1VQ7S

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vq7S00
2A3JA 4YUDA 1KD1T 4W90B 3UE2A 2KRBA 3THTA 5LXRA 1XN9A 2CQ4A 2E5GA 2F9JA 3CCLS 1VQNS 2CPDA 2N82B 1X4HA 2VODA 3CCUS 3HHNB 2MQMA 2RRBA 2ZJQQ 3SDEA 3P6YC 2KM8C 1VQ6S 2OSQA 2RUGA 2DK2A 2BZ2A 1WHWA 1VQLS 1VBZA 2CPFA 2XS2A 5CYJA 2DHGA 3ZZYA 1U2FA 1FJEB 1VQ8S 2D9PA 1O0PA 1WHVA 2KVIA 4BS2A 4WKRA 2LCWA 2EK1A 5IFMA 1VQKS 2E5IA 2EK6A 1DZ5A 2MKIA 1SJ3P 4IOCQ 1UFWA 5FJ4A 2MQQA 3MUVP 2MPUA 1M5OC 2CPXA 5ITHA 4F26A 1Q86T 1X4DA 2DO4A 3U1MA 1FT8A 4TU9A 1AUDA 3P49B 4C4WA 3BO4A 2N3OA 1VQ7S 2E5JA 3CMAS 2J0SD 2RQ4A 5DDOC 3G4SS 3MXHP 2F9DA 2MJUA 1X5SA 2CQGA 3TP2A 1ZZFA 2OTJS 2DNYA 1WF2A 2MB0B 2M88A 3US5A 3CXCR 5HL7Q 3IWNC 2CQIA 2DNMA 1NO8A 2DGUA 3VF0B 2BOPA 3HI9A 2AYBA 2GO9A 2I38A 3CPWR 2DO0A 1U1KA 5LJ5Y 4TU8A 5IQQA 3IRWP 2G4BA 4WFBQ 4V19X 2MKHA 1VQ5S 2YKAA 3NNAA 3Q2TC 4ERDA 4J5OA 1VBYA 2MJNA 4C7QA 2KRRA 2MQPA 2JRSA 3EX7B 5JVGQ 3VAHA 1RK8A 1SXLA 2FHOB 3CCRS 2M2BA 3MUTP 3NNCA 1WG5A 1HD1A 2CQ0A 2MZRA 5EN1A 3CC4S 2FC8A 3UWTA 3I56S 3UD4P 2OSRA 3MUMP 2CQCA 2UP1A 2MGZA 3S6EA 4C0OC 2CQHA 1OPIA 2SXLA 1FO1A 3H2UB 2MQOA 2N7CA 2OTLS 1U6BA 5DDQC 1VQPS 1YJWS 2G1DA 2J0QD 2LQ5A 1WEXA 2CPIA 2X1FA 3R1LA 2CPYA 4CIOA 2QA4S 5GADU 1HL6A 4WF9Q 2Q79A 2F3JA 1WI8A 3BEGB 1WTBA 3VAFA 2LA4A 2M4MA 3SMZA 2QFJA 1ZZNA 4A8XA 2B0GA 2MXYA 1M90T 4TU7A 4ED5A 5LSLA 3OW2R 2XNRA 2DGTA 4IOAQ 3JB9k 2HGMA 2DNGA 1X4AA 2DNOA 2RT3A 3SXLA 2RVJA 2FC9A 2XB2D 2DNPA 2J8AA 1WI6A 2X1AA 5GVQA 1X4CA 1NU4A 2DNQA 2LEAA 3G8TA 2DGVA 4WFAQ 3CUNA 1P27B 1YI2S 1FJCA 2FY1A 1FJ7A 1JJHA 1WELA 2M9KA 5IM0A 4WFNQ 5LSOA 2CPHA 4UY8T 2K8GA 3NS5A 3NNHA 2V94A 3H2VE 1H2UX 1P1TA 2MKCA 2XSFA 2RS2A 1BY9A 5MLCV 2X1BA 2RU3A 2MHNA 1Q81T 1K8AT 1X4FA 3MI7X 5GAHU 1HD0A 3CCJS 1WWHA 4OZ1A 2CQ3A 4QQBA 1D8ZA 2L9WA 1RKJA 1A9NB 4WCEQ 4RU2A 2NLWA 2MKKA 1QVFR 3R27A 2KXFA 2KN4A 3DLLQ 2KFYA 2MKJA 3FEYB 4F02A 2L08A 5GAEU 2KI2A 2CQPA 2MZSA 2LYVA 1UAWA 3U1LA 2DNHA 4Y0FA 3CCES 5CXTA 2LMIA 4LJMA 2DIUA 2MGZB 1U1NA 2VOPA 1R8HA 1N52B 2XNQA 1SJ4P 2VOOA 1YIJS 3THPA 1VC6A 5JVHQ 1L3KA 4LIRA 4QU6A 2I2YA 3UD3P 2YH1A 3CCQS 2J76E 5HO4A 1WEZA 1FXLA 1M5PC 2KH9A 2MSTA 2M0GB 3CF5Q 3VAJA 1K73T 1YITS 2YWKA 3LPYA 4QU7A 3CD6S 1WF0A 4EGLA 2DIVA 4F25A 3CTRA 2DH7A 1JMTA 2KM8B 2DHXA 4FXWA 3LQVA 2AD9A 2DGQA 1OIAA 1U1OA 3BO2A 1VC5A 1N8RT 2KU7A 1CVJA 2CQBA 5CA5A 2MY7A 3B4MA 2O3DA 3B4DA 1N88A 3K0JA 2HVZA 1X5TA 1ZH5A 3MURP 3VAIA 1QM9A 2MZ1A 1X4EA 1X4GA 1X4BA 2DNZA 1A7GE 2X1GA 2LA6A 3S7RA 2RNEA 5BJRA 2DH9A 1FNXH 2DISA 2HYIB 1SJQA 1HA1A 1URNA 2DB1A 2CQDA 1M5KC 4U67Q 3G8SA 4PR6A 1WG4A 2LXIA 2N3LA 3G96A 5H1SV 3PIPQ 1SJRA 1YTYA 1H2VZ 1VQOS 2OIHA 4CQ1A 2K3KA 2CPEA 1KC8T 5IM0B 2DHSA 1U1QA 1YHQS 3MD3A 3MD1A 5D77A 2D9OA 1VC0A 3P5TL 3ZZZA 2LXUA 2RQCA 3VAMA 1S72S 2E44A 2DNRA 3G6ES 2RRAA 4IO9Q 4W92B 3CC2S 4CH1A 4PKDB 2M70A 1OWXA 2WBRA 2YH0A 4YB1P 2RS8A 2HZCA 1U1MA 3NMRA 2EVZA 3TO8A 1JJ4A 2MKSA 2GHPA 2ZJRQ 2CQ1A 2KHCA 3EGZA 1VQ9S 1H6KX 2KXHA 3VALA 3FEXB 5DDRC 2G0CA 2M8HA 2CPJA 2DNLA 1M5VC 2MQLA 1JJ2R 1OO0B 2DNNA 1FHTA 5GAGU 2L41A 1VQ4S 2CQ2A 1KOOA 3J7ZT 3L3CA 1UP1A 2U1AA 3VAKA 3RW7A 1IQTA 4CH0S 1U1PA 4IUFA 4Y00A 1UW4A 3G9CA 3R1HA 4PRFA 3TYTA 2CPZA 1DBDA 1F9FA 2DGXA 2KXNB 1W2BR 1KQSR 2E5HA 1WG1A 1KOHA 1WHXA 3UCZP 3MOJB 3P3DA 1SJFA 1PGZA 3G71S 1U6FA 2KG1A 3Q2SC 2ZJPQ 5DM7Q 3UCGA 3VAGA 2MYFA 2KYXA 1X5PA 1D9AA 3D2WA 2OJ3A 2DGSA 2JX2A 2ERRA 3CCVS 1M1KT 3S01A 1H2TZ 1DHMA 2QEXS 2DHAA 2MQNA 3MDFA 1Q7YT 1WEYA 3V4MA 2ADCA 3CC7S 3DXBA 4TLQA 4LMZA 2MSSA 1G2EA 1S79A 3BO3A 3J7YU 3BS9A 2NZ4A 1WF1A 3RW6A 2PE8A 3CMES 4WIIA 3S8SA 1Q82T 2JVRA 2XS5A 1WHYA 2ADBA 2JWNA 2M52A 2DNKA 2LKZA 2VONA 2KT5A 1N54B 2KG0A 5DDPC 1U1RA 2AYGA 4M5DB 5LJ3Y 2JVOA 1YWXA 5DETA 4Z2XA 4ZKAA 1B7FA 2YTCA 3N9UC 1X5OA 2DITA 3UCUP 3ULHA 1QVGR 2FPHX 2DGOA 5D78A 2LEBA 2M8DB 4P6QA 1X0FA 1R8PA 2HGLA 2U2FA 2MMYA 4QPTA 1VBXA 3CCMS 1NJIT 2AYMA 2MY8A 1K9MT 2AYEA 2DGWA 1YJ9S 3NS6A 2CJKA 1VQMS 3I55S 4OZ0A 3SDEB 4FXVA 2HGNA 2DH8A 2M7SA 4YOEA 2XS7A 3CULA 1U1LA 1DRZA 2MZQA 5DM6Q 2MZTA 3EGNA 1PO6A 2PEHA 2D3OR 4UQTA 3PIOQ 1YJNS 2MZJA 5GMKa 2LECA 5LXYA 3CCSS
chains in the Genus database with same CATH superfamily
1UJ4A 1APSA 3EDQB 3THTA 4XPEA 2KTQA 3PY8A 1M5HA 2PA3A 1W2IA 1U25A 2L9DA 3GIMA 1WHWA 1VQLS 4KB7A 2WVDA 1LK7A 4FYDA 3G6XA 3UVJB 1Z1ZA 2GIQA 2RIJA 2LQ9A 3KHLA 3MM6B 2D69A 3M2VA 1CLFA 1Q5VA 1DURA 2BBEA 5DDOC 3BM7A 2HQDA 2HHXA 3MTKA 2XWXA 3MMJA 4LF4F 3CJTA 4U8YA 4ZMMA 1SQGA 5DLFA 4GMKA 3P96A 4Q8FA 2DY9A 2ROPA 1QSYA 4DV7F 3JAMY 1NCLA 1Q7LB 2QL7B 1VQ5S 3Q2TC 4J5OA 2KDOA 2WB4A 4OX9F 3OPKA 1YZ6A 3CDBA 3T1HJ 1YBAA 1VCTA 2W8KA 4DX7A 2QN6B 3UN5A 3G86A 4I7FB 3FRZA 4JI0J 2Q79A 4DUYF 1JLFA 3SMZA 2YWWA 4G1PA 1GNKA 4YFUA 1ZPWX 4HKQA 1NDPA 1AROP 1C0UA 4C98A 2DNGA 3OR2B 3GCXP 2YQ0A 1NKCA 1TV6B 1XNQJ 1NPKA 4YR2A 3AJDA 3D6MB 2J8AA 1RE1B 1X4CA 2HS3A 4HT5A 4WFAQ 2J9DE 1YI2S 1O51A 2BRLA 5A6WA 4WFNQ 1QUPA 4FS2A 3CJ0A 2V94A 1H2UX 2VIHA 2F40A 4OMFG 1Q81T 1JXLA 3KK1A 4IFVA 1I94F 1HD0A 1N32F 1IWGA 4B9LA 4QQBA 1LK5A 4DPOA 4DN0A 4E0DA 3DOLB 5D4NA 4OJ1A 3CJKB 3DRRA 1X8DA 4J9NA 2F63A 3QMQA 4PG6A 3THPA 3D1QA 3MM5A 5HO4A 3V81B 5HJYA 4QR1A 2FHJD 4K8RA 1RTHB 2HS4A 2QLBB 2AD9A 1OIAA 5KFRA 2A2DA 4HYKA 2O3DA 3GFXA 4LREA 2AJ1A 1SL0A 3U27A 2RNEA 1SJQA 2W9BB 3K17A 1YG0A 1ZA1B 3BR9A 1DLOB 3D66A 3CJ5A 1HBMB 3T5HA 4ECWA 1HWUA 3ZZZA 2HK3A 1C1CB 2OPSB 3IR7B 3CC2S 2ZNZA 5CAAA 2XM3A 1RWOB 4UQGA 2GMHA 4QJVA 4O0IA 4C0HA 1U48A 1Y00A 1K1SA 5KOXA 3PYGA 4Y2MA 1IWAA 1JB0C 2ZITA 5BR8F 4DR7J 2W7OA 2J7WA 3CCZA 4QWBA 2VA2A 4DL7A 3R3TA 1FRMA 1HMVB 4UT4A 2VA3A 1QAJA 4NA2A 5L1LA 4J9MA 4EZ6A 1X5PA 3DLEB 1WNEA 2ZC3A 1JQGA 4K0KJ 2Q6CA 1S6QB 2ASJA 1TL5A 5ETPA 4C9DA 3NBPA 3OTDA 4ZVRB 1FWLA 3OFGA 3LW5C 3BDEA 1YJRA 3WIUA 3G87A 4WIIA 1EIYB 4LQ3A 1SCJB 1WHYA 2LDYA 1RWUA 4ICLA 5ADZA 3W9IA 3GJQB 4AQYJ 2C2KB 4DV2F 1K47A 4OYMA 4B08A 2AYGA 1E6YB 1CJKA 2AKWB 1VLOA 1C4CA 1QVGR 7FD1A 2BQRA 3OUYB 1WD6A 5DQGA 5KFFA 3AJ2A 1Q8LA 3FQLA 2YKNB 1SC4B 1WOSA 4RW9A 2I6WA 2CYYA 2R8JA 1H38A 2WSCC 1T8EA 2D3OR 2C2ZB 4KC5A 4IRCA 1VBKA 3L7OA 1SKUB 4USVA 3VV2B 4CLTA 1RQ0A 1LV5A 4ANCA 4ECSA 1JIHA 2AU0A 4L72B 1UVKA 1EP4B 2MHEA 1B3TA 4O3NA 4N5SA 1WC4A 3PM9A 2GGPB 4J7CA 4OYAA 5I3UB 2HHTA 1KP6A 1ZM9A 4NMLA 4X66J 4JI7F 4WKRA 4EBEA 3KLGA 3W61A 1VJQA 3Q0AA 5FJ4A 4RW4A 4OX7A 2AJ0A 4DPWA 4K59A 2N3OA 5C2GA 3CMAS 1UA1A 4CH7A 4ZVEA 1TKZB 3NLCA 3M2UA 2BANA 4FYYB 1TK0A 2HPUA 2RDIA 2XI3A 3MR6A 3BGOP 3NOGA 1M1HA 2IHR1 3IG1A 3TUIC 1AFIA 4ELUA 2GW8A 2BOPA 2J9DA 1JXEA 3RUBL 3TUZC 5A8KA 4QWDA 3GE9A 1SV5B 3ZTRA 5JVGQ 1RAIB 2M2BA 4PPDA 2RB7A 4JI2F 1V3RA 3CE8A 4LR8A 1LEOA 5KFJA 3FFIA 2JL9A 2I8EA 2QL5B 2B4PA 2F65A 3LANA 3M30B 4Q2MA 3IN5A 1N36J 3KK3A 4WXOA 4OI2A 3DC2A 1TK8A 3C6TA 4LF8J 3MM7B 3KLVA 4UOCA 4KGVB 2P5VA 3Q89A 1XMQF 5KG7A 3PG9A 1JX4A 4F50A 2ZH7A 2RF2A 3KLFA 3SCJE 2ZWOA 2HBRB 2F4FA 4NXMF 2OPQA 3C15A 3D0IE 1T05A 1VHFA 4OZ1A 2CQ3A 3M8QA 2ZD1A 4FNIA 4NCAA 3OL7A 2EW9A 1QVFR 5HLFB 2ZNYA 4M5LA 1EETA 3MPYA 1HFEL 3QLHA 4ZVUB 3FCVA 2B8PA 4KYZA 4CO5A 5IOLA 5D0RA 4O44A 3M9OB 1LFWA 3GR0A 4IOBA 3AA9A 4ZPTR 1VRTB 2QYCA 2CFXA 2JLEA 2ILZA 4UW2A 5HANA 1I5OB 4WK1A 2MZ1A 3LTOA 5L9NA 2PFFB 4I6AA 2LA6A 1FNXH 2OUGA 2DISA 1NHUA 2BYCA 1S9FA 2YPYA 3CJRA 3WQPA 3KG0A 2QC3A 4J91A 1KC8T 1S59A 1OYEA 2KB2A 3JSYA 4J90A 5A2QU 4OZ2A 4N47A 4W92B 3CD0A 3NMRA 4QYZK 1JJ4A 2G0IA 2KHCA 1RT5B 2IDEA 4FVCA 4NLXA 4CO0A 2DVIA 1FHTA 2EFNA 3J7ZT 1IKWB 4C8ZA 4IUFA 5IC6B 3RG6A 2QLXA 2KXNB 3BF4A 1S1VB 4A47A 3G71S 1U0SA 4J9OA 3M1VB 2HHVA 4ZP8A 3RRKA 3Q8SB 3CCVS 5KFKA 3EGWB 2DHAA 4I2PB 4K4WA 3KXDA 2KO1A 3DMJA 1WEYA 4LVOP 5E3QA 4CTAB 4ZPWR 3FQKA 3CMES 3M2RA 4OIXA 1HYSA 4HLBA 2ADBA 2AGOA 4B3TJ 2YVSA 5JMNA 1NJXA 1IBKF 2YTCA 5I42A 2RAQA 1S57A 4MYUA 3V4IA 3T1AA 2W4DA 2FJWA 2G1HA 3PW4A 4QIVA 4OJHA 1NB7A 3GV5B 1NJIT 2DEIA 2XLIA 4XDDA 3CNQP 5J1EB 3GIJA 2G13A 1XTZA 2VFVA 2EFQA 1RYSA 3R2CJ 5HBMB 4ZIWA 3N6LA 1R8CA 1VQNS 2GQQA 3JAMU 1FEHA 1TKTA 5HMYA 4FN5A 3CCUS 4Y2CA 1QAIA 3SDEA 3CJ4A 3P6YC 2G9OA 2GVZA 2OSQA 3B78A 1TTHB 1OY6A 4A8MP 4DWIA 3AOAA 5CYJA 1S99A 4BS2A 4DR2F 1L3VA 2HRUA 3QATA 2KYZA 3CJQA 7FDRA 2J0XA 3RB6A 2CPXA 1KN6A 4LRFA 5T7LA 2IAJB 4NX9A 1KEKA 2BW2A 3JQJA 1HPZA 4IH6A 5D8HB 4F3OA 1KONA 5GAEI 5KFGA 1ZZFA 1AFJA 2CNNB 1SC1B 2LQBA 5HL7Q 2LXFA 1YBTA 2QLJB 1A0OB 3HI9A 3IMQJ 2YKMB 5LJ5Y 3TR5A 4KO0B 1DFDA 4V19X 3NNAA 3M8PA 4M5IA 4EI2A 4KKOA 3UI3A 5HSPA 1RT6A 2FHOB 1EJ7L 5H9FK 1WC5A 2XO7A 4ID8A 2UP1A 2MGZA 3AFGA 4QOTA 1OPIA 4CI0B 4B3SF 4F4AA 2HAFA 2OTLS 4Y6IA 2QT7A 2K7JA 1WEXA 3IP0A 1P9QC 4DV4F 3R5DA 4F8RA 1LNQA 2FJEB 4TKTA 4AUKA 1I3OB 2QFJA 1ZZNA 3DRSB 1V9OA 5LSLA 1BD6A 2CNKB 4PPZA 3D1HA 2HGMA 4PYAA 1RT3B 3AQPA 2APOA 2RT3A 5FLXU 4DZ6A 3IGVA 3PJ9A 5T14A 2EFOA 1NNDA 3PRBA 2VFUA 4DR5F 1U24A 3V6KA 1RLDA 2GIFA 4ATNA 3G6YA 1FJCA 2FY1A 2W2QP 2JEJA 1WELA 1H0HB 5LSOA 1X31C 2VF3A 1R31A 1NAQA 3NS5A 1T9YA 5LOQA 2XSFA 3SV4A 3J7A1 2CWKA 2AX1A 3QT8A 2V68A 2AGPA 2HS0A 3G82B 1TELA 1NJZA 3BDPA 2VG5B 1FX4A 1MU2A 3JSMA 2FIUA 2FVPA 2HMIB 1R8BA 4TY9A 2IRUA 2RJZA 2NUHA 3TA2A 2ROEA 4U7UK 2OGUA 4DV1J 2Z58B 3MEKA 4IDKA 4KHPJ 2FZKB 1BHNA 1FX2A 2BJ7A 3LPYA 4QU7A 3O1LA 4JYAF 4PQUB 3LQVA 3JYTB 2HFZA 4NCBA 3MPWA 2FZGB 2NREA 3B4MA 1WSVA 2HHHF 4OZNA 2P8IA 2OMOA 2AMCB 1URNA 4KBIA 3G8SA 4PR6A 3K89A 4MJKA 1NBEB 5A76A 2OI2A 4KFBB 3A3NB 2K3KA 4NXNJ 4ZJLA 1KQGB 1HNXJ 2DHSA 2CJQA 6FD1A 2AZ1A 1VC0A 1S72S 2A0FB 2RRAA 3J7Z5 2P9EA 5H9FJ 4URQU 4NRTA 1URRA 1R8AA 4EYIB 2EEYA 1NZAA 4DG1A 4X4OA 2CPJA 1OS5A 3BREA 3OVAA 4QCLA 4LR7A 1UEUA 3KK2A 1NJWA 4USWA 3Q22A 4Q2LA 1HWIA 2XEXA 1GXUA 2B9YA 2GHWA 2F8MA 2POKA 3UCZP 4FNHA 2B6AA 3VAGA 3CEDA 5HAOA 3H5XA 4NI2B 3I5BA 1EKSA 1PYTA 2YY3A 4C3KA 2CJYB 2VG7A 3K5LA 4TYBA 1CBKA 3J7YU 3BS9A 1RHKB 2RHQB 4K4XA 3E01A 1FTCA 1HQ2A 2UUCJ 3B82A 2P9CA 4L75A 1X7VA 1SQEA 3WX8A 2EKNA 3PHEA 4QBUA 5LJ3Y 3AY0A 4ZKAA 1P1LA 1B7FA 1RT2A 5K8OA 2BACA 3N9UC 5E0OA 1TL7B 2VC0A 1RT4B 3FJ2A 1W7WA 2CNOB 3QSYB 2DTJA 2AYMA 3MM9A 4ES3A 3F56A 2YWHA 3PEJA 5KG5A 4RBVA 2JFKA 2HGNA 2ZM6J 4U7UD 6AT1B 4DS4A 2UVWA 5DM6Q 3AODA 1JLGB 2RKIA 1RHUB 1DTTA 3TARA 5F8JA 1P8GA 3I32A 3AAWB 3M2VB 5L46A 5ETSA 2FVCA 5KT5A 2DHGA 1LXNA 1RTIB 1FJEB 1PILA 3ETOA 2IIHA 4OQJA 1TR0A 3F0NA 3DLHA 2NXEA 3FVYA 4LF4J 5BYSA 3HVRA 1HBOA 3P8BB 3I9ZA 2VQFF 3HFZB 1DQAA 1WF2A 1RKIA 5F8IA 4DV7J 4NOHA 3I9V9 2CJXB 3ELHA 2B9EA 2VC1A 4RUCA 4B9TA 3DLGA 5C7PA 3V6DA 4OX9J 1N6QA 5F8LA 2GO9A 2UV8G 3CPWR 1NUEA 4ENOA 2QG9B 4OZ3A 2HK2A 4Q0BA 5FDLB 1VBYA 3BH7B 3CCRS 2XSJB 1S7IA 4NLSA 5IT0A 4RL1A 5K9FA 2UVVA 2R7WA 1AUSL 2KL8A 4DUYJ 1DTQB 1FKOB 3NXZA 1C0UB 2CPIA 4CIOA 4LF9F 1XBWA 2FVRA 3L4BC 1FRKA 2M4MA 5HP1A 5B0CA 3A8JA 2A2CA 4OJGA 4ZVGA 4OV6A 1XR6A 4WIQA 3KLIA 3E3XA 1U45A 4LSLB 4DSJA 2WBMA 3W8GA 2HBZB 5L1JA 2MEWA 2YNHB 1BQNB 2H3EB 1NU4A 1TL1A 4GO5X 3KK1B 2RQMA 4IFVB 3PKMA 2OPRB 3D28A 3THVA 1JLBA 1BWEA 4ZDNA 1I94J 3NNHA 1N32J 2XYPB 3CWJA 4XO0A 5MLCV 5GMEA 3U7JA 3GYXB 4JI1F 2I0XA 2VJVA 1PJ7A 5KT2A 1VRUB 3MR3A 4AL7A 3UN2A 3PO4A 5DJBA 3R5BA 3ZXWA 4TVAB 3DOMA 2VOPA 3SQOP 3ILOA 2M3DA 2WONB 3CCQS 3W66A 4RW7B 1Y7PA 1SKRA 4YDDB 3WDOA 3TZYA 2DH7A 3G2XA 3Q8QB 3KJQB 2XO6A 1JMTA 1O5JA 2I1RA 4BDPA 2BJ8A 2DHXA 1U1OA 3IRXA 2H5JB 4I6YA 1F2HA 1UJ6A 3I5AA 5KG1A 2RU9A 2ASYA 3DYAA 3M6UA 2CQDA 1RJJA 4XTTA 3UD5A 3TUPA 4PWDB 1UFLA 2PEBA 4MAKA 4ECTA 1B0VA 1KS2A 2CPEA 2J0WA 3ZO7A 4I67A 4JV2A 2EXUA 1S7HA 2N7YA 1HQUB 2J6UA 4LSNA 1HQEA 5AXLA 5L38A 4DV6J 4C2MA 2HZCA 4MKVA 3C16A 2OO4A 1EQMA 5LMUF 3MMAA 2NXJA 4PG4A 4BCAA 4JBCA 5BR8J 1M5VC 5HVHA 3TX0A 5GAGU 4DEZA 2NCKL 1VQ4S 2ABYA 4HACB 2QMXA 4M63A 4LF7F 3MM8A 2V2VA 3H59A 2PA8D 3WBZA 4NWBA 2E7XA 1D9AA 2BM1A 3AT1B 3UVJA 4YB5A 1FFWB 2MQNA 4ICLB 3MDFA 1NK0A 3GFYA 3SBMA 2VICA 2BKOA 3H2LA 1CJKB 2WOMB 5B0EA 4G1QA 1T03A 1FWKA 4PXBA 3EYZA 5KT6A 4DLGA 2EG2A 2J5AA 1VYAA 1U2CA 2CJBA 1Q82T 1NK6A 4F0MA 3LO3A 2OD4A 4ZPDA 4DXLA 4RW9B 4JI5F 1GK8A 2XZTB 4WP3A 3SYZA 3PYDA 1S1XA 3BGFA 4J9QA 4P2FA 4DSEA 4FVMA 4B9VA 3AHPA 4FKXA 3GPAA 5E3CA 3RAQA 2E7VA 4YOEA 2XS7A 1S1UA 3PIOQ 4ELTA 5GMKa 2O67A 1FFSB 1CQMA 3QGIA 2CG4A 4IG3B 3KLGB 1Z2LA 1YJUA 4JI0F 5G4DA 5KFOA 2ZJQQ 4I7FA 4RW4B 4JI7J 3K5NA 4C11A 3C3LA 2CVIA 1UETA 1IBLF 2KHDA 3ZC4A 1U26A 1GAOA 3HHLB 3W5ZA 5C5JA 4MKYA 3MAAB 2EK1A 3M2UB 3OXGA 3H98A 3OR2A 4Q43A 4F4KA 3IG1B 2LQ8A 4TLRA 3BSAA 3BO4A 3PX4A 5IV4A 2HW3A 3V2UC 2RHSB 3KHHA 4LBIA 2XI2A 4FBTA 3AB4B 4C8NA 5E7OB 5LL6d 3KJVA 1FDDA 4NLTA 5F9NA 3FFIB 3M4XA 4JI2J 4NL5A 4WFBQ 2J9CA 3BKTA 3EVWA 2KT2A 4C7QA 2GVDB 2JRSA 3DOLA 4DSFA 5E2QA 1D3WA 3CJKA 1DY3A 4EU0A 3OTEA 3KK3B 2AW0A 1JNRB 1M1GA 4C0OC 1FRXA 1PBAA 1AT1B 3C6TB 3V81A 2J0QD 4FF1A 3MMCB 1H7WA 1FE0A 4HTIA 5GADU 4LR9A 2B9WA 4NLOA 2JFDA 1FI4A 5IWAF 1WJ9A 2RF2B 5F8GA 1XMQJ 3NAIA 4G3IA 2ZFHA 5F8NA 3TOQA 1FVSA 2CJAA 2D7SA 2RVJA 3PW0A 4D3GA 4DUTA 4K4YA 3VGUA 4NXMJ 3HSJA 1MG7A 4WE1A 3RJMB 3M8QB 3Q86A 2ZD1B 2M9KA 2UUTA 2Q6BA 5C25B 4JP8A 1Y4ZB 1EETB 1O8BA 3FRYA 1K8AT 4FF4A 4M95A 1WWHA 4KY3A 2ZWPA 5KFUA 2ZZMA 3FEYB 3W63A 4O44B 2C2RA 3RGIA 1UKUA 2LMIA 3LA0A 2DIUA 1VIOA 1RBOB 4KE5A 5KFIA 4JB8B 3D3CJ 4UUWA 1Y9OA 2I2YA 5KFNA 5K5MA 1HMVA 4K0KF 3Q8VA 3GB0A 3ZZRA 3R97A 3BGRB 2DIVA 3LH2S 2QMUB 4RUBA 3KUHA 4CO3A 4FPRA 2YNGA 3EWGA 4TY8B 5CCLA 1HNIA 1H74A 3NL0A 1RZMA 3IBCB 4YDXA 4OI1A 5KG6A 3NY0A 5F41A 4ZCIA 4UOFA 3R9LA 1YSJA 3EVMA 2DB1A 2QLFB 1UJ5A 2LXIA 3T6JA 1E6YA 1R0BG 3KNGA 2B5JA 2Y1IA 2QSFA 3PIPQ 1YTYA 2MDAA 3GONA 1QAYA 2OIHA 4CQ1A 4PXCA 4YS2A 4BBYA 2Q66A 1ZM4A 2RQCA 5IXUA 2E44A 3G6ES 2ASLA 3BKUA 1S1WB 2OKQA 2GHPA 4JV5F 1BMQB 3JQMA 4EBDA 2UU9J 2D1CA 5ETLA 4YQWA 2ZH4A 4K50A 4PRFA 4NLGA 1NXIA 3T19A 4DCPB 1KOHA 4PAAA 1KLNA 5AXNA 1ZOTA 2GGPA 3UCGA 5I3PA 5I3UA 2GJ2A 5M2PA 4B3RF 1UFKA 4N41A 5LT5A 1HYSB 1GXTA 4TNOA 5M2RA 5D15A 1F5CA 1G2EA 1S79A 4DUZF 1WF1A 4ZOSA 1NLKL 2NSCA 4ZJOA 1IBKJ 2GAGC 1TKZA 2DR6A 2LEPA 2V8PA 4IG0A 1RT7B 3TAPA 1ELOA 2HQIA 3LP0B 2V8HA 2FJXA 2H4YB 4URSA 5L8RC 3OXLA 2XMKA 2P9GA 1XMOJ 1XIQA 2IVYA 2MLYA 2JC0A 3R7SB 1YGYA 2KT3A 2ZOFA 3H5UA 1SV5A 1TKTB 4FYXB 3SDEB 4NPOA 2GVZB 2AF6A 3UR0A 2MZTA 5D0HA 2FGCA 2K1RA 4USHA 1BQXA 5IQ6A 3M30A 3C19A 5DS7A 4DR2J 4K4UA 2G0JA 6FDRA 3M8ZA 2AX0A 4CWBA 4LF8F 2R7UA 3ZZOA 4DSLA 1D9FA 5F0WA 3MMBA 3MM7A 2NUUG 2MQQA 3ZZTA 4F26A 4Z7YA 3TNVA 2L48A 3QIPB 1ITPA 2ZOGA 3I0SB 2H65B 1X5SA 1N48A 2B9XA 5A6PA 3DDKA 2GQCA 3BBCA 3QGPA 2DNYA 3M8PB 2AJ4A 2HWTA 1F5BA 1TKXB 4KKOB 3NS7B 1G7CB 1EAYC 3W3SA 2CQIA 2V63A 1ZS6A 3M32A 5IQQA 4I1TA 4X65F 2FLNA 4KGXB 2UV8A 4IRKA 3POTA 5HLFA 3C66A 3FCHA 4QIGA 4B3SJ 2FC8A 3S1TA 3UWTA 1S6PA 2H48B 1RB0A 3QT7A 5EWGA 2JEFA 3HF5A 3PW5A 4DV4J 4ES2A 3ONQA 4OYBA 3OL9A 5DGBA 2CA9A 1VQPS 1YJWS 3TVYA 2DRDA 1KDNA 5K8MA 4P7VA 1WTBA 1S0MA 4ZVSB 3TW0A 1VRTA 4AL5A 4ZS6A 4LBHA 4F4YA 5ETKA 4IOAQ 3ISZA 4DR5J 2Y8YA 4K4SA 1LW0B 2B4UA 2DJWA 4F0HA 3HKZD 3FSYA 3GV7B 2VKRA 5DG8A 3WZ0A 3CUNA 2UXCF 5IZHA 3HSZA 2K8GA 2IMWP 2F4VF 2AJ2A 2E7WA 1DJ0A 3HLUA 4DV0J 1SH3A 3JSMB 1UZDA 1FKPB 5J2MA 3IFEA 4ZPBA 2YQ3A 5AXMA 1GH8A 4IDKB 1A9NB 4ECXA 1S9EB 1PC4A 4Y0FA 5CXTA 2GNKA 3BYRA 5KG4A 2XNQA 2UZAA 1R43A 2XMTA 2FD2A 4LFAF 4JYAJ 1S1VA 3WX4A 2QE5A 3K5PA 4KPCA 1RWKB 1YITS 2OLWA 2OD6A 3I4HX 4F25A 3GSDA 4OZ5A 2HHHJ 3SSQA 4I2PA 4YY3F 2WZ1A 2LFVA 5E3AA 2LU2A 4CTAA 1D8YA 3TZZA 4ZPVR 1G3OA 2VBWA 4WJBA 1EKRA 4YMEA 3MEEA 1X4EA 1X4GA 1Q0NA 1X4BA 2LQJA 3DHWC 2DH9A 3CB4A 1WG4A 3IWXA 1OSCA 4UF4A 3CD7A 1GEHA 1RAAB 2VBZA 3QAUA 3EGVA 5KOWA 1QTNB 3H8YA 2V2ZA 2WSFC 3KK2B 2ZZNA 4M1KA 3R5GA 4YP3A 2PSZA 4OYIA 3M8SA 4HVZA 1IJEB 2ZJRQ 2CQ1A 4H54A 4RWXA 2KXHA 5HBMA 5HROA 4OZLA 4IH5A 4DPXA 1JJ2R 1KOOA 3DGPB 2UUBF 3OL8A 1RTDA 4UOGA 1RT1A 2GV1A 4PG7A 1VLYA 3ZZUA 1MN7A 3GILA 3RAXA 2XHWA 5DZ7A 1HNZJ 4ZLNA 2MYFA 3E01B 3QZ7A 2ZBRA 3MCNA 3HULA 1N5TA 4F2RA 1NK7A 2Z57B 1IBMF 1OYDA 2PGCA 3UFCX 1HBNB 1RT2B 2BX6A 3MEDB 2H1YA 3GIRA 3VQSA 5CYMA 4LFBJ 4X62F 2EC2A 5CCMA 3HZGA 2O5DA 3WHIA 1WSRA 4DL3A 3W62A 3LP1A 2ATCB 3MM9B 1MROA 2ZUAA 3ENWA 3VTIA 1X9SA 4B9MA 2AIRB 4WFZA 4J9UE 2GC8A 4LF6F 2ZC4A 2CJ9A 4WP9A 2VQEF 2YKMA 3ILIA 4KO0A 1DTTB 1K9MT 1FXRA 2CJKA 1NJYA 1KFSA 1V5VA 3QFWA 2C42A 1PAUB 5A8WA 1F9EB 3CCSS 3CSKA 4W90B 2Y1LB 4OI6A 4KJIA 5KFZA 1PKUA 2EI5A 3BKFA 4GVBA 5F8MA 4GVLA 3K7RA 4NA3A 2EG1A 1VQ8S 2RUSA 1T9UA 1WHVA 3TAMB 1HBOB 3VCDA 2B8QA 1RT3A 3ZTPA 2DD8S 1GX6A 2DRBA 5ITHA 1BE4A 4CM2A 3OFFA 5DRKA 1X4DA 4DOZA 5IS2A 2VPZB 3F73A 3K59A 2J0SD 3DLGB 2H9ZA 2RQ4A 1N6QB 3G4SS 2L3MA 1V3SA 4ZP9A 3GJSB 2G2OA 3I0RA 3I4PA 2HZAA 2JLFA 5KTQA 1F0XA 1UA0A 3JTOA 5LM7E 3D68A 5HATA 4DX8H 2OFHX 3I31A 3PFEA 2E1PA 5THWA 2R4FA 2HFOA 2CDQA 4FPIA 3G82A 1P9YA 2MJNA 2VG5A 2KRRA 3HT3A 1MMNA 2BJEA 4RWWA 1IM6A 1WG5A 2HMIA 3CC4S 1UVIA 4U95A 1HI8A 2CQCA 2V4RA 4LF9J 2CQHA 1HWLA 1IBCB 3MR7A 4DJBA 3QRRA 2SXLA 2ZKTA 2XMVA 3H2UB 3KJNB 1LXJA 3KLIB 4NLVA 4NA1A 3RR7A 2LQ5A 4IFYA 5SZTA 2RSQA 4DR3J 3BEGB 3CGIA 4ILRA 5HMXA 1RGVA 5D4PA 3JYTA 1TL1B 4DL4A 2DGTA 2IJNA 4RZRA 1V3ZA 1JLBB 4KQZA 3N79A 3FC9A 4N76A 4FP9A 3H90A 3VVTA 2M5YA 1L5UA 2JDJA 1P27B 1FD8A 4ED4A 2DR8A 1FNOA 4ITSA 2VDIA 2ZHAA 4IR9A 5G0RA 3OR1A 1LOUA 1S5ZA 3AXKA 4RNMA 2MHNA 3D6FB 2CG8A 3OXFA 2HHUA 2ZH3A 4PXDA 2IJFA 4ID5A 2QFIA 4HTJA 3CD5A 5J2NA 4LJMA 1N52B 1XR5A 2RILA 3IRXB 1VC6A 2FY8A 4QU6A 5C24B 1IVZA 1M5PC 2FHMA 2C3YA 2M0GB 4CZCA 4MKAA 2AEMA 3QYYA 1NKEA 5F3TA 4K2JA 4FXWA 1N5SA 2FB0A 5U47A 2VPYB 1CVJA 3ZTOA 2HFUA 3UQSA 4U6PA 1N88A 1M0SA 4JI3F 4ED7A 4CDIA 2X1GA 2HRTA 2YXLA 3DLJA 1FVQA 1R6YA 4ANDA 2N3LA 4MTPA 4USIA 5H1SV 5DGAA 3NMAA 3Q8PB 2G2ZA 3SSRA 3SV3A 5IM0B 1U1QA 2JSXA 3HFVA 3G6VA 5D77A 3P5TL 4DR1F 5LMUJ 1ICEB 4DFMA 2IM1A 4RX6A 5CZXA 2ZM6F 2M70A 4DX6A 1TUGB 3MM8B 3DHXA 4LF7J 3FEXB 2E1CA 1GMVA 3EUNA 1JLGA 3L95X 2L41A 5IC4B 4C3LA 3VGTA 1RBLA 3QJPA 3TYTA 2Z4PA 2X3GA 1TKDA 5CH7B 1V5IB 4G1QB 1T03B 2UVRA 2F8HA 5E41A 1RTIA 2ZDOA 4TYAA 2LDIA 4Q8EA 2L9NA 2ERRA 1M1KT 2QA2A 4RBUA 3T41A 3IC1A 2C22A 1X9MA 4QIWD 2HFVA 2QV6A 5M2UA 2HAIA 2Y9HA 4I64A 1S1XB 4LT6A 1HW9A 4JI5J 3JSRA 2R8HA 4F2SA 3H4BA 1G4CA 2GA7A 3GQCA 4A8QA 1U1RA 4F7VA 1T7PA 2NPFA 3IS9B 4RR5A 4TN2A 1WDTA 3KMQA 2YKQA 1S1UB 4GC6A 2A6MA 5L1KA 1Y3KA 2V0NA 2FLLA 1LW2A 1HR0J 2DGWA 5FDLA 1YJ9S 4RLEA 4P75A 4V1Ak 2XSJA 4LF5J 3A12A 4C11B 1QY7A 1NSKL 1K44A 2PEHA 3NWRA 8AT1B 4XAKA 5CHCB 3FUYA 4J9KA 4OI0A 2HVEA 1DTQA 1FKOA 1IBLJ 2BDPA 2MQMA 2RRBA 1XNRF 3GWCA 1K1QA 5KFAA 2BE9B 3QRQA 2DK2A 4IQMA 3J81U 3OV7A 3T5LA 5KG0A 3ZZYA 2KVIA 2C2DA 3MR2A 3CCTA 4LSLA 1GT8A 4USTA 4RBTA 1U8SA 3SEOA 3KJVB 2R8KA 2YNHA 3LGNA 4P73A 1BQNA 4K4TA 1VQ7S 1J2VA 2ZH9A 2OPRA 1YKWA 3TP2A 2QGFB 4QIEA 4Y2KA 3FBCA 1MNEA 5KFLA 3BH6B 4CNZA 2I38A 3FZ2A 4TU8A 4H4MA 2WVFA 4NZ0A 1VRUA 4L3NA 2O1PA 3HDSA 1A6LA 2ROGA 3K5MA 4LRDA 3UD4P 5EX0A 2NXNA 3L9ZA 4OI4A 3S6EA 1QTMA 4WKYA 2HWHA 2WONA 2I5JB 3BPDA 4F36A 4P7TA 4RW7A 3IAM9 3VVUA 4IO1A 2OFGX 5IWAJ 1VGYA 1HL6A 4W4MA 5AE2A 3BPSP 5DO2A 2HQFA 8ATCB 4B3OA 5C42A 5B08A 4WE1B 4KGMA 1N33F 3OTOF 1NDKA 5F3ZA 4IRDA 3KWMA 1S1TA 1WI6A 1MWYA 2BA9A 4PWDA 3G8TA 4F3MA 2V2KA 3W9HA 1JJHA 1RTZA 1RACB 1ZETA 4DV6F 2ZH2A 3W1YC 1FFGB 1FRIA 1HQUA 2RU3A 2V5HG 2YWGA 5DZ6A 5GAHU 4USMA 3PX0A 1U49A 4Y2IA 3BN7A 3V6JA 1KVIA 1NK5A 3OLAA 2KN4A 3I6PA 3DLLQ 4WTYA 2LYVA 3N4WA 2V6AA 1NSPA 2VDHA 4HACA 1TUVA 2BQ3A 3J7YI 3T6BA 2YNGB 4ZVQB 3HHLC 1RABB 1HNIB 3UD3P 1QD1A 5KT7A 3QIDA 2C3MA 1Y11A 2YNIB 3Q8YA 3DI6A 3DFEA 1LWEA 2W2MP 3G8QA 4R8UB 4P9SA 2WOMA 4Q7AA 2B5JB 2QL9B 1T95A 2HVZA 3BGUA 3MURP 3FBFA 1QJHA 2UXBJ 4LQ9A 1FERA 2BM0A 1S9GA 5DQIA 1CULA 4DFJA 1NSAA 1AW0A 4YHHF 1H2VZ 3KTQA 1CG2A 4UY85 3NCPA 2BR0A 4FYWB 3HHKA 2DCLA 3O2IA 4JV5J 1KLMA 3WIVA 2IBOA 1CJVA 4CH1A 5CD4H 1J5OA 3T1YF 4K2XA 4FS1A 2EVZA 3MPVA 2COLA 3VZHA 1MLAA 2X51A 2FVSA 4LBPA 2DNNA 1R3NA 1GMWA 1I51B 2OAUA 5KFHA 1FK9A 3CIZA 4IG3A 3VAKA 2BV3A 3JTNA 2CPZA 4B3RJ 1OY8A 2H54B 3RBDA 4S0MA 1YX2A 4BC7A 4J9VA 1U6FA 3HHLA 3MAAA 4DUZJ 2V9KA 3H0PA 4IG0B 5AE1A 5FIIA 4CLYA 4LMZA 4CP5A 2ZDPA 3M8RA 1M5SA 3W60A 4WYLA 4CCHA 1VIXA 2HQCA 2JVOA 2XY5A 2FLPA 4LRCA 3VR1A 1OY9A 3PX6A 4X2BA 2DITA 4HT7A 2HIQA 2FPHX 2DGOA 1RU2A 2WCXA 4EFAC 1QAXA 2ZBPA 3W2VA 1R7IA 2FLOA 2MMYA 3GP9A 2XYHB 2K1RB 3PJWA 2E1MC 2OELA 4M5DA 2AYEA 4BC9A 2E1AA 2GVDA 4PXEA 4CNYA 3VGVA 3R5CA 4HL9A 5LXYA 2K7KA 1ZAVA 2ALZA 2C2NA 3L09A 3IM9A 3N6MA 3WC0A 3MMBB 3O8WA 3MMCA 4FZVA 3MGJA 2OEMA 3QSIA 1WACA 5FD1A 1R27B 2XS2A 5LSRA 3BN4A 4M5HA 4P71A 3I96A 3QGHA 4OL8A 2N4DA 4QPXA 3MUVP 1TUWA 3PV8A 1VOMA 3QPIA 1T3NA 4PEOA 2BABA 3V6HA 1AUDA 5D3GA 4GKJF 3MZIA 2F1FA 2MJUA 2OEKA 3M32B 1ZPVA 4OJ3A 4ETZA 4IYQA 3POTB 5C25A 3PEHA 3MFHA 4WU3A 4X65J 4DL2A 3T9ZA 2BQUA 3VF0B 1S6PB 2NXUA 5D4LA 3UO0A 2YNFA 2G4BA 4YEAA 4OYOA 3MAQA 1QSSA 1YDLA 4TQRA 3DDNA 4OX6A 1RK8A 3O5TB 3AB2B 3MUMP 4YB7A 4RUHA 3LF0A 3CW2C 4U7CA 1IR1A 2G2YA 2EC0A 2IM0A 2QYGA 4ER8A 5KFXA 2X1FA 3C6UA 3D67A 2Z2MA 3LGMA 1JLEB 3BGRA 2JC1A 2AQ4A 5KFEA 2R7QA 3M05A 3OHAA 4KAIA 4TU7A 4CO4A 4TY8A 2R8GA 4USUA 3OW2R 4OHYA 3OFEA 1SIWB 3KJFB 4OI3A 2UXCJ 2DNPA 2R7OA 2F4VJ 5J2MB 2FJBB 3ET6B 5GAGI 3RB4A 2PC6A 4RJVA 1UWBB 1REVB 1RUSA 4KHRA 4BLGA 2B4VA 5KFWA 4M5MA 3HFKA 1S1WA 3L7PA 4HI2A 2J7UA 4DL6A 4M8LA 2UU9F 2W2NP 2MKYA 5HQ8A 1BGXT 1Y5IB 4F02A 4IH7A 2B51A 4LFAJ 4C8OA 4ED8A 1AA1B 5E3PA 1UCNA 3SQGB 3FNNA 3SCIE 4Y28C 3DRPB 1ZA2B 2WHOA 4KTQA 1UPPA 4YY3J 5KG2A 4URGA 3MEEB 3DN9A 4O4RA 1K73T 1FTRA 1IJFB 1HI1A 1H73A 2V8GA 1RBAA 1IKYA 1TQLA 1RISA 2HKEA 2XYGB 1WOPA 2KU7A 3IBWA 1GTHA 1OSDA 4K5RA 4ZPCA 5DLGA 2DNZA 1XC9A 3S7RA 2KZMA 4F3QA 3T9NA 3FSIA 1RT7A 2HZVA 1Q1KA 2X3DA 2DPIA 1QUVA 3LP0A 3OSPA 4CLFA 1XMOF 3MD3A 4HH0A 5HROB 4OHZA 3NP5A 2DCUB 1RTDB 1RT1B 1U1MA 2HBQB 2R7RA 2C2OB 3RAMA 2UUBJ 1FA0A 2B7CB 1VQ9S 3R7NB 2JEIA 1PJ6A 3NWGA 2G0CA 1IR0A 1N4LA 1LWFB 2CQ2A 3L3CA 1RTJB 2CNLB 2ACYA 4Y00A 4DU7A 3LP2B 4GKKJ 3R5JB 1WG1A 2BOAA 1IBMJ 5CYMB 4ALZA 4BWMA 4H4OA 1H2TZ 2ZBQA 1B4SA 2CWXA 1Q7YT 4CLZA 3LP1B 4X62J 1CSJA 2NYHA 1MROB 3W2WA 4TLQA 1RAHB 5EDWA 1NH8A 3QIPA 1ZYQA 2XCAA 5LMNF 4TQSA 3I0SA 1TMMA 2WTFA 2HBYB 1FF2A 4LF6J 3RRGA 3RR8A 1W26A 2VQEJ 1TKXA 2UUWA 4OX8A 2W7PA 4X4PA 4PABA 2M8DB 1EARA 4ECRA 2Z30B 5A8WB 2B4OA 2HGLA 1Q53A 2A1BA 1FNMA 1P6TA 2ILYA 1VMBA 4USJC 4DQIA 2MY8A 3KLHA 2V50A 2RMLA 2IA6A 2C3OA 4GVBB 5L9XA 1JWWA 1XEZA 2M7SA 4IQXA 2CRLA 2RQKA 1YJNS 3CMQA 1KFDA 1S6UA 3PHTA 3HK2A 3PW7A 4HDGA 1SKSA 1OMSA 2A18A 4L6V3 3VWSA 3D0GE 2BZ2A 1FDNA 1N5QA 3OHBA 2LCWA 1IN0A 1H98A 4EYHB 2PI4A 5F9LA 5ETVA 3I0RB 4DPUA 2E9ZA 1SVDA 3Q83A 2QX0A 1LW0A 1FT8A 4WXWA 3K2YA 4ECVA 4TU9A 1TFYA 3A8EA 4KH0B 2XGQA 4CLWA 1OQ3A 4DV0F 2YWEA 1QSLA 3H7HB 4YN3B 3QFHA 2QO3A 3IWNC 1C4AA 1FKPA 3TAQA 1QE1B 4M94A 4NLUA 4ZN3A 2CADA 4QW9A 4H4KA 2IVFB 4PWUA 4L73A 3JTPA 3HVTB 2ZUGA 1S9EA 2JLGA 5ETNA 1ZTWA 4IFYB 3TVZA 2CQ0A 2XLJA 1PSDA 4Y34A 4JI6F 4DI6A 3RBZA 4ZVTB 2EFVA 1BWVA 1RHQB 4DLEA 4P52A 2W24A 2BKNA 3EDRB 1SI9A 1TFWA 4DL0C 1FCAA 4NLPA 2GS8A 2F3JA 5L1IA 2XY6A 3CCWA 4P10A 4M5GA 2BVZA 2DBBA 2NR0A 1KQKA 3SFGA 1IXKA 4X4TA 5AJ3F 5G0RB 2F7VA 2QA4G 4DSKA 1FJGF 2XB2D 3OR1B 4ELVA 1FRLA 2W4PA 4CO2A 4E8UA 3Q8UA 4EO8A 4MFBB 1R89A 4J9SA 4RO0A 1SC6A 1PAEX 4ID5B 5DG7A 3EZ5A 4NLQA 3PCOB 3OD2A 1JLCB 5J2NB 4NLYA 1W25A 3D7SB 2W9AA 3AD8C 2IC3A 2KFYA 2KI2A 3KLEB 3DGPA 4DHVA 2YPZA 3CCES 4ZVOB 4WPAA 1JNZB 1T9TA 3N28A 1N0UA 1NEEA 3KMSA 1HNZF 1BUXA 1C0TB 3PKYA 4LIRA 4AL6A 2KJWA 4AXIA 1WEZA 2MSTA 4DS5A 3IA0A 1F2GA 5B0BA 4DL5A 3R6GB 4YB6A 2KM8B 4JI3J 1RWWB 3AOCA 5D0GA 2Y1JA 4LFBF 1HBNA 1HHTP 4ILLA 3B4DA 3MEDA 3K0JA 3VAIA 3DU5A 3KHRA 3DLKA 4U67Q 1IKVB 4DR1J 2DXFA 4X64F 4FKYA 4ZVPB 1YHQS 4DF8A 1D0EA 2XG8A 1OWXA 1WC6A 1RYRA 3TO8A 2ZBCA 5D4OA 4OV1A 3SI8A 4DV3F 3VALA 4NEZA 4QR2A 2PI5A 1OO0B 4ZLPA 2GMJA 1CQNA 5CYQA 2PO4A 4A8OA 4OLOA 3GYGA 3DCAA 1RHRB 3A8KA 1UW4A 4NE9C 1F9FA 5HK4A 2E9RX 1D09B 4P2XA 3P3DA 1PGZA 2ZJPQ 2KYXA 1NHVA 3M8YA 3KDNA 3TAMA 2ZE2A 2QEXS 3OBIA 3FKBA 3V4MA 3Q23A 2ADCA 3EZOA 2UXDF 1S77D 2YX4A 3K8VA 1KTQA 2NZ4A 5FLXY 4PZVA 5KFTA 4C8KA 4B9UA 2NXCA 2JWNA 4I2QB 2M52A 2IA0A 2KT5A 2UUAF 4ANEA 1LW2B 1TL3B 3NOCA 4KR0B 3KFWX 2XC9A 3HJVA 4N56A 4QIFA 1LFPA 1U02A 4WZQA 2HURA 3PYFA 2HVHA 1U4BA 2DH8A 3CULA 4J9LA 3HSDA 1PO6A 2W1BA 2LECA 1XNRJ 1IM4A 4AD6A 1U8WA 4UTGA 4DR3F 1S0NA 1RWMB 3GMGA 1SUQA 3PR5B 4ZVHA 1NKBA 1T3OA 2XMUA 3H40A 1ZTTA 2MPUA 4YR3A 1Q86T 2WW4A 2QJ3A 3U1MA 1F9HA 4ZP6A 3R5AA 2BJ1A 5KFBA 4F4XA 5I4MA 4H4MB 2CQGA 1XQIA 4OYZA 2PMHA 2MB0B 3RZAA 3US5A 1FEEA 3B6BA 3OVSA 4GO7X 4U96A 4W98A 1RXOB 3PRVA 4RW6A 3ILJA 3M8WA 4NCGB 5IT9Y 3A3OB 2W4CA 1L3SA 3D0HE 3HVWA 4A8SA 1R0AB 3M6VA 2H51B 1JXVA 4B3OB 5C42B 4PYDA 5C24A 5ETMA 1S4FA 4DMZA 2G1DA 4O3SA 4NMXA 2DR7A 3QT5A 4JI4F 3KDOA 1N33J 2VG6A 3MWBA 2LA4A 4XK8C 3OTOJ 1S1TB 5KFDA 1M90T 3UW1A 3FDSA 3MECB 2XNRA 1X0PA 3PFOA 1YLXA 1GQEA 3D3BJ 3R8YA 2DXEA 5MAOA 1X4AA 4DFPA 4ECQA 1RI7A 2AGQA 2X1AA 5GVQA 1U7LA 1KNZA 3H42A 1BQMA 4V19J 4PQAA 5IM0A 1EX8A 4CRJA 1TAQA 1AYEA 3A4TA 4WWSA 4G6VB 4B3MF 3C14B 3BJYA 3WC2A 4I68A 2HNYA 3GTYX 4BHQA 2L9WA 4NZ7A 3R27A 4O3OA 2MZSA 4Y2AA 3OVBA 1HHSA 3DI6B 2CIMA 1LWEB 1T9WA 3OQ2A 4ZLLA 3DOKB 1XJWB 1S97A 1KVJA 3R2DJ 3VAJA 1OQ6A 2IPOB 4ZLJA 1UEKA 5JUMA 2ZOMA 4LFCJ 1CPZA 1S9GB 4EMDA 3VHQA 3CDUA 2DGQA 1CULB 2EFPA 4DR4F 1NDCA 4LRBA 4L74A 4HHJA 4YHHJ 3GFHA 1A7GE 4I0WA 4LRAA 2FQQB 2XBPA 1YRXA 3FZBA 1KLMB 1CJVB 4DR6F 1J5OB 2NSBA 3H4DA 5SUHA 1WOOA 2Y0SD 3IS9A 2QIFA 2ZHBA 3T1YJ 1KQFB 3H25A 2D9OA 1S12A 4C0BA 1HR0F 3AXMA 1EZZB 3DRYA 4LF5F 1FK9B 2WBRA 2F5GA 2RS8A 3CDWA 2PT0A 2XY7A 4DCJB 3N5FA 3M6WA 2E9TA 5K8PA 1KHVA 1S0OA 4K4VA 3ITHB 4FXDA 2VU5A 2ZKUA 1UTAA 2H5EA 3B8HA 3R1HA 1UVLA 1N5YB 3UDCA 5DM7Q 1Y5LB 2DGSA 1ZAWA 3HM9A 2BE2B 4LSZB 5HN0A 1O6XA 1DHMA 4ZPAA 1R0CB 1Q95G 3JQKA 2RDDA 1C1BA 1CC7A 2WB1D 3GIKA 3BO3A 2HIYA 3CJ8A 1MWZA 1PYSB 4J37A 3W2VB 4FF3A 2V9WA 2DRAA 2VONA 2KG0A 5DDPC 4HHHA 4M5DB 1RA7A 4Z2XA 2BRKA 5BYRA 3CO0P 3HJFA 4PUOB 3PZPA 5A0YA 4R25A 4DPYA 2PDAA 5L39A 4ZJQA 4QPTA 2N4CA 4F4WA 2D74B 4RNNA 5J2QA 7AT1B 4TXSA 1NB2A 4CO1A 2A3JA 4YUDA 3UE2A 2KRBA 4FDFA 1E6VA 3MCSA 4X4SA 2CQ4A 1LKZA 4I56A 3CCLS 2I5JA 3TA0A 3TWZA 1X4HA 3UNGC 2HNDB 3E8OA 1YJTA 2PMZD 2CPFA 3NGTA 2VKZG 1TVRB 5K8NA 5D3GB 3TA1A 1JKHA 4RUAA 4QWEA 1MMLA 3PACA 1N34F 1AZSA 4GKJJ 1XMBA 3P4UB 3ETMA 4X4NA 3ZNUA 3N6NA 4Q5VA 4LUBA 2HG4A 4CLPA 3KG4A 3P49B 4C4WA 1EHWA 5AT1B 3TEGA 3HKWA 2YNFB 2OTJS 3EPIA 5H9EK 2M88A 3ZTQA 2MLZA 3CXCR 3A13A 1S10A 3OL6A 1NRKA 3C2PA 4N77A 4OLPA 2C3PA 4RPFA 4RNOA 3A1YG 1HLWA 1Y3JA 3GR1A 3A8IA 5E33A 2ZH1A 1FE4A 5AXKA 4UZBA 3VAHA 1WC3A 1FD2A 3C6UB 1ZAXA 3NNCA 4P2MA 3BYPA 4ED6A 4HEA9 4P72A 4A4JA 2P6SA 2MQOA 2N7CA 4HI1A 3ICLA 4R0EA 4DBQA 2F8EX 1GXLA 2XWYA 1FRHA 1PIEA 2YNIA 1WI8A 4HHUA 2PN6A 4R8UA 5E5NA 3K58A 2UXBF 3J81j 2XZDB 3D54A 4RW8A 3TQ1A 3GFZA 3OTBA 2OPPB 4C48A 1K0TA 5EX3A 2XQCA 2V67A 3KYLA 2PFDA 2B3TB 2KJVA 1GMWD 3RBXA 1VK3A 1Q8KA 1BLUA 5DQHA 2X1BA 4OHXA 2RE1A 1KVKA 2R8IA 2J9EA 3ENVA 1FDBA 1RDRA 2GQ2A 4QZVB 2R2RA 2DHHA 1T9XA 3M9NB 4WCEQ 2MKKA 2AP6A 5ETOA 5A8RB 3HHLD 2MKJA 3TX8A 4QYZJ 4DV5F 4F0KA 1UAWA 1JLAB 2K06A 2CUYA 1SIZA 2GJFA 1IKYB 3AD9C 1YIJS 5JVHQ 3ZFVA 3NAHA 1WF0A 4EGLA 2VUGA 3O6QA 4R5PA 1ACMB 2XTJP 1YBUA 2GMLA 2HVDA 2CQBA 5CA5A 3IBFB 3JSBA 2YKOA 1GFWB 1QLNA 1VISA 1N56A 3LPEA 5H9EJ 3O3LA 2HYIB 3D5MA 3G96A 5BYQA 2R7TA 1N0VC 1UEVA 1U2RA 4HH1A 2VHGA 2VBYA 3MR5A 3OSNA 1NSQA 2FVQA 1IKXA 4B17A 4IO9Q 1HHQA 1HBUB 3QO9B 5K14B 3HMJG 2YH0A 4YB1P 2V8VA 4NYOA 1SL1A 2AHOB 1H6KX 1L3TA 4M5KA 1LWXA 2MQLA 1EB0A 3ISNC 2R2TA 1X60A 3T3FA 3RBEA 3TUJC 1UP1A 4CH0S 4H4OB 3LALA 1W2BR 3W2WB 5HQMA 1SKWA 3SSSA 4WFYA 3AH6A 4ZHRA 1UMJA 4G1IA 2BMBA 4EWTA 2OJ3A 3X1LB 3FMWA 2FHKA 4MKBA 3EPGA 5LMNJ 3BV8A 3LUYA 3BBFA 4BWJA 4ECYA 3HHDA 2PE8A 1Q8IA 4O4GA 4AXJA 3D9BA 4CYUB 2JVRA 2QMWA 3I82A 2DPJA 2MLXA 3GIIA 3KLHB 4E98A 2XMAA 4A46A 3MEGB 1LWCB 1UWAA 4AE5A 3ULHA 2LEBA 1YVFA 5IT4A 5F8HA 4B9SA 2DXDA 1T9VA 2HFSA 1VDHA 2MQ8A 2W7AA 4NZ6A 2Q1LA 1S6OA 3NS6A 2W9CA 1UZHA 2VZ9A 1U1LA 2V4JA 3EGNA 4JI8F 4UQTA 1PJ5A 4LVNP 4F4ZA 3BSCA 4KIAA 1NMEB 1KD1T 3GJTB 5LXRA 1XN9A 3UDVA 4D3HA 1RAFB 3HHNB 3CDEA 5IT9U 2DR5A 3FCWA 3GSIA 1JLEA 2RUGA 4C6AA 1VBZA 2R3VA 3GLJA 4JOUA 2GCFA 1FDAA 1U2FA 2D9PA 3PDNA 3M7VA 1UVNA 3EJMA 1HNWF 1SC3B 3DM2B 4WTOB 2FDNA 4WP8A 3IGNA 2KKHA 2FUG9 5GAHI 3TJ8A 2BKPA 5HVGA 4DDFA 2E5JA 2IBKA 2IRYA 3P45B 3ET6A 4USKA 1S49A 2LP4A 3IAS9 1TMJA 2HNZB 1UWBA 1REVA 4X4VA 1VQSA 3TJ9A 4K7QA 2XZWA 1VI7A 2XMWA 2AYBA 1U1KA 2D3O1 3IRWP 2MKHA 4JI6J 1CJTB 1VS3A 4Y65A 1SL2A 4JUZA 1XERA 3PW2A 4QWAA 5EHHA 2ATLA 3QNWB 5EN1A 5KFCA 3SQGA 3DRPA 1SH0A 4UZCA 4KH1B 3MAHA 3N5BA 4NYPA 2EWHA 3SCLE 4XDCA 1PG5B 3SFUA 3PVXA 4PG5A 2IM2A 2IDLA 2BJ9A 3TZXA 4A8XA 4PCQA 5AJ3J 3F44A 4DQRA 3D4JA 1FJGJ 3OFHA 4X84A 3VZIA 3ADAC 3JB9k 4DF4A 4R0JA 2W8LA 3NGDA 3SXLA 3FBEA 1F3VA 2O01C 1HI0P 2RD5C 2DNQA 4ZCLA 2RDJA 4I4BA 2DGVA 3BQ0A 3NCQA 2IC3B 4I69A 2CPHA 3V5RA 1HNVA 1P1TA 2OMLA 2GX8A 2RS2A 3NGUA 4DX5A 3RTVA 2VPWB 2AEFA 3TZWA 3AA8A 4WZMA 4L3KA 3UN3A 2XCPA 1EQ0A 4RU2A 2KXFA 3CVKA 1LWFA 4ZCKA 1VFJA 4MT1A 1KSPA 1RTJA 2DNHA 3EXCX 4GKKF 3BR8A 1RHJB 1C2PA 3LP2A 1S4EA 4LF1A 2K2PA 4ZN1A 2J76E 4ZK7M 3CF5Q 1JLQA 4OYWA 4ED2A 3PO5A 1F5AA 1JLFB 2GZOA 5KFPA 3DLKB 4A8WA 3MPUB 1JJCB 3H20A 2E5LF 3BSOA 3GU0A 1ZH5A 5B0DA 4X64J 5J1NA 3QQCD 3HT0A 2CAJA 1WTFA 3AOBA 1SJRA 1YJ7A 1CJUA 3GZ7A 1NM2A 4X4RA 5JXSA 2LXUA 2ZBIA 4KSEB 4ETXA 3VAMA 1Q16B 2OP5A 1B0TA 4DV3J 5CYQB 4XPCA 4ECUA 4ED3A 2YKPA 3K8WA 3QGGA 2DNLA 3K5OA 2AV5A 5B0FA 1G6BA 3PYEA 1FXDA 1KTVA 4NEYA 5EWFA 1TZ0A 3DRRB 1U1PA 2ZE2B 4MK8A 1DBDA 4AT1B 3OLBA 1WKLA 2R2UA 1KQSR 2ZEJA 4MK9A 3MOJB 4Q45A 2XLKA 1OJ4A 3MM5B 3Q2SC 3VGSA 2V34A 1NHKL 2UXDJ 2D3UA 2UVUA 2HEKA 3PRDA 2FTRA 5GMDA 1QDUB 1J5EF 1AXQA 5B7WA 2JZ5A 2V2QA 3DXBA 4AFFA 4N8NA 4WK3A 2UUAJ 3LGHA 2BXJA 2FHJA 3FEZA 1HWKA 1WORA 5DETA 1PBUA 4KV8A 2FJAB 1U0HA 4O3PA 1X5OA 3W9JA 2EBEA 3PXGa 5D78A 1QE1A 3NKYA 1X0FA 1R8PA 4MIWA 1RLCL 1RCXB 3LAKA 3HVTA 4MIAA 1VQMS 5CZVA 4FXVA 1SUQB 1DQ8A 1LQ9A 1RAGB 2EBGA 1XR7A 5KFSA 3QWUA 3C8YA 2DR9A 5J2PA 2V8DA 2KM8C 2OEJA 1RP5A 2P6TA 1NH7A 1CS4A 2C28A 1DARA 2VD3A 1VQKS 2EK6A 1TL4A 5B0AA 1SJ3P 4OHVA 5D6GA 3NBPB 5EUHA 1NPPA 2WSEC 2R9LA 4GRSA 1SB6A 4MK7A 2DO4A 4F04B 2PD1A 2NYIA 2HLUA 2YQ1A 5D0EA 3MFIA 4RW6B 3GJRB 2F9DA 3CIMA 3PTWA 5CQGA 4MFBA 2H4WB 3MM6A 2BW7A 4DV2J 2LVWA 1N5VA 1NO8A 2E1RA 1JLCA 3OJUA 1S0VA 2B7BB 2WVEA 4Y3CA 2DO0A 1SBRA 2IJRA 4CM0A 2YKAA 2AEJA 3CO9A 4RNFA 3KLEA 3K57A 5ETTA 2OSRA 1H72C 4XIUA 2VG6B 3DKDA 3DGVA 2HSEB 5T41A 2ZVSA 4JI4J 4KHMA 1C0TA 1FO1A 2J7KA 3IM8A 4NASA 1U6BA 5DDQC 3T1HF 1VK8A 3R1LA 2CPYA 1F3FA 1KKHA 2B0GA 1YK9A 1U47A 3RRHA 3UPFA 3IWLA 2EPIA 3RU0A 4J9PA 1BQMB 3U02A 4DZDA 2DNOA 4WYWA 1IR2A 5KFMA 2BEFA 2LU1A 4LIWA 2FC9A 2KFZA 3QWPA 2CZVC 1IKVA 2IYGA 2LEAA 4ZIVA 3IR6B 4OYPA 2HNYB 1KHWA 1XNQF 2AJQA 2BANB 1RWPB 3NG8A 4B3MJ 1K0VA 4UY8T 2XMJA 1CC8A 3ENQA 1TV6A 2WAQD 3H2VE 3HX9A 2DY1A 2XGPA 4L76A 3AD7C 2I9SA 2R2SA 3HD2A 3CCJS 5A8KB 4DQPA 4X4QA 3OTCA 1WC1A 1AB8A 1V6HA 4IKAA 1ROFA 2JJ4D 2JH3A 2L08A 5GAEU 3U1LA 3PJXA 4E2FB 3GCWP 1SJ4P 3FMBA 3DNCA 1L3KA 2ALYB 3FBBA 3BGLA 2OHDA 3MPDA 4B02A 1BC6A 1RWNB 1OPZA 2KH9A 4DR4J 2YWKA 3EE3A 4IR1A 2OH2A 3AJ1A 1TP7A 1N8RT 1TAUA 2KZZA 4DR6J 1X5TA 5KAKA 1UL3A 2GO8A 2AT1B 1PCAA 5BJRA 1RTHA 3UDEA 2ZH6A 1HA1A 3OT9A 4I2QA 3H5YA 2JNJA 2ACMA 1RADB 1TL3A 3KLFB 5DG9A 3MTJA 3MD1A 4NYZA 1REGX 1U6ZA 2K3IA 2DNRA 2W9BA 2OPQB 4OYXA 2BJ3A 4PKDB 3C15B 2IVMA 1DLOA 4Z37A 4I6WA 1T05B 3MCOA 3MHYA 1HBMA 1GX5A 1FKAF 4U9RA 5RUBA 3B54A 2IRXA 4CLLA 1C1CA 2OPSA 2U1AA 3RW7A 1IQTA 4OFZA 4WFXA 4EZ9A 3EICA 3QLHB 4HDHA 4OZJA 3W64A 3QBCA 4C3MA 3E51A 3C46A 3I87A 2NS1B 2E5HA 1WHXA 4DU8A 1C1BB 3W5XA 5KFVA 4B9NA 4DR7F 3HD1A 3CT9A 3J80Y 4K5SA 2IMOA 2QRRA 2YBVA 3CC7S 2MSSA 4EK2A 3Q24A 4ED0A 2Z2YB 3HZEA 4ZVFA 5KT3A 3DLEA 5A0YB 3QJJA 2D3ZA 1S6QA 2B56A 2LKZA 2YWFA 4PWWA 2B43A 1YRUA 5J2QB 2R7VA 3BQ2A 3UCUP 2IY5B 4AQYF 4P74A 1KBRA 4NCGA 3A3PB 1E6VB 4Z7CA 4KGKA 2R42A 5K20B 1VR6A 4Q44A 2Q3PA 4NLRA 1DRZA 2MZQA 3OUYA 1RAJA 4OHWA 1R0AA 2MZJA 2PMWA 3U1NA 2Y1RI 1MW7A 1Q78A 1JKHB 3UDLA 2YKNA 2E5GA 2F9JA 3KKFA 2W2PP 3RB0A 2CPDA 2HVIA 3DXSX 1JK9B 1AZSB 2QZ8A 1VQ6S 1IQZA 8RUCA 4ED1A 1N34J 2RRNA 1F60B 2NZCA 2ZZTA 2J6TA 1U09A 3MECA 1RCOB 3ZZ0A 4IOCQ 1UFWA 3DMJB 1EP4A 5HVFA 1M5OC 4EBCA 1NK4A 4LF2A 4X66F 1B99A 1IUJA 3HO1A 3BBBA 2GIRA 3M2RB 4EO6A 4U8VA 1FRJA 3EZUA 1SPBP 1ZM3A 4MIBA 5I42B 1RA6A 3V4IB 3RB3A 2HRYA 3C14A 4MMOA 2HHPA 4ZA1A 4M5NA 2QTWA 3E2EA 4ERDA 4DQQA 2MQPA 3EX7B 1SXLA 1HD1A 2MZRA 3I56S 2ZH8A 1RWVB 4QR0A 3DOKA 1F1BB 1KWMA 2P2CB 4HR2A 4LFCF 4A48A 3GYNA 4RW8B 2FGOA 4QYRA 1KR4A 2VJUA 1RAOA 4FYVB 3VAFA 2AZ3A 2NPIA 3MF5A 2WRMA 4ED5A 4J9RA 4A8FA 1N36F 4QWCA 1SJ1A 4QW8A 1B7YB 5T7LB 2ZVIA 2C2MB 1HPZB 1TK5A 4JV0A 9RUBA 1X9WA 2WW8A 2DYAA 1FJ7A 3H5SA 3DRXA 3W5YA 2MKCA 3QRPA 2FJVA 1Y10A 4FF2A 3EM1A 1X4FA 3QZ8A 4DV5J 3MI7X 2JHEA 1S76D 4KRWA 5B0GA 2FJDB 1MWQA 4DSIA 1T94A 3HPOA 5CD4A 1RT6B 3TANA 2FYXA 3OJSA 3ITHA 3DDIA 2IFXA 1FWPA 3IR5B 2MGZB 1B70B 1U1NA 4N8OA 1R8HA 2DT9A 4R5PB 1RAEB 1N5YA 2BUNA 3Q8RB 2V4QA 2YH1A 5IV3A 3CJSA 3DU6A 3J81Y 5EGYA 2Y8WA 2BE2A 3CD6S 1Z2ZA 1XWLA 2GJIA 3TVKA 3QAEA 3BO2A 1VC5A 1HKAA 3M9MB 2CZ9A 4NLDA 1RU1A 1MSWD 2JEGA 1QM9A 3BQ1A 3BSNA 3TQEA 5KT4A 1IKXB 1M5KC 2WVCA 1H3DA 3D6TB 4PUOA 2HLTA 4X4UA 9ATCB 4DQSA 4CLUA 4KGZB 3KNAA 1UW9A 3PR4A 3CDAA 2LLZA 2CXEA 2EKYA 4AYBD 4JV1A 1WDDA 1HW8A 4NLWA 3KUEA 2Z8QA 5DDRC 1KRPA 4ZHRB 1MU2B 1WKKA 4O3QA 1VJWA 4C8YA 4O23A 4RKUC 1YQHA 3G9CA 2DGXA 4WU2A 5HJXA 1FESA 1RT5A 2HNDA 2XULA 4ILMA 3RYLA 1SJFA 2YX1A 1TVRA 2WVBA 3F41A 2XHCA 4O4GB 1IKWA 2JX2A 3HHEA 3S01A 2IYIA 3ZNJ1 4NRUA 4CT8A 3MCMA 2HFNA 3CJ3A 2AJFE 2VH7A 3R7BB 3M1VA 5KFYA 3GG0A 3S8SA 2XS5A 3IO1A 2GAHC 1J27A 2O66A 2DNKA 1NDLA 5HMZA 3KUGA 2VFRA 3HP6A 3TEHB 1YWXA 2W9CB 1NZ8A 5I3QA 3TI0A 2V4JB 4B3TF 4M5JA 4O0NA 1BXNA 1Z4UA 3KHGA 1T02A 1VBXA 2GHVC 4CLSA 3CCMS 4KT0C 2ASDA 1HIYA 4JI8J 2R7XA 1VHIA 4DCOB 3FGVA 3JXOA 5J1PA 3I55S 1ZBTA 4A8KA 3D1OA 4OZ0A 2QSWA 3EMTA 2DEJA 4DG1B 4A8YA 4C97A 1GTEA 2KFNA 3SIPB 2J8SA 3UNYA 5J1EA 2N82B 2H5IB 2VODA 1YJVA 3VQTA 1HNWJ 1WKJA 1NPRA 1MN9A 1VQYA 4CLKA 2HHQA 3BZQA 3ILLA 3NEKA 2VFSA 3HVAA 5AE3A 2B6AB 2E29A 2GFFA 1O0PA 3HCXA 4CT9A 3AQOA 5IFMA 2E5IA 1DZ5A 3ZZPA 2MKIA 1YZ7A 1UVMA 2VG7B 1GMUA 5HQLA 3LWLA 3LAMA 2Z2ZA 2OPPA 2CDRB 2NQPA 3MXHP 3EVOA 2FZCB 2IAJA 4PG8A 1PYOB 1H7XA 2HHWA 2JOQA 1UVJA 2HWIA 2DNMA 2DGUA 5B09A 2VBXA 3UR3C 3W8PA 2IM3A 2ZHOA 5A8RA 1VRQC 3R6LB 3MUTP 3W65A 1JLAA 2ZH5A 3NGKA 3FK4A 2BJDA 2A10A 1PC5A 2RKIB 3P5BP 4ZP7A 2J6SA 1L3UA 2D41A 3IXQA 2CVEA 4N7TA 4UUXA 2A6OA 2KVQE 1MMDA 2QA4S 2HHSA 4WF9Q 4P2SA 3PNIA 3M6XA 2YX7A 1DAXA 3D6HB 2MXYA 1RHMB 3ZTSA 5JJBA 3T5JA 1I6JA 3NRBA 4UOHA 3GV8B 1F6TA 3T5KA 3HXMA 2VB6A 4RNHA 1NK8A 1HNVB 3N0VA 2PIIA 3J7AN 2X7IA 3DRSA 3N01A 3SZ2A 2HQGA 3GG1A 2Y3YA 2MTLA 2VQFJ 5EWEA 3HSGA 1BY9A 1HBUA 2Y0BB 3QO9A 5K14A 1T11A 1B64A 3V6DB 2W01A 5E3RA 2V69A 1D8ZA 4FBUA 4Q0BB 1RKJA 3NGRA 2NLWA 1Q4RA 2CQPA 5F0UA 1JLQB 4DPTA 5C2CA 2VASA 3EXYA 4MH8A 2WK4A 2VOOA 1FXLA 2E5LJ 3SCKE 4KPYA 4DFKA 4DV1F 2CKWA 3CTRA 4KHPF 1DQ9A 2BE7D 5HP1B 1RSCA 1HWJA 1Q8BA 2MY7A 3I5CA 4ECZA 1CJUB 4H4KC 2VV5A 1G1XA 1YRTA 4CYUA 3L7UA 5HI7A 3J80U 1WC0A 4PQUA 5GADI 1CEZA 5CABA 3W7BA 1Q79A 3MEGA 1LWCA 1VQOS 3TRGA 2Z2LA 2VL1A 5BXIA 5ETRA 3QJLA 2EFGA 3BB5A 3X3UA 4K4ZA 3ISND 4MYTA 4NXNF 1HNXF 4KFBA 1SH2A 2MKSA 3NCRA 3TJAA 3EGZA 4JI1J 2M8HA 3CJ2A 3LOUA 4C8MA 3LWMA 4EEYA 2Z0GA 2C3UA 2XMMA 3JS9A 3ENAA 3O44A 3DOMB 3KG1A 2DKOB 1S48A 2Z56B 3QT6A 1Y0HA 1J5EJ 1HARA 2KG1A 3KOAA 5KG3A 5HMWA 1T0TV 2RH3A 3D2WA 1I1GA 3DM2A 1ULRA 4ZCMA 4DN9A 4ZITA 1NK9A 4KV8B 2HQ3A 5KFQA 4ES1A 1U0HB 4O3RA 5A2QY 1D9DA 4RU9A 1SQFA 3RW6A 4NI2A 5ETQA 1R6VA 3DYAB 2R7SA 4YR0A 1N54B 2C2EA 4WBFA 2HNZA 2QLWA 2UUCF 2AWZA 1RWXB 3FSXA 2VFTA 2W25A 3DLBA 1Q5YA 4P6QA 4EUVA 2C1EB 2E66A 4GC7A 2U2FA 3NGSA 3MOZA 1UPMB 4LSNB 1D1UA 1HQEB 1WUUA 1ZM2A 2VPXB 4F67A 2CZ4A 1TU0B 1CJTA 4G65A 3C16B 1Y5NB 2W2OP 2Q43A 5J2PB 3MMAB 1TL7A 4C8LA 1XK8A 1RT4A 1CS4B 1B0PA 2QA1A
chains in the Genus database with same CATH topology
2K7KA 1UJ4A 1APSA 1KD1T 1ZAVA 3THTA 4XPEA 2KTQA 4IG3B 2ALZA 3L09A 5LXRA 1XN9A 3KLGB 1Z2LA 3N6MA 3WC0A 1YJUA 4JI0F 5G4DA 5KFOA 4D3HA 3MMBB 3PY8A 3HHNB 2ZJQQ 3CDEA 1M5HA 4I7FA 3O8WA 2DR5A 4RW4B 3MMCA 2PA3A 1W2IA 3K5NA 1JLEA 4C11A 2RUGA 4FZVA 3MGJA 1U25A 2L9DA 3C3LA 3GIMA 1WACA 2CVIA 1WHWA 5FD1A 1VQLS 1UETA 1VBZA 1R27B 1IBLF 2KHDA 4JOUA 2XS2A 2GCFA 3ZC4A 5LSRA 1U26A 1FDAA 1GAOA 1U2FA 4KB7A 3HHLB 2D9PA 3PDNA 1LK7A 5C5JA 4MKYA 4FYDA 3BN4A 1UVNA 1HNWF 3G6XA 3I96A 1Z1ZA 2EK1A 2GIQA 3DM2B 3QGHA 3M2UB 2FDNA 4OL8A 2N4DA 2RIJA 3IGNA 3OXGA 4QPXA 3MUVP 3H98A 3OR2A 2KKHA 2LQ9A 4Q43A 2FUG9 3PV8A 1VOMA 3QPIA 3KHLA 3MM6B 1T3NA 2BABA 4F4KA 5GAHI 3M2VA 1CLFA 3IG1B 4DDFA 4TLRA 3V6HA 1AUDA 5D3GA 3BSAA 3BO4A 1DURA 3PX4A 2E5JA 4GKJF 2IBKA 2BBEA 5DDOC 3MZIA 3V2UC 3BM7A 2HW3A 2F1FA 2MJUA 2IRYA 3M32B 3KHHA 2XI2A 1ZPVA 3AB4B 4FBTA 1S49A 4C8NA 4OJ3A 3IAS9 4ETZA 2HHXA 2HNZB 3MTKA 2XWXA 3MMJA 1UWBA 4IYQA 3POTB 1REVA 5E7OB 5LL6d 3PEHA 5C25A 3MFHA 4LF4F 3KJVA 4X4VA 1VQSA 4WU3A 4ZMMA 4DL2A 2XZWA 3T9ZA 1VI7A 1FDDA 5DLFA 4NLTA 2BQUA 3VF0B 5F9NA 1S6PB 4GMKA 2NXUA 3P96A 2XMWA 3FFIB 2AYBA 4Q8FA 5D4LA 3M4XA 2ROPA 2YNFA 4DV7F 1QSYA 1U1KA 3JAMY 3IRWP 2G4BA 4YEAA 1Q7LB 4NL5A 4WFBQ 2MKHA 3MAQA 1VQ5S 1QSSA 3Q2TC 4TQRA 2J9CA 3DDNA 4J5OA 2KDOA 2KT2A 1VS3A 4C7QA 4OX6A 2JRSA 2WB4A 3DOLA 1RK8A 4OX9F 3OPKA 4DSFA 4Y65A 1SL2A 4JUZA 1XERA 5E2QA 3PW2A 1D3WA 4QWAA 5EHHA 3CJKA 4EU0A 3O5TB 2ATLA 3OTEA 5EN1A 3AB2B 3KK3B 3CDBA 5KFCA 3MUMP 4YB7A 3SQGA 4RUHA 2AW0A 1JNRB 3DRPA 3LF0A 1SH0A 4C0OC 4U7CA 1YBAA 1FRXA 3MAHA 2W8KA 3N5BA 4NYPA 2EC0A 2IM0A 3C6TB 3V81A 2J0QD 2EWHA 3SCLE 5KFXA 2X1FA 3G86A 4I7FB 3C6UA 4XDCA 4FF1A 2Z2MA 3MMCB 3FRZA 3LGMA 1H7WA 3SFUA 1JLEB 1FE0A 4HTIA 5GADU 3BGRA 3PVXA 2JC1A 4PG5A 2IM2A 2Q79A 4DUYF 1JLFA 2AQ4A 5KFEA 2R7QA 3SMZA 4A8XA 3M05A 2B9WA 4NLOA 4PCQA 3OHAA 4KAIA 3F44A 4G1PA 4TU7A 1GNKA 2JFDA 4CO4A 4TY8A 4DQRA 5IWAF 4YFUA 2R8GA 1ZPWX 3OW2R 3OFHA 4OHYA 2RF2B 4X84A 3VZIA 4HKQA 5F8GA 3JB9k 3OFEA 4DF4A 1AROP 1C0UA 3NAIA 1SIWB 2DNGA 2ZFHA 3OR2B 4R0JA 4C98A 4G3IA 5F8NA 3TOQA 2W8LA 1FVSA 1TV6B 1NKCA 3NGDA 4OI3A 3SXLA 2CJAA 2D7SA 4YR2A 2O01C 2RVJA 1HI0P 2DNPA 2J8AA 3PW0A 2R7OA 2RD5C 1X4CA 4D3GA 5J2MB 2DNQA 4ZCLA 4K4YA 2RDJA 2HS3A 2FJBB 4I4BA 4HT5A 2DGVA 4WFAQ 2J9DE 4WE1A 3NCQA 3BQ0A 1YI2S 5GAGI 3RB4A 2PC6A 1O51A 2BRLA 3M8QB 2ZD1B 2IC3B 5A6WA 2M9KA 4WFNQ 4I69A 1QUPA 2CPHA 2UUTA 1UWBB 2Q6BA 1REVB 5C25B 3V5RA 4FS2A 4KHRA 3CJ0A 1HNVA 2V94A 1H2UX 1P1TA 1EETB 1O8BA 1Y4ZB 2B4VA 2OMLA 2F40A 2GX8A 2RS2A 3FRYA 3RTVA 5KFWA 3HFKA 1S1WA 2VPWB 3L7PA 4HI2A 4OMFG 1Q81T 2J7UA 1K8AT 1JXLA 4DL6A 3AA8A 3KK1A 4M8LA 4FF4A 4WZMA 4IFVA 1I94F 1HD0A 2UU9F 4M95A 1WWHA 1N32F 4B9LA 4QQBA 1LK5A 4DPOA 5KFUA 4DN0A 5HQ8A 1BGXT 1Y5IB 2XCPA 4RU2A 4E0DA 2KXFA 2ZZMA 3CVKA 3FEYB 4F02A 3DOLB 5D4NA 4O44B 1LWFA 4ZCKA 4IH7A 1VFJA 2B51A 2C2RA 4OJ1A 3CJKB 1KSPA 1UKUA 1RTJA 2DNHA 4ED8A 4C8OA 3EXCX 5E3PA 3DRRA 1X8DA 4GKKF 2LMIA 3BR8A 2DIUA 4J9NA 3SCIE 1C2PA 3FNNA 3QMQA 1VIOA 3SQGB 4KE5A 4Y28C 3DRPB 3LP2A 5KFIA 4PG6A 4UUWA 3THPA 1Y9OA 2WHOA 4KTQA 2K2PA 5KFNA 2I2YA 5K5MA 3D1QA 5KG2A 1HMVA 2J76E 4K0KF 3MM5A 4ZK7M 5HO4A 3V81B 3GB0A 4QR1A 2FHJD 3MEEB 4URGA 3CF5Q 3DN9A 4O4RA 1K73T 1JLQA 1FTRA 3ZZRA 1IJFB 1HI1A 3BGRB 4ED2A 3PO5A 2DIVA 3LH2S 1RTHB 1F5AA 1JLFB 2V8GA 1IKYA 2HS4A 4CO3A 1TQLA 4FPRA 3DLKB 5KFPA 4A8WA 3H20A 2E5LF 1RISA 2YNGA 2AD9A 3BSOA 1OIAA 4TY8B 5KFRA 5CCLA 1HNIA 2A2DA 2KU7A 3NL0A 4HYKA 3IBWA 1GTHA 2O3DA 3GFXA 4YDXA 4OI1A 5KG6A 5F41A 1ZH5A 1OSDA 4K5RA 2AJ1A 4ZPCA 5DLGA 5B0DA 4ZCIA 2DNZA 1XC9A 1SL0A 5J1NA 3U27A 3S7RA 2RNEA 1YSJA 1SJQA 2W9BB 2KZMA 2DB1A 1YG0A 4F3QA 3T9NA 3FSIA 1RT7A 1UJ5A 3BR9A 2LXIA 1DLOB 3T6JA 1WTFA 1E6YA 3KNGA 1Q1KA 2B5JA 2Y1IA 3CJ5A 2QSFA 3PIPQ 2DPIA 1QUVA 3LP0A 1SJRA 2MDAA 1YTYA 1QAYA 1HBMB 3T5HA 4ECWA 3OSPA 1XMOF 4CQ1A 2OIHA 1HWUA 4PXCA 3GZ7A 3MD3A 4HH0A 4BBYA 5HROB 4X4RA 4OHZA 2Q66A 1ZM4A 3ZZZA 5JXSA 2LXUA 2ZBIA 2RQCA 5IXUA 4KSEB 4ETXA 1C1CB 3VAMA 2OPSB 1Q16B 2E44A 1B0TA 2DCUB 2OP5A 3IR7B 3NP5A 3G6ES 5CYQB 4XPCA 2ASLA 3CC2S 4ECUA 2ZNZA 1RTDB 1S1WB 2OKQA 4ED3A 1RT1B 4UQGA 1U1MA 2R7RA 2GMHA 3RAMA 2GHPA 2YKPA 1FA0A 4QJVA 4O0IA 2B7CB 4JV5F 3K8WA 4C0HA 1VQ9S 1U48A 3QGGA 2JEIA 4EBDA 3NWGA 2G0CA 1Y00A 2DNLA 1K1SA 1IR0A 3K5OA 2AV5A 1N4LA 5KOXA 5B0FA 2D1CA 1LWFB 4YQWA 1G6BA 4Y2MA 2CQ2A 1FXDA 1KTVA 3L3CA 5EWFA 1JB0C 1RTJB 1TZ0A 3DRRB 2ACYA 1U1PA 2ZE2B 2ZITA 2ZH4A 4MK8A 4K50A 4Y00A 5BR8F 2W7OA 2J7WA 4PRFA 3LP2B 1DBDA 4NLGA 3CCZA 4QWBA 3OLBA 2R2UA 3T19A 2VA2A 1KQSR 1WG1A 1KOHA 4DL7A 4MK9A 3MOJB 4Q45A 2XLKA 3R3TA 1FRMA 1HMVB 3MM5B 1KLNA 2VA3A 3Q2SC 5AXNA 1ZOTA 2GGPA 1QAJA 3UCGA 4NA2A 5L1LA 5I3PA 4J9MA 5I3UA 4EZ6A 2GJ2A 1X5PA 2D3UA 3DLEB 5CYMB 5M2PA 2UVUA 1WNEA