2F8MA

Ribose 5-phosphate isomerase from plasmodium falciparum
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
237
structure length
237
Chain Sequence
b'HHHHMDSLKKIVAYKAVDEYVQSNMTIGLGTGSTVFYVLERIDNLLKSGKLKDVVCIPTSIDTELKARKLGIPLTTLEKHSNIDITIDGTDEIDLNLNLIKGRGGALVREKLVASSSSLLIIIGDESKLCTNGLGMTGAVPIEILTFGYEKIIENLLKIYTLKGCTYKIRKRNGEIFITDNKNYIVDFFFTEPIQDLLETCTRIKMTTGVVDHGIFVNMTNVALISKHDGTVLTLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribose 5-phosphate isomerase
molecule tags Isomerase
source organism Plasmodium falciparum
publication title Structure of ribose 5-phosphate isomerase from Plasmodium falciparum.
pubmed doi rcsb
total genus 77
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f8mA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f8mA01
2F8MA 4L5JA 3MWBA 3AB4B 2H9ZA 2RE1A 3O1LA 2PA3A 3NZEA 3HHEA 1LK7A 4OQPA 1M0SA 3HN6A 3KV1A 1HORA 2J0XA 5IT4A 2F1FA 1UJ6A 2LVWA 4GO7X 5FIIA 2DT9A 3ENWA 3BXHA 4X84A 1U8SA 5HJ5A 4L4ZA 3OC6A 2JOQA 3EB9A 1FRZA 2RQKA 3P96A 1FS6A 4IO1A 3IBWA 4LUBA 3CEDA 1LK5A 3OFEA 3BXEA 2BKXA 2PC6A 3OFHA 3CSSA 2QMXA 2ZHOA 3BXGA 1JT9A 5T41A 3UW1A 5IS2A 1RWUA 1FS5A 3CH7A 2P9CA 1FQOA 2RQMA 2GNPA 1YGYA 2OKGA 4L51A 1CD5A 1UJ4A 3DHWC 3OFGA 3TUZC 2W48A 3NWPA 2FGCA 2J0WA 1HOTA 3ENQA 1NE7A 3W7BA 4GMKA 2JHEA 3MAHA 2P9EA 3OFFA 4R7TA 4L50A 2CDQA 2RI0A 4TM8A 2BKVA 1PBTA 2WU1A 2P9GA 3E15A 1PSDA 3MTJA 4NMLA 4L4YA 3LHIA 1YBAA 1ZPVA 4L5IA 4GO1A 3AAWB 1Y7PA 2KO1A 5JJBA 3EFBA 3TX2A 3ICOA 1LKZA 4TM7A 2O0MA 1O8BA 3K5PA 4OQQA 2QMWA 4PWUA 3NRBA 3LUYA 2LQJA 3U7JA 2J0EA 2NYIA 1Y89A 1VL1A 2MDAA 2QRRA 2R5FA 4GO5X 1DEAA 3E7FA 3DC2A 3IXQA 3ENVA 1SC6A 3LOUA 3TUJC 4M8LA 3OBIA 1UJ5A 3TUIC 4R9NA 3N0VA 3DHXA 3L7OA 2RI1A 1KS2A 1FSFA 2DTJA 3AB2B 3DDNA 5IT0A 3LWDA 1XTZA 2QSWA 3S1TA 3KWMA 3BXFA 2I9SA
chains in the Genus database with same CATH superfamily
4L5JA 4Y2VA 1AGRA 4HAOA 3KKMA 1A9ZA 4G9GA 4YJ2F 2BABA 3UMRA 1XRJA 3EE6A 2HVZA 1UPAA 4GM4A 4YMWA 4KWHA 5DNYB 2XDQA 5DM60 3V6LA 1AQIA 3JALA 2VOPA 3TTYA 3BZWA 4UTRA 3FZ2A 3BXXA 4F8RA 1WV0A 3AIKA 5TMBA 1QF7A 1O95D 3LWNA 2A0FB 4IDKB 1QYIA 3KB8A 3CVKA 1S5PA 1THTA 5IN4A 1UFKA 4BMNA 4KKOA 3SSRA 1SKWA 2NPOA 3CPEA 2RGAA 1NXOA 4A46A 2Z4PA 4M8KA 1NVWQ 1SCKA 2YNMC 3PNBA 4NEYA 2FG5A 3FSGA 3FDZB 1JNXX 2FVQA 3NS5A 1KY4A 4F3QA 3L8MA 3M7VA 4BNTA 3PKZA 4BQRA 5COBA 2PBFA 1QUEA 3RVRA 4DLBA 1ODSA 1IB0A 3O9MA 1GRCA 4Q0BB 5EIBC 5KWEA 1AUQA 5A6PA 3DH0A 1L5FA 2W58A 3W6OA 3GFPA 4L9RA 1FVQA 5KT5A 5KG5A 3NVKI 1QTMA 2XSFA 2BJ1A 2GWRA 2PUCA 3SYLA 3HKCA 5FV7A 1SKUB 2W9BA 1ONPA 3FTNA 1VCNA 1L7NA 3A05A 2YZMA 3F9CA 4DUZJ 3DE2X 2W9BB 4XEHA 2H4HA 1ZQ9A 4MKZA 4R1PA 5KJFA 4K5RA 4S2UA 1TADA 4C0XA 2JCBA 5EGSA 2W6IA 2O20A 3WSWA 2P1DA 2PFSA 4O0NA 4KVZA 2F43A 1E5VA 3V4SA 4KAXA 2OPPA 1I9CA 1E1QA 4QNMA 2JIMA 4IQ0A 2L9DA 1VCIA 3B3JA 2CW5A 1WF1A 4P5EA 4XUCA 2PLAA 4PR3A 3H3JA 2RVJA 2E89A 3PUHA 4O3QA 5E5NA 4MFBA 4QYWA 4TZTA 2A7XA 3R8YA 1RQPA 1TTPB 1JH9A 2O54A 1GFZA 1ADGA 5LBUA 4ZLPA 2ZWIA 1CY8A 1FVSA 2VKRA 3TVDA 1V6HA 1VG8A 1XYYA 3HFVA 3KLEA 2K3IA 3D8RA 1U28A 3PDWA 5BORA 2BR4A 1VQYA 1NL3A 2JEYA 1Q6YA 4J9PA 3HTXA 2V0NA 4ZCMA 2A30A 4DB2A 2BRLA 1YB2A 1J5PA 4L0DA 3NM5A 2CWDA 1U7OA 3CIOA 1VHIA 2EI5A 1BRTA 3TAXA 2CHEA 5KQLA 4LE1A 4DCTA 5DM2A 4QRDA 3GFQA 1EG2A 1RQRA 1Q95A 2DCMA 3NTVA 4EFMA 1BGXT 1RJFA 1SJ4P 3C6XA 2AP6A 2AG0A 4QRHA 5JRJA 5C1PA 4K9MA 2V2QA 3LW8A 2IDLA 2CFCA 3C5HA 2OC4A 3I5UA 1LWFA 3GFOA 4M1ZA 4RPGA 3FVQA 1UXKA 2R2TA 2YRFA 3ANSA 1YIJS 1WXXA 2D5LA 4RTPA 1OLSB 2IZ7A 2FHOB 3R74A 2XWSA 1FDRA 3ZU5A 4YUVA 1FJGF 1F4LA 2Q45A 3UJ7A 2MR5A 2ZQ5A 5ES4B 1ZLXA 3OCVA 1YJAA 1JX6A 3O3OB 4ND8A 1TT7A 3V00A 1KQGA 3QT6A 4M9UA 3VZDA 4O29A 1EQMA 2F8HA 3I9ZA 1JA9A 4TRNA 2J09A 3A31A 4DV3F 2WU3A 4TWBA 2XVZA 3CDWA 1Y00A 1U8SA 2F9DA 3VYSB 5BRAA 2BRUA 1UMDB 3T3MB 3DFIA 1ZIDA 1USUA 2YJNA 1GXUA 3K8OE 2C77A 2JAQA 1IN8A 1L0BA 2RQMA 1V4NA 3HR4A 3KK1B 3LPMA 1ZETA 2G0TA 4GPEA 2F3RA 2G76A 3TG8A 2HBZB 4LF9F 2WD9A 2AXPA 4MWOA 1XFDA 5HTKA 3T5AA 1T02A 1TA0A 5ITHA 2YWXA 1LNZA 2A5YB 1S8FA 2JJ8A 2HRCA 3OVMA 4R71A 1PG2A 4MQ4A 3SOZA 5KEIA 5TQ2B 1QH1B 2VP2A 2XY4A 4Q0BA 1T4GA 2NNWB 5LA6A 4TT8A 4RADA 4JV1A 1I0IA 5BN3A 3GZNA 5E6SA 1G8HA 1UANA 5A0YB 1D0VA 4CO0A 3E3MA 4OSOA 1CCWA 2BZGA 2EFYA 4I6JA 4FKYA 3C5WP 3PHIA 2VTBA 4P82A 4R2LA 3B1YA 4CH0S 3OMXA 1G2IA 2MHCA 2W2PP 2Q4TA 1SAYA 2M6RA 3DE4X 5B64A 1U0OC 1M2FA 5DLFA 1QE1B 4Y2GA 3H5YA 1BU8A 5BUCA 3NCRA 2G6TA 4N0PA 2A6MA 5LMNJ 1P0CA 1JJAA 2WSSD 1KLMA 4ZOSA 1ZFNA 3H86A 3IS3A 3NBXX 2ZPAA 4UQPA 1Q1QA 4ECZA 1LLQA 2QSJA 2FC8A 1C2YA 3PNKA 5EAIA 2QN9A 4GKKB 1U6KA 3M8YA 4B3DA 2PUVA 3GCXP 2WVGA 1N9KA 2QMUB 1F2HA 3OAAA 4X1YA 3W7VA 2IHYA 4HYEA 2QSWA 2NVBA 1EWRA 1Z6ZA 1RM5A 3UWTA 2GI4A 1QKKA 1UJMA 1TKXA 4RLSA 5KYXA 3Q87B 1PWEA 4FYJA 1HORA 4M9CA 1RT6A 4KTTE 5CCXA 5ALMA 4MKHA 1OYDA 5ICGA 3CMCO 3BB3A 1TM1E 2Q1TA 2ZYSA 3C3WA 2PD1A 1Z0DA 3P0FA 5HZHA 4Y9RA 2ZUUA 4RF5A 4KQZA 1R0WA 3BFKA 5ALOA 3UW1A 1US8B 3OTWA 2BBEA 1SVIA 1Q0PA 3SQDA 3LKDA 2FPPA 5EP4A 1EETA 1JXLA 2DPGA 3E7DA 3ZQJA 2BQUA 3L46A 3JTPA 4HGYA 3T7IA 2BKOA 5T14A 3DFZA 4NZPA 4IG3B 3ETJA 3CB2A 4N6NA 2UU9B 2P9ZA 3UW3A 1NZJA 4PWDA 3NGTA 1U0BB 2VXOA 3UUGA 2WSLA 4RF4A 4OYRA 2BJWA 1XQXA 4A6EA 3EJMA 4PLGA 4D9CA 4QLAA 3G82A 2ZRHA 4IXNA 5J2MB 5GZ3A 1JXAA 1H2VZ 4ED5A 1E2LA 1MO5A 2VF4X 2IS6A 2JGNA 3K70C 3RJTA 2BHRA 3KKQA 2HDHA 3IAM1 3BQ1A 5B58C 1J5EJ 3U7IA 1HT2E 3LH5A 3IUJA 1JAZA 5DKFA 2AW0A 4F1KA 4A0GA 4KV9A 3S2YA 1KEPA 1MJNA 1P0IA 5EMHA 4YIKA 1XI2A 2BQ3A 4MQFA 3BK7A 1T34A 1WHXA 1XVIA 4ZODA 1AX9A 2XF2A 3JARB 3GV5B 3D7LA 3VKHA 2PZKA 2G08A 1NPPA 4CIOA 1JLRA 2O8VA 1XKLA 4PV7A 2YNIB 5F9LA 3H8YA 4FOTA 3FRYA 2HWHA 3QVUA 4KXNA 4O4JB 5D8HB 3ELUA 3QFWA 2AJ2A 2FSVC 3CTRA 1G8KA 4JI8F 3KUUA 4CTJA 2Z6QA 2QX8A 1VE6A 2VA9A 1VC6A 3KYCA 1L5YA 3UTDA 5FBKA 5A3JA 3VPBA 4F36A 1VQMS 5GJWC 1LDYA 1W96A 2PTHA 3GXOA 3NBAA 3KG0A 3AD8C 5BT8A 3D6FB 3ZHTA 3CCVS 4B71A 1V25A 3DRPA 3Q0TA 1B0UA 1FFSA 4OHWA 4FBLA 2CB9A 4YP5A 5BUZA 4RH1A 3DWGA 1D07A 1AKYA 3JD0A 2DD8S 5AJ3J 1TLLA 1NKCA 3KPUA 1G0OA 1PJ2A 4MS1A 5CX1B 1R88A 4UVEA 4BGVA 1XDUA 4TSKA 3DBLA 3EHEA 2EKDA 5HILA 1YUBA 3VU3A 2Q9CA 2AYEA 1YJXA 1YIOA 4AZ0B 1UFVA 1Z5OA 4TYQA 3EVEA 1A1SA 5MAOA 3NHSA 4MPTA 4HVAA 3JSRA 4UBOA 1EKRA 5LOVF 2O4CA 2Q2VA 4IUFA 3MGGA 2F65A 1CBKA 1S8OA 4J0CA 3CJRA 4ND3A 2GHIA 1C9YA 1YB1A 1H98A 2QF7A 1XNGA 1B2LA 4PWZA 2OQRA 3N0VA 4DL6A 4UPVA 2B8PA 2ISCA 1P2BA 3MJHA 5JJKA 3G7NA 5IJ0B 2IP4A 5FUQA 1AT1B 3B51X 1FTSA 1ZAVA 4AL5A 1TKZB 1D8YA 2FC9A 4PKDB 1MJFA 3K9FC 1FSPA 5IFLA 4BYMA 4RUAA 4ZKDA 1QP7A 5EE9A 5D0GA 2OHHA 3OEWA 3GJYA 3C45A 1PU2A 1HYEA 4MO9A 1GTL1 2WT4A 3IIMA 4PWWA 2V9KA 2R47A 1N2SA 4GLFA 3KB6A 2EARA 3G8YA 1JYEA 2HO5A 1R8QA 3I6YA 4G5FA 2RSLA 4MLPA 3GGJA 4EJSA 1K98A 1ZM3A 2KFYA 1FUUA 4R2JA 3T7SA 3EK2A 1I2MA 3CR8A 1V47A 3C48A 3FFTA 1QHYA 2Z2YA 4PRZA 3TOZA 1ANKA 3D54A 1M34A 2FHSA 4YT5A 1B15A 3D1QA 4IQGA 3D1LA 1LTQA 2ZBPA 5LVAA 1NTRA 3C16C 3QU7A 3MWFA 3C15C 4KV8A 1PHPA 1N5LA 2V7VA 4HDNB 3ZGOA 3VJRA 1HLDA 1CB7A 1WWKA 1WI6A 3X3UA 4L2IB 4RMHA 5E7OB 2QPOA 2XMRA 3QFHA 2BFNA 2ODPA 2WIKA 2PT0A 3CVYA 1K3TA 5KTKA 1EKSA 3K8VA 3PNYA 1V3TA 4DA7A 2OXTA 4X66F 4RBNA 1DKLA 3RTAA 4MWTA 4GPBA 4JI0F 4Y18A 4IUYA 3AVTA 4JB8B 3AHFA 2HIQA 4P81A 1WMEA 2YJ4A 1FYVA 1E9SA 3V55A 1WMSA 3PR4A 4LZJA 4B7ZA 5HK8A 4N5IX 3KU1A 4U8YA 1DHTA 2DQ4A 2WG1A 4A8TA 2YOFA 3ZEAA 2JBAA 4I4TA 4RFSB 1UWAA 2HCJB 3QKSB 4A92A 1FXUA 1P2GA 4CLFA 3EXAA 4X8OA 3FF1A 2IEAA 1O7JA 1BIFA 1NMEB 3KR1A 1L6IA 1M5UA 2GMWA 1OFVA 1E6LA 2ZI6A 4MB0A 3O6VA 2Z08A 1NO8A 2H7YA 1RXWA 5B3AA 3ELYA 1CS4C 2WVFA 2QN6B 2GUWA 4NHOA 3K5NA 3DM9B 3ZC4A 4RF2A 1V9CA 5F73A 4YRJA 5DRKA 3NC1C 2IEIA 2XM3A 1F5AA 5THKA 3CEAA 2ZH9A 1ZQ1A 2NX2A 3EG9B 2HLUA 4WKGA 5F7JA 2GHVC 5I3CA 1R6AA 4I08A 4I4NA 3WL7A 1I7NA 1MC8A 1LPSA 4B6FA 3OFEA 5FJJA 5LZ9A 4ZHRB 1NT2A 1E2EA 1OWMA 1NQXA 2J5KA 3W5JA 4YO7A 2ZI7A 5KTNA 3AV0B 1UBLS 2VZ9A 3O2SB 1FVFA 4Y6GB 2W48A 4RKYA 2WTBA 2DRIA 4MV8A 3KHLA 2YIDA 1FX4A 3EEBA 3UJDA 2F9JA 4DFPA 1Z3IX 1F8XA 2XHEA 1MOZA 1XMOF 1P9YA 2N46A 1UBCA 4M7RA 3TRFA 3PX0A 2QM0A 5D5QA 2OZVA 2X19A 4OM8A 1MQAA 4BFWA 3ZH9B 3T95A 1R6DA 5ALTA 2X4GA 2NZJA 2G13A 1Q14A 3U1NA 5IARA 4BPBA 3FN4A 2VFVA 1NI3A 3GMDA 3WO0A 1PAUA 1EUYA 4YP6A 3R3SA 4QG3A 1BH2A 4IG3A 2B51A 4IDEA 2GT1A 2NVWA 5AVJA 5KFNA 2GEBA 3B78A 4Y0NA 4K88A 3H2GA 2Q3JA 2RK6A 5KNDH 4AY2A 1ZC4A 4LREA 2NM0A 4R2MA 1YRUA 2H48B 2CVPA 3KTAB 5EUHA 5LLSA 3PPVA 4HYTA 5FPYA 3WTCA 2RI0A 5KIAA 3AOEA 1QOQB 1KZ6A 1LK0A 3MJSA 1QFZA 5G1OA 4BUCA 1Q3TA 3OAAD 4Y98A 4AP9A 3TW0A 4WN3A 1DQZA 4MAMA 2YKMA 3RYTC 2AGVA 2KYZA 4BU1A 1XZJA 3QEJA 4MYHA 5AE2A 2GPYA 1BE1A 3HZGA 3IJPA 1GKIA 5JS7A 5CQGA 2AYMA 4KR0A 1F0XA 2PR7A 3ZS8A 2B6AB 3L7IA 1DLJA 1SV5B 4RSMA 1U26A 3PHJA 5J2TA 2HIGA 2PVPA 4QWEA 3ZK8A 2X1GA 4EG6A 2QTHA 4NYMQ 4TTIA 3HKCB 3MB8A 3Q41A 1Z4IA 4RKRA 4ZVVA 3IPAA 1M1KT 4OYWA 2DWCA 1SBZA 2VTBB 4FCCA 3MUMP 1REVB 3L93A 4P3OA 3K5MA 1TJ5A 4G67A 4D96A 2ZUEA 1LEOA 3K6SA 1TL7C 3JRWA 3K0SA 1BFDA 1UEVA 4N0EA 1GSOA 1LLFA 3I2JA 2W2QA 2H0AA 2YRXA 4LFAB 2XDAA 2FE4A 2A58A 4QXPA 3ABZA 2QRJA 2W6QA 1UXJA 4PYJA 1OH8A 4CV1A 1M5HA 4CEHB 3NGDA 4GE0A 4ZO6A 2D1CA 1W4LA 1T2UA 3V2HA 1JU3A 4RNMA 4DR1J 5B6IA 2PMDA 1P81A 5CBPA 1YJ8A 1WCIA 1F2UB 4CPDA 4E1VA 4XJTA 1JDUA 5FYQA 3FNRA 1SH7A 2MWMA 3GRCA 4XTCS 4F38A 1O0CA 2YKQA 3RADC 3WKAA 3QUQA 4WFZA 3SF0A 3LLMA 3OPMA 1NUTA 4JP3A 1PDVA 3R9XB 4U00A 1R43A 4W1PA 2DXEA 5SV2A 2VRNA 1X7XB 1FQKA 2W9AA 5TY0A 1XFAA 2VDJA 4HTFB 3T1OA 2R6ZA 2B20A 3TL2A 3JZAA 3TQFA 3FYUA 1ADYA 2XUFA 4MV4A 4QIGA 1FDTA 3E3NA 3Q88A 2VSQA 4KDCA 4EYHB 2ECQA 2IPMA 4EA6A 4H9GA 1VE9A 3A2MA 4BAZA 2F62A 3AVXA 1GGEA 2V7XA 4USKA 2VRBA 1BC6A 1PTJC 2G04A 4C4YA 4RU1A 3ZWBA 1HBNA 3MCUA 3FWPA 3KB1A 2G0AA 2AG5A 1W5BA 3MURP 2MDTA 3WNCA 4GYKA 2ZIGA 1JGTA 3AJEA 4O4LA 4X7PA 3CINA 4CLHA 1JIIA 2P2LA 1SBQA 3NXSA 2HIHA 1M0EA 4O4LB 4B6QA 1OR8A 2HPVA 3QGIA 2VNJA 1YUMA 4MKVA 1WEXA 3BFVA 1SC1B 4PF1A 4FMDF 5HEKA 1VKOA 2H00A 2PLFA 3JWIA 3QX8A 4DV0B 4H6XA 1GQEA 1AQJA 4AMVA 1BE6A 1S1WB 4KLAA 3VAIA 1PO6A 1Y4AE 4C29A 1ZNYA 4B82A 1I3OA 4CT5A 4J43A 1Z0SA 3LT5A 3GFXA 4ZVQB 2C9MA 4YECA 5LM7E 1S9EB 3S8YA 5K6AA 3VVCA 1MO3A 2XMDA 1GU1A 1DO8A 4AX8A 1Y5LA 3UCZP 2I99A 3CR3C 2X0DA 2O2GA 5FIUA 1KIFA 2J0QA 4EKIA 8ATCA 3A6JA 5KU1A 3I1IA 3PD1A 2CJWA 1A2KC 2F4FA 3BXPA 3QXJA 1A27A 4MDHA 4E88A 4JA0A 4PVDA 3ETLA 2XKKA 1VQSA 2YN4A 5EINA 3G0CA 3L4BA 4G5YA 3LP5A 4KPFC 5KYGA 3G59A 3EVWA 5E6RB 4S04A 1Z5VA 3QX7A 3CC4S 1IYZA 1II0A 3NHWA 3O1JC 1A5ZA 4Q45A 5FL3A 4DIBA 4P1ZA 1SR8A 2ZATA 4ZOLB 2OYRA 1JXOA 2ZH5A 4I2QB 5IVIA 1CR4A 4WKNA 3D68A 4AO7A 2RBGA 1U1OA 3MECB 5DM70 3RLIA 2UVRA 3JQRA 3CRRA 1QTNA 4MPRA 3I9V1 4DLZA 2WMDA 3ERCA 4BVLA 1D2RA 2W6ZA 4RETA 4QOGA 1AGPA 2QL6A 3JALB 1OFGA 3ZTQA 3GRUA 4G5HA 4F06A 2QRPA 2KLHA 3AT1A 2ZT6A 4KU4A 4TTTS 4ZQCB 4A6DA 3DL2A 4OKNA 1S57A 2P6RA 1D5WA 1RT7B 5B3LA 3E4DA 2V1XA 3KK1A 5C32A 2JAPA 5DTEA 1LFDB 5HJYA 5JJBA 3L9ZA 4DRXA 1PG5B 5H1SV 4TYYA 1O54A 4TKUB 3VDQA 1SPXA 4BZQA 2H11A 3OQPA 1AKQA 3E51A 1QHFA 4D3SA 5FJ4A 2W4PA 4ZPJA 1X74A 2JVKA 1QONA 4BKPA 3KJZA 4ZJUA 2I6FA 4PX5A 5K6TA 2YN2A 2ASEA 3ECAA 1NN3A 3SVTA 1ZVJA 3ZXUB 3DHVA 1CNEA 2BUCA 4CM0A 2C2KB 4MCJA 1FMLA 4XR4A 1AK9A 2YBDA 2Q0QA 2AF3C 2II6A 2IC3B 4JI7J 5FQNA 1FFGB 4EHFA 4UU1A 3FAZA 3OLAA 1WC5A 2H1SA 4YLYA 1N5YA 5P8WA 1RWNA 5D15A 2JI4A 1G5PA 2UYQA 5BN4A 1MEJA 1ATIA 1J56A 4KGVA 2ZWMA 3R3UA 1Z2ZA 4ND1A 3SEAA 3TW4A 2EJTA 5IJ9B 4C8KA 1U47A 1GYRA 4MCAA 3K8WA 3WLEA 3E61A 1YJRA 2NYVA 5FOSA 1YA4A 2XE4A 1B1AA 3IVAA 3QYFA 1HSZA 4C08A 1WV1A 2DHHA 1Z29A 1N9GA 5I8ZA 4XW2A 3PGLA 4AJHA 2HHJA 2ZYDA 3E15A 2NS1B 1ZL0A 2WTXA 4YCLA 1ZNZA 5LJLA 5A9SA 4YR3A 1CEZA 4X1KB 2H5JB 2QMYA 4P4UA 3V4VB 3E3OA 1Z38A 4MRPA 3OZCA 5REQA 1GN9A 3C5CA 2A1IA 1Z18A 4JT4A 1QZUA 2IPXA 4QBTA 4ECRA 4QE3A 4HL9A 4ED7A 2LDXA 4KSYA 4DPYA 1QHEA 1GCIA 2UZ1B 4EDFA 2CDRA 2C9BA 3ZHBA 2J7PD 1I51A 4O2BA 4LHZA 1F9HA 4I1TA 3DFFA 1YHNA 1XZEA 3KT3A 3A6DA 5CHCB 5T6BA 2H4ZA 1QIDA 3I64A 3DYAB 1H23A 4D0LB 1R8JA 4RESA 4FWTA 2J33A 3EIXA 5FBVB 1M0SA 1NE2A 4GBJA 1RIFA 5I51A 5DNWA 1Z35A 1J90A 1UBSB 3IV6A 4C6TA 1KD1T 2WIFA 2GBFA 3IC1A 3LIIA 3IA7A 1ISPA 3BGOS 3UMFA 2IRYA 1P61B 1I7QB 4BMVA 4DG1A 3BMOA 1EFHA 1CIVA 2K5UA 1J5OB 4YRRA 4NLPA 3FLEA 3OZDA 5EIBD 1DBDA 4UJ3A 2I71A 3DO8A 1WCXA 1OPRA 5TF0A 3IV9A 4DV4F 3RB6A 2XMGA 2V03A 4ED1A 2I4TA 3COZA 4YRAA 1F9AA 3NNAA 3Q0EA 4QKQA 1X0VA 3A8IA 4GW3A 2RD5C 2DR3A 1GADO 3KG4A 4RLEA 4KH0A 3PFBA 2JC0A 3DQQA 3QNMA 3KR2A 1JAYA 5DI3B 3DDSA 3C3YA 1J8FA 1TUWA 2WYUA 1HR0J 5K1ZA 2XCRB 3P4XA 4JBLA 4J6EA 2I8LA 4G37A 2OOKA 4C21A 1AXEA 3QPIA 1VJWA 4HNGA 1H93A 3V46A 2W6ID 5B0EA 5LMNB 4IUDS 4QPPA 2QQ5A 1SC4B 2AOTA 1A82A 1TEHA 3NWGA 4RMJA 3RRZA 4FB4A 4MQFB 3M2UA 5B7WA 3TINA 2J6UA 4GRAA 1QCCA 4DE5A 4LDQA 2I8EA 3NANA 3P9RA 2O5VA 3ITHB 5K0TA 2JZNA 3VBCA 2HHTA 2CNWD 2PCJA 5ENVA 3SAJA 5LYJB 1YDMA 1WUJS 2OUIA 1OT3A 3NTUA 1ZGZA 1R74A 4QDUA 1KL7A 3EX7B 1XA4A 4L73A 3ZHCA 3BUSA 2H1WA 3VH3A 4LZWA 4M0LA 1NJWA 2DAPA 5AR1A 2IU6A 4BATA 4CO2A 2VXCA 4DA0A 3GJ7A 3QOXA 2ZYVX 5D00A 4HDNA 4DB4A 3KQMA 4KDEA 3CNOA 3SPXA 4CO3A 1U0JA 1CRLA 1U5CA 2VJDA 4PTYA 2H8GA 2XB9A 4QJVA 3DXFA 2GW8A 1K5DA 2NXUA 5IDQA 2RB5A 4XPIA 4J8PA 3MAAB 1MHTA 4CG3A 3V6DB 1EM6A 3PFCA 1QIJA 1Q5VA 3QLHA 2AR9A 2H1CA 1GKUB 2IS1A 2H07A 2KS6A 1X13A 4O4IF 5GAHU 4UVHA 3D0HE 2VBZA 2VK2A 1GDHA 4HJRA 3CVUA 1XJ0A 4H4KA 3QW4B 4E4RA 1RZUA 3WV4A 4PX2A 1MD9A 2PZBA 2IZ0A 5E9WA 1YR9A 3OSZA 3J81Y 4B87A 4MICA 2OAGA 3VSEA 1R27A 2ZCUA 1K47A 3HP7A 3IVMA 1Y3HA 1P0FA 3RAGA 2ASYA 1SO8A 1N6IA 5CM8B 5AO9A 5JALA 1N0IA 2PGIA 4XCVA 3WL8A 4CU2A 3IAS9 5ADVA 1AT1A 2ONZA 5FUXA 2IXEA 1XWWA 2AJTA 3DEKA 4I46A 4LF8F 2GN2A 3KOMA 2QSZA 3DD1A 4YCJA 4PCUA 3IPXA 4CKEA 1S8AA 2H29A 2LVBA 2JRSA 5KOIA 1CJVC 5KI6A 4B2IA 1PJ7A 4AN0A 4J1QA 3F3KA 2M8HA 3CNQS 1W5EA 3U9SA 5KVAA 3PG9A 4DMMA 1GVNB 5JCJD 5EQTA 2MKHA 4B2PA 4DV6J 2O8NA 3R9LA 1A77A 5FOTA 5G1PA 2ZUGA 3CF4G 5EXTA 5GWXA 3HU1A 3L7JA 4YRNA 4K1XA 2D54A 3H11B 1EK5A 4JI6F 1J2EA 1O2DA 3FBWA 3K53A 3OVBA 4IFEA 5CVEA 2NUHA 1QAXA 1MA0A 4PYRA 1R0BA 1M73E 2FAXA 3TXXA 2Q3CA 3WWZA 3DVRX 3NYQA 4RY9A 5IQQA 3LCVB 3UHFA 1P5FA 3D6AA 1T9HA 2QN2A 1XNRF 3AFGA 1INLA 1KH2A 4MWGA 3AD7C 4F2GA 3TP2A 1JMKC 1PZMA 5JWHA 3KLPX 1Q0TA 1Y9DA 4FMPA 2FHJA 2DJIA 4ZVGA 4QUHA 2R96A 4K6CA 1MX5A 1U90A 3U4GA 3DQZA 3FOWA 2FMIA 3PO4A 4FILA 4HNAA 1FDBA 1X1RA 4FR2A 3DWFA 4ZVUB 1SURA 2F9FA 4BAGA 2LDYA 1VQ5S 2Q41A 3CWJA 4MR9A 2C82A 3VGVA 1RXUA 4GUDA 3ZCUA 4EJ2A 4IH6A 1REGX 2IVFB 4DM7A 2YQZA 2YASA 3L8ZA 1URPA 3IS9B 1YE5A 4H7HA 4IJVA 4ZPCA 5TGDA 5TNXA 1O95C 1PNVA 1S89A 5E3HA 4M60A 4M5NA 4RKUC 4RK0A 2OUGA 1L5MA 1KOHA 2C94A 1S1TB 1JHXA 4DR3J 1MAAA 5HSGA 2O3TA 3NNCA 3M7IA 4Q7LA 4IFIA 2VPXB 5HDBB 3SXJA 1TM5E 2QVZX 5KOJA 1YRHA 4F3NA 1ITZA 2OPRA 2X13A 4OGLA 4HI0E 1PZFA 4P34A 1GPAA 4EEKA 3BH0A 3T94A 3GCGA 1YB7A 1FCJA 1K8XB 4BO3A 4WK2B 5B36A 1FQWA 4WOCA 4NMWA 4ASUD 2ZBIA 5T67A 1Y8RA 4Q7MB 1NVEA 2QLMA 3DSRA 3GH1A 1ZM2A 2B4VA 2OP1A 3I5BA 1RABB 3VO9A 4XLLA 4XUDA 3C8ZA 3HVRA 1MWZA 3C4JA 3N2GB 4H0FA 1YZYA 4YH1A 4RK1A 1Y37A 1F06A 1GGJA 4FC6A 1WCYA 1LFPA 2ETVA 4LYGA 3RASA 3T1NA 4IHAA 1W25A 2BT4A 5A7GA 3T5CA 1HNXJ 3UWOA 3TEJA 1RVDA 3A1SA 2DNZA 4YDSA 4X1YB 5DDPC 3PX2A 5KTPA 4LRCA 5CG1A 1JIQA 4RMGA 2DF8A 4DR6J 2M9KA 4LXTA 2JGKA 1NJXA 2XNQA 1A9XB 1HQDA 1U9CA 4DL7A 2EP5A 1A9PA 5D77A 3GR0A 3TZYA 3QIVA 4NCXA 2YWFA 4AJIA 1OF1A 1SMKA 3MMPA 3TKAA 3QEAZ 4OX9Y 4F3KA 3I9V9 1HO3A 1AE1A 1KYZA 2JS7A 4BLPA 1L8QA 4DZZA 3NHJA 4YXWD 1DAMA 1LNQA 3V5RA 2GFFA 5L95A 3HA3A 4U6PA 2YQ4A 4MHOA 2B21A 1H1LB 3U5ZB 5KS2A 3IP6A 1Y4ZA 4GVLA 1E8DA 2ZULA 4GYWA 3H40A 1RWQA 5E3IA 4Y8VA 3WA6A 3F5DA 3G5MA 3N6RA 3SM9A 2DR6A 4BO8A 3WMFA 3LOPA 2E9TA 4HDAA 4MLZA 3E7WA 4CQNA 3MR3A 1PG0A 2DXFA 3JARA 3J7ZT 3FSGD 5LA6B 3C14C 3GMSA 2Y0CA 2QRLA 5CXTA 5F2EA 4KHRA 1RXYA 3NUQA 4MARA 4UCXA 2M52A 1MDBA 3SQWA 3UKDA 4FF1A 2DFTA 2QLJA 1D04A 1FSFA 5DBIA 1RLJA 4HXGA 2D59A 5CYQB 4C20A 2O3RA 1PT6A 1Q1EA 4I5IA 3EGCA 2QGFA 1LK7A 4WXEA 5EI5A 4WADA 1EE2A 1EXMA 4IJQA 1K27A 2AMVA 2Q6TA 2ZU0C 1U3DA 2XUIA 4AB1A 1ZN9A 3GLIE 4Y34A 4QECA 2GC8A 4ENWA 1QAJA 1NHUA 2FXIA 4IAOA 3TD2A 1AHNA 5C51B 1C4CA 1PKXA 2EHJA 2I4MA 1WUIS 3KEMA 3M6MD 4IDPA 3LDFA 2POKA 5IT9Y 3T1YF 1K6EA 3W05A 3T41A 6FDRA 1IVYA 1NOJA 3CDAA 1V35A 4J0EA 4ZLNA 1ECJA 1EXNA 2OZKA 2G07A 2WOJA 3M1YA 3QPDA 1V9OA 4WPGA 4Z8XA 5AK4A 3VALA 2PMZD 1SQGA 2IQ5A 2ZHBA 2FFQA 2VBFA 2WE8A 4KQJA 1P2VA 1IJFA 1JYFA 4IF6A 4WH0A 1VE3A 3BIJA 1OILA 2V5AA 3LUCA 1PX2A 5UKDA 4L8LA 3HYNA 2OBNA 2IU3A 4IGEA 5KPDA 4FNIA 2GF2A 4WBNB 3NBPA 1JU4A 2V8OA 4BNYA 4OHVA 4GI5A 3UMGA 5IV4A 2IAJA 4WOBA 2XO7A 5JH7F 1S0NA 3SFUA 2ZR9A 2FA9A 4RZRA 4QBKA 2OCKA 4Y6QA 1YRTA 3NUGA 1RP1A 3CE9A 4I67A 2C8VA 3RTDA 1AW0A 4GQIA 3F6YA 1MB4A 1V8DA 4H17A 3FCEA 1BW9B 4I4LA 4F9EA 1ACLA 2AX4A 3SSQA 2DFDA 1VLOA 4YEAA 1BFKA 3HYSA 4AZ3B 3GRVA 3I23A 3R41A 2Z43A 4XO0A 1XJWB 2PL9A 4U2CA 1MW7A 1JDSA 1VC2A 2WZ1A 5B1EA 3COPA 2JLVA 1L7EA 4D43A 5ECGC 4RYDA 2JJQA 1H2ZA 3R5JB 1DTTA 1UBJS 5JMOA 1ECPA 3K4PA 4UC0A 2X5KO 2E7XA 1ECGA 4HB4A 3UWSA 3O2JA 1FEHA 2ZI4A 3STTA 3KCNA 4OL9A 2BOAA 3GAZA 1XDBA 4WK1A 1PP4A 4YMIA 2HDWA 2PUEA 3I5CA 2RHSB 4HZUB 2DYAA 3A8JA 1RCXB 2EQAA 5JSHA 3C3DA 3NEJA 4NBNA 3ZU4A 1SU6A 3PQDA 4DCPB 4YJKA 3I9JA 1KSGA 3Q3IA 3TLGA 4XB1A 4CFYA 3FCXA 2DRBA 2WVCA 5CD1A 2VPIA 4ZZ2A 2K1RB 1R8CA 4EKEA 1XMQJ 4LYYA 3MWDA 3KJIA 3MECA 1QIEA 3EFBA 2Z5LA 3EZ6A 1PWHA 4BGDA 1IWOA 1I4OA 2XB6A 3DLGA 1Z34A 3M2TA 2Q50A 3EASA 4C8NA 4FJ0A 4QGGA 1RKIA 3LAMA 1VQ8S 1QSLA 3OTOF 5E6RA 2PNJA 1IB6A 4IHJF 1CP3A 3CX6A 5A4MS 1PILA 3O5AA 1YK0A 3OFSA 4OZ0A 3ADKA 2ECPA 3LOQA 4O1MA 9ATCA 1SKQA 3K70D 2YY5A 2H1YA 3H9GA 4EKYA 4L5CA 4WFKA 5COAA 4QDZA 1UK7A 2NW6A 4F0MA 1ENZA 1CJUB 2N4DA 4L9SA 1RPNA 1KFKB 1N33B 1U28C 1CETA 4OCZA 1T4CB 1QS0A 4ZZ3A 2DHEA 3L2OB 3HULA 2FZ4A 1M1HA 3M6AA 4EATA 2V6FA 5KQPA 1G59A 4II3A 4NLDA 2O8DA 1F20A 4NBKA 3ZWMA 3BTOA 1IKWA 4WN9A 4K0KF 4YAGA 5AYVA 1YQGA 5T8KA 2FSGA 1NK7A 3FI0A 5JROA 3R23A 1I7SB 2IAJB 2VTKA 1GWNA 4TWJA 5EN4A 2KL8A 1MAHA 2J6BA 1OH7A 1DOZA 3MELA 2HS4A 4GC6A 3N2LA 2IM0A 4U2GA 1AXQA 4X6XA 3KXIA 1H8HD 1XMXA 2IOYA 1P2SA 1EP4A 5K0JA 3W2TA 4KGXB 3ETGA 4MB6A 1K5HA 2VP4A 3ML1A 1RTJB 5IT0A 2HU7A 2PYIA 4FYXB 4IHQA 3LBHA 4V19X 3KK3A 2C7VA 5FI0B 3MGJA 3G1UA 1IM4A 2O8BB 3JYQA 5JSQA 2ENUA 3CUNA 2E4WA 1MXHA 3NHZA 1EFKA 1ZCJA 4ZDNA 3KTQA 4AT1B 2Q2NA 2IUYA 4YN3A 2ZJ0A 1PO7A 4RWEA 5YASA 1ZM9A 2X7JA 4E21A 2G1HA 4A2QA 2JIRA 3RVKA 1M8JA 4XD7D 2WMNB 3ZE9A 4YQEA 4OHMA 3W6PA 2M8DB 2R11A 2B5JA 1G5HA 3PGXA 3OJUA 5AOBA 4JJKA 2BGTA 2PUBA 4TLRA 4JVSB 2KRBA 5EJGA 2RGGA 1S1TA 2D2FA 4WLUA 1S2NA 1NOKA 2GEUA 2H65A 2IY9A 5K0LA 4E2WA 4C97A 3ES9A 3LC0A 3TAUA 1NSPA 5EVCA 2XVAA 1Z36A 3R1LA 2PE8A 3DLCA 3GAAA 5B3JA 5F8LA 2BTOA 4MT1A 1KYXA 4ED9A 3WBJA 3LKBA 1Y5RA 1YQWA 2ZQYA 3DOUA 3PD7A 4JROA 5EUCA 3CG0A 1T9AA 3GP8A 3KLFB 3SJCA 3LVFO 2ACYA 2OZLB 3WYDA 4G85A 2WVBA 2ZTSA 1LW0B 2Y1CA 2R2AA 2CXNA 3EMDA 2K7FA 4NBUA 2DMRA 2AN5A 1M1YB 3R7AA 3S55A 2BMFA 3A4IA 3TUZC 1BOFA 1EVQA 4RZ2A 2M5YA 1HX7A 4Y9SA 5A8WB 1B0AA 3RK4A 1C8KA 4D3HA 5EJ5A 1S6PA 4R9UC 3KQPA 2QLNA 3SQNA 1GG2A 4TMWA 2H1OA 3RARA 1KRWA 3R5XA 5AM4A 4MA5A 4XZ3A 2CG4A 4JR1A 2QTZA 4PG4A 1AZWA 2ZCJA 3T3OA 4P3XA 1U1EA 1U0TA 3FUCA 5FULA 3FMIA 3NVDA 3HGQA 3OZWA 4OHRA 1DARA 1VHDA 1FWPA 3EUFA 3OEHA 2QTCA 2NTEA 3BXOA 3FFXA 3RC8A 3V4PB 1C4WA 6YASA 2SXLA 2FJUA 1SVNA 3GFTA 1YRBA 6REQB 2FKAA 4K81B 5L9XA 1UEUA 3KZOA 3H5WA 4C7MA 3KV1A 4Q16A 3V34A 2AEMA 4LOLA 3BRWA 5BYJA 4Z99A 2NYAA 3QTLA 5L4NA 5EXSA 1NK4A 5EZYB 3MCOA 3URKA 3V81A 1C8LA 1ZM7A 5LNK1 1A8QA 5AXBA 4WVFA 3RSZA 1DG1G 3CYFA 3U3ZA 3J81A 1GPUA 3JYPA 4AI6A 3EWGA 1WG1A 4WDQA 4P7VA 2MGZB 4I1VA 3ZGVA 3LANA 1T0HB 2PCLA 4N6OA 5ELMA 3N74A 5I3UA 1WQ4A 2GGPB 5EIWA 5L9NA 3TXYA 5P21A 3BJZA 3HE3A 2ZJ5A 3NRBA 4WZBB 1DJOA 3G1WA 3PS9A 3OJOA 3R0JA 4BO7A 1GXSB 1PAUB 3A04A 1IHOA 3G8DA 4BC1A 3MAGA 1BA2A 3EGOA 2EKYA 5AXMA 5JFTA 4BNLA 4TU8A 4HAXA 3QT5A 1L5OA 5L3SB 4ES6A 1C81A 2G9RA 4J0FA 3FWKA 3ZXIA 1L5RA 5ECDA 3ICQB 4YAEA 1T3GA 2IS2A 3AJ8A 2WF9A 4KHPF 2FDXA 4MEJA 4RSRA 4UUNA 3ZI7A 2GBIA 4LR9A 2WMOB 1Y9OA 3WGHA 5E7IA 1RZVA 3FIJA 3MPYA 1XQ1A 1T9WA 2JJMA 1FK8A 1UPMB 2MSTA 4LAFA 2EFPA 2VQDA 1DV1A 4Q7QA 2CWWA 2XODA 3CONA 2LDBA 4YP9A 3WGMA 4YT8A 2LQBA 4I55F 2IJGX 3K58A 4OPMA 2JI8A 5M5BA 4P52A 4LGYA 4MUAA 5BW5A 1XROA 3NBUA 2H1LA 2JJ2A 3RC1A 4RHYA 3EA0A 2I22A 2L41A 1AO0A 4HPWA 4WOKA 2BR5A 3IR6B 4IZ6A 2ONJA 3NHBA 5DWDA 1HR0F 1JQJC 5IG2A 3Q7IA 5DZ7A 3EUAA 1GTG1 3QBVA 3JQBC 1HHQA 4RW7B 3OLVA 4RWXA 2QD3A 3PQEA 1G2QA 3OLYA 1Z0FA 3ZUGA 3NNSA 2EDCA 2HWIA 2VPXA 3BK2A 3U62A 1ZD1A 3F47A 3CW2A 2AG8A 2YFKA 3COWA 2QLJB 4B3HA 4LWPA 1UOEA 4L5AA 1K88A 5KT4A 1H3NA 3N8DA 2XNCA 2YH1A 2DR5A 3N7AA 3ZHRA 5LOVA 1GMVA 3DEIA 1D2CA 1QPBA 1OS5A 1O5TA 4XLTA 2H9AA 2YX4A 2CXTA 4I5FA 4LUBA 2O6LA 1R4MB 2YWGA 3QMPA 4QOSA 5A9RA 5KC9A 1ODTC 3KKLA 5T6MA 3TOQA 4HRVA 4QW9A 3TBFA 1MX1A 2CVOA 2XTNA 3AKZA 1YL7A 4MW7A 2ZYIA 3EGXB 3AHHA 2HFJA 4OZLA 1RW4A 3I3SR 2A2DA 1K4KA 2CXXA 1HTTA 5IJAA 3H2SA 2VJVA 2RRNA 1N1MA 2OZPA 3U80A 3DLIA 4IOMA 1XCPA 3IOEA 4EMUA 3G68A 1VKZA 4BP3A 1CVLA 4GLLA 4EHJA 2NIPA 2F8EX 1OU0A 4C7OB 2M70A 4P4SB 3WI7A 5CLFA 2DETA 2FOXA 5G0SA 4FP9A 3NDBB 4KO0B 2CQPA 5C52B 1W48A 4IEEA 3TTSA 5LXTB 1DEKA 3TLKA 1Z9BA 1ZOIA 4ADSG 1D6SA 2BTEA 3P19A 2BFEA 2Z2KA 1SM4A 1N5RA 1QYXA 2FK7A 1RAJA 4EY8A 3B70A 2XZTA 1TUVA 2ACEA 5K8JB 1PR0A 1QYDA 3TSWA 1OFUA 1NQTA 3GD5A 5CHYA 1VSBA 1VIDA 4JCOA 5M3BA 2W2LD 1BDIA 1DTWA 4CRWB 2FGCA 3GYBA 2Y77A 3K5IA 4IFVB 2EF1A 2JLAA 1G5FA 1ESMA 1H5NA 3UH1A 3QKWA 1NNLA 1P6TA 1FPMA 4Y2PA 4CWAA 3LP2A 2JK1A 4EF4A 3RAPR 1EIZA 4LBYA 1ELOA 3MT9A 1UMBA 1VYAA 4IOKA 4N3GA 1NBOA 1G9SA 4JJZA 1D1SA 2P91A 2ASLA 1JPVA 3CMAS 2O4UX 3GLHE 1V3ZA 1GXSA 1KBOA 1PE0A 2EFDB 3H1GA 4DDVA 3GOHA 3TBHA 3E9YA 1EFRD 3GLFA 1GIAA 5H16A 4UE2A 2LP4A 2C9YA 1C41A 3DUFB 1V8PA 3GIMA 2RCNA 2D8MA 3L3BA 4DWOA 3T3GA 4P0PB 3K1AB 5A4DA 1BVYF 4BEBA 2AEFA 1OUMA 4BCBA 2EFEB 4E5UA 1IBMF 3BSYA 4I8DA 3HKEA 1UM9B 1OB2A 1EI9A 4Z4EA 3KL4A 3CZ4A 4AU1A 1THMA 2VP3A 1PR6A 3GVHA 4YR7A 2CLFB 3Q7RA 3HA7A 4UM5A 3VVUA 4PRKA 2HRDA 2J5RA 3RYIA 1V16B 3GUCA 3I8XA 3OQMA 1EWVA 2ZOMA 1RWWA 4W9MC 1KU0A 1FKPA 2H2HA 2YMQA 3TDNA 1EZ4A 2B1GA 1PL8A 1SA0A 3FCSB 4X62J 4UEJA 2H1RA 3TR6A 3DT8A 3OU7A 2X6RA 3DYIA 1WG8A 4GDFA 1EM8A 4RIEA 1TTHA 3L7CA 3DOFA 1I5EA 2RMKA 4IRUB 4CM7A 1ZMTA 3A14A 1TRHA 3ESBA 2VF7A 4R69A 5SYAA 1MXFA 2K7JA 4GD3Q 2E29A 5BRNA 1UMCA 2F1FA 1KFJB 2GZ2A 1PIEA 3HKBB 2QP9X 2ZWOA 3PJFA 2R7OA 2CK3A 4EYIB 2G9NA 2Z56B 2V4JA 1X7VA 2HQOA 4FNHA 2PL5A 5CT8A 4FD3A 3CLRD 2Q3EA 3F1KA 1VI6A 5AFSA 1UIRA 3FBBA 3OZ7A 1SC3B 1ZOOA 2BMEA 3MEEB 1R4ZA 3ET5A 4L02A 1X15A 2LECA 5ANRB 2P9BA 5DBHX 3RWOA 3LUAA 4D8VA 1UVJA 4BVKA 5KWJA 3O5TB 1KK0A 1KPIA 3ST7A 4BEWA 5JRZA 2Y9HA 4R6XA 3HKWA 1PBAA 3GV8B 2J0SD 3I1FA 1U0HA 5LSLA 2JGMA 1C50A 1UBHS 3KSUA 4O44B 1KSFX 4GPAA 1QE5A 4HPXB 4NNPA 4FCTA 4TY8A 2Q27A 2VHYA 5GJCA 1E9EA 3T3DA 3CCMS 1W0KD 2ZBDA 1RKJA 5IT4A 3A4LA 1KJZA 3U1TA 1N5DA 3LRTA 5SUHA 3TQSA 1S48A 3IMGA 1PN3A 3AODA 4RR5A 1RAFA 1SC9A 3DMRA 1W52X 4EPVA 5CT6A 1XTRA 3ABSB 1RTDA 3F97A 4WE1B 1XEWX 2ZTUA 4WZZA 3OIUA 5C1IA 2Z57B 2YXNA 4YN3B 4MMOA 3MR5A 4LJLA 3EULA 1Q0NA 2A7QA 3SCLE 1MV8A 3RQIA 1N77A 1ZPVA 4GMGA 5JD3A 3HHDA 4CZCA 4U2DA 1VCOA 2V59A 4PQFA 3R20A 1BUXA 2I6SA 1RRFA 1N48A 3ROEA 2JCGA 2VCEA 1PW7A 3KQOA 3I6MA 2HJVA 3UKJA 2QU8A 4D46A 1GCUA 5C2JB 5LKRA 3D9BA 3N4WA 3MJFA 1E94E 2AJLI 3LY7A 2XGMA 4K59A 3VR4A 3QOWA 4BNXA 2QUJA 2IGTA 4GGPA 4M3NA 5HPYB 1E3JA 5KB3A 3TOSA 3X1ZA 3A26A 3WGKA 3ZZ0A 3IT1A 4KX5A 3F4BA 8ADHA 1NTOA 4ZDWA 4ALMA 3RRGA 4XEUA 3ZVLA 1FXDA 3W5AA 3L7LA 2VC2B 5FRDA 5EWMA 2WSSA 4AXXA 3HDYA 4E70A 3TQQA 1IBCA 1OIWA 4DLYA 3DOKA 2HLDD 1LF5A 1GN8A 2PGDA 2GZRA 4FNMA 4RMIA 3HYTA 2FW6A 4CDRA 2C7BA 3D0KA 4TLMB 3WNVA 2JLRA 2Q49A 5IAEA 3JAWA 4P53A 2WM9B 3MLBA 1BHO1 4KGKA 3NOGA 1EB8A 4IO0A 1WD6A 2NSJA 3O8WA 3TIVA 4AUKA 5EQDA 2BKEA 4QUKA 1JJFA 4DCVA 1RXSA 1ZN7A 5LP6B 2HNBA 3JWJA 2YZKA 2LLZA 5EOVA 4YRBA 2DE0X 2ASDA 4O6VA 2J8SA 1KVSA 3WG9A 2FSHA 4J16C 3OR2A 1Z2EA 4CDGA 3FZNA 5DX1A 3BN3A 4EUHA 2IZ1A 4MQMA 3SDBA 1H5UA 2RHWA 1YFKA 1RT3A 5K99A 3K32A 4Q4LA 4BB5A 5HMLA 1UL3A 4R5HA 4ZOLA 3OEYA 3OJEA 3W2VA 3EZ5A 2NG1A 1YJ7A 1TMYA 3CCQS 1HWLA 2H1IA 1KY5A 4HR7A 2XW6A 3HUFA 4DUGD 4E2FA 4OQLA 2KYXA 2G6BA 4HS9A 3IAUA 1RAOA 3JQCA 2GN4A 1UKUA 3RR8A 3OFND 2PMWB 4JI4B 1P72A 3ABOB 3MT8A 3BJRA 2GAAA 3HP6A 4HB3A 4AY3A 4QT4A 2PSSA 1FESA 2I2WA 4M4SA 1TZ2A 3N0WA 4MUGA 5JCXA 5LWHA 1LWXA 3B2EA 2EYQA 2WPNA 3HC7A 3LALA 1K0UA 2C07A 1W4AA 1RHUB 2VJMA 1DAKA 1XAIA 3FRJA 4KMRA 2X76A 1TQ6A 2Z9BA 2C61A 2GAHC 3RU7A 3F5MA 1C4OA 1U25A 5KDDA 1DUVG 1Z47A 1RLTA 3HFSA 3ZU3A 3K09A 2PU5A 3SBOA 4EO6A 3TI7A 2D0DA 2R7NA 4CCAA 1WQ1R 1T9BA 2YNMA 4FFVA 4LZZA 4AUEA 3FCOA 3ZHYA 4DJTA 5BR8J 3COSA 3GCWP 3GLJA 4F7VA 4TVAB 4QQKA 3EJWA 4EBCA 3P0EA 4URWR 4MRVA 4XJVA 3WC0A 4CFSA 3ZG6A 3EFOB 2GXUA 5KAPA 2RKIB 2LZ0A 4MR7A 1GPMA 1H6KX 3R7WA 3RR2A 2W7TA 4QJ5A 5JS6A 3NAHA 1UZNA 5FPTA 5CLLA 3WQRA 4DR1F 4GKKF 3CC7S 2EKLA 1WHSB 1H8ED 4D6XA 4BKQA 4C4OA 121PA 1U9YA 2XTJP 2AN9A 4CEHA 5C4MA 3WZ0A 2ZETA 2HFNA 4DR6B 2FFAA 2W7PA 1PYOA 2FPMA 3OCZA 4D3DA 1UDBA 1L7AA 3LW7A 4C3OB 1W30A 2YIMA 3R27A 4P35A 3PVSA 4OHOA 1EK2A 2K3KA 3EXIA 4KMOA 2O57A 3L8FA 4YP3A 3IUYA 2VDUE 3BRCA 4Q5VA 3TRGA 1A4XA 3GPLA 2HIYA 3JY6A 1KQ3A 2QZZA 2XNRA 3LX6A 3QBJA 1GL9B 5HL7Q 3UWDA 2AA3A 3IO1A 1VGVA 1REVA 5BUQA 3RTBA 4B4DA 2Q6IA 1G2EA 2ORWA 2F00A 4DSAA 3AJ2A 2GVDB 3FVWA 1D1QA 1F6BA 4UREA 4ZOLF 3PP8A 5I3PA 3DOLB 4DN9A 1WG4A 1QSYA 2NOAA 4QFBA 5G0UA 4F9FA 1OWXA 3SHWA 5DYGA 1O5JA 2YXPX 2BEVB 3BQMB 2O2CA 1L4UA 2VD3A 1HPLA 3LQQA 4YXWA 4HHEA 4B7AA 4ND7A 4EO8A 5EDWA 3IH5A 4YK7A 2J3IA 2P1ZA 4BCAA 2POCA 2JDIA 4TT3A 5IRCD 1W35A 3P26A 2PSHA 1VRQC 4AM8A 1O0SA 3OL7A 2A0XA 1CC7A 2BM8A 2CDCA 2FWAA 2V8BA 1RXEA 3RF6A 1JLBA 4ZT4A 2IBTA 5D0HA 2RHHA 2R3SA 5DM0A 5AW1A 1N3YA 5JTUA 4WGFA 4IGIA 3MOIA 2H9ZA 2NQPA 1UK8A 4YQYA 1AURA 5CNJA 2UVUA 1E3DA 8OHMA 1GZ5A 1X87A 4WZBE 2CJWB 4RJKA 4C0QC 4F67A 4EARA 1HIYA 4WK4B 1O89A 3UBTA 2COKA 1VLJA 4ZWNA 3QJYA 4B3OA 4I8IA 4F4FA 4W7HA 5CB4A 2J8ZA 1N34B 2HHVA 1Z6TA 3CO5A 4D9FA 2MCFA 4KC0A 1RNLA 3PXCX 4GO1A 4F4CA 1V48A 1V3UA 1OV6A 3GQBA 3B7PA 4F56A 2H06A 4E03A 1NYLA 3M8QB 2RILA 1YA8A 3R5BA 2J9FB 1T6YA 1HKAA 3LPAA 4QIVA 2HFVA 3C6UB 1R0YA 1TJPB 4AYXA 2IYPA 2FUCA 4JOQA 3VC7A 2DGUA 2FY1A 3G5UA 3ODPA 2R42A 3PIPQ 2UYGA 2H85A 2GQ2A 1BXRB 1Z45A 4XIGS 1AGXA 1MB2A 3FVRA 1Z39A 3H7IA 3GBPA 5EJ7A 1Y1LA 4B0PA 4RGYA 2P9JA 5JECA 2L08A 2Q5FA 1XR7A 1N75A 2JFBA 2NU7A 3MGAA 2XZTB 2VA2A 1I5RA 4WZAE 2OD6A 3MM7B 1HLFA 4WXHA 3JSMA 2D7DA 2FFBA 1YRQA 4KO0A 1FYEA 2X4IA 1JFVA 2P9HA 3DL7A 3T9NA 1EJ7L 2JAXA 4H31A 2QAJA 2EWMA 3HJNA 3N6NA 4CMIA 2IHJA 1J2JA 4JC0A 3CNEA 5FL7D 2XD4A 2OPQA 3R8CA 3H1EA 4L8YA 3K5PA 4R2IA 1P1HA 2Q1SA 2E5GA 1J5EF 1C3EA 5C24A 1IY8A 4O2LA 2XNDA 2H3EA 5F23A 2CN1A 5IOLA 4JLBA 3SN6A 3BSNA 3EF0A 5CH8A 2ETXA 1YVUA 1T1EA 3KZNA 5FKJA 4F91B 4FEYA 3CZ5A 3PZPA 2VUUA 4LFAF 3LSYA 5TF4A 1RAHA 4RKQA 1E2GA 3OF3A 1OQAA 3HJTA 4WIAA 2WWFA 3FWNA 1I94F 3AJ1A 3ZYZA 1RTHA 4ZO9A 4N8EA 2KH9A 2E6KA 2P1RA 2IPNA 2NO5A 3FHTA 2J59A 4HGQA 1X60A 4XM2A 1H6CA 4QPTA 5JI3E 4XVCA 1KPGA 1R9NA 5HQMA 3NVMB 1JLSA 4IWNA 3NC0C 1F6DA 3K9LA 3TSCA 3TPFA 3O7MA 5JS8A 4KI7A 4RDCA 2VF2A 1H6DA 3GJ5A 3KOYA 3LYUA 2IX9A 4PLZA 1BHSA 1Q0UA 3MAHA 2GRAA 3NIWA 1O6BA 2XS7A 2X3FA 2CQ2A 3VKVA 3NG1A 3W9BA 1SH0A 3SIXA 3PRYA 4X85A 4YQWA 4AS2A 1UP7A 3SLKA 5CBKA 4I2PB 1JLCA 2AGQA 4LC0A 3M4ZA 1JIVA 3K0AB 5KU7A 5IXSA 1VP9A 2V6JA 4BMPB 3JQ8B 2JZOA 3KB2A 4BLOA 1MNAA 4IXMA 4OAQA 1K63A 1RYNA 3O3CA 3TUPA 2RGUA 1QLHA 3ZCSA 2H59A 1MR3F 4ZRDA 1M1XB 4QFDA 3RVSA 3NKFA 4TTRA 2ATLA 4ZJZA 4DNPA 1TC2A 4PAAA 2H7VA 4BJ5A 4DV6F 1XTBA 2RJOA 3OE5A 2ZBFA 3TDKA 3ZWKA 4C6TB 3WWPA 2E9ZA 1P75A 1W581 5AXLA 4ETXA 2HPHA 4JUAA 5HMZA 3JAKA 4CNBA 1MVNA 1CJVB 3I76A 3LPDA 1M2OB 4HGNA 2AHOB 2AX0A 4BAUA 4WEQA 2JEOA 3QGGA 1Q7EA 2QTRA 3UKOA 2ZIFA 3K0BA 2QX6A 3B9BA 3MTJA 1THZA 4TROA 4EI2A 1OYWA 1QWSA 5KTYA 4PNHA 3VWSA 4UCQA 5HDQA 2F67A 2XQCA 1KNZA 1P39A 2R85A 3AKDA 1JKIA 4Y1GA 3KYIB 1CF4A 1LJ8A 4X6UA 4ENSA 1R6TA 5FNVF 1KIMA 5G02A 3DM2A 3OTIA 3RRBA 2J5XA 3SR0A 3EVDA 4I1RA 1VHLA 1ZRHA 2HB6A 3QMWA 4MSUA 4P10A 1IY0A 3RQSA 3ICPA 4UAJA 4ZAXA 2NLWA 1QE0A 4L6V3 4BKUA 3B54A 3MXTA 1CJKB 1UFWA 4ZV9A 1U31A 1NF3A 2FEOA 4O0LA 1WXHA 5H3CA 1G20B 3SJBA 3EH2A 3U44A 4E5KA 2ATIA 1JE1A 3DFUA 3EODA 5HBGA 2XGQA 2RQKA 3IBWA 5KJ6A 2RAUA 1VPDA 1BYUA 4RVHA 4JHXA 1DY3A 4XH9B 1R15A 1N7GA 3R5AA 3G7SA 3L4BC 4DABA 1X4HA 3PX6A 3K5OA 4PIVA 1U98A 2BXJA 4M49A 3QNUA 3P2KA 4E14A 1FNXH 4C0KA 3GGDA 1YJBA 2WW8A 3DV9A 3BHMA 4C4RA 2DCLA 4DV3J 2RDDA 3OM8A 1F9EB 2JCSA 4K6MA 4JUIA 4OV1A 4B2YA 4WNAA 1JLCB 2YC2C 3OT9A 2Z3WA 2JEIA 2EG2A 1VGYA 2FGKA 2UVVA 1K73T 2FF7A 2QA2A 3AB7A 3MRTA 3T19A 3KWMA 2N1BA 2F6RA 1E96A 2HC9A 3VAZA 2V9WA 2ZU6A 1KY2A 3HXQA 1NMEA 2PWYA 1GAEO 1SY7A 3U9TA 4BRWA 3WGTA 2EVWX 4BCCA 1JBEA 1OY8A 3HXLA 4GIBA 2QZJA 2RHCA 5DHQA 4ZAVA 1WEYA 3GEDA 4CM3A 3GLGE 2O5CA 5IS2A 2RHRA 5HATA 3BILA 5FBRB 5C8YB 2ROPA 1AG9A 1TQLA 3PNLA 3DM5A 3G2PA 4R2WA 3RBZA 4DR2J 1JA0A 5HJ2A 3BOSA 1GZ4A 5IUKC 3JQEA 2OXCA 2O1EA 1ULZA 1C29B 4H4MB 3QRPA 4H7IA 2PYZA 3MMCA 1SCQA 4PNPA 4HWKA 1DVRA 3SKXA 3QX9A 5HMWA 2IRUA 4XVHA 4UARA 3TCXB 2WA2A 3RFUA 1PVVA 3HNRA 1Q7YT 4LMPA 5B37A 2W2MA 1AM4D 5CEJA 5JVHQ 3CCZA 2ZSUA 1VIYA 1NDKA 3LY5A 5C31A 2GNAA 1Y3JA 4W1QA 4KJXA 4QA9A 5FLEX 4ED4A 1L5UA 3AO0B 4KBIA 2FPUA 4RAOA 1N2CA 5JLAA 5IF9A 4FVCA 3U48A 3LGNA 3FUXA 4ID5B 1LNSA 3HDGA 4CM4B 2BEWB 4C4XA 2HK6A 4DR4J 1PJQA 4W7SA 5ITSA 2FPPB 2NTYC 4JC5A 5DWVA 4IW3B 4TLDA 2Y27A 3ONFA 2DBZA 4Y2HA 3QFTA 5C25A 4C2MA 4EZEA 2JGDB 2YPZA 3S81A 1QH9A 4KXFB 4ZU6X 1P9LA 1BQMB 2UZ4A 4N18A 3QEMB 5TC4A 1U2EA 4UNSA 4ROSA 2PX5A 2JB9A 2E7WA 2VBGA 5GONF 3D6UA 1E69A 3RYFB 3WV5A 1SVMA 2IDMA 5H70A 4QIEA 2DGWA 3F98A 3WLJA 4IYQA 6NULA 3MTBA 3STWA 4YRGA 1CJKA 1TL7A 1YB4A 2B7LA 2UZ1A 1ZMOA 5BQ5A 1E62A 2J0QD 2NYRA 1T91A 3PL1A 5F5NA 2CNNB 3C8UA 4F8JA 3EVCA 5CDTA 4NHEA 5EJMA 4LF1A 2Z8XA 3EPKA 2O1SA 2HNZA 1TQDA 5A4KA 5C8VA 3ZIAA 4I50B 1Y6GA 2ZUSA 4OM7A 1D2HA 3ZE2B 5A9SB 3EGIA 2BANB 1DO2A 1AS2A 1UETA 2BACA 4V3BA 4MI9A 5BSTA 1RJ9B 3DXXA 4PHCA 4NK5A 2G88A 4WJBA 3O94A 4F50A 2QA4S 2HA0A 1U7PA 3PV0A 2PX0A 2WMYA 4LJRA 1QZTA 4QTUB 4N8NA 3FSRA 3FPEA 3DKRA 5K3DA 2I6QA 3O47A 4XDYA 1VIAA 1IQRA 1B8UA 3K8YA 1W2IA 5A8KB 2Z09A 4AY4A 4W9NC 3PW0A 2D0OB 3LMKA 1WTBA 1PL6A 4GMHA 1RA7A 2PA0A 4CDNA 3EWIA 4DV0J 4PLVA 1QV9A 4QLBA 1RWKA 4W1SA 3V8BA 2B8JA 5CCMA 4DQKA 4MKGA 3K7RA 4LK3A 1AUSL 5LMUJ 3VPHA 5KUTA 3AV3A 4KTVE 5HGXA 4H1UA 4F96A 1TNDA 4IINA 1YQ9A 3SXUB 2LKCA 4O8CA 3LVQE 2VQ6A 3OTEA 2C0CA 4NYIR 2PIIA 2R2UA 1K7CA 2AL7A 2TMYA 3EUWA 3U3KA 4B3CA 4QQBA 4AKTA 1UJ6A 1T0PA 3R3JA 3KBBA 1M1NB 4PEVA 4H3SA 4BE7B 3MCTA 3FIUA 4PQGA 1RYYA 2JLCA 1MNQA 1ZONA 1P1BA 5ED0A 3GNTA 1DTSA 3H98A 5AXAA 2LEPA 4E12A 1GQYA 4UUWA 2VAPA 4J7XA 3T54A 3W8FA 2F1JA 3HI9A 3I0SB 2GYWA 3IJRA 5FEMA 1YVEI 5J3JA 1N5TA 2NTJA 1O95A 4FQ8A 5IC4A 4Y67A 1GXTA 4K4YA 2P9YA 3AD9C 4FW8A 3EM1A 2DH9A 3G96A 5J47A 3BV8A 3EMBA 4LN1A 2A6OA 2VT7A 5TV2A 3Q89A 4QASA 2XNJA 1XK6A 2GFHA 3V6MA 3WKBA 1VR6A 1SULA 1X7ZA 3RBVA 5TXGA 1Z2PX 4CI9A 1DINA 1YBTA 4LS3A 3QK7A 3PEWA 3SLGA 3MWBA 3KLIB 4ZJYA 4CR8A 1WMBA 3LGAA 1OSCA 1QMGA 4F2SA 2ZT7A 3IQEA 3HCFA 3RG6A 1HE5A 1YR1A 1II9A 2FDCA 2CY0A 4G4IA 3EVBA 5BT9A 3K73O 4JJ8A 1RBMA 4XQ9A 1RU2A 3O4HA 3GRKA 2CZGA 2F1RA 1M2NA 3ZK9A 4XM0A 4JI5B 4KQ6A 1UVMA 1RZRA 2BISA 3ZE0B 1SK9A 2C4MA 1ZCBA 3RRHA 5AM5A 4XM1A 2DNNA 3RE1A 3F56A 5HK4A 4EH1A 2NO7A 3V6JA 4XJXA 1OXVA 1VMBA 3JQAA 1T5IA 4DSUA 4U9HS 3O4JA 4KIFA 4M99A 3V1UA 2YS7A 1SB6A 1V8ZA 1IHPA 1YR2A 2FRDA 1HZJA 4WA7A 4JYAB 3C14B 1RXOB 3KS9A 4PZUA 4Z1MD 4KGVB 3DFEA 3B53X 4GLJA 1ULRA 3JTOA 1NJ1A 1RYDA 4L16A 4RFVA 3TDMA 4Z1OA 4YXFA 1YONA 2N3LA 3I87A 1KZYC 4C6HA 2QBYB 2C2KA 2ZTMA 4B4WA 4PZ0A 1ZR2A 2OV8A 1H4VB 1V37A 4CLDA 5TR9A 3BZUA 3S5UA 3NIBA 4A10A 4YJDA 1PC5A 1JR3D 4KACA 2J8AA 4H3KB 1EBFA 2IVMA 4CIYA 5CNKA 2FZEA 4OXRA 1M33A 2ZI3A 1VGQA 4PLHA 4P3KA 2HL6A 2EF0A 2Q0HA 5C35A 3N6MA 4EPXA 5IULC 3UJHA 5EJ6A 3C74A 3TPZA 1KQOA 4NZMA 3OH8A 1JLAA 2OV4A 2CLIB 4KAIA 4RZUA 4P22A 5EIOA 3UE2A 3CZRA 5EX3A 4RA9A 2XCTB 3HY4A 3E18A 2FG6C 4KY3A 4UBNA 1QE3A 1TZJA 4FYWA 3S29A 1U2FA 4YB6A 3NWEA 3JQ9C 1GT6A 5E6SB 3RC7A 4BLWA 1RLUA 1OQ3A 1FRFS 1XZFA 1Y8QA 4WX2B 1BNCA 4J9QA 3P9KA 3HXTA 1UAAA 2QPTA 1YVRA 2ZRGA 3DI6B 3QJJA 4YFUA 1E6UA 1SXJC 3VM6A 1LJLA 3PF9A 5KWIA 4P54A 3WIDA 4OXYA 4FK8A 5AKEA 1EIWA 1Z4QA 4II7A 3ZD6A 2PO5A 3ZGZA 2R8HA 3KFLA 1SIWA 1EX9A 3OCUA 2XNDD 3BGFA 3N8KA 1RC0A 4NZZA 1P2DA 1IR1A 5F5LA 2JDID 5TVGA 1B8VA 2R6R1 3FVTA 4LQ9A 4UZBA 1Q74A 2BDEA 5HM8A 4ONEA 1RJ9A 5DG8A 3X1WA 4KR9A 1OFTA 1JLLB 4HVZA 1N36F 2VT2A 4DLRA 3E8OA 4HLQB 1H2FA 4BPRA 4WFQA 5D2CA 2A57A 2XXBA 1UMDA 3IQFA 5GV7A 5JUMA 3ZKWA 5HGJA 3D5QA 1HWYA 4HQFA 2OGSA 4PQUA 4G5QA 4DJAA 2ISQA 4KW7A 4L74A 1VISA 3BH7B 4XFDA 3VC1A 3A3NB 1NVDA 4HWOA 2W2NP 3DMHA 3Q12A 3EPIA 4DZRA 3CRVA 2JEJA 2ASVA 3O0TA 4DG9A 3T1HJ 5FOWA 1TQ4A 5BSUA 1MQ8B 2P5TB 4N65A 2M2IA 1MHPA 1YDWA 1RWBA 2ILVA 3QFCA 1E6YA 4HDKB 1WO8A 4YV7A 2WJGA 2OI2A 1GZ3A 3KZCA 2NXWA 3S7ZA 1AHIA 4OMCA 2QR5A 2CF5A 4U6NA 5JAHA 1U7LA 2O8FB 5HW0A 2VKQA 1M8KA 3HSSA 2FB9A 4DA8A 1KSJA 1WSRA 4Y2UA 4TLLB 1EE1A 3IDZA 3QKIA 2Z4TA 1D4OA 2IZ6A 1JLEB 1JSZA 4IYRA 1NMYA 1AD2A 3EBPA 2RC5A 1HQCA 2AMYA 3KJNB 2Q3DA 4HDQB 3AHCA 1IOVA 5D6GA 2VDPB 2RGNA 1KZ1A 5FWXA 1CFZA 2PAAA 4FWBA 1T3HA 3HUTA 4EVQA 2PHZA 4RSGA 1G17A 2EIHA 2VYFA 4YHHJ 3PEEA 1R50A 5DRTA 3E9CA 1CDOA 2Y3IA 3KLIA 3NONA 4B34A 3QLVC 1A7GE 3DBLB 3QPVA 3HWX1 2R1UA 2C00A 3BGRA 3BO4A 4WNYA 4H4MA 1D8ZA 1HH4A 5K8TA 2VCYA 1V11B 2X5XA 2V4QA 1R8XA 5LXTA 4G6ZA 5HSPA 4E11A 3G8SA 3KVRA 4E8UA 5GONA 4ILKA 5FORA 3M8KA 2MMCA 4BFYA 4CIWA 4FHDA 3UMYA 1GSAA 2ZBRA 2R8PA 4ZI7F 3Q9NA 4DFMA 1FFDA 1DRUA 4F4ZA 3RJMB 3STHA 3GGSA 2BH2A 3NKLA 4RD2A 3KUGA 2FPWA 4TWIA 4D2IA 1C0TB 4DMFA 5CB8A 4V24A 5ADUS 2VG5A 4DCCA 2Y1FA 3U0VA 3IOMA 1CV2A 2HA3A 2QD1A 4YJFB 3NWOA 4NEQA 2C9OA 2Q4RA 2BE2B 4Q43A 3SFTA 3T9DA 2AS0A 3BHJA 1HQYE 3ZCVA 5FLXA 3DCNA 3I42A 3ULKA 4EUSA 5DCLA 3ACCA 3DXZA 3TB6A 4Q93A 2WPDD 1B7YB 5HLFB 3IE2A 3KKZA 2HBQB 3DMPA 4QREA 1CC8A 1SV5A 2FP4B 2I80A 2G40A 2NUTB 2D1QA 2E5LB 1M7BA 1EAMA 3V8QA 3QEKA 1E6EA 3HJRA 3JASB 2RGDA 3EC7A 2KM1A 3E2EA 3TLXA 4MIAA 4UUMA 1L5HB 2OJ3A 4G8CA 2YVQA 2ZIZA 3EOBI 3CSSA 2ZM5A 1IBCB 4NAUA 1XN9A 4CMAA 2JFDA 1C0LA 3QA3E 3WHIA 3MI7X 5IT9U 2GERA 3U44B 1GUYA 3KXLA 3QIPB 4BLQA 2RARA 4C5BA 2HNYA 1HL7A 2BFDB 4I68A 4NI2B 1DRVA 2JJ1A 1OIAA 3LFHA 2C9DA 2BQRA 3NT5A 1Y0BA 3IR5B 1S49A 4DX6A 1BEZA 4KNWA 3H16A 1PLJA 4FGUA 4TT3D 5AT1A 5CEFA 3FFIB 2W9XA 1L8XA 4HDSB 1WKKA 1GU7A 2WSFC 3EVTA 3TK1A 1MEEA 3CCJS 1RBAA 1FLDA 4KDFA 2FHJD 1AQNA 1YI0A 3TQIA 3DKIA 3VVLA 1SU4A 4TKVB 5D4NA 2G2ZA 1RWXB 4AQ7A 4OLFA 1SD1A 4NEGA 4U02A 4HX5A 2XKJE 3CW2C 4OQYA 1CRZA 4WCFB 3NBKA 4QUEA 2BW7A 1WXIA 1XQWA 3DULA 4PFJA 1G6OA 2QENA 3PDHA 2FVCA 3KJXA 1XCGB 3RYLA 5MF6A 4TVOA 3P2MA 4YJ2A 1P60A 4AZ0A 1F8YA 4CM2A 4DMUB 5AI6A 2J5BA 4ELUA 2E4UA 3KSBC 1XP8A 1MWYA 5CYMB 4A8JB 4ZI7B 3NCTA 5FEUA 4H4DA 3FHJA 1SXJB 4G5SA 4CI0B 1BVRA 1RBQA 5DQHA 5K8NA 2ZXFA 2W6OA 4TL7A 1Z33A 5GOZA 3EAQA 4DNQA 3AIOA 3Q2IA 4EFAC 3QG1A 3WNBA 3UAYA 1GAWA 4RU9A 2DPXA 2ZKTA 1R6XA 2F4VF 4A5SA 1S6QB 1HBUB 4TS1A 5L3VA 1B26A 5IM0A 1C1DB 1J5EB 1XQYA 4RD0A 4QXOA 4Q6WA 3R3VA 3LDUA 1LRJA 5BWCA 2BZ0A 4O4RA 4G1MB 4MKAA 1NVUQ 2X8JB 3LT0A 3UB4A 2ON6A 4XARA 3FX2A 2HQCA 5LQNA 2OE2A 2AQ4A 2EEYA 4ZDKA 2ZC3A 4DY6A 3GH3A 2RKBA 5JATA 2KW5A 4B6SA 4RE6A 3LP1B 3FDFA 1P62B 3QG5A 4YLEA 3O31A 4DL9A 1CLFA 2OM2A 3ETOA 3KAKA 5SZJA 2W2XA 3HDVA 1NDLA 1P1RA 2B83A 4FYYB 3QWUA 5I01A 3I8OA 2FQXA 3E35A 2Z4SA 4KWTA 4B35A 5FXMA 5BWOA 4KQXA 2CPYA 1TO6A 5KX5B 2OR3A 5AUQA 1SUPA 4OXXA 2JHAA 3ZTYA 2Y05A 2DT8A 1TZ0A 3HLKA 5FR1A 3EXHC 1KP3A 3RS3A 4F6RA 4M0EA 4EK9A 3JQPA 3HL4A 3C1TA 2EBWA 2C57A 4NPOA 4JLUA 1STOA 2ZIXA 1B43A 4S3MA 1J8VA 2PX4A 3DB2A 5A8WA 4IUCS 4B81A 5T64A 2VTEA 2WUDA 4AYTA 4KH0B 1A5SB 4NICA 3ASZA 3SFGA 1VCHA 3SX0A 3DOLA 3UD5A 1VDMA 4W8OA 4BIIA 2ZAYA 3G82B 3FFAA 3G2OA 2WAMA 5KTRA 1LI4A 2ZR8A 4TQUS 1OO0B 4BB0A 3PHEA 2WJJA 4JYBA 3BSFA 3UR3C 1UCFA 3A7EA 2PUAA 3L0OA 5B1HA 5LMZA 4W5RA 3USZA 3ZLVA 4DBVO 1RBZA 3D5EA 2W7AA 1E3QA 4PLWA 1KVQA 3E53A 1ZCAA 4ED8A 2AOUB 5CD4H 1ODFA 3WLNA 3QU5A 2FFRA 1BWSA 2PANA 3R6LA 4BLGA 4OIMA 4LXGA 4NAHA 5KSYA 4GM0A 1XVUA 2HQBA 1U02A 1IEWA 5L1IA 4MW6A 3WK4A 1VPWA 3DYAA 3ENQA 1UT5A 5TQVA 3VGUA 3I62A 3NIDB 2EW2A 2RGXA 5JAMA 5HQ3A 1Z4MA 3NNHA 3Q7QA 3T8YA 5KOWA 2P2YA 1QGUA 3KKFA 1N32F 2GTPA 4HXEB 3CX4A 5AUOB 4HKTA 2C2EA 3TSYA 1ORIA 4ZI5A 3W60A 1XHLA 3O9ZA 1YR3A 3F9IA 1RI2A 3F90A 4JBWA 1RYFA 1JYSA 4UU8A 1E0DA 3BQ9A 2QAGB 4I1OA 2OPQB 4BC0A 2OSQA 4EQ6A 1ZMXA 2I9SA 4JBCA 2DSTA 4FEGA 3RAFC 1Z6YA 3OZUA 3IRXB 4Z7QB 1B76A 1Z63A 4ATNA 1KONA 1OI3A 2BEUA 3AUSA 1DG3A 1S72S 4AZVA 1DX4A 2LCIA 4B9MA 1QNFA 2SCUA 5IJ9A 5JCOA 1O1YA 1FXSA 1X19A 4MH8A 4LY9A 3IBFA 3G2MA 3GU3A 4GKJF 1NVFA 3DZGA 4HYQA 1FZTA 1OJLA 1MLDA 4ZO7A 3SQGB 1V96A 4M0CA 1R0SA 1QLWA 3GFYA 4G0OA 4QDKA 2DVMA 1R8BA 3SCZA 4CHGA 4GVBA 2DNPA 4D8TA 5G0RA 1VBXA 2RAPA 4JT8A 1N8KA 5AIAA 3GVPA 3TZ6A 2CCKA 4C8ZA 4LRWA 5GV8A 3VTKA 5I9MA 3QA9A 1ESDA 3GQBB 3GQVA 4K9OA 1ZCZA 3IMFA 3PDNA 2FDRA 2HPAA 1EK6A 1RJGA 4UOGA 3JD4A 3E7XA 2V7WA 4DA4A 4U1RA 4DSNA 3AI7A 2R97A 1DAXA 4OZ5A 3IUPA 1GX5A 3OTDA 3ZBPA 1MBZA 1JXQA 2IELA 3KJFA 1PS0A 2V0GA 3KDAA 5THXA 3BN4A 1GZDA 3R77A 2BE9A 3GPBA 1B00A 3EIUA 3NFYA 5CT5A 3T1HF 4NS1A 2X3GA 3LFTA 4KLCA 4MJ7A 1R0AB 4Y30A 2BFFB 2UYHA 2PMHA 2ZDHA 3UMCA 2VDIA 1FJEB 5A9TA 3KBOA 2HBRB 3SEZA 2NO4A 1OREA 4PAQA 2BWJA 2V7TA 3QKTA 4LQ3A 3R7BB 1SUBA 2F3SA 4UW2A 2NQTA 3O8OB 3LK7A 2QO3A 4ZEWA 2CL6X 1NJ8A 2AZDA 2PSFA 3AVWA 2QL7B 2NXCA 4CH7A 2C2ZB 1KO4A 4QPCA 3TRIA 4HEQA 4RNHA 3HQ4O 2J3HA 1SHUX 1WC4A 3X1KA 2OQVA 2VHQA 1CUUA 4Q9IA 3F3YA 1RTHB 4DA9A 4UTGA 1W7WA 3AF5A 5KKAA 3R6GA 3HJAA 3GN1A 5M34A 3EOZA 3Q8QB 2HFZA 4M1TA 1IJKA 3L9XA 1NZAA 3C87A 4Q7AA 1VLQA 5LUBA 2OYSA 5I7VA 1FXLA 3IQZA 4RXMA 3SLRA 1ABFA 4ZANA 1EA5A 4MR8B 3FR7A 3UJ6A 3F5QA 4E2FB 3TAMA 4BKOA 1E0AA 2QW1A 4TN1A 1NPDA 3DP7A 2C04A 1GA4A 4MV9A 3NRCA 2E49A 1PKUA 2PUFA 3WB1A 4D26A 3IRUA 4G1PA 2XO6A 3BHNA 4A7PA 2JAOA 3DOHA 4JNCA 5MN4A 2QL9A 5E95A 1IZ9A 2C1EB 4LYAA 3VU9B 4ND6A 1P8GA 5FLXY 4UNQA 4M86A 2NZXA 4YALA 4RBVA 5AICA 5IHXA 1TMJA 2K6GA 5KFAA 4IQMA 2QTLA 4IGKA 2ICAA 3ZU6A 1Y7TA 3M1VA 2OV1A 1U80A 6CHYA 4R16A 1JKHB 4RZSA 4JLMA 5EJFA 2H4WB 2FX5A 2GJAA 1RJEA 3PW4A 4ML3A 1J21A 1JQBA 2WPDA 2G3YA 1XJCA 3OE7A 1N6PA 3CUVA 3Q83A 4FF2A 1C30A 1T05A 1MVLA 4EGQA 2QZ9A 3FYUB 3VC2A 3MCSA 7ABPA 2RKIA 1BU5A 4BHTA 4OX6A 4B3TB 4PSDA 3EXEB 2P90A 1VHJA 4BWYA 1P9WA 3FB1A 1RRMA 3DMNA 3AB3A 3EZLA 1RAAB 2PT9A 1NW7A 3AESB 2Q1XA 3IQIX 3CEMA 3G5TA 4UHBA 1JALA 4Q66C 2ZRKA 3K1TA 1OMSA 1T24A 1EFAA 4NL4H 1CJUA 1NAQA 3JR3A 4GX2A 4W98A 1AKWA 4B2LA 1YQHA 2P9EA 1Y8AA 3UA3A 1H7WA 1HI0P 3TRDA 4ZIVA 2QDKA 2X6QA 1U9ZA 3SHTA 3ZTPA 4QOIA 4D9IA 3LTOA 1OZHA 4YB8A 1DIAA 1FXWF 1L4YA 1ZK4A 4HVLA 4CM6A 1VSVA 1K6IA 2ZHAA 3DGPB 5B1DA 5LOQA 2J0EA 2GK4A 2GQCA 5T4HA 3WLPA 4YJGA 2K2WA 3IAAA 5GADI 3R7DA 4ARZA 2LFVA 3O74A 3HJFA 1JHUA 5JIBA 1ULTA 3T99A 1CDZA 3QM1A 3PQ4A 2HQFA 1AB5A 5HMYA 2IYAA 2VUSA 2QX4A 3HZOA 4JC4A 3GOQA 1DO0A 3L0IB 2GZ1A 1FRMA 1NFFA 2MZ1A 3HHEA 4ECTA 4YRMA 3MGBA 3UYKA 2BY4A 3LPCA 1CR0A 2CA9A 2DQYA 4J3FA 5JXJA 3L0ZA 3MEKA 3D67A 1QG0A 1CPZA 1NC1A 2W42A 3FKSA 3FCHA 2JLWA 1JG3A 1VLVA 5I9IA 4DUTA 2JX2A 1E3WB 1UKCA 2WRZA 3K9WA 3QQ5A 4JJEA 4K6OA 2X6TA 3US5A 5KNBA 2Z1MA 4E3ZA 4Z0NA 3K6KA 1O6ZA 1PQYA 1RK8A 2EP7A 1Q11A 4Q3DA 4GECA 5L46A 1PK8A 1E6KA 3W5ZA 3VISA 3ME5A 4HDGA 4NV1A 1E5TA 2PQ2A 4E09A 4X3OA 4DL4A 2R7WA 2XTJA 3ETHA 1X70A 1WF0A 4X66J 3DYVA 2J9DA 1CZLA 4UY8T 3A1YG 2VJUA 2PEZA 4KPCA 5DYTA 2ZXUA 3JCZA 4C0WA 1SIZA 3O4VA 3ISNC 2GOYA 4M0DA 1GM5A 1CSJA 2HRZA 2NUUG 1R8AA 1PR9A 1PFYA 3FZEA 2NYHA 4NG4A 3NMUF 5LXRA 4HDMB 3EIOA 4KX3A 1YOBA 2V7QA 4F5ZA 2I34A 2AK3A 5C80A 3HY6A 1GSHA 1R2QA 4ZT2A 2IKSA 2EFVA 3GHHA 1D2GA 1IUJA 2ZGVA 1W1UA 5HF6A 1M5PC 4O3SA 3BH6B 4R0JA 1MT0A 1TA4A 3N0TA 2EG1A 3M33A 1I2ZA 3BMQB 4RA6B 3UCGA 5JQWA 3B2NA 4MKYA 1OWNA 3QY0A 4L5IA 1SWVA 2WVEA 4K1LA 1QFSA 3E3XA 4O1HA 2Z6UA 5AI0A 4N54A 2VH5R 1HEYA 4QJIA 3JRNA 5HJEA 4YAFA 4LGVA 4D42A 4Q9JA 3BRQA 4F5DA 3IOCA 4OBXA 2JAUA 2LIVA 2VWQA 2R0QC 3L6OO 2DQKA 3HWWA 2OH2A 5BV2P 3UM9A 1K0VA 5CA0A 2R4TA 4OOFA 3MMAB 2H7XA 2QVXX 3DDCA 4BWFB 4ZEMA 1XCLA 3C39A 2ZFUA 4QUJA 1FBNA 1HG0A 4L4RA 3IKTA 2PL3A 4RLFA 5FDLB 2A67A 5FTNA 1Y63A 2V50A 2R4QA 4LDNA 2P77A 3IHLA 1F6TA 3MMSA 4KVAA 1GPJA 3E84A 1R6BX 4C01A 1YBHA 3JQ9A 2O1XA 4L51A 3IT0A 4PFQA 2H17A 2NZYA 4RE5A 3SSMA 2I1WA 1DLIA 1M1NA 4J49A 2PWAA 4Y6OA 1N8SA 2YINC 4OVKA 1UKEA 3PUIA 3K5WA 4B02A 3K5HA 1NBHA 1RYMA 4BLTA 4M88A 3TR5A 1XVVA 1X8JA 1JBKA 1U09A 4V0ME 5HZKA 3WYBA 3VDNB 3G2QA 4R5MA 2DNRA 2FLKA 4IR7A 5JWOA 3J7AC 2O59A 2VL7A 4UTVA 1N5SA 3TM5A 2QVYX 2OO5C 2W5UA 2DEJA 1ACJA 3ORHA 1IM2A 4E1BA 4GR5A 1HWJA 1M2VB 3K8QA 2VG8A 1WX1A 2Q3HA 5B53A 3P6YC 1AA6A 3QELA 1L5SA 4GI3A 1Y9EA 2GS8A 4UOFA 2ZRMA 5IANA 3CLTC 4FXVA 4K05A 4NA3A 3L82B 3ICCA 4L4ZA 1A2OA 3M1AA 3BREA 4FBGA 4PZ9A 3P0IA 4D9EA 4O4JF 1MMFB 1FP6A 3GA7A 1MJGA 2FF5A 1BQNA 4PYQA 2K87A </