2JSXA

Solution structure of the e. coli tat proofreading chaperone protein napd
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein napD
publication title Structural diversity in twin-arginine signal peptide-binding proteins.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Chaperone
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03927 NapD NapD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jsxA01
1I1GA 2W24A 2E7WA 2GQQA 2PMHA 2IVMA 1RI7A 3I4PA 2Z4PA 2ZBCA 2YX7A 2E1AA 2PN6A 2EFPA 4PCQA 2QZ8A 2JSXA 2EFQA 2VBXA 2P5VA 2VC1A 2EFNA 2CYYA 2YX4A 2VBWA 2EFOA 2CG4A 2E1CA 2VBZA 2E7XA 2DJWA 2ZNZA 2W25A 2P6TA 2VBYA 2ZNYA 2IA0A 2DBBA 2VC0A 2CVIA 2CFXA 2P6SA
chains in the Genus database with same CATH superfamily
3HKWA 2ZJQQ 1CJVA 2H4WB 2MZSA 2BZ2A 1HQEB 1TL1B 2HS0A 2OEMA 2H5EA 2SXLA 2FD2A 1SC6A 5EX3A 2CDRB 1VHFA 4CO3A 3KKFA 4DUZJ 2ZOFA 3W7BA 3TVYA 1N6QB 2BM1A 2ZUGA 3U7JA 5DLGA 4OHZA 2LEPA 3QT6A 4F4ZA 3KMSA 3PEJA 3W66A 3FCWA 3ADAC 3HVTB 1WHXA 2NQPA 4FVCA 2CPJA 2BW7A 2ERRA 1X5SA 1NO8A 4EWTA 1GFWB 5LT5A 1YK9A 2F8HA 1HPZB 1O6XA 5K14A 3M32B 2MYFA 3CCTA 5D8HB 2ZDOA 1XEZA 4G1IA 4DCPB 3NGKA 4B9VA 2M88A 4QIWD 3A13A 4PWDA 2AMCB 2G0IA 2VUGA 3DHWC 3RB6A 2KVQE 5HVHA 3N5BA 3Q2TC 1N32F 2AHOB 2HURA 3B54A 3M1VA 3OTOJ 4UQTA 1IVZA 3C3LA 2MKIA 1UA0A 2XYGB 1SV5B 5A8KA 1HYSB 2NCKL 1EJ7L 4LFCJ 1AB8A 3A3NB 1DLOA 2MDAA 4NI2B 4WPAA 4DV2F 2ZKTA 4S0MA 4B9LA 5L1LA 1AROP 1OWXA 3BYPA 2BQUA 4C8ZA 1Q8KA 2OO4A 3GFYA 3U1LA 2FPHX 3KHLA 4LVOP 1X4GA 5DDRC 2VQFF 4C0OC 4CO0A 1Q79A 2V63A 4B02A 3OSNA 4UOHA 3QRPA 2VBWA 3JSMB 4GC7A 5B0GA 2L48A 1S1WB 4F2SA 2BJ1A 2EFPA 1EAYC 2N82B 4WK3A 3U27A 2LA6A 1XK8A 5KT6A 1F5BA 2C3UA 8AT1B 4KHPF 2HGLA 3BSCA 1ZM4A 4ICLB 2AX0A 2YX7A 3PYDA 4QIFA 2AJ0A 1RAIB 1H74A 3NLCA 3UCGA 2HAIA 4G65A 2W4DA 2E7XA 2UZAA 1WI8A 2KZMA 3R2DJ 3VAFA 1EIYB 3U02A 2VODA 1FRXA 1ELOA 1JQGA 5B0EA 1C0UB 1Y10A 1RT3A 3R5BA 5I4MA 3HSJA 2AV5A 3K5NA 1J27A 2K3IA 4AYBD 2YNGA 1K8AT 1URRA 1WC0A 2LLZA 1FJGF 2CADA 3OL7A 4NLWA 1DBDA 2AD9A 5D0EA 1NK0A 2FIUA 2GX8A 3W5XA 2CZ4A 2A6OA 3DI6B 2M4MA 2D74B 2XHWA 3HXMA 2UU9J 2FZKB 1HWKA 4I0WA 4KGKA 1S9GA 4TKTA 1W26A 1T03A 2Z2LA 1TK0A 1QSSA 2HS3A 3S7RA 4LRAA 2YKNB 1PBAA 3DOKA 4LIWA 2HHUA 1HBOA 1JXVA 3SQGA 5LOQA 4KH0B 2RF2A 4LRCA 4LBIA 3GIKA 3GLJA 3N01A 3W3SA 2NXNA 2BE2B 1NMEB 4NLDA 3R8YA 3BKUA 2AT1B 3HX9A 3DRPA 3R1LA 1SQFA 2J9DE 3C46A 4ED6A 4C8LA 5KT2A 1JK9B 4CP5A 1SC4B 4EO6A 4YP3A 4CM2A 1GH8A 3RW6A 2W9CB 1RBLA 1SL1A 3MPVA 4NZ7A 3KWMA 4P71A 3THTA 3S8SA 5HATA 5A2QY 4DR7F 2HEKA 3PW4A 1U2CA 1T05A 2L9NA 1RAGB 2DBBA 3NCRA 2A2DA 1JLFA 4TVAB 4DPTA 3MPYA 5I3PA 1YLXA 3FCHA 1U1MA 4WTYA 3BN4A 1I94J 3OFFA 4UZBA 4P10A 2DISA 2FHMA 5DO2A 4XPCA 2V2KA 2BM0A 1NK5A 3TZZA 1IUJA 3OJSA 5M2PA 1RHUB 1T9XA 1WACA 4Y00A 3Q8VA 3AJ1A 1X5TA 3AY0A 3PYGA 2C2KB 2YNHA 3BN7A 2XGPA 2HFNA 4IG3B 4F8RA 3LW5C 1U4BA 3DNCA 3CF5Q 4BDPA 3HHKA 2AGOA 1S1UB 2FYXA 3M2UA 2MKYA 2CIMA 4WYWA 2RQKA 1NH8A 3LP0B 4ECUA 5A8RB 4WP9A 1Q1KA 5D4LA 2HS4A 3NG8A 4ZPDA 2OI2A 5DDQC 2P2CB 2JC1A 3NNCA 1YJTA 1J2VA 3M2RB 1TU0B 3OT9A 1IBKJ 3W2VA 1HNIA 4LFAF 2KG1A 2E5LJ 1BQMB 2R7UA 2I9SA 4E8UA 3DMJA 4WKYA 4UQGA 1T9WA 5KFRA 3G6ES 3TZYA 2HBRB 4DV6F 2AYGA 2HQIA 4MK7A 2J7WA 5E3RA 4QQBA 4FF3A 3HKZD 2A3JA 3GG0A 2YKQA 1UVMA 2KFZA 3RR7A 1S0MA 1O5JA 1LFPA 2ZKUA 1YTYA 4GKKJ 1HLWA 3CJRA 4AD6A 3K59A 7FDRA 3DU5A 5KOWA 4D3HA 2D41A 4Q8FA 2Q43A 1YQHA 1NZ8A 2C2OB 4KGZB 2DT9A 3KG1A 3JSYA 2ACMA 4M94A 2DRBA 1QUVA 4IH5A 3IR6B 1NK6A 4LR7A 3TUPA 4CLUA 3UDLA 4JBCA 4DQRA 4A46A 3DGPA 4FF2A 2CQ2A 2RMLA 3D4JA 4KTQA 4N41A 4ZVTB 3OD2A 3FEYB 2PEHA 3F56A 3VV2B 1Z2LA 4YB7A 3FQKA 2H48B 3HD2A 1WWHA 4KV8A 2QG9B 3K8VA 3TQEA 2DNNA 4JP8A 5IXUA 3IFEA 1S5ZA 1VQ6S 7FD1A 1FDAA 2KB2A 1NBEB 4DR6J 2LDYA 3TNVA 3OL6A 2VFRA 2CWXA 1RWXB 4QOTA 1FXRA 3UFCX 1HNZJ 5KT4A 4RNOA 1N33J 1XR6A 1Y9OA 3M8PA 5DG9A 3SDEA 1S79A 4LQ9A 2VBZA 2WTFA 3OL8A 2DNOA 4Q45A 2YQ0A 1UETA 2UVVA 4JUZA 3J7ZT 1CS4B 1ZOTA 2NS1B 3PKYA 1HHSA 4ZVOB 4DL2A 2R8JA 2YWKA 3BZQA 1TL7A 2XHCA 2VQEJ 2QLFB 4DV4J 5F8MA 1C1CA 1PJ7A 2NZ4A 1WF2A 2NUHA 5BYQA 4WE1A 4QBUA 4MIBA 3T41A 1NRKA 3KK1A 2W4PA 3ZZYA 3JQJA 4C8OA 1ZA2B 3SCJE 1EX8A 3V81B 3G9CA 4ETZA 4DL5A 7AT1B 2CJKA 4B17A 2V69A 3UI3A 4OYZA 2UXBJ 1RAEB 2UVWA 2WBMA 2VFTA 2LECA 5DJBA 3BGFA 4OJGA 4ZCIA 2ATLA 2IRUA 4NZ0A 4LSNB 3O1LA 3UWTA 1EKRA 4NCBA 5HROB 4PWWA 4Y6IA 2X1GA 4P72A 3GYGA 1KTQA 4M1KA 2MQLA 4PKDB 1Q5YA 2GZOA 1RUSA 2XMWA 1CJKB 4FNHA 4K4TA 4B3MF 2KVIA 4O3PA 1B0VA 1WEXA 3FBBA 3MGJA 4Z37A 4LF1A 4LF9F 3I5BA 2VKZG 3JAMY 3JSRA 3TO8A 3UD5A 4LRDA 2MJUA 4NPOA 2M7SA 3MEDA 5KFWA 3VQTA 3F41A 1D8ZA 1KQKA 2DR5A 2YWEA 3V6KA 4LF7F 3ISZA 3I31A 2OD6A 5GAHU 4UW2A 1JIHA 1HD0A 2V34A 4N47A 3QGIA 2BKNA 3TOQA 4AL5A 3CXCR 4ZHRB 2G4BA 1TELA 3JQKA 3OVBA 2EEYA 5LMUF 3IAS9 2VG5A 3RAMA 5C2CA 1SI9A 4O3RA 4PYAA 2AEFA 1YITS 3MM9B 1NSQA 4QYZJ 5J1EB 3CJ5A 1A0OB 3AD8C 5KG4A 3OPKA 1G3OA 2JOQA 3D5MA 1WORA 3CJ8A 3K5LA 2BA9A 1RT6A 2RUSA 3IBCB 1R0AB 1M5VC 4DV0J 5DM7Q 1JKHB 3JTOA 2QYCA 1HL6A 2KHDA 3DDIA 3MCSA 2B3TB 2VD3A 1I6JA 2E9ZA 1X4HA 2CPYA 1HBNB 3BR8A 2WOMB 3LAKA 1NAQA 1HWJA 1WTFA 1M1KT 3PEHA 4DPOA 1F60B 1Y5NB 1HBUA 2V4JA 3PTWA 4Y2CA 5KFIA 5EUHA 4DR1F 4PXEA 1KLMB 1YVFA 2YX1A 1U1NA 1U8WA 1D9AA 4WCEQ 2E7WA 2EWHA 3QWUA 2I5JA 4NCAA 4ILRA 2FJXA 5L1KA 1F2HA 3CJKA 3BGUA 3TX0A 3LGHA 2EVZA 1HD1A 3PX6A 4AQYJ 5KFUA 2VHGA 4UF4A 2C2ZB 2DEJA 1QE1B 1ZM3A 4HHHA 4WTOB 3ILLA 3CWJA 3HZGA 2YQ1A 3KJVA 3PHTA 2DHAA 1YRXA 3DDKA 2ILYA 2ZEJA 1TUVA 4RW9A 2KL8A 3L7PA 5EHHA 4HACA 4L73A 2QIFA 1J5OB 2GQCA 3K5OA 1T9UA 2QFIA 4ED4A 3MPWA 3H2LA 1S0NA 3SSQA 4J9VA 3MPUB 1I51B 4NEZA 2FY1A 3QT8A 2E9RX 3TA2A 1R0BG 4KHMA 4KGVB 4F4WA 3EVOA 2CPHA 1RTHA 1FEHA 2L41A 2IAJB 1O51A 2H5IB 5GAGI 4Y2AA 1GEHA 4U7UD 4ECYA 3NKYA 4R0EA 4X4VA 4OYPA 1SKSA 1IM4A 3DKDA 1U26A 1U45A 4CH7A 1NHKL 3WX4A 1GMWA 1W7WA 4KSEB 2ZZTA 4A8XA 1ROFA 4ES2A 3CCQS 2J0WA 4LR9A 1F5AA 4LSZB 1PJ5A 5K8OA 4EBCA 3UN3A 4YY3J 1S9EB 1AUDA 3UDVA 1BGXT 5A6PA 2WB1D 4MIWA 1WOOA 2XEXA 2EK6A 1LWEA 2E1CA 4X2BA 2C3YA 4OX6A 4I7FA 5IC4B 4RW7B 3MMBA 4ZPTR 3IM8A 4I6AA 1IKWA 4GVBB 3VALA 4B3MJ 2CZ9A 3N6NA 3JSBA 5KFDA 3BKFA 3ET6A 4LF9J 3E3XA 4CRJA 1ZZNA 1VDHA 4O0IA 2YKPA 4A8KA 2YKMB 3VF0B 4NMXA 1XQIA 3DXBA 1VC0A 4Q0BB 2RU3A 3ZFVA 2CQ0A 3SV3A 4F4YA 4LF7J 4PQUB 3V6JA 1Y0HA 4NXNF 4EMDA 4OQJA 1RKIA 4ILMA 4RO0A 3GV5B 1NPRA 4KFBA 4CYUA 1TK8A 2KM8C 2WHOA 1Q86T 1FK9B 1X8DA 4HT7A 3FDSA 3QAUA 2X1AA 2FZGB 4O3QA 5K5MA 3R5DA 4KGXB 2IRXA 2J6UA 2QL5B 5HBMB 5C7PA 3N5FA 1YWXA 4QZVB 3LP2B 2MZJA 3SXLA 4HEA9 6FDRA 5E3CA 4R5PB 1U25A 4ZCLA 5IS2A 5AXLA 4UOCA 3GJTB 1NSKL 4NL5A 3V4IA 4DCJB 1XNRJ 1FWLA 4A8FA 3EGNA 1WD6A 4NA3A 3SEOA 4DPUA 3GYNA 5J2NB 4JI2F 5I42A 4DPXA 5F8IA 3BKTA 5AE2A 4K0KJ 1MWYA 2DHSA 3ETMA 3FGVA 3VAIA 1HR0F 1XMOJ 2W25A 2M3DA 2BABA 2GGPA 2MHNA 1RT2B 3AXMA 2HGMA 1RHMB 3UVJA 2LP4A 2CQ4A 2NR0A 4I67A 3R1HA 2JRSA 3C14A 1LKZA 2EFQA 1BWVA 4JI8F 1XC9A 1QD1A 3TUJC 2OJ3A 2FB0A 3T5JA 4TU7A 3CC2S 3QGPA 2R7WA 5A0YB 3L9ZA 1V5VA 3MPDA 2QGFB 2NZCA 4NYZA 3IWNC 3A3PB 2F9JA 4PXCA 5K8PA 1TMMA 5JMNA 2B51A 1Q8BA 4OZ1A 4F3OA 1PC4A 1UEVA 3CD0A 1KFSA 2K7JA 3FSXA 1NZAA 1D09B 2IJFA 2QX0A 2F4FA 1S6QB 2EK1A 2WSCC 4F3QA 1FRKA 1OYDA 3UQSA 4X4QA 2XLJA 1FFSB 4ECTA 5C25A 1LQ9A 2OSQA 3VGUA 2PDAA 3ZXWA 3G71S 1Y11A 2IC3B 1ZZFA 1NK7A 5ETQA 3VAMA 4ZP7A 5J2PB 3NGRA 3A8IA 4URGA 4HTJA 1VQMS 3RUBL 2L3MA 2QSFA 4LFBF 4KAIA 1APSA 4EI2A 3G96A 4ZVHA 5F0UA 1S10A 2DO0A 5HJYA 3MUVP 5IWAF 2J0XA 3OHBA 1B4SA 1PIEA 2LQJA 2ZHBA 4CH0S 2YWFA 1VQNS 2YY3A 4YHHJ 1Q7LB 4UY85 2J5AA 1AT1B 3SV4A 2HMIA 1W25A 3AOAA 3OW2R 4YR2A 2HNDA 3SBMA 4JI0F 2MZQA 1U1RA 4RW6A 4R8UB 3WIVA 2PN6A 2MQPA 1FVQA 3QLHB 2HLUA 2DR9A 1MU2B 2RVJA 1N52B 4DR5J 1JLAA 5IZHA 2B4PA 3BYRA 3MAHA 2V6AA 3CNQP 3HHLC 1UJ6A 3RBZA 1TVRB 2GHVC 5CYQA 1OIAA 3M8QB 3M8SA 5KG0A 2HQDA 4B3OA 5GAGU 5D6GA 4Z7CA 4B08A 2HKEA 1FX4A 2HRUA 3B4DA 4DF4A 3K7RA 2HHXA 2H65B 4Z2XA 2BJ7A 1KOOA 4ZP6A 1IKVA 2CJ9A 1Y7PA 3UR0A 1IWAA 2DPIA 3QWPA 3KFWX 5IV4A 1UJ5A 2VJUA 4DLEA 1DFDA 1SQGA 1C1BA 4TQRA 3ZTOA 1VBYA 4CTAB 2P6TA 2CJXB 2CNOB 3Q8UA 5DQIA 3J7AN 3LGNA 4A8OA 2PSZA 4YUDA 2BX6A 5U47A 2IY5B 1P1LA 3FKBA 1HWIA 2OEJA 1U1LA 4U9RA 4PG6A 5EDWA 2MTLA 5AXNA 1TKDA 3BEGB 1U09A 4OL8A 1SVDA 3SYZA 2XC9A 1C0TA 4X64J 2NPFA 2MHEA 5AJ3J 3PRDA 3H42A 2V5HG 2FLNA 3KXDA 5KFSA 2NPIA 2CQGA 1RXOB 3N79A 3GCWP 2UXCJ 1DZ5A 1T94A 4NWBA 2F63A 1DTQB 1X5PA 1S1VB 5ADZA 4O4GA 3SQOP 3T19A 3PFEA 3DM2A 4OX9F 4QJVA 4JI2J 5CYMB 3QO9B 2CQ3A 5LMNJ 1JLQA 5F9NA 3MFHA 1HR0J 3OR1B 1Q78A 3RW7A 2D7SA 2C2MB 5LSRA 4R0JA 4IQXA 2YVSA 1WHVA 4YB1P 1HA1A 4DFPA 1AW0A 1N0UA 3PJXA 3HHLD 4U95A 1ZAXA 4KB7A 1C4CA 5FLXY 1KLNA 2BQRA 1RT4A 1S76D 3AQPA 2KKHA 2PA3A 3CIZA 3OUYB 2HVIA 2DVIA 3DDNA 4DJBA 5L1IA 2PIIA 1L3KA 2G1HA 2XZDB 2V8HA 1SH2A 1RI7A 5HP1A 3H5SA 2XYPB 4RR5A 2XY5A 4MKAA 1REGX 3KLIA 2YH0A 3R7NB 2FJVA 2DHHA 3BBFA 3MM7B 2MQQA 1S7HA 3DOMA 3C6UA 2HIYA 2OFGX 1VRUA 3IRXA 5E3QA 1ULRA 4I2PB 1SC1B 3UPFA 2HHHJ 3CSKA 4RU9A 2V8VA 4NMLA 1RWKB 4CLZA 1V9OA 5KFGA 1P1TA 4QU6A 2W2NP 3CMAS 1FNXH 5EN1A 4DUYF 2W2MP 4IFYA 2L9WA 2DXDA 3V6DA 5H9FJ 1KQSR 1R8BA 3POTA 3OHAA 1N6QA 4F0MA 3KLFB 4NCGA 4OFZA 3EDRB 1MWQA 4V1Ak 3IAM9 3QYYA 1MNEA 2E5HA 2MQ8A 3NGTA 2QMXA 4QR2A 1SB6A 2I38A 4ED8A 5E3PA 3HPOA 5DETA 1FEEA 2VPYB 4MIAA 4P73A 1IKXB 3M32A 4DPYA 1IR0A 5HQMA 4ES3A 2W24A 2CNNB 2G1DA 2UP1A 1T9VA 3M8WA 3Q89A 1HNVA 1H38A 3R6LB 3Q22A 4ELTA 4JB8B 2Y1IA 2QC3A 5KFZA 5IQ6A 2R8GA 2EBEA 1SV5A 3CO0P 1HYSA 3THPA 3DCAA 4ZJOA 3LO3A 3LF0A 3RRGA 4ZOSA 5KFPA 1A9NB 3ZO7A 4QIVA 2XSFA 1OY6A 3DLKB 3EZ5A 1FRLA 2MLXA 2MB0B 1IJFB 4UUXA 3WBZA 3I9ZA 5L9NA 1MSWD 2K3KA 2OPQA 2CPFA 4HYKA 3H59A 4JI6F 4KT0C 1F9FA 1UJ4A 5HQ8A 3JAMU 4DPWA 2CJQA 1CJTB 2XNQA 4ZVSB 4ECXA 1RAAB 3EPGA 3PG9A 2HNYA 4X66J 1WF0A 5D3GB 3MM6A 1OO0B 3PDNA 1X60A 3GB0A 3Q86A 2HZCA 4K4ZA 1TZ0A 4ANDA 2ZBRA 4B3SF 2YWWA 2QZ8A 4ICLA 4OI0A 2HNZB 3JYTB 1XR7A 4MYTA 5KTQA 1TFYA 3I5CA 1T9YA 2XMVA 4WJBA 4FNIA 1IBMJ 4RW8A 1BE4A 5CCMA 3ILOA 4Q8EA 2MJNA 5KT3A 1TL3B 2LQ5A 2Z2ZA 2EC2A 4QYRA 1BQXA 2IA0A 4O3OA 2NREA 1KVJA 1SXLA 5KG6A 2R7QA 4PZVA 3ZZZA 2ZH1A 3AA9A 2W9BA 3PKMA 3TP2A 1RU2A 4WFNQ 1PO6A 3PM9A 4DFJA 5JUMA 1PBUA 2AJQA 2ZBCA 2LA4A 4RWWA 1RWPB 1BUXA 2JLGA 3B82A 1WG5A 4PXDA 2CWKA 2MKJA 2LQ8A 1FKPB 1NLKL 2UUWA 2DHGA 3S1TA 2HHTA 4NZ6A 3DHXA 4LMZA 1YSJA 3LTOA 2YPYA 1UAWA 1T11A 4P2XA 3KLGB 2JH3A 3GIRA 2BEFA 4C48A 2QA1A 2KT3A 2RIJA 3CDWA 3HO1A 4I2QB 4ZN1A 2ACYA 2AJ4A 3QATA 3FJ2A 2AYEA 4F4AA 2XCPA 3KLEA 3DN9A 3IO1A 2ROEA 4GMKA 2JEIA 3MR6A 3LAMA 3OR2B 5DLFA 3N0VA 5KFTA 4Q2LA 1N36F 4PWUA 5DZ7A 2XMMA 1X4CA 4OZNA 2B4VA 1QAYA 4TQSA 3DLEA 5B0BA 1VFJA 3L3CA 5JVHQ 4ES1A 4N56A 2ZH7A 1H2UX 4DS4A 4OIXA 3TAMA 3OLAA 4DUYJ 1KC8T 4F67A 1UVNA 3QJJA 5CD4H 2JEGA 4DU7A 1TKTA 2OPPA 2E5IA 2GNKA 4FZVA 4IH6A 2AQ4A 3NAHA 1WELA 3QRQA 1VCTA 3PR5B 2DYAA 2K1RA 4JI1F 2WCXA 2M8HA 1DQ8A 1RTJB 1UVLA 2RU9A 4OYAA 4ZJLA 4ED7A 3E01B 4TYBA 1AXQA 3KJQB 2BUNA 2LVWA 5C42A 1CJVB 2RH3A 2MQNA 4WP3A 1JXEA 1FT8A 2XMAA 1Y5LB 3ZZOA 4IRDA 3V4MA 3I0SA 3TJ9A 1S1UA 4FKYA 3L7OA 4NYPA 5BYSA 3H25A 5A8RA 2BQ3A 2OIHA 4F2RA 5KG1A 4RWXA 3ZTQA 1T3OA 4IH7A 1F0XA 1XNQF 2DNMA 1HKAA 3A12A 4MTPA 1RWWB 2W8KA 1U49A 1V3ZA 3M2VA 1JLGB 2QEXS 2DGOA 4PWDB 3W63A 1ZAWA 3BBCA 1TK5A 1T3NA 1EQMA 3G6YA 2Q1LA 1VK8A 5BJRA 3C66A 1RTIB 1RWMB 2DGTA 4PXBA 1WOSA 1IBLF 4OZ5A 2Z8QA 5F3TA 1BQMA 4OZ3A 1B99A 3QT5A 1FD2A 1WTBA 3NOGA 3LWLA 5THWA 3CTRA 4WKRA 4QIGA 1KKHA 4CLTA 3HJFA 4LSLA 5KFOA 3I0RB 5HO4A 1KS2A 2HZVA 1DLOB 1TV6A 4JV5F 2ZWOA 3IWXA 3D3BJ 3TYTA 3FZ2A 1CSJA 1FTCA 5IOLA 3PCOB 1NK9A 5LSLA 3E51A 1D9DA 1NM2A 2MGZA 4OI4A 2PT0A 4ANEA 4H4OA 4DZDA 3J7A1 2GIFA 4Y65A 2M0GB 3OTCA 4WU3A 3ZTPA 2CPDA 2W8LA 4C8MA 1KHWA 4GVLA 1ZAVA 3ZTSA 2F4VJ 1HNWF 1N5TA 1WI6A 1U48A 1MLAA 2CJAA 1RK8A 1TKZA 4QW9A 3N4WA 3WIUA 3VVTA 1T02A 1U0HA 2WVDA 4X4UA 3RBDA 3EUNA 3KHGA 5GAEI 2LYVA 2Q3PA 1TMJA 3D1HA 5I3QA 3NOCA 1N34J 2ZH3A 1S6UA 3BPDA 1BQNB 1H7WA 4YEAA 2J76E 1S57A 2OFHX 3C16B 4J37A 3KOAA 2ZD1B 4YFUA 4C8NA 2YBVA 1SH0A 3P5TL 4A48A 5D77A 4DV1J 4PEOA 4R25A 3L09A 4DL4A 3VHQA 4O0NA 1RT3B 2O3DA 3CEDA 4A8YA 3KK3A 2C2EA 2DNLA 1FTRA 4DR4J 3MURP 2YNGB 2ZDPA 1XWLA 3IBFB 2XLIA 3DRXA 2IPOB 1E6YA 2ZC4A 3R2CJ 4H4KA 3RU0A 5JJBA 4JOUA 4DXLA 2Z2YB 3SI8A 3TJAA 1S9GB 1V5IB 5E33A 4P2SA 5EWGA 2VONA 1HFEL 4B3TJ 1QY7A 2EPIA 2CVIA 3PY8A 4F02A 3SQGB 1CC8A 2D1CA 2EG2A 2KT5A 2MKCA 4KKOA 1IKYB 2R4FA 2RF2B 4CLPA 2DNPA 2MZRA 4NLYA 4DX8H 1S9FA 2NSCA 3ZNJ1 3VGTA 2KG0A 1S59A 4FVMA 2U2FA 4OI1A 5E7OB 1HARA 2XGQA 3BSNA 5HVFA 1VMBA 1ZTTA 1UFKA 1Q82T 1RGVA 4RNFA 3DLBA 1VIOA 1UKUA 1XMQF 4LSNA 4QIEA 4X62J 3IGVA 5HROA 1GMUA 2GHWA 1YJNS 1UPMB 4F36A 2LDIA 4LF5F 1HWUA 2V9WA 2BOPA 1CJKA 4I56A 4Q44A 3GIIA 2OTLS 1FA0A 1JLFB 1YJRA 2HFVA 1RWVB 4BCAA 1NSPA 4M5NA 4F0HA 2QTWA 3MFIA 3T5LA 5HLFA 1RQ0A 1FKOA 4E98A 1SH3A 4RW4A 1HW8A 3RB4A 5E2QA 2KFNA 3T5KA 3DU6A 1VLYA 1H73A 3HFVA 2Y1JA 5E5NA 4QR1A 3OLBA 5K20B 3LALA 3AOCA 1RTDA 3KLVA 2A0FB 2JWNA 4IFVA 5HMXA 1RA7A 3ENWA 4USMA 2ZH8A 1YG0A 1VOMA 1HHTP 1IBLJ 2CPXA 1OQ6A 5BR8J 4J91A 3KDOA 1S12A 1SKRA 3NWRA 2DR7A 5CZXA 4A47A 2DH7A 2HK3A 2FHOB 4UTGA 1FFGB 1WHYA 2EG1A 3B6BA 5AT1B 1V6HA 2RHQB 4ECRA 3CVKA 4DF8A 4DR3F 2YNFB 3EGWB 1NU4A 2GV1A 3W2VB 1HNIB 1SJ3P 4OLOA 3CPWR 3EJMA 1ZETA 4CLKA 2XS2A 3DMJB 5B0DA 4U7CA 2XTJP 5IT9U 1R43A 3PW2A 1SIWB 3MUMP 1HBMA 2KDOA 3M30B 4FDFA 4USHA 1TP7A 2ZOMA 1Q5VA 1UVKA 1KVKA 4LF6J 4MFBB 3I9V9 3HULA 2RS2A 2KT2A 3RB3A 3C2PA 4KR0B 1VQ9S 1KOHA 2CJBA 4Q43A 2A6MA 3GV7B 3DFEA 2GMLA 4OJHA 3EDQB 2OAUA 1XMBA 1MMNA 2VKRA 1UVJA 1SL0A 1S97A 1G6BA 2DY1A 2DY9A 4O4RA 3B78A 3DLJA 2CVEA 2V9KA 3HMJG 4M5LA 4LF4F 4NXMF 4H4KC 1QE1A 4X4TA 2PMWA 2VG6A 1HQUB 2MPUA 4ECQA 3C8YA 3FZBA 5B08A 1ZM9A 4OZJA 2B6AA 3DGPB 1RJJA 1TL4A 2DRDA 3PIOQ 5D4NA 1S4FA 2YNIA 2E5GA 1UP1A 1B0PA 5KFQA 4USVA 4C2MA 4HHJA 3CCUS 4EYHB 3M6XA 4JYAJ 1D3WA 2V94A 2OKQA 2IMWP 5FD1A 3HF5A 3BREA 4M5DB 2EKYA 2IAJA 4MMOA 1Q7YT 1LOUA 4C0BA 2ZBPA 3BO4A 2H9ZA 1SCJB 3O8WA 1FXLA 4AXIA 3M8PB 1GNKA 4MH8A 1HNXF 4NLSA 3CMQA 3E8OA 3EPIA 1S99A 4HDHA 4B3RJ 2MEWA 4G6VB 3GJQB 2FDNA 2ROPA 3BQ0A 1RA6A 5CABA 5ETNA 4EO8A 2K2PA 1U7LA 4EBEA 1C1CB 4EU0A 2OEKA 2XY6A 5AXKA 4WE1B 3IS9A 3I96A 1M5KC 2C1EB 4X4NA 4ZJQA 3KK1B 1AYEA 3R3TA 3QSIA 3C15A 5A8WB 1JWWA 1XMQJ 4O23A 3D2WA 4KPYA 2YPZA 3SFUA 4FYWB 4RW7A 3O3LA 1HIYA 3NBPB 3FSIA 1YI2S 2FHJD 4GVBA 2GVDA 3I87A 5C2GA 2DCUB 4IO1A 2DTJA 2E1RA 4DL0C 2JL9A 3AAWB 2RILA 3C19A 2B5JA 2F8MA 3OQ2A 2CA9A 2YKMA 4YQWA 2MZTA 4LRBA 2D3OR 4Q0BA 3W9HA 1SC3B 2CQDA 4BWJA 4EEYA 5I3UA 3P45B 2FVRA 3AB4B 2HK2A 3GR0A 2VDHA 3N6MA 1AZSB 2HHWA 2FVPA 3OTDA 2B4UA 2DO4A 2BBEA 5DRKA 1FK9A 3CIMA 1L3UA 3VZHA 4MJKA 1SJ1A 4TNOA 4TU8A 4K4UA 5KT5A 2B9EA 3G82B 1K73T 2QMWA 1R3NA 5M2RA 1CULB 2BKOA 3G8QA 5C5JA 3D6TB 4CNYA 3EX7B 4RBUA 1SJQA 1V3RA 3LP2A 5ETSA 3NGUA 3EZOA 3AJDA 2ZUAA 2XS5A 4FBUA 4DSFA 3I82A 3RRHA 3BH7B 4X4RA 3JTNA 4CLLA 4R5PA 3HVAA 1JLBA 1FD8A 1URNA 3CC4S 2AWZA 2U1AA 2QLWA 3T1YJ 6FD1A 3ZC4A 3H2UB 2O66A 3I4PA 2AZ1A 2QE5A 2OMLA 4WYLA 1U0SA 2B7CB 4YMEA 1X4EA 5CA5A 3HSZA 5F8LA 2J7UA 2KM8B 2BV3A 3CCRS 2BJEA 3IP0A 1RT6B 1YDLA 1FRHA 3LQVA 3R7BB 1ZYQA 1RP5A 4TY8A 2I1RA 5A0YA 2RKIB 4J9QA 5GVQA 4WK1A 3PXGa 2AGQA 2N4CA 1ZTWA 3QNWB 1CLFA 4X65F 5JXSA 4USWA 4ZDNA 1HBUB 2V4JB 2UXDF 4DX7A 2WONB 2XB2D 3QIPB 2OD4A 4DR2F 4M5HA 3B4MA 3HM9A 1IBCB 1X7VA 5KFHA 1FF2A 1S6QA 2HHPA 4K4XA 1N54B 3ITHB 2WVFA 3ZNUA 4KPCA 1EQ0A 3K58A 2RUGA 2UUAJ 2EFOA 3CJKB 3X1LB 3PJ9A 1HMVA 2LU2A 4P7TA 2AJFE 2F5GA 5J2QB 2GVZB 1R6YA 4ZIVA 3DLGA 2QA2A 1MW7A 3J7YU 3FEZA 4Y0FA 5FJ4A 2FJEB 4DS5A 1D0EA 4C3KA 3BH6B 2NLWA 3M6VA 4P7VA 4P2FA 4KE5A 3MWBA 4JI3F 1KRPA 5HMYA 1WEZA 3AD9C 4RW9B 2FLPA 4ALZA 4USUA 3CDUA 3MAAB 2DGVA 4ECVA 1X4DA 1GTHA 4E2FB 1P9YA 1XIQA 2B4OA 1HNXJ 1REVA 3O5TB 2ZH5A 1JX4A 3QZ8A 4YR3A 3HHEA 4BS2A 2RRNA 4R8UA 1FWPA 2DEIA 2G0CA 1UCNA 1P6TA 1VQ8S 2J6TA 1RTHB 5GMKa 3M8ZA 3FVYA 1P27B 4CO4A 1ZS6A 4WFYA 3P96A 3OXLA 2DJWA 1FO1A 2W1BA 3D1OA 2XMTA 2CAJA 2HBYB 1TVRA 1KR4A 1SUQB 4I64A 3RRKA 2ZZMA 2KN4A 2CZVC 1EP4B 3I6PA 3MMCA 1N32J 3M8QA 2EI5A 3CW2C 1OY8A 4FXVA 3WDOA 2XO7A 2DNGA 3IBWA 2FJDB 3TA0A 2LQBA 1UA1A 3S01A 1X0FA 2CQIA 3OBIA 5JVGQ 3G86A 1D8YA 1N8RT 1NB7A 1N5VA 2V2QA 2KH9A 3LP1A 4TXSA 4ZA1A 1LWEB 4DV2J 1VQPS 2LEBA 2MSSA 3H7HB 2CQ1A 3N6LA 5F3ZA 1RWNB 1CJUB 1IKWB 2Y3YA 2VL1A 4FYVB 1RBAA 3GWCA 3Q8YA 2P9EA 3QJPA 5IM0A 1WSVA 4LF8F 4TY9A 4TYAA 2AU0A 1MROA 2VQFJ 2FLOA 3QGHA 2B9WA 3FSYA 2DKOB 2DPJA 3JQMA 2FC8A 5ETMA 2FHKA 4C4WA 2JDJA 2XWYA 2RHSB 3HT3A 3MMJA 4XPEA 3TQ1A 3HHLB 4WFXA 5KFVA 1N88A 4CNZA 1Q8LA 1I1GA 1YZ6A 3C6TB 1NKBA 1S48A 4K4SA 2GMHA 1MG7A 3DRSA 1M5OC 3DOLA 5IC6B 3ZZTA 1XBWA 4GC6A 4KHPJ 4K59A 3R5AA 4KFBB 4CYUB 1S1VA 1GAOA 4USIA 1TKXA 3D6FB 2DR8A 2COLA 3K89A 4FP9A 5CYMA 3QO9A 4Y2KA 3QPIA 1BLUA 1LXNA 4CWBA 4DFKA 2AJ2A 1P9QC 3HVWA 4V19J 4ED1A 1OS5A 1NJXA 1FJGJ 4Y28C 2V0NA 2HHQA 3ENQA 5T7LA 4OV6A 3KTQA 1ZPWX 3CJ0A 4K4YA 4XIUA 1QSYA 2BANB 2KXNB 1DY3A 4M8LA 2OLWA 1FJCA 4F7VA 2CG8A 5KFFA 1SQEA 1VC6A 3OUYA 1LWFB 3OXFA 2A18A 3KHHA 2G9OA 2R7VA 3UVJB 3P49B 1BC6A 3C14B 2IM0A 4L74A 4I1TA 3BGRA 2FQQB 1J5EF 2Z4PA 4XO0A 1BD6A 2R7TA 5DG8A 2BDPA 3J7Z5 2DNRA 3I4HX 1H7XA 1NK8A 1BMQB 2G0JA 4BWMA 2GQ2A 4JI7F 3I32A 3I55S 2DXEA 4RUCA 3CO9A 3TUZC 2FGCA 1EETA 3GIMA 2HYIB 1DTTB 3RBEA 4WFZA 2I8EA 3T1HF 3KLFA 2IBKA 1PCAA 4PPDA 5H1SV 3VVUA 5F8NA 4Y3CA 2GCFA 2VC1A 4DR7J 5C25B 4ZPBA 4X4SA 2OPSB 4ECSA 4RL1A 1NH7A 2E44A 4YDDB 1F9EB 5K9FA 2Z57B 4L76A 4ERDA 4E0DA 3MCNA 4DUZF 4A8WA 2LMIA 4BHQA 4W90B 2MKHA 2A1BA 5KOXA 1Q16B 2CDQA 3CJSA 1RAFB 1UPPA 1LV5A 4H4MB 4PCQA 4Y2IA 2OGUA 4KIAA 2LCWA 2PC6A 2XYHB 2ASJA 1FERA 1WC5A 3F0NA 4UUWA 3RZAA 3KK2A 2HMIB 1N48A 2HNDB 2IJNA 1TR0A 2JVOA 3H5YA 4RW6B 4ID5B 2KZZA 1JMTA 2DNYA 2NYHA 4JV0A 3OTOF 2K06A 1KQGB 1L3SA 2NXEA 3R7SB 2HQFA 2O01C 4EYIB 1JLAB 4WXWA 1Z1ZA 2ZVIA 5F0WA 1VS3A 4QWDA 2MLYA 2WBRA 3F73A 1S0VA 1SPBP 3GMGA 4LFCF 2XI2A 4KHRA 1NJZA 1U1QA 3DRYA 2UUTA 2N4DA 4OHXA 3W8PA 1NDLA 3K8WA 5CYQB 2R3VA 2H1YA 2XCAA 2QLJB 5D3GA 4J90A 2L9DA 4LFAJ 4N77A 1OYEA 1WEYA 3AOBA 2Y9HA 3NS7B 3HDSA 1GQEA 2XSJA 3K17A 2DIUA 2E1MC 3GR1A 5F8GA 2HVDA 1QM9A 4DV6J 4K5SA 4PABA 1Y00A 5HQLA 1LW2B 1WC4A 2MKKA 3LA0A 1NDKA 2X1BA 2KFYA 3H8YA 3T5HA 1RT7A 2FUG9 1X31C 3BSAA 2FLLA 2LXUA 2JNJA 4OV1A 3BV8A 3J80Y 1A7GE 2ZH9A 3MZIA 1G4CA 3FNNA 2GIRA 2CJYB 2E29A 3OXGA 3A1YG 1CEZA 2EKNA 3GILA 1JJ4A 4PUOA 3MOZA 3R9LA 3IM9A 5H9EK 1C0TB 1G2EA 3IC1A 3H40A 2NXJA 5EWEA 1FWKA 1MMLA 1QDUB 1UVIA 2VB6A 3H0PA 1LK7A 4NEYA 2PD1A 2VG7B 1R7IA 5IFMA 1M5PC 2R7XA 4O4GB 3IRWP 2BJ3A 2D9OA 2NXUA 3H20A 2POKA 2GW8A 2XULA 5IT4A 3DM2B 1RT5A 1ITPA 4DL3A 2RS8A 4ZVQB 5KFLA 5G0RA 3BO2A 3ULHA 3KG0A 4HR2A 1X9SA 4HH0A 3P5BP 1VJWA 2F65A 3RBXA 2UU9F 5KFJA 1IQTA 4J9OA 2Z30B 1FCAA 2KXHA 4FS2A 1M90T 2BW2A 2HVEA 1VYAA 2XMUA 4B9MA 3CCSS 1RLCL 8RUCA 4NRUA 1F3VA 4RUBA 1YIJS 1PAUB 1U6ZA 4EBDA 1J5EJ 1CC7A 4W4MA 1VQKS 2FGOA 4YR0A 2CQBA 2EFNA 4DQQA 4URQU 5KFNA 1VBXA 1RT4B 4JI7J 4FS1A 3LWMA 2CXEA 3RAQA 4W92B 3IG1A 1VR6A 2YKAA 4O44B 5HP1B 4DX6A 2JEFA 4DG1A 4OJ1A 3KLIB 3HT0A 3T1HJ 3W60A 2EXUA 3DOMB 2LQ9A 3C6UB 3PX0A 3K0JA 3HHNB 1LWXA 1VRUB 1YKWA 3J81Y 3QRRA 3P3DA 3CD7A 4NLTA 3SZ2A 4WWSA 3E01A 3VZIA 4LREA 1H72C 4MYUA 3H5UA 1VRTB 3Q2SC 3PZPA 3DXSX 4IFYB 2RRBA 3V6DB 1X4AA 3NNAA 3OJUA 1BXNA 3POTB 2HQ3A 3PHEA 3GFXA 3KJFB 1I94F 3KNAA 3G87A 4NCGB 2R42A 4RJVA 4C98A 3VAHA 5ETKA 1VLOA 4FF4A 3UNYA 4X4OA 2A10A 4WZQA 3PFOA 3MCOA 2DGQA 1DJ0A 1JLGA 2QMUB 2WVEA 1L5UA 5FIIA 3W61A 2IRYA 3D54A 3CJ2A 1RTIA 2ZITA 4FKXA 1YJ7A 1RT1B 1HNVB 3N9UC 1FI4A 4QWCA 3EM1A 3PW5A 4KO0A 2KYZA 3BDEA 3KNGA 4P6QA 3HVRA 2HRYA 2XZTB 1K0TA 1KVIA 2HWHA 1F5CA 2Z56B 3TUIC 4DQSA 3I0RA 1H6KX 2Z0GA 5KFBA 4ZLLA 5LMUJ 2D3ZA 1R8CA 4NASA 4ZCKA 1PSDA 4GKJF 3R6GB 1IBKF 3RAXA 3PO5A 2HZAA 4C6AA 4FPIA 1SJRA 4RX6A 2PE8A 2E5LF 2ZNZA 3CCJS 2FJAB 2OPQB 5ETPA 4C11A 2O5DA 1XJWB 4I6WA 5CAAA 3PW7A 4DL7A 1X0PA 3UD4P 2V2VA 2JLFA 3DLHA 4OX7A 1RZMA 2HNYB 3MM6B 2RE1A 4CDIA 2I0XA 4UT4A 2MMYA 3SIPB 1YRTA 3D67A 1LW0A 3ELHA 4CLFA 4GKKF 3NS6A 4NLXA 3H4DA 1SKWA 1BQNA 2X51A 4YN3B 1VBKA 2GAHC 4J9MA 3MM5B 4O3NA 3C16A 4DR1J 3M4XA 3FBFA 1S1TA 1RHJB 1WDTA 4J9RA 2WK4A 3ETOA 1GXLA 2ZD1A 3TW0A 1RHQB 4DWIA 2J9EA 2BE9B 4DUTA 5SZTA 4KH1B 4XTTA 4RW8B 5E0OA 3DRRA 2MXYA 4DBQA 2IM3A 5ETLA 4IDKB 1U47A 3LH2S 1VQSA 3M8YA 1IJEB 2J6SA 1ZPVA 3D3CJ 4NLRA 1IWGA 3FBEA 8ATCB 2J8AA 1NCLA 2R2TA 2VV5A 5L39A 1E6VA 2W9BB 1K44A 3MMAA 5HMZA 1YBAA 1PYTA 4L72B 4AXJA 4JV1A 3KLHB 1T0TV 3W62A 3CCMS 5D0HA 1T7PA 2CPEA 1MN7A 3EXYA 1LXJA 5J2MA 3FBCA 9ATCB 1RISA 4ZVUB 2NSBA 2CFXA 3EZUA 3AFGA 3BS9A 4IG0B 3TR5A 1S72S 4DR6F 3E2EA 3GU0A 2HLTA 5BXIA 1DRZA 2RRAA 3QT7A 4DV7F 1HNZF 5D15A 1X5OA 4YB6A 1N5YA 3VTIA 4DQIA 1N33F 4ZVGA 2XMKA 3GYXB 3HFZB 4U96A 1S77D 1IKYA 2UUCF 3CUNA 1RYSA 2APOA 2HHVA 2K7KA 5M2UA 3AA8A 2R8KA 2KRRA 2HSEB 2C3MA 3W2WA 4ILLA 2VQEF 4DV4F 3KLEB 2F40A 5FDLB 5LJ5Y 2W01A 3ZZ0A 1TL5A 2IBOA 2DRAA 2ZBQA 1UW9A 1O8BA 1GXUA 3H98A 3CD5A 1Q95G 4PRFA 2V68A 2W7PA 2ALYB 1RACB 3DLEB 2KI2A 3A4TA 2IM2A 2ZJRQ 5A2QU 2UXBF 1XN9A 4WBFA 1RWUA 3PW0A 3TAMB 3SCKE 5AXMA 2X3GA 5ETTA 3MF5A 2A2CA 1RABB 4F4KA 3PVXA 1WG4A 5GAHI 1PAEX 4CZCA 3MEEA 3MXHP 2ZE2B 1TKTB 2OPPB 5C24A 4OZ2A 4L6V3 2Z58B 1FRMA 1VIXA 2K1RB 1GK8A 3J81j 3W5YA 4J9PA 4ATNA 4EK2A 2I2YA 1KDNA 2AF6A 2GS8A 4A8MP 5IQQA 4XK8C 5C42B 3CCVS 2DNKA 4OZ0A 2M52A 2Q79A 2OSRA 3TZXA 4OHYA 3I0SB 1H3DA 1RAHB 4ENOA 4LRFA 1SKUB 1OPZA 1VQ7S 4NXNJ 3I56S 3M9NB 5DQGA 3P6YC 4FN5A 4C97A 1NJWA 1JLEA 2FC9A 2OPRA 2KRBA 3DGVA 3NCPA 1S6PA 4FBTA 1NKCA 1WNEA 3M2VB 2GHPA 3HFKA 1BWEA 1VJQA 3Q23A 2YNFA 4GKJJ 2BXJA 1F1BB 5LJ3Y 2Y0SD 2K8GA 5HANA 1KHVA 1GMWD 3Q8RB 2RDJA 3H90A 1KBRA 1GMVA 1NEEA 2DH8A 1GT8A 2IYIA 2YXLA 5L8RC 1RWOB 3M30A 4LSLB 2VZ9A 4MFBA 1TV6B 4ZN3A 4DV0F 1RCOB 4C0HA 2ZC3A 1R6VA 1G1XA 1WC3A 2AJ1A 3THVA 3W5ZA 2AW0A 3OFHA 3CJTA 2MGZB 4ZIWA 4WZMA 4H4OB 4G1QA 2HFOA 1LWCB 4ELUA 4PG4A 2HFUA 2E1AA 2YH1A 1N5QA 2VJVA 2ASLA 3OV7A 4JI8J 1YJWS 4ED2A 5A6WA 1FVSA 3GJRB 2PI4A 5D0RA 3QZ7A 1TKZB 4RLEA 1U0HB 2YKOA 2V50A 4ZLNA 4MKVA 1HQUA 2GO8A 3DYAA 2N7CA 2NUUG 2MQOA 4I69A 3KG4A 4U8VA 4M5KA 2DH9A 3GG1A 1H98A 4AQYF 1FDNA 2RQMA 1QVFR 1S1XB 2JSXA 2FVQA 2AZ3A 2R7RA 2YTCA 1F6TA 4M5DA 5D0GA 4QWEA 1VI7A 4ECWA 1W2IA 2JZ5A 3CULA 3KK3B 3MM8B 4A8QA 2DB1A 4DV7J 4UZCA 1IM6A 1XR5A 4DV5F 4NLUA 4ZK7M 1HQEA 1TL1A 1TQLA 2LFVA 2ZM6F 3GPAA 4RBVA 3FRZA 4LFBJ 4ZITA 1M5HA 2UUCJ 3A3OB 2H4YB 2HG4A 1E6YB 3QBCA 1Q81T 1SJFA 4LR8A 3O6QA 5IWAJ 3HVTA 1FX2A 1EKSA 2QLXA 5KG2A 5L1JA 1ZBTA 4XAKA 2FVCA 1NHVA 5B0CA 3MR7A 1HPZA 4DMZA 3CE8A 3BQ1A 1JJCB 3ISNC 5LSOA 5DQHA 3OTEA 2IM1A 4KKOB 5A8WA 4JI0J 2X7IA 3M8RA 3NGSA 4ZS6A 3M6WA 5KG5A 1TAQA 4OYWA 1UWBB 5KT7A 3NBPA 5KG3A 2QSWA 4LQ3A 4TN2A 1RLDA 2RT3A 2CPZA 3MECB 2R9LA 1Z2ZA 2VIHA 1U1KA 4YY3F 5CZVA 1Q8IA 2V67A 3BSOA 5MAOA 2F7VA 3GJSB 4NI2A 3KUGA 1PYSB 4OI6A 2V2ZA 1V3SA 2W2OP 4PG5A 2JC0A 3CMES 1QAIA 4I4BA 3W9JA 1QAXA 1JB0C 5HSPA 4IR1A 1AZSA 3M7VA 5G4DA 4EZ9A 2W2QP 1KD1T 4OYIA 3TJ8A 5HVGA 3VGVA 1Y3JA 2W7AA 1OMSA 5CQGA 4OHWA 4RUAA 2F1FA 3SMZA 4WXOA 3NGDA 3IMQJ 5HLFB 3G82A 3JSMA 2R8IA 2V8GA 4ZKAA 1FKOB 1CULA 3G6XA 4F04B 2X1FA 1S1WA 4K8RA 2I6WA 2B0GA 3QGGA 4RW4B 4Q5VA 1CVJA 2ALZA 4BC7A 2CKWA 2XNRA 2ZH4A 4Q7AA 4LT6A 2F9DA 1RYRA 4DLGA 1RTDB 2J9DA 2DNZA 4IFVB 4KRWA 4LVNP 2IHR1 2J7KA 2Y0BB 3HSDA 2Y1LB 3Q24A 2ROGA 2J0QD 3LOUA 4ANCA 3UN2A 3M9OB 2LXIA 4N76A 4WFBQ 2OH2A 1C0UA 2R2UA 4JV2A 3WC2A 4CO1A 2OHDA 1N0VC 3FFIB 3DC2A 1NUEA 3CCES 4OYMA 3HLUA 1UZHA 1DURA 1VRQC 3D9BA 4QW8A 3ZZRA 2CNLB 4OX9J 2WVCA 4G3IA 1NDPA 1Z4UA 1XNRF 3MEGB 3TZWA 4C9DA 1RAOA 1WHWA 3ISND 2BJ9A 3J80U 3HP6A 1HHQA 1KSPA 5CH7B 3DI6A 2RKIA 1JJHA 1TUWA 4K0KF 5HL7Q 3HZEA 3IR5B 2IMOA 1XMOF 2PO4A 1VQ4S 2YKNA 1HBMB 4NRTA 1RHKB 1B0TA 2WONA 3QIPA 4IYQA 4M5GA 3PRVA 1S49A 2C42A 5F9LA 3H2VE 4AUKA 2XG8A 3ITHA 3BPSP 4CQ1A 1JLCB 2QT7A 2BE2A 4J9UE 2M2BA 4EGLA 4J7CA 4CIOA 1N4LA 3X3UA 2AGPA 2M70A 2N3OA 3UW1A 4M5IA 4DSEA 5J2QA 2GVZA 2PA8D 3US5A 2FVSA 2W9CA 2WB4A 3ZZPA 1SIZA 2QRRA 1FNOA 3VCDA 2AEJA 4B9NA 1U2RA 2VG6B 4AT1B 1D1UA 4OX8A 4ZCMA 3RTVA 3ILJA 2B6AB 4MK9A 2VOPA 4DV5J 2RSQA 3MAAA 2MSTA 1ACMB 2ZNYA 3U1NA 2ZM6J 2XY7A 2YNIB 1NKEA 2PGCA 2XLKA 3VAGA 3L7UA 2CUYA 3BQ2A 1IQZA 4Y2MA 4M5MA 2PI5A 2HAFA 2R7OA 4JI5F 4HI1A 2VH7A 3W9IA 5ETRA 4USKA 3BF4A 1PILA 4CM0A 4YHHF 3T6BA 2C2RA 2Q6BA 4J9LA 4IG3A 1F3FA 1SUQA 2D3O1 1EP4A 4IR9A 4ER8A 1R31A 5BYRA 1BHNA 5HAOA 4ZLJA 3VWSA 3LP0A 3D0IE 3J81U 4WP8A 3K57A 2D69A 1RSCA 4DR5F 5K14B 4CLYA 3KDNA 3IS9B 2DGUA 2VBXA 1VK3A 3M2RA 3C15B 2LKZA 4F26A 3K5MA 2B8QA 1VQ5S 2ZH6A 1F9HA 2J9CA 4RBTA 4DU8A 2WRMA 2PEBA 1QJHA 3CDBA 3M1VB 4J5OA 2RAQA 2ATCB 1CJUA 3IA0A 2KHCA 5CCLA 2GVDB 2XBPA 5A8KB 2AX1A 4JI6J 3D6MB 1QLNA 2DCLA 3MAQA 4X84A 1YBTA 1EHWA 1NB2A 2B5JB 4TU9A 2C3PA 4M63A 2Q66A 3HHLA 5GMDA 3NRBA 3CGIA 3OFGA 3WX8A 3C6TA 5I3UB 2VC0A 2FZCB 3D7SB 2W4CA 4B3SJ 1NHUA 4K4WA 1M5SA 4EZ6A 4DN9A 2Y8WA 1NJIT 1R89A 4AL6A 1FRJA 3NWGA 5HK4A 1H2TZ 3MEKA 2QL7B 4B9TA 4LF2A 2Z2MA 4P74A 4X64F 5AJ3F 2FJBB 3VAJA 3QQCD 4FPRA 1Q4RA 2VPZB 4MAKA 2UXCF 3R97A 2RQ4A 1JLBB 2G2ZA 3O2IA 2XS7A 4KYZA 4NYOA 2GQQA 1QSLA 5E41A 2BANA 2JHEA 2WW4A 2G2OA 5LMNF 2QN6B 4M95A 1M0SA 3EYZA 1K1QA 1LWFA 4P9SA 3VR1A 3T9ZA 3FCVA 2ZFHA 2V4RA 2C28A 2DGXA 1WDDA 2OTJS 3VAKA 2HPUA 3GV8B 5AE1A 4TY8B 1YX2A 1CS4A 2KJWA 3CD6S 1GX5A 3BR9A 1B3TA 3ENAA 4MKBA 1T03B 4DZ6A 1X4BA 3DOKB 2CRLA 2R2RA 1YRUA 4ZPVR 1HBOB 4DOZA 5D4PA 4WF9Q 1MMDA 1N36J 1DTTA 3M05A 2HW3A 3R5JB 2RDIA 3V81A 4J9NA 2H54B 4RZRA 1PGZA 3T9NA 3RR8A 2HWIA 4GO7X 1XTZA 4LUBA 1OY9A 3MCMA 2BRKA 4OI2A 4URSA 2HHHF 2OPSA 1HMVB 1DHMA 4UOFA 3DRPB 2IVYA 1S7IA 5GADI 1GXTA 4IOBA 4QWBA 4FF1A 1L3VA 3DLGB 2EFGA 3K5PA 4U67Q 1MWZA 2W7OA 2B9YA 4RUHA 2F3JA 2DNHA 4JI1J 4P2MA 4USJC 3EXCX 1O0PA 1KQFB 3L95X 2ILZA 4ZP8A 4DFMA 4JI5J 4H4MA 1T05B 1RU1A 3SSSA 4KBIA 4L3NA 1ZA1B 1KTVA 1FE4A 3GE9A 2B9XA 4ELVA 4UY8T 3HD1A 1REVB 1ZM2A 3Q8QB 3FMBA 2JX2A 2MY7A 3U1MA 5MLCV 5DM6Q 3CJ3A 3AH6A 1QTMA 4ID5A 2HBQB 2BRLA 2GO9A 3P4UB 5SUHA 5EWFA 1XNQJ 1H0HB 2CPIA 4IRCA 1Y4ZB 2R8HA 2BOAA 4DN0A 2HRTA 1I3OB 2YNHB 4ZHRA 1FDDA 3NNHA 1B7FA 2GC8A 5ETOA 3SCIE 3BDPA 3VGSA 1VQLS 3EVMA 3MMCB 3M2UB 5DGBA 3FUYA 1W2BR 5KAKA 2J0SD 3MM9A 3CC7S 5T41A 2AYMA 5J1EA 1RKJA 1YBUA 3TAPA 3FMWA 4KQZA 3QMQA 2DD8S 3EE3A 2ASDA 4D3GA 5EGYA 1LW2A 2R7SA 3LP1B 5CHCB 4JV5J 2EC0A 1R0AA 2ABYA 1JKHA 1TFWA 1SL2A 3PR4A 3G6VA 5CXTA 4X66F 1T9TA 4DSLA 5K8MA 4M5JA 3ILIA 1NPPA 2ZWPA 3KUHA 3GTYX 5IM0B 1HBNA 3SSRA 2WOMA 2FY8A 2VOOA 2N3LA 5IT9Y 1MROB 3MDFA 5KFXA 1IXKA 2CQPA 2KU7A 4C7QA 4DL6A 1RHRB 4EUVA 1HNWJ 1KLMA 3FRYA 3CJQA 2B43A 2WSFC 4F0KA 3R27A 2RB7A 3AJ2A 2P5VA 1IBMF 4YDXA 2QA4G 5EX0A 3V5RA 2RNEA 3DRSB 3DOLB 5DGAA 1QAJA 2E1PA 3Q8SB 3MR2A 2VG7A 2MZ1A 4DDFA 1GX6A 3OVAA 2UUBF 3PYEA 2IYGA 1TKXB 5L46A 3F44A 3LANA 3HI9A 3IN5A 2QYGA 4OJ3A 2F8EX 3WC0A 2E5JA 1VQOS 4DHVA 1N5SA 4BC9A 1HWLA 5GMEA 1CBKA 2CQHA 1FKAF 1B70B 2DXFA 1J5OA 2ZHOA 5GAEU 1S0OA 1WKKA 3TAQA 4QYZK 5T7LB 4KV8B 2ZHAA 3NMRA 4ED5A 1X9MA 4DX5A 4OMFG 3GQCA 2DK2A 4B9SA 4PR6A 1YJ9S 1X9WA 2XI3A 1T95A 4QR0A 4DI6A 5FLXU 1EARA 2GA7A 2OUGA 4CO5A 2RD5C 4RKUC 3TA1A 2AKWB 2VA3A 4IO9Q 1NNDA 3ZZUA 4O44A 4RNMA 2D9PA 3SDEB 4KC5A 2BVZA 3ENVA 2V4QA 3EICA 3TEHB 2QL9B 3BGRB 3AODA 2VPWB 2C2DA 2VU5A 3QFHA 5DZ6A 4OLPA 3NMAA 2KTQA 3EWGA 1UFLA 3OTBA 4OYOA 3RGIA 2B8PA 4JI4F 1TL7B 1S9EA 1EETB 2M9KA 2KO1A 1VRTA 4IRKA 5K8NA 4OYXA 1WG1A 4HVZA 4EFAC 2DGSA 2DGWA 1K1SA 2JFDA 3EMTA 1ZH5A 1PC5A 4W98A 4LF5J 1NPKA 2IIHA 2R2SA 5ETVA 1UEKA 1Y3KA 3MHYA 1IR2A 2HIQA 1WKLA 2ADCA 1H2VZ 3NS5A 1UL3A 3RYLA 5RUBA 4A8SA 3GFZA 3BGOP 4HLBA 1IN0A 3TX8A 3QAEA 3MTKA 2VBYA 3TI0A 3BBBA 4NLGA 2VDIA 2HBZB 1EB0A 3R5CA 4K4VA 1PKUA 3MUTP 4IUFA 1RT1A 5GADU 2H51B 3QFWA 4PQUA 3V6HA 1VQYA 2MQMA 3CCZA 2XQCA 1WUUA 5H9EJ 2O1PA 2JVRA 2DITA 4L75A 2VA2A 3RG6A 3KK2B 1JXLA 4K7QA 2X3DA 3Q83A 2CG4A 1KWMA 1DQ9A 5F8HA 3MEDB 2BYCA 5L38A 3NCQA 5HBMA 2CQCA 2JLEA 3CB4A 4BBYA 5DS7A 4NA2A 1QVGR 4QWAA 4CT9A 3OL9A 1U8SA 1LK5A 2AEMA 3AXKA 1NSAA 4DSIA 2EW9A 5KG7A 2BJDA 4DR3J 4YS2A 2VG5B 3CT9A 2YX4A 1LNQA 3AT1B 3KMQA 5J2NA 4ED3A 3G2XA 2QO3A 2GMJA 4TLRA 3PJWA 2XSJB 1NJYA 1YJUA 1C2PA 4G1PA 2ZH2A 3A8JA 1S4EA 2FTRA 1RT2A 4RNHA 4YB5A 3MM5A 3GCXP 1VHIA 3AQOA 4YOEA 2GIQA 1FHTA 3LUYA 2O67A 2YWHA 2F4VF 3UR3C 5B09A 2KJVA 1PG5B 3BJYA 1RT7B 2E66A 1G7CB 2RJZA 4IDKA 9RUBA 4KY3A 2G2YA 1P8GA 3QSYB 3QJLA 4IOAQ 2KYXA 4NLQA 3UCUP 1N34F 3HJVA 4K2JA 2VPXB 3JB9k 2UUBJ 1QUPA 3M6UA 1K9MT 1C4AA 1YGYA 4LF4J 4NXMJ 4LBPA 1NK4A 1TAUA 3MD1A 3KLHA 4PUOB 2JFKA 1K0VA 3N28A 2DR6A 1M1GA 5B0FA 3BO3A 3D0HE 4DV1F 4P52A 4C8KA 2I5JB 2ZOGA 2GJIA 3Q0AA 5F8JA 4IG0A 1Q0NA 4LBHA 4V19X 3HSGA 1UEUA 4J9KA 5LXYA 3IXQA 4DV3F 4ZVRB 1R0CB 2IC3A 2WVBA 4PYDA 4AE5A 2OP5A 1FFWB 5J2PA 4DR4F 1AA1B 2BJ8A 1N56A 1RT5B 2HVZA 4J9SA 3TWZA 4U7UK 2HGNA 1JJ2R 3TVKA 4ZPAA 2BMBA 5G0RB 5LXRA 4ETXA 2RDDA 2HHSA 4RPFA 3W64A 4HTIA 3KJVB 5KFYA 3UN5A 4AFFA 4ECZA 3LPYA 5B0AA 2DHXA 4HACB 4NLVA 5J1NA 3QIDA 2EBGA 1U1OA 4B3TF 3A8KA 2VFSA 4U6PA 4ZLPA 3UCZP 2WSEC 3KUEA 4F50A 4U8YA 2AYBA 4CCHA 1R8HA 5FDLA 3HK2A 3FEXB 2ZJPQ 3PO4A 3CCLS 4WIIA 1HI0P 4WIQA 2ZZNA 4QPXA 3W8GA 2MLZA 3FQLA 4X4PA 4L3KA 4PPZA 3QLHA 4MK8A 1WSRA 4A4JA 1MU2A 4JI4J 1WOPA 3WZ0A 2FJWA 4IKAA 1R8PA 3IG1B 1LFWA 1KONA 1KNZA 2MY8A 5J1PA 2M5YA 4O3SA 1XERA 4DG1B 1IR1A 4IOCQ 5CD4A 2ZE2A 1OQ3A 3D0GE 1WJ9A 4X62F 6AT1B 2QFJA 3S6EA 4FXDA 1K47A 2M8DB 2BKPA 5D78A 4B9UA 4N7TA 2IJRA 3H5XA 1Y5IB 4KJIA 3PNIA 3Q8PB 2H3EB 5T14A 1ICEB 2UVUA 3AD7C 3OFEA 2GJ2A 2E9TA 2ZVSA 1MN9A 5CYJA 3MR3A 2IA6A 4FYYB 4I7FB 5HJXA 4H54A 4ITSA 3MMBB 4CTAA 1VISA 1Q53A 4XDCA 1OSCA 4I6YA 2IVFB 3CJ4A 2AP6A 2DIVA 4NA1A 3MD3A 4LJMA 3ET6B 4FYXB 2HVHA 2BE7D 3RJMB 2RQCA 3NY0A 2D3UA 1DARA 4HL9A 2L08A 4FXWA 3OVSA 2HFSA 1OSDA 3I5AA 3L4BC 3ZTRA 4BLGA 1AFIA 2WAQD 1AUSL 3MOJB 1RTZA 3LPEA 3R5GA 3D6HB 3PYFA 2ADBA 3D28A 1OPIA 5HI7A 4RU2A 5BR8F 2CYYA 4KO0B 5DDPC 3NEKA 3SCLE 3GIJA 4NLPA 1R27B 2G13A 2HWTA 1DTQA 1B7YB 4PG8A 2B56A 1A6LA 1YJVA 3O44A 4ZVPB 2XZWA 4NE9C 3IGNA 1DQAA 1SJ4P 4C3MA 3FK4A 1FNMA 1I5OB 1RADB 2LXFA 4DQPA 3PV8A 3NP5A 4XDDA 3UO0A 2AIRB 3OR1A 3UDCA 4C11B 4FYDA 3GSDA 3OSPA 1LWCA 1WC1A 4DCOB 3TVZA 3V4IB 4HDGA 3UDEA 2OELA 4RNNA 1VC5A 4LF6F 2P9GA 2VICA 1SBRA 2VFVA 4DEZA 4QCLA 4CT8A 1RCXB 5I42B 2PFDA 3T6JA 4PQAA 3P8BB 1F2GA 3PX4A 3EGZA 1LW0B 3T1AA 4X65J 5B7WA 5ITHA 4CO2A 2J8SA 2GGPB 3TRGA 2XO6A 2W2PP 4CH1A 2LU1A 4GRSA 2UXDJ 1S1TB 1CQMA 3SFGA 4DR2J 3TEGA 1KEKA 2P8IA 3H4BA 4NLOA 2UV8A 1S1XA 1UZDA 2FHJA 3GSIA 3MM7A 3DRRB 5DDOC 2IDLA 2W9AA 1UTAA 2JEJA 4I2PA 4DSJA 3RB0A 3GP9A 4DV3J 4UOGA 4F3MA 1RAJA 4C8YA 3MM8A 4F4XA 4PAAA 2PFFB 3HHDA 1E6VB 4Y34A 2ZBIA 3MMAB 2NXCA 3NAIA 5KFMA 1DAXA 3UNGC 2BACA 3TANA 4JYAF 5DG7A 2E7VA 3D66A 4WFAQ 5J2MB 4JI3J 2V8DA 3HCXA 5F41A 4C3LA 1KFDA 1IKXA 5L9XA 3G8TA 3MTJA 5HN0A 3BB5A 1N5YB 1CG2A 3W1YC 1JNZB 4K2XA 1S6OA 1CQNA 3IR7B 3NXZA 4DSKA 3K2YA 2IDEA 1U6FA 3DLLQ 4ID8A 4AL7A 2CNKB 1UWBA 4N8OA 4B3RF 1QTNB 3GFHA 3BGLA 2UV8G 3MECA 3W2WB 4CLWA 3UE2A 3MI7X 4ED0A 1M1HA 2VFUA 1UWAA 5KFAA 3DLKA 1WF1A 1LEOA 2WZ1A 3A8EA 5KFKA 5E3AA 4ZVFA 2C2NA 2JJ4D 1AFJA 2N7YA 4K5RA 2C22A 2HFZA 3JTPA 2LEAA 4N8NA 2WW8A 2GJFA 2UVRA 4GO5X 1CJTA 3B8HA 5HMWA 1VGYA 4Q2MA 1HI1A 1UFWA 2XMJA 3MEEB 2NYIA 2YWGA 5C24B 4Z7YA 1FJ7A 4B3OB 1GTEA 4QU7A 2Y1RI 4WU2A 3CCWA 4LF8J 5H9FK 1EZZB 1U24A 4HHUA 4NOHA 1VBZA 1TTHB 5LM7E 2GFFA 1IKVB 1FDBA 4ZPWR 3TARA 4USTA 2QJ3A 1YZ7A 2HNZA 4OYBA 3FC9A 3JYTA 3CDAA 2KXFA 1FJEB 5A76A 5KFCA 4OHVA 5LL6d 4F25A 1C1BB 3GONA 1RE1B 2XM3A 1TL3A 4HKQA 4HH1A 3PACA 1FXDA 5KFEA 1KN6A 1U02A 1HQ2A 3ONQA 1JLEB 3PIPQ 2HQGA 2OPRB 3FFIA 4ZVEA 1UMJA 3WQPA 4ZP9A 4QPTA 2IFXA 1S6PB 2IVMA 3W65A 2GAGC 4TLQA 2B7BB 4CLSA 3BM7A 1RDRA 1KP6A 3LGMA 2EFVA 3MEGA 5AE3A 1HW9A 3PRBA 3ICLA 3T1YF 5D4OA 2PMHA 3JS9A 1PYOB 2C3OA 1U2FA 1PJ6A 1U6BA 1FKPA 1RB0A 4MKYA 3KHRA 2QLBB 4K50A 2H5JB 1OJ4A 1YHQS 1L3TA 2MKSA 2V8PA 2HQCA 4ZPCA 1HI8A 2PMZD 4LIRA 2Y8YA 1NXIA 1D9FA 3EVWA 3KJNB 3KLGA 1BY9A 3G4SS 1T8EA 4HT5A 3J7YI 1JLCA 1JLQB 2QA4S 1X4FA 4I2QA 2YQ3A 1B64A 2BR0A 4N5SA 4G1QB 1RBOB 2XWXA 3OR2A 3CDEA 4KGMA 2VASA 1WKJA 3UD3P 2VF3A 3EGVA 1FE0A 1FRIA 2P9CA 1UW4A 2OMOA 3DYAB 4PG7A 2UUAF 4OZLA 4ZMMA 3GZ7A 4HI2A 3D1QA 1JNRB 3V2UC 1FESA 3WHIA 3MR5A 1NDCA 1CPZA 4P75A 3NL0A 2ASYA 2Q6CA 2QV6A 1U1PA 3KYLA 3AHPA 4IQMA 3JXOA 4CI0B 5IT0A 1R8AA 1WC6A 4NX9A 4I68A 3G8SA 1TUGB 3D68A 3T3FA 3M9MB 4OI3A 3IRXB 5IV3A 4MT1A 1RTJA 3VQSA 2DNQA 3IWLA 3AB2B 2P6SA
chains in the Genus database with same CATH topology
1QJHA 3CDBA 3HKWA 3PJXA 1S1VA 3M1VB 2ZJQQ 3HHLD 2MZSA 1GAOA 2BZ2A 4J5OA 1HQEB 1TL1B 4USIA 2HS0A 3IA0A 1ZAXA 2H5EA 2SXLA 1TKXA 4KB7A 2FD2A 1SC6A 5EX3A 2KHCA 1C4CA 5FLXY 5CCLA 1KLNA 2BQRA 1VHFA 4CO3A 3KKFA 2DR8A 1RT4A 1S76D 2ZOFA 3AQPA 2COLA 3W7BA 3TVYA 2KKHA 2XBPA 2PA3A 3CIZA 1N6QB 2BM1A 5A8KB 2AX1A 2ZUGA 3OUYB 2HVIA 2DVIA 3DDNA 3U7JA 4DJBA 5DLGA 5L1IA 1QLNA 2DCLA 4FP9A 4OHZA 2LEPA 2PIIA 4F4ZA 5CYMA 1L3KA 3QO9A 3MAQA 3KMSA 4X84A 4Y2KA 3PEJA 2V8HA 1SH2A 3QPIA 1BLUA 1LXNA 1RI7A 5HP1A 3HVTB 2B5JB 1WHXA 3H5SA 2C3PA 4TU9A 2NQPA 4FVCA 4M63A 2XY5A 2Q66A 2CPJA 3HHLA 2ERRA 4MKAA 4DFKA 1X5SA 1NO8A 3KLIA 2YH0A 4EWTA 1P9QC 5LT5A 3HVWA 3NRBA 2FJVA 2F8HA 3MM7B 1HPZB 3CGIA 4V19J 3OFGA 5K14A 3M32B 2MQQA 1S7HA 3DOMA 3C6UA 2MYFA 3C6TA 3CCTA 5D8HB 4ED1A 2ZDOA 5I3UB 2VC0A 1OS5A 1XEZA 2OFGX 4G1IA 3NGKA 4B9VA 1VRUA 2M88A 4QIWD 3IRXA 1NJXA 5E3QA 1ULRA 4I2PB 4PWDA 2W4CA 3UPFA 4Y28C 2V0NA 3CSKA 3ENQA 4RU9A 2HHQA 5T7LA 2VUGA 1NHUA 3DHWC 2V8VA 4NMLA 3KTQA 4K4WA 1M5SA 1V9OA 4EZ6A 1ZPWX 3CJ0A 4DN9A 4K4YA 3RB6A 3N5BA 5KFGA 3Q2TC 4XIUA 1P1TA 4QU6A 1QSYA 1N32F 2BANB 3CMAS 1FNXH 5EN1A 4DUYF 1NJIT 3M1VA 2KXNB 1R89A 4AL6A 4UQTA 3C3LA 1FRJA 2MKIA 3NWGA 4IFYA 2L9WA 4M8LA 3V6DA 2OLWA 5H9FJ 1FJCA 1H2TZ 1KQSR 1R8BA 1UA0A 3POTA 5KFFA 3MEKA 1SV5B 1SQEA 3OHAA 1VC6A 1N6QA 5A8KA 3OUYA 1LWFB 1HYSB 3OXFA 2A18A 3KLFB 4NCGA 4B9TA 4OFZA 3KHHA 2Z2MA 2G9OA 4X64F 5AJ3F 2R7VA 2FJBB 3IAM9 3QYYA 3P49B 1MNEA 1BC6A 3VAJA 2IM0A 2E5HA 4FPRA 1Q4RA 2QMXA 2VPZB 4QR2A 1DLOA 1SB6A 2I38A 2MDAA 3BGRA 4I1TA 4MAKA 4ED8A 1J5EF 2Z4PA 5E3PA 4DV2F 3HPOA 4XO0A 1BD6A 5DETA 2R7TA 2RQ4A 1FEEA 2ZKTA 2VPYB 5DG8A 4MIAA 2BDPA 1IKXB 3M32A 1JLBB 3J7Z5 2DNRA 4B9LA 5L1LA 3I4HX 1AROP 1OWXA 3O2IA 1IR0A 1H7XA 1NK8A 2BQUA 2XS7A 4C8ZA 2OO4A 3GFYA 4ES3A 4NYOA 4BWMA 3U1LA 2GQ2A 4JI7F 3I32A 2FPHX 3I55S 2W24A 3KHLA 2GQQA 4LVOP 1QSLA 1X4GA 2G1DA 2UP1A 5DDRC 5E41A 4RUCA 2BANA 3CO9A 3TUZC 2FGCA 2JHEA 2VQFF 1EETA 3GIMA 4C0OC 4CO0A 1Q79A 4B02A 3OSNA 1HNVA 2HYIB 1H38A 5LMNF 3Q22A 4ELTA 4M95A 1M0SA 2VBWA 1DTTB 2Y1IA 3RBEA 5KFZA 5IQ6A 3EYZA 2R8GA 2EBEA 3JSMB 1SV5A 4WFZA 1HYSA 1K1QA 1LWFA 2I8EA 3T1HF 3KLFA 3THPA 5B0GA 4GC7A 2L48A 3DCAA 2IBKA 3LO3A 1S1WB 4F2SA 3LF0A 4PPDA 3VR1A 5H1SV 3RRGA 4ZOSA 2E9ZA 3T9ZA 5KFPA 1A9NB 2EFPA 2ZFHA 4QIVA 2V4RA 5F8NA 4Y3CA 2XSFA 2GCFA 2C28A 2DGXA 2N82B 2VC1A 5C25B 2OTJS 4WK3A 4ZPBA 4X4SA 3VAKA 2HPUA 2OPSB 3DLKB 3U27A 2LA6A 4ECSA 1XK8A 5KT6A 1F5BA 3GV8B 2C3UA 3EZ5A 5AE1A 4TY8B 4KHPF 2HGLA 1FRLA 1NH7A 2E44A 4YDDB 3BSCA 1ZM4A 2KJWA 3CD6S 4ICLB 2MB0B 1IJFB 1GX5A 4UUXA 5K9FA 3BR9A 2AX0A 2YX7A 3WBZA 3I9ZA 4QIFA 5L9NA 1MSWD 4ERDA 2K3KA 4E0DA 2AJ0A 4MKBA 2OPQA 4DUZF 1T03B 2CPFA 4HYKA 3H59A 4A8WA 3NLCA 4JI6F 1X4BA 2HAIA 3UCGA 2LMIA 2W4DA 2E7XA 2UZAA 1WI8A 4BHQA 2KZMA 3DOKB 2CRLA 4W90B 4KT0C 1F9FA 3VAFA 2MKHA 2A1BA 5KOXA 1UJ4A 1Q16B 1YRUA 2CDQA 2R2RA 3U02A 4ZPVR 1HBOB 4DOZA 2VODA 5HQ8A 1FRXA 5D4PA 4WF9Q 1ELOA 1MMDA 2CJQA 2XNQA 4ECXA 5B0EA 1C0UB 1LV5A 4H4MB 4PCQA 1DTTA 3M05A 2HW3A 1RT3A 4Y2IA 3EPGA 3R5BA 5I4MA 2RDIA 3V81A 4J9NA 2HNYA 4RZRA 4KIAA 1WF0A 5D3GB 2AV5A 3MM6A 1OO0B 2LCWA 3PDNA 3K5NA 1PGZA 2PC6A 3GB0A 3T9NA 3RR8A 2ASJA 2HZCA 2HWIA 4GO7X 1FERA 1XTZA 2K3IA 4LUBA 4UUWA 3RZAA 4AYBD 2YNGA 1K8AT 4DSIA 1URRA 3KK2A 4DR2F 2LLZA 2HMIB 4K4ZA 1FJGF 2BRKA 4OI2A 1TZ0A 4URSA 1N48A 3OL7A 2HHHF 2HNDB 2OPSA 1DBDA 4NLWA 4B3SF 1HMVB 1DHMA 3DRPB 2QZ8A 2IVYA 2AD9A 2IJNA 1TR0A 2JVOA 5GADI 3H5YA 4RW6B 4ID5B 1NK0A 2FIUA 1GXTA 2GX8A 4IOBA 2KZZA 4QWBA 1JMTA 4FF1A 2DNYA 4ICLA 2CZ4A 2HNZB 4OI0A 4JV0A 3DI6B 1L3VA 3DLGB 2M4MA 2EFGA 1XR7A 2D74B 3K5PA 4MYTA 4U67Q 1KQGB 2XHWA 3OTOF 1L3SA 1MWZA 3HXMA 5KTQA 1TFYA 3I5CA 4I0WA 1HWKA 4KGKA 1S9GA 4TKTA 2W7OA 2XMVA 4WJBA 2B9YA 4RUHA 2O01C 1T03A 2Z2LA 4EYIB 1TK0A 1QSSA 1JLAB 4FNIA 4WXWA 1Z1ZA 2HS3A 5F0WA 4RW8A 3S7RA 1VS3A 2F3JA 2DNHA 4QWDA 2YKNB 3DOKA 2WBRA 5CCMA 4LIWA 3F73A 1S0VA 4Q8EA 2MJNA 3GMGA 5KT3A 4LFCF 2HHUA 2XI2A 1TL3B 4KHRA 4USJC 1NJZA 3EXCX 1HBOA 2LQ5A 1O0PA 1KQFB 3L95X 1U1QA 2ILZA 3SQGA 4QYRA 1BQXA 3DRYA 4ZP8A 2IA0A 4DFMA 2UUTA 4O3OA 4H4MA 2NREA 1KVJA 2N4DA 1SXLA 4OHXA 1T05B 3SSSA 5KG6A 3K8WA 4KBIA 5CYQB 4L3NA 2R7QA 2RF2A 3ZZZA 1KTVA 2XCAA 1FE4A 2ZH1A 3GIKA 5D3GA 3N01A 2L9DA 3AA9A 3W3SA 3GE9A 2B9XA 4N77A 2W9BA 3PKMA 1WEYA 3TP2A 2BE2B 4ELVA 4WFNQ 1PO6A 3HDSA 3PM9A 4DFJA 5JUMA 4UY8T 1GQEA 4NLDA 1REVB 2XSJA 1ZM2A 3Q8QB 3FMBA 2JX2A 2MY7A 3U1MA 2DIUA 3HX9A 5MLCV 3DRPA 5DM6Q 3R1LA 3CJ3A 2E1MC 3GR1A 2J9DE 5F8GA 2ZBCA 3AH6A 3C46A 1QM9A 1QTMA 2LA4A 4ID5A 4K5SA 4RWWA 4ED6A 4C8LA 1Y00A 5KT2A 1JK9B 4EO6A 4YP3A 2JLGA 2BRLA 1GH8A 1LW2B 3B82A 1WG5A 2GO9A 4PXDA 3RW6A 2MKKA 2W9CB 1SL1A 5SUHA 3MPVA 2MKJA 5EWFA 4NZ7A 1H0HB 2X1BA 1FKPB 2KFYA 3H8YA 2CPIA 4IRCA 3T5HA 1RT7A 1Y4ZB 2FUG9 3KWMA 2R8HA 2UUWA 3BSAA 2FLLA 2DHGA 3S1TA 2LXUA 4DN0A 4OV1A 2HHTA 4NZ6A 3J80Y 2YNHB 3THTA 1A7GE 4ZHRA 1FDDA 3NNHA 1B7FA 2GC8A 3S8SA 3DHXA 2ZH9A 5A2QY 3SCIE 4DR7F 3BDPA 4LMZA 3MZIA 3PW4A 1VQLS 1T05A 1YSJA 2L9NA 3FNNA 3MMCB 3M2UB 2DBBA 2GIRA 3NCRA 1UAWA 5DGBA 2A2DA 1JLFA 2E29A 3KLGB 1W2BR 5KAKA 2JH3A 2J0SD 3OXGA 3MM9A 2QA1A 3CC7S 3MPYA 5T41A 2KT3A 2AYMA 5I3PA 3A1YG 3FCHA 5J1EA 1U1MA 1CEZA 2RIJA 3CDWA 4WTYA 1RKJA 3BN4A 3HO1A 3OFFA 4I2QB 3GILA 4PUOA 1JJ4A 3MOZA 1C0TB 2ACYA 2AJ4A 2DISA 3FJ2A 2FHMA 3FMWA 3TAPA 4KQZA 1G2EA 3QMQA 2AYEA 2DD8S 3IC1A 2XCPA 3KLEA 2ASDA 3DN9A 5DO2A 3IO1A 2ROEA 4GMKA 4D3GA 3H40A 2JEIA 3MR6A 4XPCA 5EGYA 3LAMA 2V2KA 3OR2B 2BM0A 5DLFA 1LW2A 2R7SA 5EWEA 3N0VA 3LP1B 1MMLA 5KFTA 1NK5A 1IUJA 5CHCB 3OJSA 5M2PA 1UVIA 4Q2LA 1N36F 2EC0A 4PWUA 1R0AA 2VB6A 2XMMA 1WACA 1X4CA 4OZNA 1LK7A 2ABYA 1JKHA 1TFWA 2B4VA 4Y00A 2PD1A 2VG7B 1QAYA 3PR4A 3G6VA 1SL2A 5CXTA 4X66F 1R7IA 5IFMA 1M5PC 2R7XA 4TQSA 3AJ1A 1X5TA 3AY0A 4O4GB 3IRWP 2YNHA 3BN7A 3DLEA 5B0BA 2XGPA 2D9OA 2NXUA 4DSLA 5K8MA 3H20A 1VFJA 2POKA 3L3CA 5JVHQ 2GW8A 2HFNA 2XULA 4IG3B 3LW5C 4F8RA 5IT4A 1U4BA 3DNCA 3DM2B 4ES1A 1RT5A 4N56A 2ZH7A 3CF5Q 1H2UX 5IM0B 4DS4A 4BDPA 1HBNA 3SSRA 3HHKA 4OIXA 3TAMA 4DL3A 3OLAA 2AGOA 1S1UB 2WOMA 2RS8A 2VOOA 2N3LA 3M2UA 5IT9Y 1MROB 5KFLA 5G0RA 2CIMA 1KC8T 3MDFA 4WYWA 5KFXA 4F67A 1IXKA 2CQPA 3BO2A 1UVNA 2KU7A 3ULHA 3KG0A 3QJJA 4C7QA 4DL6A 2RQKA 1NH8A 3LP0B 4ECUA 5A8RB 5CD4H 1X9SA 4EUVA 1Q1KA 1KLMA 4HH0A 2HS4A 5D4LA 1VJWA 3FRYA 2JEGA 2UU9F 3NG8A 5KFJA 4ZPDA 5DDQC 2B43A 2WSFC 1TKTA 2OPPA 1IQTA 4J9OA 1FCAA 2E5IA 3R27A 2GNKA 2KXHA 2RB7A 3AJ2A 4FS2A 4FZVA 2BW2A 4IH6A 1M90T 2JC1A 2P5VA 3NAHA 1WELA 2AQ4A 1IBMF 4YDXA 3NNCA 2XMUA 4B9MA 3PR5B 2QA4G 2K1RA 5EX0A 4JI1F 2WCXA 3CCSS 2M8HA 1DQ8A 3V5RA 2RNEA 1YJTA 1J2VA 3DRSB 4NRUA 3M2RB 3DOLB 1YIJS 1RTJB 5DGAA 1U6ZA 1UVLA 2RU9A 4EBDA 1QAJA 4ED7A 1CC7A 3E01B 4TYBA 3Q8SB 3MR2A 1AXQA 2VG7A 3W2VA 2BUNA 2LVWA 5C42A 1VQKS 1HNIA 2FGOA 2MZ1A 2CQBA 4YR0A 4DDFA 1GX6A 2EFNA 2RH3A 3OVAA 4DQQA 4URQU 2MQNA 2UUBF 2IYGA 4LFAF 1TKXB 2KG1A 1JXEA 1BQMB 1FT8A 5KFNA 2R7UA 3F44A 1Y5LB 2I9SA 1RT4B 3LANA 3ZZOA 1VBXA 4IRDA 3V4MA 3HI9A 3I0SA 4E8UA 4FS1A 3DMJA 4WKYA 3LWMA 3IN5A 4OJ3A 4UQGA 1S1UA 3RAQA 3L7OA 2F8EX 3IG1A 4W92B 5KFRA 2YKAA 4NYPA 3WC0A 2E5JA 3G6ES 4DV6F 5BYSA 4O44B 1VQOS 4DHVA 2AYGA 1N5SA 2HQIA 5HP1B 3H25A 4MK7A 5A8RA 2J7WA 4BC9A 2BQ3A 2OIHA 2JEFA 4F2RA 5KG1A 4DG1A 4OJ1A 3JYTB 5E3RA 4QQBA 3KLIB 1HWLA 4RWXA 4FF3A 3HKZD 1T3OA 4IH7A 2A3JA 1F0XA 1XNQF 2CQHA 1FKAF 3GG0A 2DNMA 2YKQA 2LQ9A 3C6UB 1UVMA 4MTPA 1J5OA 3PX0A 2W8KA 3HHNB 3K0JA 2ZHOA 1U49A 1V3ZA 2KFZA 1VRUB 3RR7A 3J81Y 3M2VA 1JLGB 5GAEU 1S0OA 2QEXS 1S0MA 2DGOA 4PWDB 1O5JA 1LFPA 3TAQA 1ZAWA 2ZKUA 5T7LB 1YTYA 3P3DA 1T3NA 1TK5A 3G6YA 3CD7A 4NLTA 2Q1LA 1VK8A 4KV8B 3SZ2A 5BJRA 2ZHAA 3C66A 3K59A 3NMRA 1RTIB 3E01A 7FDRA 1X9MA 4ED5A 3DU5A 3VZIA 4OMFG 2DGTA 4PXBA 5KOWA 3GQCA 1IBLF 2DK2A 4B9SA 4MYUA 4PR6A 3H5UA 4OZ5A 4D3HA 2XI3A 1T95A 1VRTB 2D41A 3Q2SC 3PZPA 1YJ9S 1X9WA 3DXSX 4IFYB 4Q8FA 4QR0A 2RRBA 2Z8QA 3V6DB 2GA7A 1BQMA 5F3TA 1X4AA 4CO5A 2Q43A 3NNAA 2RD5C 3OJUA 1YQHA 4RKUC 3TA1A 3POTB 2HQ3A 3PHEA 3GFXA 1FD2A 1WTBA 1I94F 3KNAA 2VA3A 2DT9A 3KG1A 3LWLA 4IO9Q 4NCGB 1NNDA 3JSYA 5THWA 3ZZUA 3CTRA 4M94A 4WKRA 2DRBA 4O44A 4RNMA 1QUVA 2D9PA 4IH5A 4QIGA 4C98A 3IR6B 1NK6A 3HJFA 4LSLA 3SDEB 3VAHA 4KC5A 2BVZA 5KFOA 3ENVA 4FF4A 3I0RB 5HO4A 3UDLA 1KS2A 4JBCA 2V4QA 4X4OA 2A10A 4DQRA 1DLOB 1TV6A 3BGRB 4JV5F 4WZQA 3IWXA 3PFOA 2VPWB 4A46A 2C2DA 3DGPA 2DGQA 3TYTA 1DJ0A 4OLPA 3NMAA 2KTQA 4FF2A 2CQ2A 2RMLA 4KTQA 3FZ2A 4N41A 1CSJA 3FEYB 1JLGA 2PEHA 3F56A 1Z2LA 1FTCA 1L5UA 4YB7A 5FIIA 3FQKA 1UFLA 2IRYA 3OTBA 1NK9A 5LSLA 3D54A