1VQ7S

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vq7S00
3UD4P 2K3KA 2DNMA 2DGXA 1UW4A 3G96A 1BY9A 1NO8A 2CPJA 1YWXA 4WFBQ 2CQ4A 3CCUS 3BO4A 1HD0A 2U2FA 2F3JA 4FXWA 2VONA 4WIIA 3H2VE 2DHSA 2BOPA 4QU6A 1H2TZ 2CQ2A 2OIHA 1YITS 2DO0A 3MDFA 2L08A 2KM8B 1YJ9S 2E5JA 2DK2A 3P5TL 1HL6A 1R8PA 4LJMA 3OW2R 2DNZA 2MQNA 1N54B 3VAKA 2XS5A 3S6EA 4PRFA 5GAEU 1VQNS 1WF1A 2FC9A 3BS9A 3TP2A 3NNCA 2MKHA 4RU2A 4UY8T 2KT5A 2MZSA 2M9KA 2DGWA 1CVJA 3MXHP 3BO2A 2VOOA 2CPHA 2EK1A 2K8GA 4WFNQ 2EVZA 4WFAQ 1HD1A 3CCVS 2XNRA 1JJ2R 2LXIA 3FEYB 2X1AA 1RKJA 2DGTA 3EGZA 2DITA 3G4SS 1W2BR 1VQ5S 2BZ2A 2CQPA 2YWKA 1DZ5A 2CQ1A 1DRZA 3CC7S 3CF5Q 1N88A 4UQTA 3UE2A 1X5SA 2FC8A 1YTYA 1X4DA 2N3LA 3BO3A 4OZ1A 2D9OA 3FEXB 4A8XA 2RRAA 3VF0B 3THTA 5GADU 3R1HA 2MGZA 2KHCA 2JX2A 3NS5A 3G71S 3VAJA 1NJIT 1M5PC 2MQMA 1WHWA 2M4MA 2GO9A 4TU9A 3EX7B 2JVRA 2OSQA 3BEGB 4WF9Q 2KN4A 1WELA 2KM8C 1M5VC 1M5KC 2RT3A 1VBXA 2FHOB 1PGZA 1WHXA 2VODA 3VAGA 1WEYA 2KRBA 2DNKA 2QFJA 1D8ZA 2FPHX 4C4WA 3MUMP 2ZJQQ 5MLCV 1U1RA 1S79A 1X4AA 1U1KA 1Q82T 3MOJB 2RQ4A 1ZZNA 2I2YA 1WHYA 2J76E 2L9WA 3U1LA 3IRWP 1O0PA 2G4BA 2KXHA 2Q79A 2JWNA 4CH1A 1U1NA 2ZJRQ 1U6BA 2KU7A 4M5DB 3CCES 1ZZFA 1F9FA 2DO4A 1D9AA 1WTBA 2LEBA 1P1TA 1X4FA 2G1DA 1FHTA 2MQLA 3UWTA 1K8AT 1K9MT 1FJEB 1DBDA 4YUDA 2NLWA 3B4MA 3VAMA 1UFWA 2MPUA 2M0GB 2B0GA 5HO4A 3S01A 3G8SA 3CC2S 3VALA 3ULHA 1X5TA 2CPIA 2OSRA 3V4MA 3RW6A 2MKSA 4P6QA 2MXYA 2DHXA 1WF0A 1U1MA 4ZKAA 2RS2A 2DIVA 3I56S 3UD3P 4F02A 1FXLA 2M88A 1H6KX 4WKRA 1M5OC 2DNPA 2MKIA 2D3OR 3CUNA 2MZRA 4CIOA 2CPDA 1VQKS 5DDPC 5CA5A 5GAGU 2I38A 1UAWA 3CTRA 3JB9k 2KH9A 1YIJS 4IUFA 1OWXA 1WEZA 1A7GE 4TLQA 2OTJS 2RU3A 2KG0A 1YJNS 1U1LA 2RVJA 2DH8A 4CQ1A 1R8HA 3SDEB 2MZ1A 2MSSA 3NNAA 2CQDA 5FJ4A 1WG1A 3CCLS 4J5OA 2KG1A 1A9NB 2CPZA 1Q86T 3MURP 2DIUA 3L3CA 1S72S 4LIRA 5GMKa 3CCMS 3P6YC 2MMYA 2ZJPQ 2DHGA 2LEAA 3P3DA 5BJRA 2DNHA 1WG5A 1KOHA 2DNYA 4ED5A 3S7RA 1WI8A 2DH7A 1VQ6S 1K73T 3IWNC 2N3OA 3VAIA 4Y00A 1QM9A 1X4CA 3LPYA 2CQIA 4Y0FA 3CMAS 3B4DA 1H2VZ 1N8RT 1WF2A 2YKAA 5HL7Q 1YHQS 4IO9Q 3VAFA 2MQOA 5D77A 1OO0B 2YH0A 5H1SV 5JVHQ 2MZQA 2F9DA 2ADBA 1L3KA 2LYVA 1X4BA 2MJNA 4OZ0A 4PKDB 1DHMA 2DNNA 2HZCA 2QEXS 2RNEA 2DHAA 1WWHA 3U1MA 1WEXA 1FT8A 1VQ8S 2DNGA 2XSFA 4PR6A 3UCGA 4W92B 1YJWS 5EN1A 2MJUA 3MD3A 3MUTP 1SJQA 2O3DA 2LECA 3Q2SC 2XNQA 1X5OA 2OTLS 4IOAQ 3UCUP 2GHPA 3G9CA 2OJ3A 5IFMA 4EGLA 5DDQC 2DNRA 1OPIA 1Q7YT 2JRSA 2HYIB 3UCZP 1WI6A 2ADCA 2LA4A 2HGLA 4FXVA 3Q2TC 3CPWR 1HA1A 2CPXA 2LKZA 3CCRS 5D78A 3US5A 4TU8A 2RQCA 1OIAA 1VC6A 1P27B 2MY8A 5JVGQ 1VQ4S 1X5PA 2E5GA 3PIOQ 1Q81T 5IQQA 1SJFA 3DLLQ 2KYXA 2A3JA 2DH9A 2MQPA 2DGVA 5DDRC 1JMTA 1VQOS 3CXCR 4BS2A 2DNLA 1G2EA 1SJRA 1VC5A 3S8SA 1SJ4P 2X1FA 1X0FA 2NZ4A 1QVFR 2L41A 3PIPQ 3I55S 3ZZZA 2X1GA 2XS7A 4YOEA 5IM0A 2YTCA 4IOCQ 4F25A 1NU4A 5DM6Q 1YI2S 5GAHU 2CQBA 1KQSR 2CQ0A 2RUGA 3SMZA 2PE8A 3CCSS 1IQTA 5LXRA 1M1KT 2MB0B 1VQ9S 1VQMS 4C0OC 1XN9A 1KOOA 1U2FA 2M2BA 1U1PA 2KFYA 4QPTA 3H2UB 1SJ3P 4QQBA 2RS8A 3CC4S 2MZTA 1U6FA 3MI7X 3SXLA 5LXYA 1VQPS 2WBRA 1VQ7S 2DGSA 4TU7A 2LMIA 2MQQA 1RK8A 2G0CA 2F9JA 2M8HA 2CPYA 1AUDA 2FY1A 3TYTA 3LQVA 2HVZA 4Z2XA 2M8DB 4CH0S 4W90B 2M70A 4LMZA 5LSLA 3VAHA 1FJCA 1WG4A 2U1AA 2MY7A 2MKKA 3G8TA 3SDEA 5DM7Q 2DNOA 2CQ3A 3D2WA 2X1BA 2CPFA 3MUVP 2DISA 3HI9A 1VQLS 2MKCA 1ZH5A 2SXLA 2AYEA 1SXLA 2MHNA 1VBYA 1PO6A 2DNQA 1FNXH 1U1OA 2MGZB 5LSOA 3CCQS 3R27A 1H2UX 2DGOA 2DGUA 5GVQA 3CMES 2N82B 4U67Q 2PEHA 1N52B 2RRBA 2N7CA 1URNA 4V19X 2XB2D 2CQCA 2D9PA 2DB1A 2J0QD 1UP1A 3G6ES 2KXNB 2LQ5A 5ITHA 2LCWA 5DETA 4ERDA 5LJ3Y 2VOPA 3RW7A 1M90T 5DDOC 1JJ4A 2AYGA 2M7SA 1FJ7A 2KVIA 3ZZYA 2QA4S 2MZJA 3R1LA 3CULA 2J0SD 2E5HA 5CYJA 2HGNA 1WHVA 3CD6S 3NS6A 2E5IA 3THPA 2YH1A 2M52A 1KD1T 3EGNA 1FO1A 1U1QA 2EK6A 3DXBA 2LXUA 1X4HA 2DGQA 4YB1P 1QVGR 2AYBA 2CQHA 3TO8A 1JJHA 2CQGA 5LJ5Y 2XS2A 2CJKA 1X4GA 3N9UC 3CCJS 2MSTA 3J7ZT 5CXTA 3K0JA 2CPEA 3J7YU 4QU7A 2AYMA 2KI2A 2MYFA 1VC0A 3NMRA 1B7FA 2MKJA 3MD1A 4WCEQ 2AD9A 4C7QA 1VBZA 4F26A 2ERRA 3NNHA 2J8AA 1X4EA 2KRRA 3HHNB 3P49B 2LA6A 2HGMA 2KXFA 1KC8T 2UP1A 2E44A 2JVOA 5IM0B 2V94A
chains in the Genus database with same CATH superfamily
4FYDA 1F5BA 3DYAA 1F0XA 4F8RA 2M3DA 4FPIA 3BN4A 3HFZB 4CWBA 4Y65A 4ZIWA 1KTQA 1OQ6A 4MAKA 3U27A 3QFHA 4I67A 2AQ4A 3KLEA 2DO0A 3GZ7A 1WNEA 3ILLA 3R7NB 4ZS6A 3ZZOA 1W25A 1U0HA 3KG0A 4QR0A 3RR7A 2WRMA 4USIA 2NYHA 3S6EA 3DRPB 1S1UA 2O01C 2KJWA 2DGWA 3E8OA 4K4XA 2DJWA 2F4VJ 2D7SA 5F9NA 4ZVRB 1GMWD 2H4WB 3JSRA 4HR2A 3A8KA 2DITA 3OR2B 2FLLA 4DR2F 1DZ5A 2Z56B 2ZZNA 3KK1A 3DRRB 4RNNA 3BKUA 1FDDA 3TUIC 3VF0B 2IVYA 4HHHA 3W7BA 3M6WA 2JX2A 1NJIT 3DXSX 3LP0A 1GXLA 4FNHA 4NPOA 2W9BA 1WELA 2KM8C 1M5VC 2RT3A 1PGZA 2V8VA 2YNFB 1HQ2A 4P2SA 2P6TA 1ZZNA 3RAMA 1WHYA 3T19A 5DG8A 2MDAA 4M1KA 1FK9A 2UV8A 3J7YI 3D67A 3CCES 4I1TA 1K1QA 3HO1A 3CD5A 1FWPA 3FC9A 5HO4A 2B0GA 3ULHA 5K8OA 3ETOA 3C66A 3AOBA 5BR8F 1N36F 4DG1B 1SL2A 3NAIA 3CDBA 1S1TA 2XMTA 2YX1A 1CULA 2CPDA 3GJRB 4O0NA 4A47A 3PW5A 1RADB 2P9EA 1OWXA 1IM6A 4OX7A 1HWJA 2RDDA 4AXIA 5C42A 4MKBA 2HHPA 4DX5A 3IXQA 1YG0A 2BM0A 4I4BA 4RUCA 2AMCB 5M2RA 2HNZA 2Z57B 5GMKa 2W9CA 3HHLD 2XY7A 1B7YB 5BJRA 3ISZA 2DT9A 5F8GA 2J6TA 1T9UA 4OJ1A 3AA9A 3MMBA 4JI7F 4FVMA 1VFJA 4IQMA 4C6AA 5CZVA 4EFAC 3WC2A 3CD0A 1WWHA 3CT9A 3KK3A 1VJQA 3H59A 2HVDA 1QE1B 4ES2A 2LECA 3MPUB 2EBEA 1FTRA 2ZBQA 4HDHA 1BXNA 1PG5B 3ET6B 3ZZRA 3RTVA 3KHLA 3TA0A 1OIAA 3RU0A 1VQ4S 2QLBB 4I2PB 2R8JA 3CJQA 2DY1A 2ZKTA 3QSYB 2HQCA 3TJ8A 3BGRB 3BZQA 1EP4A 1SH3A 3KK2B 2NZ4A 4ILLA 5KFTA 3KUEA 2WVFA 4J9QA 4YEAA 1FE0A 4DDFA 4HH1A 4YOEA 1QY7A 3NMAA 4XPEA 1NU4A 2J5AA 3HPOA 2P9CA 5HVGA 1GXTA 3O3LA 4KIAA 1U24A 2FZCB 3DLKB 4DCOB 2FJDB 4NZ6A 1SKRA 1XN9A 2DR7A 2RH3A 2DEIA 1WSVA 1SJ3P 1U6FA 4IFVB 4PXDA 4RW9A 5F8HA 4TU7A 1U6ZA 2GIFA 3BBCA 2HRUA 5D0GA 2DXDA 4KGZB 3MZIA 4Q5VA 2DNOA 1NCLA 2JHEA 4LF9J 3X3UA 2OEJA 2DISA 1SV5B 3ILJA 1HWKA 4OI4A 3W62A 1NDLA 3CCQS 2RAQA 2DGUA 2PEHA 1N52B 4ZVPB 2CQCA 5LMUJ 3UN5A 4EMDA 1JJ4A 3AH6A 4A4JA 1ELOA 1NSQA 3R1LA 2C1EB 2OH2A 4DUYJ 3ONQA 1N5QA 3E2EA 2HKEA 2I8EA 2C3MA 3DLEB 1SCJB 2RU9A 4DUZF 3T1HJ 4OZ2A 1JJHA 2HIQA 4QIEA 3PRDA 2CJKA 3K2YA 2ZH7A 2YNGB 3TW0A 3MM7A 3I82A 4I69A 4C7QA 1FDNA 3KLVA 1JK9B 1TP7A 4EU0A 2HGMA 2NUUG 2PGCA 1RA7A 3QGGA 3NS7B 1XR7A 4OX6A 2IM3A 5KT3A 4EO8A 2I1RA 4YY3J 1HR0F 5CYMA 5DJBA 3MECB 2V50A 4G1QA 1R27B 4EI2A 1FKAF 3H2VE 2HQDA 2FD2A 4ZP9A 4OHZA 2KM8B 4USJC 2QGFB 2FHKA 1HI8A 2Q6CA 1RAAB 1N5TA 1RTHA 4DV5F 4X4UA 2IJFA 1Y0HA 1M5HA 4RBTA 1JIHA 1ZA1B 3DDIA 3MXHP 2VOOA 4NCGA 4DL4A 3QJJA 2EFQA 2VL1A 2I5JA 4OYZA 1FDBA 2CQPA 3V6DB 2V4RA 3D28A 1WC0A 1X0PA 1PAUB 4I68A 3BO3A 3QAUA 1VI7A 1DTTA 1JKHB 4CM2A 4ECUA 2RB7A 5KFZA 1VK8A 3J81U 1WHWA 2OSQA 2GVZB 3C8YA 4MKVA 4L73A 3V5RA 4DBQA 4ZVFA 4MFBA 2ASDA 1TL1B 5KFJA 2LFVA 4X66J 3UW1A 4B3SF 1S6PB 3NGDA 3MOJB 3OBIA 1OPZA 2R7QA 3H5YA 4YP3A 4JYAJ 2NXEA 4O44A 2YWFA 5G0RA 2MQLA 3B4MA 4LFBF 3SV4A 1DFDA 5E3AA 2GAHC 1FXLA 3MMAB 1WTFA 2CVIA 2YQ0A 4C0HA 4P2MA 2P6SA 4HH0A 1YK9A 2VU5A 4KJIA 2B56A 1YBAA 5J2NB 4KY3A 5KFDA 3DLKA 5HBMA 5L1KA 4UOGA 1XIQA 1YBUA 3NNAA 1GNKA 1J5OA 1UVIA 2WVBA 2RIJA 1HBMB 3NG8A 4HHUA 1U48A 2DHGA 2LEAA 3P3DA 4ED6A 4LRFA 4C8NA 1VQ6S 4LBHA 2YKMA 4QIVA 4KFBB 4AL6A 4DL2A 2W2MP 3G6YA 1YHQS 1AUSL 1JLFA 4LF7F 2CJYB 3MCMA 5AT1B 3TOQA 3W9IA 4L76A 5H9FJ 4ILRA 1LW0B 4DV6F 2XNQA 4X4NA 3MPVA 1E6YB 4ER8A 2W8KA 4NA3A 3PYGA 2HMIA 1RHQB 3PYFA 3LOUA 4CLZA 1VC6A 1P27B 4ZLPA 1HMVA 3EZOA 5DG7A 1IR1A 1FF2A 1TTHB 3PFEA 4LSZB 1SJRA 5B0EA 2EFNA 2QLXA 3PXGa 3LAKA 1REGX 1QVFR 3I55S 2CDRB 2JEIA 3CJ8A 3IR7B 1M0SA 4ZVUB 3MAQA 4NZ7A 4RNHA 3TJAA 4DQRA 2UUBF 1KDNA 3GB0A 3NOCA 3W61A 2B9WA 4ES1A 3GIIA 4GKJF 4Q2MA 3NOGA 4K4SA 3MMCA 3MPWA 2HWIA 2F63A 2J9EA 1HBNB 3WX8A 3MR2A 4ZJLA 2V8PA 5HMYA 2ZDOA 3TEHB 2W2QP 4CH0S 3Q8SB 5LSLA 3HJFA 2HS4A 1LK7A 2BOAA 2QIFA 5CD4H 1RTIA 4LRCA 1U26A 1RTJB 1FNXH 1C2PA 3MR3A 4O3OA 3GE9A 2WBMA 4BHQA 2HHWA 3Q0AA 5L39A 3O2IA 3M2UA 2BW2A 2ILZA 4DL5A 1T3OA 4BC7A 3BPSP 2QSFA 4MJKA 1HNXJ 3THPA 3CNQP 1HHTP 3EGNA 2V2VA 4X4VA 2BJ3A 4DI6A 4NLGA 1N33F 2VPYB 3DM2A 4ZOSA 3PJ9A 1RSCA 2PO4A 1S6PA 2MKJA 2OAUA 4C8MA 2K2PA 1TELA 4HL9A 2KRRA 3IBFB 1RCXB 4WK3A 1S59A 3ZTSA 2JVOA 5KAKA 1RWKB 2OMLA 3G96A 4PWDA 2HQGA 2WOMB 3CCUS 2LQ9A 3OQ2A 3PCOB 3QWUA 1Q79A 5AE2A 4CLFA 3PRVA 3ZTQA 2P8IA 4FXDA 4CT9A 2HHVA 2YXLA 2DK2A 4JI0F 3N79A 2CDQA 5EWFA 2WK4A 2XS5A 1S10A 4RNOA 2A6MA 2E9RX 4DQQA 3UNYA 4HT7A 1RWWB 1C1BB 3E01A 3BO2A 3C16B 3RBEA 2LVWA 1G6BA 1VLOA 3FFIB 3FRYA 4WP8A 1DJ0A 4CLSA 1VCTA 1FE4A 1KWMA 1U47A 4RW6B 2V4JA 2GNKA 5HSPA 2NPIA 3T1AA 5AXKA 2QL9B 3IAS9 2JLEA 1HBOA 1O8BA 1WC4A 4KQZA 3HHDA 1SB6A 2RUSA 1KRPA 2FJXA 1NPKA 3JSYA 1IR2A 4QZVB 1V3RA 4ZK7M 3RAXA 2X7IA 4LF5J 3DRSB 3M1VB 4P9SA 5F0UA 1LW0A 5B7WA 5KG7A 5MLCV 1NK6A 1S0NA 2Q79A 3AY0A 4WZMA 3OTOF 1VHIA 4M5JA 2XTJP 2FVCA 2KU7A 1F9FA 1GX6A 2CNKB 5EUHA 4QIFA 3M6XA 5IC4B 1XMOJ 4YR3A 3D3BJ 3ZTOA 4P6QA 4IR1A 2B5JA 2GGPA 3UD3P 3DNCA 2Z0GA 1BQMA 2JZ5A 2WSEC 4OI0A 2VG6B 2XG8A 2WONB 2VPWB 1P1LA 2I38A 4M5HA 1YDLA 2KYZA 1YIJS 2AP6A 3DCAA 3AOAA 3WDOA 2DH8A 1HWLA 4O4GB 4M5GA 2R4FA 3WX4A 1S6QA 2QC3A 1Q7LB 3MURP 4Y2IA 4AL7A 4MK9A 1RB0A 1NDCA 1S4FA 2GMJA 2ZNYA 2Q3PA 4H4OA 1FKPB 2EKYA 4FBTA 2Z30B 5BYSA 3DU6A 1H2VZ 2FUG9 2XZTB 5JJBA 1WF2A 1NZ8A 1TL7A 4DR7F 1NJXA 5C25A 3N5BA 2LYVA 1NDKA 4B3TJ 3JYTB 2QEXS 1IXKA 2W24A 2HS0A 3UDCA 1CJKB 2AEMA 4TQRA 1VQ8S 4DQIA 5L9NA 4ECTA 1C0TA 4PUOB 1U0SA 4X62J 3MM5A 2BW7A 3HVTA 2DNRA 3DI6B 5AXNA 4OYMA 2FHMA 4ZPVR 2QA2A 4D3GA 2A10A 3P96A 1TK8A 1ZTWA 1VQSA 3Q23A 1XNQJ 3KDOA 4ED2A 4ED8A 1VC5A 3TQ1A 3MM9B 3PIPQ 4X4TA 2XWXA 4RUAA 3ZNUA 4YDXA 1VS3A 5HROA 3AXMA 5LL6d 2PE8A 4DR4F 1IQTA 5EDWA 2AHOB 2WOMA 4G1PA 1IKWA 5JXSA 1RWXB 1VIXA 3SXLA 1F6TA 2WBRA 3A8JA 2DGSA 4N77A 3H25A 3K8WA 2IM2A 2MY7A 5FD1A 2X1BA 3MUVP 5KT7A 3SEOA 2K1RA 5AXLA 3M9OB 1Q4RA 3MAAB 2IC3A 3EPGA 1LFWA 4OZ5A 5ETTA 5HANA 1CQMA 2HWTA 2VQEF 1L3UA 3IM9A 1SKSA 5KFYA 2B51A 1M90T 4DPUA 4DV1J 3QT6A 4PYAA 1VHFA 5DGAA 2LDYA 3QO9A 4ZVSB 4P73A 3F73A 4WU2A 2V2KA 2YWHA 4OZNA 2AEJA 2F4VF 4EZ6A 5FLXU 3W2WA 2QA4G 5K8MA 2E1PA 3H90A 4IDKA 3N9UC 3K0JA 2CPEA 1X8DA 2J9DE 3HT0A 1N5YB 1LW2A 4QIGA 4JI8J 5I4MA 1NHUA 1V5VA 4E2FB 2YKNA 1GK8A 5IM0B 1J27A 2JEJA 4LF6F 3L7UA 3THVA 3OTDA 4MK7A 1V6HA 3G86A 1Z2LA 3SI8A 3OL6A 1K0TA 3G2XA 2OP5A 3PW4A 3Q24A 1R7IA 5L1JA 3IAM9 2NXCA 4WJBA 1BLUA 2XY5A 2UV8G 3UFCX 1S49A 3UDEA 2ZITA 5E5NA 1PJ5A 1WF1A 2MZSA 1KSPA 3HT3A 5CHCB 1YBTA 3TQEA 1T11A 1UJ6A 1JJ2R 4C48A 1QUPA 1VRUA 3CF5Q 4WXOA 4NWBA 3UE2A 2QZ8A 3GWCA 1HBUB 2D9OA 3FEXB 3SIPB 4S0MA 1N0VC 3R1HA 4JBCA 2QLFB 2KHCA 3NS5A 3PHEA 2MQMA 4C8ZA 1LWCA 3LTOA 1SH2A 2RJZA 4KV8B 2CNOB 3JYTA 3M05A 1UVKA 5A8WA 2PC6A 3DHWC 1SQFA 4LRAA 1U1KA 5CYQB 1T03A 2ALZA 4PWUA 3QMQA 4FYYB 2R7RA 2L48A 1TVRA 4KGKA 3ILIA 2V6AA 2D3O1 2LEBA 2G1DA 2NLWA 4RLEA 1RT3A 3FMBA 4FYWB 3PDNA 4ID5A 2ZWPA 1MU2A 3GJQB 4IRKA 1RT2B 2W9AA 2RS2A 2HG4A 1H72C 2A2DA 2WB1D 1LOUA 3BJYA 1Y10A 3QSIA 4IH7A 2HHQA 4NMLA 3JB9k 1PAEX 4HVZA 4CTAA 1D0EA 2MSSA 4OV6A 2IVMA 4WE1B 1AXQA 1R8BA 2BRKA 5E3QA 1NJZA 2J7WA 3K5LA 2MMYA 4Z7CA 1KLMB 4OYOA 3LGNA 1Q53A 3U1NA 2EG2A 4C97A 5A8KB 1P9QC 2YNIB 2NZCA 1I94F 1X4CA 2I6WA 4Y0FA 1QTMA 3G8QA 3KG1A 3TAMB 5HL7Q 4IO9Q 2YH0A 3DGPB 2AWZA 3KLGB 3UDVA 4LVOP 2YQ3A 4FNIA 3DDNA 3CO0P 3NKYA 2AIRB 1RZMA 5HMXA 3C3LA 2VG7A 3MM6A 3MD3A 2H5IB 3R8YA 1H7WA 2ZKUA 5IFMA 2WHOA 1Q7YT 2JRSA 2BKNA 2BJDA 3KWMA 2LA4A 2HPUA 4C98A 4DFKA 1ROFA 4KO0B 1HNIB 2IIHA 3KLHB 3TWZA 3BM7A 1SPBP 4IH6A 1E6VA 2B7CB 1L3TA 2BDPA 3LP1A 1QDUB 1TKXA 2GHWA 2VQFJ 1RISA 1JX4A 3ZZZA 3GCWP 2BM1A 5IM0A 3ZFVA 4DUYF 1NPPA 1RACB 4LREA 4AL5A 4MYTA 2ZFHA 4ZVGA 3QT8A 3T1HF 4NLYA 1VDHA 1RXOB 1FX2A 4RJVA 1ZPWX 2AX1A 4FF4A 3OD2A 2CZ4A 2B8PA 5A0YA 1N6QA 3J81Y 4OZJA 4ED7A 1RUSA 2V8HA 3GIKA 1WG4A 4KAIA 2ZH9A 4WTOB 4R8UB 3D2WA 2ZEJA 1SUQB 2C22A 1YRUA 1UJ4A 2M5YA 1MG7A 5E41A 4KGMA 2RKIA 3PHTA 2H1YA 4YY3F 3FQLA 2RRBA 4ECVA 1HYSA 3OUYB 1W26A 2D3UA 1HNVA 4EYIB 3MEDA 2VOPA 3RW7A 2YQ1A 4KPCA 4G65A 3TUPA 2PFFB 1VBKA 2E5HA 3NS6A 4FPRA 4J9RA 4X65J 2E9TA 2GVDB 2VKRA 3EXYA 5A6PA 5KG0A 1S9GA 5KFWA 4DWIA 1WKJA 4M5KA 1AZSB 4H4MA 2E1CA 1NMEB 4ZCMA 2KTQA 3M32A 1AYEA 1TUGB 4QU7A 2WVEA 1HPZA 4RR5A 1QD1A 2WCXA 2N7YA 1JLEB 1CPZA 2ERRA 2IJNA 2VFTA 4N41A 3GJSB 3M8PB 1YWXA 4ZHRA 4PQUB 2KT3A 5CH7B 2HAFA 5HATA 2V5HG 2VONA 1IBMJ 1SKWA 5DLGA 4F0HA 1H2TZ 3I4HX 3T41A 5K8PA 1QAXA 1RAIB 2RE1A 2FVRA 4USWA 4X66F 3M8QA 2YKPA 1RE1B 4R25A 1RYRA 3KUGA 3PZPA 1NDPA 8ATCB 1EETB 2HNYA 4USKA 5GAEU 2V34A 5M2UA 3BS9A 4JYAF 2HURA 1VQYA 3N6MA 4WE1A 3K5NA 4WFNQ 4ZP8A 2EVZA 1N34J 3CCVS 4C3MA 2P2CB 4ZLJA 2DGTA 1M1HA 4DZ6A 2XYHB 2ZOFA 1YJUA 3P5BP 4WPAA 1C0UB 4TY8A 2VPZB 3CDWA 5IWAJ 2EXUA 2ZZTA 4RZRA 5GADU 3UDLA 4ELVA 1YJTA 2M4MA 1UW9A 3FMWA 3KLGA 1Y3KA 5K14B 2V9WA 3HFKA 3W5ZA 5KFSA 3OTEA 1D8ZA 1RP5A 1OSCA 3NXZA 5IS2A 1SI9A 3VQSA 2KFZA 4F2SA 1RWMB 4DR1J 2RILA 4M5DB 2JLFA 1FA0A 1WTBA 4B3OA 2LQ8A 4HHJA 3W5YA 1Y5LB 2Y1LB 1X5TA 3BBFA 4MIBA 1RT7B 4ZKAA 3QJLA 1N56A 1X7VA 3CUNA 4JI7J 4NRUA 1VQKS 5DDPC 2BE2B 3CTRA 3W60A 3C14B 1A7GE 3KJVA 1Z2ZA 1S1WB 2ZD1A 3CJKB 1Y4ZB 5H9EK 4XIUA 2V4QA 5FJ4A 2V69A 4PXBA 3I9ZA 4WFZA 2HHXA 3HKZD 1TMJA 2CAJA 2L3MA 1WKLA 2UVVA 3BQ2A 2KL8A 2OHDA 2A1BA 1NK5A 1KNZA 3DHXA 1EJ7L 3DRXA 4NLUA 2BANA 4QOTA 3MEEB 1LKZA 2HZAA 5H1SV 2GQCA 4ETZA 5T7LA 3ZNJ1 2ADBA 1C4AA 4DR3F 2NS1B 5KT2A 5SUHA 3RGIA 1UWBB 4B9MA 3OHAA 4C3LA 4LSNB 3EYZA 2JNJA 3G87A 3HF5A 2G0IA 4TN2A 1NK0A 1NSKL 1UCNA 5J1PA 1F9HA 4LSLB 3Q2TC 2NXJA 1HA1A 1NAQA 4UUWA 4IFYB 2XHCA 3M2RB 1TL3B 2BJ7A 1EB0A 1RT4B 4O3NA 3QRPA 1U25A 2QA1A 2PA3A 4UF4A 4L72B 2ZE2A 4KYZA 5ETKA 2JC0A 3TAQA 3FK4A 2L9DA 2CG8A 3OXGA 1S12A 5HMWA 1NM2A 2P9GA 1X0FA 3T5HA 1OYEA 3OJSA 3OVBA 4QW9A 4DL7A 4IOCQ 1IKXA 1JNZB 2XULA 5BYRA 1HNXF 5LXRA 1YSJA 5C24A 2M2BA 5F41A 2MLXA 4PXCA 2ZH1A 3IBCB 1QSLA 4Q2LA 1FRLA 3R97A 3R5JB 1K44A 2MKKA 3BN7A 4QJVA 1PBAA 3LGHA 4NRTA 2MHNA 1S1VA 1U1OA 4WFYA 3CMES 1JLGB 4B9TA 1VGYA 1K1SA 1P8GA 4B3MJ 2AYGA 1F3VA 1NXIA 4D3HA 2BA9A 4FF3A 2IAJA 1WHVA 3HK2A 4ZP7A 3Q8PB 2NCKL 3BH6B 1C1CA 2YH1A 3G6XA 3HLUA 3DXBA 2DRDA 3R7SB 4RUHA 3PRBA 1I1GA 4ELUA 1TKDA 2CG4A 4DX7A 4X4OA 3VTIA 1UKUA 5H9EJ 3FEZA 4NXMJ 4LRDA 1K0VA 1F5CA 4F26A 2AJFE 4UOFA 2JLGA 1D9FA 3OFGA 2YBVA 1IKYB 4OJ3A 2DGXA 2DR8A 3VGSA 1R31A 2CPJA 2DBBA 2JSXA 3HX9A 4USTA 1EARA 1XK8A 2OPQB 3GSDA 2WW8A 2E9ZA 2DHSA 2NUHA 1FESA 1YRTA 3D6TB 1YITS 4LF5F 3TJ9A 3GIJA 2DR5A 4N76A 2YNHB 4FDFA 5FIIA 3KHHA 1ZOTA 3H42A 2CJQA 3KOAA 3Q8QB 3R2CJ 2CNLB 3L7PA 2FC9A 4RU2A 2ZVSA 3NWGA 4WFAQ 1NBEB 3K5OA 1X60A 4ZP6A 5J2PB 3N0VA 3CIMA 2DY9A 6FDRA 3IMQJ 5HJYA 4FKXA 3HHLC 3EDRB 5LM7E 5IT4A 5ETLA 4LFBJ 3N28A 2CWKA 2KKHA 3OR1A 2KN4A 2IM1A 2ZHAA 4AE5A 4J91A 1TV6A 4LFCJ 4ITSA 1B70B 3NBPB 4OV1A 1Q82T 1GX5A 5DGBA 3BPDA 1F9EB 1R43A 4B08A 4HDGA 4BLGA 4J37A 4F4KA 4OHXA 5LSRA 1ZZFA 1ZM4A 1D9AA 2ZBCA 3E51A 4YUDA 1S0MA 4I2QA 4Q43A 2HLUA 2ZHOA 3DLGA 4F02A 3NP5A 1FFGB 1O6XA 1SVDA 2AJ0A 1WUUA 4R0EA 4CO2A 4X62F 1B64A 3ENQA 3UQSA 1R0AB 5KFHA 1NB7A 2OTJS 2KG0A 2JDJA 1CJTB 2NSBA 4GC7A 4CQ1A 2B4OA 2YKQA 1Q0NA 3BSCA 3M9MB 2DIUA 2BQ3A 1TR0A 4UZCA 1JWWA 3HVAA 4RW7A 3ENVA 4EBCA 3IWNC 5FLXY 5ETMA 4USVA 2GS8A 4X4SA 3HHKA 1Q78A 3CDAA 1FCAA 1Q8KA 1YJ7A 2C2ZB 2MQOA 2LU2A 3MR7A 1JLBB 5GADI 5KFFA 4NYZA 4RBUA 5C5JA 1UEUA 2XGQA 1WEXA 3O6QA 2RRNA 3BDEA 5HLFB 2XZDB 3CVKA 1FD2A 3KMSA 4I64A 1SJQA 2GCFA 2LP4A 4CYUB 5D4NA 3K17A 4NYOA 4GKJJ 3D1HA 1WI6A 1T94A 3UN2A 2JFKA 4AYBD 4P7TA 2R8KA 2QJ3A 3GMGA 2OPRA 5IQQA 1SJFA 2OD4A 3AA8A 4DFJA 3ISND 1KONA 2RF2B 1HQUB 1SC1B 4IKAA 2W2PP 2DTJA 1CJVB 3MEKA 3BSAA 4RWWA 3EICA 3QRQA 5HJXA 2X1GA 4ECXA 3IA0A 4HYKA 4ANEA 5HVHA 1OS5A 3FRZA 2XMAA 4HKQA 2DCUB 4A46A 5GAHI 1TUVA 4C0OC 1U2FA 4ZLLA 1GTEA 2Z58B 1Z1ZA 4UOCA 1N48A 1SC3B 1UPMB 2NQPA 3FBCA 5LXYA 3TUJC 4DL6A 2HHUA 3GG0A 4Q0BB 3TYTA 3HHEA 4PAAA 4JI8F 2C3YA 4R5PB 4Y6IA 4Y3CA 4EO6A 2J6UA 5KT6A 3C6UA 1HHSA 3EDQB 2VV5A 2MLYA 2W4PA 4QWDA 1JLAA 1VK3A 2RSQA 3R27A 2WSFC 3T6BA 1HI0P 1FXRA 2IDEA 3G6ES 5L46A 3L95X 2AJ2A 3PJWA 3DKDA 2RD5C 1B0PA 4CLYA 1WORA 3S1TA 1RWVB 3CULA 2PMWA 3ITHA 2PSZA 1DLOB 1H7XA 1REVB 1NPRA 2IPOB 2OLWA 1FO1A 8RUCA 1U1QA 2EK6A 1NK8A 3EVMA 5J1EB 3H40A 1RLDA 3MR5A 2BMBA 4B9VA 1X4HA 1QVGR 1MMDA 2VG5A 2CQGA 2XSJB 1JJCB 5CXTA 3NLCA 3BV8A 3O1LA 3UVJB 1T8EA 1RU2A 4OI1A 3VHQA 1UEVA 3RRHA 4DJBA 1CC7A 1R0BG 4V1Ak 1NKEA 4WFBQ 3HHLB 4JI4J 3BO4A 3HSJA 1R6YA 3RB4A 5IXUA 4I7FA 2L08A 3UO0A 3FUYA 1TKZB 4P7VA 5DS7A 1WOOA 1R8PA 1U8SA 2VBXA 1U2CA 5C2GA 4ETXA 2VJVA 2FJVA 1WJ9A 4DV7J 3TP2A 3NNCA 2QT7A 2KT5A 2L9NA 4Y2AA 2GV1A 5ETRA 1TL5A 1UA0A 4NCAA 4ICLB 4G3IA 1FTCA 2H5JB 4C8LA 3UPFA 3FEYB 3UD5A 2A18A 3BBBA 4O4RA 1R89A 2GIQA 1UFLA 2IMWP 2P5VA 2UUWA 1X5SA 4CLUA 1X4DA 3QT5A 4A8XA 3KG4A 5GMDA 4USUA 4KKOA 1FFWB 3EX7B 4NMXA 3LPEA 1EQ0A 2BUNA 2HQIA 4U96A 2KO1A 5CAAA 5B08A 2JL9A 2ZNZA 4K4YA 4JV1A 1S79A 4DU7A 2HBZB 5A8RA 3IS9B 3FSIA 2IDLA 3U1LA 1SQGA 4DV2J 1UA1A 4CH1A 4CM0A 1S9FA 1H98A 4J90A 1V3ZA 2YPZA 4MT1A 2FJEB 2HNDA 4O3SA 1KTVA 1WC5A 3G8SA 2DXEA 1HLWA 1MWYA 1UEKA 2R7XA 3Q83A 2DIVA 4HACA 4HI1A 4MTPA 4OLOA 4DZDA 1P9YA 2MZRA 3CCWA 1CEZA 2BVZA 1FJGJ 1CBKA 4DR7J 1D8YA 1CG2A 5EX3A 2ZH4A 4TLQA 3JSMA 3SDEB 3T9ZA 1WG1A 5HN0A 4LT6A 2Y0SD 4ES3A 3MM8B 3P6YC 2LDIA 4TNOA 2H3EB 2F8MA 4NLWA 5IOLA 2VQFF 3M8WA 1OJ4A 2DH7A 5EHHA 2N3OA 3MTJA 3TI0A 3LPYA 3HZEA 1VOMA 2KVQE 3DOKA 3C6TA 1FRHA 2LXFA 2CJBA 1WC6A 1V9OA 3OFHA 3U02A 2MZQA 1QSYA 4AFFA 3SQGA 5JUMA 1XR6A 2BJ9A 1JLCB 4CLPA 1NJWA 1EKRA 3IRXB 3OTCA 4ZN3A 3R2DJ 2XMMA 4JOUA 2HYIB 1WC1A 2ZOMA 3EGWB 3QIPB 4NXNJ 2E5LJ 2XI2A 2VJUA 5DQIA 2IA6A 1G7CB 2HFNA 5J2MB 1SH0A 3AJDA 2DPIA 3TVYA 5AXMA 3V4IA 2DNLA 1G2EA 5L1IA 1Y3JA 1DTQA 2KZMA 2VHGA 2YTCA 3QATA 2OELA 4DV4J 1FFSB 1KQSR 2FZKB 4U7UK 4AD6A 4X65F 4NL5A 1IKVB 3HKWA 3JQJA 2VQEJ 4N5SA 4IG3A 1S57A 3MEGA 5I42A 1KP6A 2OGUA 4JV2A 3GCXP 2M8HA 2CPYA 5G4DA 1DQAA 2H65B 3W2VB 3RRKA 4PG6A 4KB7A 4CLKA 4UQGA 5L9XA 3I96A 3OV7A 5A2QU 2RHSB 1EZZB 3M2VA 3OXFA 2POKA 4ZPAA 4JI6J 3T5LA 5J1NA 4JB8B 4NA1A 4U67Q 1DY3A 1IBMF 3J7AN 1FWKA 3I0SB 2N4CA 2UXCJ 4LF6J 1FEEA 4J9VA 4IO1A 3GIMA 5CYJA 2HGNA 3GJTB 2K06A 2DYAA 1PSDA 3A1YG 3LUYA 2HVIA 1TK0A 2CWXA 1N34F 4YB6A 3H8YA 5IZHA 5KFPA 1YZ7A 3BSNA 2IM0A 1FRXA 3IS9A 4FF2A 4EBEA 1HW9A 2R2SA 4A8YA 1HQEB 2LA6A 3AD8C 2FIUA 3C15B 5IWAF 5F8JA 5DG9A 1T9XA 1CS4B 4LFAJ 4CH7A 3OVSA 1UFKA 2F8EX 1ZAVA 2QL7B 3O5TB 3KTQA 2VICA 3ENWA 4Z37A 1I5OB 3OW2R 3I32A 2CJ9A 4C11A 2DPJA 3NGSA 4L3NA 3MGJA 3FCWA 3L09A 4DR1F 3KLIA 3IG1A 5HMZA 4M95A 2CPHA 4QWCA 1VRTA 3MM8A 3G4SS 1YGYA 1RTDB 1VQ5S 3MR6A 2BYCA 3DOLB 4J9UE 2YWKA 2D41A 1K47A 1JXVA 3T3FA 2AX0A 3PKMA 3GYNA 3C2PA 2JEGA 3FCVA 3THTA 2MGZA 1FKOA 4RW4A 3BEGB 2NREA 1RAEB 1LWFB 2XO6A 3DOMB 4MIWA 5HP1B 4C4WA 3K58A 4PQAA 4NI2B 3FQKA 1Q8BA 3Q86A 3HJVA 2KXHA 4FF1A 2JWNA 3QIPA 4TY9A 4A8KA 4F4ZA 5FDLB 3WIVA 1R3NA 1RKIA 3AD9C 2G2ZA 2AKWB 2JEFA 4C9DA 4GVBA 3M8YA 4GO5X 3V4MA 5J2QB 2R7VA 1I94J 4LQ9A 1GAOA 5GAGU 3KLFB 4KRWA 4DPOA 4XDCA 4IUFA 3HULA 4RW8B 4ZITA 3RBXA 4EZ9A 3CCLS 3AQPA 3AB2B 4EWTA 3DDKA 4KHMA 4QBUA 1JXLA 4OMFG 3EJMA 3FCHA 2DNYA 3W2VA 1HIYA 4ED5A 4ZPCA 1NK4A 3DRPA 3OVAA 1RWOB 1QM9A 1OQ3A 3M6UA 2B4UA 3CMAS 3JXOA 3BGUA 1BQNB 2FY8A 3QAEA 3VAFA 3PV8A 3OR2A 1IBKJ 1S99A 2RNEA 1QLNA 2ZUAA 3DRRA 1RTZA 2O3DA 5A6WA 3KYLA 3I0RB 3NL0A 3HCXA 3PX6A 1PJ7A 3LA0A 4PPDA 1ULRA 2UUTA 4NE9C 4OLPA 5D78A 5CQGA 3KHGA 2YNFA 3ENAA 5D3GB 2DH9A 3SBMA 4ELTA 3KKFA 1KVJA 2B6AB 2HRTA 3QQCD 1SJ4P 3NCPA 2QLJB 1UZDA 2XMVA 3W3SA 4B3MF 5RUBA 4BWJA 1SC4B 3MPYA 2XGPA 2CQBA 1ICEB 1AFJA 3H5SA 2B3TB 2XI3A 2KFYA 5JMNA 4DG1A 3CC4S 3R5BA 4TKTA 2MQQA 4NLDA 2W2NP 2ZH2A 2F4FA 4NXMF 3PEJA 2M8DB 4LR7A 4KHPJ 3OL8A 1MROB 5KTQA 1Q8LA 5KFIA 4W98A 1Q95G 3AB4B 3HSGA 1QAYA 1RT1B 2HEKA 5I3UB 4IG0B 2AJQA 4G6VB 1BHNA 1B4SA 3K59A 2LQ5A 1ZM9A 2YWWA 5DETA 3GU0A 4ERDA 4OZLA 2ACYA 2VASA 4HLBA 4I0WA 1MN7A 1F2HA 3A3PB 4ECWA 3GV7B 2OPPB 2R8IA 2PI4A 3EVWA 2ZZMA 2XMUA 1QE1A 2IY5B 5L1LA 3CCJS 1UVJA 5ETPA 3ET6A 4K4TA 3DMJB 2HK2A 3D1QA 5FDLA 4WKYA 4I2PA 1WKKA 3P8BB 4OL8A 2OEKA 3BGRA 1CJUB 2RQKA 2V68A 1OY9A 3KK2A 1XQIA 4M63A 1T9YA 4LFCF 1IJFB 2DNZA 2JOQA 5ETOA 1DAXA 4PRFA 1Q8IA 2KZZA 5KFMA 2UXDJ 3M30B 3X1LB 2AU0A 3MMJA 2HS3A 4IFVA 2HBQB 4B9SA 1YZ6A 2XEXA 2YWEA 2X3DA 2X1AA 4LR9A 3EGZA 1P6TA 2DKOB 3AHPA 4WWSA 2XHWA 3MHYA 1FD8A 2E1MC 1JXEA 3KDNA 1VJWA 2N3LA 1SV5A 3D4JA 4OZ1A 1B0VA 4TYBA 4M5IA 1RLCL 2IBOA 3HSDA 3VAJA 3K89A 2UUAJ 4B9LA 3GG1A 3Q8RB 4EEYA 4PG8A 1UVLA 1T3NA 3QGHA 2AGQA 2DNKA 1XTZA 4F0MA 3N6LA 1HWUA 4F4AA 2RQ4A 3T1YJ 2J76E 1HNWJ 2G4BA 2XMWA 1U1NA 3DLEA 1FEHA 2R7WA 4A8SA 1A0OB 1S5ZA 2DO4A 4CT8A 1P1TA 1FHTA 2ZBRA 1BUXA 1N5VA 2M0GB 1AT1B 3M8RA 2CPIA 2YNGA 1QSSA 2HK3A 1ZAWA 4DR5J 2XYPB 2IRYA 4TLRA 4Q8FA 4EUVA 3MFIA 1GT8A 1ZS6A 2D69A 2VPXB 2MKIA 3SSSA 2EI5A 2HRYA 2RHQB 4QWBA 3GILA 2D1CA 1U8WA 3T5KA 1GQEA 2PMHA 1U1LA 2LQBA 4DR3J 3AQOA 3MECA 2MZ1A 1AFIA 3D0HE 3MAHA 2OPSB 3GV8B 1Q86T 3UI3A 3CJ0A 1S1XB 4DV0F 2AZ1A 2EBGA 5T14A 1Q1KA 3E3XA 3KMQA 1RT6B 2OMOA 1NK9A 3S7RA 4WIQA 2VC1A 3MOZA 5LOQA 1LXJA 4U7CA 4NCBA 1X9SA 5I3UA 1T9TA 2IA0A 5JVHQ 3V6DA 3VWSA 3VGUA 4U95A 3ADAC 2BQRA 1JKHA 1U49A 4J9NA 1T05B 5IC6B 4F2RA 3GFXA 4E0DA 1HARA 1ZPVA 2GX8A 2GVZA 4TYAA 3RUBL 2ATLA 3QPIA 2MY8A 4DEZA 3PIOQ 3T6JA 2KYXA 3DYAB 1TL1A 4B02A 4IOBA 4PG4A 2GZOA 4BS2A 3NY0A 2IBKA 3S8SA 2COLA 3BGLA 3HVRA 1O5JA 2HFVA 3KLEB 1N4LA 3H98A 2CRLA 1I51B 3NCQA 2J0WA 1L3VA 1U0HB 3SMZA 4ZDNA 4LBPA 5GAGI 1PKUA 3CIZA 1S1UB 3K5PA 3RJMB 1TMMA 3CJ4A 3MMAA 3MI7X 3UNGC 2XLJA 3PM9A 2H9ZA 5J2NA 1T9WA 4W90B 2UXBJ 3VAHA 4ZVQB 4K4ZA 3LH2S 4OYPA 2VBWA 4OJHA 3KK1B 5KFVA 4OQJA 1HBMA 1TUWA 3AFGA 2AYEA 2Q66A 1OY6A 5CABA 1VLYA 4CLLA 4YQWA 4DN0A 3LP0B 4JI4F 4O3RA 2E66A 3GFYA 2VUGA 4OI2A 2W9BB 2KDOA 1S0VA 2J0QD 2QN6B 4PABA 5HQLA 2D74B 4KFBA 4FP9A 3DN9A 3ZZYA 2MZJA 4K4UA 2R8GA 4WYWA 4B17A 1G4CA 3L9ZA 1FK9B 4DV7F 1SQEA 1NJYA 3LWLA 1RAGB 1CLFA 2GQQA 5IT9U 2AYBA 5BXIA 4IH5A 3NGRA 3ZTPA 1E6YA 3RBZA 1SIWB 3KJQB 4WCEQ 2AD9A 2PFDA 3BSOA 4F04B 3J7A1 4O3QA 1S1TB 3TA2A 4P10A 1CULB 4XPCA 5KFGA 3HMJG 1MNEA 4ZCLA 1TKTB 3V6HA 4DOZA 5B0GA 5C42B 4F7VA 5KFNA 1IJEB 4K2JA 3FSYA 2CQ2A 2OIHA 2HNZB 2XM3A 4OHVA 2HWHA 2E5JA 1HL6A 3EM1A 4KTQA 3A4TA 1UVMA 4AUKA 4DV2F 5EWEA 4CP5A 4UY8T 3TZWA 5KG1A 1OYDA 3MMBB 1HBNA 1MSWD 2NXNA 4N8OA 3NCRA 2HZVA 1RKJA 3IFEA 2WZ1A 7FDRA 2YPYA 4CRJA 2OI2A 3KK3B 2FGOA 2E7VA 1S7IA 5D4OA 5KFUA 5E2QA 4URGA 1SIZA 1FJGF 1RTJA 4AT1B 1FNOA 1R8AA 1UETA 5EWGA 4OYAA 1YVFA 4USMA 2W2OP 4KE5A 2FHOB 1FRIA 4DSEA 3V6JA 1TL4A 2VZ9A 1WEYA 2KRBA 2ZC3A 1F60B 4ZJQA 4RL1A 3EXCX 1RABB 1U1RA 1EP4B 1BE4A 1KKHA 1BQXA 3PFOA 3V6KA 2ZJRQ 1T7PA 1IR0A 4NLVA 2R2RA 3VAMA 3CC2S 2BKPA 2BV3A 3RW6A 2DCLA 1BMQB 5A2QY 1WF0A 4X84A 3BH7B 2GA7A 1H6KX 4WKRA 4A8FA 3H5XA 4ZPTR 4NEYA 4RW9B 4Y28C 1WDTA 3W64A 3OLBA 2WB4A 2VBZA 1YJNS 4NXNF 2E5LF 4JV0A 4NASA 4L74A 5DQHA 2R7UA 2ZM6J 4U9RA 1A9NB 3TZXA 4CO0A 2LLZA 3TZYA 4DV3J 1FRJA 1D9DA 2C2NA 4KBIA 4JI3F 4M5NA 1MW7A 1HFEL 1KOHA 4ZPDA 3VVTA 1WI8A 1WD6A 2GMLA 1K73T 4AQYJ 3M8ZA 1C1BA 1I3OB 3C16A 4RPFA 1KVKA 3GR0A 4BWMA 3AXKA 3ELHA 1ITPA 4DV4F 4V19J 2IFXA 4UZBA 3FFIA 1OO0B 2ZH3A 4PYDA 1X4BA 2MJNA 2Z8QA 4OZ0A 2DNNA 2CA9A 5K9FA 4RW6A 3PW2A 2RDIA 1FRKA 2F65A 4W92B 2W01A 2BKOA 1URRA 3PX0A 3MUTP 4KH1B 3MM7B 4M5MA 2XC9A 4FXVA 3GLJA 2C2MB 2LKZA 3R9LA 9RUBA 3FJ2A 3CSKA 2E5GA 4JV5J 2ZH5A 3DRSA 3M1VA 2ASYA 4K4WA 4JI6F 1MWZA 2VA3A 2A3JA 4ZPWR 3CXCR 3TARA 1PJ6A 2BJ1A 4NEZA 2CUYA 5CYMB 4G1QB 1FERA 1LWEB 1RBAA 2K3IA 4H4KA 2OKQA 1NNDA 4FYXB 1NZAA 4F36A 1R0CB 2UXCF 4X4PA 4F25A 2ATCB 3BF4A 5IT0A 1QAIA 3CCSS 2VKZG 4JUZA 4YDDB 2AW0A 3Q8VA 1TKTA 1RTHB 4DF4A 3W66A 3KFWX 2CIMA 2CJAA 3GV5B 2QMUB 4WFXA 1CSJA 2LU1A 4NCGB 3WHIA 3A12A 2VG6A 2WONA 2I5JB 2G0CA 1D09B 4Z2XA 2XO7A 4FZVA 4LMZA 2E7XA 4HT5A 4NX9A 5DM7Q 4O4GA 3LGMA 4CNZA 3OL7A 2H4YB 1VQLS 2MKCA 1DTTB 1L3SA 3SFUA 2HFUA 4LFAF 1LQ9A 5AJ3J 5LSOA 2W7OA 2FJWA 1FKPA 1UP1A 1VIOA 2KXNB 3GFHA 3HVWA 4MFBB 1SBRA 2KVIA 1S6UA 2OFGX 4ZVOB 1KBRA 4HEA9 4OYWA 4IQXA 4DHVA 3QGPA 2V2ZA 3BGFA 4KGXB 2D3ZA 4O44B 1CJKA 4XK8C 5ETSA 2CJXB 5G0RB 4YB1P 2AZ3A 4PUOA 3G82B 3ZZUA 4PPZA 2MSTA 1F3FA 4CO5A 1EX8A 1DQ9A 1VBZA 3DI6A 2BBEA 2HQFA 2H51B 2XMJA 1RAOA 1DQ8A 1QUVA 1QJHA 1S7HA 3I5BA 1NLKL 2DNMA 4MKYA 1Y00A 1BY9A 1AW0A 3I6PA 5KFEA 4K5SA 1UL3A 4DR6J 2Y8WA 3GP9A 2HHHJ 2UVWA 5HBMB 1RDRA 4ENOA 2JC1A 4WP9A 1NB2A 2Q1LA 4OYBA 1J5OB 3W8PA 4QU6A 3MM9A 3A8IA 3A3OB 3GONA 1JB0C 5D15A 2E1AA 3P5TL 4FS1A 2MQNA 4CO4A 3WIUA 1M1GA 2IYGA 2YKMB 1KFDA 2PA8D 2O67A 4L3KA 4DXLA 2LXIA 1LWXA 3D6FB 1JLFB 3CD7A 4P71A 4ED4A 1W2BR 3SZ2A 4NLXA 2K7JA 4DS5A 4DX8H 4I6AA 3RZAA 2IYIA 1UZHA 1XR5A 3MAAA 3G71S 3ZZTA 2HMIB 4FS2A 3B54A 1J2VA 4WK1A 1HMVB 2FPHX 2PIIA 2ZWOA 3SCLE 3MUMP 3N6NA 5AE1A 2GJ2A 4QIWD 2Y8YA 3H5UA 4ED3A 1R6VA 1RJJA 1KS2A 3IGVA 1RWPB 5H9FK 1HHQA 2MPUA 4U6PA 2MKSA 1N5YA 1NEEA 1IBKF 3MMCB 1LWEA 1FVQA 3ISNC 4CIOA 3QZ8A 2G1HA 1PYSB 3CJTA 2CYYA 1PCAA 2W1BA 2W4CA 4JI2J 4R0JA 4GVLA 4LUBA 3RYLA 2GHVC 2QRRA 2KG1A 2BABA 2OUGA 1RTIB 3FBBA 2ZJPQ 3ICLA 2DRBA 4OHWA 4L75A 5D4PA 1RWUA 1MMLA 1CC8A 3M2UB 5F9LA 2CQIA 1RA6A 3OSNA 1B0TA 2B43A 3CE8A 2YKAA 1UPPA 5B0CA 4OI3A 5D77A 3R7BB 2F9DA 1WDDA 3U1MA 3I5AA 1FT8A 4ED1A 2EC2A 5CD4A 1S77D 1HBUA 2V9KA 1JQGA 3DM2B 2VBYA 2VD3A 3QGIA 3CMQA 1SL1A 3I87A 3JAMU 4KHPF 5DDQC 1OPIA 3M7VA 4KV8A 1H73A 3HM9A 3CPWR 3CJ2A 2CPXA 2QV6A 1B99A 4TU8A 2CZ9A 4KT0C 2Z2YB 2JH3A 1KLNA 4KH0B 3G82A 2IVFB 4PWDB 5CYQA 1LFPA 4C8KA 2UVRA 4ILMA 3SV3A 1H0HB 4B9NA 5M2PA 4X64J 1V3SA 4JI5J 4Y2MA 2RUGA 2C2RA 2MB0B 1RT2A 4ALZA 1PIEA 1U1PA 3K8VA 3ZC4A 3CJ5A 2R2UA 2MZTA 2EW9A 3E01B 3DLHA 2XZWA 4LQ3A 1S76D 4J9PA 1AUDA 4H4KC 4CLWA 2FTRA 2U1AA 3G8TA 5D8HB 5D0RA 2H48B 4CO1A 1RAJA 1XMQF 2V4JB 4GC6A 2F40A 2EEYA 3QNWB 3N4WA 3K57A 4YB7A 1HBOB 1YX2A 3DGVA 3BKTA 1KLMA 4DX6A 4GKKJ 1UMJA 5A8KA 5BYQA 3A13A 2XB2D 2YNIA 5ETQA 3KJNB 4DL0C 1MLAA 5F8MA 3SSRA 3TAMA 3CD6S 4ATNA 3DGPA 5KOXA 1EIYB 3NWRA 1KFSA 2ASLA 1KN6A 2UXDF 1LEOA 3VGVA 2BEFA 3J7ZT 1XJWB 2B4PA 2B5JB 2GGPB 2J8AA 4KO0A 1BD6A 1HNIA 3P49B 3KLHA 2KT2A 2UP1A 1BQMB 2VC0A 4CDIA 1UW4A 1XWLA 2UUAF 2X3GA 5D0EA 4ZVTB 3JSBA 4J9KA 3VCDA 3PG9A 3AD7C 3H4BA 2CADA 4DLGA 2BOPA 2Q6BA 3TNVA 1S6QB 5A76A 2XY6A 2J7KA 3MCSA 5KFLA 1N54B 3T1YF 1S48A 1HNWF 4H4OB 1ZM2A 2FQQB 2CKWA 3OLAA 3K5MA 4DPYA 3BREA 1HNZF 2HVHA 2J6SA 4F0KA 1TL7B 2AJ4A 3RB3A 1X9WA 5L8RC 2CVEA 5C25B 1FX4A 3J81j 4DR5F 3N01A 4C2MA 2ZBPA 2WVCA 1ZETA 4R8UA 2G2OA 4A8OA 1SUQA 1C0TB 2XBPA 4ZJOA 3FZ2A 4ZN1A 4YHHJ 2PD1A 3MM5B 4J7CA 3HVTB 2UU9J 2C2KB 3QT7A 4TU9A 3OUYA 1WHXA 5HI7A 1UTAA 3EWGA 3VAGA 2HVEA 1FRMA 1X4AA 2I0XA 3PW0A 1O0PA 2GVDA 1RYSA 1U6BA 1AZSA 1GEHA 1PC5A 1DBDA 5CCMA 5HROB 3D1OA 5F8NA 1ZBTA 2MHEA 3D66A 1IKWB 1EAYC 1JLEA 3I56S 3LF0A 1YJVA 3PEHA 1N32J 4RU9A 4U8YA 3M8PA 4PQUA 3IC1A 1WOSA 1XERA 4BDPA 5DLFA 4BBYA 2K1RB 2GFFA 2Z4PA 5HQ8A 3CCMS 4AXJA 2IC3B 2DNHA 2QE5A 1SKUB 4HTJA 1EETA 2FZGB 1DARA 5K8NA 4NLSA 4Y00A 5IT9Y 3BR9A 3CJ3A 3EGVA 4C8YA 2O66A 3TRGA 2AV5A 1NK7A 3QJPA 2YVSA 3QO9B 4YS2A 1WC3A 2DHHA 2XSFA 2ZH8A 1C0UA 3W2WB 3U7JA 5C2CA 4IDKB 4LF8J 2C3UA 4UY85 3G9CA 2OJ3A 2UXBF 1LW2B 1RT5B 2O5DA 3T9NA 4URSA 5K14A 3AJ1A 3CCRS 2YKNB 2FVQA 2Y1RI 3FBEA 4ID8A 3DLLQ 1X9MA 2DGVA 3D7SB 4XAKA 1IBLJ 4FN5A 2VFVA 2LQJA 4M5DA 2MQ8A 2EFPA 4WTYA 2W8LA 3FZBA 5DM6Q 1YI2S 3BQ0A 3BKFA 2VH7A 3WC0A 3FNNA 4ZCIA 1HW8A 4B3RJ 2B9EA 1RT7A 1KOOA 3HSZA 4YFUA 3EZUA 1HWIA 4NYPA 2XQCA 2V63A 2BE2A 5KT4A 3C14A 1VRUB 2FHJA 1S1WA 3CJKA 5KT5A 3R6GB 1T02A 4CLTA 2G13A 2Y3YA 1PO6A 2H54B 4IR9A 2DGOA 4UOHA 1LWCB 3A8EA 2YX7A 3M8SA 1U7LA 3BGOP 3R5AA 4MMOA 1YKWA 3RG6A 3R3TA 4V19X 4MK8A 2VB6A 2XYGB 5LJ3Y 1Q16B 5A8WB 4J9SA 3QIDA 2HHTA 2GW8A 5ADZA 7AT1B 1T03B 3MEEA 2VIHA 1FWLA 5IQ6A 3KNAA 1KD1T 4J9OA 1TVRB 1UWBA 1NHVA 4A48A 2HAIA 4LSNA 2NSCA 3ETMA 3LWMA 5LJ5Y 1Y7PA 1RT3B 2V8GA 3POTB 2IJRA 4ID5B 3WZ0A 3KNGA 3HD2A 1HI1A 1MU2B 2MYFA 3TZZA 4DPTA 4BCAA 1XNRJ 3NEKA 4LSLA 3AOCA 4DF8A 1Y5NB 2KXFA 5E33A 5F0WA 4LRBA 4IFYA 2A2CA 3M2RA 2Y1JA 3LO3A 1TL3A 5GMEA 1FVSA 1RT4A 5LMNF 3UD4P 2ZUGA 2C2DA 3P45B 1N0UA 4X2BA 2U2FA 4CTAB 2AEFA 5DRKA 3FDSA 1BWVA 3RAQA 4DSFA 3MDFA 1N5SA 1IWGA 2B8QA 4ECRA 2QYGA 3F56A 4ED0A 4N8NA 1AA1B 3I31A 1TU0B 5KG5A 5GAEI 2M9KA 5B0BA 4FBUA 1RAHB 3MFHA 5HK4A 1TK5A 3IWLA 3D6MB 2A6OA 2E1RA 2CQ1A 1JNRB 3UR0A 5IV4A 2FC8A 5KG3A 1YTYA 2VG7B 3MM6B 1IWAA 2K7KA 4QYRA 3HZGA 1UVNA 4ZCKA 4O0IA 2JVRA 1JLGA 4WF9Q 2ZM6F 4F3OA 5B09A 1E6VB 2ZVIA 3QZ7A 1LK5A 4DV3F 3LP1B 1TKXB 3O8WA 3TANA 4L6V3 1RT5A 4JI1J 4WP3A 1U09A 2GC8A 4AQYF 4EYHB 2ZHBA 4P74A 2Y0BB 1X4FA 6AT1B 1RGVA 5KFRA 1EQMA 1K9MT 4DV0J 2Q43A 4F67A 2OSRA 5E7OB 2XLKA 2J9CA 3FGVA 2MXYA 4DCPB 1U1MA 4HTIA 1IKYA 3BYPA 3F0NA 3N5FA 3EUNA 1EHWA 2VDIA 5A0YB 1N6QB 2ZDPA 4KC5A 1QTNB 2KH9A 2R7SA 2MKYA 1ZA2B 2RVJA 2OPQA 1KQFB 4KGVB 4OFZA 1VISA 4JV5F 4UT4A 3L3CA 2YNHA 2RKIB 2B9XA 3I9V9 3AJ2A 1KR4A 3ZO7A 5L38A 1HYSB 2EFGA 1T95A 1HNVB 3MEDB 4RWXA 3PJXA 3D0GE 3B4DA 3FVYA 1N8RT 3ZZ0A 1NRKA 2BACA 3PW7A 2XLIA 5J2PA 4EBDA 4CO3A 3OPKA 1S9GB 4YN3B 2CXEA 3IWXA 3C19A 2HIYA 3VZHA 3MCOA 4H4MB 4WZQA 3RBDA 3UCGA 3A3NB 4F4WA 1LNQA 3Q2SC 1X5OA 3M32B 2AF6A 3OTBA 2XCPA 4X4RA 2ZH6A 2GHPA 2N4DA 1HPZB 4NLRA 3BDPA 2R7TA 3VZIA 3PO5A 2RQCA 3Q22A 3CCZA 4DN9A 1Q81T 1UWAA 2WAQD 4Y34A 1KEKA 2MQPA 3NBPA 5AJ3F 1JMTA 1VQOS 4LF4J 3UN3A 3POTA 1ZTTA 4ZHRB 3VGTA 2ROPA 4XO0A 4IYQA 1SJ1A 2RDJA 2YY3A 4ZVHA 4U8VA 3Q8YA 7FD1A 3M8QB 3CDEA 2IRXA 5KFOA 2HNYB 5EGYA 4DSKA 1VQMS 3SCKE 3MWBA 3I4PA 1WOPA 4QPTA 2BJEA 4UUXA 1Y11A 2Z2ZA 2QMXA 1J5EJ 2UZAA 4UW2A 3KJFB 1F1BB 1RK8A 5D6GA 2F9JA 3H2LA 2HVZA 4WXWA 1R0AA 4QR1A 1CJTA 2F8HA 2QTWA 3WQPA 3D54A 2GJFA 4TY8B 4K0KJ 5E3RA 5DQGA 4C8OA 4DR6F 1TZ0A 2N82B 2HHHF 3CB4A 2NPFA 1URNA 3P4UB 3QYYA 1GTHA 5ITHA 1OMSA 2BQUA 2E7WA 3ZTRA 2QA4S 3QWPA 2J0SD 4PG5A 3IR6B 1RHUB 2E5IA 1O51A 4CZCA 1JLBA 2M52A 2HBYB 1S4EA 4LF9F 3OFFA 2HFOA 1CQNA 2DGQA 4RX6A 4B3OB 4OIXA 5HLFA 1JLQB 3JQMA 3L4BC 4CYUA 3R5GA 3JS9A 2PN6A 4I56A 1KVIA 5LMUF 3NNHA 1KC8T 1GMVA 3LAMA 2UUCJ 5CZXA 1RU1A 2HFZA 1W7WA 1NO8A 1PYOB 4MH8A 2RF2A 1HQUA 3KJVB 1B3TA 2ZD1B 1CJVA 3IM8A 2KJVA 3V2UC 4ECQA 3VAKA 3VV2B 1GMWA 2C28A 4TQSA 1RHJB 4BC9A 1SL0A 2UVUA 2R2TA 4DU8A 2BANB 4OX9J 2C2OB 3H0PA 3JAMY 2XMKA 5KOWA 2DR9A 1LV5A 4Q0BA 1MN9A 2BJ8A 5T7LB 2BZ2A 3EMTA 4YR2A 4LVNP 4R5PA 3CC7S 5T41A 3K7RA 1N88A 1LXNA 2MTLA 1Q5VA 3IBWA 1AROP 4JI2F 4OX8A 2RRAA 2EWHA 1VR6A 2W7PA 1S0OA 2GO9A 4A8QA 3FBFA 1PC4A 2ASJA 3SCIE 3B78A 3W8GA 2QFJA 4WYLA 2ZJQQ 3MF5A 1H74A 2W7AA 2ZE2B 2HBRB 4DFPA 1DLOA 3IRWP 1REVA 3LP2B 2ALYB 4XTTA 4QW8A 5F3ZA 4CNYA 1APSA 5J1EA 3EZ5A 3UWTA 1K8AT 1FJEB 1IKXB 2XSJA 1UFWA 5KG6A 4JI3J 4NLTA 5C24B 4DR2J 4ECYA 3TR5A 4ZMMA 4Q44A 4PG7A 1YQHA 3UVJA 2M88A 4J9LA 2D3OR 3W63A 2HFSA 1XMBA 4A8MP 5EX0A 1UAWA 4OJGA 1VRQC 4QR2A 3DU5A 3HHLA 1OY8A 3R5CA 1WEZA 1R8HA 3J80U 3J7Z5 3WBZA 1TFWA 1TKZA 1S1VB 1BC6A 2YKOA 2GJIA 2G2YA 2F5GA 2G0JA 3D68A 4K4VA 4X64F 4ICLA 4JI5F 2IAJB 3G6VA 1C1CB 5BR8J 1L3KA 3GYXB 4PKDB 1DHMA 1N36J 2DHAA 1PYTA 1D3WA 1YJWS 2B7BB 1Y9OA 3AAWB 3BQ1A 2ACMA 2OTLS 1OSDA 4ZA1A 4NOHA 3QFWA 2FVSA 1XBWA 2QLWA 5B0FA 3UCZP 4N7TA 2F7VA 2HGLA 4ANDA 3GSIA 5U47A 2HHSA 3O44A 1JLQA 2BR0A 5DDRC 2C3OA 4A8WA 3CW2C 1FXDA 2PEBA 2WSCC 2V2QA 4GKKF 2NXUA 4F3QA 3NAHA 3EPIA 5ETNA 2R9LA 1U02A 3B8HA 3SFGA 5D4LA 4N56A 2XS7A 3D3CJ 4PXEA 5GAHU 2FVPA 2Z2MA 4YMEA 1M1KT 5MAOA 5KFAA 1S6OA 3H2UB 4QQBA 2PDAA 1VQPS 3ZZPA 5THWA 3BR8A 1RWNB 2YX4A 2FY1A 2VDHA 5K20B 4O3PA 3C46A 3SDEA 2CQ3A 2SXLA 4DMZA 2EG1A 1TFYA 1SXLA 2GQ2A 2DNQA 3CWJA 4TXSA 1XEZA 3OR1B 2ROGA 4ZVEA 2N7CA 3FKBA 2LCWA 4G1IA 1TV6B 2CNNB 4RBVA 1MWQA 1FJ7A 2XWYA 2J7UA 1KHWA 3SYZA 1U45A 2J9DA 3DRYA 3R5DA 2FGCA 3Q89A 1C4CA 3F41A 1KHVA 2DRAA 3OT9A 1JLCA 1SC6A 1DURA 4I2QB 2MEWA 3IRXA 2WTFA 3NMRA 3MD1A 2QFIA 3DLGB 3LP2A 3QLHB 1X4EA 1NKCA 3F44A 2E44A 4ANCA 5J2MA 1GXUA 3GPAA 4YHHF 3T5JA 4F4XA 2UU9F 1T9VA 4DLEA 3JQKA 2PI5A 4F3MA 1HD0A 2F3JA 4FXWA 4WIIA 4QYZK 2IHR1 1Z4UA 1ZAXA 4K5RA 1YJ9S 5DO2A 4KHRA 3IO1A 5I3QA 4WBFA 4C0BA 4ZPBA 3CO9A 2DD8S 4RW7B 2C42A 4RNMA 2JFDA 1IKVA 3ZXWA 2MKHA 1R8CA 3MCNA 4DUZJ 2OO4A 3W1YC 5D0HA 1QAJA 3PACA 1HD1A 3R6LB 2VFRA 2Y9HA 4LR8A 3TVZA 3GQCA 4EK2A 3PY8A 4P52A 1DRZA 1RQ0A 4HI2A 2BXJA 3DLJA 4KSEB 2QYCA 1N32F 4NLPA 2MLZA 1M5PC 3NGUA 5SZTA 1XC9A 1HR0J 4FKYA 1YJRA 4N47A 3I0SA 2VODA 3FSXA 3GYGA 2OPRB 3BYRA 5B0AA 3TX0A 3CGIA 4GRSA 2I2YA 1IQZA 2KB2A 4DV5J 4DCJB 2GMHA 4FVCA 2B4VA 2OD6A 1ZYQA 4IRCA 4CI0B 1GMUA 5LT5A 3M4XA 3VALA 2WW4A 5E3PA 1RCOB 2VF3A 3RRGA 4PCQA 5ETVA 2ZOGA 4PWWA 1RI7A 1HQEA 1M5OC 1Q5YA 2QG9B 4MIAA 3C15A 4NZ0A 4KR0B 2IRUA 4LF8F 4Q7AA 1CS4A 3OXLA 5CCLA 4WU3A 4USHA 1G1XA 2GO8A 4W4MA 3OFEA 3C6UB 2I9SA 3LW5C 4U7UD 1IUJA 4OYIA 2FLOA 4LIRA 4QWAA 3PTWA 1JLAB 5IV3A 1XMOF 4F50A 1VMBA 4B3SJ 1IBLF 1WG5A 1YRXA 4DPWA 1IN0A 1HKAA 1ZM3A 2R3VA 4Y2CA 3VAIA 2FLPA 3TX8A 1F2GA 3ITHB 3RR8A 3H7HB 4Q45A 1RTDA 4K50A 3W65A 4B3RF 3DOLA 4QWEA 2HZCA 4K7QA 2BRLA 3MTKA 3OSPA 3TA1A 5EN1A 2VG5B 2MJUA 3CEDA 2F1FA 4IOAQ 4FYVB 3UCUP 3LANA 2FJAB 4QYZJ 2R8HA 4Z7YA 2EKNA 9ATCB 4DQSA 3US5A 1LWFA 2ZBIA 3DOMA 3SCJE 3DC2A 1X5PA 2B9YA 3VQTA 2RQMA 2APOA 5HP1A 3PVXA 4M8LA 3QBCA 4MKAA 1PBUA 2Z2LA 4NI2A 4DUTA 4B3TF 1RAFB 1XMQJ 2L41A 3KHRA 3QLHA 1NSPA 1AB8A 2H5EA 4I7FB 3PYEA 5E0OA 2FB0A 2IMOA 4Q8EA 3W9HA 2FLNA 5J2QA 4LF7J 1VYAA 1NHKL 1Y5IB 1RHRB 2W4DA 4QCLA 4DFMA 2DEJA 1WSRA 2O1PA 3W9JA 2ABYA 4ZIVA 5KG2A 4DV6J 1XNQF 3KLFA 4DQPA 2VFSA 1XNRF 2M70A 4RW8A 3PX4A 1BWEA 4QPXA 2CPFA 4LBIA 4DSLA 4NLQA 2BE7D 1GH8A 1NKBA 1L5UA 4KKOB 2FHJD 3PR5B 3HD1A 4JP8A 1TAUA 3Q8UA 2D9PA 2RMLA 2DB1A 1RBOB 2V0NA 3SQOP 5AE3A 5DDOC 3CJSA 3L7OA 5F3TA 2HQ3A 4OZ3A 2UUBJ 1BQNA 5KFCA 4K59A 4GO7X 1NUEA 5A8RB 2XCAA 2GAGC 2HNDB 2CQHA 4P75A 2XS2A 3RB0A 5DZ7A 3I0RA 3J7YU 3V81B 4URQU 2AYMA 2DR6A 1VC0A 1B7FA 3OHBA 5HVFA 2OEMA 3HHNB 4HACB 4OI6A 2DVIA 4P2XA 2FYXA 2QX0A 4DV1F 2V94A 1HNZJ 2X51A 2K3KA 5D3GA 3IN5A 4M5LA 2CQ4A 1PILA 4IRDA 2AGOA 3IP0A 3JSMB 2B6AA 4ECZA 1BGXT 2J8SA 2NYIA 1FNMA 1RHMB 4NA2A 4LJMA 4YR0A 2EFOA 1KQGB 1FI4A 2ROEA 4JI1F 1VQNS 4LF1A 2G9OA 3GIRA 3PYDA 4Y2KA 2ILYA 3W5XA 3KUHA 3DOKB 1CVJA 1N33J 3C6TB 3PO4A 2EK1A 2K8GA 2XNRA 3JTNA 4E98A 3IR5B 1U2RA 3GTYX 3SQGB 2FDNA 1MROA 3HXMA 4UQTA 3TAPA 4LF2A 1IVZA 1F5AA 5KFXA 1RT1A 2KHDA 4B9UA 3UR3C 4IG0A 4DSIA 3JTPA 2QO3A 1S9EB 3QRRA 8AT1B 3OJUA 1M5KC 1VBXA 1A6LA 2C3PA 3TVKA 5I3PA 3RB6A 1RBLA 2Y1IA 3D6HB 3DFEA 1RHKB 4JI0J 2AT1B 2OPPA 3HFVA 2VFUA 3V4IB 3M9NB 2L9WA 1FDAA 1T0TV 2EPIA 1DTQB 2LEPA 5C7PA 1YLXA 2QSWA 2QMWA 5F8LA 5HAOA 2A0FB 2BE9B 2BX6A 2JJ4D 3H4DA 3AODA 3S01A 1U4BA 1IBCB 2DHXA 5K5MA 2KFNA 3OL9A 4IG3B 3DMJA 3VR1A 4MYUA 1D1UA 3MEGB 2DNPA 2DXFA 5I42B 3MPDA 3GR1A 4P72A 2PT0A 4K2XA 3B6BA 1TQLA 5CA5A 2AJ1A 4YB5A 4PZVA 1V5IB 3NGTA 1CJUA 2OFHX 2RU3A 2NR0A 4F4YA 1WACA 2CQDA 4DS4A 4J5OA 3M2VB 4I6WA 1M5SA 2CPZA 3CCTA 4C3KA 1S72S 4LF4F 4H54A 3CJRA 2YWGA 4TVAB 1NH8A 2CZVC 2V8DA 1S97A 3OTOJ 3M30A 4OYXA 3SSQA 4DSJA 3PNIA 3LALA 2AGPA 1G3OA 4RNFA 3GFZA 2EC0A 2DNGA 4PR6A 5DZ6A 4DPXA 3HDSA 4DL3A 1J5EF 2PMZD 3PR4A 2V67A 4EGLA 2ADCA 1X31C 4E8UA 5KFBA 2W25A 2HSEB 1H38A 3IGNA 3NGKA 4K0KF 1UJ5A 4CCHA 5JVGQ 2ZC4A 1IM4A 4RO0A 4OHYA 3V81A 1H3DA 3TEGA 3KXDA 3JTOA 2X1FA 4K8RA 5KFKA 4ZLNA 3B82A 3HP6A 5B0DA 6FD1A 4XDDA 2CQ0A 4C11B 1MMNA 3M6VA 1EKSA 2QL5B 1VQ9S 3EE3A 3BB5A 3KLIB 4PEOA 3IG1B 2RS8A 2J0XA 1GFWB 3PKYA 4UTGA 2FJBB 2W9CB 1VQ7S 4I6YA 1VRTB 2LMIA 4RKUC 3EVOA 1KQKA 2GIRA 3LQVA 1TAQA 1FJCA 2C2EA 3HI9A 2UUCF 3NRBA 1ZH5A 2OPSA 5KG4A 3I5CA 4X4QA 2E29A 4NLOA 3ILOA 1VBYA 3D5MA 1S1XA 5KFQA 3H20A 4GMKA 2HLTA 2MGZB 4P2FA 1H2UX 1RT6A 5GVQA 1FKOB 1NH7A 4RW4B 2HW3A 2VA2A 4RUBA 2R42A 4KPYA 4ECSA 2CFXA 2M7SA 4O23A 5LMNJ 2EFVA 3AT1B 4M94A 4DR4J 1NSAA 1S9EA 5E3CA 2LXUA 3CDUA 3TO8A 1ACMB 4J9MA 4GVBB 3D9BA 4OX9F 1T05A 1X4GA 5HQMA 3DLBA 2KI2A 2WVDA 3J80Y 4LIWA 2R7OA 5F8IA 1I6JA 3VVUA 1W2IA 3TUZC 3D0IE
chains in the Genus database with same CATH topology
1FVSA 1RT4A 4I2PA 5LMNF 4FYDA 3UD4P 1F5BA 3DYAA 2ZUGA 2C2DA 1F0XA 4F8RA 2M3DA 3M8PB 4OL8A 1N0UA 3BN4A 1YWXA 3BGRA 4ZHRA 4X2BA 4PQUB 2RQKA 2KT3A 4Y65A 5CH7B 2U2FA 4CTAB 1KTQA 3KK2A 1OQ6A 2V5HG 4MAKA 2VONA 3U27A 1SKWA 4M63A 5DRKA 4I67A 3FDSA 2AQ4A 5DLGA 1H2TZ 3I4HX 4DSFA 5K8PA 3RAQA 3KLEA 2DO0A 3GZ7A 3MDFA 1N5SA 1WNEA 4LFCF 1QAXA 2RE1A 4ECRA 2FVRA 3F56A 4X66F 1IJFB 2DNZA 4ZS6A 3ZZOA 3M8QA 4ED0A 2YKPA 1W25A 2JOQA 4R25A 1RYRA 3PZPA 3KG0A 4QR0A 4N8NA 3RR7A 2WRMA 1DAXA 3I31A 4USIA 3S6EA 1EETB 2HNYA 4PRFA 5GAEU 1Q8IA 2KZZA 3DRPB 5M2UA 1S1UA 3BS9A 4JYAF 1VQYA 5KFMA 5KG5A 3M30B 5GAEI 2O01C 3N6MA 4WE1A 2KJWA 2M9KA 3K5NA 2DGWA 5B0BA 2AU0A 3X1LB 3E8OA 4K4XA 2DJWA 3MMJA 2HS3A 4IFVA 4B9SA 2D7SA 4WFNQ 2XEXA 4FBUA 4ZP8A 5F9NA 2EVZA 2YWEA 3CCVS 4C3MA 3MFHA 3JSRA 2X1AA 2DGTA 3EGZA 2DITA 3OR2B 1TK5A 3IWLA 2FLLA 4DR2F 1P6TA 1DZ5A 3AHPA 2ZZNA 2XHWA 2E1RA 3MHYA 2ZOFA 1YJUA 2CQ1A 1JNRB 3UR0A 1FD8A 2E1MC 2FC8A 3KK1A 1JXEA 5KG3A 1YTYA 1VJWA 2N3LA 1SV5A 3DRRB 1C0UB 4OZ1A 2VG7B 3MM6B 1B0VA 4RNNA 4TY8A 2K7KA 1FDDA 4QYRA 2VPZB 3CDWA 4TYBA 3TUIC 3HZGA 3VF0B 2IVYA 1UVNA 4RZRA 5GADU 4ZCKA 3W7BA 3UDLA 2IBOA 4ELVA 4O0IA 3M6WA 2JX2A 1YJTA 3DXSX 3VAJA 1NJIT 4B9LA 3LP0A 2M4MA 2JVRA 1GXLA 3FMWA 1JLGA 3GG1A 4FNHA 4NPOA 3Q8RB 4WF9Q 2W9BA 3KLGA 1WELA 4EEYA 2KM8C 1M5VC 1Y3KA 4PG8A 5K14B 1UVLA 2RT3A 2V9WA 1PGZA 1T3NA 2ZM6F 4F3OA 5B09A 1E6VB 3QGHA 3HFKA 2V8VA 2YNFB 2AGQA 5KFSA 3QZ7A 2DNKA 1XTZA 3N6LA 1LK5A 3OTEA 1D8ZA 4DV3F 1HWUA 1RP5A 1OSCA 4P2SA 3LP1B 5IS2A 1SI9A 3VQSA 2RQ4A 1TKXB 2P6TA 1ZZNA 3RAMA 1WHYA 2KFZA 2J76E 3O8WA 3T19A 5DG8A 3TANA 2MDAA 4M1KA 4L6V3 1RT5A 2G4BA 1FK9A 2UV8A 3J7YI 4F2SA 2XMWA 1U1NA 1U09A 1FEHA 2GC8A 3DLEA 2R7WA 4AQYF 4A8SA 2RILA 4M5DB 2JLFA 3CCES 2DO4A 4I1TA 2ZHBA 4EYHB 1K1QA 3HO1A 1FA0A 3CD5A 4CT8A 1WTBA 4B3OA 1P1TA 1X4FA 1FHTA 1RGVA 5KFRA 1K9MT 4HHJA 1Y5LB 1N5VA 2Q43A 2M0GB 2B0GA 5HO4A 3ULHA 3M8RA 5K8OA 1X5TA 4F67A 2CPIA 2OSRA 2YNGA 3ETOA 5E7OB 2XLKA 3C66A 2J9CA 3FGVA 2MXYA 5BR8F 4MIBA 1QSSA 1ZAWA 1RT7B 1U1MA 1N36F 4ZKAA 3QJLA 2IRYA 4TLRA 4Q8FA 4DG1B 4EUVA 3MFIA 1GT8A 1SL2A 1N56A 3NAIA 2VPXB 2MKIA 1X7VA 3CDBA 3CUNA 3SSSA 2EI5A 1S1TA 2XMTA 4HTIA 1IKYA 4NRUA 2HRYA 2YX1A 2CPDA 3N5FA 1VQKS 5DDPC 3EUNA 2BE2B 4A47A 5A0YB 1N6QB 4QWBA 3GILA 2ZDPA 3CTRA 4KC5A 3PW5A 2KH9A 2D1CA 2R7SA 2P9EA 3T5KA 1OWXA 1GQEA 2PMHA 1A7GE 3KJVA 1Z2ZA 4OX7A 1S1WB 2ZD1A 3CJKB 1U1LA 2RVJA 1HWJA 1Y4ZB 2LQBA 4AXIA 3AQOA 3MECA 2OPQA 2MZ1A 1KQFB 4XIUA 2V4QA 5C42A 4MKBA 5FJ4A 2HHPA 4OFZA 1AFIA 3D0HE 3IXQA 1YG0A 2BM0A 4I4BA 4RUCA 3MAHA 4PXBA 2OPSB 3GV8B 3I9ZA 1Q86T 4JV5F 5M2RA 2HNZA 4WFZA 3UI3A 3L3CA 2HHXA 3HKZD 2YNHA 3CJ0A 5GMKa 2RKIB 2W9CA 1S1XB 4DV0F 2EBGA 3HHLD 5T14A 1Q1KA 2L3MA 3E3XA 2XY7A 3KMQA 5BJRA 1RT6B 2B9XA 3ISZA 3I9V9 3AJ2A 2DT9A 1KR4A 5F8GA 5L38A 2OMOA 1NK9A 3BQ2A 2UVVA 1HYSB 2EFGA 2J6TA 1T95A 3S7RA 2VC1A 3MOZA 1HNVB 3MEDB 1LXJA 4OJ1A 4RWXA 2A1BA 3PJXA 3D0GE 3AA9A 3MMBA 4U7CA 1NK5A 4JI7F 4FVMA 1VFJA 3B4DA 3FVYA 1KNZA 4NCBA 1N8RT 1X9SA 3DHXA 3DRXA 4NLUA 2BANA 4IQMA 3ZZ0A 1NRKA 4QOTA 5I3UA 3MEEB 5CZVA 1LKZA 2BACA 3PW7A 2IA0A 5H1SV 2XLIA 5J2PA 2GQCA 5JVHQ 4ETZA 5T7LA 4EFAC 4EBDA 2ADBA 4CO3A 3V6DA 3WC2A 3OPKA 1C4AA 4DR3F 3VWSA 1S9GB 2NS1B 3IWXA 3CD0A 3VZHA 1WWHA 5SUHA 5KT2A 1UWBB 4B9MA 4H4MB 3CT9A 3KK3A 4WZQA 3RBDA 3OHAA 3UCGA 4C3LA 3H59A 4LSNB 3EYZA 2BQRA 1JKHA 1U49A 4J9NA 1QE1B 4ES2A 4F4WA 2LECA 1T05B 3Q2SC 2EBEA 1X5OA 3M32B 2AF6A 3HF5A 3GFXA 4F2RA 3OTBA 2XCPA 4X4RA 1FTRA 2ZH6A 2GHPA 2N4DA 4TN2A 4E0DA 1HPZB 4NLRA 4HDHA 1NK0A 3BDPA 2R7TA 1HARA 3VZIA 1ZPVA 5J1PA 2GX8A 4TYAA 4LSLB 3ZZRA 3PO5A 3Q2TC 3RTVA 1HA1A 2ATLA 2RQCA 1NAQA 4UUWA 1OIAA 3TA0A 3KHLA 3Q22A 4IFYB 3M2RB 3QPIA 3RU0A 3CCZA 2MY8A 1TL3B 4DEZA 1VQ4S 4DN9A 1RT4B 3PIOQ 4I2PB 3T6JA 1Q81T 2R8JA 2WAQD 2KYXA 3DYAB 4O3NA 4Y34A 1KEKA 2MQPA 1TL1A 1U25A 2QA1A 1JMTA 2PA3A 3NBPA 2ZKTA 4IOBA 4B02A 5AJ3F 1VQOS 4PG4A 3BGRB 3BZQA 1EP4A 3POTA 1ZTTA 4ZHRB 4L72B 2ZE2A 1SH3A 4BS2A 2JC0A 3TAQA 2IBKA 2L9DA 2ROPA 4XO0A 3OXGA 3KK2B 5HMWA 2P9GA 4IYQA 2COLA 3S8SA 3BGLA 1X0FA 4ILLA 2NZ4A 3T5HA 1SJ1A 5KFTA 2RDJA 3HVRA 1O5JA 3KLEB 3OJSA 1N4LA 3OVBA 4J9QA 4YEAA 1FE0A 4QW9A 2YY3A 3H98A 4DDFA 4HH1A 4ZVHA 2CRLA 4YOEA 4DL7A 1QY7A 3NCQA 4IOCQ 2J0WA 1L3VA 3NMAA 1IKXA 4XPEA 1NU4A 2J5AA 3HPOA 7FD1A 3M8QB 2P9CA 1GXTA 1JNZB 3CDEA 3O3LA 4KIAA 3SMZA 4ZDNA 1U24A 2XULA 5BYRA 2IRXA 5LXRA 3DLKB 1HNXF 2FJDB 1YSJA 5KFOA 5GAGI 2HNYB 5EGYA 5C24A 1VQMS 3SCKE 4DSKA 3CIZA 4NZ6A 1SKRA 1XN9A 2DR7A 3MWBA 1S1UB 2M2BA 2RH3A 3I4PA 3K5PA 5F41A 4QPTA 1SJ3P 3CJ4A 3MMAA 4PXCA 2BJEA 2ZH1A 1U6FA 3MI7X 1QSLA 4IFVB 4UUXA 3UNGC 2QMXA 4Q2LA 2UZAA 4PXDA 4RW9A 1FRLA 4UW2A 5F8HA 1U6ZA 4TU7A 2XLJA 2HRUA 3PM9A 1RK8A 2H9ZA 2F9JA 5D6GA 5J2NA 3H2LA