2JSXA

Solution structure of the e. coli tat proofreading chaperone protein napd
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity in twin-arginine signal peptide-binding proteins.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Chaperone
molecule keywords Protein napD
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03927 NapD NapD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jsxA01
2CVIA 2EFQA 2E7XA 3I4PA 2PN6A 2QZ8A 2IA0A 2VBWA 2ZNZA 1RI7A 2GQQA 2YX7A 2CFXA 2CG4A 2IVMA 2EFPA 2YX4A 2ZBCA 2E1CA 2VBXA 2VBYA 2DJWA 2E1AA 2E7WA 2PMHA 2Z4PA 2JSXA 2DBBA 2ZNYA 2EFNA 2W25A 2EFOA 2VC0A 2P6TA 2W24A 4PCQA 2CYYA 2P5VA 2VBZA 2P6SA 2VC1A 1I1GA
chains in the Genus database with same CATH superfamily
4DMZA 1HNXF 4OLOA 3MTKA 2IBKA 1MU2B 2J7UA 2XSFA 1D09B 1I5OB 1URRA 3BPSP 4ENOA 2XMJA 3QJLA 1CBKA 1W7WA 2QLJB 3M2VB 3MAAB 3AT1B 3R5AA 1WKKA 2Z2ZA 3PW7A 2UXDJ 1S79A 2CVEA 1VQ8S 1IVZA 3QLHA 1FD8A 1RUSA 3JS9A 3MMJA 3W2WA 5EN1A 5HVGA 3C16A 4DU7A 3MR3A 2ZZMA 1HI8A 2AW0A 1Q8KA 3BV8A 5C7PA 3PNIA 1B99A 2LMIA 5HMZA 3PRDA 1R8CA 4F4AA 4AL5A 5KG6A 1WC5A 5ETTA 3M8QA 3WHIA 2IPOB 3A13A 4X66F 3HK2A 2EW9A 2MHNA 3AH6A 1Q8LA 2IMOA 3TQEA 2CRLA 4K4WA 2PEBA 2Z0GA 4DN0A 1NKEA 3K89A 5E3CA 4ZVPB 1KQKA 2R2TA 4W92B 2CQCA 4QW8A 4M5DB 2GX8A 4ECRA 2CJYB 1R0AB 1DAXA 1MW7A 4Y00A 4J9LA 2V69A 4DFMA 1DZ5A 5FLXU 5C2GA 4K8RA 4N47A 3TYTA 2IM2A 4DPOA 2HAFA 3NCRA 1D8ZA 5KOWA 1FCAA 6FDRA 1WHXA 2HLTA 3D3BJ 2PN6A 1C1BA 2J7WA 5GAHI 1S59A 3NGSA 4DHVA 2MQOA 4ZP9A 5GAGU 4NLDA 1EZZB 5KT5A 1YZ7A 4DV5F 1S1VB 1RHUB 5G4DA 1JXVA 4O4GB 3OVSA 1B64A 1U6BA 1N32J 3BGUA 4ED4A 2MY8A 2H4WB 3UVJA 5JVHQ 3I6PA 3W8GA 1X9SA 1R31A 1HBUB 2HYIB 3IGNA 4F3MA 3Q0AA 4WZQA 2FJWA 2F5GA 2Y0SD 2A3JA 1U24A 2GVDA 4LBHA 1RT3B 3GR1A 5SZTA 1VFJA 5A2QY 2K3KA 4OX7A 4USVA 1RAFB 1NCLA 4JI1J 2ZH2A 4WYWA 4KYZA 4B9SA 1Q79A 4P75A 2F63A 1TZ0A 3HD2A 4PG8A 1JLQB 2UVUA 2CZ9A 2KG1A 2ZD1B 2OO4A 2W4DA 3J81Y 4DUYJ 4RW4A 3R3TA 4OHWA 3K5LA 2WW8A 3TAMB 1L3VA 1UAWA 1S9GA 1RWOB 2YQ0A 4WBFA 5LSOA 3QPIA 3MM7B 3BGRA 2J6SA 1NH7A 2XS2A 1D3WA 1NO8A 1YBAA 4UOFA 1Q53A 5AXMA 1F3VA 4YS2A 3VQSA 4DV2J 1IKVB 2QMXA 4KGMA 3GG1A 2NQPA 2HBQB 3C6UA 3OR2A 4JI4J 1CC8A 4ZN1A 3D2WA 3UVJB 2IYIA 2JOQA 2WZ1A 2IAJA 3OFEA 3GILA 3K5PA 1Y5NB 3FDSA 4DR2F 1YZ6A 2BEFA 3D66A 3DGPB 1IWGA 1S1TB 4OLPA 4K7QA 1RT3A 4ZPDA 1N32F 3S6EA 4L72B 4X4VA 1EAYC 3AD9C 2OP5A 3TZZA 1FFWB 3R97A 4AT1B 4CRJA 3AOAA 4Q2LA 4AQYJ 2JVRA 2MGZA 2HZVA 2E1MC 3MMBA 3E2EA 3ET6A 2XCPA 1SI9A 4HH0A 2RRBA 2XQCA 1P1LA 2AGPA 2ZDPA 2V4RA 2ZNZA 3H90A 4CLUA 1XWLA 3H59A 4QWDA 3RTVA 2KXNB 2VJVA 3LP2A 2G1DA 3J7A1 2VASA 1UKUA 2FYXA 3QGPA 5AXNA 3LP0B 2FUG9 3V4IB 2V9KA 1UA0A 3KTQA 2XSJB 5ETPA 2VHGA 3BDPA 4ECUA 3ILJA 2I9SA 4IUFA 5E33A 1IQTA 2GW8A 3OXFA 1VRTA 4NOHA 4M5MA 3OTOJ 2VA3A 4IOAQ 1TVRA 1MLAA 2DH9A 2VDHA 2KYZA 3M6VA 1TK5A 2VQEF 5THWA 1K9MT 2OPPA 2C2ZB 1EQ0A 3HJFA 2OD4A 5LXRA 3KJFB 1S1UA 1GX6A 1OYDA 2N3LA 3MHYA 3MI7X 3PXGa 4NA3A 4J7CA 3VAKA 3MPUB 3M8YA 3T6BA 4A8XA 1X60A 1XR5A 4HEA9 2ATCB 2BBEA 1H7XA 4EFAC 1HNZF 3D6FB 1SKWA 3KOAA 1HW8A 3M6UA 2RKIA 2EC0A 1WOSA 2GAHC 3D6HB 5J2MB 2R8GA 1TKXB 2HW3A 5E7OB 4HT5A 4CLZA 5J2QA 4F0HA 3BR8A 5ITHA 4Q43A 1Y11A 1BD6A 4XTTA 1UVJA 4DR4J 3CDBA 1RTJB 5HQLA 1HBOB 1XJWB 2WVFA 3CD7A 2BM1A 3OXLA 4O23A 5FDLB 1T03A 1N8RT 3P3DA 4A46A 3DYAB 4ZKAA 4CH0S 2C3PA 1PCAA 1JLGA 2DHHA 5IV3A 3L7UA 1KWMA 4TY9A 3K17A 5EX0A 2XO7A 2Z8QA 3MM8B 1LW0A 2HQDA 5LMNJ 3PVXA 3QRPA 3MR5A 2UVRA 1SIZA 4HTJA 2PFFB 1FT8A 2FD2A 3GSIA 1G2EA 2XMAA 2W9CB 2NSBA 3QT7A 4G1QA 4LJMA 2V50A 3GTYX 5CYQB 1KP6A 1VI7A 1C1CA 1RT6A 3MEKA 4PXCA 2IVMA 4B3TJ 1BQNA 3CD5A 2W01A 1TAQA 3JTOA 3RUBL 5HJXA 2ZOFA 2KT3A 1UVNA 2OKQA 5KFGA 4FZVA 4PXBA 5J1PA 3H4BA 4OYPA 4OHYA 1FHTA 2AX1A 4KO0B 3DM2A 4WKYA 3BF4A 1KOOA 1NBEB 1R0AA 4N41A 2FZGB 3CD6S 3HHEA 3ILLA 4ICLB 2W2QP 3NBPB 1SC4B 2RT3A 2RRNA 3MM9A 1KBRA 2JLFA 1ICEB 5EWEA 4KTQA 3BSOA 4LRAA 3OW2R 1JQGA 1DTTA 5C24B 1Q86T 1L3TA 3UN2A 1TQLA 3OLAA 2V63A 2MQ8A 3BBFA 4P73A 5KFLA 3DOLA 3MD3A 4CO3A 4ED2A 3DHWC 2Y8YA 4PG7A 1OWXA 1M5PC 3KK2A 4NZ6A 3VQTA 3IRXA 3RYLA 1S12A 3GJQB 2C28A 4N76A 1YLXA 2VH7A 1FDNA 2PGCA 3EMTA 1G7CB 4GRSA 4KJIA 2X1BA 3AD7C 4ECXA 1U49A 3ENAA 1JLBB 4HI2A 4L3NA 1CC7A 3M7VA 4P2XA 1X5OA 3WBZA 2Q6CA 2PC6A 1UFWA 1SIWB 2YQ3A 3SXLA 4MT1A 3JSMB 2LXIA 4PXEA 4PG6A 3I56S 5DG8A 1DQ9A 4MFBB 3VGVA 2W24A 1PJ5A 3AY0A 1HQUB 5H1SV 4QWAA 5E0OA 5L1IA 4K4VA 4ZPAA 1VQ6S 2EK6A 4H4OB 5D8HB 2ZWOA 1RKIA 3BSNA 4IRDA 2OGUA 1DBDA 3N5FA 1NJZA 2QA1A 1RE1B 3ITHA 3OL7A 5A6PA 3T19A 2E9RX 2FPHX 3TA2A 5F0WA 2JFKA 2H9ZA 1NNDA 2HWIA 2DGQA 1LWFB 2UUBF 3NS7B 4NCGB 4YB6A 4LSNB 4B3OA 5KFWA 1IKYA 1ZBTA 2YX7A 5IXUA 3L3CA 1JLFB 2RQ4A 1RYSA 4DSEA 2C22A 1FK9B 3I4HX 4G1IA 2DVIA 1R6YA 7FDRA 4QIGA 1XNRF 2B7BB 1X4CA 1HBNB 4RNHA 4CI0B 5EHHA 2JL9A 3OUYA 4WKRA 2BOPA 4DCOB 2VPXB 4Y2IA 2DGTA 1R8HA 5KG3A 1FKOB 2AZ1A 2B9EA 3TW0A 1HMVB 3HULA 5L9NA 3NOGA 5A2QU 3RB3A 4Q0BB 3D0HE 1U6FA 3Q86A 3V2UC 4DPWA 4ECWA 2PSZA 1XMBA 1RISA 1X0PA 2MJNA 2YNIA 1N6QB 4L74A 4K5RA 4TVAB 4ZK7M 1JXLA 4TY8A 3HPOA 1MMDA 5KFFA 2OPRA 2B6AB 4TU9A 2IJFA 1SQFA 5A0YB 3QT8A 4OX6A 2VQEJ 3FEXB 4CLFA 4EBCA 5DZ7A 3EPGA 1JKHA 2ZVIA 4RW6B 3T5LA 2CA9A 3RB0A 1KSPA 1HA1A 2HKEA 4MJKA 4ZVEA 2G2YA 3N9UC 3IBCB 5LM7E 2C2NA 2DGSA 2MDAA 3RBDA 3MCSA 5I42A 2OEKA 2KXFA 1UPPA 2QYCA 4DR7J 2MZTA 2CYYA 1S5ZA 3D5MA 2HLUA 3IA0A 1M0SA 2HQCA 2BM0A 1RCOB 2C3OA 1VC6A 2RIJA 1NU4A 4B9MA 1R89A 1FKOA 4IQMA 4C0HA 1FEHA 2V5HG 4CLTA 2HGMA 2HVIA 4ZIWA 1VDHA 2ZC4A 3UPFA 1RKJA 1WEXA 4RWWA 4Q45A 3HHKA 1OPZA 3L7PA 3OTCA 5HVHA 4O44A 2V68A 4MIAA 4JI0F 4BC9A 3PKMA 3OFHA 4DBQA 4OYWA 5LMUF 2DH7A 5GMDA 3IR6B 2LEBA 1SC3B 2V8GA 4ZPBA 1VHFA 1NSQA 1S9EA 4C8NA 3FSIA 4YN3B 2H4YB 4CIOA 2QEXS 1BQMB 3IO1A 1NSAA 3M1VB 1S6UA 2MJUA 3AODA 4OYMA 4G3IA 1RT1B 3ENWA 1VBXA 3IAM9 1K1QA 3ULHA 4OHVA 2K3IA 4P71A 3HT0A 5HMXA 1OS5A 4XPCA 1XIQA 3M8SA 4NLQA 5HMWA 3CCQS 1EX8A 3KLGB 4LQ3A 1YKWA 4FS2A 2FVQA 2DIUA 3FFIA 3TX8A 2MQNA 5GAHU 2RS8A 5KG1A 3O5TB 3G96A 4M8LA 1RTDB 2A6MA 4DPXA 4ZVFA 3BH6B 3V81A 4DR6F 1J5EF 2UXCF 3MCMA 2H3EB 3BPDA 1JJCB 4ECQA 1YBUA 5K8MA 2HZAA 1Q95G 3CDWA 4LRDA 4GO5X 4AXIA 2HNYB 4O4RA 2R2SA 3RW6A 4N77A 4YDXA 4R0EA 4U96A 2V4JA 4DV1J 4IDKB 4YUDA 2HHVA 4QQBA 4B3RF 4GMKA 3QO9A 2YKOA 4ICLA 4UQTA 1GTEA 3WZ0A 4CP5A 4DFKA 4M5KA 2JEFA 4R8UB 1DQ8A 1SL0A 3SDEB 1RT1A 1ROFA 1S9GB 3UE2A 4UF4A 2XO6A 2KFYA 1RHKB 1IJEB 3K57A 4ECSA 1AXQA 2FHOB 1UVMA 2RILA 2L48A 3GR0A 2NYIA 3KK2B 2F8MA 4XPEA 4OX8A 1YJVA 2VUGA 2DNHA 3CEDA 3M32A 2J8AA 3DLGB 5HBMB 2QZ8A 2UUBJ 1T0TV 1B7YB 1TKZB 4X4UA 3PYFA 3CVKA 3HVWA 9ATCB 3R5BA 5F8NA 4U6PA 2KO1A 3PRVA 4OX9F 1REGX 1LV5A 3MEDB 1HR0J 1OQ3A 3LWLA 2RS2A 4F3OA 2XNRA 3NL0A 2IJNA 4J9OA 2E7WA 3WX4A 1S9FA 1LK7A 2MHEA 1CG2A 3PTWA 4MMOA 4LIWA 1X4BA 3UD3P 2ROPA 3FK4A 3TAQA 2VL1A 3KXDA 4JI3F 4FVCA 3BM7A 1GXTA 4H4OA 4CLLA 3OR1B 5KFRA 3VAHA 1YHQS 1I1GA 2DNOA 4JYAF 3SQGB 3PG9A 2Y1RI 3PW4A 3JQMA 4WK3A 2HMIA 5AJ3J 3Q8VA 2R7QA 2HHUA 5A6WA 3OVBA 1SQGA 3GMGA 2VB6A 5JMNA 3D68A 2NPIA 4EZ9A 4FF2A 4K50A 5I3PA 4ECTA 5GADI 2Z2MA 4DJBA 1KHWA 4MIWA 1GQEA 5JJBA 1YJ9S 1CS4A 3DHXA 2GQ2A 2IVYA 3CCTA 2DR9A 2XLKA 2D3O1 4JV5J 1VQSA 3OUYB 1RHMB 5FJ4A 3AAWB 1YRXA 4OL8A 3KFWX 2HPUA 2NSCA 3H8YA 2RJZA 1X9WA 1BXNA 4EMDA 3T5HA 3MMCB 2BQRA 2BOAA 3U1LA 4NE9C 4NLPA 3VR1A 1T3OA 2YNIB 1W26A 1N6QA 1CQNA 1OSDA 4ZVRB 3PO5A 4LF6J 2ZBIA 4PWDA 3HHLD 2UXBF 7AT1B 3OV7A 2HFOA 5DG7A 2IM3A 3HVTB 3C19A 2VG7A 2ZH3A 3PYGA 3CCRS 1NJIT 4CCHA 1XC9A 4K2JA 4LBPA 4QYZJ 2CPYA 2J0WA 2MQQA 4I0WA 1N5QA 1RAEB 2Z56B 2KB2A 3NCPA 2G0JA 4NMXA 3SIPB 3AJ2A 3OL8A 2VZ9A 2CJXB 3HFKA 1H2UX 1C2PA 2ZNYA 3RB4A 4B9LA 2FY8A 2BE2B 2K06A 2CNOB 3M2UB 4N7TA 1LW0B 2PA3A 3PV8A 1X4FA 1MMNA 3D1OA 1VQNS 3BYRA 3OHBA 2BR0A 4ZJLA 4QWEA 4DU8A 1JLEA 5CH7B 1S6OA 1MMLA 4J9SA 1HW9A 2WRMA 1RWMB 2Q1LA 3LPYA 3QBCA 4PYDA 1AT1B 4ELTA 5CZVA 1VYAA 1CSJA 4NASA 3THVA 4FBUA 1RAIB 3CJ5A 4OYIA 3VCDA 3C46A 2R7TA 2YWFA 2BJEA 3Q8YA 4A48A 2RH3A 1HHQA 4LFBF 2C2OB 2YWEA 1VIXA 2DXEA 2X7IA 3NBPA 5L8RC 4ZHRA 1YJWS 2D3UA 2XMUA 2F65A 1WG4A 4EK2A 3RR7A 3PHEA 2IA6A 1IR0A 2A2DA 5HAOA 1AZSB 2OPPB 3CNQP 4C8LA 1FTCA 2R4FA 4USIA 4NA1A 3U02A 2LA6A 2LU1A 5A8KB 2BA9A 3HCXA 4U95A 3ZTPA 2JWNA 3IRXB 2IRYA 3AOBA 4Y28C 2GFFA 1M5VC 1Y5IB 3LGMA 3TR5A 3VGSA 3ILOA 3DOMB 1SXLA 1Y10A 5EWFA 4A47A 3G8SA 3B8HA 4ATNA 2PMZD 3O8WA 2GQQA 2UUTA 1M1KT 1XEZA 2HEKA 1WUUA 2L08A 3QATA 3KLEA 4RW8B 2AD9A 1UETA 4IFVA 2IIHA 3LAKA 3IM8A 2DPIA 2I0XA 4ZP7A 2COLA 5F8MA 3KDOA 5IFMA 1DRZA 4F2RA 1NSPA 1S49A 2HK2A 3LGNA 2JSXA 3CDEA 4RW7B 1B0VA 4YB5A 5F8LA 4FNHA 1U1PA 4RU2A 5L1LA 3CCZA 3DRXA 3R9LA 1Y0HA 1UMJA 3EZ5A 2UU9F 2KFZA 2BV3A 2D9PA 2XTJP 2BANB 1LW2A 3FQLA 1Q8BA 2M52A 2ZBRA 3FMWA 4M5NA 4QIEA 1FFGB 3AOCA 3CF5Q 2YNGB 4A4JA 3OR2B 3C3LA 4RLEA 4MIBA 5ETVA 3KLHA 3FSXA 4C0OC 3HSDA 5HBMA 3HSGA 4BWJA 4CO4A 4DN9A 2ASYA 4KV8B 2DHSA 3FRYA 1BUXA 1PSDA 3T9NA 5KFMA 4Q5VA 2BYCA 3GSDA 2MY7A 3EUNA 1WF2A 3HX9A 4GO7X 1MG7A 4DL6A 2Z58B 4A8YA 4CZCA 3PFEA 3M2RA 2OELA 2EXUA 3DXBA 2JNJA 4DV4F 4AE5A 1P6TA 1GMWD 2L9DA 4FKYA 5E3RA 2ZD1A 3HI9A 3C8YA 2NXEA 4ERDA 3HHLB 3W5XA 1EKSA 5KFVA 2I2YA 4J9KA 1HKAA 4OI2A 4F2SA 4NXNJ 2JH3A 3SQGA 3QRQA 1RLDA 2EBEA 5D15A 2VV5A 1F9FA 2VG6A 2E5GA 5CYJA 4URGA 2W2OP 2HGLA 1LK5A 2RDIA 4OYBA 1CJKA 1DY3A 2FB0A 3GFZA 1LWCB 3QGHA 4HLBA 4P52A 2OMOA 4WFAQ 2FHKA 3FBFA 5KT3A 2HHTA 4S0MA 5B0BA 2VG5B 3UWTA 1JLCA 2AWZA 2PO4A 4Y6IA 3RBEA 3MAQA 1H73A 2HFSA 3TA1A 3P45B 2CADA 1S7IA 3T5KA 3B78A 1CS4B 3IP0A 2MZQA 3GQCA 3KLGA 2DT9A 2YKMB 3LP1B 1VJWA 2DNRA 3N0VA 3H0PA 4YHHJ 3BZQA 1U1LA 2UUAJ 2LP4A 1RTIA 3BKFA 4JB8B 1V3SA 5KFKA 4IRCA 5DO2A 1R0BG 2F7VA 3MMCA 3OSNA 1G6BA 2NXNA 5D0EA 3UNYA 3I0SA 2KG0A 4QCLA 3TUJC 4QIFA 5D0GA 3RB6A 1I3OB 3HF5A 4R5PA 1O51A 2AIRB 3VGUA 4U8VA 4DCPB 4FPIA 1MSWD 3PR4A 5KFPA 2BE7D 3UR0A 1YX2A 3QMQA 1B70B 1P9QC 3C6TA 5CHCB 3RG6A 3W66A 3VAFA 1TKDA 3QO9B 5T41A 2AU0A 1QVFR 3G2XA 4PQUA 4OZ5A 1XTZA 1FKPB 1MN7A 2BKOA 4WP8A 4KAIA 5BYQA 1Y9OA 3WQPA 3J7Z5 2KH9A 5KFAA 5HP1A 3MFHA 5D0RA 1R8BA 1VS3A 4NA2A 3MEGB 4KSEB 3I9ZA 4Y34A 2N3OA 1SJ3P 1GEHA 5D4LA 4JUZA 4I6AA 4JI8F 3MFIA 4A8MP 5GAEI 2YNFA 2CQ3A 1H74A 3W3SA 5AE3A 4K4SA 1AUSL 3FC9A 1O6XA 2P6TA 3VZIA 3MD1A 3GV7B 1RHQB 3OLBA 1KLNA 2KT5A 2ZHOA 2CQBA 4EYHB 3QZ7A 5ETKA 2E5HA 2V8HA 3PFOA 2J6TA 1S77D 5C42B 4IQXA 2HQ3A 4PXDA 1PC5A 4QJVA 5J1EA 1SL2A 2OJ3A 5IS2A 1NK8A 2BRLA 4AFFA 1Q78A 1Z2ZA 4I69A 1UVKA 2QMWA 2GMJA 3H98A 5IWAJ 2YNHB 3IN5A 1KVIA 1QAJA 3TQ1A 1EIYB 2XNQA 4KPCA 1WORA 5ETSA 5CD4H 1R8AA 3SV3A 4ID5A 5I3UA 2M70A 1N5TA 3HVAA 2HHQA 2M8DB 2DTJA 2EFPA 3N6LA 4NI2A 5AXLA 2QSWA 4DZ6A 1DTQB 1YSJA 5U47A 5LOQA 4LRCA 2CJAA 3IG1A 3FCVA 1D9AA 3BQ1A 2RF2A 4C98A 3CJ0A 2UU9J 5B0AA 5KG0A 1T9WA 4DV0F 4CNZA 1CULA 2P5VA 3PY8A 3FUYA 3HKZD 2BXJA 2P6SA 2OSQA 4NLWA 4Z37A 5KFCA 3V6JA 4I7FB 5ETRA 4A8KA 1PGZA 2BUNA 4J90A 2ZH1A 2ZUGA 2DHAA 1WC4A 3UDLA 3TA0A 3ZZZA 4CM2A 2Q79A 3OHAA 2V4QA 2ZZNA 4NCAA 1FDDA 3R8YA 2GJIA 2IC3A 2E44A 1KTQA 1FDAA 2QFJA 2Q3PA 3UDVA 1NK5A 3M8ZA 4JI1F 3EGVA 3PW5A 1QAXA 3GPAA 4D3HA 1ZYQA 3QNWB 2HNDA 2FC8A 3W65A 4XIUA 1KOHA 3A8KA 3C66A 2ZH8A 4GC7A 1WTFA 3M4XA 1N34J 3FBCA 4IKAA 2VBXA 4UUXA 3H5SA 2QLBB 2XS5A 3OR1A 2G0IA 3CCVS 4ANDA 4UQGA 2AYGA 1NHKL 2R9LA 4EEYA 2F9DA 2CPDA 1Q8IA 2K2PA 1U2RA 2XYPB 2C3MA 1S6PB 1VCTA 2M7SA 3C14B 4KC5A 4OQJA 4X4PA 2BQ3A 1YI2S 1R3NA 4C8ZA 3W64A 5M2PA 4LIRA 1UL3A 2HNZB 1RWWB 3KG0A 1YTYA 2NUUG 2B4UA 4I7FA 1RU2A 3PX4A 4C8KA 4AL7A 5KFQA 1JJ2R 2XULA 2XZDB 1JX4A 4UUWA 1N88A 2NXJA 3SFUA 1WJ9A 1KQSR 2NR0A 3BSCA 3LANA 1U7LA 2XHCA 4JP8A 4NLSA 1GX5A 1ZM3A 3UDCA 1P27B 3DRPA 4EWTA 1Q7YT 1ZAVA 1VQ4S 4B3TF 1XMQJ 3C2PA 4Q8EA 2X1FA 2MKHA 3S8SA 5EX3A 2KU7A 5DETA 4WWSA 5KFOA 2UVVA 2H5EA 1RBLA 2HWTA 5GAEU 1FJGJ 3Q22A 4DPUA 1YBTA 1DQAA 5KG7A 2VBZA 1O8BA 2R7WA 1RTHA 4WU3A 4LFAJ 4LF5F 3C14A 1KLMB 3DRRA 4OYXA 5A8RB 4DR5J 1VQKS 4I56A 3NNCA 3UO0A 3KG1A 2ATLA 5F3ZA 5J1NA 1VQLS 3FRZA 5B0GA 1ZTTA 1T05A 2KT2A 1IBLJ 3DLHA 1MN9A 1H3DA 3CMQA 1AW0A 2KM8B 4PWWA 3VV2B 1SJRA 3EDRB 2FLNA 3D7SB 3RW7A 4PG5A 2I38A 1T8EA 1Z2LA 1KNZA 4D3GA 1T9TA 1WKJA 3MR7A 4DPYA 4P10A 2HS0A 1NK9A 2K1RA 2IBOA 1JB0C 1NHUA 2OFGX 3CT9A 3CC2S 3O1LA 1RTIB 4DXLA 2XHWA 2OEJA 2ZJQQ 4EBEA 1ZZNA 3BH7B 2JLGA 4IYQA 2AHOB 2FZCB 4DSKA 2VICA 5D3GA 2W8KA 1AYEA 3M8PB 1SVDA 4DSIA 4KB7A 4BBYA 1UP1A 3KK3A 4B9VA 2GJFA 5B0CA 1M1GA 3IBFB 2BMBA 1KONA 1TKXA 2BZ2A 2D9OA 3A3OB 3FZBA 3OL9A 5J2QB 2UP1A 2GHPA 1HWJA 2ASDA 2CZVC 3EE3A 1WACA 2F8HA 2QL9B 4M5JA 4CDIA 5KT6A 3IS9A 2PI4A 4PQUB 2KZMA 4RW6A 1F5AA 2WOMA 4V1Ak 2BE9B 2MYFA 3K2YA 4MK7A 5CA5A 1YITS 2JEJA 1URNA 3M05A 1OJ4A 5KG5A 4UT4A 3WC0A 4HACB 4WFNQ 2UVWA 2XMTA 3BKTA 4WFXA 4ZVSB 2A1BA 4YB1P 4HH1A 2CPJA 3M2VA 4W98A 3S01A 1XMQF 3R7BB 4K0KJ 2HIYA 3H2VE 3UNGC 3LQVA 3HSJA 4DZDA 4O3SA 1E6VB 1SH2A 2B7CB 1ZA1B 3CJ4A 4PZVA 3W9JA 4X4SA 1VGYA 3VGTA 5EGYA 2ZM6J 2XY7A 2KVIA 4Y2MA 1VMBA 4DFJA 2W4PA 4O44B 2MKSA 4GKJF 3BYPA 3D28A 3PX6A 2J9DA 2JRSA 1NK4A 1LWEB 1V3RA 2FHJD 2ZZTA 3GWCA 4XAKA 3KLEB 1F1BB 1S72S 3PO4A 3MDFA 2HS3A 1SKSA 3HVRA 2FLOA 4DR3F 1N33J 2FJDB 1H38A 2JZ5A 1K44A 4Q44A 3NAIA 1H6KX 2OPSA 3HMJG 2GVZA 1GNKA 4NLVA 2ACYA 3SQOP 4KE5A 3ITHB 4YDDB 2YX4A 3A3PB 2J8SA 2VBYA 1KDNA 5F8JA 1L3UA 2RF2B 2KTQA 4CH1A 2X3GA 3J80Y 2GCFA 3P5BP 3TRGA 2WSFC 2HK3A 5C2CA 2KVQE 2HG4A 2DNLA 1SV5B 2G9OA 3FGVA 3VF0B 3I5AA 5CAAA 3R6LB 5T14A 3VAJA 3AD8C 4Z7CA 4AD6A 3W5ZA 1S1UB 4LF7F 5H9FK 2YKMA 3B4MA 2DR8A 5IT9Y 3RZAA 4HT7A 4PRFA 1GT8A 1HBMA 4J9VA 4TYBA 1HMVA 2OTLS 4USJC 1S0NA 4NLRA 1V6HA 5DGAA 5KFXA 1C0TA 2MZJA 1I94F 2KRBA 1YRTA 4WK1A 3JQJA 1CJVA 3KYLA 4LFCJ 1JIHA 1NM2A 4F4ZA 2OPSB 1BGXT 4J5OA 4NX9A 1X4HA 1N54B 1RHRB 2DNMA 4IG3B 1F3FA 2I5JA 4PR6A 2OPRB 3VAGA 1UVLA 4DX6A 2XI2A 4F02A 4RBVA 3DRSA 3NOCA 3KDNA 1IJFB 3BGFA 1LOUA 4FNIA 3KJNB 3KLFA 4YOEA 4LSNA 4ECYA 3NS6A 3MM5B 3RBXA 3UD4P 4C3LA 1U0HB 4KR0B 3ZNJ1 4OV6A 3M6XA 2UUCJ 4V19J 4WF9Q 3MEGA 4EO8A 2QX0A 3TOQA 4DX7A 4B9TA 2MQPA 2J76E 3DGPA 3DOMA 3CJ3A 3EM1A 4RBUA 3ZTRA 4WFZA 1SJ1A 4E8UA 4KGVB 1OSCA 1TMMA 5AE1A 4FP9A 2GAGC 3ZXWA 4G1QB 4NZ7A 1FRJA 2ZHAA 2M2BA 2R2UA 1APSA 2OMLA 5CYMB 2KN4A 1J5OA 2R42A 3DI6A 1C0UA 2ADCA 2VIHA 1DARA 5DS7A 1ZAWA 3IRWP 3UN5A 2CAJA 1C4CA 2UUAF 3ZTQA 3A3NB 3AFGA 2YNHA 4FKXA 2I5JB 4OFZA 1FWKA 1WSRA 3OBIA 4F25A 3ISND 3MM7A 1XBWA 5BXIA 2DIVA 3DM2B 1XK8A 5ETNA 2JEIA 5FLXY 3RAMA 4IOBA 1TTHB 3A8EA 4QIWD 4WPAA 1Y7PA 5KFYA 4I6YA 5LMUJ 4YQWA 3I82A 3G6YA 5JVGQ 1CJTB 1UWBB 1U0HA 1TVRB 2C2KB 3FCHA 4K4XA 3K5OA 4B02A 3I0RA 3JSYA 4LRBA 3ILIA 4CLWA 2BE2A 1TUWA 1RJJA 2R7XA 1DLOA 2W1BA 1Q5YA 1RHJB 2O5DA 2XYHB 2NUHA 4G65A 2N82B 2OIHA 3G87A 4KHRA 4NLTA 1TR0A 2R7SA 4K4UA 5BYRA 2KM8C 1VK3A 2CWXA 2WVDA 4RUCA 3EICA 2PEHA 2HRYA 5LJ3Y 3VALA 3DI6B 1J2VA 2V34A 3ET6B 2YKNB 5HI7A 4YFUA 1M90T 1EETB 2CQGA 3T5JA 1Q7LB 3RGIA 3NG8A 4RJVA 2KL8A 5B0FA 1XNQJ 2GIFA 4ZCKA 1XQIA 2VQFF 3EYZA 1D0EA 3NWRA 2Z30B 2V2ZA 3V6HA 4DUYF 2ZH4A 1CJKB 3EWGA 3R5DA 3RRHA 2CXEA 2QGFB 4ZVOB 1XR7A 3OQ2A 4NI2B 1HPZB 3RJMB 1NK7A 5ETMA 1FNMA 4E2FB 1JLGB 2A18A 1TMJA 1HWKA 1PILA 4LF4J 3H42A 3SSRA 1WKLA 3SBMA 1HL6A 3VVTA 3NMRA 4QYZK 3D3CJ 1G4CA 4NEZA 2ZH5A 1NZAA 2WAQD 4TU8A 1ZA2B 2C2DA 3EXCX 4ELUA 1PO6A 1SUQB 2MLZA 4ED3A 1E6VA 4DF4A 3PZPA 4X64J 2DK2A 4XK8C 2AQ4A 5GMEA 3KHRA 4Y0FA 2W8LA 2UXBJ 2DNQA 3QGGA 3NGTA 2V67A 2WVCA 3QGIA 3M8RA 4LF4F 1BE4A 4IH7A 1DHMA 2RVJA 5GMKa 1KR4A 1RWNB 1HR0F 2W25A 3CCSS 4OX9J 2EFQA 1WDDA 4LSZB 4QYRA 1RYRA 1F5BA 4Z7YA 4R25A 4RZRA 1X7VA 3NY0A 2EC2A 4NEYA 4CQ1A 1TFWA 1SPBP 1U09A 4I6WA 3BGRB 2KZZA 2VF3A 4OI3A 2BANA 3J7AN 5A0YA 3H2UB 5C25A 3QAUA 4LRFA 4DI6A 3WDOA 4DF8A 1SJFA 3SZ2A 3DMJA 1YIJS 4ER8A 1CJUA 1IXKA 2W4CA 3DKDA 3MM6A 1G3OA 4FPRA 3HKWA 4LVOP 1RT2A 5AJ3F 1B3TA 1RWVB 2FVPA 2UXDF 2VU5A 2JVOA 3TVYA 1ZH5A 1D9FA 1VLOA 2EWHA 2CZ4A 5E3PA 3BEGB 4KKOB 3ADAC 2AGOA 4I2QB 3VVUA 2WSCC 2V8PA 3Q8RB 2IFXA 2IYGA 1U1QA 3N01A 4AYBD 4HKQA 4H54A 3KLIB 1C0TB 1TL1B 1WC6A 1YJNS 4LF8F 1GH8A 1VRUA 2QN6B 1B0TA 2AYMA 4ZVGA 3R7NB 3TJ9A 1RT5B 2NYHA 2X1AA 3TZXA 1Y4ZB 3GB0A 3EDQB 4WIQA 1FDBA 2J9EA 2F3JA 2ILYA 2YTCA 1QY7A 4HTIA 5BJRA 3DRSB 1S9EB 3JSBA 3T1YF 3ISZA 2IRUA 2FZKB 3MM5A 1F9HA 3C15B 4J9RA 2FQQB 3DCAA 2KHDA 2HFVA 4ZVUB 3W62A 4WE1A 1WELA 1RT2B 1U1NA 3MEEB 2WCXA 3LTOA 4EO6A 3ZTSA 3IAS9 5L1JA 2Y1JA 2XEXA 3DDIA 4UTGA 3RU0A 4J9NA 2VPWB 2FC9A 4HDGA 2RRAA 4LMZA 2JHEA 1BLUA 1F5CA 1P1TA 1G1XA 2JC1A 2B9XA 2ZDOA 3UCGA 1H0HB 5IC6B 1S97A 2XI3A 2FJVA 1C0UB 1IBCB 5DDPC 1T95A 4NPOA 1FEEA 3CDAA 2DO0A 2X3DA 4UY85 4YHHF 4PWDB 4LF1A 1Q0NA 2B3TB 2XLJA 2J5AA 4F0KA 4YY3F 1NPKA 1RB0A 2IJRA 1BHNA 2OHDA 4JI3J 2HHHF 4JI7J 3TI0A 2E5LF 4ZA1A 3K7RA 2OFHX 1SC6A 3DGVA 4DR4F 2EKYA 1FWLA 1QD1A 4MKVA 4HACA 2B56A 3CMAS 5KT7A 2B5JB 3HHDA 4OMFG 3M2UA 3M32B 3G6VA 3F41A 3OTEA 4PPZA 2OPQB 1R6VA 2QL5B 3JXOA 4YP3A 4DR2J 3F56A 1FO1A 5E41A 1JJHA 1UFKA 1A9NB 2LQ8A 1GXLA 4H4MA 4ED7A 2C2EA 2LQJA 1K1SA 2QYGA 3L7OA 5HANA 5K9FA 5J1EB 4DV4J 1S10A 3W7BA 4IO9Q 1KN6A 2XGPA 4LSLA 5LJ5Y 1R7IA 2OD6A 1FRLA 2YH0A 4QWBA 4EGLA 4DV3F 3PW0A 1HNZJ 4NYOA 3T1YJ 4JV2A 1X4GA 2E5IA 3OFGA 4OYZA 4E0DA 1FKAF 1Q1KA 2QFIA 2RHSB 3IC1A 2E1PA 1PYSB 2RD5C 3K59A 1ZTWA 3CJRA 4C8OA 3EX7B 2OTJS 3B4DA 3LAMA 4X4OA 5CABA 2QJ3A 4P7TA 2MKYA 4A8WA 2Y1IA 1HNIB 2YVSA 1TL5A 1GAOA 2CNNB 2CQ4A 1V3ZA 3RBZA 4CLKA 4O3QA 4GVLA 1AROP 3CJSA 5IWAF 2QLXA 2MTLA 3I4PA 4B3MJ 1ZM2A 2RNEA 1MU2A 1UW4A 1ZZFA 4HI1A 4CO2A 2DGWA 3DOLB 4CM0A 1N48A 1C4AA 1SCJB 5F0UA 3HZGA 3TANA 4KY3A 3ZZ0A 2B4PA 2OUGA 2V8VA 3ISNC 3R6GB 4M5LA 4DDFA 1WOOA 3GCWP 3V81B 2AJ0A 2CJQA 2X1GA 3C16B 3JTPA 3Q83A 2KFNA 2VODA 2FGCA 3SCKE 1DFDA 4ZPVR 4C48A 1M1HA 2GA7A 1JLBA 4ZJQA 5D3GB 4JI6F 4J9UE 1UWAA 1YRUA 4MYUA 2BJ3A 2GIRA 4WZMA 1F2HA 2ILZA 5HLFA 2FLPA 2V4JB 4NLGA 4FN5A 1QM9A 2BKPA 1R43A 2QO3A 2XWXA 5KT2A 2K7KA 4IDKA 5HN0A 3TAPA 4USTA 2E5LJ 4NLOA 1UEKA 3DLLQ 4Y2KA 2ZEJA 4Y3CA 4B3SJ 2DYAA 3KMSA 1WHWA 2LEPA 3MZIA 4DV6J 2AYBA 2W2MP 3OL6A 2L3MA 1KEKA 1FJCA 4L75A 4F7VA 2R8IA 3IG1B 4HHUA 2FIUA 2POKA 1RT4A 4PEOA 4TYAA 3IGVA 1ZM9A 2XMWA 2HWHA 3ZFVA 3G71S 1JXEA 1TK0A 1N5YA 1TUGB 2DPJA 1CJUB 3I87A 3LOUA 3MM6B 5ADZA 2VDIA 3HXMA 4USHA 3I0RB 4HYKA 2B4OA 2RB7A 3HFVA 1SL1A 1FTRA 4IH6A 1YG0A 4K4ZA 3NNAA 2CDRB 4BDPA 2HZCA 1CPZA 5HROA 1IR2A 4DUTA 3DRPB 2GZOA 2B8PA 5AT1B 1RABB 1O5JA 4K0KF 1NHVA 2PMWA 3JAMY 1QUVA 3OTBA 3MUMP 1IKWA 3ETOA 3LALA 1D1UA 2K8GA 1YJRA 4YR3A 3QIDA 2AF6A 2DY1A 5KFUA 2RQKA 4YB7A 3THTA 4FYWB 4ITSA 1ZS6A 2GVZB 2LEAA 4ZVQB 2B6AA 4J9QA 5A8WB 4X84A 2RQCA 2EPIA 3GONA 3OXGA 5JUMA 1HARA 4NXMF 1S6PA 4MKAA 2DEIA 2NS1B 3D1HA 5T7LB 4C3KA 1VQ5S 1N5YB 1D8YA 1FKPA 5CXTA 3L09A 5D78A 1PG5B 2ZWPA 1RACB 5H9EJ 1SJ4P 1SB6A 2XG8A 3V5RA 2DITA 5B08A 3MEEA 1OO0B 1JLCB 2R8JA 3U7JA 2EI5A 1PYTA 5I42B 3BBBA 3IM9A 3CULA 1TV6B 2CPZA 2K7JA 2ZH9A 2Z57B 1QTNB 2PE8A 4FBTA 2GGPA 4QOTA 4ALZA 2BRKA 2KHCA 3UCZP 1M5SA 2RE1A 2DD8S 2VKRA 3MCNA 3Q8PB 2HVEA 2DB1A 2UUWA 1X4DA 3ETMA 2DO4A 2JFDA 2HBZB 2A10A 2HVDA 4BHQA 4JI2J 3MMBB 3H40A 2YH1A 4QWCA 1VQ9S 4GKJJ 1FERA 2OLWA 3V4MA 1HI0P 3R27A 1EB0A 4C0BA 2XM3A 3CWJA 4OZ1A 3T3FA 2R7VA 2D41A 2CJKA 3KUHA 2Z4PA 2EEYA 3C6TB 2DBBA 4OJ3A 4U67Q 4FVMA 1JNZB 1S76D 1VIOA 2HAIA 1I94J 2ZOGA 1X4AA 1R8PA 4K2XA 2ASLA 1HQEA 3S1TA 2BJ1A 1WF1A 4DX5A 1ZETA 4F8RA 3DC2A 2AT1B 2WB4A 4LFAF 4DX8H 1R27B 4X2BA 3V6DB 1YJTA 1H98A 4H4KC 5KFHA 2GGPB 5LSLA 4LR9A 5KG4A 2HVHA 1FJ7A 1F0XA 3NAHA 2B51A 2UZAA 3CCJS 1S0VA 4UOCA 4OJGA 4DSFA 2BW7A 2E9TA 1JLEB 2CPHA 2RKIB 3VAMA 4IG0A 4DV7J 3DDKA 3NS5A 4NLYA 5HATA 4F4XA 2DRBA 2HURA 4O3NA 1UTAA 3NWGA 1KTVA 2B8QA 4OZJA 2Y1LB 4JI2F 3DXSX 2FJEB 4CT8A 5GADU 1MROB 3F0NA 5DG9A 1E6YB 7FD1A 4PCQA 4URQU 1VQPS 1VBZA 3QYYA 2MB0B 4C8MA 2YQ1A 3P6YC 3A8JA 4RBTA 4ZVHA 4NXNF 1FNXH 2BJ8A 2MKCA 4ETZA 3W2VA 4DV2F 2JLEA 4KBIA 4TXSA 3E01B 4OHXA 1AZSA 1TUVA 1IBLF 2O66A 2ZBPA 4C11B 1C1BB 2J0XA 5A8KA 5K8PA 4HL9A 1XMOF 2FJAB 5JXSA 1FX4A 4WFYA 1NK6A 2DH8A 1QSSA 3TUPA 3MECA 3TARA 1UZDA 2VG5A 2ZE2A 2AJFE 5KOXA 1F6TA 2G0CA 4PAAA 2H51B 5KT4A 2GMHA 4RW9A 2ZKUA 2HHPA 5BYSA 2E29A 2XMMA 4KGKA 2IVFB 3MGJA 2YPZA 3UR3C 2GVDB 3IXQA 3RAXA 2KI2A 3W60A 5DJBA 3M9MB 1FJEB 2LFVA 1XMOJ 3SMZA 2GJ2A 3D0GE 3W61A 3N4WA 8AT1B 2ZJPQ 2GIQA 4O0IA 5K8OA 1F60B 1NUEA 5IT4A 2DHXA 4TNOA 3W9HA 3PX0A 2Y0BB 3GYGA 1OY6A 1FNOA 3ZTOA 1UZHA 1RT7A 4ED8A 3NGKA 3O6QA 4UOHA 4X4QA 3GFXA 1I6JA 2HQFA 1TKTA 4G1PA 4DS5A 3E51A 2YNGA 1D9DA 1I51B 1W25A 5HJYA 4A8QA 1IKVA 1FF2A 3OPKA 5KFBA 1TL7B 2C2RA 2E7VA 3BSAA 2P9GA 1SUQA 1GXUA 2SXLA 4B9NA 3G4SS 3QRRA 4CTAA 3JYTB 2MZSA 5DDQC 1N36F 4DQIA 2DGXA 4L3KA 3G8QA 3Q2SC 3G6ES 4J9MA 4DR6J 2CPEA 2RDDA 4L73A 4USKA 4WJBA 4ZPWR 1WG5A 3O2IA 2QA2A 2QE5A 2QV6A 2LKZA 4IFVB 4LQ9A 3H5UA 1RWUA 3POTB 1BWVA 4JI4F 4OZNA 5F41A 4K59A 3SCLE 2DGVA 2RSQA 1U2CA 2R2RA 3J81U 1NRKA 4IG3A 1RAAB 1VOMA 3ELHA 1S1XB 1ZAXA 4AXJA 5I4MA 5E5NA 3MPYA 4UW2A 3IMQJ 3TJAA 1LW2B 4RL1A 4K4TA 1U48A 4FYVB 4OJHA 4OIXA 4CO1A 4ZITA 2WBRA 1HNXJ 3KK1A 2MZRA 2E1CA 1QJHA 3X1LB 3EZUA 4RUAA 1S6QB 3GJRB 2MKKA 1WC1A 1REVB 1SH3A 2WVEA 5CCMA 3F44A 3NLCA 4LBIA 2APOA 4NLUA 4C3MA 2EFOA 4QBUA 2NZCA 1FFSB 2LYVA 1HBNA 5RUBA 2L41A 3VAIA 4W90B 1GMVA 1CLFA 3LWMA 4IR1A 1V9OA 3MAAA 3R5GA 4C9DA 2B0GA 3Q8UA 3SCJE 4WTYA 1ULRA 5J2NA 1NJWA 2J9CA 4FDFA 3RAQA 1L5UA 1VHIA 5DZ6A 2Y3YA 1WTBA 4XDDA 2WONB 3GJTB 5IT0A 1W2BR 2WHOA 1VISA 2ZUAA 1EETA 4JI0J 3G82B 2XZTB 1LQ9A 1S4EA 3PM9A 4PWUA 2CG8A 3ENQA 3TNVA 2BJ7A 2G13A 1TL4A 1UJ6A 5KFIA 5K14B 1N34F 3B54A 5B09A 4RW4B 2AP6A 2DJWA 2QC3A 3L95X 5F3TA 2D69A 3R2DJ 3C15A 2FHMA 1FJGF 3NEKA 2CWKA 2ASJA 4DR7F 4KHPF 2V6AA 4EUVA 3QT5A 4ZIVA 3KKFA 1N4LA 4DL5A 3OVAA 1RT4B 1YWXA 4U7UK 2YNFB 2EFGA 3OD2A 4L6V3 2XY6A 2D3ZA 1L3SA 3AHPA 3BBCA 1U0SA 5L39A 1FXRA 4P74A 3QSIA 3OSPA 2ABYA 3DLEB 1WHYA 4YY3J 2KYXA 4F3QA 1UFLA 2WONA 2HQIA 4I1TA 3HO1A 5M2UA 3FEYB 3PYDA 4R5PB 1FXLA 2YWKA 4RW8A 4DOZA 4ZJOA 4ZS6A 5D4NA 1JLQA 3MCOA 2WW4A 3DN9A 2KXHA 3G86A 4H4KA 4TU7A 3W2VB 1N0VC 4ECZA 5IQ6A 4LFCF 4N56A 1L3KA 5B7WA 2HHXA 1ELOA 3E8OA 3PEJA 3FVYA 3GP9A 2KJVA 4N8NA 2DXDA 5A8RA 2QLWA 5T7LA 1HYSB 3D67A 3QJJA 4ZOSA 3PDNA 1Q82T 4NLXA 1NAQA 3N28A 1U47A 1WEYA 3H20A 2AEJA 4DL7A 1VBYA 2IAJB 3DDNA 5D4PA 4RW9B 8RUCA 1SV5A 1K73T 4DV1F 1UA1A 3K8VA 4USWA 2HSEB 1NEEA 2EFVA 2V0NA 3GYXB 4GVBB 4LREA 1RAGB 4ED0A 3MPVA 3GFHA 1HBMB 3PHTA 1TK8A 4Y2AA 5EWGA 4B3SF 1HNWF 4I67A 3PEHA 1HI1A 4ETXA 2UXCJ 1VR6A 2ADBA 4XDCA 1FXDA 1U26A 1U8SA 3AA8A 3CSKA 1Y00A 2XWYA 3HHLA 5F9NA 3OJSA 1Y5LB 3KK3B 4EYIB 1DURA 1T9YA 3MPDA 3SDEA 3Q24A 4F4YA 1JK9B 1FE0A 3N5BA 2U1AA 5J2PA 3HVTA 3KHGA 2CJBA 2KKHA 3DRYA 3RRKA 4DR3J 3UCUP 2ZH6A 3LP0A 4DEZA 3LUYA 5KFZA 2A2CA 2EVZA 2W7AA 3HFZB 2WOMB 3VZHA 5LXYA 4NCGA 5KFTA 4RNNA 2JEGA 1CULB 2NLWA 1N5SA 3DLGA 4KH0B 4DG1B 2VFSA 3HT3A 2FDNA 4JI5J 2Y8WA 2XZWA 4KRWA 2LDYA 1EP4B 1M5HA 2DY9A 3D0IE 3CW2C 1OQ6A 2BKNA 1HBUA 1FA0A 2HFZA 1VQ7S 1ZOTA 1TAUA 1XNRJ 4DV6F 2NZ4A 1T94A 3D9BA 2QSFA 2HQGA 1U1MA 1MWZA 1SJQA 4YR0A 3CIMA 3MMAB 4KFBB 2BJ9A 4K5SA 3I31A 2LQ9A 3FQKA 2E9ZA 2ZVSA 2U2FA 2YKAA 1RBAA 5KFNA 1RWPB 2LQBA 1PIEA 2ZKTA 4MK9A 2VFTA 4LF9F 4KIAA 4LVNP 5I3UB 3R1LA 3CJTA 3DU5A 1FI4A 4DUZF 1IBKF 2OEMA 2IDEA 3KNAA 3BJYA 4CYUA 3KJVB 1JKHB 4C7QA 3KHHA 1LXNA 1XNQF 4TQSA 4UOGA 5KTQA 4LT6A 5KFJA 5C24A 5HP1B 2YWGA 1S0MA 4DR5F 4B3MF 4ZPTR 3H25A 4M5HA 1WC0A 2ZBQA 5HROB 5E3QA 1GFWB 3WC2A 5B0EA 3TUIC 3EPIA 4QPTA 4DS4A 2K1RB 5EDWA 2M0GB 2LU2A 2FVRA 3LPEA 1RQ0A 3MMAA 4KFBA 5KG2A 1IKWB 3OTDA 1DJ0A 5D0HA 4AQYF 2IMWP 3DLKB 3MWBA 1YQHA 4GC6A 3MUVP 1WG1A 1C1CB 1V5IB 4LSLB 4IG0B 5EUHA 5IOLA 4ZCMA 3J7YI 2AV5A 3FJ2A 4M5IA 2JX2A 4OHZA 2BQUA 4RR5A 3MPWA 3AXMA 2VA2A 1TL3A 3AB4B 1JNRB 2VFVA 5H9FJ 1U2FA 1IKXB 1QE1A 2BABA 1HWLA 2VD3A 2C42A 2VG7B 2ZITA 3GE9A 4ID5B 4KO0A 3VTIA 1RK8A 1UEVA 4MH8A 4WTOB 1BQMA 3M1VA 4I68A 2R3VA 2H54B 3G6XA 2DNPA 3MR6A 1NSKL 3KJQB 4ZP6A 5LSRA 4WCEQ 2PDAA 4O0NA 1MWQA 4F26A 2MEWA 3HP6A 2E1RA 4QR0A 4WP3A 2XC9A 3SI8A 4B3OB 3DU6A 4ZN3A 1VQMS 3T41A 5MAOA 4M5GA 4KQZA 2AJ4A 3AA9A 4MTPA 2PA8D 2FY1A 4QU6A 2FTRA 3UFCX 4A8FA 2ZJRQ 1FD2A 2F40A 1UJ5A 2ZE2B 1QAIA 4LF5J 2CVIA 3LF0A 3N6NA 4OJ1A 3THPA 2QA4G 3Q23A 3HHLC 4WXOA 2CNLB 1S1WA 2UV8G 1RCXB 4IH5A 3T1HJ 2NCKL 4IFYA 3S7RA 2IC3B 8ATCB 1FRMA 2V2VA 3PCOB 4KH1B 3QQCD 4CT9A 4DQRA 3BQ0A 3U27A 2EG1A 4Q7AA 2C3YA 1ITPA 1GMWA 3ZZYA 1KFDA 3TJ8A 2AGQA 2O01C 5HQMA 1IKXA 1QE1B 4M5DA 3A4TA 3QZ8A 3KLIA 2DRDA 3L9ZA 5C5JA 4LUBA 1AUDA 4ZLPA 1KVJA 4RNMA 5DQIA 3FBBA 1IR1A 2N7YA 1GK8A 1OY9A 4LR8A 4X4TA 2O3DA 2J9DE 3BGLA 4DV5J 1WNEA 2HBRB 2NXCA 3W5YA 5IV4A 3MM8A 3W9IA 4Y2CA 1IKYB 3KUGA 4BC7A 1T11A 4CO0A 3Q2TC 4KPYA 2HNZA 3ZO7A 4TQRA 1RADB 1NDKA 2GS8A 2MQMA 1KFSA 4EU0A 3NCQA 3PIOQ 3BO4A 4ELVA 2LA4A 1J5EJ 4NCBA 3NGDA 4IFYB 1RAHB 4FYDA 3HZEA 3CJKA 2DISA 3CC7S 2PI5A 3H7HB 2QIFA 2BX6A 4OI1A 1LFWA 3PJXA 3ZZUA 3TEGA 4OI0A 2I8EA 4GVBA 1LWEA 3MOZA 4I2QA 2F8EX 4DR1J 4Q0BA 2XY5A 3IFEA 2RMLA 4RX6A 2MXYA 5HO4A 4JI6J 3QWPA 2RU9A 4P2FA 4JV0A 2E5JA 2W2NP 4AUKA 5GAGI 4P7VA 2DR5A 1H2TZ 4DSLA 3H5XA 4M1KA 4TY8B 4LFBJ 4RWXA 5F8HA 1JMTA 1QLNA 3VWSA 3M30B 4E98A 5J2PB 3M9OB 3EVOA 1AA1B 2G1HA 1U6ZA 3Q8QB 2YX1A 3FCWA 4OI6A 1X9MA 1RP5A 4DR1F 1LKZA 4RNFA 2RQMA 1NXIA 1VRTB 3AQOA 3JQKA 5CQGA 3T9ZA 4DLGA 4P2MA 2VBWA 5KFEA 5LL6d 4Q2MA 1IWAA 1Z4UA 4USUA 1K8AT 4WE1B 1AFIA 4PYAA 2DNKA 4CLPA 4Y65A 1TV6A 2XCAA 3L4BC 5G0RB 2QMUB 4FXDA 3K5MA 4DFPA 2LCWA 2MKIA 3CJKB 3HSZA 4LF2A 5K5MA 3UQSA 5BR8J 3MUTP 3HM9A 4QU7A 2AEMA 3I5BA 2QRRA 3KWMA 1YDLA 3OJUA 5CCLA 1VK8A 3QIPB 3AJ1A 3CXCR 4AL6A 5D6GA 3CCWA 3GIJA 1X8DA 4IO1A 2XLIA 2R7RA 2AYEA 1S7HA 1B0PA 2H65B 4NMLA 4R0JA 4CLSA 4MK8A 3CDUA 1LWXA 3EJMA 3HLUA 2BW2A 4IOCQ 1RTJA 1UW9A 3QFWA 4DQSA 2CQDA 1JLAB 3CTRA 3IR5B 4YMEA 1LWCA 1K0VA 3ZZPA 1T9UA 4ZMMA 1NPRA 1S48A 5ETLA 4Q8FA 1EHWA 2ROGA 4LR7A 4OI4A 2CQ2A 3FSYA 1KD1T 1VLYA 1UCNA 4USMA 4J37A 4ID8A 1DLOB 2VPZB 3PACA 1HQ2A 3V6DA 3DMJB 2E1AA 1IM4A 3FZ2A 1NJXA 4FF1A 1B7FA 1IBMJ 2G2OA 1TU0B 2AX0A 3JTNA 2F9JA 3LP1A 4O4GA 1WF0A 2I6WA 3GV5B 3W1YC 4ED1A 1RGVA 4A8SA 3PYEA 2EK1A 3KLVA 2HHSA 4DV0J 3I96A 5IT9U 3F73A 2MPUA 1HD0A 1RT6B 2FHJA 2YKNA 3HDSA 1ACMB 1BQNB 1NDPA 1HWIA 3NP5A 2CQ0A 2XYGB 2Z2LA 2GV1A 2LXUA 1FRXA 2HGNA 2MKJA 3PRBA 2XGQA 1QAYA 4DPTA 1RSCA 1S1XA 3AB2B 5D77A 3CCLS 4PUOA 2HFUA 1T02A 1Q81T 3MM9B 2G4BA 4N8OA 1O0PA 2M4MA 2V2KA 4UZCA 2DR6A 1QVGR 2CPXA 4ZHRB 1HNIA 3HJVA 2QT7A 1REVA 3U1MA 5L1KA 2KDOA 3NGRA 3BKUA 4ANEA 5CD4A 2WSEC 3SEOA 4C11A 2EFNA 3GFYA 5HMYA 5K8NA 4CO5A 2LECA 2DR7A 4QR1A 3OTOF 1HYSA 3BDEA 2F4VF 4DQQA 1VC0A 1PYOB 4JV1A 1KHVA 1OMSA 2V94A 1OY8A 1KC8T 4DSJA 3QSYB 1CEZA 4URSA 2W9CA 1NKBA 4OZ3A 1X31C 2Q66A 4F50A 4NXMJ 1IQZA 2M88A 2NREA 1N36J 3UI3A 1H7WA 3MR2A 2R7UA 4JI8J 4DWIA 2DGOA 2E7XA 2P8IA 2CIMA 4P9SA 3GU0A 1NB7A 1R0CB 2BJDA 2H5IB 2Q6BA 4O3PA 2RUGA 4KHPJ 2HS4A 3CPWR 3ENVA 2D74B 3CE8A 3Q89A 1EARA 2W9AA 4RO0A 2MQLA 3GIIA 1CJVB 2MGZB 3B6BA 2V8DA 2CPFA 2HRUA 1HHSA 4F67A 4OV1A 3NXZA 2ERRA 1WHVA 6FD1A 3KMQA 3TAMA 5B0DA 4X4RA 1RAOA 5H9EK 1YJ7A 4GKKJ 3P8BB 3EGZA 3I9V9 3LP2B 2RU3A 1NZ8A 2JDJA 2HMIB 3H4DA 3SSQA 1MWYA 1HHTP 2YY3A 2XSJA 3KLFB 1S57A 3I55S 3BQ2A 4ZDNA 3CJ8A 2GQCA 2DXFA 1H72C 3KLHB 3OT9A 3NNHA 5L38A 4JV5F 4WIIA 2AJQA 2F4FA 1VJQA 2PFDA 4GKKF 1GTHA 3AXKA 2IA0A 3BN7A 1VC5A 2YPYA 4TLRA 1K0TA 4DL2A 1T9VA 1YGYA 2RHQB 2WVBA 5FIIA 4JI5F 1RA7A 3AJDA 3CD0A 4A8OA 4FXVA 4ZVTB 2CQHA 1EQMA 1F9EB 3DLBA 2DRAA 1OPIA 2PMHA 3PIPQ 4I2PB 4NWBA 3SSSA 3UDEA 2C1EB 2RDJA 3SV4A 1XR6A 2ZOMA 3EGNA 4PABA 3OFFA 4CH7A 5KFDA 4CNYA 4WFBQ 4N5SA 1X0FA 2L9NA 4C8YA 2MZ1A 2DGUA 4U7CA 3TX0A 3V6KA 2VKZG 5C25B 1HBOA 4FXWA 5FDLA 3BN4A 1HIYA 3EVWA 1CJTA 1FE4A 1UWBA 1S6QA 3LA0A 3TO8A 5LT5A 4X66J 2BDPA 4V19X 3GV8B 2QL7B 4NYZA 4C2MA 2QLFB 2MSSA 1NKCA 2B43A 3RRGA 4RPFA 1S0OA 1YJUA 1QSLA 2XB2D 1RTZA 2J7KA 2DCLA 3SYZA 2MLYA 3DOKB 2J0QD 2CFXA 1QDUB 1SQEA 5J2NB 1QTMA 4HHJA 4F04B 2YBVA 4KKOA 4B9UA 3PW2A 4P2SA 2VFUA 2GNKA 3EXYA 3QIPA 5KFSA 1U4BA 3B82A 1N33F 3HHNB 3CO0P 1S1WB 1F2GA 2V9WA 2IHR1 2XMVA 2DEJA 2LVWA 4I2PA 4RKUC 2IM1A 2OH2A 4EZ6A 1KQFB 1VBKA 3T1AA 4DQPA 4ZCIA 1BMQB 3CCMS 1FRIA 1RT5A 3BO3A 4FS1A 4JYAJ 4O3RA 5BR8F 5F8IA 4CWBA 2A6OA 5K14A 4WYLA 2ZFHA 4O3OA 2H5JB 1LNQA 1A7GE 5SUHA 3GIKA 4RW7A 2YWHA 2OSRA 2GC8A 2CDQA 1IBMF 1HPZA 2C2MB 5HK4A 1FVSA 3QFHA 2DCUB 5DQGA 3K58A 4ZLJA 2Z2YB 2FVSA 2NXUA 5D4OA 3E3XA 2O1PA 5CZXA 3RR8A 3BS9A 5A76A 2GHVC 3DOKA 2MSTA 3GCXP 3JB9k 2V2QA 1HNVA 4X64F 4RUBA 1VQOS 3MURP 2LQ5A 4RNOA 2VPYB 1RTDA 1OIAA 1Y3JA 1X5PA 3DLEA 3LGHA 1T7PA 4MKYA 3D54A 5KAKA 4DUZJ 1IBKJ 2H1YA 2VJUA 1S1TA 3WX8A 2OI2A 2IRXA 3M8PA 2M3DA 2VC1A 2OAUA 3G82A 2HBYB 3DFEA 3R5CA 2CPIA 4X65J 5IM0B 4LF6F 3M9NB 3M2RB 2R8HA 4BWMA 1WSVA 1KKHA 4I64A 4HVZA 4QIVA 1NDLA 2ZH7A 4LF7J 3GJSB 5MLCV 3K0JA 3U1NA 4K4YA 3TUZC 4P6QA 1PKUA 1UJ4A 2UV8A 3SCIE 3X3UA 3IS9B 1E6YA 2D7SA 2CQPA 4KGZB 4C6AA 5L46A 1JJ4A 2FLLA 2WTFA 4UZBA 3BREA 2IM0A 1RA6A 1RLCL 3GLJA 4DL4A 1SKRA 1PBUA 2FJXA 1PAUB 1RT7B 2MLXA 1RWKB 2BVZA 4X65F 1M5KC 4DV7F 1VQYA 3E01A 4F0MA 2Q43A 3GIRA 3TVKA 4HR2A 4OYAA 1HFEL 1NMEB 2EG2A 3EGWB 1JLFA 2HIQA 2ZM6F 4ZP8A 4ES2A 4X4NA 4C97A 2GO9A 1FK9A 4WP9A 1TKZA 1U1KA 3N6MA 2B4VA 4KV8A 4CTAB 3JYTA 3FMBA 1MNEA 5ETQA 5AXKA 9RUBA 2A0FB 4BS2A 3CO9A 3MEDA 3UW1A 4L76A 2ZHBA 2HNYA 4DV3J 3CB4A 4HDHA 1U45A 2N7CA 4YR2A 2GO8A 4F4WA 3ZZOA 4ILRA 2F4VJ 5GVQA 4RU9A 1ZM4A 1VRQC 4P72A 3POTA 1HQUA 1VRUB 3FEZA 1S4FA 1TL1A 1LXJA 3MF5A 1FRHA 1FX2A 3N79A 3NGUA 3TWZA 4KGXB 5HSPA 5L9XA 1JWWA 2EKNA 4R8UA 2ROEA 2FGOA 3QAEA 4M95A 4ED5A 1FWPA 3PJWA 5DRKA 2CJ9A 4ZPCA 3UN3A 1Y3KA 5LMNF 3M30A 1T9XA 1PAEX 3KUEA 3MTJA 2W9BA 4ZLNA 1P9YA 1SH0A 1U02A 2XMKA 3C6UB 4OZ0A 1PBAA 1HQEB 4DL3A 1RAJA 1ZPWX 1UVIA 4ILMA 1WC3A 2I1RA 5F9LA 1CQMA 2DKOB 3MAHA 1TELA 4EI2A 4KHMA 2LLZA 4U8YA 1NB2A 3IWNC 3NRBA 3G8TA 1N5VA 6AT1B 1WWHA 1PJ7A 2P2CB 2ACMA 2O67A 4FF4A 2N4CA 4X62F 1KRPA 1B4SA 5HVFA 5DLGA 3TEHB 3PKYA 2MMYA 5ETOA 1RWXB 4OYOA 3HD1A 3FNNA 5M2RA 2KJWA 2KRRA 2E66A 3TZWA 3ONQA 3TZYA 5A8WA 3P5TL 2J6UA 1V5VA 2HHHJ 2WBMA 4JI7F 3Q8SB 2JJ4D 3IWLA 4TKTA 2R8KA 1MROA 2H48B 4ZCLA 4CYUB 3KJVA 2Y9HA 4I4BA 1PC4A 3IR7B 3W8PA 1JLAA 1KLMA 1IM6A 1KS2A 3DRRB 2DNYA 2VQFJ 1NK0A 2R7OA 4MYTA 1WI6A 4DG1A 1U8WA 1DTQA 1X5TA 1X5SA 1BQXA 2X51A 1EP4A 4OZLA 4PG4A 1T05B 1HD1A 3CJ2A 1SKUB 4PPDA 2B5JA 5DQHA 2DHGA 4Z2XA 2DNZA 2QG9B 2VFRA 1U1RA 3J81j 1NLKL 2CUYA 3QLHB 3UD5A 3W2WB 2EBGA 3J7ZT 1QSYA 1N52B 4F4KA 5DDOC 3O3LA 3GZ7A 1IUJA 2ZBCA 3TVZA 2CQIA 3O44A 4DL0C 2RUSA 3M8WA 4XO0A 4FYYB 3R2CJ 3MXHP 5J2MA 2QTWA 1BY9A 3K8WA 3DNCA 3LW5C 1Q5VA 2F1FA 5FD1A 3PR5B 1FRKA 4ES1A 2W7PA 4F36A 1U1OA 1WEZA 3NKYA 3SFGA 3IWXA 4C4WA 1K47A 3DLJA 4NRUA 3WIUA 3DYAA 4J91A 1S99A 1WOPA 1HWUA 1IN0A 4LF9J 1NJYA 4KT0C 5E2QA 3M6WA 2YKPA 4M63A 3ZC4A 4B08A 5AE2A 1CVJA 2W7OA 4IR9A 1RI7A 1YVFA 1WI8A 1BWEA 1YK9A 1AB8A 2C3UA 2FVCA 2PD1A 1S1VA 4DCJB 5K20B 4X62J 2CG4A 2G2ZA 3WIVA 3FBEA 4QPXA 2D3OR 4WU2A 1FESA 3I32A 3A8IA 3FFIB 3MOJB 4U9RA 2VONA 1KQGB 3QT6A 1A6LA 4FF3A 2W2PP 2AJ2A 5CYQA 4BCAA 3VHQA 4TLQA 4LF8J 3DLKA 1TP7A 3CJQA 3QWUA 4B17A 3NMAA 3EVMA 3JAMU 2GMLA 2VOPA 2YXLA 3GIMA 5IM0A 2P9EA 4PUOB 5HLFB 4EBDA 1Q16B 3T6JA 4NYPA 2XBPA 1WD6A 3T1HF 1LFPA 1SBRA 2DNNA 4QZVB 5DDRC 1EKRA 4MAKA 4TN2A 2M9KA 4ED6A 2ALYB 2LXFA 1RDRA 2M5YA 4NRTA 3BR9A 5DM6Q 1OYEA 3CIZA 4MKBA 2IY5B 1SC1B 1QUPA 1RZMA 4FYXB 3KG4A 3D4JA 1ZPVA 4ILLA 2LDIA 2UUCF 2P9CA 2XS7A 2YKQA 1M5OC 3ZNUA 4QW9A 3ZZTA 1A0OB 3H5YA 2IDLA 4HHHA 3JSRA 4ECVA 1EJ7L 2CNKB 1KVKA 2M8HA 3LH2S 1H2VZ 5HQ8A 1TFYA 4W4MA 2HRTA 4PQAA 3P96A 2YWWA 4ANCA 3P4UB 3EZOA 5C42A 2B9WA 3JSMA 1T3NA 1FVQA 3D6MB 3P49B 1Q4RA 3CCES 1AFJA 3D1QA 5DM7Q 1J27A 2AZ3A 3R7SB 1HNWJ 3CGIA 1BC6A 1N0UA 3G9CA 3QJPA 3KHLA 4QR2A 1NPPA 2N4DA 2WB1D 4G6VB 3CCUS 3CC4S 4UY8T 3GG0A 1NH8A 2VG6B 2BACA 4JOUA 4PKDB 1DTTB 1WDTA 3BB5A 1TKTB 4ZLLA 3V4IA 1N56A 3BGOP 1LWFA 1RTHB 2CKWA 2AMCB 1U25A 2GHWA 3W63A 2NPFA 4ES3A 4U7UD 2D1CA 2W9BB 1RBOB 2RAQA 3MECB 4J9PA 3ZZRA 2WK4A 4JBCA 1GMUA 3AQPA 2B9YA 3K5NA 1NDCA 5G0RA 5IZHA 3J7YU 4DLEA 4M94A 3D6TB 4NZ0A 3J80U 3A1YG 3CMES 1P8GA 1HNVB 5I3QA 3ICLA 4NL5A 3R1HA 1XERA 2OPQA 2ALZA 1RXOB 1X4EA 3R5JB 4B3RJ 5HL7Q 3A12A 4H4MB 4MFBA 2HNDB 2AJ1A 1PJ6A 3GYNA 3I0SB 2HVZA 4WXWA 3US5A 3BO2A 5CYMA 4RUHA 3H2LA 1J5OB 1UEUA 3FKBA 3CUNA 2ZC3A 3M8QB 5F8GA 3TP2A 2FJBB 2HFNA 1LEOA 1TL3B 4OZ2A 4YEAA 1RU1A 2QA4S 2CQ1A 4IRKA 2J0SD 1UPMB 1W2IA 2JC0A 5IQQA 2PT0A 2VC0A 1T03B 5DLFA 5E3AA 2HHWA 5DGBA 3LO3A 5IC4B 3KK1B 3IBWA 2L9WA 4BLGA 1Z1ZA 3KNGA 2VOOA 2AEFA 3PJ9A 4CLYA 1TL7A 3I5CA 1HLWA 2PIIA 2AKWB 2DNGA 1XN9A
chains in the Genus database with same CATH topology
4DMZA 1HNXF 4OLOA 3MTKA 2IBKA 1MU2B 2J7UA 2XSFA 1URRA 3QJLA 2XMJA 3M2VB 3R5AA 3PW7A 1S79A 2CVEA 1VQ8S 3QLHA 1FD8A 3W2WA 5EN1A 3MMJA 3MR3A 2ZZMA 1HI8A 2AW0A 3PNIA 2LMIA 5HMZA 3PRDA 1R8CA 4AL5A 5KG6A 2KZMA 3M8QA 4X66F 3HK2A 2EW9A 2MHNA 3AH6A 1Q8LA 2IMOA 4K4WA 2CRLA 2Z0GA 4DN0A 1NKEA 5E3CA 1KQKA 2R2TA 4W92B 2CQCA 4QW8A 4M5DB 2GX8A 4ECRA 1R0AB 1DAXA 1MW7A 4Y00A 4J9LA 4DFMA 1DZ5A 4N47A 3TYTA 2IM2A 4DPOA 3NCRA 1D8ZA 5KOWA 1FCAA 6FDRA 1WHXA 2HLTA 2PN6A 1C1BA 2J7WA 5GAHI 2MQOA 4DHVA 4ZP9A 5GAGU 4NLDA 5KT5A 4DV5F 1S1VB 5G4DA 4O4GB 3OVSA 1B64A 1U6BA 3BGUA 2MY8A 5JVHQ 1X9SA 3I6PA 2HYIB 1R31A 1HBUB 4WZQA 3IGNA 4F3MA 3Q0AA 2FJWA 2Y0SD 2A3JA 1U24A 1RT3B 3GR1A 5SZTA 1VFJA 5A2QY 2K3KA 4OX7A 2ZH2A 4WYWA 4B9SA 1Q79A 1TZ0A 4PG8A 1JLQB 2UVUA 2KG1A 2ZD1B 2OO4A 2W4DA 3J81Y 4RW4A 3R3TA 4OHWA 3K5LA 2WW8A 3TAMB 1L3VA 1UAWA 1S9GA 5LSOA 3QPIA 3MM7B 3BGRA 2J6SA 1NH7A 2XS2A 1D3WA 1NO8A 1YBAA 5AXMA 1Q53A 3VQSA 1IKVB 2QMXA 4KGMA 3GG1A 2NQPA 3C6UA 3OR2A 1CC8A 3D2WA 2IYIA 2JOQA 3OFEA 2IAJA 3GILA 4DR2F 3K5PA 1Y5NB 3FDSA 4OLPA 1S1TB 1RT3A 4ZPDA 1N32F 3S6EA 4L72B 4X4VA 2OP5A 4Q2LA 2JVRA 2MGZA 2E1MC 3MMBA 2XCPA 1SI9A 4HH0A 2RRBA 1P1LA 2AGPA 2ZDPA 2V4RA 2ZNZA 1XWLA 3H59A 4QWDA 3RTVA 2KXNB 3LP2A 2G1DA 3J7A1 2VASA 1UKUA 3QGPA 5AXNA 3LP0B 2FUG9 3V4IB 2V9KA 1UA0A 3KTQA 2XSJB 3BDPA 4ECUA 2I9SA 4IUFA 5E33A 1IQTA 2GW8A 3OXFA 1VRTA 4NOHA 2VA3A 4IOAQ 1TVRA 2DH9A 3M6VA 2KYZA 1TK5A 2VQEF 5THWA 1K9MT 2OPPA 3HJFA 2OD4A 5LXRA 1S1UA 1GX6A 2N3LA 3MHYA 3MI7X 3PXGa 4NA3A 3VAKA 4A8XA 3T6BA 4HEA9 1XR5A 2BBEA 4EFAC 1H7XA 1HNZF 1SKWA 3KOAA 1HW8A 3M6UA 2RKIA 2EC0A 5J2MB 2R8GA 1TKXB 2HW3A 5E7OB 4HT5A 5J2QA 3BR8A 5ITHA 4Q43A 1BD6A 1UVJA 3CDBA 1RTJB 4CCHA 1HBOB 3OXLA 4O23A 3CD7A 2BM1A 5FDLB 1T03A 1N8RT 3P3DA 4A46A 3DYAB 4ZKAA 4CH0S 2C3PA 1JLGA 4TY9A 5EX0A 2XO7A 2Z8QA 3MM8B 1LW0A 3PVXA 3MR5A 2UVRA 1SIZA 4HTJA 2PFFB 1FT8A 2FD2A 1G2EA 2W9CB 2NSBA 4G1QA 4LJMA 5CYQB 1VI7A 1C1CA 1RT6A 3MEKA 4PXCA 2IVMA 1BQNA 3CD5A 1TAQA 3JTOA 2ZOFA 2KT3A 1UVNA 2OKQA 5KFGA 4FZVA 4PXBA 5J1PA 3H4BA 4OHYA 1FHTA 2AX1A 4KO0B 3DM2A 4WKYA 3BF4A 1KOOA 1R0AA 4N41A 3CD6S 3HHEA 4ICLB 3NBPB 2RT3A 2RRNA 3MM9A 2JLFA 5EWEA 4KTQA 3BSOA 3OW2R 5C24B 1DTTA 1Q86T 1L3TA 1TQLA 3OLAA 5KFLA 5F8JA 4CO3A 3DOLA 3MD3A 4ED2A 3DHWC 4PG7A 1OWXA 1M5PC 3KK2A 4NZ6A 3VQTA 3IRXA 3RYLA 4N76A 2C28A 2VH7A 1FDNA 2PGCA 4KJIA 1G7CB 2X1BA 4ECXA 1U49A 1JLBB 4HI2A 4L3NA 1CC7A 1X5OA 3WBZA 2Q6CA 2PC6A 1UFWA 1SIWB 2YQ3A 3SXLA 3JSMB 2LXIA 4PXEA 4PG6A 3I56S 5DG8A 1DQ9A 4MFBB 2W24A 3AY0A 1HQUB 5H1SV 4QWAA 5E0OA 5L1IA 4K4VA 4ZPAA 1VQ6S 2EK6A 4H4OB 5D8HB 1RKIA 3BSNA 4IRDA 1DBDA 3N5FA 1NJZA 2QA1A 3OL7A 3ITHA 5A6PA 3T19A 2E9RX 2FPHX 3TA2A 5F0WA 2JFKA 2H9ZA 1NNDA 2HWIA 2DGQA 1LWFB 2UUBF 4NCGB 4YB6A 4B3OA 4LSNB 5KFWA 1IKYA 1ZBTA 2YX7A 5IXUA 3L3CA 1JLFB 2RQ4A 1RYSA 4DSEA 2C22A 1FK9B 3I4HX 4G1IA 2DVIA 1R6YA 7FDRA 4QIGA 1XNRF 2B7BB 1X4CA 1HBNB 4RNHA 4CI0B 5EHHA 2JL9A 3OUYA 4WKRA 2BOPA 2VPXB 4Y2IA 2DGTA 1R8HA 5KG3A 1FKOB 3TW0A 1HMVB 5L9NA 3RB3A 4Q0BB 3D0HE 1U6FA 3V2UC 4ECWA 2PSZA 1XMBA 1RISA 1X0PA 2MJNA 2YNIA 1N6QB 4K5RA 4ZK7M 4TY8A 3HPOA 1MMDA 5KFFA 2OPRA 2B6AB 4TU9A 2IJFA 5A0YB 4OX6A 4EBCA 3FEXB 3EPGA 1JKHA 4RW6B 3T5LA 1KSPA 3RB0A 1HA1A 4ZVEA 4MJKA 3N9UC 2DGSA 2MDAA 3RBDA 3MCSA 5I42A 2KXFA 2QYCA 2MZTA 2CYYA 3D5MA 2HLUA 3IA0A 1M0SA 2BM0A 2C3OA 1VC6A 2RIJA 1NU4A 4B9MA 1R89A 1FKOA 4IQMA 4C0HA 1FEHA 2V5HG 2HGMA 2HVIA 2ZC4A 3UPFA 1RKJA 1WEXA 4RWWA 4Q45A 3HHKA 1OPZA 3L7PA 3OTCA 4O44A 4MIAA 4JI0F 4BC9A 3PKMA 3OFHA 4DBQA 5LMUF 2DH7A 3IR6B 2LEBA 2V8GA 4ZPBA 1VHFA 1S9EA 4C8NA 3FSIA 4CIOA 2QEXS 1BQMB 3IO1A 3M1VB 1S6UA 2MJUA 4G3IA 1RT1B 3ENWA 1VBXA 3IAM9 1K1QA 3ULHA 4OHVA 2K3IA 5HMXA 4XPCA 1OS5A 3M8SA 4NLQA 5HMWA 3KLGB 4LQ3A 4FS2A 2FVQA 2DIUA 3FFIA 3TX8A 2MQNA 5GAHU 2RS8A 5KG1A 3O5TB 3G96A 4M8LA 1RTDB 4E0DA 3V81A 4ZVFA 4DR6F 1J5EF 2UXCF 4ECQA 5K8MA 3CDWA 4GO5X 4AXIA 2HNYB 4O4RA 2R2SA 4N77A 4YDXA 4R0EA 2V4JA 4IDKB 4YUDA 2HHVA 4QQBA 4B3RF 4GMKA 3QO9A 2YKOA 4ICLA 4UQTA 1GTEA 3WZ0A 4DFKA 2JEFA 4R8UB 1DQ8A 1SL0A 3SDEB 1RT1A 1ROFA 1S9GB 3UE2A 2KFYA 1IJEB 3K57A 4ECSA 1AXQA 2FHOB 1UVMA 2RILA 2L48A 3GR0A 2NYIA 3KK2B 2F8MA 4XPEA 4OX8A 1YJVA 2VUGA 2DNHA 3CEDA 3M32A 2J8AA 3DLGB 5HBMB 2QZ8A 1TKZB 4X4UA 3CVKA 3HVWA 3R5BA 5F8NA 4U6PA 2KO1A 4OX9F 2XNRA 1LV5A 3MEDB 1OQ3A 3LWLA 2RS2A 4F3OA 3NL0A 2IJNA 4J9OA 2E7WA 3WX4A 1S9FA 1LK7A 2MHEA 1CG2A 4MMOA 4LIWA 1X4BA 3UD3P 2ROPA 3TAQA 2VL1A 4JI3F 4FVCA 3BM7A 1GXTA 4H4OA 3OR1B 5KFRA 3VAHA 1YHQS 1I1GA 2DNOA 4JYAF 3SQGB 2Y1RI 3PW4A 4WK3A 2HMIA 2R7QA 2HHUA 5A6WA 3OVBA 3GMGA 2VB6A 4FF2A 4K50A 2NPIA 4EZ9A 5I3PA 4ECTA 5GADI 2Z2MA 4DJBA 1KHWA 4MIWA 1GQEA 5JJBA 1YJ9S 3DHXA 2DR9A 2GQ2A 2IVYA 3CCTA 2XLKA 1VQSA 3OUYB 5FJ4A 3AAWB 1YRXA 4OL8A 3KFWX 2HPUA 2NSCA 3H8YA 2RJZA 1X9WA 3T5HA 3MMCB 2BQRA 3U1LA 4NLPA 3VR1A 1T3OA 2YNIB 1N6QA 1CQNA 1OSDA 3PO5A 4PWDA 2ZBIA 3HHLD 3OV7A 2HFOA 5DG7A 2IM3A 3HVTB 2VG7A 2ZH3A 3CCRS 1NJIT 4QYZJ 1XC9A 2CPYA 2J0WA 2MQQA 4I0WA 1N5QA 3NCPA 2KB2A 3OL8A 3AJ2A 2VZ9A 3HFKA 1H2UX 1C2PA 2ZNYA 3RB4A 4B9LA 2BE2B 3M2UB 1LW0B 2PA3A 3PV8A 1X4FA 1MMNA 3D1OA 1VQNS 3OHBA 2BR0A 4QWEA 1JLEA 5CH7B 1S6OA 1MMLA 4J9SA 1HW9A 2WRMA 2Q1LA 3LPYA 5CZVA 3THVA 1CSJA 4FBUA 3CJ5A 2R7TA 3VCDA 3C46A 2YWFA 2BJEA 4A48A 2RH3A 4LFBF 2YWEA 1VIXA 3NBPA 4ZHRA 5L8RC 1YJWS 2D3UA 2XMUA 1WG4A 3RR7A 3PHEA 2IA6A 1IR0A 2A2DA 2OPPB 4C8LA 1FTCA 2R4FA 4USIA 4NA1A 3U02A 2LA6A 2LU1A 5A8KB 2BA9A 2JWNA 3IRXB 2IRYA 4Y28C 2GFFA 1Y5IB 3LGMA 3TR5A 1SXLA 5EWFA 4A47A 3G8SA 3B8HA 4ATNA 2PMZD 3O8WA 2GQQA 2UUTA 1M1KT 1XEZA 3KLEA 2L08A 4RW8B 2AD9A 1UETA 4IFVA 3LAKA 2DPIA 2I0XA 4ZP7A 2COLA 5F8MA 5IFMA 1DRZA 4F2RA 3RW6A 1S49A 3LGNA 4YB5A 2JSXA 3CDEA 4RW7B 1B0VA 5F8LA 1U1PA 4FNHA 4RU2A 5L1LA 3CCZA 3DRXA 1Y0HA 1UMJA 3EZ5A 2UU9F 2KFZA 2BV3A 2D9PA 2BANB 1LW2A 3FQLA 2M52A 1Q8BA 3FMWA 4QIEA 3CF5Q 2YNGB 4A4JA 3OR2B 3C3LA 4RLEA 4MIBA 3KLHA 3FSXA 4C0OC 5HBMA 4BWJA 4DN9A 4CO4A 2ASYA 4KV8B 2DHSA 3FRYA 1PSDA 3T9NA 5KFMA 4Q5VA 2BYCA 3GSDA 2MY7A 3EUNA 1WF2A 3HX9A 4GO7X 4DL6A 4A8YA 4CZCA 3PFEA 3M2RA 3DXBA 4DV4F 4AE5A 1P6TA 2L9DA 4ERDA 5E3RA 2ZD1A 3HI9A 3C8YA 3HHLB 5KFVA 2I2YA 4J9KA 4OI2A 4F2SA 2JH3A 3SQGA 2EBEA 4URGA 2VV5A 1F9FA 2VG6A 2E5GA 5CYJA 2HGLA 1LK5A 2RDIA 2FB0A 3GFZA 3QGHA 4HLBA 1LWCB 4WFAQ 3CCQS 2OMOA 2FHKA 5KT3A 2HHTA 5B0BA 2VG5B 3UWTA 1JLCA 2AWZA 2PO4A 4Y6IA 3RBEA 3MAQA 3TA1A 3T5KA 3B78A 3GQCA 2MZQA 3KLGA 2DT9A 2YKMB 3LP1B 1VJWA 2DNRA 3N0VA 2PI5A 3BZQA 1U1LA 1RTIA 1V3SA 5KFKA 4IRCA 5DO2A 2F7VA 3MMCA 3OSNA 1G6BA 3I0SA 2KG0A 4QCLA 3TUJC 4QIFA 3RB6A 3HF5A 4R5PA 1O51A 1MSWD 3PR4A 5KFPA 2ASDA 3UR0A 3VAFA 3QMQA 2UXBF 1P9QC 3C6TA 5CHCB 4PQUA 1TKDA 3QO9B 5T41A 2AU0A 1QVFR 4OZ5A 1XTZA 1FKPB 3J7Z5 5BYQA 4KAIA 2KH9A 1Y9OA 5HP1A 5KFAA 3MFHA 1R8BA 1VS3A 4NA2A 3MEGB 4KSEB 3I9ZA 4Y34A 2N3OA 1SJ3P 5D4LA 4JUZA 4I6AA 4JI8F 3MFIA 4A8MP 5GAEI 2YNFA 2CQ3A 3W3SA 5AE3A 4K4SA 2P6TA 3VZIA 3MD1A 3GV7B 3OLBA 1KLNA 2KT5A 2ZHOA 2CQBA 4EYHB 3QZ7A 2E5HA 2V8HA 3PFOA 2J6TA 1S77D 5C42B 4IQXA 2HQ3A 4PXDA 1PC5A 4QJVA 5J1EA 1SL2A 2OJ3A 5IS2A 1NK8A 2BRLA 4AFFA 1Q78A 1Z2ZA 4I69A 1UVKA 2QMWA 2GMJA 3H98A 3IN5A 2YNHB 1KVIA 1QAJA 3TQ1A 2XNQA 5CD4H 1R8AA 3SV3A 4ID5A 2M70A 1N5TA 3HVAA 2HHQA 2M8DB 2DTJA 2EFPA 3N6LA 5AXLA 2QSWA 1DTQB 1YSJA 5U47A 2CJAA 3IG1A 1D9AA 3BQ1A 2RF2A 4C98A 3CJ0A 5B0AA 5KG0A 4DV0F 4CNZA 2P5VA 3PY8A 3HKZD 2BXJA 2P6SA 2OSQA 4NLWA 4Z37A 5KFCA 3V6JA 4I7FB 4A8KA 1PGZA 2BUNA 2ZH1A 2ZUGA 2DHAA 3UDLA 3ZZZA 3TA0A 1U1MA 3OHAA 2Q79A 2ZZNA 2V4QA 4NCAA 1FDDA 2GJIA 2IC3A 2E44A 1KTQA 1FDAA 2Q3PA 1NK5A 4JI1F 3PW5A 1QAXA 4D3HA 1ZYQA 2HNDA 2FC8A 4XIUA 4GC7A 1KOHA 3C66A 2ZH8A 1WTFA 3M4XA 4IKAA 2VBXA 4UUXA 3H5SA 2XS5A 3OR1A 3CCVS 4UQGA 2AYGA 2R9LA 4EEYA 2F9DA 2CPDA 1Q8IA 2K2PA 1U2RA 4OI1A 2C3MA 1S6PB 2M7SA 4X4PA 4KC5A 4OQJA 2BQ3A 1YI2S 1R3NA 4C8ZA 5M2PA 4LIRA 1UL3A 2HNZB 3KG0A 1YTYA 2NUUG 2B4UA 4I7FA 3PX4A 4C8KA 4AL7A 5KFQA 1JJ2R 2XULA 1JX4A 4UUWA 1N88A 3SFUA 1KQSR 2NR0A 3BSCA 3LANA 1U7LA 4NLSA 1GX5A 1ZM3A 3UDCA 1P27B 3DRPA 4EWTA 1Q7YT 1ZAVA 1VQ4S 4B3TF 3C2PA 4Q8EA 2X1FA 2MKHA 3S8SA 5EX3A 2KU7A 5DETA 5KFOA 2UVVA 2H5EA 2HWTA 5GAEU 3Q22A 1DQAA 5KG7A 2VBZA 1O8BA 2R7WA 1RTHA 4WU3A 4LF5F 1KLMB 3DRRA 1VQKS 5A8RB 3NNCA 4I56A 3KG1A 2ATLA 5F3ZA 5J1NA 1VQLS 3FRZA 5B0GA 1ZTTA 1T05A 2KT2A 3DLHA 1AW0A 1H3DA 2KM8B 1SJRA 2FLNA 1T8EA 3RW7A 4PG5A 2I38A 1KNZA 1Z2LA 4D3GA 2HS0A 1NK9A 2K1RA 2IBOA 1JB0C 1NHUA 2OFGX 3CT9A 3CC2S 3O1LA 1RTIB 2ZJQQ 2XHWA 4EBEA 1ZZNA 2JLGA 4IYQA 4DSKA 5D3GA 2W8KA 3M8PB 4DSIA