3FCWA

Crystal structure of the mimivirus ndk n62l mutant complexed with udp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
131
structure length
131
Chain Sequence
GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 40
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fcwA00
4DI6A 3EICA 1B99A 3BH6B 2DY9A 1NDPA 4F36A 3L7UA 2CWKA 1F3FA 3G2XA 3WX8A 1PAEX 1UCNA 1S59A 3FBCA 3BBCA 2HVEA 1S5ZA 3FBEA 1HLWA 3EJMA 3ELHA 4HR2A 3ETMA 5C7PA 4W98A 1K44A 5CAAA 3FC9A 3DDIA 1U8WA 3PJ9A 3GPAA 1F6TA 3B54A 3EVWA 1NSPA 3FBBA 3B6BA 1BHNA 3ENAA 1NSKL 3Q83A 3NGTA 4C6AA 5BXIA 2HURA 1JXVA 1WKJA 3EMTA 1WKKA 3FBFA 3ZTQA 2VU5A 4EK2A 1NPKA 2NCKL 2DXEA 2DYAA 1BUXA 3EVMA 3FCWA 3GP9A 3FKBA 1HIYA 2BEFA 2HVDA 3EVOA 3VVTA 2BX6A 1MN7A 4UOFA 4ANDA 1B4SA 1NCLA 3NGRA 3NGSA 1NUEA 1WKLA 3ZTRA 3Q89A 1NSQA 4ANEA 4FKYA 1VYAA 1BE4A 2DXDA 1S57A 4KPCA 3Q8VA 3EM1A 3EE3A 4UOHA 1XIQA 1W7WA 3Q86A 1ZS6A 1NLKL 3BH7B 1EHWA 4ANCA 4S0MA 4DZ6A 1PKUA 1XQIA 3VGTA 2AZ3A 3Q8UA 1MN9A 3MPDA 2ZUAA 3BBBA 3VGUA 5CABA 3ZTPA 3ZTOA 2B8PA 3FCVA 1NHKL 1LWXA 1NB2A 3VGSA 3JS9A 1NDLA 5IOLA 4WBFA 4DUTA 3VGVA 3BBFA 3Q8YA 4O0NA 4F4AA 4CP5A 2B8QA 2AZ1A 3VVUA 4FKXA 2DXFA 3PRVA 3NGUA 4ENOA 3R9LA 3ZTSA 1HHQA 1NDCA 3DKDA 4UOGA 1LEOA 1KDNA 1NDKA
chains in the Genus database with same CATH superfamily
4DI6A 1CJVA 1RAHB 4DJBA 3TA1A 4MKAA 2KFYA 2RF2A 2XBPA 3FBEA 4DR3F 4LT6A 2IC3B 5J2NA 5KFPA 1NNDA 2FC8A 3PX6A 5L1IA 5D8HB 4M5GA 5E2QA 2RB7A 3GE9A 4P2SA 4LSLB 1SQGA 2HVHA 2CVIA 4KB7A 4M5DA 2OSRA 1LFPA 3BB5A 3M8QA 1J5OA 2DNHA 1HQ2A 2FDNA 4LFAJ 1HNVB 1U24A 3G82B 3J7Z5 4KBIA 4ILLA 4X4TA 3ILOA 3O8WA 3KUEA 3CT9A 1N54B 3E51A 3W2WA 1RTHB 1T03A 1BMQB 3W2VB 3AD8C 4HYKA 2RMLA 3KK3B 4HT7A 3I32A 5HK4A 2ZH6A 2RDJA 1S1XB 4DR7J 1X4AA 4EYIB 3LO3A 2PA3A 2YKMA 4YB6A 1A9NB 4YOEA 4M95A 4YDDB 2BANB 2K7KA 4A4JA 2XI3A 2XQCA 2X51A 1XR6A 4NYZA 5D4OA 1JLAB 1TQLA 2EG1A 2RAQA 3KHRA 5CH7B 1DTTB 2MHNA 3SSSA 1C4CA 4NXMF 1A7GE 3D7SB 3N6LA 3GMGA 1RT4B 2W4PA 1PJ6A 2V4JA 9ATCB 4DS5A 3EUNA 4OHZA 4WCEQ 1KVIA 2YKOA 2FHJD 2E7VA 2W2OP 1NB2A 3R6GB 3M8PA 1HQUB 4ZN3A 4LF5J 2R8HA 4ZVQB 1Q5YA 4FKXA 2POKA 5D4LA 1SJ3P 5I42B 5B0AA 5EX3A 1RT2A 4Q2LA 5DQIA 2FJWA 1KDNA 2UU9F 2ZEJA 4HHHA 4A8YA 1WELA 3N5BA 2CIMA 2ZH3A 4HTIA 2Y0BB 3M6UA 2W25A 4XIUA 4F2RA 5GADI 3CD0A 3Q8QB 1S4EA 2GX8A 5KFMA 1GTHA 1GEHA 5KG0A 2C2DA 2EPIA 3SCJE 3NAIA 2HWIA 5MAOA 3DDIA 4AL5A 1T3OA 2JVRA 3AQPA 2VQEJ 5EHHA 3FQLA 4B9LA 2ZC4A 3J80U 4LF8J 1YBTA 2BKNA 5IZHA 4H4MA 3MECB 3GCXP 4M5KA 3ZXWA 3PEJA 3PW5A 2MYFA 1BUXA 1NPRA 3DCAA 2L9NA 4OJHA 1EJ7L 1FRKA 1XNQF 1P8GA 2HK2A 2J6UA 1B7FA 1M0SA 2HQFA 2F8HA 3PZPA 4HDGA 4ZIVA 2WBRA 3UD4P 1VDHA 5HO4A 5L8RC 3O6QA 3E2EA 4ZLPA 2QLBB 4ZDNA 1TELA 3PRVA 1QTNB 4AXIA 3ZZOA 1L3UA 3PW7A 3FFIB 3BYPA 4CO4A 1CQNA 3W9HA 1HMVA 3MMAA 1FKOB 5KFAA 4JI4F 5HL7Q 1IWGA 5J1PA 3TA2A 2DITA 3KNGA 5CXTA 2RQ4A 1FHTA 2HBRB 5CCLA 3SV4A 2HFNA 1FTCA 2KT3A 1F9HA 2RKIB 3PO5A 1XBWA 2MMYA 2PIIA 2QGFB 5F8HA 2E1RA 1XR7A 2DGXA 3K8VA 3UD5A 1RT6B 1PBAA 1YJVA 2CQPA 5L46A 3V4IB 3MGJA 4M5IA 3GQCA 5A8KB 2ZBQA 3BPSP 4EMDA 1RSCA 2HMIA 1FFWB 4NCBA 4QWCA 2UVVA 1KN6A 1TL7A 5A8RA 1S6UA 1OY6A 2DH9A 2C1EB 1RBOB 3HDSA 3JQJA 2CNLB 2PN6A 3IBCB 5E0OA 1VJQA 1RT1A 5A6WA 1VBKA 3FVYA 3ILLA 1SH2A 2V94A 3CCLS 3FNNA 3C3LA 4OJ3A 4OX9J 1FDBA 5D0GA 2GO8A 1LWFA 4UY8T 4ZVOB 5BJRA 2R8KA 5GMKa 2KO1A 3CMAS 3MUVP 3JQMA 4JI5J 1WG4A 3K8WA 2X1BA 4UTGA 2FVCA 1SCJB 3NCRA 1S0VA 3UCZP 1PCAA 1HL6A 2O67A 2V2QA 4ANEA 4ITSA 3DLBA 1S57A 1Y9OA 4O4RA 4DL0C 3MPYA 1H38A 1HBUA 1Y7PA 1VBYA 5I4MA 3JSMB 2IAJB 5T41A 4B3MJ 2E9TA 1JLCB 1JLQA 2RUGA 1N52B 3H5YA 4NMXA 7FD1A 3FEXB 1BWEA 1QSSA 2OEJA 2J6TA 5DZ6A 3LW5C 4R8UA 3G71S 2WTFA 3RAXA 2BQRA 2CXEA 2JEFA 5DG7A 5KT5A 3D0IE 4JI7J 4DSIA 3I0RA 4ED8A 3UCUP 1HR0F 1B0VA 1NDPA 1RBLA 1TKZB 2B7CB 5A76A 4ZHRB 1PC5A 2V9KA 3PYGA 4Y3CA 4EO8A 2ZVIA 3QGHA 1VLYA 4KV8B 3MF5A 4RJVA 4OYOA 3S01A 5LXYA 4CTAB 3DM2A 3R3TA 1O51A 5IM0B 4DR6F 4DCJB 1YJUA 3MFHA 4HT5A 3DLHA 5HANA 4Y6IA 4HACB 1HIYA 2B4VA 4LF7F 1UVMA 3P6YC 2BOPA 1Q7YT 2AU0A 3G6YA 1Y00A 3IFEA 2DPIA 2MQNA 1KP6A 2JSXA 5J1EB 3DN9A 2MPUA 1FFGB 5CABA 4Q43A 2VBYA 3M32B 2E5HA 2GGPA 2J7UA 3NP5A 1S9FA 3V81A 3OXFA 4DLGA 1RTJB 3V5RA 3N6NA 3VGVA 5H1SV 2B5JB 4M94A 1NJXA 1FWKA 2Q79A 4R5PB 4W90B 3V6DB 4DN9A 4J37A 2YWHA 5HATA 2OKQA 2W9BA 4X64F 2IRUA 3BO3A 2XB2D 1ELOA 2KG1A 3JSRA 1UCNA 4DN0A 2JC1A 2BW7A 4EGLA 2P8IA 2AJ1A 5KFSA 4LFBJ 4OZLA 4OIXA 2VQFF 2LXIA 2P9GA 5KFXA 4CQ1A 1HBMA 1EIYB 4FPRA 1N32F 3X1LB 3T3FA 2G0CA 2K1RB 2FHKA 1K8AT 2GJIA 3RR8A 1DAXA 4JV5F 2VC0A 1WC6A 3W1YC 2CPZA 4DV0J 1UZDA 4LQ9A 4CH1A 4IYQA 4HL9A 2EEYA 5CD4A 1N34F 1OQ3A 4CLUA 2GAHC 4NE9C 1S7HA 4X4SA 3JSBA 3UN3A 4MKVA 3S7RA 5D15A 5KT3A 2MB0B 3VGUA 3G8QA 5A8WA 4CLYA 2GVDB 4LVOP 4TLQA 1TL3A 2G0IA 2XC9A 2HGNA 2CQ3A 2J8AA 1TK8A 1HHSA 1T9YA 3JQKA 1T3NA 5C25B 5A2QU 4Y2MA 4DUYJ 2VDHA 2HQIA 1LNQA 4PQAA 2DNLA 5LM7E 4YP3A 4U7UD 3EJMA 1RBAA 3UE2A 4CH7A 5HBMB 1IBMF 1DRZA 4WYWA 3BF4A 1U0HB 2IJNA 2C22A 1F6TA 4FYXB 2YNGA 3RW6A 2HG4A 3QRPA 2WOMB 4ZPDA 2M3DA 3RRHA 2DNZA 2VPYB 2OTLS 1WOSA 1TV6B 2V8GA 1VOMA 3RJMB 3SFUA 1FVSA 4B9MA 1YHQS 4Y28C 2VFUA 3IR6B 2DKOB 3SSQA 1PAUB 4P7TA 3NWRA 2HGLA 2QMXA 3GFYA 1EETB 1CJUA 3FJ2A 1FRIA 4DV3F 4P71A 4EO6A 4DV5J 4USKA 5K8NA 3HPOA 2EC0A 3C8YA 2C42A 2OMLA 3GIRA 3P49B 2B9WA 3I96A 1UFKA 1UP1A 4ECUA 2J6SA 4K4TA 1JLGA 4JI0J 2Y1JA 2F9JA 4ZPCA 1WHXA 3BBCA 1SC1B 2HVEA 1TTHB 1BQNB 1KR4A 3AOCA 1O6XA 1MMLA 5ETNA 1R8BA 2ZJQQ 2AHOB 1VI7A 4I7FB 4HEA9 2QA4G 4GC7A 2HNZA 1L5UA 3RR7A 3MM9B 3DU6A 4OX7A 4DFPA 4DUZF 4PWWA 2GIFA 2I6WA 3CJTA 4B3SJ 3TYTA 1E6YB 2CDQA 1SL1A 2DGVA 4ZJOA 2CG4A 1FEEA 4ICLB 1FFSB 4MH8A 3G8TA 4DSJA 5KFYA 2E5JA 1HBNA 5KG7A 2HBQB 3PJXA 5CHCB 2VKRA 4YR2A 5GAHU 2RQMA 3KUGA 1RCOB 1N5YA 1S0NA 2KM8C 1NDCA 5HMWA 1CBKA 4QIWD 2A10A 1OJ4A 1HNIA 2M7SA 1WDTA 4ZLJA 3R1HA 3NRBA 3UD3P 4IO9Q 1Q81T 4FYWB 4DQQA 1U1KA 1NSKL 2UVUA 2E9RX 1P1TA 4EK2A 2HLTA 3ET6B 2LCWA 2OPSB 2CQDA 4JYAF 2JZ5A 1NKEA 1LQ9A 5DO2A 1RHQB 2DR5A 3KHLA 2GMLA 3OL6A 1XNRF 2J9DA 1R0AA 2XG8A 2WZ1A 4ED4A 1NKBA 2MDAA 2PT0A 4K7QA 1XQIA 1S6PA 1WF2A 2CPDA 3OSNA 2VB6A 3H2UB 1FDNA 2ASLA 2RS8A 2BXJA 4P2FA 3VR1A 2V8HA 4L3KA 1DQAA 1WI6A 3G4SS 5ETPA 4DV1F 1ZETA 4BC7A 4A8FA 3MM8B 3VZHA 4NCAA 3TI0A 2HHXA 2VASA 1C0TA 1UVLA 3M6XA 2ZNYA 2JLGA 4KSEB 4WFBQ 3KOAA 2HRYA 3IGVA 4CLFA 3K0JA 2M9KA 1N36F 4LF6J 3BGLA 4M5HA 2N3OA 2DYAA 2ZE2B 4NA3A 2CJKA 4IDKA 1KQKA 4DEZA 2R2TA 2CQ2A 4FKYA 4AYBD 4OZ5A 4IRDA 4AFFA 1RZMA 2DGUA 2NYHA 1D8YA 3I0SA 3A13A 2W2QP 1YBAA 1WC4A 4NWBA 3BN4A 2N7CA 2QSFA 1RWNB 4IG3A 3TX0A 4WXWA 2WRMA 1I94F 3GV5B 5FJ4A 2HHSA 4K59A 1F5AA 2X3GA 4QR0A 1MWZA 4YB5A 3VAFA 1UVIA 5DS7A 2UV8A 2DR9A 4GKJF 5AE2A 4ES1A 1R27B 4WE1B 4CLPA 1H7XA 2KI2A 5KFJA 5KG4A 5L1KA 4K4ZA 1NJWA 1TVRA 3IR5B 2VJVA 3RBEA 1KC8T 3OUYB 2Z30B 3MMCA 1KTQA 5KFUA 5L1LA 4JI1F 5LXRA 3C16B 3PW2A 2RRAA 3NBPB 4ZP9A 3R5JB 4LFCF 4PQUA 3UW1A 4QYZJ 1VHFA 1NSQA 3RB6A 4MIBA 3MMBB 3FEYB 1T8EA 1UWBA 4USWA 2AGOA 4USTA 3D0GE 3QWPA 4P2XA 2N4CA 3BBBA 3B4DA 2W9CA 2F5GA 1FRLA 2HBZB 4C8MA 3WBZA 2DGQA 3FGVA 3W7BA 2QSWA 2JX2A 3R8YA 2XCPA 2XYPB 5GMDA 5J1NA 3OTOF 2L9DA 2YNHA 3KUHA 4KH1B 3SMZA 3LPEA 1H73A 4OYXA 1S0OA 1KNZA 1WSVA 4F0MA 2E29A 1RACB 4K0KJ 2GVZA 4ZCMA 5B08A 5KFVA 2CNNB 1R89A 3MM5A 1YRTA 2YNIB 2ZBRA 4JI2F 2ZKUA 2UXBJ 1Y4ZB 2LA4A 1RTIB 3IP0A 2OGUA 2VG5B 2YVSA 3PHEA 3H5UA 4B9TA 4P72A 2QYCA 4EZ9A 4F4WA 2HBYB 2XSJA 2R7UA 2NXUA 2MGZB 3FDSA 4BWJA 1Y11A 1DQ9A 3T41A 2FVPA 4FYYB 4MFBA 2MJUA 4ECSA 4FF2A 1QLNA 5E3CA 5KFCA 4KO0B 1N88A 4L3NA 2ZWPA 5M2RA 1UZHA 1RT7B 2HRUA 1FKPA 4D3GA 4IR1A 2CJ9A 1PBUA 2G2OA 2JOQA 5CYMB 2GA7A 5K14B 2KZZA 4YMEA 4RW6A 1GFWB 4Q45A 3CO0P 8AT1B 2W7PA 3LF0A 1X4FA 4ZP8A 2HGMA 1S59A 1KLMA 3ITHA 2YBVA 4HR2A 1PG5B 3ETMA 4ZPAA 2DCUB 1EKRA 2KB2A 3PRDA 5T7LB 3IM9A 2D9PA 3CJ8A 1SUQA 4F67A 3KK2B 3M2VB 3QMQA 4TY9A 2P6TA 1FDDA 2C2EA 3KMQA 3EVOA 1RWOB 3D9BA 2CQ0A 3PR5B 3PO4A 5C2CA 2W2MP 4LF9F 5RUBA 3CD6S 5IC6B 3HSZA 3RTVA 5KG3A 3VAHA 3DDNA 3G96A 3BGRB 1NB7A 3OXLA 4DG1B 1HNWF 4J91A 5KOWA 4ID5A 2HYIB 5DGBA 4LR7A 2DCLA 4P7VA 1XN9A 1I6JA 2E66A 3FK4A 4DQRA 2YH0A 4LIWA 1CJKA 2HQCA 5E3PA 1IKYA 4C8LA 3LP1A 2DISA 1RWPB 1FRHA 3TW0A 2Q66A 1PAEX 5IWAJ 3BS9A 4F0KA 2MHEA 3PCOB 1ZZFA 3KJVA 2B9EA 4KHPJ 5F9LA 2FC9A 1QSLA 2JHEA 1ZAVA 2DVIA 1DY3A 4DV6F 3OFFA 4KT0C 1B70B 5ETOA 1FK9A 1QY7A 3CB4A 2MQMA 3SDEA 1S7IA 3TANA 2M2BA 2ZZNA 4FS2A 2ZHOA 1BQXA 3D28A 3H5XA 4RPFA 1YI2S 2R2UA 1L3VA 1YZ7A 4LMZA 2DD8S 5F3TA 3NAHA 3POTA 3BH7B 1EHWA 2JEGA 1U7LA 1WC1A 2HVIA 2BM0A 2KRRA 8ATCB 2AJ0A 2B8PA 4AD6A 4DV2F 1V6HA 1UAWA 2JVOA 1LWCB 3AODA 2XZTB 3BN7A 5J2PB 4LIRA 1NK0A 1YJTA 2PMWA 4P75A 1KOHA 3DLJA 1JXLA 2MQLA 2AX0A 2W7AA 1PYOB 2LU1A 1OPIA 2O1PA 2ZM6J 2BUNA 1CULA 2R7OA 1QD1A 3ICLA 5C7PA 3RBZA 5J2QA 4C4WA 4RW4B 3O3LA 2VZ9A 2HKEA 3MEKA 3TAMA 2C28A 4X62J 1R8PA 3K5PA 4Z37A 1X4GA 1VC0A 1UJ6A 1W2IA 4KHMA 3NG8A 4DFMA 1GXLA 3T1YF 2QFJA 3R5DA 1T11A 3DYAB 2CKWA 2OAUA 1C1BB 3MZIA 2UUBJ 3QT7A 1MG7A 2AZ3A 2VOPA 3SQGB 3DI6A 1SKUB 1YRUA 1OS5A 5KFOA 3TVYA 4DU7A 1GMWD 4GRSA 4F02A 5EN1A 3BBFA 4I64A 2BZ2A 1TKXB 2HNDA 2K8GA 4CIOA 1X5OA 1U09A 2CNKB 3K59A 2BVZA 4CT9A 1W2BR 5CYQB 1S1UB 4OLOA 1RJJA 3NY0A 1L3SA 3FMWA 3G2XA 3TA0A 3DMJA 3ULHA 4TU9A 4ALZA 1TMJA 3OJUA 3NKYA 3MURP 1FI4A 3KFWX 4ERDA 3D67A 3T5LA 1IBCB 2CDRB 4P10A 2I2YA 3A3NB 1RWUA 1HWIA 1N8RT 2ZH2A 1R3NA 4O44A 2R4FA 4C8YA 4I2QA 5CCMA 3CCJS 3FMBA 4O3PA 1HD1A 4PXDA 3HHEA 4C98A 6FDRA 3DOKB 1KRPA 1IN0A 4J9LA 3RZAA 4CT8A 3SZ2A 3E01A 1T7PA 4IFVA 3ZZUA 5FDLB 2E7WA 2V8PA 1HYSA 3LWLA 2UUTA 4B9SA 2KTQA 3KLGB 2GC8A 2C2KB 4MK8A 1RUSA 2AEFA 3OVAA 4WFZA 5DG8A 2R8IA 1Q95G 1D9AA 5JUMA 4DMZA 1HHQA 1B3TA 3TUIC 4N77A 4ETZA 4MYUA 4CNYA 2E9ZA 1RAGB 3W9IA 1OMSA 2KT5A 4DR7F 1M5VC 2KM8B 4TY8A 2ZBIA 2KVIA 1QAJA 4C0OC 5HQMA 2ILZA 4QYRA 4E2FB 4NXNF 3Q8RB 1RISA 5KT2A 2L48A 4X4RA 2CQBA 2DXEA 2HQDA 4X4NA 3CIMA 1SJ4P 1UETA 2QA1A 3FKBA 3DRRB 1S1WB 2KJWA 3M1VA 1ICEB 3T19A 1VYAA 1JKHA 4WF9Q 4ANCA 3HULA 2ROEA 5G0RA 5HLFB 3MFIA 3CVKA 3OJSA 4PXBA 3H98A 5ETRA 4ED3A 2QLJB 2EK1A 1U1LA 4FYVB 3CMQA 5K9FA 3UR3C 2BMBA 3LOUA 4CM0A 2NUHA 2MZRA 3C14B 5IXUA 1G6BA 4G6VB 4ID8A 3HX9A 2HHVA 1NK9A 1QAYA 1IJEB 2AEJA 4URQU 1JJ4A 1C1CB 1HLWA 4W98A 4LRCA 1RT5A 4KQZA 2ZHAA 2DHXA 3T9ZA 1TUVA 3G86A 1ZH5A 2KH9A 4QBUA 3RB4A 1LK5A 2UZAA 2VQEF 1ZPVA 4L6V3 3KLHA 1TZ0A 1DLOB 2WB1D 3Q23A 4KAIA 4I6WA 4DXLA 4MJKA 2RQKA 2I38A 3Q24A 3DLGB 2KHCA 5KFFA 3TAPA 3KK1A 2AX1A 1TAQA 2F8MA 2OPRB 3C15B 3DNCA 4NLOA 4WWSA 3HVRA 1U1RA 2B4UA 1NK8A 3IRXA 1OY9A 5HROB 1K0TA 2DEIA 3H5SA 3GILA 3VCDA 5J2MB 1CPZA 2ZD1A 2WHOA 5KFNA 3MEEA 3O5TB 2H9ZA 4DUTA 3GR1A 3M8RA 1K9MT 1NH8A 1T94A 2VOOA 5E3RA 1D3WA 1X5PA 3GV7B 2YKAA 2CPYA 1IR2A 2BE2B 4MIWA 2CWKA 3G82A 2ATCB 4OL8A 3GIJA 3PFEA 1SH0A 1SKRA 1UFLA 4QJVA 3UVJB 3MR2A 5FIIA 1RWKB 5THWA 1J5EJ 2DHAA 2QO3A 4FBTA 3MD1A 1RTHA 4ED6A 2ZUGA 1N56A 2AD9A 1K0VA 5GMEA 1KHVA 3DDKA 5D3GA 4BS2A 4M5NA 4M5DB 4WU2A 2ZDPA 2XY6A 3B78A 3HKWA 1S1XA 4IQMA 1VCTA 4MAKA 3M8QB 4UZCA 3N28A 4LF2A 2BRLA 3EZ5A 2IFXA 1WACA 2RT3A 3N5FA 2BQUA 4LF4F 3JTNA 4JI8J 1YG0A 1CC8A 4DPYA 1HQEA 1U6BA 3IR7B 5IV4A 4IO1A 4DFJA 3KLEA 3EE3A 1YITS 3QSYB 3GIIA 3MOJB 3RAMA 3HSGA 4DZ6A 3BV8A 1JLAA 3DRPB 1FO1A 2JEJA 1P27B 1YK9A 1VISA 3CIZA 3KJFB 5DLGA 1JNRB 1FD8A 4OZ1A 3W2WB 2WVDA 1NDLA 3MPUB 2A3JA 2FVQA 3J81U 3ENWA 1URRA 4QW9A 3NGUA 2I0XA 5KG5A 3HP6A 2HFUA 2DGOA 4URSA 3L7UA 3M05A 1IR0A 4KYZA 3J81j 1CG2A 4Y2CA 3GB0A 3NNHA 3H40A 1UJ4A 1YJWS 4DSLA 1G1XA 5KFIA 2V67A 4OYMA 1IJFB 3TZWA 1K1SA 2X3DA 5CA5A 2FYXA 3HHLC 4GMKA 3JYTA 1OYDA 1DURA 3BGFA 4EEYA 2V4JB 4DQSA 1H72C 4KFBA 1QM9A 2MY8A 3D0HE 1FVQA 1MMNA 3I5AA 1WTBA 4YY3J 1S49A 4GO5X 4G1PA 2XWYA 2BJ1A 4JP8A 2XEXA 4B3MF 3MECA 2EFOA 1V3SA 4A8SA 2X7IA 3G6ES 2EBEA 4ZS6A 1CVJA 1TL1B 3W9JA 2QTWA 4QU7A 1LW0B 2FLOA 3HVAA 4PG5A 2X1AA 3TEGA 4K8RA 4JI7F 1VFJA 4J9NA 4C3LA 3D68A 4PG6A 2PA8D 2IVMA 2UUCF 3CJSA 4M5LA 2QLWA 3AOAA 3FFIA 4GC6A 1LXNA 5EWEA 1SIWB 2MKJA 3ISNC 2MLZA 1VLOA 3GSDA 4UT4A 3CC4S 2ZH5A 1QVFR 2HK3A 2RKIA 2GV1A 2R7XA 2YWWA 3FCVA 2KXNB 1WF0A 3NS6A 3ILIA 4UUXA 5I3QA 2YPYA 5LSOA 2D69A 3O2IA 1RT6A 3M9NB 1VK8A 4I0WA 3F0NA 3V4IA 4ENOA 3THTA 1HMVB 2XHWA 3MMAB 1Q86T 2DGTA 4KR0B 5A8KA 1ACMB 4GVBA 4QYZK 1H74A 3FBCA 5C42B 3VF0B 3DLLQ 2BV3A 4A46A 5DZ7A 4DX6A 2J0XA 2Q3PA 2OJ3A 2XMVA 4ZVTB 4ZPTR 3T9NA 2AV5A 2OIHA 1NK4A 3IBWA 1R8CA 4EBEA 2DR7A 5HQ8A 2D3O1 4XPEA 4B02A 4O23A 2O3DA 3OSPA 4A47A 1FJGF 2NS1B 1N5VA 2AYMA 2V2KA 3OTDA 2Y8YA 1X60A 2L3MA 4DV0F 2HMIB 1ZS6A 2FJAB 4PXEA 4NXMJ 3CJ4A 1TL7B 5A8RB 4F04B 4YFUA 3QGGA 3ZTOA 2BBEA 2ATLA 1FTRA 2W9AA 1WC3A 2DRDA 2H4WB 3EXYA 3BZQA 3R5CA 1RT1B 4RBTA 1SC6A 3JTPA 5GAEU 1Q16B 2I8EA 4OQJA 2Y8WA 2R7SA 1FERA 2F4VF 3AHPA 1U1PA 3IWNC 4ZJLA 1WSRA 3KG4A 4OYZA 1L3TA 4RUCA 2CWXA 4DUYF 3U27A 4J5OA 2G2ZA 1FF2A 3M8YA 4DL3A 2BR0A 4J9SA 2BM1A 1MU2A 3CF5Q 1P9QC 3KTQA 4DL7A 3NGTA 1S12A 2BJDA 4ECTA 2MKHA 4USVA 2R7RA 1VQ8S 2HS4A 2VA2A 3M4XA 3PVXA 4AE5A 4QWEA 4EZ6A 2HNYA 4DSFA 1EZZB 1HBUB 4F4YA 4UOFA 4C8NA 4ZHRA 3SEOA 1RKJA 2J7KA 5LSRA 2GHVC 2NXCA 1VRUB 3RG6A 5IM0A 1HI1A 4WFYA 3GG0A 4R8UB 2RU3A 4FN5A 4A8WA 4HACA 3JS9A 1K1QA 1H0HB 3I0RB 2DR6A 1GX5A 4J9VA 4KGMA 4ED0A 3I31A 1YKWA 1IBLF 4IH6A 3OTBA 2OUGA 4DBQA 2MKKA 2HHWA 1U47A 4RU2A 3AJ1A 2CAJA 2EBGA 4JI0F 1Y10A 1RABB 3FSXA 4RW9A 3DM2B 3L4BC 4PZVA 1RTJA 4NL5A 2OFGX 4TN2A 3DRSA 3DC2A 2KVQE 2JJ4D 3F44A 3OBIA 4O3NA 3GZ7A 1FCAA 2YH1A 1M1HA 2AEMA 1FJEB 2DHGA 2BEFA 5F0WA 1JLBA 2B56A 2WONB 1KQFB 1NK6A 4CCHA 4B3SF 1RAJA 4IH7A 2F7VA 3V81B 1QE1B 1VQNS 4N47A 4ZVRB 2XCAA 3J7AN 5GAGU 1AA1B 5SUHA 3QZ8A 2LYVA 3QSIA 2W9BB 2L08A 2NQPA 2E1PA 4MKBA 3Q2SC 3RYLA 4CNZA 5DGAA 3DOLA 1HBMB 1YQHA 1X4HA 2LQ5A 3WIVA 2OEKA 2RIJA 3AA8A 3R1LA 3B54A 2LLZA 2OPPB 2IHR1 4IFYB 2J0WA 1H2TZ 2UVRA 1R43A 5C25A 3W8PA 1Q1KA 4RUHA 5HAOA 4K5SA 4I6YA 3D1OA 4Y2IA 5AXMA 3Q89A 5HBMA 2E5LJ 4RBUA 2WSCC 3KNAA 3CDEA 1FWLA 4WFXA 1NLKL 2WOMA 2HLUA 5D0HA 5EDWA 3UWTA 1GX6A 1D9DA 5D4NA 4QQBA 2XY5A 1SVDA 1KEKA 4OHYA 1SXLA 4IOCQ 3W8GA 2WVEA 2VBWA 1NJYA 3OVSA 5KFBA 1VQOS 3GTYX 1YZ6A 5KFLA 2XY7A 3C6TA 1Q7LB 1MSWD 3IS9A 4DS4A 3SBMA 3FUYA 3ZNJ1 4F3QA 3T5HA 4ECRA 2ZITA 1CC7A 1S6OA 2EWHA 2JH3A 4V1Ak 1BGXT 4QU6A 4RWXA 2B9XA 4DWIA 3PNIA 3GR0A 1OSCA 3H0PA 5HMYA 4IKAA 5LMUJ 5JVHQ 5IQ6A 4NYOA 2F63A 3CCTA 2EFNA 3P4UB 4C0BA 4LF6F 3QRRA 4GO7X 1XMQJ 2C2ZB 4QIVA 4DR6J 3DOMA 1BQNA 1V3RA 3Q8PB 2FTRA 4NCGB 4F3OA 2CQ4A 3QYYA 2I9SA 3IM8A 4I6AA 4JOUA 1WOOA 3HSDA 1EB0A 1KWMA 2KRBA 4I7FA 1U25A 2ZOGA 2LMIA 4UQTA 4FS1A 2VH7A 4YHHJ 4DR5F 2QL5B 2VG6A 4LVNP 1SQEA 1T9TA 4LRFA 1UPMB 1LW2A 3BDPA 2R8JA 4NZ6A 3NS5A 2PI5A 3M6VA 3MM7A 4YUDA 4ICLA 3GSIA 5H9FJ 5K8MA 3DHXA 1VR6A 3E8OA 1KHWA 3HD1A 2XS7A 4IG0A 4BWMA 2VBXA 2XZWA 2BJ3A 1FXLA 2BJ7A 5DG9A 3M6WA 1S48A 5FLXU 3LQVA 2ZBCA 2GIRA 2HNZB 1XK8A 2CG8A 2AYEA 1F5BA 3UDLA 1NHVA 1B0PA 1RHMB 2HQGA 4FXWA 2HIQA 3G6VA 4QPXA 2R7QA 2RUSA 1FA0A 2IA6A 3MEGA 2DNOA 3CCRS 3HJVA 3U02A 3HT3A 3UN5A 3VGTA 1HBNB 1HPZB 2ZZTA 2WW8A 5KG6A 2CQHA 1H3DA 3D5MA 1S1VA 3DRYA 3K17A 1PGZA 2OPSA 3CJKA 4NMLA 1N5YB 4KY3A 1OY8A 3BO4A 2ZH8A 3MWBA 3SCKE 2W01A 1UPPA 1HNIB 3AT1B 3TUPA 2CZ9A 3MR6A 2K7JA 4ECQA 5GADU 4KKOB 4URGA 1RE1B 1RTZA 3LGMA 3IA0A 1BD6A 3VAIA 1Y5NB 1YJRA 2VD3A 3QFWA 3SXLA 3CCQS 6FD1A 5H9EJ 4K0KF 3MM8A 2E1AA 1IBMJ 2IRXA 2H5IB 2NCKL 3T6JA 4BC9A 2UXBF 4L72B 1DARA 3PY8A 1R7IA 2KXFA 2E44A 1IR1A 1EP4A 4ZPVR 1JLFA 2GHWA 3A3OB 3OLBA 2V4QA 2YQ3A 3AB4B 1S6QA 1Y5LB 3HHLB 4Y0FA 1Q53A 4KPCA 1SBRA 4OI0A 2MZQA 2WVBA 1TUGB 4DX8H 3KLFA 2R42A 3I4PA 3CCSS 1U2CA 4ZN1A 2ZE2A 2OI2A 3QIDA 2DNPA 2RD5C 2K3IA 1J27A 4B3OA 1HBOB 1UEKA 5KTQA 1C0TB 1JIHA 4KC5A 3CDWA 2DPJA 2JDJA 1NDKA 4USMA 3GIMA 4X4UA 2J76E 2GAGC 1YJNS 3CCES 3DLKB 3OR2A 2M0GB 3KKFA 3EX7B 1X4DA 1S76D 4BBYA 4ZCKA 5K5MA 2G0JA 2W2NP 2EXUA 2MQQA 5IT9U 4IDKB 2GNKA 2XWXA 2D3UA 1N5QA 3AA9A 1WWHA 2GCFA 3PRBA 4JI6F 2VBZA 4WE1A 1GQEA 2HW3A 2KXHA 3I0SB 2PGCA 4UZBA 1YVFA 2IRYA 2FQQB 4B3TF 5B0CA 2E1CA 1SIZA 4WJBA 4U95A 2LKZA 4K4YA 3HHKA 3ONQA 4O0NA 4WFAQ 3EPGA 4HH0A 1FXRA 5KFDA 3MMBA 3QFHA 2ZZMA 1BLUA 2VPWB 4HHUA 4DSEA 4NRUA 1TVRB 2BOAA 2BA9A 3M30A 5M2PA 1LXJA 1SPBP 3MR3A 3MMCB 2AKWB 2RDIA 2GJ2A 4E0DA 1ZM9A 2AQ4A 1LV5A 1N6QB 4X65F 4N56A 3W64A 3M7VA 2EKNA 3Q8SB 3NGDA 2DRAA 3I82A 3T5JA 3PYDA 4PQUB 4CO1A 4KGZB 4PG4A 4ZCIA 5DDRC 2VFSA 5C2GA 1UWBB 1NCLA 2HHTA 1P9YA 4P73A 3L95X 4DOZA 1XIQA 1GMVA 2DNQA 4JYAJ 1ROFA 3I5BA 3J7YU 4C8ZA 1G4CA 3GU0A 1XNRJ 3CDUA 3QWUA 4G1QA 4K4WA 1X4BA 4TLRA 4ELUA 2EFGA 5KFQA 3QLHA 4N7TA 3AFGA 1TL5A 2XGPA 3H4DA 2YWFA 2PFDA 1F60B 5HMZA 4XTTA 3LP0A 4QIFA 1OSDA 3CJ3A 4NLRA 4NLXA 3L9ZA 3GONA 1URNA 1RT7A 3MM5B 4X4VA 2BJ8A 3LANA 2W4CA 3Q2TC 3FBBA 1TFYA 5AE3A 1OQ6A 1AZSA 3P45B 3BEGB 5K14A 3BQ0A 2LVWA 2B4OA 1RLCL 3GWCA 3TVKA 1BQMB 4NLUA 1NH7A 4X62F 2AT1B 2XSJB 4DCPB 2CJAA 3J7YI 4ANDA 4B3RJ 4CO2A 7FDRA 2R7VA 4AQYF 2AIRB 4OV6A 4ZMMA 4IQXA 4UY85 2DRBA 2Z0GA 4DL2A 3DXBA 3UFCX 3WX4A 1S9EA 1N48A 2BQ3A 3MPDA 3ZTPA 4ED2A 5E33A 3HFKA 5LOQA 1RAIB 1HNZF 2C2RA 4O3OA 4RW6B 3L3CA 5BYSA 2HAFA 2QT7A 1IQTA 2FY1A 3WC0A 4B9NA 2DO0A 4MT1A 4TYBA 4PUOB 2X1GA 1R0CB 2XNRA 1DTQA 3EYZA 1B99A 2UUAF 1WJ9A 3DGPA 1MWQA 2XMWA 3BGRA 2HHPA 3WX8A 4O3SA 4DG1A 3BJYA 2DHHA 1FT8A 4Q7AA 3M2RB 1SUQB 4FDFA 4N76A 3R97A 4F26A 1T9VA 4RUAA 1FEHA 1SJQA 1AUSL 3NL0A 2VJUA 1X9MA 5CZXA 3Q8VA 2VKZG 2NUUG 3DFEA 1S10A 1U02A 1VC6A 3NCQA 2R7WA 4HHJA 1NZAA 2QA4S 4ID5B 4OX8A 2FJEB 2H54B 1SI9A 4KTQA 2ZH4A 3GFHA 3L7PA 3JAMY 1LFWA 4LSNB 1NHKL 3RBDA 1CJKB 5KFGA 3W63A 4CP5A 3BSOA 1KQGB 3PV8A 3LP1B 4N8OA 4FXVA 2W1BA 1Y5IB 2VA3A 2QC3A 5I3UA 3KMSA 3IBFB 3C2PA 2DB1A 2FGOA 1UA1A 2UV8G 3KWMA 2YQ0A 2I5JA 2DR8A 1QTMA 5AE1A 3PTWA 1N33F 4F4KA 3WIUA 1D9FA 2IMOA 4I67A 4CM2A 3OTOJ 1FK9B 2V8VA 5J2PA 3EVWA 3SDEB 2R9LA 1IM6A 4NYPA 1AUDA 1FESA 3QJPA 1YRXA 4MK7A 1NHUA 4I2PB 2GQ2A 2QN6B 3NEKA 4BHQA 4L76A 2FPHX 5KFZA 3R27A 3EVMA 1RA6A 2HVDA 3FEZA 3KLIB 4JI2J 2IMWP 4CH0S 3A8KA 4Q8FA 4RW4A 1S0MA 4ZVSB 2CQCA 2V50A 3CC7S 3T5KA 4DV7F 1K73T 4Y00A 3TZZA 2AYBA 3KJQB 2D3OR 1F0XA 3OR1B 1VQ7S 1WEYA 3V6HA 1WI8A 4LQ3A 4W4MA 4ZVEA 2PI4A 2NSBA 5IOLA 3PDNA 3ILJA 5IQQA 3N6MA 4P6QA 3IMQJ 4KGVB 5HJYA 3PIPQ 3DYAA 3SV3A 2FLNA 1RQ0A 3MAHA 1FRJA 3EDRB 5SZTA 3CEDA 3K58A 3NLCA 2WAQD 4RR5A 1CULB 1S97A 2UXCF 1FJCA 2KYZA 1T9WA 1RWWB 1VJWA 3I55S 3ELHA 3TAMB 2NZ4A 3PIOQ 2QIFA 4OZNA 2LECA 1M5PC 1TKXA 5MLCV 3PYEA 4G1IA 1IM4A 3EXCX 5DM7Q 2RJZA 3BR8A 5LMNF 1EQMA 1A6LA 2L9WA 3R5GA 2HZAA 3MOZA 4CLZA 1H2VZ 4KGXB 4RNFA 1MWYA 2OLWA 4USUA 4OI2A 2KG0A 3HVTA 2DHSA 3DI6B 1REGX 3QT8A 2WCXA 4YB1P 1FNOA 5A0YB 1OWXA 4X66F 5BR8J 4ZOSA 4ATNA 3D2WA 4O4GA 4IOAQ 2B6AB 2C2MB 3DOKA 3S1TA 2P6SA 1RWVB 4DV4J 4TQSA 1JJ2R 3A12A 1KSPA 3GYXB 2Z2LA 3UO0A 3B82A 3LALA 3KLGA 4WYLA 3QATA 5B0FA 5IV3A 1JXEA 3PW4A 1Q4RA 1QVGR 3BSCA 4JBCA 1ZPWX 2Q43A 1HW8A 1U8SA 2QFIA 3MM6A 2PO4A 4FXDA 5F41A 2WK4A 5EX0A 2OD6A 2HS0A 3TO8A 4MKYA 4O44B 2HWHA 3KHHA 1J5EF 1HKAA 2MZTA 4KH0B 1FRMA 2W7OA 2W2PP 2M52A 5LJ3Y 3E01B 3FCWA 3GJQB 4IFVB 4DV6J 3GV8B 3NGRA 2XS2A 3H4BA 2XMUA 1Z2ZA 1HI0P 2HFOA 4JI8F 2E5IA 5K20B 3J80Y 5I3PA 4S0MA 3BO2A 1MN9A 5G4DA 2ASYA 1FXDA 2K3KA 3NMAA 4MIAA 1RB0A 2Q1LA 3K5MA 5ETMA 3I5CA 1S1WA 2XTJP 1UW9A 3W65A 2CNOB 2HHHJ 1X4CA 4J9MA 4QWDA 1TMMA 2W4DA 1YGYA 1TKTA 2IM3A 4TY8B 2BDPA 1VQSA 3X3UA 1R8HA 4AUKA 2YWGA 1PYSB 5F8NA 4OJ1A 2OH2A 2E7XA 1MNEA 3ZZRA 2IM2A 1UTAA 1IKVA 2G13A 3D3BJ 4ES2A 2ROPA 4R25A 1WHVA 5BXIA 3UN2A 1HA1A 1NPKA 2B3TB 2RS2A 3TVZA 3M1VB 4A8QA 4DR2F 2AYGA 2BACA 1FX2A 3HHLD 3ISZA 1JKHB 2LP4A 1SQFA 2UXDF 4ZKAA 5G0RB 3K7RA 1REVA 2GW8A 3PXGa 4J9QA 2XYGB 2Z2YB 1LWEA 4F2SA 2A18A 3NGKA 3QO9B 1VHIA 1WDDA 4L74A 1VRQC 2MEWA 1IBKJ 2C3UA 3HLUA 2IM0A 4ZP7A 4WBFA 2E5GA 2B8QA 4F0HA 3UNGC 2ZH7A 3DLGA 3M2UB 3WC2A 2CA9A 2CADA 2JLEA 1YX2A 2RVJA 2CPHA 3U1LA 5HI7A 1FKAF 3CXCR 3UPFA 2FJVA 3K5NA 3PKMA 3KLHB 2ZHBA 3MPVA 2M70A 1WKJA 4CDIA 3LP2A 3J7ZT 3RBXA 4X4QA 3CD7A 2BE2A 5A6PA 2V63A 3KK1B 2BX6A 1MN7A 4C11B 1QSYA 3DU5A 1UEUA 1KVKA 3IRXB 4DL5A 2L41A 3US5A 3UVJA 4FPIA 4DL6A 2CZ4A 4H4OA 1RGVA 3ISND 4QOTA 2V4RA 2ZD1B 3P5TL 3A8JA 1O8BA 5H9FK 4Y2KA 1AFJA 3MEEB 2XHCA 2FD2A 2JFKA 2DEJA 3CC2S 1RYRA 1LOUA 4PWDA 1WTFA 3H42A 1TKDA 4WKYA 1Q8BA 1S9GA 5CZVA 3R5AA 2V34A 1ZM4A 4JV2A 5F8GA 3RGIA 3WQPA 1XMOJ 3MUMP 2VPZB 3DRPA 1U45A 2BYCA 3A8IA 4WK1A 4HI1A 2PMZD 2VODA 1CLFA 1PYTA 1N5SA 4DPXA 1RT3A 5D3GB 2QEXS 2D7SA 2UP1A 3E3XA 4RX6A 3IWLA 4U8VA 4O3QA 4OI3A 1HQEB 1XMBA 1F9FA 4NXNJ 3KLEB 1UW4A 4TQRA 4B9UA 4QR1A 3W5YA 4Q2MA 4OZ2A 3D66A 2FVRA 1U2RA 1I1GA 3HD2A 1VQ4S 3W62A 3AY0A 1C0UA 4ZPWR 5AT1B 4LREA 3SCLE 5IS2A 2A2DA 3O44A 1T05A 3SSRA 3TX8A 2NPIA 2WSEC 2MLYA 4WTYA 3CJQA 3UR0A 3CJ5A 1M5OC 1NM2A 3IWXA 1KQSR 3MMJA 2CPEA 1RYSA 2J9CA 1FE4A 3G87A 5H9EK 4WKRA 5AXLA 2H4YB 2FLPA 2ERRA 2FHJA 4DDFA 4KE5A 2EG2A 1V3ZA 4DZDA 1FJ7A 4CZCA 5KT4A 3C6UA 3AJDA 1MROA 4G65A 1C2PA 5CAAA 2CYYA 4C2MA 5L39A 2DO4A 2HS3A 2Q6BA 1NRKA 2Y0SD 1TL1A 2BJEA 1LW0A 1IKWB 4UOCA 3JYTB 2ILYA 2FJXA 3U1NA 1WEZA 1O0PA 4KFBB 2EFPA 1JJCB 2KYXA 4ZJQA 4FF1A 2JC0A 3VVTA 5KFEA 4AXJA 2B43A 3GJSB 1ZZNA 4J7CA 2KFZA 3OFEA 3TP2A 4K2XA 4HTJA 1HNXJ 4EI2A 1GMUA 3LAMA 2A2CA 4NLDA 2PEBA 1T95A 1HFEL 1KOOA 3D1HA 5BYRA 2GIQA 3QIPA 4YR0A 2IVFB 4LBPA 1I3OB 3J7A1 5KT7A 5HJXA 2M4MA 3PHTA 3IO1A 1VIXA 3LWMA 5DQHA 2ROGA 2FHMA 3CCMS 4Q5VA 3UNYA 1CS4B 4H54A 4ZPBA 4B08A 4ZCLA 4DQPA 4RZRA 3I9ZA 2BABA 2AJ2A 1S77D 2WVFA 1HW9A 4CO0A 3I6PA 3GPAA 4J9PA 2VFVA 1S1TB 5A2QY 3FCHA 4DR4J 2VU5A 2ZNZA 4AL6A 3PX0A 2ZH9A 5AJ3F 4QIEA 3NWGA 4HVZA 2DNYA 1AXQA 4CI0B 1XR5A 1RHUB 5C42A 1IXKA 1NBEB 3KYLA 3EM1A 5M2UA 1UWAA 2QZ8A 4NLQA 1P6TA 2QYGA 1RXOB 1F2GA 4LF4J 2CPIA 2XNQA 4ETXA 2HFSA 3ZC4A 2Y1LB 4XAKA 2KT2A 1G7CB 2XLIA 5C24A 4A8KA 2G1DA 3GG1A 3UCGA 4WU3A 3TJ8A 3EZUA 3H90A 3MEDB 3ZNUA 3GJRB 4GVBB 4LRDA 3NOCA 1DJ0A 2GJFA 3U7JA 4I56A 1RAFB 3PACA 2EW9A 2DIVA 4NZ7A 1GNKA 2CFXA 4X4OA 4ZP6A 1JXVA 5HVFA 2AWZA 3EMTA 3A3PB 1Q8KA 5ETTA 4FYDA 4KPYA 3L7OA 2MLXA 1VK3A 4WPAA 2NREA 4JV0A 1QUVA 5D6GA 3DGVA 3P8BB 2E5LF 1H7WA 1NK5A 1Q8LA 4NLSA 1OIAA 4YN3B 4P74A 5IC4B 2LA6A 1Q0NA 3BGOP 3A4TA 2DNGA 5DLFA 2CPXA 3VAMA 4UOGA 3KDNA 3MTKA 1VRUA 2P2CB 1UVKA 2V9WA 1F3FA 4XDDA 3QAEA 3PEHA 1PIEA 7AT1B 2J8SA 1MU2B 4CYUB 3HT0A 2H65B 1QAIA 5HMXA 3K5LA 4Y2AA 5D0RA 1TUWA 4RW8A 2HNYB 3THVA 4Z7CA 3BSAA 2QMWA 2HZCA 2VG7A 5ETQA 2IDLA 5LMUF 2UUCJ 4USJC 3NGSA 1XMQF 1NAQA 2GMHA 1JNZB 1WC5A 4DR1F 1BC6A 3H25A 1DZ5A 3PFOA 1VQLS 4C9DA 4IRCA 4IR9A 2VIHA 1YDLA 2NSCA 3FZBA 4NEYA 4U9RA 1I5OB 3HKZD 3ZO7A 4YEAA 3IG1B 3TNVA 4YHHF 3AB2B 3FSIA 5D4PA 1SV5B 3ZTSA 2C3OA 1HWKA 5CYJA 2WONA 2IYIA 2V2VA 1X8DA 3U1MA 2D74B 4RW9B 2PFFB 1QE1A 2EFVA 4MMOA 4NA2A 1JLEA 4ZLNA 4PXCA 1YLXA 3DRSB 4PKDB 2VF3A 3D4JA 4Y65A 4ECZA 1NMEB 3MAAA 4C6AA 1M5KC 4NLVA 2EC2A 1WOPA 2BJ9A 3ENQA 1XWLA 3AH6A 3H2LA 2G4BA 2CJYB 1JLBB 4LFAF 2G2YA 4JI3J 3NOGA 1D09B 2FHOB 2FZCB 2V6AA 1WKLA 3CD5A 2C2NA 1IKXB 2O01C 2DXDA 1BE4A 4EU0A 2BRKA 2J9EA 3JXOA 4HLBA 1W7WA 3T1HJ 3SCIE 4M8LA 4TU8A 2OPPA 1TAUA 3HCXA 4IFYA 2YNFB 5T14A 1FJGJ 4WZQA 2A1BA 3PX4A 1U26A 1E6VB 4PPZA 2ADCA 2H51B 2LDIA 1GXUA 1VQMS 3PW0A 4RLEA 4UUWA 2AJQA 3TWZA 2YY3A 4TU7A 4DX7A 3JSYA 3R9LA 1HWLA 5IT0A 1Q79A 4NI2A 1VBXA 3DOLB 3K2YA 1YSJA 3KJNB 1Z1ZA 5F0UA 3OFGA 5EGYA 1RTDA 2OD4A 5LSLA 3OPKA 2F4VJ 3PJ9A 2QMUB 3HM9A 4C8OA 3N4WA 4M5MA 1U6ZA 3D6TB 5HP1B 2PEHA 3VWSA 2OPQB 3KG0A 4YR3A 5KFRA 4Q0BA 3TEHB 2YKNA 1VRTA 2Y3YA 1CJTA 1JQGA 2JEIA 3A8EA 4RW7A 1T02A 4NRTA 4RNNA 4OI4A 4K50A 3ZTRA 4ZLLA 4DU8A 2H3EB 3R6LB 4WP3A 2KDOA 3H20A 4OHWA 2LEBA 3BDEA 3DLEA 3W66A 4LF5F 1J2VA 3IAS9 5EWFA 5KG1A 3OL7A 3C6TB 3VGSA 4ER8A 4GKKJ 2V2ZA 3EGWB 3IS9B 1XERA 2YXLA 2K2PA 1KKHA 2R7TA 3M8ZA 4XO0A 2DXFA 4IRKA 8RUCA 3BYRA 1WC0A 4NCGA 2PE8A 1JX4A 2EVZA 4CO3A 3CCZA 5HSPA 2NZCA 2ADBA 3CUNA 2ZWOA 2MKCA 3HMJG 3EZOA 4LF8F 1IBLJ 5E3AA 3L09A 3QJLA 4NOHA 1HD0A 2Z56B 3HHNB 2MQ8A 2ZC3A 3Q83A 2C3MA 2IC3A 3FBFA 4PWUA 4EBCA 2GMJA 1GH8A 2XO7A 3DOMB 4OZ3A 2F3JA 3ZZYA 4D3HA 3AD9C 2DY1A 2GS8A 1I51B 4ELVA 4LSLA 2AW0A 1W25A 3MDFA 2QL9B 3EGZA 4RWWA 2OP5A 1CJVB 4OZ0A 3BQ1A 1IQZA 2VG6B 1U48A 3ETOA 3MCOA 2RF2B 1HNVA 2BW2A 1UA0A 2WB4A 4PRFA 2VC1A 3AXKA 4PYAA 1LW2B 5J2NB 4A8XA 2FUG9 1B64A 1RLDA 2XS5A 1HWUA 3MM7B 5KOXA 4OI1A 4CWBA 4IG0B 4H4KA 1VS3A 5L1JA 3QRQA 3W2VA 5KFTA 1HPZA 4ED5A 2HFZA 3KK3A 3CWJA 3QBCA 1J5OB 1K44A 2KN4A 2IJFA 1YBUA 2BANA 2Y1RI 2OMOA 2COLA 2EK6A 1HWJA 4BLGA 1W26A 4WFNQ 3C46A 3BKFA 3G8SA 4KKOA 3GP9A 1QUPA 3MPWA 4YB7A 3MEGB 4C3KA 1U1QA 5KFKA 1DTTA 1T03B 4ZITA 4K4VA 4Q44A 3H2VE 2VICA 4EFAC 1S1VB 1T0TV 4A48A 2JWNA 2D1CA 3VAKA 3CJKB 2QV6A 2XZDB 1RT4A 2EI5A 2YKMB 4HI2A 4N5SA 4I69A 1U1OA 1NJIT 2V68A 4I1TA 2IYGA 2O5DA 3VVUA 2KL8A 3HHLA 2ZH1A 1DHMA 1R6YA 5GAHI 1S72S 1HQUA 4OX9F 1RWXB 3SFGA 1TP7A 2NXNA 2VL1A 5I42A 2HZVA 2N4DA 4X84A 3M8SA 4JI5F 3N01A 2V8DA 3G9CA 4DHVA 1HBOA 2E1MC 2IBKA 1EP4B 1JLFB 1U1MA 4K2JA 1UEVA 1S6QB 4PABA 2LXUA 4UF4A 3M8PB 2PC6A 3TUZC 3KLFB 4TNOA 4EYHB 3DLKA 4L73A 4B3RF 1RT2B 1JMTA 2MZJA 2IIHA 4TKTA 4EBDA 1PJ5A 2IA0A 3JTOA 1SKSA 5B0DA 2RU9A 5DJBA 1Y3KA 3NNCA 4B3OB 3A1YG 1GK8A 2SXLA 2YPZA 1JWWA 4U6PA 1UL3A 3S8SA 5ADZA 4H4MB 1U49A 4DR5J 3N79A 1S79A 4V19X 2W8LA 4XPCA 2BKOA 1RKIA 3OR2B 1MMDA 4DR3J 4OYIA 1TL4A 1SC3B 1SL2A 1S5ZA 2YTCA 4RL1A 2ACYA 4FP9A 1FKOA 2D9OA 2M5YA 1WKKA 3JB9k 3IXQA 3TRGA 2FGCA 2Z2MA 2F40A 3LH2S 4F8RA 3RAQA 1SL0A 1N4LA 2F65A 2MSTA 3LUYA 4DPUA 2FJBB 2PD1A 2DIUA 4Q8EA 4UW2A 4FNIA 1N6QA 1VQ9S 4PEOA 3CPWR 2ASJA 2HRTA 3LTOA 2D3ZA 2MY7A 1KLNA 1LWXA 1PC4A 1VQ5S 2LQJA 2XLKA 4N8NA 3BKUA 4ES3A 4LFBF 3R7BB 3M30B 4V19J 1WHWA 2HHUA 2J0SD 2R2RA 3OD2A 3MI7X 1WD6A 4ZVPB 4U67Q 2DNKA 2QLFB 3RB0A 4O0IA 3OTCA 3KG1A 4J9OA 3NNAA 3THPA 1VQYA 2CJBA 1NU4A 1NKCA 4WP8A 1SJFA 1M90T 3BPDA 3PYFA 2KHDA 4UOHA 3CJ2A 1B0TA 2C3PA 4G1QB 3HK2A 3GJTB 5AXNA 3H7HB 4B17A 2VDIA 3VQSA 4OX6A 1X9WA 4KGKA 3JSMA 2IAJA 1BQMA 3CCWA 3QLHB 4MTPA 4I4BA 3CJ0A 1JLCA 1LWFB 4F4AA 2UU9J 3LP0B 3WDOA 4DQIA 2F9DA 2FB0A 3UDEA 4LSZB 3ZZPA 5B09A 1LK7A 5K8OA 1JK9B 2JFDA 2Y9HA 1RU2A 2ZJPQ 2XMAA 4QCLA 4JV1A 1AZSB 3CNQP 4ECWA 1T9UA 2LEAA 1TKZA 1RADB 1YTYA 3LPYA 2QA2A 3LAKA 4USHA 3V6JA 4RUBA 1JLQB 3B8HA 4CRJA 4PUOA 4KV8A 2IJRA 2JL9A 4PPDA 4CTAA 4HH1A 2P5VA 1XNQJ 3LGNA 2DH8A 1V5IB 4XK8C 4TYAA 4U7CA 4X4PA 1KBRA 1S9EB 4RNMA 4RNOA 3M2RA 1U4BA 4DV5F 3R2CJ 4JI6J 3D6HB 1UMJA 3PM9A 3OHBA 3M9OB 4PCQA 5J1EA 5BR8F 4NLTA 1WEXA 4J9RA 1U1NA 3M32A 1DTQB 3V4MA 4WXOA 4B3TJ 3DGPB 1MW7A 3OXGA 4DV4F 3SYZA 5F8MA 2B5JA 4WZMA 2OTJS 3KLVA 2OHDA 4JI4J 3P96A 1YWXA 4R5PA 2ZFHA 3V6DA 5LL6d 1VMBA 1PO6A 4LSNA 1DFDA 3FC9A 5JXSA 1NSPA 5KFHA 1IVZA 2XGQA 1RDRA 1IUJA 3CE8A 2AGQA 3RUBL 5CD4H 4LBHA 2GGPB 4IOBA 2WBMA 2J9DE 1X0FA 2HVZA 2K1RA 2M88A 4X65J 1RHJB 5DDPC 4FNHA 3I9V9 2CQ1A 2J7WA 2GO9A 2RQCA 4KHRA 2VFRA 1M1GA 2BE7D 1GT8A 4I2PA 1FD2A 3LA0A 2G1HA 5I3UB 1MLAA 3OHAA 3KLIA 4NPOA 3Q8YA 3IGNA 4N41A 3N0VA 5B7WA 2GVDA 2HHHF 2H5EA 4NZ0A 2I5JB 4ILRA 1FNMA 2YKPA 4DSKA 1B7YB 4NA1A 3R5BA 1ZAWA 5HVHA 3OR1A 2I1RA 3ZZZA 1BWVA 2IVYA 3K57A 1VQKS 2QRRA 2ALZA 2RH3A 2XM3A 5CQGA 3K5OA 1SJRA 5C5JA 2HURA 4TVAB 1U0HA 3ZZ0A 2VFTA 2HHQA 5A8WB 2AGPA 5IFMA 1TL3B 2DNMA 5E41A 2YWKA 2EFQA 1TV6A 4PR6A 5EUHA 5LT5A 2OELA 1NO8A 3SQOP 3VTIA 1PJ7A 3QNWB 1HARA 3HVWA 4A8OA 4AQYJ 3NXZA 1P1LA 1U0SA 4UQGA 4J90A 2HFVA 1EETA 4DPWA 3MXHP 4G3IA 3VZIA 3NCPA 2YNGB 4NX9A 2AJFE 2XULA 2AZ1A 1IBKF 4Z2XA 2OO4A 1HR0J 2V0NA 1N0VC 3GFZA 3CTRA 4DPOA 1TU0B 1N5TA 1GMWA 1HNZJ 1BXNA 3BH6B 5A0YA 2YWEA 2DBBA 3VAGA 1UJ5A 1ZA1B 2ZDOA 2J0QD 3PR4A 1WUUA 3K89A 2B6AA 3J81Y 2UUAJ 2MQPA 2ZOFA 3AOBA 1WG5A 1CJUB 2GHPA 3RRKA 2XYHB 1BY9A 5F9NA 4LF7J 1XTZA 1A0OB 3HVTB 2KZMA 5KAKA 2XMMA 4PYDA 4U7UK 2CJQA 3MM9A 3TZXA 5DETA 1OYEA 3ZZTA 2Q6CA 4O4GB 2J5AA 1JLGB 1UVNA 1D8ZA 2RHSB 2OSQA 3HI9A 3I56S 4NASA 1E6YA 1F5CA 3MUTP 4FBUA 2MTLA 4TXSA 4QWBA 1NPPA 5F8JA 3EWGA 1NSAA 5L9XA 2CJXB 1RP5A 4CLKA 3P5BP 1YIJS 3D1QA 2YKQA 1XEZA 1ITPA 4X64J 1LEOA 3OQ2A 4ZVUB 3HJFA 3AXMA 2LQBA 3MM6B 3KDOA 2FJDB 4XDCA 2HAIA 1XMOF 2VUGA 2VQFJ 1H98A 3SIPB 1N32J 3BM7A 4C97A 4WTOB 3D54A 3FRZA 4J9KA 1M1KT 2XLJA 2XSFA 5DRKA 3ZTQA 1N33J 5F8IA 4JV5J 3MCMA 5B0EA 2B0GA 1HI8A 4FF4A 1N0UA 1X5SA 2NXJA 3ET6A 3ENVA 1N34J 4J9UE 1RAAB 2HPUA 3CW2C 2B4PA 1RK8A 2XMJA 5JMNA 4F4XA 1RHKB 3M9MB 2F8EX 4DCOB 1TR0A 4CLTA 4M5JA 3R7SB 4M1KA 3CSKA 3MD3A 2KFNA 3FRYA 2R2SA 3VAJA 5D77A 4DV7J 2LXFA 1SH3A 4OI6A 1XJWB 2QJ3A 1UKUA 5DM6Q 1TKTB 1RHRB 5DDQC 2NXEA 1VGYA 3OVBA 3W5XA 3TQ1A 1OPZA 1KFSA 1AROP 1FX4A 1IKVB 4E8UA 2Z2ZA 3QO9A 4CLWA 1X9SA 2MJNA 1R0AB 1ZM2A 1U8WA 2MQOA 2UXCJ 4ZVHA 2Z4PA 4RBVA 5E3QA 2MKIA 1S6PB 2QX0A 3M2UA 3H8YA 4ZVGA 2LQ9A 4LRAA 4C48A 3OT9A 3TQEA 4RKUC 1S99A 4CLSA 1DBDA 2JLFA 5ETVA 1REVB 1AYEA 2FVSA 1WG1A 4F25A 1EX8A 5LMNJ 3PJWA 1LWEB 2DJWA 1VBZA 3W3SA 3HZEA 4DV3J 2DGWA 3Q8UA 1FDAA 1HNXF 3CO9A 3MR7A 1K47A 5LJ5Y 2M8HA 2WVCA 2K06A 4QWAA 4C11A 3TOQA 4X66J 3Q22A 4X2BA 2ZKTA 2UVWA 4ELTA 2MXYA 3HHDA 3EICA 3D3CJ 3GFXA 2RILA 2N3LA 1KVJA 1T9XA 1AT1B 1KFDA 1Q82T 2O66A 2Z8QA 3HXMA 2MKSA 5KG2A 2LDYA 3LP2B 2GQQA 1BHNA 3I87A 2DGSA 2RNEA 2YX4A 1U6FA 1GAOA 1QJHA 1RAOA 4OYAA 4DF4A 1EQ0A 3OUYA 4IG3B 4DUZJ 4DR4F 2RRNA 2DNNA 3RRGA 1V9OA 3HFZB 4QZVB 1AFIA 4H4OB 4BDPA 2GQCA 3C16A 4ECYA 1L3KA 3NBPA 4YQWA 4OZJA 1GTEA 3T1AA 4PWDB 4WP9A 3MCSA 4H4KC 1ZYQA 1NJZA 1M5SA 4K5RA 2M8DB 2QG9B 1FE0A 3OV7A 1S9GB 3SI8A 1VIOA 2H1YA 2MZ1A 4RNHA 1NK7A 2BE9B 1X5TA 3PKYA 5IWAF 3TAQA 4KHPF 1EKSA 3M8WA 3T6BA 2P9EA 1RT3B 2H5JB 3IRWP 4WIQA 2UUWA 1WF1A 1WORA 5ETLA 5JVGQ 3QGIA 4RO0A 2JNJA 4PG7A 1SKWA 1JJHA 2W8KA 4ED1A 1WHYA 4U96A 2W9CB 3F73A 1D1UA 3OL9A 2B9YA 3HZGA 2YNIA 2CVEA 5HN0A 4M63A 3OL8A 4KJIA 1C0UB 4JB8B 1RTIA 3BKTA 2VG5A 1T05B 2R3VA 4QR2A 1CQMA 4DR2J 3KHGA 3Q0AA 3VQTA 3WZ0A 2YNHB 3HO1A 4BCAA 4EUVA 3PG9A 2MGZA 1IKWA 2ZUAA 2UXDJ 2IY5B 4HDHA 3C66A 1R0BG 4KO0A 4DV1J 1RI7A 1APSA 2N82B 1PILA 1KTVA 2GVZB 1CSJA 3IN5A 3FQKA 5B0BA 1SJ1A 2ZM6F 3QAUA 2C2OB 3I4HX 5CYMA 3C6UB 1MROB 1HHTP 4PAAA 2Z57B 1R8AA 2VONA 1FRXA 3O1LA 1LKZA 2YX7A 4DPTA 1V5VA 1CEZA 3KXDA 5FD1A 1UVJA 5F8LA 3LGHA 4MFBB 1N36J 2RE1A 2CPFA 3CULA 4MK9A 3VALA 3S6EA 3B4MA 5T7LA 1FKPB 3RB3A 3BSNA 1M5HA 1X0PA 3MAQA 1F9EB 2DTJA 2DNRA 1CS4A 2UUBF 1RA7A 1RU1A 3C19A 3KK2A 1NUEA 3TJAA 3M2VA 5HVGA 4OLPA 1IWAA 2LEPA 3V2UC 9RUBA 4DFKA 3GIKA 2LU2A 2CPJA 4IH5A 3ADAC 2QE5A 3F41A 3QPIA 4W92B 1PKUA 5E5NA 3QIPB 4FVCA 1S1TA 3CDBA 2A6MA 4P9SA 2EKYA 1Y3JA 2ZVSA 3F56A 1I94J 1KLMB 3ITHB 2IDEA 4R0JA 1FNXH 2FZKB 4DX5A 3MTJA 2RRBA 2MKYA 2V69A 1R6VA 1QAXA 4GKJJ 1O5JA 2XMTA 2ABYA 3GYNA 5B0GA 1TK5A 3DHWC 4FZVA 4DLEA 4GVLA 3UDVA 4OFZA 4KRWA 1ZA2B 3RU0A 4USIA 2ALYB 2FLLA 4JI1J 3MEDA 4ECXA 3W60A 1KS2A 1D0EA 1RAEB 4LFCJ 3FZ2A 4OYPA 1Q78A 4NLYA 5D0EA 2OEMA 4C8KA 1ZTWA 2Y1IA 1XC9A 2CZVC 4JI3F 4LF1A 2HQ3A 4NLPA 1EARA 3QT6A 3AQOA 2AMCB 2HIYA 2ZBPA 3GLJA 1IKYB 4ECVA 5C24B 3T1HF 4ILMA 4AL7A 3QQCD 3W5ZA 5IT4A 3OW2R 3KJVB 4DL4A 2KU7A 3BR9A 5KFWA 1F2HA 1SC4B 2JRSA 1NXIA 5L38A 3R2DJ 3ZFVA 1LWCA 1Q5VA 2PMHA 2R8GA 4ED7A 2RDDA 3HF5A 2B7BB 2DY9A 4NLWA 4OYWA 3OLAA 1H6KX 4LBIA 1F3VA 1SB6A 2LQ8A 5JJBA 2AF6A 4WK3A 2B51A 5ETSA 2G9OA 2NLWA 3POTB 3CGIA 5ITHA 1JB0C 4OJGA 3OFHA 5F3ZA 1YJ7A 3UI3A 2XMKA 1QDUB 5U47A 3AJ2A 1FWPA 4OHXA 1X31C 3QT5A 4LR8A 4CYUA 3QJJA 2RHQB 5FLXY 2DT9A 2CQIA 1RWMB 5AXKA 3HSJA 2KKHA 4CLLA 5K8PA 2GFFA 2WSFC 2WW4A 3UQSA 3AAWB 1WNEA 2NYIA 4C0HA 4F4ZA 4NLGA 1ULRA 1C1BA 2IM1A 3EGNA 2YQ1A 4U8YA 2HWTA 3EGVA 5J2QB 3SQGA 4FVMA 1TK0A 4RU9A 2KJVA 3V6KA 5ETKA 4GKKF 1EAYC 1RCXB 2LFVA 4IUFA 5GAEI 4OMFG 2V5HG 2X1FA 1NZ8A 3TZYA 2YX1A 4OYBA 5BYQA 4F36A 1X7VA 4ZVFA 1ZBTA 5CYQA 1S1UA 2PDAA 4RW8B 2C3YA 4FF3A 3VV2B 2W24A 4NEZA 3R7NB 3IG1A 2VG7B 3B6BA 4B9VA 3DRXA 4EWTA 2DK2A 5HQLA 2AP6A 1Z4UA 2CQGA 1SV5A 4QIGA 4CO5A 1ZOTA 2ASDA 2Z58B 4F50A 1ZAXA 4LF9J 2HNDB 3CJRA 4OV1A 3QGPA 4QW8A 2FIUA 2ACMA 5AJ3J 1OO0B 2QLXA 3GYGA 4MYTA 2FY8A 3W61A 1HNWJ 4O3RA 5FDLA 3DMJB 3TARA 3UDCA 2DH7A 4QPTA 3TR5A 3MHYA 4LUBA 4OHVA 4I68A 3CCVS 1IKXA 3VHQA 3BREA 4P52A 4Z7YA 4R0EA 1JLEB 4I2QB 3WHIA 3NMRA 1C4AA 2YNFA 3QZ7A 2U2FA 1E6VA 4KIAA 4HKQA 3MAAB 3CCUS 2NR0A 2AJ4A 2QL7B 3IC1A 1HYSB 1PSDA 3IAM9 1NEEA 3ENAA 2IPOB 1ZM3A 2P9CA 2F4FA 1UFWA 3BQ2A 1KD1T 4ZA1A 4LR9A 5DQGA 3CDAA 4LRBA 2A6OA 4DF8A 1Z2LA 4F3MA 1ZTTA 2MSSA 2MZSA 1B4SA 2APOA 3CMES 3TUJC 3FSYA 3DRRA 2NPFA 4C3MA 3GCWP 1VQ6S 4E98A 3NS7B 5IT9Y 1S4FA 5KT6A 5E7OB 6AT1B 4AT1B 5HP1A 4DV2J 4YDXA 2OPQA 3DXSX 2VHGA 5D78A 3RW7A 3D6MB 5GAGI 2HSEB 4ZIWA 5HLFA 3G6XA 1GXTA 2H48B 4NI2B 4Y34A 2HEKA 2RSQA 1F1BB 3OTEA 2CUYA 1AB8A 1RTDB 2ZJRQ 3EDQB 4PG8A 2XO6A 1TFWA 1AW0A 3EPIA 3P3DA 3C14A 2A0FB 4WIIA 3BGUA 1Q8IA 1KONA 1G2EA 1C1CA 3HFVA 4Q0BB 3MCNA 2U1AA 2YKNB 1VRTB 1CJTB 2IBOA 4RW7B 2ZOMA 4L75A 1Y0HA 4K4XA 3T1YJ 1DQ8A 3JAMU 4YY3F 3TJ9A 2VV5A 5GVQA 2N7YA 3DLEB 1DLOA 4JUZA 1YJ9S 2F1FA 4C7QA 3D6FB 2CRLA 3Q86A 2PSZA 4K4SA 4YS2A 3MR5A 1VQPS 4F7VA 3H59A 5EWGA 4K4UA 2OPRA 3C15A 3AD7C 5DDOC 4P2MA 1H2UX 2XI2A 3N9UC 5HROA 2D41A 1G3OA 5L9NA 1RT5B 2GZOA 4DR1J 2VPXB 4A8MP 5J2MA 1U2FA 2BKPA 2OFHX 1R31A 4ZK7M 2FZGB 4LJMA 1VC5A 3DKDA 1X4EA
chains in the Genus database with same CATH topology
4DI6A 3EICA 1B99A 3BH6B 2DY9A 1NDPA 4F36A 3L7UA 2CWKA 1F3FA 3G2XA 3WX8A 1PAEX 1UCNA 1S59A 3FBCA 3BBCA 2HVEA 1S5ZA 3FBEA 1HLWA 3EJMA 3ELHA 4HR2A 3ETMA 5C7PA 4W98A 1K44A 5CAAA 3FC9A 3DDIA 1U8WA 3PJ9A 3GPAA 1F6TA 3B54A 3EVWA 1NSPA 3FBBA 3B6BA 1BHNA 3ENAA 1NSKL 3Q83A 3NGTA 4C6AA 5BXIA 2HURA 1JXVA 1WKJA 3EMTA 1WKKA 3FBFA 3ZTQA 2VU5A 4EK2A 1NPKA 2NCKL 2DXEA 2DYAA 1BUXA 3EVMA 3FCWA 3GP9A 3FKBA 1HIYA 2BEFA 2HVDA 3EVOA 3VVTA 2BX6A 1MN7A 4UOFA 4ANDA 1B4SA 1NCLA 3NGRA 3NGSA 1NUEA 1WKLA 3ZTRA 3Q89A 1NSQA 4ANEA 4FKYA 1VYAA 1BE4A 2DXDA 1S57A 4KPCA 3Q8VA 3EM1A 3EE3A 4UOHA 1XIQA 1W7WA 3Q86A 1ZS6A 1NLKL 3BH7B 1EHWA 4ANCA 4S0MA 4DZ6A 1PKUA 1XQIA 3VGTA 2AZ3A 3Q8UA 1MN9A 3MPDA 2ZUAA 3BBBA 3VGUA 5CABA 3ZTPA 3ZTOA 2B8PA 3FCVA 1NHKL 1LWXA 1NB2A 3VGSA 3JS9A 1NDLA 5IOLA 4WBFA 4DUTA 3VGVA 3BBFA 3Q8YA 4O0NA 4F4AA 4CP5A 2B8QA 2AZ1A 3VVUA 4FKXA 2DXFA 3PRVA 3NGUA 4ENOA 3R9LA 3ZTSA 1HHQA 1NDCA 3DKDA 4UOGA 1LEOA 1KDNA 1NDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI6 A;  3EIC A;  1B99 A;  3BH6 B;  2DY9 A;  1NDP A;  4F36 A;  3L7U A;  2CWK A;  1F3F A;  3G2X A;  3WX8 A;  1PAE X;  1UCN A;  1S59 A;  3FBC A;  3BBC A;  2HVE A;  1S5Z A;  3FBE A;  1HLW A;  3EJM A;  3ELH A;  4HR2 A;  3ETM A;  5C7P A;  4W98 A;  1K44 A;  5CAA A;  3FC9 A;  3DDI A;  1U8W A;  3PJ9 A;  3GPA A;  1F6T A;  3B54 A;  3EVW A;  1NSP A;  3FBB A;  3B6B A;  1BHN A;  3ENA A;  1NSK L;  3Q83 A;  3NGT A;  4C6A A;  5BXI A;  2HUR A;  1JXV A;  1WKJ A;  3EMT A;  1WKK A;  3FBF A;  3ZTQ A;  2VU5 A;  4EK2 A;  1NPK A;  2NCK L;  2DXE A;  2DYA A;  1BUX A;  3EVM A;  3FCW A;  3GP9 A;  3FKB A;  1HIY A;  2BEF A;  2HVD A;  3EVO A;  3VVT A;  2BX6 A;  1MN7 A;  4UOF A;  4AND A;  1B4S A;  1NCL A;  3NGR A;  3NGS A;  1NUE A;  1WKL A;  3ZTR A;  3Q89 A;  1NSQ A;  4ANE A;  4FKY A;  1VYA A;  1BE4 A;  2DXD A;  1S57 A;  4KPC A;  3Q8V A;  3EM1 A;  3EE3 A;  4UOH A;  1XIQ A;  1W7W A;  3Q86 A;  1ZS6 A;  1NLK L;  3BH7 B;  1EHW A;  4ANC A;  4S0M A;  4DZ6 A;  1PKU A;  1XQI A;  3VGT A;  2AZ3 A;  3Q8U A;  1MN9 A;  3MPD A;  2ZUA A;  3BBB A;  3VGU A;  5CAB A;  3ZTP A;  3ZTO A;  2B8P A;  3FCV A;  1NHK L;  1LWX A;  1NB2 A;  3VGS A;  3JS9 A;  1NDL A;  5IOL A;  4WBF A;  4DUT A;  3VGV A;  3BBF A;  3Q8Y A;  4O0N A;  4F4A A;  4CP5 A;  2B8Q A;  2AZ1 A;  3VVU A;  4FKX A;  2DXF A;  3PRV A;  3NGU A;  4ENO A;  3R9L A;  3ZTS A;  1HHQ A;  1NDC A;  3DKD A;  4UOG A;  1LEO A;  1KDN A;  1NDK A; 
#chains in the Genus database with same CATH topology
 4DI6 A;  1CJV A;  1RAH B;  4DJB A;  3TA1 A;  4MKA A;  2KFY A;  2RF2 A;  2XBP A;  3FBE A;  4DR3 F;  4LT6 A;  2IC3 B;  5J2N A;  5KFP A;  1NND A;  2FC8 A;  3PX6 A;  5L1I A;  5D8H B;  4M5G A;  5E2Q A;  2RB7 A;  3GE9 A;  4P2S A;  4LSL B;  1SQG A;  2HVH A;  2CVI A;  4KB7 A;  4M5D A;  2OSR A;  1LFP A;  3BB5 A;  3M8Q A;  1J5O A;  2DNH A;  1HQ2 A;  2FDN A;  4LFA J;  1HNV B;  1U24 A;  3G82 B;  3J7Z 5;  4KBI A;  4ILL A;  4X4T A;  3ILO A;  3O8W A;  3KUE A;  3CT9 A;  1N54 B;  3E51 A;  3W2W A;  1RTH B;  1T03 A;  1BMQ B;  3W2V B;  3AD8 C;  4HYK A;  2RML A;  3KK3 B;  4HT7 A;  3I32 A;  5HK4 A;  2ZH6 A;  2RDJ A;  1S1X B;  4DR7 J;  1X4A A;  4EYI B;  3LO3 A;  2PA3 A;  2YKM A;  4YB6 A;  1A9N B;  4YOE A;  4M95 A;  4YDD B;  2BAN B;  2K7K A;  4A4J A;  2XI3 A;  2XQC A;  2X51 A;  1XR6 A;  4NYZ A;  5D4O A;  1JLA B;  1TQL A;  2EG1 A;  2RAQ A;  3KHR A;  5CH7 B;  1DTT B;  2MHN A;  3SSS A;  1C4C A;  4NXM F;  1A7G E;  3D7S B;  3N6L A;  3GMG A;  1RT4 B;  2W4P A;  1PJ6 A;  2V4J A;  9ATC B;  4DS5 A;  3EUN A;  4OHZ A;  4WCE Q;  1KVI A;  2YKO A;  2FHJ D;  2E7V A;  2W2O P;  1NB2 A;  3R6G B;  3M8P A;  1HQU B;  4ZN3 A;  4LF5 J;  2R8H A;  4ZVQ B;  1Q5Y A;  4FKX A;  2POK A;  5D4L A;  1SJ3 P;  5I42 B;  5B0A A;  5EX3 A;  1RT2 A;  4Q2L A;  5DQI A;  2FJW A;  1KDN A;  2UU9 F;  2ZEJ A;  4HHH A;  4A8Y A;  1WEL A;  3N5B A;  2CIM A;  2ZH3 A;  4HTI A;  2Y0B B;  3M6U A;  2W25 A;  4XIU A;  4F2R A;  5GAD I;  3CD0 A;  3Q8Q B;  1S4E A;  2GX8 A;  5KFM A;  1GTH A;  1GEH A;  5KG0 A;  2C2D A;  2EPI A;  3SCJ E;  3NAI A;  2HWI A;  5MAO A;  3DDI A;  4AL5 A;  1T3O A;  2JVR A;  3AQP A;  2VQE J;  5EHH A;  3FQL A;  4B9L A;  2ZC4 A;  3J80 U;  4LF8 J;  1YBT A;  2BKN A;  5IZH A;  4H4M A;  3MEC B;  3GCX P;  4M5K A;  3ZXW A;  3PEJ A;  3PW5 A;  2MYF A;  1BUX A;  1NPR A;  3DCA A;  2L9N A;  4OJH A;  1EJ7 L;  1FRK A;  1XNQ F;  1P8G A;  2HK2 A;  2J6U A;  1B7F A;  1M0S A;  2HQF A;  2F8H A;  3PZP A;  4HDG A;  4ZIV A;  2WBR A;  3UD4 P;  1VDH A;  5HO4 A;  5L8R C;  3O6Q A;  3E2E A;  4ZLP A;  2QLB B;  4ZDN A;  1TEL A;  3PRV A;  1QTN B;  4AXI A;  3ZZO A;  1L3U A;  3PW7 A;  3FFI B;  3BYP A;  4CO4 A;  1CQN A;  3W9H A;  1HMV A;  3MMA A;  1FKO B;  5KFA A;  4JI4 F;  5HL7 Q;  1IWG A;  5J1P A;  3TA2 A;  2DIT A;  3KNG A;  5CXT A;  2RQ4 A;  1FHT A;  2HBR B;  5CCL A;  3SV4 A;  2HFN A;  1FTC A;  2KT3 A;  1F9H A;  2RKI B;  3PO5 A;  1XBW A;  2MMY A;  2PII A;  2QGF B;  5F8H A;  2E1R A;  1XR7 A;  2DGX A;  3K8V A;  3UD5 A;  1RT6 B;  1PBA A;  1YJV A;  2CQP A;  5L46 A;  3V4I B;  3MGJ A;  4M5I A;  3GQC A;  5A8K B;  2ZBQ A;  3BPS P;  4EMD A;  1RSC A;  2HMI A;  1FFW B;  4NCB A;  4QWC A;  2UVV A;  1KN6 A;  1TL7 A;  5A8R A;  1S6U A;  1OY6 A;  2DH9 A;  2C1E B;  1RBO B;  3HDS A;  3JQJ A;  2CNL B;  2PN6 A;  3IBC B;  5E0O A;  1VJQ A;  1RT1 A;  5A6W A;  1VBK A;  3FVY A;  3ILL A;  1SH2 A;  2V94 A;  3CCL S;  3FNN A;  3C3L A;  4OJ3 A;  4OX9 J;  1FDB A;  5D0G A;  2GO8 A;  1LWF A;  4UY8 T;  4ZVO B;  5BJR A;  2R8K A;  5GMK a;  2KO1 A;  3CMA S;  3MUV P;  3JQM A;  4JI5 J;  1WG4 A;  3K8W A;  2X1B A;  4UTG A;  2FVC A;  1SCJ B;  3NCR A;  1S0V A;  3UCZ P;  1PCA A;  1HL6 A;  2O67 A;  2V2Q A;  4ANE A;  4ITS A;  3DLB A;  1S57 A;  1Y9O A;  4O4R A;  4DL0 C;  3MPY A;  1H38 A;  1HBU A;  1Y7P A;  1VBY A;  5I4M A;  3JSM B;  2IAJ B;  5T41 A;  4B3M J;  2E9T A;  1JLC B;  1JLQ A;  2RUG A;  1N52 B;  3H5Y A;  4NMX A;  7FD1 A;  3FEX B;  1BWE A;  1QSS A;  2OEJ A;  2J6T A;  5DZ6 A;  3LW5 C;  4R8U A;  3G71 S;  2WTF A;  3RAX A;  2BQR A;  2CXE A;  2JEF A;  5DG7 A;  5KT5 A;  3D0I E;  4JI7 J;  4DSI A;  3I0R A;  4ED8 A;  3UCU P;  1HR0 F;  1B0V A;  1NDP A;  1RBL A;  1TKZ B;  2B7C B;  5A76 A;  4ZHR B;  1PC5 A;  2V9K A;  3PYG A;  4Y3C A;  4EO8 A;  2ZVI A;  3QGH A;  1VLY A;  4KV8 B;  3MF5 A;  4RJV A;  4OYO A;  3S01 A;  5LXY A;  4CTA B;  3DM2 A;  3R3T A;  1O51 A;  5IM0 B;  4DR6 F;  4DCJ B;  1YJU A;  3MFH A;  4HT5 A;  3DLH A;  5HAN A;  4Y6I A;  4HAC B;  1HIY A;  2B4V A;  4LF7 F;  1UVM A;  3P6Y C;  2BOP A;  1Q7Y T;  2AU0 A;  3G6Y A;  1Y00 A;  3IFE A;  2DPI A;  2MQN A;  1KP6 A;  2JSX A;  5J1E B;  3DN9 A;  2MPU A;  1FFG B;  5CAB A;  4Q43 A;  2VBY A;  3M32 B;  2E5H A;  2GGP A;  2J7U A;  3NP5 A;  1S9F A;  3V81 A;  3OXF A;  4DLG A;  1RTJ B;  3V5R A;  3N6N A;  3VGV A;  5H1S V;  2B5J B;  4M94 A;  1NJX A;  1FWK A;  2Q79 A;  4R5P B;  4W90 B;  3V6D B;  4DN9 A;  4J37 A;  2YWH A;  5HAT A;  2OKQ A;  2W9B A;  4X64 F;  2IRU A;  3BO3 A;  2XB2 D;  1ELO A;  2KG1 A;  3JSR A;  1UCN A;  4DN0 A;  2JC1 A;  2BW7 A;  4EGL A;  2P8I A;  2AJ1 A;  5KFS A;  4LFB J;  4OZL A;  4OIX A;  2VQF F;  2LXI A;  2P9G A;  5KFX A;  4CQ1 A;  1HBM A;  1EIY B;  4FPR A;  1N32 F;  3X1L B;  3T3F A;  2G0C A;  2K1R B;  2FHK A;  1K8A T;  2GJI A;  3RR8 A;  1DAX A;  4JV5 F;  2VC0 A;  1WC6 A;  3W1Y C;  2CPZ A;  4DV0 J;  1UZD A;  4LQ9 A;  4CH1 A;  4IYQ A;  4HL9 A;  2EEY A;  5CD4 A;  1N34 F;  1OQ3 A;  4CLU A;  2GAH C;  4NE9 C;  1S7H A;  4X4S A;  3JSB A;  3UN3 A;  4MKV A;  3S7R A;  5D15 A;  5KT3 A;  2MB0 B;  3VGU A;  3G8Q A;  5A8W A;  4CLY A;  2GVD B;  4LVO P;  4TLQ A;  1TL3 A;  2G0I A;  2XC9 A;  2HGN A;  2CQ3 A;  2J8A A;  1TK8 A;  1HHS A;  1T9Y A;  3JQK A;  1T3N A;  5C25 B;  5A2Q U;  4Y2M A;  4DUY J;  2VDH A;  2HQI A;  1LNQ A;  4PQA A;  2DNL A;  5LM7 E;  4YP3 A;  4U7U D;  3EJM A;  1RBA A;  3UE2 A;  4CH7 A;  5HBM B;  1IBM F;  1DRZ A;  4WYW A;  3BF4 A;  1U0H B;  2IJN A;  2C22 A;  1F6T A;  4FYX B;  2YNG A;  3RW6 A;  2HG4 A;  3QRP A;  2WOM B;  4ZPD A;  2M3D A;  3RRH A;  2DNZ A;  2VPY B;  2OTL S;  1WOS A;  1TV6 B;  2V8G A;  1VOM A;  3RJM B;  3SFU A;  1FVS A;  4B9M A;  1YHQ S;  4Y28 C;  2VFU A;  3IR6 B;  2DKO B;  3SSQ A;  1PAU B;  4P7T A;  3NWR A;  2HGL A;  2QMX A;  3GFY A;  1EET B;  1CJU A;  3FJ2 A;  1FRI A;  4DV3 F;  4P71 A;  4EO6 A;  4DV5 J;  4USK A;  5K8N A;  3HPO A;  2EC0 A;  3C8Y A;  2C42 A;  2OML A;  3GIR A;  3P49 B;  2B9W A;  3I96 A;  1UFK A;  1UP1 A;  4ECU A;  2J6S A;  4K4T A;  1JLG A;  4JI0 J;  2Y1J A;  2F9J A;  4ZPC A;  1WHX A;  3BBC A;  1SC1 B;  2HVE A;  1TTH B;  1BQN B;  1KR4 A;  3AOC A;  1O6X A;  1MML A;  5ETN A;  1R8B A;  2ZJQ Q;  2AHO B;  1VI7 A;  4I7F B;  4HEA 9;  2QA4 G;  4GC7 A;  2HNZ A;  1L5U A;  3RR7 A;  3MM9 B;  3DU6 A;  4OX7 A;  4DFP A;  4DUZ F;  4PWW A;  2GIF A;  2I6W A;  3CJT A;  4B3S J;  3TYT A;  1E6Y B;  2CDQ A;  1SL1 A;  2DGV A;  4ZJO A;  2CG4 A;  1FEE A;  4ICL B;  1FFS B;  4MH8 A;  3G8T A;  4DSJ A;  5KFY A;  2E5J A;  1HBN A;  5KG7 A;  2HBQ B;  3PJX A;  5CHC B;  2VKR A;  4YR2 A;  5GAH U;  2RQM A;  3KUG A;  1RCO B;  1N5Y A;  1S0N A;  2KM8 C;  1NDC A;  5HMW A;  1CBK A;  4QIW D;  2A10 A;  1OJ4 A;  1HNI A;  2M7S A;  1WDT A;  4ZLJ A;  3R1H A;  3NRB A;  3UD3 P;  4IO9 Q;  1Q81 T;  4FYW B;  4DQQ A;  1U1K A;  1NSK L;  2UVU A;  2E9R X;  1P1T A;  4EK2 A;  2HLT A;  3ET6 B;  2LCW A;  2OPS B;  2CQD A;  4JYA F;  2JZ5 A;  1NKE A;  1LQ9 A;  5DO2 A;  1RHQ B;  2DR5 A;  3KHL A;  2GML A;  3OL6 A;  1XNR F;  2J9D A;  1R0A A;  2XG8 A;  2WZ1 A;  4ED4 A;  1NKB A;  2MDA A;  2PT0 A;  4K7Q A;  1XQI A;  1S6P A;  1WF2 A;  2CPD A;  3OSN A;  2VB6 A;  3H2U B;  1FDN A;  2ASL A;  2RS8 A;  2BXJ A;  4P2F A;  3VR1 A;  2V8H A;  4L3K A;  1DQA A;  1WI6 A;  3G4S S;  5ETP A;  4DV1 F;  1ZET A;  4BC7 A;  4A8F A;  3MM8 B;  3VZH A;  4NCA A;  3TI0 A;  2HHX A;  2VAS A;  1C0T A;  1UVL A;  3M6X A;  2ZNY A;  2JLG A;  4KSE B;  4WFB Q;  3KOA A;  2HRY A;  3IGV A;  4CLF A;  3K0J A;  2M9K A;  1N36 F;  4LF6 J;  3BGL A;  4M5H A;  2N3O A;  2DYA A;  2ZE2 B;  4NA3 A;  2CJK A;  4IDK A;  1KQK A;  4DEZ A;  2R2T A;  2CQ2 A;  4FKY A;  4AYB D;  4OZ5 A;  4IRD A;  4AFF A;  1RZM A;  2DGU A;  2NYH A;  1D8Y A;  3I0S A;  3A13 A;  2W2Q P;  1YBA A;  1WC4 A;  4NWB A;  3BN4 A;  2N7C A;  2QSF A;  1RWN B;  4IG3 A;  3TX0 A;  4WXW A;  2WRM A;  1I94 F;  3GV5 B;  5FJ4 A;  2HHS A;  4K59 A;  1F5A A;  2X3G A;  4QR0 A;  1MWZ A;  4YB5 A;  3VAF A;  1UVI A;  5DS7 A;  2UV8 A;  2DR9 A;  4GKJ F;  5AE2 A;  4ES1 A;  1R27 B;  4WE1 B;  4CLP A;  1H7X A;  2KI2 A;  5KFJ A;  5KG4 A;  5L1K A;  4K4Z A;  1NJW A;  1TVR A;  3IR5 B;  2VJV A;  3RBE A;  1KC8 T;  3OUY B;  2Z30 B;  3MMC A;  1KTQ A;  5KFU A;  5L1L A;  4JI1 F;  5LXR A;  3C16 B;  3PW2 A;  2RRA A;  3NBP B;  4ZP9 A;  3R5J B;  4LFC F;  4PQU A;  3UW1 A;  4QYZ J;  1VHF A;  1NSQ A;  3RB6 A;  4MIB A;  3MMB B;  3FEY B;  1T8E A;  1UWB A;  4USW A;  2AGO A;  4UST A;  3D0G E;  3QWP A;  4P2X A;  2N4C A;  3BBB A;  3B4D A;  2W9C A;  2F5G A;  1FRL A;  2HBZ B;  4C8M A;  3WBZ A;  2DGQ A;  3FGV A;  3W7B A;  2QSW A;  2JX2 A;  3R8Y A;  2XCP A;  2XYP B;  5GMD A;  5J1N A;  3OTO F;  2L9D A;  2YNH A;  3KUH A;  4KH1 B;  3SMZ A;  3LPE A;  1H73 A;  4OYX A;  1S0O A;  1KNZ A;  1WSV A;  4F0M A;  2E29 A;  1RAC B;  4K0K J;  2GVZ A;  4ZCM A;  5B08 A;  5KFV A;  2CNN B;  1R89 A;  3MM5 A;  1YRT A;  2YNI B;  2ZBR A;  4JI2 F;  2ZKU A;  2UXB J;  1Y4Z B;  2LA4 A;  1RTI B;  3IP0 A;  2OGU A;  2VG5 B;  2YVS A;  3PHE A;  3H5U A;  4B9T A;  4P72 A;  2QYC A;  4EZ9 A;  4F4W A;  2HBY B;  2XSJ A;  2R7U A;  2NXU A;  2MGZ B;  3FDS A;  4BWJ A;  1Y11 A;  1DQ9 A;  3T41 A;  2FVP A;  4FYY B;  4MFB A;  2MJU A;  4ECS A;  4FF2 A;  1QLN A;  5E3C A;  5KFC A;  4KO0 B;  1N88 A;  4L3N A;  2ZWP A;  5M2R A;  1UZH A;  1RT7 B;  2HRU A;  1FKP A;  4D3G A;  4IR1 A;  2CJ9 A;  1PBU A;  2G2O A;  2JOQ A;  5CYM B;  2GA7 A;  5K14 B;  2KZZ A;  4YME A;  4RW6 A;  1GFW B;  4Q45 A;  3CO0 P;  8AT1 B;  2W7P A;  3LF0 A;  1X4F A;  4ZP8 A;  2HGM A;  1S59 A;  1KLM A;  3ITH A;  2YBV A;  4HR2 A;  1PG5 B;  3ETM A;  4ZPA A;  2DCU B;  1EKR A;  2KB2 A;  3PRD A;  5T7L B;  3IM9 A;  2D9P A;  3CJ8 A;  1SUQ A;  4F67 A;  3KK2 B;  3M2V B;  3QMQ A;  4TY9 A;  2P6T A;  1FDD A;  2C2E A;  3KMQ A;  3EVO A;  1RWO B;  3D9B A;  2CQ0 A;  3PR5 B;  3PO4 A;  5C2C A;  2W2M P;  4LF9 F;  5RUB A;  3CD6 S;  5IC6 B;  3HSZ A;  3RTV A;  5KG3 A;  3VAH A;  3DDN A;  3G96 A;  3BGR B;  1NB7 A;  3OXL A;  4DG1 B;  1HNW F;  4J91 A;  5KOW A;  4ID5 A;  2HYI B;  5DGB A;  4LR7 A;  2DCL A;  4P7V A;  1XN9 A;  1I6J A;  2E66 A;  3FK4 A;  4DQR A;  2YH0 A;  4LIW A;  1CJK A;  2HQC A;  5E3P A;  1IKY A;  4C8L A;  3LP1 A;  2DIS A;  1RWP B;  1FRH A;  3TW0 A;  2Q66 A;  1PAE X;  5IWA J;  3BS9 A;  4F0K A;  2MHE A;  3PCO B;  1ZZF A;  3KJV A;  2B9E A;  4KHP J;  5F9L A;  2FC9 A;  1QSL A;  2JHE A;  1ZAV A;  2DVI A;  1DY3 A;  4DV6 F;  3OFF A;  4KT0 C;  1B70 B;  5ETO A;  1FK9 A;  1QY7 A;  3CB4 A;  2MQM A;  3SDE A;  1S7I A;  3TAN A;  2M2B A;  2ZZN A;  4FS2 A;  2ZHO A;  1BQX A;  3D28 A;  3H5X A;  4RPF A;  1YI2 S;  2R2U A;  1L3V A;  1YZ7 A;  4LMZ A;  2DD8 S;  5F3T A;  3NAH A;  3POT A;  3BH7 B;  1EHW A;  2JEG A;  1U7L A;  1WC1 A;  2HVI A;  2BM0 A;  2KRR A;  8ATC B;  2AJ0 A;  2B8P A;  4AD6 A;  4DV2 F;  1V6H A;  1UAW A;  2JVO A;  1LWC B;  3AOD A;  2XZT B;  3BN7 A;  5J2P B;  4LIR A;  1NK0 A;  1YJT A;  2PMW A;  4P75 A;  1KOH A;  3DLJ A;  1JXL A;  2MQL A;  2AX0 A;  2W7A A;  1PYO B;  2LU1 A;  1OPI A;  2O1P A;  2ZM6 J;  2BUN A;  1CUL A;  2R7O A;  1QD1 A;  3ICL A;  5C7P A;  3RBZ A;  5J2Q A;  4C4W A;  4RW4 B;  3O3L A;  2VZ9 A;  2HKE A;  3MEK A;  3TAM A;  2C28 A;  4X62 J;  1R8P A;  3K5P A;  4Z37 A;  1X4G A;  1VC0 A;  1UJ6 A;  1W2I A;  4KHM A;  3NG8 A;  4DFM A;  1GXL A;  3T1Y F;  2QFJ A;  3R5D A;  1T11 A;  3DYA B;  2CKW A;  2OAU A;  1C1B B;  3MZI A;  2UUB J;  3QT7 A;  1MG7 A;  2AZ3 A;  2VOP A;  3SQG B;  3DI6 A;  1SKU B;  1YRU A;  1OS5 A;  5KFO A;  3TVY A;  4DU7 A;  1GMW D;  4GRS A;  4F02 A;  5EN1 A;  3BBF A;  4I64 A;  2BZ2 A;  1TKX B;  2HND A;  2K8G A;  4CIO A;  1X5O A;  1U09 A;  2CNK B;  3K59 A;  2BVZ A;  4CT9 A;  1W2B R;  5CYQ B;  1S1U B;  4OLO A;  1RJJ A;  3NY0 A;  1L3S A;  3FMW A;  3G2X A;  3TA0 A;  3DMJ A;  3ULH A;  4TU9 A;  4ALZ A;  1TMJ A;  3OJU A;  3NKY A;  3MUR P;  1FI4 A;  3KFW X;  4ERD A;  3D67 A;  3T5L A;  1IBC B;  2CDR B;  4P10 A;  2I2Y A;  3A3N B;  1RWU A;  1HWI A;  1N8R T;  2ZH2 A;  1R3N A;  4O44 A;  2R4F A;  4C8Y A;  4I2Q A;  5CCM A;  3CCJ S;  3FMB A;  4O3P A;  1HD1 A;  4PXD A;  3HHE A;  4C98 A;  6FDR A;  3DOK B;  1KRP A;  1IN0 A;  4J9L A;  3RZA A;  4CT8 A;  3SZ2 A;  3E01 A;  1T7P A;  4IFV A;  3ZZU A;  5FDL B;  2E7W A;  2V8P A;  1HYS A;  3LWL A;  2UUT A;  4B9S A;  2KTQ A;  3KLG B;  2GC8 A;  2C2K B;  4MK8 A;  1RUS A;  2AEF A;  3OVA A;  4WFZ A;  5DG8 A;  2R8I A;  1Q95 G;  1D9A A;  5JUM A;  4DMZ A;  1HHQ A;  1B3T A;  3TUI C;  4N77 A;  4ETZ A;  4MYU A;  4CNY A;  2E9Z A;  1RAG B;  3W9I A;  1OMS A;  2KT5 A;  4DR7 F;  1M5V C;  2KM8 B;  4TY8 A;  2ZBI A;  2KVI A;  1QAJ A;  4C0O C;  5HQM A;  2ILZ A;  4QYR A;  4E2F B;  4NXN F;  3Q8R B;  1RIS A;  5KT2 A;  2L48 A;  4X4R A;  2CQB A;  2DXE A;  2HQD A;  4X4N A;  3CIM A;  1SJ4 P;  1UET A;  2QA1 A;  3FKB A;  3DRR B;  1S1W B;  2KJW A;  3M1V A;  1ICE B;  3T19 A;  1VYA A;  1JKH A;  4WF9 Q;  4ANC A;  3HUL A;  2ROE A;  5G0R A;  5HLF B;  3MFI A;  3CVK A;  3OJS A;  4PXB A;  3H98 A;  5ETR A;  4ED3 A;  2QLJ B;  2EK1 A;  1U1L A;  4FYV B;  3CMQ A;  5K9F A;  3UR3 C;  2BMB A;  3LOU A;  4CM0 A;  2NUH A;  2MZR A;  3C14 B;  5IXU A;  1G6B A;  4G6V B;  4ID8 A;  3HX9 A;  2HHV A;  1NK9 A;  1QAY A;  1IJE B;  2AEJ A;  4URQ U;  1JJ4 A;  1C1C B;  1HLW A;  4W98 A;  4LRC A;  1RT5 A;  4KQZ A;  2ZHA A;  2DHX A;  3T9Z A;  1TUV A;  3G86 A;  1ZH5 A;  2KH9 A;  4QBU A;  3RB4 A;  1LK5 A;  2UZA A;  2VQE F;  1ZPV A;  4L6V 3;  3KLH A;  1TZ0 A;  1DLO B;  2WB1 D;  3Q23 A;  4KAI A;  4I6W A;  4DXL A;  4MJK A;  2RQK A;  2I38 A;  3Q24 A;  3DLG B;  2KHC A;  5KFF A;  3TAP A;  3KK1 A;  2AX1 A;  1TAQ A;  2F8M A;  2OPR B;  3C15 B;  3DNC A;  4NLO A;  4WWS A;  3HVR A;  1U1R A;  2B4U A;  1NK8 A;  3IRX A;  1OY9 A;  5HRO B;  1K0T A;  2DEI A;  3H5S A;  3GIL A;  3VCD A;  5J2M B;  1CPZ A;  2ZD1 A;  2WHO A;  5KFN A;  3MEE A;  3O5T B;  2H9Z A;  4DUT A;  3GR1 A;  3M8R A;  1K9M T;  1NH8 A;  1T94 A;  2VOO A;  5E3R A;  1D3W A;  1X5P A;  3GV7 B;  2YKA A;  2CPY A;  1IR2 A;  2BE2 B;  4MIW A;  2CWK A;  3G82 A;  2ATC B;  4OL8 A;  3GIJ A;  3PFE A;  1SH0 A;  1SKR A;  1UFL A;  4QJV A;  3UVJ B;  3MR2 A;  5FII A;  1RWK B;  5THW A;  1J5E J;  2DHA A;  2QO3 A;  4FBT A;  3MD1 A;  1RTH A;  4ED6 A;  2ZUG A;  1N56 A;  2AD9 A;  1K0V A;  5GME A;  1KHV A;  3DDK A;  5D3G A;  4BS2 A;  4M5N A;  4M5D B;  4WU2 A;  2ZDP A;  2XY6 A;  3B78 A;  3HKW A;  1S1X A;  4IQM A;  1VCT A;  4MAK A;  3M8Q B;  4UZC A;  3N28 A;  4LF2 A;  2BRL A;  3EZ5 A;  2IFX A;  1WAC A;  2RT3 A;  3N5F A;  2BQU A;  4LF4 F;  3JTN A;  4JI8 J;  1YG0 A;  1CC8 A;  4DPY A;  1HQE A;  1U6B A;  3IR7 B;  5IV4 A;  4IO1 A;  4DFJ A;  3KLE A;  3EE3 A;  1YIT S;  3QSY B;  3GII A;  3MOJ B;  3RAM A;  3HSG A;  4DZ6 A;  3BV8 A;  1JLA A;  3DRP B;  1FO1 A;  2JEJ A;  1P27 B;  1YK9 A;  1VIS A;  3CIZ A;  3KJF B;  5DLG A;  1JNR B;  1FD8 A;  4OZ1 A;  3W2W B;  2WVD A;  1NDL A;  3MPU B;  2A3J A;  2FVQ A;  3J81 U;  3ENW A;  1URR A;  4QW9 A;  3NGU A;  2I0X A;  5KG5 A;  3HP6 A;  2HFU A;  2DGO A;  4URS A;  3L7U A;  3M05 A;  1IR0 A;  4KYZ A;  3J81 j;  1CG2 A;  4Y2C A;  3GB0 A;  3NNH A;  3H40 A;  1UJ4 A;  1YJW S;  4DSL A;  1G1X A;  5KFI A;  2V67 A;  4OYM A;  1IJF B;  3TZW A;  1K1S A;  2X3D A;  5CA5 A;  2FYX A;  3HHL C;  4GMK A;  3JYT A;  1OYD A;  1DUR A;  3BGF A;  4EEY A;  2V4J B;  4DQS A;  1H72 C;  4KFB A;  1QM9 A;  2MY8 A;  3D0H E;  1FVQ A;  1MMN A;  3I5A A;  1WTB A;  4YY3 J;  1S49 A;  4GO5 X;  4G1P A;  2XWY A;  2BJ1 A;  4JP8 A;  2XEX A;  4B3M F;  3MEC A;  2EFO A;  1V3S A;  4A8S A;  2X7I A;  3G6E S;  2EBE A;  4ZS6 A;  1CVJ A;  1TL1 B;  3W9J A;  2QTW A;  4QU7 A;  1LW0 B;  2FLO A;  3HVA A;  4PG5 A;  2X1A A;  3TEG A;  4K8R A;  4JI7 F;  1VFJ A;  4J9N A;  4C3L A;  3D68 A;  4PG6 A;  2PA8 D;  2IVM A;  2UUC F;  3CJS A;  4M5L A;  2QLW A;  3AOA A;  3FFI A;  4GC6 A;  1LXN A;  5EWE A;  1SIW B;  2MKJ A;  3ISN C;  2MLZ A;  1VLO A;  3GSD A;  4UT4 A;  3CC4 S;  2ZH5 A;  1QVF R;  2HK3 A;  2RKI A;  2GV1 A;  2R7X A;  2YWW A;  3FCV A;  2KXN B;  1WF0 A;  3NS6 A;  3ILI A;  4UUX A;  5I3Q A;  2YPY A;  5LSO A;  2D69 A;  3O2I A;  1RT6 A;  3M9N B;  1VK8 A;  4I0W A;  3F0N A;  3V4I A;  4ENO A;  3THT A;  1HMV B;  2XHW A;  3MMA B;  1Q86 T;  2DGT A;  4KR0 B;  5A8K A;  1ACM B;  4GVB A;  4QYZ K;  1H74 A;  3FBC A;  5C42 B;  3VF0 B;  3DLL Q;  2BV3 A;  4A46 A;  5DZ7 A;  4DX6 A;  2J0X A;  2Q3P A;  2OJ3 A;  2XMV A;  4ZVT B;  4ZPT R;  3T9N A;  2AV5 A;  2OIH A;  1NK4 A;  3IBW A;  1R8C A;  4EBE A;  2DR7 A;  5HQ8 A;  2D3O 1;  4XPE A;  4B02 A;  4O23 A;  2O3D A;  3OSP A;  4A47 A;  1FJG F;  2NS1 B;  1N5V A;  2AYM A;  2V2K A;  3OTD A;  2Y8Y A;  1X60 A;  2L3M A;  4DV0 F;  2HMI B;  1ZS6 A;  2FJA B;  4PXE A;  4NXM J;  3CJ4 A;  1TL7 B;  5A8R B;  4F04 B;  4YFU A;  3QGG A;  3ZTO A;  2BBE A;  2ATL A;  1FTR A;  2W9A A;  1WC3 A;  2DRD A;  2H4W B;  3EXY A;  3BZQ A;  3R5C A;  1RT1 B;  4RBT A;  1SC6 A;  3JTP A;  5GAE U;  1Q16 B;  2I8E A;  4OQJ A;  2Y8W A;  2R7S A;  1FER A;  2F4V F;  3AHP A;  1U1P A;  3IWN C;  4ZJL A;  1WSR A;  3KG4 A;  4OYZ A;  1L3T A;  4RUC A;  2CWX A;  4DUY F;  3U27 A;  4J5O A;  2G2Z A;  1FF2 A;  3M8Y A;  4DL3 A;  2BR0 A;  4J9S A;  2BM1 A;  1MU2 A;  3CF5 Q;  1P9Q C;  3KTQ A;  4DL7 A;  3NGT A;  1S12 A;  2BJD A;  4ECT A;  2MKH A;  4USV A;  2R7R A;  1VQ8 S;  2HS4 A;  2VA2 A;  3M4X A;  3PVX A;  4AE5 A;  4QWE A;  4EZ6 A;  2HNY A;  4DSF A;  1EZZ B;  1HBU B;  4F4Y A;  4UOF A;  4C8N A;  4ZHR A;  3SEO A;  1RKJ A;  2J7K A;  5LSR A;  2GHV C;  2NXC A;  1VRU B;  3RG6 A;  5IM0 A;  1HI1 A;  4WFY A;  3GG0 A;  4R8U B;  2RU3 A;  4FN5 A;  4A8W A;  4HAC A;  3JS9 A;  1K1Q A;  1H0H B;  3I0R B;  2DR6 A;  1GX5 A;  4J9V A;  4KGM A;  4ED0 A;  3I31 A;  1YKW A;  1IBL F;  4IH6 A;  3OTB A;  2OUG A;  4DBQ A;  2MKK A;  2HHW A;  1U47 A;  4RU2 A;  3AJ1 A;  2CAJ A;  2EBG A;  4JI0 F;  1Y10 A;  1RAB B;  3FSX A;  4RW9 A;  3DM2 B;  3L4B C;  4PZV A;  1RTJ A;  4NL5 A;  2OFG X;  4TN2 A;  3DRS A;  3DC2 A;  2KVQ E;  2JJ4 D;  3F44 A;  3OBI A;  4O3N A;  3GZ7 A;  1FCA A;  2YH1 A;  1M1H A;  2AEM A;  1FJE B;  2DHG A;  2BEF A;  5F0W A;  1JLB A;  2B56 A;  2WON B;  1KQF B;  1NK6 A;  4CCH A;  4B3S F;  1RAJ A;  4IH7 A;  2F7V A;  3V81 B;  1QE1 B;  1VQN S;  4N47 A;  4ZVR B;  2XCA A;  3J7A N;  5GAG U;  1AA1 B;  5SUH A;  3QZ8 A;  2LYV A;  3QSI A;  2W9B B;  2L08 A;  2NQP A;  2E1P A;  4MKB A;  3Q2S C;  3RYL A;  4CNZ A;  5DGA A;  3DOL A;  1HBM B;  1YQH A;  1X4H A;  2LQ5 A;  3WIV A;  2OEK A;  2RIJ A;  3AA8 A;  3R1L A;  3B54 A;  2LLZ A;  2OPP B;  2IHR 1;  4IFY B;  2J0W A;  1H2T Z;  2UVR A;  1R43 A;  5C25 A;  3W8P A;  1Q1K A;  4RUH A;  5HAO A;  4K5S A;  4I6Y A;  3D1O A;  4Y2I A;  5AXM A;  3Q89 A;  5HBM A;  2E5L J;  4RBU A;  2WSC C;  3KNA A;  3CDE A;  1FWL A;  4WFX A;  1NLK L;  2WOM A;  2HLU A;  5D0H A;  5EDW A;  3UWT A;  1GX6 A;  1D9D A;  5D4N A;  4QQB A;  2XY5 A;  1SVD A;  1KEK A;  4OHY A;  1SXL A;  4IOC Q;  3W8G A;  2WVE A;  2VBW A;  1NJY A;  3OVS A;  5KFB A;  1VQO S;  3GTY X;  1YZ6 A;  5KFL A;  2XY7 A;  3C6T A;  1Q7L B;  1MSW D;  3IS9 A;  4DS4 A;  3SBM A;  3FUY A;  3ZNJ 1;  4F3Q A;  3T5H A;  4ECR A;  2ZIT A;  1CC7 A;  1S6O A;  2EWH A;  2JH3 A;  4V1A k;  1BGX T;  4QU6 A;  4RWX A;  2B9X A;  4DWI A;  3PNI A;  3GR0 A;  1OSC A;  3H0P A;  5HMY A;  4IKA A;  5LMU J;  5JVH Q;  5IQ6 A;  4NYO A;  2F63 A;  3CCT A;  2EFN A;  3P4U B;  4C0B A;  4LF6 F;  3QRR A;  4GO7 X;  1XMQ J;  2C2Z B;  4QIV A;  4DR6 J;  3DOM A;  1BQN A;  1V3R A;  3Q8P B;  2FTR A;  4NCG B;  4F3O A;  2CQ4 A;  3QYY A;  2I9S A;  3IM8 A;  4I6A A;  4JOU A;  1WOO A;  3HSD A;  1EB0 A;  1KWM A;  2KRB A;  4I7F A;  1U25 A;  2ZOG A;  2LMI A;  4UQT A;  4FS1 A;  2VH7 A;  4YHH J;  4DR5 F;  2QL5 B;  2VG6 A;  4LVN P;  1SQE A;  1T9T A;  4LRF A;  1UPM B;  1LW2 A;  3BDP A;  2R8J A;  4NZ6 A;  3NS5 A;  2PI5 A;  3M6V A;  3MM7 A;  4YUD A;  4ICL A;  3GSI A;  5H9F J;  5K8M A;  3DHX A;  1VR6 A;  3E8O A;  1KHW A;  3HD1 A;  2XS7 A;  4IG0 A;  4BWM A;  2VBX A;  2XZW A;  2BJ3 A;  1FXL A;  2BJ7 A;  5DG9 A;  3M6W A;  1S48 A;  5FLX U;  3LQV A;  2ZBC A;  2GIR A;  2HNZ B;  1XK8 A;  2CG8 A;  2AYE A;  1F5B A;  3UDL A;  1NHV A;  1B0P A;  1RHM B;  2HQG A;  4FXW A;  2HIQ A;  3G6V A;  4QPX A;  2R7Q A;  2RUS A;  1FA0 A;  2IA6 A;  3MEG A;  2DNO A;  3CCR S;  3HJV A;  3U02 A;  3HT3 A;  3UN5 A;  3VGT A;  1HBN B;  1HPZ B;  2ZZT A;  2WW8 A;  5KG6 A;  2CQH A;  1H3D A;  3D5M A;  1S1V A;  3DRY A;  3K17 A;  1PGZ A;  2OPS A;  3CJK A;  4NML A;  1N5Y B;  4KY3 A;  1OY8 A;  3BO4 A;  2ZH8 A;  3MWB A;  3SCK E;  2W01 A;  1UPP A;  1HNI B;  3AT1 B;  3TUP A;  2CZ9 A;  3MR6 A;  2K7J A;  4ECQ A;  5GAD U;  4KKO B;  4URG A;  1RE1 B;  1RTZ A;  3LGM A;  3IA0 A;  1BD6 A;  3VAI A;  1Y5N B;  1YJR A;  2VD3 A;  3QFW A;  3SXL A;  3CCQ S;  6FD1 A;  5H9E J;  4K0K F;  3MM8 A;  2E1A A;  1IBM J;  2IRX A;  2H5I B;  2NCK L;  3T6J A;  4BC9 A;  2UXB F;  4L72 B;  1DAR A;  3PY8 A;  1R7I A;  2KXF A;  2E44 A;  1IR1 A;  1EP4 A;  4ZPV R;  1JLF A;  2GHW A;  3A3O B;  3OLB A;  2V4Q A;  2YQ3 A;  3AB4 B;  1S6Q A;  1Y5L B;  3HHL B;  4Y0F A;  1Q53 A;  4KPC A;  1SBR A;  4OI0 A;  2MZQ A;  2WVB A;  1TUG B;  4DX8 H;  3KLF A;  2R42 A;  3I4P A;  3CCS S;  1U2C A;  4ZN1 A;  2ZE2 A;  2OI2 A;  3QID A;  2DNP A;  2RD5 C;  2K3I A;  1J27 A;  4B3O A;  1HBO B;  1UEK A;  5KTQ A;  1C0T B;  1JIH A;  4KC5 A;  3CDW A;  2DPJ A;  2JDJ A;  1NDK A;  4USM A;  3GIM A;  4X4U A;  2J76 E;  2GAG C;  1YJN S;  3CCE S;  3DLK B;  3OR2 A;  2M0G B;  3KKF A;  3EX7 B;  1X4D A;  1S76 D;  4BBY A;  4ZCK A;  5K5M A;  2G0J A;  2W2N P;  2EXU A;  2MQQ A;  5IT9 U;  4IDK B;  2GNK A;  2XWX A;  2D3U A;  1N5Q A;  3AA9 A;  1WWH A;  2GCF A;  3PRB A;  4JI6 F;  2VBZ A;  4WE1 A;  1GQE A;  2HW3 A;  2KXH A;  3I0S B;  2PGC A;  4UZB A;  1YVF A;  2IRY A;  2FQQ B;  4B3T F;  5B0C A;  2E1C A;  1SIZ A;  4WJB A;  4U95 A;  2LKZ A;  4K4Y A;  3HHK A;  3ONQ A;  4O0N A;  4WFA Q;  3EPG A;  4HH0 A;  1FXR A;  5KFD A;  3MMB A;  3QFH A;  2ZZM A;  1BLU A;  2VPW B;  4HHU A;  4DSE A;  4NRU A;  1TVR B;  2BOA A;  2BA9 A;  3M30 A;  5M2P A;  1LXJ A;  1SPB P;  3MR3 A;  3MMC B;  2AKW B;  2RDI A;  2GJ2 A;  4E0D A;  1ZM9 A;  2AQ4 A;  1LV5 A;  1N6Q B;  4X65 F;  4N56 A;  3W64 A;  3M7V A;  2EKN A;  3Q8S B;  3NGD A;  2DRA A;  3I82 A;  3T5J A;  3PYD A;  4PQU B;  4CO1 A;  4KGZ B;  4PG4 A;  4ZCI A;  5DDR C;  2VFS A;  5C2G A;  1UWB B;  1NCL A;  2HHT A;  1P9Y A;  4P73 A;  3L95 X;  4DOZ A;  1XIQ A;  1GMV A;  2DNQ A;  4JYA J;  1ROF A;  3I5B A;  3J7Y U;  4C8Z A;  1G4C A;  3GU0 A;  1XNR J;  3CDU A;  3QWU A;  4G1Q A;  4K4W A;  1X4B A;  4TLR A;  4ELU A;  2EFG A;  5KFQ A;  3QLH A;  4N7T A;  3AFG A;  1TL5 A;  2XGP A;  3H4D A;  2YWF A;  2PFD A;  1F60 B;  5HMZ A;  4XTT A;  3LP0 A;  4QIF A;  1OSD A;  3CJ3 A;  4NLR A;  4NLX A;  3L9Z A;  3GON A;  1URN A;  1RT7 A;  3MM5 B;  4X4V A;  2BJ8 A;  3LAN A;  2W4C A;  3Q2T C;  3FBB A;  1TFY A;  5AE3 A;  1OQ6 A;  1AZS A;  3P45 B;  3BEG B;  5K14 A;  3BQ0 A;  2LVW A;  2B4O A;  1RLC L;  3GWC A;  3TVK A;  1BQM B;  4NLU A;  1NH7 A;  4X62 F;  2AT1 B;  2XSJ B;  4DCP B;  2CJA A;  3J7Y I;  4AND A;  4B3R J;  4CO2 A;  7FDR A;  2R7V A;  4AQY F;  2AIR B;  4OV6 A;  4ZMM A;  4IQX A;  4UY8 5;  2DRB A;  2Z0G A;  4DL2 A;  3DXB A;  3UFC X;  3WX4 A;  1S9E A;  1N48 A;  2BQ3 A;  3MPD A;  3ZTP A;  4ED2 A;  5E33 A;  3HFK A;  5LOQ A;  1RAI B;  1HNZ F;  2C2R A;  4O3O A;  4RW6 B;  3L3C A;  5BYS A;  2HAF A;  2QT7 A;  1IQT A;  2FY1 A;  3WC0 A;  4B9N A;  2DO0 A;  4MT1 A;  4TYB A;  4PUO B;  2X1G A;  1R0C B;  2XNR A;  1DTQ A;  3EYZ A;  1B99 A;  2UUA F;  1WJ9 A;  3DGP A;  1MWQ A;  2XMW A;  3BGR A;  2HHP A;  3WX8 A;  4O3S A;  4DG1 A;  3BJY A;  2DHH A;  1FT8 A;  4Q7A A;  3M2R B;  1SUQ B;  4FDF A;  4N76 A;  3R97 A;  4F26 A;  1T9V A;  4RUA A;  1FEH A;  1SJQ A;  1AUS L;  3NL0 A;  2VJU A;  1X9M A;  5CZX A;  3Q8V A;  2VKZ G;  2NUU G;  3DFE A;  1S10 A;  1U02 A;  1VC6 A;  3NCQ A;  2R7W A;  4HHJ A;  1NZA A;  2QA4 S;  4ID5 B;  4OX8 A;  2FJE B;  2H54 B;  1SI9 A;  4KTQ A;  2ZH4 A;  3GFH A;  3L7P A;  3JAM Y;  1LFW A;  4LSN B;  1NHK L;  3RBD A;  1CJK B;  5KFG A;  3W63 A;  4CP5 A;  3BSO A;  1KQG B;  3PV8 A;  3LP1 B;  4N8O A;  4FXV A;  2W1B A;  1Y5I B;  2VA3 A;  2QC3 A;  5I3U A;  3KMS A;  3IBF B;  3C2P A;  2DB1 A;  2FGO A;  1UA1 A;  2UV8 G;  3KWM A;  2YQ0 A;  2I5J A;  2DR8 A;  1QTM A;  5AE1 A;  3PTW A;  1N33 F;  4F4K A;  3WIU A;  1D9F A;  2IMO A;  4I67 A;  4CM2 A;  3OTO J;  1FK9 B;  2V8V A;  5J2P A;  3EVW A;  3SDE B;  2R9L A;  1IM6 A;  4NYP A;  1AUD A;  1FES A;  3QJP A;  1YRX A;  4MK7 A;  1NHU A;  4I2P B;  2GQ2 A;  2QN6 B;  3NEK A;  4BHQ A;  4L76 A;  2FPH X;  5KFZ A;  3R27 A;  3EVM A;  1RA6 A;  2HVD A;  3FEZ A;  3KLI B;  4JI2 J;  2IMW P;  4CH0 S;  3A8K A;  4Q8F A;  4RW4 A;  1S0M A;  4ZVS B;  2CQC A;  2V50 A;  3CC7 S;  3T5K A;  4DV7 F;  1K73 T;  4Y00 A;  3TZZ A;  2AYB A;  3KJQ B;  2D3O R;  1F0X A;  3OR1 B;  1VQ7 S;  1WEY A;  3V6H A;  1WI8 A;  4LQ3 A;  4W4M A;  4ZVE A;  2PI4 A;  2NSB A;  5IOL A;  3PDN A;  3ILJ A;  5IQQ A;  3N6M A;  4P6Q A;  3IMQ J;  4KGV B;  5HJY A;  3PIP Q;  3DYA A;  3SV3 A;  2FLN A;  1RQ0 A;  3MAH A;  1FRJ A;  3EDR B;  5SZT A;  3CED A;  3K58 A;  3NLC A;  2WAQ D;  4RR5 A;  1CUL B;  1S97 A;  2UXC F;  1FJC A;  2KYZ A;  1T9W A;  1RWW B;  1VJW A;  3I55 S;  3ELH A;  3TAM B;  2NZ4 A;  3PIO Q;  2QIF A;  4OZN A;  2LEC A;  1M5P C;  1TKX A;  5MLC V;  3PYE A;  4G1I A;  1IM4 A;  3EXC X;  5DM7 Q;  2RJZ A;  3BR8 A;  5LMN F;  1EQM A;  1A6L A;  2L9W A;  3R5G A;  2HZA A;  3MOZ A;  4CLZ A;  1H2V Z;  4KGX B;  4RNF A;  1MWY A;  2OLW A;  4USU A;  4OI2 A;  2KG0 A;  3HVT A;  2DHS A;  3DI6 B;  1REG X;  3QT8 A;  2WCX A;  4YB1 P;  1FNO A;  5A0Y B;  1OWX A;  4X66 F;  5BR8 J;  4ZOS A;  4ATN A;  3D2W A;  4O4G A;  4IOA Q;  2B6A B;  2C2M B;  3DOK A;  3S1T A;  2P6S A;  1RWV B;  4DV4 J;  4TQS A;  1JJ2 R;  3A12 A;  1KSP A;  3GYX B;  2Z2L A;  3UO0 A;  3B82 A;  3LAL A;  3KLG A;  4WYL A;  3QAT A;  5B0F A;  5IV3 A;  1JXE A;  3PW4 A;  1Q4R A;  1QVG R;  3BSC A;  4JBC A;  1ZPW X;  2Q43 A;  1HW8 A;  1U8S A;  2QFI A;  3MM6 A;  2PO4 A;  4FXD A;  5F41 A;  2WK4 A;  5EX0 A;  2OD6 A;  2HS0 A;  3TO8 A;  4MKY A;  4O44 B;  2HWH A;  3KHH A;  1J5E F;  1HKA A;  2MZT A;  4KH0 B;  1FRM A;  2W7O A;  2W2P P;  2M52 A;  5LJ3 Y;  3E01 B;  3FCW A;  3GJQ B;  4IFV B;  4DV6 J;  3GV8 B;  3NGR A;  2XS2 A;  3H4B A;  2XMU A;  1Z2Z A;  1HI0 P;  2HFO A;  4JI8 F;  2E5I A;  5K20 B;  3J80 Y;  5I3P A;  4S0M A;  3BO2 A;  1MN9 A;  5G4D A;  2ASY A;  1FXD A;  2K3K A;  3NMA A;  4MIA A;  1RB0 A;  2Q1L A;  3K5M A;  5ETM A;  3I5C A;  1S1W A;  2XTJ P;  1UW9 A;  3W65 A;  2CNO B;  2HHH J;  1X4C A;  4J9M A;  4QWD A;  1TMM A;  2W4D A;  1YGY A;  1TKT A;  2IM3 A;  4TY8 B;  2BDP A;  1VQS A;  3X3U A;  1R8H A;  4AUK A;  2YWG A;  1PYS B;  5F8N A;  4OJ1 A;  2OH2 A;  2E7X A;  1MNE A;  3ZZR A;  2IM2 A;  1UTA A;  1IKV A;  2G13 A;  3D3B J;  4ES2 A;  2ROP A;  4R25 A;  1WHV A;  5BXI A;  3UN2 A;  1HA1 A;  1NPK A;  2B3T B;  2RS2 A;  3TVZ A;  3M1V B;  4A8Q A;  4DR2 F;  2AYG A;  2BAC A;  1FX2 A;  3HHL D;  3ISZ A;  1JKH B;  2LP4 A;  1SQF A;  2UXD F;  4ZKA A;  5G0R B;  3K7R A;  1REV A;  2GW8 A;  3PXG a;  4J9Q A;  2XYG B;  2Z2Y B;  1LWE A;  4F2S A;  2A18 A;  3NGK A;  3QO9 B;  1VHI A;  1WDD A;  4L74 A;  1VRQ C;  2MEW A;  1IBK J;  2C3U A;  3HLU A;  2IM0 A;  4ZP7 A;  4WBF A;  2E5G A;  2B8Q A;  4F0H A;  3UNG C;  2ZH7 A;  3DLG A;  3M2U B;  3WC2 A;  2CA9 A;  2CAD A;  2JLE A;  1YX2 A;  2RVJ A;  2CPH A;  3U1L A;  5HI7 A;  1FKA F;  3CXC R;  3UPF A;  2FJV A;  3K5N A;  3PKM A;  3KLH B;  2ZHB A;  3MPV A;  2M70 A;  1WKJ A;  4CDI A;  3LP2 A;  3J7Z T;  3RBX A;  4X4Q A;  3CD7 A;  2BE2 A;  5A6P A;  2V63 A;  3KK1 B;  2BX6 A;  1MN7 A;  4C11 B;  1QSY A;  3DU5 A;  1UEU A;  1KVK A;  3IRX B;  4DL5 A;  2L41 A;  3US5 A;  3UVJ A;  4FPI A;  4DL6 A;  2CZ4 A;  4H4O A;  1RGV A;  3ISN D;  4QOT A;  2V4R A;  2ZD1 B;  3P5T L;  3A8J A;  1O8B A;  5H9F K;  4Y2K A;  1AFJ A;  3MEE B;  2XHC A;  2FD2 A;  2JFK A;  2DEJ A;  3CC2 S;  1RYR A;  1LOU A;  4PWD A;  1WTF A;  3H42 A;  1TKD A;  4WKY A;  1Q8B A;  1S9G A;  5CZV A;  3R5A A;  2V34 A;  1ZM4 A;  4JV2 A;  5F8G A;  3RGI A;  3WQP A;  1XMO J;  3MUM P;  2VPZ B;  3DRP A;  1U45 A;  2BYC A;  3A8I A;  4WK1 A;  4HI1 A;  2PMZ D;  2VOD A;  1CLF A;  1PYT A;  1N5S A;  4DPX A;  1RT3 A;  5D3G B;  2QEX S;  2D7S A;  2UP1 A;  3E3X A;  4RX6 A;  3IWL A;  4U8V A;  4O3Q A;  4OI3 A;  1HQE B;  1XMB A;  1F9F A;  4NXN J;  3KLE B;  1UW4 A;  4TQR A;  4B9U A;  4QR1 A;  3W5Y A;  4Q2M A;  4OZ2 A;  3D66 A;  2FVR A;  1U2R A;  1I1G A;  3HD2 A;  1VQ4 S;  3W62 A;  3AY0 A;  1C0U A;  4ZPW R;  5AT1 B;  4LRE A;  3SCL E;  5IS2 A;  2A2D A;  3O44 A;  1T05 A;  3SSR A;  3TX8 A;  2NPI A;  2WSE C;  2MLY A;  4WTY A;  3CJQ A;  3UR0 A;  3CJ5 A;  1M5O C;  1NM2 A;  3IWX A;  1KQS R;  3MMJ A;  2CPE A;  1RYS A;  2J9C A;  1FE4 A;  3G87 A;  5H9E K;  4WKR A;  5AXL A;  2H4Y B;  2FLP A;  2ERR A;  2FHJ A;  4DDF A;  4KE5 A;  2EG2 A;  1V3Z A;  4DZD A;  1FJ7 A;  4CZC A;  5KT4 A;  3C6U A;  3AJD A;  1MRO A;  4G65 A;  1C2P A;  5CAA A;  2CYY A;  4C2M A;  5L39 A;  2DO4 A;  2HS3 A;  2Q6B A;  1NRK A;  2Y0S D;  1TL1 A;  2BJE A;  1LW0 A;  1IKW B;  4UOC A;  3JYT B;  2ILY A;  2FJX A;  3U1N A;  1WEZ A;  1O0P A;  4KFB B;  2EFP A;  1JJC B;  2KYX A;  4ZJQ A;  4FF1 A;  2JC0 A;  3VVT A;  5KFE A;  4AXJ A;  2B43 A;  3GJS B;  1ZZN A;  4J7C A;  2KFZ A;  3OFE A;  3TP2 A;  4K2X A;  4HTJ A;  1HNX J;  4EI2 A;  1GMU A;  3LAM A;  2A2C A;  4NLD A;  2PEB A;  1T95 A;  1HFE L;  1KOO A;  3D1H A;  5BYR A;  2GIQ A;  3QIP A;  4YR0 A;  2IVF B;  4LBP A;  1I3O B;  3J7A 1;  5KT7 A;  5HJX A;  2M4M A;  3PHT A;  3IO1 A;  1VIX A;  3LWM A;  5DQH A;  2ROG A;  2FHM A;  3CCM S;  4Q5V A;  3UNY A;  1CS4 B;  4H54 A;  4ZPB A;  4B08 A;  4ZCL A;  4DQP A;  4RZR A;  3I9Z A;  2BAB A;  2AJ2 A;  1S77 D;  2WVF A;  1HW9 A;  4CO0 A;  3I6P A;  3GPA A;  4J9P A;  2VFV A;  1S1T B;  5A2Q Y;  3FCH A;  4DR4 J;  2VU5 A;  2ZNZ A;  4AL6 A;  3PX0 A;  2ZH9 A;  5AJ3 F;  4QIE A;  3NWG A;  4HVZ A;  2DNY A;  1AXQ A;  4CI0 B;  1XR5 A;  1RHU B;  5C42 A;  1IXK A;  1NBE B;  3KYL A;  3EM1 A;  5M2U A;  1UWA A;  2QZ8 A;  4NLQ A;  1P6T A;  2QYG A;  1RXO B;  1F2G A;  4LF4 J;  2CPI A;  2XNQ A;  4ETX A;  2HFS A;  3ZC4 A;  2Y1L B;  4XAK A;  2KT2 A;  1G7C B;  2XLI A;  5C24 A;  4A8K A;  2G1D A;  3GG1 A;  3UCG A;  4WU3 A;  3TJ8 A;  3EZU A;  3H90 A;  3MED B;  3ZNU A;  3GJR B;  4GVB B;  4LRD A;  3NOC A;  1DJ0 A;  2GJF A;  3U7J A;  4I56 A;  1RAF B;  3PAC A;  2EW9 A;  2DIV A;  4NZ7 A;  1GNK A;  2CFX A;  4X4O A;  4ZP6 A;  1JXV A;  5HVF A;  2AWZ A;  3EMT A;  3A3P B;  1Q8K A;  5ETT A;  4FYD A;  4KPY A;  3L7O A;  2MLX A;  1VK3 A;  4WPA A;  2NRE A;  4JV0 A;  1QUV A;  5D6G A;  3DGV A;  3P8B B;  2E5L F;  1H7W A;  1NK5 A;  1Q8L A;  4NLS A;  1OIA A;  4YN3 B;  4P74 A;  5IC4 B;  2LA6 A;  1Q0N A;  3BGO P;  3A4T A;  2DNG A;  5DLF A;  2CPX A;  3VAM A;  4UOG A;  3KDN A;  3MTK A;  1VRU A;  2P2C B;  1UVK A;  2V9W A;  1F3F A;  4XDD A;  3QAE A;  3PEH A;  1PIE A;  7AT1 B;  2J8S A;  1MU2 B;  4CYU B;  3HT0 A;  2H65 B;  1QAI A;  5HMX A;  3K5L A;  4Y2A A;  5D0R A;  1TUW A;  4RW8 A;  2HNY B;  3THV A;  4Z7C A;  3BSA A;  2QMW A;  2HZC A;  2VG7 A;  5ETQ A;  2IDL A;  5LMU F;  2UUC J;  4USJ C;  3NGS A;  1XMQ F;  1NAQ A;  2GMH A;  1JNZ B;  1WC5 A;  4DR1 F;  1BC6 A;  3H25 A;  1DZ5 A;  3PFO A;  1VQL S;  4C9D A;  4IRC A;  4IR9 A;  2VIH A;  1YDL A;  2NSC A;  3FZB A;  4NEY A;  4U9R A;  1I5O B;  3HKZ D;  3ZO7 A;  4YEA A;  3IG1 B;  3TNV A;  4YHH F;  3AB2 B;  3FSI A;  5D4P A;  1SV5 B;  3ZTS A;  2C3O A;  1HWK A;  5CYJ A;  2WON A;  2IYI A;  2V2V A;  1X8D A;  3U1M A;  2D74 B;  4RW9 B;  2PFF B;  1QE1 A;  2EFV A;  4MMO A;  4NA2 A;  1JLE A;  4ZLN A;  4PXC A;  1YLX A;  3DRS B;  4PKD B;  2VF3 A;  3D4J A;  4Y65 A;  4ECZ A;  1NME B;  3MAA A;  4C6A A;  1M5K C;  4NLV A;  2EC2 A;  1WOP A;  2BJ9 A;  3ENQ A;  1XWL A;  3AH6 A;  3H2L A;  2G4B A;  2CJY B;  1JLB B;  4LFA F;  2G2Y A;  4JI3 J;  3NOG A;  1D09 B;  2FHO B;  2FZC B;  2V6A A;  1WKL A;  3CD5 A;  2C2N A;  1IKX B;  2O01 C;  2DXD A;  1BE4 A;  4EU0 A;  2BRK A;  2J9E A;  3JXO A;  4HLB A;  1W7W A;  3T1H J;  3SCI E;  4M8L A;  4TU8 A;  2OPP A;  1TAU A;  3HCX A;  4IFY A;  2YNF B;  5T14 A;  1FJG J;  4WZQ A;  2A1B A;  3PX4 A;  1U26 A;  1E6V B;  4PPZ A;  2ADC A;  2H51 B;  2LDI A;  1GXU A;  1VQM S;  3PW0 A;  4RLE A;  4UUW A;  2AJQ A;  3TWZ A;  2YY3 A;  4TU7 A;  4DX7 A;  3JSY A;  3R9L A;  1HWL A;  5IT0 A;  1Q79 A;  4NI2 A;  1VBX A;  3DOL B;  3K2Y A;  1YSJ A;  3KJN B;  1Z1Z A;  5F0U A;  3OFG A;  5EGY A;  1RTD A;  2OD4 A;  5LSL A;  3OPK A;  2F4V J;  3PJ9 A;  2QMU B;  3HM9 A;  4C8O A;  3N4W A;  4M5M A;  1U6Z A;  3D6T B;  5HP1 B;  2PEH A;  3VWS A;  2OPQ B;  3KG0 A;  4YR3 A;  5KFR A;  4Q0B A;  3TEH B;  2YKN A;  1VRT A;  2Y3Y A;  1CJT A;  1JQG A;  2JEI A;  3A8E A;  4RW7 A;  1T02 A;  4NRT A;  4RNN A;  4OI4 A;  4K50 A;  3ZTR A;  4ZLL A;  4DU8 A;  2H3E B;  3R6L B;  4WP3 A;  2KDO A;  3H20 A;  4OHW A;  2LEB A;  3BDE A;  3DLE A;  3W66 A;  4LF5 F;  1J2V A;  3IAS 9;  5EWF A;  5KG1 A;  3OL7 A;  3C6T B;  3VGS A;  4ER8 A;  4GKK J;  2V2Z A;  3EGW B;  3IS9 B;  1XER A;  2YXL A;  2K2P A;  1KKH A;  2R7T A;  3M8Z A;  4XO0 A;  2DXF A;  4IRK A;  8RUC A;  3BYR A;  1WC0 A;  4NCG A;  2PE8 A;  1JX4 A;  2EVZ A;  4CO3 A;  3CCZ A;  5HSP A;  2NZC A;  2ADB A;  3CUN A;  2ZWO A;  2MKC A;  3HMJ G;  3EZO A;  4LF8 F;  1IBL J;  5E3A A;  3L09 A;  3QJL A;  4NOH A;  1HD0 A;  2Z56 B;  3HHN B;  2MQ8 A;  2ZC3 A;  3Q83 A;  2C3M A;  2IC3 A;  3FBF A;  4PWU A;  4EBC A;  2GMJ A;  1GH8 A;  2XO7 A;  3DOM B;  4OZ3 A;  2F3J A;  3ZZY A;  4D3H A;  3AD9 C;  2DY1 A;  2GS8 A;  1I51 B;  4ELV A;  4LSL A;  2AW0 A;  1W25 A;  3MDF A;  2QL9 B;  3EGZ A;  4RWW A;  2OP5 A;  1CJV B;  4OZ0 A;  3BQ1 A;  1IQZ A;  2VG6 B;  1U48 A;  3ETO A;  3MCO A;  2RF2 B;  1HNV A;  2BW2 A;  1UA0 A;  2WB4 A;  4PRF A;  2VC1 A;  3AXK A;  4PYA A;  1LW2 B;  5J2N B;  4A8X A;  2FUG 9;  1B64 A;  1RLD A;  2XS5 A;  1HWU A;  3MM7 B;  5KOX A;  4OI1 A;  4CWB A;  4IG0 B;  4H4K A;  1VS3 A;  5L1J A;  3QRQ A;  3W2V A;  5KFT A;  1HPZ A;  4ED5 A;  2HFZ A;  3KK3 A;  3CWJ A;  3QBC A;  1J5O B;  1K44 A;  2KN4 A;  2IJF A;  1YBU A;  2BAN A;  2Y1R I;  2OMO A;  2COL A;  2EK6 A;  1HWJ A;  4BLG A;  1W26 A;  4WFN Q;  3C46 A;  3BKF A;  3G8S A;  4KKO A;  3GP9 A;  1QUP A;  3MPW A;  4YB7 A;  3MEG B;  4C3K A;  1U1Q A;  5KFK A;  1DTT A;  1T03 B;  4ZIT A;  4K4V A;  4Q44 A;  3H2V E;  2VIC A;  4EFA C;  1S1V B;  1T0T V;  4A48 A;  2JWN A;  2D1C A;  3VAK A;  3CJK B;  2QV6 A;  2XZD B;  1RT4 A;  2EI5 A;  2YKM B;  4HI2 A;  4N5S A;  4I69 A;  1U1O A;  1NJI T;  2V68 A;  4I1T A;  2IYG A;  2O5D A;  3VVU A;  2KL8 A;  3HHL A;  2ZH1 A;  1DHM A;  1R6Y A;  5GAH I;  1S72 S;  1HQU A;  4OX9 F;  1RWX B;  3SFG A;  1TP7 A;  2NXN A;  2VL1 A;  5I42 A;  2HZV A;  2N4D A;  4X84 A;  3M8S A;  4JI5 F;  3N01 A;  2V8D A;  3G9C A;  4DHV A;  1HBO A;  2E1M C;  2IBK A;  1EP4 B;  1JLF B;  1U1M A;  4K2J A;  1UEV A;  1S6Q B;  4PAB A;  2LXU A;  4UF4 A;  3M8P B;  2PC6 A;  3TUZ C;  3KLF B;  4TNO A;  4EYH B;  3DLK A;  4L73 A;  4B3R F;  1RT2 B;  1JMT A;  2MZJ A;  2IIH A;  4TKT A;  4EBD A;  1PJ5 A;  2IA0 A;  3JTO A;  1SKS A;  5B0D A;  2RU9 A;  5DJB A;  1Y3K A;  3NNC A;  4B3O B;  3A1Y G;  1GK8 A;  2SXL A;  2YPZ A;  1JWW A;  4U6P A;  1UL3 A;  3S8S A;  5ADZ A;  4H4M B;  1U49 A;  4DR5 J;  3N79 A;  1S79 A;  4V19 X;  2W8L A;  4XPC A;  2BKO A;  1RKI A;  3OR2 B;  1MMD A;  4DR3 J;  4OYI A;  1TL4 A;  1SC3 B;  1SL2 A;  1S5Z A;  2YTC A;  4RL1 A;  2ACY A;  4FP9 A;  1FKO A;  2D9O A;  2M5Y A;  1WKK A;  3JB9 k;  3IXQ A;  3TRG A;  2FGC A;  2Z2M A;  2F40 A;  3LH2 S;  4F8R A;  3RAQ A;  1SL0 A;  1N4L A;  2F65 A;  2MST A;  3LUY A;  4DPU A;  2FJB B;  2PD1 A;  2DIU A;  4Q8E A;  4UW2 A;  4FNI A;  1N6Q A;  1VQ9 S;  4PEO A;  3CPW R;  2ASJ A;  2HRT A;  3LTO A;  2D3Z A;  2MY7 A;  1KLN A;  1LWX A;  1PC4 A;  1VQ5 S;  2LQJ A;  2XLK A;  4N8N A;  3BKU A;  4ES3 A;  4LFB F;  3R7B B;  3M30 B;  4V19 J;  1WHW A;  2HHU A;  2J0S D;  2R2R A;  3OD2 A;  3MI7 X;  1WD6 A;  4ZVP B;  4U67 Q;  2DNK A;  2QLF B;  3RB0 A;  4O0I A;  3OTC A;  3KG1 A;  4J9O A;  3NNA A;  3THP A;  1VQY A;  2CJB A;  1NU4 A;  1NKC A;  4WP8 A;  1SJF A;  1M90 T;  3BPD A;  3PYF A;  2KHD A;  4UOH A;  3CJ2 A;  1B0T A;  2C3P A;  4G1Q B;  3HK2 A;  3GJT B;  5AXN A;  3H7H B;  4B17 A;  2VDI A;  3VQS A;  4OX6 A;  1X9W A;  4KGK A;  3JSM A;  2IAJ A;  1BQM A;  3CCW A;  3QLH B;  4MTP A;  4I4B A;  3CJ0 A;  1JLC A;  1LWF B;  4F4A A;  2UU9 J;  3LP0 B;  3WDO A;  4DQI A;  2F9D A;  2FB0 A;  3UDE A;  4LSZ B;  3ZZP A;  5B09 A;  1LK7 A;  5K8O A;  1JK9 B;  2JFD A;  2Y9H A;  1RU2 A;  2ZJP Q;  2XMA A;  4QCL A;  4JV1 A;  1AZS B;  3CNQ P;  4ECW A;  1T9U A;  2LEA A;  1TKZ A;  1RAD B;  1YTY A;  3LPY A;  2QA2 A;  3LAK A;  4USH A;  3V6J A;  4RUB A;  1JLQ B;  3B8H A;  4CRJ A;  4PUO A;  4KV8 A;  2IJR A;  2JL9 A;  4PPD A;  4CTA A;  4HH1 A;  2P5V A;  1XNQ J;  3LGN A;  2DH8 A;  1V5I B;  4XK8 C;  4TYA A;  4U7C A;  4X4P A;  1KBR A;  1S9E B;  4RNM A;  4RNO A;  3M2R A;  1U4B A;  4DV5 F;  3R2C J;  4JI6 J;  3D6H B;  1UMJ A;  3PM9 A;  3OHB A;  3M9O B;  4PCQ A;  5J1E A;  5BR8 F;  4NLT A;  1WEX A;  4J9R A;  1U1N A;  3M32 A;  1DTQ B;  3V4M A;  4WXO A;  4B3T J;  3DGP B;  1MW7 A;  3OXG A;  4DV4 F;  3SYZ A;  5F8M A;  2B5J A;  4WZM A;  2OTJ S;  3KLV A;  2OHD A;  4JI4 J;  3P96 A;  1YWX A;  4R5P A;  2ZFH A;  3V6D A;  5LL6 d;  1VMB A;  1PO6 A;  4LSN A;  1DFD A;  3FC9 A;  5JXS A;  1NSP A;  5KFH A;  1IVZ A;  2XGQ A;  1RDR A;  1IUJ A;  3CE8 A;  2AGQ A;  3RUB L;  5CD4 H;  4LBH A;  2GGP B;  4IOB A;  2WBM A;  2J9D E;  1X0F A;  2HVZ A;  2K1R A;  2M88 A;  4X65 J;  1RHJ B;  5DDP C;  4FNH A;  3I9V 9;  2CQ1 A;  2J7W A;  2GO9 A;  2RQC A;  4KHR A;  2VFR A;  1M1G A;  2BE7 D;  1GT8 A;  4I2P A;  1FD2 A;  3LA0 A;  2G1H A;  5I3U B;  1MLA A;  3OHA A;  3KLI A;  4NPO A;  3Q8Y A;  3IGN A;  4N41 A;  3N0V A;  5B7W A;  2GVD A;  2HHH F;  2H5E A;  4NZ0 A;  2I5J B;  4ILR A;  1FNM A;  2YKP A;  4DSK A;  1B7Y B;  4NA1 A;  3R5B A;  1ZAW A;  5HVH A;  3OR1 A;  2I1R A;  3ZZZ A;  1BWV A;  2IVY A;  3K57 A;  1VQK S;  2QRR A;  2ALZ A;  2RH3 A;  2XM3 A;  5CQG A;  3K5O A;  1SJR A;  5C5J A;  2HUR A;  4TVA B;  1U0H A;  3ZZ0 A;  2VFT A;  2HHQ A;  5A8W B;  2AGP A;  5IFM A;  1TL3 B;  2DNM A;  5E41 A;  2YWK A;  2EFQ A;  1TV6 A;  4PR6 A;  5EUH A;  5LT5 A;  2OEL A;  1NO8 A;  3SQO P;  3VTI A;  1PJ7 A;  3QNW B;  1HAR A;  3HVW A;  4A8O A;  4AQY J;  3NXZ A;  1P1L A;  1U0S A;  4UQG A;  4J90 A;  2HFV A;  1EET A;  4DPW A;  3MXH P;  4G3I A;  3VZI A;  3NCP A;  2YNG B;  4NX9 A;  2AJF E;  2XUL A;  2AZ1 A;  1IBK F;  4Z2X A;  2OO4 A;  1HR0 J;  2V0N A;  1N0V C;  3GFZ A;  3CTR A;  4DPO A;  1TU0 B;  1N5T A;  1GMW A;  1HNZ J;  1BXN A;  3BH6 B;  5A0Y A;  2YWE A;  2DBB A;  3VAG A;  1UJ5 A;  1ZA1 B;  2ZDO A;  2J0Q D;  3PR4 A;  1WUU A;  3K89 A;  2B6A A;  3J81 Y;  2UUA J;  2MQP A;  2ZOF A;  3AOB A;  1WG5 A;  1CJU B;  2GHP A;  3RRK A;  2XYH B;  1BY9 A;  5F9N A;  4LF7 J;  1XTZ A;  1A0O B;  3HVT B;  2KZM A;  5KAK A;  2XMM A;  4PYD A;  4U7U K;  2CJQ A;  3MM9 A;  3TZX A;  5DET A;  1OYE A;  3ZZT A;  2Q6C A;  4O4G B;  2J5A A;  1JLG B;  1UVN A;  1D8Z A;  2RHS B;  2OSQ A;  3HI9 A;  3I56 S;  4NAS A;  1E6Y A;  1F5C A;  3MUT P;  4FBU A;  2MTL A;  4TXS A;  4QWB A;  1NPP A;  5F8J A;  3EWG A;  1NSA A;  5L9X A;  2CJX B;  1RP5 A;  4CLK A;  3P5B P;  1YIJ S;  3D1Q A;  2YKQ A;  1XEZ A;  1ITP A;  4X64 J;  1LEO A;  3OQ2 A;  4ZVU B;  3HJF A;  3AXM A;  2LQB A;  3MM6 B;  3KDO A;  2FJD B;  4XDC A;  2HAI A;  1XMO F;  2VUG A;  2VQF J;  1H98 A;  3SIP B;  1N32 J;  3BM7 A;  4C97 A;  4WTO B;  3D54 A;  3FRZ A;  4J9K A;  1M1K T;  2XLJ A;  2XSF A;  5DRK A;  3ZTQ A;  1N33 J;  5F8I A;  4JV5 J;  3MCM A;  5B0E A;  2B0G A;  1HI8 A;  4FF4 A;  1N0U A;  1X5S A;  2NXJ A;  3ET6 A;  3ENV A;  1N34 J;  4J9U E;  1RAA B;  2HPU A;  3CW2 C;  2B4P A;  1RK8 A;  2XMJ A;  5JMN A;  4F4X A;  1RHK B;  3M9M B;  2F8E X;  4DCO B;  1TR0 A;  4CLT A;  4M5J A;  3R7S B;  4M1K A;  3CSK A;  3MD3 A;  2KFN A;  3FRY A;  2R2S A;  3VAJ A;  5D77 A;  4DV7 J;  2LXF A;  1SH3 A;  4OI6 A;  1XJW B;  2QJ3 A;  1UKU A;  5DM6 Q;  1TKT B;  1RHR B;  5DDQ C;  2NXE A;  1VGY A;  3OVB A;  3W5X A;  3TQ1 A;  1OPZ A;  1KFS A;  1ARO P;  1FX4 A;  1IKV B;  4E8U A;  2Z2Z A;  3QO9 A;  4CLW A;  1X9S A;  2MJN A;  1R0A B;  1ZM2 A;  1U8W A;  2MQO A;  2UXC J;  4ZVH A;  2Z4P A;  4RBV A;  5E3Q A;  2MKI A;  1S6P B;  2QX0 A;  3M2U A;  3H8Y A;  4ZVG A;  2LQ9 A;  4LRA A;  4C48 A;  3OT9 A;  3TQE A;  4RKU C;  1S99 A;  4CLS A;  1DBD A;  2JLF A;  5ETV A;  1REV B;  1AYE A;  2FVS A;  1WG1 A;  4F25 A;  1EX8 A;  5LMN J;  3PJW A;  1LWE B;  2DJW A;  1VBZ A;  3W3S A;  3HZE A;  4DV3 J;  2DGW A;  3Q8U A;  1FDA A;  1HNX F;  3CO9 A;  3MR7 A;  1K47 A;  5LJ5 Y;  2M8H A;  2WVC A;  2K06 A;  4QWA A;  4C11 A;  3TOQ A;  4X66 J;  3Q22 A;  4X2B A;  2ZKT A;  2UVW A;  4ELT A;  2MXY A;  3HHD A;  3EIC A;  3D3C J;  3GFX A;  2RIL A;  2N3L A;  1KVJ A;  1T9X A;  1AT1 B;  1KFD A;  1Q82 T;  2O66 A;  2Z8Q A;  3HXM A;  2MKS A;  5KG2 A;  2LDY A;  3LP2 B;  2GQQ A;  1BHN A;  3I87 A;  2DGS A;  2RNE A;  2YX4 A;  1U6F A;  1GAO A;  1QJH A;  1RAO A;  4OYA A;  4DF4 A;  1EQ0 A;  3OUY A;  4IG3 B;  4DUZ J;  4DR4 F;  2RRN A;  2DNN A;  3RRG A;  1V9O A;  3HFZ B;  4QZV B;  1AFI A;  4H4O B;  4BDP A;  2GQC A;  3C16 A;  4ECY A;  1L3K A;  3NBP A;  4YQW A;  4OZJ A;  1GTE A;  3T1A A;  4PWD B;  4WP9 A;  3MCS A;  4H4K C;  1ZYQ A;  1NJZ A;  1M5S A;  4K5R A;  2M8D B;  2QG9 B;  1FE0 A;  3OV7 A;  1S9G B;  3SI8 A;  1VIO A;  2H1Y A;  2MZ1 A;  4RNH A;  1NK7 A;  2BE9 B;  1X5T A;  3PKY A;  5IWA F;  3TAQ A;  4KHP F;  1EKS A;  3M8W A;  3T6B A;  2P9E A;  1RT3 B;  2H5J B;  3IRW P;  4WIQ A;  2UUW A;  1WF1 A;  1WOR A;  5ETL A;  5JVG Q;  3QGI A;  4RO0 A;  2JNJ A;  4PG7 A;  1SKW A;  1JJH A;  2W8K A;  4ED1 A;  1WHY A;  4U96 A;  2W9C B;  3F73 A;  1D1U A;  3OL9 A;  2B9Y A;  3HZG A;  2YNI A;  2CVE A;  5HN0 A;  4M63 A;  3OL8 A;  4KJI A;  1C0U B;  4JB8 B;  1RTI A;  3BKT A;  2VG5 A;  1T05 B;  2R3V A;  4QR2 A;  1CQM A;  4DR2 J;  3KHG A;  3Q0A A;  3VQT A;  3WZ0 A;  2YNH B;  3HO1 A;  4BCA A;  4EUV A;  3PG9 A;  2MGZ A;  1IKW A;  2ZUA A;  2UXD J;  2IY5 B;  4HDH A;  3C66 A;  1R0B G;  4KO0 A;  4DV1 J;  1RI7 A;  1APS A;  2N82 B;  1PIL A;  1KTV A;  2GVZ B;  1CSJ A;  3IN5 A;  3FQK A;  5B0B A;  1SJ1 A;  2ZM6 F;  3QAU A;  2C2O B;  3I4H X;  5CYM A;  3C6U B;  1MRO B;  1HHT P;  4PAA A;  2Z57 B;  1R8A A;  2VON A;  1FRX A;  3O1L A;  1LKZ A;  2YX7 A;  4DPT A;  1V5V A;  1CEZ A;  3KXD A;  5FD1 A;  1UVJ A;  5F8L A;  3LGH A;  4MFB B;  1N36 J;  2RE1 A;  2CPF A;  3CUL A;  4MK9 A;  3VAL A;  3S6E A;  3B4M A;  5T7L A;  1FKP B;  3RB3 A;  3BSN A;  1M5H A;  1X0P A;  3MAQ A;  1F9E B;  2DTJ A;  2DNR A;  1CS4 A;  2UUB F;  1RA7 A;  1RU1 A;  3C19 A;  3KK2 A;  1NUE A;  3TJA A;  3M2V A;  5HVG A;  4OLP A;  1IWA A;  2LEP A;  3V2U C;  9RUB A;  4DFK A;  3GIK A;  2LU2 A;  2CPJ A;  4IH5 A;  3ADA C;  2QE5 A;  3F41 A;  3QPI A;  4W92 B;  1PKU A;  5E5N A;  3QIP B;  4FVC A;  1S1T A;  3CDB A;  2A6M A;  4P9S A;  2EKY A;  1Y3J A;  2ZVS A;  3F56 A;  1I94 J;  1KLM B;  3ITH B;  2IDE A;  4R0J A;  1FNX H;  2FZK B;  4DX5 A;  3MTJ A;  2RRB A;  2MKY A;  2V69 A;  1R6V A;  1QAX A;  4GKJ J;  1O5J A;  2XMT A;  2ABY A;  3GYN A;  5B0G A;  1TK5 A;  3DHW C;  4FZV A;  4DLE A;  4GVL A;  3UDV A;  4OFZ A;  4KRW A;  1ZA2 B;  3RU0 A;  4USI A;  2ALY B;  2FLL A;  4JI1 J;  3MED A;  4ECX A;  3W60 A;  1KS2 A;  1D0E A;  1RAE B;  4LFC J;  3FZ2 A;  4OYP A;  1Q78 A;  4NLY A;  5D0E A;  2OEM A;  4C8K A;  1ZTW A;  2Y1I A;  1XC9 A;  2CZV C;  4JI3 F;  4LF1 A;  2HQ3 A;  4NLP A;  1EAR A;  3QT6 A;  3AQO A;  2AMC B;  2HIY A;  2ZBP A;  3GLJ A;  1IKY B;  4ECV A;  5C24 B;  3T1H F;  4ILM A;  4AL7 A;  3QQC D;  3W5Z A;  5IT4 A;  3OW2 R;  3KJV B;  4DL4 A;  2KU7 A;  3BR9 A;  5KFW A;  1F2H A;  1SC4 B;  2JRS A;  1NXI A;  5L38 A;  3R2D J;  3ZFV A;  1LWC A;  1Q5V A;  2PMH A;  2R8G A;  4ED7 A;  2RDD A;  3HF5 A;  2B7B B;  2DY9 A;  4NLW A;  4OYW A;  3OLA A;  1H6K X;  4LBI A;  1F3V A;  1SB6 A;  2LQ8 A;  5JJB A;  2AF6 A;  4WK3 A;  2B51 A;  5ETS A;  2G9O A;  2NLW A;  3POT B;  3CGI A;  5ITH A;  1JB0 C;  4OJG A;  3OFH A;  5F3Z A;  1YJ7 A;  3UI3 A;  2XMK A;  1QDU B;  5U47 A;  3AJ2 A;  1FWP A;  4OHX A;  1X31 C;  3QT5 A;  4LR8 A;  4CYU A;  3QJJ A;  2RHQ B;  5FLX Y;  2DT9 A;  2CQI A;  1RWM B;  5AXK A;  3HSJ A;  2KKH A;  4CLL A;  5K8P A;  2GFF A;  2WSF C;  2WW4 A;  3UQS A;  3AAW B;  1WNE A;  2NYI A;  4C0H A;  4F4Z A;  4NLG A;  1ULR A;  1C1B A;  2IM1 A;  3EGN A;  2YQ1 A;  4U8Y A;  2HWT A;  3EGV A;  5J2Q B;  3SQG A;  4FVM A;  1TK0 A;  4RU9 A;  2KJV A;  3V6K A;  5ETK A;  4GKK F;  1EAY C;  1RCX B;  2LFV A;  4IUF A;  5GAE I;  4OMF G;  2V5H G;  2X1F A;  1NZ8 A;  3TZY A;  2YX1 A;  4OYB A;  5BYQ A;  4F36 A;  1X7V A;  4ZVF A;  1ZBT A;  5CYQ A;  1S1U A;  2PDA A;  4RW8 B;  2C3Y A;  4FF3 A;  3VV2 B;  2W24 A;  4NEZ A;  3R7N B;  3IG1 A;  2VG7 B;  3B6B A;  4B9V A;  3DRX A;  4EWT A;  2DK2 A;  5HQL A;  2AP6 A;  1Z4U A;  2CQG A;  1SV5 A;  4QIG A;  4CO5 A;  1ZOT A;  2ASD A;  2Z58 B;  4F50 A;  1ZAX A;  4LF9 J;  2HND B;  3CJR A;  4OV1 A;  3QGP A;  4QW8 A;  2FIU A;  2ACM A;  5AJ3 J;  1OO0 B;  2QLX A;  3GYG A;  4MYT A;  2FY8 A;  3W61 A;  1HNW J;  4O3R A;  5FDL A;  3DMJ B;  3TAR A;  3UDC A;  2DH7 A;  4QPT A;  3TR5 A;  3MHY A;  4LUB A;  4OHV A;  4I68 A;  3CCV S;  1IKX A;  3VHQ A;  3BRE A;  4P52 A;  4Z7Y A;  4R0E A;  1JLE B;  4I2Q B;  3WHI A;  3NMR A;  1C4A A;  2YNF A;  3QZ7 A;  2U2F A;  1E6V A;  4KIA A;  4HKQ A;  3MAA B;  3CCU S;  2NR0 A;  2AJ4 A;  2QL7 B;  3IC1 A;  1HYS B;  1PSD A;  3IAM 9;  1NEE A;  3ENA A;  2IPO B;  1ZM3 A;  2P9C A;  2F4F A;  1UFW A;  3BQ2 A;  1KD1 T;  4ZA1 A;  4LR9 A;  5DQG A;  3CDA A;  4LRB A;  2A6O A;  4DF8 A;  1Z2L A;  4F3M A;  1ZTT A;  2MSS A;  2MZS A;  1B4S A;  2APO A;  3CME S;  3TUJ C;  3FSY A;  3DRR A;  2NPF A;  4C3M A;  3GCW P;  1VQ6 S;  4E98 A;  3NS7 B;  5IT9 Y;  1S4F A;  5KT6 A;  5E7O B;  6AT1 B;  4AT1 B;  5HP1 A;  4DV2 J;  4YDX A;  2OPQ A;  3DXS X;  2VHG A;  5D78 A;  3RW7 A;  3D6M B;  5GAG I;  2HSE B;  4ZIW A;  5HLF A;  3G6X A;  1GXT A;  2H48 B;  4NI2 B;  4Y34 A;  2HEK A;  2RSQ A;  1F1B B;  3OTE A;  2CUY A;  1AB8 A;  1RTD B;  2ZJR Q;  3EDQ B;  4PG8 A;  2XO6 A;  1TFW A;  1AW0 A;  3EPI A;  3P3D A;  3C14 A;  2A0F B;  4WII A;  3BGU A;  1Q8I A;  1KON A;  1G2E A;  1C1C A;  3HFV A;  4Q0B B;  3MCN A;  2U1A A;  2YKN B;  1VRT B;  1CJT B;  2IBO A;  4RW7 B;  2ZOM A;  4L75 A;  1Y0H A;  4K4X A;  3T1Y J;  1DQ8 A;  3JAM U;  4YY3 F;  3TJ9 A;  2VV5 A;  5GVQ A;  2N7Y A;  3DLE B;  1DLO A;  4JUZ A;  1YJ9 S;  2F1F A;  4C7Q A;  3D6F B;  2CRL A;  3Q86 A;  2PSZ A;  4K4S A;  4YS2 A;  3MR5 A;  1VQP S;  4F7V A;  3H59 A;  5EWG A;  4K4U A;  2OPR A;  3C15 A;  3AD7 C;  5DDO C;  4P2M A;  1H2U X;  2XI2 A;  3N9U C;  5HRO A;  2D41 A;  1G3O A;  5L9N A;  1RT5 B;  2GZO A;  4DR1 J;  2VPX B;  4A8M P;  5J2M A;  1U2F A;  2BKP A;  2OFH X;  1R31 A;  4ZK7 M;  2FZG B;  4LJM A;  1VC5 A;  3DKD A;  1X4E A; 
#chains in the Genus database with same CATH homology
 4DI6 A;  3EIC A;  1B99 A;  3BH6 B;  2DY9 A;  1NDP A;  4F36 A;  3L7U A;  2CWK A;  1F3F A;  3G2X A;  3WX8 A;  1PAE X;  1UCN A;  1S59 A;  3FBC A;  3BBC A;  2HVE A;  1S5Z A;  3FBE A;  1HLW A;  3EJM A;  3ELH A;  4HR2 A;  3ETM A;  5C7P A;  4W98 A;  1K44 A;  5CAA A;  3FC9 A;  3DDI A;  1U8W A;  3PJ9 A;  3GPA A;  1F6T A;  3B54 A;  3EVW A;  1NSP A;  3FBB A;  3B6B A;  1BHN A;  3ENA A;  1NSK L;  3Q83 A;  3NGT A;  4C6A A;  5BXI A;  2HUR A;  1JXV A;  1WKJ A;  3EMT A;  1WKK A;  3FBF A;  3ZTQ A;  2VU5 A;  4EK2 A;  1NPK A;  2NCK L;  2DXE A;  2DYA A;  1BUX A;  3EVM A;  3FCW A;  3GP9 A;  3FKB A;  1HIY A;  2BEF A;  2HVD A;  3EVO A;  3VVT A;  2BX6 A;  1MN7 A;  4UOF A;  4AND A;  1B4S A;  1NCL A;  3NGR A;  3NGS A;  1NUE A;  1WKL A;  3ZTR A;  3Q89 A;  1NSQ A;  4ANE A;  4FKY A;  1VYA A;  1BE4 A;  2DXD A;  1S57 A;  4KPC A;  3Q8V A;  3EM1 A;  3EE3 A;  4UOH A;  1XIQ A;  1W7W A;  3Q86 A;  1ZS6 A;  1NLK L;  3BH7 B;  1EHW A;  4ANC A;  4S0M A;  4DZ6 A;  1PKU A;  1XQI A;  3VGT A;  2AZ3 A;  3Q8U A;  1MN9 A;  3MPD A;  2ZUA A;  3BBB A;  3VGU A;  5CAB A;  3ZTP A;  3ZTO A;  2B8P A;  3FCV A;  1NHK L;  1LWX A;  1NB2 A;  3VGS A;  3JS9 A;  1NDL A;  5IOL A;  4WBF A;  4DUT A;  3VGV A;  3BBF A;  3Q8Y A;  4O0N A;  4F4A A;  4CP5 A;  2B8Q A;  2AZ1 A;  3VVU A;  4FKX A;  2DXF A;  3PRV A;  3NGU A;  4ENO A;  3R9L A;  3ZTS A;  1HHQ A;  1NDC A;  3DKD A;  4UOG A;  1LEO A;  1KDN A;  1NDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...