2F8MA

Ribose 5-phosphate isomerase from plasmodium falciparum
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
237
structure length
237
Chain Sequence
b'HHHHMDSLKKIVAYKAVDEYVQSNMTIGLGTGSTVFYVLERIDNLLKSGKLKDVVCIPTSIDTELKARKLGIPLTTLEKHSNIDITIDGTDEIDLNLNLIKGRGGALVREKLVASSSSLLIIIGDESKLCTNGLGMTGAVPIEILTFGYEKIIENLLKIYTLKGCTYKIRKRNGEIFITDNKNYIVDFFFTEPIQDLLETCTRIKMTTGVVDHGIFVNMTNVALISKHDGTVLTLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribose 5-phosphate isomerase
publication title Structure of ribose 5-phosphate isomerase from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 77
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f8mA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f8mA01
2DT9A 2BKXA 3TUZC 2W48A 3OFFA 3L7OA 1ZPVA 3P96A 3HN6A 3OBIA 4L50A 1HORA 3KV1A 1M0SA 5IS2A 3IXQA 4NMLA 1CD5A 1XTZA 4L4ZA 4OQQA 4R7TA 1UJ5A 5T41A 2RQMA 3N0VA 3LHIA 1RWUA 2R5FA 3OFEA 4PWUA 3BXFA 3ENWA 2LVWA 1PSDA 2P9GA 2J0WA 3BXGA 3HHEA 3KWMA 1LKZA 1YGYA 4OQPA 3TUIC 3CH7A 3U7JA 3CSSA 3TX2A 1UJ4A 2F1FA 2F8MA 2PA3A 4L4YA 3AAWB 4IO1A 5JJBA 3AB4B 2LQJA 3OC6A 2QRRA 3AB2B 3LOUA 4X84A 2OKGA 1HOTA 1FSFA 3ICOA 5IT0A 5HJ5A 1U8SA 3MWBA 3E7FA 3MAHA 2MDAA 2JHEA 4LUBA 2CDQA 3LWDA 4GO1A 3CEDA 1LK7A 4M8LA 1FQOA 1NE7A 3DHWC 3LUYA 4TM7A 2P9CA 2NYIA 2RQKA 4L51A 3EFBA 1DEAA 1Y89A 2QSWA 2GNPA 5IT4A 2WU1A 3ENQA 2RI0A 3E15A 4R9NA 4TM8A 1LK5A 4L5JA 2H9ZA 1Y7PA 4GO7X 3TUJC 2QMWA 3MTJA 1FRZA 4L5IA 2J0XA 2FGCA 4GMKA 3NZEA 1FS5A 3K5PA 1FS6A 2J0EA 1O8BA 2DTJA 3IBWA 1SC6A 1UJ6A 3DC2A 5FIIA 3BXHA 2ZHOA 1VL1A 3BXEA 2JOQA 2P9EA 2BKVA 1YBAA 2O0MA 3ENVA 3S1TA 3O1LA 2PC6A 3W7BA 2KO1A 3NWPA 2RI1A 3DDNA 3EB9A 2RE1A 3UW1A 4GO5X 1KS2A 2I9SA 2QMXA 3OFHA 3OFGA 1PBTA 3NRBA 1JT9A 3DHXA
chains in the Genus database with same CATH superfamily
3BMQA 4CH0S 4MUEA 1SC1A 3PEUA 1LWCB 4LQDA 3GJSB 2XRMA 5A0VA 3SXPA 4OY3A 1A82A 1B0UA 2VO1A 3DT9A 4UZFA 3T1HB 2BMEA 3DKKA 3H9UA 3GXOA 1RISA 5EE9A 3EZYA 4MKAA 3FB4A 3LGXA 3KB1A 2IT1A 3HY4A 2UXCB 2KPOA 3R5KA 4PYLA 1QFYA 4R71A 2BRLA 2P6OA 4I55F 1UF9A 3T5AA 1G6Q1 1HOTA 1U7OA 1RACA 3U3OA 3OM1A 2VHCA 4ZZ2A 1DDGA 3M9NB 3RT9A 4HNHA 3ESRA 5H9EK 2PZKA 1JKJB 3OT1A 4ITRC 5F1PA 4C01A 5AVTA 3FHOA 4Q4JA 1XKQA 4JLNA 5C3UA 2VCHA 4Q37A 1U7WA 3SICE 3H8WA 1ZJ6A 2AFHE 3WJ2A 3FUXA 2D41A 1DLJA 3O3LA 3LFHA 1SJ3P 3L3BA 2OD2A 3UR0A 4LWPA 3EEOA 3K0AB 1ZSYA 1NR5A 3MTGA 4E13A 1WEKA 5FOUA 1SVWA 1EHCA 1G20B 5EKSA 4HZUA 2H5IB 2H0QA 3G2KA 1Z2NX 1FWKA 1N34B 4GYKA 2LQ9A 1A5BB 2C2RA 3GLKA 3LX4A 2G80A 1ZH0A 1VKHA 4ITUA 3OKAA 3QPBA 3FGNA 2JAXA 1GTVA 1WEHA 3B53X 1RSZA 1OC4A 1Y3BE 4X4VA 4O3MA 4NJEA 2LQBA 4KO0A 5IH7A 1EHWA 3PXDA 2EF1A 4HDNB 2Y8WA 1XTJA 2I7VA 2J3QA 4OJMX 2V5VA 2UAGA 1DV2A 2CVQA 2PNFA 1X9IA 2EJUA 1YJVA 4UCQA 2ZT6A 1W2BR 4AJIA 1WXXA 5I7EA 4AXBA 1TT5B 4MMZB 3LP8A 1G55A 5GJCA 4U63A 3BD8A 3T19A 2DWOA 3GN1A 4HDRB 5AVWA 4OZLA 1NX6A 5GMKa 2CADA 4BDSA 3PTWA 3M6UA 1CIJA 2I7XA 1JFSA 5CB6A 5I9IA 4HVAA 1JDZA 3VR6H 3BZWA 3O90A 4COOA 4CG2A 2DX7A 5JVDF 5C51B 3WA7A 2VASA 3CLKA 1UKCA 2ZOFA 4TMZA 4H4CA 4GZ5A 3R0JA 4Q2MA 4QU7A 1VKNA 4O4IA 2CUNA 1UBMS 3SR4A 2ZJBA 5IEJA 2H4WB 3RB4A 1OV4A 3RYFA 5ADZA 3M32A 2HUNA 5AVQA 2GXUA 4LSNB 4TGLA 2ZK7A 1NUHA 4EZBA 5DTJA 3E9QA 2FSPA 1Y4UA 4QOFA 1G3IA 4I3HA 3HVWA 1JDPA 2ACVA 4JEIA 2ECFA 4ZQBA 2GK7A 4G9BA 3ZKWB 1ZN9A 1GIAA 3OE5A 2V9WA 3OKFA 1GTSA 1PGOA 4I46A 2H1RA 5I9TA 3PS9A 1IHDA 4XIJA 4N3AA 1XXHB 4U2GA 4KQCA 1KEEA 3T4EA 1GAEO 3FBEA 3G0IA 1JZTA 4IEEA 4F97A 3ZVMA 1K1QA 3MEGA 3I9V6 2C42A 2PT7A 4U2EA 4DV4F 3OFSA 3IODA 3PVZA 1LDGA 1FKPA 1X5OA 3Q2OA 5J5CA 2P9JA 2Z2KA 1YD7A 3IAM1 3SQLA 4BFVA 2N1MA 2PKRA 3UUGA 4DIOA 3NHUA 4YRBA 2GXQA 3TLCA 4MKZA 3KSRA 5HF6A 5F8IA 3ETLA 1NVFA 1OV6A 1OHHD 3M6LA 3JS5A 1WB9A 1RXYA 3PGVA 5A8KB 5KBYA 1RI4A 4RPKA 2FG6C 5D3MB 5G4KA 4FTWA 3HO6A 4X64F 1A98A 4ZAXA 5D5PA 3W2VA 2VP2A 3TRKA 2XUHA 1MQSA 1NN3A 3SC3A 4YDQA 1JLEB 2A3JA 2D59A 3QNWA 2ATIA 4P31A 5CCMA 1I51B 1FFSB 2O1WA 5GAGI 3AYXB 3PBKA 4FGKA 1XZ8A 3NBAA 1M7GA 2KFYA 2KZZA 3A1FA 4DV7B 3GTYX 4OLHA 2B4KA 3ID6C 1HEUA 4S24A 2OZPA 4L16A 4X71A 5G3ZA 3FOFC 1RQPA 3HJNA 3EIWA 1H0HA 4DBQA 3AFGA 3WMEA 1SQ0A 1S2MA 3V97A 3ICQB 2FZGB 5HL7Q 3E05A 2AQKA 2VDMB 3B1JA 3BH6B 4Y65A 3EZ9A 1TM1E 3KQKA 3FUUA 5FADA 1NFQA 3ETDA 5DQGA 4QUBA 2HCTA 4G09A 3B13B 3X2SA 2H2GA 2V5UA 3H18A 1D6MA 4NU0A 1RCTE 4QWMA 5BR8B 1V1MB 1EK2A 1FW6A 4TKMA 1ZJYA 2NO9A 5JMPA 1U8AA 4DUTA 1CLUA 1OY9A 3G9CA 1GNKA 3TJZA 1A27A 1L4NA 3NBYC 4AFNA 3STUA 5EKUA 2X4DA 1QP0A 4BO0A 1T13A 4BB0A 3UKDA 1UC9A 3NHJA 1LEOA 4YRDA 3PP8A 5LA6F 3EXAA 3QNMA 2IHTA 3AB7A 3G5TA 5J1PA 5HDQA 2P7HA 1CUWA 2WSSD 2CG4A 4YC7A 3QJPA 5EZ5A 2QU8A 3MBOA 5EZYF 3HXTA 1DG1G 2PZAA 4QBTA 1EETA 3UAZA 1JBQA 1GN8A 4INOA 2VDUE 4JUBA 3FB1A 5E33A 4BLTA 3R3ZA 1IVSA 3NHFA 1QLHA 4IDPA 3F5QA 5EJEA 1F4VA 5LXTA 5AWFC 3QGIA 2HQDA 1A77A 1XQWA 5H1SV 4IIBA 3A6GA 4DZDA 1JZSA 1UAWA 3HGQA 3R0ZA 1QX3A 1YK9A 3ILSA 2ZBCA 2BGMA 1MROA 1YOVA 3SYNA 4BJ3A 2QJFA 3QPCA 4ZEMA 3FLEA 3QHQA 5DE3A 5B64A 1NJGA 1F5SA 1CB7A 4E7OA 1D2NA 5T57A 1LV5A 3S68A 3H2IA 5A6WA 4CQNA 3RW9A 4MQLA 1CUIA 3WP1B 3S70A 2PO5A 1HE8B 5EQDA 4WBNF 1M6HA 1U1CA 3HV2A 4TTAA 3ANMA 4DSUA 2RGDA 3T7TA 5HUJA 3T9EA 4YJHB 3T5HA 3R0XA 2HAIA 4L08A 4CQMB 1SIOA 4JJKA 2VIHA 2I9PA 2JAOA 3G6KA 5FXMA 4ZYZA 5I7VA 2CMHA 4HDSA 2O5RA 5CXQA 1KHVA 3QQCD 2R7VA 3MJSA 1OLOA 2VJYA 4FONA 3V7YA 1HNZF 1L7DA 4I9FA 1KO8A 2PD6A 4JP1A 3FZBA 3BR8A 2B1RA 5K8NA 5ADVA 4RDHA 1UOOA 4U8YA 4WFKA 1VQMS 1IK6A 5TS3A 2OZLB 1ICIA 3RYCB 2VRCA 1FJCA 2Q46A 4N82A 4NG4A 4BB6A 3BK2A 2B6AA 3PACA 4I67A 3O44A 5CDUA 3RSSA 4I6JA 3OM0A 5DM70 3BORA 4DFKA 1KAGA 2BF7A 5FTKA 3VJKA 2C5LA 2EDAA 2O7QA 3GVPA 1CUCA 3IESA 3DGFC 1ACLA 3MJFA 4P74A 3QPWA 3VBCA 1TTHA 4XRRA 2A10A 2VQSA 3SSAA 1VG9B 3L79A 3GLRA 2EFOA 4DKXA 3ZY6A 2ESRA 5U4XA 3VNRA 1E3WA 3EXIA 1ZEJA 2CPDA 2OKQA 2VH5R 4WUTA 2ZREA 1TL3A 2XQGA 1W0JD 3UCUP 4YCMA 1JMVA 1A76A 1FVQA 1ZJZA 1AN0A 1SKRA 3H5YA 5A0YA 1WF2A 5AICA 4DPKA 2O7VA 2W2OA 5KNDH 3BD9A 2GVZA 1O0BA 3DOCA 1Y1QA 1KDVA 4A3SA 3VC1A 3FYUA 3VTFA 1Z3CA 2HMSA 1WA5A 3O4HA 3INTA 3ROPA 1F20A 2Q3HA 3TGWA 1Y8RB 1NVDA 1F3FA 3G6WA 3IA2A 2XWBF 3W8EA 4JK3A 4W9RA 1XQYA 3JTPA 1V5IB 3M70A 1NDQA 2X7IA 2E5LF 3UWDA 2ZIEA 1UP6A 1T1SA 3A3KA 5IS2A 5COAA 2N3OA 3Q9UA 4AZTA 1RQXA 1RU1A 1OT3A 3ZWXA 1SH7A 2GLXA 1GYRA 1L5SA 2GO7A 5KTSA 1KKMA 2HYIB 3M4JA 1XYYA 2J0VA 3G7SA 2FJUA 2W2QP 2CZQA 4JBCA 1GD1O 4Y9RA 3L1IA 2Y0PA 4E5NA 3HXPA 4ZAYA 1U9CA 3VI3B 4IHJB 5DYNA 1P7YA 4QUGA 4QIWD 4MTCA 5B7PA 1DG9A 4TVAB 1BQNB 1ECPA 5FPQA 1YJQA 4LF5F 3WLSA 3IIKA 2BDUA 4QDJA 2CQ0A 3ZCQA 4XFDA 2AMVA 1M5OC 1P8JA 1ZG3A 1PSZA 1UK6A 3BV8A 3T5JA 2APJA 2W0SA 4PLWA 4V0QA 3LKVA 3C2PA 3Q8QB 4R6WA 2J31A 1K0FA 2CLKB 3IX7A 1EXMA 4KK3A 2ZH1A 2OWDA 3U4DA 3AF3A 4K6FA 3QWAA 1UT8A 1TEXA 5F12A 3J7YI 1ND6A 4KTVE 2R00C 4LZPA 1HXHA 1YMQA 3BTVA 4ZARA 4C0AC 3VO2A 1O95A 4XB6B 2HJHA 2CZ4A 2OXRA 2Z95A 2YMLA 5EA2A 4O02B 1HT2E 1UJ4A 2AS0A 3N2IA 4Z2YA 1KQ3A 3G89A 3H11A 4AKGA 2B3TB 2GSWA 4WNCA 4QWAA 5IM0A 2N7YA 4FVCA 4DPWA 2WWYA 3IHLA 3K0JA 2JLBA 4Q0BA 1IM6A 4EUVA 3MM5B 1CP3A 2IA6A 2ZR0A 5KWSA 3VO1A 4QVKA 1M1YE 2QLWA 5DTIA 2D2XA 2B83A 4KY3A 3PHIA 3C16C 3HC7A 2QSFA 4B6EA 1BE6A 3GGCA 5HMLA 3TWOA 5FLEX 3AOBA 1DIHA 2Y2UA 1QO0A 3SQOP 3WK6A 2QTVB 3SQDA 5A62A 2R1VB 4KEAA 2O05A 1RE1B 2LVBA 2ZHOA 2JX2A 2ZJ2A 4XAQA 2VP6A 4YRZA 5I8PA 2QRLA 2JLVA 3QXJA 3D1OA 4LQ4A 3TZYA 2Z8QA 2JC0A 4P2FA 3J7ZT 1S7GA 1FDSA 4PO8A 1K1SA 5F3ZA 1QYCA 4XD7D 2CJQA 1QHHB 3G71S 3DT6A 3LOQA 1F9HA 3CJTA 1LF0A 4QUJA 2IM0A 1XAIA 5K45A 2OPQB 4CIYA 2E3JA 1GAJA 2NREA 1NCLA 3NASA 1TUGA 1AMOA 1XJQA 2FPGB 3OX4A 1DBIA 1KOJA 4TYNA 5IKPA 3PYLA 2ORED 4E5DA 2DNKA 2ILTA 2GN1A 3VV3A 4IRDA 3ZWBA 2Y3YA 2OC9A 4O4GA 1FQOA 1BVHA 4BX2A 3OZEA 4DC1A 2QTWA 1CYDA 1S1UA 5LKAA 2J9XB 2Y1GA 5DTQA 1W7WA 4BYMA 3QVXA 1PBAA 2P6RA 4BKPA 3BMCA 3LVBA 2X13A 1KP9A 4IXTA 4WBXC 5JD6A 1AGNA 2LDYA 1DO2A 4M5IA 2ZB8A 4FZ3A 1WXWA 4XDCA 4EYQA 1SB6A 5PGMA 1VQKS 1KP2A 3DRYA 3R9LA 3OUTA 2HRTA 4IO0A 3CBQA 4BEVA 2C2YA 3V8VA 2Y92A 4DQ0A 2FPOA 5B57C 3AH8A 4HR7A 5BPHA 1W5FA 8ABPA 4BFYA 2PV7A 5ETLA 5LXRA 3A6ZA 1G41A 3TZ6A 4KTTE 5CH7B 1Q7LB 1UMKA 2FSHA 4NYMQ 1Q95A 4IDGA 4ZN6A 5EIEA 3BD6A 5AI8A 3C7DB 3ZZTA 4ZJOA 1HDYA 1ODKA 5I4IA 1BDIA 2E9ZA 4UASA 4USHA 4EA8A 3H2UB 4WVFA 2X22A 1ZRNA 2GPWA 2BFCA 5AKLA 3ULHA 1J2JA 2EZ4A 621PA 2BBOA 3UCGA 4L0CA 2EJCA 3HGMA 5KVSA 1X13A 2XHEA 2Q43A 3I9V1 2ONCA 2BBTA 3PE4A 1LRJA 2IIPA 5M2PA 1YUMA 2WAXA 1T36B 1WHSB 1ORWA 4E21A 2X23A 3A6PC 1TKDA 5AKIA 4DOZA 3OTCA 3MFIA 3A1SA 1R6UA 3DRSB 3EPRA 2TRSB 3CUEF 3DLPX 1TI7A 4XRGA 1ZCAA 2ZM6J 4CDNA 4G0PA 3G9QA 3PD0A 4N6NA 1N4DA 4CYUA 5DGHA 2TMKA 4JLDA 4KPGA 3MQ4A 1DAHA 4MAMA 1GNVA 5C3MA 3BE4A 5JEEA 1YK1A 1L7VC 2KWIA 2I38A 3ITNA 4NH4A 3BF4A 2IDLA 4PAWA 5CT4A 4WFBQ 4B81A 1E2LA 1KP6A 4DGQA 3FZ2A 4X7MA 4CLEA 1R6VA 1W2WB 3GFOA 4JI3J 3EC1A 3N6NA 2L08A 5BRJA 2O8FA 1Q7YT 5CNKA 3TA0A 5F21A 2H5EA 1VBFA 3GEHA 3PNVA 1VCHA 3SSQA 3I2IA 2ZSIA 2A33A 4CL8A 3NCQA 4DWJA 5KYUA 1OBHA 4OXQA 3C48A 1CRWG 2BMWA 1MJFA 3WNDA 5ALIA 1USWA 2XVYA 2G4VA 4DCMA 1B7FA 3EH1A 1E6UA 1IB0A 3V9AA 1JKFA 2O57A 3I23A 3R5HA 4BQPA 3RVRA 2B9VA 4F11A 2UXDJ 1NKVA 5EKDA 4ZPCA 3MR6A 1KYZA 3FVQA 2QLBB 1J33A 2XUDA 2O6LA 2GBFA 4ZMSA 3I9OA 5KFPA 2A30A 3M5PA 3ON5A 2Z09A 4IIJB 4FC6A 4L3NA 2Q5JA 1VA4A 4Q01A 4AZ0B 1VQSA 1U0NA 3F2VA 4YB8A 2GO1A 5K4GA 3D4BA 3HUDA 1E9BA 4DM3A 4ON9A 2YFKA 1HHQA 1ISIA 4CLKA 3EDYA 2IY5B 1NDHA 3OCVA 2DNYA 1JK9B 1VC0A 1DCMA 1PFUA 2DFVA 5CFOA 3TZZA 2RHJA 4QX6A 5LU8A 3OVAA 2O8EA 1K3TA 1NUUA 4BRZA 2ACEA 1FDUA 1M5HA 4JJ4A 4OUDB 3ZY2A 1FNBA 4MGHA 2OBLA 3UC9A 2ZRDA 4U0JA 1MNQA 4RGYA 4FGZA 3TJMA 3RAGA 3MWDB 4MLPA 3TOCA 4V0ME 4N5NA 4O3PA 4XQEA 5BRNA 3J80U 2ZIZA 1GPUA 2WB4A 3B8EA 3RGIA 4AK9A 3LDHA 4WA8A 3G85A 5HZHA 2F2TA 4WNIA 3TMKA 3TGPA 3HM9A 1BS2A 1ECLA 3D6FB 3M2UA 1X7DA 2QD1A 1QB8A 4NICA 1JG4A 4M94A 3K5HA 4D92A 3X3UA 5HFNA 5ALDA 4PQFA 3EY4A 3LC1O 4WD3A 2CIMA 2Q45A 3L5OA 3PZBA 2XUQA 2J59A 4MK8A 4F25A 3FZYA 1UMJA 4TZTA 4UM9B 3LQ4A 1U1QA 2EPIA 1NVXQ 1ULBA 1VCIA 2XUIA 1TMOA 3HB5X 3QU5A 1M8KA 4O29A 4TYAA 1F8XA 1ISHA 5KFDA 2QPTA 5CT9A 2J1LA 3CJKB 2JLAA 1TK9A 1FE0A 4BQOA 1Y3CE 2O1SA 3W61A 2CBXA 2ZYGA 1GCUA 5ARDA 5GMEA 3W3ZB 1YA8A 2QTRA 3IUYA 3RJTA 4IKPA 2QT9A 4KO2S 3KZNA 4KPEC 3AHPA 2P0YA 2G17A 4NCKA 3THWB 2VRCD 2K7JA 5EESA 5EMLA 4AYWA 1NN0A 1RADA 1YFKA 5BN4B 4ZVHA 2QK4A 4YQZA 3UWPA 4OXIA 1CYEA 4K3VA 4REOA 1QVAA 1OZ0A 1YDLA 4ID8A 2HNDB 3CD7A 4D8TA 1DTTB 1U2PA 2HHPA 2CAJA 2NYVA 1S1XB 3ZXSA 3GLUA 3ZIDA 2IYXA 1WL8A 3EGWA 1U94A 2V2KA 2NUAA 1RXCA 4BVJA 3HCAA 5BT8A 3N75A 4F3KA 4WERA 2OCIA 5CNIA 2C20A 3ESCA 4UAGA 2RFLA 1KH3A 1G5QA 5AVXA 2ZRMA 4CHGA 5IBQA 4Q2LA 5KFVA 3A6DA 1HI8A 5GZ6A 2HSEA 5JSKA 3DDNA 1L4GA 4FEGA 5AHXA 1MRZA 3JVUA 5SYNA 1X87A 4ALJA 3NP7A 2EBGA 2J3LA 2MYTA 3REOA 4HHJA 3A25A 3HXQA 3TEMA 1GGHA 3E1KA 4WINA 1ZUNB 2J09A 2KVIA 3BIXA 2ZBUA 5ICGA 3BH0A 1LBHA 3DM2B 1TADA 4A8FA 1JLCA 3OUYB 3BOSA 3QKIA 2I8CA 2UV8A 4MLZA 4E3ZA 1VC6A 2BHNA 2WAYA 4QYRA 2NSCA 2IRXA 3FRJA 4KV9A 1Q7EA 2XI4A 2OR3A 4XJTA 2BMDA 3IUMA 4HV4A 2MZSA 5G0RB 4OBWA 4FYJA 3NAMA 2GPYA 2DQ4A 1K7XB 1EHIA 4RFVA 4PLFA 2O0KA 5EJ8A 2YIDA 4RW8B 1GNLA 2IXFA 4DZTA 4F5WA 3HLUA 1KVTA 3DVAB 4OQMA 5H59A 4QPPA 1EFVB 2FPHX 4RYDA 1PZGA 4WOJA 2O20A 1CEEA 1PTKA 2KFNA 4W90B 2HDWA 1PZFA 4USKA 1VI7A 2P41A 5H80A 3DMFA 3T0IA 3G5LA 3DFUA 1U2GC 3KOXA 3QEJA 4YMUA 3MMXA 3PYXA 2W24A 4W5QA 5KG5A 3L77A 4OJNA 5I7FA 1OPIA 5BMVF 2DNRA 1A0OA 3KK1B 4DNFA 2ZJ6A 2VWGA 5EP3A 1DL5A 1CULA 3QWFA 3C5VA 3AAWB 4WK6A 4BNTA 3VGVA 1TKRA 4IFEA 1UVKA 5DTMA 1O5JA 1U7XA 4XUEA 3PR4A 1N5JA 1L3IA 4PSUA 3RS9A 2K2PA 1JMYA 3IS9B 4ETXA 3TOQA 2JDIA 3Q85A 3W5BA 2AG5A 2GNOA 3C87A 3H1FA 2XOKA 5I5GA 4DLAA 2IJFA 1DQPA 3VGSA 2FNAA 5HIJA 2J6HA 4F4XA 3BWVA 3MJ4A 3DLCA 2CD9A 4HNGA 4Q03A 3DDSA 1CEQA 2HF2A 1JEJA 1NW7A 1RE0A 5L9AA 3THVA 2EZTA 4MR7A 1FSZA 5DK4A 3SCJE 1RD4A 2NV0A 4PFKA 3X0DA 3MEEB 4NXMB 5KYVA 2P75A 4FYVB 5GONF 1L5VA 5FLYA 2OLJA 3UW3A 3V4RA 3EGXB 4AP5A 3G4SS 4J0DA 3BHNA 1SQGA 3GO4A 4A9AA 5J4KA 1R6BX 5G4DA 1A5TA 4X60A 3LKDA 2DR9A 3ZOKA 3KJHA 3LGAA 3J80A 2QVCA 2C2KA 4EF5A 4B83A 2C2OB 3CW2C 5B09A 4J9RA 2DR5A 4J2HA 3MMJA 2GO9A 2XW6A 2VUGA 1E2IA 3NXZA 3STHA 4RD6A 1S2GA 2O19A 4Y2YA 1T05A 2GLTA 5K0NA 3JATB 3ESZA 4IYJA 3SK0A 5JSZB 4XW2A 4ZGBA 1PWXA 1RAAB 1T2EA 5UKDA 1OVMA 3D67A 3TINA 3VHXB 4ELTA 3KMQA 1THGA 2OK7A 1EX6A 1SBYA 1OA1A 3NHYA 2W6JA 3VPCA 4BWJA 4LFAB 1KK0A 3GE9A 3ET6A 2ZOMA 3OPYI 5G0TA 3QSGA 2OWEA 4WY5A 4YASA 3RK4A 1VSQA 3CU5A 1EFRA 3F4LA 3UWSA 3CSUA 1NPYA 3TNYA 4X20A 2IBSA 4KUEA 5IKOA 3AILA 3MR2A 2YQZA 3BDVA 1TM4E 1JXQA 5LYJA 2LDIA 9RUBA 3WWOA 4UQGA 3ODPA 4N5HX 4FFWA 1RHJA 1AN9A 3KUUA 3W5AA 2PMDA 2VQDA 1LH0A 2NYRA 4IQMA 3RAXA 3LY9A 5JROA 4KDCA 3FYTA 3MM8A 2B21A 3GLQA 4NARA 3LRTA 4DZ6A 3N0RA 4PV7A 3CX8A 1GNQA 1Q2XA 3RHFA 1USKA 3QVUA 3M9XA 2FVRA 3EEYA 4MW1A 5J2TB 3PVCA 3BWEA 5LQCA 2WHYA 2PS0A 1D2MA 4C20A 4DLPA 4AM8A 4BMOB 1IBLF 1HI9A 3N8KA 1CCWA 2JA2A 4PSCA 1N1MA 1XTQA 3R7SB 4NLYA 3WKAA 1HHSA 3VR2D 3LUGA 2VXOA 4JJGA 2CFSA 4F2RA 3PJFA 2AE2A 5E3RA 3UMJA 1NJ1A 3DM9B 5HJ7A 4OI1A 3O6QA 2XB4A 3FPKA 3FF1A 2E1MC 4LWQA 4F2DA 4F9EA 4KPYA 5JI2E 5FFFA 4C1NA 4NEQA 3GAMA 2JVRA 1EZZA 4P3PA 4JYCA 2O5VA 3HTXA 5IC5A 1VJ1A 2PVPA 3ZDZB 2ENWA 2IEYA 3N4WA 2YWXA 4FDFA 3EVFA 2QLMA 3M3PA 3GFGA 4FYYA 3GFBA 1U0TA 3EMKA 2YHIB 5ULLA 3MWBA 1NXQA 1Q17A 4RVCA 4EB3A 2QAGB 2BVNA 2PN1A 4URFA 1P1HA 2ZSFA 3HZOA 4W5HA 4XD2A 5A8RB 5A0TA 1VE7A 2OO7A 3RVLA 2XXBA 2JGRA 3ONFA 1RTDA 5AVSA 1TZKA 2P27A 5KX5F 3A2LA 5FL3A 1MBZA 4J9QA 1W96A 5A4KA 2G9OA 4M7OA 3T7SA 5CEJA 1GKUB 2WM3A 2I7CA 3CV3A 4KH0A 1L7RA 1LBEA 2O1EA 1DBQA 3VSEA 2I87A 5EQFA 2AJ0A 2OHOA 3VM6A 4R2IA 1P6QA 2PD1A 4C87A 2MWMA 3ESQA 4FKMA 1S59A 3HKBA 1E6YA 4TT3A 3BSYA 3I6IA 3O84A 3P0EA 1EZ1A 4PWWA 3TFQA 1HHTP 1JTEA 1VQ5S 2CDBA 3HI4A 1A50B 3I76A 4B9EA 3CPSA 1KMNA 2GGPA 2JGIA 4YUWA 1HBUB 4J9SA 2KYZA 4OK5A 2A1TS 2VJQA 5ICEA 4REQA 1L5WA 4XEHA 4X3OA 1Z15A 1JSRA 1PJSA 1PLLA 1INLA 3C3KA 3ZR4B 2JZ5A 2RBKA 5IZCA 3RIGA 2WZ1A 4H31A 3GROA 4Z4FA 3JZFA 2GKSA 2O5EA 2W6IA 4YV2A 4KNVA 3G1TA 1N2GA 2ZYWX 1T8YA 4FFRA 4PPNA 1YL6A 4M36A 2PKEA 3ZHXA 4P86A 3TMAA 3MTIA 1ZX1A 2QA5A 3KSUA 1PG5A 3Q3HA 3NBMA 2PT9A 1YUNA 3DMYA 4W1PA 2RE1A 5T64A 3F47A 2Q99A 3OVMA 2CHEA 4ZZ1A 4NKRA 1IBMB 4PLHA 1GKIA 2VAXA 1U24A 3ENZA 1S3GA 3EGDA 1VIMA 1C1DA 3DE1X 1N5YB 1NSYA 2NU9A 3ZNJ1 1SVIA 3WX0A 2R9VA 2C98A 2VPWB 4WP3A 3DAOA 3AUXA 3UXHA 1LPPA 1TAQA 3V4IA 1PR4A 2VP5A 2R1UA 5IAKA 2HKEA 1DC6A 3FHJA 4HWTA 1Q16B 5U47A 5FA6A 3AM4A 1Y33E 1ZLYA 2RKWA 4R25A 2NPFA 2LR0A 5IU6A 3EWSA 1Q7BA 3HFKA 3C3XA 2GF9A 1K9MT 2PMEA 3NMRA 2I6FA 3B38A 3DTVB 4P2BA 2JANA 3CD0A 1ESZA 1ZZNA 1V3VA 1OX4A 2YJ5A 1FJXA 4J0KA 3AVXA 3NIBA 2UXBJ 3T1YJ 1HUQA 2P5SA 2AH5A 3J7A1 1QYIA 3E3NA 3IMCA 2EVZA 2JFYA 4B4UA 5KT2A 1N3BA 4C3OB 3AEXA 1KI7A 5BYKA 1CJBA 1O5TA 3R4CA 1VISA 1US8B 3G82B 3IT1A 1B8NA 4R1PA 1IU9A 2FG5A 2NXCA 2UVWA 3FPHA 4A0SA 4LFBJ 3QSIA 2GV1A 3U31A 1A71A 1TQ6A 3USCS 4DLKA 1PIWA 4JU8A 1L1RA 4R41A 2QZ8A 5IASA 5K4HA 3BDIA 2JBWA 4MWSA 4Q82A 4ZVUA 4HT5A 4G1QB 2HA7A 3CXUA 3T1QA 3Q86A 1CUEA 2C7BA 4OP1A 2V2ZA 5DGTA 3GF4A 1LI5A 3DB2A 4KYTA 1H4SA 1S99A 2B5JA 1Y81A 1G8JA 1L8LA 1G5TA 3B85A 4ZGGA 1WO8A 5JARA 1RJ9B 2PE8A 5SY4A 3N6VA 2Z3VA 1K44A 4HNAA 1X7YB 3IAM6 3REFA 4LHYA 2HZ7A 5JZBA 5IKMA 3RJMB 2W6ZA 2XY6A 4EKDA 1S72S 4XWTA 4IY1A 1FTCA 3MQ2A 3H40A 1N5SA 2KT5A 4MQEB 2FF7A 1BMTA 4DFMA 2ADCA 3PA8A 4BZWA 3ZE6A 5JS2A 4PGAA 3FAKA 3VH3A 1JLLA 3QXCA 2QW1A 1IZ8A 4BMDA 5EXXA 1EI9A 5C0OE 3TA1A 4DJTA 3PX2A 1JX6A 1U5BA 4BBPA 5CDHA 4RD4A 2B8WA 4D6PA 3OMXA 4H6VA 1SVUA 4XLLA 2H1OA 5E38A 2MZRA 4FC7A 2VF7A 1AGRA 1CIVA 4RENA 4NBTA 1AMUA 4H1UA 4IYQA 1W6RA 1KS9A 3WGJA 5JD3A 3IP9A 2HTFA 4JXZA 3A1CA 3EDRB 2G77B 3QQPA 2BKUA 1XALA 3OETA 1JA0A 2IHBA 3LBYA 4IFIA 4F7VA 4BE7B 1X9GA 4G3IA 1WXDA 4WZBB 3OZAA 3SF0A 3X1ZA 4C2MA 2XNKA 1MLDA 4ESOA 3QSYA 3OCYA 4K6GA 1UWBA 3EGCA 2VJMA 2ZRGA 4F3CA 3AJEA 3TZCA 1NPKA 1NOKA 5DGXA 4MGIR 1QF7A 5I8ZA 4XQCA 2FJEB 3EDQA 4EPYA 2D74B 1GT8A 5F52A 4RFSB 3M8PB 3THXA 4OX9F 1WU8A 2ZSAA 2C2HA 2RI1A 4QTTB 2XMAA 2I6WA 3G0DA 4B6GA 3VZCA 2EFCB 2CJFA 1NVGA 2RS8A 1BLUA 1Q20A 2IHUA 2IRWA 3VKHA 2C4HA 3PJEA 2VJBA 1R74A 1JHRA 1M1XB 5ECYA 4DMZA 2V0NA 3NGXA 4K9PA 1E2DA 2C4UA 3BBCA 4BS2A 2CLLB 4KLNA 3ZDDA 2QUZA 3I4CA 1GZ6A 2KRRA 2IWHA 5JJLA 1EDZA 3B12A 4W5NA 4NY1A 4ZLPA 1JI0A 1BS1A 4ETNA 3ZD6A 1YHNA 1KEUA 2P2NA 1D1PA 1YRTA 2HMIB 3GP8A 2RRNA 3SQGB 2HG4A 4Y1GA 1NK9A 4I7FB 4ILEA 4PWYA 3NHSA 2ZSKA 2POQX 4EKEA 4UUOA 1BU5A 1XJ5A 2OPPB 1N5OX 5KTMA 2C2GA 1C41A 2E89A 2P30A 5HP1B 4UC0A 3F8WA 4YROA 4LZLA 4MYTA 3FOZA 5K3FB 1I4OA 3EB9A 3ZXXA 5AW2A 4UFOA 4RDIA 4B3DA 1VSBA 4X7RA 1N2OA 4YJDA 5JATA 5T14A 2DXDA 3P9SA 4H3HB 2EGHA 1HNWJ 1U3FA 4EI2A 1H2EA 4ROTA 5KQMA 4ENWA 2P2CB 5D84A 1WW8A 2MGZA 5JDIC 4JI6F 5K8PA 2W6JD 2UVDA 4XYGA 3LUHA 5CJ2A 3KM0A 3B6KA 2QQEA 2VAWA 3DAFA 1N6HA 4B31A 1SC3B 5F5XA 2E4UA 3FPSA 4QXMA 1HYEA 2VVTA 5LL6d 5HDBB 3AB8A 3OQNA 2NTJA 2X3UA 2P1RA 4Q1DA 4TN2A 1JXMA 1R8JA 4LY9A 3WYGA 1K6MA 2PJDA 1PE0A 1GGEA 3KLPX 4DABA 5LWQA 3CUWA 5C24B 5ESWA 5BW6B 1R7RA 3KK3B 2FFHA 4LDJA 4DF3A 4AL4A 1V48A 3WBKA 3DJFA 7FDRA 1XQIA 2DR3A 1WXIA 4ND8A 3IBYA 3PNMA 4NOHA 1Z8HA 1ITPA 1OBCA 4FYXA 4WTOB 1XTVA 3SKVA 5BUCA 2CJYA 1VHWA 4EG3A 3F5FA 5EJ6A 2ZATA 2QTHA 2V74B 3KKZA 3A7DA 3QX9A 2DGSA 3QIPA 5KFZA 1E2QA 3QUQA 2P77A 2NUHA 2O23A 3OA2A 4QXOA 4ER3A 1YQEA 2J0QA 2CVOA 3OFND 3DLEB 2P9GA 5JCPA 2C0PA 5LDHA 1TL1B 1J56A 1R4AA 2ZB4A 2NQPA 2QSZA 3OAAD 4YVFA 4DT1A 2JEFA 4NQRA 1Y5MA 1V4BA 2AXNA 2WJWA 4AJ4A 5EEHA 5BYBA 4JAVC 1CFJA 2FLVA 1SCUB 1ZRSA 4GSLA 4OJKA 4K9MA 4M22A 1DOHA 1J7JA 3CONA 1WOMA 2IPLA 4GLJA 3Q88A 4RA6A 1RTIA 5D8HB 1XZIA 1RWMB 5GZ1A 3GGPA 3ACCA 2V3CC 3G0GA 4DL4A 1XZAA 2GK3A 5JCZA 2WMOB 3EEQA 4D0GA 2VC1A 4EEKA 5C7IO 2AUNA 3K4HA 1JEDA 2FVSA 1T9YA 3O8OB 3GD7A 4CMHA 1WEZA 3IG1A 4GKKF 2HRDA 3BBLA 3KJEA 2VH2A 1SJRA 4R8KA 3KFLA 4P4SA 2NV2B 1KJNA 4V1Ak 1KHHA 4NJMA 1R8QA 2QYTA 4QBGB 3QFHA 5KFTA 4BB5A 5KJCA 5KEIA 2AR7A 5FAKA 1OBOA 3PSHA 5C1IA 1M54A 1JQ3A 3Q2TC 1XMJA 4TTQA 2BV3A 4WFAQ 4DGSA 2OXEA 4KHZA 3IEUA 3VH1A 3PUKA 1TJ5A 1J5XA 1UZDA 4KUGA 2MQLA 1OQAA 1YRXA 9ATCA 4YRAA 2BJ1A 1TRKA 2QT1A 5JVGQ 1SXGA 3O38A 2MQQA 1SZPA 3MJTA 2RHGB 1EK5A 4GBED 4D99A 1R0ZA 2BUBA 1BMFA 2XZLA 1OLSA 1YFJA 4UMDA 4JV5J 2ZTHA 5D7NA 1SD1A 2H4HA 4MRAA 4KXVA 1VXRA 4EYKA 4LHVA 2NUPA 3F74A 3E23A 2FKAA 5DM60 2F3PA 1Z75A 3IBWA 4EJFA 1V8ZA 1JJIA 2XLCA 3K70C 3BXHA 3KNZA 1WCWA 1TKTB 1G7CA 1BWRA 2NU7B 5A04A 5F3DA 3ZBTA 1VYTA 2IXGA 2QLLA 3DB1A 1EEXB 2FLNA 2FFAA 3I3SR 3CW9A 1X5PA 3DOKA 4FWIB 3FDIA 2VNIA 3NBKA 3L6UA 1A7GE 1CJUA 2XZWA 4WFZA 4AUKA 4M5KA 2PZ8A 4DXHA 2XS7A 4BKUA 3QBVA 5E3HA 5DOZA 3GEDA 5HZMA 1N5QA 2HXYA 3W5UA 3LP6A 1UJNA 2YJ6A 4F4IA 1FRHA 1ZYUA 3L4BC 1QXSA 1RW4A 2P7IA 1XR7A 2W83A 4OXKA 3I4PA 1FUKA 3M1VB 1GXSB 1RQLA 3AHHA 3OTQA 1I0LA 1RWPA 1JU3A 1Z4PX 3KG4A 1ZONA 2PMFA 3Q0AA 1KH1A 2FFRA 2BM1A 3SS7X 2C78A 1EP1B 2JLZA 3FTDA 4L1KA 5EWMB 5G41A 4B8YA 2VEOA 3WMWA 1QDLB 4WY2A 1DRJA 5KQGA 2CN1A 1WG4A 4IJ5A 3DPUA 4K4SA 1GADO 3CDBA 2WJIA 1KI2A 3M83A 3GWZA 1JG3A 4FBUA 2K6GA 4DARA 3A0RB 2FSVC 1IHUA 1C1BA 2XHZA 1PTJA 3U5ZB 4AWAA 3U3DA 2C5SA 5A9RA 1GDDA 1SHLA 3IKJA 1O0CA 2BRKA 1H3DA 3EXHC 3DI6A 3CMAS 3GOQA 2EKPA 1XNQJ 2MDAA 3E2PA 3RFTA 3I6BA 2Q1TA 1AB8A 3NTRA 5A3JA 1FFCA 3DE3X 1NZDA 1NURA 4PXDA 1WOOA 1I13A 4MYUA 2ZE7A 1R0KA 5ALYA 3DV0B 1TW3A 1NVMB 2EF0A 2C07A 3LS2A 3VVBA 2DBBA 3UNYA 5DIFA 4LXTA 1QRAA 3C3LA 3ONEA 2AI3A 3IVXA 1IY0A 2Z0MA 3R5XA 1ZI8A 4UOGA 3IT3A 5ERGB 4CF7A 1RYRA 3IXQA 4ZJLA 1EP4B 1SB8A 1Y37A 5F3RA 2QMZA 2Z98A 3ECAA 4C0JA 3MWKA 4BGIA 1N54B 4PLTA 2GXSA 3EWNA 4YRCA 3RVPA 1D09A 2FEPA 1QRTA 1IR0A 5KAKA 2QF7A 2O3RA 2CVZA 4RUCA 1N57A 3V00A 1OO0B 4WKBA 5IKXA 1QYVA 4OVKA 2HNBA 1BXRB 4UCFA 1ABBA 2PD3A 1BW9A 3LVQE 4NLWA 1AKRA 1VJDA 2VUSA 2AJLI 1AOXA 2QRVB 3UM9A 2MSTA 4DC0A 2XMSA 2ID4A 2BW0A 3P9CA 4LSLB 4HYEA 1FXDA 3AR9A 3RSOA 4ZMMA 4P52A 3BM7A 3KKFA 1WSDA 3QPAA 1S5PA 3JQGB 4WASA 4JT2A 5ETMA 5HK4A 1LWNA 1W88B 2H2WA 1TF5A 1SKQA 2GSDA 1HQKA 3A32A 3JWEA 4A03A 1HL3A 5KB3A 4DCPA 5DGDA 3HDYA 3CNQP 2FPPA 5IC6A 4GI1A 1Z0IA 4LBVA 2KKHA 2YH2A 4Q8FA 2J6IA 5F64A 4QDXA 5J58A 1UXHA 2YW2A 2OZEA 1ZIDA 1MU2B 4MUMA 3C43A 1LNSA 4BPRA 4RNCA 3JSYA 1UWLA 3WL5A 4MKVA 1WOPA 2HPAA 4M7WA 2VF4X 4CM7A 3DLJA 3S3TA 4J3JA 1GLGA 1W46A 4LDNA 5MAOA 3H8JA 3I96A 2DM6A 4NVRA 4I9HA 3N28A 4ECZA 2O1PA 1OF1A 4NPCA 5ALQA 2DHHA 4OYHA 2PAAA 4BNYA 1GKYA 1U98A 4TXLA 4ALIA 4C1BA 3ASZA 5EX0A 4JC0A 2B2NA 3WSTA 2ZSUA 1NM5C 1IBKF 3I0NA 3T9FA 3ZD8A 3COPA 4C0QC 4I1TA 1AS0A 3NDJA 4PCUA 4BGVA 4GPZA 1DIGA 4K8OA 4OSOA 4P98A 3C6UB 3KZ1E 4E08A 3BEDA 4G84A 3CSKA 1I2CA 4U9RA 3HYNA 4OK6A 3T1VA 4UE2A 4LF4J 1JPNA 3EODA 2C95A 5DISB 3ZS8A 1KXJA 3HXMA 1K47A 3FY4A 1JV2B 5KFCA 3AI7A 3B2NA 4KBYA 5FPPA 3WRVA 2WTMA 4FKYA 1FSSA 2XECA 1CUXA 2PCLA 1JLSA 3MGGA 1F60B 4CR7A 1JLQB 1L4LA 1X2EA 4ENQA 1VE3A 2ZI6A 5AXLA 5EXDA 4HTFA 2GHPA 4NE9A 4YJFB 2HCJB 1E69A 1RHUA 1PJZA 2RRBA 2LP4Y 5LIPA 3NHWA 2YTCA 3V4SA 2A0FA 3P9RA 5AJZA 4R9SA 3PWKA 3BDPA 4UTVA 3GGDA 2IDZA 2Y3IA 2H65B 1P61B 3L8CA 2OY0A 1BDBA 3R7NA 2G2ZA 3KJQB 3LZDA 3F6BX 4R8UB 4HFRA 4PX3A 1QC5B 1P77A 3THYB 2O66A 2P91A 5L7TA 4FYHA 2CG8A 4V19X 4PLPA 3DR5A 4WOKA 4YV0A 4C0SA 4EG8A 1TMYA 4G4IA 2XNRA 3EE3A 1MJGM 3LG2A 1QGYA 1X7ZA 3QYFA 3WDOA 5DEIA 2D3WA 2QGNA 3RKSA 5KT3A 1H38A 2J0QD 3P4UA 3QJLA 1C8KA 1HH4A 1ODJA 1M0WA 1C4AA 3HHLB 1T9AA 5DNYB 3AI1A 5LPNA 3V6LA 1COWA 3RR2A 1D1QA 5JRZA 2EP8A 3EJMA 1XEXB 4ZEOA 4MW5A 1YH3A 2H9ZA 4PS0A 1I6WA 1HR0J 2QEQA 2X9VA 3D4JA 1NVTA 1SD5A 3QWPA 3TF5A 3BICA 4YMVA 3T5CA 2XA2A 2WWHA 1YVUA 2QG9A 3Q12A 5IJAA 1CTQA 4XYBA 4DQPA 2Z1NA 4L9RA 4GSKA 2XZPA 2FVQA 4DRYA 3LP5A 4Y6LA 1XZNA 3WNCA 2BFEB 3PFEA 2CMKA 1IIBA 2ZIXB 3BUSA 2PD4A 4C21A 3EAQA 2W01A 1BY9A 1NVWQ 2XGMA 3KZMA 2VBFA 2EFYA 1SH2A 4BVBA 3WFIA 4EECA 4AJJA 2OHHA 2VXCA 2ADBA 2P2LA 3IP1A 4TV9A 3TLYA 3WBFA 4M6WA 1DBSA 2H3HA 4HGZA 3I34X 5E2IA 2YXNA 3C6TB 2Y05A 3ISND 1FC0A 2FPXA 4PYOA 1KOLA 3IJRA 2D4HA 4LRSB 2P6NA 4PZ0A 3CYFA 1DQ8A 4KN9S 5KWVA 5FOWA 3AFOA 3IH5A 3O8RA 3ZV5A 3TR6A 1QQ6A 4C6HA 3AEYA 2XQVA 4RVUA 2R00A 1J1IA 2BZ2A 4MV7A 3LXXA 2R8IA 4JLPA 4Z1MD 5DNAA 5EL0A 3R3UA 4A5OA 3MRTA 4L7VA 1OBVA 4GU5A 2IVYA 5J63A 1BMFD 1FWPA 1PRYA 2EBFX 3AXMA 3QY9A 2HFUA 1NMXA 2V0GA 2G72A 4R98A 3SFTA 2J32A 2AMLA 5IHXA 4ZOLB 5J2QA 4LF6F 4FFBB 3A3YA 2R6GA 1K66A 2FDNA 4QBUA 2OUKA 3NMUF 3SS8A 5A05A 1QYWA 4XK8C 2Z9BA 3PIDA 1I3OB 3CDAA 4I9GA 1QCDA 3NTVA 2GHRA 3AVQA 2PH3A 1KU6A 1D3WA 4Z7YA 3NNNA 3F71A 4D9CA 3V5RA 5AM0A 5AH0A 3TX8A 3I55S 1U3CA 3U7RA 5TF4A 2HHQA 3CNEA 5IQQA 4WAUA 2PR2A 2ZRAA 4K6MA 4R16A 4XWAA 1L8AA 4OYLA 5ALHA 3D6VA 3ERCA 2C03A 2GLUA 3VKGA 4UW2A 2ZUUA 3QVOA 4YJ3F 1XQ1A 5I9BA 4IYRA 2R7NA 4TM8A 3SF8A 1EB0A 3MTJA 1Z5GA 4CTJA 3FCHA 2DO0A 1JXLA 4KXWA 2WFLB 1YCGA 4Q4AA 5F9NA 1T4MA 1P91A 2I6TA 4ZVPB 1SJFA 2FQYA 1XA0A 1QVFR 1MG7A 1JAYA 3ONNA 2N3ZA 3PNIA 4KH1B 1FCAA 4NYJR 3TXYA 2G1UA 3GP9A 1T15A 2KYRA 1R9JA 4FOLA 1ZN7A 1FJGB 4F6CA 4YAOA 2XH8A 3L8HA 2VDWB 4DDUA 1U7HA 2AG6A 2ODNA 2WAMA 4OXYA 5LJLA 1SUQA 3GRPA 1OTHA 3RS7A 1DTWB 2MKIA 5KOYA 2ZKUA 3KK0A 2WONA 2V97A 1PFGA 2GWRA 3OIWA 2DY1A 5DXAA 1QGUA 4V1CA 4Q21A 4EY5A 1ZDMA 5F9FA 5AKXA 4Z9FA 3E3AA 1NJ6A 5KYYA 5T4HA 4WZZA 5DX1A 1S2LA 4PYAA 4DLYA 1PEKE 5IN4A 4B47A 3TJAA 4XWWA 3KKPA 2EKZA 2R47A 3K73O 5JC1A 3MLAA 5AK3A 3B48A 4HJRA 2QV7A 3AJAA 3DXYA 4C0XA 5IAAA 3W9SA 2HQ1A 3PPXA 3D8HA 2VNKA 5HF9A 2OTCA 1L5HA 2RRAA 3QYJA 3JAWB 1YKWA 2HHHF 3Q6MA 3B1XA 2AQ8A 2PQ2A 1GV1A 2JARA 2QAGC 1ETUA 3U4AA 5DHPA 1X2BA 4DYVA 1V7PC 1RWWB 4JSRA 1BHQ1 2M2IA 3EXFB 2CXUA 4ZN3A 2Y6VA 2CQ2A 3RB3A 3DFFA 1ZEMA 4GOKA 5FI3A 3PNQA 3SHVA 4F2SA 4LMRA 4KFBB 1N5KA 1Y6JA 9ABPA 3GEBA 1ZTTA 1FTGA 3UD4P 3Q1KA 1K4YA 3KJFA 4V0OA 4XEUA 2BEVB 4IGIA 2EYUA 2PEZA 4FEYA 3BIWA 1PLKA 2PIAA 2AOTB 4LGYA 1QH9A 4LX0A 1DDIA 3WNVA 2Z4TA 2XB6A 1C80A 4E14A 3COVA 1UQTA 3KTOA 4BBJA 2XCOA 4UTRA 1XELA 4EW2A 1DAGA 4ELUA 1T6BY 2JFWA 3B7WA 2ZHAA 1UL1X 2HHLA 1L7PA 1ISPA 1WELA 2I1QA 2Y0CA 1J23A 2AGPA 2JF0A 1UMDA 5TY0A 1J8MF 2FEMA 1CY1A 2F43B 3FZEA 1J5EF 1TX4B 5FQNA 2CJPA 4CXMA 3PL5A 3FPJA 4PSAA 3C1TA 1SCNE 1QFJA 2XY7A 1Q7CA 2A5FA 2XYRA 4C6TB 3FHTA 3RVNA 4JLOA 4GXTA 5ENDA 3I53A 1I1HA 1IHYA 1RTJB 1DRKA 1UDBA 2YY6A 3L2OB 2HSZA 3QGMA 3QU2A 5TNXA 1QAMA 2QLJB 3AW9A 2A1TR 2CYYA 4ZN1A 3U7IA 4JASB 1VJRA 4GYJA 4MYCA 1UAAA 3LF1A 4AC9A 1S7HA 3PRYA 1RWXB 4NU6A 9LDTA 5JS1A 3IQGX 3TB4A 3UUFA 4GOOD 2Q49A 1FYWA 3DFZA 5L9NA 4ALNA 1UCNA 4UHHA 2QD2A 4LJ9A 1RWKA 1GA6A 1R64A 1TFUA 1FTNA 4XFKA 2WPDA 2X8WA 3HYRA 5I9NA 3QV1A 4Q00A 3HWWA 2HZBA 1DX4A 1QHYA 3PV8A 1OLXB 2XNQA 2OI2A 2DE0X 1K9VF 2DERA 1IY1A 2HNKA 4BX8A 3LHIA 2R5FA 3WV4A 5K0BA 1Y6FA 3W9UA 5DDPC 3WGHA 1NHWA 3LTOA 4N3CA 1UW4A 4MKGA 1KK1A 4BKQA 4NA3A 1F3LA 2IA5A 1F2DA 4HH0A 5DW3A 3P27A 4YP6A 3PSAA 3UOGA 1SIWA 4DA6A 2YOFA 2UU9F 1UZHA 1V4NA 4YFUA 4K2AA 5DWQA 3G82C 2CWDA 1GPAA 3A4LA 3IAS9 1OQ3A 1U0GA 4P4GA 3OL7A 1IFXA 4DSOA 1EGQA 3FSXA 1H66A 4K6OA 2YN0A 3WYCA 2H6EA 2ZANA 3RKUA 5BSWA 2KLHA 4TYYA 3TO5A 1U0HB 3BGRA 1RLTA 1X31C 3KWLA 1DJNA 3GJ6A 2X8BA 2PBZA 4B3SF 3DBLB 1B0PA 3O03A 4J07A 3BB3A 4J0EA 1NL3A 3Q87B 4RKEA 4YMTA 4IDBA 1Z22A 2O7SA 3VALA 1T5DX 2VONA 2DUWA 1B6TA 1ID1A 2BUAA 3ICCA 4KE8A 2DWUA 2AC2A 3ZJ4A 3V8BA 1KEKA 2B78A 1PJ7A 3TD6A 2I67A 4YX9A 4TZ6A 2V8HA 4NX9A 4FBTA 5CGQB 3UGJA 4KQZA 1YIJS 3PEEA 4O4JF 4D3YA 4X1YB 3EW7A 1T8TA 4LHZA 3PDCA 4K59A 1RC1A 4JNCA 5KYXB 2U1AA 1G8MA 4RTPA 4JUFA 3BGVA 1FKOA 1FNXH 2RDIA 3UH1A 4DB2A 3NYQA 3OO0A 4YJ2B 2UUCB 5EG5A 3Q7TA 1E2EA 2ZPUA 2VD3A 2PH1A 1UZUA 1XXLA 4PTLA 3N6RA 3UF0A 4K9QA 2EFPA 2FHMA 3RTDA 3L7MA 1COWD 4X5OA 4X4TA 3Q8LA 2B3DA 2RDJA 5BQ3A 2CDNA 3TLGA 1V5WA 1SJQA 1AB5A 4TKUA 5LOVF 4ZTBA 3ORYA 1B15A 2IP2A 3L7AA 1JFRA 2VYVA 3O31A 1A2QA 3WIEA 1JLBA 5KG2A 4D0RA 1PV1A 2LRHA 2C2MA 3GT0A 3RUHA 1W1UA 4GDMA 1ZCJA 4Z7JA 2FI1A 4PRLA 1WCXA 1OH6A 2F8MA 3FMGA 3MM6B 3AB4B 5ETSA 2AZDA 5TEWA 5IYZA 3HP4A 2WU3A 1ZK0A 3ZEIA 2QPOA 2CQGA 3C15A 1DKQA 1UP1A 4Y3UA 5JLAA 5C5IA 3OJWA 4ECUA 4B3TF 3VVLA 2D5LA 4DR6B 2OGTA 4DLSA 1U2GA 4K0KB 3ZDXB 1L3BA 5DTRA 1BHSA 3CNLA 3EZ2A 3CX3A 4DI6A 1YC5A 4F04B 4NEZA 2X1MA 1XJCA 4PPZA 1GGMA 5CURA 2FN3A 2V1XA 1X0XA 4R69A 2HQGA 5DH9A 4KIJA 3WX4A 4FYDA 3OJUA 3L7KA 1CDDA 4DR2J 2FJPA 4EABA 1KHTA 1KIAA 4X1KA 4RD1A 4G0VA 5DYYA 2Y1LA 2QTMA 2YV5A 3KVNA 1YJCA 3GCXA 1NQXA 5AI4A 5FBQB 2QJ3A 5TPWB 3FDJA 2IL1A 3E01A 1BHNA 1CBKA 5KFJA 3DDKA 1BWSA 1NVEA 4KOAA 1UJ5A 1CY2A 3RI3A 5K20A 1KC1A 2D1FA 4GMFA 2C4MA 3TOSA 3G8QA 4BKMA 5B0AA 1UKVY 4KHMA 5K14B 3DLGB 1U6IA 2RHTA 2Q7DA 5DHFA 2J5BA 2PMWB 1K92A 2OOSA 2GF2A 1QTMA 4AX8A 3H0CA 5BXYA 2W2KA 1KI6A 1YJ9S 2VPZB 2WU0A 1I94J 1ZBDA 5AUPB 5CCBA 3GNSA 2OV3A 5D4NA 3H5AA 1K6XA 4ND1A 5D1NA 3AD7C 1U1PA 2HBZB 1SWVA 3PX3A 1GG8A 2XCSB 3BJYA 3Q8PB 2I62A 3OTOB 1S0OA 3KKOA 5G40A 4CM3A 2VG6B 2CZGA 2A9JA 5F8LA 4EL0A 4WGFA 5J47A 3IGFA 4P7KA 4LYFA 4CGZA 5LQAA 1FX4A 5HVGA 3G23A 2WAOA 3CX4A 2FETA 1XZKA 1W73A 3PXGA 3CX6A 1U3DA 4TPKA 3CW2A 1DRUA 2H7XA 1FFGB 4MV9A 2OPSA 1NR7A 3NP9A 4IQFA 1HQEB 3RFVA 4ED8A 1K7YA 5JBQA 1RLDA 2X5JO 2AC4A 3T8YA 5DYGA 1ELOA 3AQOA 5HIKA 4FX5A 2WCXA 1L5OA 1NN5A 3R7AA 3H59A 4WCVA 1O95D 3SVTA 3PW5A 3PNOA 1CY8A 2ZB7A 4DCGA 1QFMA 2QAJA 4Q3DA 4XCVA 3K6SA 1SEVA 2V9PA 3K4QA 2A9FA 4MRMB 3Q40A 3IWNC 3TIFA 2FYXA 1NB2A 1G21B 1XFDA 3WYAA 4E7PA 2DPGA 4B4KA 1SCJA 3UGQA 3WLHA 3PRKE 5D3GA 2BFFB 4KTQA 4Y2SA 2XGOA 1NXXA 1IUPA 4CMCA 4GXQA 2GFQA 3PPWA 2QA4S 2ZUCA 2ZRKA 5EMMA 1W34A 1VCNA 4AL6A 3D5TA 3L3CA 1SV5B 5AOCA 5LKRA 1NDKA 4EP1A 2PX6A 2PFFB 5LMZA 1QO0D 1C30A 4AULA 1AQIA 4LJRA 4PCVA 2DHRA 5H1YA 3ZCVA 1Q0QA 1SJ1A 3OQVA 2CB9A 2QTTA 2RGNC 3HKEA 5LZ4A 3FOBA 2EJVA 2B9YA 1OXBB 5DGIA 1EQ2A 3MCAA 1CS4C 2IPMA 2ZJOA 1S3FA 2VQFJ 1PD0A 4P9NA 2P8SA 5DM1A 13PKA 2VC0A 5LXYA 3T3GA 3B3AA 3GCDA 5J2NB 1W5TA 2BMVA 4FJ1A 3KETA 3SD7A 3VSDA 4NMXA 4TNOA 2AN4A 1GPDG 5CM8B 4FHFA 4GF5A 4ANCA 1J5PA 3BULA 3CH6A 1J2UA 3R3HA 1R0AA 4BEBA 2D1QA 2IOYA 2EBEA 3PFGA 1L5MA 3WRYA 3KO8A 5HMXA 4JLSA 1KVKA 1VRQC 5H68A 4MMYB 1CF4A 4DIEA 1AH2A 1DGQA 3EXEA 4UBOA 2P68A 1IY8A 3IRUA 4RZUA 7REQB 4P4TA 1KVIA 4CMIA 5B30A 1M5UA 2IC3A 3B9QA 1KY4A 2IZ6A 4RIHA 2D5IA 3L0DA 2ILZA 1QPBA 3GIWA 1VCTA 1UPAA 2UZ4A 4QDZA 4GOLD 4DNXA 1VQ9S 2ZETA 2DR6A 3DZBA 2BLLA 1EP3B 1JU9A 2IVFA 3QLEA 2G7ZA 3TGLA 3HCEA 3TCKA 4UHKA 4BZZA 2HMVA 1XZDA 4YYEA 5RUBA 2QN1A 1WSWA 3FKJA 4P71A 3CS3A 4QU5A 1NKCA 2OLKA 3TQRA 5D51S 1P2FA 2Q8NA 4BXOB 1XZMA 1VIVA 5EGSA 5JYBA 3T9ZA 1U48A 1ZAXA 1KH2A 2HO5A 3DMTC 1RT7A 2XXAB 1MABB 3KKEA 2PWYA 4IF6A 5EHGA 3LP0A 3S6EA 5KFEA 1MQ9A 3D7SB 1OPRA 3WICA 3E7PA 3DYAB 1P4GA 4AD6A 1DQRA 8AT1B 3A9RA 4X4RA 1PS8A 1HNIB 4D0NA 3QIAA 2PUHA 2XS5A 5FTNA 3UV6A 1G3MA 1P4SA 3AU8A 2IW3A 3RNLA 3I0ZA 4BMCA 2GTIA 2GHTA 5AW9A 2J9GA 3O8DA 4CR6A 4GT1A 1VRUB 1NBAA 3KXLA 1I36A 5P8WA 4IZ6A 4FFDA 1RXSA 2QN3A 1YFLA 3X1WA 3VCDA 2RGBA 2AEFA 4MQ6A 2N75A 3CSDA 3BERA 1P5ZB 3NHAA 3JQAA 2UUAB 3NDRA 2AW0A 3GZJA 4ZA1A 4I19A 3TQQA 1SUCA 5B2EA 3CCLS 2WPDD 2H2HA 2WZCA 5HQMA 1FVOA 4HYYA 2A35A 3AEQB 1NA5A 4N8EA 4WECA 3FMIA 1HDIA 3JB9k 1W2GA 2ONJA 4U7TB 2MINB 4FW8A 4AQYF 4LMZA 4ED1A 5G3YA 5D0HA 4DLXA 4ILLA 4EGFA 2W8ZA 2FVYA 5I3ZA 4ERDA 3MPYA 2Q4RA 4Q5VA 3SR3A 3NC0C 4MA4A 4KOEC 2C4TA 3OJSA 4DV0J 3IBCA 5JADA 1UEIA 1PT9A 1A9TA 4F86A 2IOFA 2DEIA 4XKJA 2RARA 2R65A 5KFMA 3WLMA 2H1IA 1Y7IA 3D64A 2FZ5A 4K9SA 1UFRA 1LZLA 2DITA 3S01A 1GFWA 1XN4A 3SHFA 5LMUJ 4KAAA 1SC4B 1E0KA 1ST2A 4CG1A 3WRWA 3OQBA 3TSAA 4DNQA 1FDDA 2VPYB 1OROA 4MV0A 4LVCA 4C05A 4GC7A 4KR0B 4JBYA 4NLXA 2NU6B 5CXSA 4DA7A 3WMFA 4ZJUA 2ZUEA 3RABA 5L7WA 9LDBA 2P9HA 1KDTA 1QGED 1VBZA 4I0WB 5SUHA 1JSXA 1ZOTA 1NK6A 4JL6A 3UQSA 4I64A 1G9TA 2WE7A 1GRRA 1UBJS 2X7HA 4PCQA 3TANA 3B1ZA 4XE5A 3FMFA 5LJ5Y 4P5PA 3USES 2G9QA 4P82A 3MYRA 3FH0A 1LK7A 4R0MA 2CLHB 3GPAA 1PP4A 2VXBA 4Y30A 2OAEA 4ZK2A 4V38A 3KL4A 1O96A 3EUFA 2FPIB 1IK4A 3LKZA 3KLFA 1OE0A 1DKPA 3MPDA 5E2BA 2AJQA 1DADA 2OO5A 3OLYA 3E27A 3V42A 3VGJA 2L41A 2A9QA 5KT5A 4QUEA 2M8HA 4CDIA 1ZHHA 1V35A 1PFYA 2WYHA 1K7CA 4R1LA 3D5MA 3R5GA 5FPHA 3F6PA 1L3CA 2AMCB 1ULUA 1LPMA 3LOPA 3AHJA 4IUYA 1LXJA 4O1MA 4K4TA 1NQAO 3SEZA 3S8YA 2EX4A 2D1SA 1Q5VA 4C11A 1XMPA 5HJXA 2E44A 4L27A 1VK8A 4FVMA 3DHNA 3GJ0A 5DDRC 2PA3A 3G87A 4PAGA 4GOND 3VTKA 4L4SA 5FCDA 4HGYA 2VYVD 5JWRA 3GEIA 4NXNJ 2JFBA 1UVIA 3CC4S 2HHUA 3ORRA 1Y34E 4PN3A 1IY9A 5ICCA 2L69A 2DF8A 5FR2A 3QK7A 2V4QA 4EENA 4E22A 2XT6A 4I1RA 2VT3A 3TLXA 4DR1B 1AUDA 3EZOA 1U4BA 3AERA 4HKTA 3OZIA 2FUCA 4JA0A 3CVJA 3PT9A 5FL7A 3EIUA 2MKJA 3QGHA 1RM5A 3BCHA 4RY9A 3D7NA 2QT0A 2C3MA 4DV5J 2AOUA 2YQ1A 5CZXA 4MZDA 3MCSA 3PI6A 4OJHA 2P1DA 1Y8CA 2BDTA 3KLHA 4GWKA 4YO8A 4F8YA 4HQNA 4U3JB 2SKDA 3SIPA 4YRKA 1VPVA 5GGYA 3W79A 2NTNA 4Y2RA 3NDBB 2RUSA 3MLBA 3I8OA 1ZBQA 3UFXA 1C7JA 2DRDA 3ZWMA 4NFLA 2NR0A 1CR0A 2W1BA 4HRAA 4Q3OA 1SVMA 1L7XA 1HZZA 3QFWA 4MW9A 4ZO7A 3R3TA 4TXNA 4K4WA 4WIAA 2WWVD 1RT1A 5JHHB 5JQGA 2DEJA 1V9CA 3WQSB 3T1OA 1Y63A 4ARSA 3QVGB 1E2BA 2AJFE 1J2RA 1HWIA 1AE1A 2R97A 3X1JA 2FZCA 1T8UA 1U3GA 5BJRA 3MGAA 1YZYA 2QI9C 2CXNA 1J42A 3ACBA 3FROA 4JIMA 1N6LA 1G6HA 3MPWA 3TW8A 2B7BB 2EG9A 3CCQS 1PS0A 2YWDA 4EATA 2GF0A 4TLQA 2JRCA 1LV7A 3GP5A 3THTA 3AI2A 3SQWA 4MP6A 1PNTA 5KTRA 1V47A 2CJWA 4GZ3A 3NCRA 4G23A 2ZH8A 4ZV7A 3X2FA 2CNNB 3QYYA 1EWKA 1K1EA 2VHVA 5D5QA 2R7XA 2P6SA 1FUYB 4WKCA 2M1ZA 2CCJA 4JI0B 4I4TF 5ALJA 1IQ0A 4U2KA 1Z45A 3VX4A 4IFTA 1AKVA 2VZ8A 2QJOA 2FKNA 4U7HA 1F06A 2AT1B 2R44A 1SOVA 2JAQA 2G7MC 3O92A 5JAZA 2PUFA 2CNKB 3CINA 4I3FA 4B3CA 1S6PB 2PGIA 3F9IA 4Q4CA 4JYZA 3B3GA 4ZPXA 1NSAA 2YASA 4IPTA 2IV7A 3PU6A 2J9EA 1XJWA 3W9IA 3W3AH 3WIUA 1BCRA 2JDID 5JS6A 1JJFA 4KMSA 3AWIA 1P4RA 4QLBA 2XOKD 3G8YA 3OECA 3CT9A 1RP1A 5JDIA 2C1EB 4LF7F 4OBBA 4PFJA 5BP7A 2WYUA 3W7AA 2KM8B 3CH5A 3BDEA 4U2BA 2DHDA 4UDXX 2P79A 3PL1A 3O0DA 5CLJA 4BC9A 3U9LA 1TLTA 3E4DA 3IUEA 3GWCA 1H2AS 1NDPA 2P6UA 1T11A 5I48A 4AYXA 2JRLA 4OSEA 4ZAZA 2DY0A 3UO0A 2XDWA 1P5HA 2ZE2A 1ORTA 3TIXB 3DF9A 4LAFA 3HHLC 1MN9A 4XOUA 3A70A 5DIZA 4Q34A 1VPLA 2JA1A 1EYZA 1TUEA 4XX1A 4XZ3A 5K5EA 4YI5A 2YWKA 4N8NA 3VV2B 3AB2B 5BQXA 3UMRA 3RR8A 3S1SA 3RIMA 2IVMA 2O2YA 1VRTB 3K9LA 3HJGA 2PG3A 3DNCA 1IJFA 2W93A 5I42B 5A03A 4UOCA 2IW1A 3B6EA 1IEWA 5HHTA 4BP3A 2PANA 2V4UA 2Q1UA 3QPDA 1VHFA 3ENQA 2WQ6A 3LCCA 2X42A 1IYZA 2JJ2A 4MP8A 5J5VA 4DSTA 2Q9UA 1QE0A 1XK7A 3M2VB 2WJ3A 4GKJF 3FSGA 4W1SA 3NXKA 4L72B 4B6JA 2X3FA 1T29A 1UAGA 3K2YA 3V80A 4KXNA 1W44A 3S5JA 4J0IA 5ECGC 1EFRD 1NUPA 3BSOA 5I3UA 3WRXA 3RD5A 2HNZA 3IPRA 1PDVA 3JQBA 4L07A 1WXFA 4ZHQB 4CNQA 3A6JA 2FFJA 5D85A 1J9EA 2Q0XA 3MFQA 2XBUA 4O3NA 4KWEA 2ZYRA 1LDEA 2B8NA 4ESEA 4YDXA 4WLUA 4B6QA 1BVYF 1MO2A 3MUFA 1CVRA 2OXFA 3TAMB 4BQQA 3K09C 5IDVA 2VBXA 5HKBA 3FLAA 5IPFA 1G42A 2OA0A 1K63A 1PAUB 4M5HA 5IJ9B 4KNWA 2HYIC 4P08A 4JB8A 1KJJA 3BT7A 3CLUD 4JI4B 3R5SA 1P17A 3O74A 2X76A 2ODPA 5A3VA 2VHTA 4R9UC 5CBKA 4DL7A 4CMBA 1G6BA 4USMA 1ENPA 4G0ZA 1KEVA 4ZP6A 3EDMA 3N2KB 5LP6B 3N74A 3S27A 2NVOA 3JASA 5DO9A 3Q8WA 1QKIA 3C2QA 3F46A 2H92A 4WNYA 1PEAA 4EG6A 3SKXA 4IG0A 3SV3A 3M8KA 2IXTA 1ECJA 1CQWA 1VJWA 1UWVA 3KR0A 4HXYA 1RBZA 1GZ7A 5AW3A 3WQPA 3MWLA 4Z7NB 3BSWA 2A2CA 2J9YB 3R09A 4ECYA 1IUNA 2X6TA 4CO5A 3V2HA 2WU4A 4DV1J 3LY8A 2GNKA 3W8DA 3JQAD 3D81A 2EJBA 4Y2PA 2FVXA 4LF8F 3KJNA 2BGGA 4O0MA 3T3DA 4Q9JA 1V8FA 4N48A 3QU9A 3QZ7A 3H42A 1B41A 2I8EA 1QQ5A 2VG7A 2AX1A 1CBUA 4D4GA 1H69A 2HD4A 4OHRA 3VZRA 3IERA 4LTMA 3HB1A 4LJYA 2GN4A 4N5IX 3FPCA 4FN5A 3L8EA 1PCXA 2V7XA 1GX6A 3DD5A 2QEXS 2DKOA 1E1DA 2FJBB 2JVKA 3J81j 1IDOA 4ED4A 5CA1F 2G0CA 3GUZA 3MR5A 4V2UA 1GNSA 3NHKA 3ROXA 3RWBA 4BASA 1P1TA 2NO5A 4LXIA 3DUFB 4YHHB 1XZLA 2ADMA 6GPBA 4TT3D 5HNKA 4YUVA 5F98A 4JBGA 2PUGA 4NSNA 4DUYF 3L6RA 4AIRA 4Q6BA 2CUZA 1Z2ZA 2D7JA 4ND5A 4BO7A 4MCAA 3IQXA 1ZAYA 3L04A 2EW8A 3UXEA 1JRLA 4ZPDA 4I5DA 1CF9A 3Q8UA 5D3QA 2XYGA 3PFBA 4JA2A 3HLTA 3AHIA 1YCFA 2QN6B 4RSGA 4G26A 4GRSA 1U3UA 2MQOA 4F84A 2W6ID 1EG2A 5FJJA 3HV0A 4GQIA 2G0TA 2DNMA 1UM8A 3CNQS 1ZGJA 7ADHA 1KO4A 5HI7A 1U9JA 1XNRB 4IQGA 1IQRA 5DF1A 3OZWA 4TV8A 2FSVA 3UUWA 4YUAA 4HVZA 3OW2R 3NVDA 4Q8EA 1IQTA 3RVKA 1F2TA 1YBAA 3D3WB 3GILA 3CO9A 3CGWA 4LFCF 4HXGA 2O48X 1EBBA 4AURA 5FPKA 3IURA 2UUBB 3EXHA 2XM3A 2UYYA 3SLGA 3ADBA 1P4HA 2XKJE 2VTBA 2BFWA 4BJ6A 3GLHB 2QROA 3SOPA 1UM9A 2BTQB 2IYOA 3TTYA 4ZJYA 4ALZA 2NO0A 1S1CA 5BWMA 1EA7A 2V5HG 3DMJA 2DH5A 2XSZA 2DNZA 1BEZA 2V69A 1MW7A 5DI9A 4CM4A 1D6NA 5B36A 3WAKA 3DRRA 3BG5A 3AW8A 5AXNA 3OT4A 3P4YA 2LFVA 3RE1A 4H4OA 4KXQA 5JEDA 3C4VA 5I3PA 2DNQA 4F36A 1L9KA 2WZQA 2C92A 2HIAA 4JOQA 4M7PA 1P2SA 3AOGA 4R2HA 1YI2S 1YQGA 2D2IA 4GBJA 4P5EA 1H1DA 3NEPX 1ACMB 3DLAA 1PG0A 2RAFA 2DKNA 1X7VA 1DC8A 2ZW9A 1RNLA 5CBPB 3F49S 1X0FA 3DE0X 1LA2A 3R6LA 1P7ZA 3IDSA 4O59O 4ID5A 1Y3HA 3N39C 4PXSA 1M83A 3FDXA 1S9GA 3RVOA 3P52A 2VPXB 4ZCMA 3ZIAA 3C7KA 1RTZA 1OJLA 3PRHA 2GPBA 1ICEB 2GARA 4IHKA 3P5TL 2Y9MB 4HUJA 1QAQA 3PQFA 1C14A 3PZRA 4U7FA 4MIOA 3HZRA 1R43A 3OD2A 1GPLA 2Y6UA 4MDHA 2NPIA 3FTCA 1WPRA 1G4UR 1UEXC 2ODTX 5IT0A 2C7OA 2OXIA 3AQPA 2OBFA 4KJIA 2I4IA 1JX4A 4ADSG 1XDBA 3PKJA 3LL4A 1UDAA 2IM1A 3B89A 1QSGA 3OI7A 1Y89A 5JR3A 2QYSA 1UIMA 3H6KA 1GSOA 1OZAA 2AYMA 4HDKA 1TEZA 1EGAA 4ZAWA 4WFIA 4EA6A 2I4MA 1BDMA 4RA9B 3MECA 1X4GA 3W2WB 4DR4J 3EQ8A 2W5UA 2Y68A 1RPTA 2YNFB 5KG7A 2H07A 4R1QA 4NNJA 1T5IA 3OJOA 5KPDA 4X97A 2YR0A 4CNBA 3JWJA 2JD0A 1S9HA 4WZAB 2OQVA 5FBWB 3R40A 1TT7A 2YC4C 2CL5A 4PWUA 3ENWA 3R8CA 1N5VA 2RU9A 4QELA 3PYGA 1MB0A 4BO2A 1DC4A 3K8OE 5J1NA 3TEHB 2A88A 4JHXA 1TQHA 2KX7A 4D9GA 3WLTA 4JLMA 5ER6A 5K7SA 2F3UA 3HA3A 4DR5F 1AYEA 5BNZA 4YAFA 4RL6A 1Z39A 4D79A 2DT5A 4ZGWA 2BSQA 1GVHA 3ZCRA 4DR7B 5JTUA 2QZPA 1FU4A 2AR9A 3E15A 3KQVA 5BNIA 2IJRA 1O97C 2Z56B 2HK6A 5H70A 4KMOA 1NV8A 1Z2EA 3PC4A 2I1VB 1XMXA 4ZOBA 1NVVR 4C76A 3T7IA 3UQYS 1D2HA 4E2FA 2BH2A 1LWFB 2C7RA 4P10A 4AT1A 2ODBA 4HH3C 4XDZA 5CG2A 2V34A 3KQLA 3TZQA 4HWOA 3AEZA 4BC1A 1C0TB 4U96A 2A0KA 1PEYA 3KFXA 2R7UA 2XTNA 3NIGB 2VQEB 2B4VA 1P9YA 1QDUB 3ELYA 1Z5ZA 2CT8A 5C8XA 3VDXA 4DUZB 1SO8A 1HNXJ 3THSA 3CMES 4DREA 4LZNA 3RHSA 4ER5A 1WLYA 5TGDA 1PKEA 1OILA 3CF0A 3VU9B 1T4CB 4BCAA 4NOMA 5A5DA 4HNUA 1PFKA 3FYCA 5HBRA 3BMOB 3U1MA 4XASA 4CTNA 2VICA 3KBOA 4MEJA 2G82A 1W75A 2G1PA 2IPAB 3UVJA 1XMOB 2QLFB 4H3VA 3T5LA 3FKSA 1JVBA 1XRLA 1DFIA 1U0LA 1A7KA 1ZP6A 2PV0A 4WRRA 2AKYA 4PTZA 3IKTA 3T4UA 2YXEA 4ZANA 4DL9A 4FE3A 4INAA 2CJXA 4HDMA 2HBYA 1LLDA 3NS5A 4DLZA 3GYBA 3H9CA 4U39A 4KPUA 4MS3B 4DDTA 3KG1A 2REOA 1FFAA 4B7UA 2QRZA 3FUWA 4CUKA 3AK4A 2XRZA 4I50F 1WORA 5EXSA 5IX8A 3OEHA 2Z58A 2Z4PA 3IMFA 2W9XA 1GPNA 5DWVA 3QMMA 4AMVA 2IGBA 3GY0A 4CWAA 3WFJA 3M9WA 2PKCA 5CT5A 4W7HA 3WZMA 4RW7A 2QOEA 3SC4A 3L7CA 5AVOA 2C2WA 3BIOA 1TVKA 1OTYA 3RANA 3OJEA 5J59A 4ZO4A 1PIEA 5CLFA 2JRSA 4OQJA 4DQQA 4MGYR 4WW0A 5DTEA 5AT1A 3I4HX 5IT4A 3B20A 1VCMA 1TIPA 2EFDB 5FNVA 2BEJA 2CEAA 4X62B 2NIPA 4JYMA 5A6VA 4OXXA 4C8NA 4JVMA 1E9SA 4GVBB 4A6PA 2DNGA 4M5LA 2ZH5A 1C9YA 5F7ZA 2BFDB 4FOTA 3HD1A 5IANA 1F12A 2W2OP 3OXFA 1C1CB 1XCJA 4DZRA 2WHOA 3GI1A 5AVZA 2YY7A 1QUPA 3DOIA 2QG4A 1ZOPA 2CYAA 4O2AA 4YRPA 1WWHA 1TIBA 2X6RA 3T95A 5KOHA 2DC1A 4D4LA 2WKWA 5FBZA 1KZ4A 2DNPA 1GR0A 1W76A 2FZKA 1KFSA 3WNBA 4JC5A 4JI2F 3Q3VA 3VVMA 3W2EA 2QZSA 2R7SA 4ALKA 5A02A 1UWAA 1TMGE 2IFXA 1EB8A 1XX6A 1V9SA 3DZGA 3COZA 4YP5A 2QXUA 1SXHA 1S1VB 5JAMA 3FFIA 1VL2A 3H9GA 2VZ9A 3L8DA 4EK9A 5CHYA 1A72A 2QMQA 3EZ7A 1YU9A 2A58A 1VL0A 1AKNA 1Y6RA 2VUHB 4NU8X 3Q23A 2E29A 4YT2A 1ESCA 3FVVA 4UU7A 2F8LA 2E5JA 2XYVA 1C3VA 1XCBA 2IEBA 3VMMA 2P9YA 4EFMA 2Z2XA 3QOXA 3M6WA 4CT8A 3D6UA 4AZWA 4NNOA 4EY4A 2ZJRQ 3WDLA 4L2IA 3UG7A 4UUAA 4G63A 3EVGA 2WIFA 3F1KA 4HI0E 4R31A 3DSRA 3B51X 1BROA 3R6DA 5CFLA 1MFPA 2AN1A 5CLLA 4LOJA 2BKNA 1XPUA 3C5WP 3T3EA 4IR7A 4DLTA 4WLNA 5CYGA 2I4LA 2EGUA 3AZPA 3GG9A 1MB3A 3HPOA 2AIRA 1C9KA 3PD7A 1TKZA 3MUEA 2QA1A 3A4TA 1MX9A 3AEKA 3SBMA 1W29A 1N36J 4EPXA 3DNPA 5EIFA 3BE8A 1RIFA 4UDOA 3O4FA 5DSXA 4X8MA 1JIIA 2BSAA 2ICAA 1DE0A 1LUAA 1WSBA 3KLGB 3KDSE 4YQFA 3T5MA 3CWJA 1ZNXA 1R66A 1A8HA 2ILYA 4GSYA 3J81U 4Z6KA 3LCJA 3BKTA 2QA4G 3BJIC 5CA0A 1NU6A 5C42B 3II6X 5BW5A 1ZM2A 2H51A 1JYEA 2O01C 4GMDA 1DURA 2WKQA 3W65A 3QKSA 4FI3F 5JQWA 3GA0A 4B9SA 1J8DA 3DBOB 3USZA 1QIHA 4GWGA 1NZ8A 5HATA 3TJ9A 5CXUA 3Q89A 2J0XA 2ZYAA 2H4YB 4OMFG 2BE7A 1YHYA 5FOSA 3R74A 2B98A 2NUTA 3L0YA 3FUYA 2BDPA 4OMUA 5HGXA 5KFXA 2V7WA 1JXAA 3C16A 4HB2A 1EH5A 2YV2A 1XCPA 1JEQA 4MI9A 4DJAA 5EAIA 3T9AA 1UBUS 1UINA 4DV3B 4HFMA 1N32F 1RZVA 1GDTA 4QU6A 3ANXA 5TGZA 3JD0A 1HPZB 2QUIA 4ES1A 3CZ9A 1J6UA 4A0GA 3R3VA 3COJA 2GHQA 4M87A 1CNMA 1XKLA 1CLEA 4Q19A 2AVDA 5ALNA 3VO8A 1Z4MA 4AZ3B 3NWGA 3HZHA 2CHQA 4ENUA 2H8KA 1TCUA 3R20A 3AFHA 3QEBZ 2B4OA 2D1CA 3VKUA 3PUWA 4IV8A 3D4PA 4W1QA 1VC2A 2ONKA 3KUKA 5HX7A 3PX0A 5DJ5A 2F4VB 4L5JA 1G17A 3U56A 2HIGA 4AL5A 4Q9DA 4CH7A 3A26A 4Y9SA 3PC7A 3BBFA 4P33A 2QGZA 2PGCA 5AHRA 2WZDA 3GQBA 1RT3A 4RK7A 3U4MA 5CDTA 3VR5A 1AUQA 4MFBB 2AYGA 1M1UA 5C52B 4ILMA 1FMFA 2ZWIA 5CLIA 1ZMXA 4ZDJA 1RAFA 1WKCA 3IKVA 3KV1A 4U4AA 2OVFA 3EJWA 2MSWA 5HP4A 2B9XA 4BQRA 3PXEA 1N2EA 1MNAA 2HJVA 2ZEJA 4IEIA 1HBOA 2QMHA 2OPHA 1EFPA 3OHMA 1EVZA 1QNFA 2REQB 4TUYB 3MMCB 1EAYC 4HBGA 4UHBA 2Q7OE 4KIWA 2P6MA 2E4WA 5GTDA 3E8OA 3NUQA 3K0BA 1TUWA 2FWPA 3FBGA 1DO8A 5C25B 3T5DA 2AUTA 3DDIA 1NB7A 2VSOA 4W5OA 2RIJA 4HLCA 4O2BF 3IV6A 4LZJA 2Z2YB 3G86A 1VL8A 1QG0A 2BEFA 2RUGA 2EC0A 2OV4A 1NSPA 5B3KA 1C1XB 4NZ6A 4WFQA 5ARCA 3EPLA 3PIPQ 2PX3A 4YRRA 2WZBA 3U1BA 4BS9A 2Z8YM 5L38A 4X94A 3CCZA 4AROA 3Q2IA 5C31A 2NVUB 4C7OA 4A8YA 1FX1A 4RVGA 1NBOA 3L7OA 4A8WA 2NP6A 1WVMA 2PQ6A 4ELVA 3D4IA 1C8VB 1I4EB 3LQRA 1FNDA 3M30B 3LUFA 3I0MA 1PSDA 4CLOB 3IE1A 5FHRA 4KRFA 2XSJB 2J6CA 2O8BB 2XI3A 2IHR1 1KJ8A 2J41A 4Q02A 5BVHB 1RJJA 1DIOB 4BMNA 3AVVA 4KFUA 4MVJA 5EUHA 2WF9A 1UJBA 4U5QA 2Q2QA 3UWKA 1TUBB 4RWZA 1CJCA 1L0BA 1NK7A 5DT9A 2IFTA 1FFXB 5ETRA 5IUNC 1OJ7A 3DT8A 1W87A 2IYUA 2MSLA 4Z4CA 4CM1A 4M8LA 1NE7A 4MCIA 1WXHA 2B5VA 1Z6YA 5IHPA 3P9PA 1K5HA 5ICFA 4LV6A 3AY0A 3IHKA 3NG1A 3ZY4A 4IF4A 3KP1A 6REQB 4U8HA 3VR4A 2HA6A 4DXLA 3N8NA 3MPVA 4I1OA 2WW8A 3PPVA 2XF8A 3GYXB 3V9PA 1EJ2A 1YRAA 4FMCF 1AS2A 1YB5A 5H3HA 5AIAA 2GPJA 4F0KA 3ME5A 3AM3A 3ZOZA 3VU3A 1T0UA 2BR0A 2ZT8A 2KT3A 4YRQA 2QYOA 3J81A 4XVRA 2P3SA 2J9RA 3JWGA 2YVQA 1ZH6A 4D56A 2CV2A 4WOPA 3SHWA 2V6FA 3O1IC 3QVKA 1LBIA 2J9FA 4DMCA 2EP5A 3MELA 3UB3A 3GCZA 4QOGA 2C0CA 4MVWA 2Y67A 2YYSA 1X1AA 2FX2A 4FZ5A 4NRDA 4F1KA 4P3YA 3RAQA 1RM0A 3LF0A 3B36A 4DJFC 4ZPTR 1RSCA 1USGA 4QPXA 2R11A 1HE1C 1UODA 4MLDA 1AB6A 1IHXA 2GJFA 4M4SA 2I6XA 1LJ8A 1MLAA 6LDHA 4OFZA 2GCOA 3FKSD 2J8ZA 1G2IA 3ANNA 4B3RB 2LDXA 4AG3A 3PF9A 1V3UA 4NYJQ 1II8A 2DR8A 2I3AA 5F0WA 4GX2A 3CJ5A 3PO4A 2XZTA 2KSQA 5REQB 3QG5A 4Z3OA 4G25A 4Q1BA 1NDLA 1AZTA 2PQMA 5FPTA 5BV1A 2MOKA 1KTQA 3DE5X 2X0JA 5HQJA 5AUNB 1YZUA 3UENA 4OJ1A 1T43A 4LF9F 3GJQA 3CVWA 4RQBA 3UT5B 3OEHD 6YASA 4F6RB 3ONWA 1AUSL 3R7LA 5KG0A 3ZGZA 4Q16A 3EPIA 2QN8A 4KWCA 1IKXA 5AVRA 4OHMA 1WKLA 2O8VA 3BQ1A 1VS3A 4DV6J 3BYRA 1KPHA 2OMKA 2WVBA 3D0QA 1YJAA 1HGXA 2CDRA 1TC1A 3LP2A 2XYHB 1EVLA 2FD2A 1R27A 3M8QA 3QY0A 2GCNA 3QBCA 1RT6A 1E8DA 3BQMB 1NF9A 5J2UF 1I7LA 3KUDA 4TZ0A 1QB7A 3BC1A 4JXJA 2HHJA 1KFDA 3SE0A 3CB4A 1W2HA 2WVGA 3NIWA 2ZNY