1VQ7S

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vq7S00
1U1NA 3S8SA 2ERRA 5GAGU 1A9NB 4C4WA 3G6ES 3ZZZA 4CH0S 2CJKA 4F25A 2YKAA 2JRSA 1WHWA 2RRBA 4PR6A 3NNCA 2LA6A 2CQ0A 2KT5A 1VQ5S 3ZZYA 1N8RT 1R8HA 4W90B 1KOOA 1U1LA 1SXLA 1YWXA 2LCWA 1JJ2R 2E44A 4WF9Q 3R1HA 2QA4S 2I38A 2JX2A 2KG0A 3OW2R 3EGZA 2CPDA 3IRWP 4WIIA 5LXYA 2G1DA 1SJ3P 2DH8A 4IUFA 2M4MA 3DLLQ 2MQQA 3BO4A 3D2WA 2M52A 2CQPA 1M5PC 2KRRA 2LEAA 2N7CA 1QM9A 2DGOA 3JB9k 2X1AA 2MGZA 3LQVA 2MZRA 1URNA 4YB1P 3VAFA 2DNHA 4Y00A 1NU4A 5GAEU 2N82B 1WHVA 2WBRA 1WG1A 2CQCA 1YI2S 4CH1A 2DGQA 4OZ0A 2FC8A 1CVJA 2CQDA 2KM8C 5BJRA 1VQ7S 1OO0B 3HI9A 2F3JA 2JVOA 2LXIA 1UAWA 2B0GA 3G8SA 5H1SV 1WF2A 1R8PA 4WFAQ 2DITA 3BEGB 2PEHA 2LXUA 1YHQS 1YJNS 2AYMA 2DGVA 1U1KA 2ADBA 3U1LA 4V19X 2J76E 2RQ4A 1WELA 2HGLA 2KRBA 2X1BA 4IOAQ 2CPHA 1WEZA 4WFNQ 2JWNA 1WG5A 1WG4A 1U1RA 1VBZA 2HYIB 2KHCA 2QFJA 1FJEB 4M5DB 1YITS 3UWTA 5MLCV 1VC6A 2VODA 2MQNA 2CQ2A 3VF0B 2MKJA 3NMRA 2YWKA 2MKIA 4IO9Q 2L9WA 1VQKS 2ADCA 4WFBQ 2FC9A 1G2EA 1PO6A 1WHYA 1UP1A 1SJRA 4C0OC 3CULA 2DNMA 4UQTA 1DRZA 4YOEA 2M8HA 1WF1A 5DM7Q 3RW7A 3G4SS 1S72S 4J5OA 1FO1A 2RQCA 5D78A 2OJ3A 2CQBA 2DH7A 3DXBA 1VBYA 2M9KA 3P3DA 4PKDB 3G8TA 3CCES 1ZZNA 1X0FA 1ZH5A 1NO8A 3CC4S 3HHNB 3P6YC 1F9FA 1D8ZA 2VOOA 4UY8T 3PIPQ 1K73T 3K0JA 2V94A 3CCQS 2DO0A 3SDEA 2XS2A 2MZJA 2CQ3A 2KVIA 2XB2D 2CPXA 5GVQA 1OPIA 2KXFA 1KD1T 1VQOS 2L41A 2NZ4A 3EGNA 5DDQC 2VONA 4LIRA 2CPZA 1VQNS 2MZQA 2YH0A 1DZ5A 1VQ4S 1K8AT 3S01A 2DGSA 4BS2A 2DGXA 2DNYA 3H2VE 1X4GA 2D9OA 1N54B 2K3KA 5LSOA 3CC7S 2KU7A 1X5OA 2KM8B 3CCVS 2DGWA 2DNQA 2KXHA 2MKCA 4TLQA 3SMZA 2DISA 2U2FA 1P1TA 4QQBA 2DNPA 1SJQA 4C7QA 5JVHQ 2DIUA 2LMIA 5IM0B 2CQHA 2MPUA 4U67Q 2FHOB 5DDPC 2RRAA 1U2FA 2J8AA 3P5TL 1O0PA 1VQMS 1M5OC 3S7RA 2MKHA 2OSQA 2MY8A 2G4BA 1WEXA 3UCZP 2DHAA 3G96A 1HD1A 4A8XA 2LEBA 3CD6S 4EGLA 2CPIA 4RU2A 1H2TZ 4LMZA 1X4AA 2Q79A 3TYTA 3Q2TC 1U1PA 3G71S 1X4BA 1SJ4P 1VQ9S 1U6FA 1NJIT 4WCEQ 1D9AA 2XS7A 3G9CA 1WEYA 2EVZA 1YJ9S 2M2BA 2DGUA 2MMYA 3UE2A 2AYEA 4IOCQ 3J7ZT 5GAHU 2MQLA 1S79A 2LKZA 4ERDA 5LSLA 1DHMA 5IFMA 4P6QA 2E5JA 3MXHP 1WI8A 5IQQA 1U1QA 2D9PA 3CXCR 2EK6A 1Q86T 3NS5A 3P49B 3THPA 1HD0A 3MUVP 1M5VC 2KYXA 1X4CA 2BZ2A 3ULHA 2XSFA 2EK1A 2M70A 1Q81T 2DHGA 3SXLA 1HL6A 2E5IA 4ZKAA 1VQ6S 3TO8A 4FXWA 2G0CA 4WKRA 1U6BA 2DHSA 3CCRS 2AYBA 2M8DB 2RS8A 1U1OA 2MGZB 2CQGA 1RK8A 2YH1A 5JVGQ 2UP1A 1JJ4A 4Z2XA 2XNRA 2NLWA 1M90T 1X4FA 5D77A 2DNZA 2KG1A 2LECA 3H2UB 4QU6A 1JJHA 1KC8T 1M1KT 3N9UC 1N88A 2VOPA 3I55S 1B7FA 1H6KX 2PE8A 2I2YA 3THTA 4QPTA 1BY9A 2XNQA 5LJ5Y 2DH9A 1WTBA 1VBXA 1VQLS 4W92B 1N52B 3NS6A 4Y0FA 2CPYA 2M0GB 2OTJS 1X5PA 3CTRA 3CMAS 2JVRA 1FJ7A 4FXVA 1U1MA 1M5KC 1AUDA 1VC5A 5CA5A 3CUNA 2YTCA 2DHXA 1KQSR 2LA4A 2SXLA 2CQIA 2MYFA 3FEXB 2MQPA 3MDFA 1YIJS 2QEXS 5GADU 2M7SA 1UFWA 5DDOC 2GHPA 2KH9A 3US5A 5ITHA 1FT8A 2MKKA 5CXTA 3LPYA 3UCGA 2HGNA 1WF0A 3VAGA 2CPJA 2KI2A 1UW4A 2DNKA 2FPHX 2E5GA 2U1AA 2KFYA 2BOPA 3MOJB 2AD9A 2OSRA 5EN1A 2DGTA 2MZ1A 3J7YU 2GO9A 4CQ1A 2HZCA 2OTLS 2A3JA 4LJMA 1XN9A 2N3OA 1Q82T 5DDRC 3B4DA 4F02A 1JMTA 5DETA 3UD3P 3RW6A 1IQTA 3BO2A 2ZJPQ 4YUDA 2J0SD 1SJFA 1ZZFA 3R1LA 3CC2S 3NNAA 2L08A 2MQMA 3SDEB 4TU9A 2MB0B 1WI6A 3U1MA 2RNEA 2DNNA 1YTYA 1PGZA 1HA1A 3S6EA 2MXYA 1WHXA 1RKJA 2DNGA 2FY1A 1L3KA 2LYVA 3PIOQ 3MUTP 2CPEA 2MY7A 2RU3A 3VAMA 2ZJQQ 1WWHA 2CQ1A 3IWNC 2X1GA 5HL7Q 4PRFA 2KN4A 2LQ5A 2O3DA 3VALA 1VQPS 2ZJRQ 2J0QD 1FHTA 1X4HA 4ED5A 1X5SA 2MZSA 2F9DA 3VAJA 1X4EA 4F26A 5LXRA 2HGMA 3MUMP 1VQ8S 1H2UX 2D3OR 2XS5A 3CCJS 2DK2A 3R27A 3BO3A 2MZTA 2RUGA 5CYJA 2DNRA 2CPFA 5HO4A 1FXLA 2DIVA 1X5TA 4OZ1A 2E5HA 2CQ4A 2MJNA 2MHNA 2HVZA 1KOHA 2KXNB 3NNHA 2RS2A 2MKSA 2N3LA 3V4MA 5LJ3Y 1OWXA 3CCMS 2RVJA 5IM0A 1QVGR 1DBDA 3TP2A 2DNOA 4TU8A 1FJCA 3CCLS 3VAKA 3CCSS 3UCUP 3B4MA 3MI7X 4QU7A 3CF5Q 1OIAA 2K8GA 2OIHA 3BS9A 1K9MT 2DNLA 2DO4A 3I56S 1X4DA 5GMKa 3VAHA 2DB1A 2AYGA 5FJ4A 2F9JA 3CPWR 3UD4P 4TU7A 1W2BR 3VAIA 3Q2SC 1VC0A 1Q7YT 3MD3A 1YJWS 4CIOA 3CMES 1A7GE 2X1FA 2M88A 1QVFR 2RT3A 3FEYB 1H2VZ 2MJUA 1FNXH 3MURP 5DM6Q 2MQOA 2MSSA 2MSTA 1P27B 3EX7B 3CCUS 3L3CA 3MD1A
chains in the Genus database with same CATH superfamily
2VFRA 2B6AB 2W7AA 3NCPA 2HRUA 3DRPA 1EP4B 3VGUA 3NNCA 2I5JB 3MMAA 2HSEB 1SXLA 1TKXB 3OQ2A 3BGFA 1GH8A 1NJWA 2B4OA 4B3MJ 3FC9A 2YWFA 4C98A 1UEVA 2M4MA 2J8SA 1P8GA 3QMQA 1J5EJ 2PI5A 2Y0SD 3BGRA 4ILRA 4YB1P 1N6QA 4KIAA 5ETLA 3AJ1A 5KAKA 2GO8A 1CG2A 3DDIA 1D09B 2CNOB 3OFGA 3G8SA 1U1KA 4OHYA 4FYYB 3D67A 4H4OB 2KYZA 1G3OA 2IMOA 4LVOP 2J76E 3FVYA 1Q8LA 2CPHA 4WFNQ 2DPJA 2GAGC 4RUBA 1XWLA 4M5DB 4H4KC 1F5CA 1YITS 4GMKA 4KKOB 3J7YI 1WC5A 2QA2A 4O3NA 1T05B 3HT3A 1FRMA 3LOUA 1SJRA 1B3TA 4UQTA 5DM7Q 4RWWA 2JLEA 2MDAA 3RRGA 3RW7A 2VQEF 1YLXA 1LV5A 1O51A 2OPRB 1CJTB 1HW9A 3HSZA 5ETNA 2V94A 4A8MP 1JB0C 1FKPA 4NEYA 1R0AA 5AXNA 4F0HA 2ZFHA 3JSMB 2L41A 2B8QA 4F3OA 3FCWA 2GIFA 2AW0A 2VD3A 1K8AT 2F65A 2LQBA 2ZZNA 4C11A 1N5YA 2MKCA 3KLHB 5D0EA 2DXDA 1GX6A 3VQTA 2DIUA 2LMIA 2J8AA 4K2XA 2C22A 4RLEA 4KPCA 1LFPA 4M63A 2HHVA 4DV3F 4ZLJA 3I0SA 4A8XA 4PG8A 4LF7J 1T95A 2OO4A 3R2CJ 4KHRA 3M8ZA 2IC3A 3IR7B 2Q79A 3PR4A 2V8HA 2AJFE 3CCWA 3IBCB 1U4BA 3L95X 4ER8A 4WCEQ 2E9ZA 3DM2B 4OYXA 2J9DA 1D9FA 4KRWA 4DV4F 1J27A 1DHMA 4O23A 5I3QA 4P6QA 4AQYF 2D9PA 4RBUA 2XMUA 3LP2B 4WU2A 1Q86T 1FRXA 4UZCA 1M5VC 1MMNA 1U25A 4IH6A 4B3RJ 2M70A 4CWBA 3SXLA 1I6JA 3EWGA 1NK9A 2B4UA 2CQGA 3PR5B 4R8UA 4CT9A 2XNRA 3ISNC 1M90T 1X4FA 1KC8T 2HLTA 3QLHA 1UPMB 2VOPA 3VR1A 4DR6J 2PE8A 1YJTA 3K17A 4EMDA 2XNQA 5LJ5Y 4DS5A 4NLUA 3CDBA 2BE2A 3CUNA 3QWPA 2HBYB 4GRSA 4I6AA 1UA1A 1RWMB 1YIJS 3HHLC 3O6QA 1UFWA 2JFKA 5DDOC 3I96A 2W9CB 1S1WA 5CXTA 4USHA 2DNKA 2YNIA 2IVYA 4EEYA 2ZOGA 4CT8A 2M3DA 3HT0A 3MAAA 1XN9A 3VCDA 4O3SA 4I2PB 3RW6A 3UR0A 4OV1A 4KGMA 4A8WA 6AT1B 4AFFA 4R5PB 2ASDA 1NK7A 3VAMA 3PYFA 3DFEA 3MCMA 4IH5A 1RTJA 2KN4A 2VBZA 4FNHA 4RX6A 3K8VA 1WOSA 1M1HA 5CABA 1C0TB 3H40A 5HLFB 3HHKA 1HQEB 3BSAA 3KLVA 2QL7B 4DUYF 1CJVA 2CPFA 3T1YF 3ZTRA 1LKZA 3ISND 4K5SA 2FJDB 4O3OA 4NXNF 1TMJA 2X51A 5IM0A 3M30A 4MKYA 3TEHB 4K4XA 2V50A 2Y1IA 3DLEA 3MM7B 3HLUA 1FK9A 2DO4A 2K7KA 1X9SA 1FFSB 2AYGA 1S6QB 2W2PP 1NKCA 3HHLD 2HIYA 4K4SA 3FZ2A 3HX9A 1Q7YT 2X1FA 1NPKA 1U0HB 2M88A 3DRRA 5DM6Q 2R4FA 5U47A 2ATLA 4K4ZA 5HP1B 1T9WA 4NLPA 4MTPA 3EVOA 2JRSA 2GVDB 2UXBF 2DY9A 3A3NB 1KLNA 3TWZA 4DV3J 4DZDA 5D4NA 3IG1A 2JFDA 1HBNB 3EGZA 1SJ3P 3DLLQ 4DR5J 3D2WA 3OR1A 2AX0A 5D15A 4ECVA 1QD1A 4E98A 1FI4A 1DTQB 3GWCA 2ZH9A 2ZC4A 1E6VB 2PEHA 2V8GA 2LVWA 4UQGA 1RHUB 3E51A 2B3TB 1RJJA 1IBLJ 4NYPA 4FKYA 3Q8RB 3MWBA 1TKZB 2CVEA 1HBMB 3KLGA 1FKAF 3ZC4A 2OPQB 3VF0B 4JI1J 3GSIA 2FZKB 3OJUA 2AQ4A 4WFBQ 4QYRA 3M1VA 1WHYA 4QW8A 1WF1A 1SC6A 1S0OA 3M8WA 4NCGA 2HIQA 3V6KA 4D3HA 1NO8A 3P6YC 5KG7A 5DGAA 5J2QA 2H5EA 3PRDA 4JV0A 1HBUA 4M5KA 1XERA 4FYDA 4RNFA 3NCRA 2KXFA 2E9RX 2X3DA 1Z1ZA 3IRXB 2A10A 4RW9B 4LIRA 2MZQA 2HNYB 1X4GA 3D68A 4M95A 2DGWA 2KXHA 1BQNB 1JLAA 2DNPA 4YR3A 1T9TA 1DLOB 1RWVB 2C2RA 1U2FA 3GMGA 2I9SA 5AJ3J 3QYYA 2DHHA 5CZXA 5KFOA 4WP8A 2B56A 3PW7A 3DGPA 1H2TZ 1N4LA 3MEGA 4KGVB 1TL3A 3GE9A 1U6FA 2JH3A 4X4VA 1NJIT 2OELA 2CJBA 2GVZA 1R8AA 2DCLA 1JLQB 5LT5A 3DXSX 2RDJA 2GS8A 3T1YJ 1Q1KA 2AEJA 3MXHP 3BH6B 5C24A 2C3UA 1NSAA 3LPEA 4NXNJ 4HI1A 1AYEA 2AWZA 3WX8A 3ZO7A 4B9SA 1TV6A 3TO8A 2E5LF 5G0RB 2FGOA 5G4DA 1J5OA 3E01A 4HDHA 4ECUA 1VFJA 4FS2A 2HBQB 2IRXA 4MKBA 5EX3A 1Q79A 2KVQE 2OD4A 2NLWA 2WSCC 3I0RB 5J2NA 4CTAB 2CG4A 3FQLA 1S1TB 3F56A 4DX5A 1IKYB 3PXGa 1EZZB 1AUDA 2AMCB 1RE1B 1HWKA 3NGDA 3AOBA 1PJ7A 3QBCA 1U49A 3RRHA 4ECXA 3VTIA 1PJ6A 5FDLB 3JSRA 3US5A 2WHOA 4QWDA 4UT4A 1RQ0A 1WF0A 4B3SF 1FKOB 4DF4A 1UW4A 2U1AA 2QSWA 3D54A 5I42A 1XC9A 3MMCB 3C6UA 2ZHBA 3L09A 1VRQC 5KG5A 1EETB 5SUHA 3M6WA 3LP1B 1FX2A 2VPZB 1LWEB 2AZ1A 4DSLA 2RIJA 3PZPA 5L1KA 3AJDA 3D6MB 2DNGA 3QIPA 1L3KA 4NE9C 3CCZA 3CJKA 3TNVA 2GMLA 2YX1A 1FHTA 2FVRA 5GMEA 3ZTPA 5C42A 4F26A 1R6VA 2B9XA 1IKXB 4CDIA 2DK2A 2QZ8A 1JLEB 5CD4H 3F41A 1C1CB 2UV8G 2ASYA 5E3QA 4ECQA 1NK5A 3DLJA 1G6BA 1SUQA 3GFZA 4KC5A 2OIHA 1UVNA 4ZCKA 2UVVA 1IXKA 5KFPA 4TU7A 3QT6A 3RR8A 4EYIB 4OYWA 2DD8S 3PYGA 3OHAA 4U8VA 4ZMMA 4KH0B 1A9NB 3I5AA 4DL3A 2LEPA 3K5OA 3O2IA 3DHWC 4EYHB 4FS1A 2ZDOA 4I7FA 3DOKA 1VK8A 1PG5B 5J1EA 4WE1A 1KHWA 4ZIWA 4N77A 3HSGA 4DR2F 3UQSA 4JUZA 4FYWB 4P9SA 2NR0A 1P1LA 3C16B 2DXFA 2D3O1 3PDNA 2X1BA 4PAAA 1EQMA 2OLWA 2E5LJ 1RAAB 2KHCA 3KOAA 2QFJA 1HBOA 1JXEA 3ZNJ1 1ZM2A 2HS3A 5MLCV 1H7WA 1VC6A 1B0VA 1LWCA 4QIGA 4IQXA 1C4CA 3NEKA 3TVKA 2J6SA 1WUUA 3T41A 3MM5B 1YJRA 1LNQA 4D3GA 3KMQA 5DG9A 3DOLA 5AE3A 4ZS6A 1ACMB 1LOUA 4OYOA 4KPYA 5ETSA 4ZK7M 1W7WA 2VPWB 1MWYA 1CC7A 3TRGA 3VWSA 1IM6A 1KLMB 1FE0A 1KD1T 2P9GA 3MCOA 2VONA 3TZZA 4B3SJ 2ZBQA 4NA1A 2EG2A 3HKZD 2QJ3A 4PQUB 5HN0A 4ED4A 3NOCA 2HURA 1C0UA 3EGWB 3QGIA 1WKJA 4Z37A 2W7OA 2CNLB 5E3RA 4QW9A 4RW8A 1RT5A 3V6DA 4NLTA 2MY8A 4O44A 2QGFB 3G96A 2XLIA 3OLAA 3AJ2A 4A8KA 4EGLA 1RADB 4UUXA 4O0IA 4RBTA 1CULB 2YKNB 2PMZD 3TUIC 1F5BA 3G9CA 5KG2A 2Z4PA 1BGXT 2VFUA 3DRPB 4QR1A 2XMMA 5IFMA 4WZQA 3EXCX 3MMAB 3CEDA 1NH8A 4CO5A 4P7TA 4A8QA 1UEUA 3QRRA 2ZBCA 1Q81T 2DBBA 1VQ6S 5L8RC 4WKRA 2OKQA 3GPAA 3NBPA 4NA2A 2R7OA 2PMWA 5DQHA 2XULA 1YRXA 2V4JA 4DV7F 2HS0A 1O6XA 3BGRB 1N6QB 2QX0A 2VBYA 1OSCA 3N9UC 5KT2A 1X0PA 3KHRA 4PG7A 2EI5A 3ZTOA 4Y0FA 2M0GB 3JXOA 1FVSA 2AJ4A 3CMAS 3WDOA 5FLXU 5CA5A 4ITSA 1B64A 4HACA 1XBWA 4BWJA 4LFAJ 3VGTA 2MQPA 2KFNA 3AD8C 5ITHA 2ROPA 1NB7A 1S57A 3H5XA 3LPYA 3UCGA 3VAGA 1Y5LB 2HRTA 1XMBA 2MZ1A 4JI3F 1UWAA 1E6YA 4UF4A 2GQ2A 4DR2J 3JAMY 1NSKL 2MQMA 1R0AB 2HFZA 1WI6A 2MLXA 2BXJA 4DOZA 2LYVA 2OGUA 3MUTP 2CPEA 4YB6A 4C11B 3BKTA 3VALA 3GZ7A 1VQPS 1N5YB 2EFQA 3HK2A 1F9EB 4LUBA 5IT4A 1R43A 2J9EA 1X4EA 4M5MA 3FMBA 3K5MA 2ZWPA 1K1QA 3BO3A 3Q86A 3PEJA 3W8GA 4LFCJ 2B7CB 4M5NA 3PHEA 2RS2A 3I0SB 4DHVA 1SH2A 2RVJA 1QVGR 4K4YA 2YKQA 4A8SA 4ZVGA 3T3FA 4QU7A 4ZPDA 1IWAA 1HNXF 1JJCB 3CPWR 2AIRB 4BC9A 3Q8UA 2D69A 1VLYA 2VA2A 1WOPA 2HWHA 2E1MC 4IRDA 2HMIA 5I3UA 4DX6A 2C2NA 3GV7B 4ED7A 1FTRA 2CQ0A 3D6TB 1YJVA 3M9OB 1R8HA 1JWWA 4HTJA 3B78A 2HG4A 2LP4A 4CO2A 4R8UB 3BPDA 1UTAA 1YBTA 5LXYA 3QAUA 4F4YA 3N4WA 3BO4A 3QLHB 3KK2A 1BWVA 4Y00A 3SQOP 2V2ZA 2DXEA 4KV8B 1WG1A 1YI2S 4GKJF 4X4RA 3J81Y 2OPPA 4KSEB 4EWTA 5L1LA 4B9NA 2WCXA 2Z30B 4WFAQ 3DMJA 3I87A 4DPXA 4J9OA 4PEOA 4TYBA 1A6LA 4OJ3A 2ZH8A 1RTIA 2HWIA 1ZAWA 2HNZA 3TJAA 1WG4A 2DT9A 3QGHA 4DI6A 4TQSA 1ZAVA 3ZXWA 2YNIB 1HNVA 4LR9A 2CUYA 4GVBA 1YZ6A 3MAAB 2HAIA 3DLBA 3HM9A 4JOUA 3KJFB 4USKA 2ADCA 5K5MA 3N79A 5KFGA 3IR5B 3DU5A 1FO1A 2J9CA 1IR1A 2O66A 1X0FA 3G8TA 2IJRA 3OTDA 3Q0AA 1RTJB 4OI2A 5IZHA 1MU2A 4N8OA 4J9MA 4RJVA 1QE1A 2F4FA 1Y10A 2YXLA 1FDAA 1JKHA 4ELVA 2CPZA 2YQ3A 3SV3A 2W9AA 1CJVB 4JI3J 3EPIA 5HJXA 3MECA 4ZHRA 1UETA 3PYEA 3D9BA 4QIEA 1SJQA 4W4MA 2QLBB 3M30B 5IM0B 3GTYX 1RWOB 2BOAA 3TZXA 1RDRA 3DLEB 1KNZA 1SB6A 4UZBA 1NDKA 1FK9B 2VC1A 4O4RA 2VIHA 5ETQA 4N56A 3MFHA 2AP6A 1NMEB 2ZKTA 3GB0A 4PCQA 3UW1A 1X4BA 3N5FA 1SJ4P 1HNZF 3DRRB 3UNYA 2HQFA 5HMWA 4WZMA 4MK7A 5FD1A 2VBWA 3H7HB 2ZVIA 3MTJA 1HWJA 3CXCR 3OV7A 3IBFB 3P49B 1BMQB 2CWKA 2W4DA 3CJTA 2VUGA 3IG1B 1RUSA 1TAUA 3OTBA 3KJVA 1D0EA 3OR1B 1YZ7A 3FMWA 5C25A 3HDSA 3MR7A 2L9DA 3N01A 2HHXA 1YK9A 4A47A 5F9NA 3FBFA 4DV5F 3IM9A 5ETOA 1VBXA 4J9UE 2P9CA 3PACA 5DJBA 3FBCA 3R97A 3KLGB 2RMLA 2EC0A 2XMAA 1D3WA 4ZPVR 2MKKA 5ETPA 1MWQA 3GLJA 5KFWA 4WYWA 3M1VB 4ECWA 2IRUA 4OFZA 2HZCA 1RT3A 3B4DA 2GIQA 4GKJJ 3IMQJ 2WVCA 5J2QB 1FRHA 1SJFA 2J6TA 3R1LA 2K7JA 2L08A 1HBUB 3U1MA 4LREA 1U45A 2IJNA 1YTYA 1QAXA 2HHPA 3SBMA 2VB6A 1M1GA 1KVIA 4IFYA 4K4WA 3J7A1 4P2MA 1JLAB 4MK8A 2V69A 3E8OA 1S1UB 1DAXA 3WX4A 3CD5A 4ZLNA 1Q5VA 2XCPA 5CYJA 1GXUA 2DNRA 1ZTTA 2OD6A 2MJNA 4OHXA 1RTDA 3NNHA 3IGNA 2E1RA 1HHSA 1VLOA 4QIWD 1HWLA 1B0TA 3DGPB 1RKIA 4LBPA 1TU0B 3MEGB 1TL3B 1R89A 2WONA 4FVCA 3EMTA 2GVZB 1S1XB 4RNOA 2XMKA 2QL9B 1W2BR 3Q2SC 4P10A 5IWAF 4OZ5A 5HROA 2MJUA 3R3TA 2E9TA 1T94A 3DRSA 5ETRA 2MSSA 3FBEA 5C24B 4MFBA 4X62F 3CCUS 2UVUA 2XEXA 1FERA 2LA6A 2KT5A 4LSZB 1TV6B 4CLYA 4NLYA 1MMLA 1J5OB 3HZGA 3KLEA 3OT9A 1NK8A 4EZ6A 5J2NB 3KXDA 2Z56B 2LEAA 3T6JA 3SCKE 1URNA 1NU4A 2N82B 1WHVA 4A8FA 2P6TA 4TYAA 2DGQA 4Y28C 4NYZA 3OFEA 2W9BA 2P8IA 2HKEA 2ADBA 4V19X 1RT6B 4X2BA 2KRBA 3H90A 1U2RA 4DN9A 4NRTA 3H0PA 3TX8A 2HYIB 1UFKA 5DLGA 2CQ2A 5I42B 2GV1A 3C6UB 2G2YA 2IM3A 3LA0A 2EFOA 2Y8WA 2AEMA 3UN2A 3F73A 2GQCA 2GHWA 3D3BJ 1S48A 1FA0A 3A8JA 2HHHF 2HBRB 1T3OA 3QIPB 1XMOF 3L9ZA 2NYIA 3CC4S 1GX5A 3CJKB 4QR2A 2CJAA 3R2DJ 3TUZC 2V2VA 4KHMA 1LW0A 5C42B 3EGNA 2CKWA 4DR4J 2YQ1A 1U02A 2JLGA 1S6OA 5KFZA 3FK4A 3LP0A 4F3QA 1S6PA 3MR6A 3WC2A 3SMZA 2HNDA 3PW2A 4C7QA 3QZ7A 4RWXA 3U02A 1VQMS 3GSDA 2QFIA 4EBDA 3FZBA 4NMXA 5D3GA 2CPIA 3OFHA 1BE4A 4RU2A 1Y3KA 5JUMA 3ENWA 2W8LA 4OV6A 5RUBA 1S12A 2PN6A 3AD7C 4TY8A 2NS1B 4MIBA 4LRDA 2VQFJ 4L72B 2W7PA 4QWEA 2XBPA 3THPA 2CA9A 2FQQB 4LF5F 4KR0B 4ES3A 2CJQA 1K47A 2ATCB 4I7FB 3DOKB 2ZKUA 5CH7B 3CCRS 4F0KA 5J1EB 1RWUA 5L9XA 4FN5A 4KGKA 4WE1B 2LU1A 4QU6A 5ETMA 4X62J 2JDJA 2CPYA 2OTJS 2W2MP 4ZVPB 5KG0A 4YHHF 4NMLA 4N8NA 1LFWA 4DV1F 4MJKA 4BWMA 1KQSR 2FZCB 1RCXB 1IJEB 1HBOB 4ZDNA 2XZWA 1AXQA 4RU9A 1EARA 3NAHA 3SIPB 4A4JA 2KFYA 2WTFA 4X66F 2E5GA 1REVA 1X31C 5KTQA 2OSRA 3DOLB 5J1PA 3EE3A 3JTNA 1M5SA 3P8BB 4M8LA 4OJ1A 1XIQA 4TU9A 3HF5A 3SSSA 1CC8A 2FY1A 2QLJB 5KT4A 2CXEA 2ZJQQ 1PAUB 1TQLA 1Y4ZB 1ZYQA 1N33J 5HL7Q 4JV1A 1X4HA 4ED5A 1CSJA 3A8IA 1C0UB 4RL1A 3OXGA 1RT2B 2QG9B 4J9VA 1RHQB 4RW8B 1RT5B 2C2MB 4TNOA 3QIDA 3BBCA 4WPAA 2R7XA 3M9MB 4O44B 4WP9A 1XMOJ 1WTFA 5LMUJ 4P72A 2VDIA 4O0NA 2YKMA 1L3TA 1FJCA 1VYAA 3VAKA 1LEOA 1K9MT 1C2PA 4K7QA 2VV5A 2ABYA 5LSRA 5GAHI 2RB7A 5KFXA 2EBEA 3MURP 4X4OA 3L3CA 1MSWD 5F8NA 3G6ES 3SCJE 8AT1B 4UY85 3R8YA 1RTZA 3Q8QB 2IHR1 3NBPB 3KUHA 2LCWA 2V4JB 4FZVA 1KRPA 3SZ2A 5IV3A 2KG0A 3O8WA 1RWPB 1IKVA 4WIIA 2F4VF 2B43A 2IA0A 3QRPA 3TA2A 5KFMA 5GAEU 1UKUA 4P2FA 1SKWA 2VA3A 1WDTA 5AXLA 3IXQA 4HH1A 4HACB 4DPUA 2BDPA 4DDFA 3OD2A 2LXUA 4Y3CA 4YQWA 1YHQS 4ZPBA 1TL4A 1V3RA 1XR6A 3MOZA 1HMVA 1VS3A 4PXDA 1L3UA 3C66A 4OYZA 3QSIA 4UTGA 3CDEA 1SH0A 2EPIA 5L9NA 3DDNA 2JEGA 3QT5A 1QUPA 2RHQB 2IBOA 2VC0A 3LO3A 1Z2LA 4F3MA 2HRYA 4ENOA 2DH7A 3KG1A 4L76A 3B8HA 4DV1J 5K8MA 1HHQA 7FDRA 4UY8T 4O3PA 2WOMA 2FHJD 4JI5J 2BV3A 2K3IA 2VBXA 2HAFA 3MR3A 4X64F 5LSOA 1V9OA 3BYPA 4HDGA 2G13A 1ZS6A 3NRBA 1T7PA 3RRKA 5KFTA 2F63A 3AOCA 5CCLA 4NLSA 2R2UA 3E2EA 3GP9A 5A8WA 3M32A 4DU7A 1NZ8A 2NZCA 5H9FK 3D28A 1NZAA 2FDNA 2UUBF 2C3YA 4FBTA 2VF3A 2G9OA 2XMWA 3OTOF 1MN7A 3LAKA 4DJBA 5CAAA 3OL8A 2DGUA 4MIWA 3UE2A 2RHSB 2FTRA 5GAGI 3NWGA 5I3UB 4DR1F 1RAFB 5IT9Y 2MQLA 1N5SA 3IBWA 1U1QA 4HT7A 5LOQA 2EK6A 3NS5A 3NGKA 3W5YA 3T5LA 1LQ9A 2IFXA 1DFDA 2M8DB 3V4IA 4ILMA 2VASA 3KK3B 1VRUA 1R8BA 3KK2B 1SCJB 5H9EK 2UP1A 3C8YA 2LECA 3FFIA 2ZHAA 2YBVA 1N88A 2OPPB 1U47A 2ZH5A 1W25A 5HVFA 2GIRA 3DMJB 3THTA 4U7CA 4USVA 1UZHA 2J5AA 2C2ZB 1ZBTA 2AJ0A 3D0HE 3CWJA 1RTIB 2C2OB 4E0DA 2HNZB 3GCXP 1HARA 1G1XA 3RZAA 1HNVB 4OHZA 3GV8B 2KH9A 4GVBB 2WRMA 4DX7A 5DG7A 4LFBF 2CRLA 3KJNB 1F0XA 1XR5A 1KWMA 2NREA 4DR3F 1JMTA 1HWUA 4DL5A 4QIVA 2R8HA 3M9NB 5IV4A 1MU2B 2MB0B 2NUUG 2R8KA 4ED3A 5HQMA 1JKHB 3MHYA 2H3EB 2RU3A 1LWFA 1UPPA 2X1GA 4PRFA 2A0FB 3MECB 3IO1A 4ZHRB 1FEEA 5KFHA 3MUMP 5IC4B 1Y5NB 4C8LA 1P9QC 1X60A 1RWKB 3WC0A 1BC6A 3CSKA 1GQEA 4BCAA 2DIVA 3PFEA 2EG1A 3FBBA 1M5HA 1GTEA 4EO6A 3M6XA 4ZN3A 1S4FA 2CZVC 4H4KA 4ED0A 3O1LA 4W98A 3UCUP 3PW5A 2K8GA 3TW0A 3FRZA 1KFSA 1BXNA 4QZVB 2H48B 4FYXB 2HWTA 3UD4P 3VAIA 3DI6A 2DR5A 1CJUA 2BABA 3OL9A 3FEYB 3MM9A 2UXDF 1YRTA 1F3FA 2JEJA 2ZH6A 4KGXB 5ETVA 1P9YA 4TQRA 2AGQA 3UPFA 3W65A 1VQ5S 2Q6BA 3BH7B 1QDUB 4OYIA 2D3ZA 3T5KA 1JJ2R 3KJVB 5C25B 4IG0A 3OW2R 1NDPA 1Q4RA 2ZZTA 2UUBJ 2DH8A 4IUFA 1AA1B 4MAKA 3OTOJ 2XLJA 2ZM6F 2G0JA 4DPTA 2L9NA 2DKOB 1T3NA 4OZLA 3C6TA 3QPIA 4DR1J 4ZPWR 1Q8IA 2AZ3A 3AXKA 1SV5B 1OO0B 2VHGA 2JL9A 2KFZA 1R8PA 3BEGB 3U1LA 2ZDPA 2VU5A 1VIOA 1OYDA 5H9FJ 2C3OA 2BJDA 2UUAF 3RB6A 2C2KB 1U6ZA 2VODA 4B3OA 2HHQA 1S5ZA 5F0UA 3DYAA 2YWKA 1OY6A 1RT3B 4CM0A 3A8EA 1UP1A 1U2CA 4B9VA 2R7SA 5F8HA 1NCLA 1DTTB 5J2MB 4CM2A 1AW0A 4NXMF 1EIYB 2BM1A 4L74A 5HMXA 1VBYA 1T8EA 4NLWA 1TKDA 2C2DA 4DQRA 1K73T 4V19J 3BQ0A 4IFYB 2OHDA 4J9PA 2XB2D 2XYPB 3OXFA 3KDNA 2DRDA 1CJKA 2YH0A 4LFBJ 1HR0F 4B9MA 3X1LB 2HVDA 5E3AA 5BYRA 1QAYA 1X5OA 2DNQA 2WVBA 5GMDA 9RUBA 2DISA 4DR3J 1RTDB 4ZVSB 1JXVA 1Q78A 5B0EA 4KH1B 3H4DA 1BD6A 4OMFG 4GVLA 4F4ZA 4C8NA 3CJSA 2WONB 8RUCA 2LEBA 4RKUC 3UN3A 4PPDA 5BXIA 4DXLA 1U1PA 3QT8A 2XQCA 3ADAC 4IKAA 1VQ9S 5HROB 4JYAF 2YPYA 1UL3A 1D9AA 4NLVA 4MFBB 1OS5A 3Q8YA 2LKZA 4ERDA 3T1HF 2XGPA 1AT1B 3CJ8A 4LF4F 3HKWA 3F0NA 5E0OA 2NXUA 4ELTA 3SYZA 3HPOA 4ID8A 1G7CB 1RK8A 2XLKA 3MEEA 3FQKA 3M2RA 4Z2XA 1PBUA 2DNZA 1VRTA 1M1KT 3R5AA 2UXDJ 2W9BB 4JI8F 2YWGA 1BHNA 2HFSA 2AT1B 2LA4A 2G2OA 2LDYA 2I6WA 1GMUA 3FCHA 1VBKA 2FZGB 3ET6A 1FT8A 2R42A 4PABA 3QFHA 1B4SA 4XPCA 3SFUA 3CO9A 1IBMF 5D4OA 5I3PA 2HQDA 3KYLA 3LANA 4J9QA 4FVMA 5AT1B 2IMWP 3ILOA 4U9RA 4TVAB 4DSIA 1IQTA 1QJHA 5AE1A 4DPOA 2C3PA 2V8DA 4EBCA 4CLUA 1HLWA 1BQXA 1S99A 1XJWB 5KFVA 2UUAJ 1LW0B 1U8SA 3CW2C 3O44A 5A0YA 2CQ1A 4WFXA 1VQYA 4USIA 2AF6A 5J1NA 1B99A 4F4XA 1S6PB 1H7XA 4F0MA 2CADA 2HNDB 1XR7A 2I5JA 3C15A 2MZTA 2KDOA 3VV2B 1FXLA 1KR4A 2QYCA 2CQ4A 5E3CA 1TKXA 1S0NA 1KOHA 4NXMJ 3U1NA 1ZOTA 1RTHA 4HR2A 3W63A 3D1QA 2DJWA 3PTWA 3BGOP 5D3GB 2P6SA 1OQ3A 2B51A 2ILZA 2JZ5A 4ZP6A 3H5YA 4KO0A 1NHKL 4X4QA 1N56A 2AJQA 1X4DA 3WIVA 4CI0B 1PC4A 2F9JA 4TY8B 1HR0J 4DL0C 2V2KA 4U6PA 2ZE2A 5KFCA 2RSQA 1S0MA 3ILJA 3EZ5A 2YWHA 4H4OA 4N5SA 3AB2B 3HSDA 1P27B 3R5BA 4OI4A 3MD1A 2L48A 2ERRA 4BLGA 3JAMU 1SJ1A 1IBKJ 4OYPA 2F8MA 4DL4A 4ZVQB 4W90B 3RUBL 3CDWA 1RBAA 1SL1A 5K8OA 1IM4A 3MAHA 2MQQA 3OUYA 4R0EA 2UVWA 2NXJA 2GFFA 5A8RA 4ZVTB 3H5UA 4OYAA 4HH0A 2OPRA 1HNIA 2CQCA 4KHPF 3G82A 4EU0A 1EKRA 2VKZG 3T1HJ 3VGVA 3HI9A 2LXIA 1VCTA 4XIUA 3TUPA 1WF2A 4YR0A 3QFWA 1IUJA 4LF4J 3AHPA 4L3KA 1X8DA 2LU2A 5E41A 2OPSB 5A6PA 4OZ3A 4B17A 1RAGB 1REVB 2GCFA 4OX8A 2XYHB 4PUOB 1T9UA 2MKIA 4M1KA 2MKYA 4EZ9A 2FYXA 3BM7A 4WTYA 1N5VA 4JI8J 2BRKA 4ECYA 1HNWF 2BEFA 1NH7A 2M9KA 4G6VB 1FRJA 1UWBA 5KFFA 4BDPA 2YKPA 4TXSA 2OEKA 1SBRA 1YGYA 1BLUA 3PX0A 4DQSA 3D0GE 7AT1B 3JSYA 2I1RA 4FF2A 1N54B 2KM8B 3CNQP 3KHGA 2DTJA 3K8WA 4TLQA 1S76D 3FSIA 4F67A 3W2WA 4U67Q 3J81U 1WORA 4KAIA 2YKMB 1SH3A 4DSFA 4DPYA 2CDRB 3H25A 2IYIA 4KTQA 3AA8A 2YQ0A 3TYTA 3Q2TC 4L3NA 4OI6A 1ULRA 3GYXB 4Q45A 3B82A 1JLFA 1Q95G 4NCAA 4IG3A 2DY1A 1TFYA 2A1BA 3R7BB 4ZCMA 2MLZA 4J7CA 2EFGA 3NY0A 5LSLA 4RUAA 5D0RA 5EWGA 1L5UA 1MG7A 3GJTB 3W5ZA 2VPXB 1LXJA 4WBFA 4K5RA 4FF3A 3M2VA 1DJ0A 2X7IA 4J9LA 4ZKAA 1IKVB 1WNEA 2ZBPA 3BDPA 2KJWA 2BJ3A 2VQEJ 4J9RA 4JV5F 5T7LA 1KDNA 1SIWB 1Y0HA 4F36A 3RBEA 4YMEA 1NK6A 2GJIA 5ETKA 3H2UB 1D9DA 3I55S 2IDEA 1FVQA 2I2YA 4LF1A 4FF4A 1AROP 1RT1A 3D6FB 2NXEA 1PAEX 2BE7D 1X5PA 3D7SB 4F4AA 1HMVB 4NEZA 2R8IA 2OAUA 1XNRF 2SXLA 2CQIA 3MDFA 1I51B 3HO1A 1PJ5A 1IR2A 2HHWA 1JLCA 1C0TA 2GHPA 2AGOA 3FJ2A 4LR7A 3JQJA 3K58A 3KUEA 5KOWA 2OTLS 1FFGB 3AQOA 2D3UA 5F8LA 3CD7A 4CLSA 4F02A 3BSCA 5EUHA 4TY9A 4ELUA 1CPZA 1NKEA 2R7QA 1RT4A 3QJPA 1KONA 3V2UC 2WOMB 3NGTA 2FLLA 2C2EA 2RILA 2X3GA 3D0IE 4DV4J 3KUGA 5KFJA 1X9WA 2CNNB 2R2SA 4AQYJ 4XAKA 3ENQA 1X5SA 2LFVA 1ZM9A 1VQ8S 3N28A 2GVDA 2H54B 2Z2LA 4F4KA 1CQMA 1S1VA 5KT6A 4IH7A 4OZ1A 2IJFA 1ZTWA 4GC7A 1HNWJ 2Q6CA 3FSXA 4LBHA 5A8WB 2GMHA 5KFUA 5LJ3Y 3M32B 1OWXA 3ILLA 4Z7CA 1UMJA 5KFBA 4B9TA 4FXDA 3MFIA 3PJ9A 3IAS9 5KOXA 3BV8A 4C8OA 3HFVA 4DWIA 2HHSA 3LH2S 4WTOB 4DR7F 1TL7A 1V6HA 2VJUA 4WJBA 2FY8A 3G6YA 1HQUA 3EX7B 1IWGA 4JI0F 1AB8A 2YKAA 2HLUA 3W5XA 2RRBA 4OYBA 4DSJA 1HBMA 4Z7YA 3V4IB 1U1LA 1FRIA 2BACA 1QSLA 1VRUB 4H54A 1AUSL 3TJ8A 4ZP9A 3HMJG 4WFYA 2RF2A 4L73A 3FFIB 4B08A 2CVIA 2F1FA 1EX8A 4R25A 4USJC 1GXLA 4ID5A 1S9GB 2VFSA 3PO4A 1R7IA 3MCNA 3A1YG 3X3UA 1VHFA 1QTNB 1O8BA 1JLGA 5DO2A 5LL6d 1R0BG 4CLZA 4KBIA 4YFUA 1SC3B 2CYYA 3P5BP 4R0JA 3DLHA 2V0NA 3OR2A 4P2SA 4G65A 4DUYJ 3UD5A 3IN5A 5HK4A 1NJXA 3GONA 4PWDA 3GYGA 2JLFA 3D6HB 1BWEA 4CLFA 1VQKS 4NYOA 3THVA 3GIJA 1TR0A 1WC0A 2VKRA 3QJLA 4FBUA 4PG6A 3ZZPA 3QNWB 2QA1A 4ZPAA 1RAHB 1Y3JA 2Z58B 3RBDA 4EUVA 1QSSA 1K0VA 3ZNUA 2BQUA 1HKAA 1MMDA 3CCES 1XNRJ 3D3CJ 3W2VA 1FDNA 1LWFB 5IS2A 3UDCA 2CPXA 1VMBA 2OFGX 1JNZB 3ILIA 5JJBA 3AH6A 2W8KA 1N48A 3TVZA 1Z4UA 1QY7A 3K2YA 1KFDA 3CJ5A 5K9FA 1F2GA 2UXBJ 4OLOA 2XGQA 2XCAA 2G0IA 1ZPVA 3M8SA 4ZCLA 2FJXA 2Q3PA 2N7YA 4WIQA 2VH7A 1Q0NA 3SFGA 1SVDA 2IAJB 4DV0F 2N4DA 1NLKL 5KFQA 2FHOB 3PM9A 4ZJOA 1TUWA 4Y6IA 4DS4A 1UFLA 2NCKL 1VJWA 2NPIA 3NWRA 3I0RA 4LMZA 1SKSA 3DI6B 1CJUB 3GIMA 1VHIA 3G71S 1R0CB 2BQ3A 2ZITA 3MM9B 2XMVA 3RAMA 3MPWA 4QIFA 1NXIA 3KJQB 2J0WA 1FD8A 5IQ6A 2CJ9A 4MK9A 4WP3A 2HFVA 5IQQA 1CEZA 2UUCF 1JLBA 3AT1B 2XHWA 2P9EA 3ULHA 3BKUA 4IG0B 2DHGA 4WU3A 1NJYA 2FD2A 4OZNA 3RAQA 2OUGA 5HBMA 3CE8A 1DURA 2YH1A 1N34F 3C6TB 4DR7J 4ECSA 2CJXB 1NK0A 2Y1LB 2KTQA 4NLRA 1IQZA 5KFAA 3BSOA 3V5RA 3FEZA 3NS6A 1WJ9A 4OI3A 2JVRA 4OQJA 4FXVA 3KKFA 2GJFA 3J7AN 4LIWA 4B3TF 2C28A 2XTJP 3DYAB 3B54A 1HIYA 2ZNYA 2HGNA 2CPJA 4DSKA 3MOJB 1HYSA 3J7YU 2AEFA 2ZUGA 2AX1A 2BR0A 5BR8F 3AY0A 1F5AA 1ZM4A 4B3MF 1F1BB 4F2SA 1SKUB 4ZLLA 2XC9A 1V5IB 4C8ZA 2ASJA 3BREA 4Q44A 1HHTP 3HVAA 1CJKB 2FLOA 5CZVA 2XY7A 3M6UA 2XSJA 2EXUA 4DFKA 2ZH7A 1DQAA 2HFNA 2YNHA 2VICA 2HGMA 5E2QA 3BBFA 1YQHA 4C3LA 1MW7A 2DEIA 1MLAA 4MIAA 3R7NB 1R27B 1IKWA 2VG7A 2QIFA 3HHLB 4UW2A 4P2XA 2W2NP 1RAEB 2MKSA 1T0TV 1PYTA 2BE9B 5DGBA 5DZ6A 3RAXA 2DNOA 2DVIA 3GILA 4RW6A 2D1CA 3MI7X 1OIAA 2O1PA 1H3DA 4DQQA 2YKOA 4I68A 4NX9A 2BMBA 2ALYB 1T9VA 2YWWA 4M94A 3QZ8A 1RZMA 4NLDA 2EFPA 3CJ0A 4H4MB 5B7WA 2E7XA 2FJWA 3ITHA 2KZZA 4ZJLA 1NK4A 1PIEA 1X7VA 3HULA 4NLXA 1RLDA 2R2TA 1WHWA 1T11A 3MAQA 3KFWX 1S9EA 1N8RT 2PMHA 2KZMA 4LF8F 1YX2A 3TX0A 3MEEB 4J90A 3VQSA 2R9LA 3H59A 3KG0A 4FPIA 3MF5A 1QM9A 2X1AA 3NMAA 1LW2A 4NZ6A 2QRRA 3DU6A 4Y2KA 3MMBA 1FJGF 4O4GA 2HQ3A 3OVAA 3CB4A 2DEJA 3GJQB 2UUCJ 5JMNA 4HLBA 4ECTA 4B9LA 2BJ7A 3ET6B 2XG8A 4M5GA 2QE5A 2HHTA 4DV2F 3GJRB 3ICLA 5IOLA 4MT1A 2MKJA 1N34J 3NMRA 1NEEA 2E7VA 4IO9Q 5D4LA 4NLGA 4L6V3 1NSQA 1N5TA 3RB4A 4B3RF 3WZ0A 2DNMA 4BHQA 4YOEA 1S72S 5D78A 3RR7A 3OFFA 2BJ8A 5KFEA 2NSBA 3AQPA 3P3DA 4WXOA 2UXCF 4OHVA 4RPFA 3Q8VA 2VOOA 5K14A 3MGJA 4OLPA 3K57A 2DO0A 2XS2A 1ELOA 2LQ8A 2KVIA 1F3VA 4MH8A 1U24A 4F50A 3R5GA 2Q1LA 3C15B 4NLQA 2UUWA 4CLWA 2XZDB 4AL5A 4X84A 5BR8J 2U2FA 3DDKA 1KBRA 1RTHB 3W66A 3GCWP 2CQHA 2RDDA 1PBAA 2VG5A 3SQGA 5DDPC 3NG8A 1M5OC 3M8YA 1FX4A 3TZYA 4KO0B 3QAEA 4CLKA 2ROEA 3UCZP 5E7OB 3ELHA 1NHVA 2H5IB 2NXNA 1X4AA 4DG1A 2ZE2B 5HANA 2COLA 1Q7LB 1Q8KA 1FKPB 1WSRA 1XEZA 1WEYA 1NJZA 3SI8A 3ZZOA 5KT5A 1KQFB 3PJWA 3SSRA 4KY3A 2BJ1A 1WI8A 2QYGA 4XDCA 2E1CA 1UEKA 4RNHA 2G1HA 3R5JB 3NLCA 3P4UB 2QLWA 4LT6A 5F41A 3OUYB 5B0BA 5A8RB 3V6HA 1F60B 4I69A 2HQCA 4USUA 2I0XA 1RGVA 1HNIB 1T02A 3G82B 2IC3B 1VR6A 3MM6A 5SZTA 3MZIA 4QPTA 2UVRA 4W92B 4IR1A 3GQCA 4ES1A 4C3MA 4LF8J 3G8QA 1OPZA 4HHJA 4Q8FA 2XI3A 3HJVA 3POTA 4L75A 3GV5B 4CCHA 2C42A 1UVLA 1ZM3A 3N5BA 2IYGA 5EWEA 2GO9A 4Q43A 1RAJA 2N3OA 2VZ9A 1V3SA 2ACYA 2GQQA 1FJGJ 5F8JA 5HQLA 2HVIA 4NI2A 4DV6F 2Y8YA 5DETA 3R7SB 5IT9U 2RQKA 3BO2A 4F7VA 2ZJPQ 4YUDA 4RNNA 2XY6A 1UWBB 4I2QA 4EK2A 4DR5F 1SQEA 1RXOB 3VZHA 3Q8PB 1OQ6A 3IC1A 1FWLA 2HPUA 1D1UA 1R6YA 3CJ3A 4ZP8A 3Q83A 3DLKA 4IR9A 2BE2B 4TN2A 4MKVA 5HMYA 2IA6A 2R7TA 4UOCA 4N47A 2J0QD 4DV2J 4ZA1A 4M5JA 2PI4A 1IBCB 3EDQB 4O3QA 5E5NA 5DZ7A 3W1YC 5L1IA 3CCJS 3LWMA 1S1WB 1IBLF 1UVKA 3W2WB 2W25A 1F9HA 3ENAA 2XO6A 4DV7J 2IY5B 3MCSA 3I6PA 1VDHA 3PVXA 4J9NA 4LSLA 4JI1F 3WQPA 5ETTA 3KWMA 2UXCJ 1VIXA 4CO3A 3EJMA 2OFHX 3RBZA 2VG6A 4ZVOB 3MPUB 2Y0BB 3MEDA 2XMTA 3DLGA 1JLFB 3BS9A 2Y3YA 4IG3B 2Y1RI 4KV8A 1H74A 2BM0A 1EAYC 3W9JA 1YKWA 4CIOA 1RHJB 2WVDA 1QUVA 2RT3A 1FNXH 4EBEA 4FP9A 1U1NA 1X9MA 4C4WA 4YS2A 3ZZZA 3KK1A 2WB1D 3M2VB 4PR6A 4X4PA 4YN3B 3W9HA 2W2QP 1CBKA 1H38A 4GKKF 3AD9C 1VQSA 1JXLA 5T7LB 4HEA9 4E2FB 4QWCA 3WIUA 1CLFA 4P73A 2E1PA 3OTEA 4P71A 1B0PA 2CQPA 1FXRA 2N7CA 4Q7AA 3JB9k 2MGZA 5AJ3F 2BANA 3A3OB 2IM0A 1RT1B 3TR5A 2KB2A 4NCBA 2BRLA 4A48A 3PEHA 3L7PA 3W8PA 1VQ7S 2BA9A 2F3JA 1NRKA 1NPPA 2DR9A 2AYMA 2DGVA 4ZLPA 3KDOA 4URQU 4ECRA 4RW4A 1JLCB 4RR5A 4IOAQ 5I4MA 2BYCA 5HQ8A 1VI7A 2O5DA 2CAJA 3QGPA 3D1HA 3HHDA 3UWTA 5EGYA 3M05A 4C97A 2DR7A 1RA7A 4ED2A 1GEHA 2RE1A 1EKSA 2FLNA 4DL6A 4M5LA 1PO6A 1U09A 1RT4B 1DRZA 3UVJA 4USMA 2EWHA 5D0HA 1HNXJ 3G4SS 3TJ9A 4ED8A 3PY8A 2H51B 4G3IA 3BR8A 4PKDB 3DC2A 4GC6A 1HI8A 5GVQA 3A4TA 4IO1A 2NSCA 1URRA 1VQNS 3Q89A 4TKTA 3S01A 2DGXA 1S1VB 1T03A 1KVJA 4AYBD 4ZVEA 4DV6J 4EFAC 4QCLA 2MPUA 2B4PA 2PDAA 2J7WA 4USWA 3S7RA 4CH7A 1HWIA 5L38A 1WEXA 2ZNZA 2DHAA 4NCGB 5KFSA 1TL7B 4ZITA 2E1AA 5THWA 3HFKA 3IS9A 2XS7A 2PEBA 1SC4B 2EVZA 1YJ9S 1RABB 4KYZA 1HQUB 4XDDA 4IOCQ 5B0GA 5C5JA 4C6AA 1PSDA 3J81j 2HK3A 4ED6A 5DRKA 1HD0A 1HPZA 3MUVP 1FESA 2KYXA 2BZ2A 4M5IA 2XSFA 1B70B 2V8VA 2EW9A 3JYTA 1AFJA 2RF2B 1RHKB 5C7PA 3KNAA 3R5DA 2EFNA 4ID5B 1VK3A 3V81A 4A8YA 5D77A 2PFDA 2QN6B 1JLGB 4USTA 1B7FA 2QTWA 2P5VA 4C0BA 2CNKB 3OJSA 5T14A 2Q43A 3OSPA 3GFYA 2ZWOA 1QAJA 1N0UA 3EZOA 1NKBA 3OR2B 2UUTA 4GKKJ 1S77D 3SV4A 1UJ5A 4I0WA 4PWDB 3BZQA 1FDDA 1S1UA 4EO8A 3AOAA 4LRFA 3KNGA 2KI2A 4O3RA 2AD9A 3E01B 4LJMA 5K20B 4DBQA 2WZ1A 5DDRC 2FHJA 2QV6A 1ITPA 5KG6A 2EBGA 3W2VB 1HNZJ 3BPSP 2BW7A 3CC2S 1UCNA 3KHLA 1ZAXA 2PSZA 2H5JB 4WYLA 2RNEA 1S1XA 4PG5A 1RKJA 4ILLA 1TL1A 2V9KA 2YVSA 1G4CA 2R7RA 3FCVA 3BQ1A 1NNDA 2Y9HA 3W62A 2ZBIA 2A6MA 4K0KF 2MTLA 1GFWB 1YJ7A 5KT3A 3K7RA 4C2MA 5HO4A 2V4QA 2W4PA 1OMSA 3MR2A 1RU2A 2BVZA 3NGUA 3EUNA 4N7TA 1QSYA 3HJFA 3U27A 4DV5J 3B4MA 3CF5Q 4I6WA 2OH2A 3L7UA 4NASA 4HI2A 5C2GA 4K4VA 2B9EA 4HYKA 3JQKA 2MQOA 1RT6A 2BJ9A 1DY3A 4Q2MA 1A0OB 4PZVA 1JLBB 4K8RA 4PXBA 1XK8A 3NL0A 2FVQA 5HBMB 3U7JA 2QA4S 2K2PA 2OMOA 3N6MA 3R5CA 3IRWP 3ETMA 4WWSA 1SUQB 3UDEA 2KHDA 2O67A 2VFVA 2PT0A 2I8EA 2DPIA 1NDLA 2WBRA 4CH1A 5CHCB 2DR6A 3R6GB 2C3MA 2CQDA 3LGHA 1DARA 4Y2MA 2V67A 3MM8A 4NOHA 1RAOA 2F40A 2HGLA 1SKRA 2ZHOA 1WEZA 4J9SA 2FHMA 1VBZA 3T6BA 4J9KA 1TP7A 4HL9A 3TEGA 2FUG9 2BKNA 2FB0A 1HYSB 2RDIA 4PYDA 2CFXA 1G2EA 1YSJA 4YDXA 2YNFA 2HQIA 3BQ2A 4V1Ak 1WD6A 2IM1A 1RWNB 1FRLA 4Y34A 4XK8C 1OY9A 3TA1A 5C2CA 3KTQA 3CT9A 5IWAJ 1D8ZA 3DKDA 3K0JA 2XSJB 4DL7A 3BKFA 3T9ZA 2YNHB 4DFPA 2NZ4A 4JI7F 5F0WA 4DN0A 4PWWA 2Y1JA 2DNYA 3TAMA 2D9OA 4LFAF 2QC3A 1IKWB 4WKYA 4WK1A 1LWCB 2VG7B 2XWXA 3AB4B 4DPWA 4YDDB 4URSA 3RJMB 1H72C 3EICA 3P5TL 1IJFB 2POKA 3LTOA 4RW6B 3T9NA 2WAQD 3NCQA 4IDKA 3EPGA 3H2LA 4C3KA 2RD5C 1HD1A 5L39A 2V68A 5A8KA 3C3LA 2APOA 4Q5VA 2ACMA 4QYZK 4DL2A 3ITHB 3OL7A 4K0KJ 4JV2A 4WK3A 1TKTA 3GIRA 3J80Y 2Q66A 5J2PA 4J37A 4M5HA 1T9XA 1WC3A 4AT1B 1S9EB 4Q8EA 1Y11A 3PV8A 2Z57B 4G1QA 4ZP7A 2QMXA 4ICLA 3GFHA 4FXWA 3CCTA 2V6AA 1GMWA 4LFCF 3V6DB 2HHHJ 2RAQA 3PYDA 2A18A 2KT3A 1AZSA 4IRKA 1LW2B 3M8QA 4DUZF 4ES2A 3NS7B 5B09A 3M8PA 3MMBB 5D0GA 4O4GB 2FJBB 4KE5A 5KFDA 4ETXA 2DH9A 1VQLS 4NPOA 3N0VA 2WW8A 3W7BA 3CTRA 1FJ7A 2QT7A 1VC5A 1NUEA 3FNNA 1I5OB 3GJSB 1GAOA 1BQMA 2OMLA 5A76A 4Q0BA 1RT2A 2GNKA 4LQ9A 1UA0A 3TAPA 2FPHX 1P6TA 4DQPA 2BOPA 2XWYA 4OHWA 3B6BA 4PXCA 1YJUA 3S1TA 3CGIA 3RTVA 1V3ZA 2H4YB 4N76A 3BYRA 7FD1A 1ZZFA 5K14B 3D1OA 4CLPA 3OXLA 2DRAA 3ZZUA 3OL6A 4NZ0A 1JNRB 4QOTA 2AKWB 3S6EA 3N6LA 1H73A 2C1EB 4FYVB 1RBOB 1S97A 4LQ3A 2JEIA 2RRNA 2O3DA 4Y2CA 3VAJA 1RISA 1MNEA 1U7LA 3CJ2A 4LF5J 4B02A 2DCUB 1S6UA 3NAIA 1ZA1B 4OZJA 2XS5A 4DCOB 2VG5B 3SQGB 4CZCA 3O5TB 2HVZA 3FGVA 1I94F 1E6YB 1RYRA 2N3LA 1NM2A 5KG3A 4TU8A 1WC4A 4GO7X 4DG1B 3HCXA 4OL8A 3CCLS 2MHEA 3PX4A 3OVBA 3R6LB 1YVFA 5F9LA 2HZAA 4JI7J 1RT7A 4YHHJ 2DB1A 4K59A 3UFCX 1FEHA 1W2IA 4OJHA 2E7WA 1H2VZ 1TAQA 1WKKA 5JXSA 1FE4A 2L3MA 2RKIA 5LMNF 3ZTSA 3W64A 4UOHA 2JNJA 4P7VA 1NB2A 4OX6A 4X66J 5AXKA 3Q8SB 3W9IA 2BBEA 2IRYA 2J9DE 1KOOA 3K5LA 3PG9A 3R1HA 4K50A 2K1RA 1RYSA 2EFVA 3GR0A 4PWUA 8ATCB 2CPDA 4EI2A 2HHUA 2QO3A 1M5PC 4A8OA 2MZRA 3MM6B 2J6UA 2ZVSA 4RBVA 4OZ0A 4GO5X 5CCMA 2JVOA 1I1GA 1UAWA 1WC1A 3QSYB 2CWXA 3A13A 3QT7A 3TVYA 1R8CA 3TQEA 1WELA 2HMIB 1C1BA 4QYZJ 2VDHA 1RAIB 5EDWA 1SC1B 2V34A 3POTB 2B4VA 2HFUA 3HXMA 1NBEB 5AXMA 2Z2ZA 2FVSA 4I67A 4ZVHA 2NXCA 4DUZJ 1KKHA 3LWLA 1RLCL 3LALA 2FC9A 4NI2B 3IA0A 1ZETA 3CULA 4CO1A 4U8YA 4I2QB 3R9LA 2RQCA 2OEMA 4X4UA 2QSFA 4JI6F 3TAQA 3ZFVA 1FRKA 2XMJA 1U48A 3DLKB 2R8JA 2WB4A 3SDEA 3P45B 2CQ3A 1SIZA 3K5NA 2PIIA 1OPIA 4CNYA 1BUXA 3VZIA 2WVFA 3C14A 5DDQC 1DZ5A 4U7UD 4BS2A 4I4BA 2FVPA 1XQIA 3CCVS 2BQRA 1IN0A 4LSLB 3W61A 3TARA 1N36F 2V2QA 2F4VJ 1F2HA 1TK8A 1O0PA 3PCOB 2FIUA 2VG6B 2OSQA 3KK3A 3MEDB 2ZBRA 2G4BA 4LVNP 3DLGB 4K4TA 2RJZA 5HMZA 2A6OA 3BJYA 4KGZB 3I31A 2LXFA 2FJAB 4JI2F 3FSYA 1QE1B 1S4EA 2UZAA 1M0SA 3MMJA 4AUKA 2YX7A 3KK1B 4LF9F 4MKAA 1REGX 3W60A 4YEAA 1I94J 2HQGA 2B5JA 5HSPA 2KO1A 4QWBA 1I3OB 3TI0A 1PC5A 1GXTA 3AODA 1Q16B 1U26A 5GAEI 4FDFA 2MGZB 2BANB 3G87A 4G1IA 2GZOA 1CQNA 3E3XA 2R7UA 3T1AA 5A6WA 2PA3A 3NP5A 2ZOMA 2KG1A 1FD2A 4FKXA 4DMZA 1H6KX 1VJQA 5LMNJ 3PKYA 1N52B 4RW4B 3PFOA 1M5KC 2YTCA 4X64J 2XO7A 5KG4A 3PW0A 4BC7A 1IVZA 5GADU 2M7SA 3LGNA 3I5BA 2G2ZA 5DG8A 3UDVA 4K4UA 4FF1A 3NOGA 4MMOA 2B8PA 1N0VC 3FRYA 1KQKA 2PFFB 5KFRA 1KN6A 1QAIA 3UVJB 2UU9F 1NHUA 4NL5A 1Q82T 2GX8A 5F3TA 3IR6B 5KFKA 3TOQA 4ZCIA 2D7SA 3UD3P 3ENVA 4ANCA 1RU1A 3C46A 2J0SD 3H4BA 3UN5A 1SPBP 1FNOA 4I64A 4U7UK 5D8HB 1PILA 2DNNA 4XO0A 1UW9A 1WHXA 1GMWD 5CYQA 2H1YA 3HVTA 2MY7A 4X4NA 1WWHA 3IWNC 4HT5A 2HEKA 2YNGA 2MZSA 4DFMA 4DLGA 1T03B 2A2DA 2EC2A 4P74A 2XHCA 3SEOA 2JC0A 3R27A 3JSBA 4I6YA 4KFBA 3UNGC 1CS4A 4RUHA 3CJQA 2KXNB 3RGIA 4F04B 3H98A 4JI6J 5EX0A 3M2UA 6FDRA 1MROA 3TP2A 4X4TA 1Y00A 1TK0A 1S7HA 3JTPA 4PQAA 2F8EX 3IS9B 2DNLA 4YY3F 3VAHA 2GGPA 4XPEA 4P75A 4KB7A 1RI7A 3G2XA 1SV5A 2ZZMA 1VC0A 3I82A 3CMES 2D41A 5F8IA 2GJ2A 4KJIA 2W2OP 3OBIA 3HVWA 1N36J 4LSNA 3KLFA 1HPZB 4CH0S 4KQZA 4DR4F 2MQ8A 3QO9A 3K5PA 3JYTB 1FDBA 2FLPA 3PJXA 2WSFC 3C2PA 2G1DA 3V81B 3TANA 1GNKA 1GK8A 2KRRA 2FVCA 4JI2J 2DGOA 2WBMA 1DTTA 2ZUAA 4IFVA 3LQVA 5AE2A 5L46A 3KG4A 5J2MA 2DNHA 2YPZA 4ZVFA 3OSNA 3KHHA 2YWEA 3F44A 4LF9J 2UV8A 2B0GA 2V9WA 3DRSB 2VFTA 3JQMA 3PW4A 4HTIA 2R7WA 1TVRA 2BKOA 4AXJA 4OX7A 2IVFB 2VQFF 5M2RA 4QBUA 1JK9B 4DX8H 1KTVA 1SL2A 2F8HA 4RW7A 3KLEB 2ZD1A 5HI7A 3DOMA 2J7UA 4C0OC 2QA4G 1TFWA 4J5OA 2BW2A 3H5SA 2OJ3A 3SCIE 3DXBA 3L4BC 1TL1B 2NUHA 1F9FA 5B0FA 4C48A 3DRXA 4CNZA 2MZJA 4ZN1A 1HW8A 2KKHA 4ZPCA 1H0HB 3EZUA 5EHHA 5A2QU 4CYUA 3GIIA 2K06A 5BYSA 4CO0A 5BYQA 3H2VE 3K59A 5B0AA 3CC7S 1FNMA 1KHVA 2UU9J 3QWUA 4NA3A 1FF2A 4CRJA 1RHMB 3SCLE 1LWXA 2ZM6J 3KLIA 2MKHA 2P2CB 5CYMA 2E66A 2ASLA 2V8PA 3CD6S 3PRBA 1H98A 2PGCA 3VVTA 3RB0A 5GADI 1ROFA 5B0CA 4IQMA 4CP5A 2MMYA 4U95A 1FWKA 1XTZA 1TTHB 1PKUA 5GAHU 1S79A 4RUCA 3PX6A 4DCJB 2JHEA 1OSDA 1N33F 3LP0B 3I4HX 2B6AA 3BDEA 1X4CA 1TK5A 2EK1A 1EP4A 2KL8A 1HL6A 1U6BA 2DHSA 4YY3J 5KG1A 1O5JA 3NGRA 1GTHA 3CIMA 5DQIA 2ILYA 5LMUF 3HZEA 3UDLA 4ANDA 3MM8B 5DQGA 1WTBA 1FFWB 3HD1A 2W4CA 5T41A 4Y2IA 4BBYA 1SI9A 4C8KA 4OYMA 3VHQA 4K2JA 3PHTA 5K8PA 3Q24A 4E8UA 2DRBA 4M5DA 1KP6A 1S59A 4KKOA 3VGSA 5HJYA 2YNFB 4LRBA 4C8MA 2DGTA 3DRYA 4CQ1A 3BSNA 2H4WB 2ROGA 2KJVA 1T05A 4JYAJ 3HFZB 2WVEA 3JTOA 3PNIA 4J91A 1Z2ZA 4S0MA 2MXYA 4LF6F 1CJTA 4PG4A 4F4WA 3TAMB 3CDAA 2ZJRQ 3PO5A 2WW4A 3MEKA 2F9DA 3JSMA 1SL0A 3QATA 5LXRA 1EB0A 4LR8A 1S9FA 4YP3A 2B7BB 4I56A 1RHRB 3KLHA 2MHNA 3EXYA 4IDKB 1UVJA 2QL5B 3V4MA 1VOMA 3JS9A 5A8KB 3CCMS 1DBDA 2Z2MA 5DLFA 1FTCA 4F2RA 3CCSS 5K8NA 3PRVA 5MAOA 3EDRB 1QTMA 1TKTB 4DZ6A 2OEJA 2WSEC 2R8GA 2AJ2A 1YJWS 3D4JA 5J2PB 3DM2A 1L3VA 1RWWB 2MSTA 5D4PA 1XNQF 4JI5F 1EJ7L 1HQ2A 1XMQF 1NPRA 3GFXA 3S8SA 5GAGU 2V4RA 2OPSA 2CJKA 1S0VA 4G1QB 4F25A 3G6XA 2JSXA 5HVHA 4ICLB 4HVZA 1IBMJ 4F8RA 3D66A 1NSPA 3ZZYA 3DCAA 3LP2A 1YWXA 2E44A 2AGPA 4PUOA 1L3SA 1AZSB 3T19A 3M8QB 3I9V9 2JX2A 2XZTB 1TELA 3M8PB 3M6VA 4IYQA 3GR1A 4IRCA 2M52A 3QQCD 3RG6A 1J2VA 3H8YA 2LQ9A 3LF0A 3OVSA 4ALZA 3CVKA 3HVRA 3DNCA 2AHOB 1CVJA 3RYLA 1N32F 2QMUB 4OIXA 2IDLA 5H1SV 2DITA 4RO0A 3HD2A 4PXEA 2GHVC 1WC6A 1BQMB 2D74B 4CLTA 4ZPTR 4Q0BB 3K89A 1UVMA 2JWNA 1U1RA 1RA6A 1Q8BA 3AA9A 3WBZA 4ANEA 1ZA2B 2HK2A 3CD0A 2RU9A 2IM2A 5IXUA 5CD4A 2W9CA 1WDDA 2PO4A 1RCOB 1GMVA 2L9WA 2HBZB 1NDCA 1R31A 2W01A 3CJRA 5CQGA 2M8HA 5DS7A 3OLBA 3EVMA 3N6NA 3M8RA 2ZOFA 3ZZ0A 3CIZA 4I2PA 3OHBA 1ZZNA 3HHNB 2LLZA 2HFOA 3CCQS 3ZTQA 4NLOA 3CO0P 3IWLA 3LUYA 4R5PA 2MEWA 4RNMA 1VQ4S 2DGSA 2ZC3A 1LK7A 2K3KA 2KU7A 1PYOB 4N41A 5HLFA 1HQEA 1P1TA 3T5HA 1MN9A 5FLXY 2Z8QA 2ZH1A 3TQ1A 1APSA 3IAM9 1T9YA 2V63A 2E29A 4LF6J 1Y9OA 4UOFA 1ZPWX 4TLRA 1Y5IB 3ETOA 3MPVA 4KHPJ 1VGYA 1RT7B 4PPZA 4QPXA 3DGVA 3QGGA 2FJVA 1YBAA 2DR8A 2KT2A 2HS4A 5LM7E 3BGUA 4MYUA 4ZVUB 3MM7A 2VJVA 3IP0A 4FPRA 3GG1A 2R3VA 1WACA 2M2BA 2RKIB 1TUVA 1S6QA 1Y7PA 2IBKA 3W3SA 1DQ9A 3HP6A 1U0HA 4NZ7A 2F5GA 1EHWA 1FXDA 1YDLA 4JI4F 2Z0GA 4ETZA 1YRUA 5HP1A 5F8GA 2HW3A 1B7YB 1F6TA 4PYAA 2K1RB 4LRCA 1KEKA 5D6GA 2G0CA 2AYBA 2IVMA 2RS8A 3AFGA 3GG0A 1GT8A 3EGVA 1U1OA 4UUWA 3H20A 1HBNA 5JVGQ 2PD1A 4LRAA 3ISZA 1HI0P 2B9WA 1JJHA 1S49A 4AE5A 4AL6A 2HVHA 4JB8B 2LDIA 1XNQJ 3I32A 1XMQJ 3TZWA 1JQGA 1C1BB 2V5HG 2Z2YB 1U1MA 4FNIA 4OJGA 3TUJC 1DTQA 1HI1A 2GAHC 1E6VA 4YR2A 5L1JA 3H42A 2MYFA 3BN7A 3WHIA 2QEXS 4KT0C 3ZZTA 3C19A 5F8MA 1KQGB 2QLXA 5IC6B 1TKZA 3Q23A 3G86A 2PA8D 3QJJA 2OPQA 1TUGB 2A3JA 2CDQA 2JOQA 3IFEA 3T5JA 2AJ1A 1N32J 3IGVA 5B08A 3VVUA 4QJVA 3SDEB 1OY8A 1PGZA 1HA1A 3C14B 3NGSA 3PIOQ 1QLNA 4OX9F 3CDUA 3LAMA 5KFYA 3M4XA 3IRXA 4RW9A 1UJ4A 3BB5A 1TMMA 2H65B 3HSJA 3G6VA 1TL5A 1H2UX 2D3OR 1MWZA 3ZZRA 3LGMA 2HNYA 4OZ2A 4ED1A 4ZIVA 4JV5J 5KFIA 1BQNA 2QLFB 2CJYB 5M2UA 3RBXA 2CZ4A 3UO0A 1DLOA 4C0HA 4LBIA 2B9YA 2FGCA 2M5YA 1S9GA 4CO4A 1KVKA 4Q2LA 4ZOSA 1JX4A 3BR9A 3I56S 2DYAA 5FJ4A 5EWFA 2ZH3A 1Q5YA 4RZRA 4X65F 2IPOB 3IM8A 3QRQA 1A7GE 2JJ4D 3A8KA 3BN4A 2CZ9A 1RP5A 1JLQA 5B0DA 4OI1A 3D5MA 2B5JB 1RB0A 1VISA 3EM1A 2IIHA 3I4PA 3NKYA 3M7VA 4MYTA 5KFNA 4WF9Q 1N5QA 2GA7A 2I38A 4AL7A 1YG0A 2CG8A 5G0RA 2WK4A 2AV5A 2OI2A 2J0XA 3VAFA 3SSQA 2OP5A 1C4AA 2F7VA 5KT7A 2HZVA 3DN9A 3RU0A 4CTAA 2FC8A 2KM8C 5E33A 5BJRA 2CIMA 2LQJA 3GYNA 1S1TA 4JI4J 4WXWA 4ATNA 3A12A 1YJNS 1IKYA 2ZH4A 2MLYA 2RQ4A 2R7VA 1UJ6A 1WG5A 4QR0A 4A46A 4DSEA 1FJEB 4DUTA 2BJEA 5F3ZA 5HATA 4DEZA 2XYGB 3A3PB 5FDLA 2MQNA 1RBLA 3AXMA 5ADZA 2GC8A 2IAJA 3J7Z5 1FKOA 2XM3A 3MPDA 4ECZA 2NQPA 3CJ4A 3MMCA 3OPKA 2BX6A 2EEYA 2CQBA 1YBUA 3ONQA 1S7IA 1EETA 5CYQB 3LP1A 3HVTB 1ZH5A 1LWEA 3AAWB 3PIPQ 1UZDA 2VPYB 5M2PA 3GIKA 2YNGB 3BGLA 4URGA 1VQOS 1DQ8A 3BBBA 4JI0J 3EVWA 4YB5A 4P52A 2GMJA 3UR3C 5IT0A 3DHXA 4KFBB 4B3OB 3MPYA 2VL1A 1CS4B 2BUNA 4XTTA 2O01C 1IKXA 4I1TA 4G1PA 4QQBA 3V6JA 3M2UB 1RWXB 5JVHQ 1JLEA 1WOOA 1MROB 1C1CA 2RRAA 3FKBA 4NWBA 1ICEB 4JP8A 4NRUA 2YY3A 3FDSA 1W26A 2EKNA 2RH3A 2GGPB 4OX9J 4HHHA 1KS2A 3IWXA 2ZH2A 2BKPA 4OI0A 3MR5A 1J5EF 1OYEA 4DQIA 4C9DA 2ALZA 2AYEA 2NPFA 4LSNB 3KLFB 3J7ZT 1LXNA 4HKQA 4Y2AA 2W1BA 3MTKA 3QO9B 2E5JA 1V5VA 6FD1A 1LK5A 4UOGA 1PYSB 1TZ0A 2NYHA 3P96A 3NXZA 2E5IA 2YX4A 1KSPA 4IOBA 3LW5C 3UI3A 1WKLA 1FCAA 3KMSA 4IFVB 4DFJA 2XY5A 1JJ4A 2FJEB 4X65J 4ZJQA 3OTCA 2JC1A 3RB3A 5H9EJ 1BY9A 5KFLA 1K1SA 1U8WA 1R3NA 2DHXA 4DF8A 4YB7A 1TVRB 3FEXB 4U96A 3C16A 5HAOA 1PCAA 1IR0A 1JIHA 4AXIA 4DV0J 3Q22A 5E3PA 4RW7B 2R2RA 2HVEA 2ZD1B 3DOMB 1IBKF 4DCPB 2QMWA 2RUSA 4QWAA 5EN1A 5HVGA 3HHLA 1EQ0A 5A2QY 3L7OA 3HHEA 3MM5A 3M2RB 3J80U 1OJ4A 2PC6A 4DU8A 1VRTB 3O3LA 3NNAA 2XI2A 2H9ZA 2RQMA 1WSVA 3EYZA 2JEFA 4LF7F 4CYUB 2GW8A 3GU0A 4HHUA 2EKYA 4H4MA 2LQ5A 1KLMA 1SQFA 4LF2A 1K44A 2ZEJA 4DLEA 3BF4A 4PQUA 2RUGA 2AU0A 9ATCB 1AFIA 1X5TA 3KLIB 2E5HA 5CYMB 2J7KA 2FHKA 1NAQA 4AD6A 1U0SA 1FWPA 3TA0A 1K0TA 1RSCA 3I5CA 2A2CA 1RACB 4B9UA 3PKMA 1Q53A 3CMQA 4Y65A 1HFEL 4WFZA 5FIIA 5GMKa 4CLLA 1D8YA 4JBCA 1UVIA 2W24A 5A0YB 3I9ZA 2N4CA 1S10A 1CULA 2YKNA 3FUYA 3MD3A 4C8YA 4B3TJ 4ZVRB 1SQGA 1QVFR 1KTQA 4X4SA 4DR6F
chains in the Genus database with same CATH topology
2VFRA 2B6AB 2UVUA 2W7AA 3NCPA 4JI0F 2XEXA 4P7VA 2HRUA 2YKAA 2HLUA 3DRPA 1FERA 4OX6A 2RRBA 5AXKA 1EP4B 3NNCA 2I5JB 2LA6A 2KT5A 3MMAA 1TV6B 3Q8SB 4DSJA 1HBMA 4NLYA 2BBEA 2IRYA 2J9DE 3V4IB 1MMLA 1KOOA 1U1LA 1SXLA 1FRIA 1J5OB 2BACA 1QSLA 1TKXB 3OQ2A 3K5LA 3BGFA 3R1HA 1VRUB 4H54A 4K50A 2K1RA 1NJWA 1GH8A 2B4OA 3HZGA 3KLEA 1RYSA 2EFVA 3GR0A 4ZP9A 4PWUA 2YWFA 4C98A 2CPDA 3HMJG 1UEVA 2HHUA 4WFYA 1NK8A 2RF2A 2M4MA 3FFIB 2QO3A 4B08A 2CVIA 4EZ6A 1P8GA 5J2NB 2F1FA 1M5PC 2LEAA 3QMQA 4R25A 4USJC 1GXLA 3T6JA 4ID5A 2PI5A 1S9GB 2VFSA 2MZRA 2Y0SD 3BGRA 4ILRA 3SCKE 4A8OA 4YB1P 1N6QA 3MM6B 3PO4A 2J6UA 1NU4A 4KIAA 2ZVSA 1R7IA 2N82B 3A1YG 1WHVA 3AJ1A 5KAKA 2GO8A 4A8FA 2P6TA 4TYAA 3X3UA 2DGQA 4Y28C 4RBVA 1CG2A 1VHFA 4NYZA 4GO5X 4OZ0A 1O8BA 5CCMA 1JLGA 5DO2A 5LL6d 2JVOA 1I1GA 1UAWA 3OFGA 3G8SA 3OFEA 4KBIA 2W9BA 4YFUA 1U1KA 2CYYA 4OHYA 2ADBA 4H4OB 4V19X 2KYZA 3TVYA 1G3OA 2IMOA 1R8CA 4LVOP 2J76E 1RT6B 4X2BA 1WELA 2KRBA 3FVYA 2HMIB 1C1BA 1Q8LA 4R0JA 2CPHA 4WFNQ 2V0NA 1U2RA 4DN9A 3OR2A 4NRTA 4P2SA 2DPJA 3DLHA 4QYZJ 3TX8A 2HYIB 5EDWA 1XWLA 4M5DB 3IN5A 4H4KC 3POTB 1NJXA 2B4VA 1F5CA 1YITS 3HXMA 4GMKA 5AXMA 4PWDA 4KKOB 2FVSA 4I67A 4ZVHA 5DLGA 3J7YI 2CQ2A 5I42B 2JLFA 2GV1A 1BWEA 2QA2A 3C6UB 2IM3A 2EFOA 3LWLA 4O3NA 1VQKS 4NYOA 1T05B 3LALA 2FC9A 3IA0A 3HT3A 1FRMA 3THVA 3LOUA 3GIJA 1TR0A 2VKRA 1ZETA 3QJLA 1SJRA 4FBUA 3CULA 3F73A 4PG6A 3ZZPA 2GQCA 4CO1A 2QA1A 2GHWA 4UQTA 1S48A 4ZPAA 5DM7Q 4I2QB 1FA0A 1Y3JA 4RWWA 2JLEA 2MDAA 3RRGA 3RW7A 2VQEF 2HHHF 3RBDA 2RQCA 4X4UA 4EUVA 1QSSA 1K0VA 1LV5A 1T3OA 2QSFA 1O51A 2OPRB 3QIPB 2BQUA 4JI6F 3TAQA 3ZFVA 1FRKA 1XMOF 1HW9A 1MMDA 2XMJA 3CCES 1U48A 2NYIA 3W2VA 3DLKB 3CC4S 1FDNA 1LWFB 2R8JA 1GX5A 2V94A 3CJKB 2WB4A 3SDEA 4A8MP 4QR2A 2CJAA 2CQ3A 1JB0C 1FKPA 1R0AA 5IS2A 3UDCA 1SIZA 2CPXA 5AXNA 2ZFHA 3K5NA 2PIIA 1VMBA 2OFGX 3TUZC 1OPIA 4CNYA 1JNZB 3JSMB 4KHMA 3VZIA 5JJBA 3AH6A 1LW0A 2W8KA 1N48A 5C42B 2L41A 3TVZA 1Z4UA 1QY7A 3K2YA 4F3OA 3EGNA 2CKWA 5DDQC 2AW0A 1KFDA 3CJ5A 5K9FA 2VD3A 1DZ5A 1K8AT 1F2GA 4OLOA 2JLGA 2XGQA 2LQBA 2XCAA 4BS2A 1S6OA 2ZZNA 4C11A 1ZPVA 4I4BA 3M8SA 4ZCLA 1N5YA 2FVPA 5KFZA 2FJXA 2Q3PA 2N7YA 3CCVS 3LP0A 4F3QA 2MKCA 2VH7A 2BQRA 3KLHB 1S6PA 3MR6A 3WC2A 3SFGA 3SMZA 1IN0A 4LSLB 1GX6A 3TARA 2HNDA 3VQTA 1N36F 2IAJB 3PW2A 4DV0F 4C7QA 3QZ7A 2DIUA 2LMIA 2N4DA 5KFQA 2FHOB 2J8AA 4RWXA 4K2XA 1TK8A 3U02A 1O0PA 1VQMS 2FIUA 2C22A 3PM9A 2VG6B 3GSDA 4RLEA 2OSQA 3KK3A 1LFPA 4M63A 3MEDB 4EBDA 2G4BA 4LVNP 2HHVA 3FZBA 4Y6IA 3DLGB 4DV3F 1UFLA 4DS4A 3I0SA 1VJWA 4K4TA 2NPIA 4A8XA 2RJZA 5HMZA 4PG8A 5D3GA 1T95A 2OO4A 2CPIA 4KHRA 3OFHA 4RU2A 2IC3A 3IR7B 3BJYA 3I0RA 1Y3KA 4LMZA 2Q79A 1SKSA 5JUMA 3DI6B 3ENWA 3PR4A 3I31A 3GIMA 2V8HA 2AJFE 3CCWA 3G71S 2W8LA 2BQ3A 2ZITA 2LXFA 1U4BA 3L95X 2FJAB 4WCEQ 2E9ZA 3DM2B 4JI2F 3MM9B 3FSYA 2PN6A 1QE1B 2UZAA 2XMVA 2J9DA 1M0SA 3MMJA 3RAMA 3MPWA 4TY8A 1D9FA 4QIFA 2NS1B 4KRWA 4AUKA 2J0WA 4DV4F 2YX7A 3KK1B 4MIBA 1FD8A 4LF9F 5IQ6A 1DHMA 4O23A 4L72B 2W7PA 2CJ9A 4MKAA 4MK9A 5I3QA 4P6QA 4AQYF 5IQQA 4YEAA 2D9PA 4RBUA 4QWEA 1CEZA 2XMUA 3LP2B 4WU2A 2UUCF 1Q86T 1FRXA 2XBPA 3THPA 1JLBA 1MMNA 1U25A 1M5VC 2XHWA 2P9EA 4LF5F 4KR0B 4ES3A 4IH6A 2B5JA 2CJQA 3ULHA 2M70A 4IG0B 2DHGA 3SXLA 4I7FB 1I6JA 4WU3A 1NK9A 3DOKB 1NJYA 2FD2A 2ZKUA 2B4UA 2KO1A 5CH7B 3CCRS 4OZNA 4QWBA 3RAQA 5HBMA 3TI0A 1PC5A 1GXTA 3CE8A 1Q16B 1U26A 5GAEI 5J1EB 1RWUA 2MGZB 1DURA 2BANB 4G1IA 2CQGA 1CQNA 3E3XA 4R8UA 5L9XA 3PR5B 2YH1A 2R7UA 4FN5A 4KGKA 3T1AA 4WE1B 1N34F 3C6TB 4CT9A 5A6WA 2PA3A 2XNRA 3NP5A 3ISNC 1M90T 1X4FA 2ZOMA 2KG1A 2LU1A 4ECSA 1FD2A 1NK0A 4QU6A 1KC8T 2HLTA 3QLHA 4DMZA 2KTQA 4NLRA 2VOPA 3VR1A 1H6KX 2PE8A 1IQZA 5KFAA 1YJTA 3PKYA 3BSOA 2XNQA 5LJ5Y 3V5RA 3FEZA 1N52B 3NS6A 2JDJA 2CPYA 4DS5A 4NLUA 4OI3A 4RW4B 2OTJS 2JVRA 4OQJA 4FXVA 3PFOA 5KG0A 1M5KC 3CDBA 3KKFA 4YHHF 2BE2A 4NMLA 4N8NA 1LFWA 3CUNA 2YTCA 3QWPA 4DV1F 4MJKA 4BWMA 2XO7A 1KQSR 5KG4A 1IJEB 3PW0A 1HBOB 4I6AA 4BC7A 1UA1A 1YIJS 5GADU 3HHLC 2M7SA 4LIWA 3LGNA 4ZDNA 4B3TF 2XZWA 3I5BA 3O6QA 2C28A 1UFWA 2JFKA 5DG8A 5DDOC 3I96A 2W9CB 3DYAB 1AXQA 4RU9A 1S1WA 3NAHA 5CXTA 4FF1A 4K4UA 4MMOA 4USHA 2ZNYA 2HGNA 2CPJA 4A4JA 2KFYA 2DNKA 2YNIA 2E5GA 4X66F 2WTFA 1N0VC 3FRYA 1REVA 1KQKA 4DSKA 3MOJB 2PFFB 5KFRA 5KTQA 2OSRA 2IVYA 3DOLB 1HYSA 1KN6A 4EEYA 2ZOGA 3J7YU 5J1PA 1QAIA 4CT8A 2M3DA 2ZUGA 2UU9F 1NHUA 2AX1A 1XN9A 3VCDA 2BR0A 4NL5A 1Q82T 5BR8F 3AY0A 2GX8A 4O3SA 5F3TA 3IR6B 5KFKA 1F5AA 3JTNA 3TOQA 1ZM4A 4ZCIA 4B3MF 2D7SA 3UD3P 3ENVA 1M5SA 4I2PB 4F2SA 3RW6A 3UR0A 4OV1A 3C46A 4KGMA 2J0SD 4M8LA 4OJ1A 3H4BA 4A8WA 1FNOA 4I64A 4U7UK 2XC9A 4TU9A 4AFFA 3HF5A 1PILA 5D8HB 3SSSA 2DNNA 4XO0A 4R5PB 1CC8A 1WHXA 2ASDA 5CYQA 2FY1A 4C8ZA 2ASJA 1NK7A 3BREA 3HVTA 5KT4A 4Q44A 2MY7A 4X4NA