2JSXA

Solution structure of the e. coli tat proofreading chaperone protein napd
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein napD
publication title Structural diversity in twin-arginine signal peptide-binding proteins.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Chaperone
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03927 NapD NapD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2jsxA01
2VBXA 2W25A 2EFNA 2IA0A 4PCQA 2PN6A 2Z4PA 2ZBCA 2QZ8A 2ZNZA 2GQQA 2DBBA 2E1CA 2W24A 2E7WA 1RI7A 2DJWA 2P6TA 2P5VA 2CYYA 2VBWA 2EFOA 2YX7A 1I1GA 3I4PA 2CG4A 2IVMA 2VBYA 2E7XA 2CVIA 2JSXA 2EFPA 2CFXA 2ZNYA 2VBZA 2P6SA 2YX4A 2PMHA 2VC0A 2EFQA 2VC1A 2E1AA
chains in the Genus database with same CATH superfamily
4F25A 2E1PA 3A8JA 4ECTA 4ECXA 2AD9A 2HS0A 4R25A 1GK8A 4OV1A 1ZPVA 5CYMB 3GE9A 1D9FA 4NRUA 4RW6A 4TU7A 1EX8A 4OQJA 2V4JA 3EVOA 1JXLA 1FXRA 2V2KA 4C11A 4DSIA 1S0VA 4ZN3A 1VOMA 3Q8UA 2VUGA 2PIIA 1IR0A 4OLPA 4RNOA 3CCMS 3CD7A 1D8ZA 1U49A 1WOPA 1HBOA 2CPXA 2XTJP 2YWHA 1XMQJ 2X1GA 2CQ0A 1VI7A 1OSDA 1MN9A 1N88A 2C1EB 2C22A 4CI0B 1HNZJ 3PY8A 2Z2LA 4QPXA 1J5EF 3IR7B 1CS4A 2MKKA 3LH2S 1RGVA 2CZ4A 2DRAA 1SCJB 4DV7F 3JTPA 4UTGA 2GIRA 1OMSA 4UY85 3MUTP 2COLA 1H72C 2B8PA 3RB3A 2AJ1A 2VJVA 5A2QU 2VPXB 3F0NA 2W9CB 1YWXA 2YKOA 4MK8A 3I6PA 1B3TA 2ZH2A 1TKTA 4DDFA 2HS4A 1U0HB 2GZOA 2E66A 2BKPA 5CYMA 1RTDB 2VV5A 2ZUAA 5DG7A 1AT1B 2VFTA 1EARA 2A6OA 4RR5A 2IBOA 1KC8T 2PFFB 4YOEA 1RCOB 3DHWC 1PC4A 4NXNJ 1KQFB 2BE2B 2LU1A 4GVLA 2VA2A 2DB1A 3HK2A 2K3KA 1W2BR 3RRHA 3EE3A 1X4AA 3CJKB 5CXTA 4DV6F 2NUUG 1HD0A 4CP5A 2N82B 2M0GB 2BEFA 3MEDB 5A6PA 5KOXA 1FO1A 1OPZA 2KYZA 3KK3A 4ECSA 4GMKA 3GONA 4X4UA 3KG1A 2PMHA 2BE9B 4URQU 2HS3A 1RU1A 3A8IA 3DOLA 5KFPA 5THWA 3R6GB 5IC4B 1ZBTA 2KM8C 3I5CA 5LMUJ 4C9DA 2DCLA 1Q7LB 1S0OA 1U0HA 1U6FA 4M5DB 3UCZP 1X5TA 2B7CB 1RTJB 1VDHA 4UZCA 3LQVA 4HT5A 1NH8A 3G2XA 3P96A 2APOA 3LP0B 2KHCA 1CJTA 2HNYA 2OHDA 1WF1A 2MQ8A 3EGZA 1VJWA 3R1LA 3KLIB 2CWKA 2BE2A 2HHWA 4DPYA 3NNAA 4IH7A 1NB2A 2BJ7A 5KFAA 2PMZD 2E5GA 4UOFA 1V5VA 2J0WA 5A76A 2DXFA 2H4YB 4NXMF 3QYYA 1OY9A 3BYPA 2XLKA 4WU3A 1REGX 3A3PB 1BY9A 4C8MA 1NH7A 9ATCB 2PO4A 3QRPA 2OPSB 5JMNA 4BCAA 4J90A 1SQEA 1XTZA 3FRZA 3G8QA 2HFUA 3A1YG 4YB1P 3KLHB 1QSYA 1VISA 1UTAA 2CNLB 2ZM6F 1U48A 5A8RB 2XNQA 1IKXB 5IT0A 4LUBA 4M5DA 4FYYB 3L95X 3IGNA 2J9DE 1U1RA 4KAIA 2R7RA 1IKWB 4HDHA 4ES3A 5HJYA 1BWEA 4WKRA 3LP0A 4ZJOA 2ASLA 2FVPA 1IM4A 3HD2A 3R7BB 3SCKE 3QFWA 3KLIA 4L72B 1K44A 3I55S 4WIQA 2V5HG 3R5BA 5J1PA 2XS7A 4AL5A 3J81Y 4ZCLA 4I6YA 4OX6A 1NEEA 4MT1A 4PXDA 1GMWA 1JLEB 4QPTA 1CJUA 5C7PA 4DQPA 1VMBA 4USUA 2CJXB 3PO5A 2ZBIA 3H4DA 3GFHA 1TUVA 2IMWP 3CD5A 2OPSA 1WNEA 3TP2A 1B7YB 3Q23A 1KWMA 2FHJA 3W2VB 1QJHA 4DX7A 2DY9A 1IKXA 3NOGA 2QYGA 2ZVIA 2FZKB 2E7WA 3W65A 1TELA 3TX8A 4LQ3A 1XNRF 1IKWA 1E6VA 2UU9J 3SV4A 1EAYC 1UAWA 2MSTA 4J9NA 4G1QB 2DNZA 5IC6B 2VG7B 3GIJA 4IFYA 5CHCB 2P9CA 3MPUB 2X1BA 4EEYA 5J2MB 3DKDA 3KTQA 2B6AB 1JQGA 5KG3A 1S6QA 5D0RA 1N5QA 5J2PB 5KFMA 1VK3A 2ILYA 3EZUA 1M90T 3T3FA 4MK9A 5K9FA 3N01A 1RWWB 2V68A 5C42A 2J76E 1DJ0A 3LPEA 1XMBA 2FY8A 3SDEB 2F1FA 2CFXA 4JI8J 4MKVA 3CIZA 4G1PA 1T9YA 3FC9A 1RTZA 1HPZB 4F0KA 4DLGA 8ATCB 2XZDB 3DLKB 2N4DA 3TQ1A 3RYLA 4V1Ak 5JUMA 1S1XB 3AOAA 2NZCA 4Y34A 1O51A 1RAGB 2C3UA 4RLEA 1LWCB 3GJTB 4ED4A 4IQXA 4KB7A 2K1RA 5KT4A 3D0HE 3CCSS 2FLPA 4QBUA 1TFWA 3M9OB 1VRUA 3EXYA 1SVDA 4C8LA 2JEFA 1PBAA 1F5CA 2W2OP 4DV2J 3A3NB 3CWJA 2R8JA 2EFQA 2KT2A 2RUSA 1N56A 4CLFA 2ZHBA 2ACYA 3KG4A 4DR5F 1S9EA 4WP3A 3CC2S 2OTJS 1IBLF 2VG7A 1T9VA 1VQ4S 1G7CB 1S6PB 4LBIA 1YJ7A 4ZPTR 3PW4A 3DXBA 3C6TB 4CLTA 4EMDA 5I3PA 4BWJA 3GIIA 1I1GA 3G8TA 3DDKA 2CZVC 4DHVA 2CQBA 4A8XA 1Y0HA 3ILJA 5KG0A 1VQPS 3JSRA 4EWTA 3VAMA 3BBCA 2CJQA 3A8EA 5E7OB 3N9UC 4CLPA 1NO8A 3CMQA 5IT4A 4LIWA 5DG8A 3MEEA 4PG7A 5HMYA 1ZA2B 3PM9A 1S1XA 1FWLA 3MM6A 3TWZA 4M5HA 2XMJA 4OYIA 1V9OA 2CA9A 5KFNA 2FJWA 1UPMB 3KWMA 3H5SA 2MKHA 4DSKA 2Y0BB 3H42A 3Q8YA 2CQIA 3M05A 3HFVA 4J9MA 1PC5A 5B0EA 5HMWA 3GJSB 1J5EJ 4KR0B 3OL7A 2DR7A 5CYQB 3VGVA 1HHTP 3WQPA 1UP1A 1VHIA 4LF5F 1NK4A 4WE1B 1X8DA 4RW8B 4A8WA 4F2RA 4DV7J 1RE1B 4C3LA 3JYTA 2FJVA 3C6TA 2IJNA 5M2RA 2PFDA 3NG8A 1EHWA 2MJNA 2AMCB 4Z7CA 4OZNA 1P8GA 1OQ3A 4RUHA 3C14B 3HJFA 3FK4A 1WTFA 3PACA 4HHHA 1H98A 3VGTA 4DR4J 2HFVA 7AT1B 2J0SD 1RBLA 1KONA 1P1LA 4O0NA 1SIZA 1RJJA 2DGQA 4F4WA 3SV3A 1I6JA 2P9EA 2CVIA 2XYPB 2YH0A 2VBZA 2GIQA 4NCBA 1X4HA 1SI9A 1VGYA 3OXFA 4K4YA 4ILLA 2GS8A 1SKUB 2GGPB 4Z2XA 1XK8A 2RNEA 1WC6A 4E0DA 5FIIA 4DV6J 1OYEA 2YQ0A 3KLVA 1NB7A 2F4VF 2X7IA 3NCPA 4DS5A 1VBZA 4RW8A 3GTYX 3PX6A 3DLEA 4TYAA 1TK5A 5T7LB 1W26A 1GAOA 1S1VB 1RAAB 4K4UA 2ZZTA 1S59A 3CW2C 2BXJA 2EK6A 1NSKL 2QZ8A 4QWCA 5H9FK 3FVYA 1X0FA 2F65A 3CCQS 2GJIA 2QSWA 4ZJLA 3C14A 1DLOB 2VJUA 3W9IA 1NDPA 4UUXA 5I3QA 1Q79A 2IRYA 1RT7B 4B9TA 2HK3A 1JXVA 4NYZA 1RSCA 2Z2MA 4EYIB 4ZDNA 4LR7A 1RYSA 4RU2A 2PEBA 3CDEA 2RRAA 4BBYA 2N4CA 4FF2A 3VAJA 4L75A 4OZJA 2KHDA 1ZZFA 1H74A 1WI6A 1C1BA 4B3SF 4CZCA 3K0JA 5JVGQ 3CJ4A 5KFGA 1YTYA 3EMTA 4C98A 5D3GA 3BN7A 2WVCA 4B08A 1K9MT 5ETRA 4B9LA 4JV2A 4ERDA 4NLDA 2HHVA 5HK4A 3MHYA 2RU3A 3HULA 1FRKA 3DOMB 4R5PB 1QE1B 3H40A 4NCGA 3MEKA 3QQCD 2PC6A 4NLWA 2WOMB 4KKOA 5F41A 2P6TA 3BKUA 1UJ6A 1DTQA 2CG8A 2P2CB 1MROA 1N4LA 3NWGA 2ZM6J 3W7BA 4CO5A 3IAM9 4FS1A 4TLQA 3W9HA 3RW7A 1VQ5S 4H4OA 3MGJA 3EYZA 1A6LA 4Y65A 2OELA 2DH9A 1FI4A 2NPIA 4JI4J 3LGMA 3R2DJ 4UT4A 2Y9HA 2JOQA 3PZPA 3C6UB 3LW5C 4HVZA 2EPIA 2XMMA 1NUEA 1Q7YT 1HNVB 1VBXA 3L7PA 4NA2A 3FQLA 2C2MB 5L1LA 3VALA 2LDIA 5E5NA 3DOMA 4ZLPA 3CVKA 3TYTA 4H4KA 2WOMA 2RU9A 2VODA 1FDBA 2NQPA 1L3TA 5EN1A 2D3OR 3R8YA 1WF2A 3P4UB 4NMXA 3KHRA 1UJ5A 4F50A 1SB6A 1R27B 3J7A1 4P7TA 1UMJA 2QX0A 2AKWB 3DNCA 2UUBF 2ZH7A 2JFDA 3V6JA 2QN6B 4DV3F 4RX6A 3UR0A 2DHGA 2V9WA 1XNRJ 2XC9A 3J7ZT 2HHQA 3UE2A 5A8KB 5ETSA 3K8WA 4PG8A 2PSZA 3PW2A 4KGZB 1IXKA 3HI9A 1HLWA 3C6UA 1HHSA 2EKYA 3OUYB 4U7UK 2GO8A 4MAKA 1YHQS 1EQMA 1HNVA 4O23A 1CPZA 1X4CA 1UVKA 2YNHB 4CNYA 2ALZA 3KNGA 3MFHA 1HI1A 2K8GA 1BD6A 2D7SA 5KFZA 1YVFA 2V67A 2XSJB 2AHOB 4EBCA 2HSEB 2F5GA 3HXMA 4ZOSA 4RNFA 1S7HA 1AXQA 3R7SB 5B08A 1X9SA 2CRLA 4ED1A 2HPUA 1JLFB 2IRUA 3LTOA 1KOOA 3EGVA 1MWYA 3K8VA 4DR5J 2BANA 4ZP7A 3IWLA 3HLUA 5EX0A 3GFZA 2QC3A 4LT6A 4DL3A 4CQ1A 2W9AA 4B9NA 2AP6A 1R43A 2WVDA 4LRDA 3I87A 4DFJA 3GIKA 2HGLA 5HAOA 1TMMA 1X0PA 4CO2A 4DF4A 1FWPA 5J2NB 2FQQB 2DK2A 2YNHA 3TUPA 2Q66A 4CNZA 3I96A 2HBYB 4IYQA 3T1HF 4DL0C 3TJ8A 4CIOA 1IVZA 3NMAA 5BYQA 2PD1A 2HQDA 1CC8A 4DI6A 5GMEA 2RRNA 3PW5A 4TYBA 3D6HB 5SUHA 4YUDA 1N5VA 3CC7S 2IPOB 2UZAA 3JAMU 2FY1A 2V63A 2XSJA 4TKTA 3TJAA 4ZLLA 3RBXA 2GHVC 4Q0BB 4ZVUB 1O5JA 1Q8BA 2ZOMA 1NPRA 4XDDA 2YX4A 1Y10A 3UDVA 2IYIA 2DNMA 1TR0A 2GMLA 1U1LA 2AF6A 4GKJJ 5M2UA 5HATA 1SC4B 4RWXA 4DCJB 1ZM2A 2H5JB 1N36J 1T03A 4OFZA 1P1TA 2IY5B 4ILMA 2O67A 2KXHA 5F8IA 1U1MA 2EFNA 4LF5J 4OYBA 4M1KA 4J9KA 1UVIA 2AW0A 2WBRA 3VVUA 2FPHX 4LSLB 4P75A 3GWCA 4C6AA 3ELHA 3LO3A 1FKPB 1SQGA 1WORA 4LF6F 4KGXB 1S1UB 1AROP 5CZVA 2C2NA 4ZVFA 3K5LA 4IRDA 2BW2A 3CD0A 2L9DA 2ZOFA 1TL1A 3U1NA 2VBYA 5D15A 2GVDA 3EPIA 2W4DA 2FVSA 4NZ7A 1VJQA 3HT0A 4PCQA 2OUGA 2PN6A 4M5KA 2VU5A 3T5KA 4A46A 2J7WA 1WEXA 3I0SB 4PEOA 1KLMA 3NNHA 4F26A 1AUSL 4LF9J 1VQMS 1K0VA 1C1CA 3NGKA 1HYSA 1RKJA 2CUYA 4MKBA 3JB9k 2W2PP 2DHXA 4X4SA 1TKXB 2A6MA 3HFKA 2Q6BA 1UZHA 2BE7D 2AYBA 4OHVA 3UDEA 1RTIA 5H9FJ 4I2PB 3WIVA 2R7WA 1D1UA 2M3DA 1UFWA 2HVIA 1XIQA 3SCJE 3Q0AA 4NEZA 1KFDA 1MG7A 2FYXA 1ZAWA 2WAQD 2YNGA 1B0TA 1KQKA 1R0AB 4K4VA 2YWEA 3NY0A 4B9MA 3CJRA 3M6UA 5F8MA 3SYZA 5GAGU 4YS2A 2KRRA 1DQ8A 2AGOA 3K5PA 3PYGA 1U45A 3M2RA 3G8SA 5CD4H 3BDPA 2MZSA 2HRUA 5C24A 1F9HA 3HM9A 4NOHA 3E51A 1PJ7A 2FHKA 3BO3A 3KK2B 3HJVA 2QLJB 4PPDA 3LGNA 3KLGB 4P10A 4QWBA 1FRXA 4B3SJ 2XI3A 2D1CA 4ECYA 1NJZA 4OYWA 1LWXA 3KNAA 1H0HB 3QWUA 4ZN1A 3M32B 2HFOA 1F6TA 1HBMA 1H7XA 2FZGB 2JRSA 3D0IE 1RT1B 1Z4UA 4I2PA 4F36A 3C19A 1CQNA 4A48A 1R0AA 1PBUA 1T7PA 3I82A 5HP1A 1JLBA 2H1YA 3R5AA 4AE5A 3H5YA 2IM2A 1HWJA 1R8PA 5HMZA 1NK9A 2GIFA 2CJBA 1VC0A 3R3TA 1VQ7S 4B3RF 1OPIA 4CYUA 2CQGA 1SJRA 2E7XA 1YJ9S 5F8GA 2QEXS 1HL6A 4X4OA 2F9JA 4P6QA 5GAEU 4NMLA 4HHJA 4RL1A 1Z2LA 4DPTA 2J5AA 3KK2A 3LWMA 4NLGA 1TU0B 4PUOB 3CDUA 2UUAJ 3N5BA 4AYBD 3HHLD 2D9PA 3BKTA 1O8BA 2VFRA 1I3OB 1FJEB 1WC5A 3M1VB 1IM6A 1DFDA 4IUFA 3EZOA 2FVCA 4DCOB 2MSSA 3O2IA 3TJ9A 3KHHA 1C4AA 1FDAA 2HURA 4EFAC 2Y1IA 1YDLA 1EB0A 4P2FA 2QT7A 3FDSA 5E3PA 2V8HA 3H0PA 3CJ8A 1O6XA 3MM5A 2XO7A 4CLSA 4U8YA 1K1QA 4WCEQ 5LXRA 2F3JA 1VCTA 4IO1A 3TEHB 4CCHA 3CB4A 1T3OA 1KP6A 4I2QB 4LREA 2NSCA 2FVQA 3SI8A 5EUHA 1R89A 2CJ9A 1NJWA 3RB0A 3OFGA 3T1YF 2HEKA 1YQHA 4NASA 1K0TA 3VF0B 4C8KA 2J9EA 4B9UA 3M8RA 5IZHA 1SIWB 3MPVA 4AQYF 1TUWA 4I4BA 3FEXB 1VLOA 1T11A 3U27A 1TTHB 4GO7X 5DDRC 1BQNB 1JNRB 3M1VA 2OEKA 1FX4A 4RBTA 2HFNA 2B4PA 2J9CA 2Z57B 1Y5LB 3VAKA 2NCKL 2ZNZA 2I5JB 3SIPB 2DNGA 3UNYA 4DPOA 5KFCA 2DCUB 2MEWA 2XY6A 1WEYA 1S57A 3H90A 1CC7A 3MR2A 4ED8A 1F5BA 2RQ4A 3AXKA 2I0XA 2C2OB 4MK7A 4UQTA 5HQMA 3N28A 4M95A 1OY8A 1WC3A 2ZBQA 2YWWA 4I2QA 4A8SA 2BQ3A 1WEZA 2AEJA 5K8MA 3MMJA 3PKYA 2OJ3A 4ANDA 3QAUA 2ZKUA 1LV5A 2ZH9A 3CIMA 1BC6A 1G1XA 4CLLA 3HP6A 4M5IA 3FCWA 2ZNYA 2FC8A 4PKDB 3R5GA 2UUWA 4URGA 1H2UX 3AA9A 3BKFA 1HKAA 3G71S 1HFEL 2O1PA 2OGUA 2R2SA 2ZH1A 2ZH3A 3H59A 4LR9A 3S6EA 3K17A 3ILOA 4IG3B 2NS1B 4L3NA 3FEZA 3QFHA 3TI0A 3W63A 1S97A 4O4RA 4J91A 1YRTA 2I5JA 1EQ0A 4KQZA 3HKWA 4GKKF 3FBEA 5IFMA 2E9RX 4ZVHA 2V34A 2FC9A 2OI2A 2RDJA 3K57A 4I67A 2C2EA 4BS2A 1AZSA 1A7GE 2YX7A 1KHWA 5DETA 2C2ZB 5KFVA 4N47A 2HQGA 2M70A 2RD5C 5GMKa 3ICLA 3MWBA 1YGYA 3CDBA 2HWIA 2Y1RI 4GC7A 5IM0A 2XZTB 4ZP9A 2R9LA 4LF1A 5B0DA 3KMQA 3OLBA 5IT9Y 3Q8RB 2RVJA 5HVGA 3JTNA 1NHVA 1VLYA 2DXEA 3W5XA 2W8KA 3VQSA 3GB0A 3Q2SC 2EK1A 4OYPA 1F0XA 2XMUA 3QLHA 2XMTA 4LF6J 2X51A 4X62F 2JJ4D 4YQWA 1AUDA 4FNHA 4YR3A 4KJIA 4Y2CA 4ED0A 1B0PA 4DSLA 1U24A 1BHNA 1L3UA 1ZM4A 3EPGA 1T05A 3NGDA 2VPYB 3B6BA 4HEA9 3W61A 4NI2B 2ZBCA 2CQDA 4AXIA 2B4OA 1XNQF 2YKNA 5I42B 3DFEA 2DGVA 4CDIA 4DV1F 1VS3A 4KV8B 1F3FA 2FTRA 1Y7PA 3AJDA 2DITA 3V4IB 1S1TB 5KG7A 3NMRA 2BJEA 3W66A 5B7WA 2HMIB 4PWDB 1SJ1A 2KZMA 2MB0B 1SJ3P 4ZHRB 3BGRB 1PYSB 4ED6A 3Q8VA 1XMOF 4KHPJ 2HNDA 3VHQA 5CZXA 3FBBA 2BKOA 4NLTA 2A18A 3DRYA 2HFSA 1GMUA 2ZDOA 3OL9A 2B8QA 3D1OA 1ZM9A 2Y8WA 3QGHA 5E3QA 2RF2A 2W9BB 4ZK7M 2Y1LB 1LW2B 4NLVA 2FGCA 3HSJA 1KTVA 4C8NA 1HWLA 2MMYA 2OSQA 5KT2A 2B7BB 9RUBA 3B8HA 3LP1B 2XYGB 4G3IA 1YX2A 2V4RA 3DDNA 5AE1A 3AA8A 4NI2A 1RAEB 3RB4A 3GIMA 2XSFA 3LGHA 1WHXA 1AYEA 5I42A 3TZYA 3PCOB 4KV8A 4MKAA 1HWKA 2QA4S 3QGGA 1RWMB 3M2VA 1DAXA 2YKQA 4J9PA 3QT8A 3D6TB 3CPWR 4PWDA 4OJ3A 3D2WA 5FDLA 5I3UB 5KTQA 3IS9B 2QGFB 2IC3A 4ED2A 3FRYA 4KH1B 3BGUA 4USHA 3OTBA 3WDOA 3CULA 2ZD1B 4LVOP 3BGOP 4X4TA 2GX8A 2V4QA 3E01B 4X4QA 4ZIVA 4HTIA 1JLQA 2K06A 4DG1B 2YNFA 4PWUA 1HWUA 2RDIA 3QRQA 3KUGA 1H2TZ 2XQCA 4RW9B 1IKVB 3W1YC 2HG4A 5D4PA 1YI2S 4M5JA 3LF0A 1NK8A 1LW0B 3CO0P 1LW2A 2NXEA 2OPRA 3VR1A 1FA0A 4DOZA 1VRTA 5HJXA 3PV8A 1YJWS 3OTDA 1HQEB 1M1HA 4HL9A 2HZVA 3GYNA 4I69A 3OL6A 2PGCA 2QV6A 3MCSA 4WJBA 3E8OA 4B3RJ 1FERA 2A2CA 3IRXB 1YBUA 3HVTB 3B54A 3M30B 2YKMB 4RW4B 2E1CA 1RA7A 4H4MA 4ID5A 1FKOB 5C5JA 2XGPA 4DFKA 2DD8S 1NDKA 5BJRA 3IS9A 1SH0A 2QA2A 3KYLA 2LFVA 4FXDA 2J7KA 1VRQC 3DRRA 1EETA 4RW7B 4USIA 4LF7F 2MXYA 1S5ZA 3ENWA 2XY5A 1S7IA 3O3LA 4KIAA 2P5VA 1RB0A 2VZ9A 1HNWF 1FT8A 2KZZA 5GAEI 1J27A 4OX7A 4DG1A 4HH1A 2E5JA 4AXJA 4RNMA 2V94A 1HARA 1GX5A 2RUGA 5IQ6A 3HFZB 2WW4A 4NXNF 4EZ9A 2H51B 5L39A 2ATLA 3OFHA 2QL5B 3BSAA 3GMGA 3SFUA 1FESA 1HMVB 3C16B 4K8RA 3F73A 3G9CA 3T9ZA 4QIWD 4AUKA 4CM0A 1UFLA 4R8UA 3W2WB 3HHLB 4UOCA 4B3OA 4TU9A 1AB8A 4UUWA 3ET6B 3AQPA 5J1EA 2DPIA 2XBPA 3T1YJ 3S1TA 4RW4A 2YY3A 3GV8B 3AOBA 2YKAA 3BJYA 4PQUA 1EP4B 2MGZA 1FKOA 2LQJA 3IBWA 2RS8A 2GAGC 4IOBA 3SFGA 4WP8A 2ZZMA 4NCAA 5ETLA 2M9KA 3J7AN 1S12A 5F0UA 4AQYJ 5HN0A 4LSNB 1IKYA 3AHPA 3VCDA 2WK4A 1FEEA 1KVIA 2C42A 3CMAS 2MZQA 4P7VA 1Y9OA 3OFEA 1D9DA 3EDQB 1PGZA 1FK9B 3KUHA 1WG4A 4M94A 3GPAA 2HGNA 2F63A 2BVZA 2IVMA 4O3PA 1JJHA 2WSEC 1ZH5A 2NLWA 3C15B 1LK5A 2GC8A 1GTEA 1RQ0A 2QJ3A 5A0YA 2FJEB 1FHTA 3KK1B 5IWAF 2HVEA 1XR7A 1ZM3A 2HQIA 5EX3A 2IMOA 3UPFA 4ANEA 4OI2A 3W2WA 2H65B 3HHLA 4MYTA 1HBNA 3ET6A 1RT5A 2DBBA 3PVXA 4IDKA 2B56A 1SJQA 2GHPA 2MQQA 2DO0A 2RJZA 2JDJA 3AODA 3AAWB 3L7OA 4N8NA 1WUUA 3CF5Q 2J6SA 2AX1A 2HBRB 2V8GA 5FLXY 3P5TL 3FNNA 4MFBA 1FWKA 4LSNA 2RQCA 2W01A 2ZWPA 3W60A 1RABB 2O01C 1LKZA 1JJCB 1PILA 5AJ3J 1T0TV 1TVRB 3J7YU 4USTA 1SKRA 1NK0A 2IDEA 3BPSP 2BX6A 2B9WA 2I38A 4Q2MA 4ELTA 2QA1A 4QIEA 3OL8A 4F3QA 1JJ4A 3SQOP 1VBYA 5L1JA 3KJVB 2OFGX 3KK1A 3OR1A 4FYXB 2ZEJA 1HWIA 5D77A 5B0FA 2B51A 4LRCA 3ZFVA 2JEJA 5LMNF 4JV0A 3M9NB 4NZ6A 5H9EK 4LFAF 2G4BA 1ZOTA 2M8HA 3BV8A 3HSGA 2PA8D 1LNQA 5C2CA 3QT5A 2HHTA 1E6YB 4LFBF 2ZE2B 5F9NA 3MTKA 2HIYA 3M8SA 2KO1A 2HWTA 3KLFA 4QYRA 2G9OA 4FF3A 2K2PA 3PX4A 4LQ9A 4CLZA 4X4RA 4WF9Q 4Y00A 5HL7Q 3AOCA 4RNNA 4A8QA 1RHMB 2LXFA 3BGLA 2JSXA 4USJC 3MMCA 3THVA 2HLUA 3TNVA 2PE8A 5J1NA 4X62J 1HW9A 1QVFR 3RRGA 3QWPA 3ZZRA 5LXYA 1SUQA 1UVNA 3N79A 4IR9A 1Y5NB 1VQOS 1P6TA 4JI2F 2VIHA 3UQSA 2HHXA 1S72S 2V50A 1PO6A 4DPXA 3G6VA 1S9FA 5ETOA 1XNQJ 2B4VA 2WONB 3EICA 4N8OA 4WWSA 3QSYB 2MDAA 5F3ZA 4U95A 3PDNA 4B9SA 1JLCA 2DEJA 1GMVA 2NXCA 1GXTA 1Q0NA 5E2QA 2F4FA 1M5OC 1SC3B 2A2DA 3KLEB 3DDIA 2DGUA 1WHWA 1XMOJ 3EUNA 5DG9A 3MCOA 4J7CA 4YB7A 3T1AA 4LBHA 2CPZA 4WYLA 4Q5VA 2EKNA 3ZNUA 3PYDA 5K8NA 3EGWB 4J9LA 3L09A 4D3HA 1QLNA 4IFVB 1Z2ZA 2YPYA 1S9GB 4TY8A 4I56A 3CCUS 1NSPA 5B0AA 1F1BB 2E29A 3T9NA 2B9XA 3TVZA 4N5SA 1K8AT 2LYVA 2KTQA 3DOKA 1NPKA 2GQCA 2DGSA 3ETMA 4DUYJ 2B3TB 2BBEA 3Q8QB 4OJ1A 3HKZD 4LJMA 2JLEA 2VFUA 2WONA 3W62A 3NLCA 2VD3A 1MSWD 4ZP6A 2VDIA 3L7UA 4YEAA 1EZZB 2B9EA 4K4SA 4MYUA 1FFSB 2W7PA 2Q79A 4JI7F 4JI5F 3PKMA 3T5JA 1QAIA 3O8WA 1RDRA 2H48B 3VAIA 3KLEA 3ZTSA 3MZIA 3THPA 2IBKA 3AY0A 2QL9B 3CJ3A 5JVHQ 1V3RA 1F9EB 4YFUA 2VF3A 1VC6A 4ETZA 1G2EA 3DI6B 2P6SA 3VAHA 5A8WB 1U0SA 1FTRA 1NKCA 4LFCF 4AL6A 1FFGB 1WTBA 3J7Z5 1RWUA 5K14B 2HIQA 5DLFA 3SMZA 1PG5B 2XWYA 3FMBA 4DPWA 2FHMA 4A8YA 1IWGA 3ENVA 2ERRA 3D6FB 4YY3J 1RA6A 2PI5A 2PDAA 4ZCKA 3I4PA 5D0HA 5HVFA 1S1WB 2YTCA 3PR5B 1IQZA 3DMJA 2H5EA 1KHVA 1FRHA 3KJQB 1XWLA 5DZ7A 1C0UA 4XDCA 4O4GA 2F9DA 3DM2B 3VQTA 2B5JA 1IBKF 2M2BA 1N5YB 2IAJA 2YPZA 1U2RA 4FKYA 4JI6F 3R27A 3FZ2A 4LF7J 4DR4F 3CCJS 3CD6S 1HNWJ 4K0KJ 1QAYA 2KU7A 1V6HA 5HQLA 2MZJA 1Q78A 3ZZUA 4EO8A 2AJ0A 3NS6A 4EI2A 1LFPA 3EXCX 2C3YA 3R9LA 1B7FA 5K14A 5LOQA 3MMBB 5KG5A 2F7VA 3MXHP 3RBDA 3M6VA 1RACB 1MNEA 5BYRA 1S6OA 4I64A 4DQQA 1VQNS 2JZ5A 2AJQA 5RUBA 1S1WA 1TL3B 5LSLA 1KEKA 2PA3A 4P2XA 2HYIB 3IBCB 4YP3A 3BBFA 4M5GA 4EUVA 2KM8B 2I1RA 2MKJA 3DM2A 3PO4A 2E9TA 4K4TA 4PG6A 3U02A 4OYMA 1RISA 4WPAA 4DV4F 4ANCA 2W9CA 3UD4P 1JLAB 4ZPDA 4HLBA 5HROB 2BACA 3KDNA 3BB5A 4HACB 3HHKA 1RTDA 2DNQA 2FD2A 4OYXA 4DUZF 3AD9C 2Z0GA 5CYJA 2DHAA 1T94A 3JSMB 4ITSA 1TV6B 4ZVGA 1NMEB 1JX4A 3NGUA 4DR2F 1UETA 4WU2A 2ROGA 4B17A 3KOAA 3IG1B 1KLNA 4LRFA 1W7WA 4Z37A 2M8DB 2NSBA 1NSQA 5MLCV 3W3SA 4RUBA 5IWAJ 1N33F 3I9ZA 1UVMA 3CJKA 2VG5B 4DV0J 5GMDA 5LT5A 4DUTA 2FLOA 3D3CJ 2BZ2A 3JXOA 2EBEA 5IV4A 1TL3A 3MD1A 3MEDA 4ECUA 3O44A 4PG5A 5KFYA 4XO0A 4KPYA 4KO0B 1L3VA 3MAAB 2IM0A 2R2RA 2RAQA 3C2PA 4A8FA 4IR1A 1FKAF 3BPDA 2VL1A 4DBQA 3SSSA 1WC1A 3EZ5A 4DFPA 1KN6A 3H20A 2PT0A 3TA1A 4Y28C 5D4NA 3MPYA 1XR6A 4GVBB 3Q22A 2ZZNA 1RTJA 1LXNA 3B4DA 3PRDA 4DR7F 2WVFA 1CLFA 1JIHA 5LJ3Y 4IG0B 2E1MC 2KJVA 4ECRA 3GJQB 4ELUA 4JI4F 2KXFA 3GYGA 4JOUA 3CJTA 4QQBA 3DRSB 3DLGB 5H9EJ 4DQRA 4PWWA 3M8WA 3J7YI 3SCLE 1T9WA 1ULRA 4F2SA 3H4BA 1IBCB 4DL5A 5LMNJ 3P49B 5EWFA 1X4EA 4LFAJ 2WRMA 3TVKA 1LK7A 4J9RA 1K47A 4LFBJ 1MMDA 3ZZZA 3Q83A 2W4PA 3T19A 4HHUA 2HHSA 3MAAA 5D0EA 3JQJA 2IA0A 3UDCA 1VIXA 2OTLS 1M5KC 4F4AA 5HQ8A 3K2YA 4ER8A 1PAUB 3RAQA 2DKOB 4KGKA 3KLHA 1S4EA 1YRXA 3W8GA 2R7OA 4K4XA 1HA1A 1NLKL 2FHOB 3BR8A 5A8RA 1H73A 4OX8A 3TA0A 4F04B 5DM6Q 4I68A 3TO8A 4IO9Q 4GVBA 2GQ2A 1D09B 1U6BA 1TFYA 5F3TA 3MM8B 4J9QA 2OSRA 3HZEA 2E1AA 5CQGA 3I5BA 2VASA 4JI2J 3I31A 2MPUA 5CD4A 2A0FB 3UO0A 2ROEA 3WHIA 1REVB 1QSSA 2E5LJ 1RLCL 2XMWA 2G2OA 3CCES 1RU2A 2FUG9 4O3QA 4K50A 1NKEA 2CQ4A 2SXLA 1DURA 2RH3A 1JLEA 1R0CB 4LIRA 3AT1B 2QIFA 3O6QA 4MIWA 2R7SA 3ITHB 1QAJA 1IBMJ 4ZKAA 3I0RB 3P3DA 3BGFA 2W2NP 4ES2A 3MR3A 3IFEA 1NPPA 3IRWP 4GC6A 4WKYA 3GSIA 4FN5A 2F8HA 2X1FA 3I56S 3W2VA 1LQ9A 1R3NA 2OLWA 2U2FA 4DLEA 2QLFB 4ZIWA 2KVIA 4O3SA 2WCXA 3LUYA 3FCHA 1CJKB 3MM8A 3EDRB 4DN0A 2YKPA 2UVUA 2VDHA 4EO6A 4FVMA 5HI7A 4G1QA 1VIOA 1WACA 2KG1A 5CCMA 2GA7A 5J2MA 4C0OC 4JP8A 4FXWA 2GHWA 4NLUA 2B6AA 5T14A 1RT3B 2J0XA 2QO3A 4DQSA 5J2PA 4ED5A 1CULB 4P9SA 2JEGA 3CXCR 2BMBA 2VOPA 1RAJA 3L9ZA 3IM8A 3MCMA 4CM2A 4MIBA 4JI7J 4JI5J 3TA2A 2OEJA 3SDEA 3ITHA 4C0BA 2I9SA 3IGVA 4HH0A 1HPZA 4HI2A 4ZVOB 3DLKA 3IR5B 2XM3A 3DYAB 2VPWB 1C4CA 3CGIA 1RWPB 3VZHA 4LFCJ 3HVWA 1LWCA 2MQMA 2DVIA 2M7SA 4F4YA 4RWWA 2ZBRA 3D1QA 3G96A 4BDPA 3QRRA 1RHJB 2CQPA 2CQ2A 3SQGB 4DS4A 2H5IB 4QWDA 4F0MA 5L46A 2ROPA 3FSIA 3PG9A 1CJKA 4GKJF 4Y2IA 1GMWD 2C28A 3DRPB 3CJ5A 1N36F 4KE5A 5E3RA 2FVRA 2DRDA 2QMWA 2MHNA 4JB8B 1OSCA 3IP0A 1S6PA 5AE2A 2F40A 1RT2B 3PTWA 4BC9A 5KFOA 1XN9A 1RT3A 4QW9A 3V2UC 4CLWA 2EG2A 4D3GA 1BLUA 4RUCA 4OI6A 3U1LA 3BO2A 2HRYA 3VV2B 5DGBA 1I5OB 3JQKA 1IBKJ 3A3OB 4H54A 4WFBQ 3OTOF 3MR7A 2H3EB 4XAKA 2ALYB 4F4XA 4DJBA 3H5UA 3Q2TC 3OHAA 3WC2A 1WOOA 4JI6J 3H7HB 2ZH4A 3HO1A 3X3UA 3DYAA 2VQEF 3OV7A 4C48A 2BUNA 3DU5A 4DL2A 2OPQB 4ALZA 4CLUA 3UVJB 5H1SV 4KC5A 2JC1A 4OHXA 4CO1A 4QU7A 1IWAA 5DDOC 4LF9F 4C8YA 1V3SA 4F3MA 4NLRA 2ZJPQ 4NA3A 4P2SA 4X2BA 2K7KA 4MIAA 2XS2A 3PJXA 1M5HA 4LF2A 5D8HB 3BH7B 2RS2A 4HTJA 3DRPA 1VQYA 1F2HA 2MLXA 5CYQA 2DNKA 3BQ0A 3LOUA 2HFZA 3RUBL 4KT0C 3W64A 1RLDA 4KH0B 4WE1A 4CH0S 4TU8A 4C3MA 3M8QB 3H5XA 2C3MA 2EFOA 1S48A 3KJNB 3B4MA 1RT4B 1Y3KA 1R7IA 1ZETA 3K5OA 1ITPA 5DQHA 5BR8F 1S4FA 5K5MA 4ZPBA 5D4LA 4PAAA 4DL7A 4DV4J 2EC2A 4WYWA 2DNHA 3UN5A 3BH6B 3DGVA 3V4MA 3AFGA 2UXBF 2R2UA 2AQ4A 2V2QA 3JQMA 2ZC3A 3DCAA 3PFEA 4ICLB 2G2YA 1MMLA 4DUZJ 4FKXA 2HHPA 1UW9A 3BQ2A 1WC0A 2HVHA 2OPQA 4CLYA 3IMQJ 3UVJA 4DR2J 2EG1A 4B3MF 2ZH5A 4OYOA 2Z56B 4WP9A 1Q81T 5KFQA 1XERA 3OSPA 2BKNA 2O66A 4NYOA 4NA1A 2VICA 4WFNQ 2QLWA 4IRKA 2CZ9A 3S8SA 4I7FB 3OW2R 1N48A 5HBMB 2GGPA 4PYDA 5KG4A 4DPUA 1N33J 1T02A 2CWXA 3DLLQ 3CJ2A 5KFSA 1V5IB 3A8KA 3I4HX 5KFKA 3UN3A 5T7LA 2FGOA 1RWXB 1HHQA 1S1VA 1RT4A 5DO2A 5KFDA 3M8ZA 4KRWA 1FJGJ 3CDWA 4I1TA 2VBWA 2O5DA 2I2YA 1NSAA 2HQCA 3RBZA 1DLOA 4ECQA 1FVQA 2Z2ZA 1WOSA 3HCXA 2NYIA 2BOAA 2MLZA 3AQOA 5KFIA 1RT7A 1IJEB 2G0IA 3KMSA 2Y0SD 3MTJA 4HT7A 5MAOA 4ICLA 4URSA 4DR7J 4QIFA 2JNJA 3BBBA 2R2TA 1U1OA 1CBKA 1X5OA 5KOWA 1FD2A 4WFYA 2QG9B 4ZPAA 1OJ4A 4RW6B 1G3OA 4NZ0A 4KFBB 2UUAF 3OFFA 4I7FA 3C8YA 4YR0A 3GV7B 1DARA 3V6DB 1NHUA 4FBUA 2AYGA 2RDDA 2VOOA 1HBOB 2FDNA 3NXZA 1DZ5A 4QR1A 4DV5F 4X4VA 3FCVA 1U2CA 5LSOA 2AWZA 3QO9B 3FFIB 3HVAA 4R5PA 1QE1A 2IA6A 1GFWB 5CA5A 3RR8A 3PNIA 3OVAA 1C2PA 2E5HA 4J9OA 1X4BA 2GO9A 2BW7A 5KFBA 1UKUA 2MJUA 2G1HA 4Q2LA 3POTB 3OLAA 4CO4A 4WFZA 1QVGR 2BJDA 2RE1A 5AXNA 1DQAA 3EJMA 1VQSA 3QZ8A 3T6JA 2JX2A 4C3KA 3CTRA 2R4FA 1F2GA 1JNZB 1RAOA 1TKTB 3UR3C 3DRXA 3FZBA 2EC0A 2OD4A 3X1LB 1K1SA 5HVHA 2DHSA 3NCRA 3TRGA 1VQKS 2LQBA 4KFBA 3PX0A 4N41A 1HI8A 4MKYA 3ZZ0A 1QUPA 3PRVA 4OX9F 3V6DA 2CJYB 2KT5A 1ZZNA 2UVRA 3HD1A 5E0OA 2OMOA 5ETNA 3WC0A 1RAIB 2EI5A 1U4BA 2BJ8A 5AXMA 3HT3A 1DY3A 1NJXA 3ZZTA 1MMNA 2W25A 3KHGA 3QO9A 4ES1A 3FFIA 4ZS6A 5E3CA 2M5YA 1S0MA 4C4WA 3DC2A 1TL5A 6FD1A 3EX7B 6AT1B 2RMLA 3GU0A 1SC1B 3BDEA 3KK3B 2UVWA 4P52A 4UF4A 3POTA 3W8PA 3GP9A 1XBWA 1QD1A 3AB2B 4CTAB 3J80Y 4JI0J 4G65A 3BO4A 3IN5A 3TAMB 3DOLB 1XQIA 3PIOQ 1YK9A 3Q24A 1MWZA 1Q8LA 4EBEA 1PJ5A 4Q43A 3OHBA 2VKRA 2GJ2A 4NEYA 3DLJA 3N5FA 5F8JA 4DCPB 2CNNB 5A8KA 4C2MA 1LXJA 4C8OA 2CXEA 5E33A 3LP2B 3OUYA 1RHUB 2HAIA 1CJTB 2HNYB 5D0GA 2VHGA 5IT9U 1XEZA 3Q86A 2GMHA 1QM9A 2J9DA 5F0WA 1RBAA 4Q8EA 2VG6B 3LAMA 1NK5A 2GMJA 1DBDA 3GR1A 4KYZA 3MOJB 1AA1B 2WHOA 2HBQB 1AFIA 4LRAA 4XPCA 4YDDB 1U7LA 2E1RA 3GSDA 2BQRA 1RZMA 2BYCA 4USMA 5KAKA 1OY6A 4CTAA 3ISNC 1RWVB 2KN4A 4JBCA 1KTQA 4ENOA 2GAHC 1JLFA 3D66A 1WDDA 3TAMA 3QIDA 2OIHA 3IA0A 2MHEA 1TKDA 1ZAVA 4K5SA 3C46A 4ZVRB 5IQQA 3VAFA 1GXLA 5IOLA 4JI1F 2RT3A 2AJFE 3IAS9 2KB2A 5LSRA 2XO6A 2R8GA 2IVYA 3LP2A 1FE4A 1MW7A 1OYDA 3AXMA 3R6LB 4W4MA 1YRUA 4OMFG 4DR1F 2BJ9A 4A8MP 5J2NA 4XPEA 2V69A 1Y00A 5CAAA 3OTOJ 1R0BG 2AU0A 3Q8SB 4CT9A 2KXNB 2LA4A 4OHZA 2IVFB 1XC9A 2VG6A 1YJRA 2C2DA 5LM7E 1FRLA 3UDLA 4HI1A 2QSFA 1HBUB 5AXKA 3D7SB 1WDTA 5HSPA 1FRIA 2J8SA 4ZA1A 3OVSA 2VQFJ 3OTCA 4WFXA 3VGUA 2VQEJ 1CJUB 1I94J 2JVRA 4NE9C 4Q0BA 1VQ9S 3H98A 4EYHB 2V9KA 1RHKB 2IJRA 5EWEA 4ETXA 3G87A 4DX8H 2HKEA 1SL0A 2L48A 1G4CA 4DN9A 3KXDA 2X1AA 4NLPA 1X4DA 4ECZA 1JWWA 2G13A 2XLJA 2AV5A 1U1PA 4KHPF 2P8IA 4Y2KA 2E7VA 1DRZA 1R6YA 3MD3A 5F9LA 3OPKA 2VBXA 4FYDA 1QAXA 3N4WA 1VK8A 4DZ6A 4X4NA 5E3AA 3R97A 3TUZC 3W9JA 3OJSA 1KQGB 3QATA 1MWQA 1Q8IA 1E6VB 4LSLA 4LSZB 3FEYB 5L1IA 1FKPA 1Q4RA 2U1AA 4RBUA 4M5NA 1RWKB 1H3DA 3QJPA 1S1UA 5DS7A 5BR8J 3SSRA 1JKHB 4IFYB 1NJIT 4IKAA 2CDRB 2BM1A 2KG0A 3IC1A 4TQSA 3E3XA 1JJ2R 2MLYA 1S6QB 5D78A 3MEGB 2UXBJ 3RG6A 4O3NA 1HBUA 5C42B 3BYRA 2NPFA 1TK8A 2RHSB 3M8PB 3PJ9A 2W1BA 3A12A 3JSYA 4FNIA 1WELA 3HDSA 2I8EA 3KFWX 4FYVB 1BXNA 2IJFA 3I0SA 4B3MJ 1X9MA 2OAUA 1XR5A 2DO4A 4HYKA 4WFAQ 2JC0A 4O0IA 2GFFA 2RQMA 3UWTA 2XULA 5B09A 1QTMA 1NDCA 5KG6A 2FIUA 2I6WA 4NLQA 3AD8C 1SPBP 2K1RB 1T8EA 3NGRA 2GNKA 3NOCA 4K4ZA 1VRUB 2DJWA 3AJ2A 2NXJA 1TKXA 4OJGA 5D4OA 2CPYA 1N32F 1N5SA 1SH2A 1HR0J 4GO5X 2NZ4A 3BSCA 5GADU 2KJWA 4O44B 2LEPA 4QYZK 1U1NA 4LF8J 3ZTPA 1S9EB 4KY3A 3ZTOA 2XCAA 3WX4A 2VFVA 2M52A 2YNIB 1JKHA 2ZH6A 1X31C 4QOTA 4Y3CA 2LKZA 4NX9A 3RBEA 3CJSA 5D6GA 2XY7A 1BWVA 3TZXA 3GR0A 1YJUA 3MEGA 2JLFA 3M8PA 1HQUB 4EK2A 3I32A 1ZA1B 3CCZA 4X66F 5B0GA 2AJ4A 4OI1A 1L3KA 1SL2A 5AE3A 1WG1A 2V8PA 4F7VA 1KBRA 1DHMA 3MEEB 4HKQA 3DGPB 3Q89A 3KLGA 3MM6B 1M1KT 3MOZA 1CEZA 1N5TA 3ZC4A 3N0VA 1TL7B 3AH6A 3MI7X 1EJ7L 4DR6F 1ROFA 4DV5J 3M32A 3MR6A 3MECB 3ENAA 1YG0A 3LPYA 2IRXA 1RT1A 4X64F 4O44A 4ZJQA 3PHEA 5CABA 5GAHU 1FDDA 6FDRA 1K73T 3NCQA 2QMUB 3D6MB 2G2ZA 5KT7A 2YNIA 2EFPA 4UOGA 3TVYA 2J0QD 1T9XA 4S0MA 4A47A 3OQ2A 2LA6A 2Z58B 3ZTRA 2DR6A 3JYTB 3KHLA 4QCLA 1VC5A 1X9WA 3RR7A 1XJWB 4YB6A 4P2MA 1HQUA 2VB6A 5T41A 2Z8QA 2ASDA 2QRRA 2DGXA 1NXIA 3JSBA 1J5OB 1FX2A 5IV3A 4ID8A 3M8YA 2A10A 4LMZA 4F3OA 2AEMA 4PUOA 4DMZA 3DGPA 2AGQA 4N7TA 4E2FB 5A6WA 1SJ4P 2KVQE 1NK7A 3DXSX 3N6NA 4DSEA 4OX9J 2L41A 2MQPA 2EWHA 3OXLA 1T9TA 1TL7A 2CJAA 4ATNA 1FJ7A 1YKWA 2KL8A 3TZWA 3RAXA 1F5AA 5JXSA 3MECA 2DNYA 2DY1A 4UW2A 5FLXU 2QLBB 3BR9A 2B0GA 3D5MA 1C0TB 4Y0FA 1TL4A 3FMWA 4YN3B 2IM1A 4FF4A 2PEHA 4IRCA 2BOPA 2MKSA 3R5DA 3DLEB 1NU4A 1F60B 1KFSA 1T95A 2N7CA 2RILA 2LLZA 5GVQA 2UV8G 4USWA 4RJVA 1GTHA 4YDXA 2XG8A 2RHQB 1J5OA 2DR9A 4Q45A 1S0NA 2HHUA 5DRKA 4P73A 4ED7A 4JI3F 2ASJA 4DQIA 2M88A 1BQNA 3FBFA 5ITHA 5AJ3F 5C25B 4TY9A 2CKWA 3GFXA 3BM7A 1RI7A 1WD6A 2CADA 1C1BB 4O3RA 1BGXT 4FYWB 5A2QY 4FBTA 3CNQP 1C0TA 4K59A 4N76A 1M5VC 2VC1A 5KFHA 5D3GB 2R8KA 1TQLA 2J7UA 4XIUA 4IQMA 5BXIA 3PIPQ 2HRTA 4PXEA 3HMJG 4EU0A 4NCGB 5DM7Q 1X60A 1Q16B 4X84A 4KKOB 2DNLA 3CUNA 3ILLA 1DTQB 2XHWA 1UPPA 3NS5A 2CPIA 1MROB 3V81B 5KFWA 5IXUA 1O0PA 3ZO7A 1U25A 4KTQA 2MTLA 4U96A 4JI1J 2W2MP 2C3OA 4A8KA 1NZAA 1SH3A 4H4OB 1L3SA 2B43A 4OHWA 3ZXWA 4I0WA 2R7XA 2N3LA 2YWFA 2Y1JA 3CO9A 2UXDF 4DR1J 2J6TA 3D4JA 4IG3A 4ZCMA 1U1QA 2UUTA 2L9NA 5C25A 3N6LA 4I6WA 5L9NA 4ZCIA 2XWXA 2VONA 3NL0A 2Q43A 2LP4A 5ETKA 2HHHF 4F67A 1FEHA 3VVTA 1DQ9A 1YZ6A 3MCNA 4WBFA 2CPFA 5K8PA 3SCIE 4NXMJ 3TUJC 3TZZA 2DIUA 2JVOA 4QW8A 1NBEB 3W5ZA 5L1KA 4NRTA 2ABYA 3NGSA 2WB4A 4KSEB 4PXCA 3MURP 3NP5A 2CQCA 1S77D 4ZPWR 3WX8A 1D3WA 2NXNA 4W90B 2EFGA 2DXDA 1RADB 1KKHA 1UVLA 3P5BP 3V81A 1UFKA 1PJ6A 3J81j 4H4KC 3ZZOA 1VHFA 3GCWP 3QSIA 2VFSA 4QIGA 3PW0A 1R8AA 4XK8C 1HNIB 1M1GA 2ZJQQ 2AZ3A 3TX0A 4MJKA 1N0VC 4N77A 4I6AA 2Q6CA 1H6KX 5DGAA 1Q82T 3MAQA 4PXBA 4IH6A 1KS2A 2J6UA 1FRMA 3FSXA 4FS2A 1Y5IB 5F8NA 3BSOA 2CNOB 1KQSR 2UVVA 4JV5F 2DNNA 2V2VA 3NKYA 1X5SA 3UD3P 3C66A 2HW3A 4G6VB 4DUYF 1BE4A 2XCPA 4OZ3A 2DEIA 4OZ0A 1GXUA 4C8ZA 2G1DA 2O3DA 3U1MA 5GAGI 3V4IA 1S1TA 2HVZA 3LA0A 2HMIA 4BHQA 4NLOA 2X3GA 2W7OA 2Q1LA 4ED3A 4ZHRA 3BN4A 3BGRA 2NR0A 1KVKA 4IOCQ 4ZP8A 2QA4G 2XEXA 2DRBA 2MZ1A 2IYGA 2OKQA 4K7QA 1B0VA 4QYZJ 3TAPA 1HNIA 1N32J 3N6MA 5G4DA 1D0EA 2BANB 1N34F 1ZYQA 3TOQA 1UWBB 2W9BA 2CQ3A 2FLLA 2AYEA 4P74A 2RIJA 2QLXA 1QTNB 1TZ0A 5KFLA 3NWRA 1UEUA 5GADI 4YY3F 4NPOA 3LP1A 2VPZB 1S76D 2XS5A 1TMJA 3UN2A 3MUMP 3RGIA 4CT8A 2CNKB 3GFYA 4X66J 1FFWB 2YXLA 4UY8T 3GIRA 4U8VA 3IM9A 3BSNA 1RHQB 3QIPB 1R8HA 1TAUA 2HWHA 5I3UA 2NREA 3LWLA 2QYCA 1BUXA 2K7JA 4C0HA 1PYOB 2ZD1A 3E01A 2YWGA 4K0KF 4DR3F 2M4MA 3GZ7A 4DR6J 4DSFA 3OR2B 4K2XA 4WTYA 4RW9A 1WI8A 4OHYA 1IKVA 4DEZA 4X64J 3K89A 4TQRA 2LQ5A 4FZVA 2IM3A 2LECA 3OSNA 2ZFHA 3OJUA 1T03B 3CCTA 1UWBA 1LW0A 3DHXA 4X65F 4J9UE 1IBLJ 3FBCA 3IBFB 1NM2A 1U1KA 1VQLS 1HQEA 3V6HA 2OH2A 2DT9A 4LRBA 1WF0A 1VBKA 5GAHI 2ZOGA 2C2RA 1Q8KA 1U09A 3EGNA 4PG4A 3G6YA 3CCLS 2UV8A 3IRXA 3R7NB 4A8OA 1YJTA 1QSLA 3HVTA 5KG2A 1TL1B 3M30A 3MUVP 1UA1A 2YKMA 2GVDB 2DR8A 5L8RC 3QIPA 2ZWOA 1X4FA 4M63A 3F44A 1VQ6S 3KKFA 3K7RA 2OD6A 3LANA 4AD6A 4TVAB 2YQ1A 1WWHA 4RW7A 3JS9A 3NBPB 1YITS 1KLMB 3OVBA 4UQGA 3QT6A 1WC4A 1C1CB 1LWFB 2CPHA 1HYSB 3CEDA 1VYAA 3OR2A 4J5OA 3OBIA 1KOHA 4K5RA 5SZTA 2R8IA 5KFUA 3SBMA 4DF8A 4NLSA 5E41A 1OIAA 3M9MB 1NK6A 2Z4PA 1HMVA 3C16A 1RTIB 3G82B 2ZHAA 4DV0F 4DU8A 1KD1T 5EDWA 1SKWA 1YSJA 2YNGB 4CLKA 2WVBA 2CIMA 4JYAF 2OEMA 3HZGA 4V19J 3CT9A 3KDOA 1KNZA 2GCFA 2MQLA 3T5HA 2H4WB 3J81U 2HBZB 3PXGa 1EP4A 3IO1A 2CQHA 1R8BA 2WB1D 1EKSA 3M2RB 1D9AA 1FNMA 2DGTA 1JMTA 3BQ1A 4F02A 2J8AA 2ILZA 1BMQB 1WJ9A 2A1BA 1GT8A 1HD1A 4JI3J 1U8SA 5C24B 1RT6B 3NBPA 3T5LA 1RTHB 2L3MA 1S10A 2IHR1 1LWFA 3CCWA 3FJ2A 1FK9A 2R7VA 4X4PA 3L3CA 3HSDA 3IXQA 5KFRA 3R2CJ 4QR0A 2GVZB 2BV3A 3C15A 1HNXF 2DR5A 2LCWA 4KGVB 1ZAXA 2F4VJ 1WKLA 3HPOA 3D28A 1RK8A 2AIRB 1HBMB 2MKCA 3FSYA 3G82A 1RKIA 2CPEA 3SZ2A 3P45B 2WBMA 5HP1B 2X3DA 1JLBB 1NHKL 1UA0A 1PSDA 4LF4F 1D8YA 4UOHA 4FVCA 1WHYA 1P9QC 2G0JA 2BRLA 4CYUB 5BYSA 1Q53A 3MR5A 1N54B 2E44A 1Q5VA 3RJMB 2UXDJ 1RT6A 3BZQA 3O5TB 1RTHA 3D0GE 1TVRA 3FKBA 1KDNA 2H54B 3B78A 5HMXA 1G6BA 4IH5A 2BQUA 4G1IA 3DU6A 1Y3JA 2HHHJ 4RU9A 4OYAA 2WVEA 5J2QB 4R0JA 3TARA 1AFJA 1NRKA 2GVZA 4KHRA 3QGPA 4WK1A 3KJVA 2W4CA 2E5LF 3RAMA 2ZKTA 3D67A 2C3PA 1ACMB 3TAQA 2F8MA 2QE5A 2CG4A 2GV1A 1E6YA 3EVMA 2XGQA 1IBMF 3A4TA 2ZE2A 3MM5B 3GG0A 2Y8YA 2R3VA 3US5A 3I5AA 2LEBA 4PYAA 3GLJA 4QWEA 2IDLA 1QDUB 1SKSA 1UCNA 3HHEA 1YJVA 1IUJA 4CH1A 2PMWA 2POKA 3MMAB 4DL6A 4RO0A 4BLGA 5HO4A 3EWGA 2FJBB 3FGVA 1CG2A 5F8LA 4L6V3 3IR6B 5DDPC 2JL9A 2HVDA 2LVWA 2F8EX 1M0SA 1TK0A 2ACMA 3ZZPA 3K5MA 1Q5YA 4DSJA 4KGMA 5J2QA 4JV5J 4KBIA 2E5IA 1NZ8A 2EBGA 3EM1A 4JUZA 3MPDA 3ZTQA 4DXLA 1ZPWX 1RYRA 1APSA 2ZH8A 1GH8A 2GQQA 1RAHB 3TW0A 4J37A 4PQAA 1UEVA 3GG1A 3QJLA 3PRBA 4EBDA 2JFKA 1BQXA 2EEYA 2W8LA 2HQFA 1P9YA 4L76A 1S99A 3GILA 3FQKA 2OFHX 1F3VA 2UUBJ 4HR2A 1A0OB 4DV3J 2HAFA 1KR4A 1Q95G 2MQNA 3V6KA 1UJ4A 2A3JA 4KPCA 1W25A 4YHHF 2MY7A 1X4GA 1N34J 4IFVA 3MMAA 5EGYA 4TNOA 4ZLNA 2R7UA 1S9GA 3ZNJ1 4OL8A 1YBAA 4ZPVR 2KFZA 1NJYA 1VQ8S 3HF5A 7FDRA 5K8OA 1S6UA 4Q7AA 4AFFA 4WXOA 2B9YA 1N6QB 2R42A 5ADZA 2YH1A 1B99A 1RP5A 4B02A 4LBPA 1UL3A 1RHRB 4NWBA 1B70B 4IOAQ 2DHHA 4F0HA 1YZ7A 3CSKA 3AJ1A 2ADCA 4C7QA 1FRJA 1HW8A 3R5CA 3IWXA 3NEKA 4ZVEA 2JLGA 2EFVA 2LQ8A 4TN2A 2XI2A 3D9BA 1N0UA 1AZSB 5C2GA 4M5LA 5K20B 2JEIA 3MDFA 1X5PA 5ETVA 3QT7A 3T6BA 5DQGA 3UD5A 2YVSA 4DR3J 2H9ZA 1U02A 3DI6A 1M5SA 5A8WA 5IM0B 1RAFB 3AB4B 1LWEB 4E8UA 2W24A 4HDGA 4GRSA 2UXCF 2DH8A 2RB7A 1SJFA 2MQOA 3PYFA 4Z7YA 3THTA 2L08A 1TKZB 1URNA 1RCXB 1TUGB 4X65J 2DISA 4WK3A 4TXSA 1R31A 3I9V9 3WZ0A 1KVJA 4B3TF 3K59A 3O1LA 3M2UB 1N6QA 3QLHB 4DZDA 2KDOA 2NYHA 4Q8FA 3T1HJ 4FP9A 1HQ2A 4PABA 4CWBA 3D68A 1FDNA 5G0RB 1IR1A 4OIXA 3VAGA 1T05B 3MPWA 1GQEA 2GW8A 2XHCA 1SXLA 1S49A 3CJ0A 1N5YA 1Y4ZB 4W98A 4NYPA 5L9XA 2DPJA 4R0EA 1F9FA 2DTJA 2YKNB 4YB5A 3FUYA 3D1HA 1WKKA 5CCLA 5KFEA 1LFWA 2MKIA 1FNXH 1A9NB 2ZVSA 2MKYA 2BRKA 2OPPB 3PW7A 2WW8A 1LWEA 1IQTA 2QL7B 4K2JA 3HX9A 1TP7A 3DN9A 4MTPA 3UW1A 4WTOB 1RWOB 1CQMA 2V8VA 3MMBA 2DGOA 2HNDB 5DJBA 1TKZA 2ADBA 1MU2B 2Z30B 1LOUA 2IFXA 1EIYB 3NAIA 2JWNA 2KI2A 3ISZA 2AX0A 3R5JB 1U47A 4NLXA 2OO4A 3JAMY 3M2UA 4CRJA 2HQ3A 1LEOA 2RF2B 3PR4A 3C3LA 4OV6A 3MM7B 1ZS6A 4FXVA 2V2ZA 3SSQA 2RQKA 3S7RA 4JYAJ 4A4JA 3SXLA 2N7YA 4USVA 1U26A 2K3IA 5G0RA 3VWSA 5DLGA 5KT5A 5JJBA 3F41A 1FJGF 1DTTB 4ILRA 1QUVA 3NAHA 4FPIA 4DL4A 3CCRS 3PEHA 1IN0A 3HSZA 3QPIA 4YMEA 4B9VA 2YWKA 1JLAA 5M2PA 1NAQA 4USKA 5HROA 3IWNC 2Y3YA 4QJVA 3MM9B 3M2VB 3PJWA 1I51B 4HACA 1V3ZA 3M4XA 1TAQA 3ILIA 5FDLB 3WIUA 2QTWA 2IC3B 3JSMA 1M5PC 1TV6A 2OPPA 3IG1A 3QMQA 2EVZA 3P8BB 1HNXJ 2BA9A 1JLQB 1MU2A 4YR2A 3MFIA 5L38A 5FD1A 2FB0A 4AT1B 4OZ2A 2YNFB 5ETTA 2D74B 1ICEB 4DX5A 4WIIA 3VZIA 2ASYA 2VG5A 3P6YC 2DYAA 3MF5A 2LMIA 2UUCF 1CJVB 2AEFA 2DGWA 1OO0B 3MM7A 3BS9A 1JK9B 2C2KB 4O3OA 5EHHA 2OPRB 2EW9A 1VRTB 4FF1A 1Q86T 4EGLA 4KO0A 4LF4J 3Q8PB 2D3UA 1MLAA 1DTTA 1PCAA 3HVRA 4RNHA 3ONQA 1FCAA 3MAHA 3AD7C 2FJDB 3H2VE 3RRKA 2WTFA 1GEHA 3QGIA 1VFJA 4U7CA 3MM9A 4H4MB 2HNZB 1FTCA 2HK2A 4ID5B 4WZMA 2OP5A 1NNDA 2CYYA 2N3OA 2XZWA 2XNRA 1WHVA 1H2VZ 3LALA 4IG0A 3S01A 3RW6A 4RKUC 3DRRB 1EETB 4RPFA 1W2IA 2HZCA 1HIYA 4LR8A 3PEJA 2CJKA 2FLNA 4ZVSB 3DRSA 2YX1A 3DLGA 3J80U 1SQFA 4QIVA 3ENQA 1U2FA 1H7WA 3G6ES 1UZDA 1WSVA 4E98A 3DLHA 3CCVS 2D41A 1ELOA 1YLXA 2XYHB 3V5RA 2D9OA 2AZ1A 2AJ2A 2D3ZA 1CJVA 3GCXP 2KKHA 1XMQF 4U7UD 1WSRA 2Z2YB 4MMOA 1N52B 2ZHOA 5B0BA 3QAEA 3L4BC 4OI0A 4UZBA 2VC0A 4CO0A 1HNZF 2CVEA 1JB0C 2W2QP 4R8UB 2XLIA 4B3OB 2AGPA 4BWMA 2Q3PA 4U9RA 4ZVTB 2BDPA 4ZITA 3NNCA 5J1EB 4QR2A 2BJ1A 4JI0F 2R7QA 3CC4S 3BREA 4PQUB 2HNZA 2MGZB 2KRBA 2NXUA 2BABA 1B64A 3KUEA 1FJCA 1BQMB 3JTOA 1AW0A 3KG0A 3OD2A 1SBRA 1IKYB 4N56A 3ISND 4FDFA 2GJFA 4OJHA 5IS2A 2RKIB 4JV1A 1X7VA 3LAKA 5KG1A 3DLBA 1REVA 5DDQC 3M6WA 3PFOA 4L74A 4P71A 5ETPA 3WBZA 2QFIA 1T9UA 4PRFA 2ZJRQ 1CVJA 1PYTA 4P72A 4RUAA 1MN7A 1U6ZA 5A0YB 3QJJA 3H2LA 5KFXA 2ZITA 4OZLA 3ULHA 3I0RA 2CPDA 1P27B 1RBOB 3RTVA 1PAEX 1B4SA 4OYZA 1Y11A 3NS7B 1SC6A 1HBNB 5HLFB 4L3KA 1JLGB 3SEOA 1RT5B 1UVJA 2DNPA 3E2EA 4IDKB 3H2UB 3HHLC 3U7JA 3TEGA 3M6XA 3A13A 4BC7A 3UNGC 4YHHJ 2XMKA 3HHNB 3CDAA 3OXGA 2D3O1 4AL7A 2CPJA 1Z1ZA 1BQMA 5AXLA 4WZQA 5LMUF 3BEGB 1FF2A 4MFBB 4OI4A 2HZAA 2E9ZA 4DFMA 1CSJA 1HI0P 2MZRA 1KRPA 2RKIA 1YBTA 4QWAA 3G6XA 4DWIA 2LDYA 3CE8A 2L9WA 3ETOA 4Q44A 5KT6A 3UI3A 2VKZG 1ZTTA 2ZBPA 2KT3A 2WZ1A 5DQIA 1CULA 2HGMA 4U67Q 3BF4A 4W92B 5U47A 2FHJD 3OR1B 2W7AA 4K4WA 5ETMA 2YQ3A 2CQ1A 1U8WA 1URRA 3RB6A 3QBCA 2VQFF 3NGTA 4OZ1A 4TLRA 1I94F 5HLFA 4EZ6A 1JLGA 3VTIA 4RBVA 2RSQA 2PI4A 1FVSA 2QMXA 2NUHA 3H8YA 3UCGA 2V0NA 2UXCJ 2MYFA 4J9SA 4MH8A 2ATCB 1J2VA 3KLFB 3T41A 3SQGA 5CH7B 2OMLA 2P9GA 2R8HA 2XB2D 2ZDPA 4FPRA 1UWAA 2G0CA 4KHMA 8AT1B 1SL1A 4ZVQB 3OT9A 4B3TJ 1R8CA 3MMCB 4Y2MA 2DNRA 4F4ZA 5EWGA 2LQ9A 1RT2A 5B0CA 3G4SS 5HANA 1KSPA 4ELVA 3D54A 4ECWA 1SUQB 4J9VA 3ADAC 4QZVB 4CH7A 3K58A 4WXWA 4PZVA 2QFJA 2LXIA 1QY7A 2R7TA 5FJ4A 4GKKJ 1RWNB 2KFYA 1YJNS 2XMVA 4ZMMA 1N8RT 2RRBA 2EXUA 1RUSA 2VA3A 2XMAA 1VR6A 4DX6A 2B4UA 1ZTWA 2AYMA 4M5MA 3K5NA 1JLCB 2BJ3A 3D3BJ 1FXDA 2UP1A 4XTTA 3F56A 4NLYA 4ZVPB 5KFJA 3GQCA 4OZ5A 4L73A 1GX6A 2JH3A 5DZ6A 3CJQA 2JHEA 4C97A 3PHTA 2HLTA 3CMES 4QU6A 5LJ5Y 2LXUA 5KFFA 1SV5B 1GNKA 2V6AA 3B82A 4Y2AA 2ZUGA 3OTEA 4M8LA 1YIJS 2LEAA 1WKJA 3NRBA 2FJXA 1HR0F 4TY8B 3KJFB 2LU2A 3M8QA 1OQ6A 2BR0A 2DNOA 2UU9F 4F8RA 1H38A 2FZCB 4LF8F 1T3NA 3M7VA 2WSFC 4ZLJA 3DOKB 3W5YA 4PPZA 2KFNA 4V19X 1NDLA 4U6PA 1R6VA 1FNOA 3PYEA 2DIVA 2D69A 2BM0A 2IIHA 3VGSA 2KH9A 4DV1J 1WG5A 1UW4A 1FD8A 4OI3A 3TUIC 2CDQA 3EVWA 1IJFB 4JI8F 1FXLA 3H25A 5ETQA 5I4MA 3RZAA 5AT1B 1IR2A 4Y6IA 7FD1A 4PR6A 1OS5A 4OLOA 5KFTA 8RUCA 3GV5B 2AT1B 1FE0A 2V4JB 1NCLA 5LL6d 1S79A 1L5UA 2KYXA 4C11B 1RXOB 3RU0A 5HBMA 1SV5A 1PKUA 1OWXA 2WSCC 1PIEA 2CAJA 3UCUP 2V8DA 3UFCX 2UUCJ 1Q1KA 2FJAB 3TQEA 3G86A 4DV2F 2ZC4A 4CO3A 3HHDA 3QZ7A 3R1HA 4LVNP 1CS4B 4ECVA 1JXEA 4F4KA 2MY8A 2VH7A 2DH7A 3ZZYA 3DMJB 3GJRB 4ZPCA 4NL5A 1C0UB 2MZTA 4O4GB 1EKRA 1UEKA 1NKBA 3TANA 4DU7A 2B5JB 3TR5A 3GYXB 4RZRA 3QNWB 2IAJB 5F8HA 5KT3A 2YBVA
chains in the Genus database with same CATH topology
5KFLA 2X1FA 4F25A 1C4AA 3I56S 3W2VA 1UEUA 5GADI 4YY3F 4NPOA 4ECTA 1LQ9A 3LP1A 2VPZB 4ECXA 1FDAA 2HS0A 1R3NA 2AD9A 1S76D 2XS5A 4R25A 4EFAC 4OV1A 2Y1IA 2OLWA 2U2FA 1ZPVA 5CYMB 4DLEA 2KVIA 2QT7A 3GE9A 1D9FA 3FDSA 4NRUA 4RW6A 4TU7A 5E3PA 4O3SA 3MUMP 2V8HA 2WCXA 3LUYA 4OQJA 4CT8A 2V4JA 3FCHA 1JXLA 3GFYA 1FXRA 2V2KA 3MM5A 4UY8T 3MM8A 4C11A 2XO7A 4DSIA 1S0VA 4DN0A 2YKPA 1VOMA 2UVUA 2VUGA 2PIIA 1IR0A 1K1QA 4EO6A 3BSNA 4OLPA 4FVMA 5HI7A 4RNOA 3CCMS 4G1QA 4WCEQ 3CD7A 1VIOA 1D8ZA 5LXRA 2F3JA 3QIPB 1U49A 4IO1A 1HBOA 2CPXA 1WACA 2YWHA 2KG1A 4CCHA 5CCMA 1R8HA 2GA7A 3CB4A 1T3OA 2X1GA 5J2MA 1TAUA 2HWHA 5I3UA 2CQ0A 1VI7A 1OSDA 4I2QB 4C0OC 4FXWA 2NSCA 2GHWA 2NREA 2FVQA 4NLUA 3SI8A 5EUHA 1R89A 2B6AA 5T14A 3LWLA 1RT3B 2CJ9A 1N88A 2J0XA 2QO3A 2C22A 4DQSA 2QYCA 5J2PA 2K7JA 4ED5A 4CI0B 4C0HA 1NJWA 3RB0A 3OFGA 2Z2LA 4QPXA 2ZD1A 1J5EF 3IR7B 3T1YF 2JEGA 3CXCR 2MKKA 2VOPA 1RAJA 3E01A 2YWGA 1YQHA 1K0TA 3VF0B 4K0KF 4C8KA 2J9EA 4B9UA 3LH2S 4DR3F 2M4MA 3M8RA 3GZ7A 5IZHA 1RGVA 4MIBA 1SIWB 2CZ4A 3MPVA 2DRAA 3TA2A 4DSFA 3SDEA 3OR2B 3ITHA 4K2XA 4C0BA 4WTYA 4RW9A 1WI8A 4DV7F 4OHYA 2I9SA 1IKVA 4DEZA 4AQYF 3JTPA 4I4BA 4TQRA 2LQ5A 3IGVA 3FEXB 2GIRA 4FZVA 4HH0A 2IM3A 1HPZA 3U27A 4UY85 4HI2A 3MUTP 2LECA 2COLA 3OSNA 2ZFHA 4GO7X 3DLKA 5DDRC 3OJUA 1BQNB 1JNRB 3M1VA 3IR5B 3RB3A 1T03B 2AJ1A 3CCTA 1UWBA 1LW0A 3DHXA 4X65F 4RBTA 2HFNA 3DYAB 2VPWB 2B4PA 2J9CA 2VPXB 1C4CA 3CGIA 2W9CB 1Y5LB 1YWXA 2YKOA 4MK8A 3I6PA 3VAKA 2ZH2A 3VZHA 3HVWA 1TKTA 1LWCA 2ZNZA 1U1KA 2I5JB 1VQLS 4DDFA 1HQEA 2HS4A 2DNGA 2MQMA 3V6HA 2OH2A 2DT9A 2DVIA 2M7SA 1WF0A 4DPOA 5KFCA 4F4YA 5GAHI 2DCUB 4RWWA 3D1QA 3G96A 4BDPA 2E66A 2XY6A 2CQPA 2CQ2A 2ZOGA 1WEYA 5CYMA 1RTDB 3SQGB 2VV5A 4DS4A 2C2RA 1U09A 3EGNA 1CC7A 4QWDA 3MR2A 2ROPA 3FSIA 4PG4A 3G6YA 4ED8A 5DG7A 3CCLS 1F5BA 2UV8A 2VFTA 2RQ4A 4GKJF 4Y2IA 3IRXA 2I0XA 1YJTA 4A8OA 1QSLA 2C28A 4MK7A 3HVTA 5KG2A 1TL1B 4UQTA 3M30A 3DRPB 3CJ5A 3MUVP 1UA1A 2YKMA 2IBOA 1KC8T 1N36F 2PFFB 4KE5A 5E3RA 4YOEA 2DR8A 5L8RC 3DHWC 2FVRA 1PC4A 2QMWA 3N28A 3QIPA 4M95A 1X4FA 4M63A 1KQFB 2BE2B 2MHNA 3F44A 2LU1A 1VQ6S 1OSCA 1S6PA 3KKFA 3K7RA 2OD6A 5AE2A 2F40A 1RT2B 4I2QA 4A8SA 3LANA 2BQ3A 1WEZA 5K8MA 4BC9A 3MMJA 3PKYA 2OJ3A 5KFOA 2VA2A 1XN9A 2DB1A 1RT3A 4QW9A 3V2UC 2K3KA 3HK2A 3QAUA 1W2BR 2ZKUA 1LV5A 3RRHA 1WWHA 4RW7A 2EG2A 4D3GA 2ZH9A 1BLUA 1X4AA 3CIMA 3CJKB 4RUCA 4OI6A 1BC6A 5CXTA 3U1LA 4DV6F 1G1XA 3BO2A 2HRYA 2NUUG 1HD0A 3NBPB 1YITS 2N82B 3HP6A 5DGBA 1KLMB 3OVBA 2ZNYA 2FC8A 2M0GB 4H54A 4WFBQ 4UQGA 3OTOF 4PKDB 4URGA 2UUWA 4XAKA 1C1CB 1LWFB 1H2UX 3AA9A 3MEDB 5A6PA 1FO1A 5KOXA 1HFEL 2CPHA 3G71S 1HYSB 4F4XA 3CEDA 4DJBA 3H5UA 3OR2A 1OPZA 3Q2TC 2KYZA 4J5OA 3OHAA 3KK3A 3WC2A 3OBIA 1KOHA 2O1PA 4K5RA 2R2SA 5SZTA 2ZH1A 2R8IA 2ZH3A 4ECSA 3H59A 5KFUA 2ZH4A 4GMKA 4X4UA 4DF8A 3S6EA 4NLSA 3KG1A 3HO1A 4IG3B 5E41A 2PMHA 4URQU 2NS1B 2HS3A 4L3NA 3X3UA 3DYAA 1OIAA 3FEZA 3DOLA 3M9MB 5KFPA 3TI0A 2VQEF 5THWA 1NK6A 2Z4PA 3OV7A 1ZBTA 2KM8C 1S97A 1HMVA 4O4RA 2BUNA 3DU5A 4DL2A 2OPQB 3I5CA 4ALZA 1RTIB 1YRTA 2I5JA 5H1SV 2ZHAA 4C9DA 4KC5A 2JC1A 2DCLA 4OHXA 4DV0F 4KQZA 1Q7LB 3HKWA 1S0OA 4CO1A 4QU7A 1KD1T 1U6FA 4GKKF 4M5DB 5DDOC 4LF9F 4C8YA 3UCZP 1V3SA 5IFMA 4F3MA 4NLRA 5EDWA 1SKWA 1X5TA 2E9RX 1YSJA 4ZVHA 2B7CB 2FC9A 2YNGB 1RTJB 2ZJPQ 2RDJA 2CIMA 3LQVA 4HT5A 3K57A 4JYAF 4I67A 4NA3A 4P2SA 4X2BA 3HZGA 2C2EA 1NH8A 4V19J 3CT9A 2K7KA 4MIAA 3P96A 2XS2A 4BS2A 1A7GE 3PJXA 2APOA 3LP0B 2YX7A 2KHCA 1KHWA 2HNYA 1M5HA 1KNZA 5D8HB 2GCFA 2RS2A 2MQLA 4HTJA 3DRPA 5DETA 1VQYA 3T5HA 5KFVA 4N47A 3PXGa 2M70A 2RD5C 1EP4A 1WF1A 3IO1A 5CYQA 2CQHA 2DNKA 5GMKa 3ICLA 3BQ0A 3MWBA 1R8BA 3EGZA 1VJWA 3R1LA 3LOUA 3KLIB 1YGYA 2WB1D 3CDBA 2BE2A 2HFZA 2HHWA 2HWIA 2Y1RI 3M2RB 1D9AA 4KT0C 1FNMA 2DGTA 1JMTA 3BQ1A 4WE1A 4GC7A 5IM0A 4CH0S 3NNAA 4F02A 4TU8A 2J8AA 2ILZA 4C3MA 3M8QB 3H5XA 4IH7A 5KFAA 2C3MA 4ZP9A 2EFOA 2R9LA 2PMZD 3KMQA 5B0DA 1S48A 3OLBA 5IT9Y 2E5GA 3Q8RB 2A1BA 1GT8A 1HD1A 1U8SA 2RVJA 3B4MA 2J0WA 5C24B 1RT4B 1Y3KA 1RT6B 1R7IA 3NBPA 3T5LA 1ZETA 3K5OA 1RTHB 3JTNA 5DQHA 2L3MA 5BR8F 1S10A 4NXMF 1S4FA 5K5MA 4ZPBA 1NHVA 1VLYA 5D4LA 2IHR1 4DL7A 1LWFA 2W8KA 3CCWA 4WYWA 2DNHA 3FJ2A 1FK9A 3VQSA 3QYYA 2XLKA 4WU3A 3GB0A 3Q2SC 3V4MA 2R7VA 1BY9A 4X4PA 3L3CA 2EK1A 2UXBF 4C8MA 2R2UA 2AQ4A 3IXQA 5KFRA 1F0XA 2XMUA 3QLHA 2XMTA 4QR0A 1NH7A 2BV3A 2X51A 2ZC3A 3DCAA 2PO4A 4X62F 1HNXF 2OPSB 2DR5A 2LCWA 3PFEA 4BCAA 1ZAXA 4ICLB 2JJ4D 1MMLA 1SQEA 1XTZA 3HPOA 3D28A 1RK8A 3FRZA 3G8QA 4YQWA 1HBMB 2HHPA 1AUDA 4FNHA 3A1YG 4YB1P 3KLHB 1QSYA 2MKCA 4YR3A 4KJIA 3BQ2A 4Y2CA 4ED0A 2HVHA 3FSYA 2OPQA 1B0PA 4DSLA 2ZM6F 1U48A 1U24A 4B3MF 2EG1A 1L3UA 2ZH5A 1ZM4A 5A8RB 3EPGA 2XNQA 1T05A 1IKXB 3NGDA 2VPYB 5IT0A 1Q81T 1RKIA 4HEA9 5KFQA 4LUBA 2CPEA 4M5DA 3SZ2A 1XERA 3OSPA 4NYOA 2O66A 2ZBCA 4NA1A 2CQDA 3L95X 4WFNQ 4AXIA 2QLWA 3IGNA 4IRKA 2WBMA 2B4OA 2J9DE 1U1RA 3S8SA 1XNQF 4I7FB 3OW2R 4KAIA 2R7RA 5HP1B 1N48A 2YKNA 1IKWB 5I42B 3DFEA 4HDHA 2DGVA 4ES3A 1JLBB 1BWEA 4DV1F 5HBMB 1VS3A 4WKRA 3LP0A 2GGPA 4KV8B 5KG4A 2FTRA 2ASLA 1UA0A 1PSDA 2FVPA 4LF4F 1IM4A 1D8YA 1Y7PA 1T02A 4FVCA 2DITA 3V4IB 1S1TB 5KG7A 3NMRA 2BJEA 1WHYA 3SCKE 5B7WA 2HMIB 3DLLQ 4PWDB 1SJ1A 1P9QC 3CJ2A 3KLIA 5KFSA 2BRLA 4L72B 2KZMA 2MB0B 3I4HX 1SJ3P 4ZHRB 3BGRB 3I55S 5KFKA 2V5HG 3R5BA 5J1PA 5BYSA 2XS7A 1Q53A 4ED6A 4AL5A 3J81Y 4ZCLA 4I6YA 3MR5A 1N54B 2E44A 4OX6A 5T7LA 2FGOA 1XMOF 1NEEA 1S1VA 1RT4A 5DO2A 5KFDA 1RT6A 4PXDA 3BZQA 2HNDA 4KRWA 3O5TB 1JLEB 1RTHA 5CZXA 3D0GE 3CDWA 4QPTA 4I1TA 1TVRA 5HMXA 2VBWA 3B78A 2O5DA 1G6BA 4IH5A 2I2YA 4NLTA 2BQUA 4DQPA 1VMBA 2A18A 3DRYA 3PO5A 4G1IA 3DU6A 1Y3JA 2ZBIA 2EC0A 3H4DA 1DLOA 2ZDOA 4ECQA 1FVQA 3GFHA 4RU9A 3OL9A 3D1OA 1TUVA 4R0JA 5J2QB 3TARA 2NYIA 2IMWP 1ZM9A 1AFJA 1NRKA 3QGHA 4KHRA 3AQOA 3QGPA 2RF2A 5E3QA 5KFIA 1RT7A 1IJEB 3CD5A 2W9BB 3KMSA 4WK1A 2OPSA 2Y0SD 3MTJA 4HT7A 5MAOA 4ZK7M 3KJVA 1WNEA 4ICLA 1LW2B 2W4CA 4URSA 4NLVA 3TP2A 2FGCA 4QIFA 2E5LF 1KTVA 3RAMA 3Q23A 4C8NA 1HWLA 2MMYA 2OSQA 5KT2A 2ZKTA 2R2TA 2FHJA 2B7BB 3W2VB 1U1OA 1X5OA 5KOWA 3B8HA 3LP1B 1FD2A 1QJHA 4WFYA 4G3IA 2C3PA 1IKXA 2V4RA 3DDNA 4ZPAA 5AE1A 2E7WA 3AA8A 4RW6B 1G3OA 3TAQA 2F8MA 4NZ0A 2QE5A 3RB4A 3GIMA 2XSFA 2CG4A 4KFBB 2GV1A 2UUAF 1E6YA 1WHXA 3OFFA 4I7FA 3C8YA 3TX8A 4YR0A 2XGQA 1IBMF 4LQ3A 1XNRF 2ZE2A 3MM5B 1IKWA 5I42A 1E6VA 3GG0A 3GV7B 3SV4A 1DARA 4KV8A 4MKAA 1UAWA 1HWKA 2MSTA 2QA4S 3V6DB 3QGGA 3US5A 1NHUA 3I5AA 3M2VA 4FBUA 2LEBA 2AYGA 4G1QB 4J9NA 1DAXA 2DNZA 2YKQA 4QWEA 4J9PA 2VOOA 1SKSA 1HBOB 2VG7B 2FDNA 3GIJA 3CPWR 4PWDA 4IFYA 5CHCB 1DZ5A 2P9CA 4QR1A 2X1BA 4OJ3A 4DV5F 4EEYA 5J2MB 4X4VA 3D2WA 5FDLA 5I3UB 5KTQA 3KTQA 3IS9B 3HHEA 2IC3A 1YJVA 2B6AB 4ED2A 3FRYA 3BGUA 1IUJA 5LSOA 5KG3A 4USHA 1S6QA 1N5QA 2AWZA 3OTBA 5J2PB 5KFMA 1VK3A 3QO9B 3WDOA 3CULA 3FFIB 3HVAA 4CH1A 2ZD1B 2ILYA 3EZUA 4LVOP 1QE1A 4MK9A 5K9FA 2GX8A 3N01A 4R5PA 4X4TA 3T3FA 2V4QA 2IA6A 3E01B 5CA5A 5C42A 4X4QA 3RR8A 3PNIA 2POKA 3MMAB 4HTIA 4DL6A 2J76E 3OVAA 1C2PA 1JLQA 2E5HA 5HO4A 1DJ0A 4J9OA 1X4BA 2GO9A 2FJBB 3FGVA 5KFBA 1XMBA 1UKUA 1CG2A 4DG1B 2YNFA 2MJUA 5F8LA 4PWUA 4L6V3 1HWUA 2F1FA 3IR6B 3SDEB 2RDIA 5DDPC 2CFXA 2JL9A 1H2TZ 4Q2LA 4RW9B 3POTB 2LVWA 3OLAA 4CO4A 1IKVB 1M0SA 2F8EX 4WFZA 1TK0A 1QVGR 3CIZA 4G1PA 2BJDA 3ZZPA 2RE1A 3K5MA 5AXNA 1HPZB 1DQAA 1VQSA 4DLGA 4DSJA 4KGMA 3QZ8A 5J2QA 2HG4A 5D4PA 3T6JA 3DLKB 2JX2A 4C3KA 1YI2S 2N4DA 3TQ1A 4KBIA 3CTRA 3LF0A 2E5IA 1NK8A 1LW0B 3RYLA 2EBGA 5JUMA 1S1XB 2R4FA 1LW2A 1F2GA 4Y34A 2OPRA 3VR1A 1JNZB 1FA0A 1O51A 4JUZA 4DOZA 1VRTA 3PV8A 1YJWS 3OTDA 2C3UA 4RLEA 1TKTB 1LWCB 1ZPWX 3DRXA 3UR3C 1RYRA 1HQEB 1APSA 3FZBA 4IQXA 4KB7A 4HL9A 2K1RA 2ZH8A 5KT4A 1GH8A 2GQQA 3D0HE 3GYNA 3CCSS 3TW0A 2FLPA 4QBUA 2OD4A 4I69A 4J37A 3M9OB 1TFWA 1VRUA 1K1SA 2PGCA 3EXYA 4PQAA 3OL6A 2JEFA 4C8LA 1UEVA 2QV6A 3MCSA 2DHSA 3NCRA 4WJBA 3TRGA 3E8OA 1VQKS 1F5CA 3GG1A 3QJLA 3PRBA 1FERA 2A2CA 4EBDA 2LQBA 4KFBA 3PX0A 4N41A 2JFKA 1HI8A 3CWJA 2R8JA 4MKYA 3ZZ0A 1BQXA 2EFQA 2KT2A 3IRXB 1QUPA 1N56A 3HVTB 2W8LA 2ZHBA 4OX9F 2ACYA 3M30B 2YKMB 3KG4A 4RW4B 3V6DA 4DR5F 1RA7A 2KT5A 1ZZNA 2E1CA 2UVRA 1S99A 4H4MA 3GILA 1S9EA 4ID5A 1FKOB 5C5JA 5E0OA 3FQKA 2XGPA 3CC2S 4DFKA 2DD8S 2OTJS 2OMOA 3WC0A 2OFHX 1IBLF 2VG7A 1VQ4S 2EI5A 1U4BA 1G7CB 1S6PB 5BJRA 5AXMA 3HT3A 1KR4A 1NJXA 3ZZTA 3IS9A 1SH0A 2QA2A 4ZPTR 2MQNA 3KYLA 3PW4A 3DXBA 1MMNA 4FXDA 2W25A 2J7KA 3DRRA 3KHGA 1EETA 3C6TB 3QO9A 4RW7B 4ES1A 3FFIA 3V6KA 4USIA 5I3PA 1UJ4A 2A3JA 4BWJA 4ZS6A 3ENWA 2MXYA 1W25A 5E3CA 2XY5A 4LF7F 3O3LA 4YHHF 2MY7A 4KIAA 2P5VA