2F8MA

Ribose 5-phosphate isomerase from plasmodium falciparum
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
237
structure length
237
Chain Sequence
HHHHMDSLKKIVAYKAVDEYVQSNMTIGLGTGSTVFYVLERIDNLLKSGKLKDVVCIPTSIDTELKARKLGIPLTTLEKHSNIDITIDGTDEIDLNLNLIKGRGGALVREKLVASSSSLLIIIGDESKLCTNGLGMTGAVPIEILTFGYEKIIENLLKIYTLKGCTYKIRKRNGEIFITDNKNYIVDFFFTEPIQDLLETCTRIKMTTGVVDHGIFVNMTNVALISKHDGTVLTLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ribose 5-phosphate isomerase from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords ribose 5-phosphate isomerase
total genus 77
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f8mA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f8mA01
2QRRA 2PA3A 3W7BA 3E7FA 2RE1A 3UW1A 3HN6A 3BXFA 3CEDA 1PBTA 5HJ5A 3DHWC 3LUYA 3BXEA 1Y7PA 2QSWA 2OKGA 3TUIC 2LVWA 3KV1A 3N0VA 1YBAA 1UJ5A 1RWUA 4L4YA 3AB4B 2RI0A 2PC6A 2BKXA 5JJBA 1CD5A 5IT4A 3OFEA 5IS2A 2BKVA 3K5PA 3AAWB 3LHIA 1FQOA 4L4ZA 1O8BA 2ZHOA 2J0EA 4TM8A 3ICOA 3CSSA 2P9CA 4R9NA 4GO7X 1FRZA 2P9GA 2WU1A 3P96A 1VL1A 2R5FA 3IXQA 2NYIA 1NE7A 2LQJA 3E15A 4L51A 2MDAA 3TUJC 1DEAA 3EFBA 3LWDA 1LK5A 2FGCA 1FS5A 2H9ZA 1KS2A 3AB2B 3TX2A 3O1LA 3IBWA 2JOQA 4L50A 2J0XA 2J0WA 2I9SA 3ENWA 1UJ6A 2DTJA 3TUZC 2F1FA 3MAHA 3NWPA 1YGYA 4R7TA 1HOTA 2GNPA 2QMXA 2W48A 4L5JA 1M0SA 2DT9A 4LUBA 3LOUA 1HORA 2QMWA 5FIIA 3HHEA 2KO1A 4GO1A 4OQQA 4OQPA 2RQMA 1FS6A 3ENQA 3EB9A 3MWBA 3U7JA 3BXGA 3DHXA 2CDQA 3DC2A 3S1TA 4L5IA 3MTJA 2RI1A 3OFGA 3ENVA 4X84A 3BXHA 5T41A 2F8MA 4NMLA 1Y89A 5IT0A 1PSDA 2JHEA 3NZEA 2P9EA 4TM7A 4GMKA 3L7OA 4PWUA 3OFFA 4IO1A 1FSFA 1LK7A 1XTZA 1SC6A 3OFHA 1ZPVA 2O0MA 3DDNA 3NRBA 2RQKA 4GO5X 1LKZA 1UJ4A 3OC6A 1U8SA 1JT9A 3OBIA 3CH7A 4M8LA 3KWMA
chains in the Genus database with same CATH superfamily
1S57A 2Z0GA 4MFBA 3SY8A 5DOZA 4DXAA 5I45A 4QU0A 4EF6A 2BEJA 1YRWA 4YPFA 1GUAA 1B99A 4YRGA 4DYHA 2XE8A 1UK9A 3GFPA 4I7FA 3RRMA 4DQSA 5ERXA 3V2GA 1YBTA 1HL3A 5L1JA 4MVJF 1T2AA 4Q16A 4K88A 3ZJ4A 5I8ZA 1EWVA 3WNCA 2FXIA 4RMHA 3O5AA 4M0MA 4JELA 1X3SA 2OA0A 1P4AA 5A7GA 3COVA 4H7HA 1J90A 3H18A 3HKDA 1VECA 5GGYA 5K3EA 3U1BA 4NDZA 5JCOA 4CO2A 5E9QA 3IX7A 3DPIA 2HK3A 3C6TB 5FL7A 3NTXA 4B9LA 1TQLA 4E6PA 5C5DA 4QBIA 2ODTX 1C2TA 1JWBB 4RHEA 2QIFA 3UJ3X 3CD7A 4IINA 4DWJA 1RHRA 4ODIA 2QV0A 4G9BA 1GPYA 2QX7A 5ILQA 4TS9A 5LJIA 4YCDA 1EUCB 4YB7A 3U44A 4ZJOA 2H1CA 1X77A 3DDNA 2B99A 4B2YA 3H7IA 4GM4A 3QFHA 4NFHA 1NFRA 1JLLB 5MF6A 3KXPA 4WK0B 4KQGA 1W5FA 4D8WA 1YDFA 2YJ4A 3RHFA 4DZDA 2IHJA 3IP0A 4EAQA 2YXBA 5F2OA 2QR2A 5AVUA 1PT9A 1MJ5A 1PJQA 3LP6A 3WGJA 4ILMA 1QH8B 1O03A 4LWZA 1LEHA 3AR7A 3LP0A 2IYLD 2RI6A 4QOFA 2XNJA 1IJBA 4CCWA 2FEPA 3UDCA 3R7BA 3U0VA 5SV2A 5EGNA 1CQZA 4X44A 4Q1EA 2WSIA 4DU7A 3PSAA 2YWDA 3PC4A 4N39A 4XX1A 3A70A 5FD1A 5KHLB 2E4ZA 1HG0A 2KJQA 1FS6A 5F5XA 1OIWA 1NULA 4C0SA 3CE9A 4NKRA 1SD1A 2O19A 2PJZA 3OZBA 3H2ZA 1H2UX 2HFUA 3V8QA 3W5BA 1P4RA 3QT8A 4QLAA 2EZ4A 5J5CA 4J0JA 1SXJD 3DRSA 1E8NA 2GX6A 3M6XA 1MMLA 3DZ8A 2BD0A 1EWQA 2ZH6A 2A5GA 2XZDB 2WQZA 1DAOA 3IFSA 3TL6A 2X4DA 1TYDE 1J6UA 2DGSA 1MQSA 4RA9B 5DGDA 5ETRA 1PV4A 3DBLB 3DWGA 3MBIA 1MZPA 3AL0C 4JQOA 4C43A 2OXTA 2I4NA 1L5OA 3W9SA 3IQZA 3DZBA 1RWXB 4JXJA 1WHTB 2Q7XA 2ZSJA 2WJJA 4FC7A 3LQQA 2J5RA 1WUYA 3T61A 1F9EA 1RA6A 2HZ7A 2XNDD 4CKBA 4WUTA 2OPPB 2OPBA 4BQEA 4PYJA 1Q91A 5G53C 4C3LA 3BFPA 3N2GA 5CD4A 4E21A 4Y28C 3EDQB 2K8GA 4L4UA 4I6AA 2FHSA 3MT8A 3K6RA 4EF4A 1FK9B 5IMBA 3D7NA 3UTDA 2QLXA 3A31A 4CCYB 1GLNA 4GS5A 1IXKA 3I1FA 1ZGAA 3SEQA 4JUBA 4NLLA 2VQFB 2R8EA 1R8PA 5KG6A 3FVVA 2OCLA 2BM0A 3IJRA 3CN9A 2ICAA 1K3TA 2GJ4A 3PKMA 4I6EA 3VAMA 4EG5A 4C6TB 1CY8A 1SKUB 1C4AA 3SS9X 3BJIC 1A9ZA 5CA1B 3WL5A 3K20A 1W4AA 3KLBA 1YJWS 1QGDA 4JI5B 5JAIA 4BNUA 5DYTA 1FTSA 1AXQA 1B8UA 3EUEA 1GKLA 3NTQA 1VYAA 3MRXA 4GSYA 2Y0PA 5AJTA 4HN9A 2JLEA 1O94D 4KT0C 4LYDA 4MUBA 4BHTA 4S0XA 2UUBB 1HMPA 2BGTA 4E2FA 4TTQA 4UKDA 2UXBB 2PFGA 4X8MA 1LWEA 4K9LA 4WV3A 1O89A 3AR3A 5HWSA 2HFJA 2O3TA 2B8EA 2PRIA 2QSUA 1KY2A 2QMXA 1GU0A 2X0RA 2APJA 5FPPA 3K2YA 1VJ5A 2JGMA 1X5PA 4OOEA 2HS4A 5AYVA 4MMZB 3URKA 4PS0A 1TJ5A 4MR8A 4C8NA 3OJXA 4U6QA 3M70A 3EZGA 5ALVA 3R5JB 2BACA 5FUVA 1M8GA 4H9GA 5JVHQ 1NXWA 2ZULA 3AUFA 3FCYA 4EHLA 2YNGA 3WRWA 3CIZA 1YHYA 3MMSA 2ZC4A 1U9YA 2A35A 2DQSA 1MN7A 3QFCA 4JR2A 2IGTA 1HYHA 2FLNA 3SQOA 2BR4A 1QGUA 1HLWA 2B5OA 1VBXA 1QTNB 3KALA 4IOMA 2A9PA 4IDKB 3CCLS 4B3TF 1TD1A 4TVAB 2OBXA 3DBVO 4JX9A 1KFEB 1UUFA 1NR1A 4AU1A 5AJ3J 1P2BA 1GPJA 3O8WA 5DE3A 2EZ9A 2QLJB 1QP8A 4K9QA 3CW2A 1GXTA 3RB8A 5LBUA 4WK4B 2I80A 3GT3A 4WXRA 1U25A 3HY6A 1RJFA 3JVVA 2PWBA 2XZDA 7FDRA 3A9TA 3PC2A 3B9QA 4MKRA 4R8RA 5CAAA 4F8RA 2WYOA 4X41A 3BPDA 2Q6CA 3JQAA 3C7DB 3ITHB 4HSGA 5E1OA 3L04A 4RMIA 3O6QA 3LA8A 4ZCKA 1K6MA 4DQVA 2HRZA 4HT5A 2O48X 4YUXA 1E7WA 3GMTA 2QRQA 2Q3MA 2VP9A 3LIIA 1OXKB 2CCJA 1XVLA 2JAQA 4MV7A 1TM7E 4ID8A 3F3SA 4WK3A 3IEIA 1S2NA 3GLFE 2NO7A 1MENA 4LXGA 1JLRA 3ELHA 1YRXA 4G1FA 3Q8YA 3SYNA 8LDHA 2PS0A 5DHTA 1EIZA 4DEXA 3EVMA 3FWHA 3LLVA 2IBSA 3G4SS 4X1YB 5CT5A 1C9DB 4HC4A 2F9MA 3ANMA 2I6TA 3N3AC 2DM6A 2B8NA 3PGMA 4Z9BA 3IBFB 4TXHA 2RGCA 2TS1A 3PV8A 2DRBA 2GBLA 1FXUA 3DEAA 2OL4A 3CHYA 3QBTA 3OQNA 3VR0A 3E3OA 3PGVA 4J9OA 2DHQA 2VC0A 2WJGA 3RC9A 1YRLA 1M1YE 3DEJA 3LO8A 3UAOA 1OY9A 1AUVA 1Y3BE 1A2OA 4XM1A 3EAFA 2WP8J 1ISFA 4GR4A 1MVNA 4OA8A 4B80A 4X4UA 1S4QA 5SZTA 4MR7A 7MHTA 5L46A 1C1XA 1J25A 2EKNA 2FYXA 1KARA 2A86A 2QGFA 4BYGA 3P9NA 2WB4A 2FWJA 2DWPA 5CYQA 5B09A 4E7PA 4X2BA 1L5FA 1CD5A 3BMNA 3WLPA 3W79A 3VSDA 5B3AA 4AROA 1E96A 4WY8A 1SH2A 4G09A 1MABA 3AA9A 1W8IA 3EBPA 3NJ4A 2QOEA 1VDZA 2ZI5A 4JWTA 3HFKA 3OZDA 1WUTA 3TPFA 4QDXA 2OCGA 1VQLS 5JFGA 2PKQP 3R5JA 5K14A 3UXEA 1X4DA 2XWPA 5I7VA 2ZBDA 3UMRA 1C3XA 3NQ41 4C9BA 2XUHA 2IHYA 1HFJA 3UCGA 4MR9B 4KACA 4I2VA 2GZHA 3AX6A 2M6SA 1ZO8A 3EFHA 2ZSAA 1AVTA 4EB3A 2I65A 1N57A 5KOHB 2RF2B 4B81A 3AVWA 2O0MA 4RWXA 3NGRA 2ZZKA 3V4MA 2FQ1A 1CJUB 1P1JA 2O01C 2JAUA 3SG0A 1HNNA 4RJLA 1P2GA 1R50A 2DPGA 1MX1A 7MDHA 1TVRA 2GCNA 4MUGA 1XCBA 4RKWA 5D5QA 3FSRA 5LMNJ 3QPBA 2HLHA 4YN3A 1H05A 2YNMC 4N76A 4R8KA 1SVLA 4L7VA 4DMMA 5IVDA 3PRVA 2FMHA 3H1BA 3IKMB 5CH8A 3RRFA 1TGYA 1D5WA 3KMQA 2SNIE 4DR7J 4RHYA 3I4FA 1E9SA 1KF0A 2HMSA 1K1QA 1YQWA 2SBTA 4TRJA 2EQBA 5JH7A 2ERRA 3LT5A 4GPEA 1GNLA 1RBMA 3ITHA 2PAAA 5DM0A 4BX3A 2IRWA 5J2TF 3RASA 521PA 4LDQA 2FRXA 3AQPA 2KJVA 3HHEA 3OT1A 3EXAA 1ISGA 5GMOA 5D0RA 2O7QA 4U3JB 4OV1A 2CAJA 5EMMA 2HK8A 4ZU3A 4WNYA 3ROXA 5J47A 5CVDA 3K5MA 2JLXA 1KONA 4XUEA 2V7TA 2R7QA 1CUDA 2CADA 4LFBJ 3MMCA 4FX2A 3WWCA 2VFVA 2NADA 4DY4A 1Y4DE 5T4FA 3H59A 3NG8A 3PX4A 2FTKE 3ONVA 3TAXA 1PK9A 3AIKA 2EX0A 3VZHA 2ZKLA 5I8PA 1T9BA 2IYQA 3DCIA 3QFSA 1WEKA 5AICA 3AI7A 5LJ5Y 1FXRA 2QL7B 3WDKA 2FN9A 4EKIA 5AUQA 3LTEA 1FX0A 3NTUA 3WK6A 4MKAA 3NDIA 4ZCLA 5A7HA 4OPMA 2B92A 5HCUA 4NFLA 2LKZA 4WZMA 3IUJA 2O3JA 3WIDA 5IG2A 2CKMA 2VKZG 3LAWA 3T3NA 4GKJB 4BB9A 1F38A 3FI0A 2KN4A 2I1LA 3VNRA 1GU7A 3FAZA 5AHOA 1CS0A 1Q7TA 3O8LA 1VA5A 5E3RA 1NE2A 5CDGA 2E1AA 1ZZGA 1S1WB 2XGOA 2XITA 3PIDA 1LWXA 5M04A 5F23A 2W2NP 1JSRA 4XQ9A 3I9V6 2HAIA 1RPJA 5HE8A 5GOZA 1VFNA 3RYIB 3HKEA 1QNFA 3I45A 4RY2A 1RLDA 5BVGB 3I2HA 2PPLA 3W1YC 4N18A 2FWNA 5BPHA 4JI0J 1DO8A 3NOGA 3AOBA 2IK8A 4HVLA 8AT1A 4PS1A 2B4YA 2ZYRA 4IGIA 2QMUA 3ROPA 1JHYA 4ZA2A 1UPPA 1XR6A 3J80A 1Z4LA 4E6EA 1X9MA 3IOYA 1M2OA 1V2GA 1NMQA 2H1OA 4C6TA 2F3RA 2A57A 4CQMB 2KI2A 1SC4A 3HSSA 2QD2A 4L72A 3RUDA 1E3JA 1R0XA 3QVSA 5EIOA 3UJAA 1JEYB 3ZHBA 4XJTA 2HGNA 3W4IA 1HC7A 3TOCA 1UA1A 3HWSA 3JTNA 4P36A 4XSGA 1MSWD 1ZSNA 1B8OA 2PMFA 4YRPA 1U26A 2AUTA 3VPGA 3L79A 1CYDA 4IM7A 3RK4A 4C11B 2DGVA 4YJ3F 3PFNA 2IZ0A 3PA6A 1PGZA 1C4KA 5JANA 4EWTA 5SZIA 2HA4A 4BQOA 1E7SA 1F8GA 1OOEA 4TROA 1OX6A 3X3UA 2L9NA 5JDCA 1NQWA 1LPPA 4YACA 3C3LA 2PVCA 3IEUA 1XJ5A 4J4HA 4Q0BA 3OD5A 1KP2A 4N6GA 1FDAA 2NNLD 5C81A 2IJGX 2NXUA 2PSDA 3V8RA 3SQMA 1N2EA 4IVNA 1L5ZA 2DNMA 5JQGF 3SDEA 2QU8A 4FF3A 2XGPA 5JXJA 1EM8B 4Q4AB 1HE5A 3T5AA 2P2SA 1BW9B 1TYBE 1H6DA 1N2GA 3IRUA 2Z2YB 3H75A 4DRZA 1SHLA 2G1AA 4V0QA 4ZHQF 2FZCB 2KVIA 5KWJA 4MULA 4P32A 2QL7A 4RORA 2A9VA 4Z7NB 4U95A 2OLKA 3NAGA 5LNK1 5HO4A 2POKA 1GTVA 2FF7A 5DHUA 3DMGA 4FFBA 4KAFA 5EP1A 3D02A 3THRA 5DYGA 3DKKA 3UFCX 2GBFA 4FFNA 1LVUA 4GMFA 4DT1A 3N28A 3GF4A 1VHJA 4IG3B 1VQMS 1UDBA 4E4TA 3C14B 4YPOA 1TTHA 3U61B 2DHXA 2PUCA 4EVIA 4IYQA 5TPWB 3IIKA 2HH9A 3CEJA 4YQWA 2NAFA 3OBBA 4BQNA 1MN9A 3MQFA 1PTKA 3MINB 4KQHA 3SPXA 5C31A 4FLFA 1YCHA 1KJYA 2NYAA 2XMJA 2RAFA 2HZVA 3TGWA 4G4JA 3A1CA 4Z6KA 3D5MA 1YBHA 1P0QA 4RVSA 1GILA 1N8NA 4FDUA 3C48A 2IA0A 1A9PA 4KQMA 4CLLA 5IC6A 3E1SA 1SURA 2CLOB 3IG1A 4GRSA 3LW7A 3TFWA 2FR8A 2A14A 2MY8A 4URYR 1GM5A 4GXNA 3DOLB 3M4NA 1KYZA 1S2MA 5GQSA 9ATCA 1HA1A 1JVNA 3F74A 5EX3A 2DQ4A 3EUFA 4FZRA 5D4LA 1CRLA 5DGCA 1JI3A 3ND5A 2ZC3A 5KFQA 2VLIA 5IJXA 4P84A 3DYVA 3W6PA 5G02A 3SHOA 3C7KA 1J2TA 3ZCUA 2I9KA 1IN7A 1GNQA 3OE7A 1N34F 3H4DA 1W581 4DF8A 4MQFB 2IDZA 2HW3A 2IOQA 4E51A 5CYPA 2A6PA 4B32A 4NP6A 2E5WA 1V8BA 5FOWA 3NC4A 2EKQA 3ZC3A 2LR0A 3WLLA 2E1RA 3O4IA 3PQ5A 4OX9B 4MKIA 3H5XA 1S59A 1Y1QA 4X7BA 3GLGA 2HQCA 3CLHA 5K8MA 2XKAA 3RTDA 5TLSA 2V69A 4W82A 5FH9A 1B0ZA 1OB2A 5GGXA 3AV3A 3KOXA 2EJCA 3WGOA 2J6IA 2I29A 1U3VA 3TARA 5JSYA 3MM8B 3PYFA 1MNAA 1IXYA 4N41A 2YCLA 5A4KA 3JR3A 2XTAA 5FHQA 4QLOA 4JBIA 1GTRA 1T7PA 3T4XA 4UVGA 3NRBA 1ZZFA 1U2CA 4RSMA 3E3MA 3IA0A 4BBJA 2QT1A 4BNJA 4ESOA 2YL2A 3FYUB 4Z3DA 1CBUA 3V46A 1HFEL 4IRXA 5A9SA 4RS3A 3DUFA 2BH2A 4CMAA 3EG9B 2RKBA 4DS3A 4DFJA 2XCUA 3G2OA 4YGXB 2XMSA 2P6NA 5EJEA 4BLWA 1LNZA 4CLUA 3EFEA 5JI2E 2CVFA 2Q6KA 4RGBA 1GPNA 3ESDA 4NJOA 3ZW7A 4ZMSA 1AROP 3WICA 2DNKA 4WOJA 2JJ8A 3MEDA 3KJVA 1FVSA 3LP2B 4DR3J 2VJMA 1Q6ZA 5DLFA 3DFEA 2VPPA 2FJDB 2D3ZA 1UEKA 1NUUA 3ZZ0A 4A16A 1FESA 4KN9S 1UC5B 5JG7A 3RS3A 3TMYA 4G1UC 5HFAA 1HTBA 1IRXA 4YRLA 4JVMA 3UT5A 4OHXA 2Z95A 2G76A 2JHFA 1DC5A 3KC2A 5J2UF 2QLFA 1VG8A 5TQ0B 1NVUQ 2H3EB 2YXPX 3GCWP 4X00A 5HBMB 2DWQA 1PJLA 2WJAA 5G3YA 3EWAA 2X19A 4DUPA 4Q3NA 2UZ4A 3V55A 5GOTA 2UYQA 5T4HA 1RWNB 4YY3B 4R9VA 3I8SA 2IC3A 1WKVA 4HB2A 1ECCA 2XIQA 4OLHA 5CCLA 1FWKA 1OASA 4QYMA 4LRDA 5CVUA 1ACMA 1E6YB 2UUTA 4JUCA 5FI1B 4NBSA 1I14A 1OTXA 3U3ZA 1TW3A 4EJ0A 2YN2A 1EXMA 2BGIA 2BSAA 4MH0R 1EB0A 1FVOA 4JL8A 3KL2A 5LA6B 1I51B 2B6NA 2GXAA 3WYGA 4JJ6A 4NCIA 4B3JA 2WFMA 5BSVA 1P80A 4J0FA 3HNOA 4CIYA 3DLKB 1DXOA 1TO2E 3NUQA 3M8WA 3P2KA 3JVUA 4JI2J 4ED0A 3EDRA 1RWBA 3VGPA 2KB0A 4NMXB 1YRTA 5KTKA 3A9SA 3IAAA 3M5PA 1U98A 2XUDA 4NCBA 1GGEA 1YJCA 3DKPA 3AUJB 2RE1A 4PV7A 4MJXA 2HQ3A 4WFBQ 4MKYA 2B7BB 2KT2A 5H70A 2CPHA 2A0YA 3VV2A 1YNSA 1VI5A 3PEWA 5T3UA 3JWIA 2PZMA 1Y3HA 2WWFA 3WL3A 3R3WA 2EKPA 5ERGB 1CDZA 3OKCA 4PZPA 2YPYA 3S7TA 2H2IA 3QVKA 3RBVA 1CEYA 3J80U 3CZ4A 4DV7B 1KFSA 3UVJA 3DMPA 5LJ3Y 2IV2X 1WB9A 2JIBA 4Y2QA 4A5SA 4EG8A 2I9SA 2DRIA 3C5CA 4XWGA 1VE6A 4UUBA 5E3QA 2IIVA 2WG1A 4HH4A 1BU5A 3T38A 4RQUA 4KXYA 2G1KA 3NGXA 1FTRA 3KK2A 2Y8YA 4J3FA 1KETA 4KYTA 4JQYA 2CQ0A 1JX6A 3RSLA 3EGVA 1YXMA 5LR6A 4TY9A 1ZRHA 2PFDA 1REGX 2NZVG 1NBEB 1XMIA 3KDPA 3R24A 1HYGA 2CLMB 2SICE 2CJBA 3SKVA 3OFJA 3IT1A 3WMGA 1NK5A 3OZUA 5CX4A 1YZTA 3TQOA 3F0TA 1U8UA 4D4HA 5AH0A 5JNLA 4DBLE 2D1SA 3O83A 3D43A 3DLEB 4G1BA 3PHCA 5C7LO 3Q7TA 2VG6A 1OZ0A 4GR5A 5FOXA 5EN1A 5BV2P 2Z8ZA 4F84A 3N0WA 5F51A 3MTGA 1NBEA 3E3AA 2NTEA 4GLJA 3CG4A 3FDSA 2PE5A 2FX5A 2WJYA 1FRZA 1KTVA 3NBYC 4CCHA 1MWZA 5CG2A 3O82A 5JS6A 2ZJPQ 4DCUA 1QE3A 1YZ6A 2H54B 4UCFA 5GJBA 4Y6GB 4DADA 4AXJA 4DXDA 3GT7A 3A4NA 3AJRA 4QGGA 4PX2A 1X2BA 3SZGA 2Y05A 1G3QA 3SR4A 2QTBA 1M34A 4TMFA 4ZVSA 1TCCA 2QYOA 3T1YB 1T9KA 4CG2A 1KQFA 2DEUA 4X4QA 3HVHA 3CLUD 4OJKA 4MUEA 2ZZMA 2SKDA 2AWOA 1IBLB 2QD5A 1ZCBA 1RA7A 3F46A 2D06A 5FTNA 4L3VA 2W9XA 1XMSA 3AL3A 1T9HA 2DFPA 1H5UA 2H92A 5FR1A 1VMEA 4NCHA 4FS3A 3QJPA 5EMKA 1J00A 4PU0A 4USKA 3MF5A 2FYTA 3DSRA 1PV1A 3MELA 4S1TA 1OYOA 1WTFA 2DX7A 5J1SB 1NVDA 1IKWB 3AI3A 3KKEA 1WU7A 4GUAA 4O2BA 3CXCR 1GGHA 3S8MA 4TMXA 3JZIA 1JYEA 4UBMA 2OPQB 1RHQB 3KNAA 1GWNA 3T4PA 1WSRA 1S8FA 3AHCA 4KBIA 3BN3A 3VR6D 3M33A 2J6BA 4RKRA 4GI5A 3MEDB 1KR5A 2PFKA 4FGWA 4L6CA 3JQEA 4GEGA 1QYXA 3A8KA 1E20A 1GZ7A 4I36A 3WC2A 2N3ZA 2GERA 2EWWA 4OZJA 2QMYA 4Q3AA 2GVZC 3SYRA 2M1XA 4S0MA 1J42A 1FEEA 3K1AA 2BBSA 2HVZA 3QH4A 1HT1E 2X1LA 2KXHA 2KSQA 4UFNA 1FP7A 1RBYA 1UPBA 3AMVA 1GEEA 5EZSA 5HCIA 1DWOA 1HOXA 3FZBA 3D2AA 3BKFA 3OVMA 2X9QA 3BXZA 2Q2QA 3LUJA 2G2YA 1R37A 5E4JA 4HXYA 3KSBC 2UXCF 1K9MT 3CINA 2CNNB 1QOPB 5GAHU 3HBMA 4NOJA 4DIKA 3M2TA 3WFJA 4RVGA 2IYWA 4UNQA 4OHPA 1IZ0A 5C5EA 4FR2A 1D09B 4KVZA 2VRBA 5AMXA 1X15A 3RV4A 2CY0A 2AXEA 1LJ8A 4Z99A 4GHWA 3GQBA 4JJKA 4JUAA 5L8RC 3DMJB 3CH5A 3G7UA 4EM6A 1XNHA 2WWGA 5J4LA 2EZTA 1J0DA 2JGJA 4HDSA 2FQQA 4KK4A 3ZV5A 1YS4A 3W9YA 1PWYE 2VDOB 4AZTA 2OB2A 4K4VA 1Z0IA 2LMIA 4WI1A 2EZUA 1JAXA 1C1YA 4M2LA 4CR7A 2W1BA 2P1RA 3BGLA 1QQ6A 4L1KA 3GMDA 5ETPA 2I7VA 4LTNA 3RO7A 2CDBA 1YJ9S 1BUXA 3U7RA 1JW9B 4Q4JB 1U5CA 3OO1A 1Y1SA 4L76A 4EPYA 4YEAA 1F5CA 4ZVQA 2PT7A 4G6ZA 4OGFA 3ZBUA 2YZKA 1TM5E 1KIFA 4R68A 2Z4RA 2CZCA 4PZDA 1LWCB 3K5OA 3BN4A 3F73A 3ACDA 2BLLA 3LHKA 3C41J 1EVJA 1AGNA 2PUJA 4MYRA 3H5UA 3GLIA 2EJBA 6FDRA 4HDMA 3CH6A 5BSRA 1KHWA 3EHDA 3MS7A 2YVUA 4V1CB 3G2QA 5ARBA 2E85A 1T1RA 4I9NA 5J63A 4HWKA 3ZHSA 2F59A 2FUKA 3I0MA 1RT4A 9MHTA 2D4AA 4A46A 2BI4A 4Q45A 3O2IA 4U9HS 3G6YA 1S5ZA 1Z75A 1AHPA 3EIFA 3W7VA 2CNWD 3U17A 3CRNA 4USHA 3SCKE 2XTMA 3RSCA 3ZHCA 4F2DA 1XNJA 4A36A 1NDPA 3OJCA 4Q47A 5AXDA 1U04A 3QWIA 2FSIA 1TKAA 1Z8DA 1OWXA 1PR1A 4H0FA 4CQJA 1P0FA 4NJEB 2BHLA 2IVYA 2DECA 1I33A 4DR5F 1KZ7B 4K9SA 2OP0A 4UJ3A 1D9DA 1ZC3A 3OSZA 4WTYA 3QIVA 4EYSA 3WSVA 3LWMA 4AZ3B 3RIGA 2R7MA 3U13A 1FX0B 3DCNA 1KS9A 4NEZA 3HVJA 2XYQA 2JLUA 4E5PA 3L8ZA 2V8HA 4JIMA 1N9GB 3R2DJ 1M0WA 2AOWA 4ZYZA 3PNQA 1NA5A 1XJWA 5DSZA 4ZARA 4KGVA 2I1WA 4OSPA 1XXHA 4FYDA 2NREA 4GW3A 1N5YB 4BZQA 3LF0A 5KIAA 1AQIA 1D0SA 2RK3A 1Z38A 3ZU2A 3TM5A 2XMMA 3M9NB 2BZSA 1ST2A 5GAGU 1YU6A 2ZRFA 4ZC8A 5DLPA 5K09A 1S4FA 2BR5A 5KNDH 3VSAA 5I4MA 3G1UA 3RIMA 1LBTA 1YDGA 4OXQA 4S1VA 2WI8A 5JJLA 2X58A 3K5IA 1SQ6A 2MWMA 5C8YA 4YS2A 2VHUA 3DLKA 3BXEA 2MSSA 4Q4HB 4R2MA 5E6UB 1IVSA 3A6HA 1VLHA 2F8HA 2PO7A 3JY6A 2HCTA 3QJJA 3RS2A 8AT1B 1W26A 3I32A 4ZT6A 3RVBA 1C1XB 2I2WA 3I34X 3IQHX 5HSGA 4IMIB 1RTJA 4C6AA 5BY2A 3TUJC 1PBNA 1RXEA 4KPFC 2Y1XA 3L4JA 3M1IA 1S1TB 1HH4A 3GUYA 1WC1A 4EJSC 1QB7A 2Y3IA 4UMFA 4LGYA 4M5GA 2C5FA 1G2IA 1W36C 1S2GA 1XG5A 4WKRA 5EKUA 2CF6A 3HCWA 1FT8A 4WZZA 4YP1A 3VUFA 2NS1B 2IC5A 4LRQA 1QG6A 4IKOA 4AL6A 4JHLA 4ZQFA 4ICLA 3CPHA 1X94A 4P7TA 4QQNA 2HNBA 1L8QA 4MEAA 4TSRA 5C80A 4FEEA 1B3RA 1SHUX 2JBAA 3CUWA 4LFBB 4YALA 1RKBA 4PCUA 3U4QA 2C92A 4P4SA 4OFZA 4RXUA 3OM0A 1MW8X 1NATA 4EZBA 3ZLBA 3MM5A 2BTOA 1F1BA 3S1LA 4GBJA 4RSHA 1SXHA 3GG1A 2Q7OE 4FCCA 3OPYA 5TGDA 1LNQA 4F45A 1A2BA 4Q3CA 3AHHA 3NAMA 1VE9A 2BANB 3CTMA 1IHYA 4KXNA 3T5JA 3ABSB 1BQ4A 4Y9SA 2DLDA 1JXAA 3BGSA 3DGPB 3OTWA 1JDBB 5JIBA 1JLAB 5J1EB 2RCYA 2NLWA 1X5TA 2GNPA 4N5DA 4QBHA 4ZA1A 2ECFA 1SH3A 3FDJA 3CO5A 2QP4A 1VJDA 1WC0A 2CQHA 1V71A 5LMZA 2PU7A 3LCUA 4MW5A 1CJSA 3DS8A 4R54A 1T2UA 4H31A 1IY9A 2YVAA 2EWVA 2H3HA 3R3ZA 3IP1A 1YJAA 1CEEA 4EVQA 3S1AB 2G0NA 2ERXA 4L0DA 1I0IA 2DNPA 4N6OA 1ODKA 4N8EA 4K9RA 4KP7A 3FYCA 1DQPA 3C5EA 1LDNA 5JLAA 4Y2VA 4FPRA 4MVJP 1ZBQA 4IDKA 1XKTA 2C84A 3NVDA 1IM4A 5AESA 4ZVQB 2W4DA 3TSCA 4MITA 1IKWA 1N5YA 2IV7A 4LUCA 4B82A 4DDHA 2XYGA 1I7DA 3N9IA 4J9KA 2QTWB 4HYKA 1TFWA 1DE0A 4F72A 1VSTA 3PX3A 3WL7A 1R88A 4MVJG 2HXGA 2WWIA 3ZNOA 4NAVA 1MNQA 2HHHJ 1L9KA 3GQVA 3L40A 3VVBA 2DISA 4B85A 1Q4RA 5DLEA 1PO6A 1RP7A 1X4FA 4G01B 3W5DA 1NNI1 2QTZA 2GN9A 3W5XA 4YMGA 3BAFA 2IY7A 4USMA 2EHJA 1BMQB 1R8CA 1X70A 4Q3BA 3QAUA 3KEMA 2HHTA 2JD0A 2O8FB 4YRFA 4GO5X 1NDHA 5CURA 1YB2A 2G7MC 5CYGA 5HGXA 3PF8A 2OAGA 1B1AA 3RC2A 4YDXA 4CWBA 1DVRA 2W25A 4V3CA 2OWDA 2NU6A 2H5IB 1T8RA 3FK4A 1Q12A 5IVHA 1XEXB 4I9HA 1ZXBA 4ACAA 3LPNA 1S3FA 1QH9A 3RHTA 1TQDA 2EBEA 2O6LA 3LHFA 1W2IA 4OX6A 4F04B 5M34A 3KO8A 5CXTA 3ITNA 2ZI6A 4LHXA 3JSBA 5DP2A 2Y1DA 3GRKA 5BT8A 3VR6H 3CVVA 4O8ZA 2D41A 4DL6A 3IHWA 1UP6A 3DI6B 3RUCA 3WLOA 3T1HJ 3M32B 4B4UA 2ZJ1A 3EDRB 4U2KA 2E5HA 5KZMB 3MOJB 4EHJA 1ODTC 5KTTA 3DMJA 4BQIA 4D96A 4ENRA 2ERYA 3MWDB 2X1BA 4ZPVR 1DJQA 3K96A 1JYFA 1TKCA 2FQXA 3S3TA 3NORA 2HK9A 2FPPB 3KLGA 3V4IB 3QLHA 3NWOA 4KFSA 4DZRA 4YMUA 4HGPA 3IKVA 5JATA 1GRCA 3G9XA 5C1PA 1L3TA 1GJRA 1C1HA 1RWVB 4I5EA 3RG6A 3Q24A 2XT0A 4EYOA 1ONNA 1T11A 1T03B 3KIPA 4EATA 3WWYA 1P27B 3PTZA 5JHGB 4KGMA 1JKXA 3ZDXB 2BFFB 3KOUA 3L0ZA 4CG1A 4PHGA 3O2SB 3CV3A 2DQYA 4K9MA 2B5JB 3UNXA 2NTJA 5KSYA 4O44B 3G5MA 4P1ZA 1U7PA 4QARA 4RUHA 3WFZA 5KFZA 3ZN2A 3UJPA 4LBVA 4R5PB 2H7CA 5KYYB 3IMKA 2OMKA 4OYHA 1LD3A 5KQMA 2ECKA 2HDWA 1E98A 1LK5A 1YQ9A 1SBHA 2FJWA 2FQWA 2QYGA 5TQ0A 2JJ2A 3OLVA 1MGOA 3F90A 1H2FA 4O4LF 4WKGA 4K7QA 5B1SA 1FDOA 4X6XA 2E1MC 1NQVA 3PT5A 3K7EA 2B5JA 3F4KA 1V26A 1UWVA 1D9FA 2V0NA 3A2NA 2O0JA 3CUSA 5CLFA 1RYZA 5COQA 5A4IS 4JB2A 1VIAA 3DEYX 3D8RA 2I76A 4HNVA 3AOEA 4MB2A 2VF5X 2WIDA 1GPMA 2XUQA 3OEEA 1JAIA 2C2RA 4M0LA 2MINA 4HDKA 1X1BA 3MD0A 1KOJA 1OIXA 1BC5A 1TUGA 1FWPA 3ZLVA 4IP0A 1CVRA 5KTSA 4A0SA 2XZWA 2VQEB 4RLFA 5KQPA 1SVDA 2VF8A 3HEMA 4MNTA 4UTVA 3MGKA 3B3QA 4GZ6A 4F4YA 3K5PA 4G5OA 2VXOA 4CKCB 1TCBA 3KM0A 5JY1A 2QRMA 2AYXA 1T9YA 3EIXA 2YNHB 1E2JA 4G8DA 1QJHA 1ZM2A 4ZZ0A 2B3DA 4WN9A 3A32A 3PJRA 1RTJB 4C22A 2GBGA 2WONB 2Q3BA 3PA8A 4L5YA 3P9CA 4E94A 2OILA 3VOTA 3ZY2A 2D5AA 4TXMA 5EHIA 1CJVB 4P2GA 1U7HA 1J4AA 3BQNB 1U0OC 3ABOB 5JZSA 1DADA 3JATA 4UY85 2Q1XA 1T3GA 5BN1A 4G65A 4JLMA 1WZ2A 2HW8A 1MB0A 3MNFA 3OZTA 3PXUA 2PGDA 2YTZA 3F9RA 4TMWA 3EPLA 4N0PA 5CVJA 2DUMA 3LGHA 3OZIA 2C2NA 2JGLA 1OC4A 2BUAA 4NLVA 3QRWA 3MUEA 1M5HA 4L8GA 2W9CB 4KI0A 1JVBA 3FNEA 4IH9A 5L7YA 3QRQA 4R9SA 2ZKIA 5KAMA 2YMLA 2GZRA 3THXA 2XAUA 5KSWB 1VHLA 2B7CB 4G84A 1ABFA 5CVEA 5FPKA 4LRWA 2A0FB 4OYOA 1J2EA 3HXQA 5C7OO 3HO8A 3P9QA 3LBIA 2YKOA 4MWCA 2R4TA 1KEWA 4JUIA 4OQNA 3PNMA 2HBYA 3TW8A 3PXCX 3ROMA 3CYFA 5AHXA 3Q6IA 1GG9A 5I6DA 2IJNA 3UCUP 2V0CA 2XVMA 2AFHA 1SU6A 1ULHA 2PKEA 1T94A 4XR9A 1O6GA 2HA2A 2X2EA 3MJCA 1O2DA 3CZPA 3RRBA 3BGRB 2ADMA 3ROGA 2XGJA 3PEEA 5IAOA 4YMEA 1QAYA 4D0SA 2GZ3A 2BFBA 3DMTC 3GE9A 3S2GA 2YV2A 4OZ2A 2IDKA 2NIPA 1FRMA 4JC8A 2W7TA 2LIVA 3PVSA 2P4EA 2OP1A 1FP6A 1E61A 5FBVB 2AC4A 4USJC 4ZV4A 3OLXA 1YOBA 1HDIA 4PSVA 4RWEA 4HX9A 4K9KA 1M54A 2FPUA 4I7FB 1OSCA 4UTNA 5JVDA 1AM4D 4B3MF 1GZHB 3MHPA 4QQFA 4FVTA 4U8GA 1QG4A 1WO8A 4HAXA 2BFOA 1P0PA 3DKDA 1VJQA 3EIHA 1GTJ1 1IY2A 2JEZA 4QVIA 1OA0A 4W4TA 4PPNA 3N2KA 2DUUA 1E2UA 3F6PA 3LDUA 2A9JA 2J87A 4LXHA 2XBUA 3I6BA 4Q7LA 4U7PB 1RJ9A 4FCVA 3EMKA 3QFFA 2GCOB 2V8VA 4NLWA 1UBMS 4N3GA 3SFGA 3ILVA 3FPLA 5CT6A 2D5CA 2MXYA 3ZHYA 3PI7A 3KVYA 2HHVA 4NYJR 4V2IA 1U99A 3I5MA 2ECPA 1OMSA 4R5MA 1FBTA 2O8DA 3QVUA 3G88A 3BHMA 2FHJA 3V5RA 2OHJA 3G9QA 2HKEA 1R8AA 4K40A 4OG2A 4ZK2A 1YQGA 2GZAA 4K9NA 3ESBA 2CKDA 1CF2O 4ZD6A 3ZY3A 1GDTA 5PNTA 2E9SA 1E3EA 1HL6A 2WTAA 4BFWA 3IGFA 3KLEA 4RIFA 1FNNA 2CMDA 3L6CA 3O8QB 5HRCA 1C2PA 4P6QA 3ZDQA 1TQ8A 1SQ0A 3EEQA 2VJCA 4B7UA 4Q9HA 4UATA 1ACMB 1XDSA 3MS4A 3DP7A 3TSOA 4BPBA 4O33A 4XGRA 4XGKA 4CU2A 2HFZA 1TUIA 4MZXA 1QAJA 3LH5A 1BVYF 4PYRA 5F9FA 2GHVC 1Y37A 1KSHA 2WTFA 4P08A 4E07A 4KE7A 1YIAA 5KWEA 4FNMA 4E0DA 1SIWA 3LPDA 3KT3A 4ZGGA 3UCFA 2WJVA 1DIOB 3EASA 4OBXA 1NHKL 3TEJA 3O8DA 3RAGA 1GSIA 3OZAA 3IBFA 1Z4UA 1DKLA 1X1AA 2FDNA 3I28A 3JQ8B 1D6JA 3SXJA 4OCZA 4YP7A 5BN4B 4LFAJ 2RE8A 2R8ZA 1U2ZA 5TX7A 4BVJA 4ZIVA 3BSAA 5G2OA 1V3TA 1CUJA 3V7NA 4KQEA 1FEZA 3NNSA 2DERA 3KYLA 4IGEA 1SB8A 2B78A 4DFKA 2JKYA 2Z58A 3JAWA 4PO8A 2UVRA 3HG7A 4FZVA 2REQB 2FHJD 2DD8S 4LF9B 1ZITA 1AA6A 4M6WB 3M89A 1O6ZA 3T6JA 1KZ1A 4C01A 3LVQE 1N6NA 1G0NA 4JT4A 4H4DA 1PDVA 3N7TA 3FGZA 4DB2A 2EV9A 1XF9A 3GFHA 5AM5A 5CCXA 5H68A 2ZYUX 1Q7YT 1YB7A 3UO8B 3E2MA 4RLHA 4PQYA 3ZGYA 3ZI4A 1U7XA 3FPFA 4DR7B 1C4CA 4CLOA 4DR6B 3T1TA 3NHBA 4KTTE 4H7JA 2J9GA 1OMOA 2QYTA 1WCIA 3ETNA 4ANCA 3BCSA 3VPBA 3UAYA 4CIAA 4BCAA 1YTUA 2VXBA 4V24A 1DWQA 5G4LA 3BH6A 1Y9AA 2PNFA 4K9OA 4LZWA 1FSPA 2QTVA 2VNIA 1RI3A 1V6CA 1TK9A 1C1CB 4K4TA 3FBTA 5FBZA 4JBYA 3NNHA 2GHWA 3AU9A 1W4ZA 5B0BA 2CMKA 4PSKA 1GZSA 1JJVA 5B7QA 2GGPB 1J8FA 3BD6A 3R9KA 4LF6F 1YF3A 3IC5A 1U1MA 4XO0A 1RABA 2YFYA 3AVXA 3LGSA 4MYTA 1QM5A 1A69A 3QE4A 2QI9F 3C87A 1P9WA 2EFCB 2EFNA 3PNVA 1S9EA 1Z7EA 1OFTA 2YOHA 5I7EA 1CUFA 2HSWA 2O14A 1E0KA 3BXHA 3H83A 3TN7A 5L6MB 3V4FA 2XNRA 4R81A 4ZXFA 4NYZA 5CDUA 3OW2R 1M8KA 4UJ5A 3O95A 1DC8A 1WDDA 2W4PA 5BWBA 1IZYA 5F77A 2EFDB 4M87A 3OL6A 4JBWA 3R3UA 1T4CA 4GX1A 3L7CA 1PBTA 4Z1MD 3N39C 2J9FA 3LYUA 2B8QA 3R7SA 2XVXA 1N4AA 2VDJA 5IULC 3H2SA 4EBBA 5C53B 3KTQA 3BL5A 3S8YA 3MEGB 1E4VA 5K8UA 3W8GA 2Z56A 3TF5A 2Q5FA 3ZEIA 2PO4A 2IYUA 2H1IA 2IU4A 2ZIFA 3H5IA 4X60A 2KVQE 3D8NA 1F0NA 4I81A 3VHXB 3BGWA 2IYGA 3KHTA 4Y6IA 3TTYA 4RTPA 2Z98A 2D1TA 4CKBB 4CMEA 3NUZA 4LJ5A 3TUZC 3K6KA 4KJZA 3THVA 4ZITA 2QBYB 4DV5F 4RKUC 3VVCA 3GFFA 2Y67A 4S1PA 2Y1KA 3C3JA 4BXOB 4JI7B 2ORED 3QYAA 2DUNA 5E9WA 5E2IA 1IH8A 3LRPA 4ER8A 5CTAA 2WUFA 1ZVVA 2HQDA 3CG0A 3LWZA 4LY0A 2K3IA 3LY8A 1AKWA 1VL2A 2JHEA 4L6V3 1AKYA 4KSYA 2QRHA 1LSOA 2YMQA 3T94A 2O2GA 5KAKA 3ZCRA 4F3KA 1XDGA 4ENOA 5KMGA 2FEMA 2LQBA 4FJ2A 1UF9A 1GO2A 3GFTA 1DAHA 3ZQJA 1N56A 3QHQA 3PGA1 4CYMA 1RT5B 1TEHA 3AXMA 2E3JA 3O0DA 4C04A 4IDFA 3WX8A 1C0PA 2J33A 4O02B 5G0RA 5A5DA 1H38A 4N8SA 1YS9A 1K73T 4TLMB 3EEBA 3BT7A 2B5WA 2M5YA 4D3DA 3I39X 1I4WA 4ZYLA 1MH1A 1JJHA 3L8CA 1SCBA 2PKQO 6AT1A 1YS2X 1U6ZA 1KYYA 1XROA 4OXIA 2OM2A 3NEKA 4JK3A 3OE5A 2VUHB 4LN1A 1S5PA 4O2RA 2W0MA 5LD2B 2CFRA 4YCBA 4ED7A 1QHFA 1RBOB 2QRPA 2CLFB 1OV6A 2ANCA 2R7AA 4CBVA 2MSEB 2G2ZA 3AKZA 3DKIA 4BC7A 4OP1A 4CLXA 2R1VB 2IOFA 4MRSA 1NR5A 1T8SA 4R6WA 3V6DA 4ABTA 4R6XA 2HEGA 3Q3JB 1WMDA 3VQSA 5FYDA 1W4CA 3F7NA 3D1OA 1RM0A 3ZIDA 5KFWA 5ETVA 2FZ5A 1FNSA 1T9GS 3FSJX 4MCAA 4PGAA 5JMPA 1R0LA 5DRYA 4ANEA 2ZHOA 5J3JA 2D2FA 4ZRDA 1HWYA 4DSEA 4K0KJ 4JGBA 2VP0A 5DU2A 1MOSA 3R0IA 4UCXA 3P5TL 2BGJA 4CPDA 3GB9A 2ZH7A 4EYIB 4DNOA 1Z5PA 2QZSA 1N3YA 5AVYA 3ZUPA 3O2QB 4TN2A 1QTNA 3EG9A 4AD8A 3W9IA 1Z34A 3WGLA 1OGYA 2CBGA 2PX2A 4F4AA 2FW9A 3DTYA 3M3DA 5JH7B 1XLVA 1FTNA 4ASUD 2V3WA 1DO0A 1V3ZA 3OIYA 3HPOA 5BR1A 3UD4P 1TZ2A 3ILSA 3CCZA 2P35A 3C1TA 3NRJA 3Q89A 4LGMA 3OPQA 4EDHA 4YMHA 3M8QB 3RAFC 2ESRA 5JYDA 2EF1A 3I73A 4KH1B 4CMIB 2ZTVA 1MQAA 1L1EA 4V0SA 5G4KA 4FSDA 3UD5A 4A4JA 3PW2A 4KQZA 3GEMA 3AHGA 2Q6IA 4BE9A 1RRCA 3MCVA 1CJTC 1PJ5A 2O59A 2JVJA 3N8DA 1XQXA 4LXUA 4M49A 4HQOA 4FN4A 3AYZB 1P7ZA 1RT6A 2IBMA 4HNQA 1HT3A 3SZOA 2VV5A 3KKFA 3BSSA 3HFGA 3WRXC 3VU3A 1LV7A 1MVLA 3RW9A 2PT0A 2HPVA 4ZICA 2WVFA 3KTAA 3ROFA 1H8HA 3K05A 4LEIA 1FDBA 2VIIA 2WU8A 4RTJA 4YWJA 4FE3A 1KO7A 3LQKA 1DLOB 3QEJA 4XTTA 5DTJA 1NUHA 4F3QA 3Q8XB 4PZ0A 4M3NA 4MPJA 2XUKA 3BXPA 3DC2A 2O50A 3EVAA 2B30A 2QSJA 1SOWA 3R5BA 4KKOA 3ZZPA 2YVLA 2AJQA 4UOEA 3QVGB 2NSDA 4LF8B 4M99A 4EKDA 1V3UA 4YQYA 1YB6A 5FWDA 4N7BA 4AQYJ 2VHVA 2HT6A 2QD3A 4HQRA 3LKZA 1MDFA 1X1CA 3L05A 5HLFB 4HMOA 3RFUA 1R3NA 1ITPA 5I3UB 4YAFA 1FF2A 4MVJI 1S96A 3MB8A 2NQPA 1JHAA 1OXTA 4JLNA 3P9PA 5LC1A 5ADZA 2ZWOA 2BCEA 3V6JA 2VNJA 1D8AA 3ZOZA 2YQ5A 5H1YA 1KQKA 2Q9AA 2HLPA 5DB4A 4QEKA 2J9ZB 2RRAA 4O0LA 5K2OA 3TDNA 3M2VA 2CJXB 4LXIA 2JI9A 2XDAA 4W5NA 2ORWA 1VSUA 2ZSUA 2B61A 1KY5A 1E5DA 3SBMA 2QZPA 3JXEA 1JLMA 3TNDA 1PZFA 2R8IA 1NLKL 1J70A 1D4ZA 3QWPA 3UDEA 4EZIA 1PHRA 4OMFG 3VNVA 2W6NA 1RWPA 1SHZA 3Q10A 2XZOA 4QYZK 4NF2A 4EHAA 1F2UB 3COZA 4GVPA 2ZFUA 2VBFA 2QPLA 3FMOB 2JFOA 3PXGA 3CLVA 1JH8A 3SOPA 1ZM3A 3PYEA 1DV1A 1PFKA 4RKQA 2CV1A 1CJUA 5E6SA 4DSOA 4DL4A 1E3MA 2FN7A 2XDYA 2QSWA 4JI4F 1USVA 2H4ZA 4IG0B 4BGEA 5A2GA 4PYQA 1YDMA 1CIJA 2YN4A 4IHQA 4DHWA 3N87A 1OI4A 1TX4B 2D74B 2GAJA 5JD4A 3R5CA 3R3JA 1NHGA 4FWTA 3WRXA 2TYSB 3ZGXA 1RYEA 1LPAB 1HMVA 1ZAVA 3EMTA 3WLSA 2VT6A 1GQEA 2X14A 4QR1A 4K81B 2MSLA 5DLGA 1D6NA 1IAVA 5BV8A 2NO4A 4CO1A 3SSAA 4GZMA 2C2GA 3EGCA 4J9PA 1SVIA 1NXXA 3R9XB 2A1BA 1ZWLA 3DUFB 2OBBA 3FNNA 2VYCA 3C14C 4PUOB 1KK0A 1L1FA 1FPQA 2QF7A 4H3KB 5HQLA 5C3UA 4X1KA 4OZ3A 5EUHA 1W25A 1LWFB 4HACB 3TGLA 3VYTB 3AOGA 3AR2A 1GMWA 3EARA 3AF6A 4KV7A 2BPOA 1HSZA 5KJEA 4DF4A 2YN0A 1NK6A 1DIRA 4DFPA 4IFVB 2HF8A 4TTVA 1XZLA 2KM1A 3LNCA 3EXHA 1NK7A 3SOZA 4LJAA 1ZAYA 2RK6A 4K26A 5FUBA 4DT1B 2YIMA 3L9WA 1JEJA 2QE7A 4BAZA 4C4YA 1FRJA 1ST3A 4DEYA 1ZWKA 5HX7A 3TQIA 2OD9A 4ER6A 2YKMB 1INLA 2X5NA 2CJ9A 2DNYA 3U7QA 1SBCA 2H1SA 3LP1A 2DP4E 3UGQA 3U3XA 4AJ2A 4DLKA 1N77A 1ADFA 3MWLA 1QVFR 1Y5IB 3GROA 1EPUA 1TC2A 2FIUA 4WBSA 3QUCA 4GP6A 1VBMA 4MVJE 1DMRA 2O1XA 1KJ8A 5MN5A 3OH8A 3A8JA 4RV4A 4F8JA 4BKRA 2NOAA 3GBVA 4PPZA 3G1TA 3H2IA 2ZRPA 3OZVA 3QWBA 1IBMJ 1UVNA 3TJ8A 3TAHA 3V9PA 1QX4A 4ZAWA 1NHWA 2CV0A 3O93A 3Q8UA 3HFSA 5DETA 3RTBA 2D3TA 2ZJBA 3FVRA 5KC8A 3NHMA 2R62A 4PXEA 1OU0A 4EHHA 4PRZA 4YIHA 5DH9A 1TL7A 2OFHX 1HD1A 4RLSA 1JEOA 3TKYA 1YQQA 5JXSA 4P7JA 3I4HX 2X2PA 2NO0A 3R6DA 2PE8A 1G64A 1L4MA 1YGPA 5B6JA 5FO0A 1V4BA 4JVSB 4X64F 2ZAOA 3HNRA 4J1QA 4WWSA 3RYHB 4ZVRB 2JGEA 3D7LA 2PJRA 4LNAA 3R27A 4BS2A 1HNIB 1W35A 3N8GA 2V96A 1Q19A 2RONA 4H27A 1RAIB 2XB9A 1R8SA 1NSTA 2Z5FA 3W61A 3RNOA 2AVNA 1GADO 2YDYA 2XI4A 1XIVA 1KH2A 1T6YA 3LD9A 3I52A 4A5OA 2WT9A 3OWXA 2QVLA 3E27A 1ABBA 4GOND 4DSZA 4YCAA 2FEAA 3EW9A 4YDHB 1GGKA 4OK3A 3PUKA 2NZ8A 2RCNA 4INAA 7GPBA 2BH9A 2JVRA 1WC4A 2B0GA 4OYZA 1DIGA 3GA7A 5DCLA 2RH3A 1T2FA 3HA3A 1UANA 1C1CA 1J2JA 3OECA 4P3NA 5A4MS 3ELUA 1QNLA 2G9OA 3AT1A 4EKGA 3W2FA 2GPBA 1VIXA 2ZXEA 4J16C 3C2QA 2X8WA 2BDPA 5U9CA 2O1WA 4INPA 3V6DB 3G2PA 2VQ3A 3K70B 4KJIA 1TKTA 3K57A 1C5KA 2MQQA 2AXQA 4N3BA 2VH5R 3R0VA 4G5FA 2GH1A 3I0NA 3N5CA 5BMVB 5BXIA 2UZ1A 4RUKA 1HX7A 2VWGA 4B7XA 1NXSA 4LMRA 3R7BB 2P3LA 5LMUF 3ZHRA 1U0SA 5J59A 3AVQA 1WPQA 3BWVA 4OGLA 2K06A 1SCNE 1G21A 3QW4B 1NWHA 2JFHA 1QFMA 1XD9A 2HA3A 3NHRA 3B6ZA 3LP0B 3O92A 4ND5A 4EJSA 4OQMA 3LK6A 4LXTA 2VKRA 1EEXB 4C7MA 1H6BA 1OD6A 3E05A 2HYIB 3VC2A 3U09A 2CHGA 5HKBA 2PA0A 3UJ6A 1Z0ZA 4DR1F 4RTOA 2C4MA 5BJRA 4PICA 4OP3A 4EBDA 2OAEA 4OYXA 3TRHA 1AO3A 3PNOA 3U6KA 1A5AB 3QU7A 3RC1A 5HBGA 5AQ1A 1V7ZA 1D2GA 1N6HA 2V6BA 3PVXA 1U8YA 2AN3A 3TJRA 3T0FA 2ZJAA 3MUFA 3C1OA 1REVB 2E4AA 1HHQA 4JB3A 1VYUA 2HO4A 2RMLA 1NBHA 1LWOA 3K1AB 1H65A 3EF1A 1ZMBA 1B8NA 1C1DA 4OMDA 1L7XA 1ZRSA 3JVDA 2OYSA 1JLKA 1F20A 4D2IA 1TEZA 1MTZA 1ZS9A 4Z9YA 2F3PA 1KLMA 4ID5B 1S48A 2FSVA 1Y7IA 4KUGA 2CEKA 1Y9JA 1VMAA 4IVQA 4DLYA 3IR7B 1G60A 3PDIA 1H2EA 4GNKA 2DH8A 2O05A 3FF1A 5EJ8A 3J7YI 4V03A 3B1XA 5BN3B 1SBNE 2EW2A 3CR3C 3L6DA 5HATA 3P0RA 4G0PA 3JD2A 2CFCA 3UN3A 5E4YA 3WGKA 5JASA 3AGPA 3CNQS 2Q5JA 1JEAA 5HP1A 4UUWA 4I5DA 3GLIE 3SHQA 4QKQA 2G28A 5EWMB 2GRAA 2OFPA 3HDTA 3RUPA 4F04A 2Z30B 2HS0A 5A8WB 3SCJE 2OHXA 2GO9A 2B9YA 1UZHA 2P5VA 1PJZA 1JMTA 1TA9A 2QL9B 1T9TA 1Y6ZA 1G3UA 1K0TA 2WMDA 1X38A 3ZWMA 5D3QA 3RWMB 2BGUA 3ENWA 2P0AA 2IY8A 1VLMA 4C3VA 2QW1A 2XADA 4JP3A 2AEMA 1FMLA 1EP9A 4XX0B 3W5UA 3WG9A 1XOIA 3F1KA 4IJ6A 3OIVA 2AMVA 5B58T 3CLRC 1F6DA 4GXQA 3BIWA 4MKBA 4L5IA 3Q5DA 2J6HA 3G8DA 1GGNA 4QU7A 2UZIR 3EDOA 1NBIA 4LJ9A 2HBYB 1G8HA 1HYSB 1FMFA 4JLOA 4ZIRB 3OJFA 3A10A 4RD6A 1BWRA 5K3CA 4ZJQA 3A6PC 1J56A 4CF7A 3RHZA 3H90A 5E1MA 5FWXB 1VCHA 3SJZA 2NG1A 3DZFA 5WRFA 3KOYA 2Q3HA 1ISJA 5BYAA 3G9ZA 3TZLA 1UMCA 1F48A 1RT7B 2I33A 3TNYA 3OHBA 1E66A 4IQGA 5EWLA 5KEIA 2AX4A 3MILA 1PFGA 2FVSA 5BWCA 3BGUA 1JQLB 4MKGA 3SQDA 3OEWA 5LBTA 4L85A 3ZDBA 2H1YA 5IWAJ 2FJUA 3USCS 3S1SA 1BWQA 3GCWA 2W6JD 3V42A 4P2MA 3U49A 3QGPA 1OSDA 4JITA 2Y3YA 4TVSA 3EGXB 3E82A 2GGPA 1SKBA 1WSDA 4TYAA 4EO9A 1DG1G 2HI0A 2WE8A 4Y6OA 4IIJF 1VCOA 1C8VB 3JAMY 2G83A 3P8ZA 3KK2B 2NZYA 4FEYA 4HXFB 1T0UA 5DNUA 3BGDA 4ZHSA 1XB2A 2YQ3A 5JS7A 3IDFA 3LDHA 4GMKA 4W1RA 3U9SA 2VOOA 2WSBA 4MAKA 3LYHA 4BOYA 4L6AA 4BO6A 1EE9A 1UPUA 1IBMB 4DQKA 4I2QB 1THZA 4DLEA 5AI4A 4PKDB 1LSJA 3G86A 4K0KF 3A14A 4RJIA 4F97A 3IMCA 1BE1A 1VC0A 1QMGA 4WECA 2OGWA 3R74A 3KFWX 2OXRA 1Q50A 3NDPA 1OWNA 1T3OA 2QRKA 2X8AA 5B1HA 2JCYA 1QZXA 3T7EA 4E3ZA 2BQ3A 2GQ0A 4QWBA 2Y27A 1F3VA 1KEVA 2P11A 4Y18A 4HEA6 2A1TR 3OUYB 2ZBFA 5FLYA 3R41A 4O4IA 3IVMA 1L5GB 3OVSA 3F47A 3LZCA 2XNSA 4DV6F 4PNZA 2C00A 1T4MA 2IEZA 3EY9A 2GXUA 2CKWA 1O4WA 5CFQA 1X60A 3RS4A 3I30X 1T02A 5ENZA 4K0KB 2XQFA 1UEUA 4M1EA 4GP7A 1WXDA 3CQ9A 5DNCA 2UZ1B 4NCGA 2H51A 2NUAB 5L3SB 2XGSA 4CDNA 3K0FA 2OM6A 1Q92A 1QR6A 5HOEA 4US2R 1RQXA 3IHTA 3NDRA 3DGFC 1TMOA 4ZQCB 5IQQA 2AZ1A 2HHWA 1NSFA 2I7TA 2OOKA 1VYHA 3CJ0A 1R4NB 2UXDF 1RE1B 2BOVA 4B40A 2H9IA 4OEHA 1ZIPA 4ZOLF 1G20B 2LXIA 1GDDA 1FTCA 4GGPA 1EFKA 4MWZA 2DT8A 2EBGA 8MHTA 2NUAA 2H08A 2XQIA 2LKDA 3AXTA 3DMHA 1PU2A 2QN6A 4HDSB 1N6QB 3M6WA 4W90B 3D54D 3RJ5A 3M6VA 2D5LA 4QIHA 4LJ8A 3C6TA 1A9XA 3PWKA 5JJIA 3TX2A 1WLSA 2BGNA 3UCEA 4FYVA 5ARCA 2DCUB 2H4FA 4L4XA 2FAXA 2DHCA 1QQTA 2Y0BA 2W6IA 2YY7A 3E1GA 1S2IA 4KXVA 3AZPA 4HEA9 3P2MA 5CG1A 1XMOB 1YFZA 4LC9A 1RC1A 4WNAB 1ESDA 5C8DA 3R1LA 1TT7A 4II2A 3DV0B 3ELYA 5HTOA 4BV3A 2D9PA 2PRJA 2YZ7A 1ZI9A 2HCJB 4D3FA 2WB1D 4XRGA 1R0RE 3EISA 4BX9A 3D4BA 2CXHA 2M7SA 1AOXA 3HCXA 1C0IA 1KPHA 3K9NA 1SKUA 3PGXA 1FK8A 2VT7A 5A0VA 2I55A 4CDIA 4DPKA 1P5RA 4USVA 3MD3A 1VB3A 4FKBA 2X4GA 1USKA 3UUGA 1URPA 5ALWA 4RVOA 2A5FA 3EQ2A 3EGDB 3TQSA 2PS9A 2LA4A 5AFSA 3LUCA 3QQCD 1ODCA 5K2MA 3ED5A 1XPRA 4PY2A 3AJAA 2ZIXB 3ZW8A 5F2EA 3B3FA 1K2WA 3UMGA 3RAQA 5CPBA 3K53A 2AQHA 2B4TO 3TD6A 5KUTA 2X1VA 1YDWA 1QS0B 5K8VA 3ISVA 1Y9DA 4F92B 5BO5A 4DUGD 4FXOA 3EGXA 4I4TA 1HZZC 1WI8A 5DVZA 1YQTA 1CXZA 1A71A 4QUBA 4JV0A 3OR2B 3VSCA 4HB3A 2B43A 3OHAA 2I6WA 4BCDA 1KDYA 1X1QA 3QSYB 3JWEA 4LMBA 3PRJA 2HD4A 1QTIA 4C4RA 2CC2A 2VH2A 1A8QA 2I4LA 1SC6A 2RHSB 3EX7B 2JIMA 2QM8A 3NHJA 3RFTA 3H98A 1WG8A 2PKWA 4RJ2A 5J2MA 1OYDA 2H4YB 3CD6S 2I6FA 3C8HA 4J1TA 3CNHA 1IDOA 3S70A 4ND7A 1EX9A 3BMQA 4MS4B 3EPKA 2RB5A 2CWKA 1USWA 4YJ2B 2DH9A 4WU3A 3HCOA 5DHPA 3PX7A 2F90A 2QQ0A 1KI3A 4CP5A 3MUTP 2SECE 4D8YA 4D98A 1F06A 2G0JA 1ORDA 5EP4A 3DDWA 2JLRA 2UUBJ 2IPXA 3KSZO 3KRTA 4EGJA 1KVQA 1A88A 4FDTA 1MAVA 3M9OB 3QX8A 2Q5EA 3JATB 1PTJA 1F2VA 2ZWAA 3B60A 1M0SA 5KSPA 3K4QA 2ACWA 2YW2A 3R7SB 4UBJA 4NESA 2NT3A 3T3PB 2B2CA 3I83A 4MPDA 3ESZA 2NV2B 2HLTA 5LXYA 1U24A 3FIUA 5JAZA 3HHDA 5EPEA 2W9CA 5EWJB 4ZPCA 2J4DA 3G2HA 1VPDA 4HGNA 3KWMA 4R98A 4N48A 4C7OB 2NUTA 2O4CA 1QSYA 1Q1QA 5KVCA 5F7JA 3CT9A 2JPDA 1L5VA 2LU2A 1HKAA 2IS2A 5KAPA 3SK0A 4II7A 3DM5A 2MZSA 1T0TV 1CZKA 4DHVA 3FVWA 4ZJYA 3QTLA 3TEMA 4DX6A 4X4NA 3COJA 2H59A 3M5CA 4V0RA 2Q9BA 4IZHA 3P45B 4A91A 2WYIA 4XJXA 5B7GA 5DGAA 1N75A 4JV1A 3A1EA 3M34A 2ZRMA 4B73A 1M9NA 2BMEA 2DPMA 3JSYA 4KXUA 3IVCA 2G40A 1BZYA 3LLSA 3PX6A 4B43A 4ZEMA 5B53A 4GKKF 8ATCB 2BZ2A 5IM0A 1GCOA 4F2PA 4Q9NA 4MYDA 4QHTA 2BVZA 4Q5VA 1Z0AA 3CH4B 1VQ9S 2QRNA 4ED6A 3D7RA 3DI6A 2Y0CA 4PN7A 4MI9A 1PZXA 2P2CA 4OB7A 3T06B 1KYXA 4WZBA 1IKXA 4X71A 1JYSA 5B64A 3M1VB 2WHPA 2JC1A 5LDGA 4M1QA 4KO0B 2Z09A 5DNEA 2M52A 3VZRA 4D9JA 4GXRA 1B3BA 3QUSA 4YRAA 4WPAA 4QFCA 1UKEA 2XMVA 1O95C 2RG7A 1ZK1A 3CUNA 3EC1A 3V2UA 1BD6A 3T99A 3E0XA 3A2LA 5F1YA 1SVNA 3AUSA 4LYEA 4F21A 2Z2IA 1XV5A 3DRPA 1YI1A 3DLAA 2JS7A 4ENWA 2AR9A 4CTAA 5TMBA 2VZ8A 4GBMA 1SL0A 2BGGA 3EOZA 4K3VA 3RJ9A 1JLLA 3OEHD 5D4PA 4YV0A 2I91A 2HCRA 5KJFA 5EXXA 3BBFA 1UCNA 1OPIA 1XRPA 2QTHA 3DV0A 2ZM5A 2YVKA 1RWMA 3R23A 2WVHA 3QENA 4DV7F 1Z8NA 3Q9SA 5ALNA 4K4UA 2QTWA 3I5UA 1G6HA 5L1LA 1UBOS 4PEVA 2HNDA 1GQOA 1A1VA 3ZR4B 2J7UA 3KV1A 2PG3A 1A7GE 4WXYB 3M4XA 3D6MA 1U1NA 2ID9A 2AK3A 4ALIA 1N2HA 1OZAA 2CVQA 3MEGA 3KS9A 3DTVA 1PYGA 1DG9A 3LQ1A 2PLRA 3OA2A 2V6GA 1LW2A 1JE1A 2I38A 3EZUA 4L0MA 2J9DA 1MEJA 1PR5A 2E7ZA 3OTIA 5EXPA 3L0YA 4LX0A 4GI1A 3M8QA 2YNIB 1L7MA 3G02A 3FSEA 5AW1A 2GD0A 1RJEA 2CLCX 6AT1B 3KUDA 3C8ZA 2VC1A 5FNVB 5EYPB 3PYDA 3KTAB 3HULA 4CKYA 2OV1A 5H1SV 4WOKA 2YUTA 4ELUA 2A92A 5HAOA 5BXQC 2CE2X 4CM4B 2QLBB 1GZ5A 3KYJB 3N6NA 1UEJA 2K2WA 4O2AB 4WYWA 2GVDA 1RXIA 3BDAA 5ESDA 5AXAA 1FSGA 1V3QE 4A2QA 4OYPA 3OF5A 4V2UA 4TX1A 2FE4A 3OZFA 1A0OB 3TCKA 3IRXA 3HUTA 2FH5B 1GNKA 2HZBA 5HS6A 2XWQA 1PC4A 3H9CA 2O5EA 4KXQA 5CQGA 1M33A 4I1TA 3UBMA 5FYQA 2AJCA 1SUPA 4ITRC 1XNRB 3NAQA 2CL5A 1YA4A 2FGJA 1DQZA 3BQMB 3O6VA 4Y6RA 1M90T 1CB7A 3QXGA 2NVUB 4EBCA 4KAXA 2ZPUA 3QBCA 5KSZA 5D8HB 3EBLA 1TRHA 5JCJD 3RBAA 4CZCA 5JSKA 5BSKA 2QT9A 3JQMA 1CRWG 2C5EA 1G7CA 1SELA 4ID3A 3ABRB 5LM3A 4WNAA 1V96A 1YE3A 2WB2A 1N8TA 1S89A 4W9MC 1E3TA 3CBQA 2NSJA 2FSVC 2G5GX 2DCUA 2WD7A 4JH0A 4GSLA 4IIBA 5DTIA 4A8KA 2P5UA 4UTGA 2ROQA 4OSOA 1JMYA 4PXAA 4EL0A 2BRUC 3QLHB 4K1LA 1R0AA 1LWCA 1YZFA 4MUIA 3HKEB 4DFDA 2JRSA 1FLNA 4H4MA 2JLGA 2NUTB 2C1XA 2QW0X 2Q6VA 4ES3A 1ZH6A 5AKKA 2BBWA 3FGPA 3VR4D 1U4SA 1OX4B 1AZWA 4L5CA 3EXIB 3X1MA 3AIIA 2Z0MA 2XOKA 1F9AA 2XNHA 5MLCV 2A67A 4BRUA 5JWOA 5KFBA 4MGIR 2HCFA 2PQ0A 2AP6A 4JV5F 3I0SA 4WLNA 2QNIA 4TZ6A 1J1ZA 3VX4A 1L8OA 2ORIA 2P3OA 3FNBA 4ER7A 2Y93A 3QPIA 2ZDOA 1DPGA 2I0FA 3GRAA 4FR5A 1XJQA 3EZ6A 1PAEX 3DRRB 4MKXA 1BEUB 5D78A 4BQSA 5IAKA 3VAIA 2C4KA 5KT2A 4X8LA 3ONQA 3T5PA 1X4GA 5KWSA 5FDLB 1ONPA 4RMJA 1RWWA 1RTDB 3G3EA 4NJEA 5EZYF 5DM1A 4ZU1X 2QGZA 4PWDB 2EIXA 2C2OB 1U7UA 2ZREA 3O8QA 1SOVA 1FRFS 1HNWJ 4MIEA 4R7GA 5IYZB 1G3IA 4F60A 1MRNA 3KJVB 1FXWA 1RWVA 4MXDA 4EFLA 2XMZA 4JBNA 3F5QA 4YJ2A 1YUMA 4OGKA 4PRYA 4AURA 4B09A 2PL5A 1Y8ZA 1LPBB 1RB0A 1SA0A 3FM9A 3SLGA 2WKWA 1HPLA 2Y99A 2Z2ZA 2BJHA 5CM8B 1NGSA 1NBOA 1WW8A 3EVTA 1JS1X 2MZQA 2GPSA 1F3OA 2CPXA 3AERA 1ZA1B 7REQA 3H2JA 1NU8A 4X92A 3LBAA 2GW8A 3CTRA 1UMKA 5I7WA 4GLFA 1GARA 3Q23A 2HMWA 3K94A 4TU8A 2QKYA 2BA9A 3IVAA 2JLWA 5LXTB 3HGTA 5LA6F 1DRKA 3MM7A 4PVCA 1HY3A 3QHAA 2ZUBA 4CMIA 1XZHA 5D1NA 1II8B 1FJXA 4FEGA 2KRBA 1XBTA 2H1FA 3ZBPA 4H0CA 1XHLA 4B9AA 2MSDB 4Y30A 1Z9BA 1SKYE 3JD0A 2I2AA 4L78A 2YKNB 3K0EA 4IR9A 5H9FJ 3KOZA 5TV2A 5KFTA 3CJ5A 3IUYA 1PP4A 4MUMA 4JGIA 2QZ8A 3VU0A 1OLUB 4RD3A 2ZQZA 2BF4A 2JBWA 1GYQA 2PIAA 2XOKD 3IBGA 1N5DA 2PANA 3R97A 5IXJA 1V5WA 2JNWA 2VPZB 1MJFA 4EY8A 2FSGA 2GQ2A 4IH5A 2MQNA 1EWTA 2OESA 2WU4A 4ED4A 2VD3A 4ZCMA 3WYNA 1JQEA 4CM8A 3ZJ5A 3SI8A 5ELLA 4CT9A 4OYYA 3TSAA 4OZ5A 1WTBA 4A8MP 1ANKA 3T3HA 3UK1A 4D79A 3GR1A 2NYHA 2XE6A 1B76A 2UXBF 1UBSB 1D07A 2NUBA 3D2BA 1XCJA 1HE3A 4RNHA 2EGHA 2JBAB 3FX2A 3P6YC 1NN3A 1SG0A 4MIKA 4HD8A 4BQPA 2F4FA 1L5KA 2I8AA 1MQ9A 1R9GA 4M89A 3SM9A 3MCWA 3WLMA 2DY9A 5AT1B 2DFKB 4IWYA 1RZRA 4NS4A 2O2CA 3F2IA 1ONBA 4ZOSA 3VC1A 2AD1A 1UZDA 1XN9A 1GL3A 2G2OA 1UW9A 3GYGA 4B47A 1RZMA 4CT4B 1EWRA 4LSNA 1C7ZA 2BM1A 2JF0A 3MM9A 2BKVA 3MTDA 3SNHA 5L4LA 2XCPA 3NH6A 4UQTA 2GO7A 6ADHA 2Q8PA 2VNAA 5ALSA 4UAVA 3ZU3A 5A3SA 3CUTA 1E1RA 5JI3E 1WY7A 5FFFA 2VHTA 3RS5A 3KR0A 4UUNA 4CEJA 1BXZA 1PIWA 3HK2A 2CQCA 4WAUA 2WT4A 2Q1YA 1U1QA 4IDGA 1BSVA 3SSRA 5AK3A 2B20A 1SXJE 1K8AT 1TU4A 2YQ4A 3OUUA 3V33A 2DIUA 1U5AA 4FFSA 4N3CA 2ZQYA 2L41A 1BXGA 3K35A 4MWOA 4JODA 1V1MB 3R44A 4D80A 3O3OB 1R6XA 4H35A 1UPTA 4WA8A 1WI6A 3WRYC 4R25A 3UAGA 4MQEA 5IQ6A 4IJ5A 3UIEA 1GRNA 2RB7A 4ZP7A 1M2VA 3IURA 1TAHA 5LZ4A 4ZVOA 1N5JA 4BMXA 3FPBA 1N5TA 1OYVA 3F6RA 5FWAA 3SCZA 2E2WA 4DJEC 2DR3A 4RF4A 2I2BA 4YY3F 2QE5A 2B98A 2BZGA 4PC6A 4YR2A 1CQIB 3CC2S 4AIRA 1DKMA 1WLYA 4C05A 1Y33E 5K4GA 4MO9A 3CIMA 1Q0ZA 4WZAE 2JRCA 2IWRA 5JXGA 1ZOSA 2I7DA 5D4NA 3ZDZB 4KDRA 2YZGA 4CIVA 1CTQA 2FETA 3ZVLA 2ZIZA 1HR0J 1ZSYA 2B51A 2WF6A 3MEEB 2VICA 3ANTA 4LIRA 4LFCB 5B0GA 2C83A 1E1RD 1NH7A 5C4IA 3B5JA 3DGVA 2P9YA 2MT9A 2ZITA 5I7RA 4ZP1A 2PKYX 1DO2A 1OVMA 1WX1A 1NX9A 1RZRD 4CM2A 2RHTA 1SWWA 5L7WA 4LVNP 1R4NA 5KJCA 4JMLA 3T1NA 1IOVA 1FXSA 1IONA 4HNTA 1FY2A 3K5LA 3QLUA 4IDDA 2GKGA 2PNJA 1OPZA 5D8DA 3IUMA 4KRWA 1IFXA 2Q8NA 4IIUA 2H2WA 4HG2A 2AWNA 5F8IA 2QX0A 3VZBA 4NARA 2IL1A 3EYZA 1JAHA 3SYLA 3SIPB 3FOFC 3FMVA 1TDJA 1RAFA 2J7WA 4QO8A 3G49A 4F3OA 3JYTA 2YW9A 9RUBA 4BMSA 1HNXB 3BH6B 4LMZA 3NVKI 4EYGA 5HVHA 4DMRA 3IR6A 4M55A 1JG3A 3VJLA 3X1LB 3FFXA 4QIFA 1W8DA 4G25A 4MLDA 1I4LD 4ZDIA 5EIBD 1YITS 3AODA 1EFAA 4EHBA 4PLVA 2NZ2A 4JA2A 1U1FA 4DV2J 4LHWA 4NWBA 3PHGA 4A1OA 3GFYA 4X85A 2QL9A 4PEOA 2Q4TA 2RJ3A 3KG1A 4QPXA 3ZTSA 3JPYA 1WACA 2CLDX 2GK7A 2BKPA 5JPIA 3BGIA 3NMRA 3B4DA 4C5CA 3OE4A 2MSWA 1XGKA 3C66A 1NQAO 2AN4A 3FW1A 2WUGA 3EA5A 2NU7A 3QK7A 4R0JA 4P81A 1ORIA 1XU7A 3QSYA 3AR6A 4IH1A 3SV4A 4JI7J 2OOSA 5ITHA 1P60A 2O7VA 3D8HA 3J81j 1XT6A 4ZTZB 1N6RA 1F2GA 2PYIA 5JD5A 3B52X 4MW6A 2BFPA 4NOHA 4OLBA 2YIDA 4RVDA 3KLGB 3V4IA 1XA4A 3ZV7A 4JB8B 3O1LA 3RAPR 3ON5A 4DJBA 1PFQA 2YUIA 1QRDA 1XEWX 1EUCA 1EBBA 3UV6A 1DAPA 1IEVA 3IAXA 1P1LA 4OU4A 3LP2A 2HSEB 1S7HA 3WBZA 3RFCA 4CM8B 1HURA 4U7FA 4AXIA 2IXFA 1GXSA 3NVMB 1XMQB 1T9AA 4WMLA 1QO9A 4HUTA 4HNRA 5J1NA 3DOEA 4R51A 4GQAA 2CL7X 4D46A 2I3BA 4D4KA 2LTAA 4DBQA 3GUVA 4IJMA 1Y8QA 1TL3A 4E70A 1U6IA 3UZUA 1RT4B 3N2IA 2X8BA 3O4RA 4MJ7A 1C3OA 4TPKA 1RXVA 4RTSA 2CDAA 2CUKA 3QLUC 2V2KA 2WJPA 4N3AA 3U4GA 1NBWB 4C7QA 2DEIA 4Y2MA 3LALA 5CX1A 4H2DA 1C8LA 3TRKA 5I5EA 5FJIA 4M5IA 2VHXA 2BGWA 2F55A 5AK6A 3FDIA 1KMMA 5AI5A 4INOA 5IZCA 4KFUA 1CDOA 2GA9A 3GLHE 3EFOA 1XFAA 3I64A 3SJAA 4AICA 1WBDA 1S1XB 5IKOA 4OAPA 3KLEB 1MRSA 5FP0A 3M4YA 2FK7A 2EXXA 3MD9A 3IP6A 1S7IA 3AR4A 1QO7A 1N5IA 2BKAA 3GMGA 5F9LA 3FG9A 3BSWA 2R11A 3B4MA 2AJFE 5I7AA 3FTNA 3SXUB 4L5JA 2YQ0A 5CA1F 1MROB 4DILA 4OYBA 4QU5A 1XPUA 2RQMA 1SV5A 1G20E 1JVSA 1O97C 2WWVD 1QUVA 3V7FA 1T2NA 4CH0S 5JSQA 2R1ZA 1XHEA 3MWEB 1PWHA 1YRUA 5B3LA 1QDUA 4X6UA 1WD7A 3NKYA 3NWEA 1BJKA 3TKLA 1HFWA 4WGFA 1P2DA 5DBGA 3J81A 1E7RA 5ULLA 1KC1A 4GKAA 3PE4A 2XXAB 4ZOCA 4LTDA 3QNUA 3TTXA 4MQEB 1P2FA 1TA4A 2HS3A 1UEXC 4BEBA 3NHUA 4ILLA 2YNIA 2ATEA 4AFNA 3ZWKA 2OFXA 4QBKA 3TZWA 3GRZA 1NIPA 4Z0NA 5ETTA 4WKOA 4NBKA 3DWIA 2NYUA 3VR2A 5GJCA 4EPTA 2KHDA 1JKIA 3OR1B 1SJ9A 2CD7A 5GZ6A 4WU2A 1QP0A 2ATXA 4P35A 4HDRA 4PG6A 2ZQ5A 1HWUA 1ZA2B 2AL7A 3DLCA 3BREA 4HH1A 4EJFA 5B4VA 2ETXA 1DTTA 1YA8A 4AF8A 2Z8YA 3O9VA 3J81k 3GB0A 4J1SA 4JI8J 1PL0A 2A58A 4NZYA 4ZN6A 1Z2EA 3GPBA 2ODPA 3PICA 1QFXA 5EC8A 1U9IA 1WHWA 4K7JA 2E44A 2WPDA 1JDJA 4EY5A 3IS3A 3GEDA 3K30A 2AKWB 1HNZJ 3STWA 1ADGA 4F6RB 5IN5A 3K6JA 3OF3A 4C30A 2QX6A 3QXSA 4KRYA 4IDNA 4MKHA 1SO8A 1AXGA 2FB0A 4IOLA 5L3QB 2C8VA 3FMGA 4NE2A 3MSXA 4UXIA 4CLHA 1FTYA 2EFPA 1JLCA 3RRJA 3IAS9 4U8YA 1BRMA 3RAXA 1Y80A 1RWUA 4LJ6A 4BWMA 1UVLA 4CTJA 2RI0A 3F56A 4ER5A 3SVTA 1KN6A 1ZPWX 5HPYB 4L4ZA 3FLBA 3KJNB 1X80A 1NVGA 1CPYA 3K7RA 3VSBA 2HDOA 1NE7A 3RANA 1G4CA 4UQGA 1RQ0A 3STHA 5KFSA 2PTHA 4KQWA 4R4JA 1KVJA 1U45A 1NVKA 3BO4A 2ZANA 2J6UA 1Y5RA 2J9RA 4JEHA 3KYDB 1BVUA 3HXTA 1X7VA 1LBEA 4M1OA 3KQUA 2V3CC 1CS4C 2GYWA 4GGMX 4C87A 3GXBA 4I5GA 2WHQA 5BR7A 2GQCA 1AB8A 3ZWPA 3RQSA 4XSVA 4YGYA 4YFUA 4I2PB 3JZAA 3PJGA 4PLFA 3TRGA 4FKYA 5BT9A 2CMGA 4OFWA 4GX2A 2X7JA 3FUTA 4QXAA 1YA6A 1RACA 5KPJA 3H0EA 2RK4A 3TD9A 2CGEA 5KT7A 3BD9A 5FBHA 3HV0A 5SYAA 2CK3A 5EVJA 1TZMA 4LE0A 2AJLI 4EARA 3W65A 4DG5A 5B6PA 2F7SA 2VZEA 5TJHA 3H9QA 3E2IA 1FTGA 3NXZA 3KAKA 1W29A 3M3HA 4Q1DA 2QVXX 2ST1A 3W90A 3B2QA 1YG0A 2I3ZA 3OPMA 1IJFA 4Z8XA 1DFDA 2HT1A 2ZUGA 1W88A 3O2NA 2RH9B 2J9YB 3QNMA 1QFYA 4K8OA 1FJHA 4TUYA 2C31A 3QE3A 1KQGA 4XB1A 1E6CA 4R7TA 1KMHA 1U2TA 5J23A 1SQFA 2J9DE 3KK3A 4K4YA 1TCUA 2YNMA 2ZSIA 2HQ1A 2DG2A 4LVOA 4HK4A 1K47A 2L0XA 4E7OA 2MEWA 1VQNS 1UJCA 2DPIA 4J7UA 4A8JB 4OJNA 3K2EA 5ADWA 2R8YA 3KNZA 4TYBA 2C9MA 5J2NA 3PW5A 3WJAA 4IJWA 1VE1A 5ISMA 4TWBA 1DCKA 4D02A 2AF4C 4L3KA 3TI0A 1RLCL 3M6MD 2I8EA 2C04A 2V74B 1Z4NA 2W2QA 5IASA 3BJMA 5AKGA 2BKXA 1FX2A 3SYZA 2HX1A 3UPFA 3VOSA 2HSJA 4LV8B 3UKDA 4CETA 1QVVA 1YJXA 2P69A 1QD1A 2P6RA 1HR0B 3K6SB 3UN2A 4GYJA 5EUMA 5AE2A 2VBIA 4I68A 4Y98A 2HLNA 4LQDA 4JI2F 3CWJA 2ORVA 4A8PA 4B6EA 6YASA 2BBEA 1SK8A 3VWSA 3DR3A 3OX1A 3WC4A 2GSDA 2WF7A 3WYDA 1ZD4A 1Y0HA 4I9UA 3OJUA 3FBBA 3DGPA 3ADAC 5KOJB 4FXPA 3R76A 3HFRA 5ALEA 3NT2A 1J07A 1LI4A 1XMPA 1IHDA 5KNCH 3FBGA 3SVZA 3I82A 2DWUA 3LY5A 4UMDA 4Y2PA 5JE8A 3IP9A 3N58A 1RAJA 2Z57A 3RB3A 2R1TA 2CXTA 1RRVA 2HJHA 2CZQA 2E48A 5HZGA 2E18A 1RTKA 4M8LA 1S4MA 4E4YA 4QWDA 1I10A 3TEFA 1ADJA 3UYKA 3AF4A 1IUKA 5HDQA 4M7PA 4PTYA 2DR7A 1SM4A 2PUDA 3NHAA 3A37A 3DTNA 1R0AB 1MG7A 3D64A 2B35A 5FAXA 4P7BA 4PC2A 2IU6A 3AFMA 1FQOA 4RZXA 1XQIA 3I2FA 2J8AA 4KPCA 1K7FB 1L7BA 5B0FA 3HADA 3VV3A 3HI4A 3QX3A 3NLLA 5H8WA 2JFBA 2QENA 4DLRA 1TTPB 2KHCA 2OLWA 2CHVA 4BFVA 1OLSB 3I9V9 4GKBA 3MUMP 3SQNA 4DJDC 4RR5A 2JHGA 2P5YA 3A4LA 1G17A 4X7RA 4XR4A 5C35A 4WJZA 2AGOA 1L3BA 1DURA 3TJMA 5H5JA 4UEOA 5C1DA 4LXYA 2AXPA 1N32B 1YIOA 3TLEA 1Y4SA 2QN7A 1JJAA 4EI2A 4Q9AA 1XXLA 1NBMD 3G1WA 1OFUX 3PL1A 3ZWAA 1FCAA 1A8HA 1OC2A 5HTKA 4B08A 4IDBA 1J2RA 3UC5A 3K8QA 1GRQA 4DDUA 1G5PA 1NU6A 3ZU5A 1S0VA 5DK4A 3RC7A 1KLNA 3I5CA 3OFEA 2DGDA 1DAGA 1VPEA 3QATA 5ECYA 1SEPA 5JWRA 4LSWA 3BR9A 1H6CA 4TLAA 2XXBA 1MGPA 2Q3PA 2AYEA 4H7FA 2QMOA 3SX0A 3A36A 2OEMA 4MH8A 2X42A 2GAHC 1FJCA 3N6XA 4LSZA 2R4UA 3LDAA 3T41A 3HP1A 4K8RB 4CF3A 2BDUA 4BVAA 1NMEB 1CULB 4IO9Q 4HR7A 1ULTA 5EKDA 2E5LF 3FCAA 4B6JA 4NEYA 1KOOA 1OS5A 3L7LA 5I7SA 3RRGA 4RV9A 2Y77A 4CNYA 1QANA 2MGZA 4NR0A 1PL8A 4GOKA 1E0SA 1RHMA 4KV8B 1NEEA 1O5JA 3BRCA 2KMLA 4US0R 5ALRA 1X7HA 3HKCB 3PEYA 1PI3A 1TTQB 2CZGA 3KEQA 4C07A 1K4YA 4UHKA 3FSIA 2HDNB 4Y2HA 4NQZA 2BEWA 2VONA 3GIRA 1PK8A 2OFOA 3PX2A 4AMGA 3TZEA 4UUXA 1N6QA 1Y1TA 4OB6A 4X4OA 5D3GB 2BHNA 4NVRA 4C4OA 1M1GA 3CVUA 3HBFA 4OJ1A 4ZK7M 4U7WA 4F2GA 1NL3A 3UGJA 3NTOA 2UV8A 2CUZA 2EG9A 5GPBA 2QTNA 1SIUA