2F8MA

Ribose 5-phosphate isomerase from plasmodium falciparum
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
237
structure length
237
Chain Sequence
HHHHMDSLKKIVAYKAVDEYVQSNMTIGLGTGSTVFYVLERIDNLLKSGKLKDVVCIPTSIDTELKARKLGIPLTTLEKHSNIDITIDGTDEIDLNLNLIKGRGGALVREKLVASSSSLLIIIGDESKLCTNGLGMTGAVPIEILTFGYEKIIENLLKIYTLKGCTYKIRKRNGEIFITDNKNYIVDFFFTEPIQDLLETCTRIKMTTGVVDHGIFVNMTNVALISKHDGTVLTLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ribose 5-phosphate isomerase from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords ribose 5-phosphate isomerase
total genus 77
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f8mA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f8mA01
3OFGA 5HJ5A 2PC6A 1YGYA 4L4ZA 2PA3A 4L51A 3LHIA 4OQPA 3OFEA 1FS6A 2QMWA 4L4YA 3N0VA 2ZHOA 1PBTA 3KWMA 2JHEA 3NRBA 2RI1A 3MWBA 2R5FA 1FRZA 4TM8A 2QMXA 2DTJA 3DC2A 3L7OA 3ENQA 1NE7A 2O0MA 3IBWA 3LWDA 3TUZC 1UJ5A 4R7TA 2LVWA 1FSFA 1HOTA 2H9ZA 2BKXA 3BXEA 3EFBA 4R9NA 5T41A 3NWPA 3OFFA 1YBAA 3K5PA 3EB9A 2OKGA 2QRRA 3KV1A 1CD5A 2LQJA 1HORA 4L5JA 1O8BA 3AAWB 3HHEA 3OC6A 1RWUA 3BXHA 3MAHA 3MTJA 3HN6A 4OQQA 2NYIA 2F8MA 3IXQA 3S1TA 2RQKA 4GO7X 2P9GA 3OBIA 2BKVA 4NMLA 5IT4A 1SC6A 4M8LA 1U8SA 3DDNA 3AB4B 2J0XA 3ENWA 1KS2A 1UJ6A 3U7JA 3UW1A 2RQMA 1PSDA 3ICOA 1JT9A 4LUBA 4L50A 3DHWC 5FIIA 2W48A 4L5IA 3BXFA 1LK5A 3E7FA 4GO5X 4PWUA 1FQOA 2P9EA 3AB2B 5IS2A 5IT0A 5JJBA 1LKZA 1Y7PA 2I9SA 3OFHA 1UJ4A 3TUIC 3O1LA 1ZPVA 2CDQA 2KO1A 2WU1A 4GO1A 1XTZA 2JOQA 3P96A 2DT9A 3LOUA 3TUJC 1M0SA 2F1FA 3E15A 3LUYA 1Y89A 2MDAA 4TM7A 4IO1A 2RI0A 2QSWA 2RE1A 4GMKA 3W7BA 3BXGA 3DHXA 2J0EA 1DEAA 3CEDA 3ENVA 4X84A 2GNPA 3TX2A 1LK7A 2J0WA 2P9CA 3NZEA 1VL1A 2FGCA 3CSSA 1FS5A 3CH7A
chains in the Genus database with same CATH superfamily
3NEYA 2P35A 4ZZ0A 3WB1A 1AGNA 1L7BA 3KQMA 3HN7A 1TGVA 4B48A 2G0NA 4DG5A 2Z98A 3D43A 1S72S 3GTYX 2ZQ5A 1ATIA 3D0QA 4Q1CA 2QPLA 1TL7B 2X5NA 4B6EA 2A9OA 3KG4A 3LUHA 2TECE 5JD6A 5LOVB 3TZQA 3I0SA 4MUKA 1SPXA 2YPZA 3IVRA 1KQ3A 1T9DA 4ZVSB 2HF2A 2GM9A 3IBFA 1XZIA 2J6TA 1NJ1A 1TV6B 3RBEA 3IEIA 5B08A 1HR0J 1U7PA 1PCXA 2VJLA 1VE7A 1KJWA 3FM9A 1ZIXA 1SKQA 4EHAA 2BM1A 2J9ZB 4B44A 3C7KA 4WP9A 4I4BA 2EIHA 4MX8A 4BLQA 1ODJA 2Z2ZA 5AKYA 2Z9DA 1IU9A 4B3JA 2OCBA 1XTZA 5CDHA 5EWLA 4TSFA 1YBHA 2ZBGA 4L28A 2OHVA 4ARAA 3IEMA 3H9CA 4AJPA 1XCMA 2YNGB 2C5AA 1GAXA 1ZCBA 4BWMA 1K92A 5D0HA 3R41A 2BEJA 1Z38A 2HBRA 1RFLA 3CSSA 3G2JA 2PZJA 3N5FA 1HYQA 4AMBA 1C3EA 4CMBA 2JFXA 1MEEA 4OMFG 1S6PB 2C4WA 3HV2A 1T03B 1FFXA 1RR6A 5CA1B 1KHTA 1S8OA 3E4DA 2NVOA 1N8RT 1NVMB 1GAJA 4I50A 3T35A 1JQJC 4AFNA 1QTQA 4L5JA 2GHRA 2XBMA 1QYCA 3OX1A 2FPSA 5DRTA 1KI7A 5J5AA 3I6BA 4JSTA 3W2WB 1C0KA 4X4OA 4URSA 3UXEA 2VTDA 4MQEB 3LCMA 4OBWA 2X76A 2DHXA 5F8HA 1H5QA 4Z7JA 5FR2A 1HKHA 1FNXH 2PM8A 2NCKL 1Z4IA 2QBYB 4JUDX 2IUFA 3NHBA 1R0YA 5GJBA 4U2BA 2XMDA 2J07A 2WVFA 3P71T 1C4KA 2I8AA 3O90A 1NNEA 1GXLA 2IPMA 4CR6A 4N12A 1XELA 5ALOA 1MO2A 3JAMA 4I5EA 2X1VA 2X40A 1TFUA 3HSGA 2J9XB 1LXCA 1VRQC 4PCAA 3MCOA 4DZTA 3PTLA 2CJ9A 1UC5B 2QMXA 4XGQA 2VNIA 5AR1A 3VR6D 2I2AA 3HN2A 5JCXA 2I6XA 1IY0A 3DYAB 2WI8A 3P9IA 4LZZA 4FLMA 1E7RA 2YNGA 3HXKA 4UDXX 4GQBA 1V5IB 3GFHA 3VJRA 1H0KA 1UPUA 2IYWA 3U4CA 4B3GA 1WCIB 4N7TA 4DAOA 4FKZA 1VQYA 4K9SA 3ESDA 1T03A 3MELA 1R1DA 1X8KA 2Y2VA 4GPTA 1V45E 4MB6A 2G9RA 4ED7A 1V26A 4GYWA 3NT4A 5KZMB 4FVCA 3SHVA 4KV8A 1JDJA 1TLFA 4HUQB 4RVGA 3QUBA 2V4JB 2HVZA 1G20B 4XFJA 4PYKA 4Y30A 2FEXA 2Q29A 3C6XA 2B1GA 1RXYA 4UXJA 1P8AA 2PJRA 3AU8A 3DLKA 1XJ5A 2EEPA 1ENPA 4FEEA 4A23A 2FN9A 1U8FO 3LP5A 2KB0A 2M8HA 4BNDA 1QAOA 1KRXA 1TMOA 1MU0A 4F02A 2HA6A 4YAEA 4K4VA 1JRLA 4HOYA 3UUEA 3MAHA 4HEHA 3CX7A 3WLAA 2DC1A 1JEDA 2EK1A 4KOAA 2B51A 5BV7A 5A8RA 3K9BA 3HXOA 1LSJA 3EXCX 4RY9A 4OJKA 5BNTA 3OTGA 4Q7MB 2QTLA 4WSOA 2NAPA 2UUBJ 4C4PA 2O5EA 3KT6A 4IAOA 5LP6A 1CUCA 3EISA 2Q2WA 1T94A 1G42A 1Z63A 3ET6B 3BWDD 2GAAA 4FX5A 1F8FA 1ICEB 3A31A 4P5PA 1XL0A 2RDJA 3G2OA 4FI3F 3ZTPA 4TYPA 1WU7A 3F2IA 4ZCIA 4EB6A 5ILGA 5FQNA 3I92A 5IDQA 4YJ2B 1GQOA 4OHUA 3G6YA 4NFSA 4X20B 2BE9B 4BYGA 3TMAA 3JQPA 3JAMU 1K8YB 4K0RA 1FXLA 4PYLA 1R37A 4LE1A 4WKNA 5HRAA 3MTEA 3I5CA 2Q4BA 2GBFA 4J9VA 2BI7A 1U1DA 2IUTA 3K30A 3MAAC 4CLXA 2C7BA 2WIBA 3K5HA 1M7HA 3RTEA 2OD9A 4GI5A 1YZ3A 1D6SA 1SVLA 3UJAA 1CFZA 3GP5A 2QMYA 2QPOA 3GU0A 1SHKA 4JOSA 2OLEA 1CU1A 1YWXA 2J7PA 2OPRB 3I9V6 3MSXA 3TIIA 3KSDO 4LOKA 1X7XB 3HDHA 3T9DA 1GMWD 3C8HA 5ANRB 1F0NA 4K5SA 4KWIA 1MSWD 2XMAA 3K5IA 5CIQA 2J87A 2RJ3A 4DLSA 5AT1B 3IC5A 3QE4A 3RVPA 5F35A 3I04A 1JA9A 3OFHA 3N8NA 2ID4A 3DOIA 3TIXB 4K26A 1N34F 4LCEA 4AI6A 1Z3CA 3M49A 3THOA 3DMTC 5DASA 1QOPB 2G70A 4R5HA 2FJWA 2Q6OA 3EZUA 3OQHA 4C87A 4ICLA 3N3BC 3MWEA 4Q66C 5AOAA 1I30A 1XQXA 4DR1J 3RVQA 1QFJA 3RTCA 3E1KA 4LF5F 5NLLA 5B7NA 1DOAA 5D00A 4ZVVA 3VSEA 2ZSJA 4FC6A 2DECA 2OK7A 4NOKA 1UC8A 4W63A 1U8YA 3E9ZA 3M8QB 1TK5A 2F3JA 3BSAA 1Q20A 2XOEA 5CVJA 2QTGA 2QG9B 5B6IA 3EEBA 1FTNA 1Z82A 1EB0A 3EWAA 4ZKAA 2R2GA 9LDTA 1SJ3P 3H2BA 3SSQA 1YQUA 3JAKB 2Y1FA 3OJWA 4DOZA 4AJNA 3R4VA 3R6TA 5JMOA 3N0WA 3GFXA 1LLFA 1Z4UA 1A88A 3B6MA 3KDAA 2FOLA 1W76A 4DC9A 2KI2A 3CQ9A 3GPCA 4R40A 4Y2SA 5SZKB 3J80A 2D69A 1O5OA 3UT5A 3MTQA 3VHXB 1QH9A 2ETVA 2HQRA 1TMGE 3WZLA 4TKVA 4CLOB 1LFAA 3RAMA 5FPHA 5CLHA 5HRUA 1HNXJ 2C9CA 1WSAA 2X5OA 5HF6A 2X7IA 1OLXA 3UXYA 4OJGA 4MIOA 1YI2S 3VTAA 4UAGA 4YR2A 5DV9A 1REVA 3G13A 4DUZJ 1WTFA 2UXBF 4WOCA 4UFOA 3L3CA 4IFYA 5CPFA 3I64A 3CDUA 5TQVA 1FJGJ 5KWIA 3OC6A 3GN1A 1XX6A 4QOHA 1SCNE 2AX4A 2YNHA 4NLDA 3S1TA 3NHRA 1BYIA 1C0EA 4Q00A 1N2CE 4L6AA 4C0LA 4WCFB 1RS0A 5L7TA 3PQ6A 3ORFA 2ZSDA 3RG6A 2IRUA 1ZLXA 3ORRA 3PUHA 1GRNA 1LW7A 2WFZA 4FBLA 5JJBA 4Q93A 4F2GA 4CH7A 2EG1A 4QNRA 5KT2A 1U4BA 2VT7A 3HI6A 3KUXA 4R84A 4HRVA 3IDQA 2EERA 3B12A 4K2HA 1KAQA 2ZB8A 4QHTA 3MECB 1FP4B 3DE0X 4NL4H 1ZVMA 2BJEA 1IN4A 3PJEA 4LSLB 1WUUA 2MSLA 2DM6A 2FLKA 4EJSB 3ECCA 1GZSA 2O2CA 3C7AA 1G8HA 3FMGA 4WLEA 2EKZA 2QF7A 1FVFA 2CNDA 3WQRA 4ZVUA 4WJLA 4LTNA 3WWZA 2FK8A 2GIFA 3CD6S 2F8LA 4JR1A 1NP7A 8ATCA 3SU8A 3UN5A 3EVCA 2ADFA 2BX6A 3BICA 1SCAA 4RHYA 4DZ6A 2CMHA 1PBUA 2C0QA 5L4SA 4MQMA 1X0XA 3G0DA 3DEJA 3E0QA 2CBGA 5CDGA 1EA7A 1SBQA 1DJ0A 1NO8A 3PR1A 2QRKA 1OLXB 4RPKA 3EEYA 1JDZA 1U63A 1ZJ6A 1OY9A 4ADSG 4D8VA 3IR6B 3BJYA 1YMQA 2IIQA 3FEYB 2G6BA 3QJPA 3DPSA 2DKNA 4C2MA 1NUSA 5G4KB 3ACCA 2G36A 3KNAA 2VSOA 2C94A 3O1IC 1RAHB 3RYIA 5GADI 4N6GA 3KDSE 3PNMA 2WJVA 2ZHBA 1KY2A 1RW4A 3L6DA 4D79A 4Y1RB 2VDIA 2MIIA 3S2ZA 2L9NA 2AR7A 3HK2A 1EG2A 5FWXA 2RGDA 1KLNA 1D1UA 1OAOC 4HNSA 4LOLA 2FEPA 2ZUUA 1P4AA 5CDFA 2O7VA 3PHJA 1A9SA 1D0VA 1Y6FA 4NFYA 4EYKA 3K5LA 3DKDA 4RNNA 1NUEA 4A8HA 2CNNA 4K2JA 1RWUA 1W88A 1E9BA 4YDQA 3DFZA 6PFKA 1TMJA 2H17A 5JNWA 4DWVA 5LSRA 4FYXB 2ZSHA 2A8YA 3VNAA 4NQZA 1I24A 2O23A 1H8EA 2ZT6A 4AO7A 3W78A 4FLFA 4YQEA 3P4XA 1AK9A 1B0UA 1S1VB 1XVUA 4EF6A 4ZHQF 4ZODA 4O2LA 1P0QA 1UAAA 4O63O 2HSJA 1Q0PA 4ABTA 4X54A 4DSLA 4JI7J 3AY0A 2J6SA 4MAMA 1RJGA 4CQ1A 1K75A 4J9PA 3WDKA 1HEYA 2R79A 3SYLA 4BFXA 4LCJA 4LRTB 4RW6B 4ER8A 1L1EA 1HO3A 2OT3B 5EUCA 5EJMA 1IQPA 1FFCA 1UWKA 4FFRA 3BCRA 1MENA 1Z5WA 2O66A 1P6XA 2AXQA 3IBWA 4LHVA 4EJMA 1NXVA 2FPGB 5AUNB 2RHOA 3HYSA 2AWOA 4FI3C 2Z2YB 1C1BA 3YASA 3UC5A 1THMA 3AIKA 1NQVA 4HWGA 2JLXA 4EJ6A 1VK3A 4DJEC 4NVRA 2WIAA 3LCRA 4ILRA 3VKWA 1A04A 3VYRB 1E66A 1ZL2A 1VOMA 4GO5X 1S57A 4RMGA 3QVGB 2AQIA 4ECYA 4LJ7A 2H4YB 1FIUA 3DSRA 1K89A 1KYVA 3M2PA 3LWBA 5AJUA 2JOQA 4GR5A 1VIYA 1RHJA 2O7RA 4L4UA 2HPZA 1ZBTA 2QTZA 2RQ4A 4D80A 5JSHA 2YNMA 4RQUA 4Q3BA 2EL9A 5EJ4A 2K7KA 4BJ5A 5CAAA 2GPNA 1X8LA 3NOOA 1KH3A 3DRXA 4HMQA 1VPDA 3LAKA 4OHXA 5BW5A 2ZOMA 1EWRA 4FFMA 3QA9A 3WL3A 1PK9A 2G9UA 1KI9A 3FJ2A 1JNXX 2AQHA 4C8NA 2WVBA 2Z57B 1IKVB 2C3YA 2GGPB 4MKYA 1GCUA 2EG5A 3ILVA 4OIXA 4KCGA 3P0HA 1E8NA 4KVGA 4CQLA 4KWTA 4XKJA 3BHNA 5FI0B 1Z47A 1UH5A 1C4OA 4XASA 5AMXA 2XWYA 1VL0A 1SUQA 1HPZA 2IC5A 4TWJA 2QTVB 2Q5FA 2F3PA 3CEMA 3FPFA 3NWEA 2BFFA 2UZ1A 2FPMA 2QVGA 3FKBA 4G0VA 4KKXB 5AOCA 2O2HA 1GZVA 3Q12A 3W7AA 1NLMA 5C5CA 4ABYA 4X66F 1RAHA 4DS3A 4B7AA 4Q12A 1L6IA 2JJ2A 1OSNA 2ILTA 3T6BA 1Q0QA 2F1OA 3MCTA 4AX8A 1MF7A 3AJ8A 1YCHA 4QWEA 3BM5A 2B8EA 4U7HA 3IBTA 4JI3F 1JFFB 5FXMA 2IYAA 2ZTMA 2OFWA 3I61A 2DBYA 3LVQE 3DB1A 4NPOA 3GMIA 1E2PA 4D2IA 3CTMA 3I5BA 4HYKA 1SN7A 2JIQA 3MTKA 1RTJB 2G07A 1H22A 2JZNA 2ODTX 1EQ2A 1BD6A 1Z73A 2D1CA 4LF1A 1NR7A 1A7UA 2WF5A 3LVFO 2ATEA 4NMXB 1UXHA 4KPUA 5GY7A 4KXFB 1XL1A 4ZVPA 1N2GA 1V35A 3BULA 1YS4A 3WKDA 3JQGB 1JTEA 2MTLA 3PYGA 2AJBA 4ECAA 1Q5VA 4G5RA 5F1YA 3SEOA 3SM9A 4LECA 4WVFA 4ERDA 2C2KB 3O2QB 3LBYA 5J4VA 1PJLA 4RKQA 3JSYA 1B64A 1ISHA 1YQXA 4WINA 2IH4A 1WWHA 3WNQA 4DL9A 4NK4A 5BV8A 3F5QA 3IUBA 2Q2OA 3H5SA 5E6UB 2R6FA 3K0FA 2QQEA 3C19A 5EPEA 2PFSA 4KIAA 5JPDA 3L8HA 3C74A 4Q4AA 1DQ8A 1CF9A 3G2KA 4RKRA 3DMYA 2QLWA 1ULUA 5EKDA 3WISA 5CJ2A 4L02A 4OB7A 1RABA 1IKXB 2YZKA 4M6WB 2HWTA 4REQB 2I8LA 4X2BA 3G6XA 4B3DA 4CODB 1UP1A 3UV3A 4F8EA 1MMLA 4MZXA 3TP2A 1SCJB 3I76A 4AN0A 3LALA 3B85A 1XZNA 3KO8A 4L4SA 2NTYC 3VAFA 2ARKA 3W3SA 2PZFA 1NUTA 3O47A 3CUSA 3WMRA 2CK3A 1O94D 4JLMA 3ZZMA 4E1AA 2F1RA 1QIGA 4OQDA 1SZCA 1NRXA 2W2MA 2VOOA 2YMLA 4OYMA 2O2ZA 3EARA 1UINA 4ENSA 3L8ZA 4ELVA 5HSGA 3BXFA 1WOPA 3GRZA 1ZL0A 1JFFA 4QQFA 3SJ7A 1RYHA 2GCIA 4FPRA 4PF1A 5K6RA 2ZDGA 3R5KA 3JYTA 4TRRA 3B1YA 2WWHA 2E7VA 3PCOB 3MJSA 2E89A 1H3DA 2HNZB 4YJ2A 2FC8A 4LZWA 1RPTA 4RLSA 3HO8A 3SQGA 4JI6J 4CM4A 1OQ3A 5HO4A 4TTQA 5KVCA 1JG3A 1T6XA 1RZVA 3ZGYA 4O3MA 5ETTA 1Q1AA 3R24A 1YZNA 4EP1A 4HPWA 3D7SB 1G55A 2OD7A 4ZKDA 5FTNA 4X8OA 3QAUA 4NYMR 4J9NA 2Q0SA 4FXPA 3HU3A 4PTZA 2FJAB 3KVVA 4YHBA 3RCBA 4ER5A 3FMWA 4Y2HA 4G1BA 1T36A 3WRXA 3EK2A 1ZH2A 3QVLA 2B82A 3IDOA 1U2RA 2FJPA 1S77D 1T9AA 4XSVA 1GILA 1USUA 3UR0A 4NY1A 2BH9A 2G63A 4PZDA 2QTFA 3ZI0A 4QUJA 4MHOA 2I6FA 1KS2A 2PZGA 1X7XA 3O9VA 1BX1A 3BDAA 1KP2A 2FLPA 4KBFA 4OAQA 1D0EA 1T9GR 4EDFA 1BQEA 4X4NA 1EUDA 4AJLA 4YUDA 1NKEA 2HMUA 2CRLA 2VG8A 5CVDA 3L7UA 1ZGHA 4K81B 3BJEA 4P3OA 3OTIA 3HY6A 4AQYF 4KXWA 4E30A 1HDYA 3T52A 3RVRA 3NHKA 5B1DA 5CFZA 5LL6d 4RF4A 3J81k 1QRAA 4WMLA 4F1KA 3BGFA 5JQWA 5EOVA 3DD1A 3NZEA 2HBQA 5JNTA 2GH1A 4LYJA 1MABB 2XOKA 2FIUA 3NI2A 4YPFA 4CG1A 4KOEC 1IBLB 5JECA 3GX1A 5CT4A 1A8HA 5TJHA 1CRQA 2ZDPA 2NSYA 3IV6A 2SKCA 3MUTP 2JD0A 1JLAA 3ZX4A 1W35A 1FNOA 5F64A 4GO7X 2Y05A 2LCQA 2JC0A 2VFUA 2V7XA 1JLLB 2HNZA 2VAWA 1FFDA 2K2QB 3KD2A 3RUAA 3UJ6A 4ZTUB 3KU1A 2CJYA 2CV1A 2ZJOA 2Z3ZA 2VUIB 1HD1A 2GA7A 5IQQA 4P81A 2JBAB 5C1IA 1CJVB 4HDMB 1IZ7A 3BSSA 3A58B 1TZ2A 2CN1A 4LXQA 3VGUA 2GA9A 3ROZA 3FBFA 4KWCA 4XVCA 1C2YA 3HEBA 5MFPA 3ISVA 1OXTA 2QVCA 3KYIB 4C0AC 3E70C 2AYYA 3PWKA 5BWLA 3SIXA 1T9HA 5FWNA 1DQYA 2WWYA 1FNSA 1JIVA 3OKCA 3NMAA 3V46A 4ZITA 4F96A 4GR9A 4R1MA 4O3RA 4C5CA 1VIAA 3D4LA 4FYDA 5IKXA 5HQ3A 3H19A 3BPSP 2OFHX 2QI9C 3W8PA 2GEBA 1L7NA 2TRSB 4M38A 1PYOB 1KJQA 1DLIA 2IM3A 2J0QD 5DM70 4TUYA 2R65A 1N3BA 2DRIA 2WA2A 4TVKA 4GP6A 4DA8A 1RHKA 4RW7A 1KU6A 4JXJA 1MEOA 2FSVC 4D3SA 1YS7A 2IZ6A 4REOA 3WDLA 3ES9A 1KQGA 4CTAB 3GA7A 1MIOB 2RNEA 2ZJ4A 5IVDA 4JLNA 4R2IA 2FA9A 1EETB 1UJ4A 4ASUA 4Y67A 4AS1A 5D86A 5DYWA 1PZHA 2CNLA 2WJ4A 4BS2A 2RHQB 2YJNA 3W66A 3CA8A 5H3CA 4H7EA 4B5LA 7AT1B 4AROA 3P0JA 3DM9B 3MMBB 3E53A 1E2EA 4DSFA 4XB6B 3NJ4A 3FSXA 4MCIA 1MX9A 2J0EA 4IQMA 2OYCA 4CN9A 2MYFA 4YJDA 2R97A 3LUKA 2P78A 4Y1FA 3H2UB 4QGFA 2PWPA 2FSFA 1J8DA 1V5IA 4XUGB 3T9NA 3D0HE 5FJ4A 3G8CA 2AN1A 1FXRA 4JJKA 4C5AA 1SD1A 4YIHA 2DH5A 4JI2B 2DIVA 1AMNA 5AHXA 2X14A 3KTDA 4HDMA 1JFTA 2FZCA 3WYEA 2XMPA 1X1DA 2LQJA 3B1JA 3HZOA 1GZ3A 5JCJD 5HBMB 2Y8EA 3RODA 3PC6A 4X62F 3BPSA 3TQCA 1P5ZB 2B6HA 3DOOA 4QPDA 3MFIA 2F55A 4P84A 5I01A 5DX8A 2QVBA 2EFHB 4B6QA 3MPUB 4BJ3A 2NV6A 3L43A 2DHSA 1WXDA 4RHTA 2IUSA 2P4HX 3H40A 4FFWA 4H3SA 2ZM6F 4OJQA 3G5MA 1D6JA 4JYAF 3R6DA 2O7SA 1Y8RB 4B3RB 5IKOA 3LKZA 2QD2A 2ON6A 5I7AA 3A3PB 4IEEA 4UCFA 3U4DA 4XWOA 1WF6A 1UFRA 4ZRNA 3OM1A 1JXEA 4PAOA 3P27A 4M9CA 3KJNA 4UCQA 5DOZA 3EBLA 4O33A 2BWJA 4Z5XA 2O2EA 2HBQB 4AKEA 3ACBA 2GBGA 3NR2A 1XZAA 4V1CI 1F6TA 2BW0A 3IS3A 2D2XA 2D5CA 2OAEA 1V1MB 4TM8A 1IUPA 4BLWA 4NMMA 4B73A 4CO5A 1UEXC 3PENA 4NZ6A 3MBOA 3GFVA 1V7PC 1OJ4A 2B7BA 2RHWA 3CLVA 1SXJC 1E7QA 5HVGA 4RPHA 5ETQA 3PNKA 5EIAA 7FDRA 4P1ZA 5CD9A 3O75A 4AC9A 3IFEA 1IN5A 1KOHA 2A9PA 1FNBA 3BBCA 4TS1A 4TY8B 4MPTA 3PE3A 4QT4A 1EU1A 1U3GA 1TKTB 3E05A 3I52A 2GNOA 1HL7A 5CTAA 4KV7A 4B9VA 3GARA 5DIFA 1Q22A 5FL3A 4P0QB 2AKYA 4MK7A 4J7CA 3GDWA 3OPQA 4R0MA 1RWPA 2OPPA 4OEHA 3FYUA 1QC5A 1J5EJ 1E9FA 3G2QA 3QLEA 4GBGA 4RTKA 4FDTA 1W1UA 3EBOA 5GMKa 3HPQA 4MVJF 4LJKA 5HBMA 4FNIA 3A1CA 1EDZA 2L2QA 4DBVO 4OJ1A 3GUZA 1UPXA 1NJGA 1U8WA 2AN4A 4FT2A 1D0SA 4LOAA 2YX4A 4DL3A 2P75A 4G4GA 4E03A 5C5JA 1GDDA 3F78A 1V9LA 1Q2UA 3G8AA 4BQFA 2V3VA 1C1YA 1Y8RA 3G9QA 2CDCA 4LTDA 3FMBA 5KFIA 1PSWA 1V5FA 5IKEA 3VJKA 3IA7A 2BTQB 1JG2A 2B4VA 5L3QA 1PX0A 4LSGA 4HWKA 1U0TA 2G83A 3QY0A 3TNVA 2ROGA 1RT9A 1Z7YA 3GBVA 1ISGA 3EWSA 1R0AA 1Y1TA 3BG5A 5ALVA 1U6KA 2KHDA 4P72A 1XOIA 2FN3A 2COLA 4EYOA 3WV5A 2XADA 1VKJA 1YL7A 4XPCA 4DZDA 4IMRA 1OGYA 1RMTA 3M32A 5JG7A 3KLGB 4IH6A 3VU8A 4Z1OA 2EV9A 5C8VA 4OZJA 3L6OO 5I7VA 3TRDA 1RI2A 1CFJA 5SYAA 4HDHA 1Q1GA 3H87A 2BOVA 2JD2A 3AQIA 4J1TA 4ZCQA 2DPYA 1RCXB 3QLHB 5DYIA 1GXSA 3A4LA 4DB2A 1EP4B 2JKYA 4HGYA 5ALZA 3I9MA 2VNSA 5IDXA 3R2DJ 1UBKS 2H00A 4WE3A 1XDBA 3RYHB 4JLAA 3F8WA 2YY3A 5I9NA 3COVA 3OAAD 4R0EA 4R8RA 3DZJA 2P9QA 2IDMA 1LQ9A 3PC8C 3L6BA 4L1KA 3N8DA 1CNMA 1AURA 2JAHA 3I3OA 3B51X 4LVCA 5FPSA 1GRVA 3M9MB 1RT2B 4DV2F 5AVOA 1TEZA 4PIMA 1NAQA 1ND5A 1DG9A 4LYFA 1AHNA 2HDNB 4CCAA 3UN1A 1KI6B 3WV4A 4YCDA 2HFSA 2KYXA 4B6PA 4EB0A 2XMVA 5KINB 3PXEA 1XD2A 3FSGD 1EVYA 2BHSA 3COWA 1SELA 2GSWA 1N52B 1HUQA 4OGWA 3PFEA 5T57A 2GYVA 3THWA 1TZJA 2IS1A 4DV1F 2JEJA 3RVBA 4NRTA 1SM4A 4EMTA 1LDYA 1DEOA 1A4RA 1IEQA 1U6JA 5FLEX 4GOLD 5J3JA 3EYZA 1K7SN 2IA5A 2HSWA 1I2ZA 4KQHA 1LXJA 5K8JB 1S0UA 4PAWA 2AFVA 3I56S 1RXIA 2KWIA 4RD4A 3EG9A 4G37A 3ZHYA 4ENWA 4C98A 1P1IA 1QQ7A 4ZYTA 1V1MA 2Q7XA 5JH7B 5G02A 4PSCA 4CU2A 5AVTA 3IB6A 2OTCA 3R75A 3S99A 1FRLA 3JQ6A 1PGNA 3W7VA 2WM3A 3A1VA 4HNQA 1N54B 3SZ3A 4UNSA 2A0YA 1Y0HA 3ZWAA 2P2DA 2VICA 3F6EX 3OCUA 5CA1F 3U4IA 2Q3EA 1TTHB 1H69A 5C8YB 1JKXA 3ZIDA 1J7JA 2GXAA 4DV6J 2F2TA 3NETA 3TVDA 1B0PA 3A37A 2XMCA 3GK3A 4AKSA 3EFEA 3EBPA 5DRYA 4ZCMA 4EL5A 1W26A 1T9BA 2D1QA 2ZIAA 8ATCB 3NBMA 4CF5A 2OPPB 3IIEA 1YDLA 2HH9A 1NVUQ 3Q8VA 4RNFA 2W2QA 3BL5A 1EJ6A 2FN4A 1Q79A 1FTYA 1TLTA 4I5IA 4EO9A 5E9QA 2HFVA 4X9XA 4LBHA 3TPFA 5ALUA 2VJYA 2GZAA 4WXOA 3Q8KA 2P7HA 2FD2A 5LSLA 4DLEA 3TIGA 3LCUA 1FX1A 3KC2A 3TTTA 5BV1A 3NGSA 4YDHB 4Q05A 1W5TA 3LHIA 1V6AA 3BT7A 3H9JA 3GMDA 2OE2A 5L9AA 1E9EA 1JHZA 4XYMA 5BSGA 1KFKB 3EC1A 4KN6A 3W60A 2HHXA 1ZW6A 2D2FA 4HLUC 2ASEA 3IEPA 2RC6A 2I7VA 5AJXA 4IJ5A 2JRCA 1WUKS 1BN6A 5DM1A 2CY0A 4JBGA 4MIWA 1USWA 4OHMA 2QTTA 3TAMB 3LPNA 3KR2A 2B21A 1Y3DE 1FUIA 2G1KA 4W7IA 3GIRA 1I7NA 2G9NA 3IQEA 1B15A 3R7WA 1ZISA 3ZGVA 5J4HA 3QLJA 2W8KA 1U8UA 2B4AA 3KFXA 4KXVA 1ZM2A 3UCZP 1RP1A 3QKSA 3TLXA 4A27A 2MLXA 2CDAA 2JFOA 5JS2A 5BR4A 3OTBA 5K8UA 1J23A 4QTXA 1K1QA 2XDYA 1MW7A 1TM5E 3G2XA 1E1RA 3CISA 3SLGA 3NOXA 3UHOA 2OELA 4HNAA 4O1IA 2RG7A 2J9CA 4AZTA 1AMUA 4USWA 2WVEA 5E95A 5EWMB 2XB2D 4TTAA 1U1KA 4ZIWA 4PO1A 5D5HA 2ZIWB 3S1SA 2ZI7A 3E03A 1B8OA 1OHHD 2JIZD 3RJTA 5C8XA 3OZTA 4WCFA 1SKSA 3EGOA 4QYIA 1HYGA 4S2UA 4LJSA 3STXA 1U0GA 1X4HA 3KOZA 1ESMA 4P75A 2O3UA 5B0DA 2ZE7A 1ZK1A 3BQNB 3C70A 3PC4A 3GLFB 2QG6A 4UVHA 2P11A 4XEUA 3GGPA 1DCTA 1DAMA 3G2PA 5E4TA 2PSSA 5EMNA 1S3GA 2Y1DA 5AW5A 1EDBA 3FPGA 3CFYA 5LU9A 1QWOA 3NHJA 4Y7DA 3GRVA 1RT2A 1SUSA 1XC7A 4BE4A 1V8ZA 5FTJA 1TXGA 1CUZA 1AVTA 4ZQBA 4HMOA 1NVEA 1I1QB 3BIFA 1LNZA 2HOQA 3R5AA 1B73A 4IVNA 4Y9SA 4HYEA 2Z9BA 4MP6A 4BBAA 2FPGA 5G0RA 2VPWB 2RIPA 1OBOA 3KR0A 4ND7A 4ZHQA 1YRYE 3UXHA 5KQSA 3LQQA 3IBCA 6NULA 4ZANA 2Q2NA 2NR0A 2H48A 2P4SA 2DFPA 2P41A 2RAPA 1R27A 2YJ3A 3HLKA 2ZUSA 4RCZA 1WSVA 4WECA 4UZFA 1PEKE 3EVEA 3NEJA 4MUYA 2WYVA 3J81U 3KOWA 1YRWA 3O92A 3S28A 5T6BA 1YSJA 4MR9B 2B3TB 1OXXK 4TL9A 1M1NA 1S2NA 3GCWA 2Q8PA 4FHZA 4WYLA 5BYSA 5EHZA 2OCDA 2DHRA 1KIAA 1Z5PA 3H1FA 1U0RA 2QR3A 4MMOA 2O5RA 4F3RA 3B7WA 4OJ3A 4KFBA 1C9EA 2ZRKA 2VL1A 4GKJJ 1CC7A 1RVV1 3HHLB 1HV8A 1JIIA 1HQYE 4JENA 3GUUA 1UCFA 4YONB 5HF8A 2GJFA 1EAYA 4TOIA 3NBUA 4KH1B 4XYLA 1Q7BA 2KHZA 5CVUA 1W0CA 2EW9A 1KGDA 4TLQA 1CS4B 2XGSA 3CE9A 1WKVA 2P30A 4D56A 1DINA 2IZZA 3DLJA 1KDVA 2PBZA 1H4QA 1NN0A 5H9EJ 3G86A 2W90A 2Z95A 1MG0A 2Y0SD 1AA9A 1AS0A 1NWCA 3HL0A 4FS2A 4LF6J 5T14A 2J59A 2X15A 3NTQA 1K0TA 4RD3A 3SBEA 4UUAA 1QONA 2XV1A 3K5PA 8LDHA 4KDRA 1B70B 1CY6A 1T4CB 2CFIA 5CFQA 1ML4A 1ZCJA 3FPAA 3U09A 2P5TB 3V6MA 1WKLA 1XE3A 4WQMA 2B9VA 2XZOA 1DO8A 1WZ2A 1R12A 3MEGB 4NP6A 4D9BA 3T0FA 4M9UA 3F5FA 4JUBA 4TZ0A 5JS6A 4XH9B 4QM7A 4CTAA 4IHJF 2M6KA 3M2VA 3D4IA 2A0XA 4EABA 5HP4A 1MGPA 1KMHB 1T0BA 5EUQB 2XYPB 1NNDA 3PX3A 4IKAA 4PZ0A 2AJQA 1MROA 3CWCA 2TMKA 3S0JA 1JX4A 4YRMA 2I4NA 2PQMA 4QBFA 5F5NA 3G82B 4GDFA 3AW9A 3I32A 4JI5B 3FSYA 5MFZA 5KVAA 3M6WA 1HFWA 2UVPA 3K0EA 4CUJA 4C6SA 4UTGA 5J2PB 2GRUA 4EBEA 1EX7A 4C4OA 4EQZA 1FVSA 1N5RA 3HDSA 3MUFA 3NC4A 3PQ8A 1UWLA 4DCVA 4BVBA 2PGOA 1CIJA 2FUCA 2GX6A 1UWVA 2AOXA 1BSVA 2P65A 4CHGA 3C3PA 3DOUA 3DLIA 3TG8A 5KT5A 1HWUA 4NYPA 4Y2CA 2IVMA 2MU1A 1P4RA 1SL0A 3HN6A 3I53A 1XCPA 2IEIA 1S1XB 5I4KA 4NU6A 3R9XB 1KEVA 3TI7A 4KQZA 1DO0A 3RBXA 3ENWA 3DW1X 4LMPA 3UWMA 1BDBA 5KU7A 5AE1A 3QOWA 2BEKA 5FPYA 2KTQA 1FX0A 3BGWA 4KFRA 2QL7A 2C3MA 2AP6A 2M52A 2I8EA 4FBGA 3EUEA 5TMDA 3QWAA 4FYJA 3A1FA 1DIOB 4Z1MA 1FK9B 4V39A 2D2VA 4KITB 1QYWA 3FSIA 1VKRA 1WHTA 4LDAA 4BDPA 3GP9A 1QVVA 1U0EA 3A4VA 3EUAA 2XYHB 3A6KA 5JBQA 2MZ1A 4BGIA 3LZDA 5FULA 2UZ1B 3KNZA 2AG6A 4RPCA 4V0OA 2OM2A 1GPYA 1FKAF 2RSLA 5C18A 4B79A 3L0DA 2E1CA 1RQXA 5CH5A 5DNUA 3KXDA 4GIBA 2J5AA 2HEKA 2VHZA 3NX4A 4Q4LA 3BN7A 4DR7B 4RWXA 2VC2B 2BOPA 2E85A 4JI4F 3WL5A 4UZSA 4AWBA 1N57A 5F9MA 1UR5A 1LWFB 3UAVA 4JI8F 3BZWA 1FVQA 2RI6A 1HMPA 4LZOA 4WU3A 4XIJA 4NHOA 3AF1A 2WABA 1ZUHA 4MI3A 1VL2A 1FQWA 3GVCA 4QOIA 3RB6A 2FX5A 3GFBA 1JYEA 2ZIGA 4AS2A 2ZQZA 4CEHA 4EGCB 1YAHA 4CHTA 5CD4A 2I9KA 2BMFA 2IE8A 2IP1A 1RWPB 3F4LA 2AFIB 4HYTA 3L09A 3FQKA 5H9WA 2H4XA 3DU6A 3ED5A 2B43A 3RUEA 1TVKB 4LOJA 1DVRA 2R8OA 1DKNA 1Q3TA 4FJ0A 1WB6A 1RWNB 2C28A 2SCUB 3WLJA 3CZ5A 3NRCA 4NA3A 3V42A 5CM2Z 4A6PA 1HD0A 1J0BA 5AM3A 5DM60 4MNTA 1QHHA 4KO4S 1UBUS 2Z2MA 1UJMA 5IM0A 5GGXA 3KLFB 1DCMA 1XVTA 1SPBS 2FWJA 3WXBA 4QRDA 1E6KA 4YR9A 1E9RA 3JQ8A 1WUYA 4PLWA 3FZGA 2WSCC 4DL7A 3S68A 4UCXA 4Y2XA 2DG2A 3DL0A 1GUDA 4B4WA 2BTQA 3QSGA 3CGIA 2IOFA 3Q2SC 3EQ6A 2LU1A 1ZJ5A 3C5HA 1IBRA 4ECEA 4LSNB 1RWBA 4U3JA 1BXKA 1FXSA 1P19A 1WC4A 2R2TA 1C7FA 1NU6A 3DBHA 1Y7LA 1EAMA 2K2PA 1S6QA 3ILYA 1GDHA 1WBDA 1K1SA 3I6YA 4HEA1 1IPHA 4L8YA 5FTKA 1XNQB 1YTYA 3PB3A 1XD9A 5LVAA 2JVJA 3PDCA 4WADA 4R54A 1WE2A 1LDBA 1YL6A 4FFNA 5CM8B 1LSUA 2CBXA 4EFMA 1AXQA 4ALNA 3UPTA 1JECA 1V8BA 2QPAA 4KH0A 4O0MA 4JAVC 3ADKA 1YA8A 3OQ6A 4A8MP 1XO1A 4ZGWA 2DHDA 1XNHA 4AZ0A 2WKQA 4HACB 1D9FA 2IU6A 2QLFB 1M2FA 1KO7A 2CHUA 2OPHA 3AJ1A 2CNNB 3U7FB 5IT9Y 2CHFA 2YHUA 1ZMTA 1VG0B 1G3MA 2BONA 2JJMA 1ULHA 2QN7A 2HWKA 3KJGA 3N2YA 5I7FA 1RHMA 2FMTA 1E79A 1EM6A 1NFQA 4A5OA 5AI5A 4JI1J 4OQNA 1OZAA 3S8YA 4QNNA 5B0EA 4Z37A 2X8LA 1F0YA 1X3SA 2RHBA 3Q8RB 4QPCA 3CDWA 1PCAA 5F21A 2BPOA 2VRNA 1IDOA 1W0JA 3GFTA 4WNCA 2F1FA 2X8AA 1UP4A 3PIRA 3VC1A 9ATCB 3JPWA 5JXJA 1TT5A 4IO1A 2XSZD 1N9GB 1X86B 3T4EA 3QNUA 4U4AA 1NVTA 2GNPA 1ZD4A 2P8SA 3SE0A 2P9FA 1KGSA 1S7IA 3OC0A 4BMXA 1X1BA 1URNA 1Z8NA 4UEJA 2WWGA 3FZYA 2SBTA 1ZPWX 2H2HA 2EBUA 4NBUA 2HHPA 4OFWA 3D6MB 3WGUA 4OXNA 1XYGA 2OBXA 2PZKA 3OMLA 5C37A 3U5TA 1TIBA 5HN0A 3KTQA 5F3ZA 3UAOA 4G6ZA 1GV0A 4BE9A 3G82C 3T1NA 5KTKA 3NXSA 1WVMA 2Z4PA 1T2CA 2Y6VA 5E1OA 5K99A 3LXRA 1PVOA 3BMOB 2VF2A 4K9OA 4D0SA 1QKIA 1X42A 4PFSA 4MS4A 3LU1A 1QLHA 4GGPA 4AO8A 4PC7A 1ZJWA 1AF4A 1TELA 3U3OA 3AUYA 3AUKA 3WQQA 3S6EA 4IL5A 2PUCA 3OUYB 3DVAB 2C4NA 1XN9A 2PV0A 2GCNA 1ECGA 1XLWA 3MM4A 3IOMA 4B09A 2HMAA 5FLYA 1Y37A 4I4NA 2J7KA 2LFVA 3E9RA 4IFVB 3DZGA 2KVIA 8OHMA 1IFXA 2O3RA 4I9UA 2WD8A 1QHHB 1CJVA 4O2AB 1SC9A 4I55B 4N41A 4GQAA 1UJBA 3Q22A 1I51A 1MMFB 2ZR8A 4MVCA 4RPLA 2DLNA 1X2BA 4FF2A 2C3UA 2CFOA 3QFFA 4F6LA 4URYR 1KI3A 1ZH0A 4G9BA 5JCJA 3DXBA 3RAEC 3R7WB 2I6TA 1Y5RA 2O54A 2F63A 4OYZA 4DCPA 2V5AA 1HPZB 3PDJA 4JB3A 4IP0A 4F06A 4L9SA 4G9EA 2OV1A 1B8NA 4CM9A 4DV7B 3SD7A 2WTEA 1L7XA 4Q9NA 5EWMA 2QRQA 3GVIA 2HMIA 4R1OA 4G41A 4M60A 4LHYA 2RDMA 4J4HA 1TTPB 3GG0A 4F26A 3CMMA 3EIXA 2K7ZA 3ZX5A 2JKVA 4EEYA 1Q95A 1ZD9A 1GLGA 4AF8A 5AVRA 3GA5A 2V67A 2BEVA 3LFTA 2PJUA 4AQYJ 3RUCA 4DTIA 3MJFA 1NLFA 3Q3CA 3TVYA 3AM3A 3OTOB 4OXRA 2YWGA 2D3TA 1H38A 5JISA 1E94E 4KGZB 2YQ5A 4BZPA 1X3LA 2IUUA 1ABBA 5LZ4A 2I6QA 5LQJA 1UA0A 3OLCX 5JO9A 1TF2A 1K8XB 4S1VA 4OYYA 2BFMA 1F2TB 2R6R1 5K3SA 1PK7A 5L6MB 4K9DA 4KQGA 3VR2A 1L4LA 4AS3A 4OQMA 9ABPA 2J31A 5IH7A 3CG4A 1TU4A 5JPIA 1L1QA 3CKYA 4N6NA 3C39A 1EFHA 4DR6B 2DO0A 2YXPX 4J8PA 2F59A 2C2RA 4HX2A 1UC4B 1GPWB 2RRBA 2B25A 2JZCA 4HVCA 3NNCA 3LPCA 2HV8A 1A27A 2JL1A 1TGYA 1B6SA 4OXIA 3A9WA 5BMVA 1EHYA 2XNJA 4QIVA 5E38A 3SZOA 1RYRA 3C2PA 1EGMB 1F14A 3IR7A 3DDWA 2XWBF 3GGCA 3T5JA 4LZJA 2E9TA 2EKYA 2JDID 4PFKA 5BYKA 3HWWA 1YONA 3IO1A 1TL7A 2XWSA 1SCJA 4IIJF 3PGJA 4M0PA 1NKTA 1SURA 4J43A 4HPJB 4E94A 3KP1A 4MAAA 1C3LA 4I08A 3NVDA 3IAXA 3O91A 4I4TB 2JHAA 3KSAC 1KMCA 4MVJI 4R1TA 3NGUA 1N4AA 2C7GA 3NVAA 4BLTA 5DU2A 4KXYA 4IKPA 4G4IA 3CUNA 2BFEA 3UGTA 1AC5A 1PL0A 5IM4F 3V4VB 1YAJA 2N1MA 1EJBA 2OHFA 1G59A 2DPIA 3R9KA 1GPLA 1O6ZA 3NT2A 4BPRA 1AQNA 1XRLA 3G88A 3MHTA 3OQMA 3V8MA 2GOYA 1WO8A 1TJ5A 4INZA 2G1JA 1ZXLA 4DLVA 2HHWA 3KKPA 1J99A 4G2NA 3KLHB 1APSA 3VX4A 5EX3A 3BBPA 5JCPA 2WM9B 1PC4A 1OZHA 3ANXA 2ZJQQ 3FOEC 4CKEA 5HGJA 4A2QA 1B6TA 5TQ0A 5TF0A 2YNIA 4TWAA 1KDZA 4U8YA 1YZUA 5A05A 2PEYA 2R8YA 1NW7A 1RBMA 4YVFA 4X93A 4DSNA 2ETXA 3L6CA 1S6PA 2OH2A 3VYSB 2R1ZA 3QF4A 2XVXA 3AR7A 2BY4A 2MJNA 3B4DA 3OZXA 5DXJA 3QUAA 3MM6B 4Y18A 4JA2A 4DCGA 2H2FA 5EG5A 4ARVA 2XMWA 4U6NA 1XRPA 1QB7A 1YB2A 5ALLA 4MJXA 2OFOA 3L0SA 2VC0A 3ORQA 3WQPA 1FXUA 4FN4A 2RB7A 1CQWA 2Z2LA 4PN7A 2Y0BB 2QHXA 4OYHA 3PYFA 2RJNA 3EIEA 3GEBA 4LVOA 3AC0A 1M75A 2W4PA 3QVKA 2WJAA 2ZM5A 2LQ5A 1DAGA 2IXGA 3AHGA 4AY2A 2QW1A 1Q57A 3FGOA 2Q49A 3BF4A 3EASA 3C3WA 1AV6A 3PQ4A 2DR2A 2YQ3A 4OZ0A 5IG2A 3AIOA 5CA0B 4H0FA 1QLNA 4NEZA 4MUMA 5K0BA 4HADA 3L9XA 1VJWA 1L3KA 1XF9A 4WLOA 5K3DA 5IUNC 2DFVA 4JV5F 3RUDA 3BXXA 2ADOA 3AFHA 2Q6CA 3GFYA 4YB6A 4NEQA 4YJKA 3UFXA 3WE7A 1YI8A 4YMVA 4D7AA 1WUHS 3PG9A 3AM5A 4JUCA 5F3TA 2Q3MA 1RWWB 3WX0A 1BHNA 2RILA 4AT1A 1F2TA 4BJ1A 1R3DA 4NKRA 4DMUB 2EFGA 3T3FA 2R66A 4NLGA 4YJ3F 5JD3A 4PPFA 4BNJA 3R5HA 4JA0A 3HO1A 4ZXFA 3QYPA 2UU9J 4OF4A 4FWTA 4AFFA 3AI2A 1BMQB 1TL3B 3O95A 4BX8A 2ZYDA 1RRVA 1U7TA 1Y80A 4I0WA 3HY3A 2OWDA 5JZVA 4B40A 5GIOE 5IEJA 4IGAA 4R1QA 1AUQA 3PA8A 4YRRA 1FVXA 2Y9MB 3STTA 1DFIA 3S40A 4EB3A 3FTQA 5KYVA 3WLOA 2EP5A 4ES1A 4EYIB 1VLLA 3F47A 1ZMOA 3L1UA 4W8OA 4DR4J 4AZ3B 4RABA 5HM8A 3HHDA 5EX0A 2JH9A 2ZRAA 1DURA 4QFBA 1X9MA 1VC5A 3LXMA 1ZVJA 4KN5A 5LM3A 3ESAA 3MRTA 4CIYA 1SKBA 1Y9JA 2FPXA 4IG3A 4AG3A 2FZEA 3DEYX 4GZLA 5J2MA 1A8SA 2RQMA 4RSMA 2A92A 1GYPA 5BXIA 2B8WA 2QRHA 3DEHA 1WKCA 4QU5A 3SN6A 4WTOA 3KOOA 5D3ZA 3Q7RA 1ACMA 4F7WA 3H8WA 2XTNA 4WFXA 4K4YA 3W0LB 3I9LA 4YMLA 2I6GA 3AKDA 3G8DA 3MINA 1S3IA 1NMSA 4U7WA 1ZHFA 2X9LA 1IIBA 4ZVKA 2I0XA 4HAXA 2PIIA 1RZMA 2X6TA 3C14A 2MY8A 1LS1A 3R7NB 3VC7A 5KT7A 3KCNA 3DQZA 2Q1YA 3QFHA 4ZRMA 1YX2A 4XPIB 3LYUA 1JKHB 2FZGB 4N4AA 2EEYA 1NDLA 4MV9A 3BDVA 1JEQB 2CPXA 1JJCB 4GKBA 4DN9A 1HC7A 3C1AA 3PX2A 2IVFB 3M1IA 1JIUA 5H7XA 5GAJA 1RLIA 2MHEA 1JHVA 4YCLA 3AERB 4Z9BA 1PEDA 5GAEI 2HHCA 2PFGA 3DDNA 5K4AA 1GT6A 4YACA 2QAGC 3K3PA 1LV8A 4HT3B 4ZDKA 5JAPA 2HNBA 2J08A 1VGYA 3IDFA 3MPUA 3FH0A 4PHTA 2PA0A 3OTOF 2V7QD 3SK0A 1QVWA 1P2GA 2YIJA 5TJ9A 1TC2A 5AXAA 4E09A 3MQ4A 1QX4A 1MN9A 3VR6A 2AEEA 2EFVA 4LJYA 5FUWA 1S1UA 5GM2A 1MNEA 1SH2A 5F78A 3DHXA 2QYCA 1JB1A 1LJLA 4CT5A 2RS8A 4UM7A 2VKRA 2FZKA 1YZ7A 2RBEA 4ANDA 3ABSB 3DTTA 3PD0A 2YKGA 3UJCA 5GZ3A 4D9IA 3DGPB 2IGTA 1NFRA 4DIMA 4QIWD 3W77A 4PSAA 4BTVA 3HU2A 4KIGA 3SX2A 5CT9A 5HUQA 1JLBA 2HKEA 5A4MS 4KQXA 5C7OO 4D9GA 3IP5A 3ZZRA 1QYVA 1KAMA 3MINB 2BI8A 4JFRA 4LIPD 3R4CA 4UBLA 1IR1A 4FBMA 2RMLA 2I67A 2LIPA 1Y6RA 2RGBA 1JB9A 3EGEA 4CFZA 3CNQP 1N33F 3GMSA 4J2OA 2GGPA 2J3KA 1XWFA 2K4MA 1WUJS 4RNMA 3PFGA 3QJ5A 3CNOA 2JEFA 1U94A 3VZBA 1X4EA 4LA4A 4CLKA 1GOTA 1YNSA 3ONNA 3L8FA 3M30B 4FR2A 2J30A 2PX8A 4AMVA 5C1PA 3ELUA 3L0PA 1SU7A 3K2BA 1XVIA 1CETA 1SK9A 2B3DA 3CEDA 3W61A 2QTVA 2FXIA 4Q34A 3DQQA 4WOPA 3R0VA 3LCCA 2BKEA 2H4FA 2XY4A 2J85A 4QGBA 2JEYA 4WKRA 2RK4A 2Z8YM 3JALA 2YIDA 2GF9A 5JYCA 1EFPB 1M8KA 4NOLA 2A5DA 4ZAFA 1BDJA 4AZ3A 1X9GA 1R0XA 1KC1A 4L5AA 3OVMA 4KZKA 2BW2A 3GLGA 4F84A 3IAS9 2PWBA 2L9WA 5L3QB 1TL7C 3OE7D 1B0TA 3O8OA 3L7LA 2F1IA 3ZFVA 4LQCA 3L95X 5AKGA 1AUDA 1MPXA 5JV5A 4JEMA 621PA 5F8GA 1T2FA 1Z83A 4FILA 3TLEA 2JAOA 4C8MA 4D97A 4NJEB 1CEYA 4F5ZA 1C7RA 3QNMA 2MR6A 3GR1A 3O8WA 3JQGA 5KG3A 2HB6A 1AG9A 1FP4A 4HN9A 3Q3JB 1RWMA 2CPEA 4GKKF 4HZGA 3HCDA 2CGEA 4MW6A 1E6CA 4F8RA 2QMEA 4US0R 5IXUA 3FD8A 1G8MA 1KA9H 5D3QA 4EY7A 3VSCA 1BGVA 3V8VA 1OYEA 4HWTA 2IZ7A 4HB2A 2QTMA 2C1EA 2ZW9A 1GMWA 4FGUA 3QLHA 4CT8A 4CMIA 3KLOA 1L7MA 4KH1A 4NI2A 1JQ5A 2D0PB 4ZN3A 2B1JA 2N47A 3LJKA 1LLDA 2B0CA 1XRRA 3OZRA 1TQHA 4B3FX 5KVVA 3QIPA 2X8BA 3WAGA 1X7ZB 4KLZA 4AG5A 4Q4AB 3WHLA 3BBLA 2CYYA 4ITSA 5IBQA 1T05B 1AXGA 1KZ6A 1TP7A 3AHJA 4IS3A 5FTLA 1PAUB 2QSZA 5BR7A 1RABB 1IM2A 2I29A 4O2AF 1GNTA 3ADPA 4Q43A 3EMVA 2XBPA 1V3TA 2C2BA 1IQ0A 10MHA 2QZZA 2RT3A 2BHLA 3O1LA 3LLSA 3WC0A 3K0AA 1C9DB 1JALA 5ADUS 4J2HA 3QPAA 1PNVA 3TBFA 3R6WA 1WNFA 2XAUA 2Q5LA 2O8EA 2X9QA 3H1GA 4Z1MD 2VJAA 2G5TA 8ADHA 1IWOA 1N8TA 2WSSD 3G5AA 4X63A 2UP1A 1GGFA 2KG0A 3D8NA 2VG5A 3ZWBA 3EGZA 3A6GA 2VBWA 4HQLA 1FKPB 5B1EA 1Z0IA 2YJ6A 5KQRA 3R5XA 3EG9B 1OWOA 5FFNA 2PANA 5C8YF 2K1RB 3ZH9B 5BQFA 3G82A 4OZLA 4N03A 1ONBA 1VQMS 4Q1AA 1CKEA 4FS8A 4H1WA 1TVKA 3RASA 4IMPA 4NBWA 2RQKA 2YVQA 4NCBA 5BSRA 4QXOA 2JS7A 4J9SA 2WC1A 3K1AA 4B7UA 1U1QA 4H27A 5DK6A 2E4XA 3FDIA 4FYXA 2E55A 3JQ7B 1T0JB 4CL2A 4OYAA 3W3AH 1Q82T 5JZMA 1J0CA 3SYRA 3I2IA 3GV8B 2BCGY 2RHDA 2AGVA 2FEMA 3WOHA 3MGJA 2XTJA 3LG2A 3UUWA 5IJ9A 5D6OA 2DRDA 4CKYA 1COWD 2MB0B 3E9DA 2WF6A 4DSAA 3WNVA 4BVLA 1X5SA 4R16A 2OHOA 3ZK8A 3C8YA 1HNVA 4DADA 3T06B 1HSOA 1VISA 2O19A 2OO3A 3NONA 2RFLA 3SOPA 2RUGA 5L95A 3FPCA 4D9HA 3EUNA 3EGNA 4CMAA 3H6KA 3HKCB 3IESA 4RL1A 1QJCA 1YZFA 1U4OA 3WIUA 1DQNA 2ZKIA 3PHGA 1DJOA 1P4JA 3DZHA 3SVLA 1QE0A 1HWIA 3S7RA 5HYVA 1SB8A 2B8PA 5DNDA 3L4SO 2GM4A 2AD9A 4CR8A 4PQAA 4O3NA 2F40A 3AA8A 1RZ3A 1LV5A 3KEQA 4B9MA 1KO5A 9GPBA 1JIQA 2EJCA 3RSHA 3DLPX 4ACAA 5AW2A 5GAHI 1ISRA 4DR7F 4K5RA 2FSSA 3O7MA 4N77A 4LNHA 2YVKA 1YDHA 1HGXA 3O8QA 3UJDA 4YMTA 1L4BA 1AH2A 4QR2A 3FGZA 3HDVA 5EEHA 3W9UA 5DSTA 2B5JB 2DKOA 1EUZA 1M1YB 1GTG1 3JQ9C 3U26A 5D6GA 1SJ1A 2OEJA 4NV0A 1VPEA 4H4MB 4CKEB 4HXFB 5TQ0B 1T1RA 1STOA 2O8DB 4RHCA 4ENTA 2PKQO 1RYMA 1VPLA 3ZC3A 4B84A 4CTNA 5FLXU 3KSBC 1BQ4A 1KH2A 2FWNA 4O5OA 5HUJA 3HY4A 1S0MA 1JXQA 4KN9S 2ZDOA 4B43A 1SA0A 3RS2A 1WULS 2OCIA 3AMVA 4BO2A 2GZRA 1YE5A 4LHEA 4RV9A 3TNLA 2PTHA 2YS7A 4O4LA 5ABPA 1A77A 2G17A 5KREA 1GRRA 2IXTA 4GKKB 5DXAA 5TGDA 2R6ZA 2R7UA 2VQ3A 4U2CA 5DGAA 2DK2A 1A9QA 2ZH6A 3RV3A 5IVPA 1QX3A 2YWXA 2J9FB 3PM9A 2GMWA 1PW5A 2GPJA 2X2FA 4MH0R 2B69A 4Q4JB 2ZYTX 4M87A 5BMVF 3B89A 2HRQA 1VHQA 1OI2A 4KL8S 1WCXA 3V55A 3ZV5A 3I9FA 5H9FJ 4CCHA 1D7OA 3JQAA 4AY4A 4JYMA 1PR1A 3D6MA 1AKNA 4DILA 1XMSA 5C1OA 2OR3A 3IXMA 1TZKA 1VQOS 1ZBDA 3N2ZB 1FMCA 1MW9X 5LQCA 1XEFA 3ZDZB 1GZ4A 5EY5B 3QZ8A 3DOEA 3ZE7A 2F4VB 3LE8A 1AKMA 4IHKA 1RXVA 4WBNB 4LJLA 4UQOA 1RPAA 1O6CA 3T8YA 3GFGA 3UF0A 3OT9A 3M6AA 4TV9B 3PPXA 5B7PA 1X7DA 1JILA 3NVMB 1G66A 1RIFA 3F9RA 5DEIA 4YALA 4IZOA 4XQGA 1RTJA 1UBNA 1DTTA 3MUNA 3W9BA 4DIFA 1LD3A 1QCYA 5HKKD 3FB1A 2YVAA 3KVRA 2OAUA 2AV5A 2QMHA 1HLFA 1U0JA 1XDZA 3I01M 4ZQIA 4I55F 2FFBA 1U3UA 2CQPA 1A5BB 3CPJB 4OH7A 4Q1DA 4Q4DA 4HX9A 2VQFB 4DQRA 3HUUA 1P0MA 1XF1A 5F76A 3JQQA 4EGQA 3LYHA 2WD7A 2VG6A 1H4TA 2YWHA 2PYZA 1Q1EA 5ECGC 4NYJR 3TS1A 1NVKA 4J49A 3HHKA 1XMJA 2I4LA 1ZKMA 4HLUA 1FTRA 2NGRA 4X65B 1RLMA 3H16A 2Q6LA 3JD4A 4UQGA 4TMWA 1AS3A 1AKEA 5KOJA 2VHWA 4OG2A 4MS3A 4NOMA 1EWKA 5AYVA 1FZQA 2CPZA 4DSTA 4HPXB 1GAOA 4TUYF 3UKOA 3BMNA 2R2SA 4QU7A 3R1LA 1BXNA 3W5YA 3PLAE 2B4OA 5EIEA 3AHFA 4WN3A 2BISA 2QL5A 1GFIA 5ITVA 3WGHA 4BB6A 2EZ8A 2NIPA 1MNAA 1ZOTA 4WKCA 5H02A 4PRLA 4CT0A 3H7AA 1USKA 1XBWA 2MKYA 4OQEA 5JRDS 3GVPA 5B37A 1WVGA 2K8GA 1K5DA 3ASVA 1XMPA 4A0QA 4QGGA 4GXNA 1KAEA 4YUVA 4FNGA 1MNQA 1N6IA 4HEQA 4KLCA 1W25A 4MKVA 1KNZA 1XN4A 3VX3A 1O0PA 4O4JF 1DRWA 2OK8A 3L49A 2J9DE 4QOJA 1M6VA 3KQVA 1HRKA 5HPYB 5I9MA 2CXNA 3H2SA 1N34B 3FFIB 1HDZA 3PGLA 4GKAA 5JHHB 2VA3A 3SQGB 2JFVA 1UODA 2DWCA 4BWJA 1J90A 3RK1A 5ITSA 5K03A 1KY5A 3UCEA 1ZJJA 1C3OA 4FOPA 3O3CA 2MKIA 4PTYA 3H11B 5B3JC 4BFCA 2EFOA 2RK3A 1Z7EA 1RB0A 4F6RB 3FCHA 3JWJA 2RH3A 2X9NA 5LJ3Y 1DC3A 3O44A 3G6WA 3H3XA 1RAIB 5J2UA 4RXMA 4TMFA 5LMNB 1N8NA 4PHFA 3NBKA 1OTHA 5D3MB 4Z2AA 5L40A 4FHFA 4BEVA 1EIZA 2Y4NA 1E1QD 5EWGA 3TDKA 4LHZA 3P1JA 3KKKA 4V2UA 3ZPXA 4DREA 2H3EA 3QU5A 3QWBA 2N3LA 4K1XA 4LF7B 1N32B 5HK4A 2A1BA 4J6EA 3X1ZA 2XS5A 3TZXA 4QPTA 4ZIRA 1AGRA 1WF0A 1PR0A 3LC0A 1RBZA 5D4PA 3BFJA 4Q16A 2GJ2A 3AHDA 5DGIA 4MI1A 4M1WA 1NMYA 4HVAA 5BWCA 3A05A 4OK6A 3U80A 3IAM1 1U4SA 2JGFA 4RL4A 2XYHA 3ZZ1A 3R8XA 3CH6A 1O51A 3KQTA 1XYVA 3H5WA 3N01A 5TQ2A 1Y48E 4X97A 4UM9B 4G0NA 2V5UA 2OBBA 5K9FA 2V4RA 3MF4A 3DC2A 1F1BB 2AYZA 4F7VA 2W6PA 3M3PA 3FZNA 3CXCR 5B7QA 3RRJA 2FUG1 3THTA 3M4JA 3SDEA 4GC6A 2PR7A 1OB2A 1GAQA 4M88A 5EZYF 4YPOA 3AQOA 3CW9A 2VDVE 1N2SA 5D5QA 1XMQJ 5DNAA 4U0KA 5G0TA 2NZXA 2BEVB 3F1KA 3I37X 2PBRA 1X1AA 2YNIB 4ZGGA 1OXUA 3L05A 2W6IA 3TLJA 7YASA 2H4JA 3WX8A 4QBUA 2IYRA 3RBZA 3H65A 3RJZA 3HA7A 1M34A 4P0TA 2N7CA 3OR1B 3TPCA 2B92A 4DF8A 3CEJA 1LRLA 4NJMB 1NYTA 3UQZA 2MZTA 3VPCA 1RWNA 3IUJA 4QXAA 3IT3A 5I4MA 4ZAZA 3RG2A 1H4SA 1R10A 1PEAA 3HDGA 2FNAA 2KRBA 4MICA 2Y0BA 3EDRA 5DNWA 3SR3A 4DZZA 5IM0B 3TMKA 4HQKA 1G8GA 3CUTA 3MMZA 2V8OA 3TO5A 1ODCA 1MB2A 3KTAA 3BQ2A 5L53A 1D4FA 2HBZA 4HTJA 3UMYA 1FZTA 3TQOA 5EIXA 1E32A 3H3JA 3GUHA 2YW2A 4F0JA 3JQDA 2FJBB 1AUSL 3OZCA 5HQMA 1H5NA 4OA8A 3C98A 1VQ5S 1WDMA 2MKJA 1Y0BA 2PN6A 1JE0A 1J9EA 5AW7A 4OL8A 3CD7A 1ITZA 4YLGA 4PC2A 2R86A 1OZ0A 4CEIA 3HPRA 4BQEA 1JLHA 4PHHA 3IQHX 5JSFA 4X7PA 3V9PA 2SKDA 1W2BR 5C31A 3LT1A 3OD2A 2Q1SA 4QDJA 1EE9A 3UCXA 2FI1A 1FDBA 1TTHA 2ZJ5A 4K8OA 2HZAA 4ZQHA 2XNQA 2MYTA 3PR2B 2ZTLA 4RNCA 4ENQA 1X87A 3HB7A 3IYLW 4Z4HA 4WKYA 1LBHA 2ONZA 1KXZA 3CRW1 3EVNA 3FZQA 2IZOA 1RWXB 4YROA 1I5OB 1OW3B 4HAIA 3PC7A 1ELOA 3G9CA 4UOHA 2PKWA 3M9LA 3MFHA 2WFAA 4OA5A 3OR1A 4L78A 2J3EA 2FWAA 4X71A 3OCCA 1QH0A 2H6EA 3WGOA 4ROSA 4UOGA 4QW9A 1S3SA 3PKMA 4IRDA 1DQSA 2V2KA 1J2RA 4WUVA 3LX6A 4IQGA 4NYIR 3T7DA 2COUA 4FYPA 2OP1A 3S1LA 2HFUA 1NXWA 5D84A 2ZANA 3IHTA 5BUSA 5G1NA 4NDNE 3M2RA 1EVLA 3QQCD 4M1ZA 4WRRA 3BZBA 2MWMA 4AIIA 2RGXA 3EHDA 4KJIA 3S2SA 4LFCF 1GNQA 3Q7IA 1GFWA 5LT5A 3LHFA 3WKAA 3SSMA 3WNBA 3FMFA 2D54A 3VNUA 2CCJA 2X8JA 3I9NA 3UWDA 3II6X 2XE7A 1U7LA 2IYSA 1E4YA 2B8NA 1TNDA 1VXRA 4QATA 3JZDA 2GARA 3I42A 5BNFA 2AJ0A 3GFPA 3U60B 2FFHA 3HNRA 5FL7D 1HDOA 3D9QX 3WRVA 2QM3A 3VKHA 3PDNA 1HM5A 3VGSA 1UVNA 2A3JA 3UANA 1PL6A 5HLFA 2PYDA 1RZUA 1D07A 3B5EA 1EP1B 1KQKA 3N2GA 5KYKA 2ACWA 2O7NA 3JASA 2JGIA 1BQNA 1IBSA 2OORC 3UJ3X 2C2HA 5U4QA 3U3MA 5JEDA 2O5DA 2BUAA 3UN3A 3UNGC 3A9RA 3KZVA 3LK6A 3EDMA 1W19A 1QZTA 1GYRA 2WOJA 3UFXB 1JHDA 9LDBA 4W5QA 3SEAA 3RKUA 4PZPA 1EX9A 4KRGA 2ZD1A 4WJZA 4PX5A 4UXIA 4TL6A 3TZEA 3MM5B 5G4LA 1BWVA 3RAFC 1DE0A 1AUOA 3KYCA 3MS2A 3VAKA 2J0QA 3AERA 3AJAA 3IE1A 2FUG9 2DFLA 5TVGA 4YGXB 4X00A 2AFHB 2WT9A 2OC9A 1IK4A 4OHYA 1TL3A 1BMQA 1TJYA 1D6NA 2H1HA 4WZAB 4O2AA 1LPAB 4IJUA 1VPWA 1QO7A 1USVA 1YB4A 1MZVA 3V4RA 2W22A 4G2TA 1M1GA 4RMJA 3W6OA 3DXXA 4YV2A 3T0IA 3M2RB 1J8VA 4FC7A 4Y2JA 4DCCA 1N1DA 1AF7A 1NC3A 3P9SA 1UOQA 1BU8A 2O9JA 1XEXA 1UVKA 1RRKA 4R1SA 1FNDA 1T10A 3TD2A 2C07A 4NESA 1BTOA 5HUHA 5TPZA 1XTIA 4MV3A 5JCOA 3CJSA 4W8GA 4V1CB 4Z9AA 3V1MA 4P4TA 5FPTA 2XSFA 5CU7A 1TL5A 3M4XA 5HJ2A 1EFTA 1E3DA 3JTMA 2UYCA 3UCFA 4RV4A 2ZUBA 3D3JA 4NLUA 1L5HA 3M32B 2O8DA 4D6YA 2V4QA 2XMGA 5ETOA 2YJGA 4D4IA 2H11A 1EJ7L 4UDYX 4N5MA 3GP3A 3BWYA 3D8SA 1ONPA 4IWYA 2R8HA 1FU4A 3EXEA 2ECFA 2OXRA 1L5ZA 1V7QA 2JFDA 1B43A 4L8FA 4JYAB 1V95A 3NNDA 4YRNA 3KKEA 1U2ZA 3TBHA 2G09A 1Q77A 2QA5A 3GV0A 3EZ5A 1XXHB 4M46A 4P7JA 5YASA 1ZVKA 3AHPA 1I5OA 2QVLA 1LSOA 4D3HA 5JVGQ 3CONA 3G0BA 2DEJA 1PBNA 4C4ZA 1HEIA 1WP9A 4DYVA 3TKAA 3AM1A 3IAM9 3V6DB 3R0IA 3S2FA 2KM1A 4LNUA 4L9WA 4JI3B 3U4GA 4JR0A 2WWVD 2IUEA 3MBKA 1G7CA 3FOWA 1JKHA 3CLRC 3GEEA 1PJ7A 2A94A 3SV3A 1FDAA 4EPVA 3DN9A 3HADA 1R3UA 3H1AA 5IT0A 5MLCV 2OORA 4LY0A 4WKBA 4KT0C 1IN8A 5REQB 2IJGX 4QHYA 1AA1B 2DT9A 1DXHA 1T4CA 3TFQA 5IEBA 4LREA 4MQ5A 4A3SA 2NNLD 4YN3A 1KF0A 1YVEI 4UU7A 2EATA 2IP4A 1GJRA 4KJXA 1NQAO 3ZYCA 2PMFA 3IR7B 2QRMA 3MD0A 3K5MA 3HTXA 2ZBRA 2ROEA 2VJKA 4B9EA 3OD5A 2UDPA 3N2LA 3C15B 3BAZA 2IPOB 2MZQA 4G0WA 2DJ5A 1KJ8A 4C1BA 4GLBA 4GZ6A 4NLSA 1Z2NX 1RRCA 3SZMA 2HVIA 2EYUA 4NZMA 3KOAA 2DRAA 4BQIA 4HRAA 1KAOA 2EX1A 2CVIA 4Q44A 4EEKA 3N2GB 1JLQA 1CF4A 3KXKA 5TV2A 1P5HA 2QX4A 3FFXA 1ULZA 3JD0A 4QUHA 1JA0A 5FPKA 4WF9Q 1F38A 3WMWA 4LRYA 4EEXA 4IF6A 4AJ2A 2BVNA 2XD9A 2YZ7A 1FD2A 3TTSA 3W2GA 3LLVA 1JMYA 4A1OA 2NP7A 2NZWA 4N3BA 2BJHA 2Z58B 4Z0PA 4GEKA 3HMQA 1U9YA 3KB1A 1EWTA 2DETA 3PHLA 3ZNNA 3HO6A 1BVHA 4DR6F 1LGYA 1N3YA 3LY7A 2VP3A 4NTZA 1KKUA 4RJLA 2OO4A 3KLEB 4BO7A 2AF6A 1YQQA 2L0XA 1UAWA 2DGXA 2H92A 1HOTA 3MR7A 3QF4B 4LRBA 2JD1A 3C14C 3UV6A 4M0CA 1OLUA 4DV6F 4UBJA 1UPFA 3V8NA 3PNOA 3TAMA 3UG7A 1UT8A 3K1JA 1GK8A 3OX4A 4MP8A 3RRGA 3BERA 4FZVA 3PUJA 4Q9IA 2PJZA 1YIJS 1WMDA 3KK3A 4CYMA 4M54A 1JQEA 1UM9A 2A0WA 4LDJA 4LF4J 4GWLA 1CJKB 1QGED 5SZHB 1CZLA 1NDHA 4R6XA 1TK8A 3VSAA 4BO1A 1WMSA 3LUBA 1YJ8A 1TKXB 3ANYB 3DM2B 4FXWA 2BT4A 1JWLA 2RJZA 2ZCUA 3LKBA 4V19J 3PA6A 4DJTA 2ZVQX 1YQWA 4IXTA 4HNVA 4OSEA 1IBMB 3RSQA 4C9BA 3SIPA 2IHNA 2C2YA 1G8KA 4DE5A 3O8OB 2J9RA 4G0XA 5GM1A 3MMPA 2J3JA 3TBKA 1HDEA 5CD4H 4LFCB 4QWBA 4TYNA 1JZTA 5JVDA 5BW6B 1OFUX 3GLHE 3SFGA 2QY6A 4XTRA 5E1MA 1BXGA 2W8BA 4EF5A 3JQ7A 1YRXA 4P4NA 2PVSA 2O14A 1JU9A 1L4GA 4Q6BA 3H42A 2P9HA 3JWIA 3OOWA 4RXTA 1RT3B 5D78A 3RSZA 1MA0A 4O59O 4IO9Q 2WW4A 1RXSA 3INNA 2CJXB 1Z3IX 3SNHA 1G2QA 2WPDA 1SOVA 2QV6A 4ZJLA 5FUVA 4TYQA 3BO2A 2QRZA 2B8JA 3DUWA 3GJTB 1AXRA 4X85A 1ZNXA 4ZHRB 2ZT7A 3NM4A 4X1KB 2IIBA 1NN5A 3JCZA 1SPBP 3F41A 2FPPA 5F77A 2C8LA 2ZHAA 3UG6A 1EQAA 3GP8A 2HK8A 4NI5A 3G8BA 2XLCA 4BQPA 1USIA 3HJNA 4N54A 1WI8A 3LUPA 4NX9A 1DUVG 2PZBA 3TB4A 1E2NA 4RUKA 4OHOA 3WP1B 1QTIA 5AESA 3A11A 4FYHA 5KYWA 3QE3A 3V1NA 1ZVVA 3I4CA 3D4PA 1M9NA 2V3WA 1P44A 4NZOA 4PAQA 2YBDA 5CH3A 3R7AA 4X66B 4BFUA 1WJGA 1SH7A 1W2IA 2PUGA 2H29A 3H7IA 5JAZA 1NPYA 4GYKA 5BQ5A 3UAZA 2DPJA 3CCJS 1OXKB 1U6ZA 3O8QB 3DNMA 4MVJP 2RGYA 1UK8A 3GJYA 1YOVB 3FLAA 3HT3A 1UADA 4NNOA 3E5NA 2Z1NA 1NF8A 2CXHA 2VH1A 1KJIA 1VL8A 1NA5A 4JUAA 1XTKA 2Z83A 5CITA 4AZ0B 2VG7B 3PNYA 1QM5A 2PZ8A 2QX8A 2W48A 3MMAB 5CZVA 4BP8A 2J9DA 2MEWA 2H5EA 1ACMB 1YG0A 2Y9PB 4L72A 3P2YA 4L8WB 2QEXS 3FNRA 3ZU6A 4R2KA 2ALYB 5JXWA 1U3DA 3IPAA 1N5YB 3SHWA 1HYBA 5AW4A 1TU0B 2HBYB 5IYZF 3GR0A 2XXAA 5DQIA 1OI7A 5HBGA 2V34A 3NHPA 3S2YA 4X6XA 1RVDA 3E8OA 1X70A 4FBUA 3ETLA 2OD2A 4CGYA 2FHOB 5DP2A 7FD1A 2CXQA 1US8B 5K09A 4XPEA 3TQTA 2Y68A 1YJQA 1Z39A 5BWMA 2R7MA 3BTVA 4JXXA 2MLZA 2I2DA 4C8LA 3I05A 4WOKA 1A97A 3B2EA 4MTLA 3M1LA 1VC6A 2AC7A 4CMEA 1XNJA 2XB2A 4BFTA 3EQ2A 2AK2A 2JLFA 2ZXEA 1N2BA 2FRDC 3V4FA 4YXWD 2O2JA 1KD1T 4BNFA 1NAIA 2XE6A 3D1OA 4CG3A 2LV8A 4QL3A 2XNRA 2HS3A 1IATA 2VATA 4II3A 2EIXA 4KE7A 1VLQA 1I8TA 1NN3A 3HV0A 4CLZA 5ES3A 2ZSUA 1HWYA 2IV3A 1KVSA 1QG4A 1VI2A 4A8FA 2EWVA 1I6LA 4GP7A 4DWWA 2FK7A 4MS1A 5BN1A 2LEBA 1RD4A 1KRPA 4RLFA 4OLOA 4F2SA 2CYCA 4JVLA 3S8SA 1Y6JA 1RBOB 2IPNA 2FE4A 1W34A 4K7QA 5KFKA 3CZ4A 3TM4A 2VTVA 4S1TA 3DGPA 5DPMA 1IRXA 5EZSA 4CNBA 1CNFA 3FB4A 2QZ9A 1ZS6A 3JWEA 4TXLA 1UBLS 1ORWA 2NWQA 4QT0A 2NTNA 2H3HA 3R3HA 4K87A 1EKXA 2OUGA 4LDNA 5FNVF 3P2MA 1EIWA 5HOQA 1SJ9A 3GQBA 1FI4A 1QTNB 4M1EA 2NYAA 1Z2ZA 2VYNA 4QDZA 1M5PC 4YUAA 1NK8A 1YR3A 3QGIA 4LWPA 5HQTA 4I55A 1KZ4A 5BO5A 2E2WA 2Q79A 4U00A 2XITA 4FONA 5CCBA 3VTZA 2VFAA 3QZ7A 2FPPB 4EMBA 1CC1S 3E8SA 2LCWA 3PC8A 5LP6C 2D8AA 3SZUA 3PHTA 1ZK4A 3TXXA 2XY5A 4Z9YA 1UM8A 4AJJA 4LY6A 4FYVA 2ZB4A 3K09A 1OAAA 3W1EA 2ZUTA 1XLTA 4ECQA 2GHTA 3LOPA 4GKVA 2O07A 3R7SA 5T64A 4UASA 1L7RA 1QTMA 1OV4A 2O05A 2HLNA 4U67Q 1MTZA 5IVKA 2HMIB 4FZ5A 3OPYA 4E1BA 5FWDA 3MN1A 1P2UA 4YCJA 1SEPA 4YMHA 1A9YA 1PFKA 3HJUA 3JARA 2V8VA 3PX6A 2P9BA 1XT6A 1NMXA 4ZAXA 4TLLB 5DYNA 2XKJE 2OAP1 2X6RA 4WA8A 2C78A 1KK2A 2X1LA 3MERA 3X1YA 1F06A 1T2VA 821PA 1Z0KA 2FRDA 4DVGA 4GM1A 1XTQA 5LFAA 3OZ7A 1Z5NA 5BSUA 1E9DA 4C4RA 4DV1J 1JYFA 5KTSA 4IDKA 1R0RE 3ZNJ1 3IRWP 4QICA 1EQ0A 1WDTA 1UFVA 4JITA 4BV3A 1KFCB 5B6PA 2CQGA 3UAWA 1TEVA 5CIWA 3GAMA 1KZYC 2J6BA 3BB5A 1VDZA 3T7IA 2NZYA 3VVCA 3MJDA 3UBMA 1X1QA 4L4ZA 1ZSNA 2FEWB 4R0VA 4M76B 3ZE6A 3WLIA 4Q2MA 4I4LA 3MPVA 2X3UA 4NI2B 2JFYA 2DR3A 3RD5A 3KJFB 3MUMP 1Y5NA 1T3NA 4QULA 1NNLA 2NUPA 3DDCA 4M8NE 4R25A 1A4XA 2UKDA 4N49A 3FBCA 1MV5A 1KYTA 4ZV9A 3AXMA 1B8UA 1UEIA 2KN4A 1UVJA 4U3JB 3UJBA 2FPKA 2GPAA 3T1AA 5HVHA 4RVDA 5EJ6A 5C2GA 2PSEA 2O01C 4ZOLB 3QHQA 4AVYA 5G53C 1PIWA 1F20A 2UZIR 1D09B 2C2ZA 3W5VA 4YRPA 1MV8A 2QL5B 3TZBA 4CR7A 1YS6A 3AUSA 1TW3A 2VJNA 4UULA 4XPZA 1EQUA 3DRPA 1HZZA 1GZ6A 5DHUA 2V6AA 5GV7A 5AXLA 3AR2A 4OYBA 1ZY2A 2YPYA 3J81j 2GBCA 5ALGA 2E49A 2W6OA 1LDGA 1M2VA 2P6UA 2GZDA 2OG1A 3W2VA 1FU7A 4O4JB 1WB4A 1T1JA 2K7FA 1Z75A 4MUBA 5BY2A 1P8GA 2PMDA 1WD7A 2WDZA 3RVNA 1XKXA 2EDAA 3NYWA 4LWZA 1NVAA 2Q0QA 1G8AA 4AECA 3ET5A 4FF4A 4G0YA 3RIXA 3ITDA 2POCA 5DM2A 4MB2A 1TKZB 3GCDA 5C24A 3F7OA 3M4NA 3AFNA 2JCXA 2YY7A 1JJFA 5LYYA 2QRPA 2MMYA 2OYRA 4OCZA 2F43A 4OHFA 4KIWA 2AF4C 4BEBA 1VL5A 1PUJA 4Y6OA 4EHFA 1EXWA 1U99A 4RANA 1CVIA 1VOTA 3QSIA 2HJ9A 5PGMA 2R2AA 3QYAA 1PV4A 3ETHA 1UPCA 3R40A 4GI2A 4DV0J 2GB4A 1OPIA 1VPTA 3KB2A 2E4UA 3BK2A 3ZWXA 4E11A 3L07A 1BOFA 4MUAA 2GK3A 2ZH7A 1VE1A 2JC1A 2A3RA 4C22A 5D3MA 1H8HA 3NC1C 5M5BA 4Q3CA 3KBBA 1DBIA 2PS3A 1O0SA 4YCMA 4TVAB 2HRDA 2VJBA 4P7TA 4IH1A 4RZ3A 3V6HA 3MLEA 4K8RA 1KMNA 1HI8A 3ZNOA 5ALSA 5KG7A 2C29D 1ZZEA 3VC2A 4MMYB 4XRGA 3GEDA 3K09C 4PG8A 2Y1JA 3EXHA 2XHCA 4E0BA 4XB2A 1HYHA 4Y2UA 4PG4A 4K9QA 3DRPB 1XA3A 4DEVA 4LRUA 2VBCA 2WLTA 1YIDA 2PUDA 2EG2A 3CMCO 5AQ1A 4QJBA 2VN8A 1WMEA 2VBGA 4KB5A 3QBDA 5CVVA 3G02A 1H6AA 3QEKA 5CT5A 3KLBA 5E9JA 4MRMA 2V9CA 4K9PA 1PTKA 4GL2A 3G49A 4D9MA 4BS9A 3CCBA 5BW4A 3D8UA 2G2YA 3ZO7A 5AIAA 1FP7A 3ZWDA 2FTRA 3FVQA 3VOAA 1IJBA 3EGDB 3BGSA 2QV7A 1B0AA 3HCRA 4P52A 3TJAA 3KK2B 3EMTA 2V4ZA 4X84A 3IP9A 5JDCC 2IPAB 1RE0A 1WTAA 1YB5A 2HPHA 1IY9A 3W2IA 2D1YA 1T13A 4GVLA 4L6IA 1RRPA 4WCDA 4LI3X 4K7JA 3NAQA 5A62A 4GD3Q 4RKWA 1XZMA 5IAEA 5IASA 2EW2A 1L7PA 2NO6A 5IZCC 2UVRA 1C5KA 1W36D 2OXTA 1YO6A 1D8YA 1S1CA 4MRVA 4ZI5A 2DIUA 3NUZA 4HRXA 3Q1LA 4DZRA 1QGOA 3OEWA 4GOJA 4L4RA 3U9TA 4K6FA 1Q7YT 2Q5IA 3GDHA 3PF9A 1A7AA 5BOSB 1R0KA 4NR0A 2ZRIA 4Q82A 2X0EA 4RADA 2Q45A 4BMPB 4C2UA 3NHZA 5L3ZA 4D57A 4CWAA 4U95A 5HMXA 3DM2A 5H16A 3EZYA 1KY3A 4U7TB 2W01A 4A8YA 2QN2A 1JE1A 1DCKA 3EXHB 2ZJ0A 1Y89A 4CCWA 1UL1X 1FE4A 3KDNA 4B6SA 4ZCKA 3HYNA 2FW9A 2WHQA 4XX0A 2JLCA 2EXUA 5KMGA 4F4UA 3WXMA 4F3YA 3F6RA 3P3DA 3WGMA 3DTVA 3X1JA 4PR3A 4YJ3A 3QFWA 3JD1A 3ZW8A 2FEAA 2P2ZA 5CDYA 1IEVA 5J1PA 4US1R 3GFRA 1MOSA 1Z36A 4R7TA 1OROA 4MQ4A 4P2GA 3MXOA 1ZQ9A 1LZKA 4CM8B 3DDKA 3S8MA 1SQSA 3IUPA 1GV1A 4EUSA 4H6VA 1XBTA 2F43B 1X14A 3DEZA 5CDTA 4OOEA 3PCXA 1Z0AA 2JIMA 4MCHA 2A35A 5DI9A 4UZBA 1ZXXA 1E0SA 3C4VA 4L3WA 1UPTA 3EZFA 5LB4A 1CUDA 4QZVB 3PITA 4UE6A 1UFLA 1VRUA 1GMVA 2V8DA 4H18A 4NYOA 1EVZA 1QRSA 2HLDD 3I6QA 4DMMA 3BDIA 1CP3A 4QXPA 4J1TC 4X92A 1JFSA 3AIIA 3KUKA 4L08A 3DZIA 2Q66A 1WL8A 5LWQA 3TX2A 5H82A 1E3LA 2X2EA 3IUYA 2ECPA 2W6CX 2BGWA 2DT8A 3E27A 2GRJA 1TCCA 2J7WA 3ZXWA 1G38A 3RQIA 2V8PA 3RS5A 4ZK2A 5A2QY 4UOEA 3AVYA 1TIPA 4ND8B 3X1MA 1A0OB 2YKNA 2QLJB 4EITA 5A2QU 2G9OA 4OIFA 1OV6A 4XJSA 2CL0X 2G0CA 5I9BA 2JFFA 3WHIA 3O21A 2ID7A 3EXHC 1RYSA 4RK7A 4PO3X 1MVOA 5EN1A 4LBZA 2BFEB 3TR0A 1EX6A 1XALA 3IKJA 1BWQA 2PLAA 4LFCJ 1CEQA 5AOVA 3TUIC 4O02B 2P3SA 1IWBB 2IKSA 5H81A 2VBFA 1N5YA 4NS4A 3ZCVA 1IONA 3H04A 1D8AA 1OCEA 1XAGA 4RHXA 1CS0A 3ZTYA 1XR5A 4GVBA 4LE2A 4KAJA 2BFBA 5AFSA 3CU5A 5CUQA 3PNPA 3TL6A 3BK1A 6Q21A 5K0EA 4B3MJ 4PCQA 3HA2A 2Q21A 2DD8S 1YZVA 2I4OA 1X9WA 1YGYA 1CULB 5LMNF 3PXDA 2XWXA 2M98A 3W1YC 1GCOA 4HDOB 2DUWA 1A2KC 3J7ZT 2NLOA 5KNCD 4Y0VA 3J7AC 2WHYA 4KLAA 4G84A 5EP1A 1RACB 3BTOA 3GGDA 1N2HA 1T91A 5LUAA 2WTFA 2GYWA 4UM9D 2BH2A 4DHVA 2YKMB 4GM4A 1QFMA 3DMHA 3CCVS 4JKOA 3A9SA 3CC2S 1C8VB 2AXEA 4EGSA 2GEDA 4HQRA 4F6RA 5BSHA 2VDOB 3MM8B 4Q7KA 3GVXA 4RH3A 2GD0A 3DDHA 4IDCA 4J2TA 3L93A 1LUAA 3JQFC 5EE5B 3ITNA 2PMWA 4KE5A 1ZITA 4B2LA 1SL1A 3LVRE 3RBDA 2Y77A 1NBME 3MUEA 2GJ4A 2OUIA