3MR3A 1WACA 1TVRA 4YB7A 2CVIA 2DXDA 2DRDA 1G6BA 2DNGA 4NEYA 4B9TA 4DSKA 5KFTA 3DOKB 3AFGA 3MMCB 5I3UB 2DT9A 3M32A 1HBUA 1RU1A 2RKIB 4ZVRB 5I42B 2ZZTA 4CT9A 1TUVA 4FZVA 2MQOA 2IM0A 2V6AA 3I0RA 4O3OA 2F8HA 4NA2A 4ETZA 3P5TL 3A12A 3NL0A 2FJBB 3FQLA 3PZPA 3FUYA 3M6UA 3OTBA 4WU2A 4Z7CA 5DJBA 2UU9F 4X4VA 1HHTP 2JEJA 3OJSA 3ZZOA 4B02A 5F41A 2V4QA 5CA5A 4WZMA 2EFQA 1S79A 2QG9B 4DR5F 3QZ7A 4O4GA 1IWAA 1G1XA 4L74A 2M3DA 2GAGC 1FWPA 2FJAB 2BM1A 1JNRB 4LVNP 2OEJA 3AODA 1OSDA 2V2ZA 1SKUB 1KLNA 1CQNA 5ETOA 1MROB 3ITHA 2DTJA 4R8UB 3BM7A 2DHGA 4MFBB 4RNNA 4CO1A 3LP1A 3MM9A 3GIKA 2MLXA 5CYJA 3M8PB 2KRRA 4OZ1A 1X9MA 2H65B 2IDLA 2Z2ZA 1CC8A 1V6HA 3RW6A 3DDNA 1TV6A 4Q0BB 5J1PA 3PM9A 3CCJS 1OYEA 3U02A 3FBBA 3I4PA 4DPWA 1FJCA 2ZBPA 3AJDA 4ZPTR 1LFWA 4ECUA 2B9YA 3AA9A 2GV1A 1SV5B 1NEEA 2G0IA 5GVQA 3R5JB 2DCLA 4O3NA 3FZBA 2V2VA 3K58A 1JMTA 2QMUB 2V8DA 1Q86T 4ED7A 1R0CB 1VQ5S 3GYXB 1JLFA 2XY6A 4JV2A 1RT2A 2JDJA 2VPWB 3KLVA 4DR1J 1U1QA 1U2FA 2VU5A 2DISA 1XEZA 2DYAA 4AUKA 3KNAA 1N33F 3RTVA 1C4CA 2D3O1 1RXOB 3MMJA 3NY0A 2MHEA 4ICLB 2DNOA 4KYZA 1UVMA 2I8EA 1UWBA 1QAXA 2CJBA 2MHNA 4HT7A 2VJUA 1N32J 4USWA 3ZZZA 3HD1A 3VCDA 1KOHA 1L3TA 4F4WA 4KIAA 2E5LJ 1P8GA 1PAUB 3E51A 2QJ3A 2JLGA 3M6WA 2IMWP 2O5DA 2QC3A 5KFGA 1WNEA 5KT7A 1F2GA 1SC3B 1TKZA 2DNYA 1UEVA 4EYHB 1NK5A 1CJVB 2D9OA 3DMJA 3ITHB 8AT1B 1FJGJ 4DR6J 1ZPVA 3FEXB 2MJNA 1VQMS 1KP6A 1RZMA 2E29A 2GJFA 2KHDA 2LEPA 3KMSA 2IPOB 5LM7E 1E6YB 4K2XA 3M8QA 4H4OA 4B3OB 5G0RA 3M05A 2UXCF 1DLOA 3JTPA 4OYZA 2RT3A 2YNGB 2C2DA 4K50A 3DLEB 3OFGA 1JLBA 2GVZB 2L9NA 4KH0B 4KTQA 3E2EA 4PG7A 2OGUA 4TU8A 1RB0A 2XQCA 2E44A 1K44A 3DN9A 2KVQE 1K1SA 3H4BA 1JXVA 2E5IA 4GVLA 4LRFA 4PR6A 5D4LA 2MZ1A 4U8VA 2HVIA 5CXTA 1JLBB 3QAUA 4AQYJ 1S6PA 3CPWR 1T9VA 3VGSA 2CQHA 1VFJA 3GPAA 5IFMA 3KK3A 1Q0NA 3LA0A 4DS4A 1S97A 2ZITA 1FKAF 4G1QA 2OSQA 2NLWA 1BQNA 3CCQS 4JV5J 2JEIA 4WIQA 5A76A 5L1IA 3C6UB 1NDKA 3DM2B 3IAM9 4TN2A 5GADI 4GC7A 2LMIA 3NAIA 2YWEA 2Z4PA 4FYYB 3SFGA 2UVRA 1UVNA 3C2PA 3P8BB 4JI7J 1UFKA 2IMOA 2OELA 1IUJA 3SYZA 4HHJA 3ZZRA 1NNDA 1RHQB 5KAKA 2UXDF 3GJQB 1N5YA 1JIHA 3F73A 1KFSA 3OVBA 3BDPA 2L08A 2DGUA 5L39A 3MM6B 1XWLA 2RU9A 4EBEA 1ZPWX 1UEKA 4XPEA 1EQMA 3QSYB 3V4IA 1N6QA 4LMZA 3O1LA 2AIRB 4IG3A 3D0HE 3NCRA 5KG0A 1D9AA 2FVPA 2PC6A 3TR5A 3G9CA 1NKCA 1IBKF 1T9YA 2M70A 4RW6B 2MKSA 1RT7A 4XTTA 3T9ZA 2YNHA 1Q8IA 3V2UC 5EHHA 4B9VA 1NPRA 4DQPA 2DKOB 4NASA 2Q6CA 4ZVPB 3VWSA 1I6JA 4WZQA 2JEFA 3CW2C 2FJEB 1AB8A 2U2FA 2W7PA 4UOCA 2SXLA 3BF4A 3ISZA 2FGOA 4QWBA 1RT7B 5B0AA 4AXIA 5E5NA 4DI6A 4U67Q 2EFVA 3HHDA 4ZLNA 3HD2A 3K5MA 1U1LA 1LV5A 2OLWA 5A8KB 3J81U 2UXDJ 1PBUA 3RB0A 1XR7A 3KHHA 5F8HA 3KHGA 4DV6F 2EG1A 2C3OA 1R8CA 4NLPA 4DFJA 2O1PA 1WC6A 5AE2A 3MEDA 4IFVA 4M5HA 2N4DA 4ZCMA 2B5JA 2FC9A 2IFXA 3GJSB 2VPYB 4WKYA 3BKUA 4JI3F 3RBDA 3P45B 3TZXA 3HSZA 4DBQA 1SJ4P 3W5YA 1EKSA 1I5OB 5DS7A 4ZN3A 5BXIA 3W63A 5KFSA 2NXJA 3KJVB 1TL5A 2PMHA 3GR0A 1HW9A 4C11B 1FE4A 5E3RA 5B0EA 4F67A 2ATLA 1ZETA 3GCWP 5IM0A 1G7CB 4DV6J 1ROFA 3C16A 1WC3A 3FK4A 4RL1A 3NWGA 3RU0A 1RU2A 1U48A 2LP4A 3IR7B 3G8TA 1VQ8S 3TWZA 1MSWD 2LYVA 2PDAA 1S76D 1H7WA 1HWIA 2NUHA 1D9FA 1DTQB 5EWGA 2IJFA 5DDOC 3U1MA 4B3SF 2PA8D 2DIVA 2MSSA 2DPIA 4RWXA 1KC8T 1MMNA 2QLXA 1G4CA 1DTTA 3FJ2A 3G96A 2NCKL 3M8ZA 2XYHB 3MMAB 1KQFB 4NLXA 3W3SA 3C6TB 2QL5B 2OJ3A 3BH7B 1H73A 2B7CB 3OV7A 4RR5A 3MEKA 1H72C 4FKXA 2DITA 2UV8G 3PJWA 4LFAJ 3MGJA 1WHYA 1JKHA 2CFXA 1FRXA 2B4VA 2FZCB 3KLEA 3GIMA 2R8GA 3MMAA 1UFWA 2VFRA 5B0GA 1FWLA 3UPFA 3RR8A 1LWCB 3A8EA 5D4OA 3GIRA 3I5BA 1QSLA 4ZPCA 2V8VA 1FF2A 2YKAA 3B4DA 3SI8A 1YBTA 2CRLA 2K8GA 2E5LF 1N33J 4WF9Q 3TAQA 1E6VB 3O6QA 1UPPA 2VL1A 1HNZJ 1NZ8A 4F7VA 1NM2A 2E9ZA 1SJQA 2WSCC 1Y3JA 1OWXA 1HBOB 1BXNA 4FYVB 2JLFA 2HNZA 5ETVA 1SB6A 3CF5Q 4ED3A 1HKAA 2XZDB 1NK9A 1RKIA 1R6YA 2GQCA 2V2QA 2H48B 4J5OA 5LSRA 3DXSX 5KT2A 1U1KA 1UVJA 1WHWA 1YVFA 1EJ7L 1PCAA 1ZM4A 2GGPA 3MR2A 4LF4J 2HVHA 3BBBA 1X8DA 1D3WA 1LW0B 1C1CA 4D3GA 1TKXB 3IP0A 3PVXA 2CQ4A 3PJXA 2CUYA 4J90A 2XGQA 2ZH1A 5DQIA 3EGNA 5LT5A 2AU0A 2AGPA 1RT3A 3MOZA 2ZWOA 2KVIA 1NJYA 2AEJA 1VQ4S 1IJEB 1SC1B 3M8RA 4NA3A 3TZWA 3DRSB 1RTIB 3IRXA 5LMNJ 4L72B 1LWEA 4P7VA 4CDIA 5F8LA 1UVKA 2HRYA 2I0XA 3MMCA 2M9KA 4K4YA 1XNRF 3MR6A 2FY8A 1OY8A 2ZBCA 3C15A 3EYZA 1NK8A 1HNXF 3B4MA 3ETOA 1R0AA 4K0KF 2LEAA 3T6JA 1S1UB 1RWMB 4DV4F 4Y2IA 3E01A 1ZA1B 3I0RB 3KDNA 2YQ0A 4DSJA 1F0XA 5J2NA 4X4NA 2C3YA 3SDEB 1U25A 1OY9A 3ENAA 3MUMP 4CM2A 2J6TA 1KD1T 2IYGA 2N4CA 3R7BB 1DQ9A 1VQYA 2OHDA 3SSQA 2D3OR 2HGMA 4PXDA 1FE0A 2A1BA 3OPKA 3HO1A 1N88A 1WC4A 4IYQA 1FRKA 1TL7A 5T7LA 4TU7A 3G2XA 3TQEA 1K8AT 1YJVA 3FMWA 4Q2LA 1GH8A 4JP8A 3QT8A 1PG5B 4MIBA 3RBEA 2M5YA 4NLSA 1JXEA 3BGOP 4P52A 1JJHA 3PHEA 3DGVA 4FYWB 4J9LA 5IOLA 3K0JA 2DGQA 1YG0A 5K9FA 4C2MA 2QL9B 2BANA 3CTRA 4QWDA 4ANDA 5CD4A 1U6FA 2FVQA 3W2VB 4RNHA 1ZA2B 2KHCA 4WE1A 5ETKA 4IOAQ 2RQ4A 1MMLA 1RT3B 3VZHA 5LSOA 5GAHI 4X4RA 1RYSA 2UUBF 3HZEA 2BXJA 3M30A 2HLTA 3THTA 4F4ZA 1RAGB 2J9EA 1YK9A 2HNYA 4PG5A 3TX0A 4CH7A 4EEYA 2RRNA 2DD8S 4A46A 4FXDA 2XI2A 1CJUB 1OPIA 2VASA 4Y6IA 3ENWA 2W1BA 5EUHA 1BLUA 2OD6A 1Z1ZA 4MK9A 4R5PB 1TL1B 5KOXA 1TK0A 4OZ0A 2GVZA 1AA1B 1H3DA 4P73A 2DHHA 3ET6A 1NDPA 1OO0B 2BYCA 2CZ9A 2WW8A 2BW2A 5DRKA 1FJGF 1FJ7A 3MUVP 4ELUA 2E5GA 3HFKA 2OFHX 5J2PA 4OZJA 2ZH3A 3OFHA 2ALZA 2OTLS 5KT5A 1P1LA 2VBXA 5E41A 5LXYA 1RTHB 4HDGA 4NOHA 5B0DA 3KNGA 3OL8A 1NCLA 1TL7B 4O4RA 4P7TA 4ZVSB 4BCAA 4J9SA 2COLA 5GADU 5B0FA 3BH6B 3EPGA 4PXBA 3TJ9A 1SKRA 3CJ0A 1SQGA 2J9CA 4O4GB 4QR2A 4Q45A 1N48A 1VMBA 5C42A 4DR1F 3EVWA 4KKOA 4NXMJ 2XY5A 5C5JA 1B99A 1I94J 3M30B 3MD3A 3W7BA 3T5KA 4LF6J 1NBEB 3BR9A 1S77D 5AE1A 4A8FA 4I0WA 4Q5VA 1VK8A 3AT1B 1PSDA 4WK1A 1TKTA 4DV3J 5DQGA 2ASLA 4EZ9A 2F4VF 3U7JA 4C48A 2NQPA 3K59A 2QA1A 4DUTA 1T3NA 1M90T 4PEOA 4LR7A 4DR5J 2HFOA 3F44A 2J6UA 2O3DA 4RPFA 3IBCB 2ACYA 3K5PA 4LR8A 2YKQA 2RILA 2R7QA 3PFOA 2YQ1A 4IKAA 3PYDA 2L41A 2CJYB 4RBUA 4F25A 3HMJG 1U09A 4GKJF 1RSCA 1BQMB 4IDKB 1BWVA 3LOUA 2CPEA 3THVA 2DR7A 1EQ0A 4I67A 2B4UA 3HKZD 4AD6A 4C0HA 4X4QA 1E6YA 2XMTA 3W62A 5KFNA 4CH0S 3Q8SB 2M7SA 1W7WA 2KXHA 1S6OA 2Z2MA 4OHWA 5CQGA 5LSLA 1ZYQA 4IFYA 2IRYA 4UUXA 3M8WA 5B08A 3NGSA 3QWPA 4K2JA 4PXEA 1A6LA 4QW8A 3PW7A 4NLOA 1QAJA 1NHUA 3N9UC 3X1LB 1C4AA 1Q8KA 3C6UA 5H9FJ 3RAQA 4QCLA 2A3JA 4DR3F 5HLFA 1ELOA 4V19X 2BJ9A 3UCGA 3TVYA 3CO9A 3QGGA 2R2SA 3F41A 3AB2B 2PEBA 4C11A 2CA9A 1S99A 1N5YB 3BGRB 5ETMA 3J7ZT 2BW7A 1TL3A 1T9UA 5BR8F 2HFZA 4CM0A 4F0HA 1RKJA 1T9WA 3D3CJ 3PNIA 4I2QB 5L8RC 1N36F 4LSNB 4Z2XA 5CYMB 5M2UA 3QIDA 3NAHA 1R6VA 1TZ0A 2GJIA 2V69A 1QUVA 2ROGA 3AOBA 4WPAA 3R7SB 5C7PA 2B0GA 2UUTA 5U47A 4ZLJA 4X64F 4JI2F 2X3GA 3DRPB 4DV2J 5DG9A 4LF8J 2AW0A 1F2HA 2AEFA 2F9DA 2G0CA 1RAAB 3L4BC 2J0QD 2QIFA 3OBIA 5J2MA 1MNEA 3J80Y 1UP1A 4JI4J 1X4EA 1FO1A 2BACA 5AE3A 2V50A 2ZJQQ 3PY8A 4EZ6A 4MKBA 3A3NB 3CMQA 2ZHBA 1CC7A 2QYGA 2GZOA 4HACA 2AJFE 4YY3J 3H2LA 3KK1A 1S72S 1KR4A 1UMJA 3BBFA 3ILJA 2DB1A 5MAOA 1TR0A 4DWIA 3MAAA 1RHUB 2Y8YA 3CJ5A 3UNGC 5IM0B 1QD1A 5KFIA 2WAQD 2IA0A 2ZDPA 1LOUA 2R8HA 4JI0J 2FDNA 2Q6BA 4M5LA 4XDDA 3UNYA 5KG2A 4J9OA 5SZTA 1X5SA 4RW4B 1IKVA 2X1AA 3A4TA 2KL8A 3TUIC 2HIYA 3I6PA 2NZ4A 2Y1JA 2FJWA 3DXBA 3IS9B 4RW7A 4JI8J 2XS7A 2HGLA 5ETNA 2DNRA 3MEEA 3R7NB 3W65A 2N3OA 1XNQJ 1FKPB 4M1KA 1NJIT 5B0CA 1N52B 4I64A 4J9VA 3C6TA 1T0TV 4F4AA 4E2FB 4YFUA 2ZJRQ 2K06A 3DFEA 1UL3A 2CPYA 2HEKA 4IRDA 3PKMA 4LRBA 4HH1A 1LKZA 2VJVA 2XSFA 4DHVA 3NOGA 4RLEA 3HHNB 1S0OA 1KN6A 2KTQA 4I6WA 5F8NA 2CPXA 3JTOA 2Y3YA 2FLNA 2EKNA 5I3QA 1FA0A 1I51B 3V6HA 2ZZNA 4CO2A 5KG1A 3OXLA 5KG6A 4B9NA 5HATA 1NLKL 1S49A 4K8RA 3DI6B 1J2VA 1E6VA 1HWJA 2RMLA 4TYAA 2HMIB 2KG0A 1JB0C 4OHZA 1NK7A 4Z7YA 5JVHQ 2HVEA 4DL2A 2C2RA 3AXKA 2CQDA 2VPXB 2CZVC 2M52A 4X4OA 1R31A 5HVGA 2HS0A 2P8IA 1JKHB 1NPPA 3KLFB 2ZNZA 4A8QA 3OL6A 4NXMF 3TI0A 1LWCA 1HNXJ 3VGUA 2JC1A 4A4JA 3OLAA 4DF8A 3HHKA 3WC2A 2OUGA 3T41A 2R9LA 3ELHA 4C8MA 3VQTA 4XIUA 2P6TA 2EFOA 2KN4A 3BO4A 3BEGB 4P72A 3KK2B 4NCGA 2VG7A 1RHRB 2OMOA 4U7CA 4G3IA 1SXLA 1AROP 2MZRA 1M5HA 4K4SA 2J0XA 3TZYA 1YDLA 1QSSA 1M5KC 4OZLA 1S10A 4YHHF 3FCVA 3GMGA 2BUNA 5F8IA 5E3CA 3J7A1 4KHPF 2YWKA 2XZTB 2P9CA 3CJRA 1NDCA 2V4JA 4LIRA 2NPIA 3R6GB 1HL6A 4PXCA 4URGA 2R7RA 2C28A 3CJ4A 5ETLA 4QWCA 3OXFA 2AMCB 1NK4A 1HLWA 3ENQA 4GKJJ 3SCJE 1EB0A 2P9EA 5KFEA 1FRIA 3EZUA 1NSKL 4KSEB 5GAEI 1RTDB 2C2ZB 4Y2AA 4K4ZA 1LW0A 1RTZA 4A47A 3H5UA 1TKDA 4ZP7A 1P9YA 1RADB 2NR0A 1ITPA 4QWAA 4OV6A 1FXRA 4N47A 1SIZA 4UZBA 3OUYB 7FD1A 3Q83A 2CQIA 1JJ2R 1NSQA 4BWMA 3G8SA 4P74A 4PUOA 1I1GA 4LRDA 1K1QA 2ADBA 2HHHJ 5CZXA 3CCSS 4DL6A 5HK4A 1V3RA 2HKEA 1B3TA 2GCFA 3KLIA 3M2UB 1SBRA 2GGPB 4USMA 3AXMA 3PKYA 1FDDA 3US5A 4RU9A 2A6OA 1KSPA 2KO1A 5D0HA 4N56A 2DPJA 2KFNA 2R2RA 4DFPA 5K8PA 1HQUA 2IVMA 2FHMA 3BSAA 1JK9B 3M2VA 4I69A 4QR0A 5C42B 2LCWA 2C2OB 1GXLA 2JHEA 4NRUA 5I42A 3OQ2A 1RWOB 1VS3A 4MMOA 2LU2A 2YBVA 4FS2A 2Q79A 3A13A 1H74A 1VDHA 2LA6A 4GMKA 5DZ6A 4J9RA 4M5KA 3OL7A 2P5VA 4LFCF 2HHQA 1RCOB 2BJ1A 4JI6F 2BMBA 2CQCA 5KG4A 4RNOA 3RB3A 4CWBA 2ZH2A 4C3MA 3HVAA 4XDCA 2BOAA 2G2YA 1SI9A 4YQWA 4DQSA 3BGUA 3W5XA 1RT5A 5E3PA 2Y1RI 1AT1B 2RHSB 2FVCA 2B9XA 4CCHA 2IRXA 1A0OB 1TP7A 2IJRA 3DYAB 3IA0A 2YKNA 1KQKA 2E5HA 4I6AA 3W2VA 3PX4A 4IRKA 2RKIA 4BDPA 1U24A 3ILOA 5LJ5Y 4DN0A 3G82B 3MEGB 3QIPA 4W4MA 1GX6A 4LBPA 4DSIA 5L9XA 4B9UA 3TP2A 2DBBA 4ID5B 3H40A 3KFWX 4IR9A 2E9TA 5A6PA 1JLEB 1RBAA 3UR0A 1QM9A 2GVDB 3KJQB 4NLUA 1UTAA 5GMEA 5THWA 4QU6A 2VFVA 4Y2CA 2IAJA 2F63A 3EVMA 5EDWA 4A8WA 3P6YC 4UQTA 1F60B 2CYYA 4ID5A 1GQEA 1NRKA 2ZUGA 4EO6A 1URNA 4DMZA 2EFNA 3VQSA 1SKWA 5D4NA 2QO3A 3POTB 2FZKB 1V9OA 3PW4A 3LAMA 4A8KA 1U1NA 3M1VB 1SJ3P 2XS5A 5HANA 1VIXA 4EBCA 1S1TA 1CSJA 1Y5LB 3MMBA 2ALYB 2C3PA 5IS2A 3BPDA 1WG5A 2VODA 2D3UA 2ZVIA 4ZP9A 1YJ9S 1RAIB 4AXJA 2XMJA 1WWHA 2DR9A 3D0IE 2VOPA 1FNXH 2HLUA 2LXIA 1QJHA 1BY9A 4ECRA 1WD6A 2CADA 1WTFA 4KHMA 2MDAA 1VHIA 3QT6A 4RJVA 4ZJQA 3GJRB 5LOQA 5KFFA 3CVKA 2DNNA 1X4HA 4F04B 2RF2A 2EKYA 4OI6A 2RS2A 5J2PB 1HYSA 1U1OA 5J1NA 4JV0A 3QSIA 5E33A 2DGSA 4OIXA 2NPFA 1U6BA 4DL0C 6FDRA 3IM9A 4YEAA 3CJQA 3VGVA 4GC6A 2E1PA 4ICLA 3WIUA 3TRGA 1BE4A 1S12A 4ZCKA 2ZJPQ 1S57A 4WFNQ 3RRHA 1HBMB 4HLBA 3EX7B 2WOMB 3KUGA 3GCXP 2R8JA 2W4CA 2QV6A 5CD4H 4UT4A 5M2PA 2LQ8A 3AD9C 3WIVA 1R8AA 4K4UA 5IV3A 3CD6S 1T3OA 2DR6A 4I2PB 2OSRA 1U0SA 2CNLB 3OXGA 2M4MA 3MAAB 2WOMA 4PQAA 1CVJA 4PRFA 1QE1A 1HWKA 3IG1A 4DFKA 1WF1A 2LLZA 2IY5B 1EAYC 2VKRA 2CJAA 3MR7A 4QW9A 4DUZF 3DOLA 1R8PA 4URQU 4RKUC 4ELTA 2GMJA 5HN0A 4FXWA 4CO0A 2UVUA 2HRUA 3ILIA 4LSLA 4AL6A 3P3DA 2NSBA 4L6V3 1LW2A 4YR3A 6FD1A 3C3LA 1KVIA 2D74B 3T1AA 1KDNA 4N41A 2C1EB 2JZ5A 2KFYA 1WEZA 4F3MA 2RB7A 4FP9A 2GMHA 1HFEL 2EW9A 2JFKA 2HYIB 4OZ2A 3SV4A 3MM7A 3A8JA 4RUBA 3QFHA 2MLZA 2YWFA 4HACB 5CYMA 5ETQA 4WIIA 5DDQC 4DR3J 1MU2A 1Y10A 4BWJA 2H9ZA 4LSZB 5KFYA 3DLKB 2WW4A 3IR6B 4O44B 3GONA 2VDIA 5A8WB 2W25A 4YOEA 4CI0B 3BSOA 4P75A 3H0PA 3CCMS 2D41A 4YUDA 4PG6A 3SV3A 3M6XA 3HSDA 2V9KA 1RGVA 2P6SA 3IMQJ 1YX2A 2G2ZA 2M8DB 4ED5A 1WELA 4Q8FA 4X4UA 3E3XA 5CYQB 5E2QA 5C24A 4DG1A 1KRPA 3IG1B 1U0HA 1WC5A 4Q43A 4QBUA 1YHQS 3DLBA 1I3OB 4HHHA 2FJDB 3IC1A 3F56A 1JNZB 3NS7B 5KT6A 3TVZA 3WC0A 4HKQA 3EGVA 3U1NA 1N0VC 2DEJA 3RRGA 4LF7F 1HQ2A 1RWKB 4ZPWR 4IOBA 5HQMA 1EETB 2HQFA 1VR6A 4DCJB 2KDOA 4LF5J 2YWWA 1FTRA 4LF2A 3QJJA 1S9GB 3G87A 2CQ3A 2W9CA 4DV3F 5GAEU 4USJC 4OYXA 2HK3A 2F8MA 1HD0A 3MFIA 1KHVA 3AJ2A 4FS1A 2CPZA 8RUCA 2VQFF 1VQOS 6AT1B 2IC3B 2F40A 5DDPC 4DEZA 2XG8A 3EPIA 2OIHA 5AJ3F 3QZ8A 1Y3KA 4LVOP 2YXLA 2LXUA 3T1YJ 1VC5A 3Q8YA 3SBMA 1PAEX 3T5JA 3MTKA 2LQ5A 4PG8A 4FBTA 4Y28C 2CPJA 5H9EK 2B6AB 2XEXA 3CD0A 4RW7B 4WK3A 2R7UA 3D28A 4ILRA 2AYBA 4M94A 3H5XA 3OTDA 1MLAA 4ZVUB 1HNIA 2ZH7A 4NEZA 3HFZB 3HHLC 3H8YA 2JLEA 1NZAA 2XTJP 4CYUB 1KFDA 1HHSA 4OFZA 2X1BA 4N76A 4TKTA 1NSAA 1Q95G 1G2EA 5C2GA 4DUYF 5HP1B 4B3RJ 1UA1A 2ZH6A 4O3SA 4LT6A 1S0VA 3KLFA 4KE5A 2XLIA 3D1OA 3KLIB 5KFRA 2YNIA 2KXNB 2ZOFA 2VIHA 3EGZA 2XMAA 3CCES 4EI2A 3BYRA 4ILMA 3NGUA 5AT1B 4O3RA 3PX6A 2PFFB 2VD3A 3AH6A 3OSPA 2OTJS 1CJKA 4DL4A 1RK8A 4H4KC 5HJYA 2IVFB 3DHWC 2I5JA 3DRYA 2RQCA 3DOKA 3NEKA 3RUBL 1SVDA 2G0JA 2HHVA 4NLVA 3ZC4A 4CLWA 5D0RA 2AKWB 4LBIA 4C3LA 1KVKA 3H25A 1TUGB 1RLCL 1YJUA 3BKTA 3U1LA 4IR1A 3I87A 3CD7A 2HBRB 3CIMA 1VK3A 5KFJA 3HHEA 5FIIA 1RBOB 4E0DA 1XJWB 3NOCA 1UFLA 4M5IA 3W60A 1SH0A 1TMMA 1VBKA 2MPUA 3OR1A 5DGAA 3C8YA 4DN9A 1S5ZA 4EGLA 2HNDA 1UA0A 3T6BA 3DLJA 4U7UK 1VQPS 4ED6A 4DJBA 4I7FA 2YPYA 3GP9A 4PYDA 3Q22A 5CHCB 3GG0A 3LUYA 5EWEA 1FDBA 1QDUB 3PW5A 4KGKA 3CC7S 3CJTA 2XLKA 3EUNA 4P2SA 2R8IA 3BO2A 2FUG9 1BHNA 2FQQB 3O2IA 4N5SA 5DM7Q 2H5EA 1MROA 2NS1B 4ECVA 2AQ4A 4I7FB 2R7SA 4H4KA 5IT4A 1XNQF 1S1WA 4OX9F 3M32B 2EK1A 2MQQA 4MIAA 4RX6A 1ICEB 3RAXA 4NCAA 4HI1A 4WFXA 3GJTB 1HD1A 1Q5YA 1Q5VA 4P2FA 2X1FA 3QLHA 5KG3A 1BGXT 2VB6A 2ADCA 1Y4ZB 2JX2A 3M9NB 4ALZA 1FI4A 3ZXWA 1RJJA 5DLGA 3W9JA 4F4XA 3BGFA 3GG1A 4LR9A 4PUOB 2HIQA 1N5SA 1B7YB 2G13A 2MYFA 3HHLB 2OD4A 4QIEA 3UE2A 2GO8A 4F0MA 2MKCA 2BJEA 2OPPA 3MZIA 3QLHB 1FKOA 2E7VA 2ZKTA 4ETXA 4ZMMA 2BOPA 2QFJA 2KM8B 2BANB 4OX7A 3W9HA 2MZSA 1FD8A 3CC4S 5K14B 3T5LA 3FSXA 5ETPA 2BDPA 3HHLA 2VKZG 3LP2B 2YY3A 4H4MB 2XMUA 1B0PA 1U1MA 1VRUA 3LO3A 8ATCB 2HBYB 3HVWA 3VGTA 1QAYA 4MYTA 2FTRA 5T7LB 3MFHA 1S1VB 4OJ3A 2GIFA 3M8PA 1U4BA 2EPIA 4M5DA 1SUQB 3C14B 4OYOA 4C9DA 4J91A 4KHPJ 3MWBA 3EZOA 4JI6J 3QGIA 1JX4A 3O44A 2ZH9A 4DOZA 3BSCA 1HQUB 2XBPA 2NREA 5DQHA 2XY7A 2CJXB 4M5JA 4FPIA 2DH9A 2JVRA 5DETA 1Q81T 2R3VA 1R0AB 1PO6A 1HMVB 2RDDA 2Z0GA 4FNIA 1RT6B 3QGPA 3MD1A 4JB8B 4QPXA 4MFBA 1RT2B 4BBYA 3BQ0A 3D66A 4NXNJ 2CNOB 2W2PP 2UU9J 3FCHA 3IWXA 4TY8A 2XI3A 5AJ3J 2ZH4A 1HBUB 2PFDA 3KDOA 2VFUA 2HHWA 4AE5A 4FKYA 2GX8A 3OTCA 4X4SA 1B0VA 2V67A 1S6PB 2HS3A 3PYGA 4YB6A 2ZZMA 3IBWA 3E8OA 4J9KA 3OSNA 2PEHA 3T9NA 1SJ1A 2ZVSA 1NJWA 2W2MP 2X1GA 3TJ8A 3LWLA 1UJ4A 1B70B 3W8PA 3P96A 4USVA 5F3ZA 4YY3F 3T1YF 3MEGA 1X5PA 1X5OA 4HVZA 1KQGB 4I1TA 1M1KT 5IT0A 2PO4A 1H38A 2XYPB 1R43A 2VF3A 3MM7B 4USKA 9RUBA 2KM8C 4DV7J 2OAUA 2CAJA 1MWQA 2BM0A 3A3OB 3D4JA 4OLPA 3U27A 3RB4A 3CJ8A 4TQRA 1N56A 2F4VJ 2J8SA 2X51A 3UD3P 4P2XA 4IH7A 1TKTB 3MPUB 4NYPA 1YKWA 2RUSA 2XMWA 3A3PB 3IGVA 1YBUA 2I38A 2ABYA 3MM9B 4KPCA 1H0HB 4ZJOA 2C2MB 4CLFA 1OYDA 3EMTA 4LRCA 2W9BB 1DFDA 1KNZA 2V8PA 3QT5A 2XCPA 2FZGB 2PI5A 4J9QA 2MQ8A 5KFUA 2P9GA 3VAKA 1N34F 3IO1A 1Q8BA 2N3LA 3HSGA 1H7XA 4M5GA 4DR4F 2RSQA 2Z2YB 2GFFA 4DQQA 4IDKA 1FVQA 3GFZA 2OFGX 3N28A 3VAHA 4DL7A 3PO5A 2BA9A 2XYGB 2XULA 3N0VA 2J6SA 3MR5A 1LWFB 4M5NA 4YR2A 4OYPA 3MCOA 5AXNA 2AGQA 3NS5A 3OVAA 1VLOA 4NPOA 3GFHA 3MM5A 1T11A 3S7RA 2ASYA 5LMUJ 3AA8A 4FF1A 5EN1A 1X9SA 5AXKA 4H4OB 3DLGA 4C8NA 2HZAA 1U2CA 2F9JA 2J9DA 3B78A 2XM3A 1IBMF 4LF9F 1DHMA 2JWNA 3PRBA 3KUEA 5I4MA 2NUUG 1TFWA 4JI4F 1AXQA 2FHKA 3CDBA 2OEMA 4XK8C 1VQ9S 2EEYA 1KVJA 3OR2A 2YTCA 2D69A 2WVFA 2Q43A 5KFBA 3DM2A 1N36J 2BKOA 1WG4A 1LQ9A 5IC4B 5KFHA 4WXWA 3M2RB 4USHA 4BLGA 4Q8EA 1X0FA 2HQGA 1RT4A 2DHAA 4CQ1A 3UFCX 3KK3B 1HQEB 1VRQC 2U1AA 4PYAA 5H9FK 2Z56B 3TEGA 1L3VA 2CQBA 2JRSA 2WBMA 4B3OA 2LECA 2E1AA 1GTHA 2QSWA 4ID8A 4KGZB 2EFGA 3W8GA 5CCMA 3G6VA 4FYDA 1SC4B 4Y65A 1TL4A 1Y00A 3VTIA 1L3SA 3D54A 2YX7A 3D67A 3W2WA 3D0GE 1RHKB 3R5CA 3DLKA 3N5FA 4JOUA 2FB0A 4ECXA 1VBYA 1Q7YT 2MQNA 2LEBA 1PJ6A 3HZGA 2QL7B 1RTJB 5BYRA 3HDSA 4OI1A 4B3MF 4I6YA 1VLYA 3HJVA 3H7HB 5F8GA 1XERA 3CCTA 5LJ3Y 3B8HA 2CQ2A 3IGNA 3ILLA 1U49A 2AP6A 1C0UA 2H5JB 4NI2B 4ZLLA 5CYQA 1MWZA 3UD5A 2UVVA 1EETA 3T5HA 1Y5NB 2B4OA 2POKA 4ZVEA 1APSA 2NZCA 4TYBA 4IQXA 3BQ1A 5IQ6A 4JI1F 1HWUA 1IQZA 3GYNA 3I5AA 4QZVB 4YR0A 3FEYB 4J9MA 4ZOSA 4WJBA 1NUEA 2WTFA 3KJVA 2RAQA 4G6VB 1PYSB 1N5VA 1C0UB 4NI2A 3SCIE 3LPEA 2HFUA 3OFFA 2IC3A 2XC9A 2QA4S 1NJZA 1DQAA 1RLDA 4GKKF 2CWXA 5ETSA 2HRTA 4C8KA 3FZ2A 1NHVA 4B3MJ 3MEEB 4W92B 2ZC4A 3AD8C 3MEDB 4IFVB 3WBZA 1GFWB 2DH7A 3D9BA 2O01C 2Z30B 4ZP6A 5FJ4A 2PE8A 1XR5A 4EK2A 3VALA 5DM6Q 3ENVA 1JLAA 4HTJA 1TU0B 4NLDA 1QTNB 4RW8A 2VQFJ 3VAMA 4XAKA 1ZM3A 3M4XA 4N8NA 2AV5A 2QYCA 3OJUA 1LFPA 4C97A 1AUDA 1WEYA 1WKJA 1NH8A 4DV2F 1BQXA 3CMAS 2GQQA 1PC4A 1FCAA 3CJ2A 4J9UE 1RAHB 2GC8A 2QMXA 3RAMA 1UJ5A 4RU2A 1TFYA 2HHSA 1VJQA 3BSNA 4K4VA 2MTLA 4MJKA 3R9LA 2G1HA 1S59A 3D6TB 2MY8A 2PMWA 4KJIA 1REVA 1KLMB 1D8ZA 4KGVB 2A2DA 2E1CA 3C15B 3LANA 2HWHA 2A2CA 2OPSA 2W2OP 1IKXA 1SPBP 3QGHA 4QYZK 3DU6A 4HTIA 3N5BA 1IBLJ 2B5JB 3JS9A 5EX3A 2F5GA 3R5DA 1NB2A 5J2NB 2E1RA 4ATNA 2XS2A 2MEWA 1ZZNA 5JJBA 1NPKA 5KT3A 1X31C 2FIUA 2WVBA 3W64A 2XO7A 1DRZA 3KMQA 2MKJA 2H5IB 1C1BB 4GO7X 2DXFA 4HL9A 3G71S 2DEIA 3R6LB 1RHJB 1S1XB 1WDTA 2ACMA 4DSLA 4AL7A 1NKEA 2KZMA 1FFSB 4DV0J 1H2UX 2QN6B 4IOCQ 1YJRA 2BRKA 1Q53A 1WOOA 3C16B 3LP2A 2HFSA 2EC2A 1CJTA 1KOOA 3R5AA 3HI9A 4QJVA 4ZHRB 3BR8A 4IQMA 4E8UA 4Y0FA 1M5VC 3P49B 2B9WA 1NXIA 4BC7A 1FDAA 3DCAA 1VRTA 4ZVHA 4BHQA 3PV8A 1F9FA 3QPIA 3RZAA 1XMQJ 2E9RX 1UJ6A 4OYWA 1ZAXA 2C2EA 3DGPB 3QYYA 5RUBA 1CLFA 4DLEA 2BJ8A
chains in the Genus database with same CATH topology
2LDYA 2QRRA 2RE1A 4TU9A 4UQGA 1VQLS 1UAWA 1WG1A 2M2BA 5LSRA 1DAXA 1NO8A 2HQ3A 4DQRA 2NSCA 4B17A 4XPCA 2FVRA 4E98A 4W90B 3CCZA 2VUGA 3GFYA 2VZ9A 1FRJA 2AX1A 2L9WA 2OPQA 3JSMB 2B3TB 3GIJA 1N0UA 3DI6A 4CT8A 1HNZF 3ZZPA 2HMIA 1VQKS 1T94A 1ZAWA 2HWTA 3H2UB 1NK6A 2HHHF 3PW2A 4IO1A 2CPIA 3ZZTA 3OW2R 4C98A 3HVTB 3K5NA 4DL5A 3TA0A 1C1BA 1M5SA 1RTDA 1XMQF 4U6PA 1QVGR 1T03A 2KXFA 4NLTA 5E0OA 4ZCLA 3DLHA 1FEHA 2FGCA 4WU3A 3CULA 4YDXA 1ZBTA 4PCQA 3UW1A 2GHPA 3IN5A 4M5DB 1GT8A 3FGVA 3IXQA 1YQHA 4QYRA 4CTAA 1U7LA 1S1UA 4U9RA 5B0BA 4NCGB 1TVRB 1X4FA 2LKZA 1Q16B 5HQ8A 2IM2A 1TK5A 5A6WA 3TOQA 2DGVA 1L3KA 2KKHA 4KKOB 4KRWA 4P6QA 5F8MA 5B09A 3IAS9 1ZTWA 2AJ4A 1X0PA 2DIUA 2VG6B 3BDEA 2YKPA 1GXUA 4FBUA 4R5PA 2B43A 2QE5A 2VFSA 3L95X 2VC1A 3T1HF 1LWEB 2RDIA 1S1WB 3VAGA 3NMRA 4TY8B 4NYOA 3MAHA 4X66F 2W9BA 1FK9A 2ZOMA 1SUQA 4CH1A 2Y0SD 1N54B 4DFMA 1YBAA 2ZD1A 4TLRA 1SKSA 2BE2A 2OKQA 4LF8F 4QU7A 2KJVA 2AF6A 4F26A 1FHTA 1X7VA 3GE9A 3UQSA 3WZ0A 1UWBB 2D7SA 4ZVGA 3VAIA 4JV5F 2HHXA 1TL1A 2BABA 4MKAA 2FC8A 4KHRA 2BE2B 1K73T 3NRBA 2MKHA 3NCQA 4LF4F 5GMKa 1JLFB 3Q24A 3FEZA 4DX8H 5MLCV 1HMVA 4WYWA 2CJQA 1LK7A 1X4GA 4IFYB 2FHJA 2KT3A 1UW4A 3NNAA 2GHWA 1U2RA 2HZCA 2VC0A 3WX4A 3BZQA 3FDSA 3V6KA 1WI6A 1EP4A 1IKWB 2F1FA 2YKMA 4F4WA 5DO2A 3PW0A 2E1MC 3OL9A 2WSFC 1K0TA 1XC9A 5G0RB 5IT9Y 1XN9A 2XLJA 2UUCF 1HBNB 3GQCA 4QIWD 2Q1LA 4CO5A 2DRAA 2W7OA 4IG0A 1YRXA 3FRYA 2M88A 2FPHX 2YVSA 3PEJA 3MECA 3TAMB 1MW7A 2K7KA 3SEOA 2BV3A 4ZCIA 3MM8B 4JI5F 4FF3A 1YTYA 4V19J 4FVCA 4ZP8A 2RD5C 3FNNA 2FJXA 4F2SA 2EFPA 5G4DA 1CPZA 3MECB 5L1LA 5HI7A 2FJVA 3KLGB 2VA3A 3DOMA 1WNEA 1VGYA 3V4MA 3KTQA 2DGWA 1YIJS 2EBEA 3CEDA 2VBWA 2LQBA 3N79A 2RH3A 1IBLF 1VIOA 2L48A 5J2QA 4TQSA 4LQ9A 1T95A 3G6ES 3M2RA 2DNZA 1Y9OA 4F3QA 2DGTA 3VZIA 2ZBIA 2K3IA 5KG5A 3G6YA 2WK4A 4PWDA 2L9DA 2QLWA 5AXLA 2PA3A 1FNMA 2DNPA 1S6QA 2IJNA 2AYGA 1CEZA 3LQVA 1OQ6A 5JVGQ 5KTQA 2B4PA 2YH0A 3SCKE 3CT9A 4EU0A 4F02A 1VBXA 3DRXA 1QE1B 2J7UA 4C7QA 2RNEA 2BJDA 2ZHOA 4PPZA 3JYTB 1FJEB 2V5HG 3SQGA 2FHJD 4ZKAA 1HW8A 3K8VA 2XWXA 2VH7A 4Y34A 3BGRA 3AQOA 4JI7F 3MPYA 5KFLA 3MF5A 2Z2LA 1FRMA 1U1RA 1BD6A 5LL6d 3SQGB 1JLGA 4JV1A 3AHPA 4QQBA 2AGOA 1B0TA 2J7KA 3D1QA 5L1KA 5T41A 4UY85 2ERRA 4OJHA 1NKBA 1KLMA 3LPYA 3KOAA 3HT3A 2J76E 3TUZC 4Y2KA 5FLXY 2EC0A 5E3QA 2UVWA 2KT2A 4J9NA 4NZ0A 3K5LA 5J2MB 4EO8A 4PWDB 5H1SV 4NWBA 2DNKA 3MAQA 4LUBA 5T14A 2YX4A 2F3JA 1RT4B 4O3RA 1H2VZ 1FKPA 2F7VA 2XWYA 4MK7A 4NLRA 4N77A 5BYSA 1SJFA 3SZ2A 3IRWP 3UD4P 4A8MP 3O3LA 5HP1A 4LQ3A 1FRHA 4NLYA 2OPRA 1TL3B 1S0MA 1CG2A 3HJFA 4ECSA 2B7BB 5HMXA 4TY9A 1IR0A 1Q78A 4I2QA 4AYBD 2J7WA 1WI8A 3SFUA 3OVSA 2W8LA 1IJFB 3KK2A 4LFBF 4CIOA 3BO3A 4ZS6A 3PO4A 3IFEA 2CKWA 2WB4A 4A48A 1N8RT 2BQUA 2B51A 2XZWA 3H59A 4X2BA 3IS9A 1D9DA 3DU5A 4RUAA 2UZAA 4YMEA 4DV0F 3R1LA 1BC6A 3DC2A 1IKXB 1JLGB 1XK8A 4GO5X 4EWTA 2DR5A 5F0WA 3EXCX 2WRMA 3I32A 4RW4A 3RB4A 1WEXA 1U47A 5HL7Q 1IKYA 2DNQA 1DTQA 5E7OB 4JI0F 3B82A 1OSCA 2G9OA 2JC0A 3JSBA 3K5OA 3N01A 4G1IA 4X84A 3SSRA 4HDHA 3V5RA 5I3PA 5JXSA 2MMYA 2GIQA 4RBVA 1N6QB 3I0SB 2ZH5A 1QAIA 3TQ1A 1UVLA 2ZOGA 2D9PA 2LVWA 4ES1A 3HVRA 2LXFA 5K5MA 4FXVA 3LH2S 3HPOA 2DH8A 5KFAA 2J0WA 1F5BA 1FD2A 1IKVB 5HBMB 2VG7B 5KFVA 4DSEA 1TKXA 1Y5IB 2F8EX 4C0OC 2ILYA 3OTOF 1QLNA 2GQ2A 4ZPAA 4DQIA 3S6EA 2E7WA 2GW8A 1RT1B 2M0GB 3I5CA 5F0UA 2MQLA 4OHXA 3UR3C 2HS4A 2MKIA 2HNZB 2PSZA 3CE8A 2GNKA 2Y1IA 3CCUS 1FERA 2DNLA 4EBDA 5KFXA 3PIPQ 1VRTB 3IR5B 4ECWA 3I82A 4X4TA 2DK2A 3N4WA 3QO9A 1Q8LA 1L5UA 2GO9A 4OX6A 3LALA 3CJ3A 3H4DA 4F8RA 2XGPA 2XNQA 2HNDB 3Q8QB 1J5EF 2OPPB 1QUPA 2XMVA 3BS9A 2MY7A 3I0SA 4ED1A 4K5RA 2CVEA 4NLQA 5FDLB 5L38A 5DGBA 1ZTTA 4DR6F 5J1EB 2Q3PA 1B7FA 4ELVA 3AY0A 3PXGa 3NGDA 4DPOA 4UY8T 2V4JB 1Z4UA 3GWCA 1N32F 1HPZB 5K8OA 4QIGA 1Y7PA 4MIWA 2AJ1A 2HG4A 4UUWA 5ITHA 2IA6A 2JJ4D 2ZM6F 1B64A 3Q0AA 2W4PA 2DO4A 2PMZD 1DURA 4QPTA 5C25B 2XNRA 2B56A 3DRSA 4F4KA 1FKOB 1VHFA 3OTEA 4H54A 1IM4A 3KG0A 2XB2D 1SV5A 2MQPA 4FF2A 2ILZA 2OPQB 4IUFA 4ZPVR 4KFBA 3Q23A 1S9FA 3TAMA 3IWLA 2EG2A 2HNYB 4EFAC 3GSDA 4K4WA 3NG8A 2KB2A 4J37A 3TO8A 4I68A 5LXRA 1RAJA 1OQ3A 1QSYA 2MJUA 3H5YA 2NYIA 4RNFA 3HM9A 2ASDA 4NZ7A 4BC9A 2N82B 1F5AA 1TAUA 1M5PC 1Z2LA 3NBPA 4NCBA 1YWXA 2OO4A 2J9DE 3LW5C 1WF0A 3C66A 3TYTA 1RDRA 2CDQA 2O66A 3KKFA 2PGCA 2V94A 3PDNA 4OJ1A 1V3ZA 5KG7A 4M95A 1HI8A 2FLLA 1S48A 1YITS 2VG6A 4OL8A 3G6XA 4RW9A 2CPFA 2MSTA 2HHUA 2C3UA 3D1HA 2RDJA 4JUZA 3GV7B 4OI3A 2V8GA 2BQRA 3K2YA 3GIIA 1S6QB 4IH5A 4B9MA 2KG1A 3DOLB 3AB4B 5EX0A 4X4PA 4X65F 2KJWA 4KR0B 3FQKA 2YWHA 5CZVA 5D4PA 4TXSA 4DDFA 3DNCA 4O23A 2RRAA 5K14A 4AQYF 3N6MA 4FN5A 3UCZP 1Q7LB 1H6KX 1NU4A 3EGWB 4NL5A 5D8HB 1OS5A 4PQUB 3I56S 5J2QB 2XCAA 4F50A 3QIPB 3M1VA 5FD1A 1R7IA 5A2QY 3PW7A 3J7YU 4DF4A 2G1DA 4C4WA 4O3PA 1I94F