2JSXA

Solution structure of the e. coli tat proofreading chaperone protein napd
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Protein napD
publication title Structural diversity in twin-arginine signal peptide-binding proteins.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03927 NapD NapD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jsxA01
4PCQA 2GQQA 2Z4PA 2E1AA 2VBXA 2CVIA 2VC0A 2ZNYA 3I4PA 2CG4A 2E7WA 2IVMA 2PN6A 2IA0A 2W24A 2EFQA 2P6SA 2ZNZA 2EFOA 2EFPA 2P6TA 2EFNA 2DJWA 2E7XA 2P5VA 2JSXA 2QZ8A 2VBYA 2YX7A 2CYYA 2W25A 1RI7A 2YX4A 2PMHA 2VBZA 2E1CA 2VC1A 2DBBA 2CFXA 2ZBCA 1I1GA 2VBWA
chains in the Genus database with same CATH superfamily
5D4PA 3VGTA 1T03A 4UW2A 4N41A 4I2PB 3H98A 1NB2A 3BBBA 5D4LA 3W62A 4CM0A 2CYYA 1LFWA 3KDNA 4QCLA 3GJTB 4C8YA 4N77A 4R0EA 2DGSA 1DQ9A 4NL5A 3ZZ0A 1FXLA 1KHWA 4ANDA 1FJGF 4DV2J 2Y9HA 2MKSA 3MURP 4OI6A 2WSCC 3MM9A 2LECA 1NRKA 2RU3A 1BUXA 4J9OA 4ZS6A 2HHHF 3IAM9 2QL5B 1K0TA 5E7OB 1HL6A 3OSNA 1ZM2A 4TXSA 1FFSB 1XK8A 9ATCB 4FVCA 1QTMA 3M6XA 3DXBA 1T94A 2JHEA 4C8LA 4MK8A 3QT8A 2E9ZA 1C0UB 2P2CB 3HZEA 3H4BA 1FJ7A 4LSNA 1Y3JA 1R8HA 3GIMA 4E98A 3LH2S 1RHRB 3CEDA 3PACA 2RDDA 4OLPA 2AHOB 3CMQA 4WIQA 2C2NA 1RTJA 1IKXA 3G8SA 1PJ7A 3HHDA 2WB4A 3EX7B 2SXLA 4IRDA 1DAXA 2WONB 4DR6J 1ZETA 1SI9A 4DL4A 4DCPB 4LRCA 4P10A 2GV1A 2ATCB 4CH7A 1WEYA 3I0RA 3DU5A 1W25A 1SL1A 4NLSA 3BH6B 4LVNP 3KLFA 3BZQA 4DV6J 1FNMA 2GIQA 5EUHA 2LA4A 4M5JA 1KFDA 1K0VA 1I3OB 4I2QB 3VGUA 2VC0A 3W5YA 2UUBJ 1AB8A 4D3GA 3PEJA 3G82A 4F7VA 1DJ0A 2WB1D 1FK9B 3WZ0A 2Q1LA 3MWBA 3LPEA 4ZVPB 2J76E 3N6MA 5SZTA 2XMVA 4Y34A 3PFEA 3C46A 1R31A 1F5CA 2ZDOA 2FYXA 3NRBA 1ZA1B 1VBZA 3K5PA 2FZKB 3DRRA 5LOQA 3BREA 3R5BA 4DL7A 3OJUA 1G4CA 3N01A 1OIAA 2Z56B 5LXRA 4MK7A 2NUHA 4RW7A 1CJUB 3GYGA 3R5AA 1MU2A 4FVMA 1O6XA 2CQHA 2K2PA 2CJBA 3R2CJ 3QRQA 1IM4A 4C2MA 2GX8A 3UDEA 1UFKA 2NUUG 4DG1A 2RDJA 3HVTB 1K47A 1S0VA 3NG8A 2VC1A 1DTQA 1FCAA 3MPYA 3D6TB 5I4MA 1N5VA 3CCTA 3QRRA 3AXKA 3U1MA 4ZVEA 1CSJA 4DOZA 2CQCA 4Q8FA 3M30B 2W9BB 2VODA 4YR0A 4FBTA 1RT6A 1SC4B 1UEKA 1NBEB 1WSVA 4J5OA 2C3UA 5ETMA 4WP9A 1YJNS 1FX4A 3FZ2A 5KFVA 2JRSA 2VA2A 1FRIA 3CJ3A 2ALYB 4U67Q 3O3LA 4ZN1A 2DXEA 3HJFA 2VQFF 3HPOA 4QYZJ 4K4SA 3Q8VA 4NI2B 3ZXWA 2XZWA 2Z2LA 4U6PA 1SH0A 3PJ9A 2D1CA 2VBXA 2R7OA 1TZ0A 4QW9A 4J7CA 4KHRA 3J80U 5HLFB 3FZBA 4RUCA 2W25A 4ZCMA 2BE7D 5EX0A 4ZVQB 4ZLLA 3BGLA 4X4QA 1C4AA 1M1GA 1VJWA 1WC1A 1SCJB 3T9ZA 2QV6A 2NCKL 3QGIA 3MCNA 2OGUA 5IM0B 3LQVA 3N6NA 4PAAA 4CLFA 4KRWA 3RBDA 3RW7A 3AT1B 2YWFA 2CJ9A 5I42A 2HQDA 2Y8YA 1W7WA 3Q8RB 3KLIB 4WFBQ 2KZZA 3TUIC 2E9RX 2WBRA 4ECVA 3CGIA 2XMJA 2PA8D 2Y1LB 1TVRA 1D1UA 2N7YA 4ICLA 3PNIA 1NDCA 1CPZA 2HZCA 4LT6A 4JOUA 1WJ9A 4DQIA 1H6KX 1N0UA 3HDSA 3MECA 2VU5A 2ZVIA 4C3LA 1RT4A 4ZVFA 4ZCIA 5CD4H 2V50A 3BR8A 1IBMF 2GJFA 2DNLA 3TUZC 3DKDA 1KC8T 5A6PA 3D68A 4EYHB 1U0HA 3V5RA 4AE5A 2GAHC 1DQ8A 1UTAA 2XS5A 4QWBA 1UVMA 1WF2A 3VAGA 3C6UA 1S97A 2DY9A 2XYGB 2LKZA 2ZH9A 5HP1A 4KO0B 3E51A 1BHNA 3F44A 2MKHA 3M1VB 1NJZA 2EWHA 4JI0F 2PN6A 2UUAJ 2EFQA 3M8SA 4OYOA 3N0VA 3E3XA 3Q83A 2DPIA 2BANA 2AJ1A 3SDEA 2K3KA 2BKOA 2YQ0A 3KYLA 1JB0C 1IUJA 1HMVB 5CZVA 3NGDA 1DQAA 2KRRA 5KG7A 3BO4A 2RQKA 2RILA 4K7QA 2WVEA 3OTBA 5J1PA 4MIAA 3C14A 1ZZNA 1YJVA 5LMNJ 1BQMA 1OY6A 4F4XA 1XWLA 3LF0A 4IG0A 2ZJRQ 4K0KJ 1SL2A 5C25A 4ZK7M 2L48A 1R8BA 2EPIA 3OVBA 1PBAA 3W9JA 1WUUA 4C48A 1VOMA 1OQ3A 2LDYA 5AE3A 2EKNA 3KXDA 1RHMB 3AOAA 3FBFA 1NU4A 4DBQA 4NA1A 3CJ4A 5K9FA 3ILJA 4YB7A 2EXUA 3GU0A 5LSOA 2W2MP 2FJVA 1GEHA 1YX2A 2VF3A 4ILLA 2LQ5A 3U27A 1FEEA 2RU9A 5RUBA 5E5NA 5GADI 4X84A 2Q3PA 2BJ7A 4B9UA 2COLA 2ILYA 3GP9A 2V4RA 1VQOS 3WC2A 1Y5IB 1J5EJ 3HF5A 2PMWA 4QIVA 2VOOA 2DK2A 2F9DA 2ZBIA 3M4XA 5B0EA 3PIOQ 4NYOA 1OO0B 2KN4A 2V6AA 3Q89A 5F3TA 1R6YA 2CJYB 3LUYA 3Q2SC 6FD1A 1FE0A 2MGZA 3R7SB 3H40A 2XC9A 2VPWB 3UD3P 2VFSA 2IVMA 2I6WA 4X64J 2AP6A 4IQXA 2P6TA 1ZTTA 3W2VA 3NOCA 2ACMA 3IWLA 4JBCA 1XC9A 2MQLA 4A8OA 4F25A 2K7JA 4DR6F 3D2WA 3K8WA 2HQIA 3NY0A 4USVA 3LANA 3WC0A 1WEZA 2XSJB 1SV5A 3EGNA 1UFLA 1F5BA 2BEFA 3Q0AA 1M90T 2VUGA 4DV6F 4KSEB 4S0MA 2MJUA 3R6LB 4PXDA 2BE2A 2HFNA 2BR0A 3PEHA 2GIRA 1GH8A 1Q8LA 3IRWP 2WCXA 1TL1B 4ZVSB 4CLWA 2UUBF 1KEKA 3DLLQ 3PX0A 1TKTA 3ILOA 5J2NB 2C3OA 5D77A 1TUVA 1CJTA 1WKKA 3DM2A 3D67A 2L9WA 4LRFA 3N6LA 5J2QA 3QT5A 4I69A 4MJKA 2HMIA 3UW1A 2A6MA 4ECRA 5J2PB 2KHCA 3A13A 3OR2B 3GJRB 2RIJA 4PXCA 4EZ9A 2DR9A 3NS5A 4NZ6A 2AW0A 2NQPA 1RABB 2AYEA 3GSDA 1RT2B 4MMOA 2HIQA 1EQ0A 4FYVB 4CTAB 3W8GA 5K14A 2GMJA 4KKOA 1T11A 2NS1B 1OY9A 4YEAA 3CJ5A 1E6YB 2HLUA 4A8KA 4QBUA 2IDLA 2G1HA 4FF4A 1DLOB 3QBCA 3PDNA 5GAGI 4RW6A 1UW9A 4PUOA 2ACYA 1VHIA 5T7LB 1NSQA 3P96A 4DV1F 1DY3A 1U48A 1RWWB 2LQ8A 3PW5A 3BQ2A 1RT3B 2GZOA 2DNHA 4FXVA 4UTGA 1BQNA 1VQMS 3EGWB 4JI7J 4O3OA 1ZTWA 1MWQA 3KLGA 1FKPB 3CO9A 4USKA 2OI2A 2RH3A 4C0BA 3DGVA 3CTRA 4OV6A 3ZZYA 1CULB 2ZH3A 4Z7YA 2HFOA 3CSKA 2D41A 1UJ5A 4O44B 1SKSA 1T9TA 4JI6J 4KBIA 2IVYA 3K8VA 4Y6IA 5LSRA 1AZSB 4HACB 1MMLA 5M2PA 5IT9Y 5KT7A 1H38A 2Z58B 3HT0A 4ER8A 1TL4A 1B3TA 5B0FA 3BSNA 1G6BA 4QIGA 3SCLE 2OIHA 4DSIA 1F60B 4DUZJ 3BYRA 3OHAA 5L8RC 3BO3A 3CCUS 5AE2A 2IRXA 4N8OA 3MEEB 4OZJA 2EI5A 5F9NA 3W60A 2W2QP 1QSSA 1RT5A 5ETQA 1N48A 5D0EA 2QIFA 1VK8A 1HI1A 1HWIA 3O5TB 1SQFA 2C42A 1T8EA 1DRZA 2DRBA 4C8OA 4QW8A 3OLBA 5CCMA 3NMAA 2IJNA 3B6BA 1XMQJ 1Q7LB 5I3UA 4RPFA 3N79A 5GAHU 1AXQA 1Y4ZB 1GMWD 4PG7A 2NXJA 3QQCD 4X4PA 3PR5B 2RQ4A 4CO4A 2ZBCA 3ENWA 2PI4A 1HPZB 4OYIA 3R5JB 2APOA 2OMOA 2NLWA 3LP1A 1FVQA 1V9OA 2UUAF 4MFBB 3C16B 2AF6A 1AUSL 4EWTA 4HLBA 3AJDA 4LQ3A 3E01B 3WDOA 1NK8A 1HNWF 2FJEB 3WX8A 1U1QA 4C3KA 2BA9A 3C15B 4DLGA 5KG5A 3DMJA 4M5GA 2GGPB 1O8BA 3POTA 3HO1A 1RI7A 1ULRA 2CDQA 5CYMB 1RADB 5DQIA 1PJ5A 2HPUA 3EUNA 1J5OA 4CWBA 4CLTA 2AX0A 5LMNF 4PYAA 2DGOA 2E66A 2QL9B 4K0KF 2WAQD 2K06A 3MEGA 4ZA1A 3ZTSA 2UZAA 4P73A 1LWCA 1XMOJ 3AQOA 1F2GA 4K4WA 4PYDA 5ETNA 2CQ0A 4IFYB 4RL1A 3K7RA 1VQ8S 3UR0A 2W8LA 5ETSA 3KWMA 2ZH4A 4ANCA 3HZGA 1VRQC 2VH7A 4EYIB 2PGCA 3PZPA 4PEOA 1S6OA 4WKRA 3M8QB 5CYJA 4OJ3A 4LSLB 3Q8PB 1R3NA 3FKBA 4ZHRB 1REVB 3VGSA 3GIRA 4IOAQ 1S77D 4FS2A 3F56A 3T5HA 1KDNA 3IM8A 2LEBA 4KE5A 5D78A 2VASA 2R8IA 4L3KA 4U96A 4GKJJ 3W5XA 3NOGA 3UDVA 1PAEX 4F0HA 3NCQA 2YNIA 3ET6A 4O3RA 3CWJA 2EFPA 1J5EF 2MQMA 1Q4RA 3PO5A 4H4MA 4DS4A 2Q79A 2FLPA 1N36F 2F7VA 2DCUB 5FIIA 3CMAS 1HYSA 2LP4A 5EGYA 4X64F 2HVDA 1YIJS 1YJWS 2Z8QA 4USIA 2RUGA 3TR5A 5KFLA 1KP6A 1WC6A 2A3JA 5CHCB 3TNVA 1W26A 2BE9B 3R1HA 1TL3B 3QAUA 2OJ3A 2BJEA 1VCTA 2VHGA 2AEMA 1R27B 2EBEA 1T05B 5DDQC 2OH2A 3OPKA 1J27A 3C8YA 4KH0B 3CCRS 2MQOA 3ZZPA 4Q43A 4IO9Q 2Z2ZA 1FRMA 4DL6A 2V8VA 4NLGA 1HQUA 5J2MA 2YY3A 5IQQA 4M1KA 3BGUA 3CCMS 3HX9A 4N7TA 3DLHA 5BYQA 2QG9B 5F8GA 1VMBA 4OL8A 2OD6A 4ZP9A 3MPWA 3A1YG 2HHVA 1X0FA 2XO6A 3UCZP 4TLRA 4G3IA 3U1LA 4DHVA 1D8YA 5KFSA 4TY8A 4USWA 2CPJA 4M5DA 2MZQA 2Q6CA 1IR2A 2J9DE 2MKCA 5JVGQ 2DGXA 1ZS6A 2UUWA 2HHUA 3A3OB 5I3QA 1XBWA 4PXBA 1DARA 1DHMA 2QO3A 2WW8A 2EFNA 1Q86T 3CW2C 4OYMA 2YX4A 2Z30B 5CYQA 1LWFB 1SC6A 2P8IA 2G4BA 5DETA 2IFXA 5KFNA 3W63A 1SBRA 3RBEA 1ZA2B 3ZZOA 1SJQA 1M5VC 1HFEL 3EPGA 4DSFA 4F4WA 4JI7F 2LXFA 4V19X 2UXCJ 1U6FA 3IBCB 3KJFB 3UPFA 3RB0A 3D3CJ 2DYAA 4DCJB 2QN6B 2VG7A 4JI1J 5HQMA 1KBRA 5DG7A 5LMUF 1G3OA 2PEBA 2IRUA 2J8SA 2KJVA 3CUNA 3HI9A 4DR2J 2BRKA 1TKZB 1XTZA 2CPDA 1AYEA 3BV8A 1IKYA 4GVBA 1HBUB 4NYZA 4KFBB 4HTIA 4OIXA 4JI6F 2QFJA 3J81U 3VALA 3MFHA 2WTFA 4CT8A 1JLEB 3PYFA 1Y5LB 1LNQA 4OQJA 4XK8C 1HQEA 1ITPA 2Z4PA 1V3SA 2R7UA 4ID8A 3US5A 2DR7A 1RWPB 2RAQA 4CNZA 5HROA 5L9NA 1LW2B 2QA1A 1FE4A 2E5LJ 2A2CA 4NE9C 1VLOA 4DUZF 2A10A 3CE8A 2OO4A 3F73A 3M9NB 1VISA 3TAQA 2JZ5A 1MNEA 1MROA 1GX6A 2RT3A 1SUQB 5A0YA 2R2TA 4R8UB 2V8GA 3ZTRA 2V8DA 1B99A 1TV6B 1QLNA 4L73A 3MAHA 2W4PA 1R8PA 1D09B 1V5VA 1S9EB 3KLEA 2ILZA 4X4RA 2J8AA 4DL3A 4Q0BA 3Q2TC 5KG6A 1IN0A 1NSPA 4F50A 5KG2A 1FD8A 1UVIA 1WKJA 3M2UA 1G7CB 4E8UA 4HI1A 1JLGB 3S1TA 5GAEI 3PIPQ 1FI4A 4DCOB 4TY9A 1X60A 3ZZUA 2E29A 1JLCA 3CDAA 1ZZFA 5DG9A 2DISA 1V5IB 1NDPA 2J6SA 3VVTA 4MYUA 3QYYA 3U7JA 3ISND 1O5JA 4WF9Q 4RW4B 2CRLA 4LF5J 2GVZA 2YNFA 2QTWA 4I67A 3OVSA 4ED3A 4KPCA 2HK2A 2CKWA 2WSFC 3WHIA 4NLOA 1PO6A 1RTHA 4GKKJ 4LBHA 5FDLB 3MMJA 2GMLA 2LEPA 2HNZA 4PWWA 1FKAF 1Y00A 1XMOF 1RGVA 4LVOP 4KV8B 3MMBA 4AL5A 3NBPB 5KT6A 2IBOA 4ZLJA 2R7VA 4RW9A 2R2RA 1PILA 1IBCB 3TZYA 2DNYA 3S6EA 3MEKA 2YKNA 1YKWA 2G2ZA 2R2UA 1UP1A 3OT9A 1BLUA 2ZJPQ 1QUVA 2DXDA 4FF3A 1U1MA 1VIXA 2VJUA 4DEZA 2D3OR 2HNDA 4ZVUB 3CCWA 1VQ9S 4GKJF 4ZIWA 2AZ1A 3P8BB 3QLHB 3R1LA 2J6UA 3DU6A 3ENQA 1HBOA 4HYKA 4CO5A 5E2QA 1S99A 1X4CA 1M5SA 3RB6A 4OJGA 1MMNA 2VG5A 4K4YA 4R0JA 1NHUA 1X31C 2DNGA 2WOMA 4Y2MA 4IOBA 2DJWA 3ILIA 3MR6A 1Z2LA 1LXNA 2DGQA 3CCES 1HI8A 4ECTA 1K8AT 3BSOA 4OJHA 2G1DA 3IO1A 4F4KA 3ZC4A 2MZJA 4B9NA 2B6AB 2CVIA 4GO7X 5ITHA 3HHEA 2BJ9A 3KMSA 1NSAA 3R27A 2BDPA 2V67A 1GK8A 1N54B 1QE1A 1C1BB 2V69A 4B9MA 1EX8A 3HMJG 2UUCJ 5ETOA 3SQGB 5C7PA 2FLOA 1X9WA 2IA0A 3DHWC 3VTIA 4DPXA 3A12A 4FF2A 5KG0A 4X62J 4RNNA 2XNQA 3K5NA 2FVRA 1YQHA 1S48A 4NCGB 2RVJA 2HQFA 1NPKA 5A76A 4NLUA 2C3PA 2YX7A 2XMWA 4C8ZA 2D9OA 3DRSA 5BR8J 3CDEA 4USHA 3DOKB 2RS2A 4DUYJ 2EC0A 5G0RB 2J7KA 4AXJA 2KTQA 5KAKA 4I6YA 4K2XA 4YOEA 5GVQA 1SPBP 3RU0A 2NXCA 1H74A 2OSQA 2V4JB 4WFNQ 2CAJA 1SJFA 2G2OA 2YKAA 2DO0A 5K8OA 1HBUA 1EP4A 1TFYA 1K1SA 5C2CA 1CJKB 4Y28C 3CF5Q 3MCMA 4RW8A 3OFGA 5KFXA 4B3SJ 2KXNB 3QO9A 1UJ6A 4OZ5A 1AUDA 1QJHA 1RTIA 2QYCA 3RZAA 4WFAQ 1RTDB 1KQFB 4ZIVA 2V4QA 1N5TA 3UCGA 4J90A 1JLAA 2V0NA 5C24A 1FKOB 3MI7X 4X66J 3OUYA 2YKMB 2BQ3A 1SJ1A 5KFOA 1NXIA 2FJBB 2HNYB 4LR7A 1N52B 1L3SA 4JI1F 3UQSA 4HHUA 2ZZNA 4R25A 4ZPWR 3UNYA 2BYCA 3NGSA 4DR2F 2X3GA 1KKHA 3RJMB 2KVQE 4ES3A 1XMBA 3MM8B 2JVOA 3SEOA 4LSZB 1YZ6A 4ED4A 4P75A 1LW0B 2HURA 4YR3A 1LKZA 2EFVA 1TK0A 2CNNB 4J9QA 2JH3A 4Y2AA 3EZ5A 1TFWA 1SH3A 5ETLA 2E5LF 4I4BA 4MKBA 4WFXA 2H51B 3MAQA 3LWMA 3HHLB 2HBRB 1T9WA 2W7OA 4YY3J 1KOHA 3KLHB 4LF7J 2I9SA 4F3QA 1H72C 3BGFA 3I6PA 4NLWA 3TZZA 1WC4A 3KUHA 4BDPA 4Q44A 3EVWA 2UVWA 1G2EA 5LT5A 1YRUA 5E0OA 1DTTA 2XWYA 3CDUA 2XM3A 3ICLA 2HHQA 1XEZA 4DR5J 3NNHA 4DR7J 1RAEB 5L9XA 4LUBA 2QA4G 2ZNZA 2N3LA 2P9CA 1Q53A 2XCAA 1SJ3P 4I68A 2QE5A 4X4UA 2FLLA 2AIRB 3CJKB 1FRKA 2C3MA 4QJVA 3D7SB 4J9PA 3QWPA 4QIFA 3MXHP 2ZM6J 3OTCA 1X5PA 3AD9C 2G13A 3GYNA 1WC5A 3H8YA 1TKXB 1VQ4S 2NR0A 4XIUA 4ES2A 1HNIB 3BSAA 5T41A 2HS4A 4BC9A 4CZCA 1FERA 1VQ7S 1R0BG 4L76A 2Y1IA 4OFZA 1RT1A 3B4MA 4GKKF 2OUGA 4P72A 2BM1A 5L39A 3ONQA 4IR1A 4A8QA 3I4PA 1VRTB 2XNRA 3TA1A 2UV8A 4FN5A 4ZP8A 2OPRB 4TU7A 1F9EB 5U47A 2B3TB 4NCBA 2OP5A 3K57A 2GC8A 1DBDA 2LLZA 2J6TA 2G2YA 3FNNA 2B7CB 3I0SA 5A8RB 3N28A 1E6VA 4DJBA 2HHWA 4HKQA 1EAYC 5MAOA 3JSRA 4N8NA 2WK4A 3SXLA 2H65B 8AT1B 5J1EA 3P49B 3P3DA 1SKUB 4ZP6A 4DR1J 3MM7A 3IRXA 5KFPA 2KU7A 4EGLA 3JYTB 3D1OA 4EO8A 3EVOA 4NX9A 2JC0A 1Y7PA 2KG0A 3ITHB 3DRPA 5DGAA 2HFSA 5F8HA 2FVCA 3SYZA 2VDIA 4DPTA 4W92B 3D1HA 3MR7A 4ZLNA 4O4GA 3T1HJ 1JKHA 2D3ZA 1P9QC 3BGRB 3NL0A 4XTTA 3TJ9A 3T1YF 2V9WA 3SFGA 1IQZA 2XMUA 1X9MA 3KNGA 5E33A 1KTVA 2VV5A 2YKPA 1RLCL 4WK1A 1HNZJ 3DLKA 3UI3A 5DZ7A 4YR2A 4DF4A 4RBUA 2KFZA 2NXNA 3UWTA 2BJDA 3NWRA 1F9HA 1VQLS 1JQGA 3IR5B 4LIWA 1N6QB 3V81A 3PW7A 3AH6A 4DF8A 1S0NA 2F4FA 2RS8A 1JLFA 1MG7A 2UUCF 2YNGA 1NK5A 1L3VA 1RTZA 2IPOB 4HT5A 4H4KC 1D9AA 1ZH5A 5IC4B 1L3UA 5AT1B 3MGJA 1KN6A 4F2RA 3A3NB 5GMKa 4GMKA 4X62F 1NK0A 3H25A 4J9KA 3UDLA 3DYAA 2AX1A 4YDDB 2CQDA 4DDFA 1F3FA 5KFWA 3T5LA 1H2TZ 2X1FA 2RF2A 5BR8F 4OI3A 2OFHX 3I55S 2W2OP 4M5KA 5HANA 4EMDA 1BMQB 4DUYF 1S5ZA 1YG0A 2LMIA 2HBQB 3GCWP 1UWBA 1T0TV 2ZHBA 3GONA 2KKHA 5BYRA 1MMDA 3PR4A 3GLJA 4DFPA 1N32J 1TAUA 3PYDA 2IAJA 2GJ2A 2LU2A 2ERRA 4P7TA 3H2UB 5GAHI 1S72S 2U1AA 3EDRB 4M63A 1S1VA 3BDEA 1FTRA 2JL9A 2M52A 5ETRA 3TYTA 3D3BJ 4QR0A 4ITSA 5K8PA 2HVIA 1U2CA 5IFMA 3MMAB 1RHJB 2DRDA 4DSEA 2EBGA 1LWEA 5E3AA 5GAGU 4B3SF 2P5VA 3OQ2A 4O3NA 3LTOA 3PKMA 3TJ8A 4USMA 4EZ6A 2JEGA 1UZHA 1CEZA 3W2WB 4C7QA 3TO8A 1HBNA 4USUA 2BW2A 5KG3A 4F26A 2I5JB 3NCPA 2LDIA 5G4DA 3AQPA 2DY1A 1NB7A 3KTQA 5HN0A 1PAUB 4B3OB 1FTCA 4DFJA 2H1YA 2VBWA 3BQ1A 2LCWA 4X66F 2QSFA 2RKIA 4C8NA 2FY8A 3PCOB 2P9EA 1Q0NA 3C6TB 5L1IA 2E5JA 1JWWA 2FVQA 4C4WA 3FMWA 2B0GA 2HWHA 4IRCA 2XMKA 3CCSS 4X4NA 2QFIA 2D7SA 2ZUGA 2QA2A 2K1RA 1TR0A 2ZE2A 1M5PC 2B43A 3SSSA 3W8PA 1B0VA 5DG8A 3KMQA 2X1AA 2MB0B 2AT1B 4O4RA 2BJ8A 2ABYA 2DITA 4EFAC 5LL6d 2PFFB 1OPIA 5F0UA 5DDOC 1OPZA 2M8HA 3M9MB 1HHQA 4C0OC 4EO6A 2ATLA 5AXKA 3FRZA 3CJQA 1ROFA 3LGMA 1OYEA 3VV2B 2AJ0A 3RGIA 4LF7F 3PRVA 3H5XA 4CLKA 5AJ3J 2EVZA 1RWVB 1B7YB 1YJ7A 3M8RA 1PGZA 4H4OB 4OZ1A 4AXIA 3LP2B 2MHNA 1RT7B 1HNVA 2E44A 2RD5C 4F8RA 1FDDA 4E0DA 4IFVB 1TP7A 4MYTA 2ZUAA 4B9TA 4DR5F 4DR7F 4P7VA 2W9CB 2ZWOA 4JV2A 5BYSA 2MQNA 6FDRA 2F8HA 4RU9A 3CD5A 2ASJA 1IXKA 4ECWA 2MXYA 1YSJA 2V2ZA 3DOMB 5KFUA 3H42A 2ZM6F 4AL6A 2V2VA 3JSBA 3JSMB 3T5KA 4DL2A 4DV3J 4Q2MA 2ZKTA 1M5OC 2OPPA 3QIDA 2LFVA 1HHTP 2KM8B 2HGMA 3UVJB 2FQQB 3MD1A 2Y1JA 1GMWA 3MD3A 2LU1A 4I56A 4CO0A 3GG0A 4ZPCA 4O0IA 4PG4A 3KK2B 1Z2ZA 4WIIA 3PTWA 4EBDA 2YXLA 1HI0P 3MOJB 2JX2A 2DPJA 3SCJE 1Z1ZA 2PDAA 1FX2A 4OX7A 4XO0A 4LBIA 3IS9B 3PG9A 5SUHA 4YB1P 2XYHB 2WSEC 3M2VA 1S6PA 1QAIA 2NPFA 2QLJB 3EJMA 4ED1A 3FEYB 3L95X 2ZFHA 4I64A 3NGUA 1IKVB 4B3MJ 2BM0A 4R5PB 1V3RA 1XN9A 4K50A 2G0JA 4DPOA 2F63A 1IKWB 1FDAA 3Q23A 5KFGA 1X7VA 4HHHA 3KHGA 2J9CA 3DI6A 2NSCA 5C5JA 2BZ2A 3LAMA 2VQEF 1VFJA 2GJIA 1S10A 3V6DB 1S1UB 3M8ZA 1HA1A 4ELTA 2V94A 3N9UC 3M2RA 2GVDA 3DGPB 1IWAA 3P4UB 1RK8A 2DO4A 2CA9A 3FEZA 4F3OA 1JLBB 4X4SA 2KXFA 3KK1A 1IJFB 4LRAA 1HNZF 3VZIA 2J9DA 2W4DA 4LF8J 2CPFA 3G96A 4FKYA 3EGZA 3IBFB 4ELUA 3KJVA 1X4DA 2B9EA 3IFEA 1WHXA 2CVEA 2FPHX 2BABA 2P6SA 4U8YA 1X9SA 4P2FA 2B5JB 2CZVC 2ZHOA 1I1GA 2GQQA 1JLQB 1X8DA 4XAKA 1IBMJ 3H2VE 1A9NB 3EWGA 4URGA 4PWDB 5MLCV 4OYBA 2ZD1B 4PPZA 1KONA 4CNYA 4GC6A 4I6WA 2HIYA 2R2SA 4H54A 3IA0A 3O44A 4CLPA 3GV7B 1ZOTA 3BBCA 1S1WB 4KGMA 1F6TA 1N32F 1ZPVA 4PKDB 2CPXA 1U47A 4F67A 4JI0J 4DPYA 5F0WA 4M5NA 1H98A 3AODA 2RRNA 2QC3A 1PKUA 1X4EA 4U9RA 3ETMA 3MMCA 1RISA 5LXYA 4RBTA 2QZ8A 2IC3B 3TI0A 4CLUA 3CCJS 3X1LB 1NCLA 3IP0A 2XI3A 2M4MA 4DV0J 2R8KA 3QGHA 1S1XA 3CJ2A 3T6BA 3UN5A 2GFFA 1TKDA 3FVYA 3L9ZA 1CS4B 1T95A 1KRPA 3IR7B 4Q8EA 3BDPA 5ETVA 1RBOB 4ED0A 2FB0A 1D3WA 2MLYA 3TAMA 4Z37A 3PYEA 1WHVA 4OI2A 4NLRA 2A18A 1QAXA 4G6VB 1R0CB 3CO0P 4OHXA 1N5YB 1HARA 1FHTA 2L9DA 1KVJA 2XBPA 3R6GB 2DB1A 1OWXA 3MM6B 4EUVA 2E7WA 1Y10A 5K20B 2DNKA 3IG1A 4QR1A 2OPQA 3EM1A 2HYIB 4PQUA 2FIUA 3KHRA 4ZPDA 2IDEA 1UKUA 3ZNUA 2GNKA 1RHKB 4RNFA 3HK2A 3PO4A 2NXEA 2CG8A 3RBXA 3JSYA 1GAOA 2YNHA 2MQQA 3OL8A 3P45B 4C11B 1N56A 2PD1A 5FD1A 2JEJA 2CQGA 2RDIA 1BD6A 2RMLA 3JTNA 1X4GA 3PHEA 1HQ2A 2GA7A 1H2UX 1X4AA 2PMZD 2E7VA 4IYQA 4CH1A 4DU7A 2UXDJ 1Q78A 2F8EX 2OLWA 3H7HB 4BC7A 2M9KA 1NJWA 5CQGA 1C1CB 4EBCA 1R0AA 5D3GA 4N5SA 4LFAF 3NGRA 4IG3B 3TARA 1W2IA 3J7A1 4CYUB 2B8QA 1EETA 2QLWA 3W1YC 4A47A 2OD4A 1U2FA 1HWUA 5AJ3F 4DX5A 2VFUA 1QAJA 2R7XA 1RE1B 4WE1B 1C0TA 1T9UA 3FFIA 1NK4A 2X51A 1Q82T 1JXLA 1OYDA 4BHQA 4FZVA 1UVNA 1S9GA 2CQIA 5GAEU 3BN7A 4USJC 4ECSA 5GMEA 2XLJA 3G2XA 1YDLA 2E1CA 2AWZA 2BOPA 4ID5B 1LFPA 4G1PA 1U1RA 1U45A 3CD6S 3QFHA 2OPSA 3G6VA 2KO1A 3NEKA 3AA9A 3FGVA 2XCPA 1B64A 1ZM3A 1U0SA 4DV3F 1NK7A 2W2NP 4DWIA 2A1BA 4I7FA 2WHOA 3QIPA 2H5IB 3MAAB 2C28A 5JUMA 2HFUA 1IR1A 2HVZA 1XJWB 2PT0A 3QAEA 3OL9A 3UCUP 2YX1A 3A3PB 1RWUA 4NA3A 3DDIA 6AT1B 3LAKA 2O66A 3GILA 1U2RA 5HK4A 4JV5J 2IYGA 2R9LA 2E9TA 1SQGA 3M8PA 2YKOA 2BRLA 2QRRA 2IRYA 2KVIA 3BKFA 1M5KC 3K59A 1WDTA 3ENVA 1CQNA 1HBMA 4FP9A 1P1LA 1WWHA 2CQ2A 4CLLA 1HW8A 4B3MF 3CCLS 3LO3A 4F02A 2BJ3A 1UMJA 4WFZA 2M7SA 3BR9A 3KG4A 1HD0A 1PSDA 3PKYA 3V6JA 4DV1J 4NYPA 4ED5A 2HLTA 2KL8A 1IJEB 1NKBA 2MSSA 2DH9A 2R3VA 2VG6B 4Y2KA 3HCXA 4WPAA 1GXLA 1RQ0A 7AT1B 4WU3A 2DNZA 4Y3CA 2R7TA 5L1LA 4KIAA 1RWOB 1JIHA 4LF6J 1U09A 2L08A 3LP0B 4OX9J 4WXWA 4UOFA 2Y8WA 1Y11A 5KFJA 2QJ3A 3M32A 1WF1A 4ETZA 2D9PA 3DOLB 2Y0BB 4UY8T 1OSCA 1R89A 1JNRB 1S1TA 2F4VJ 3MM5B 1Q8IA 2CQ1A 3VF0B 2ASLA 3GFYA 2FHKA 4TQRA 1CJVA 2M88A 3TQEA 3MUVP 3DDKA 3TUPA 4AFFA 2VKZG 4LF8F 5A8KB 2XY6A 4ZVHA 4G1QA 2HFVA 2FC9A 3MEDB 4B3TJ 3D0HE 4AD6A 2PEHA 4B02A 4LREA 2KT2A 1TTHB 3AB4B 1KLMB 3ISZA 3C19A 3H59A 2WVCA 5A8WB 4QYRA 5ETTA 4V1Ak 3TA2A 2M70A 2QSWA 1H7XA 1VC5A 1VRUB 3WX4A 4I2PA 3C2PA 3HHNB 1GX5A 1RB0A 1U8SA 3MR5A 2BVZA 1U25A 2J0XA 4IQMA 1A6LA 2CIMA 1NLKL 4C98A 3DC2A 4DXLA 1CBKA 5KG1A 4P9SA 1TL7B 5HI7A 1S7HA 1B4SA 4J9MA 1HWKA 3PJXA 3VR1A 1XERA 4IR9A 1KNZA 5EWGA 1URNA 3H5UA 4ENOA 4OZ3A 4DZDA 3SFUA 2WRMA 2X1BA 1Q8BA 5L1JA 3VVUA 4LRBA 4KHMA 3HLUA 3KK3B 5EN1A 3J7ZT 3AJ1A 1LK7A 1ICEB 2B4PA 3AAWB 3OR1B 1HNWJ 1DFDA 4NEZA 2XY5A 2FJWA 3VGVA 3WBZA 1X5OA 2HAIA 4DV0F 3M6UA 2W24A 1C0UA 2GS8A 1NAQA 1GFWB 4DN0A 4RUHA 3CJTA 3FSYA 3CULA 3H2LA 4MTPA 1NKEA 4KGVB 1NK9A 3TEHB 5IXUA 4RKUC 2DGUA 1H7WA 1FRLA 3PRBA 2VONA 3DLGB 3V4IB 2WONA 3BN4A 1KHVA 3R8YA 1IVZA 1EZZB 3D9BA 5F41A 2CNLB 3R5CA 1RU2A 4OZ2A 1FRJA 1SKRA 3GYXB 2C2KB 2XGPA 2O01C 4WCEQ 1WKLA 2JVRA 2YH1A 3OVAA 4I2QA 3THPA 2NZCA 2FHJD 1FK9A 2ZH8A 3MPDA 3K58A 3L7PA 3VQTA 3R9LA 2AU0A 5B0BA 3G4SS 2UVUA 2UXDF 4M95A 4CI0B 3B8HA 3WIVA 4AYBD 1N36J 4QPTA 4LF1A 4W4MA 2CQ3A 1CJUA 1N5QA 3L7UA 4MKVA 3ZTQA 3GFXA 4Y0FA 3RB3A 1LV5A 1CLFA 3TVZA 5HQ8A 3DLEB 3KG1A 1RWXB 3CVKA 3HVTA 1HR0J 4NLPA 1WHWA 2NYHA 3M30A 2W9BA 3N5BA 1CVJA 1V6HA 3SCIE 5LM7E 4X4TA 1WELA 2FVSA 4RX6A 3TA0A 3PHTA 3RTVA 1QM9A 2XMAA 2HKEA 3LPYA 1S6QB 3IXQA 4KGZB 3GCXP 5IV4A 3FQKA 2HQGA 1TUGB 4P6QA 1ZAVA 2OMLA 4LQ9A 4JI2J 4NI2A 5HQLA 3JAMU 3M6WA 3KDOA 2AV5A 1QVFR 3ZZTA 5HLFA 5ETPA 4DV5J 4ILRA 1NDKA 1QVGR 4W90B 3GR0A 3PY8A 4IH7A 2RNEA 5KOXA 4FKXA 3M8YA 1XNQF 1G1XA 4JP8A 1T03B 2CUYA 5AE1A 1MN9A 3HHLD 2VPXB 1RAGB 5IM0A 2GHWA 2QLXA 1KQKA 2VPZB 4Q5VA 4WWSA 4E2FB 1WI6A 1PBUA 4OX6A 1FWPA 2PE8A 5DM6Q 4JV5F 3G8QA 5E3QA 3UD5A 4LR8A 4QOTA 3KLIA 2H54B 4USTA 3MM9B 2V5HG 2CQBA 1Q7YT 3E2EA 2DGVA 4Y2CA 3UO0A 2IMOA 2N4CA 3VAMA 2IA6A 1UW4A 1HWLA 4CRJA 1RP5A 2X1GA 4F36A 2L9NA 2AGPA 2UP1A 2O1PA 1ZM9A 3QSYB 3R97A 3IM9A 2E5IA 1ZBTA 4LF9J 1SC3B 2XYPB 2XWXA 3GFZA 3IGNA 1N4LA 2K7KA 5F3ZA 3HM9A 1QSLA 5B0GA 5HSPA 2EC2A 3V4MA 1AA1B 4LF6F 4OX9F 1UJ4A 2DNPA 5LMUJ 1O0PA 1VQ6S 2X7IA 1RTJB 1IKXB 1MW7A 5LSLA 5ADZA 2FHMA 2BBEA 2KI2A 3AB2B 2I38A 1UPPA 4HH1A 2HWIA 4KO0A 3K17A 3M1VA 2F4VF 2BMBA 3D6MB 3I0RB 3IC1A 3HFVA 3BYPA 3NGKA 2DVIA 3KLFB 2JLEA 2O5DA 4KPYA 3ZTPA 1NJXA 1WD6A 2R8GA 4B3TF 5DZ6A 1HMVA 3OXFA 2HRTA 3G82B 1LWXA 4PRFA 3GFHA 1X4FA 2UXBJ 3IR6B 2DTJA 3ZFVA 1MN7A 4CCHA 1R8CA 3MFIA 3SZ2A 3DRRB 2DHXA 3VAFA 1Y0HA 1FDNA 3QGPA 1SKWA 3GMGA 5EWEA 4RW7B 3VCDA 4YB5A 4CT9A 1MU2B 5B0AA 5KFQA 4RWWA 2AJFE 3K2YA 4UOCA 2B7BB 2ZZMA 4QWAA 2ZHAA 3CCVS 4DS5A 4DG1B 4U8VA 1DTQB 1S57A 4PR6A 3Q86A 3KJNB 4HVZA 2U2FA 5CZXA 1RLDA 2AKWB 4DMZA 1MLAA 3QT6A 3ZZRA 3HKWA 2MKYA 5M2RA 1KLNA 2ZH1A 4CQ1A 4YMEA 1RT6B 4WKYA 2PMHA 1XNRJ 2D3UA 4NLTA 1U1NA 4ZMMA 1U1PA 3PM9A 2CXEA 3CXCR 4DL5A 4L3NA 1PJ6A 3THVA 3A8KA 3RAXA 3W9IA 3M9OB 1JNZB 2FDNA 2YQ3A 5EX3A 3QATA 1RAIB 4QZVB 1VS3A 2MZ1A 1F2HA 3FCVA 5F9LA 2VIHA 1Q8KA 1Y3KA 3I9ZA 3ULHA 5KFEA 3CMES 4A8SA 2H3EB 3LOUA 2IM1A 2XSJA 4LIRA 4DV4F 3Q22A 2MPUA 2HK3A 2HS0A 3W9HA 1Y5NB 3OFFA 1Q5YA 1R8AA 3S8SA 3L3CA 5I42B 2NSBA 1GMVA 3T5JA 1JJHA 2KXHA 1TL1A 5CCLA 3D54A 3MTKA 2ZOGA 1Q95G 4JI5J 3N4WA 4DX6A 3PX4A 2CPYA 5J2NA 3ZTOA 4Y65A 2ZZTA 1SQEA 2DGWA 4TYBA 1TVRB 2MY7A 1FNOA 4ICLB 3H4DA 5J2PA 2ASYA 3OR2A 2VBZA 1W2BR 3NNAA 1R6VA 2XEXA 3SSRA 3B54A 4EEYA 3MECB 3OW2R 3HXMA 4K8RA 1RT4B 2DH8A 3EPIA 3V2UC 1YI2S 3PVXA 3EDQB 3P5BP 4F4AA 4AL7A 5F8MA 1RT2A 4X2BA 1YWXA 5DLGA 3FUYA 3MUTP 3THTA 2DGTA 2MKKA 4QYZK 1WSRA 2DNRA 2YWHA 3ADAC 1U0HB 4CTAA 2ADCA 2XHCA 3BKUA 1PYSB 1HR0F 3NKYA 1E6YA 3C6UB 1SIZA 5HAOA 4FNHA 2GAGC 1DLOA 9RUBA 5HP1B 3FSIA 4ILMA 3R2DJ 3QPIA 3ISNC 2WZ1A 3BM7A 2YKQA 4I6AA 3RB4A 2VBYA 3TWZA 2BANB 5T7LA 3AXMA 4IOCQ 3SDEB 1NNDA 4I0WA 3UFCX 2F5GA 2MTLA 4EBEA 4JI2F 1C2PA 3NAIA 1RT3A 3CDBA 2JSXA 1U6BA 4NLXA 1ZYQA 1FKPA 3C14B 4DV5F 5A2QY 1BQMB 1EQMA 4P74A 4IG0B 1ZPWX 3KHLA 2KFYA 3ILLA 4ES1A 5C25B 4RBVA 4ZKAA 1CULA 2GCFA 5CAAA 2ZBQA 2W7AA 4O44A 4NXMF 1KOOA 3QFWA 1QAYA 1BY9A 2PSZA 1AZSA 2E7XA 4ZVGA 4HACA 1RDRA 2N82B 4H4KA 4DSKA 2JEIA 5DQGA 1WHYA 3M8WA 1AT1B 2GHPA 3I5BA 4ZVRB 1XIQA 2CQ4A 2Y3YA 4B3RJ 2BKPA 1RAOA 4URSA 3MEEA 2BKNA 1N0VC 3DHXA 3JXOA 1VQKS 5HBMB 4LF9F 2CDRB 4HT7A 2MLXA 4ZPVR 3MR3A 1NJYA 2AEFA 4J9LA 2M2BA 1VK3A 2MGZB 5IQ6A 3MZIA 1FFWB 4FYDA 2J9EA 4C97A 4XPCA 4JUZA 1S49A 2LA6A 1VJQA 3A8JA 5IT0A 4RR5A 2W2PP 3W2VB 1APSA 1VHFA 4OHYA 4OHWA 3UE2A 4UOHA 1AROP 1KQGB 2M8DB 4M5HA 2UVRA 1HPZA 2MQPA 2O3DA 1RJJA 3TZXA 5LJ3Y 2IMWP 3D4JA 3IGVA 2HHTA 4HR2A 4MFBA 3C16A 1SV5B 4DPWA 4FYWB 3EMTA 2DNNA 3OL6A 2HZAA 3E01A 5JMNA 2KYZA 2BE2B 4P2MA 1FWLA 1RAFB 2VPYB 5DO2A 3C15A 1MWYA 3HSJA 5GMDA 2GGPA 2C2DA 4AUKA 2B4OA 3L7OA 5CYMA 3TP2A 1TKTB 1LEOA 2ZH5A 4V19J 2KB2A 4OZ0A 3FBBA 2UXBF 1CJTB 3OLAA 3DM2B 2V8PA 2DEIA 1J2VA 2HQ3A 5J2QB 1S7IA 3BQ0A 1UL3A 2HMIB 2EFGA 1RXOB 3BF4A 4DV7J 3TW0A 2FJAB 4YB6A 3LWLA 1Q79A 4IFYA 1WDDA 4ZCKA 1FFGB 2XB2D 4NEYA 3M8QA 2CADA 1U7LA 4LSLA 4DSJA 4OYZA 4ZHRA 1REVA 1FDBA 4O3QA 2ZH6A 2ZWPA 1I51B 5LJ5Y 2FHOB 3GIIA 2QLFB 5K14B 3BH7B 1U6ZA 3MDFA 4KKOB 2KH9A 1X0PA 2B8PA 1R7IA 4JV0A 2WVDA 2V63A 1F5AA 1CC8A 2ZH7A 1FO1A 3NXZA 1XNRF 3T3FA 4DZ6A 2MMYA 2ZJQQ 2J5AA 4J37A 3IMQJ 4RW6B 3SV4A 4PUOB 3WIUA 1B0TA 3FBEA 3TRGA 2P9GA 1S59A 4P71A 4ECZA 1IBLJ 4ATNA 1YTYA 1IM6A 1BQNB 4Z7CA 1U1KA 5E3CA 1WC0A 1RWMB 2MJNA 3KLGB 1TU0B 4OV1A 2KT3A 2N4DA 4L75A 3WQPA 2XSFA 3CCZA 5JJBA 4UZBA 3ETOA 5DQHA 2E5HA 1GXUA 4Q2LA 1TL3A 2JOQA 2L3MA 1BC6A 5KT2A 4F0MA 3KJQB 3FDSA 2RE1A 3TQ1A 5IZHA 4NOHA 1T05A 1VQNS 3H20A 1TELA 2B51A 3CJ0A 1LXJA 4A8MP 4NPOA 2UU9J 3NGTA 1VI7A 4JI5F 2DRAA 1S0OA 4OHZA 3VAIA 3G6XA 4F3MA 5KFCA 1JMTA 3CC7S 2HVEA 2LQ9A 4OYPA 4OHVA 1T9YA 4GVLA 2H4WB 5HJYA 1WTBA 1RSCA 4RUAA 1FRXA 5L1KA 2CPEA 8ATCB 1RT5B 4HDHA 4M5IA 3J80Y 3T1YJ 2W01A 2V34A 1H2VZ 1VC0A 4U7UD 2HHXA 3GIJA 2V9KA 5THWA 2QMWA 3L4BC 3LA0A 1KQSR 2HS3A 4QWDA 4WTOB 4K4XA 2AGQA 5F8JA 4FYYB 1S4EA 5I3UB 3DRYA 4KGKA 5B0DA 4DV2F 4WBFA 4RO0A 3NMRA 3JTOA 4DL0C 3AJ2A 2QA4S 3BKTA 3KUEA 4BCAA 4HHJA 3AHPA 3ZZZA 1X4BA 3MHYA 3RW6A 1NDLA 2YH0A 3I82A 3LP1B 1KD1T 2DCLA 1LWFA 4O0NA 3TX8A 2AJ2A 2GHVC 1RAHB 1JJ4A 4JB8B 1WI8A 4X4OA 4YQWA 1U8WA 2JC1A 4F04B 5HBMA 1QTNB 2GQCA 4URQU 1NPRA 4J9SA 1WOSA 3DMJB 3POTB 5DM7Q 4BWJA 3FCHA 3Q8UA 1WTFA 1WOPA 3X3UA 1WC3A 3KNAA 2VFRA 1J5OB 2V2KA 2JFDA 4DFKA 1KVKA 5F8LA 4ECXA 1RAAB 3HSDA 1YBTA 3MEGB 2DR8A 4HDGA 1LWCB 3UD4P 3OTDA 1TKZA 4C9DA 2PO4A 3KFWX 3CPWR 4ZVOB 5DRKA 5KFZA 4KFBA 1VC6A 3P6YC 2XGQA 2ZOFA 5HATA 3MCSA 1QD1A 5K5MA 1JLEA 5CABA 4IKAA 2B9WA 1TQLA 1Q16B 3TVKA 4LFCJ 2HFZA 1A7GE 5H9FJ 3K5LA 5HJXA 4KHPJ 4YP3A 3H5YA 2BXJA 3OTOJ 1LW2A 2VB6A 4B3RF 5H1SV 2R7SA 5B7WA 2YNIB 3ET6B 2B56A 4N56A 1SJRA 5F8IA 1WF0A 2CNOB 4DQRA 1SUQA 1NEEA 4R8UA 4H4MB 2DXFA 4I1TA 3QMQA 2YPZA 1TV6A 1FF2A 2CJKA 3F0NA 3GZ7A 5KFMA 2UV8G 1HYSB 1S9EA 2FGOA 1PYTA 2IHR1 2DHHA 5HVGA 1OQ6A 4OI4A 2HG4A 5KOWA 1ELOA 1N5SA 1H0HB 3HSGA 1WG5A 3BS9A 1RHQB 1JLGA 1UWAA 2DHSA 2FVPA 4RNHA 3QJLA 3SMZA 3IWNC 4IRKA 1S0MA 2AYBA 1WORA 2GO9A 3TAPA 4QU7A 4RW4A 2R42A 2YQ1A 3RR7A 4NLDA 1HQUB 5J2MB 3E8OA 1B7FA 1KSPA 2XMMA 2EFOA 5EHHA 3OXGA 3VZHA 5FDLA 1ACMB 2ADBA 4WP8A 4DV7F 3HVWA 1BE4A 3DFEA 1JXVA 1P1TA 3I4HX 4KV8A 2ZDPA 2C2OB 3NBPA 4YN3B 1WNEA 3VQSA 4ZN3A 4TY8B 2XZDB 1XR7A 2R7WA 1K9MT 4M5DB 2IJFA 2JDJA 2CG4A 2QYGA 3PRDA 4DPUA 1JJCB 2RUSA 3KLVA 1KWMA 1LOUA 2E5GA 3SIPB 2RHSB 5KFKA 1ZAXA 5D0RA 2W1BA 3FK4A 3BEGB 2GMHA 1OY8A 1I5OB 3GG1A 4FF1A 1NHKL 2VZ9A 1EKRA 4F2SA 3GE9A 1UZDA 3QLHA 4JYAJ 1SIWB 2J7UA 1QUPA 4FXWA 4BBYA 4ED2A 3JS9A 5EDWA 3B4DA 1YGYA 3PYGA 4WK3A 3B82A 4NASA 1CQMA 3KKFA 5CYQB 2FTRA 1IQTA 4A4JA 2VA3A 1U24A 3JAMY 2ZC3A 2HQCA 3CC2S 4WP3A 2JEFA 1IBLF 3H90A 2R7QA 2HRYA 2GIFA 2MEWA 4XDDA 1VBYA 4JI8J 2B4UA 2ASDA 2B6AA 2GQ2A 5E41A 1UVLA 4IDKB 1RA7A 1K73T 2AYGA 3DLJA 2VG7B 1AFJA 1Z4UA 5D4NA 3CD7A 1C1BA 2KZMA 3FQLA 3W65A 4N47A 1T3OA 4UY85 4QWCA 1ZAWA 3SQGA 4WZMA 3I32A 2A0FB 1IKYB 4GVBB 4LMZA 2XHWA 5KFDA 1UPMB 4L72B 4GC7A 1HQEB 3AOCA 2UU9F 3OHBA 1RYRA 4NCGA 1X5TA 2AGOA 2VQEJ 4QQBA 5HROB 4MKAA 4GO5X 4K4TA 3NS6A 3DOKA 1HLWA 3DXSX 1T9VA 3J81j 5G0RA 1GXTA 4CLYA 1F1BB 1TMMA 2F8MA 2F40A 1MROB 1QDUB 2XG8A 2K8GA 4J9RA 5A0YB 2V4JA 2AJQA 3R3TA 2AYMA 4TVAB 5AXLA 4J9VA 3RG6A 4EI2A 4OI0A 1VBXA 1SXLA 3P5TL 2FHJA 3SQOP 4F4YA 2OKQA 3D66A 4NLVA 4N76A 3KLEB 4UUXA 1CJKA 1RKJA 3HFKA 4Q0BB 2YWEA 1HNXJ 2DBBA 3IBWA 4K5RA 3CDWA 1T9XA 4NXNJ 4TYAA 3OJSA 4RJVA 1RUSA 3M2UB 1KS2A 3J7YI 4G65A 1D9FA 5HVHA 2FD2A 4KJIA 2G0IA 4RLEA 2H48B 2IIHA 2R4FA 5IWAJ 1JLCB 3J7Z5 1RTDA 2RQMA 1M0SA 3V6KA 3PXGa 3K0JA 1RBLA 3QZ7A 4LF4J 1A0OB 1FKOA 1UETA 3I96A 4P52A 1YHQS 3HKZD 1FNXH 3RRGA 1UA0A 3OFEA 2YKMA 4L6V3 2GVZB 2YNFB 1YBUA 1OSDA 1GT8A 3JTPA 3OV7A 2HNYA 1EARA 4PPDA 3CC4S 4C6AA 1RTHB 1S76D 4B17A 1NO8A 3VAJA 2HNZB 3SCKE 2VDHA 5A6WA 2WVFA 4TQSA 3W64A 3BGOP 1JK9B 1GQEA 3HJVA 2UVVA 5D0GA 3MMBB 4F0KA 2C2MB 3MM8A 5JXSA 5M2UA 4RW9B 2DR5A 3PFOA 4LFBJ 2DIUA 4A48A 4ZCLA 1VIOA 2YKNB 3HVRA 2JJ4D 2ZKUA 1LW0A 1FA0A 4LFCF 1YJTA 1FWKA 3QNWB 5DGBA 3QJJA 2Z2YB 4ZDNA 1N34J 2O67A 1X4HA 4KHPF 2FLNA 2HNDB 1PC4A 4NMXA 3OTOF 2D69A 3W5ZA 4UZCA 1RBAA 3HHLA 2JLFA 1VBKA 2F3JA 4B9SA 1HBOB 3KLHA 1CC7A 3Q8SB 4J9NA 1TK8A 4FXDA 3LW5C 2VG5B 2QT7A 2WOMB 2A2DA 1FEHA 3KHHA 3NS7B 1JXEA 3GR1A 4X4VA 2AQ4A 3VHQA 1VGYA 1HD1A 3BPDA 2I1RA 1QE1B 3AY0A 1IR0A 2HAFA 2HGNA 2XI2A 3CJKA 4HTJA 3GIKA 4A8YA 5IV3A 2QGFB 2F1FA 3JQJA 5H9EJ 4K4ZA 3R5DA 5L38A 1TKXA 2CPZA 2FUG9 3BSCA 2LXIA 2LVWA 1NJIT 1RACB 2CFXA 4U7CA 2XTJP 1HNIA 2HZVA 1B0PA 3PJWA 4NZ7A 3CB4A 4LFAJ 4PXEA 4DX7A 3JQMA 2C2ZB 5DLFA 2C22A 4D3HA 3DRSB 3G86A 4BWMA 1I6JA 2DIVA 4M94A 2Q66A 2VL1A 2HHSA 4U95A 4DSLA 2E1AA 3FC9A 1VRTA 2QMXA 4IDKA 5T14A 1U1LA 2I2YA 2Z0GA 2OPRA 3TZWA 2LYVA 4PWUA 2BQUA 2IBKA 1S6UA 4DN9A 5HMWA 5A8RA 1EP4B 2RQCA 3A4TA 2VOPA 4PG6A 4A46A 2H5EA 1YJ9S 3D0GE 4CP5A 2KG1A 1T3NA 4RW8B 5KFTA 3QO9B 3JYTA 1RCOB 1H3DA 5KTQA 5B09A 3K5OA 3RRHA 4JYAF 1RTIB 2ZBPA 3D0IE 4ALZA 3ITHA 3GWCA 2W9AA 4FS1A 4YHHJ 2BOAA 3A8EA 1NMEB 2UUTA 1JLAB 4CH0S 4O3PA 2L41A 3EICA 2MQ8A 4JI4J 2RSQA 5C24B 2V2QA 2FJDB 3BGRA 1PIEA 4ZLPA 3EGVA 2HBZB 3OUYB 1FESA 1D8ZA 2QEXS 2EG1A 2POKA 4JI8F 4HL9A 1NHVA 5FLXU 2GO8A 1DURA 1VQPS 1N33J 5F8NA 3ELHA 4LJMA 1XMQF 3BO2A 3Q8QB 1N6QA 5ETKA 1RWKB 3MOZA 1UVJA 3O2IA 5K8MA 3EZUA 3PW0A 4LR9A 5IT4A 2W7PA 2PI5A 4LBPA 3S7RA 2BX6A 2JLGA 3QRPA 5KFYA 1FRHA 5KFAA 4ZPBA 1OS5A 1TK5A 4TKTA 3I5AA 4CO1A 1EB0A 3D5MA 5KFHA 2XO7A 2CJXB 2XQCA 1YJRA 4Z2XA 1IBKJ 1MWZA 5H9FK 1NKCA 4ECYA 3ENAA 4ANEA 4ED7A 2KRBA 2B9XA 2OSRA 2OELA 3TEGA 3TVYA 1DTTB 2Z57B 1VYAA 2YPYA 4NZ0A 4UT4A 2WBMA 2CPIA 1HNXF 3MMAA 2RJZA 1UCNA 2YWGA 2BV3A 2WW4A 4OZLA 4NXNF 5HL7Q 3J81Y 4KH1B 4QU6A 3W2WA 3Q24A 5HMZA 3RAQA 2I5JA 5IWAF 3QWUA 1SL0A 3TJAA 1RZMA 4U7UK 3KOAA 2EEYA 2XS7A 2BW7A 4Y00A 4ZP7A 2NZ4A 2EKYA 4RZRA 4MH8A 1EKSA 2LEAA 4WFYA 4B3OA 1AW0A 4LF4F 4MAKA 4DQPA 2H5JB 5C42B 2FY1A 2VJVA 1UEVA 1U26A 3C6TA 2BQRA 2AMCB 1RT1B 2YVSA 3FRYA 2GW8A 3F41A 4CLSA 4TU8A 1WOOA 2NYIA 2FJXA 2PFDA 3HSZA 2E1PA 2Q43A 2VICA 2OTLS 3DN9A 4A8FA 2MSTA 4KGXB 4LFBF 3I0SB 4QIEA 1E6VB 1M1HA 1SVDA 1VDHA 4A8XA 1FXRA 1S9FA 3KUGA 5J1EB 1N34F 3BBFA 3HP6A 2W4CA 3MM7B 3IRXB 1P27B 4ZJQA 3V6HA 5D4OA 2J0SD 4PZVA 1RAJA 3DRPB 4TNOA 1RWNB 3K89A 2KDOA 1T02A 4H4OA 5J1NA 4ETXA 3LP2A 3CJSA 3RYLA 3D6FB 1RT7A 3H5SA 4O4GB 4FBUA 1JKHB 4JV1A 4ED8A 2XZTB 2AEJA 3G87A 4IFVA 2YWKA 2ROGA 2RRBA 2W9CA 1SJ4P 3DLKB 4K2JA 2DHGA 2BUNA 1FXDA 1KFSA 1WEXA 3V81B 1JX4A 3HFZB 2DR6A 1JLFB 4ECQA 3K5MA 1F9FA 2YNGB 3T19A 2H9ZA 1UA1A 3DOMA 4OZNA 1DZ5A 1XQIA 2HWTA 2YBVA 3JSMA 3GPAA 2LQBA 1NM2A 3UVJA 3DYAB 4XDCA 2N3OA 3I5CA 2CNKB 2J7WA 1VR6A 3C3LA 4RWXA 3FSXA 3KK2A 2MZSA 2RF2B 4B9LA 1BXNA 2XLKA 4NA2A 2UXCF 4KR0B 2ALZA 4UUWA 2I0XA 3GJQB 3M7VA 2OTJS 2EG2A 3SI8A 5KG4A 3SV3A 1UWBB 2NXUA 2VFTA 1URRA 3IS9A 2EW9A 4ZJOA 1NH7A 2MZRA 1XR5A 2IAJB 1K44A 1IKVA 1T7PA 3IN5A 2MKIA 4M5MA 4M8LA 1S1VB 4KC5A 5KT5A 4R5PA 3IAS9 3M6VA 3PV8A 5FJ4A 2OFGX 2X3DA 1IKWA 1LWEB 2CJQA 2B9YA 1H73A 4O23A 4ZPTR 1HBNB 5B0CA 2OAUA 3V6DA 1OMSA 1S1UA 5CA5A 3RAMA 4MT1A 1X5SA 1M5HA 4YHHF 1GMUA 3CT9A 3DGPA 1R43A 2MZTA 2CJAA 1XNQJ 3ZNJ1 4JI4F 1Q81T 2R7RA 2RKIB 1JLBA 3D1QA 1SC1B 3HD1A 3EXCX 4DQSA 1Q5VA 4C8KA 1RHUB 5C2GA 1KTQA 1N33F 5D8HB 5KFBA 4AT1B 3VAHA 3AOBA 1D9DA 1OJ4A 1UAWA 2DHAA 2BJ1A 3TUJC 4WYWA 4HH0A 1D0EA 2K1RB 5IOLA 4DR4J 3EXYA 2ZE2B 2IM3A 2DKOB 3FCWA 3UNGC 4KY3A 2XY7A 4NCAA 1SH2A 2B5JA 1TMJA 1PCAA 4QIWD 2I8EA 4IH6A 1JLQA 4LF5F 5DJBA 1RA6A 3I9V9 4OJ1A 5C42A 4X65J 1FD2A 3QJPA 2QLBB 3QSIA 2ZEJA 1IBKF 5K8NA 2QL7B 4PWDA 2ZD1A 2V8HA 4PQAA 1CG2A 4J91A 2OHDA 1P8GA 4J9UE 3RUBL 1PYOB 1S1WA 1NUEA 4DLEA 3LGNA 4DI6A 2IVFB 4WJBA 4AQYJ 3W7BA 1HNVB 2AJ4A 1HKAA 1NZ8A 2C2EA 4G1IA 4DU8A 5GADU 1P6TA 2KJWA 5CD4A 2IC3A 2VD3A 1BWVA 2OEJA 1S79A 4B08A 4Y2IA 4K59A 2OEKA 3AFGA 5L46A 3T41A 2F65A 5DDRC 1CS4A 2IY5B 3MCOA 1N8RT 1HHSA 2DNMA 5D15A 2M0GB 2OPPB 4PABA 3HHLC 3TOQA 5IC6B 3EZOA 2MLZA 5H9EK 5JVHQ 3MPUB 4DX8H 3G9CA 3A8IA 1N5YA 3G71S 1QSYA 4ZVTB 4ECUA 2EK6A 3O6QA 4CLZA 2HRUA 3MM6A 4BLGA 3UR3C 4CM2A 3U02A 4MK9A 3J7AN 2HBYB 3LGHA 2CQPA 1UEUA 1UVKA 3D28A 4C11A 2KYXA 3M2VB 1S6PB 3RRKA 1YITS 1WG1A 2N7CA 5KFFA 4ZJLA 4PG8A 3OFHA 2DNOA 3OSPA 3RR8A 2ZITA 1VQ5S 1XR6A 1YZ7A 4JI3J 1RKIA 2IM0A 4YFUA 3CJ8A 5CH7B 3JB9k 4IH5A 4BS2A 1C1CA 3HVAA 4K4UA 1BWEA 3DI6B 2H4YB 4IG3A 4CYUA 3AA8A 3ZO7A 3G6YA 3B78A 1VQSA 3UN3A 1EIYB 4WXOA 4WU2A 2R8JA 3GV5B 1M1KT 3MPVA 5E3PA 2WVBA 3M2RB 3MUMP 2KFNA 3I31A 2GVDB 3HT3A 2ZH2A 4WE1A 1YRXA 5AXNA 1Q1KA 4DR3J 5HMYA 1MSWD 4RNOA 4DV4J 4NWBA 4RNMA 3PX6A 3HULA 1N88A 2YTCA 2Q6BA 2CZ9A 1YJUA 3KK1B 3W3SA 2FC8A 2W8KA 1YK9A 2MYFA 3GSIA 4ID5A 1WACA 2PIIA 5DS7A 2KHDA 3IWXA 3C66A 2AZ3A 4IO1A 3KJVB 4O3SA 2QX0A 2CZ4A 5IS2A 2DEJA 2MHEA 1I94J 4C0HA 2YWWA 1AFIA 2K3IA 3MAAA 4ZOSA 2LQJA 8RUCA 4UOGA 2DH7A 4CIOA 2C2RA 4K5SA 3NNCA 3FEXB 1ZM4A 1HW9A 5AXMA 2HEKA 3BPSP 1S12A 2HVHA 4C8MA 5EWFA 2KT5A 3EYZA 1F0XA 4OI1A 1QY7A 1FJGJ 3O8WA 1V3ZA 4NLYA 4KT0C 2G0CA 4PG5A 3LALA 2HHHJ 1VLYA 4KYZA 1NSKL 4UQTA 5IT9U 4GRSA 5I3PA 3VWSA 4YDXA 3CD0A 3T6JA 3SSQA 1REGX 4P2XA 3HHKA 4MIWA 1YVFA 2F9JA 2ROEA 3MMCB 4ZITA 3FJ2A 4TN2A 4EU0A 2E1MC 1YRTA 2J0WA 2NPIA 3NCRA 3MTJA 2FZCB 2VG6A 3NWGA 2VKRA 4PCQA 3R7BB 1NPPA 1FVSA 1S1XB 3G8TA 4KAIA 2XS2A 1VQYA 2XULA 3PW2A 3LP0A 1SB6A 1P9YA 2DD8S 4FDFA 3FBCA 4YY3F 3TANA 3G6ES 4WTYA 4OLOA 3D6HB 1K1QA 5BJRA 3L09A 3DOLA 4YUDA 7FD1A 3TAMB 4K4VA 4NXMJ 2M3DA 1TAQA 1PC5A 3MM5A 3BB5A 1TL5A 2C1EB 3S01A 1TUWA 2RHQB 4OYWA 3FMBA 1BQXA 1U02A 3IG1B 2OPQB 2VFVA 5HMXA 2B4VA 5A8KA 2DT9A 4PQUB 3MEDA 4OYAA 4TU9A 4DR4F 4LF2A 2YNHB 1KLMA 1L3KA 3N5FA 2D3O1 3GV8B 3KG0A 1B70B 4DFMA 2J0QD 3DNCA 1U1OA 2Y0SD 5A8WA 1NZAA 1KVIA 1RU1A 4UF4A 2QMUB 1VRUA 4RUBA 3DLBA 4EK2A 3OL7A 1L3TA 3T1AA 2JWNA 1BGXT 3UN2A 1FT8A 2R8HA 4WYLA 3MR2A 3NP5A 5HVFA 4A8WA 2Y1RI 4LSNB 2HSEB 2CPHA 4X65F 3M05A 2Z2MA 3CIZA 5D3GB 1R0AB 1YBAA 4FPRA 2BACA 1EETB 1TL7A 2MY8A 4ELVA 2IM2A 4FYXB 5KT3A 4MIBA 2D74B 2XLIA 1RYSA 4OX8A 4DUTA 2ZVSA 2V68A 5DDPC 4TLQA 2NREA 4AQYF 1C0TB 3FFIB 4NMLA 2IJRA 3DRXA 3H0PA 3J7YU 3KK3A 4OYXA 2A6OA 1S9GB 3GQCA 3OR1A 1C4CA 2FGCA 5HO4A 4MKYA 3UDCA 3CNQP 5B08A 4ZPAA 3MF5A 2ROPA 2IYIA 3I87A 4B9VA 3EVMA 2OPSB 2VQFJ 1EJ7L 3OBIA 3I56S 4DR1F 4WZQA 2RRAA 2LXUA 4OMFG 3AD8C 1LK5A 3JQKA 4I7FB 3QIPB 3R7NB 3PW4A 1HWJA 3DLGA 3V4IA 5BXIA 4FNIA 2HGLA 4HEA9 1GTHA 1FJCA 5D0HA 3Q8YA 3T1HF 3OD2A 1YLXA 3OTEA 3W66A 3EE3A 1O51A 4M5LA 1RCXB 4P2SA 4W98A 1Y9OA 1EHWA 5CXTA 5KFRA 4KB7A 5D6GA 1PG5B 1UFWA 2CWKA 3M8PB 1U4BA 3GJSB 4RU2A 4UQGA 1U49A 4YS2A 3CIMA 2OEMA 1HBMB 2CWXA 3AD7C 4NRTA 3QT7A 3HD2A 4L74A 3U1NA 4C3MA 4CDIA 4ED6A 4XPEA 3T9NA 2PA3A 1NK6A 1IWGA 4JI3F 2MDAA 2ZBRA 3CCQS 4KQZA 1NH8A 3TX0A 5A2QU 4ERDA 1GTEA 2KM8C 2RB7A 3OXLA 2DNQA 3DDNA 1F3VA 7FDRA 3NAHA 3GTYX 3QZ8A 2M5YA 3DLEA 3DCAA 3W61A 4CO2A 1WG4A 3GB0A 5KFIA 2ZC4A 2E1RA 3NLCA 1KR4A 2JFKA 3CJRA 3M32B 1JJ2R 2ZNYA 4FPIA 1FJEB 4Q45A 4DR3F 1S4FA 5FLXY 4KTQA 1LQ9A 4DQQA 3QGGA 1HIYA 1S1TB 2G9OA 3VAKA 3BJYA 5KT4A 2PC6A 1S6QA 2HW3A 2AD9A 4QWEA 1CJVB 4NLQA 2MKJA 4IUFA 2JNJA 3R5GA 3SBMA 4G1QB 4Q7AA 4NRUA 4HI2A 5E3RA 2EK1A 1GNKA 4CO3A 3RBZA 3O1LA 4QR2A 4QPXA 1I94F 2XMTA 2C3YA 2ZOMA 4LRDA 2HHPA 1L5UA 4F4ZA 2FZGB
chains in the Genus database with same CATH topology
2JVRA 5D4PA 2YH1A 1T03A 4UW2A 4I2QA 3THPA 3OVAA 4N41A 3K5NA 2FVRA 1JK9B 4I2PB 1GQEA 2UVVA 3H98A 1YQHA 2FHJD 1S48A 3MMBB 4NCGB 2RVJA 5D4LA 4NLUA 1FK9A 2C3PA 2YX7A 2XMWA 2ZH8A 4C8ZA 2CYYA 1LFWA 4QCLA 4C8YA 2D9OA 3DRSA 3MM8A 4N77A 4R0EA 5JXSA 2DGSA 3K58A 5M2UA 4RW9B 1DQ9A 3L7PA 2DR5A 3CDEA 3PFOA 3VQTA 2DIUA 2AU0A 4USHA 3DOKB 2RS2A 4NL5A 3ZZ0A 5B0BA 4A48A 4ZCLA 2EC0A 1FXLA 1VIOA 1KHWA 2YKNB 3HVRA 2JJ4D 1FJGF 5G0RB 3G4SS 2ZKUA 2J7KA 1LW0A 2UVUA 4AXJA 2MKSA 3MURP 1FA0A 4OI6A 4LFCF 4M95A 4CI0B 2UXDF 2WSCC 2KTQA 1YJTA 5KAKA 3MM9A 4I6YA 3B8HA 4K2XA 1NRKA 5GVQA 5DGBA 4AYBD 2LECA 4YOEA 4QPTA 2RU3A 3QJJA 4J9OA 4ZS6A 2HHHF 3IAM9 3RU0A 1K0TA 4ZDNA 2O67A 1X4HA 2OSQA 2CQ3A 2V4JB 1HL6A 5E7OB 2FLNA 2HNDB 4KHPF 4WFNQ 3OSNA 1PC4A 1ZM2A 1N5QA 3OTOF 1SJFA 3GFXA 4TXSA 4Y0FA 3RB3A 2YKAA 2DO0A 5K8OA 1LV5A 1CLFA 1HBUA 3HHLA 1EP4A 2JLFA 2F3JA 3TVZA 1TFYA 4B9SA 1XK8A 5HQ8A 1K1SA 1HBOB 1CC7A 3DLEB 3KG1A 3KLHA 3Q8SB 4FVCA 3CVKA 4Y28C 1QTMA 4J9NA 3CF5Q 3HVTA 1TK8A 3M6XA 4FXDA 3LW5C 4RW8A 3DXBA 2VG5B 4NLPA 1T94A 3OFGA 5KFXA 2KXNB 2JHEA 4C8LA 1WHWA 4MK8A 2QT7A 3QO9A 1UJ6A 2E9ZA 1C0UB 2WOMB 2A2DA 3HZEA 3M30A 3H4BA 2W9BA 3N5BA 1CVJA 1FJ7A 4LSNA 1FEHA 4OZ5A 1Y3JA 1V6HA 1AUDA 1QJHA 1R8HA 3GIMA 3KHHA 4E98A 3SCIE 1RTIA 3LH2S 4X4TA 3CEDA 2QYCA 3PACA 1WELA 2FVSA 1JXEA 3GR1A 4OLPA 4RX6A 3TA0A 4X4VA 3RZAA 3RTVA 1QM9A 2AQ4A 4WFAQ 1RTDB 1KQFB 3LPYA 2V4QA 1VGYA 1S6QB 3IXQA 1N5TA 3UCGA 1HD1A 1RTJA 1IKXA 3G8SA 1JLAA 3HHDA 2WB4A 3EX7B 2V0NA 2SXLA 3FQKA 4IRDA 1DAXA 2WONB 4P6QA 1ZETA 2I1RA 5C24A 1SI9A 1FKOB 1QE1B 3AY0A 1IR0A 4DL4A 1ZAVA 2OMLA 3MI7X 2HGNA 2GV1A 2XI2A 3CJKA 4LQ9A 3OUYA 2YKMB 2BQ3A 4HTJA 3GIKA 3M6WA 1SJ1A 4A8YA 4CH7A 5KFOA 1WEYA 2AV5A 3I0RA 3DU5A 2F1FA 2FJBB 2HNYB 1W25A 1N52B 1QVFR 1SL1A 5H9EJ 3ZZTA 5HLFA 1L3SA 4K4ZA 4NLSA 3R5DA 5L38A 4LVNP 4JI1F 3KLFA 4ILRA 1QVGR 1TKXA 2CPZA 2FUG9 3BSCA 3BZQA 2LXIA 3UQSA 4W90B 1FNMA 3GR0A 2LVWA 3PY8A 4IH7A 2GIQA 5EUHA 1NJIT 2RNEA 5KOXA 2CFXA 2LA4A 4U7CA 1HNIA 1XNQF 1G1XA 1KFDA 2ZZNA 1K0VA 4R25A 1B0PA 3PJWA 1T03B 4ZPWR 5AE1A 4I2QB 2VC0A 2BYCA 4DR2F 3HHLD 2VPXB 4NZ7A 3CB4A 4PXEA 2X3GA 4D3GA 5IM0A 3PEJA 2GHWA 1DJ0A 2WB1D 1FK9B 2QLXA 3WZ0A 2Q1LA 3MWBA 1KQKA 5DLFA 4ES3A 2VPZB 2C22A 1XMBA 4Q5VA 4D3HA 2J76E 3DRSB 3MM8B 2XMVA 3N6MA 5SZTA 3G86A 2JVOA 4Y34A 1WI6A 4BWMA 3PFEA 3C46A 1R31A 1F5CA 2PE8A 2DIVA 4OX6A 1I6JA 3SEOA 2ZDOA 4M94A 5DM6Q 2Q66A 2VL1A 4JV5F 2HHSA 3NRBA 4DSLA 3G8QA 2E1AA 1VRTA 2QMXA 4IDKA 5T14A 5E3QA 1U1LA 1VBZA 2I2YA 3K5PA 1LW0B 4QOTA 2Z0GA 3DRRA 4YR3A 2OPRA 1LKZA 3BREA 3KLIA 2EFVA 1TK0A 3MM9B 2LYVA 2V5HG 3R5BA 4DL7A 3OJUA 2CQBA 3N01A 1OIAA 4PWUA 2BQUA 2IBKA 1Q7YT 3E2EA 2DGVA 4J9QA 2JH3A 5LXRA 4MK7A 1S6UA 2NUHA 4Y2AA 4Y2CA 4RW7A 3EZ5A 2IMOA 2N4CA 1TFWA 3R5AA 3VAMA 2IA6A 1UW4A 1MU2A 1HWLA 4FVMA 4DN9A 1SH3A 2CQHA 5HMWA 5A8RA 2E5LF 4I4BA 1RP5A 4MKBA 2K2PA 4WFXA 2CJBA 3MAQA 2X1GA 3HHLB 3LWMA 1EP4B 1IM4A 4C2MA 2RQCA 2L9NA 2GX8A 2W7OA 2AGPA 2UP1A 1KOHA 3KLHB 2NUUG 2O1PA 2I9SA 4F3QA 2VOPA 4PG6A 4A46A 2H5EA 1ZM9A 3BGFA 3I6PA 4NLWA 4DG1A 3HVTB 2RDJA 3D0GE 1YJ9S 1S0VA 3NG8A 2VC1A 1DTQA 1FCAA 2E5IA 2KG1A 3MPYA 1ZBTA 1T3NA 5I4MA 4BDPA 1N5VA 4RW8B 5KFTA 4Q44A 3CCTA 3U1MA 4ZVEA 1CSJA 2XWXA 3GFZA 2UVWA 4DOZA 3IGNA 3QO9B 2CQCA 3JYTA 1N4LA 1G2EA 5LT5A 4Q8FA 1H3DA 5KTQA 5B09A 1YRUA 3K5OA 3M30B 5E0OA 2W9BB 3RRHA 1DTTA 2K7KA 5F3ZA 2XWYA 3HM9A 2VODA 4JYAF 1QSLA 1RTIB 4YR0A 4FBTA 1RT6A 3D0IE 5B0GA 3CDUA 4ALZA 3V4MA 3ICLA 3ITHA 2HHQA 4LF6F 4J5OA 3GWCA 2W9AA 2C3UA 4FS1A 4OX9F 1XEZA 1YJNS 1UJ4A 3NNHA 2DNPA 3FZ2A 5L9XA 5KFVA 1O0PA 2JRSA 3A8EA 1FRIA 3CJ3A 2VA2A 1VQ6S 5EN1A 4LUBA 4U67Q 2QA4G 2ZNZA 3O3LA 1RTJB 2N3LA 2P9CA 1IKXB 1MW7A 2UUTA 1JLAB 1Q53A 5LSLA 5ADZA 4CH0S 2FHMA 2BBEA 4O3PA 2L41A 2KI2A 3HJFA 3AB2B 2I38A 2VQFF 2RSQA 5C24B 2XCAA 1SJ3P 4HH1A 4I68A 3HPOA 2FJDB 4QYZJ 2HWIA 2QE5A 4X4UA 3BGRA 2FLLA 4ZLPA 4KO0A 3CJKB 4K4SA 3OUYB 2XZWA 2Z2LA 1FRKA 3M1VA 4U6PA 1FESA 1SH0A 1D8ZA 2C3MA 4QJVA 2QEXS 2F4VF 2EG1A 2D1CA 2VBXA 2R7OA 2POKA 4JI8F 4J9PA 4HL9A 3QWPA 4QIFA 1TZ0A 3I0RB 3MXHP 4QW9A 3OTCA 3IC1A 1NHVA 4KHRA 1X5PA 5HLFB 2G13A 3FZBA 3GYNA 3H8YA 2GO8A 3NGKA 1DURA 1VQPS 2DVIA 3KLFB 2JLEA 4RUCA 5F8NA 2W25A 4ZCMA 4LJMA 1XMQF 2O5DA 3BO2A 1TKXB 5EX0A 1VQ4S 4KPYA 2NR0A 4XIUA 4ES2A 3Q8QB 1N6QA 3BGLA 4X4QA 1NJXA 1C4AA 1WD6A 1HNIB 2R8GA 3BSAA 4B3TF 1VJWA 5T41A 1HMVA 3OXFA 3T9ZA 3MOZA 1UVJA 2QV6A 3O2IA 5K8MA 3EZUA 2HS4A 3QGIA 5IM0B 3LQVA 3PW0A 4BC9A 4PRFA 3N6NA 4CZCA 3GFHA 1FERA 1VQ7S 2Y1IA 1X4FA 4OFZA 1RT1A 3B4MA 4KRWA 3RBDA 4GKKF 3IR6B 2DTJA 2BM1A 5IT4A 2W7PA 5L39A 3RW7A 2PI5A 2YWFA 3S7RA 3ONQA 2JLGA 4IR1A 2CJ9A 5I42A 3ZFVA 5KFYA 1FRHA 3I4PA 5KFAA 4A8QA 1VRTB 2XNRA 4ZPBA 1OS5A 4CCHA 1R8CA 3TA1A 3MFIA 1TK5A 3SZ2A 2UV8A 3DRRB 4FN5A 4ZP8A 2OPRB 2DHXA 3Q8RB 3VAFA 1Y0HA 3KLIB 4TU7A 4TKTA 3I5AA 4CO1A 5U47A 2B3TB 1FDNA 4NCBA 3QGPA 4WFBQ 1SKWA 2OP5A 3K57A 2KZZA 3GMGA 3D5MA 3TUIC 5KFHA 2E9RX 2GC8A 2XO7A 5EWEA 2WBRA 4RW7B 3VCDA 4ECVA 4YB5A 1DBDA 3CGIA 4CT9A 2LLZA 2XMJA 2J6TA 3FNNA 1MU2B 5B0AA 2B7CB 5KFQA 2PA8D 1YJRA 4RWWA 2AJFE 4Z2XA 1TVRA 3I0SA 1D1UA 5A8RB 3N28A 3K2YA 4UOCA 1E6VA 2B7BB 2N7YA 4DJBA 2ZZMA 4QWAA 4ICLA 2HHWA 4HKQA 3PNIA 2ZHAA 1CPZA 2HZCA 4LT6A 5MAOA 4JOUA 1MWZA 3CCVS 4DS5A 1NKCA 4DG1B 3JSRA 4ECYA 4N8NA 2WK4A 1DTQB 3SXLA 5J1EA 4DQIA 3P49B 1H6KX 1N0UA 3HDSA 4PR6A 3P3DA 4HVZA 2U2FA 4ZP6A 5CZXA 4ED7A 2KRBA 2B9XA 2OSRA 3MECA 3MM7A 4DMZA 3IRXA 5KFPA 4C3LA 2KU7A 1RT4A 4EGLA 3JYTB 3ZZRA 3TVYA 3HKWA 4ZVFA 3D1OA 1DTTB 4EO8A 4ZCIA 5CD4H 3BR8A 5M2RA 1IBMF 2DNLA 2ZH1A 1KLNA 3TUZC 4CQ1A 4YMEA 1RT6B 4WKYA 4NX9A 2JC0A 1Y7PA 2PMHA 2KG0A 1KC8T 5A6PA 2D3UA 4NZ0A 3ITHB 4EYHB 4NLTA 2WBMA 2CPIA 3DRPA 1U1NA 3V5RA 1HNXF 3MMAA 5DGAA 4AE5A 2RJZA 2YWGA 2BV3A 4ZMMA 5F8HA 1DQ8A 2XS5A 2FVCA 4QWBA 4OZLA 3SYZA 4NXNF 1UVMA 1U1PA 1WF2A 5HL7Q 3VAGA 3PM9A 4W92B 3D1HA 3J81Y 3C6UA 3CXCR 4O4GA 1S97A 1JKHA 4DL5A 4QU6A 2D3ZA 1P9QC 4L3NA 3W2WA 2LKZA 3Q24A 3THVA 3BGRB 5HMZA 2ZH9A 3RAQA 5HP1A 4KO0B 3RAXA 3NL0A 3E51A 3F44A 3T1YF 2V9WA 3SFGA 3M9OB 1IQZA 1JNZB 2MKHA 2FDNA 2I5JA 3M1VB 2XMUA 5IWAF 1NJZA 3QWUA 1SL0A 1X9MA 3KNGA 2EWHA 4JI0F 2PN6A 2YQ3A 4U7UK 5EX3A 5E33A 2EFQA 1KTVA 2VV5A 2YKPA 3KOAA 3M8SA 3N0VA 3E3XA 2XS7A 4WK1A 4Y00A 3DLKA 4ZP7A 3UI3A 2DPIA 2BANA 2NZ4A 4YR2A 4DF4A 4RBUA 2AJ1A 4QZVB 1VS3A 2MZ1A 2KFZA 2EKYA 3SDEA 4RZRA 4MH8A 3UWTA 2BJDA 2K3KA 5F9LA 2LEAA 4WFYA 4B3OA 1AW0A 1VQLS 4LF4F 3IR5B 1Y3KA 4LIWA 4MAKA 1N6QB 3KYLA 4DQPA 3I9ZA 1JB0C 3V81A 3ULHA 3PW7A 5KFEA 3CMES 3AH6A 4DF8A 1IUJA 1S0NA 1HMVB 2RS8A 5CZVA 4A8SA 5C42B 1JLFA 3LOUA 2UUCF 3NGDA 2YNGA 1DQAA 2IM1A 2KRRA 1NK5A 2FY1A 5KG7A 2XSJA 1L3VA 3BO4A 4LIRA 4DV4F 4HT5A 4H4KC 3Q22A 2MPUA 1UEVA 1D9AA 2RQKA 1U26A 2RILA 3C6TA 2BQRA 1ZH5A 2HS0A 3OTBA 5J1PA 4MIAA 1L3UA 1ZZNA 1RT1B 2YVSA 1Y5NB 3FRYA 3MGJA 1YJVA 3OFFA 2GW8A 4F2RA 1KN6A 1BQMA 1R8AA 4F4XA 3S8SA 1XWLA 3LF0A 4IG0A 4GMKA 5GMKa 2ZJRQ 3L3CA 4X62F 5I42B 1SL2A 2NSBA 5C25A 1NK0A 3T5JA 1JJHA 2KXHA 4ZK7M 3F41A 1TL1A 3H25A 2L48A 1R8BA 5CCLA 3D54A 3MTKA 4TU8A 4J9KA 2EPIA 3UDLA 2NYIA 3DYAA 3OVBA 2ZOGA 2AX1A 2FJXA 4YDDB 3N4WA 3PX4A 2CQDA 2CPYA 4DDFA 2Q43A 5J2NA 5KFWA 3T5LA 1H2TZ 2OTLS 2X1FA 2RF2A 3DN9A 1VOMA 5BR8F 1OQ3A 4Y65A 2LDYA 5AE3A 4A8FA 1SQEA 2DGWA 4OI3A 2MSTA 2OFHX 3I55S 4LFBF 1NU4A 4TYBA 1TVRB 3I0SB 4NA1A 2MY7A 3CJ4A 4QIEA 5K9FA 4DBQA 4DUYF 1FNOA 1E6VB 4YB7A 4ICLB 1YG0A 2LMIA 4A8XA 3H4DA 5J2PA 1FXRA 2ASYA 1S9FA 1UWBA 5LSOA 2FJVA 3OR2A 2VBZA 2ZHBA 1W2BR 5J1EB 3NNAA 2KKHA 5BYRA 1MMDA 1N34F 3PR4A 3HP6A 4ILLA 2W4CA 2LQ5A 2XEXA 3SSRA 3U27A 4DFPA 4EEYA 1TAUA 3MECB 3OW2R 1FEEA 2IAJA 2RU9A 2GJ2A 3MM7B 3IRXB 3HXMA 5E5NA 5GADI 2LU2A 4X84A 1RT4B 2ERRA 1P27B 2DH8A 4P7TA 3H2UB 2Q3PA 3V2UC 5GAHI 3EPIA 1S72S 1YI2S 2U1AA 4M63A 3PVXA 1S1VA 4B9UA 3BDEA 2COLA 5F8MA 4AL7A 2ILYA 3V6HA 1FTRA 1RT2A 4X2BA 1YWXA 5D4OA 5DLGA 3MUTP 2V4RA 1VQOS 2JL9A 3THTA 2M52A 2DGTA 2MKKA 3TYTA 2J0SD 1RAJA 4QR0A 3WC2A 1Y5IB 2DNRA 2YWHA 4ITSA 5K8PA 2HVIA 3DRPB 5IFMA 4TNOA 3MMAB 4CTAA 4DSEA 2ADCA 2EBGA 2KDOA 1LWEA 1T02A 3HF5A 5E3AA 4H4OA 4QIVA 1HR0F 2VOOA 5GAGU 2DK2A 4B3SF 5J1NA 2F9DA 4ETXA 2P5VA 2ZBIA 3LP2A 3OQ2A 3M4XA 5B0EA 4O3NA 3RYLA 3PIOQ 3NKYA 4NYOA 3PKMA 1OO0B 2KN4A 4EZ6A 1RT7A 2JEGA 1E6YA 3C6UB 3H5SA 4O4GB 4FBUA 1SIZA 1CEZA 4FNHA 1JKHB 5F3TA 1R6YA 3W2WB 3LUYA 4JV1A 4C7QA 3Q2SC 6FD1A 3TO8A 1DLOA 1HBNA 2BW2A 5HP1B 4ED8A 1FE0A 5KG3A 4F26A 3FSIA 2MGZA 3H40A 2XC9A 2I5JB 2VPWB 4ILMA 3UD3P 3NCPA 2LDIA 2VFSA 3QPIA 4IFVA 3ISNC 2IVMA 2YWKA 2ROGA 2AP6A 4IQXA 5G4DA