2JSXA

Solution structure of the e. coli tat proofreading chaperone protein napd
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity in twin-arginine signal peptide-binding proteins.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Chaperone
molecule keywords Protein napD
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03927 NapD NapD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jsxA01
2W24A 2E7WA 2DBBA 2IA0A 2VC0A 2P6SA 2E1AA 2YX4A 2EFPA 2CYYA 2PMHA 2PN6A 2P6TA 2CG4A 2EFNA 2JSXA 2CVIA 2EFOA 2IVMA 2GQQA 2YX7A 3I4PA 1I1GA 2ZNYA 4PCQA 2VBZA 2W25A 2ZNZA 2EFQA 2E1CA 2E7XA 2ZBCA 2VBWA 2VC1A 2VBYA 2DJWA 2Z4PA 2VBXA 2CFXA 2QZ8A 2P5VA 1RI7A
chains in the Genus database with same CATH superfamily
4NLWA 2XY6A 2UVWA 1Y10A 4WTOB 5CCMA 4DV0F 3M4XA 3K17A 1FEHA 2HZVA 2MTLA 2LEPA 4XPEA 3DRSA 1FEEA 1JQGA 2C3YA 4O3NA 3MOJB 1RWOB 5I3UB 1TK0A 3Q0AA 2EK6A 2HFZA 4LF7F 3G87A 2JH3A 1F5CA 4RNHA 2B4UA 1WF0A 2HSEB 5MLCV 2N3LA 2FD2A 2DEIA 1AUDA 4IRKA 3I82A 2V0NA 4RW8A 3KLIB 3GFZA 4KT0C 3MWBA 3MD3A 4M94A 3SDEB 3KHGA 1XWLA 3LP2A 4DZ6A 5CCLA 1Q78A 1BC6A 3K8VA 2DNKA 1VISA 2CJ9A 1PJ6A 3FCVA 3MECA 1JJ2R 5E41A 5D0EA 3BJYA 1I6JA 1HQ2A 4WF9Q 2P5VA 1PYOB 1FJGF 2DNHA 1V5VA 1SPBP 4DSIA 1S1VB 5KFOA 4J9KA 1YJ7A 2MLZA 3D6MB 3IRXA 4OV1A 4F50A 2BANA 2VH7A 2XLJA 3MCSA 1DRZA 1FD8A 2R7TA 1U0SA 2N82B 3HD1A 2A0FB 3ELHA 5I3PA 1XNQJ 1QSSA 3WBZA 4DS4A 2IIHA 3ILIA 4LQ9A 1N6QB 1F0XA 4P9SA 3HD2A 3MZIA 3DLGA 3MM7B 5GAEU 5I3UA 3MMJA 4F2SA 1FE4A 1LK5A 4K4VA 3FQKA 3AA8A 1LWXA 2BR0A 5KFQA 5KFJA 4A8SA 2CUYA 4QIVA 1VQ7S 4K7QA 2YKMB 3ZZYA 3FBBA 2KM8B 2HS0A 1WC6A 2JWNA 1MWQA 2DJWA 4GVBB 3K89A 4ED0A 1JLQB 3S7RA 2U1AA 2DIVA 3MURP 4FF4A 1GXTA 3MM5A 2H3EB 3AA9A 2GIRA 3R6GB 4WFYA 3HJFA 3D1OA 3O3LA 5F3TA 1FF2A 4C8ZA 1N32F 2E7WA 1UJ4A 1YITS 4WU3A 4XK8C 4C48A 2EFGA 2YH1A 1NJIT 4K4ZA 3C16B 3W60A 3LP0A 3UR0A 1U24A 4P7VA 5IWAF 4MMOA 1NK0A 1S5ZA 1W7WA 1NCLA 2XZTB 3DC2A 4ZPCA 3MUTP 1TU0B 4YMEA 3G9CA 1WG1A 3FFIA 3T9ZA 2YVSA 2XS5A 5IT9U 4HVZA 1UW4A 4X84A 2GGPB 3NBPB 4ZPTR 4TY8A 4XIUA 2LP4A 1KVKA 1WKKA 3CPWR 1JLCA 3L7OA 1Q86T 4EO6A 2AGPA 4YHHJ 2GS8A 5CQGA 3DNCA 4DF4A 1M5OC 2RJZA 3UDEA 4QIWD 2WSEC 3MECB 2CZ4A 1EKRA 4G3IA 4XTTA 2CJXB 3H2VE 1AA1B 2FIUA 3U1LA 3NMAA 4QWCA 3ONQA 2X7IA 2CQGA 5KG4A 4A8QA 3ZFVA 2IAJB 3T6BA 4EBDA 2X1GA 2RRAA 1P1TA 3HCXA 2UUCJ 3W61A 4FYDA 2AJQA 4ECTA 1PBAA 3ETMA 4IFVB 2DR6A 2O67A 4UTGA 4QR1A 3RAMA 1D3WA 4NLOA 5KTQA 3K5NA 2HHHF 3JQJA 3MEEB 2FB0A 1JKHB 2R7VA 2CG4A 1FRMA 3DOLA 4AYBD 3I0RA 1FDAA 1SCJB 3FQLA 3LWMA 1EAYC 4OX9F 1Z2ZA 3M6WA 1LXJA 1REVA 1SH3A 1S99A 2M3DA 2RAQA 2PO4A 4MIAA 3GIRA 3T3FA 3F44A 2GGPA 3MR2A 2CVEA 1HWJA 2BOAA 2QG9B 2AYMA 3C14B 3ZTQA 4X65F 1U1LA 1WC4A 3BYPA 1LFWA 3CDUA 1RT1A 4LSLA 4LFAJ 1SUQA 3PX0A 2KB2A 5KT3A 4RNMA 4ZLJA 2VJUA 5EX0A 1TKZB 3FEYB 5HP1B 1J5EF 2JOQA 4KHPF 4KR0B 1LFPA 3UD4P 4MFBB 1JLFB 3Q22A 4PQUA 3MR5A 3DLKB 1R0AA 2V8VA 4IR1A 1XMBA 2MLXA 1YK9A 1IUJA 1VLYA 1JWWA 4Q2MA 4O23A 3A1YG 4J9NA 5DM7Q 4DCPB 5DDOC 1S1WB 1VQ4S 4U8VA 2CAJA 2YWEA 5HMZA 4DQSA 3W2WB 4C8KA 3I9V9 4DBQA 3N9UC 2HQ3A 2RVJA 2G0IA 2XSJA 3C14A 2GAGC 4OYAA 3VQTA 5IV4A 2HFVA 1YZ7A 1L3TA 1S7HA 3FGVA 3VV2B 3MR6A 4HKQA 2R8KA 3PKMA 1JIHA 2RUSA 2OPPA 2VBXA 4ED3A 1U48A 2XMUA 1NJXA 3HULA 1CJTA 3D0IE 2XCAA 1TKZA 3DDIA 2L48A 2YNGA 4NZ0A 4KTQA 3POTA 5ETVA 2CDQA 4OHXA 4A46A 2N3OA 4F0MA 2VPZB 1R3NA 1OJ4A 3HHEA 1VJQA 2C2EA 1Y9OA 1KRPA 4J9MA 2FY1A 3GIIA 1VQKS 1MNEA 3D1QA 4KGKA 1T9WA 3KUGA 4DR7F 4I7FA 1ZAXA 1WACA 2L9DA 4RLEA 5IM0A 4Q0BA 4DR4F 1TL3A 5C42A 5HAOA 1OQ6A 1Q7LB 1GEHA 5KAKA 2GHVC 2RKIB 1REVB 1TK8A 4ZLPA 5LSLA 3OFHA 1KLMA 2HWHA 2DGTA 1S9GA 2OKQA 1TTHB 2YX7A 3KJQB 1GTEA 1KQGB 1Z1ZA 3I96A 4IG3A 4IFYA 3VHQA 3C8YA 1HNXJ 1Q95G 4DR5F 2KXFA 4WU2A 1HPZB 3RBXA 2YKMA 4ZPWR 3DLJA 1TVRB 2CDRB 2IPOB 3RG6A 2ZHOA 2JEGA 2HHXA 4I2PB 4G1QA 2MGZB 4ZP6A 4DUYF 4F8RA 5G4DA 1S97A 4M63A 1QE1B 2D7SA 3DRRA 3OXFA 3FCWA 5GMKa 1VBZA 3QT8A 1T0TV 4AXJA 2FTRA 4DJBA 4I6AA 3NEKA 4KGMA 5F8GA 1JLEB 1RT7B 5EWGA 4P7TA 3ILLA 5H1SV 2HRUA 4H4MA 4KV8A 4F4XA 2R7UA 4KE5A 2E5JA 2HNZB 2DHSA 3PRBA 2JLEA 4NX9A 3FFIB 2WAQD 3TUZC 2LQJA 3J81j 2FGOA 3OL8A 1N32J 3CDEA 1F1BB 4IYQA 2MJNA 3NBPA 1N5VA 1PIEA 2DXFA 2IVYA 4M5IA 2KG1A 4LQ3A 2JEIA 3RU0A 3NOCA 1ZYQA 1DQ9A 1X60A 2X51A 2VA3A 3BGLA 2EPIA 1MWYA 2QLXA 4PUOB 4MYUA 1Y3KA 2LXUA 3MPVA 3OL6A 2XMAA 3QPIA 4U8YA 2QEXS 3QIPB 2KM8C 3TP2A 1YJWS 1WKJA 1L3SA 1L3UA 3E51A 1AUSL 3J7YI 2V67A 3D6HB 5KG2A 3KK2B 1HR0J 2WVCA 1HA1A 4NASA 1ZETA 3DLLQ 3CD7A 5B09A 2DR9A 3VQSA 1CEZA 4MAKA 1K1QA 4O0NA 3HVTB 3LQVA 2OMLA 3UE2A 2FVSA 4DQPA 1TAQA 2L08A 3M2VB 1TAUA 3W63A 1RQ0A 3CMQA 3MM9B 1UAWA 1IWAA 1Y5LB 4ZPDA 3U1NA 1CS4B 5IM0B 5L8RC 1XQIA 2W7AA 5KFTA 2ZNZA 1EKSA 4C0HA 3KLIA 3R7SB 1KHWA 3TQEA 2GJ2A 4ZK7M 2MKSA 3ZTRA 1X7VA 5HVGA 2BX6A 2E9ZA 2XM3A 4I2PA 4Z37A 4X4TA 4USIA 4DPYA 5KFMA 1RAEB 3JSRA 1C0TB 2DT9A 4J9VA 1YVFA 3OTEA 1HD0A 3KJFB 3VGUA 2W8KA 4OYMA 2BMBA 3NS6A 4H4KC 2QT7A 3BO4A 3QJPA 1N54B 4ENOA 3M32B 4GC7A 5J2QA 1IBKJ 2HNZA 4EWTA 3Q89A 1GK8A 4B3SJ 3I5BA 3MM6A 4UW2A 3AOCA 2JFKA 4PPDA 4WE1A 1GMWD 4OZ0A 4USTA 3GV5B 1N5YA 2O66A 3DRSB 5EHHA 3PX4A 3HHDA 2J7WA 4I6YA 4I0WA 4O3QA 3SI8A 3GTYX 4DFJA 2GVDA 1DHMA 3PRDA 4PG5A 3G4SS 5KFIA 4ZCLA 2AJ0A 2DGXA 1LWCB 7FD1A 3O1LA 4JI3J 4ECRA 1ZM2A 2DHXA 2YNIB 3CTRA 4RBVA 4ECSA 3GPAA 2WHOA 3P4UB 3QO9B 1Q8BA 5A8KA 3HT3A 2AJ4A 4MKYA 1JJCB 4OX7A 1T03B 4IR9A 1RTIB 1RT2A 1H73A 3PYGA 2R7SA 3QMQA 4JI4F 3IR5B 5DGBA 1GXLA 4I2QA 3T1YF 1RYSA 3G6XA 3MDFA 2GCFA 1PBUA 4V1Ak 4H4KA 1C1CB 5C42B 2ALZA 5KFXA 4CH1A 4NLVA 3IGVA 4KPYA 3DDKA 1JXVA 3I4PA 3G8TA 3M1VB 4RNOA 4KYZA 2R7QA 3CJTA 3ZNJ1 4DR7J 3Q86A 2RB7A 5HBMA 2AYEA 1SJ3P 4FBTA 1RUSA 2LQ8A 3KHHA 2CRLA 5C2CA 2VDIA 3H5UA 5IFMA 5A8RA 1SQEA 2DNZA 3OR2B 4N7TA 5ETRA 1TMJA 4BC7A 5AE3A 2BM1A 3RBEA 4FF1A 1NJZA 4ZJLA 1RAIB 4DSKA 3UNGC 4ZP7A 1O5JA 1Q8IA 1VQMS 3NOGA 1Q7YT 1G4CA 4I2QB 2M5YA 4ZVQB 4C97A 3D9BA 3GV7B 2EVZA 2VL1A 3PW5A 5D3GB 3KYLA 4KPCA 4MK7A 2CVIA 4KHMA 4NLRA 4QW9A 3LANA 2YQ3A 2CG8A 4UOFA 1RACB 1B7YB 5E3CA 2XMJA 3HSDA 1QY7A 3PZPA 2ZWPA 4RW9B 2HVDA 2W9CB 5K20B 2XY7A 5D4PA 2E1CA 3WIUA 3HSJA 3SFGA 2MKCA 2MQOA 1LWCA 2QFJA 5M2UA 2PA8D 1QTNB 2KRBA 4QIGA 4QIEA 3ZTOA 4WFBQ 1NUEA 4GO5X 4KH1B 4PEOA 4JI5J 1J5OB 4PUOA 4AL5A 1SJFA 1B3TA 1IN0A 5C2GA 5F8MA 5KFYA 1IKYB 4D3HA 3FC9A 2OMOA 3JTOA 5IC6B 1FJGJ 3M9MB 4C9DA 4ZJQA 3L3CA 3GFHA 1UKUA 1N34J 2HYIB 2HLUA 5KOWA 5AJ3J 2D74B 3UN2A 1YHQS 1UCNA 4KH0B 2QL5B 1YGYA 3H42A 3LW5C 2B8PA 4DF8A 3EZUA 1IBMF 1OY8A 3UN3A 2EFOA 3KTQA 1TV6B 2J6TA 2KO1A 2V2VA 3LH2S 3OBIA 4NLGA 1MMLA 3M1VA 1HNWJ 1S0VA 3GIJA 1DJ0A 4TU9A 2AHOB 4DL7A 3MPWA 2C28A 1X4FA 3IN5A 4ED1A 1H98A 1S1XB 3WHIA 3MUMP 3OTOJ 1FKOA 4OI6A 2V4QA 3DRYA 3V6DA 1U0HB 1DTQA 3QLHA 3DRPB 3N0VA 4N76A 4XPCA 2HIQA 4FVCA 4DI6A 3CJQA 4KKOB 5CAAA 4K8RA 2FGCA 3PEJA 1UEVA 4F26A 2RU3A 4IH7A 4F0KA 1AZSA 2ZE2A 4P6QA 2C2NA 1YRUA 5LT5A 3THVA 1T05B 4BS2A 4CRJA 1FA0A 2HKEA 2IYGA 5B0AA 3KK2A 3GSIA 4X4UA 5G0RA 5MAOA 1TL7A 3TJAA 1UVNA 2ROGA 5HSPA 3LGHA 2ZNYA 2CQ1A 2B4PA 3DM2A 3GFXA 3H59A 3NGRA 2FJEB 3V2UC 1YBUA 4B9NA 4ICLA 5DZ7A 3KG1A 2Z4PA 3J7Z5 1HPZA 2P9CA 1XTZA 2QLWA 3HHLB 2LVWA 4FNIA 3W9HA 2HZCA 4TN2A 3Q8PB 4DUZF 1Z4UA 1RT3B 3QLHB 4WK1A 5F9LA 4J91A 3WZ0A 3A3NB 4HTJA 1XNRF 3GLJA 3QFHA 1YTYA 2N4DA 4MK8A 1G3OA 3R9LA 1F60B 3EZOA 4LRDA 3TEHB 3OXGA 3KLHB 4DV5F 3PV8A 2ADCA 5KG0A 4FS2A 1KN6A 2M52A 2E66A 3VAJA 2OJ3A 3RRKA 1IKWA 4CYUA 2HS3A 2XGPA 1SH2A 3MTJA 4WIQA 1UFLA 5J1EA 2QFIA 1F9FA 2AYGA 4O3SA 4ANCA 2QRRA 4UQGA 5G0RB 4R25A 3R7NB 3PW0A 2G2ZA 4C0OC 1RT4B 5CYMA 2DRAA 4B3RF 3QJJA 4ZMMA 4PPZA 4MJKA 2APOA 1XBWA 2R8GA 2CQPA 3N4WA 5K14A 3W64A 3BV8A 4RW7A 3RYLA 2ADBA 4LFCJ 1M5SA 3NGDA 1R8CA 4B3MJ 2CPXA 2F1FA 3W8GA 4KAIA 4ZHRA 4DX6A 2WSFC 3TWZA 4F4AA 2Y1IA 3TAPA 4X64F 4F4ZA 2DIUA 3KLHA 3EM1A 2G2YA 2VFSA 4IO9Q 3GU0A 1MMNA 1IKWB 2HFNA 2B8QA 5D0RA 3MMBB 2EFNA 1N34F 2VHGA 1C4CA 3IWXA 1N52B 2HNYA 2XMVA 2DXEA 2QMXA 4YR3A 4CO5A 4DSJA 2VBZA 3B82A 4NL5A 2AYBA 3I0RB 5LMUJ 3CIMA 4OIXA 5KG5A 2AD9A 1QAYA 3ZZTA 1FKAF 1RB0A 3ADAC 4C11A 1AFJA 2L9NA 2Z2LA 2V8DA 4UOGA 1TKTB 1C1BA 2ZITA 3I31A 2B9YA 5SZTA 1XR6A 3TZZA 5I4MA 3SV4A 2FJWA 4F0HA 4YY3J 1OPIA 3C15B 4F67A 3JAMY 5KT7A 5IXUA 3F73A 2ZH9A 4K5SA 4C8LA 1Y0HA 4HHUA 3ZXWA 3CE8A 4CLWA 4LF8F 4MH8A 4J9RA 2VF3A 4QYRA 3IWNC 3OSNA 2Q3PA 3I9ZA 1V6HA 6FDRA 2NQPA 1R8AA 3DLKA 1WJ9A 3KHRA 4A8MP 3K0JA 4JI1J 2LXIA 3H0PA 3LUYA 4DQRA 4ZITA 5CYQB 2C2DA 1NEEA 1ZM4A 1NH8A 3P96A 4GMKA 1RP5A 1V9OA 3MFIA 5LMNF 5D3GA 2RDIA 1H2UX 5FD1A 4DDFA 4NA3A 3EVOA 1IR0A 2VBWA 4DV7F 2GVDB 1HR0F 1S1XA 2VBYA 5AXKA 1HLWA 3T1HJ 4LFAF 4C11B 4RNFA 1A9NB 4NYOA 3JS9A 4TNOA 3Q8SB 2AZ3A 1WDDA 1Y4ZB 4OYIA 5IT4A 1F9HA 1OPZA 2MPUA 5BXIA 4EZ6A 3E2EA 2HHWA 4ZKAA 5HN0A 2GW8A 3PFEA 3TW0A 4OZ3A 4DUZJ 1CJTB 2DVIA 3QNWB 2B9XA 2D9OA 4UY85 3GCXP 3JSBA 2WB1D 3IAS9 4KGZB 3CJ5A 4V19J 3KJNB 2CPHA 2H4WB 2B6AB 2JC1A 2OEJA 1GMUA 1DARA 1RWMB 2QSFA 3QAUA 4TLRA 3RB3A 3LP0B 3W3SA 2E5GA 2V2KA 2VD3A 2RMLA 5HJXA 5GAEI 2ZH3A 4JOUA 1QSYA 2XSFA 2XYHB 3DLEB 5IS2A 3DHXA 1FERA 5CYQA 2B4OA 2E29A 3GR0A 2DGUA 3VAIA 3FVYA 2Y0BB 1EETB 1UFWA 2BBEA 2MZRA 2IVFB 3HSGA 5FDLB 5CABA 2RU9A 1HMVB 2QLBB 1YJVA 3DOMB 3KMSA 1SQGA 2Y3YA 3RB0A 4OZ5A 4ZVOB 4B3OA 2FJAB 1UMJA 3VALA 3RB4A 4CZCA 1U47A 2RDJA 1X9SA 1REGX 2F4FA 2WTFA 1HHTP 2OEKA 3IM9A 3T5LA 5J2PA 3QGGA 2PEBA 2M4MA 2I0XA 3FSXA 2XZDB 2IAJA 1ZTTA 5HL7Q 3DRRB 4JBCA 3J81Y 4WZQA 1SC4B 2CQ3A 4UOCA 1EX8A 2ZKTA 4USMA 4DFPA 2EFVA 4JI6F 4YQWA 3EZ5A 5D77A 1IBLJ 1VJWA 2Z8QA 3B54A 3CJ8A 3VZIA 4C0BA 4E2FB 1U2CA 2FYXA 2E1RA 1NRKA 4NPOA 4OI2A 3IRWP 1HD1A 4DU7A 2EC0A 1S4FA 1S49A 2RHSB 3GIKA 4Y2KA 4P2FA 1RZMA 4BC9A 4GC6A 2RSQA 3A4TA 2Q66A 2ZHBA 1ZOTA 3VGTA 1RWNB 3BH6B 4YB1P 1EB0A 2DH7A 2IRXA 4LVOP 1DLOA 1VLOA 2V9KA 3C19A 1D8ZA 2NZ4A 2W4PA 4QPTA 2QMWA 4DL5A 3TARA 2UZAA 2YWGA 4L3KA 1HNVB 1PAUB 3QATA 4IQMA 3H40A 4ECZA 1MWZA 5F8JA 1S9EB 2ZKUA 4UUWA 1FXDA 3BO2A 3AAWB 2NZCA 5HROB 3QT6A 1X9MA 3P6YC 2UU9F 3TX0A 2NLWA 4R8UA 3SSSA 4CO2A 4USUA 1Q4RA 3GILA 4USJC 3MAAB 2V4JB 4LBHA 3BQ0A 4JYAJ 2H48B 4OX9J 1TZ0A 2H54B 3DHWC 4KGXB 2Y9HA 2HHVA 2VFRA 5KFRA 5BYSA 1IR1A 2WBMA 4J9LA 3U1MA 2MYFA 2FY8A 5FLXU 1HBMA 4NCBA 4TYBA 3M8WA 4KJIA 3RZAA 2CPIA 4DR3J 1RLCL 1HBOB 2MJUA 3MD1A 2OPSB 4OYPA 2ZBIA 2DNYA 2J6UA 2BABA 3BQ2A 1HQUA 5DETA 2L9WA 4O4RA 1ZZFA 3M2UA 3M8QA 4DEZA 2MY7A 2W9AA 2UXDJ 4QJVA 4EO8A 3BKUA 3ICLA 3TAMB 4W92B 1CJUB 1RISA 1SJQA 4LFBF 1F3VA 5KFZA 3OL9A 4X4VA 3G82A 5JJBA 1FWLA 5F8NA 3PYFA 2BOPA 1FRLA 3R97A 3MEGA 1VRQC 2OPRB 4MT1A 4UZBA 4OQJA 1SIWB 1SI9A 1R43A 2CZVC 2HFOA 2IA0A 3MI7X 3N6LA 4CWBA 2X3GA 2XQCA 1XEZA 2ACYA 4KQZA 1NB7A 1TVRA 4YOEA 2MKKA 3QGHA 2BUNA 1VC0A 1E6VA 1PC4A 3P3DA 2ZBPA 1XC9A 1M5VC 2W2OP 1ULRA 2CIMA 2G1DA 2VG6A 2W2QP 3BH7B 3CJ2A 3FJ2A 2ZH7A 1YJ9S 1RA7A 2D41A 3D5MA 2V9WA 2E5LF 3H5YA 1WNEA 4PCQA 1FWPA 3MGJA 4Z7CA 4LF7J 1C1CA 4F25A 2EI5A 2G2OA 3KG0A 3MAAA 3TAMA 1UZHA 3GJSB 1IQTA 1S10A 1IJEB 1KDNA 3AHPA 4XDDA 3C3LA 1TMMA 1KD1T 1XR5A 3TEGA 2WRMA 4P71A 1RI7A 3EDQB 3MEEA 2Q1LA 4FN5A 4DHVA 5B0BA 1VBYA 4F3OA 3CIZA 2J7UA 4BWJA 4C98A 3OJSA 1U8SA 4H4OA 5HVFA 5IC4B 2BQRA 2QIFA 4DR3F 4M1KA 3HHLA 4OI3A 5GADI 4OYZA 3UCZP 2KZZA 3DOKA 2ZVSA 4ED4A 3KK3A 1R89A 3QT7A 1X8DA 5KFDA 1FX2A 1X5SA 2U2FA 4WFZA 1FO1A 3M6XA 3N5FA 4OYOA 3GIMA 1XR7A 2ZH2A 1OYDA 1RJJA 3BPSP 3T19A 4OI4A 2DNPA 2NREA 1NBEB 1TL1B 1NSPA 4F7VA 3M6VA 1APSA 4PXBA 3VAFA 2VOPA 5F0UA 4M5NA 2HFSA 2K8GA 1KC8T 3CB4A 4USHA 3DYAA 1NAQA 2CJAA 1FVQA 2MLYA 3MCMA 3K58A 2QA4G 1C1BB 2XMTA 4TY9A 1MROA 2DGVA 3BZQA 3HKZD 3VVTA 1NPPA 1MW7A 3VGVA 3R1LA 3NCQA 2AQ4A 2BJ1A 5E2QA 1J5OA 2F4VJ 4L73A 1NK7A 3MMCB 3EJMA 4FXVA 1EARA 1XIQA 1PAEX 3CJ4A 1KONA 3SQGA 3IS9A 1ZM3A 4KO0A 1WTFA 3MPDA 4ECQA 1HYSB 5EUHA 5DG9A 3LAKA 2V4RA 4P2XA 2HS4A 3PDNA 3AOBA 3S8SA 4KBIA 4DSFA 2FVCA 2RE1A 3MM5B 2DYAA 4DG1A 4Q2LA 1QJHA 3OW2R 2ZBRA 2IRUA 1G2EA 3R3TA 2HK3A 2ZOGA 3TQ1A 3CCSS 1XK8A 1U2FA 2VFTA 1UPMB 3NLCA 1VC6A 5LSOA 2HVHA 2IMOA 2QZ8A 4YHHF 2BA9A 1U1PA 3DYAB 3BR9A 4JI5F 1N33J 1BD6A 4X4PA 9ATCB 2H5IB 3MCNA 2MQPA 3L4BC 2X3DA 1X4BA 2BE9B 2KRRA 2BKPA 2BQ3A 4DL4A 2R3VA 1O6XA 3ZTSA 3QSYB 3CCES 1DBDA 1MU2A 3RRGA 4M5DB 3PR5B 5FIIA 1X0PA 4HDGA 2RQKA 2H65B 5E3QA 4ZP8A 4TKTA 3UNYA 4EU0A 2CPFA 1GT8A 1S0MA 1CC7A 2ALYB 2I9SA 3LOUA 4A8WA 1ZA2B 3BSNA 1TKXB 1CSJA 2VFUA 1PJ7A 4NLTA 4NE9C 3UR3C 1E6YA 1CJUA 3AOAA 1KP6A 1S1UA 4NLSA 4A8XA 4CT9A 2ACMA 4X65J 4UY8T 1CJVB 1OY6A 1RHRB 3GQCA 4NLPA 2FVQA 3JB9k 4KB7A 1VDHA 2YQ0A 2CQBA 3KDOA 1MMDA 3M8PB 1Q0NA 5L9XA 3Q8UA 1YIJS 4DPUA 2LQ5A 2P9GA 1N0VC 3D28A 1K9MT 4G6VB 4OLPA 1RTHA 3IS9B 3CCVS 4F4KA 3ILJA 4DQQA 1QVGR 4DU8A 2QE5A 3W5ZA 2FLNA 4DWIA 3KDNA 1OY9A 1H0HB 1RBOB 1HBMB 2JDJA 4TQRA 3PVXA 2GHWA 1LW0A 1I5OB 1U1QA 2UXBF 3LGNA 3TAQA 1NDKA 2PFDA 1ZAVA 3PYDA 3KJVA 2MDAA 4CO0A 2BJ3A 1D0EA 1X31C 1RAOA 4OHVA 4PWDA 3FRZA 1KSPA 5C7PA 3PW7A 3AD9C 4A48A 3R5CA 4URQU 1RGVA 3DGVA 2V69A 1S1UB 4URGA 3QIDA 4CLFA 4B3TF 5B7WA 2ZD1B 2PFFB 2VC0A 3CMAS 3CO9A 5L9NA 2C42A 3CCMS 1FCAA 3GONA 2ZZTA 2WZ1A 2WBRA 2EKYA 4YEAA 5F3ZA 4NEYA 3W2VA 4LF2A 3BR8A 4TU8A 3NAIA 4FS1A 4PWUA 4J9QA 4YP3A 4TQSA 2XCPA 4OJ3A 1LW0B 1RHKB 2G4BA 3L9ZA 1TQLA 1NZ8A 1OS5A 4I6WA 1KQKA 3WX4A 3N28A 5KG7A 5K8PA 1RU1A 3POTB 7AT1B 4ZLNA 1M90T 1KTQA 1HQEB 1SKUB 4M5KA 4NCGB 5LOQA 4EK2A 1L5UA 1YQHA 1D9DA 4CI0B 3PO5A 2DY1A 2GX8A 2V2ZA 1SC3B 5HQ8A 2UUAF 3DLHA 2MZJA 2QO3A 3FZBA 3H20A 1RCOB 1SIZA 3BGRB 2UUCF 3WC2A 4NXMJ 5KFLA 2HIYA 1LWEA 1R7IA 4KY3A 1ZAWA 1QUVA 2BANB 4R0EA 2HHPA 5ETOA 9RUBA 4ED6A 3V6DB 1N5YB 3OTBA 1BQMB 5HLFA 1RWVB 3FCHA 1WOPA 2Z2MA 3DI6B 2UUWA 4O44A 3WDOA 3T5JA 4U7UD 3W2VB 3K5MA 5IV3A 4QWEA 1HBOA 4CLYA 2OI2A 1EP4B 1RK8A 2Z2ZA 2CPYA 1VR6A 4LF5J 3CC7S 5IT9Y 4N8NA 3ZZPA 2V68A 3QFWA 4Q44A 1RHUB 2FC8A 4DV3J 1WUUA 1F5AA 5CZXA 2N7YA 1VCTA 4KGVB 3SBMA 4CM2A 5KT2A 3VAKA 2YKQA 3OHAA 1TL7B 4ECUA 5B08A 4C3MA 4QOTA 5I42B 1NM2A 4F02A 3IA0A 1VIOA 4G65A 4IRDA 1M1HA 2E44A 2NUUG 4LIRA 2NCKL 2VPYB 2KG0A 1GMWA 2Y1JA 1T3NA 5THWA 3PCOB 4GRSA 1FJCA 3W1YC 4GKJJ 2HVEA 3FRYA 5L1JA 2PN6A 4DV0J 2GNKA 1P27B 3ENQA 2K7JA 4I69A 5D0HA 1KS2A 1U6ZA 3AJ1A 3PXGa 4CP5A 4F4WA 3BS9A 1S4EA 4B9MA 1NH7A 2DNRA 5CH7B 1I94J 2MKJA 4A47A 2W1BA 1YJNS 4FYYB 1ACMB 2FLLA 3I87A 2KHCA 1NK4A 1VHFA 4C3LA 3LP1B 1RXOB 3VCDA 1U1KA 1FRHA 1G1XA 2V6AA 5KT6A 6AT1B 4RBUA 4ZP9A 5LMNJ 4FF3A 2FZGB 1JLAB 1YBTA 4F04B 1E6YB 2CJQA 2FJXA 3A13A 4ED5A 4U9RA 2C3MA 3NS7B 4M95A 3C6TA 1JLGA 3FEZA 3OUYA 2PSZA 4KHPJ 2Z57B 2D9PA 2R7XA 1M5PC 3PEHA 1CQMA 2YNFB 1H7XA 3O6QA 4PG4A 4RW7B 4K0KF 1JKHA 1RAJA 3K5PA 4QWAA 1CPZA 2XEXA 4TLQA 1SJ4P 5IQ6A 3BF4A 3CGIA 1UVMA 4WCEQ 3NCPA 2KVQE 4HDHA 3J80Y 3V81B 3RW6A 1UA1A 1SKRA 3AXMA 1BQXA 1VIXA 4CLTA 4HLBA 2O1PA 1S57A 2MSTA 4WPAA 3VF0B 5HQLA 1BUXA 1HWKA 1X4EA 4YB7A 5B0CA 5F8LA 4J37A 3BN7A 1K0VA 3PW2A 2C3UA 1FKPB 4LF4J 1I51B 1N0UA 1WC1A 5KFVA 5RUBA 1T9TA 4OYWA 3PNIA 2UXBJ 2VDHA 2FC9A 1S1VA 4PWWA 1NJWA 3SV3A 4PQUB 2IFXA 2BV3A 5DGAA 4B3MF 2HHSA 4DZDA 1VK3A 2Q79A 1KLMB 4KC5A 2QA2A 5ETPA 3CCLS 1XMQJ 1RHMB 2CPJA 4CLUA 3QAEA 4RX6A 1RKIA 5ADZA 4G1PA 2VODA 5DDQC 1VMBA 2AEFA 2VU5A 4IO1A 1Z2LA 3OR1B 3OTDA 4QW8A 4QR0A 2BQUA 3Q8RB 5DLGA 1AYEA 4MK9A 1MLAA 3JTNA 5B0EA 4DV7J 2WOMA 1S6PA 2ASYA 2G1HA 3QRPA 4CH0S 3BBBA 2PT0A 1Q5YA 4C8MA 1RWWB 4ZVGA 2OPPB 3PIOQ 1KQFB 4DR5J 1VQ8S 1NLKL 4A4JA 2CFXA 1TL4A 1TL1A 3IC1A 2NR0A 2KT5A 3FMWA 3K2YA 2B5JA 3U02A 5K8NA 2Y1LB 4J9SA 2PMZD 2AGQA 3C16A 1AW0A 4QZVB 2AP6A 3M2RB 2WVDA 3Q24A 1SKWA 1VQSA 2HVIA 4FPIA 4DL0C 2BDPA 2KKHA 1IKXB 1Q16B 2ZBQA 4ZPVR 3NGUA 3A8JA 3AT1B 4CM0A 1RTJA 4RUHA 4M5DA 5KFFA 4ZIVA 2VV5A 3OHBA 5HVHA 4HYKA 4ICLB 4YB6A 5BYRA 2HQFA 4ID5A 2XMKA 3UN5A 2ZH5A 3O8WA 3X3UA 5AE1A 5LXRA 3SFUA 4Q43A 2F7VA 3H90A 4CNYA 2NYHA 2XC9A 3HVAA 1U1RA 3TA2A 1Q8LA 2K06A 3RAXA 2VG7B 1FFWB 2EG2A 3K8WA 3LP2B 3ZO7A 1I94F 1FVSA 2PE8A 3RB6A 4K4SA 1RBAA 3P5BP 2JEFA 2HGLA 3UPFA 1DTTA 2LDYA 1RAGB 3R8YA 3UD3P 1ICEB 2VUGA 1VRUB 1Y00A 1SL2A 1TFYA 4NCAA 2ILYA 4P52A 5U47A 4ELUA 1ZH5A 1U6BA 3UVJB 5E0OA 2OTJS 3KLGA 3NG8A 3DOMA 4AFFA 4OJGA 3T6JA 3HZGA 5L46A 3ISZA 5JUMA 1PJ5A 1SQFA 1TR0A 2AWZA 2VQEJ 3UFCX 2KDOA 4NMLA 2HQCA 4DV6F 4ECYA 5HLFB 2J9DE 2CJYB 4ZVPB 3BO3A 1UP1A 4C8YA 4NZ6A 2HHUA 3LP1A 1UVIA 2VG6B 1RAAB 1S6OA 4MIWA 1FT8A 1HNWF 2A2CA 1WELA 4GVBA 5DJBA 1HI1A 4R5PA 1JXLA 3MM8A 2B5JB 3GV8B 3RBDA 1QAXA 2JNJA 4YR0A 2F9JA 5IT0A 3SIPB 2GA7A 3LTOA 1R0AB 5D4NA 1FWKA 2E5IA 2ZD1A 4YS2A 5J1PA 2H1YA 5KFPA 1B99A 2RILA 2LA4A 1NHVA 1WSRA 1V3SA 4ERDA 4J9OA 2CADA 4LRBA 3SXLA 3ITHA 2HWTA 4F3QA 4DV1F 2XWXA 3HLUA 1CBKA 2CA9A 3AJDA 1S1TA 1QM9A 2EEYA 4QBUA 3OXLA 1KVJA 1Q8KA 3JQMA 3TNVA 3DOKB 3CJ3A 4PXDA 5F0WA 4EYIB 2DH9A 2EWHA 1QE1A 4LT6A 2OFHX 4OL8A 4PQAA 4LVNP 3I55S 4B3RJ 2C2MB 2R42A 1VGYA 1WOOA 3AQOA 3I5CA 1WEXA 4NOHA 1KOOA 4YN3B 4WFAQ 4JI3F 2AMCB 2GO8A 2NPFA 4Y28C 4WBFA 4KV8B 4WXWA 4CLLA 3HHNB 3BYRA 2MXYA 4U96A 4WJBA 1ZTWA 3FKBA 4CTAB 4DR6J 4AXIA 1N36F 2R7WA 4HI1A 1VC5A 3HK2A 2RKIA 3M05A 3D68A 2PEHA 4BBYA 4DFKA 2BZ2A 1YZ6A 3EGWB 1QD1A 3ZC4A 2KHDA 3KNGA 5KFWA 4LSNA 5C25A 4K4WA 2B9WA 3SMZA 2VQFF 4WTYA 1H3DA 4LFBJ 2WOMB 4IKAA 4WP9A 2QLFB 4Y6IA 5ETSA 4P2SA 2DGWA 3K5LA 2OH2A 2GQ2A 1UEUA 2CNOB 3W62A 1IM6A 3CT9A 4OZLA 5HATA 4R5PB 5L1IA 2NUHA 3OSPA 4NZ7A 2WCXA 2UXCF 1VQLS 4N8OA 1W2IA 3OV7A 4DV4F 2O5DA 4ZS6A 1WC5A 1U09A 4FBUA 4V19X 1UWAA 3PKYA 4UOHA 4ECXA 1OWXA 1S7IA 4K4YA 3A3OB 2LA6A 1H38A 5L38A 1F2HA 3GFYA 4DV3F 3M8RA 2E9RX 3C6UB 3FBCA 3IAM9 4NLXA 1QTMA 2A6MA 3CVKA 1PKUA 1HL6A 2HAFA 2C2OB 2XI2A 1LWFB 5ETTA 3Q8YA 5IQQA 5JMNA 4IQXA 2VOOA 3QJLA 1EETA 1U6FA 3CDAA 1RA6A 3VAGA 2ZM6F 5DG8A 1WC3A 3TO8A 1TUWA 4NRUA 4X62J 4H54A 3CXCR 2MY8A 1C0TA 2XSJB 4GVLA 1IKYA 2AJFE 5L39A 3OTOF 2VQEF 4C6AA 4WFXA 1B4SA 5F9NA 3RR8A 3B78A 1URRA 3DU6A 4ZA1A 5B0GA 5A8RB 1FFGB 2V8PA 3I56S 2NS1B 2OPQA 2CJKA 1UFKA 2C1EB 1SXLA 2NXEA 2AJ1A 4DR1F 3G2XA 4M5HA 5I42A 1TV6A 4DPTA 4NYZA 3OQ2A 1EJ7L 4CO4A 3KUHA 5CA5A 2HG4A 4NI2A 4ZPBA 1HFEL 1N88A 3IBWA 3NP5A 3G8SA 1TP7A 4E98A 2ZFHA 3DCAA 1S79A 2RIJA 3MHYA 3IGNA 2X1AA 3R6LB 2ATLA 3IBFB 4Y2IA 5JVHQ 1DZ5A 1I1GA 2LYVA 2N4CA 4FYXB 4LSZB 5KFBA 1ZPVA 1EQMA 1VI7A 2AEJA 3Q2SC 1X5TA 3NKYA 2KFYA 1NSQA 1U7LA 1U45A 1WF1A 3CW2C 2FJBB 2YBVA 3MEKA 5CD4A 4LF6J 5EX3A 4WKYA 3JYTA 2BKNA 5H9EK 3CMES 4EBCA 4ZVHA 3UI3A 1RKJA 2B4VA 2ROPA 3GB0A 1FNMA 2G13A 1YDLA 1EZZB 1TUVA 1ZS6A 2OTLS 4B9LA 2ZJRQ 1TK5A 1YJTA 3HXMA 4O4GB 5CZVA 2SXLA 2RF2A 2OO4A 4HR2A 2O01C 3W66A 1VQOS 2W4DA 4X4NA 5HBMB 1JXEA 4H4MB 4WE1B 4ZPAA 4JI8J 3EXCX 4DLEA 4JV1A 2KU7A 4IG3B 1ZA1B 4YY3F 2K1RB 2EK1A 3HHLD 3LF0A 4OLOA 5ETKA 3V6HA 2J7KA 1NJYA 4QYZJ 3BDEA 2PC6A 2XHCA 1BMQB 2B3TB 3ETOA 1WHVA 4Q7AA 1KKHA 2GHPA 4HH0A 1FKOB 3DMJA 2HBRB 4RW6B 4HH1A 4DV2J 5LMUF 2XYPB 1FXRA 5LJ5Y 2CPZA 2R2UA 1KBRA 3N6MA 5D78A 2VQFJ 3FEXB 1VBKA 2DNMA 4QWBA 4DXLA 3C2PA 4PAAA 3UO0A 4OI0A 4YB5A 4CO3A 1WTBA 1LXNA 3UQSA 3M8SA 2NXCA 2YNHA 4OX8A 2HVZA 2JVRA 3FK4A 1P8GA 1S6QA 3IO1A 4ITSA 2IM0A 1YSJA 1IKXA 3UDCA 5FLXY 3BSOA 4FNHA 4LBIA 4NRTA 1VQNS 1HBNA 4LF5F 2KL8A 2HQGA 2HMIB 3D3BJ 1GXUA 2KFNA 1YKWA 1HWIA 1GX5A 1WI8A 2DKOB 2DY9A 3G8QA 1CLFA 3A8KA 2FQQB 1CS4A 4KSEB 2W25A 4FKYA 4K59A 2WVEA 4HTIA 4RL1A 5CYJA 1DY3A 1X4HA 1EQ0A 3EXYA 3TUPA 3HJVA 2A3JA 2AW0A 1FDBA 2XI3A 1Q79A 2VKRA 5EN1A 4FYVB 2BJ8A 3JYTB 2C2RA 1C2PA 5K5MA 1S6PB 3D2WA 5E3AA 4EI2A 4Y3CA 3CF5Q 1PG5B 4N56A 1B64A 5DZ6A 2KZMA 1NU4A 3SCJE 4IOCQ 2IA6A 2F9DA 3GP9A 3QRRA 3CCWA 4ED2A 3UWTA 2HURA 5J1EB 3NL0A 2J0SD 5KFUA 3GR1A 4JI2F 2BJDA 2DO0A 5AXMA 2F8EX 2HQIA 2KYZA 2J9DA 3ISNC 1NK6A 2MSSA 1JJHA 1BWEA 3IRXB 3SZ2A 1QAIA 4OJ1A 1IBMJ 2DNLA 4X4RA 2BJ7A 4ES3A 4LF9F 3CCRS 3R5BA 3NGKA 1VOMA 4CDIA 4N5SA 4DQIA 1GH8A 4KIAA 4OFZA 3FDSA 2DNOA 3IXQA 4ZDNA 1LW2A 2XG8A 2J76E 4J7CA 2V8GA 3L7PA 3EPIA 2VB6A 1XMOJ 4LMZA 2V63A 2ZDPA 3NS5A 1FRIA 3D3CJ 4K2XA 2OPQB 2W9BA 4LBPA 2ZM6J 2YNHB 3PYEA 3V6JA 5T41A 4X62F 1UETA 2XBPA 2H5JB 4TYAA 1HBUA 2E1AA 3F0NA 1SL1A 1T03A 1HNXF 1BWVA 2OUGA 4YDDB 1M1KT 2CZ9A 1JLGB 1T3OA 1CG2A 1VQYA 2XMWA 4KFBB 2JRSA 4NA2A 1R31A 3OTCA 4OX6A 4XDCA 5DQIA 2KI2A 3G6ES 1N4LA 1YRTA 4RUAA 3J7A1 2YNFA 3MF5A 4LREA 1T9UA 3EGNA 3TVKA 1C0UB 2RUGA 2WVFA 3UVJA 3D7SB 1M1GA 2DNQA 2W2MP 3BQ1A 4ED8A 5KT4A 2L41A 3JSYA 2YX1A 1U26A 2LMIA 3IFEA 3OT9A 3Q8VA 2LQBA 3CCTA 4C3KA 1R0BG 4BDPA 2LKZA 1JNRB 2DGQA 2MQLA 4RNNA 3QO9A 1F5BA 3L95X 2UXDF 2LLZA 1FXLA 3V4IB 2Q6CA 3FNNA 2KT3A 3Q83A 1R8BA 2BVZA 1RTIA 4ES1A 5K8MA 3EMTA 1SJ1A 4HT7A 3CNQP 3DXSX 3H25A 3N79A 1K47A 1DQAA 2F8MA 4CO1A 2ASDA 2HHHJ 3GYXB 1OSCA 3ZZOA 4Z7YA 2IRYA 2WW4A 4DV5J 3MM8B 5EWFA 5LJ3Y 1BGXT 1FE0A 2R8IA 1VRTA 5LM7E 3H4DA 5CXTA 4YFUA 3AH6A 1N6QA 1VQ6S 2B7BB 4DFMA 4DX8H 2ZHAA 1VQ5S 3J81U 2K1RA 2OPRA 4PR6A 2JC0A 4Q5VA 3HVWA 2G0CA 2V94A 3J7YU 2MZSA 1N5QA 2I8EA 5GAGU 3RUBL 4EFAC 4ZHRB 1M5KC 2DO4A 4M5LA 4RWXA 3K59A 3D67A 1BHNA 1EP4A 1U02A 4M5GA 3W65A 4Y2CA 2MQQA 5BR8F 1NHUA 4U67Q 4CIOA 2E5LJ 4DSLA 1UJ6A 1VS3A 2CXEA 3H7HB 1JLBB 1XJWB 4N47A 4XO0A 1RCXB 3BEGB 2YNGB 1IJFB 3EICA 2C3PA 1SC1B 2KH9A 5ETQA 3ET6A 1NPKA 4AD6A 2UVRA 5M2RA 1VHIA 5EDWA 4AL7A 5HP1A 2DR7A 3VR1A 5CD4H 3SSRA 2VASA 2F63A 4EYHB 2GAHC 2PD1A 2B6AA 3C6UA 3FBEA 3TOQA 3ZZUA 1RHJB 3JAMU 2QX0A 1U2RA 3GMGA 2X1FA 2DNGA 3I0SB 2AKWB 3I6PA 3KWMA 5EGYA 3PFOA 1RT5B 2HPUA 1XN9A 2GQQA 3FBFA 4WIIA 4F36A 1T8EA 3BPDA 2ABYA 4WP8A 1HKAA 1S1WA 2YQ1A 1QVFR 4MKVA 3CULA 3HO1A 4Q45A 1IBLF 2D3OR 1X5PA 2JJ4D 2OP5A 1RU2A 4ED7A 3MEDA 1G6BA 1HHQA 1U0HA 2BYCA 2LU2A 4PG6A 3HMJG 4DX5A 2Q43A 1WHYA 3KHLA 1HNZF 2NYIA 3KK3B 2VONA 2VPXB 4OYBA 1UEKA 3IG1B 4JI7J 5CHCB 3EYZA 2CQDA 4RW4B 3TZXA 3M7VA 4ZJOA 5J2PB 4C7QA 1RT2B 2DXDA 2GIQA 4FYWB 3RGIA 5DLFA 1FRXA 2W7OA 3BDPA 2I5JB 2BE7D 3MM6B 5GAHU 5F41A 3AY0A 2MHNA 4NEZA 1MSWD 1D09B 5DRKA 4DV6J 3ENVA 2RS2A 1YRXA 1IBCB 3V5RA 1GMVA 1K44A 1I3OB 1X5OA 2H5EA 1HI0P 2MZ1A 4DV4J 4P72A 2XO7A 1YLXA 4DL2A 1PO6A 3DM2B 3AB4B 4NLQA 1B0VA 3V4MA 2HHQA 1L3KA 4W90B 3ILOA 1HBNB 3W8PA 3BB5A 1S0NA 2EBEA 3D6FB 1D1UA 2XZWA 2KFZA 1ZBTA 4B02A 1T9VA 4CLPA 5HJYA 2HK2A 3E01B 3G71S 2IBOA 2R2RA 1N56A 3C15A 2J9CA 4HHJA 5JXSA 3CEDA 4FZVA 2VICA 2M2BA 3ET6B 5IZHA 1AZSB 5DO2A 3UD5A 3CWJA 1P1LA 1RHQB 3V6KA 2HFUA 2V5HG 3NMRA 4O4GA 2RF2B 4B08A 1A6LA 3GE9A 3HVTA 2IM3A 4TU7A 2M9KA 4KRWA 2JHEA 2I6WA 1RSCA 2JL9A 1RDRA 3PG9A 4IFVA 2IVMA 2K3IA 4O0IA 1RTDA 4NXNF 1XNRJ 2L3MA 2FZKB 1Q53A 2AX0A 2NXNA 2OELA 1S6UA 2PMWA 3QWUA 4BWMA 5KFCA 3Q8QB 3IP0A 3DN9A 3S1TA 4HT5A 1VQ9S 5FJ4A 5KG1A 3B6BA 1FK9B 1AROP 4ATNA 3MEDB 3CUNA 3BSCA 4ETZA 1RE1B 1PCAA 1YWXA 3OD2A 2R2SA 4WFNQ 2ZUAA 3TANA 2F65A 4AQYF 3H2LA 1WHWA 2WB4A 3HX9A 4PYDA 4ILRA 4QYZK 1AFIA 1K8AT 1T11A 4Z2XA 4LF8J 3QSIA 4RBTA 4ZVSB 2YKOA 5HMWA 1N36J 1QDUB 1QAJA 2LXFA 3BBFA 1HNIB 1BY9A 1WEYA 4OZ2A 2ZC3A 4X66J 3CCZA 1N8RT 4PG8A 1CQNA 2QYGA 3NWRA 5DS7A 4ILMA 4F4YA 3QBCA 2C3OA 2CPEA 2XLKA 2EBGA 5A6WA 4LFCF 2UUTA 2ATCB 1YJUA 1K1SA 2HMIA 1J27A 4JYAF 2Y0SD 4MKAA 5KG3A 2OLWA 3THPA 3TZYA 4I1TA 4N77A 2WONA 4DLGA 4QCLA 1UL3A 5AT1B 1NPRA 3P8BB 4LR9A 4TVAB 2AT1B 4I4BA 3GCWP 3EX7B 1QUPA 4X4QA 1U49A 1VBXA 4CLZA 1JLBA 2AF6A 2I38A 3JTPA 3A12A 1R6YA 1ZPWX 4LF1A 4OV6A 2BJ9A 4DL3A 2QC3A 1S9EA 2F4VF 4ECVA 2DRDA 4ID8A 3TA1A 3HSZA 4HHHA 5GAGI 3J7ZT 2EFPA 2MMYA 3T41A 1ELOA 3VTIA 4DR6F 4I67A 2A6OA 1JLEA 1RT7A 2FZCB 3CO0P 4DPWA 3R5AA 1VYAA 3GJRB 3KG4A 2BKOA 4U7UK 4F3MA 2YWWA 4CT8A 2HNDB 3GSDA 3ZZZA 1YJRA 2K3KA 2VFVA 4Y2AA 1WORA 2RH3A 5F8IA 5JVGQ 2W4CA 1KEKA 4AL6A 3GWCA 2M70A 4ZCKA 3TYTA 2QMUB 3W5YA 2DD8S 5GMEA 4CQ1A 4AQYJ 4JB8B 1FDNA 2YH0A 1RAHB 4QWDA 3QZ8A 1VQPS 3HVRA 1JLCB 4A8FA 4IH6A 2VZ9A 1UWBB 1LW2B 2LDIA 4IFYB 4P75A 2I1RA 2FHOB 3AXKA 4PXEA 4QQBA 1S76D 4P74A 4X66F 1Y7PA 3WQPA 3RR7A 4EZ9A 4ELVA 3CCQS 3IG1A 3SQOP 2HW3A 4P10A 3O5TB 3CJKA 4DUTA 2IC3B 1N5TA 4I56A 3AJ2A 1HI8A 3LPEA 6FD1A 2MB0B 1T05A 2P6TA 2BJEA 2CQHA 4GKKF 1IWGA 2MZTA 3TR5A 2YKPA 4KFBA 1AXQA 3M2VA 3EE3A 3HPOA 2ASLA 2RRNA 2QLJB 5C24A 1HWUA 3H98A 3QGPA 1NDLA 4CLSA 3EGVA 2AZ1A 2CQ0A 1NSAA 2CJBA 2F40A 3NGSA 2NSCA 1O8BA 2D3UA 3DOLB 4PG7A 1U1NA 2E7XA 4FF2A 1FNXH 3DKDA 1X4AA 3PJWA 4DPOA 4JV2A 3I0SA 2CQ4A 2GV1A 4WYLA 4NXNJ 1T7PA 2R8JA 1D9AA 3SEOA 2UUBF 3PW4A 2A10A 5GAHI 1BQMA 2B56A 1B7FA 1DFDA 1UW9A 1X4DA 3MR3A 4ZVUB 1U25A 5HO4A 2DBBA 2XNQA 3UCGA 1SKSA 2MQ8A 3CCJS 3HHLC 1PC5A 1D9FA 3JSMA 1M0SA 3Q23A 3OVAA 5AXNA 3WX8A 2BXJA 2YWFA 2BRKA 3D0GE 3M32A 2OPSA 4ZVEA 1CC8A 1YBAA 4LR7A 4LR8A 4JI0F 3TJ8A 5J2QB 4O3OA 2M8DB 2YKNA 3IBCB 1S72S 2FHJD 5B0DA 3TVYA 5KFKA 2HNYB 5C24B 2D3O1 2KT2A 4LIWA 4ES2A 2OSQA 1N48A 2G0JA 1YI2S 3ZTPA 2GZOA 1S59A 1NMEB 2ROEA 4PABA 1R27B 4ZVFA 3MM9A 5LL6d 3H8YA 4HACA 1FK9A 1RAFB 3MUVP 4AUKA 2QL7B 2W8LA 2UVUA 2HEKA 4B9TA 3NXZA 2KJVA 4LF6F 4QU6A 1UJ5A 2FHMA 2M0GB 2YTCA 1PGZA 4BHQA 1RWPB 3DLBA 1R8HA 5E7OB 1WHXA 3MMAA 4M5MA 2P6SA 2QGFB 3PHTA 5F8HA 3T1HF 3PO4A 2A1BA 3KJVB 2WK4A 2ZE2B 5E3PA 4ETXA 1OIAA 2HGNA 8AT1B 3M9OB 4JI8F 2XULA 3N01A 4DUYJ 1S6QB 4K4UA 4Q0BB 2F8HA 2M88A 3AODA 2MQNA 2XNRA 5T7LB 1UPPA 1VRTB 4OZ1A 3BGOP 3SCLE 3B8HA 4P73A 2Y8YA 1NK8A 4R8UB 2HLTA 2UV8G 4HI2A 3MFHA 3AFGA 1FTCA 1CJVA 1RADB 2IJFA 3DDNA 3HFVA 4FP9A 3N5BA 5ETMA 3S6EA 3KLGB 2CNKB 2EKNA 3BSAA 3F56A 4MYTA 4PZVA 2V2QA 3KUEA 4OMFG 1WF2A 5LSRA 3K57A 3JSMB 4JI4J 3GG1A 5HK4A 2ZUGA 2XS7A 3RW7A 2UXCJ 1WOSA 4C2MA 4RW4A 2YNIA 5HMYA 3GYGA 3DRPA 3R1HA 1S9FA 3R7BB 2I5JA 3FUYA 1IBKF 2QSWA 3BKTA 3NRBA 2D1CA 1OQ3A 1PILA 3BM7A 2KJWA 4NCGA 5BR8J 1DURA 1IXKA 5DG7A 4D3GA 1UVJA 1NK9A 4NLUA 2EFQA 4GKKJ 1LNQA 3VZHA 1MN9A 3MPUB 4MTPA 3K5OA 3EVMA 4I68A 2XLIA 2DITA 5D4LA 2QV6A 1RT5A 3ZNUA 1NB2A 5J2NB 4ELTA 3QQCD 3QGIA 2R7OA 3JQKA 2BRLA 2EG1A 4GO7X 2FJVA 3QT5A 4O44B 2DTJA 3DI6A 1GQEA 1KHVA 2ASJA 2QTWA 2WONB 3A8IA 1MN7A 2FVPA 2YPZA 1RT1B 4LSLB 1CULA 2POKA 5B0FA 1GTHA 4DX7A 1XNQF 3TVZA 3OR1A 1WG4A 4L72B 5BYQA 1WWHA 2QA1A 3F41A 3BGUA 3HP6A 4EBEA 4U6PA 1NKEA 4QIFA 3KMQA 1LEOA 1TKXA 1FJ7A 2P2CB 2ZEJA 2PIIA 1OSDA 1RT6A 3TX8A 4DCOB 4M8LA 2CQCA 2LFVA 2FLPA 3EUNA 1RTDB 4WWSA 1NDPA 2X1BA 2LEBA 2ZZMA 1NXIA 2DRBA 2EW9A 3LALA 2G9OA 3THTA 3R27A 3S01A 1WDTA 1URNA 1R0CB 4ZCIA 2V50A 3QWPA 4ZVTB 4LRAA 3I4HX 3QZ7A 1TKTA 2A2DA 2PA3A 5H9FK 1N33F 1UZDA 3SCKE 3GJQB 1LWEB 2E1PA 2DGOA 2XMMA 3T5KA 3DLGB 3M8YA 3MM7A 3BREA 2FDNA 4OI1A 4USKA 5HI7A 1O0PA 1X4CA 4J9PA 1RWKB 2DPIA 4E8UA 3DRXA 2Y8WA 4ZOSA 2NXUA 3O44A 7FDRA 3OFFA 1HNVA 3DXBA 4B3SF 4WZMA 2GC8A 1CJKB 1M5HA 1SV5B 4WK3A 1Q5VA 5A0YB 1FNOA 2Z0GA 1WI6A 1AB8A 1FX4A 3PJXA 1Q82T 1TFWA 1VRUA 1CVJA 2ZZNA 2ZBCA 2DGSA 1NO8A 2MHEA 1S48A 3T1YJ 4L75A 3PX6A 4W4MA 2GMHA 2AV5A 3BBCA 1H2TZ 1WC0A 2QA4S 2AGOA 5J2MA 2GIFA 3FMBA 1IR2A 2C2ZB 2XTJP 4M5JA 2CWKA 2FPHX 3ENWA 1MROB 3IWLA 4H4OB 3H5SA 3M8PA 2RT3A 2H9ZA 2B7CB 2M8HA 5AXLA 3AQPA 4UT4A 2JLGA 4ZN1A 3LO3A 5D15A 2UU9J 4IRCA 3MR7A 1RTHB 2QYCA 4ILLA 4K0KJ 5KT5A 2DH8A 2IM1A 3G6YA 1IKVB 5A8WB 2GVZA 2ZH8A 5ETNA 5A76A 3VAHA 3ISND 4NMXA 1RYRA 2DISA 1F6TA 2HNDA 4BCAA 4NLDA 4DV1J 3OLBA 5A0YA 3PR4A 3SYZA 2K2PA 1BE4A 3BGRA 1JJ4A 1SC6A 2DHHA 1GAOA 4OJHA 2DCUB 2IYIA 4Y00A 3G96A 3R5GA 5C5JA 5FDLA 2J0WA 2IY5B 1T94A 2XHWA 1FI4A 3RRHA 3KNAA 4OHYA 4U7CA 4JV0A 1BLUA 2GFFA 2AU0A 5J1NA 2IM2A 5KFSA 4CLKA 2FUG9 2PMHA 3SQGB 3QIPA 1KFSA 3OR2A 4S0MA 1LQ9A 1D8YA 2R9LA 2OD6A 1JNZB 2XY5A 2J0XA 1HW8A 2BACA 3I32A 5D4OA 3WC0A 3EDRB 4JI2J 4N41A 1OYEA 4ER8A 3P45B 3H2UB 2A18A 2VA2A 3M2UB 3M8QB 3W5XA 4DG1B 3IMQJ 2W7PA 2ERRA 3M30A 1QLNA 2ZJPQ 4ZLLA 2JZ5A 4DOZA 5KOXA 4MFBA 1HQEA 2R8HA 3NNAA 5KFGA 3P49B 1FKPA 2VC1A 2MKYA 2R4FA 3MEGB 4FXWA 2VJVA 3R5JB 2LU1A 5D6GA 3MAQA 1RT4A 5CYMB 3PM9A 1OMSA 1T02A 5T7LA 1U1MA 1DQ8A 3KK1B 3HFZB 3TZWA 2Z58B 1GNKA 4EUVA 1RABB 3IR7B 3Q2TC 1B0PA 1CULB 2XYGB 1UWBA 2ZDOA 4AE5A 3NAHA 1U4BA 5K9FA 3OFEA 4IOBA 2O3DA 4WKRA 3VAMA 5ETLA 4W98A 2PI5A 3UCUP 1QSLA 5KFAA 2DPJA 1ROFA 1MG7A 2C2KB 2KXHA 4B9SA 1JK9B 2W2NP 3RAQA 1Q81T 4YUDA 3B4MA 3PY8A 2AEMA 3N6NA 1RWXB 3C6TB 4DN9A 4B17A 4EGLA 1W2BR 5GADU 3MMBA 3QYYA 4C8NA 2MZQA 3CD5A 3J7AN 2GJFA 4PWDB 3CDBA 1H72C 1Y5NB 3M8ZA 4HACB 2V4JA 2J0QD 2IBKA 4FVMA 2OD4A 3KK1A 2Z56B 4L74A 4IG0A 2HAIA 5D0GA 3MMAB 3RTVA 3KLVA 2D3ZA 3K7RA 2FHKA 3NWGA 1SVDA 4DMZA 3PHEA 4JV5J 1RTJB 1A7GE 1KWMA 2RS8A 4JI1F 4KO0B 1N5SA 1T9XA 3OVBA 4ID5B 1HIYA 1HW9A 1HWLA 2HRTA 3M30B 3TUJC 3CCUS 2FJDB 4RU9A 1HHSA 3GYNA 4IDKA 3R5DA 4UZCA 1UA0A 1R6VA 1UVKA 4LJMA 3U7JA 1JLAA 1PYTA 2FLOA 2E5HA 1ITPA 1B70B 1YG0A 1TELA 3AB2B 1U8WA 3D66A 1WSVA 4UF4A 5DDRC 1NKCA 4JI7F 2W01A 2KYXA 2J8SA 4K50A 2CKWA 4NI2B 3L09A 2VPWB 4WP3A 5HMXA 1W26A 2LECA 2DCLA 1VK8A 5ITHA 1S1TB 4K4XA 4B9VA 4B3OB 2W9BB 3CDWA 2BW2A 4C4WA 2CWXA 2UV8A 2E9TA 2ZOFA 1FJEB 3EVWA 2GQCA 3DFEA 3ULHA 1UTAA 3W9IA 1UVLA 1KVIA 2F5GA 3R2CJ 2RRBA 1F2GA 1P9QC 4O3RA 3V81A 3SDEA 4OZJA 2ZC4A 2JSXA 1SUQB 2LQ9A 2BM0A 2V34A 2VKZG 5BJRA 4QR2A 4IH5A 3KFWX 3AD7C 1SB6A 5DM6Q 3IM8A 2GJIA 1K73T 1K0TA 1NDCA 1KFDA 1C4AA 1H7WA 2JEJA 4L3NA 3G86A 2UVVA 1JLFA 1S77D 2BE2A 1G7CB 3E8OA 5E33A 4AT1B 3T1AA 2J8AA 3KLFB 3A8EA 3KLEA 4TXSA 3VVUA 4X4SA 1YX2A 5J2NA 2CPDA 4C8OA 4RW9A 4L6V3 4IUFA 2MEWA 2GMLA 2QL9B 3OVSA 3B4DA 1RWUA 4QPXA 2KN4A 2COLA 1TKDA 4JV5F 3HHKA 2AJ2A 3W2WA 2RQCA 5J2MB 1F9EB 3QRQA 4PRFA 3DGPA 5EWEA 4NA1A 3HT0A 4NLYA 5E5NA 4A8OA 4B3TJ 2XS2A 5T14A 4PYAA 4CNZA 3PTWA 1NSKL 3VGSA 2VG7A 1H6KX 4PXCA 4URSA 4IDKB 3NNHA 1DTTB 1W25A 2UUAJ 4IOAQ 5HROA 1IKVA 5A8WA 3M9NB 4GKJF 2P9EA 2ZOMA 4LRFA 3HZEA 4NXMF 1PSDA 4ZIWA 2DR8A 3UDLA 3T9NA 2BE2B 3FZ2A 3KLEB 3KLFA 3MTKA 8ATCB 2XWYA 4Y65A 4DL6A 1RLDA 1LKZA 3PRVA 4DR1J 2HRYA 5H9FJ 5AE2A 1WG5A 2RD5C 1WD6A 3M2RA 2J5AA 2YXLA 1T9YA 4CTAA 3A3PB 1DTQB 3FSYA 4FKXA 2J6SA 4X2BA 1BXNA 4J9UE 3AD8C 2XGQA 5DQHA 3LWLA 3DGPB 1NK5A 2VG5A 2ZH6A 4K5RA 2Q6BA 3HM9A 2RHQB 2ZJQQ 1IM4A 1L3VA 1IVZA 3M6UA 4ZVRB 3NNCA 2WVBA 2P8IA 4ANDA 1CJKA 1JX4A 2XB2D 1H2VZ 3BKFA 4J5OA 5IOLA 4A8YA 2D69A 5KFHA 1FDDA 2CQ2A 2IJNA 1RT6B 5L1KA 2AX1A 2NPIA 1BQNB 5KG6A 3MPYA 2DEJA 3SSQA 2FHJA 2YWHA 3G82B 4RUBA 2OIHA 4YR2A 4LF9J 4O3PA 2UUBJ 1GX6A 4R0JA 2J9EA 4E0DA 2E1MC 1FTRA 2VIHA 4K4TA 2W24A 5D8HB 4DR2J 1WKLA 2B51A 2DHGA 2MKHA 1FRJA 1TL5A 1PYSB 2GO9A 2B43A 5A2QY 1ZZNA 4B9UA 4Y2MA 3EGZA 3O2IA 1E6VB 5GMDA 8RUCA 3CD6S 1KOHA 1V3ZA 1LK7A 2LCWA 3SCIE 2VG5B 2RDDA 5E3RA 1F3FA 4DPXA 4LF4F 4TY8B 1RBLA 3RBZA 4BLGA 5HANA 2MQMA 3X1LB 2YWKA 1FD2A 1SH0A 3PJ9A 4CYUB 3HFKA 1P9YA 4HEA9 1GFWB 1AT1B 4Y0FA 2HBZB 2ILZA 1EIYB 1HYSA 4DSEA 2PDAA 2KTQA 1O51A 3D0HE 2JFDA 4X4OA 1HQUB 3MCOA 1SV5A 1OO0B 3ZZ0A 1BQNA 1KLNA 3C46A 2IMWP 2ZH4A 2IJRA 1FFSB 2OSRA 2PGCA 3UDVA 4RZRA 3W9JA 4JI0J 4RKUC 4MIBA 4USWA 5A6PA 3MAHA 4RUCA 2HQDA 5HQMA 4Q8EA 5K14B 5KFEA 1JB0C 1RTZA 1P6TA 2YKAA 4LSNB 4LUBA 4OHWA 5C25B 4ANEA 3TI0A 2RQ4A 1VFJA 2FVRA 3IR6B 4PKDB 3UW1A 5M2PA 4OZNA 4Y34A 3MXHP 2DNNA 3DMJB 4RW6A 1Q1KA 1XMOF 1V5IB 3EWGA 4G1IA 4IG0B 3H4BA 2HHTA 1FHTA 4RW8B 3LA0A 1KR4A 2BW7A 3US5A 5DDPC 2BEFA 3CJRA 3GJTB 3C66A 2LEAA 3DU5A 3E01A 1XERA 4RJVA 2WW8A 4RWWA 3CC2S 4DS5A 1KNZA 2GVZB 3CJ0A 4MKBA 3PACA 4FPRA 2R7RA 3CJSA 2GMJA 2NSBA 2OAUA 4I64A 4DV2F 2DB1A 2PI4A 1NKBA 4DR2F 3KXDA 1R8PA 3TJ9A 2E7VA 5SUHA 1S12A 3ZZRA 4CCHA 3PIPQ 3OUYB 3OPKA 1LWFA 4LRCA 3HF5A 4RPFA 2H4YB 4OHZA 2C22A 1Y3JA 1S9GB 2B9EA 2YX4A 3ENAA 3GZ7A 2M7SA 3D1HA 2CYYA 5A2QU 2ZVIA 4ZCMA 4JI6J 3LGMA 1ZM9A 4EEYA 4ZN3A 1KTVA 2F3JA 4WXOA 3LPYA 2IDLA 2OEMA 2W2PP 1X0FA 1DLOB 1S0OA 3CC4S 4UUXA 5DQGA 4OYXA 5GVQA 2HZAA 2KVIA 1SBRA 4NYPA 3RJMB 5KFNA 2Y1RI 5I3QA 3FSIA 3W7BA 4G1QB 1LOUA 2MGZA 3KKFA 5A8KB 4NWBA 2EC2A 2JVOA 3E3XA 4KKOA 2YKNB 5IWAJ 4DR4J 2OHDA 5H9EJ 1TUGB 3D54A 4J90A 2OFGX 3EPGA 1HNIA 3HKWA 1NZAA 3MOZA 1FESA 2XO6A 2AIRB 3TRGA 3CSKA 2OGUA 2HGMA 2QN6B 4HL9A 3G6VA 2V8HA 3LAMA 4JP8A 2EXUA 1V3RA 3GG0A 4FDFA 4K2JA 1X9WA 1B0TA 3TUIC 4RO0A 5K8OA 1TL3B 1J2VA 1Y11A 2RQMA 1HNZJ 2HBQB 1X4GA 3JXOA 1A0OB 2HBYB 4U95A 2KXNB 1NNDA 3ITHB 2CNLB 1MU2B 4P2MA 4EMDA 3OLAA 1KQSR 2QJ3A 3NY0A 4YDXA 2JLFA 4CH7A 3D4JA 3MMCA 1WEZA 3NCRA 4USVA 1XMQF 1RT3A 2DR5A 2H51B 3OJUA 2IHR1 4XAKA 1Y5IB 5LXYA 1IQZA 3OL7A 1H74A 3HDSA 1HBUB 2YY3A 2WSCC 4KHRA 4RU2A 2K7KA 3HI9A 4F2RA 3DLEA 1SJRA 3VWSA 3J80U 4X64J 2ZWOA 4ECWA 3KOAA 2RNEA 4DN0A 2JX2A 2UP1A 3H5XA 2B0GA 5L1LA 5AJ3F 3BGFA 4QU7A 3D6TB 3I5AA 1FRKA 3R2DJ 2NXJA 1C0UA 3P5TL 4Q8FA 1HARA 3BN4A 1HMVA 4UQTA 2CQIA 3CD0A 1DAXA 2Z2YB 3NGTA 2W9CA 4L76A 3TA0A 2ZH1A 1U1OA 1J5EJ 2I2YA 1T95A 2HWIA 3T5HA 2N7CA 1SL0A 4ALZA 4RR5A 3V4IA 4FXDA 2R2TA 2DK2A 1NHKL 3U27A 4DCJB 2Z30B 2MKIA 1EHWA 1JMTA 3L7UA 3OFGA 2CNNB 4WYWA 3CJKB 4JUZA 2IC3A 3WIVA 2YPYA 2DHAA 4I7FB 1JLQA 1LV5A 2IDEA 4A8KA
chains in the Genus database with same CATH topology
4NLWA 2XY6A 2UVWA 5CCMA 4DV0F 3M4XA 1FEHA 2LEPA 4XPEA 3DRSA 1FEEA 2C3YA 4O3NA 3MOJB 5I3UB 1TK0A 3Q0AA 2EK6A 2HFZA 4LF7F 2JH3A 1F5CA 4RNHA 2B4UA 1WF0A 5MLCV 1AUDA 2N3LA 2FD2A 4IRKA 3I82A 2V0NA 4RW8A 3KLIB 3GFZA 4KT0C 3MWBA 3MD3A 4M94A 3SDEB 3KHGA 1XWLA 3LP2A 5CCLA 1Q78A 1BC6A 3K8VA 2CJ9A 2DNKA 3MECA 1JJ2R 5E41A 1I6JA 3BJYA 4WF9Q 2P5VA 1FJGF 2DNHA 4DSIA 1S1VB 5KFOA 4J9KA 4B3RF 4OV1A 3IRXA 2E9ZA 4F50A 1DRZA 2BANA 2VH7A 2XLJA 3MCSA 2R7TA 1FD8A 2N82B 5I3PA 1QSSA 3WBZA 4DS4A 4LQ9A 1N6QB 1F0XA 3MZIA 3DLGA 3MM7B 5GAEU 5I3UA 3MMJA 4F2SA 1FE4A 1LK5A 4K4VA 3FQKA 3AA8A 2BR0A 5KFQA 5KFJA 4A8SA 4QIVA 1VQ7S 2YKMB 3ZZYA 2KM8B 2HS0A 4ED0A 2JWNA 2DJWA 1JLQB 3S7RA 2U1AA 2DIVA 3MURP 4FF4A 1GXTA 3MM5A 3AA9A 2GIRA 4WFYA 3HJFA 3D1OA 3O3LA 5F3TA 1FF2A 4C8ZA 1N32F 2E7WA 1UJ4A 1YITS 4WU3A 4XK8C 2EFGA 2YH1A 1NJIT 4K4ZA 3LP0A 3UR0A 1U24A 4P7VA 5IWAF 4MMOA 1NK0A 3DC2A 4ZPCA 3MUTP 4YMEA 3G9CA 1WG1A 3FFIA 3T9ZA 2YVSA 2XS5A 4HVZA 1UW4A 4X84A 2GGPB 3NBPB 4ZPTR 4TY8A 4XIUA 3CPWR 1JLCA 3L7OA 1Q86T 4EO6A 2AGPA 4DF4A 5CQGA 1M5OC 3DNCA 2RJZA 4QIWD 2WSEC 3MECB 2CZ4A 4G3IA 3H2VE 2FIUA 3U1LA 3NMAA 4QWCA 3ONQA 5KG4A 2CQGA 4A8QA 3ZFVA 2IAJB 3T6BA 4EBDA 2X1GA 2RRAA 1P1TA 4FYDA 2AJQA 4ECTA 3MAQA 4IFVB 2O67A 5KTQA 4QR1A 3RAMA 1D3WA 4NLOA 3K5NA 2HHHF 3MEEB 2FB0A 1JKHB 2R7VA 2CG4A 1FRMA 3DOLA 4AYBD 3I0RA 1FDAA 3FQLA 3LWMA 4OX9F 1Z2ZA 3M6WA 1LXJA 1REVA 1SH3A 1S99A 2M3DA 2PO4A 4MIAA 3T3FA 3J7A1 3F44A 2GGPA 3MR2A 2CVEA 1HWJA 1U1LA 2AYMA 4X65F 3CDUA 1LFWA 1RT1A 4LSLA 1SUQA 3PX0A 2KB2A 5KT3A 4RNMA 5EX0A 1TKZB 3FEYB 5HP1B 1J5EF 2JOQA 4KHPF 4KR0B 1LFPA 3UD4P 4MFBB 1JLFB 3Q22A 4PQUA 3MR5A 3DLKB 1R0AA 2V8VA 4IR1A 1XMBA 1IUJA 1VLYA 1JWWA 4Q2MA 4O23A 3A1YG 4J9NA 5DM7Q 5DDOC 1S1WB 1VQ4S 2YWEA 5HMZA 4DQSA 3W2WB 4C8KA 3I9V9 4DBQA 3N9UC 2HQ3A 2RVJA 2XSJA 3VQTA 1L3TA 1S7HA 3FGVA 3MR6A 4HKQA 2R8KA 3PKMA 1JIHA 1U48A 2OPPA 2VBXA 4ED3A 2XMUA 1NJXA 2XCAA 3D0IE 1TKZA 4NZ0A 2L48A 2YNGA 4KTQA 3POTA 2CDQA 4OHXA 4A46A 2N3OA 4B3SF 2VPZB 1R3NA 3HHEA 1KRPA 2C2EA 1Y9OA 4J9MA 2FY1A 3GIIA 1MNEA 3D1QA 4KGKA 4DR7F 4I7FA 1ZAXA 1WACA 2L9DA 4RLEA 4Q0BA 4DR4F 1TL3A 5C42A 1OQ6A 1Q7LB 5KAKA 2GHVC 2RKIB 1REVB 1TK8A 4ZLPA 5LSLA 3OFHA 1KLMA 2DGTA 2HWHA 1S9GA 2OKQA 2YX7A 1GTEA 1KQGB 1Z1ZA 3I96A 4IG3A 4IFYA 3C8YA 4DR5F 2KXFA 4WU2A 1HPZB 2YKMA 4ZPWR 3DLJA 1TVRB 2JEGA 2HHXA 2ZHOA 4I2PB 4G1QA 2MGZB 4ZP6A 4DUYF 5G4DA 1S97A 4M63A 1QE1B 2D7SA 3DRRA 3OXFA 5GMKa 1VBZA 4AXJA 2FTRA 4DJBA 4I6AA 4KGMA 5F8GA 1JLEB 1RT7B 5EWGA 4P7TA 5H1SV 2HRUA 4H4MA 4KV8A 2R7UA 4KE5A 2E5JA 2HNZB 2DHSA 3PRBA 2JLEA 4NX9A 3FFIB 2WAQD 3TUZC 2LQJA 2FGOA 3OL8A 3CDEA 4IYQA 2MJNA 3NBPA 1N5VA 2IVYA 2KG1A 4LQ3A 2JEIA 3RU0A 1ZYQA 1DQ9A 2X51A 2VA3A 3BGLA 2EPIA 1MWYA 2QLXA 4PUOB 4MYUA 1Y3KA 2LXUA 3MPVA 3OL6A 2QEXS 3QPIA 3QIPB 2KM8C 3TP2A 1YJWS 1L3SA 1L3UA 3E51A 3J7YI 3KK2B 5KG2A 1HA1A 1ZETA 3DLLQ 3CD7A 5B09A 3VQSA 1CEZA 4MAKA 1K1QA 3UE2A 3HVTB 3LQVA 2OMLA 2FVSA 4DQPA 1TAQA 2L08A 3M2VB 1RQ0A 3MM9B 1UAWA 1Y5LB 4ZPDA 3U1NA 5IM0B 5L8RC 2W7AA 5KFTA 4C0HA 2ZNZA 3KLIA 1KHWA 2GJ2A 4ZK7M 2MKSA 1X7VA 4I2PA 4Z37A 4X4TA 4USIA 5KFMA 3JSRA 1C0TB 2DT9A 1YVFA 3OTEA 1HD0A 2W8KA 3NS6A 4H4KC 2QT7A 3BO4A 3QJPA 1N54B 3M32B 4GC7A 5J2QA 2HNZA 4EWTA 3I5BA 3MM6A 4UW2A 2JFKA 4PPDA 4WE1A 4OZ0A 3GV5B 1N5YA 2O66A 3DRSB 5EHHA 3PX4A 3HHDA 2J7WA 4I6YA 4I0WA 4O3QA 3SI8A 4DFJA 1DHMA 3PRDA 4PG5A 3G4SS 5KFIA 4ZCLA 2AJ0A 2DGXA 1LWCB 7FD1A 3O1LA 4ECRA 1ZM2A 2DHXA 2YNIB 3CTRA 4RBVA 4ECSA 2WHOA 3QO9B 1Q8BA 5A8KA 3HT3A 2AJ4A 4MKYA 4OX7A 1T03B 4IR9A 1RTIB 1RT2A 2R7SA 3QMQA 4JI4F 3IR5B 5DGBA 1GXLA 4I2QA 3T1YF 1RYSA 3G6XA 3MDFA 2GCFA 4H4KA 1C1CB 5C42B 2ALZA 5KFXA 4CH1A 4NLVA 3IGVA 4KPYA 3DDKA 3I4PA 3G8TA 3M1VB 4RNOA 2R7QA 2RB7A 5HBMA 2AYEA 1SJ3P 4FBTA 3KHHA 2CRLA 3H5UA 5IFMA 5A8RA 1SQEA 2DNZA 3OR2B 4BC7A 5AE3A 3RBEA 2BM1A 4FF1A 1NJZA 4DSKA 3UNGC 4ZP7A 1O5JA 1Q8IA 1VQMS 1Q7YT 4I2QB 4C97A 2M5YA 3GV7B 5D3GB 2EVZA 2VL1A 3PW5A 3KYLA 4MK7A 2CVIA 4KHMA 4NLRA 4QW9A 3LANA 2YQ3A 5E3CA 2XMJA 3PZPA 1QY7A 2XY7A 2E1CA 4RW9B 2W9CB 5D4PA 3SFGA 2MQOA 2MKCA 1LWCA 2QFJA 5M2UA 2PA8D 4QIEA 2KRBA 4QIGA 4WFBQ 4GO5X 1J5OB 4PUOA 4AL5A 1SJFA 1IN0A 5F8MA 5KFDA 5KFYA 1IKYB 4D3HA 2OMOA 3JTOA 3M9MB 4C9DA 3L3CA 3GFHA 1UKUA 2HYIB 2HLUA 5KOWA 2D74B 1YHQS 1YGYA 3LW5C 4DF8A 3EZUA 1IBMF 3KTQA 2EFOA 4NLGA 1TV6B 2J6TA 2KO1A 3LH2S 3OBIA 1MMLA 3M1VA 1S0VA 3GIJA 1DJ0A 4TU9A 4DL7A 3MPWA 2C28A 1X4FA 3IN5A 4ED1A 1H98A 1S1XB 3MUMP 1FKOA 4OI6A 2V4QA 3DRYA 3V6DA 1DTQA 3QLHA 3DRPB 3N0VA 4N76A 4XPCA 2HIQA 4FVCA 4KKOB 4F26A 2FGCA 3PEJA 1UEVA 2RU3A 4IH7A 2ZE2A 4P6QA 1YRUA 5LT5A 3THVA 1T05B 4BS2A 1FA0A 5B0AA 2IYGA 3KK2A 4X4UA 5G0RA 5MAOA 1UVNA 2ROGA 2ZNYA 2CQ1A 2B4PA 3DM2A 3GFXA 3H59A 3V2UC 2FJEB 4B9NA 4ICLA 3KG1A 2Z4PA 3J7Z5 1HPZA 2P9CA 1XTZA 2QLWA 3HHLB 2LVWA 4FNIA 3Q8PB 2HZCA 4TN2A 5LMUF 4DUZF 1Z4UA 1RT3B 3QLHB 4WK1A 5F9LA 3WZ0A 1XNRF 4HTJA 2N4DA 4MK8A 1G3OA 4DV5F 1F60B 3KLHB 3PV8A 1S76D 3OXGA 2ADCA 5KG0A 4FS2A 2M52A 2E66A 3VAJA 2OJ3A 3RRKA 1IKWA 2XGPA 2HS3A 1SH2A 3MTJA 5J1EA 1UFLA 2AYGA 1F9FA 4O3SA 2QRRA 4UQGA 5G0RB 4R25A 3PW0A 4C0OC 1RT4B 5CYMA 2DRAA 3QJJA 4ZMMA 4PPZA 4MJKA 2APOA 1XBWA 2R8GA 2CQPA 3N4WA 5K14A 4RW7A 3RYLA 2ADBA 1M5SA 3NGDA 1R8CA 2CPXA 2F1FA 4KAIA 4ZHRA 2WSFC 2Y1IA 3TAPA 4X64F 4F4ZA 2DIUA 3KLHA 2VFSA 4IO9Q 1MMNA 1IKWB 2HFNA 3MMBB 2EFNA 1N34F 1C4CA 3IWXA 1N52B 2HNYA 2XMVA 2QMXA 4YR3A 4CO5A 4DSJA 2VBZA 3B82A 4NL5A 2AYBA 3I0RB 2AD9A 3CIMA 4OIXA 5KG5A 1QAYA 3ZZTA 1FKAF 1AFJA 4C11A 2L9NA 2Z2LA 2V8DA 1TKTB 1C1BA 2ZITA 3I31A 2B9YA 5SZTA 1XR6A 5I4MA 3SV4A 2FJWA 1OPIA 4F67A 3JAMY 3F73A 5KT7A 5IXUA 2ZH9A 4K5SA 4C8LA 1Y0HA 3CE8A 4MH8A 4J9RA 4QYRA 3IWNC 3OSNA 2Q3PA 3I9ZA 1V6HA 6FDRA 2NQPA 1R8AA 3DLKA 3K0JA 3KHRA 4A8MP 2LXIA 4DQRA 3LUYA 2C2DA 5CYQB 1NEEA 1ZM4A 1NH8A 3P96A 4GMKA 1RP5A 1V9OA 3MFIA 5LMNF 5D3GA 2RDIA 1H2UX 5FD1A 4DDFA 4NA3A 1IR0A 2VBWA 4DV7F 1HR0F 1S1XA 2VBYA 5AXKA 4LFAF 1A9NB 4C11B 4RNFA 4NYOA 4TNOA 3Q8SB 1Y4ZB 5IT4A 3E2EA 1OPZA 2MPUA 4EZ6A 4ZKAA 5HN0A 2GW8A 3PFEA 3TW0A 2DVIA 2B9XA 2D9OA 4UY85 3JSBA 2WB1D 3IAS9 3CJ5A 4V19J 2CPHA 3QAUA 2B6AB 2JC1A 2QSFA 1DARA 3RB3A 3W3SA 4TLRA 3LP0B 2E5GA 2V2KA 2VD3A 2RMLA 5GAEI 2ZH3A 4JOUA 1QSYA 2XSFA 3DLEB 5IS2A 3DHXA 1FERA 5CYQA 2B4OA 2E29A 3GR0A 2DGUA 3VAIA 3FVYA 1EETB 1UFWA 2BBEA 2MZRA 2IVFB 5FDLB 2RU9A 1HMVB 1YJVA 3KMSA 3RB0A 4OZ5A 4B3OA 2FJAB 1UMJA 3VALA 3RB4A 4CZCA 1U47A 2RDJA 1X9SA 2EC0A 2WTFA 1HHTP 5J2PA 3QGGA 3FSXA 2M4MA 2I0XA 1ZTTA 2IAJA 5HL7Q 3DRRB 4JBCA 3J81Y 4WZQA 2CQ3A 4UOCA 2ZKTA 4DFPA 2EFVA 4JI6F 4YQWA 3EZ5A 5D77A 1VJWA 2Z8QA 3VZIA 4C0BA 2E1RA 4OI2A 1NRKA 4NPOA 3IRWP 1HD1A 1S4FA 1S49A 3GIKA 4Y2KA 4BC9A 4GC6A 2RSQA 2Q66A 2ZHBA 1ZOTA 4YB1P 2DH7A 2IRXA 4LVOP 1DLOA 2V9KA 2NZ4A 1D8ZA 2W4PA 4QPTA 2QMWA 4DL5A 3TARA 2UZAA 2YWGA 1HNVB 4ECZA 4IQMA 3H40A 5F8JA 1MWZA 1S9EB 2ZKUA 4UUWA 1FXDA 3BO2A 3AAWB 5HROB 1X9MA 3P6YC 2UU9F 2NLWA 4R8UA 3SSSA 4CO2A 3GILA 1Q4RA 4USJC 2V4JB 3BQ0A 1TZ0A 3DHWC 2HHVA 2VFRA 5KFRA 5BYSA 2WBMA 4J9LA 3U1MA 2MYFA 1HBMA 4NCBA 4TYBA 4KJIA 3RZAA 2CPIA 1HBOB 2MJUA 3MD1A 2OPSB 2ZBIA 2DNYA 2J6UA 2BABA 3BQ2A 1HQUA 5DETA 2L9WA 4O4RA 1ZZFA 3M2UA 3M8QA 4DEZA 2MY7A 2W9AA 4QJVA 4EO8A 3ICLA 3TAMB 4W92B 1SJQA 1RISA 4LFBF 5KFZA 3OL9A 4X4VA 5JJBA 5F8NA 2BOPA 1FRLA 3MEGA 2OPRB 4OQJA 1SIWB 1SI9A 1R43A 2CZVC 2HFOA 2IA0A 3MI7X 3N6LA 2W9BA 2X3GA 1XEZA 2ACYA 4KQZA 1NB7A 1TVRA 4YOEA 2MKKA 3QGHA 2BUNA 1VC0A 1E6VA 1PC4A 3P3DA 1XC9A 1ULRA 2CIMA 2G1DA 2VG6A 3CJ2A 3FJ2A 2ZH7A 1YJ9S 1RA7A 2D41A 3D5MA 2V9WA 2E5LF 3H5YA 1WNEA 4PCQA 3MGJA 1C1CA 4F25A 2EI5A 3KG0A 3TAMA 1IQTA 1S10A 1IJEB 3AHPA 4XDDA 3C3LA 1KD1T 1XR5A 2WRMA 4DHVA 1RI7A 3MEEA 4FN5A 2Q1LA 5B0BA 1VBYA 4F3OA 3CIZA 2J7UA 4BWJA 4C98A 3OJSA 1U8SA 4H4OA 2QIFA 4DR3F 4M1KA 3HHLA 4OI3A 5GADI 3UCZP 2KZZA 3DOKA 2ZVSA 3KK3A 1R89A 1X8DA 1X5SA 2U2FA 4WFZA 1FO1A 3M6XA 3N5FA 3GIMA 1XR7A 2ZH2A 1RJJA 3T19A 4OI4A 2DNPA 2NREA 1TL1B 3M6VA 1APSA 4PXBA 3VAFA 2VOPA 5F0UA 1KC8T 2K8GA 3CB4A 4USHA 3DYAA 1NAQA 2CJAA 1FVQA 4F4XA 2QA4G 3K58A 2HW3A 1C1BB 2XMTA 4TY9A 1MROA 2DGVA 3BZQA 3HKZD 1MW7A 3R1LA 3NCQA 2AQ4A 5E2QA 1J5OA 1NK7A 3MMCB 4FXVA 3CJ4A 1KONA 3SQGA 3IS9A 1ZM3A 4KO0A 1WTFA 4ECQA 1HYSB 5EUHA 5DG9A 3LAKA 2HS4A 3PDNA 3S8SA 4KBIA 4DSFA 2FVCA 2RE1A 3MM5B 4DG1A 3OW2R 4Q2LA 1QJHA 2IRUA 1G2EA 3R3TA 2ZOGA 3TQ1A 3CCSS 1XK8A 1U2FA 2VFTA 3NLCA 1VC6A 5LSOA 2HVHA 2IMOA 2QZ8A 4YHHF 2BA9A 1U1PA 3DYAB 3BR9A 4JI5F 1BD6A 4X4PA 2MQPA 1X4BA 2KRRA 2BQ3A 4DL4A 3CCES 1DBDA 1MU2A 3RRGA 4M5DB 3PR5B 5FIIA 1X0PA 4HDGA