2F8MA

Ribose 5-phosphate isomerase from plasmodium falciparum
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
237
structure length
237
Chain Sequence
HHHHMDSLKKIVAYKAVDEYVQSNMTIGLGTGSTVFYVLERIDNLLKSGKLKDVVCIPTSIDTELKARKLGIPLTTLEKHSNIDITIDGTDEIDLNLNLIKGRGGALVREKLVASSSSLLIIIGDESKLCTNGLGMTGAVPIEILTFGYEKIIENLLKIYTLKGCTYKIRKRNGEIFITDNKNYIVDFFFTEPIQDLLETCTRIKMTTGVVDHGIFVNMTNVALISKHDGTVLTLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ribose 5-phosphate isomerase from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords ribose 5-phosphate isomerase
total genus 77
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f8mA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f8mA01
2BKXA 4IO1A 3E7FA 1FS5A 4OQQA 3ENVA 3CH7A 2QSWA 2F8MA 4L51A 3BXFA 4OQPA 1FRZA 2BKVA 2RQKA 4L4ZA 2J0XA 2DT9A 3ENWA 4GMKA 3TUJC 1ZPVA 1DEAA 2GNPA 2LVWA 1Y89A 1U8SA 4L50A 1YGYA 4PWUA 2J0WA 2ZHOA 2R5FA 2MDAA 3S1TA 3EFBA 5FIIA 4TM7A 2LQJA 2KO1A 1M0SA 3BXHA 1SC6A 3IXQA 1LK5A 5IS2A 5IT0A 1UJ4A 4R7TA 1CD5A 3ICOA 4GO7X 3DC2A 3NZEA 3TUZC 2QMXA 2W48A 2RI1A 1PBTA 3MTJA 1JT9A 4X84A 5IT4A 3IBWA 2RI0A 3BXGA 3AAWB 3N0VA 1UJ5A 1VL1A 3EB9A 1HOTA 3BXEA 3K5PA 2RQMA 2JHEA 4L5IA 3MWBA 1XTZA 2PA3A 1Y7PA 3TX2A 5T41A 3CSSA 3DHWC 3DHXA 3O1LA 4NMLA 2H9ZA 5HJ5A 3LWDA 2OKGA 2QMWA 1FQOA 3LOUA 3OBIA 2DTJA 3KV1A 3OC6A 4TM8A 4LUBA 4L5JA 1PSDA 3MAHA 2PC6A 3P96A 3L7OA 1HORA 3OFFA 3ENQA 1O8BA 3AB4B 2RE1A 3NRBA 3CEDA 2P9EA 1LKZA 1FS6A 3DDNA 1KS2A 2O0MA 4GO5X 3KWMA 4GO1A 2P9CA 1RWUA 3E15A 2F1FA 3LHIA 3W7BA 2CDQA 2JOQA 3UW1A 2J0EA 3OFEA 1NE7A 2WU1A 3U7JA 1UJ6A 2P9GA 3HN6A 3LUYA 3OFHA 3OFGA 1YBAA 2I9SA 1LK7A 5JJBA 1FSFA 2QRRA 3NWPA 3HHEA 4L4YA 2NYIA 3TUIC 4R9NA 2FGCA 4M8LA 3AB2B
chains in the Genus database with same CATH superfamily
3LRTA 3NHJA 4K6KA 5FBKA 1V3UA 4C4SA 1TU4A 3M6IA 2CDBA 1YBFA 3QAUA 1CC8A 3HN2A 4YX9A 3KLNA 4EG3A 1AA9A 1SCIA 4V19J 3KQVA 3VKHA 3E9NA 1RAAB 3RAQA 4F50A 1K5PA 4MIWA 3NM4A 3N2GB 2YQ0A 1TYDE 3E22B 5CAEA 2DCMA 2A7QA 4PBTA 2R6GA 1RACA 2OKCA 3KLFA 4HN2A 1PW5A 3B2QA 3LZDA 1PYSB 2L82A 1Q0QA 3K4PA 5K4GA 4Q3NA 2ZM6F 1ZBTA 3RH0A 1WXDA 3EIFA 4AURA 2X76A 2VJBA 3CJKB 4B3FX 3V7WA 3LC2O 1XZLA 3IDFA 1JG1A 4ZVOA 2BSXA 3CRW1 3TOVA 1IBKB 3MXOA 3IOEA 4NV3A 1J5EJ 2JFWA 1KZ7B 5KSOA 1VQMS 2CVQA 3L4BC 4HDMB 4RQUA 3NEJA 3V97A 2PQ0A 1DXOA 2JHFA 3HU5A 3IX7A 5EHXA 5LFAA 3NP5A 4YP5A 1HWJA 3D31A 4GXNA 4MNTA 2NP6A 3O3LA 4H7JA 3ZTTA 4WK0B 2J4FA 4R9SA 1GNQA 4OYHA 1L4MA 3HDYA 1DJOA 1QUVA 2HI0A 1T9UA 3PQEA 3BR8A 4I6EA 4RTPA 1U24A 2VHEA 1M2FA 4E70A 5KYYB 2O5EA 4I4CA 4MV9A 3CS3A 5KBYA 1RJFA 4A8JB 1YKGA 1BDIA 3NKLA 1QR2A 4Y2IA 2XXBA 5B3KA 3IAS6 1L4LA 4G8CA 4JZYA 1ABBA 4PLGA 3C7DB 3X43A 2NUTA 1ZVQA 2GGPA 1DQ8A 5KG1A 4PXYA 2W4DA 4KO4S 1JLEA 1HTTA 1L8AA 1WC5A 1PL8A 3IMFA 1POXA 3LGMA 2JARA 1RXUA 2WAOA 1C8LA 3HKZD 1QVRA 2OK7A 1L3IA 1ZW1A 2YQ4A 3G0DA 1KU6A 1E6CA 1P62B 4R9NA 4F3YA 3WLMA 1YZHA 3EASA 3FMBA 2ORYA 2D00A 5JDIA 1OA0A 4B71A 4DJBA 4DF8A 1MX9A 1YOBA 1M1GA 4O2BF 1AU9A 4EPYA 4OQMA 1TZJA 1TAUA 1Y6RA 4G1CA 2IVMA 1YA8A 3ONQA 1IVZA 3DC7A 6LDHA 1LC0A 2CZQA 1DBDA 1IY9A 3IIIA 1KDVA 4G86A 4XCXA 5K3BA 3AONB 2Z6VA 1MGOA 3R7WA 2J67A 2QPOA 4KX5A 1YH3A 2AKEA 4LF7J 3VKFA 3QFFA 3ORFA 1ZQ9A 3N8GA 3RK1A 4MUFA 4KBGA 3UDCA 3T1YB 2AA3A 4LYHA 2PVCA 4FX5A 4FPXA 2VXCA 3D7LA 1ZD8A 2DETA 1CUGA 4YALA 3O2JA 2R8EA 3FKJA 3ZXWA 3GEDA 3MWYW 5BV1A 4J1TC 3K8WA 1CS4B 5LMNJ 2Z09A 1FNBA 3O95A 3RS7A 4DLKA 3WB9A 3G86A 1UPUA 5FOSA 5I42B 3EA5A 3KM0A 1B1AA 3OKFA 3JQ7A 1NNEA 2BBTA 3JVDA 4N7BA 4R68A 3TG8A 1MO2A 3UOAB 3S8MA 1BCSB 1WDTA 1P3Y1 4N39A 1SL1A 1VC0A 5DMHA 1F0KA 4JL5A 8ATCB 1U9ZA 2XYGB 2G2YA 2BV3A 2VJAA 2ABWA 4R98A 1VHLA 2XNSA 4JI4F 4XAKA 3GLIB 2PXXA 4F06A 2CDNA 3I53A 1OU4A 4HB4A 4MKIA 3MM9A 5T6BA 3TEMA 2NTNA 3SHVA 2VRBA 3QX8A 1YJ5A 2I3GA 1RQPA 2B20A 1SXQA 4ZGBA 2NYAA 5EOVA 4YBRA 3PXGA 2YKOA 1ZAKA 1J2YA 2CE7A 3JSMA 5AM5A 1E0DA 4RL4A 3HZEA 1MENA 2FSSA 1U0BB 1RYMA 5P21A 2UUPA 3E53A 4Q24A 1SA0A 5HF8A 1J8FA 3R7LA 2VHTA 3DWGA 4NZ0A 4TTSA 4ZXPA 1BWRA 3TX6A 4QJ5A 1IZ9A 4TYMA 4GEGA 3D54D 2EZUA 3F7NA 1MW8X 4IS3A 4Z4IA 4MHOA 1Y4AE 4CM7A 3DM2B 2YR0A 5DGTA 3I01A 4N6NA 3TOXA 3SBDA 2X3YA 1JX4A 5K0GA 4KRWA 4OBWA 3U16A 6REQA 2Q21A 3FFIB 5CB8A 2HF9A 3VNBA 2W6JD 5D2CA 1F5AA 3L0ZA 3ZTQA 3FNRA 4GPAA 4A47A 2N4CA 3TZEA 2PD4A 2XZTB 5JSYA 4DR5B 1OTYA 2XUOA 4J9UE 4S2UA 2NUTB 4IVPA 2HHVA 3JRXA 5B1IA 2OXIA 4A9AA 2G09A 4GZLA 4P92A 1CYEA 3M1YA 1CUEA 2ZYDA 4FU0A 3I58A 5C5DA 4S05A 4NXNF 4U2DA 4OAQA 3SBEA 3KO8A 3E9DA 3DZBA 2WU1A 1FNOA 1NSPA 4NZPA 3EEBA 4BO1A 1O08A 3L7KA 3FBGA 3HO8A 1T6NA 3S7RA 5DISB 1V7CA 2I7VA 1H6AA 5CT6A 3RC8A 1G64A 3AZQA 2GPBA 2F3QA 1AMUA 2V7VA 1RBYA 1G7CB 2BGUA 3MJFA 3PQ2A 2OHJA 2VH1A 5KTNA 1NMQA 1BWEA 1S76D 1V9OA 3IO1A 1XZQA 2DPXA 1FX0B 4X64B 4DAEA 3B9BA 4DIEA 4NPCA 1P5ZB 3HBAA 5I8ZA 2AMFA 2YJ5A 3SBMA 2A1IA 3B52X 4WRRA 2ZR7A 1XOIA 3V8NA 5CCLA 2PX8A 2Q4OA 5CDFE 4I5IA 1VL6A 3B9QA 4DB2A 1I14A 2EYUA 2IQ5A 1VDZA 3LBHA 5AM0A 1FUYB 2XHWA 4X1IB 1U1NA 2J3HA 3RUEA 2XWQA 3CCVS 3U3JA 1NJIT 1PWZA 2WIKA 3RB8A 3NDJA 2V5UA 4MROA 3HB5X 4ICLB 2XRZA 3NKFA 4HH4A 2B3DA 2X2EA 3E6AA 4O4HB 1PYOB 2YHAA 2W93A 3EFEA 1AVTA 1RWKA 2C1EA 2XMGA 4QIEA 3ZGNA 3OKPA 3R0XA 1QIFA 1GAXA 1Z34A 4HLDA 1Q14A 4JP5A 3IN5A 4P7JA 1SUFA 2YH2A 2J3DA 2CKWA 1P9NA 2VHVA 4MOWA 4GQAA 2B61A 3CZRA 3VKUA 1XQWA 2WK4A 1T8PA 3FI9A 3K94A 5EGSA 5J43A 3RUDA 1W26A 2WWTA 3MQ2A 4RCYA 2A6PA 1BWSA 1UBGA 4FJ1A 4EPVA 2BFPA 4UJ3A 3QKSA 4LF5J 4LF9B 4LYJA 4M3NA 1NT2A 1Z7YA 4NU0A 4KE8A 3ZY6A 5A4FS 2FR1A 2H5JB 3M9MB 2HEIA 1UIRA 3DMJB 5ALWA 3HM2A 4RANA 4B3JA 4FONA 2WZ1A 1VLJA 2GM3A 2C7VA 3EDRB 4OX9J 4WFZA 5I4BA 1YZ3A 3T1TA 1JXOA 4MVJF 1XZHA 3OZDA 4ED9A 3S6EA 1QOQB 1LQ2A 5IC6B 2FUG6 2IBOA 1QHIA 1QVGR 4NEQA 2ESRA 2OMEA 1ECPA 4HR2A 1E6YA 3RVBA 2ZIAA 3CHYA 5DQHA 1X4EA 4TMKA 4C8LA 1JZTA 4QU6A 2FP4A 2JB9A 4NESA 3C7TA 5IZCC 2HA3A 4Q0MA 3IOMA 1N6PA 1NK9A 3MTGA 4J1SA 1MQ9A 2IL1A 5J2PB 3BDAA 5SYAA 1OF1A 1NQUA 1Y89A 1EX8A 2VCEA 5KNDD 4ACBA 3B4DA 4D41A 3OZBA 4M5JA 2FEAA 2XNQA 1WJ9A 3G0CA 4DNXA 1NNI1 2IZZA 2NP7A 2KM8B 4WK4B 2XDAA 3VH3A 5BVHA 3ETMA 3D6HB 5KMGA 3I9FA 3JW8A 4HAOA 4D97A 4A36A 4GWLA 1NB7A 3KJIA 4MEAA 3SICE 1N6LA 2I03A 2JHCA 4KU4A 3HUUA 2HWIA 3MYYA 3Q6MA 2XLCA 4Z9YA 1GQOA 4RNDB 4AJIA 4Y2CA 1XWIA 1I1GA 3VYTB 3U26A 2C03A 2FOLA 1EQUA 4BFUA 1NVVQ 1KO7A 4EBBA 2WR8A 5LZ5A 1DV1A 3K9QO 2LEBA 4KO0A 2V63A 1H2VZ 3DSRA 5LXYA 5AHRA 1Z5VA 1LW7A 1S6PA 1IBCB 3QLTA 2AYEA 2LQ9A 3IYLW 1BS2A 4LCEA 3FRJA 1E1RD 3WAGA 2QJTA 1R5OA 3MAAC 3HVRA 4K26A 4UQOA 3D02A 5FLYA 1VQPS 2HQGA 4CUKA 3EIHA 4BX3A 4OHZA 3AU9A 3T5PA 3OQ6A 3A8IA 4DQIA 3AERB 1QORA 1NBMD 4IINA 4D45A 1Z5UA 4ZIRB 4W7IA 2FSVA 2A1BA 3J80Y 2F3RA 1T5BA 2PFSA 1XZCA 1TJNA 4G5YA 2BUBA 4HXEB 4KQ1A 5DPMA 3MMCA 1BU8A 1HPZA 5IKPA 4MV4A 2I0XA 3GRFA 5CPFA 4ECVA 5FV4A 2GO9A 5A6SB 2Q5FA 5EKUA 4YUZA 2HHQA 4QYWA 4JI5F 4EPTA 1F9EB 3OFEA 3MWEB 1CUWA 2GIRA 1W0KD 3ZWCA 1JWAB 3POTA 1I0ZA 3F1LA 2XNDD 3CTMA 2QRGA 5BN4B 3NHRA 5F64A 5CHCB 5GP1A 4K6CA 4FWTA 4AUKA 2DNOA 5KVVA 1A6LA 4P86A 3LTNC 5EEHA 4DDUA 1Q4RA 1UMBB 1E1YA 3O9MA 3B6MA 1MAAA 3HHLC 3LKDA 3BDPA 4M1QA 3F6EX 4DTIA 4RU2A 4BGDA 4ZGGA 3GPAA 1FJGJ 1I4TD 3UBMA 4Q1VA 4YAKA 1Q57A 4XVCA 4LBWA 5T7BA 5LD2C 2MZJA 4U9IS 4G85A 5FUBA 3ZPXA 7FDRA 1IHDA 1X87A 2CGEA 2CLCX 2IXEA 3PFIA 2JSXA 1DO2A 5C81A 5JBIA 2GCEA 1IN1A 5ETMA 4RK1A 3G8BA 2JGIA 2WE7A 4QD3A 5TMBA 5L4LA 1RE0A 1VPEA 3NX4A 2R5NA 3GRUA 5DNUA 2BELA 3O31A 4JXJA 1HT3A 4QVKA 3WMXA 2V8DA 1SKYE 1OREA 2W4QA 3NHAA 1N2HA 4OV6B 1X0FA 1Y37A 1H23A 5I4IA 3E82A 3IODA 2XYHA 5CA0A 3PWSA 1HFWA 1E1MA 1QAXA 2F3JA 3QFCA 3CCUS 4NXMJ 4WBSA 1W0CA 4ZYYA 1A96A 2DWOA 4L2IB 1D0IA 3G8YA 3JWHA 5EWMB 4Q4JB 5KWJA 3V6DB 2EBEA 3QSYB 4ILKA 4DL4A 1J5OB 1BHJA 4MR8B 3ZTYA 4XWWA 4YR2A 3HUEA 1Z13A 1DAGA 2JC3A 4CO5A 3UGKA 4HZUB 2W43A 2IC3B 4HAIA 2MSEB 3GEPA 5J1EB 3S2FA 3L92A 3GMIA 4NBLA 3YASA 4G5RA 1V5GA 4F7DA 1Q7TA 2NS1B 2J45A 2RILA 7REQA 2ADFA 1HNZJ 4CIAA 3O9VA 4TY8A 3X3HA 2VNKA 1DIAA 6FDRA 2FUCA 4BNLA 4AL5A 1OFTA 2IX3A 1R2QA 1S2OA 4YN3A 1Q7RA 5DP1A 1QG0A 3JTNA 2VYVA 3O92A 3LJKA 4I5FA 1F8FA 2R68A 1DRUA 3IA7A 2GWHA 1SBYA 2ZUFA 4I9HA 2G9QA 3FMVA 1VBZA 2ZUGA 1FP2A 4ZLJA 1M76A 2ZQYA 5AVOA 1GPBA 1J5EB 2PUEA 3QPCA 3FSRA 3BG5A 3KOYA 3IT0A 2LRHA 4DG9A 5C0OE 3JAMA 4PZCA 3TNYA 1NMZA 4UU0A 1FJ7A 2YVQA 2W2KA 1QIMA 2P6NA 5IZ4A 3FUTA 4KXMA 1E9RA 4NBSA 4PWUA 4Y1RA 5FPKA 2QUAA 3KKLA 5CDYA 4P4GA 3WNQA 4YJKA 4MCIA 2C28A 3I32A 1RKXA 2KMLA 3AKZA 4TWRA 2GSDA 2MDTA 4G1VA 2XSZD 4CN9A 1IQUA 1W5EA 3CUWA 1B3RA 5ETSA 3TAMB 1Y9ZA 3M9OB 3OE7D 3IALA 5HRCA 4A8KA 1S2NA 1ZAWA 1GHTA 4B7CA 4UHCA 4URGA 3GJ5A 3SXUB 3OZ7A 2C2MB 2ZRCA 3MYRA 1KPIA 1NBMA 3Q5GA 2YQZA 1E1DA 3DHYA 1HURA 2RI6A 3GRAA 4FXVA 2UXCJ 3BMQA 4O44B 4KNVA 3UWTA 1PL7A 3OQ1A 3NNCA 2QRQA 4MCJA 3DTTA 5T64A 1MRNA 1M1ZA 1VI5A 3ZHSA 2R8YA 1SJQA 1RT4B 3RIYA 4EBCA 4IMJB 2IMWP 3LUJA 2I8LA 5KX5A 4PTZA 1K7FB 1LUAA 3KL4A 3C5VA 5CYMB 2I8EA 4PWWA 3VYWA 4L9SA 4K9NA 5CM8B 1NLMA 2XSJB 4MMXB 1BRTA 2GZAA 1I7SB 2FYTA 4OZLA 5I9BA 4D3DA 5M5BA 3KDPA 5EERA 1ESMA 1SJ1A 1VRCA 1CZOA 5L4SA 4G0QA 2C58A 3F8TA 2OTJS 2B1GA 2QG4A 1WSVA 3LQYA 3IAS9 4KNYA 1LFAA 1D1TA 2IV3A 2I1QA 3W7VA 1UXHA 1GMVA 2XMTA 1M7HA 1MPTA 4NIMA 1WBDA 2ECOA 4YJGB 1UT8A 3UHPA 1X4HA 5FQNA 4CKBB 2X4DA 4FYKA 3DFFA 3STVA 4EHKA 4HHHA 3JATB 3BK2A 3E01A 2V8BA 1Q6ZA 1T3ZA 4FEGA 2IC5A 4L2IA 4V2IA 2OD6A 1S97A 2XWXA 2GASA 4AUEA 2QMEA 5CA1F 3ENVA 2MYFA 1RTKA 4C6RA 1CRQA 1UKYA 5LMNB 1MV8A 3ICWA 2HNZB 1G1XA 5EMKA 5FT9A 3WNVA 2N0SA 3JQDA 4MR9A 4BCAA 2P2NA 5E2IA 1V4VA 4MO2A 2E1MC 5JQGB 3GG2A 1BD4A 4R7ZA 3N8HA 2ZSFA 3L1UA 5J2PA 1I2CA 5FWDA 3G2KA 1YB4A 3HEAA 4X95A 5FUXA 2CFIA 5D0EA 1WQ3A 4E2XA 3P4YA 2MGZB 2PN1A 1K5GA 3IUEA 1D2EA 1XDSA 4NFLA 2O8EB 3H6KA 1GXTA 2OFWA 1JA0A 4B17A 2FE1A 1GY8A 3JX9A 2LXFA 5INTA 2ZBRA 1Y4ZA 2K3KA 5F12A 5LSRA 2YN4A 4NJEB 3RSGA 3IR5A 1NK0A 4XFDA 2Y71A 1QR6A 3SKXA 4F7VA 5BWLA 3A14A 2R7AA 3FYDA 3SK0A 2PJDA 3KDNA 2PWYA 1C9YA 2HC9A 2CKMA 1E4EA 4D3YA 2OO5C 4B46A 1DG9A 4WD3A 3UR3C 2QGZA 4EQZA 3MQ4A 3W6OA 4QQFA 3ZBTA 3V2GA 1CLFA 5LXTA 4MIEA 1G6Q1 4D79A 2HHSA 4N5DA 5FIIA 3GRVA 1AQLA 2RAUA 7MDHA 2MSWA 5IX8A 3QVGA 4FEYA 4P3NA 2PO4A 2E55A 3IAHA 2GDJA 1Z12A 1AGXA 3NXSA 1J49A 2D7CA 4Z4GA 2ZUUA 3E05A 5FDFA 4RWXA 4EGCB 3VC3A 4B43A 4WNYA 1S0NA 1M10A 4X4VA 3E9QA 4G0WA 2PGLA 2XI2A 4LWQA 4BFSA 2XVMA 4KV8A 2HLHA 4ZP6A 3WO0A 1RHKB 4CKXA 5J5CA 2XTAA 4BO6A 5HF9A 4OM8A 1UVLA 4COKA 2ZVPX 3WTCA 2Z2XA 4LOJA 5JG7A 3HNOA 3KB1A 3FFTA 4B3RF 3FHJA 4IKOA 4I6GA 3TQFA 2VDKB 4DCSA 3OE7A 4A0HA 4MINA 1M34B 2QLBA 3Q10A 2G6TA 2IS6A 4KRXA 1T9GR 4AN0A 2WT8A 4UD6A 3NU1A 1U8CB 3QT7A 2H4YA 5HK4A 2ZOFA 2B7CB 5HF6A 1XYYA 3A8TA 4RE6A 4D9GA 4XLLA 2W90A 8AT1A 1CHNA 3GEHA 4Z4HA 4P32A 4OQJA 2VP5A 3WDKA 4GVLA 5KFRA 1M6EX 5IAEA 3CCFA 3KKKA 2ZRGA 3JQ7B 1RWVA 3N5CA 4JI7F 1H73A 2AX0A 2WDPA 4EI2A 2Z2MA 2ZYGA 4QTXA 4LC0A 1FNCA 3W2IA 2B8NA 1GDHA 5LL6P 5U9CA 2XA9A 1T3NA 2EDAA 1WIWA 3ITEA 1IBMB 2ZYVX 4EHHA 1E3EA 1Y3DE 3CLSC 2FLLA 2EGGA 1R0WA 3DOHA 1C0IA 2ODQA 4AJ1A 3QFTA 1AF7A 3KZCA 4JGGA 3P8ZA 1AFJA 5H9FK 1PK7A 3MHTA 2WF6A 1X77A 2RG7A 4HPWA 4FILA 2D3TA 4GVBB 4PPZA 3B6IA 1H2RS 4YWHA 2AS0A 2H1CA 4RVGA 4YCCA 4ZPAA 3I9NA 1B8PA 6Q21A 1LCIA 3J81Y 2CQ0A 2IUFA 1MKYA 4GKJJ 1HR0J 1NVTA 3O0TA 4W8HA 2ZRHA 4ZI7F 1X7GA 1ZH8A 3MZIA 2BTQB 1T03A 1SKYB 4WWSA 3TUJC 1QIKA 1QM5A 3MNFA 4ZARA 3R7BB 5IT5A 2F00A 2ZS7A 3GFTA 2QEXS 4UMFA 1QUEA 1V1MB 3KAKA 3AF3A 3DRPB 5ADWA 3OZUA 4TLAA 4YQWA 1VYAA 5CTAA 2J0SA 4X62J 2QORA 1W93A 2AFIA 4K4VA 1T94A 3FAZA 2R1UA 3PPVA 4RULA 2Y93A 1T6BY 1VHIA 1K8RA 2O2DA 4LRQA 4MV3A 4LF5B 4FMBB 4HF7A 3DM2A 2XOKD 4JQOA 2P2GA 4TQAA 3RWOA 3K6KA 4KSYA 3AB8A 3QVLA 4L5YA 4QW8A 4D82A 1RZMA 3NHZA 5K51A 2FPSA 3IQFA 3L06A 3OLQA 3PXCX 1KP3A 5F7OA 5EZQA 2B94A 3G5LA 2Z4SA 5AMXA 3BGWA 3RYIB 1HGXA 3RIHA 4UEWA 1O5JA 2A0UA 2X5XA 2E87A 1EUQA 1JI0A 2DR9A 1DTWB 2C5SA 5KFGA 4UTRA 2RKBA 3B54A 2XZDA 3HYSA 2NQTA 2VLBA 2JVOA 2UYOA 4J3NA 3E27A 6PFKA 4F97A 3CWJA 1K8ZB 2TYSB 3R9XA 5L39A 5K20B 1NPYA 2V2ZA 3KVRA 1I8TA 4REOA 5J1TB 3GJQB 3AD7C 4HT3B 4H6WA 5TQ2B 4BB5A 4KGXA 1N92A 1O8CA 5BWBA 1FUUA 4JCOA 4CRJA 3TQTA 4CM2A 1SR8A 2M1ZA 4WOPA 1M6VB 3OT1B 1FRQA 3SFTA 1XP8A 2Z3VA 4MAAA 3PL1A 9ATCA 2CL6X 3Q8SB 4TV9B 1Q1QA 5I7FA 4C1BA 3M30B 2F8HA 1OT5A 1S3IA 2O0MA 3HKEB 3KJNA 2J9YB 3RF7A 4Q66C 3NMAA 2AJTA 3G6KA 5T4BA 3CC2S 3GU3A 4KO2S 4JLVA 1QRAA 3W79A 5M3BA 5SZJA 4CIYA 4DPMA 1QPZA 4RD2A 4O29A 3KLBA 1WZ2A 3INYA 2XWBF 3OVMA 4RVOA 1ACMB 3K53A 2H2GA 5HCUA 1JK9B 4JP8A 4FGSA 1JLSA 2C1ZA 4PE5B 4KTQA 3SMZA 3DRSA 2FVPA 1TVKA 4DV2J 1FPMA 1UDWA 1FKPB 5KFQA 1FWLA 2GZRA 3GJ3A 4MWEA 4XJSA 1XU4A 4KQIA 4XJXA 1RWKB 5IWAF 2H0AA 3ZWBA 4AKGA 3LLMA 1HBUA 2R6FA 4AP5A 1OX4B 3DMHA 3C15A 2VDUE 5DHSA 1PO7A 3JALB 2YIJA 4I46A 1G8HA 3FB1A 3E23A 2OWEA 2NVBA 1PJQA 4RF3A 1LW2B 3LL7A 2CV2A 3ETDA 4LVOA 4FF3A 1NNDA 2WSMA 1DY3A 3ZLBA 2OCGA 3ZY2A 1X4BA 3SR0A 3M3HA 4IG9A 2FY8A 1T8WA 2XT0A 3PPYA 4MAKA 4QHYA 4US0R 2QD5A 2CJFA 4AK9A 5EKSA 1C4WA 3EC1A 1NAQA 1BROA 4Z0NA 1RRPA 4B48A 2RD2A 3QQ5A 3KK1B 1K3FA 1NHWA 1SZJG 2AJLI 5M29A 3ROZA 1OW3B 1JNXX 1T0JB 1TD9A 3SBOA 5GZ3A 2OFOA 1PZMA 2XXAA 3LXMA 1I33A 2JATA 4KYIB 3H4DA 1QHHA 1Z2OX 3VU9B 1WMEA 2V5HG 1ESEA 3SG0A 2ACWA 1PR5A 1IVNA 1HE4A 3QM1A 1B76A 2M98A 2B43A 1JE1A 5BR8F 5B6IA 1WQ1R 5JJIA 2BOAA 4Y8VA 4RCVA 2CYBA 3HB7A 5AQ1A 3Q0EA 1RRMA 3BH7A 3KUDA 1ZOOA 4TWBA 4AYTA 1Q0TA 3GLRA 4YIHA 1SCAA 1HL3A 3ITHA 2WYWA 2JCXA 5IN5A 4V0KA 5EIBC 3PEJA 1QPBA 2GCPA 1VKJA 5E3IA 4F96A 3PNPA 2WTFA 3RW6A 3NAHA 2I8AA 5IOLA 2IZ0A 3L8CA 3WJAA 1EGMB 1KSPA 4NATA 3F5FA 2QUIA 3KB6A 1UDCA 2C00A 1QM9A 1FC0A 4ZQBA 1M6HA 2NSLA 1XMQF 2CPZA 4IOKA 5EEGA 4I0WA 2W8BB 5E6RB 4PYJA 4ZYWA 1Q22A 1B1CA 3EFBA 4AFNA 4B35A 1E4EB 3IGNA 2PA0A 3T3OA 4MV7A 2O3TA 2WTNA 5EZYB 1GWNA 4JBXA 1O51A 2P8IA 4G2NA 3C3WA 2FSUA 2YNGA 4LHVA 4YCNA 3AAWB 2BLLA 4YWJA 3E3AA 3K0HA 4RKEA 1WTCA 4K7JA 5CBKA 4WFNQ 4L78A 3AHJA 1R16A 5K4AA 3GY0A 4C11A 1E60A 2OEJA 4LAFA 2DHEA 2QJOA 2C8VA 4ZOLB 4YP6A 2QLFB 3R3VA 2ZDHA 2AG5A 4CLOA 5HMWA 1J0XO 1IYZA 1HR0F 3VOSA 1IIRA 5K0FA 1SQEA 2W9XA 4EVRA 1BEZA 1SVOA 3M2VA 2XQCA 3P27A 3V1UA 2HSGA 5LIRA 4LWOA 5ILOA 4QO8A 2KRRA 2IA5A 4ID9A 4JXXA 1EUDB 4KN8A 5HZHA 3QVSA 3DF9A 1WDWB 5EIXA 2IBTA 5EJAA 3VVMA 3FCAA 3QWPA 3EG9A 4U3JB 3H11B 2H51B 1REQB 3D6AA 5IXUA 4L8YA 4DIDA 4WH0A 2J5QA 4DS4A 2P4SA 5CM9C 5FFNA 2Y68A 3O7WA 5BQXA 5HIKA 2CFRA 3FB4A 1NC3A 4M1EA 2JCSA 3W3AH 3GMDA 2PRJA 3G85A 4PG8A 4IGAA 4WFYA 1WSAA 3KB2A 1E3LA 2R42A 3AKEA 4FNMA 4P0QB 4KHPJ 4X1KA 3A6JA 4RK5A 5G53C 4DAOA 1WPQA 2CJPA 3I76A 1SC4A 1SK9A 5JSKA 3PFOA 3IL2A 1PTJA 2PCJA 4YECA 3LO3A 5JNVA 3V1LA 4IXTA 3I2KA 4C22A 1QYDA 2QU7A 4ZVPB 3IJRA 4PWYA 1EHCA 5JQWA 1SCUB 4HQRA 2CXXA 4HZIA 4BTEA 2G5CA 4E08A 1OFHA 1FFSA 2L2QA 3G8AA 3BSWA 3KK2B 1HX7A 4DEYA 1RABA 2WHRA 2GI4A 3OPYI 2UU9F 3CVUA 4M5IA 3KKMA 3ELUA 1EVIA 3DN9A 1T3SA 3DT8A 1WOYA 3MEDB 5GV7A 4ZDWA 2C4UA 1TYCA 2R7QA 3EICA 2HO4A 5KFOA 2YYAA 4BBYA 2FRXA 2TMYA 1HK7A 2PMHA 4TLRA 3JTPA 4Q18A 1Y98A 2RQKA 1TNDA 3G68A 5JCJD 4GXTA 1D1SA 1L8OA 3T3EA 3SAJA 2E6KA 3C39A 2IFTA 3EOBI 1IJEB 2CK3D 2IDZA 3OE4A 2EFCB 4LTMA 3QELB 3S8SA 1EBUA 3TSZA 3OJSA 2HPAA 4IYJA 4JN6B 1K47A 5DCYA 4ZCQA 3EYAA 1L5FA 1G8MA 4RIIA 1Z6PA 1U8UA 1SBZA 4EDFA 4K9DA 2LCFA 1MO3A 4BGUA 4V0ME 1Y34E 2A6OA 1E89A 1R0BA 4QSHA 1S49A 1V1MA 1CUIA 1DXHA 2DH9A 2I7TA 1JMKC 1UAGA 1C9DB 2HOQA 3U44B 2XYPB 3NHBA 4MUJA 4NBKA 2LKCA 3ANMA 3OMXA 5TT0A 4U6SA 2WG2A 3WGGA 3TB4A 4WOKA 2ZROA 2CHVA 3PHCA 4CM9A 1WZUA 5EYPA 2ZBQA 2JFFA 4C3UA 1DWPA 4A0RA 2HMTA 4TMXA 1S9GA 4MH0R 1ZXLA 1GTZA 1KYYA 2Y0BB 3Q2SC 1JG4A 3OH8A 3JTMA 1H38A 3K6SA 1D8AA 4DV1B 2Q6CA 3L2OB 3QWIA 4PLVA 3R2CJ 2IF2A 3K0FB 1EVZA 5COAA 1O4VA 1ONNA 3JQGB 3L0CA 3N0RA 1S3FA 1Q11A 2AX1A 3R3TA 2PBLA 1EFCA 5J5VA 1UT6A 3KUKA 2JBWA 2D13A 3A9UA 4HTAA 3VOAA 1WSWA 1ND5A 4CTMA 2GGPB 3ONWA 2WONA 3BIWA 1E6YB 3CKYA 3OOHA 2X5JO 3NDIA 2QTHA 2V7TA 1M1UA 2V4MA 5CYQA 4RVCA 3M8QA 4C06A 3EVAA 4HEA6 4B9SA 3E3LA 1IQTA 2BFMA 4RSMA 2QN9A 3OFJA 1QAJA 3QOWA 4LK2A 3A1WA 1GFZA 4MLPA 1P3JA 3FHTA 4LXQA 4FFDA 2DPGA 4FKZA 4NY1A 5LIPA 1G2IA 1JJVA 4FVTA 3UVEA 1HKUA 2CA9A 5KO2A 1HT1E 3PNVA 5C53B 3MT8A 3G6XA 3DEFA 4OAPA 1PKEA 3STHA 2B4KA 3WX4A 1NBOA 4NK5A 3GRCA 1JA1A 5LM3A 1BVRA 1UPPA 1B3BA 2MR5A 3H3FA 1LW0A 3T1AA 3LZCA 4PXSA 4RY2A 4Q1BA 1JHZA 4JR2A 3PFKA 1WUYA 5AM1A 4E51A 5AVKA 4JT8A 4UQTA 3ICOA 1QP4A 4TNOA 2GPAA 2ONZA 2P5UA 4J9MA 3OEED 5L45A 3T1HB 4KLRA 2JEOA 1RZUA 4L57A 2NO6A 3OUZA 1U8TA 5AD1A 4BQSA 4FOTA 1PUXA 4BS2A 1CQJA 1EVLA 1H2BA 3PITA 4D25A 5TY0A 4UZCA 2CF6A 2QGFA 4H18A 3I9JA 1TKZA 2O2EA 4F92B 1PFKA 4ALLA 4HMPA 5CAAA 2RJZA 2IWRA 1TADA 2JGKA 3DLGA 2FVCA 3EXG2 4NU5A 5SZTA 3W2VB 4GLBA 4WY8A 5T14A 2ZS8A 3NIFB 3UOWA 1DKQA 3G2MA 2QTBA 4TSKA 4YQYA 3HBFA 2A1TS 4I5GA 5K14B 5CH7B 3CUKA 4DLXA 3WMFA 5LQNA 2NSCA 2XLKA 3H5IA 3CF0A 1Z62A 1B4DA 2W6JA 4O8CA 5CNMA 2PI4A 3E22A 4F56A 5FWAA 5A9SB 3D4BA 4IYQA 1W88A 4L73A 4LR8A 4UZFA 4C2TA 1ZESA 2JFOA 3KUGA 3G2JA 2H1VA 3N70A 3AJ2A 3THYA 3LFTA 1YR2A 4X4QA 2CJXA 2ON6A 3DE0X 3BF7A 5BWMA 3CVJA 3VU9A 4TT8A 4OV6A 1RHRA 4G84A 1D0EA 4A26A 4WZMA 4RTSA 4KLNA 5B0EA 1LEHA 1YRQA 4ZT2A 4IDNA 1KLMB 3U2QA 1UCFA 4G23A 4H4MB 3E3MA 4F2RA 2ODNA 5E5NA 4A0FA 2NW6A 2O3UA 1JDVA 3L7OA 4XPCA 2GBLA 4Y6LA 2CPYA 4USTA 1AQ6A 4X85A 4A1OA 3ER8A 1ESCA 2FEMA 1RWUA 2REBA 1PFUA 3ZXUB 1O6FA 4D8YA 4Z0PA 3TN7A 3SSSA 4JT2A 1JIIA 2KHZA 3FOCA 1RHJB 1U26A 1G41A 3HWWA 3KHHA 4AJEA 3RSLA 2JKYA 1WL8A 2X3DA 1L7NA 2ZNZA 4NJOA 3QEOA 5L9AA 4DKJA 4O3NA 3KFLA 1P18A 3G8QA 2PCLA 2R6DA 3KTAA 2BW7A 4PO9A 1V5IA 4HQOA 4Y2HA 821PA 3MF5A 5DTMA 4EVIA 3AL0C 3MMPA 1PDWA 1FD2A 2OZEA 1EUCA 2QWXA 2ZKLA 3RBEA 1YIAA 4P2GA 1SUBA 2H1SA 4DXLA 3GZNB 3DUWA 2VPXB 1VR6A 3PO5A 1DT5A 5EIFA 1UP6A 4WX2B 2PZGA 1NSKL 4CTKA 4QA9A 1UZDA 1JLGA 4Z8YA 1NKCA 2CQGA 1H2ZA 2KH9A 1T9AA 1MAVA 2X3FA 3BCSA 3D3JA 4F93B 3F6YA 1L5HA 3N0WA 1RC0A 3ZDQA 2E9SA 2I7DA 1XL0A 3F74A 1IEXA 4R69A 2G1AA 2RBKA 4C4RA 2IC3A 2LKZA 4QXOA 4QYTA 4AMGA 4MUAA 3WMEA 4HAYA 3BSNA 4BU1A 1GTRA 4TZ0A 3Q8XB 3C3BA 1RTDA 5M2UA 3D4IA 4YRRA 2ERCA 4XCVA 1XKXA 1FSZA 3PNIA 4JLJA 2FLNA 1CUAA 3IRUA 4OHWA 3N5BA 3CO9A 1JLAA 4H2DA 5HRUA 4AUMA 2I22A 2O01C 3SQDA 1NIPA 4FMCB 4YB1P 3U9SA 3AVUA 4G5XA 3L95X 3FPSA 1S6UA 3Q6IA 3SYRA 1WUKS 5BQPA 4NENB 2KG0A 1UF9A 3VQTA 2R751 3OMLA 1FK9A 4ZP9A 1EKRA 5LYYA 4RD3A 1MIOA 2ILTA 2ZB7A 2HN9A 2GAHC 3NHYA 5AXDA 5BWNA 3TRFA 4N4AA 3T3IA 4B4UA 3DEKA 2VKRA 1KQOA 3ZIAA 5KREA 4CIBA 4N03A 2PFFB 1TR0A 1N2SA 3M49A 2ZD1A 4AKIA 3K96A 4LGYA 2QPAA 4DLWA 1L4HA 4B02A 4OU5A 4UE6A 3GJRB 1U1EA 1Y1PA 4O33A 1YA4A 4IMPA 4GR9A 1JFTA 4HNHA 1PGNA 1XDDA 3N07A 3NVDA 3TYXA 1R89A 2ZZTA 2BJWA 1XZJA 4I1RA 1WV0A 2O8FB 3ASVA 5I7EA 2ZI7A 1XLVA 2NU7B 4HT7A 3RSCA 2HT1A 1QB7A 3TOSA 1N0WA 3JQAB 2NAFA 4EO7A 3WLAA 3UJ7A 4D44A 3M4JA 3KKNA 2RS2A 4N5HX 2RGUA 3RRJA 3JQFA 1RKBA 3KKEA 1WDKA 2EI5A 4N3NA 2FEOA 3FFIA 4UBJA 5I47A 1YTLA 4A2CA 2X1VA 2K7ZA 3CMES 3PWKA 2ASEA 4NCHA 1LLFA 1TKXA 3M1IA 1TUBA 1GZVA 4RW7A 4CCAA 1SA0B 2J09A 3KSDO 2XYRA 1Q3KA 4C4XA 4TXJA 1HQCA 4U2BA 3AHFA 1JLFA 3W0LB 1WY5A 5C2GA 2QTTA 5B4UA 4MPJA 2RHDA 4GYJA 3AUSA 5IYZF 4Q45A 3K0AA 2HZBA 4GO1A 1CG2A 1N5RA 2EP7A 4DLNA 2HIQA 4OU4A 4JLUA 3BD7A 1XWFA 5K4HA 4DCOA 1NQAO 3C24A 4LQ9A 3QLUA 3OY2A 3QY9A 2Z9DA 1FX4A 1HBMA 1VA4A 2VQFJ 2B9YA 4Y6GB 1XLUA 2NVOA 3N8IA 4N47A 4LDPA 1FXSA 1US8A 5HCNA 3M83A 4BVKA 2H2IA 3ZHOA 5I8PA 4KDCA 3KJQB 5M2RA 4W92B 1WP4A 1TJ4A 1TK5A 1PJRA 4F9GA 4WHMA 3H17A 2YVAA 4ACAA 1RLOA 1XSEA 2Q6KA 1EEHA 2GFQA 1A7UA 2MKHA 3AY6A 5E6SA 1Z4MA 3ZV4A 1IPEA 2AW5A 2Z8ZA 3NP9A 2MKSA 1H85A 1QTNA 1JR4A 3JZMA 2ADCA 3K6RA 2I4MA 4ZTBA 3C6TB 3AILA 3PSHA 2FJWA 3DRRB 1XZMA 3H5LA 4I4BA 1E18A 5JEEA 1E59A 3O94A 3OM1A 3D8BA 4QSMA 1J0DA 3VYUB 1LDEA 3A3YA 3AHHA 5D77A 1CULB 5HQJA 4XDZA 2EFEB 1SXJA 1CUDA 3GFRA 1E2DA 1XIQA 1VE1A 2H4WA 2JK1A 4ES2A 3URMA 4WF9Q 4RW8A 3CLUD 3PIOQ 3UAZA 3X2SA 4DC9A 3X2EA 4JKOA 4R0EA 1M34A 5CYFA 2HQ1A 1IG3A 2P65A 4Z9XA 3VGVA 4B8WA 4QR1A 1EFVA 3IB6A 1Z28A 3L6BA 5RUBA 2MQ8A 5DGDA 5IKXA 3D2CA 3DGPB 2A9QA 4AW9A 2O2SA 4LNUB 4B87A 1XPRA 1QGOA 4LSZB 1T0TV 2JLUA 3EAQA 3RRFA 4XD2A 5J1SB 3DBRA 2XZLA 4QJ4A 4NE9C 4OKSA 1WPXA 3GCZA 2VL1A 1S72S 1A72A 4KE7A 3F7TA 2C7RA 1E98A 4UARA 4XIJA 2YMLA 5B1DA 2A30A 2VEDA 4C7VA 4AZ3A 4G1BA 3C85A 1TGYA 1ACMA 3AD8C 3FNFA 3OC6A 4WJZA 5BN4A 4L22A 1QB8A 4MEJA 1CJKC 2KYZA 3IQZA 4PTLA 1LQ9A 3CJ3A 5FQOA 2RF2B 1JXQA 2ZD1B 3GX1A 3VPBA 4F71A 3VYVA 1XWLA 4JK3A 2LXUA 2G40A 1W8DA 3U0VA 1QANA 4BUCA 1BDBA 1FIUA 4LDQA 3CMMA 1MJNA 2X0JA 3SHOA 1KI2A 2BRUA 1RA6A 2HHAA 5H5JA 4JY7A 3PE3A 3VAKA 2A1UA 3AK4A 3P49B 1LVGA 2IW1A 1MBZA 3HYLA 3IHWA 4AFFA 2XOXA 5ALRA 2H3EA 3EXFA 3TANA 3WAKA 3GSIA 3PX7A 5EY5B 1NRIA 4C29A 3BDIA 4DQKA 3AKDA 4J7AA 3GGSA 1YWXA 4MJXA 1GL7A 2F9LA 4BBZA 3PEVA 2ZSHA 4UM9B 2ZJ8A 3MIZA 1PKXA 1Y1TA 2BHSA 1YNSA 4AS2A 1KN6A 3I6QA 4MWSA 2LEPA 1ZC4A 1E3DA 3UT5B 4FYJA 4D9JA 2I38A 3GPDG 4ZZ3A 3N6LA 5CFZA 5E9AA 3B5EA 3J7TA 1X38A 2P79A 2VOEA 3REFA 4JBNA 3G7UA 1ZONA 2ACKA 4ZT6A 3D4OA 2ILZA 3IS3A 1RXIA 4DLUA 4NDZA 1RYDA 4TLBA 1ZJZA 3WGZA 1C8KA 3MWKA 1RLDA 4ZLLA 2PN6A 4PXEA 5JATA 1LF5A 2EL7A 1SKMA 1DO0A 4V19X 3RB6A 4IDBA 1TL4A 4R0VA 3B20A 1PR1A 3BWBA 2HRYA 3OCUA 4EFAC 4GPBA 3U4CA 2OT3B 3DLPX 4DJEC 1WQ4A 2R4TA 3T7CA 1TJ5A 4OZ1A 1FNXH 2AT1B 4TROA 3AODA 1LXNA 1CJVC 5CFNA 2PSDA 1FVFA 1MA0A 1RWPB 3OZWA 1YS6A 2HFNA 1YNOA 1CUVA 3RTCA 2GAOA 3MEGB 3KLGA 2O4UX 2XY7A 4MGHA 4NA2A 4CQLA 1ZUD1 4HLUA 2NR0A 5HJ5A 3V8EA 3SQMA 4S1WA 2PT7A 4JVLA 5HUQA 2ZSDA 3GN1A 3VU1A 3A4MA 1Y5IB 1ZMOA 2DITA 5LD2B 1KZ1A 4F3CA 1W4RA 1JG6A 5I45A 3RTVA 5DIFA 4ZDKA 4PAGA 2YV2A 2FPPB 4HRVA 4GX2A 2XOKA 1UEJA 5HOEA 3M4ZA 4KAFA 1JR2A 2ZB2A 2AXEA 1HMVB 3TECE 2VDWA 1K0TA 4AICA 3ZE7A 3SCZA 3DNPA 1A69A 2E89A 4N8SA 3F7MA 3B3GA 3GFBA 1NOIA 4HWTA 2PXAA 3BA6A 3CZMA 3FGOA 1GD1O 3GP3A 2O2XA 4TV9A 4CL8A 4ED8A 4WJLA 4IJMA 1V71A 4QO7A 4HB3A 2YNIB 1D3WA 2VH2A 3MT9A 2CDRA 4YHBA 5E3CA 5JROA 4NLDA 1Z38A 3H5OA 3HCPA 1N88A 1LU9A 5D87A 3CU5A 4E5SA 5DO2A 3S2GA 1NBME 2APJA 2WQ7A 3WBFA 1QFYA 4E0BA 1OQ3A 3ICLA 3RQIA 2ZI4A 3QE3A 3LUAA 5GMDA 3EPHA 3QRPA 5A3VA 3KJVA 4NX9A 1G6BA 1FEZA 4V3BA 4ECTA 4H4EA 1ONOA 2G1UA 2GBCA 1RHQA 3WISA 4I69A 3R0QA 4ZI7A 3RD5A 1ZUHA 1TJ3A 5DETA 4NLWA 1DC7A 3TVZA 3DUFA 2HBQB 4QIWD 3ZWOA 2IYAA 2QD1A 4C0OC 1G20E 2UKDA 3AETA 1XJWB 2QLTA 1VQ1A 2Z9BA 4FMDF 1FXDA 3D4NA 1EB0A 3PJRA 1QK3A 3ZHCA 1LSJA 2DUUA 2JCYA 3MFIA 1U3FA 2G9RA 3ZTPA 1XDGA 2TECE 3UCUP 2HB6A 3GZJA 4ZP1A 1PJLA 1E6VA 1ULRA 3FTCA 1E0AA 4YJGA 5BSGA 3CUEF 1JAXA 1J2TA 4O3SA 4L8VA 5KYKA 1JHOA 3LECA 2EQAA 1CLEA 1IOZA 4LBHA 2JIDA 1DOZA 3V4LA 3DGEC 1EX6A 1LPAB 3P3DA 2ZZKA 1GTVA 1JWLA 4G3IA 5JI2E 2QRNA 1J1ZA 1YAHA 3QPVA 4G1UC 1HFEL 1JYEA 3H9QA 4ER6A 2V4QA 3FA2A 1ZVVA 4MJ3A 4QOGA 1NVXQ 1OA1A 2DBBA 1X1CA 4KL8S 3QBTA 3V6DA 3QELA 4LREA 4DFKA 4AY2A 5B37A 2IRUA 3G02A 5AXNA 3DAFA 4D92A 1X60A 1J25A 1NYLA 1IBKJ 4PV7A 5FD8A 1DTSA 1R7RA 1YU6A 5KIAA 4TLEA 2CXOA 5BXYA 2OEPA 4WJBA 3RBAA 1QGUB 5FUQA 1IKXA 1S89A 1HI1A 3BAZA 4NX2A 1ZH6A 4BNDB 3L0YA 3SMVA 4W6QA 1P2BA 3D1QA 4ZYXA 4R5MA 4N0QA 4TMVA 2CWWA 2X1MA 4DQPA 1RMQA 2XKJE 2QLMA 1XZDA 2FMFA 5KVSA 5FIUA 1YITS 2OI2A 1J20A 2VK4A 1E96A 3SM9A 1OH7A 2EBUA 3D1HA 4UAGA 3ENKA 1UP1A 2YDYA 4EEKA 2Q2NA 3MEEA 1HQEA 3K8OE 2PX2A 1EVYA 3CSSA 2HGNA 4Y0FA 4AZWA 1W44A 2XJ9A 4HUQB 1OPXA 1XQ1A 3DE4X 3ZZZA 3QUSA 4RZXA 2BJ7A 3MURP 2P90A 1KQNA 2GK4A 1PNRA 1SURA 3G0BA 3TTYA 2UYCA 2PD3A 3BO3A 1FF9A 1FYEA 4GO5X 3RS8A 1A5ZA 3GP5A 4TXHA 2HQFA 3ENAA 3OV7A 3HLKA 4X8HA 3B1XA 2X41A 3SSAA 2PU7A 4BBJA 1JQAA 1QAIA 1D6JA 4B08A 1O57A 1O6GA 3R3SA 4D8VA 3KZKA 2P2YA 3ZYCA 2BXJA 5I9IA 1FKPA 3TGWA 1GNVA 5ETKA 1LBQA 2KX7A 2V9PA 3KT3A 3UC5A 2H4XA 4TU8A 1JFFA 5BO5A 4TS1A 5B0CA 4M9XA 1Z4LA 2NO9A 1RAFA 3CNQS 1SQ0A 3L4SO 2GPYA 3RC7A 2ZRQA 1CQWA 1S1TA 2HS4A 1FFSB 3OFNA 4YP9A 1ADGA 2DJIA 3JY6A 5KG3A 4HD8A 5IAOA 5MN5A 1ILEA 4KWCA 2XMZA 3L7NA 3LTEA 1T1GA 1WXIA 5T4FA 4DG5A 2O59A 4FNHA 3A05A 1RYYA 2JI9A 2I4TA 1T9CA 4LJ5A 5K5EA 1U0RA 3O8RA 2J07A 3T5DA 2D54A 4U9HS 4X91A 2VRWA 3NBYC 1NE7A 4DZZA 2JJ4D 4YIKA 4J90A 4LF6F 1RNLA 3FDXA 2WF8A 2EG9A 4HTFB 2MJUA 4BNWA 3ZNNA 4AJJA 4MPDA 1X15A 3EVGA 1SJ3P 3KOXA 4TZ6A 2QHXA 2VTBA 4MUBA 1QTMA 3GK3A 5TPWA 5DBGA 2UXBJ 1VQ8S 1O1YA 3PNKA 5C25A 1DURA 1CEZA 3H2VE 3MFQA 4ZDNA 1KEUA 721PA 4B5KA 1P77A 5DTQA 1ISJA 1QCCA 3CMCO 3NLCA 2XCPA 2CVPA 3RNLA 3V4OA 2OMOA 4GI2A 3T7EA 4D9MA 2DXIA 1N32B 2H3EB 3LPEA 1F9HA 3S28A 5EQFA 3W5YA 3AG5A 3IAM6 4AJ4A 4I56A 2D9OA 3H8YA 5ANRB 4INAA 2KFNA 4CTNA 1KYWA 5ARDA 5HBGA 2EFYA 4P3XA 3W66A 2NSYA 2IYZA 4DV0J 1U6BA 2KT2A 2F1FA 3EGWA 3C6XA 1C1BA 1G20B 2Z6UA 4PHHA 4ZRDA 2ISQA 5E7MA 4MVJD 1A4RA 1SPBS 3ER9A 3EUNA 1JU3A 4RF2A 1E99A 5ICCA 1E9CA 1VZ3A 1Y9OA 2HV8A 4E4TA 1QHGA 1EVQA 3IO5A 4O4HF 5F98A 1XC9A 5C80A 1IDN1 3GJ6A 2OXRA 4W5RA 3R1LA 1CKEA 2OYRA 5KAKA 3ZWMA 5J2UF 2WKQA 2MKYA 3H5AA 3WBKA 4X97A 4IRUB 4NDNE 3HB0A 5FTNA 6REQB 2VHYA 2AH5A 4BRSA 4PFQA 3DE6X 1IVSA 3VO9A 5DGXA 2WIGA 4MYSA 1H9CA 2PVSA 4RW0A 4C11B 1P4GA 2WNHA 4B9MA 3VSBA 4Z2XA 4PCUA 3H9EO 2KBEA 4OHKA 1HMYA 3DNFA 3OTEA 1YS9A 2OBNA 5CCMA 2NUPB 1UMDB 2OD9A 2BONA 1Y63A 4CZ2A 4L8WB 3UDLA 1W85B 1VRTB 1RKIA 1UQUA 4XRRA 3F5SA 4LMZA 4A7PA 1MMLA 1EFRA 2YBEA 3JATA 2GD2A 4CM8A 2GNKA 4DV7F 3DS8A 3GJQA 3H1TA 1HXHA 1M5OC 1F0YA 2IYTA 2EKLA 3CSDA 3UAOA 2WI8A 2WHPB 4FYWA 2IEIA 1KKMA 3OJXA 2WIJA 1Y1KE 1I7LA 3QMQA 2JHGA 2DB1A 3HJGA 4E7OA 3THVA 3QXJA 4EENA 2OGSA 1AK2A 5KPDA 1KYIA 1WHYA 3BGOP 4P7BA 3PQ4A 4MS1B 5ALKA 1S99A 3CJSA 3LK6A 2FLKA 4YRFA 2HEGA 3BSCA 1MQSA 2FUG1 4D3FA 3TR5A 4DBLE 4R01A 3O4RA 4P75A 3THRA 4C7QA 2R7LA 3FSIA 4Y0VA 3RF6A 2CXQA 4I3GA 2AX3A 3PDCA 4UNQA 2G77B 4RK4A 2FZ4A 5HXAA 3KLPX 2CWDA 3H04A 5AXAA 2P3LA 1BXGA 3AU8A 4R40A 2FA9A 2ZTUA 3LTOA 2XCQA 5L6MB 1JQJC 1AUQA 2DHXA 3G6ES 3FPFA 5T3UA 2P2ZA 4QUAA 3H5WA 5L7TA 1PL6A 1FSPA 3RIMA 2XMQA 1E5DA 5ALXA 1FDUA 4IM7A 3FC9A 3HVUA 4WU3A 3KCNA 1U4BA 1CZLA 4MKHA 3LW7A 3BD8A 2MKKA 5EKXA 1XQIA 1CWUA 4URQU 1KC1A 3PI7A 1GNTA 1T9DA 1EK6A 2WKSA 2CJXB 3LQ2A 3R40A 3EZ9A 5AJUA 4N01A 2X40A 3J81A 4PHCA 1KDPA 3J7A1 2JEIA 3U4HA 3HGMA 1X7ZB 4XIUA 3S55A 3NGTA 3HUDA 1YJVA 3LDUA 3V34A 2E2WA 5LNK1 2Q41A 1YVPA 1N2CB 3MTJA 4MARA 5ADVA 5IT4A 5HWSA 4DR7F 2G0NA 1CR4A 1VGYA 3P0RA 4F2GA 4F26A 5H0IA 3ZDBA 4MW9A 3JXOA 1SOUA 1II9A 3W1YC 4FYPA 4CO2A 5IG2A 4RNMA 3B7PA 4AJNA 4BDSA 2OBXA 3NWEA 4KR3A 4IJKA 2WVHA 3CCBA 2KL8A 2LQBA 1GUDA 2GRUA 1S1VB 1SH7A 3SHQA 5BN1A 3O44A 3CT9A 1EBFA 3MMSA 1R4ZA 4PYLA 4TWJA 3O90A 4OJMX 3RUIA 1SHLA 2YVKA 1Q17A 3CN7A 5AM2A 2GESA 3S8YA 1XHEA 5AKZA 1GZSA 3RAXA 1OTXA 3UVJB 2ATLA 4HDKA 4ALJA 3SX2A 3PYMA 2YRWA 2ICAA 3E0QA 1BSVA 2ZBVA 1T2EA 4QCLA 4XYMA 1QC5B 2H17A 3Q8RB 1G8YA 1VGRA 5CLQA 5KG0A 4IIGA 1UEIA 4O1IA 1O03A 5REQB 2R2UA 4KO0B 4CIXA 2D0OB 1T9ZA 3AKYA 5GMOA 2Z2JA 4KREA 2JGNA 2RBGA 3LO5A 2Y0SD 1DU4A 2MINA 4RGQA 4K2JA 1W6RA 3RAEC 5TF4A 1TKCA 5AI0A 1Z0UA 1TP7A 3AP1A 3U9TA 2HNAA 3W77A 4ZKDA 3SCKE 3VSCA 5JE8A 2HJGA 3HZGA 2GN1A 3EWAA 4IOCQ 2Q3DA 3PXBA 1XWWA 1JVSA 2DGWA 3BYPA 4S1TA 1GGMA 2JI8A 1HL6A 4IQXA 3ZJ5A 2MIIA 2VP9A 3EG5A 4LSGA 1KRXA 1JHUA 1IR0A 5HFAA 1EWTA 1GL9B 2OZVA 1E69A 2HMUA 3MJSA 3V2IA 2XZDB 3ILVA 5JFOA 2X8AA 5K0EA 1SRQA 1NOKA 4YDQA 3WYGA 2OUGA 3W4IA 3DCAA 1LK7A 1NJ6A 3PIIA 4URWR 2FHOB 2QTVA 1JB1A 5KQGA 3MGKA 1S7HA 2QA2A 5KOHB 1F7VA 1KZ9A 3I2YX 3FZGA 3R7BA 2CV0A 3IKTA 3H05A 4H4MA 5AW5A 2QAIA 4IDDA 3DO8A 4FYWB 1TD1A 2EFHB 1DEAA 1SV5A 1R0ZA 1L5UA 1IKYA 2BDPA 4RELA 1QV7A 1EUDA 5LA6F 1VSQA 3EZGA 3U4IA 3JYHA 4M63A 1EUZA 2ZT8A 2KT5A 2CHGA 3RFCA 3PD0A 5TR9A 1KAHA 1WNEA 1XAIA 3BXEA 1KR2A 3MI7X 1R0RE 2BC9A 4NEGA 3AUTA 1KH3A 3NG1A 3BWEA 3WGUA 3PKIA 4RETA 4CETA 3CCES 1UW4A 3ADCA 1M8FA 5C5CA 1O95A 4PQRA 2B36A 2DBVO 2QS9A 1T0IA 1BE0A 2P4UA 1RTIB 3C48A 2VFUA 3GG9A 3VH2A 3PXDA 5B7PA 1WF2A 3GFXA 4DV4F 4TYWA 1E5LA 1OH5A 1PR3A 2X58A 2RMKA 3PHTA 4WZAB 3MPDA 2P7HA 3TKYA 1VLLA 2LCIA 3GLGA 4PYDA 1D03A 2HW3A 2XIQA 5KI6A 2HWKA 2RGEA 1OYVA 2AUNA 4KR0A 3ENWA 4JFAA 2V7QD 3RGWS 4EUSA 2WD7A 4ENTA 3D6FB 4R2IA 3EY9A 3DMRA 1TU3A 4X71A 2E0IA 4GO7X 5EJFA 3H5TA 4ZZ1A 1C4KA 3WLPA 4FYXB 1HA1A 4EZ6A 2Q28A 3HP1A 3HA5A 4M1MA 2QW1A 1YDFA 4Q82A 2YXLA 1YQ9A 3MUOA 4ETWA 4OLOA 1OV4A 1U3UA 3A9RA 4YJFB 1DHTA 2X0EA 1OYDA 4TTTS 3DNCA 4LFAJ 5LQUA 1SVLA 2JWNA 1RHMB 1JLHA 1KKUA 1P1LA 2E82A 2QV0A 2ZDGA 3AF6A 1RZ3A 5JDIC 2YX4A 5JWOA 3CKKA 3GB9A 3QYFA 3CD0A 1UVMA 5CLJA 3ESAA 1HYEA 5L8VA 1BUXA 4P72A 4CHTA 2ZSBA 2UVWA 1V5FA 2PEZA 4UM5A 4HXYA 5EUMA 2LU1A 4DCOB 5B2EA 1P5JA 2ZIXA 1MQAA 1Y6GA 1CY6A 4P3OA 1HNZF 4BUJA 1P19A 3A9CA 1BW9A 1S7CA 2WW8A 2E5HA 4ZCSA 1U7OA 2YKMA 2ZUCA 4LRSB 3U1TA 1RLIA 5IC5A 3J7YU 5CFQA 4X0EA 3FJOA 5KOIA 5GZ1A 1XROA 4HT5A 4PAOA 5DFAA 2GD1O 1AJEA 1WCYA 2JFYA 2Q5JA 2QE7D 4S12A 2B6NA 2CVHA 1AKMA 2IDJA 1JDSA 1VRTA 4QJBA 3MWDB 4BMNA 4GZMA 3D4LA 4BV2A 1AUDA 4C97A 3IQEA 3GAZA 2WICA 3LS2A 4BMPB 3NJ4A 3BMXA 3SQGA 3BGLA 2SHKA 1KR4A 2OO5A 3CJ2A 1CTQA 1QO9A 2I4LA 1NXTA 2D5BA 1E1KA 5TS3A 1YBAA 3SFVA 1TL7C 3RDPA 3MCAA 4Q0BB 3CNLA 4TUYA 2NTYC 4C5CA 3E81A 3O26A 2ZB8A 4FZ3A 2PZKA 1V39A 7YASA 1K3TA 3W2EA 4FEAA 4D9IA 1D6SA 2W8KA 3KT6A 2QSUA 3QX3A 2CPIA 3RK0A 1OBHA 4J0KA 3EVZA 4NL4H 1FU4A 1IJKA 2NXNA 5F5LA 4MMOA 3ZGYA 2A9KA 4C7JA 4M0EA 4IOBA 1QQAA 3HKBA 1UXKA 4ZK6A 4TLMB 1EXDA 1A9NB 2HD4A 4E5KA 1NUUA 1WWKA 3SYLA 1QMGA 5CNJA 1JJ2R 4BLVA 1G8JA 1YR7A 1WTAA 1E2FA 1RTIA 1CC1S 5HR5A 2PUDA 1VJ5A 1U1GA 1JKXA 4DR6J 1RPNA 2C2XA 3H7IA 3TZCA 1RQGA 2GHIA 4NSNA 4DILA 3MPUA 3L7DA 1RXSA 3GMGA 1SBRA 2QLBB 2QVCA 4DG1A 4OPMA 3WYCA 1OGJA 4EIWA 1P7VA 2D2VA 1PEKE 4R5HA 2VHGA 2W42A 4QBUA 2WWGA 2WJGA 2WFLA 4O4JB 5C24B 1TMMA 2IYIA 4Y0NA 3W3SA 4UCWA 3BRCA 1L5GB 3VO8A 3LY5A 4XQGA 3EAFA 2F4VF 3IXQA 1M5SA 5A0YB 4NMXB 4WCFC 4AF6A 1T1SA 4E0DA 4RA9B 1YFKA 2HPHA 2ZJQQ 4MPRA 2JFKA 3X44A 2J87A 1MORA 3TJ8A 1TM5E 3WHPA 1D8YA 4EG6A 4K5SA 3JQPA 2OLEA 1VP9A 3JYQA 1L4NA 4LX0A 2JC0A 2B8WA 2HJ9A 1HQUB 1XCOA 3N86A 1D07A 4UNIA 4N48A 2IAJB 1E3IA 2Y1CA 4MK9A 1T95A 3E7PA 1BD6A 2FTRA 4PNEA 4WXMA 2YWEA 4BXOB 2WILA 1ZD3A 4DLRA 4ZN1A 1GRQA 4R1PA 1QH1A 1JVBA 1NUHA 5AK3A 3K5IA 1R27A 3RUFA 5SYNA 3I2IA 2CWKA 3E9EA 5G2OA 4Y9TA 1N7GA 3HK2A 4ECWA 1L5RA 1RAEB 2H7YA 4CEJA 3NS6A 5ECWA 3GCXA 1KVKA 4EFLA 2ANBA 2DKOB 1NNSA 5CABA 2WUDA 5LYJF 1J9GA 3WYNA 4UBIA 1EFHA 3R24A 1QDLB 3Q98A 1XAGA 4BFVA 4KFBA 1LSSA 3TXYA 1UL1X 4M5MA 1HL7A 4BNFA 4H4KC 5CLHA 1IATA 2X5OA 4HEA9 1CLUA 3K1TA 1TMJA 5KNDA 2E7VA 3OBIA 3QRRA 2QNIA 2PR2A 4D3GA 3H4IA 4YRBA 2QLXA 4GWGA 1N32J 3J80A 4W90B 4D8WA 3LPAA 2Z08A 4JI6J 4I50A 1D09B 4MB0A 1UTAA 2VXBA 2WJHA 2IUUA 2HCFA 1C3OB 2A5JA 3H5RA 5EFZA 4RH0A 3SX0A 3U7QA 3DEYX 3DYBA 3TW8A 4GC5A 3DHVA 2QA4G 4YXFA 1S4EA 4P0PB 3SVTA 4JJEA 1B70B 5HP1A 4E1BA 1G0NA 3VDRA 1ZGBA 5C52B 1L3TA 4DV7J 4GFDA 5CIYA 3M6FA 4FHEA 5JSUA 2XVXA 4Q15A 2IY8A 1UVIA 3HFVA 4G6VB 4B7UA 3KQOA 1VB3A 4ZVRB 2E9RX 5GGXA 5KFDA 3FKBA 3PW4A 3P7MA 2AZXA 3QLVC 2BE2A 3S81A 5JSZB 5LMCA 4TWAA 4PZAA 5MFPA 1QK4A 4KSBA 1FOEB 3MS4A 4TZTA 5AW2A 3WNCA 4RBNA 2RQCA 4HN4B 1I9CA 4AJHA 4GI7A 3PRJA 1EA7A 1C7JA 3LWDA 3L46A 5HBMB 1CPYA 4BECA 1NN3A 1VIOA 5KFTA 1ZYUA 1SOAA 3WIVA 5A1JA 4JBCA 4LG1A 3NAQA 2MYUA 4Q16A 3FGZA 4F9FA 1OD6A 4LF7F 2K2WA 3B12A 4MUHA 2EAUA 4MZDA 3QZ8A 4DLTA 5A7GA 2JIMA 3ZJUA 4NARA 3H99A 5AXLA 2OJ3A 4F4KA 4B79A 1FXWA 1P75A 2YV4A 1TMYA 4NLRA 4P83A 2W83A 2AJ0A 3PHEA 2BGTA 1OBCA 3FYUA 1M0WA 4LKRA 1RWOB 3WLEA 4QTZA 3F5QA 2JJ2D 3OQBA 3PV0A 5J2TB 1E2PA 1XTSA 1ODFA 3FW1A 3WWYA 1EE1A 1TVKB 2C3YA 1YCFA 5LOVF 1L0BA 3NC1C 4DPLA 4KFTA 4MIOA 3NP7A 4DL5A 1X1DA 4V2UA 3AQPA 3A3OA 2D5LA 3H1GA 3K0SA 1HNXF 4J16C 4N0EA 5EE0A 4CEHB 1XRPA 4Y00A 1P2VA 2QJ3A 1HMVA 3K2EA 1VFJA 4C4OA 3UT0A 3RARA 5ES3A 4HP8A 2H5JA 3IH5A 3ADDA 2QYGA 4FYXA 1AKVA 2PHZA 2EXUA 3KB8A 4WFKA 1JWBB 4OGGA 2WHYA 4PX3A 4NCIA 3OJLA 3IWLA 1TZMA 4ZCLA 2O1XA 2YW2A 2CHQA 3GEBA 4LE2A 1RT6A 2IXGA 2ZSKA 3LY7A 2HPZA 3F7OA 3ZNJ1 2BTOA 4WZBB 2L17A 4QM6A 1OFVA 2QO3A 1MO5A 2VJNA 2EYQA 4JP2A 2E9TA 3K1YA 4O4HA 2WAYA 4IV0A 2IEBA 2EX1A 1Y11A 1WXWA 2UVDA 1ODJA 3N05A 5AXBA 4DU7A 3QFHA 4M8SA 4USMA 4CCWA 4BWVA 2Q8NA 3DC2A 2HHJA 5BSEA 4WXPA 1O6ZA 4HH0A 1LRLA 1XTKA 3WYAA 1P2DA 2ZJRQ 2QY6A 1P1KA 2EU8A 5H82A 3FOZA 3PWZA 1UZNA 3TA1A 1W52X 1EX9A 3UHJA 1TW2A 3V2UC 1FL9A 1VIXA 3DT6A 2FGOA 1QLWA 4BLRA 1NXSA 4X6LA 3K9LA 4OJQA 3Q8YA 2OG1A 3BE8A 2BE7D 3QSGA 4MKYA 4NLXA 5E8JA 2FMHA 1ULTA 2EFNA 5E3HA 4M46A 1UJ6A 2OLKA 1JI3A 1YRHA 4R1UA 4GLOA 2NYIA 1A98A 5C4GB 4E2YA 2LMIA 5T8KA 1OAOA 1P45A 1FXRA 2DBRA 1DE0A 4GMGA 3IERA 3QI2A 1XMBA 2GS8A 3WV4A 2GEUA 3GDHA 4AMVA 3AUAA 3E3OA 4INZA 3E5MA 1HV8A 3QJPA 1FW8A 1K4YA 2OBLA 1CD5A 3FGPA 3GR1A 1U1MA 4PXAA 1Z08A 4DFDA 1NWHA 2I3AA 5F8GA 1T2UA 4BMXA 4B7AA 4MKAA 4BO7A 2YJZA 1KI8A 4J03A 4OQDA 5KFSA 5JJ5A 5ALZA 4TN5A 3RUPA 1LH0A 2XWJI 3R41A 2G2ZA 3MAHA 4ZVTA 5H80A 4K03A 4QHSA 4XQCA 4RQBA 3BSSA 4ZJZA 1S8NA 4EHNA 4JV1A 1UJ2A 1IPHA 1R18A 4Q4AB 4G5HA 2FVSA 3KG0A 3TX8A 4Q1FA 2BKUA 1JXLA 3NRCA 1DZIA 3PQDA 1HA3A 2MSNA 3MCNA 3R5HA 4Y6PA 3JALA 2Z56B 3HN6A 4FEEA 4K40A 2VYQA 2CJWA 2PIAA 3KPWA 3OLZA 3BIFA 3Q3IA 1WV1A 2XF8A 2GC8A 4C0LA 2HH9A 2GHRA 2HRQA 4F72A 2O0JA 1QTIA 1W4AA 3EVEA 4OYZA 2VPIA 4ZV9A 4ZYZA 3R8XA 2D62A 2VPWB 5ES4B 3GZNA 5E1OA 5DGCA 1Q21A 1VOTA 5HSGA 5JDCC 4F2HA 1OH6A 4UOCA 1J0EA 5KNCH 4ARZB 1A50B 4AXJA 2B8EA 4CG1A 3R8YA 3R7DA 4L0DA 4HVTA 1XJCA 1B15A 2VUIB 4QIHA 4M89A 2F62A 5FLXY 3KHKA 2ZUWA 1NJZA 2GLXA 4JI3J 2CHFA 5KYUA 5ESRA 3S7TA 1U1FA 1PO6A 3SVZA 4BFXA 1M5VC 5EG5A 1NK7A 4QTTB 2DNQA 1RLTA 5MFZA 1PRYA 2FFHA 2P9JA 3GUYA 3H42A 4IHAA 1O6BA 2C31A 1RADB 3HKEA 2Q0XA 1IJFB 4FNIA 3NT5A 2COLA 4K81B 2YZ2A 4O4LB 5I6DA 4XVHA 2B6AA 2P1DA 2E5IA 4UHKA 3LHFA 3GHHA 2W7PA 3QOYA 4MRMB 2EP5A 2WJWA 3S6JA 4YYEA 3O8DA 4TTVA 4I4IA 4JC0A 2FETA 3AEYA 4IJUA 4CM1A 5TJHA 4BNMA 2BHTA 2HG4A 2WSEC 1NY6A 2U1AA 5DJBA 2R7XA 5AJWA 1U2EA 3GLHA 1K75A 3PL5A 1JMVA 4M0LA 4X7RA 3UC9A 2HNZA 1ZINA 4ZVHA 4HZUA 3GFYA 1NVGA 2L18A 3AINA 1XJ5A 3NDBB 1ZSYA 1ETHA 3HSZA 3EXHC 2Y1GA 2JHEA 2PYIA 3K0AB 5AW6A 2VNJA 2JLZA 3CIOA 3NVMB 3ND9A 5I7UA 3GQVA 3OZSA 4TVBA 4MVXA 3E2PA 4NBNA 1QK5A 1W36C 4URSA 2EJVA 4JUIA 1FNSA 1PN3A 4KXLA 5FV7A 2XCUA 1ECCA 4MWDA 2O07A 3FUXA 5CYJA 1X7YA 1VS3A 1K5HA 5IVHA 2ANCA 2PRYA 5BSTA 2G6BA 3PDWA 4G8JA 1U28C 1LWCB 4POAA 5HX7A 5JPIA 3KHGA 3ITDA 4Y2VA 4CFZA 4DMMA 1V16B 1LPMA 4HPXB 2GQ2A 1Q1AA 3N6NA 4RYLA 5BR8B 4U1RA 3ZEAA 8ABPA 5C7LO 3MTKA 3O2NA 4D46A 4JYPA 4MS4B 3TAPA 2JGDB 1I5OB 5D51S 4EFDA 1D9ZA 2VBFA 4TTJA 1HYSA 1IVYA 1EWKA 1Y1SA 4W1RA 1FX1A 1JQEA 3JQ8B 3W2FA 3ZHYA 4IVQA 4YTEA 5EHNA 2RI1A 1EIYB 3DBRB 4DPKA 5DN6A 3D5EA 4WK1A 1CERA 1Z8FA 1SVUA 5LMUF 2A0YA 3OL6A 5ALLA 5EXDA 4YMGA 3IEIA 3FKQA 4X1YA 1ZWKA 1N4LA 5EIOA 4DYVA 3S7ZA 3ZEIA 3HSKA 2V96A 1U0TA 3MPWA 3MCOA 2YHBA 2KLHA 5KYYA 2XV1A 2EX4A 4LYGA 3AR8A 3SXUA 1OOEA 4YR9A 3TJAA 2FUEA 5CG2A 3A31A 1AE1A 4MIYA 5JS8A 1JEDA 4GBJA 4DMRA 3IUJA 3ROGA 3QFSA 2X7XA 1LSUA 5HNKA 1N6OA 3HP7A 4DB4A 5AUQA 5CVCA 4E03A 1CQMA 5FUWA 1EWQA 4BPRA 4G5OA 4Q1EA 4WXOA 4WQMA 1IHUA 2DBZA 2WJ6A 3D9QX 5JR3A 4EO6A 1QG6A 5FUVA 1E9EA 3TRKA 4TM7A 4FJ2A 3BL5A 5E6SB 2IHYA 2ZUTA 4AECA 5LT5A 1IBSA 1SUQA 1P7YA 3D5MA 3VXKA 2AEEA 1TKTB 3I05A 5BSHA 1FNDA 2FF7A 1X1TA 2C4TA 4X84A 4NECA 2PKQP 1XMXA 1VHQA 3ZU4A 3ZXIA 2V9ZA 3TIGA 2EG5A 4DDVA 1M1YA 4BEVA 3V1TC 5IZCA 2ZDQA 3ORYA 2XMAA 4XOIA 1EXMA 3IPAA 2PNFA 3OZVA 4B40A 4CP5A 3CR7A 3UMRA 2HCTA 4KHPB 2XB6A 4UULA 1KGDA 2J9DE 1DRKA 2RHTA 3V6MA 1GLVA 4JQZA 2IZ6A 3RTBA 5JO0A 3UVJA 2A1UB 4LRBA 4RFSA 4HR7A 3ZWXA 3DEHA 1SC3A 1Q79A 1YMQA 1V5WA 2QP3A 3QPIA 4E3ZA 1PGQA 1LB1B 1BXZA 3SMQA 1RU3A 2I2BA 1GCGA 2BFAA 2C96A 1F12A 4AJKA 2QTMA 3V5RA 1NVVR 1QZUA 4BYMA 3PGVA 4DUGA 2H5IB 3AM5A 1Y1LA 5KWSA 2YPZA 4HACB 5YASA 1OAAA 4B7ZA 3FCCA 1RT4A 1ZD9A 1ACJA 2DRDA 1I6MA 4NCBA 5IT9A 4KYUA 2ZT6A 4H6PA 5DE3A 1TVMA 5ISMA 3EIWA 1T36B 1COWA 5T4EA 3F9CA 4BNZA 5AK0A 5FTLA 2ZBGA 1DLIA 1U3CA 1H4TA 5AT1A 4OYWA 4XDDA 1TMKA 1L1QA 1N2OA 4Y1EA 7ADHA 2L9WA 3NJRA 3WFZA 3W3AD 2Q9CA 5D8DA 1RMYA 1NYQA 3FETA 2C8LA 5AUPB 5AK5A 5H02A 2ZYTX 1J90A 1WELA 3J81U 3KLGB 1HQEB 2MKCA 4XWTA 1EDDA 4Q1AA 2B4VA 1KEKA 2C07A 4QQNA 3W9SA 1SJRA 3FF1A 1Z88A 5SZIA 4NEZA 5KS2A 3PDIB 2J6CA 3VMFA 2QX7A 3M2VB 3EDMA 1YK1A 4WUVA 1D2AA 5L46A 4C9DA 1YKWA 1E9VA 2X13A 3V8BA 1DLOA 2VQDA 4R8MA 1EP2B 4Y3UA 1JPJA 1HDIA 3PR4A 1ZLXA 4KXNA 4X1OA 3ZS8A 1E9FA 2ODAA 4OATA 4TYPA 1U5AA 2X7JA 2FQ1A 1ZJ4A 3U13A 3UD3P 1U9IA 3P8BB 3AGQA 4EJMA 3ULHA 2R8KA 4EI8A 2M52A 1ZITA 3W6UA 3SS9X 2N3OA 3FQKA 2VDRB 4L5JA 1PYOA 1FDOA 3O8OB 4AIRA 2HZAA 2Y8WA 1J1UA 3GF4A 3AB4B 1QF9A 4TTRA 5JO9A 4J1NA 2QDKA 3ZDCA 2JOQA 4JBLA 4DWWA 2OD7A 2VA3A 1B0VA 3JQBA 5CD1A 1R3NA 2GMJA 4JA2A 2Z1DA 2BDEA 4XYGA 2Q2VA 2PQ2A 2GAAA 4I2PA 2IPXA 3JAKB 4CLLA 3W5XA 3DRXA 3TKAA 4LQ3A 3FSGD 3M3PA 3IMKA 4DV7B 1C80A 3OX2A 3MPUB 2ETXA 3G9QA 1Q2XA 3B13B 3HCNA 4HXGA 3KEOA 2B5WA 3LUBA 1WG4A 3LAMA 3GB0A 1NR1A 4YT2A 2G3YA 4R31A 4LVUA 1S1VA 3LUCA 3FIUA 2UUAJ 1YL5A 3VTAA 5AE2A 5FI3A 1A9TA 2VG5A 1C7QA 4KMSA 1JIQA 1OWNA 1M3SA 3ZWDA 1H2WA 2WTMA 3DOEA 3HDTA 2VH7A 2OQIA 4G8BA 3JVVA 4BTVA 4R05A 5AWFC 4CR7A 2O6HA 2JRCA 3RUBL 3O6QA 3FBWA 3W62A 2KXNB 2P9GA 1IOWA 1O95D 2OC4A 2DGVA 1WU8A 4DE5A 1VJQA 4FFMA 5C2CA 4C04A 1TO6A 1ZEMA 2FDXA 2EARA 1NSYA 1F1BA 4RKUC 4Q03A 4X6XA 1CYDA 4G56A 3CH5A 2PS3A 2CBZA 4URYR 3B78A 3L77A 4DNPA 4FDUA 3V2HA 3ZHTA 1B0PA 4KB7A 2VAWA 2VQ3A 4KLCA 1EFRD 3ROFA 2W4MA 3O4FA 4IG0B 1D7AA 4I4TA 1GTSA 2DKOA 3L6CA 5T8KC 1F8GA 4D0GA 4BB9A 1XI2A 3KVOA 5K99A 3MUMP 5AW0A 5ETPA 2IY5B 2ILVA 3KK0A 4CCYA 3QLHA 1UVNA 1VQ4S 3M6VA 4X7BA 1E5TA 3DXBA 1JKHB 5GQSA 1NRWA 1LWFA 2LW7A 4U6PA 3RS3A 2HW8A 2A9RA 4XPIA 4C6HA 2MZSA 2VDIA 1PV4A 2IBKA 4WBNF 4IFEA 4PN7A 3OQNA 1NI4A 4X63A 3WADA 2DPYA 2OHIA 3LLVA 1NXIA 1PS0A 5FPSA 4PPYA 3HBNA 4Z6KA 1VSUA 2OP5A 3H4VA 2ZU6A 4MZXA 1QHNA 3BYRA 3LVBA 2CVOA 3I4HX 4DGSA 2GYVA 5DU2A 4MP8A 3AW9A 1DLOB 1PX2A 2GLUA 4ARSA 2BCEA 1U1IA 4HDSA 2YXNA 3R75A 4ZCTA 3CCJS 1FRLA 2QTRA 1NDLA 1IM6A 2JL1A 3WOHA 2YPYA 1MT0A 2A5FA 5IF9A 3OR2B 2RVJA 1ADYA 4JU9A 2DOKA 3ZNOA 1IOLA 4H7KA 2XUAA 4JV2A 1ZXBA 3D6UA 2C4WA 2ZULA 4ZJPA 2R7SA 4OY3A 4RA6A 4Y6OA 1T5SA 5IM0B 4K4TA 3TQSA 3U3ZA 1R64A 2KW5A 2MLYA 2NTJA 3FNEA 5IV3A 2W6MA 5JHHB 2XXJA 1TM3E 5B0FA 3KWLA 4YUWA 5G1PA 1U7PA 4A91A 2IBSA 4YLYA 2PV7A 4FK8A 3MMAB 4D4KA 1FK9B 2B2CA 1GPMA 3HVWA 2HXGA 3TLMA 4NLGA 2IYQA 3TD9A 1B73A 4KR0B 3NORA 3CD7A 2YICA 3CNBA 5K3OA 3QJLA 4GBED 3K7EA 4UUBA 1IMJA 5K3AA 2A2DA 5IFMA 4R5PA 4EUNA 2Z4RA 4LJSA 3T5JA 3N8DA 5AJXA 1JJHA 3W5ZA 4LF8F 3HL0A 2C5FA 2GD6A 5LZ7A 3FYUB 1EBBA 5TJ9A 1UOQA 3EXAA 4YV7A 4BO0A 3EDOA 3WLSA 3KWJA 3A4LA 1OSCA 3FHCB 1LTHR 2G9OA 1T8UA 3RE1A 4HAVA 1SKAA 4S35A 4L5IA 4WCDA 3ABIA 2H63A 2MYTA 3C3KA 1W5TA 3E84A 4O2BA 5C4IA 4JYAJ 3PC8C 3X0DA 4DDHA 1P0CA 4C7XA 1H0KA 2VF4X 3LQRA 4ES1A 4DMKA 3OQMA 4F3KA 2JLSA 3BGIA 1NURA 2D41A 1S10A 1G3IA 4TKVB 4BLPA 1DSSG 1VXRA 4J2TA 5EP3A 4UREA 4N77A 4KYTA 4XPZA 3IESA 2QZZA 5A4IS 5KTSA 5BMVF 2EKZA 3MWFA 5ALMA 2RH3A 5AKGA 2XG8A 3BOSA 3IEPA 4OHBA 5LOQA 5L53A 2ASJA 1CFJA 1NM5C 1TEZA 4DUPA 2XGOA 5CU7A 1SD2A 1GN9A 4I4LA 4I9UA 2WSIA 1RRVA 4ZPBA 4FFVA 2X8JB 3G87A 4Z4FA 5J2UB 4O0MA 5IWCA 4WUTA 1GNSA 2OZLB 4OXXA 3EGDA 3IBFB 1GAEO 1DIBA 3KXLA 4J0IA 3H9GA 2DR3A 4LYAA 1UODA 2QR5A 1BLUA 3HO6A 1I1QB 2G04A 5G4DA 1GNKA 3PX3A 4I4NA 1NMXA 3DOLB 3C6ZA 3LUDA 1PT5A 5HVHA 2F8SA 4RENA 4LJ9A 2RGCA 1J5EF 3FOAA 4KUGA 2I5JA 1U25A 4EECA 2VNSA 4RBTA 3AO0B 4OJYA 4LCBA 3FYHA 1Q95G 4ANDA 1MAWA 5DGAA 3V2UA 4N7RA 4JB3A 3IELA 1RFGE 1NFQA 4B76A 3SC4A 1XA4A 4DSAA 1KI4A 4IUDS 1XMQB 1TLLA 3TTSA 4CBVA 5DBEX 3SI7A 2PIDA 4NBTA 1W4CA 2G63A 1WF1A 1CRWG 4J9RA 2WJIA 1I2MA 1D3AA 5TPZA 3RR7A 4FFBA 3SC3A 3IA0A 3NAMA 4LFBJ 2E29A 1TV6B 5JY6A 4K46A 3THWA 1GO2A 4XW2A 2AJFE 3ETJA 5DOVA 4D26A 2ZK7A 1B3TA 2P2SA 3EB9A 4UQLA 2OR3A 2CPHA 3VH1A 1USVA 3PYLA 4LA4A 4TN2A 5KT3A 2K8GA 3CZPA 4U2EA 1TUBB 2VBXA 2CJYB 3WLRA 1AS2A 1TIKA 3LIPA 2CZGA 2SNIE 3CCZA 3FUYA 4HDNA 1JLFB 1HNVA 4PGGA 3EGVA 4XGQA 3Q5EA 3HO1A 3NTOA 4QVIA 4B3HA 1M2NA 4FE3A 5F3ZA 4K4SA 2OFFA 1FDVA 2O0HA 2VNIA 5FAXA 4EG8A 2XI3A 2IHKA 1VIDA 4HEJA 2H2FA 3I5UA 3L8EA 3GH1A 1HARA 2IYGA 4EUHA 2HWTA 1NXPA 2HRBA 2JDID 4M0MA 5AVWA 4D0NA 1QAOA 1SKUB 3JWEA 3HY4A 5TPWB 1O4WA 1QGAA 2QD4A 1K1SA 3TI9A 3F2VA 2DR2A 2QM0A 1RAIA 4FB4A 4J0FA 1RKJA 2X86A 3LWBA 4CLWA 2JANA 3OZXA 3OE5A 2P9QA 1X19A 1XNQB 3RYLA 1VJCA 1FJCA 3IAUA 3K5PA 4UMEA 5EIBD 2AOTA 3R9IA 4JJIA 2AK2A 2W2OP 2IE0A 4UBKA 3NAGA 5L3QA 5FPTA 4CKEB 2J6IA 1BOOA 4LPKA 2ASLA 4I9NA 4WBFA 1CK4A 1CJVA 1OS5A 1TC1A 5LBUA 5KTKA 5LQRA 4IDKA 4RUHA 3IC1A 1J5OA 4Q1DA 2C4NA 3CGWA 1BVYF 4MR8A 2AP6A 2GZHA 1VJGA 2WD7B 4WN9B 1U0HA 1A8PA 1XLTA 4MLCA 4JT4A 1HT0A 2A5LA 4CMKA 4C3MA 3BS9A 4PHTA 1ZP6A 3PG9A 4R3UC 1G8KA 2ONKA 3IR7A 5JMOA 3CE6A 1WDLA 2YYZA 3R6LA 1RGVA 4MQLA 2O2HA 3F49S 1CQNA 2JDJA 1PC5A 4Z1MA 4CR6A 5KFAA 3CUVA 1S77D 5AIBA 3QIPB 4KITB 3R7WB 3OHAA 2CXNA 1AKQA 2VAMA 4JP3A 3NEAA 1VYUA 4CYMA 1O0SA 1UZHA 2BYCA 4Q19A 1KVIA 5CZXA 4NH4A 2JJ2A 5IN4A 1P5FA 3F96A 4MVYA 4WFIA 3X2FA 2OGTA 1QC5A 2ACVA 1USWA 2GT1A 2PMFA 2DG2A 3CSUA 2ZH5A 5EX3A 1IBMF 4UTOA 4OOFA 1RBZA 2NO5A 1I7DA 4GQBA 5DXAA 3V55A 3EEYA 4NRUA 1ZL2A 1UK9A 5F41A 3I1JA 2SCUB 2LUOA 2WJJA 2GS9A 4J43A 5D86A 5IXSA 3OIDA 4E2FA 2YMQA 2ZC4A 3PX4A 2FW1A 4GX0A 2ECQA 4J0JA