2JSXA

Solution structure of the e. coli tat proofreading chaperone protein napd
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity in twin-arginine signal peptide-binding proteins.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Chaperone
molecule keywords Protein napD
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03927 NapD NapD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jsxA01
2E7XA 2E1AA 2IA0A 2EFPA 2CFXA 2IVMA 2P6SA 2VBXA 2ZNYA 2DJWA 1RI7A 2EFOA 1I1GA 2EFQA 2DBBA 2VBYA 2ZBCA 2VC0A 2VBZA 2Z4PA 3I4PA 2E1CA 2PMHA 2W24A 2JSXA 2P5VA 2CG4A 4PCQA 2YX7A 2VC1A 2CYYA 2QZ8A 2VBWA 2YX4A 2EFNA 2CVIA 2PN6A 2P6TA 2ZNZA 2W25A 2GQQA 2E7WA
chains in the Genus database with same CATH superfamily
3E2EA 2W4CA 4MTPA 3D0IE 1RT7B 4FXVA 3V6DB 5SZTA 2CQBA 4ZP7A 1H98A 1WC0A 1XN9A 2DCUB 4DDFA 3TRGA 2W8LA 1RI7A 3AY0A 4ZIWA 3KDOA 4DL4A 4LFCF 2DITA 3D66A 1LW2B 3NBPA 5AE2A 4OX9J 3B54A 4OZ0A 2KRRA 1NJXA 3T6JA 3KLEB 2VHGA 4G3IA 4ZP9A 1NHVA 2VDIA 1WG1A 4OYAA 5E3CA 1GK8A 1VR6A 2JX2A 3MAAB 4H4MB 3MM8A 3RGIA 3R5CA 4Q45A 2AJ1A 2IBOA 1OMSA 3N5BA 4N8OA 1H3DA 1TL3A 2P8IA 2OLWA 2W9BA 2OEMA 2B43A 1NK7A 2DGSA 1D9AA 1Q8BA 5EDWA 2KZMA 1X8DA 4CDIA 2HRUA 2HAFA 4TU9A 1RWWB 3TP2A 1EARA 1H2UX 2VFTA 5I3PA 2BV3A 1SC1B 1OIAA 3MCOA 4LBHA 1S97A 3BBBA 1XNQF 5LSRA 1P8GA 2R42A 4BCAA 2ZC3A 1UVKA 6FD1A 3OV7A 4LF4F 3NGKA 1RE1B 2PO4A 3DRSA 1RKIA 2ROEA 3ELHA 2ILZA 4DV6J 2EI5A 3D3BJ 5F8IA 2B7BB 2J8SA 1Q82T 2FLLA 3NGSA 1Q4RA 4I0WA 3P6YC 2A2DA 4OYPA 3OL6A 2XHCA 1IR2A 4BDPA 3NCQA 5JVHQ 2WVFA 1S1WA 1XWLA 1HA1A 2ZBPA 4FKYA 4HHJA 2BQUA 1RWUA 2N3OA 4IR9A 1IQTA 2WSFC 3KHRA 4Q0BB 3HSDA 2OAUA 3VALA 2F8MA 2WVEA 2GVZB 3C16A 1Y5LB 5DM7Q 3FCWA 4QU7A 5ETVA 2AX0A 8AT1B 4YOEA 1JJCB 1M90T 1D09B 3AD7C 2DYAA 3R1LA 1FNXH 2R7VA 2HVIA 4KHMA 1HBOB 3KMQA 1RDRA 1T11A 3FRYA 1XNRF 1N0VC 4JI3F 2RD5C 3T3FA 1BUXA 2BANA 1T9XA 1QE1B 1MWYA 2F1FA 1Q1KA 5HK4A 2BJDA 3M9OB 4F4XA 2C2DA 2OJ3A 1WHXA 2AYGA 4F4KA 2E9RX 4Q43A 1FKPA 2AEJA 2V8DA 1LWFB 2ZD1A 2HFVA 3UVJA 3AH6A 2VOPA 3N0VA 3TWZA 2MKSA 5F9LA 1JKHB 3SXLA 3KG0A 1DLOA 3FBEA 5I4MA 1S59A 2QV6A 1EZZB 4NCAA 4PQUA 1QTNB 2Z58B 1OYEA 3GG0A 2OI2A 1I94J 1IKVA 2IM2A 3KLIB 4QWAA 4UZBA 4UQTA 1OSDA 1SV5B 4ES3A 5ETOA 1KDNA 4HHHA 4X4OA 2KB2A 5LMUJ 2ALZA 4NI2B 2GVDB 3THVA 1SIZA 4WXWA 5J1EB 1SC6A 1HD0A 1S9EA 3QWUA 3VV2B 2Y9HA 1KTQA 2W2MP 2YKMA 2YVSA 3BN7A 3KJVB 1OQ3A 2MY8A 2XMUA 4G1PA 2R7SA 2HNYB 5M2RA 3UW1A 2M4MA 4M5GA 5AJ3F 4H4MA 5E7OB 3K5MA 1JLQB 1TK8A 1FKPB 4NLXA 3I87A 1TMJA 3GB0A 1N6QA 2R2UA 2RILA 4NZ6A 2CQ2A 2YQ3A 5B7WA 4DZ6A 1FX4A 5HAOA 3BQ0A 4WKYA 1NPRA 2DNGA 1P27B 1CJVB 5M2UA 1FFSB 1BXNA 3IM9A 1DTTA 2KHDA 3M6VA 2XQCA 1QSYA 3C8YA 3W5XA 2ASJA 1IKVB 5DG9A 5K8NA 4OZ1A 3Q24A 2ZOGA 4ILRA 2W2OP 4LRDA 2DHAA 4DSEA 4HH0A 3TZZA 1WTBA 2R8KA 3G82A 4N77A 3OVBA 2QMUB 1RAEB 5KT2A 2NPIA 3EGVA 5L1KA 3EWGA 3QRQA 2E1MC 2BJ8A 3BBFA 3ENVA 2JEJA 2YH1A 3C15A 3ZZYA 4X62J 1RTDA 4DPUA 2W24A 2Q6BA 5J2PB 4M5HA 5HLFB 4DUZJ 4K4VA 2MQMA 1NSQA 3W61A 4CQ1A 3CCZA 3DXBA 3M8ZA 4B3OB 3NAIA 4CTAA 2I8EA 3SI8A 1RWMB 2QGFB 4ALZA 2VASA 1VK3A 4CYUA 5C24B 3MEGA 2R7TA 3EUNA 2IMWP 2EBGA 4M5JA 1ZOTA 4FVMA 3AJDA 2W01A 5DJBA 1T9UA 2VG5A 4N7TA 1F9FA 2OPPB 1Q5VA 1R6YA 2J7WA 2XWXA 2YWWA 1ZZFA 3MD3A 3GSDA 2A6MA 2IVMA 3P45B 5ETMA 2XWYA 1SJ4P 3UNGC 1VBKA 4WTOB 2R2TA 3PRVA 5K5MA 1X5TA 1C2PA 4JI8F 2Z2YB 1FA0A 2GZOA 2HSEB 3KG1A 4C0BA 2OH2A 4Y2AA 2GV1A 1WC5A 1U45A 3Q2SC 2DHHA 2AIRB 3D3CJ 2CIMA 2UU9F 3T1AA 3QGPA 3C3LA 2KT5A 1U49A 3M8QA 4DFJA 3RAXA 4DXLA 1QSSA 2P2CB 1HMVA 2X1GA 2OHDA 2CPJA 4PQUB 1EAYC 3IN5A 4QCLA 2F8EX 4NLSA 1U2FA 2PA8D 3NS6A 2CJBA 2I0XA 2JLEA 1I5OB 5D78A 1R0AA 4ILLA 3QO9A 3UWTA 3OUYA 2HFOA 2HZAA 3MEEB 5CXTA 4F50A 4BWJA 4CO1A 1U24A 4X66F 4R5PA 2KO1A 3GONA 3MMAB 2I5JB 5GAHU 4YP3A 2FLNA 1HWLA 3LPYA 4X64J 2D41A 4U6PA 2IVFB 1RCOB 2XZDB 4K59A 4DU8A 1S1TB 3TAPA 1U1KA 3PZPA 3V81B 2HNZB 2K7JA 4WU2A 3OSNA 2ZWOA 3M8PB 4CLKA 2F9JA 4WK1A 2HYIB 4WTYA 5I3UB 3D1OA 3U1LA 4ANEA 2CQ1A 3AOBA 1N6QB 1MNEA 2NCKL 2BX6A 1KLMA 1WNEA 4ZVGA 1KONA 4ZCKA 4DF4A 4JI2J 3I9V9 4BC9A 2MZQA 1N52B 1ZPWX 1TVRB 2ZBRA 3DC2A 4ID5A 4ZK7M 5L39A 3LWLA 3V6DA 2WAQD 3DMJB 3RBXA 1QUPA 4KT0C 2N7YA 1RT2B 2IM3A 3DGVA 4MFBA 3AXKA 3W65A 4M5LA 5MLCV 4O0IA 4TYBA 3RU0A 3HHEA 4NRTA 1HQ2A 4JI6F 1WORA 3IAS9 1R0BG 1R8BA 1U0HB 1Y9OA 3ILIA 4C3MA 4M63A 1ZA1B 3OL7A 3K58A 4EZ6A 3THPA 2FDNA 2WK4A 2RHSB 3RRKA 3KJFB 1HBMB 3L4BC 4W4MA 3X3UA 4JI0J 3TYTA 1L3VA 1XNRJ 4OHZA 2W9BB 1N54B 3GJTB 4JI0F 3BDEA 2LXUA 2HQGA 2ILYA 2DGXA 3FCHA 2BEFA 3DLGA 3M7VA 4RO0A 4DCJB 5KFFA 2CJKA 4V1Ak 2UVWA 1LWEB 5KFGA 4UY85 4K5RA 3DRYA 1RTHA 4ZVUB 3GQCA 3VZHA 1QLNA 4V19J 1M1HA 4EFAC 1GXLA 3FEZA 2IDEA 2D1CA 1HHSA 3D54A 3KHLA 1NO8A 3L7UA 3M2UB 1FE4A 2B4UA 1LW2A 3I9ZA 3S1TA 4I2PB 3R2DJ 1U47A 3G96A 2OMOA 3VZIA 2HHSA 4WF9Q 1NEEA 4WPAA 2F4FA 5G0RA 2HHXA 1VISA 2CFXA 1IKYB 1NK8A 1IWAA 2D7SA 3R5BA 3GFYA 3PIOQ 2E9ZA 2MQNA 5DG7A 2EFOA 2QG9B 3V4IA 1D8ZA 3Q0AA 2HNDA 1HR0J 4N76A 2B3TB 2OELA 4MKAA 1FWPA 2Z4PA 2AKWB 5HMXA 4P52A 4P73A 3R7NB 4ES2A 5DDRC 3RB4A 2CPYA 4PWDA 3W2WA 2LDIA 1RBLA 3LAKA 3NWRA 2HHHJ 1OS5A 3G4SS 1JB0C 1WSRA 2O01C 3DLGB 1CPZA 4EZ9A 2RT3A 4X66J 3RRHA 2G0IA 4GC7A 1FJ7A 1WKLA 3P5BP 1XERA 2MKJA 2R2RA 5B08A 2VKRA 1Q8IA 3KTQA 2DXEA 5C42B 1X0PA 1K0TA 4OYMA 1L3UA 1S49A 3H98A 4DU7A 5A8WB 1L3SA 1WD6A 3RB6A 3J7ZT 2J9EA 1B64A 3HDSA 2RF2B 4JI2F 2MLXA 4A46A 4PQAA 4Z37A 1NZAA 3OVSA 1EHWA 1TKXA 4ED3A 4URGA 2R4FA 3GCWP 2VICA 2KJVA 2NSCA 1WEZA 5KG7A 3HZGA 1NUEA 3BM7A 4JI5J 3CC7S 5F8JA 1WEXA 1NHKL 2DGVA 3ZXWA 3CJ4A 1QAXA 4ED4A 2XMMA 5FLXU 5KFZA 3K8VA 2LLZA 4DHVA 2Q1LA 1Y5IB 1F6TA 4LF8J 2BRLA 3R97A 3GV8B 3CCJS 1WC1A 4IUFA 4RLEA 4AD6A 2VZ9A 2EKYA 1SL1A 3N6NA 2VFUA 2PD1A 1JLAB 3HHLD 1U1PA 1UMJA 5EWGA 4NX9A 1JXEA 5ETLA 4RW7B 5D0EA 2PI4A 1SKRA 4F67A 4PUOB 2HBZB 4QYZK 4GC6A 1RISA 2ZH5A 1XMOJ 1EX8A 5D0HA 1UA0A 2MB0B 1AZSB 2BJ7A 4HDHA 4DR5J 4IRKA 2HMIA 5E0OA 2Z57B 1SVDA 4ZVTB 3AD9C 1HNVB 1VQMS 1RHUB 2MKYA 1R0CB 4AE5A 3FC9A 3N01A 3TOQA 4DL6A 1S9GB 1X9MA 1SKWA 1UEUA 4ZN3A 3CWJA 5HJXA 4YY3F 2NZ4A 1QDUB 3A12A 2MZ1A 4CZCA 4NE9C 1C1CA 2HRYA 1TK5A 3DU5A 1R89A 5F8NA 3FMWA 3GYGA 2OPSA 2Q43A 3MWBA 4B02A 3OFHA 1IBKF 4OX6A 2CQPA 1B7YB 1O0PA 3ET6A 3S7RA 1FVSA 2ABYA 4ED0A 3GWCA 1VBXA 2C28A 2R7XA 3D0HE 2OFGX 1O5JA 2ZOFA 2H5IB 4DN0A 4C3LA 4O4RA 1S1VB 2Y3YA 4QPXA 3DNCA 3VGUA 3PW7A 5KOWA 2CQCA 3MR7A 2EFQA 3A3PB 1NJYA 2C3MA 4DSLA 2Q66A 4NRUA 2NYHA 2RKIA 2V69A 3VTIA 3AD8C 1P6TA 2LP4A 3CJKA 2GC8A 4J5OA 4DR7J 3PNIA 3CJ8A 4USKA 3SCKE 1QM9A 3CD6S 3MF5A 3OXFA 2KFZA 1VHFA 2A1BA 3BGUA 1SL2A 5G4DA 3PEJA 2HBRB 4QPTA 4MAKA 4F4AA 1QJHA 2CWKA 2VPYB 1YJRA 2MQ8A 1RWPB 5GMDA 5BYRA 3UO0A 4YS2A 4ELUA 3K89A 4IKAA 3PX0A 3ILOA 1LQ9A 1VJWA 3ETOA 4RW4B 2EFPA 4EYHB 1JXVA 2QL7B 2V63A 3EVMA 3DHWC 1OY9A 1S5ZA 2VG7B 4Q5VA 2IA6A 1S7HA 4M95A 3MHYA 2XZTB 1CJTA 4JOUA 4C8ZA 1UVIA 1OO0B 4OI4A 5ETKA 1KNZA 1O8BA 3E51A 4OLOA 4A8OA 3D2WA 4FF1A 2PIIA 4OX8A 3N28A 1NDKA 4WE1A 3SDEA 4HL9A 2RSQA 3CCSS 2RAQA 2MEWA 1B4SA 1VYAA 2C2KB 2ZE2B 3F0NA 4FVCA 3UR3C 4R5PB 3GJRB 2ZDPA 5ETQA 2EFNA 4FDFA 2PSZA 4QR2A 3QGIA 1FTRA 2Z2LA 3KDNA 4AXJA 1T03B 3QT8A 2CRLA 1RTZA 4ICLB 3G6XA 2D9PA 3MM6A 3FBBA 2FJBB 1UL3A 5D0GA 1GAOA 5HBMB 3QIDA 1XIQA 4O23A 5KFAA 2ZDOA 1VQ6S 3HXMA 3JQMA 3E01B 5L38A 2AYMA 1U26A 4OZ3A 3RBEA 1N33F 2CNNB 4N8NA 2KXNB 3RR8A 3HK2A 5GMKa 3G71S 3J7YI 2HAIA 2BUNA 2PC6A 2Z30B 2DNKA 3OHBA 4J9NA 3CDWA 3I4PA 3WX8A 3LH2S 4NLWA 2OUGA 5KFQA 2QIFA 4N56A 4YR3A 1LV5A 1OY8A 1Q78A 5T41A 3R1HA 3MXHP 2DNRA 1HW8A 4USTA 4NEYA 4ER8A 3OTBA 3R5DA 7FDRA 5DG8A 1QUVA 2J8AA 3EVOA 4WZQA 5FJ4A 4ZPDA 2BOAA 4Z7YA 3KLIA 4DV1F 3I6PA 3FSIA 4PYDA 2AP6A 2QN6B 2PMWA 3ITHB 2CKWA 2L9NA 4IFVB 3TAMA 1YIJS 5D6GA 2HFUA 4LF2A 1IXKA 1CJKA 2B8PA 2O67A 3MM5B 3PJWA 3SIPB 3AOAA 4ZPVR 2YXLA 3VVUA 4BLGA 3T5LA 1F3FA 4IG0A 3T1YJ 3G2XA 1XMBA 2NQPA 4L6V3 2ZEJA 1NB2A 2EFGA 4UUXA 5F3TA 1RJJA 2FUG9 2JNJA 3WC0A 4ZCMA 3MFHA 1SUQA 3RJMB 3VAKA 4J9QA 4IDKB 5K8OA 2FHKA 4CNYA 1NJWA 2XTJP 1C0TB 3KYLA 1FKAF 4DG1B 4RW8B 2DK2A 3D1QA 3QLHA 3GTYX 1GMWA 1LWEA 2CZVC 3R5JB 5KFPA 2WTFA 1NKCA 4IH6A 1YBTA 3AQOA 4ZVSB 4C11B 5IWAJ 1VQLS 4ZHRB 2XMKA 2XCPA 2RQMA 2UU9J 2BXJA 3HVTB 3OFFA 3NY0A 5A6PA 5HP1B 2KZZA 2DVIA 2KFYA 2AF6A 4TYAA 5G0RB 1MMNA 4OHWA 1UPMB 2EBEA 2YPYA 1JIHA 2EG2A 3TAMB 5CD4A 3WC2A 3HLUA 3NP5A 4OMFG 4TLQA 2QSFA 3ILJA 4M94A 2HIYA 4K4ZA 4DQSA 5D3GB 4C8MA 4NASA 2BDPA 3EPGA 3RZAA 1GMWD 3SCJE 4WE1B 2XLIA 2MLYA 2QA1A 2HS4A 2VONA 2VODA 3W2WB 2E5JA 2MTLA 5AE1A 3Q8UA 4DG1A 4YUDA 1I6JA 4I2QA 1S0MA 1WELA 1S6PA 1RWXB 3C19A 4CTAB 2KYXA 3AJ2A 3DI6A 3FRZA 2VIHA 4ED8A 3MMBB 2B7CB 2G1DA 4ZHRA 3M2RA 5EX0A 4JI1F 3I5BA 4CO3A 6FDRA 1Q8KA 1N48A 1YG0A 3LF0A 4HLBA 4R25A 2E7WA 1S7IA 4DCPB 4DR3J 1YJVA 2MSTA 1RA7A 5MAOA 4PYAA 1VQSA 4WWSA 1KC8T 1QAJA 1JNZB 1H6KX 3PM9A 3JYTA 1JXLA 4B17A 1G6BA 1G2EA 1RTJB 1RSCA 3LGMA 5HMYA 5T14A 1RHRB 4DV3J 2DR8A 1W26A 2KU7A 4RW6A 5D3GA 3HO1A 1FXLA 4L72B 2E5HA 3I55S 1NDCA 3T5JA 4NLRA 2KKHA 3ZZRA 2ZH1A 4P75A 1K1QA 1DBDA 2EVZA 2QE5A 2ZKTA 2DH7A 3H2UB 5A8RB 3KNAA 4IOBA 5FDLB 1IKXA 4UW2A 3OTCA 1SXLA 1FRLA 1FRHA 1PIEA 4U9RA 1HNXJ 1C0UB 2ZC4A 4B9MA 3A4TA 5LSOA 4KC5A 1VBZA 3QRRA 4CLSA 2HGNA 2MYFA 1FT8A 4PRFA 3Q8SB 2RRNA 4U7UK 5F41A 4ED1A 3D6FB 5J1NA 3PO4A 5LXRA 1MMLA 2HG4A 3FEXB 3WZ0A 1N8RT 2HZVA 2R7RA 4O3RA 1VQ4S 1SUQB 1GH8A 4IO1A 3VVTA 4B3MJ 5DZ7A 3KLVA 1P9YA 1Y7PA 4DV2J 3TARA 4J9UE 1YQHA 4F3OA 3SQGA 3UDVA 4FBTA 2KI2A 4B3MF 2NLWA 1EB0A 4DR2F 2DY1A 2NXNA 3HVRA 2F5GA 3QFWA 2NUUG 4WU3A 3RRGA 2MZJA 3AB4B 4LF6F 1QVGR 3UDEA 3W5YA 4ZLJA 1CC7A 3M2VB 2HKEA 2LA6A 3RUBL 2CPZA 2MQLA 4KTQA 4Z2XA 3R7SB 2DRDA 2DCLA 2MY7A 3SBMA 5KFTA 4ECSA 5KT4A 4ZVPB 3V6JA 2C3YA 3HFZB 3V2UC 2RMLA 2Z2MA 3NG8A 2GHVC 2O5DA 2V50A 3MM8B 1SL0A 2GA7A 1JJHA 3DOKB 3GU0A 4KB7A 4W98A 3HVAA 3ETMA 3W5ZA 2FLPA 3HHNB 4OL8A 2OPSB 2VJVA 4J9RA 4W90B 3NCPA 1FNOA 4PXBA 2GVZA 3C16B 2CWXA 3MEDA 2FY8A 3KK1A 3D4JA 1S6PB 1CQNA 1U09A 5T7LB 2D3O1 1UZDA 3BSCA 4U7CA 2WOMA 4F3MA 3KK3B 2IC3A 2WVBA 1VGYA 1AUDA 4H4OB 2ZM6F 1PO6A 1TUVA 2BM0A 2Y1RI 3QZ8A 4RUBA 4B9TA 5H1SV 1S9EB 2G4BA 2XI3A 3UD3P 2DGWA 2RVJA 2G2OA 3M6UA 2Y8YA 2ZH6A 1PYOB 3LTOA 3IA0A 2BZ2A 4FXWA 5E3RA 5HVHA 2AJ2A 2PEHA 2AJ0A 2P9GA 2ZUAA 2DHGA 2F8HA 4ZVEA 5CD4H 4IR1A 5LXYA 1ZZNA 3GIKA 1HFEL 3BO3A 1CJUA 4R0JA 2ACMA 5L1JA 4URSA 3NMRA 3LP1B 3G6ES 4LF7J 5GAEU 2C1EB 1H0HB 3FZ2A 3ULHA 4NMXA 1BQXA 1F60B 2H51B 1WUUA 3F56A 3I4HX 4PWDB 2AJQA 3J80Y 1N0UA 2F3JA 3MM6B 4X4VA 5DGBA 2X1AA 5J2MA 1VQYA 1UAWA 1X4GA 4HACA 4MIBA 1TKDA 3CD7A 1QVFR 4YB1P 4A8KA 4QU6A 2QZ8A 3L95X 5ETNA 3BGFA 3CEDA 3PW5A 2QA4G 4A47A 1IJFB 2N7CA 2CPEA 2W9CB 4JI8J 4H4KC 4FPRA 4K2JA 2E1RA 4YDXA 1YKWA 2VU5A 4I7FA 4ZIVA 2HLTA 1OYDA 1CSJA 3ZNUA 4DFMA 2E7XA 2KG0A 1CC8A 5K14B 3VGVA 4F4WA 5K8PA 4O4GB 2I38A 3W2VA 3HSJA 3H2LA 1TL7A 3O8WA 1WDDA 4RL1A 2HBYB 3EZ5A 4NZ0A 3V4MA 3MPDA 3AXMA 4ES1A 4I1TA 3TUPA 5KFEA 2YNHA 2KDOA 4PXEA 1RADB 4DUZF 1JX4A 3BQ1A 1JJ4A 3QO9B 1D9DA 2FVPA 4CH0S 4OI3A 1RHJB 3PACA 3QNWB 4GMKA 4ZKAA 1RYSA 1PYSB 5H9EK 4CLLA 4IFYA 3CF5Q 1JLGB 1RZMA 3UE2A 4ZLNA 1KFSA 2FGCA 2H48B 1KRPA 5CZXA 2CPDA 1WC3A 4DQPA 4QBUA 3PFOA 2AD9A 3CJ0A 3QZ7A 4K5SA 4QZVB 3Q8PB 3GIIA 1BWEA 3I5AA 4NOHA 3MUMP 4B9SA 3CC4S 1OJ4A 2CPHA 4DV0F 5GADI 3BR9A 1YX2A 5L8RC 4QIWD 3DRXA 3CCQS 2E5IA 2J76E 1GTHA 5CH7B 1J5EF 4ILMA 1R0AB 2VG5B 1N34J 3K8WA 3C6UA 3M32B 3BO4A 2AZ1A 3OLBA 5LJ5Y 4F2SA 2HRTA 3K5OA 4Y65A 1HNXF 1T7PA 3ZTQA 1F2GA 2HQ3A 3D0GE 1MN9A 1WACA 3PYEA 4IYQA 3R8YA 5BYSA 5DDPC 2F63A 2CJYB 3HVTA 1PGZA 4ETZA 2JFKA 1AT1B 1ICEB 4HKQA 4ZPBA 1Z2ZA 3LAMA 5IT0A 1S1TA 3A8EA 2F4VF 2ZNZA 4LRCA 5HQLA 3C15B 1IBMF 3LP2A 4NXMJ 5ITHA 3PX6A 2DEJA 2M2BA 4JUZA 4X4SA 1H72C 3U02A 4Y3CA 4FYDA 3MCSA 3JQJA 1U1QA 2WHOA 3ONQA 5J1PA 3EDRB 1NKBA 3PO5A 2CA9A 4USIA 4L74A 3WIUA 3JSMA 2KVIA 2W2PP 4I2QB 1UJ4A 2JFDA 3DOLA 2B6AB 2C42A 2GMLA 3H5SA 1BMQB 2MKKA 2XMWA 4ZP8A 1WC6A 2HPUA 4ZPTR 3NXZA 1RAGB 3DLJA 1BQMA 2MHEA 2XNQA 2DRAA 2WW8A 2GO9A 1A7GE 2IJFA 3DRSB 1SH3A 3EGNA 3PCOB 3CUNA 4I2PA 2H9ZA 4NLVA 3MOZA 5CA5A 4TU7A 4N5SA 2RDJA 2LQ8A 2JEGA 2CPXA 2UP1A 2AWZA 4PKDB 2APOA 1XTZA 1RT5A 3QGGA 1HQUB 3IRXA 3IRWP 3I56S 4B9LA 3HHLB 2J5AA 3KHGA 4BHQA 4YHHJ 1TL1B 2BMBA 4IOCQ 4J7CA 4DZDA 3NGUA 3ENWA 2DNPA 3IAM9 1XBWA 4OI6A 4K4WA 4OQJA 3N4WA 3UN2A 4M8LA 4Y28C 2B9WA 3IGVA 2DD8S 2UZAA 4PAAA 4TXSA 2FJDB 5B0FA 4RZRA 3GYNA 2WSCC 2WBRA 2GAGC 2XBPA 3CJ5A 1URRA 3MECA 4PWWA 4Y34A 1KQGB 2DR5A 1CS4A 1XQIA 1Y10A 2BKNA 2BVZA 2QRRA 3VAGA 2FZCB 1XC9A 1KD1T 1K1SA 1HLWA 3EMTA 5E33A 2OGUA 2ZOMA 4QWBA 2XC9A 5LMNF 1LWFA 2MZRA 4X62F 4B3TJ 3D5MA 2BJ9A 3DCAA 4ANCA 1C4CA 1T3OA 3CDUA 1AW0A 1FK9A 4J91A 3OLAA 3DGPB 2I1RA 1ACMB 1Q7LB 3QJPA 2AX1A 3FK4A 1TFYA 1LW0B 5B09A 2E1AA 2LQJA 4LF4J 1FJGJ 2VQEF 4OHYA 4YY3J 5F8GA 3B78A 3TUZC 4X65J 3N79A 2COLA 3O44A 3BB5A 4DS5A 1FO1A 4YR2A 3Q86A 4I64A 1PJ7A 3OPKA 4CNZA 3KMSA 2FY1A 4XK8C 3Q8QB 3GV5B 4K4UA 1VQNS 4DLGA 4L3KA 1B99A 4XTTA 2M8HA 3EGZA 2YNGA 2DO0A 1X5OA 3BGRB 1FRXA 1T02A 5L1LA 2KHCA 2GO8A 4A8FA 4ZMMA 3CO0P 5H9FK 1TZ0A 2MQQA 1FRIA 3LGHA 1KSPA 4FP9A 3W9IA 3TJ8A 2C2ZB 2PDAA 5E41A 2HVZA 1Y3KA 3SSSA 3P96A 5BR8F 4DR1J 4L73A 5IWAF 1NK9A 2ASDA 2M5YA 3DOKA 2UUBF 2YWFA 1T94A 3MAAA 1S1UA 4OZNA 1H74A 1BLUA 1KVIA 2CUYA 2B0GA 1HKAA 4JYAF 4KKOA 4B3RJ 2HW3A 2LEBA 3HP6A 2QX0A 3H0PA 1IN0A 3TEGA 2PMHA 3T9NA 3W64A 1KQSR 3GILA 1L3KA 3LGNA 3R3TA 4NEZA 5L9NA 2ZH9A 1T8EA 3BDPA 4ERDA 1NPPA 4LFCJ 1N5YA 2UUAJ 3DLEB 2J6SA 4ZJOA 2ZKUA 2HVDA 3LPEA 5K9FA 1YI2S 2NZCA 1UKUA 2IHR1 4DX6A 1W7WA 1NKEA 4K4YA 1M5VC 3DXSX 3EX7B 1VQ7S 4TY8A 5D77A 5EHHA 2H4WB 3BGOP 3K5NA 3JB9k 4RKUC 4XAKA 1SQEA 2DB1A 3NEKA 2IMOA 4JBCA 3MECB 2BQRA 1JLBA 2BABA 2MKIA 3MM9A 3IR6B 3M8SA 4JI6J 4Q0BA 4QIGA 4WFNQ 4EBCA 2ACYA 3Q8VA 2Z0GA 2VBZA 5B0EA 3HFVA 5KG0A 4E98A 5I3QA 3NLCA 1K73T 1K8AT 2H65B 1X4HA 4M5MA 5C2CA 2G0CA 3CJRA 3SSRA 2CNKB 2B9YA 4GO5X 4EYIB 1TMMA 4H4KA 1RT4B 3MMJA 5A0YB 1IBKJ 2CYYA 1AB8A 4DEZA 4B3SF 2JC0A 4EGLA 4DFPA 1HMVB 3HJVA 3LP1A 1JLCB 1NXIA 1KTVA 1VLOA 1FRKA 3IFEA 2XSFA 4OX9F 2N4DA 2AGQA 1SH2A 1FDDA 2G2ZA 2C3UA 4IG3B 4AQYJ 3HKZD 2XYHB 4LVNP 3ZTSA 2FHMA 1Q79A 3GG1A 1DLOB 5A2QU 1FWKA 2PFDA 1DQ8A 4CLPA 4I4BA 5L1IA 2JH3A 4F0HA 2ZH4A 3I82A 2UUTA 4IH7A 1SJ1A 1PAUB 1VOMA 2IRUA 4ZPCA 4RNMA 1WG5A 2M7SA 4DQRA 2EC2A 1SV5A 1QE1A 3M8PA 5FDLA 1LOUA 3DLKB 2VFRA 5F9NA 3UD4P 2CQ4A 2KXHA 2NSBA 4RUCA 3IM8A 3OR2B 1JLEB 1MMDA 2AHOB 2HIQA 3MGJA 1HBUB 3NOCA 5CQGA 3UCZP 4R0EA 2XY5A 4F2RA 2MSSA 2M9KA 1XR7A 4A8MP 3AT1B 2GFFA 1B70B 2E5LJ 2HHQA 3MD1A 4C8OA 2PEBA 1H38A 2RKIB 1BD6A 4DL3A 4ED6A 2RRAA 4X65F 1ITPA 2MDAA 1LWCA 2YY3A 2BKPA 4JI4J 3C6UB 1S4FA 3PYGA 1TP7A 1TUGB 4IO9Q 2KN4A 1RAIB 2FC8A 4OJ3A 5U47A 1EQMA 2YH0A 3CXCR 2B5JB 4FBUA 4DI6A 5IV4A 4YQWA 2JJ4D 3R7BB 3IR7B 2W2QP 3HJFA 1N56A 5CHCB 4DSJA 2JZ5A 4DPWA 4LR7A 8ATCB 4CLUA 4KBIA 3JQKA 1VQKS 2BOPA 2Y1IA 5DDOC 4IH5A 5HROB 4LF7F 4YB5A 4PCQA 2ZHBA 3C6TB 4Y6IA 2G9OA 5D4NA 3HD2A 4TQRA 4JI3J 5B0AA 4ENOA 1UJ6A 2H1YA 3O2IA 4U96A 3EM1A 3OVAA 1MWQA 2XB2D 1N4LA 1YSJA 2DGUA 2FVCA 3JAMU 4QIFA 3PFEA 4ECRA 1V3ZA 4I6AA 1FJGF 2VL1A 5GAGU 1ZM4A 1BQMB 5KFKA 3PJXA 1T3NA 1PG5B 1LWCB 4NA1A 1RWOB 2GIFA 1RXOB 3CIZA 1V3RA 2BA9A 2KM8B 2B6AA 1NBEB 2V4JB 3SCLE 1TUWA 5IM0B 4DR6F 4U8YA 1DTTB 1RT5B 1I94F 4V19X 1S4EA 3W62A 3MOJB 4J37A 1HD1A 4RBTA 4E2FB 4DV0J 1UCNA 1VRQC 3EICA 1FX2A 2XMJA 3T41A 2V8HA 2CPIA 4AFFA 1R6VA 2MLZA 4IFVA 3BSNA 2G1HA 2EW9A 2DNZA 4DV7J 3G82B 1Q8LA 3MURP 2LA4A 1X4AA 4PWUA 1RK8A 1EKRA 5GVQA 4ETXA 2MKHA 2D69A 3GSIA 3DOLB 4B9VA 4TQSA 4FF4A 1NK4A 2GIRA 3TZWA 4QQBA 2AYBA 2PFFB 1RAJA 1CVJA 1DTQB 2OKQA 4CT8A 1F5BA 3H59A 5FD1A 2QL9B 4A4JA 1X9WA 1REVB 2F4VJ 3DU6A 1V3SA 3JSRA 3U1NA 3G86A 5CYMB 4LBIA 4P74A 4ED5A 3GLJA 2J7UA 3ICLA 5HBMA 5GAGI 1FD8A 1ZAVA 5EN1A 4GVLA 4EI2A 4P6QA 3IS9A 4RBVA 5HP1A 3L9ZA 2HS0A 1SC4B 3GPAA 2XGPA 1UVJA 3PW4A 1NSKL 1S6QB 1R8CA 1TKZB 1T9TA 2HK2A 2V6AA 4KAIA 4E8UA 5DQHA 4DV3F 1EP4B 4K4XA 3SYZA 1A9NB 2BJ3A 2YWKA 3T6BA 3H4DA 2LXIA 3OR1A 1J5EJ 1X5SA 1NSPA 1NNDA 2Q79A 5IOLA 2FZKB 4A8XA 1VC5A 1DQ9A 1ZAWA 2K06A 4MH8A 2CG4A 4RW6B 4RW8A 5JXSA 2QYCA 3IWLA 4HI1A 1V6HA 4USWA 5SUHA 4OI1A 1TAQA 2CZ4A 3MZIA 5AXMA 2X51A 4EWTA 4WP9A 3MCMA 3KLFB 2D3OR 1DY3A 4DV5J 1NH7A 1D8YA 4IRDA 2AJFE 5HQ8A 4C7QA 4ANDA 1UVLA 2H54B 3D7SB 1FDNA 3JSYA 2L9WA 1WKJA 2M3DA 4GRSA 1OSCA 4PPZA 3ITHA 3QSIA 2AQ4A 3CULA 1DFDA 1FK9B 1VFJA 2MHNA 4QR1A 5THWA 1HNVA 4PXCA 4CO2A 2BANB 2L9DA 3A3OB 4KHPJ 2WRMA 1ZH5A 3BBCA 1AA1B 2DNLA 2HBQB 2N4CA 4KY3A 4O44B 3JYTB 3A8IA 2PE8A 3WQPA 4XPEA 2R7WA 1TK0A 5E3QA 4X4RA 3P49B 2HFNA 1OPZA 1FWLA 2P6TA 1C4AA 2XEXA 5CCMA 3D6HB 4H54A 2NXEA 3C14A 3RAMA 2H5JB 4QJVA 1MG7A 3CE8A 1O6XA 3OFEA 2Q6CA 4KHRA 4QW8A 2V4JA 5KFUA 4OI2A 2C3OA 4LF9J 2NS1B 1TU0B 1EKSA 2FC9A 4I6YA 4ECQA 2LEPA 4M5KA 3W66A 3PYFA 2KVQE 3GFZA 3VHQA 5D8HB 3TR5A 1VIOA 4DMZA 2GIQA 2JEFA 2P9EA 4LT6A 1QD1A 3S6EA 4C8KA 1ZM3A 2CDQA 1UETA 3NL0A 4QYZJ 1RTJA 5HO4A 2RU9A 2XNRA 4AT1B 5JUMA 1S0NA 3CCVS 1L5UA 4NLPA 4TU8A 1P1LA 4LF5F 2VOOA 1FI4A 3FSYA 1JLBB 1DZ5A 2R3VA 2CQHA 5C5JA 4AL7A 2VQEJ 3AFGA 1F5CA 4DR7F 5CYMA 1WJ9A 1AROP 3H7HB 2ZH8A 2FZGB 2FVRA 3HSZA 3DI6B 4NLGA 3D28A 2DXDA 1MROB 3GFXA 2ZJPQ 1N5YB 3RW6A 5LOQA 2FJWA 4HR2A 3OT9A 4WP8A 4H4OA 1U1OA 1S6UA 2DGTA 3M2VA 5A76A 3EXYA 2HHUA 1S1XA 8RUCA 2ZD1B 3NGTA 4L76A 2ZJRQ 4ZP6A 3OTEA 2YWGA 3LP0A 3TI0A 2J0QD 2OIHA 1Q81T 4JV5F 2ASLA 1TV6B 1L3TA 2XSJA 3CGIA 3ZZ0A 1SKUB 4GVBB 2HWHA 4MK7A 4ZLPA 3SQGB 5IFMA 5KG5A 5KT5A 3GZ7A 3M8YA 1XK8A 4YFUA 4A8YA 1M5HA 5KFHA 3M8WA 1RKJA 3G9CA 4X2BA 4CP5A 2QA2A 4HT5A 2HGMA 5J2NB 2IYIA 5IQQA 3LA0A 5BXIA 2V4RA 4CO5A 3UR0A 2R2SA 2K2PA 1E6YA 1FEHA 1LFWA 3O3LA 4KV8A 4DUYF 1MROA 1QTMA 1X4BA 4IOAQ 2DTJA 2ZITA 4LQ9A 5C42A 2KRBA 4EEYA 1GX5A 1PC5A 1SJRA 2HNYA 2V8PA 3M6XA 4GKKF 4ECTA 1W25A 1YJ9S 3W3SA 4ZA1A 2MGZB 5H9EJ 1JLQA 4CRJA 2P5VA 3TAQA 2ZBIA 3LP0B 3TVYA 2XMTA 4U7UD 1RHQB 2NXUA 4O4GA 1U1LA 4A8QA 1GFWB 3ADAC 1UVNA 2YKNB 3KUEA 5B0GA 2X1FA 2RDDA 4USVA 3C14B 2HURA 3Q8YA 3G6YA 4RR5A 1UEVA 1FTCA 3FKBA 3BH6B 5DLFA 3T1HF 3ZC4A 1ZTTA 2V34A 5K20B 1HNWF 4HT7A 4S0MA 2DO4A 1K9MT 1ZTWA 3MEEA 4HDGA 1UPPA 2J9DA 4Y0FA 1OWXA 3MM5A 1M0SA 3ENQA 3PJ9A 1WG4A 1JLEA 1Y3JA 3H2VE 4HACB 4XIUA 2FVSA 1JLAA 3I0SA 4KGVB 4XPCA 4ECUA 1TTHB 2HLUA 1KEKA 1KOHA 2JDJA 3OQ2A 4K50A 2VPXB 5KFBA 1R8HA 1LNQA 2D9OA 1UEKA 2HNZA 3TA0A 2UUCJ 1FNMA 2K3IA 5D4LA 2IYGA 3GFHA 1NU4A 1Q95G 4KH1B 2ZM6J 1YRTA 2B4PA 1CJUB 4CLFA 3QLHB 4YDDB 2B8QA 1UJ5A 2QA4S 5KFOA 5FLXY 1XMOF 4D3HA 4N41A 4HYKA 3D6MB 2I9SA 2MQOA 5A6WA 3NRBA 3HM9A 2CQDA 1U0SA 3TJAA 2VV5A 1WTFA 2XZWA 4HTIA 4WBFA 1LXNA 1YLXA 1KWMA 1F1BB 1WKKA 3QYYA 5F0WA 2FLOA 2SXLA 4C98A 3M30B 2QLFB 3IMQJ 4I56A 2ADCA 2RH3A 1WF1A 1RCXB 4YR0A 2GX8A 1LK5A 2V8VA 2XCAA 5HROA 3FFIB 3TUIC 5J1EA 2BJEA 4CM2A 4OYOA 1CLFA 4NCGA 4OLPA 4O3QA 1FCAA 4I7FB 1FJEB 4O3PA 3JSBA 4MKYA 1KR4A 2V9WA 1RGVA 3NWGA 3LWMA 3M4XA 1DQAA 1MLAA 4UOCA 2VUGA 3T1HJ 2DHSA 4NLQA 2VB6A 5EWFA 2CQGA 1YJUA 1TKTB 1VIXA 2YNHB 3LUYA 1HPZA 3PTWA 4DR5F 3HT3A 1UP1A 5J2NA 1E6VA 2YKQA 4EUVA 3HHKA 2DNNA 2CJ9A 3ZZPA 2QEXS 1IWGA 2QSWA 3DOMA 4KGKA 1R3NA 1VCTA 1HWUA 3QMQA 4I6WA 3M30A 1HBOA 4UQGA 1Q7YT 2HEKA 3FEYB 3MPYA 4M1KA 4JI7J 2YTCA 4OYWA 3CTRA 3TEHB 2GW8A 4MT1A 1H7WA 4ZVOB 3RYLA 3QJLA 2OPRA 2YBVA 2D3UA 1HNWJ 4CH7A 1SBRA 2JLFA 4WYLA 4EO6A 4DX5A 4AQYF 4RW4A 1EIYB 3M6WA 3T19A 5IC6B 3IBFB 4DL0C 5IT9Y 2BE2A 2HGLA 2POKA 4N47A 2DH8A 5KFNA 5ETTA 2IDLA 1IM6A 5JJBA 2DR7A 2IIHA 4RWXA 4BC7A 1RU2A 1SH0A 3OTOJ 3FSXA 3AHPA 2DNOA 4OYZA 2JLGA 1R8PA 2H4YB 4J9LA 3TX8A 2GJIA 3AQPA 3BREA 2GVDA 1YZ7A 4ECXA 3DOMB 3NS7B 4DQQA 1FRJA 1U48A 3CJ3A 2JVOA 2ZH7A 3HT0A 4RPFA 2RS8A 4J90A 2P9CA 3CC2S 2PGCA 3THTA 2BACA 4KJIA 4ATNA 3HHLA 1K44A 2RU3A 4A8SA 1HL6A 3D68A 3H5UA 1TL1A 5KTQA 4WZMA 4DL7A 1RT1B 2B4VA 2RB7A 2HQDA 4FPIA 4KH0B 3M8QB 3JSMB 2BE2B 1RBOB 1QSLA 2CQIA 2R7UA 2GHPA 4URQU 3JTOA 2DNHA 2KL8A 2FQQB 3MCNA 1VMBA 3VGSA 4KPYA 1S0VA 3J7AN 3OL8A 4M5DB 3JS9A 3QT6A 1GXTA 1NLKL 1UA1A 3DRPA 3NGDA 3IC1A 2BW7A 2XY6A 3RB3A 5C25B 4C0OC 1GT8A 4EK2A 3B8HA 4D3GA 5KFCA 2RQKA 2BRKA 1K0VA 3OBIA 4RX6A 3BF4A 1FDBA 1WI6A 4PABA 3MPWA 4Y2CA 4G1QB 5KG6A 3W7BA 3RTVA 1HARA 5DGAA 2OPQA 4RBUA 5HMWA 5LSLA 3VF0B 4LR9A 2DT9A 2GCFA 4ZOSA 4CO4A 2BBEA 1GX6A 1U6ZA 4NLTA 3V6KA 1H7XA 1HR0F 1PSDA 1VQ8S 3MEDB 1YITS 3CMES 2M8DB 1OY6A 1FESA 1RABB 5AXLA 2NYIA 4QW9A 1N5TA 3CCWA 3IWXA 1S1UB 4DBQA 2GJFA 3SZ2A 3GIJA 4DSFA 2W25A 4LF5J 4C6AA 1VC6A 3OD2A 4KFBA 4JYAJ 4JI5F 3PYDA 1IKWA 2ZHOA 1XR5A 1ZS6A 2OP5A 1YBAA 4NZ7A 1T9WA 5D4PA 3D6TB 3T9ZA 4KE5A 2IBKA 2BKOA 1PJ6A 1RAFB 3MR6A 3UDLA 3MAQA 2GMJA 3CNQP 3DGPA 3DDIA 3DKDA 3QSYB 3SMZA 1KKHA 1SQGA 1IBLF 1YHQS 2UV8A 1WOSA 3B4MA 1UWAA 4DV5F 2DY9A 3TQEA 2J9DE 3HHLC 5KFMA 4CIOA 4LIWA 1J5OB 4RJVA 1URNA 5KT6A 1TV6A 3NNHA 3W8PA 1AFIA 1NCLA 3LANA 4ZITA 3UPFA 1E6YB 1FRMA 2R8IA 2QTWA 1SJ3P 3QRPA 2UXBF 2CVIA 3A1YG 4KV8B 4FZVA 2NR0A 3MM9B 5B0BA 2OSQA 4J9PA 4K2XA 3ZTRA 2I5JA 1AZSA 5F8HA 1IKWB 2IJNA 3SFUA 4LSLA 2U2FA 3SEOA 4MYTA 1PBUA 2ZNYA 4UTGA 3V81A 1YWXA 2A2CA 3QGHA 3H5YA 4WFXA 1TL7B 3UDCA 3OXLA 4RU9A 1S99A 2VG7A 2ZJQQ 1WSVA 4EO8A 1LEOA 2ERRA 2UVRA 2QFIA 4Y2MA 1NMEB 4LFAF 2C2RA 2Y1LB 4UOFA 4ZDNA 2ZH3A 2FTRA 2NXCA 3O6QA 1QAIA 1HYSB 2MPUA 4HH1A 9RUBA 3LQVA 2HQIA 4W92B 3RB0A 2QL5B 3BZQA 1NDLA 1BWVA 1VJQA 1WF0A 2AT1B 1DAXA 2LEAA 3HHDA 2YX4A 2ROPA 4NA2A 4PPDA 5EUHA 4UT4A 5IXUA 3IR5B 1U1NA 2LKZA 3DYAB 3EJMA 3IXQA 1VLYA 1GNKA 4J9SA 4WK3A 4KQZA 5C25A 3J7Z5 5F8MA 3EDQB 1M5KC 4ICLA 5KFDA 2K3KA 2AGOA 1H73A 3D1HA 5D0RA 5BYQA 2IJRA 2DPJA 1DHMA 2MZTA 4NYZA 5ETPA 3JAMY 2GHWA 3OJUA 1D9FA 2RDIA 4B3SJ 4K0KJ 3CW2C 1G1XA 2RUGA 4WFAQ 2VBXA 4AYBD 4FXDA 3DHXA 3WBZA 1FXRA 2MJNA 1KQKA 4YMEA 4X64F 2IAJA 4C2MA 2W7OA 2I6WA 4JV2A 3CJSA 1WDTA 5AE3A 4KRWA 3UCGA 2VG6A 5L46A 1RT3B 4MIAA 3PIPQ 2E5LF 2FJVA 1U6FA 2EEYA 3PXGa 4F4ZA 1XMQJ 1NK0A 3D9BA 3VAJA 1EETB 2R7QA 2WONB 3CMQA 1PILA 2M0GB 3UNYA 2DR9A 1X4EA 2MZSA 3K2YA 2B9EA 3MM7A 3KKFA 5J2QA 1D1UA 1HQEB 2V9KA 3PEHA 2CDRB 3QIPA 3VAHA 1KP6A 1N5VA 2E5GA 2CPFA 3KK1B 2J6TA 1RAAB 1F2HA 1WEYA 4DV2F 3SV3A 4F04B 2V5HG 1IKYA 4ZCIA 3PDNA 2VH7A 2G2YA 4MMOA 2W4DA 4DPYA 4RNFA 2FIUA 4FYXB 1RT6A 2X7IA 4DPXA 5HLFA 5KFWA 1IBMJ 5DETA 2HMIB 4L3NA 1WI8A 2V2KA 2WW4A 5D15A 2UXBJ 1TKTA 5KFIA 2ZZNA 1APSA 1R27B 3BQ2A 3HZEA 1S48A 2CADA 2DGOA 2CNLB 3CCRS 1S79A 4G65A 4X4UA 2CQ0A 2BE9B 3W1YC 4I68A 3TVZA 2ZE2A 2FHJA 2K8GA 4A8WA 2WOMB 2J0XA 4YHHF 2BYCA 1RUSA 2X3GA 2UVVA 4IQXA 4O3NA 2WB4A 3E8OA 2RE1A 2CVEA 3KG4A 3NKYA 3P8BB 4LRAA 4NCGB 2BM1A 1HHQA 3ZFVA 4EMDA 2N82B 3HULA 4C8LA 2ROGA 3H5XA 4WIIA 3EPIA 3CJQA 1PBAA 4ECZA 3TUJC 1X4CA 1CEZA 3PKYA 1PCAA 5ADZA 2JVRA 2C2MB 3IG1B 4LRBA 1ZM2A 4P2FA 1S1VA 4HEA9 3K59A 4KIAA 2QFJA 2W7PA 3BO2A 4DV7F 3CSKA 1X9SA 2V2VA 3FQLA 5CZVA 4J9MA 4QIVA 1B0TA 1X4FA 4Y2KA 5C24A 3V5RA 4ED7A 3CD5A 2AMCB 4P2MA 4PG5A 4P10A 1RHMB 1FFGB 1TR0A 3R27A 5D4OA 2YNIB 4ITSA 5AXKA 3BPDA 4TNOA 4P7TA 5B0CA 1PAEX 2XHWA 2NUHA 3UFCX 5IS2A 1F0XA 1KQFB 1NDPA 1GTEA 1SC3B 5ETRA 4C9DA 4F3QA 3MUVP 1AFJA 3GR0A 2EPIA 3NAHA 2RUSA 4RW7A 1VS3A 4F4YA 2UUAF 2GQQA 3BN4A 2A0FB 4OHVA 3FBFA 3HFKA 2QT7A 2J7KA 2A6OA 3MMAA 4KGXB 3NNAA 2KTQA 2YQ0A 2VD3A 1LW0A 3JTPA 4TY9A 5CYQB 5HVFA 2DPIA 1Y00A 1FJCA 1JNRB 2V67A 3BGLA 2W9CA 2VF3A 4QIEA 1U1RA 2WVCA 4KO0A 3L3CA 2HS3A 5E2QA 4DV4J 4DV6F 2C2EA 4G6VB 2Z56B 3OFGA 3TNVA 5JVGQ 2UVUA 4QWDA 3OR1B 1J27A 1U25A 1UZHA 4C48A 4WKRA 2YPZA 1Y4ZB 2IPOB 5LM7E 3WIVA 3DRPB 2J6UA 3I0RA 3U7JA 2GS8A 4PXDA 2KT2A 3O5TB 1NZ8A 2CAJA 1NM2A 1R43A 2VFVA 2YKNA 3J81U 2YNIA 2HVEA 2Y1JA 5A8RA 1S10A 4CWBA 3TJ9A 4MKVA 2W9AA 1JLGA 2MJUA 1V9OA 2A3JA 2YWHA 4RW9A 1IVZA 1RT2A 4MFBB 2XO6A 4QWCA 1X7VA 2RJZA 3BR8A 3MEKA 1EJ7L 3PHEA 3MUTP 4IRCA 2J0SD 1N33J 2IA0A 4EBEA 5KAKA 1WOOA 1MSWD 2O66A 3F41A 1HWKA 4U67Q 1SJQA 3UD5A 2DJWA 2YKMB 5KT7A 2WCXA 1KLMB 3Q89A 2BW2A 2YWEA 4CI0B 4TLRA 3W8GA 2R8JA 1UFKA 1XR6A 4LREA 3LP2B 3F44A 5HL7Q 3MAHA 4ZVHA 5F8LA 3G8SA 2I2YA 3AA8A 5IQ6A 3DM2A 3CJKB 4NLOA 4F36A 4R8UB 2E1CA 2XLKA 2OD6A 2ATLA 3H42A 2HQCA 3CMAS 1UFLA 2OEKA 3T5HA 3VGTA 2DNYA 2LU2A 3BKUA 4DX8H 4DUTA 1ZETA 1BQNA 3M32A 3N9UC 2PN6A 3KK2A 3CCES 4TVAB 1N32F 2UXCF 2HZCA 4K0KF 1U2RA 4OJHA 1Q0NA 4DV4F 4EU0A 4M5NA 4Y00A 4YB6A 1R31A 2E66A 4WXOA 1TAUA 1NJZA 1HWJA 4TY8B 4ZN1A 4U95A 2VJUA 3KJQB 2NREA 1M5PC 1VRUB 1IJEB 1Y5NB 2X3DA 4TKTA 1DRZA 2DEIA 2XGQA 3Q83A 1EQ0A 1Y0HA 2CNOB 2GMHA 3J7A1 4PG4A 4OV1A 2WBMA 4KHPF 3M1VB 4OV6A 1KHWA 1KS2A 5J2PA 1J5OA 4DR4F 5F3ZA 2GJ2A 2C22A 4R8UA 1NRKA 3R6GB 1AYEA 1YZ6A 3KLGA 1HPZB 2L3MA 1HW9A 2LQBA 2LU1A 2W1BA 3L7PA 1RT4A 2UUWA 5A0YA 4DJBA 5EGYA 3KNGA 4PG8A 1S77D 1IR0A 3Q2TC 1HIYA 5LMNJ 1X5PA 4J9OA 4LF9F 1N5QA 1TKXB 2GQCA 2HNDB 1KFDA 2CQ3A 4K8RA 1I51B 3P5TL 4UUWA 1MU2A 6AT1B 1IBCB 2M88A 2XM3A 2WSEC 2BQ3A 2AGPA 2IRXA 4WFYA 3UN3A 3HF5A 3TANA 1S72S 1J2VA 3BKFA 4P9SA 4UF4A 3K5LA 5LL6d 1NK5A 4LR8A 2NPFA 3SSQA 3W9JA 2CG8A 5AJ3J 1VQ5S 2LYVA 3A8JA 4KR0B 1LWXA 4NCBA 1P1TA 2UXDF 4FNHA 1DJ0A 3MMCB 4USMA 5LT5A 5HVGA 1PYTA 4ED2A 2OTLS 3KFWX 2KT3A 1TL5A 3GJSB 2LCWA 4LSLB 4OYBA 2AW0A 2WZ1A 4DX7A 5J2MB 3NS5A 2RHQB 1G3OA 3QT5A 1U6BA 4DQIA 3NNCA 7FD1A 2IRYA 2GQ2A 4NXNJ 2LMIA 3MR2A 1YJ7A 3N5FA 1SJFA 3R2CJ 1GXUA 1S9GA 2B51A 1VDHA 2KYZA 1M1GA 3CDBA 1F9EB 3DRRA 4JV0A 3Q23A 1YVFA 2QJ3A 1NK6A 1S0OA 2WONA 4HI2A 1U8WA 1T05B 4FF3A 4DOZA 4OFZA 3DM2B 4DSIA 2XS2A 1HQEA 2EG1A 2E29A 1XNQJ 1C1BB 1LKZA 1HBNA 1RT7A 2B56A 2E7VA 4P2SA 1HWIA 3VAIA 4Q2LA 2EWHA 1EETA 1XEZA 2AZ3A 2XULA 3QBCA 4ZLLA 2FVQA 2OSRA 1REGX 2HHWA 4O3OA 4OHXA 2YX7A 2DGQA 3TZYA 4FNIA 3GR1A 4M5DA 3BJYA 1VQOS 4KKOB 4LIRA 4NI2A 1XMQF 1IBLJ 2MXYA 1Q16B 1U02A 3C6TA 3FZBA 2DH9A 2IAJB 2XMAA 2FJXA 4DR4J 4P71A 4NA3A 2VQFJ 2A18A 5HMZA 2E44A 5AT1B 3UI3A 4EBDA 1TL4A 3GMGA 1FVQA 1VRUA 5DLGA 1KLNA 4GKJF 2EK1A 2XSJB 3ZTPA 4B3TF 3BH7B 2UV8G 3ZTOA 2L08A 2LQ5A 2GGPB 3K17A 3OHAA 5I42A 3X1LB 3MPUB 1IQZA 2V94A 5GMEA 1W2BR 1YJWS 5J2QB 3MDFA 1WWHA 1X60A 2HHVA 5BR8J 2BR0A 3PX4A 5GADU 3Q22A 3CT9A 3I32A 3FBCA 4CCHA 4OZLA 2DISA 2R8GA 2F7VA 3R5GA 2E9TA 1Z4UA 2JRSA 3CO9A 3IBWA 2R7OA 3IGNA 3M2RB 2R8HA 4F8RA 1RWNB 2YKPA 3LW5C 1YJTA 4KYZA 4NWBA 2O3DA 2R9LA 4RU2A 3FFIA 5DQIA 3I0SB 4ECYA 2QYGA 4LQ3A 2Z2ZA 2DXFA 2FHOB 1G7CB 1QAYA 3PRBA 3S01A 1DTQA 1KVKA 4BS2A 2HHTA 1M5SA 3DN9A 4JV1A 1S1WB 1HNIB 3KLHA 4NLUA 3V4IB 4LFBJ 2GGPA 5I42B 3H25A 3BEGB 2HVHA 4CM0A 4X84A 4HTJA 2DKOB 3ZZTA 2LXFA 4CYUB 2JEIA 3MMCA 4F7VA 3F73A 5HJYA 5CAAA 4DV1J 1M5OC 3J80U 3FVYA 1U4BA 3IBCB 4C97A 5T7LA 3IWNC 4DR1F 2XY7A 2VC1A 1AUSL 2YKAA 3E01A 5ETSA 9ATCB 5LJ3Y 2UXCJ 3CJTA 5HI7A 3W63A 4FN5A 3N6LA 4AUKA 5EWEA 2FHJD 2VA2A 4JI7F 1CJTB 1U7LA 2JOQA 2VPZB 1LFPA 1WHVA 1F9HA 4ECWA 3D67A 1TQLA 1SB6A 1VHIA 3Q8RB 4AL5A 5L9XA 2HFSA 1JKHA 2JL9A 3HI9A 4IG3A 2K1RB 4LF1A 5KFXA 5C7PA 1VQPS 3SQOP 3QT7A 1HI1A 3EVWA 2YNFA 2LDYA 4QOTA 2ZVIA 5E3AA 3B4DA 3RBZA 3WHIA 3VAFA 1JWWA 3ISNC 3RW7A 1GEHA 4MJKA 2VQFF 1HBNB 2DBBA 4OZ2A 3CDAA 4UOGA 2ZUGA 1RYRA 3TW0A 4NYOA 2EXUA 4GKJJ 1TELA 4CH1A 4ELTA 1X4DA 4BWMA 3HVWA 2ALYB 2L41A 1WOPA 3NCRA 1WHWA 2EFVA 1SPBP 1FF2A 3A13A 5DS7A 5KG4A 2VBWA 3WDOA 4CLYA 3W60A 5E5NA 3EXCX 1SKSA 3AAWB 2OEJA 1S6OA 1UFWA 1UTAA 2Z8QA 4O44A 2D3ZA 4WIQA 3G6VA 1UW4A 4DL2A 3DLKA 5DM6Q 3C46A 3HKWA 4ZVRB 3L7OA 3LOUA 3B82A 1GMUA 5KG2A 1RB0A 4K4TA 5K8MA 2X1BA 3BS9A 4LUBA 5K14A 1T9YA 1MWZA 4C8YA 2RRBA 5IV3A 4OJGA 4LJMA 1ZYQA 2DRBA 1MN7A 1CBKA 1O51A 1CJVA 2Y0SD 3K0JA 5DO2A 3AOCA 2E1PA 5KOXA 2VG6B 2V4QA 1N36F 4DPOA 3QAUA 3VR1A 3PV8A 1U1MA 3EYZA 4DN9A 3WX4A 3EGWB 2JC1A 4LMZA 1BGXT 1N88A 4CLZA 2W8KA 4CT9A 4FF2A 1BQNB 1UW9A 3US5A 4IFYB 5A8KB 3JTNA 4XDDA 2ADBA 4ELVA 3TA2A 3PW2A 3LALA 1NPKA 1P9QC 4IDKA 2UUBJ 1HBMA 1I3OB 1TL3B 4L75A 4LSZB 4NPOA 3M9NB 1C0TA 4TN2A 4XO0A 1HNIA 2M70A 4B08A 3H40A 4OI0A 1RT6B 3HX9A 2HWTA 3NGRA 1HYSA 1PJ5A 4OJ1A 5F0UA 2W4PA 3POTB 3GV7B 3FDSA 4Q8EA 2DHXA 3M9MB 2KFNA 2QLXA 4DR3F 2CZ9A 4WYWA 1YK9A 2M52A 1B3TA 3KJNB 2QLBB 1TVRA 2CXEA 3TO8A 3T5KA 4JI1J 2C2NA 3W9HA 3U27A 1NJIT 2QC3A 1JK9B 3OTOF 3KLGB 1RU1A 1YGYA 2VDHA 4OX7A 4OZJA 5IM0A 4LF8F 1ELOA 1X0FA 2UUCF 2MQPA 3RR7A 3OL9A 2C3PA 2W2NP 1AXQA 4NMLA 3HPOA 4B9NA 1NB7A 4NXMF 1S9FA 3B6BA 3CCLS 4Z7CA 4G1QA 3EZUA 1V5IB 1B0VA 4KSEB 3TX0A 3FGVA 1PKUA 2RQ4A 2V68A 1B0PA 3I31A 4DCOB 3HD1A 2JHEA 1IUJA 2L48A 3BYPA 3M1VA 3PW0A 2J0WA 1WHYA 2O1PA 4HHUA 2YNFB 2OD4A 4LFAJ 4X4NA 1OPIA 2PT0A 4OYIA 3H8YA 3KWMA 1RTHB 3NOGA 3POTA 4Q7AA 4JB8B 2H5EA 3VCDA 5H9FJ 3DFEA 3DMJA 1FD2A 2K7KA 1Q86T 4Q8FA 4B3RF 3C2PA 1X31C 4RNNA 5C2GA 4MYUA 2HQFA 2YNGB 3BGRA 4NLYA 4RUHA 1S6QA 1CULA 1TKZA 3ENAA 3MI7X 3SCIE 4AL6A 4CO0A 3G87A 4QYRA 1BC6A 3S8SA 2RF2A 4ZVQB 3CCMS 3IS9B 2FD2A 2ZBQA 4ECVA 5I3UA 4DR6J 1NAQA 4JI4F 1D3WA 3VQSA 4I69A 4WP3A 1JLCA 3GIRA 2PI5A 1QY7A 2ZFHA 3KXDA 3BSOA 2ATCB 3PVXA 2Y8WA 7AT1B 1BE4A 4K7QA 2HWIA 1RLDA 2EK6A 5KFYA 1S76D 1VRTA 1GQEA 1RHKB 4B9UA 5CCLA 1BY9A 1Y11A 3CVKA 4LF6J 1H2VZ 5A2QY 3M2UA 1XJWB 4K4SA 5FIIA 1RTIB 1C1BA 1Z1ZA 2F9DA 1YJNS 3ZZUA 3VAMA 1U2CA 2HHPA 1NHUA 2OTJS 4OYXA 2W7AA 2AEMA 2DIUA 2AYEA 2NXJA 3MTKA 2XO7A 1A0OB 4DF8A 3MPVA 1HI0P 2RNEA 4USHA 4F0MA 4DLEA 1WC4A 4C8NA 1RA6A 5AXNA 2RIJA 3CD0A 3K57A 5DZ6A 1UWBA 3OR2A 2LVWA 1RACB 4FYWB 3NBPB 4FYVB 1HBUA 2N3LA 1ZBTA 3PR5B 2FPHX 2RQCA 3DLLQ 5CYJA 3CIMA 3OTDA 2VPWB 2HFZA 3AB2B 2VKZG 3TA1A 3QFHA 1CJKB 1KOOA 1YDLA 1PC4A 2LECA 5KG1A 4KPCA 5KFVA 2P6SA 3GE9A 1YTYA 2AV5A 3MR3A 3KK3A 4LBPA 2PA3A 3ILLA 4USUA 4KFBB 3MM7B 1ZA2B 4JP8A 2UXDJ 2QMWA 3DYAA 3SV4A 4HVZA 3CCTA 3GCXP 1KN6A 3RAQA 4NYPA 3J81Y 3SFGA 3L09A 3R6LB 1D0EA 1YRUA 2JWNA 1SCJB 2VFSA 3KLEA 4C11A 5RUBA 5KFSA 5M2PA 3IRXB 2ZVSA 4A48A 4P7VA 2WVDA 3ZZOA 1OQ6A 5HQMA 4M5IA 4U8VA 3KUGA 3BKTA 4WFZA 3J81j 4CLWA 2KH9A 1S1XB 1HHTP 5KFJA 2A10A 1HNZF 4P2XA 3J7YU 3V6HA 1RT3A 2XMVA 4YEAA 3KLHB 3PKMA 4GVBA 3RG6A 2FYXA 1C1CB 4YN3B 1FKOB 4C3KA 1GMVA 1WF2A 5A8WA 4PUOA 1ZPVA 2OPRB 3GP9A 2D74B 4UY8T 1IM4A 2FJAB 3QPIA 4NL5A 4UZCA 4NXNF 2JSXA 1SQFA 4DWIA 3MMBA 1RAHB 3DDNA 2IM1A 3QQCD 4MKBA 3ZZZA 4F25A 1JJ2R 4ZCLA 3I96A 4DSKA 1U8SA 2FB0A 3DLEA 4USJC 5HSPA 3TZXA 4X4PA 2WB1D 3OSPA 4O3SA 1S57A 1DURA 1RWVB 2KJWA 3K5PA 3PG9A 3QAEA 3FCVA 4Q44A 4X4QA 3PR4A 4F02A 3E3XA 2YQ1A 1FXDA 3W2VB 4RNHA 2K1RA 2XS7A 4IQMA 4P72A 1JLFB 1NSAA 1Q53A 3MTJA 4LSNA 2XYPB 2QMXA 4MK9A 3P4UB 3U1MA 1HI8A 1R7IA 3H4BA 1CQMA 2GAHC 3QIPB 3ET6B 1I1GA 1ROFA 2V8GA 5DDQC 4J9VA 1RBAA 2KXFA 3BV8A 2AEFA 3ISZA 3K7RA 2XI2A 5JMNA 3CB4A 1M1KT 2B9XA 1IKXB 2CJXB 4KGZB 1T0TV 4DL5A 2Q3PA 2G0JA 3UVJB 5DQGA 2OMLA 2OO4A 2V0NA 1FFWB 1F5AA 4MK8A 1VK8A 1T9VA 3P3DA 3KJVA 1R8AA 4PZVA 5DRKA 3CDEA 3CPWR 1V5VA 1YRXA 4KO0B 2CJQA 3PRDA 3OW2R 3DRRB 3FQKA 5HANA 1UVMA 1VI7A 3FJ2A 1RQ0A 2GNKA 1JLFA 1NH8A 4LSNB 1JMTA 4PG7A 1T05A 3NMAA 2DNQA 1W2IA 4LVOP 4ZJLA 5KFLA 4ZPAA 5GAHI 3QJJA 1N5SA 2YX1A 3QATA 1HNZJ 3GIMA 3LO3A 1T95A 3PY8A 5IT9U 4F26A 3IO1A 3UN5A 2OPQB 4C0HA 1N32J 1LK7A 2XYGB 3O1LA 2RS2A 2V2ZA 3C66A 3H20A 2IM0A 4O0NA 3VWSA 5CYQA 4GKKJ 3ZO7A 1BHNA 1JQGA 1RP5A 5HN0A 1K47A 1DARA 1ULRA 3GYXB 3G8QA 4WCEQ 3SDEB 1KHVA 1S12A 5IC4B 3H90A 1RTDB 1IR1A 4OZ5A 3ZNJ1 4RNOA 1FKOA 3VQTA 2OFHX 4G1IA 4ZJQA 3A3NB 4YB7A 4ID8A 4PR6A 1N34F 4DPTA 1E6VB 4DR2J 3HSGA 3T1YF 4X4TA 2VBYA 5HATA 3AJ1A 5A8KA 4QWEA 2VC0A 1VBYA 3KOAA 2ZZTA 1CG2A 2PMZD 4JV5J 5IZHA 2BJ1A 1ZM9A 2C2OB 2IC3B 4OIXA 1EP4A 5KT3A 3OJSA 2ZZMA 3R9LA 3IG1A 3M8RA 3N6MA 3EZOA 3JXOA 1G4CA 3TQ1A 1HQUA 2ZWPA 1H2TZ 4ZS6A 1ZAXA 3AODA 1VQ9S 2FGOA 4CLTA 2G13A 3HCXA 4B3OA 2MKCA 2QO3A 3MFIA 2KM8C 2QLJB 1B7FA 3EE3A 3I0RB 2DR6A 3IP0A 3KLFA 4GO7X 4DUYJ 1YBUA 4FYYB 2AJ4A 4ZVFA 1LXJA 3FNNA 2XS5A 4LRFA 4PG6A 3MR5A 1T03A 5CABA 3G8TA 1FHTA 4E0DA 2LFVA 3MEGB 4FKXA 5LMUF 2J9CA 3I5CA 4RUAA 2EKNA 3BSAA 3QWPA 3DLHA 2OPPA 2XG8A 4NLDA 1FEEA 3A8KA 5BJRA 3KK2B 3KHHA 2CJAA 4ZPWR 3AA9A 3M05A 2QLWA 2VA3A 5KFRA 2EC0A 1KVJA 2MMYA 1MW7A 2F40A 4IG0B 3BPSP 4XDCA 2AU0A 1SI9A 2FJEB 2Y0BB 3R5AA 3CJ2A 2IY5B 2ZH2A 3KUHA 3FMBA 5KG3A 2KG1A 5EX3A 4BBYA 2H3EB 3PHTA 4WJBA 2IVYA 3UQSA 2DIVA 2XLJA 2HHHF 3OUYB 1CS4B 1Z2LA 3FUYA 2F65A 4PEOA 5E3PA 2B5JA 4DFKA 1VRTB 4FS2A 1F3VA 1FERA 1REVA 1FE0A 3BYRA 2B4OA 1CULB 3DDKA 1RLCL 1RWKB 3CCUS 1RAOA 1TFWA 4RW9B 1SIWB 2ZBCA 4C4WA 1UWBB 1C0UA 1VC0A 4Q2MA 3RBDA 4LFBF 4RWWA 4WFBQ 3OXGA 2HK3A 4QR0A 3GJQB 1MU2B 4Y2IA 2ASYA 2YKOA 1RT1A 1A6LA 1U0HA 5GAEI 2MGZA 3HMJG 4FS1A 4DS4A 3UCUP 2DNMA 1FDAA 2U1AA 1KBRA 4F0KA 5IT4A 4UOHA 1N36J 4AXIA 2IFXA 5B0DA 2ZHAA 3TVKA 4MIWA 4J9KA 2LQ9A 3DLBA 4I67A 1Q5YA 3ISND 2V2QA 1RTIA 4KGMA 4ID5B 2BE7D
chains in the Genus database with same CATH topology
3E2EA 2W4CA 4MTPA 3D0IE 1RT7B 4FXVA 3V6DB 5SZTA 2CQBA 4ZP7A 1H98A 2W8LA 1XN9A 2DCUB 4DDFA 3TRGA 1RI7A 3AY0A 4DL4A 4LFCF 2DITA 1LW2B 3NBPA 5AE2A 4OZ0A 2KRRA 1NJXA 3T6JA 3KLEB 4G3IA 4ZP9A 1NHVA 1WG1A 5E3CA 2JX2A 4H4MB 4Q45A 3MM8A 3R5CA 2AJ1A 2IBOA 3N5BA 2W9BA 4N8OA 1H3DA 1TL3A 1NK7A 2OLWA 2B43A 2DGSA 1D9AA 1Q8BA 5EDWA 2KZMA 1X8DA 2HRUA 4TU9A 3TP2A 1H2UX 2VFTA 5I3PA 2BV3A 1OIAA 1S97A 1XNQF 5LSRA 1P8GA 4BCAA 2ZC3A 1UVKA 6FD1A 3OV7A 4LF4F 3NGKA 2PO4A 3DRSA 1RKIA 2ROEA 2ILZA 2EI5A 5F8IA 1Q82T 2B7BB 2FLLA 1Q4RA 4I0WA 2A2DA 3OL6A 4BDPA 3NCQA 5JVHQ 1S1WA 1XWLA 1HA1A 2BQUA 4HHJA 1RWUA 2N3OA 4IR9A 1IQTA 2WSFC 3KHRA 4Q0BB 2OAUA 3VALA 2F8MA 1Y5LB 5DM7Q 4QU7A 2AX0A 4YOEA 1M90T 3R1LA 1FNXH 2R7VA 2HVIA 4KHMA 1HBOB 3KMQA 1RDRA 3FRYA 1N0VC 4JI3F 2RD5C 3T3FA 2BANA 2F1FA 2C2DA 1QE1B 1MWYA 1Q1KA 3M9OB 2BJDA 4F4XA 2OJ3A 1WHXA 2AYGA 4F4KA 2E9RX 4Q43A 1FKPA 2ZD1A 2V8DA 1LWFB 2VOPA 3AH6A 3N0VA 2MKSA 5F9LA 1JKHB 3SXLA 3KG0A 1DLOA 5I4MA 2QV6A 4NCAA 4PQUA 3GG0A 1IKVA 2IM2A 3KLIB 4QWAA 4UQTA 1OSDA 1SV5B 4ES3A 4X4OA 2KB2A 2ALZA 3THVA 1SIZA 4WXWA 5J1EB 1SC6A 1HD0A 1S9EA 3QWUA 1KTQA 2YKMA 2YVSA 3BN7A 3KJVB 1OQ3A 2MY8A 2XMUA 4G1PA 2R7SA 2HNYB 5M2RA 3UW1A 2M4MA 5AJ3F 4H4MA 5E7OB 3K5MA 1JLQB 1TK8A 1FKPB 4NLXA 3I87A 3GB0A 1N6QA 2R2UA 2RILA 4NZ6A 2CQ2A 2YQ3A 5B7WA 3BQ0A 4WKYA 2DNGA 1P27B 5M2UA 1DTTA 2KHDA 3M6VA 1QSYA 3C8YA 2ASJA 1IKVB 5DG9A 5K8NA 4OZ1A 3Q24A 2ZOGA 4ILRA 4DSEA 2DHAA 1WTBA 4HH0A 2R8KA 4N77A 3OVBA 5KT2A 2NPIA 5L1KA 2E1MC 3ENVA 2JEJA 2YH1A 3ZZYA 1RTDA 2W24A 2Q6BA 5J2PB 5HLFB 4K4VA 2MQMA 4CQ1A 3CCZA 3DXBA 4B3OB 3NAIA 4CTAA 2I8EA 3SI8A 4ALZA 2VASA 1VK3A 5C24B 3MEGA 2R7TA 3EUNA 2IMWP 2EBGA 1ZOTA 4FVMA 5DJBA 2VG5A 1F9FA 2OPPB 2XWXA 1R6YA 2J7WA 4G6VB 3MD3A 1ZZFA 3GILA 3GSDA 2IVMA 2XWYA 1SJ4P 3UNGC 2R2TA 5K5MA 1X5TA 1C2PA 4JI8F 2OH2A 1FA0A 3KG1A 4C0BA 4Y2AA 2GV1A 1U45A 3Q2SC 2UU9F 2CIMA 3T1AA 3QGPA 3C3LA 2KT5A 1U49A 3M8QA 4DFJA 3RAXA 1QSSA 1HMVA 2X1GA 2CPJA 4PQUB 3IN5A 4QCLA 2F8EX 4NLSA 1U2FA 2PA8D 3NS6A 2CJBA 2I0XA 2JLEA 5D78A 1R0AA 4ILLA 3QO9A 3UWTA 3OUYA 2HFOA 3MEEB 5CXTA 4F50A 4BWJA 4CO1A 1U24A 4X66F 4R5PA 2KO1A 3MMAB 5GAHU 2I5JB 2FLNA 4YP3A 1HWLA 3LPYA 2D41A 4U6PA 2IVFB 3TAPA 1U1KA 4K59A 1S1TB 3PZPA 3V81B 2HNZB 2K7JA 4WU2A 3OSNA 3M8PB 2F9JA 4WK1A 2HYIB 4WTYA 5I3UB 3D1OA 3U1LA 2CQ1A 1N6QB 1MNEA 1KLMA 1WNEA 4ZVGA 1KONA 4ZCKA 4DF4A 3I9V9 4BC9A 2MZQA 1N52B 1ZPWX 1TVRB 3DC2A 4ID5A 4ZK7M 5L39A 3LWLA 2WAQD 3DMJB 1QUPA 4KT0C 2N7YA 1RT2B 2IM3A 4MFBA 5MLCV 4O0IA 4TYBA 3RU0A 3HHEA 4NRTA 4JI6F 3IAS9 1R8BA 4C3MA 1Y9OA 4M63A 3OL7A 4EZ6A 3K58A 3THPA 2FDNA 2WK4A 3RRKA 3X3UA 1HBMB 3TYTA 1L3VA 4OHZA 2W9BB 1N54B 4JI0F 3BDEA 2LXUA 2ILYA 2DGXA 3FCHA 3DLGA 2CJKA 4UY85 5KFFA 2UVWA 1XNRF 1LWEB 5KFGA 1QLNA 4K5RA 3DRYA 1RTHA 3GQCA 3VZHA 4V19J 4EFAC 1GXLA 3FEZA 2D1CA 1HHSA 3D54A 3KHLA 1NO8A 3M2UB 1FE4A 2B4UA 1LW2A 3I9ZA 3S1TA 4I2PB 1U47A 3G96A 2OMOA 3VZIA 2HHSA 4WF9Q 1NEEA 5G0RA 2HHXA 2CFXA 1IKYB 1NK8A 2D7SA 3R5BA 3GFYA 3PIOQ 2E9ZA 2MQNA 5DG7A 2EFOA 3V4IA 1D8ZA 3Q0AA 2HNDA 4N76A 2B3TB 4MKAA 2Z4PA 5HMXA 3RB4A 4ES2A 5DDRC 4PWDA 2CPYA 3W2WA 2LDIA 3LAKA 1OS5A 3G4SS 3DLGB 1JB0C 2O01C 1CPZA 4EZ9A 2RT3A 3RRHA 4GC7A 1XERA 2MKJA 2R2RA 5B08A 2VKRA 1Q8IA 3KTQA 5C42B 1X0PA 1K0TA 1L3UA 1S49A 3H98A 5A8WB 1L3SA 1WD6A 3RB6A 3J7ZT 2J9EA 1B64A 3HDSA 2RF2B 4JI2F 4A46A 4PQAA 4Z37A 1NZAA 3OVSA 1TKXA 4ED3A 4URGA 2R4FA 2KJVA 2NSCA 1WEZA 5KG7A 3HZGA 3BM7A 5F8JA 1WEXA 2DGVA 3CJ4A 1QAXA 2XMMA 5KFZA 3K8VA 2LLZA 4DHVA 2Q1LA 1Y5IB 2BRLA 3GV8B 3CCJS 4IUFA 4RLEA 2VZ9A 2EKYA 1SL1A 3N6NA 2VFUA 2PD1A 1JLAB 3HHLD 1U1PA 1UMJA 5EWGA 4NX9A 2PI4A 4RW7B 1SKRA 4F67A 4PUOB 4GC6A 1RISA 1UA0A 2MB0B 4HDHA 4IRKA 2HMIA 5E0OA 1HNVB 1VQMS 4AE5A 3N01A 1SKWA 3TOQA 4DL6A 1S9GB 1X9MA 1UEUA 3CWJA 4YY3F 2NZ4A 2MZ1A 4CZCA 1C1CA 2HRYA 1TK5A 3DU5A 1R89A 5F8NA 3FMWA 2OPSA 2Q43A 3MWBA 4B02A 3OFHA 1IBKF 4OX6A 2CQPA 1O0PA 3S7RA 1FVSA 2ABYA 4ED0A 3GWCA 1VBXA 2R7XA 3D0HE 2OFGX 1O5JA 2ZOFA 4DN0A 4C3LA 4O4RA 1S1VB 4QPXA 3DNCA 3PW7A 5KOWA 2CQCA 1NJYA 2EFQA 2C3MA 2Q66A 4NRUA 2RKIA 3VTIA 1P6TA 3CJKA 2GC8A 4J5OA 3PNIA 3SCKE 3CD6S 1QM9A 3MF5A 3OXFA 2KFZA 1VHFA 2A1BA 3BGUA 1SL2A 5G4DA 3PEJA 4QPTA 4MAKA 1QJHA 2VPYB 5BYRA 1YJRA 4ELUA 4IKAA 3PX0A 1LQ9A 1VJWA 3ETOA 4RW4B 2EFPA 4EYHB 3DHWC 2VG7B 4Q5VA 2IA6A 1S7HA 4M95A 3MHYA 4JOUA 4C8ZA 1UVIA 1OO0B 4OI4A 1KNZA 1O8BA 3E51A 4OLOA 4A8OA 3D2WA 4FF1A 2PIIA 4OX8A 3N28A 3SDEA 4WE1A 4HL9A 2RSQA 3CCSS 3UR3C 2ZE2B 4FVCA 4R5PB 2ZH5A 2ZDPA 4ECXA 2EFNA 4AXJA 2PSZA 4QR2A 3QGIA 1FTRA 2Z2LA 1T03B 2CRLA 4ICLB 3G6XA 2D9PA 3MM6A 2FJBB 1UL3A 1GAOA 5HBMB 3QIDA 4O23A 5KFAA 2ZDOA 1VQ6S 3HXMA 3E01B 5L38A 2AYMA 1U26A 1N33F 4N8NA 2KXNB 3HK2A 3RR8A 5GMKa 3G71S 3J7YI 2HAIA 2BUNA 2PC6A 4J9NA 2DNKA 3OHBA 3CDWA 3I4PA 3LH2S 4NLWA 5KFQA 2QIFA 4N56A 4YR3A 1LV5A 1Q78A 5T41A 3R1HA 3MXHP 2DNRA 1HW8A 3OTBA 3R5DA 7FDRA 5DG8A 1QUVA 2J8AA 4WZQA 5FJ4A 4ZPDA 4DV1F 3KLIA 3I6PA 3FSIA 1YIJS 2AP6A 3ITHB 2CKWA 2L9NA 4IFVB 3TAMA 5D6GA 1IXKA 3MM5B 2O67A 3T5LA 3PJWA 3RBEA 4ZPVR 2NQPA 4IG0A 2JEIA 1XMBA 4L6V3 4UUXA 2EFGA 5F3TA 3MFHA 4ZCMA 1RJJA 2FUG9 3WC0A 4ECVA 3VAKA 1SUQA 4J9QA 4IDKB 5K8OA 2FHKA 4CNYA 1NJWA 1C0TB 3KYLA 1FKAF 4DG1B 4RW8B 2DK2A 3D1QA 3QLHA 1LWEA 2CZVC 5KFPA 2WTFA 1NKCA 4IH6A 3AQOA 1VQLS 4C11B 4ZHRB 2XMKA 2XCPA 2RQMA 2BXJA 3HVTB 3OFFA 5A6PA 5HP1B 2KZZA 2DVIA 2KFYA 2AF6A 4TYAA 5G0RB 1MMNA 4OHWA 2EBEA 3TAMB 1JIHA 2EG2A 3WC2A 3HLUA 3NP5A 4OMFG 4TLQA 2QSFA 4M94A 4K4ZA 4DQSA 5D3GB 4C8MA 2BDPA 3EPGA 3RZAA 3SCJE 4WE1B 2XLIA 2VONA 2QA1A 2HS4A 3W2WB 2E5JA 5AE1A 4DG1A 4YUDA 1I6JA 4I2QA 1S0MA 1WELA 1S6PA 4CTAB 2KYXA 3AJ2A 3DI6A 3FRZA 4ED8A 3MMBB 2B7CB 2G1DA 4ZHRA 3M2RA 5EX0A 4JI1F 3I5BA 4CO3A 6FDRA 1N48A 1YG0A 3LF0A 4HLBA 4R25A 2E7WA 1YJVA 2MSTA 1RA7A 5MAOA 1VQSA 1KC8T 1QAJA 1JNZB 1H6KX 3PM9A 3JYTA 1JXLA 4B17A 1G6BA 1G2EA 1RTJB 3LGMA 5HMYA 5T14A 2DR8A 3HO1A 2KU7A 4RW6A 5D3GA 1FXLA 4L72B 2E5HA 3I55S 4NLRA 2KKHA 3ZZRA 2ZH1A 1K1QA 1DBDA 2EVZA 2QE5A 2ZKTA 2DH7A 3H2UB 5A8RB 3KNAA 4IOBA 5FDLB 1IKXA 4UW2A 3OTCA 1SXLA 1FRLA 1FRHA 4U9RA 1C0UB 2ZC4A 4B9MA 5LSOA 4KC5A 1VBZA 2HGNA 2MYFA 1FT8A 4PRFA 3Q8SB 2RRNA 4U7UK 5F41A 4ED1A 5J1NA 3PO4A 5LXRA 1MMLA 2HG4A 3FEXB 3WZ0A 1N8RT 4O3RA 2R7RA 1VQ4S 1SUQB 1GH8A 4IO1A 3KLVA 1Y7PA 3TARA 1YQHA 4F3OA 3SQGA 4FBTA 2KI2A 4B3MF 2NLWA 4DR2F 3HVRA 2NUUG 4WU3A 3RRGA 2MZJA 3AB4B 4LF6F 1QVGR 1CC7A 3M2VB 2LA6A 2CPZA 2MQLA 4KTQA 4Z2XA 2DCLA 2MY7A 5KFTA 3V6JA 4ECSA 5KT4A 2C3YA 3V2UC 2RMLA 2Z2MA 3NG8A 2GHVC 2O5DA 3MM8B 1SL0A 2GA7A 1JJHA 3DOKB 4KB7A 3HVAA 2FLPA 3HHNB 2OPSB 4J9RA 4W90B 3NCPA 1FNOA 4PXBA 3MEDA 3KK1A 1S6PB 1CQNA 1U09A 5T7LB 3BSCA 4U7CA 2WOMA 4F3MA 3KK3B 2IC3A 1VGYA 1AUDA 4H4OB 2ZM6F 1PO6A 1TUVA 2BM0A 2Y1RI 3QZ8A 4B9TA 5H1SV 1S9EB 2G4BA 2XI3A 3UD3P 2DGWA 2RVJA 3M6UA 2ZH6A 5E3RA 3IA0A 2BZ2A 4FXWA 2PEHA 2AJ0A 2P9GA 2DHGA 2F8HA 4ZVEA 5CD4H 4IR1A 5LXYA 3GIKA 1HFEL 3BO3A 4R0JA 5L1JA 4URSA 3NMRA 3LP1B 3G6ES 5GAEU 1H0HB 3FZ2A 3ULHA 1BQXA 1F60B 3F56A 3I4HX 4PWDB 2AJQA 3J80Y 1N0UA 2F3JA 3MM6B 4X4VA 5DGBA 2X1AA 5J2MA 1VQYA 1UAWA 1X4GA 1TKDA 4MIBA 1QVFR 3CD7A 4YB1P 4A8KA 4QU6A 2QZ8A 3L95X 3BGFA 3CEDA 3PW5A 2QA4G 4A47A 1IJFB 2N7CA 2CPEA 2W9CB 4H4KC 4FPRA 2E1RA 4YDXA 4I7FA 2HLTA 4DFMA 1CSJA 2E7XA 2KG0A 1CC8A 5K14B 4F4WA 5K8PA 4O4GB 2I38A 3W2VA 3H2LA 3O8WA 3EZ5A 4NZ0A 3V4MA 4ES1A 4I1TA 5KFEA 2YNHA 2KDOA 4PXEA 4DUZF 1JX4A 3BQ1A 1JJ4A 3QO9B 1D9DA 2FVPA 4CH0S 4OI3A 3PACA 4GMKA 4ZKAA 4N41A 1RYSA 4IFYA 3CF5Q 1JLGB 1KFSA 3UE2A 1KRPA 2FGCA 5CZXA 2CPDA 4DQPA 4QBUA 3PFOA 2AD9A 3CJ0A 3QZ7A 4K5SA 4QZVB 3Q8PB 3GIIA 1BWEA 3I5AA 4NOHA 3MUMP 4B9SA 3CC4S 2CPHA 4DV0F 5GADI 3BR9A 5L8RC 4QIWD 3DRXA 3CCQS 2E5IA 2J76E 1GTHA 5CH7B 1J5EF 4ILMA 1R0AB 2VG5B 3K8WA 3C6UA 3M32B 3BO4A 3OLBA 5LJ5Y 4F2SA 3K5OA 4Y65A 1HNXF 1T7PA 1F2GA 2HQ3A 3D0GE 1WACA 4IYQA 1PGZA 5BYSA 5DDPC 3HVTA 4ETZA 2JFKA 4HKQA 4ZPBA 1Z2ZA 3LAMA 5IT0A 1S1TA 3A8EA 2F4VF 2ZNZA 1IBMF 3LP2A 5ITHA 3PX6A 2M2BA 4JUZA 4X4SA 3U02A 4Y3CA 3MCSA 1U1QA 2WHOA 3ONQA 5J1PA 1NKBA 3PO5A 4USIA 3JSMA 2KVIA 4I2QB 1UJ4A 2JFDA 3DOLA 2B6AB 2C42A 2GMLA 3H5SA 2MKKA 2XMWA 4ZP8A 2HPUA 4ZPTR 2DRAA 3DLJA 1BQMA 2MHEA 2XNQA 2WW8A 2GO9A 1A7GE 2IJFA 3DRSB 1SH3A 3EGNA 3CUNA 4I2PA 2H9ZA 4NLVA 3MOZA 5CA5A 4TU7A 4N5SA 2RDJA 2JEGA 2UP1A 2CPXA 2AWZA 4PKDB 2APOA 1XTZA 1RT5A 3QGGA 1HQUB 3IRXA 3IRWP 3I56S 4B9LA 3HHLB 2J5AA 3KHGA 4BHQA 1TL1B 4IOCQ 3ENWA 2DNPA 3IAM9 1XBWA 4OI6A 4K4WA 4OQJA 3N4WA 4M8LA 4Y28C 2B9WA 3IGVA 2DD8S 2UZAA 4TXSA 5B0FA 2FJDB 4RZRA 3GYNA 2WSCC 2WBRA