3FCWA

Crystal structure of the mimivirus ndk n62l mutant complexed with udp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
131
structure length
131
Chain Sequence
GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 40
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fcwA00
3BBFA 3NGTA 4UOGA 3FKBA 3ZTOA 1LWXA 3VVTA 1PKUA 3FCVA 4S0MA 3FC9A 1PAEX 3EE3A 1B99A 3VGTA 3ZTQA 1EHWA 1WKKA 1NB2A 4W98A 4F4AA 2DXFA 4EK2A 4CP5A 3ETMA 1HHQA 2DXDA 3WX8A 3Q8VA 3B54A 1W7WA 1S59A 3NGUA 3BBCA 2CWKA 2BX6A 1NDCA 3FCWA 2AZ3A 2VU5A 3PRVA 1UCNA 1ZS6A 2DXEA 2DYAA 2HVDA 4ENOA 1HLWA 3JS9A 3ENAA 3VVUA 4DI6A 1KDNA 4ANEA 3G2XA 1NSQA 4DZ6A 5BXIA 3EMTA 3EICA 3ZTPA 3BBBA 1NHKL 1HIYA 1WKJA 1NSKL 3L7UA 2AZ1A 4HR2A 3ZTRA 1U8WA 3DKDA 5CAAA 3VGSA 1MN9A 5CABA 1F6TA 4UOFA 1B4SA 3DDIA 1XQIA 3EJMA 3Q8YA 1XIQA 2HVEA 1BUXA 1WKLA 3VGUA 1BHNA 1LEOA 5C7PA 3BH6B 4O0NA 3EVOA 3B6BA 3MPDA 4KPCA 1NDKA 3EVMA 1NLKL 4ANDA 3Q86A 5IOLA 3FBBA 3ZTSA 4FKYA 2ZUAA 3Q83A 3EM1A 4C6AA 3BH7B 2HURA 3ELHA 1NSPA 1NDPA 1NUEA 3PJ9A 1MN7A 2NCKL 4DUTA 4WBFA 1NCLA 3FBFA 1NDLA 1S5ZA 4ANCA 1K44A 3GP9A 1F3FA 3GPAA 3FBCA 3NGSA 1VYAA 2BEFA 1JXVA 3Q89A 3EVWA 1BE4A 3Q8UA 3R9LA 4F36A 3NGRA 3FBEA 3VGVA 4UOHA 1NPKA 2B8PA 1S57A 2B8QA 2DY9A 4FKXA
chains in the Genus database with same CATH superfamily
2QTWA 1QSSA 4ETZA 1FNMA 1HWLA 4ZJQA 3QWPA 2DNZA 1VQLS 4KGZB 5IZHA 2IJFA 1PBUA 4B3TJ 2LU2A 1GX6A 4OHZA 5HVGA 1IKYB 3NAIA 3HI9A 3DYAA 4OYOA 2K7KA 4XDCA 4ECUA 1C2PA 1U4BA 3GJTB 4JI5J 5IT9U 2XQCA 2GGPA 4PG7A 3W9HA 4DV4J 3LP0A 4NYZA 3BN7A 4WXOA 5IV4A 1BQXA 1RWOB 2PMHA 3TR5A 5HJXA 3MR7A 1N6QA 1VRUB 1VQ5S 3M8RA 5GAEI 2IBOA 2H48B 2CXEA 1KHVA 2OHDA 1N5QA 1FJ7A 4NXMJ 4X64J 1P27B 1ZZNA 2AX1A 4LQ9A 3L9ZA 2HRTA 3J7YU 2NLWA 3FBEA 2NZ4A 4YS2A 3ET6B 5E33A 3VCDA 1F2HA 1D09B 2BKOA 2VJVA 1ZM9A 1RT1A 3LGHA 2V0NA 4L3KA 4CLKA 3HVWA 1YTYA 2Y1RI 5CZXA 3FRYA 5IV3A 4V1Ak 2A10A 3UVJB 1CG2A 1KS2A 3HK2A 4KV8B 4N7TA 2ZBQA 1EQMA 4CO4A 2R7SA 1MMLA 4F4KA 5ETRA 4AYBD 1HHSA 2YKNA 2DNQA 1HD1A 5HROA 4KE5A 4L76A 1HPZA 1XIQA 5KAKA 4DZDA 5HMWA 1WUUA 5D4OA 4CLPA 1ZAVA 3V81A 2CQDA 4ANDA 1N4LA 1X9SA 2HRUA 3EM1A 2KKHA 3ELHA 3DM2A 3DRRB 2FJEB 4G1PA 1FFGB 4J9UE 1U1RA 3EXYA 2IRXA 1X4BA 3AD7C 5K20B 2CVEA 4ZMMA 4RR5A 4H4MA 2VG6B 4HLBA 2HMIB 1CEZA 5KT6A 3UD3P 4OZLA 1GX5A 1S1TA 4F67A 2MKHA 4Z37A 4F50A 2ZH6A 3M30B 1WF0A 4ENOA 2DEJA 1KDNA 1WDTA 3EGVA 3OR1A 2QL5B 4ZHRA 3DOMB 3JQMA 3CWJA 1Q5VA 4JI2F 5I3PA 1T9WA 1IWAA 2Y0SD 1HBMA 1U0HB 2P9GA 3EJMA 1FRKA 3DLEB 2UUCF 2KTQA 1UVJA 1O6XA 4I2PB 4DR4F 5A8RA 2JEIA 1N5YB 3HLUA 3MPDA 2WONA 4JI6F 5IOLA 3X3UA 1KTVA 4U95A 5HI7A 1OSCA 3R8YA 3TAMA 5H9FJ 3FBFA 2V8PA 2YH1A 4NLVA 3MZIA 3JTOA 1PILA 2IPOB 1HFEL 3IC1A 4IYQA 5ETVA 5F9NA 3BBFA 3NGTA 4FXVA 3O6QA 4KSEB 2Y8YA 3DRSB 5GAHU 1JLQA 5KFAA 3EE3A 3J81U 3HSZA 3CJKB 2BE7D 5CYJA 3AOAA 3ILLA 5I3UA 4CP5A 4LFAJ 3EUNA 3G6VA 1GMWA 3RAMA 4Q44A 4LJMA 1RLDA 3PRDA 4DXLA 2AZ3A 1VS3A 3FEXB 3H5SA 5KG4A 3US5A 1YJ9S 5ETQA 2F5GA 3A3PB 3LGMA 2KH9A 1JLBA 1BGXT 2QGFB 5K14B 4CLWA 1RCOB 4K5RA 1XERA 2VOPA 3MPWA 1XQIA 4K4YA 2DR9A 2JC0A 5KG0A 2QFIA 1APSA 3GG0A 5HMYA 1TMMA 2R2SA 4F25A 1UWAA 4RL1A 3PXGa 4N8NA 3HHLD 3BGRA 3D6MB 2LKZA 2LEBA 3EDQB 2OPPB 4LFBF 5HMZA 4DFMA 2OKQA 2KYZA 3ISZA 2DGOA 3DU6A 4HH0A 3H5YA 3FBCA 4NZ7A 4DQSA 3IN5A 1S1WA 3KLFB 3I0RB 2B6AB 1TK5A 4QYZJ 2VBYA 3BKUA 4NRUA 3M6VA 3W65A 2KJWA 2EEYA 2WHOA 1Q1KA 2GA7A 4ZA1A 3SMZA 5A0YB 3SI8A 5LSRA 3C66A 3V5RA 3V4MA 1NZ8A 4YB5A 3HZGA 3HCXA 1U49A 2VH7A 4YR3A 5H9EK 1GEHA 4CH7A 1A0OB 4DN0A 1TKDA 1RTHB 2WOMA 3QIDA 2JL9A 3PDNA 5B0EA 1F6TA 1IJFB 2B4OA 1XMQJ 3OSPA 4PXBA 5DM6Q 2Z30B 3AODA 5D3GA 2CDRB 5LMUF 2QV6A 4QIGA 2HBQB 3MEKA 3R27A 3TVKA 4TQRA 2YKOA 3ZZRA 4DWIA 2K3KA 2V8DA 4Y3CA 4HH1A 2UUAJ 5D15A 4M63A 4P7TA 4OZ5A 3GWCA 2HVIA 4ECVA 1KTQA 2EK1A 3BSAA 4PPDA 4Q43A 3KK2A 1X5PA 4ZS6A 2UVUA 2FZKB 5D4NA 2UP1A 2VFTA 2H4WB 4TY9A 3KLHA 2LVWA 4DV2J 4ZIWA 1SKWA 4LF4J 1C1BB 2XO6A 3BGLA 4UTGA 1T9UA 3G6ES 5FLXY 4LBPA 2XWYA 2FLNA 3IBWA 3PW2A 2BYCA 4OI4A 3M6WA 3KJVB 2FB0A 3AD8C 4F02A 3OFFA 4OJHA 4Q8FA 2VA3A 4N47A 3CJQA 3SBMA 3OBIA 4LF2A 3W61A 1BUXA 4HHJA 1UETA 3ADAC 4ZVEA 4RUBA 1NH7A 3HHLB 2GCFA 2V34A 4U8VA 3CCWA 2HFUA 3B82A 4DSFA 3KG0A 2UXDF 3J7Z5 3GB0A 4WFAQ 2PA3A 2AHOB 1NDLA 1CVJA 1U48A 4Q7AA 2F65A 2M70A 5SZTA 3PW4A 1GH8A 1U45A 3R2CJ 4I6WA 3C8YA 3OL7A 2ADCA 4JI4J 2YVSA 1NK0A 2ZJRQ 5M2UA 3CDWA 1REGX 2UXCJ 4LRAA 3QGHA 1SBRA 3ENVA 3D3BJ 3WX8A 2ILZA 3Q8VA 2ZZMA 1R8AA 1JK9B 2BACA 4GVLA 4QZVB 4NRTA 4TXSA 1TKZB 4CLZA 2RKIA 3CW2C 1AYEA 1QDUB 2V2QA 5A8WB 5KFWA 2F7VA 3AA9A 1BY9A 4YY3F 2OP5A 3Q8YA 3R7NB 2HVEA 1SJ1A 3VAGA 2ZJQQ 4KPYA 2FJXA 2VQFF 2HFVA 3L09A 3GV8B 3Q83A 1REVA 3UFCX 3L3CA 3NGKA 3MMAA 3A8EA 1EAYC 3KHRA 5CA5A 3GSIA 8AT1B 2HWHA 3MUMP 2B8QA 5KG7A 1B0PA 2QEXS 2NYIA 4UZCA 3POTB 5KG5A 5J2PA 1HA1A 1HQUB 3K5OA 3TUPA 2HHUA 4OI6A 1MU2B 3LP1B 2IDLA 3OPKA 3J7ZT 2DHAA 3AXKA 4EEYA 1HWJA 2AF6A 4O44A 3LP2B 4K8RA 2P5VA 3GU0A 2XHCA 4LRBA 2EPIA 1WHXA 2BJDA 4OX7A 3VF0B 1GK8A 1NJZA 3MEGA 2Z58B 1W26A 3PKYA 1IBLJ 4EFAC 4DQPA 1LK5A 3PHTA 5LXYA 1ZTTA 2J8AA 1R8BA 2FC8A 1ULRA 1Q8BA 1IKVA 3PFEA 4DCPB 3C6TB 4OI1A 2J6SA 1JJHA 1MSWD 1EP4B 2MQPA 2ZOFA 2ZWOA 4ZVSB 3FFIA 2CIMA 3S1TA 2DH8A 1CJKB 1WG5A 4QIFA 3Q8UA 3SV4A 4YN3B 4YDDB 1VOMA 4DUZJ 2HGNA 1I6JA 2A0FB 1Z4UA 4JV5J 2J9EA 3KJFB 3PG9A 3R3TA 3SDEA 5F8JA 3HT0A 1S1VA 3D6HB 1NK5A 2HBYB 1EARA 2MZTA 5GADI 1N0VC 4DR5J 2YXLA 5A6WA 2ZC4A 5L8RC 1VQ8S 1RKJA 3KLGB 2YKMB 3CIZA 3IR7B 4KTQA 1HYSB 3OTOJ 3OUYB 3M9MB 1CLFA 2J9DE 1XNRJ 4DV5F 1SIWB 2PEBA 4CTAB 1JLEA 5CAAA 3P4UB 1Z1ZA 1RT3A 4ZLPA 2P8IA 1FE0A 3GG1A 2H9ZA 1FRIA 5FLXU 3LTOA 3QT8A 3RBEA 2DCLA 4C4WA 1S99A 5DDRC 3NNCA 4A8WA 3CUNA 4NL5A 2H5EA 4EYIB 4L72B 1RBOB 3QJLA 1RBAA 3RU0A 4HVZA 2FQQB 4P74A 1WSVA 2IM1A 3DOKA 3ZNJ1 2AGPA 5HP1A 3L7OA 1S6QB 3TA0A 3L4BC 3R5GA 3P45B 2ADBA 4DDFA 4LBHA 1PYOB 2CJBA 3VTIA 4X4TA 5B0CA 1WKKA 2D74B 4P73A 2C2DA 3QBCA 4HHHA 2F4VF 2MEWA 4J9VA 3C2PA 4WFYA 4K2JA 4ZKAA 4ZCLA 2CPDA 2LXFA 1ZYQA 1HWKA 2MZQA 4ANEA 2AYBA 3AJ1A 1S7IA 3ITHB 3MCSA 4F2RA 3BQ0A 2HEKA 2I5JA 4NE9C 1NU4A 3Q23A 2DO4A 1X0FA 2RU3A 1LOUA 1UWBB 3V2UC 3H25A 4ZK7M 2UU9J 1VC5A 4NLYA 3G8QA 2PGCA 4JI8J 4F3MA 4PWWA 3EWGA 5DQGA 4F04B 1FK9B 4ICLB 5KFKA 5IT0A 4QW9A 4WU3A 2OO4A 2KO1A 4Q2LA 5L9XA 1HNVA 5J2MB 4YDXA 2PDAA 1NK4A 3NMAA 1IKWB 4W92B 4I2QB 4F4XA 2G2YA 2ASLA 2H5IB 4NI2B 4EGLA 2XLKA 2QMUB 5B0DA 2RRAA 3FCVA 2YPYA 2RQMA 1OY8A 3I31A 1RT2B 1HKAA 3PV8A 1LNQA 2QFJA 1IM4A 4F4AA 5EWGA 1ZM2A 1SUQB 5K8MA 2E5LJ 1VBXA 1WF2A 2XY5A 2VASA 1RDRA 4AT1B 3ENAA 5C2GA 3GONA 4JBCA 4QYZK 2DNGA 3RBXA 2DNOA 2VF3A 3EICA 2J5AA 1RWMB 2QC3A 3KKFA 2BJ8A 2BJ1A 1D9DA 4M5KA 5GADU 1WC0A 2RE1A 4WYLA 3NMRA 2BXJA 3CVKA 3AQPA 3C14A 1O5JA 2HHXA 5FDLA 5DG7A 3TUJC 2D9PA 3MMBA 4K50A 5U47A 2UUBF 3CO9A 2QZ8A 3ULHA 4DV3F 2QLBB 4C8MA 5H1SV 4DV6F 1I94F 1GXTA 3A1YG 1UFWA 2ZFHA 1QJHA 3M1VA 2K8GA 1IKXB 2VV5A 1LQ9A 1S0NA 3NNHA 1OY6A 2B9WA 1B70B 2V4JA 4WIQA 2MHNA 2Q66A 5D6GA 2KRBA 2ZBPA 1AXQA 1HNXF 2YWEA 3BYRA 4NLUA 1FKOA 4WP3A 2GMHA 2CG8A 3ZFVA 2LA4A 2CQBA 3KDNA 4KHPJ 1SB6A 1BQNB 3MM7B 3I9ZA 4D3GA 3PX0A 5F41A 4KIAA 2C3UA 3NBPB 4ED3A 1GFWB 1Y4ZB 2AEJA 4WIIA 3CJ4A 3DLLQ 4ED5A 3K5NA 2OPSA 4NEYA 3AT1B 1DRZA 2LXIA 2WW8A 1MMDA 4PPZA 2AV5A 3HKWA 3NLCA 4U9RA 2ZHBA 5D77A 4A8FA 8ATCB 1TKTB 4RW6B 4ECWA 3R9LA 4OZ3A 1YRTA 1R0CB 1QTNB 1RAIB 2ATCB 2LLZA 3ZXWA 2MQQA 2MJNA 4F4ZA 2D7SA 4TLRA 3GIMA 3PR4A 4KGXB 3KUGA 4LR7A 5GAGU 1AUDA 1RTDB 1CS4A 1VQ4S 3VZIA 2H54B 1GNKA 1VMBA 3MPUB 2KG1A 2IY5B 2M9KA 5LSLA 7AT1B 4F0MA 1T03A 3KLIA 1F60B 3O1LA 2PFFB 2FY1A 1KC8T 2Z2LA 4ZJLA 1KLMB 1TL7A 1MN9A 3PHEA 5KFHA 3H59A 3TZWA 4DFKA 5KFUA 1FKPA 2YWKA 1HBOA 3SCIE 3P5BP 5CH7B 4ZPCA 1GMUA 3SXLA 2KRRA 4KFBA 1LXJA 2QLXA 4IO1A 2FVQA 1RT4A 3DOLB 4WFNQ 4K0KJ 4ZVTB 4ANCA 4DV7J 4FF1A 3SQGB 4JV2A 1J2VA 1ZBTA 2VBWA 3RB3A 5AJ3J 4UW2A 1RCXB 1IUJA 2ATLA 3AB2B 2HNZA 2NREA 4YEAA 1NMEB 3I96A 4K4TA 3R5AA 1F9FA 3DYAB 4X62F 3OVBA 5DLFA 2ZHAA 4EU0A 1M5PC 3RAXA 2M52A 2VZ9A 2KXNB 3MM8A 2XTJP 4UUWA 2C42A 2MDAA 4NLGA 1VLYA 2NXJA 4WFXA 5FD1A 2HNYA 2V2ZA 2SXLA 1SCJB 3M32B 3LOUA 4GO7X 3UN2A 1FHTA 1V3SA 1QY7A 2ZH4A 2YH0A 2ACYA 4C11A 4C0OC 5HATA 2HAIA 3W5ZA 1D8YA 1ZPVA 2RAQA 4BHQA 3K7RA 1N33J 2ILYA 5KT7A 4IFYA 2BMBA 1OO0B 3UWTA 3DC2A 1NK7A 3VAJA 2IHR1 3T19A 2UXBJ 4B3RF 1YK9A 4ZPTR 2V4RA 4WPAA 4B02A 4ILLA 4IG0A 3I6PA 3PO4A 1U1KA 2WVDA 4URSA 4CLLA 3H4BA 4OIXA 3DLJA 2O5DA 1KSPA 1HQEA 3PW5A 4FYXB 5LMNJ 1O0PA 1NKEA 5CQGA 3QNWB 1VRQC 3ETMA 1Q8IA 3QRQA 4ZOSA 3H98A 3GCWP 5DDPC 4FNIA 3OL8A 2BR0A 2CKWA 2YKNB 2ZUGA 3E2EA 2EBGA 4DZ6A 3FJ2A 3OR2A 4FYDA 1WI6A 1N5TA 2GQ2A 2Q6BA 2AKWB 4J90A 3GYNA 4NASA 1FDNA 2UZAA 3NWGA 1Y5IB 3MF5A 3TWZA 4KKOA 1R8HA 3LGNA 1YJRA 2JOQA 2Z57B 1A9NB 2C2ZB 2N3OA 3PYGA 2FVCA 4HACB 4QW8A 2AU0A 4NZ6A 3GYXB 4OL8A 4DCOB 2V9WA 2DY1A 1K44A 3M8QB 4H4MB 1VYAA 3V6DB 2HHVA 4DX5A 1QVGR 2NSCA 1LFPA 3IWLA 3CJRA 4TNOA 5HVFA 2CADA 1ZH5A 1JIHA 4DOZA 5KFDA 1S1TB 3AQOA 3CJ5A 2BE2B 4DS4A 1PAEX 5K8NA 4EBCA 1SQGA 4MT1A 3ISNC 2R2TA 2LECA 1EX8A 2MB0B 1UL3A 3OR1B 3GJSB 1RT5B 4ZHRB 2CQ1A 4O3QA 1DLOB 1HMVB 1HHTP 4M5JA 2HG4A 2I0XA 2KXFA 1FDDA 1YJNS 2WVEA 3MOJB 2F40A 3CNQP 3I82A 1SC3B 2IVYA 4A8QA 4NXNF 3M9OB 1OQ3A 4FN5A 4X4QA 1YJ7A 4MYUA 2HQCA 2VFVA 1QAYA 3PEHA 3DGPA 1M90T 1KVIA 2ZZTA 3WBZA 2W2QP 2EWHA 1CJTB 1D3WA 4CLUA 2XMJA 4EO6A 3FMBA 3AFGA 3RB0A 2KM8C 4J9MA 1JLQB 2FHJA 2A6MA 4IFVA 4IH7A 3QGPA 2CQ0A 1QLNA 3DCAA 4GKKF 2V94A 4RPFA 3CJ2A 2HHSA 5HQ8A 1HNWF 3EGZA 2P6TA 4ETXA 3CDAA 4PAAA 3P49B 4ZN3A 4C3LA 4AL6A 3PX4A 2P9CA 2CWKA 1JLBB 4X84A 2VPXB 3HXMA 5DRKA 1GXUA 3WDOA 2QO3A 2E5JA 3RYLA 3RR8A 1S0VA 2MY8A 1E6VA 2RRNA 2WCXA 4NCBA 3FUYA 3D0IE 3BGRB 4RUAA 1DFDA 1SV5A 4O4GB 3SV3A 3S7RA 4NYOA 2C3PA 4J7CA 2AP6A 1NRKA 1FFWB 4FF4A 4CO0A 2Z2ZA 4B9TA 3EGWB 2LU1A 2EFQA 3C19A 4DSJA 1J5EJ 1XMBA 1SJ4P 3IWNC 2EK6A 4FXWA 2VC0A 1RTIA 2CJXB 1JJ4A 1SQFA 4BS2A 2B4UA 5D4LA 1S9GB 5IQQA 1RAJA 4P10A 2H1YA 3IR5B 2VB6A 3AAWB 4EZ9A 1F9EB 2ROPA 4MK9A 3TJAA 4JI5F 4RUHA 2X1BA 4DLEA 4MIBA 2DO0A 1RAHB 4DV4F 4DUYJ 1S10A 3WIVA 4B3OB 1BQMA 1HLWA 2CQPA 5K5MA 4P52A 4JV0A 5D3GB 1HBNA 3BPSP 3DN9A 1Z2ZA 3U02A 1XMOF 1XEZA 4LSLA 3DNCA 3KK1B 1VC6A 3DRPA 4J9RA 1CULB 2BQUA 3N6MA 4OYWA 4X64F 1YSJA 1U8SA 2BKPA 2AT1B 4L74A 2RUGA 1FF2A 2J6TA 1GQEA 5E41A 1MN7A 1WEXA 1VIXA 2X3GA 1FRXA 5LT5A 2LEPA 3KLHB 3I87A 1H3DA 1FEHA 4CT9A 1JMTA 1XNQJ 2OPQA 1VQMS 3BREA 4J91A 5KG3A 1O51A 5G0RA 2RQ4A 3G71S 1M1KT 1QSLA 5L38A 1DAXA 5ADZA 1AT1B 2QX0A 4FF3A 3HVRA 1C4AA 3BR9A 2Z8QA 3VAKA 4ED0A 1P9YA 2VONA 2IA0A 4X66J 3MM5B 1B64A 3EMTA 1YITS 1C0TB 3L7PA 1TL3A 4PYAA 3HSJA 3CCZA 1L3SA 3K0JA 1LW2A 2LQBA 4QIVA 3CMQA 3QLHA 1D1UA 2H65B 1BLUA 5ETKA 1SH2A 1Y10A 4KO0A 2XULA 1NPRA 1AZSA 2Y1JA 4PWDB 1Q95G 2DKOB 5KG6A 1J5OB 3TANA 1PBAA 3H7HB 1Q16B 2B9XA 2UUWA 2XNRA 4OV1A 1H6KX 5C42A 2KI2A 3NNAA 2PMWA 4RBUA 3N0VA 1TK0A 2CPHA 1UAWA 1K1QA 5HAOA 1QAIA 1UP1A 5L39A 4QR1A 3CD7A 4USHA 1Z2LA 2YNIA 3OW2R 3ILIA 5GMKa 1K0VA 1VBZA 4GKJJ 5HVHA 3TZZA 4FS1A 2XMWA 2CG4A 4ID5A 4CLTA 3M7VA 3MCOA 4RW4A 2RKIB 2ASDA 1JQGA 2LQ8A 1ZS6A 2IRYA 4ED8A 3T3FA 1S12A 2MLXA 2KJVA 5J1EA 2HHQA 3DKDA 2FPHX 1RWNB 3A12A 2I8EA 4ZVHA 4K59A 3TUIC 2CQHA 2JEGA 3MEDA 3PJXA 4C7QA 1VRTB 3MMAB 4EI2A 4LF9J 4CH0S 4ZVPB 5GVQA 1Q78A 4FNHA 1U26A 5KFEA 4ZLLA 1VCTA 1YKWA 1WC4A 2HNDA 4Y65A 5KFMA 1KP6A 1CC8A 1R31A 2B5JA 4X4RA 4LFAF 2N4DA 2QG9B 2CPFA 3VAHA 4XAKA 1S9EB 4LR9A 4USJC 2OAUA 4P71A 1UPMB 1YQHA 2M0GB 4O44B 3T1HJ 1T0TV 2IC3B 2MQ8A 1RAEB 4QU7A 3HHNB 3EYZA 2ZC3A 4ILMA 2GIQA 5E3RA 2UV8G 4JI3J 2V6AA 2RDJA 3MFIA 5G4DA 4QR0A 3P8BB 2LP4A 3VHQA 2MGZB 5J2NA 5LSOA 9ATCB 1FE4A 4A8XA 2PSZA 4N8OA 4G1QA 1AROP 1IBKF 1EJ7L 2QE5A 4WFZA 2LA6A 4PXEA 3EXCX 4I67A 2PC6A 3OL6A 2GVZB 3SCLE 4I6YA 3RB4A 4JI1F 4LUBA 3K59A 1FD8A 2WBMA 5IFMA 2W2OP 2NS1B 3MECB 1NHUA 4DV1J 4DU7A 1KR4A 4L6V3 3GP9A 1JKHB 2VL1A 2PA8D 3WX4A 2VPZB 2XEXA 3K17A 1XR5A 1LWXA 5D0HA 4C8YA 2JH3A 1CJUA 4WTOB 2AJ1A 1S6OA 1K1SA 5ETLA 4IOCQ 2DGSA 1FRHA 1MG7A 3GLJA 3UCGA 2U1AA 4KYZA 2BOAA 2H5JB 1XMQF 1RT3B 4A48A 4BWMA 2YWFA 1B7FA 3D68A 3JYTB 1DTTA 3AJ2A 5DM7Q 1S77D 1U1PA 2E7XA 1TMJA 1S1UA 4ZCMA 1WJ9A 2RVJA 2I38A 3BO2A 2W2PP 5CYMA 2UUAF 5L1LA 2F4FA 1KD1T 4NZ0A 3IR6B 2ZDPA 5HP1B 4UQTA 2G2ZA 2IYGA 1AFJA 1RACB 9RUBA 2OJ3A 1FWKA 4M5NA 4HHUA 3IS9B 4PZVA 2D1CA 2DGWA 4MTPA 1HNZF 3HZEA 5KFBA 3S8SA 3JTPA 3KUHA 1A6LA 1A7GE 4IH6A 3M2VA 3BM7A 4NWBA 3M2UA 1U7LA 1VLOA 3DLBA 3E01B 5RUBA 1S79A 3KHGA 5IT4A 2RB7A 2I5JB 3TVYA 4R0JA 1M5HA 3VVUA 1NSQA 4U7CA 2V68A 3PO5A 1PSDA 1LWFA 3MMCA 5KFOA 3CCUS 2GW8A 2GAGC 2H51B 2PT0A 4CWBA 2BJ3A 3IMQJ 3W2VA 1VDHA 2LQ5A 3SSRA 3AA8A 1HNVB 1BHNA 2EFOA 1LW0B 4JP8A 3TX8A 1JLCA 3RGIA 4DQQA 2IA6A 1RT7A 2VG5B 1H2UX 4K4ZA 1PGZA 4C6AA 5A76A 3OXFA 5BYQA 5T7LB 4NMLA 2D3OR 1F2GA 5SUHA 2HFZA 1XJWB 4JI4F 4AD6A 2J76E 2KVIA 4KY3A 2B8PA 3W66A 1KN6A 2UXCF 3CB4A 3NCRA 3WZ0A 4ES1A 2GNKA 3IGNA 1FVQA 3I32A 1PKUA 1UFLA 2NPFA 2PIIA 5A8KB 4LF6J 2AGOA 2CPJA 2L9DA 1YJUA 3M8YA 1WSRA 4USUA 4IG3A 2MKCA 4JI6J 1PJ5A 2M88A 2WSEC 5F8LA 3KG1A 1HW8A 1TKXA 3NS5A 4FPRA 3D54A 1RWXB 2W2NP 4WZMA 3M8ZA 4CLFA 1TFWA 1YLXA 1BC6A 3VR1A 4MJKA 2EKYA 4HR2A 2DIVA 4DQIA 2W9AA 1CPZA 2W4CA 3C14B 2BW2A 5B0BA 4DR3F 1GT8A 2CJQA 4X4SA 4DR2J 4ITSA 3GIIA 1QE1B 3MMBB 5KT4A 3H4DA 4I7FA 3WIUA 2PI5A 3DLKB 2HGMA 5DQHA 4KGMA 3RRKA 5IT9Y 1FXDA 2HKEA 1ICEB 1CC7A 3R5CA 2VIHA 1YX2A 5CXTA 3M1VB 3NGSA 1HR0F 2PI4A 4O3NA 4F36A 3SIPB 1RKIA 1RYRA 4I69A 1NJXA 2V4JB 5BYRA 5JMNA 1WC5A 2YX4A 1WHWA 1L3UA 1AW0A 1YRXA 1FKOB 2W7PA 5KFLA 2N3LA 3MR5A 3LALA 3NGUA 2P2CB 4C98A 2OFGX 2YX1A 2ZZNA 1IBLF 1FCAA 4WK3A 3OTCA 1RAFB 2R4FA 4ECSA 2V8HA 3L7UA 4Q2MA 3K8VA 1IQTA 3RJMB 2GJIA 4PUOA 3CCES 1XK8A 4FS2A 1IKYA 5E5NA 1U1QA 3HVTB 1NAQA 4FVCA 2YY3A 2D3ZA 4ED2A 4DL5A 3NS6A 4IR9A 1X4CA 4DUZF 4LT6A 5B0AA 3M8SA 2MLYA 2PO4A 3BKFA 3UPFA 4KHMA 3I0SA 5LMUJ 2EW9A 2W8KA 2HQGA 4DR5F 3KFWX 5L46A 3UR0A 2ZITA 3T5JA 2QA1A 2FZGB 4OYPA 4TQSA 5KFVA 1T03B 3KLIB 2QYCA 2RDDA 3SCKE 4DS5A 1XNRF 2BRKA 2FJVA 4AQYF 3J7YI 1UCNA 3MGJA 1TL7B 1JXLA 1IXKA 3ET6A 3FZBA 3E8OA 1PIEA 1FKPB 2APOA 1RUSA 2YKAA 2P9EA 1VR6A 3N6NA 1HBOB 2ZE2B 3CF5Q 4ZPVR 3E51A 5KT5A 5GMDA 2VICA 4OQJA 1WOOA 5EUHA 3CTRA 1JWWA 4RU9A 4KFBB 1QD1A 4OJ3A 2BVZA 3UVJA 3CCJS 2JHEA 5IXUA 3KK3A 3QRRA 4KV8A 4B3MJ 1UW4A 3J80Y 1NDPA 1XR6A 1OPIA 4E8UA 2BQ3A 1DQ8A 4E98A 4P2FA 1GMVA 2LMIA 5THWA 3G87A 1E6YB 4L75A 1FD2A 2ROGA 4R0EA 2PD1A 3OTBA 4BBYA 4C8NA 4IOAQ 1RABB 1R0BG 2BW7A 4HTJA 5AXKA 2J7KA 3H90A 1YGYA 3OD2A 3MM8B 2VQEF 4I64A 3SCJE 8RUCA 1OYEA 3JTNA 5HN0A 3PX6A 2ZD1B 4UY85 3DRRA 2CZ4A 2AJ0A 2HNYB 1ACMB 3HDSA 4NCGB 3CT9A 4F0HA 2MKKA 2IM2A 1X31C 1Q7LB 4EBDA 2K2PA 1Y7PA 2OD4A 2UU9F 2VG6A 4DL4A 3BQ2A 3IAM9 3DFEA 1KNZA 2F63A 3NY0A 2MMYA 4CRJA 2HPUA 1NZAA 4U7UD 3QWUA 5KFZA 1JLGB 5C7PA 5LJ5Y 3ZZ0A 4DEZA 3R6LB 1VQSA 3M30A 2DIUA 2Z0GA 1R0AB 4YOEA 4DSKA 2AW0A 2FZCB 2VFUA 1JJCB 3BDEA 4OFZA 3DOMA 1RISA 2FHMA 4CYUA 2QMWA 4C8KA 1FEEA 2WVFA 1XC9A 2QSFA 2CNNB 4JI0J 2CJAA 4XIUA 4K7QA 1HI0P 1U24A 5HL7Q 3D2WA 3DLEA 3FQLA 3UNGC 4B9SA 2MKJA 3CD5A 2N82B 4I2PA 2W2MP 4OJ1A 1VQ7S 1LFWA 3ETOA 3RR7A 2VQFJ 2J6UA 4DX6A 1KFSA 5LXRA 5KFCA 3GILA 3B4MA 3OR2B 4QWEA 4GVBB 4Y28C 2VA2A 5J2QB 1NO8A 1LWEA 4TU7A 3CGIA 4Y00A 1UA0A 3IM8A 1HIYA 2XHWA 1V3ZA 3D0HE 1WC1A 5KFIA 4M5IA 3DRSA 5GAHI 3D1OA 1KRPA 2NR0A 3F0NA 2BUNA 2JDJA 3DMJB 3QATA 1ROFA 2MZSA 4LR8A 3C15B 4QR2A 2FC9A 4UY8T 4U7UK 3MR2A 1U02A 4KPCA 2L9NA 2OD6A 3TQ1A 3BSNA 2R7RA 1GTHA 2VG7B 3QGGA 3BN4A 1TUVA 3BGUA 1M5KC 3R7SB 4P9SA 3FMWA 2QLJB 2O1PA 2LDIA 3KNGA 5DO2A 4LRFA 1CBKA 3MCNA 1MLAA 1U6FA 1H74A 4KGVB 3PACA 1S4FA 4YP3A 2ZKTA 3H42A 3I0RA 2QYGA 3K5MA 4PEOA 2KN4A 2PN6A 1G6BA 3UD5A 1KKHA 4O23A 4RLEA 2YX7A 4CH1A 1K9MT 4RZRA 4CCHA 4Q0BB 5I4MA 5HQMA 3CD0A 5A0YA 4LRCA 4RNNA 4A47A 1X8DA 1CQNA 2O67A 5IC6B 5LOQA 3BYPA 4G1IA 3HFVA 4DQRA 2DHGA 2CNKB 4FZVA 4ED4A 4C0HA 2NCKL 4M5GA 3PIOQ 1RWWB 2QT7A 2XZWA 5E3QA 5JJBA 2YQ3A 3NP5A 1CSJA 2B7CB 2BEFA 4NCAA 4YB7A 1HD0A 3VGVA 5KG1A 1HBUA 3RAQA 3ZTOA 1EQ0A 1DARA 2GVDB 4RNHA 1HARA 2XMMA 3J80U 3K5LA 1RK8A 3MM6B 1EHWA 1Q53A 4LF7F 3OTEA 4H4OA 4B9UA 2AJFE 3H40A 3HHEA 3JSMB 2FVPA 2W01A 1HWIA 2WVBA 5D0EA 2C28A 3GFZA 1YJVA 3W63A 1KQFB 5ETTA 3GFYA 2FTRA 3CDUA 3W5XA 1LWCA 1C1BA 3LW5C 4XK8C 5KT2A 4TVAB 1ZOTA 1GTEA 2F4VJ 3LF0A 3GIJA 3OLAA 2XM3A 3GFXA 3R2DJ 1EZZB 1N54B 3BDPA 5AJ3F 5DLGA 2MPUA 1Y00A 1RWKB 4YHHJ 2JLGA 1MW7A 4DR1J 3G9CA 4CO5A 3LANA 3VALA 3UDVA 3PVXA 4JV1A 2IDEA 2CWXA 1N5VA 4A46A 3S6EA 2CQCA 2XGPA 2RU9A 1T9VA 4R8UB 1KQGB 4NLOA 3HHLA 4LFCJ 1N8RT 2C3MA 2W4PA 4OI3A 1BQMB 3HSDA 2MSTA 4AFFA 1NDCA 1HBNB 2O01C 5LJ3Y 3F56A 4F8RA 3THVA 4LSLB 1H38A 2HVHA 1NEEA 4K4WA 3C6UB 2MHEA 2ZH5A 2R7VA 4CQ1A 1X4GA 2OEKA 5BR8J 2QA4G 2B7BB 2UVWA 5KTQA 2UXBF 4ID8A 4BCAA 2E29A 1WI8A 1NUEA 2ZH1A 4PQUA 5A8WA 2OPQB 3MXHP 2HQ3A 3GE9A 1XR7A 1OMSA 2AWZA 4DSEA 4DR6J 4M5LA 5LMNF 4KGKA 4JUZA 5AE1A 3K58A 2AYEA 4OX8A 1V5VA 2E5GA 3MEEB 3W9IA 1D0EA 1FNOA 2FHOB 2DXDA 2UUBJ 2MZRA 1DQAA 4ED1A 3SSSA 4ZPAA 1C0UB 1U2CA 1K73T 2GS8A 1AA1B 3GZ7A 3D1QA 1I94J 2Y8WA 3QLHB 3T5KA 2DNMA 1MROA 1FX4A 3VQTA 3PW0A 1U8WA 5F0WA 3POTA 1B4SA 2FGCA 3DDIA 4OV6A 1VJWA 4OX9F 1FESA 4I4BA 4WP8A 1MU2A 3LP1A 3MHYA 3LO3A 1FI4A 1FNXH 3LP2A 5IWAJ 4W4MA 3R97A 3GJQB 2I6WA 2YNIB 5EWFA 4CLYA 4P7VA 1RE1B 2HS0A 1TR0A 4NLSA 2ZH2A 4KT0C 3F44A 4MIAA 2GQCA 3VWSA 3C6TA 1YHQS 3NWRA 4RJVA 2XCAA 2XB2D 3QT5A 3QO9B 2J0XA 3HD2A 1EP4A 4PCQA 3P3DA 2M8HA 4GC6A 3HMJG 1CJKA 1L5UA 5DZ6A 3CMAS 4RNMA 5LM7E 3M2RA 3BV8A 1IR1A 3BBBA 1WKJA 5HBMB 1RGVA 3TUZC 3MWBA 3KJQB 4DPTA 2R2UA 2CZ9A 4MFBB 1F1BB 1Q0NA 3I4PA 1M1HA 4Q5VA 4KR0B 1NLKL 2HNDB 3ENQA 2R8JA 3GV7B 1OPZA 1HYSA 1YWXA 2Y3YA 2WTFA 2B5JB 2XSJB 3V4IB 4CTAA 4TYBA 1IBCB 2DGTA 4Y2KA 1I3OB 2XMAA 2KFYA 3H20A 3PW7A 1SI9A 1Q8KA 1UEVA 2C2OB 2AX0A 3S01A 2HK3A 2GV1A 3GJRB 5KFRA 1Y5NB 5F8HA 1Q86T 2YTCA 2DJWA 1H7WA 4J9SA 2Q3PA 4BC7A 4CI0B 4ED6A 2XS2A 2W4DA 5J2NB 3FEZA 2ZBIA 1S6QA 2IIHA 4R5PB 3C3LA 2E7VA 4G1QB 2KYXA 2CAJA 4NLTA 2AEFA 4USKA 1KOOA 4M8LA 3M6XA 2YNGA 1N5SA 5CABA 2OTLS 5EX3A 1DQ9A 1X4DA 1IQZA 1S1XB 4RX6A 4AXJA 4YUDA 4CDIA 3QJJA 3B6BA 4CO2A 2OLWA 2LQ9A 2G0JA 1U09A 3JSRA 5KFNA 3G6YA 1RHQB 2L9WA 3VV2B 4DPOA 4DX7A 3ISND 1KWMA 1RXOB 5L9NA 4WU2A 1CJUB 2RT3A 3BS9A 5AXMA 2FJBB 1S48A 1KHWA 1OQ6A 1M5VC 4DUYF 4L73A 3ZZYA 3I56S 1X4FA 1FK9A 1WF1A 3PIPQ 2KFZA 4V19J 2GHWA 2X7IA 3NXZA 1Q7YT 1UVNA 5J2MA 2GO8A 1AUSL 1T02A 3QAUA 4L3NA 2COLA 4AXIA 1IKWA 2BM1A 3PNIA 2EI5A 4WXWA 1QAXA 4DI6A 2JWNA 5K8PA 4NI2A 5KFYA 4ZJOA 1UVLA 3KLEB 1FT8A 4RBTA 1RTJA 1SC4B 1RT2A 4OHYA 1RWVB 1IJEB 1SL0A 5KFTA 3LH2S 4FYVB 5ITHA 4RWXA 5KFGA 4MKBA 3UR3C 1U1LA 1YI2S 4MK7A 6FD1A 3EVMA 2HS4A 4XO0A 4OZ0A 4JYAJ 3GR0A 4CZCA 1UJ6A 3GR1A 1XNQF 4O0IA 3G4SS 3TZYA 5BJRA 4F0KA 4Z7YA 2C2NA 4LSNB 3UDCA 2C3OA 2BKNA 3QT7A 2IM3A 3KG4A 3M2VB 3M2UB 2OH2A 1RP5A 2Y9HA 3KTQA 1GAOA 4NPOA 3FVYA 2UVRA 1FJGF 3FQKA 2WVCA 5D78A 2DTJA 1FTRA 2X51A 2V50A 4PWUA 2D69A 3CC2S 5H9EJ 1FXLA 2DNPA 4GRSA 1TAQA 4WFBQ 3MPYA 5J1PA 3V6JA 1LWFB 1Y9OA 3QGIA 1HNIB 4E0DA 2K1RA 5MAOA 2I9SA 4WZQA 3IO1A 1IKXA 3K89A 2CPYA 3C16B 2YWWA 3CCLS 5KFXA 4Q8EA 4CNZA 3DHXA 1ZZFA 1QVFR 1Y5LB 2W25A 2V5HG 1EKRA 1R6YA 4UQGA 2G1DA 1S6PB 1WHVA 4F26A 5MLCV 4ERDA 2R7OA 4ECTA 5KOXA 1WACA 3N01A 3Q24A 3NOGA 5H9FK 3CJ0A 1BQNA 2QN6B 3H0PA 3DI6B 5CCLA 4DHVA 5KFPA 2Q1LA 2HQDA 4DF4A 2BANA 3NBPA 1WC6A 3Q8QB 3LA0A 4UUXA 3G96A 4YR2A 2GMJA 2B4PA 4EYHB 3GV5B 2MKYA 3UN5A 1TKTA 2DNYA 3D28A 3T41A 3MAAB 4J9OA 3CJSA 2FDNA 3PR5B 2EFGA 3IRXA 2DPJA 2YQ0A 1F0XA 2DH7A 2DGQA 2DK2A 3W2WB 4X2BA 4HT5A 1EETB 1CJVB 2DT9A 2BE9B 1X0PA 4I7FB 4IDKB 1HNWJ 3QQCD 3UD4P 2NPIA 5GAGI 3OLBA 2P6SA 2ZJPQ 1RTDA 3A3OB 3W64A 2E9TA 3BQ1A 1H98A 4ELTA 2KM8B 1YBTA 5E3PA 1Q5YA 1OSDA 3HD1A 1NJWA 4IO9Q 2HURA 1KLMA 1JLAB 4DLGA 2HFOA 2K3IA 2EG1A 2LCWA 3QIPB 3KWMA 1FO1A 3Q0AA 1B99A 3B8HA 5A2QY 1Y11A 4MKVA 5AXNA 4P75A 3B54A 1P9QC 4X4UA 3DOLA 2YNFA 2NXUA 2W9BA 5C24B 4OMFG 3SQGA 2VU5A 4M5DB 2IVMA 3PRVA 4FPIA 2R9LA 3JS9A 3I9V9 2AJQA 2OI2A 2IJNA 4PUOB 3W3SA 2AYMA 1RJJA 4I6AA 3IWXA 1PC5A 1U0SA 2EBEA 2B51A 5F3TA 2Q6CA 1FJCA 1UMJA 2CJYB 3CXCR 1OYDA 1PG5B 2EFNA 4DV1F 4DBQA 4OZ2A 2ZHOA 1C1CB 4QWCA 3QZ8A 1LXNA 3M32A 4ZP8A 3THTA 4LF5J 4NLWA 5FIIA 3I0SB 3CD6S 3OV7A 1XMOJ 4NX9A 3EVWA 1KLNA 5KFQA 2OFHX 4OYAA 5JXSA 4N41A 2HHHJ 3TOQA 2WW4A 2YKPA 3F41A 1SVDA 2YNHB 1R6VA 4KBIA 2XZDB 1SC6A 2CDQA 1F5BA 1WORA 5I42B 2B43A 2DXFA 4USMA 2ZM6F 1WG4A 1F5AA 4N76A 3D7SB 1FXRA 2R8KA 2RF2A 1CQMA 2XYGB 2VBZA 4M95A 1RI7A 1WDDA 3BR8A 1T05B 3KUEA 3BEGB 3DLGB 1H73A 1MMNA 5DGAA 2EC2A 3BPDA 2BJ9A 1BD6A 3IXQA 5BYSA 2C22A 3DU5A 3AOCA 4ZLNA 2HVZA 2MQLA 3TO8A 3PYEA 3KK3B 1WKLA 4O4RA 2HWIA 4ZVGA 1R8CA 2PE8A 4AE5A 2JZ5A 3IG1B 1IBMJ 4DUTA 1N48A 4ZP6A 4RW8A 2M7SA 1B3TA 3WQPA 4KQZA 1RHUB 4V19X 1WOPA 4U8YA 2B0GA 1KBRA 2OPRB 4ECXA 3SSQA 1YDLA 4HACA 4K4XA 4PABA 3W5YA 2IAJB 2RDIA 3FZ2A 3T1YF 1RWPB 3M8QA 3V6DA 1TV6B 4EO8A 3G2XA 5C25A 2NZCA 4A8KA 1ZPWX 2GHPA 4OX6A 1UTAA 3I4HX 2G0CA 1UJ5A 1UKUA 4RW7B 2BE2A 4KJIA 1F5CA 2VFRA 3V6HA 2EFPA 3QSYB 4CO3A 4DPYA 2JRSA 2H3EB 3AH6A 2HIQA 2K7JA 2GZOA 3K8WA 1RT5A 4X65J 5E3CA 2DNRA 4CYUB 1DLOA 1NSPA 1HMVA 1D9AA 3TW0A 2BZ2A 4A8MP 4IRKA 3G6XA 1S5ZA 2V8VA 5EN1A 1D9FA 1YJTA 3FK4A 4WYWA 4LF6F 3JQJA 4ILRA 3MAQA 2QL7B 1ZM4A 1SPBP 2KT5A 3MAHA 2GGPB 1R8PA 3CCVS 4ZCKA 1EKSA 2HWTA 3LP0B 2KHCA 1M5OC 4IQMA 1S6UA 1SKRA 3KHHA 2A1BA 2VPYB 3BJYA 1S76D 2K06A 4PXDA 1CJTA 3CMES 4QOTA 1LWEB 1N6QB 2BABA 3ILJA 5GAEU 4O3PA 2DGUA 3OHAA 3QRPA 4AL5A 1HQ2A 2E1CA 4DR2F 4XPEA 2BA9A 5A2QU 4PG5A 4B3SF 2YWGA 4WJBA 3KYLA 3V6KA 2CFXA 4LF8F 1G2EA 3NAHA 5T14A 4BC9A 4OLPA 3KNAA 4OLOA 2J0SD 2RQCA 1RT1B 1H72C 2F8MA 2FD2A 4BLGA 1GMWD 1DTQA 1YBAA 2ZH9A 4K4SA 3H2VE 3G82A 3QT6A 1BE4A 2RS2A 2Z2MA 4HDHA 3TARA 1IBKJ 1ZAWA 4O4GA 3VVTA 4LQ3A 1RYSA 5AE3A 1FWPA 2BOPA 5HROB 1NJIT 4JI1J 3CCQS 1HPZB 1RSCA 2XMTA 4U6PA 1UVIA 2D9OA 2R8IA 3V81B 3GIRA 2C2MB 4RW9A 4CM2A 2E1AA 2ZEJA 2DNNA 2E1PA 3DM2B 3KJNB 1S9GA 4OYMA 4P2SA 3Q22A 5F8MA 4RKUC 2E9RX 4QWAA 1VGYA 3BSOA 4RBVA 4B3OA 2DB1A 1T9XA 4DPXA 1RB0A 3A4TA 1HBUB 3PM9A 1PAUB 3U7JA 2ERRA 3KK1A 1WELA 2MJUA 3D6FB 4X4NA 3A13A 1S57A 5M2RA 3ENWA 1VI7A 4NMXA 5B09A 1CULA 4H4OB 3UI3A 1U1NA 4CO1A 2HZCA 5D8HB 3TZXA 1HBMB 4DN9A 1RAAB 1PJ7A 5DGBA 5L1JA 4X4OA 5DDQC 5A8RB 4FDFA 1BWEA 2WONB 2AMCB 3JQKA 3RTVA 4F4YA 2E66A 4OZJA 2RHQB 5CHCB 1SH0A 5I3QA 4PQAA 1LWCB 2ZOMA 3TAMB 7FDRA 3LPEA 4CT8A 3UQSA 5DETA 2B56A 1FKAF 4ALZA 2JX2A 2DVIA 1TP7A 4PG8A 1HNZJ 1RHMB 2XLIA 4B3MF 2DRBA 1LEOA 5IS2A 1Q79A 5HSPA 5D0RA 5I3UB 3ZTSA 3MM5A 3W1YC 2J9CA 1Q82T 1C0TA 1NCLA 1U2FA 2D3O1 3UDEA 1TU0B 1RU1A 5ETPA 1NPKA 2DY9A 1SQEA 1BXNA 2DPIA 5KFSA 4PWDA 1UZDA 1J5OA 1KOHA 4A8YA 1U1OA 5C2CA 2RNEA 1QAJA 1TVRA 1AFIA 3IBFB 3QFHA 4XTTA 1X4EA 5B0GA 3MR6A 3N79A 4H4KA 1JNRB 1HWUA 1T7PA 2AZ1A 3EGNA 3CO0P 1H2VZ 1S1WB 4TYAA 1X60A 2FYXA 2LEAA 1Q4RA 4Y34A 3ZC4A 1IR0A 4I68A 3RRHA 4FXDA 4PQUB 1I51B 5T41A 4USTA 4C8OA 2G13A 4B3TF 3TJ9A 2CPIA 2DCUB 4JI0F 5KFFA 2ROEA 1N88A 2D3UA 1X7VA 4HTIA 2JNJA 3MURP 4ECZA 1JXEA 4DR3J 2WOMB 1S9FA 5CYQA 3TNVA 2UUTA 2HHTA 3VAFA 3D6TB 3Q2TC 3FC9A 4TKTA 1VRTA 3TAQA 3CULA 3M9NB 2XCPA 1SC1B 1K47A 2KDOA 2RD5C 2VUGA 3HJVA 4DL0C 4QQBA 4NLXA 2RH3A 4U96A 1P1LA 1MROB 1L3VA 6FDRA 1RLCL 1N36J 1TUWA 4ZDNA 1HR0J 4UF4A 4Y2IA 3M8PA 1WD6A 4R25A 4NXMF 3BGFA 2OTJS 2MZ1A 2XS7A 4C8ZA 4Y2MA 1Y3JA 1KFDA 4I0WA 4WF9Q 1S9EA 3ZZPA 1RZMA 2IM0A 3O3LA 3KK2B 1IR2A 4JI7J 5KG2A 3MD1A 2HIYA 4DR7J 2B9EA 1S0OA 2F3JA 2AJ2A 3N5FA 2IC3A 1NM2A 3Q8PB 1YRUA 3NOCA 1S97A 1ITPA 2IYIA 2NQPA 3SQOP 5ETOA 5K9FA 4BDPA 2CPZA 2AQ4A 2J9DA 2M5YA 2MGZA 3DRYA 1SJQA 1RT6A 1TFYA 5AE2A 1R43A 2HFSA 3HFZB 3N4WA 2G2OA 3FKBA 3T5HA 4S0MA 2GVZA 4KH0B 4HEA9 5HANA 3MECA 3M2RB 2HS3A 4LIRA 3W8GA 3WC2A 1DBDA 3I5AA 4WE1A 1U2RA 2XZTB 1NKCA 3ZZOA 4ZITA 2MKSA 1TZ0A 1JKHA 1YVFA 2L48A 4PRFA 2QLFB 1TL5A 2CNOB 4MIWA 3I55S 1NKBA 3GMGA 3OVAA 4OHVA 3B78A 3LPYA 3LWMA 4ZIVA 3QSIA 3NL0A 2ASYA 1H0HB 2AD9A 4DF8A 3EPGA 2A2CA 4AQYJ 1UEKA 3N28A 3KMSA 3JYTA 2W7AA 2FLPA 4URQU 4NOHA 5ETSA 3CIMA 2FUG9 4K5SA 4LF1A 2PMZD 2VJUA 2GAHC 1VBYA 3U1NA 1T3OA 3NEKA 2VODA 2GJFA 1L3TA 2LYVA 4DG1A 3MCMA 3BO3A 7FD1A 2F8EX 3HHKA 4MMOA 2J0QD 4EBEA 2CPXA 4QIWD 3LAMA 2CQGA 3J81j 1RU2A 3LQVA 5KFJA 1UFKA 3MMJA 2HRYA 4PG6A 5F8GA 2ZWPA 1REVB 2YNGB 1UW9A 4FYYB 3IS9A 3JAMY 1N32J 2NYHA 3OHBA 3M4XA 1FRLA 3QAEA 4KHRA 5EDWA 1JX4A 3BZQA 2AJ4A 3TX0A 2KL8A 4WTYA 2VQEJ 1IM6A 2MQMA 2KZZA 2VBXA 1L3KA 2XS5A 3OJUA 2VC1A 2BJ7A 3KMQA 3JB9k 3E01A 2BBEA 2L08A 4YHHF 1AB8A 2RMLA 2HZAA 4ATNA 3KXDA 4DL7A 4DR1F 1M5SA 5J2PB 2GHVC 4DCJB 4KB7A 3CDBA 2YKQA 4DV0J 1FDBA 4FYWB 1RWUA 1MWYA 3GPAA 1P8GA 2DISA 2ZDOA 3HPOA 3I5BA 5HMXA 1PO6A 4LFCF 4DFJA 2DNHA 4ER8A 3CCTA 3HSGA 5HQLA 5E2QA 3PJWA 3AY0A 3OVSA 1LW0A 3MEGB 3EZOA 4RNOA 1N34J 3HVAA 3BSCA 1FTCA 2VG5A 1JB0C 1DURA 3Q8RB 4UOCA 1YJWS 1IKVB 2QLWA 2M3DA 5T7LA 2OMLA 1FFSB 1JNZB 2VHGA 3U27A 4UZBA 2NUHA 1RTJB 2DXEA 3AJDA 5E0OA 3FFIB 2MXYA 2CRLA 3FSYA 5L1IA 3PTWA 1UA1A 3AB4B 2VDIA 2R7TA 5BR8F 4Q45A 5A8KA 3G8TA 4DJBA 3DXBA 4IQXA 4TU9A 4AUKA 4YQWA 1V6HA 4YB6A 4YB1P 2MY7A 3SDEB 5B08A 1T94A 4DFPA 5EWEA 1S1VB 1VJQA 2AYGA 1KQSR 4DR6F 2GIRA 1ELOA 2AIRB 4USWA 4QBUA 3Q2SC 3FRZA 3N6LA 2E5HA 3HKZD 3W60A 4CIOA 3BO4A 4MYTA 4NA2A 3LUYA 4ZLJA 3VAMA 3BKTA 4FKXA 3PFOA 4WKYA 4ECRA 2CJKA 1OY9A 1QE1A 2HFNA 1JLEB 1SL1A 4O3RA 1EB0A 1MNEA 2LFVA 3DLKA 4HI1A 2Q43A 1FERA 2V4QA 2OELA 1RHKB 2K1RB 2DH9A 1HW9A 3VZHA 3NGDA 4USVA 5LL6d 2IMOA 2J0WA 1J27A 2F9DA 3DOKB 4ZVQB 3M8WA 1WHYA 2ZKUA 1P6TA 1PJ6A 2PFDA 4MKYA 5IWAF 2H4YB 4DV2F 2W9CA 5IM0A 1QSYA 4LREA 4HDGA 4KRWA 4LF4F 2W8LA 3VQSA 2R7UA 5F0UA 2X3DA 2V69A 3MUTP 2BV3A 2BANB 3LAKA 3UCUP 2OIHA 3HHLC 3NCPA 1JLFA 1ZTWA 4IRCA 2VDHA 3SZ2A 2NXEA 3ZO7A 3HVTA 1JJ2R 3HFKA 2VKZG 2KT2A 1KVJA 2E5IA 3IRXB 2B9YA 3MM9A 1WEZA 1HHQA 2J7UA 4B9VA 1M1GA 5JVHQ 2FJDB 1S59A 4BWJA 5DG9A 4A4JA 3UO0A 3ZZZA 2NSBA 4C3MA 5DG8A 1VFJA 3AHPA 2NUUG 1B7YB 3JSBA 2GO9A 2Z4PA 3D4JA 1IWGA 2W24A 4LF7J 3SEOA 3B4DA 4I1TA 1VQNS 1YBUA 4HI2A 4JI2J 3JAMU 2QSWA 2RS8A 2UUCJ 2HK2A 3MDFA 3OFEA 4C48A 4DR4J 4J9NA 3TA2A 4NLPA 2ZE2A 4O3SA 2OGUA 2XC9A 3PY8A 3QPIA 5HO4A 1SJFA 2R8HA 4F7VA 2XMVA 4QIEA 4UOHA 3QYYA 2HSEB 4J9LA 5DZ7A 1EIYB 2GFFA 2YNFB 3UW1A 2W9BB 2N7YA 4F3OA 2R8GA 3A3NB 5CCMA 2XI2A 2C3YA 1TL1A 4QCLA 5FDLB 4G3IA 3AD9C 1E6YA 1NB7A 3H8YA 3UCZP 1LK7A 1RADB 3JXOA 4AL7A 2ZNYA 1YG0A 1XWLA 2FGOA 2MKIA 3TEHB 1B0TA 4ZVFA 4HYKA 2KFNA 4TY8A 1OWXA 4OI2A 2ZD1A 1S0MA 2MTLA 1DJ0A 2EC0A 2C2EA 3TA1A 4NCGA 2BQRA 2JVRA 2V9KA 4ZPBA 3U1LA 2E44A 2XY6A 3SFGA 4Z2XA 1Q8LA 2JC1A 4ZPWR 4OJGA 1R7IA 2A3JA 2FLOA 4ZPDA 3SFUA 4IH5A 3TQEA 2RHSB 5FJ4A 4LFBJ 1NSAA 1JLGA 2V67A 4XDDA 1FX2A 4TN2A 5HLFA 3HM9A 2RF2B 4W98A 3DXSX 1R0AA 4LMZA 2AEMA 2Y1LB 5EHHA 4ELVA 1T11A 2OPSB 3FCWA 1W2IA 4RWWA 3O8WA 3F73A 1DY3A 1PC4A 5JUMA 2X1FA 1YZ7A 1NHKL 3LWLA 2L3MA 5E3AA 2DRDA 4M1KA 2I2YA 3MTKA 2B3TB 3G8SA 4JYAF 1VHIA 4OHWA 3T1AA 4JV5F 2FLLA 2WZ1A 2RIJA 2ASJA 2E1RA 3J7AN 3TP2A 1SXLA 3VGUA 1ZA2B 4J9KA 4Y6IA 1NDKA 1I5OB 4GVBA 4RW8B 3OJSA 3GIKA 5J2QA 1S4EA 4C3KA 1CS4B 3K57A 2W7OA 1SJRA 2QRRA 1VRUA 2IFXA 1RAOA 3UDLA 3DLHA 1SH3A 1S72S 3HULA 3BF4A 4W90B 4URGA 2GX8A 2RSQA 1G7CB 3OTOF 1G4CA 2WB1D 3DMJA 2C2KB 4Y2CA 3C15A 4HT7A 5M2PA 4OX9J 3CC4S 4K4VA 3FSIA 2VG7A 5C25B 4RU2A 4ECQA 1RHRB 1X4HA 2RILA 3HHDA 1RT4B 4X4PA 3PYDA 3ZTRA 3P5TL 5B0FA 4EWTA 2JFDA 4P2XA 1RBLA 2HNZB 3CJ8A 4ELUA 4QPXA 1UVKA 4LSZB 1K8AT 3WHIA 3Q86A 4C2MA 4MAKA 4C9DA 3OXGA 1VISA 2CA9A 2ACMA 1F3FA 4Q0BA 2OEJA 1WTFA 1TQLA 2UXDJ 3EDRB 4PR6A 3DDNA 1VIOA 1HL6A 4ZVOB 2M2BA 4NEZA 1VQ6S 3GTYX 4C11B 3M6UA 1RTZA 2VFSA 4JI8F 4PG4A 4N77A 2HMIA 1PYTA 4K2XA 3GQCA 4IR1A 2BDPA 5GMEA 3HX9A 4J9QA 2XY7A 3PCOB 2KT3A 4IFYB 1W25A 2N4CA 1S7HA 4DX8H 2FJWA 2BRLA 2GVDA 2FHJD 4DPUA 3CCMS 3EZUA 4LRDA 4IG0B 3MM6A 3TYTA 1T9TA 3H2LA 4EZ6A 4Z7CA 3T6BA 3MD3A 1DTQB 3W62A 4NA1A 1HQEB 1BWVA 1U0HA 1V3RA 2B4VA 4YY3J 3JSMA 3G82B 1OIAA 3T9NA 2DHSA 5D0GA 3ONQA 4N56A 2R7WA 3Q8SB 2DITA 4DL3A 1VC0A 2MSSA 1N5YA 2C2RA 2E5LF 3RZAA 1NK9A 2ZBCA 1M0SA 2MYFA 3CSKA 4RNFA 2N7CA 3H2UB 5A6PA 2ZH7A 2D41A 2O66A 1R3NA 4TU8A 3L95X 4H54A 4OYZA 2IMWP 4RW9B 2QL9B 4PXCA 4KKOB 1WWHA 3CJKA 3IAS9 2XMKA 4FP9A 2JJ4D 1SL2A 3NG8A 1VQ9S 2DR5A 3D0GE 2DGVA 2VD3A 4B08A 4QWBA 2KU7A 3ZNUA 1VK8A 3R5BA 4D3HA 2E9ZA 4R8UA 3VGSA 2DR6A 3U1MA 3D5MA 1IN0A 1WNEA 3FDSA 1KQKA 4ECYA 5K14A 1Q81T 3EVOA 4LF5F 3RG6A 3W7BA 4FKYA 1Y3KA 1HI1A 2HHHF 5E7OB 1V5IB 1H2TZ 3C6UA 1VBKA 4OI0A 1PYSB 1YZ6A 2IJRA 4LIWA 2OPPA 4USIA 1P1TA 4X4VA 3KLFA 4KHPF 2BJEA 3P6YC 4OZNA 2B6AA 3IGVA 2ZBRA 2DRAA 2QJ3A 3C46A 3HF5A 3KOAA 2YBVA 1FVSA 3KLVA 2W1BA 3RB6A 3DGPB 4A8SA 3BBCA 2DEIA 3PYFA 1D8ZA 2MLZA 1VHFA 4ZVUB 3E3XA 4B9NA 4XPCA 5AT1B 3O44A 3MEEA 1NNDA 4IFVB 1RTHA 1FJGJ 1IBMF 4DV5J 3CCSS 2XBPA 1UEUA 1H7XA 1WOSA 2JEJA 2OMOA 1G3OA 1C0UA 2X1AA 3BGOP 4OHXA 4MKAA 1XTZA 4I56A 3UN3A 2XG8A 3BH7B 4FBTA 3TRGA 2POKA 4CLSA 4J5OA 4YR0A 2R7XA 4ZP7A 1JXVA 2DGXA 3IA0A 2KZMA 3RRGA 5DS7A 4IRDA 2FY8A 1E6VB 2Z56B 1UJ4A 4OYBA 1TVRB 4OYXA 2IVFB 1SV5B 1IVZA 3D9BA 1FRJA 2V8GA 2GJ2A 2Z2YB 4C0BA 4ZN1A 4WP9A 1DZ5A 3RBZA 2HVDA 2NXCA 5IQ6A 2HLTA 4QJVA 2GMLA 2DHHA 2XSFA 3I5CA 5F9LA 4K0KF 4DV7F 3EPIA 2WRMA 3QO9A 4X65F 3KJVA 1RTIB 2WBRA 3VAIA 1QUPA 3ILOA 5C5JA 3K5PA 1URRA 3T9ZA 3NS7B 1UPPA 1F3VA 2OSQA 3J7A1 2CUYA 2DNLA 3R6GB 1X4AA 3FSXA 5HBMA 5CYQB 3Q89A 3GYGA 2LDYA 2CQIA 1U6ZA 1Y0HA 2JVOA 2G1HA 4WK1A 2M8DB 2CNLB 3AXMA 4CM0A 1U6BA 4MFBA 3RBDA 5F8IA 2KHDA 2MQNA 2WB4A 3DRPB 1RHJB 1S49A 2UVVA 1SJ3P 1NB2A 4DL2A 4A8OA 3R5JB 3M8PB 2FVRA 4C97A 2XSJA 4C8LA 1K0TA 3O2IA 2F8HA 3V4IA 1N33F 3G86A 4P72A 1X9MA 2XGQA 5KOWA 2DHXA 1NSKL 2CVIA 1TKZA 1KVKA 1XBWA 2XLJA 5JVGQ 5F3ZA 4B9LA 2KXHA 5EX0A 1T8EA 1NJYA 1LV5A 3RW6A 2MQOA 5G0RB 4O0NA 5DDOC 2GIFA 4ED7A 4NLQA 1RT6B 4R5PA 1ZM3A 4IKAA 4P6QA 2G9OA 3KDOA 1ZAXA 2YQ1A 2CZVC 3IP0A 2XI3A 3M05A 4JB8B 4WCEQ 2OEMA 2WK4A 2CPEA 3FNNA 1TL3B 4DV3J 1S1XA 4FVMA 2G0IA 3X1LB 3MR3A 3N5BA 4DV6J 1LW2B 1FJEB 3CDEA 2DR7A 5ETNA 4WE1B 2ABYA 2XO7A 4F2SA 2CJ9A 4IOBA 4B17A 2G4BA 4KO0B 1QUVA 4G65A 2NXNA 1AZSB 3QJPA 3IFEA 1HQUA 2DYAA 1RA7A 3MFHA 5C42B 2CQ4A 4IUFA 3RW7A 3D1HA 2ALYB 3DGVA 2ZVSA 1T95A 3MPVA 1OJ4A 1HNXJ 1UZHA 2HBRB 2JLEA 3QZ7A 3KHLA 4GO5X 2XYPB 5K8OA 2ZM6J 3OL9A 3DHWC 2KG0A 3R5DA 2HLUA 4M5HA 4DL6A 4K4UA 3HT3A 4ID5B 1NHVA 3GSDA 2QIFA 4RW4B 3TVZA 4B9MA 3FCHA 3RUBL 3A8KA 3R1LA 2EG2A 3SYZA 4WBFA 1FWLA 2WAQD 2R2RA 5DJBA 3OFHA 3KLEA 3ZZTA 1TK8A 1F9HA 1UVMA 4DG1B 2EFVA 1FDAA 3DRXA 3CPWR 4LBIA 3HP6A 3THPA 3OXLA 5J1EB 2V2VA 1R89A 2QA2A 3MEDB 1OS5A 5HJYA 3H5XA 4ES3A 4QWDA 1SKSA 4PKDB 4ZVRB 4LSNA 3GCXP 1MWZA 1NXIA 3CEDA 4M94A 3K2YA 2C1EB 3H5UA 1VQOS 3KLGA 2YKMA 1QM9A 3ICLA 2JEFA 3TEGA 4UOFA 3OUYA 3GFHA 3OT9A 3OTDA 4UT4A 4DSLA 4JOUA 1X5TA 2WSCC 1I1GA 2A18A 3T1YJ 2O3DA 2IRUA 2ZUAA 1RA6A 4MH8A 1HNIA 1XN9A 3HO1A 5CD4H 4QU6A 2WSFC 3C16A 4NYPA 4F3QA 4F4WA 3CJ3A 1YIJS 4YFUA 2HBZB 1S6PA 2XYHB 3ZTQA 2FJAB 2XMUA 2F1FA 2YPZA 2A2DA 1T9YA 1X9WA 1RQ0A 3TI0A 3P96A 2E7WA 4LVOP 1TTHB 2IBKA 4X62J 1TAUA 4EMDA 3CJTA 3ZTPA 3NRBA 3DI6A 1N56A 1J5EF 4WKRA 3IRWP 3N9UC 3D67A 5DQIA 2ZNZA 2HYIB 4NLDA 2F9JA 2DBBA 2HGLA 2BM0A 3ITHA 2CQ3A 1KEKA 4O3OA 1U47A 3HJFA 2RQKA 3MAAA 1R27B 3PRBA 1UWBA 4TLQA 3O5TB 1TUGB 2HW3A 2Q79A 3W2WA 2HHPA 4J9PA 4ICLA 1EETA 1CJVA 2J7WA 2R3VA 2ZH8A 4B3SJ 5B7WA 3AOBA 1FRMA 3NGRA 3A8JA 3D3CJ 2GQQA 4IDKA 4WWSA 4P2MA 1X5OA 3CCRS 4LF8J 4HKQA 4UOGA 1DTTB 4I2QA 2LXUA 3OFGA 1VQPS 2HQFA 4B3RJ 1S1UB 1N36F 2HQIA 3EX7B 5F8NA 4KH1B 2UV8A 4OYIA 4Y0FA 5CYMB 1NK8A 1V9OA 3W9JA 1JLAA 2Y0BB 2HHWA 1MWQA 2BX6A 2RJZA 4PYDA 2ZH3A 2GC8A 4CNYA 4JI7F 3MI7X 2J8SA 1SUQA 4KC5A 4DR7F 3QIPA 4U67Q 2HZVA 2W9CB 5IM0B 2Y1IA 2QA4S 2YWHA 3NKYA 1X5SA 5HK4A 2HAFA 1WEYA 2M4MA 4YMEA 4QYRA 3R1HA 2AGQA 5C24A 1VQYA 2XNQA 2JFKA 4M5DA 2DNKA 4MK8A 3FBBA 3MOZA 4NLRA 2VPWB 4NA3A 1JLFB 2E1MC 4DPWA 2RUSA 3CC7S 4OZ1A 4X66F 5CD4A 3PEJA 2R7QA 5ETMA 1U1MA 4DU8A 5CZVA 4RUCA 4E2FB 2JSXA 2JLFA 3MM9B 3T6JA 1U25A 2VKRA 1RAGB 1ZA1B 2EXUA 4ZCIA 1NPPA 1URNA 2FHKA 2FIUA 5IC4B 3MMCB 4N5SA 2OUGA 4H4KC 1C1CA 1WC3A 3W2VB 5L1KA 4EK2A 3FEYB 5AXLA 2ZOGA 3UNYA 2EKNA 5J1NA 1JLCB 1RT7B 2R42A 1WTBA 2XWXA 3PZPA 1VK3A 5BXIA 3IM9A 2YNHA 3TJ8A 2OSRA 2A6OA 1T3NA 4J37A 5I42A 2PEHA 4GKJF 3TAPA 1C4CA 4LVNP 1GXLA 3MM7A 3W8PA 4NXNJ 3FGVA 1W2BR 2V2KA 1HI8A 1VQKS 4IG3B 1FA0A 1DHMA 1T05A 2DR8A 3D66A 3DLGA 4FF2A 2ALZA 3PJ9A 4GMKA 3QFWA 3PKMA 1NBEB 3NCQA 4KAIA 2X1GA 3EZ5A 1TKXB 4M5MA 2MZJA 1LKZA 4DSIA 4QPTA 3DDKA 3IBCB 1QTMA 4RW6A 3R7BB 2V63A 1BMQB 5KT3A 2L41A 3VGTA 4HL9A 1TL1B 2QMXA 3IG1A 2CQ2A 3BB5A 4GKKJ 3OSNA 2ZVIA 3JSYA 1NK6A 1N32F 3WC0A 1W7WA 1NH8A 2KVQE 4LF9F 5D4PA 1N52B 3OQ2A 4FBUA 1N0UA 2VOOA 2I1RA 4ZP9A 2KB2A 1O8BA 3UE2A 3MTJA 4TY8B 1TL4A 1PCAA 4ES2A 4RO0A 1TELA 3QMQA 2EVZA 5EGYA 3T5LA 2OPRA 3CE8A 2DD8S 1KONA 2IAJA 1B0VA 4GC7A 2CYYA 4DMZA 1WG1A 4DV0F 3BH6B 4G6VB 2U2FA 2RRBA 1G1XA 3A8IA 1TV6A 3T1HF 3J81Y 3MUVP 4EUVA 2FVSA 4RW7A 3ZZUA 1ZETA 1SKUB 2LQJA 6AT1B 4JI3F 1N34F 4Y2AA 1SIZA 5HLFB
chains in the Genus database with same CATH topology
3BBFA 3NGTA 4UOGA 3FKBA 3ZTOA 1LWXA 3VVTA 1PKUA 3FCVA 4S0MA 3FC9A 1PAEX 3EE3A 1B99A 3VGTA 3ZTQA 1EHWA 1WKKA 1NB2A 4W98A 4F4AA 2DXFA 4EK2A 4CP5A 3ETMA 1HHQA 2DXDA 3WX8A 3Q8VA 3B54A 1W7WA 1S59A 3NGUA 3BBCA 2CWKA 2BX6A 1NDCA 3FCWA 2AZ3A 2VU5A 3PRVA 1UCNA 1ZS6A 2DXEA 2DYAA 2HVDA 4ENOA 1HLWA 3JS9A 3ENAA 3VVUA 4DI6A 1KDNA 4ANEA 3G2XA 1NSQA 4DZ6A 5BXIA 3EMTA 3EICA 3ZTPA 3BBBA 1NHKL 1HIYA 1WKJA 1NSKL 3L7UA 2AZ1A 4HR2A 3ZTRA 1U8WA 3DKDA 5CAAA 3VGSA 1MN9A 5CABA 1F6TA 4UOFA 1B4SA 3DDIA 1XQIA 3EJMA 3Q8YA 1XIQA 2HVEA 1BUXA 1WKLA 3VGUA 1BHNA 1LEOA 5C7PA 3BH6B 4O0NA 3EVOA 3B6BA 3MPDA 4KPCA 1NDKA 3EVMA 1NLKL 4ANDA 3Q86A 5IOLA 3FBBA 3ZTSA 4FKYA 2ZUAA 3Q83A 3EM1A 4C6AA 3BH7B 2HURA 3ELHA 1NSPA 1NDPA 1NUEA 3PJ9A 1MN7A 2NCKL 4DUTA 4WBFA 1NCLA 3FBFA 1NDLA 1S5ZA 4ANCA 1K44A 3GP9A 1F3FA 3GPAA 3FBCA 3NGSA 1VYAA 2BEFA 1JXVA 3Q89A 3EVWA 1BE4A 3Q8UA 3R9LA 4F36A 3NGRA 3FBEA 3VGVA 4UOHA 1NPKA 2B8PA 1S57A 2B8QA 2DY9A 4FKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBF A;  3NGT A;  4UOG A;  3FKB A;  3ZTO A;  1LWX A;  3VVT A;  1PKU A;  3FCV A;  4S0M A;  3FC9 A;  1PAE X;  3EE3 A;  1B99 A;  3VGT A;  3ZTQ A;  1EHW A;  1WKK A;  1NB2 A;  4W98 A;  4F4A A;  2DXF A;  4EK2 A;  4CP5 A;  3ETM A;  1HHQ A;  2DXD A;  3WX8 A;  3Q8V A;  3B54 A;  1W7W A;  1S59 A;  3NGU A;  3BBC A;  2CWK A;  2BX6 A;  1NDC A;  3FCW A;  2AZ3 A;  2VU5 A;  3PRV A;  1UCN A;  1ZS6 A;  2DXE A;  2DYA A;  2HVD A;  4ENO A;  1HLW A;  3JS9 A;  3ENA A;  3VVU A;  4DI6 A;  1KDN A;  4ANE A;  3G2X A;  1NSQ A;  4DZ6 A;  5BXI A;  3EMT A;  3EIC A;  3ZTP A;  3BBB A;  1NHK L;  1HIY A;  1WKJ A;  1NSK L;  3L7U A;  2AZ1 A;  4HR2 A;  3ZTR A;  1U8W A;  3DKD A;  5CAA A;  3VGS A;  1MN9 A;  5CAB A;  1F6T A;  4UOF A;  1B4S A;  3DDI A;  1XQI A;  3EJM A;  3Q8Y A;  1XIQ A;  2HVE A;  1BUX A;  1WKL A;  3VGU A;  1BHN A;  1LEO A;  5C7P A;  3BH6 B;  4O0N A;  3EVO A;  3B6B A;  3MPD A;  4KPC A;  1NDK A;  3EVM A;  1NLK L;  4AND A;  3Q86 A;  5IOL A;  3FBB A;  3ZTS A;  4FKY A;  2ZUA A;  3Q83 A;  3EM1 A;  4C6A A;  3BH7 B;  2HUR A;  3ELH A;  1NSP A;  1NDP A;  1NUE A;  3PJ9 A;  1MN7 A;  2NCK L;  4DUT A;  4WBF A;  1NCL A;  3FBF A;  1NDL A;  1S5Z A;  4ANC A;  1K44 A;  3GP9 A;  1F3F A;  3GPA A;  3FBC A;  3NGS A;  1VYA A;  2BEF A;  1JXV A;  3Q89 A;  3EVW A;  1BE4 A;  3Q8U A;  3R9L A;  4F36 A;  3NGR A;  3FBE A;  3VGV A;  4UOH A;  1NPK A;  2B8P A;  1S57 A;  2B8Q A;  2DY9 A;  4FKX A; 
#chains in the Genus database with same CATH topology
 2QTW A;  1QSS A;  4ETZ A;  1FNM A;  1HWL A;  4ZJQ A;  3QWP A;  2DNZ A;  1VQL S;  4KGZ B;  5IZH A;  2IJF A;  1PBU A;  4B3T J;  2LU2 A;  1GX6 A;  4OHZ A;  5HVG A;  1IKY B;  3NAI A;  3HI9 A;  3DYA A;  4OYO A;  2K7K A;  4XDC A;  4ECU A;  1C2P A;  1U4B A;  3GJT B;  4JI5 J;  5IT9 U;  2XQC A;  2GGP A;  4PG7 A;  3W9H A;  4DV4 J;  3LP0 A;  4NYZ A;  3BN7 A;  4WXO A;  5IV4 A;  1BQX A;  1RWO B;  2PMH A;  3TR5 A;  5HJX A;  3MR7 A;  1N6Q A;  1VRU B;  1VQ5 S;  3M8R A;  5GAE I;  2IBO A;  2H48 B;  2CXE A;  1KHV A;  2OHD A;  1N5Q A;  1FJ7 A;  4NXM J;  4X64 J;  1P27 B;  1ZZN A;  2AX1 A;  4LQ9 A;  3L9Z A;  2HRT A;  3J7Y U;  2NLW A;  3FBE A;  2NZ4 A;  4YS2 A;  3ET6 B;  5E33 A;  3VCD A;  1F2H A;  1D09 B;  2BKO A;  2VJV A;  1ZM9 A;  1RT1 A;  3LGH A;  2V0N A;  4L3K A;  4CLK A;  3HVW A;  1YTY A;  2Y1R I;  5CZX A;  3FRY A;  5IV3 A;  4V1A k;  2A10 A;  3UVJ B;  1CG2 A;  1KS2 A;  3HK2 A;  4KV8 B;  4N7T A;  2ZBQ A;  1EQM A;  4CO4 A;  2R7S A;  1MML A;  4F4K A;  5ETR A;  4AYB D;  1HHS A;  2YKN A;  2DNQ A;  1HD1 A;  5HRO A;  4KE5 A;  4L76 A;  1HPZ A;  1XIQ A;  5KAK A;  4DZD A;  5HMW A;  1WUU A;  5D4O A;  4CLP A;  1ZAV A;  3V81 A;  2CQD A;  4AND A;  1N4L A;  1X9S A;  2HRU A;  3EM1 A;  2KKH A;  3ELH A;  3DM2 A;  3DRR B;  2FJE B;  4G1P A;  1FFG B;  4J9U E;  1U1R A;  3EXY A;  2IRX A;  1X4B A;  3AD7 C;  5K20 B;  2CVE A;  4ZMM A;  4RR5 A;  4H4M A;  2VG6 B;  4HLB A;  2HMI B;  1CEZ A;  5KT6 A;  3UD3 P;  4OZL A;  1GX5 A;  1S1T A;  4F67 A;  2MKH A;  4Z37 A;  4F50 A;  2ZH6 A;  3M30 B;  1WF0 A;  4ENO A;  2DEJ A;  1KDN A;  1WDT A;  3EGV A;  3OR1 A;  2QL5 B;  4ZHR A;  3DOM B;  3JQM A;  3CWJ A;  1Q5V A;  4JI2 F;  5I3P A;  1T9W A;  1IWA A;  2Y0S D;  1HBM A;  1U0H B;  2P9G A;  3EJM A;  1FRK A;  3DLE B;  2UUC F;  2KTQ A;  1UVJ A;  1O6X A;  4I2P B;  4DR4 F;  5A8R A;  2JEI A;  1N5Y B;  3HLU A;  3MPD A;  2WON A;  4JI6 F;  5IOL A;  3X3U A;  1KTV A;  4U95 A;  5HI7 A;  1OSC A;  3R8Y A;  3TAM A;  5H9F J;  3FBF A;  2V8P A;  2YH1 A;  4NLV A;  3MZI A;  3JTO A;  1PIL A;  2IPO B;  1HFE L;  3IC1 A;  4IYQ A;  5ETV A;  5F9N A;  3BBF A;  3NGT A;  4FXV A;  3O6Q A;  4KSE B;  2Y8Y A;  3DRS B;  5GAH U;  1JLQ A;  5KFA A;  3EE3 A;  3J81 U;  3HSZ A;  3CJK B;  2BE7 D;  5CYJ A;  3AOA A;  3ILL A;  5I3U A;  4CP5 A;  4LFA J;  3EUN A;  3G6V A;  1GMW A;  3RAM A;  4Q44 A;  4LJM A;  1RLD A;  3PRD A;  4DXL A;  2AZ3 A;  1VS3 A;  3FEX B;  3H5S A;  5KG4 A;  3US5 A;  1YJ9 S;  5ETQ A;  2F5G A;  3A3P B;  3LGM A;  2KH9 A;  1JLB A;  1BGX T;  2QGF B;  5K14 B;  4CLW A;  1RCO B;  4K5R A;  1XER A;  2VOP A;  3MPW A;  1XQI A;  4K4Y A;  2DR9 A;  2JC0 A;  5KG0 A;  2QFI A;  1APS A;  3GG0 A;  5HMY A;  1TMM A;  2R2S A;  4F25 A;  1UWA A;  4RL1 A;  3PXG a;  4N8N A;  3HHL D;  3BGR A;  3D6M B;  2LKZ A;  2LEB A;  3EDQ B;  2OPP B;  4LFB F;  5HMZ A;  4DFM A;  2OKQ A;  2KYZ A;  3ISZ A;  2DGO A;  3DU6 A;  4HH0 A;  3H5Y A;  3FBC A;  4NZ7 A;  4DQS A;  3IN5 A;  1S1W A;  3KLF B;  3I0R B;  2B6A B;  1TK5 A;  4QYZ J;  2VBY A;  3BKU A;  4NRU A;  3M6V A;  3W65 A;  2KJW A;  2EEY A;  2WHO A;  1Q1K A;  2GA7 A;  4ZA1 A;  3SMZ A;  5A0Y B;  3SI8 A;  5LSR A;  3C66 A;  3V5R A;  3V4M A;  1NZ8 A;  4YB5 A;  3HZG A;  3HCX A;  1U49 A;  2VH7 A;  4YR3 A;  5H9E K;  1GEH A;  4CH7 A;  1A0O B;  4DN0 A;  1TKD A;  1RTH B;  2WOM A;  3QID A;  2JL9 A;  3PDN A;  5B0E A;  1F6T A;  1IJF B;  2B4O A;  1XMQ J;  3OSP A;  4PXB A;  5DM6 Q;  2Z30 B;  3AOD A;  5D3G A;  2CDR B;  5LMU F;  2QV6 A;  4QIG A;  2HBQ B;  3MEK A;  3R27 A;  3TVK A;  4TQR A;  2YKO A;  3ZZR A;  4DWI A;  2K3K A;  2V8D A;  4Y3C A;  4HH1 A;  2UUA J;  5D15 A;  4M63 A;  4P7T A;  4OZ5 A;  3GWC A;  2HVI A;  4ECV A;  1KTQ A;  2EK1 A;  3BSA A;  4PPD A;  4Q43 A;  3KK2 A;  1X5P A;  4ZS6 A;  2UVU A;  2FZK B;  5D4N A;  2UP1 A;  2VFT A;  2H4W B;  4TY9 A;  3KLH A;  2LVW A;  4DV2 J;  4ZIW A;  1SKW A;  4LF4 J;  1C1B B;  2XO6 A;  3BGL A;  4UTG A;  1T9U A;  3G6E S;  5FLX Y;  4LBP A;  2XWY A;  2FLN A;  3IBW A;  3PW2 A;  2BYC A;  4OI4 A;  3M6W A;  3KJV B;  2FB0 A;  3AD8 C;  4F02 A;  3OFF A;  4OJH A;  4Q8F A;  2VA3 A;  4N47 A;  3CJQ A;  3SBM A;  3OBI A;  4LF2 A;  3W61 A;  1BUX A;  4HHJ A;  1UET A;  3ADA C;  4ZVE A;  4RUB A;  1NH7 A;  3HHL B;  2GCF A;  2V34 A;  4U8V A;  3CCW A;  2HFU A;  3B82 A;  4DSF A;  3KG0 A;  2UXD F;  3J7Z 5;  3GB0 A;  4WFA Q;  2PA3 A;  2AHO B;  1NDL A;  1CVJ A;  1U48 A;  4Q7A A;  2F65 A;  2M70 A;  5SZT A;  3PW4 A;  1GH8 A;  1U45 A;  3R2C J;  4I6W A;  3C8Y A;  3OL7 A;  2ADC A;  4JI4 J;  2YVS A;  1NK0 A;  2ZJR Q;  5M2U A;  3CDW A;  1REG X;  2UXC J;  4LRA A;  3QGH A;  1SBR A;  3ENV A;  3D3B J;  3WX8 A;  2ILZ A;  3Q8V A;  2ZZM A;  1R8A A;  1JK9 B;  2BAC A;  4GVL A;  4QZV B;  4NRT A;  4TXS A;  1TKZ B;  4CLZ A;  2RKI A;  3CW2 C;  1AYE A;  1QDU B;  2V2Q A;  5A8W B;  5KFW A;  2F7V A;  3AA9 A;  1BY9 A;  4YY3 F;  2OP5 A;  3Q8Y A;  3R7N B;  2HVE A;  1SJ1 A;  3VAG A;  2ZJQ Q;  4KPY A;  2FJX A;  2VQF F;  2HFV A;  3L09 A;  3GV8 B;  3Q83 A;  1REV A;  3UFC X;  3L3C A;  3NGK A;  3MMA A;  3A8E A;  1EAY C;  3KHR A;  5CA5 A;  3GSI A;  8AT1 B;  2HWH A;  3MUM P;  2B8Q A;  5KG7 A;  1B0P A;  2QEX S;  2NYI A;  4UZC A;  3POT B;  5KG5 A;  5J2P A;  1HA1 A;  1HQU B;  3K5O A;  3TUP A;  2HHU A;  4OI6 A;  1MU2 B;  3LP1 B;  2IDL A;  3OPK A;  3J7Z T;  2DHA A;  3AXK A;  4EEY A;  1HWJ A;  2AF6 A;  4O44 A;  3LP2 B;  4K8R A;  2P5V A;  3GU0 A;  2XHC A;  4LRB A;  2EPI A;  1WHX A;  2BJD A;  4OX7 A;  3VF0 B;  1GK8 A;  1NJZ A;  3MEG A;  2Z58 B;  1W26 A;  3PKY A;  1IBL J;  4EFA C;  4DQP A;  1LK5 A;  3PHT A;  5LXY A;  1ZTT A;  2J8A A;  1R8B A;  2FC8 A;  1ULR A;  1Q8B A;  1IKV A;  3PFE A;  4DCP B;  3C6T B;  4OI1 A;  2J6S A;  1JJH A;  1MSW D;  1EP4 B;  2MQP A;  2ZOF A;  2ZWO A;  4ZVS B;  3FFI A;  2CIM A;  3S1T A;  2DH8 A;  1CJK B;  1WG5 A;  4QIF A;  3Q8U A;  3SV4 A;  4YN3 B;  4YDD B;  1VOM A;  4DUZ J;  2HGN A;  1I6J A;  2A0F B;  1Z4U A;  4JV5 J;  2J9E A;  3KJF B;  3PG9 A;  3R3T A;  3SDE A;  5F8J A;  3HT0 A;  1S1V A;  3D6H B;  1NK5 A;  2HBY B;  1EAR A;  2MZT A;  5GAD I;  1N0V C;  4DR5 J;  2YXL A;  5A6W A;  2ZC4 A;  5L8R C;  1VQ8 S;  1RKJ A;  3KLG B;  2YKM B;  3CIZ A;  3IR7 B;  4KTQ A;  1HYS B;  3OTO J;  3OUY B;  3M9M B;  1CLF A;  2J9D E;  1XNR J;  4DV5 F;  1SIW B;  2PEB A;  4CTA B;  1JLE A;  5CAA A;  3P4U B;  1Z1Z A;  1RT3 A;  4ZLP A;  2P8I A;  1FE0 A;  3GG1 A;  2H9Z A;  1FRI A;  5FLX U;  3LTO A;  3QT8 A;  3RBE A;  2DCL A;  4C4W A;  1S99 A;  5DDR C;  3NNC A;  4A8W A;  3CUN A;  4NL5 A;  2H5E A;  4EYI B;  4L72 B;  1RBO B;  3QJL A;  1RBA A;  3RU0 A;  4HVZ A;  2FQQ B;  4P74 A;  1WSV A;  2IM1 A;  3DOK A;  3ZNJ 1;  2AGP A;  5HP1 A;  3L7O A;  1S6Q B;  3TA0 A;  3L4B C;  3R5G A;  3P45 B;  2ADB A;  4DDF A;  4LBH A;  1PYO B;  2CJB A;  3VTI A;  4X4T A;  5B0C A;  1WKK A;  2D74 B;  4P73 A;  2C2D A;  3QBC A;  4HHH A;  2F4V F;  2MEW A;  4J9V A;  3C2P A;  4WFY A;  4K2J A;  4ZKA A;  4ZCL A;  2CPD A;  2LXF A;  1ZYQ A;  1HWK A;  2MZQ A;  4ANE A;  2AYB A;  3AJ1 A;  1S7I A;  3ITH B;  3MCS A;  4F2R A;  3BQ0 A;  2HEK A;  2I5J A;  4NE9 C;  1NU4 A;  3Q23 A;  2DO4 A;  1X0F A;  2RU3 A;  1LOU A;  1UWB B;  3V2U C;  3H25 A;  4ZK7 M;  2UU9 J;  1VC5 A;  4NLY A;  3G8Q A;  2PGC A;  4JI8 J;  4F3M A;  4PWW A;  3EWG A;  5DQG A;  4F04 B;  1FK9 B;  4ICL B;  5KFK A;  5IT0 A;  4QW9 A;  4WU3 A;  2OO4 A;  2KO1 A;  4Q2L A;  5L9X A;  1HNV A;  5J2M B;  4YDX A;  2PDA A;  1NK4 A;  3NMA A;  1IKW B;  4W92 B;  4I2Q B;  4F4X A;  2G2Y A;  2ASL A;  2H5I B;  4NI2 B;  4EGL A;  2XLK A;  2QMU B;  5B0D A;  2RRA A;  3FCV A;  2YPY A;  2RQM A;  1OY8 A;  3I31 A;  1RT2 B;  1HKA A;  3PV8 A;  1LNQ A;  2QFJ A;  1IM4 A;  4F4A A;  5EWG A;  1ZM2 A;  1SUQ B;  5K8M A;  2E5L J;  1VBX A;  1WF2 A;  2XY5 A;  2VAS A;  1RDR A;  4AT1 B;  3ENA A;  5C2G A;  3GON A;  4JBC A;  4QYZ K;  2DNG A;  3RBX A;  2DNO A;  2VF3 A;  3EIC A;  2J5A A;  1RWM B;  2QC3 A;  3KKF A;  2BJ8 A;  2BJ1 A;  1D9D A;  4M5K A;  5GAD U;  1WC0 A;  2RE1 A;  4WYL A;  3NMR A;  2BXJ A;  3CVK A;  3AQP A;  3C14 A;  1O5J A;  2HHX A;  5FDL A;  5DG7 A;  3TUJ C;  2D9P A;  3MMB A;  4K50 A;  5U47 A;  2UUB F;  3CO9 A;  2QZ8 A;  3ULH A;  4DV3 F;  2QLB B;  4C8M A;  5H1S V;  4DV6 F;  1I94 F;  1GXT A;  3A1Y G;  1UFW A;  2ZFH A;  1QJH A;  3M1V A;  2K8G A;  1IKX B;  2VV5 A;  1LQ9 A;  1S0N A;  3NNH A;  1OY6 A;  2B9W A;  1B70 B;  2V4J A;  4WIQ A;  2MHN A;  2Q66 A;  5D6G A;  2KRB A;  2ZBP A;  1AXQ A;  1HNX F;  2YWE A;  3BYR A;  4NLU A;  1FKO A;  4WP3 A;  2GMH A;  2CG8 A;  3ZFV A;  2LA4 A;  2CQB A;  3KDN A;  4KHP J;  1SB6 A;  1BQN B;  3MM7 B;  3I9Z A;  4D3G A;  3PX0 A;  5F41 A;  4KIA A;  2C3U A;  3NBP B;  4ED3 A;  1GFW B;  1Y4Z B;  2AEJ A;  4WII A;  3CJ4 A;  3DLL Q;  4ED5 A;  3K5N A;  2OPS A;  4NEY A;  3AT1 B;  1DRZ A;  2LXI A;  2WW8 A;  1MMD A;  4PPZ A;  2AV5 A;  3HKW A;  3NLC A;  4U9R A;  2ZHB A;  5D77 A;  4A8F A;  8ATC B;  1TKT B;  4RW6 B;  4ECW A;  3R9L A;  4OZ3 A;  1YRT A;  1R0C B;  1QTN B;  1RAI B;  2ATC B;  2LLZ A;  3ZXW A;  2MQQ A;  2MJN A;  4F4Z A;  2D7S A;  4TLR A;  3GIM A;  3PR4 A;  4KGX B;  3KUG A;  4LR7 A;  5GAG U;  1AUD A;  1RTD B;  1CS4 A;  1VQ4 S;  3VZI A;  2H54 B;  1GNK A;  1VMB A;  3MPU B;  2KG1 A;  2IY5 B;  2M9K A;  5LSL A;  7AT1 B;  4F0M A;  1T03 A;  3KLI A;  1F60 B;  3O1L A;  2PFF B;  2FY1 A;  1KC8 T;  2Z2L A;  4ZJL A;  1KLM B;  1TL7 A;  1MN9 A;  3PHE A;  5KFH A;  3H59 A;  3TZW A;  4DFK A;  5KFU A;  1FKP A;  2YWK A;  1HBO A;  3SCI E;  3P5B P;  5CH7 B;  4ZPC A;  1GMU A;  3SXL A;  2KRR A;  4KFB A;  1LXJ A;  2QLX A;  4IO1 A;  2FVQ A;  1RT4 A;  3DOL B;  4WFN Q;  4K0K J;  4ZVT B;  4ANC A;  4DV7 J;  4FF1 A;  3SQG B;  4JV2 A;  1J2V A;  1ZBT A;  2VBW A;  3RB3 A;  5AJ3 J;  4UW2 A;  1RCX B;  1IUJ A;  2ATL A;  3AB2 B;  2HNZ A;  2NRE A;  4YEA A;  1NME B;  3I96 A;  4K4T A;  3R5A A;  1F9F A;  3DYA B;  4X62 F;  3OVB A;  5DLF A;  2ZHA A;  4EU0 A;  1M5P C;  3RAX A;  2M52 A;  2VZ9 A;  2KXN B;  3MM8 A;  2XTJ P;  4UUW A;  2C42 A;  2MDA A;  4NLG A;  1VLY A;  2NXJ A;  4WFX A;  5FD1 A;  2HNY A;  2V2Z A;  2SXL A;  1SCJ B;  3M32 B;  3LOU A;  4GO7 X;  3UN2 A;  1FHT A;  1V3S A;  1QY7 A;  2ZH4 A;  2YH0 A;  2ACY A;  4C11 A;  4C0O C;  5HAT A;  2HAI A;  3W5Z A;  1D8Y A;  1ZPV A;  2RAQ A;  4BHQ A;  3K7R A;  1N33 J;  2ILY A;  5KT7 A;  4IFY A;  2BMB A;  1OO0 B;  3UWT A;  3DC2 A;  1NK7 A;  3VAJ A;  2IHR 1;  3T19 A;  2UXB J;  4B3R F;  1YK9 A;  4ZPT R;  2V4R A;  4WPA A;  4B02 A;  4ILL A;  4IG0 A;  3I6P A;  3PO4 A;  1U1K A;  2WVD A;  4URS A;  4CLL A;  3H4B A;  4OIX A;  3DLJ A;  2O5D A;  1KSP A;  1HQE A;  3PW5 A;  4FYX B;  5LMN J;  1O0P A;  1NKE A;  5CQG A;  3QNW B;  1VRQ C;  3ETM A;  1Q8I A;  3QRQ A;  4ZOS A;  3H98 A;  3GCW P;  5DDP C;  4FNI A;  3OL8 A;  2BR0 A;  2CKW A;  2YKN B;  2ZUG A;  3E2E A;  2EBG A;  4DZ6 A;  3FJ2 A;  3OR2 A;  4FYD A;  1WI6 A;  1N5T A;  2GQ2 A;  2Q6B A;  2AKW B;  4J90 A;  3GYN A;  4NAS A;  1FDN A;  2UZA A;  3NWG A;  1Y5I B;  3MF5 A;  3TWZ A;  4KKO A;  1R8H A;  3LGN A;  1YJR A;  2JOQ A;  2Z57 B;  1A9N B;  2C2Z B;  2N3O A;  3PYG A;  2FVC A;  4HAC B;  4QW8 A;  2AU0 A;  4NZ6 A;  3GYX B;  4OL8 A;  4DCO B;  2V9W A;  2DY1 A;  1K44 A;  3M8Q B;  4H4M B;  1VYA A;  3V6D B;  2HHV A;  4DX5 A;  1QVG R;  2NSC A;  1LFP A;  3IWL A;  3CJR A;  4TNO A;  5HVF A;  2CAD A;  1ZH5 A;  1JIH A;  4DOZ A;  5KFD A;  1S1T B;  3AQO A;  3CJ5 A;  2BE2 B;  4DS4 A;  1PAE X;  5K8N A;  4EBC A;  1SQG A;  4MT1 A;  3ISN C;  2R2T A;  2LEC A;  1EX8 A;  2MB0 B;  1UL3 A;  3OR1 B;  3GJS B;  1RT5 B;  4ZHR B;  2CQ1 A;  4O3Q A;  1DLO B;  1HMV B;  1HHT P;  4M5J A;  2HG4 A;  2I0X A;  2KXF A;  1FDD A;  1YJN S;  2WVE A;  3MOJ B;  2F40 A;  3CNQ P;  3I82 A;  1SC3 B;  2IVY A;  4A8Q A;  4NXN F;  3M9O B;  1OQ3 A;  4FN5 A;  4X4Q A;  1YJ7 A;  4MYU A;  2HQC A;  2VFV A;  1QAY A;  3PEH A;  3DGP A;  1M90 T;  1KVI A;  2ZZT A;  3WBZ A;  2W2Q P;  2EWH A;  1CJT B;  1D3W A;  4CLU A;  2XMJ A;  4EO6 A;  3FMB A;  3AFG A;  3RB0 A;  2KM8 C;  4J9M A;  1JLQ B;  2FHJ A;  2A6M A;  4IFV A;  4IH7 A;  3QGP A;  2CQ0 A;  1QLN A;  3DCA A;  4GKK F;  2V94 A;  4RPF A;  3CJ2 A;  2HHS A;  5HQ8 A;  1HNW F;  3EGZ A;  2P6T A;  4ETX A;  3CDA A;  4PAA A;  3P49 B;  4ZN3 A;  4C3L A;  4AL6 A;  3PX4 A;  2P9C A;  2CWK A;  1JLB B;  4X84 A;  2VPX B;  3HXM A;  5DRK A;  1GXU A;  3WDO A;  2QO3 A;  2E5J A;  3RYL A;  3RR8 A;  1S0V A;  2MY8 A;  1E6V A;  2RRN A;  2WCX A;  4NCB A;  3FUY A;  3D0I E;  3BGR B;  4RUA A;  1DFD A;  1SV5 A;  4O4G B;  3SV3 A;  3S7R A;  4NYO A;  2C3P A;  4J7C A;  2AP6 A;  1NRK A;  1FFW B;  4FF4 A;  4CO0 A;  2Z2Z A;  4B9T A;  3EGW B;  2LU1 A;  2EFQ A;  3C19 A;  4DSJ A;  1J5E J;  1XMB A;  1SJ4 P;  3IWN C;  2EK6 A;  4FXW A;  2VC0 A;  1RTI A;  2CJX B;  1JJ4 A;  1SQF A;  4BS2 A;  2B4U A;  5D4L A;  1S9G B;  5IQQ A;  1RAJ A;  4P10 A;  2H1Y A;  3IR5 B;  2VB6 A;  3AAW B;  4EZ9 A;  1F9E B;  2ROP A;  4MK9 A;  3TJA A;  4JI5 F;  4RUH A;  2X1B A;  4DLE A;  4MIB A;  2DO0 A;  1RAH B;  4DV4 F;  4DUY J;  1S10 A;  3WIV A;  4B3O B;  1BQM A;  1HLW A;  2CQP A;  5K5M A;  4P52 A;  4JV0 A;  5D3G B;  1HBN A;  3BPS P;  3DN9 A;  1Z2Z A;  3U02 A;  1XMO F;  1XEZ A;  4LSL A;  3DNC A;  3KK1 B;  1VC6 A;  3DRP A;  4J9R A;  1CUL B;  2BQU A;  3N6M A;  4OYW A;  4X64 F;  1YSJ A;  1U8S A;  2BKP A;  2AT1 B;  4L74 A;  2RUG A;  1FF2 A;  2J6T A;  1GQE A;  5E41 A;  1MN7 A;  1WEX A;  1VIX A;  2X3G A;  1FRX A;  5LT5 A;  2LEP A;  3KLH B;  3I87 A;  1H3D A;  1FEH A;  4CT9 A;  1JMT A;  1XNQ J;  2OPQ A;  1VQM S;  3BRE A;  4J91 A;  5KG3 A;  1O51 A;  5G0R A;  2RQ4 A;  3G71 S;  1M1K T;  1QSL A;  5L38 A;  1DAX A;  5ADZ A;  1AT1 B;  2QX0 A;  4FF3 A;  3HVR A;  1C4A A;  3BR9 A;  2Z8Q A;  3VAK A;  4ED0 A;  1P9Y A;  2VON A;  2IA0 A;  4X66 J;  3MM5 B;  1B64 A;  3EMT A;  1YIT S;  1C0T B;  3L7P A;  1TL3 A;  4PYA A;  3HSJ A;  3CCZ A;  1L3S A;  3K0J A;  1LW2 A;  2LQB A;  4QIV A;  3CMQ A;  3QLH A;  1D1U A;  2H65 B;  1BLU A;  5ETK A;  1SH2 A;  1Y10 A;  4KO0 A;  2XUL A;  1NPR A;  1AZS A;  2Y1J A;  4PWD B;  1Q95 G;  2DKO B;  5KG6 A;  1J5O B;  3TAN A;  1PBA A;  3H7H B;  1Q16 B;  2B9X A;  2UUW A;  2XNR A;  4OV1 A;  1H6K X;  5C42 A;  2KI2 A;  3NNA A;  2PMW A;  4RBU A;  3N0V A;  1TK0 A;  2CPH A;  1UAW A;  1K1Q A;  5HAO A;  1QAI A;  1UP1 A;  5L39 A;  4QR1 A;  3CD7 A;  4USH A;  1Z2L A;  2YNI A;  3OW2 R;  3ILI A;  5GMK a;  1K0V A;  1VBZ A;  4GKJ J;  5HVH A;  3TZZ A;  4FS1 A;  2XMW A;  2CG4 A;  4ID5 A;  4CLT A;  3M7V A;  3MCO A;  4RW4 A;  2RKI B;  2ASD A;  1JQG A;  2LQ8 A;  1ZS6 A;  2IRY A;  4ED8 A;  3T3F A;  1S12 A;  2MLX A;  2KJV A;  5J1E A;  2HHQ A;  3DKD A;  2FPH X;  1RWN B;  3A12 A;  2I8E A;  4ZVH A;  4K59 A;  3TUI C;  2CQH A;  2JEG A;  3MED A;  3PJX A;  4C7Q A;  1VRT B;  3MMA B;  4EI2 A;  4LF9 J;  4CH0 S;  4ZVP B;  5GVQ A;  1Q78 A;  4FNH A;  1U26 A;  5KFE A;  4ZLL A;  1VCT A;  1YKW A;  1WC4 A;  2HND A;  4Y65 A;  5KFM A;  1KP6 A;  1CC8 A;  1R31 A;  2B5J A;  4X4R A;  4LFA F;  2N4D A;  2QG9 B;  2CPF A;  3VAH A;  4XAK A;  1S9E B;  4LR9 A;  4USJ C;  2OAU A;  4P71 A;  1UPM B;  1YQH A;  2M0G B;  4O44 B;  3T1H J;  1T0T V;  2IC3 B;  2MQ8 A;  1RAE B;  4QU7 A;  3HHN B;  3EYZ A;  2ZC3 A;  4ILM A;  2GIQ A;  5E3R A;  2UV8 G;  4JI3 J;  2V6A A;  2RDJ A;  3MFI A;  5G4D A;  4QR0 A;  3P8B B;  2LP4 A;  3VHQ A;  2MGZ B;  5J2N A;  5LSO A;  9ATC B;  1FE4 A;  4A8X A;  2PSZ A;  4N8O A;  4G1Q A;  1ARO P;  1IBK F;  1EJ7 L;  2QE5 A;  4WFZ A;  2LA6 A;  4PXE A;  3EXC X;  4I67 A;  2PC6 A;  3OL6 A;  2GVZ B;  3SCL E;  4I6Y A;  3RB4 A;  4JI1 F;  4LUB A;  3K59 A;  1FD8 A;  2WBM A;  5IFM A;  2W2O P;  2NS1 B;  3MEC B;  1NHU A;  4DV1 J;  4DU7 A;  1KR4 A;  4L6V 3;  3GP9 A;  1JKH B;  2VL1 A;  2PA8 D;  3WX4 A;  2VPZ B;  2XEX A;  3K17 A;  1XR5 A;  1LWX A;  5D0H A;  4C8Y A;  2JH3 A;  1CJU A;  4WTO B;  2AJ1 A;  1S6O A;  1K1S A;  5ETL A;  4IOC Q;  2DGS A;  1FRH A;  1MG7 A;  3GLJ A;  3UCG A;  2U1A A;  4KYZ A;  2BOA A;  2H5J B;  1XMQ F;  1RT3 B;  4A48 A;  4BWM A;  2YWF A;  1B7F A;  3D68 A;  3JYT B;  1DTT A;  3AJ2 A;  5DM7 Q;  1S77 D;  1U1P A;  2E7X A;  1TMJ A;  1S1U A;  4ZCM A;  1WJ9 A;  2RVJ A;  2I38 A;  3BO2 A;  2W2P P;  5CYM A;  2UUA F;  5L1L A;  2F4F A;  1KD1 T;  4NZ0 A;  3IR6 B;  2ZDP A;  5HP1 B;  4UQT A;  2G2Z A;  2IYG A;  1AFJ A;  1RAC B;  9RUB A;  2OJ3 A;  1FWK A;  4M5N A;  4HHU A;  3IS9 B;  4PZV A;  2D1C A;  2DGW A;  4MTP A;  1HNZ F;  3HZE A;  5KFB A;  3S8S A;  3JTP A;  3KUH A;  1A6L A;  1A7G E;  4IH6 A;  3M2V A;  3BM7 A;  4NWB A;  3M2U A;  1U7L A;  1VLO A;  3DLB A;  3E01 B;  5RUB A;  1S79 A;  3KHG A;  5IT4 A;  2RB7 A;  2I5J B;  3TVY A;  4R0J A;  1M5H A;  3VVU A;  1NSQ A;  4U7C A;  2V68 A;  3PO5 A;  1PSD A;  1LWF A;  3MMC A;  5KFO A;  3CCU S;  2GW8 A;  2GAG C;  2H51 B;  2PT0 A;  4CWB A;  2BJ3 A;  3IMQ J;  3W2V A;  1VDH A;  2LQ5 A;  3SSR A;  3AA8 A;  1HNV B;  1BHN A;  2EFO A;  1LW0 B;  4JP8 A;  3TX8 A;  1JLC A;  3RGI A;  4DQQ A;  2IA6 A;  1RT7 A;  2VG5 B;  1H2U X;  4K4Z A;  1PGZ A;  4C6A A;  5A76 A;  3OXF A;  5BYQ A;  5T7L B;  4NML A;  2D3O R;  1F2G A;  5SUH A;  2HFZ A;  1XJW B;  4JI4 F;  4AD6 A;  2J76 E;  2KVI A;  4KY3 A;  2B8P A;  3W66 A;  1KN6 A;  2UXC F;  3CB4 A;  3NCR A;  3WZ0 A;  4ES1 A;  2GNK A;  3IGN A;  1FVQ A;  3I32 A;  1PKU A;  1UFL A;  2NPF A;  2PII A;  5A8K B;  4LF6 J;  2AGO A;  2CPJ A;  2L9D A;  1YJU A;  3M8Y A;  1WSR A;  4USU A;  4IG3 A;  2MKC A;  4JI6 J;  1PJ5 A;  2M88 A;  2WSE C;  5F8L A;  3KG1 A;  1HW8 A;  1TKX A;  3NS5 A;  4FPR A;  3D54 A;  1RWX B;  2W2N P;  4WZM A;  3M8Z A;  4CLF A;  1TFW A;  1YLX A;  1BC6 A;  3VR1 A;  4MJK A;  2EKY A;  4HR2 A;  2DIV A;  4DQI A;  2W9A A;  1CPZ A;  2W4C A;  3C14 B;  2BW2 A;  5B0B A;  4DR3 F;  1GT8 A;  2CJQ A;  4X4S A;  4DR2 J;  4ITS A;  3GII A;  1QE1 B;  3MMB B;  5KT4 A;  3H4D A;  4I7F A;  3WIU A;  2PI5 A;  3DLK B;  2HGM A;  5DQH A;  4KGM A;  3RRK A;  5IT9 Y;  1FXD A;  2HKE A;  1ICE B;  1CC7 A;  3R5C A;  2VIH A;  1YX2 A;  5CXT A;  3M1V B;  3NGS A;  1HR0 F;  2PI4 A;  4O3N A;  4F36 A;  3SIP B;  1RKI A;  1RYR A;  4I69 A;  1NJX A;  2V4J B;  5BYR A;  5JMN A;  1WC5 A;  2YX4 A;  1WHW A;  1L3U A;  1AW0 A;  1YRX A;  1FKO B;  2W7P A;  5KFL A;  2N3L A;  3MR5 A;  3LAL A;  3NGU A;  2P2C B;  4C98 A;  2OFG X;  2YX1 A;  2ZZN A;  1IBL F;  1FCA A;  4WK3 A;  3OTC A;  1RAF B;  2R4F A;  4ECS A;  2V8H A;  3L7U A;  4Q2M A;  3K8V A;  1IQT A;  3RJM B;  2GJI A;  4PUO A;  3CCE S;  1XK8 A;  4FS2 A;  1IKY A;  5E5N A;  1U1Q A;  3HVT B;  1NAQ A;  4FVC A;  2YY3 A;  2D3Z A;  4ED2 A;  4DL5 A;  3NS6 A;  4IR9 A;  1X4C A;  4DUZ F;  4LT6 A;  5B0A A;  3M8S A;  2MLY A;  2PO4 A;  3BKF A;  3UPF A;  4KHM A;  3I0S A;  5LMU J;  2EW9 A;  2W8K A;  2HQG A;  4DR5 F;  3KFW X;  5L46 A;  3UR0 A;  2ZIT A;  3T5J A;  2QA1 A;  2FZG B;  4OYP A;  4TQS A;  5KFV A;  1T03 B;  3KLI B;  2QYC A;  2RDD A;  3SCK E;  4DS5 A;  1XNR F;  2BRK A;  2FJV A;  4AQY F;  3J7Y I;  1UCN A;  3MGJ A;  1TL7 B;  1JXL A;  1IXK A;  3ET6 A;  3FZB A;  3E8O A;  1PIE A;  1FKP B;  2APO A;  1RUS A;  2YKA A;  2P9E A;  1VR6 A;  3N6N A;  1HBO B;  2ZE2 B;  3CF5 Q;  4ZPV R;  3E51 A;  5KT5 A;  5GMD A;  2VIC A;  4OQJ A;  1WOO A;  5EUH A;  3CTR A;  1JWW A;  4RU9 A;  4KFB B;  1QD1 A;  4OJ3 A;  2BVZ A;  3UVJ A;  3CCJ S;  2JHE A;  5IXU A;  3KK3 A;  3QRR A;  4KV8 A;  4B3M J;  1UW4 A;  3J80 Y;  1NDP A;  1XR6 A;  1OPI A;  4E8U A;  2BQ3 A;  1DQ8 A;  4E98 A;  4P2F A;  1GMV A;  2LMI A;  5THW A;  3G87 A;  1E6Y B;  4L75 A;  1FD2 A;  2ROG A;  4R0E A;  2PD1 A;  3OTB A;  4BBY A;  4C8N A;  4IOA Q;  1RAB B;  1R0B G;  2BW7 A;  4HTJ A;  5AXK A;  2J7K A;  3H90 A;  1YGY A;  3OD2 A;  3MM8 B;  2VQE F;  4I64 A;  3SCJ E;  8RUC A;  1OYE A;  3JTN A;  5HN0 A;  3PX6 A;  2ZD1 B;  4UY8 5;  3DRR A;  2CZ4 A;  2AJ0 A;  2HNY B;  1ACM B;  3HDS A;  4NCG B;  3CT9 A;  4F0H A;  2MKK A;  2IM2 A;  1X31 C;  1Q7L B;  4EBD A;  2K2P A;  1Y7P A;  2OD4 A;  2UU9 F;  2VG6 A;  4DL4 A;  3BQ2 A;  3IAM 9;  3DFE A;  1KNZ A;  2F63 A;  3NY0 A;  2MMY A;  4CRJ A;  2HPU A;  1NZA A;  4U7U D;  3QWU A;  5KFZ A;  1JLG B;  5C7P A;  5LJ5 Y;  3ZZ0 A;  4DEZ A;  3R6L B;  1VQS A;  3M30 A;  2DIU A;  2Z0G A;  1R0A B;  4YOE A;  4DSK A;  2AW0 A;  2FZC B;  2VFU A;  1JJC B;  3BDE A;  4OFZ A;  3DOM A;  1RIS A;  2FHM A;  4CYU A;  2QMW A;  4C8K A;  1FEE A;  2WVF A;  1XC9 A;  2QSF A;  2CNN B;  4JI0 J;  2CJA A;  4XIU A;  4K7Q A;  1HI0 P;  1U24 A;  5HL7 Q;  3D2W A;  3DLE A;  3FQL A;  3UNG C;  4B9S A;  2MKJ A;  3CD5 A;  2N82 B;  4I2P A;  2W2M P;  4OJ1 A;  1VQ7 S;  1LFW A;  3ETO A;  3RR7 A;  2VQF J;  2J6U A;  4DX6 A;  1KFS A;  5LXR A;  5KFC A;  3GIL A;  3B4M A;  3OR2 B;  4QWE A;  4GVB B;  4Y28 C;  2VA2 A;  5J2Q B;  1NO8 A;  1LWE A;  4TU7 A;  3CGI A;  4Y00 A;  1UA0 A;  3IM8 A;  1HIY A;  2XHW A;  1V3Z A;  3D0H E;  1WC1 A;  5KFI A;  4M5I A;  3DRS A;  5GAH I;  3D1O A;  1KRP A;  2NR0 A;  3F0N A;  2BUN A;  2JDJ A;  3DMJ B;  3QAT A;  1ROF A;  2MZS A;  4LR8 A;  3C15 B;  4QR2 A;  2FC9 A;  4UY8 T;  4U7U K;  3MR2 A;  1U02 A;  4KPC A;  2L9N A;  2OD6 A;  3TQ1 A;  3BSN A;  2R7R A;  1GTH A;  2VG7 B;  3QGG A;  3BN4 A;  1TUV A;  3BGU A;  1M5K C;  3R7S B;  4P9S A;  3FMW A;  2QLJ B;  2O1P A;  2LDI A;  3KNG A;  5DO2 A;  4LRF A;  1CBK A;  3MCN A;  1MLA A;  1U6F A;  1H74 A;  4KGV B;  3PAC A;  1S4F A;  4YP3 A;  2ZKT A;  3H42 A;  3I0R A;  2QYG A;  3K5M A;  4PEO A;  2KN4 A;  2PN6 A;  1G6B A;  3UD5 A;  1KKH A;  4O23 A;  4RLE A;  2YX7 A;  4CH1 A;  1K9M T;  4RZR A;  4CCH A;  4Q0B B;  5I4M A;  5HQM A;  3CD0 A;  5A0Y A;  4LRC A;  4RNN A;  4A47 A;  1X8D A;  1CQN A;  2O67 A;  5IC6 B;  5LOQ A;  3BYP A;  4G1I A;  3HFV A;  4DQR A;  2DHG A;  2CNK B;  4FZV A;  4ED4 A;  4C0H A;  2NCK L;  4M5G A;  3PIO Q;  1RWW B;  2QT7 A;  2XZW A;  5E3Q A;  5JJB A;  2YQ3 A;  3NP5 A;  1CSJ A;  2B7C B;  2BEF A;  4NCA A;  4YB7 A;  1HD0 A;  3VGV A;  5KG1 A;  1HBU A;  3RAQ A;  3ZTO A;  1EQ0 A;  1DAR A;  2GVD B;  4RNH A;  1HAR A;  2XMM A;  3J80 U;  3K5L A;  1RK8 A;  3MM6 B;  1EHW A;  1Q53 A;  4LF7 F;  3OTE A;  4H4O A;  4B9U A;  2AJF E;  3H40 A;  3HHE A;  3JSM B;  2FVP A;  2W01 A;  1HWI A;  2WVB A;  5D0E A;  2C28 A;  3GFZ A;  1YJV A;  3W63 A;  1KQF B;  5ETT A;  3GFY A;  2FTR A;  3CDU A;  3W5X A;  1LWC A;  1C1B A;  3LW5 C;  4XK8 C;  5KT2 A;  4TVA B;  1ZOT A;  1GTE A;  2F4V J;  3LF0 A;  3GIJ A;  3OLA A;  2XM3 A;  3GFX A;  3R2D J;  1EZZ B;  1N54 B;  3BDP A;  5AJ3 F;  5DLG A;  2MPU A;  1Y00 A;  1RWK B;  4YHH J;  2JLG A;  1MW7 A;  4DR1 J;  3G9C A;  4CO5 A;  3LAN A;  3VAL A;  3UDV A;  3PVX A;  4JV1 A;  2IDE A;  2CWX A;  1N5V A;  4A46 A;  3S6E A;  2CQC A;  2XGP A;  2RU9 A;  1T9V A;  4R8U B;  1KQG B;  4NLO A;  3HHL A;  4LFC J;  1N8R T;  2C3M A;  2W4P A;  4OI3 A;  1BQM B;  3HSD A;  2MST A;  4AFF A;  1NDC A;  1HBN B;  2O01 C;  5LJ3 Y;  3F56 A;  4F8R A;  3THV A;  4LSL B;  1H38 A;  2HVH A;  1NEE A;  4K4W A;  3C6U B;  2MHE A;  2ZH5 A;  2R7V A;  4CQ1 A;  1X4G A;  2OEK A;  5BR8 J;  2QA4 G;  2B7B B;  2UVW A;  5KTQ A;  2UXB F;  4ID8 A;  4BCA A;  2E29 A;  1WI8 A;  1NUE A;  2ZH1 A;  4PQU A;  5A8W A;  2OPQ B;  3MXH P;  2HQ3 A;  3GE9 A;  1XR7 A;  1OMS A;  2AWZ A;  4DSE A;  4DR6 J;  4M5L A;  5LMN F;  4KGK A;  4JUZ A;  5AE1 A;  3K58 A;  2AYE A;  4OX8 A;  1V5V A;  2E5G A;  3MEE B;  3W9I A;  1D0E A;  1FNO A;  2FHO B;  2DXD A;  2UUB J;  2MZR A;  1DQA A;  4ED1 A;  3SSS A;  4ZPA A;  1C0U B;  1U2C A;  1K73 T;  2GS8 A;  1AA1 B;  3GZ7 A;  3D1Q A;  1I94 J;  2Y8W A;  3QLH B;  3T5K A;  2DNM A;  1MRO A;  1FX4 A;  3VQT A;  3PW0 A;  1U8W A;  5F0W A;  3POT A;  1B4S A;  2FGC A;  3DDI A;  4OV6 A;  1VJW A;  4OX9 F;  1FES A;  4I4B A;  4WP8 A;  1MU2 A;  3LP1 A;  3MHY A;  3LO3 A;  1FI4 A;  1FNX H;  3LP2 A;  5IWA J;  4W4M A;  3R97 A;  3GJQ B;  2I6W A;  2YNI B;  5EWF A;  4CLY A;  4P7V A;  1RE1 B;  2HS0 A;  1TR0 A;  4NLS A;  2ZH2 A;  4KT0 C;  3F44 A;  4MIA A;  2GQC A;  3VWS A;  3C6T A;  1YHQ S;  3NWR A;  4RJV A;  2XCA A;  2XB2 D;  3QT5 A;  3QO9 B;  2J0X A;  3HD2 A;  1EP4 A;  4PCQ A;  3P3D A;  2M8H A;  4GC6 A;  3HMJ G;  1CJK A;  1L5U A;  5DZ6 A;  3CMA S;  4RNM A;  5LM7 E;  3M2R A;  3BV8 A;  1IR1 A;  3BBB A;  1WKJ A;  5HBM B;  1RGV A;  3TUZ C;  3MWB A;  3KJQ B;  4DPT A;  2R2U A;  2CZ9 A;  4MFB B;  1F1B B;  1Q0N A;  3I4P A;  1M1H A;  4Q5V A;  4KR0 B;  1NLK L;  2HND B;  3ENQ A;  2R8J A;  3GV7 B;  1OPZ A;  1HYS A;  1YWX A;  2Y3Y A;  2WTF A;  2B5J B;  2XSJ B;  3V4I B;  4CTA A;  4TYB A;  1IBC B;  2DGT A;  4Y2K A;  1I3O B;  2XMA A;  2KFY A;  3H20 A;  3PW7 A;  1SI9 A;  1Q8K A;  1UEV A;  2C2O B;  2AX0 A;  3S01 A;  2HK3 A;  2GV1 A;  3GJR B;  5KFR A;  1Y5N B;  5F8H A;  1Q86 T;  2YTC A;  2DJW A;  1H7W A;  4J9S A;  2Q3P A;  4BC7 A;  4CI0 B;  4ED6 A;  2XS2 A;  2W4D A;  5J2N B;  3FEZ A;  2ZBI A;  1S6Q A;  2IIH A;  4R5P B;  3C3L A;  2E7V A;  4G1Q B;  2KYX A;  2CAJ A;  4NLT A;  2AEF A;  4USK A;  1KOO A;  4M8L A;  3M6X A;  2YNG A;  1N5S A;  5CAB A;  2OTL S;  5EX3 A;  1DQ9 A;  1X4D A;  1IQZ A;  1S1X B;  4RX6 A;  4AXJ A;  4YUD A;  4CDI A;  3QJJ A;  3B6B A;  4CO2 A;  2OLW A;  2LQ9 A;  2G0J A;  1U09 A;  3JSR A;  5KFN A;  3G6Y A;  1RHQ B;  2L9W A;  3VV2 B;  4DPO A;  4DX7 A;  3ISN D;  1KWM A;  1RXO B;  5L9N A;  4WU2 A;  1CJU B;  2RT3 A;  3BS9 A;  5AXM A;  2FJB B;  1S48 A;  1KHW A;  1OQ6 A;  1M5V C;  4DUY F;  4L73 A;  3ZZY A;  3I56 S;  1X4F A;  1FK9 A;  1WF1 A;  3PIP Q;  2KFZ A;  4V19 J;  2GHW A;  2X7I A;  3NXZ A;  1Q7Y T;  1UVN A;  5J2M A;  2GO8 A;  1AUS L;  1T02 A;  3QAU A;  4L3N A;  2COL A;  4AXI A;  1IKW A;  2BM1 A;  3PNI A;  2EI5 A;  4WXW A;  1QAX A;  4DI6 A;  2JWN A;  5K8P A;  4NI2 A;  5KFY A;  4ZJO A;  1UVL A;  3KLE B;  1FT8 A;  4RBT A;  1RTJ A;  1SC4 B;  1RT2 A;  4OHY A;  1RWV B;  1IJE B;  1SL0 A;  5KFT A;  3LH2 S;  4FYV B;  5ITH A;  4RWX A;  5KFG A;  4MKB A;  3UR3 C;  1U1L A;  1YI2 S;  4MK7 A;  6FD1 A;  3EVM A;  2HS4 A;  4XO0 A;  4OZ0 A;  4JYA J;  3GR0 A;  4CZC A;  1UJ6 A;  3GR1 A;  1XNQ F;  4O0I A;  3G4S S;  3TZY A;  5BJR A;  4F0K A;  4Z7Y A;  2C2N A;  4LSN B;  3UDC A;  2C3O A;  2BKN A;  3QT7 A;  2IM3 A;  3KG4 A;  3M2V B;  3M2U B;  2OH2 A;  1RP5 A;  2Y9H A;  3KTQ A;  1GAO A;  4NPO A;  3FVY A;  2UVR A;  1FJG F;  3FQK A;  2WVC A;  5D78 A;  2DTJ A;  1FTR A;  2X51 A;  2V50 A;  4PWU A;  2D69 A;  3CC2 S;  5H9E J;  1FXL A;  2DNP A;  4GRS A;  1TAQ A;  4WFB Q;  3MPY A;  5J1P A;  3V6J A;  1LWF B;  1Y9O A;  3QGI A;  1HNI B;  4E0D A;  2K1R A;  5MAO A;  2I9S A;  4WZQ A;  3IO1 A;  1IKX A;  3K89 A;  2CPY A;  3C16 B;  2YWW A;  3CCL S;  5KFX A;  4Q8E A;  4CNZ A;  3DHX A;  1ZZF A;  1QVF R;  1Y5L B;  2W25 A;  2V5H G;  1EKR A;  1R6Y A;  4UQG A;  2G1D A;  1S6P B;  1WHV A;  4F26 A;  5MLC V;  4ERD A;  2R7O A;  4ECT A;  5KOX A;  1WAC A;  3N01 A;  3Q24 A;  3NOG A;  5H9F K;  3CJ0 A;  1BQN A;  2QN6 B;  3H0P A;  3DI6 B;  5CCL A;  4DHV A;  5KFP A;  2Q1L A;  2HQD A;  4DF4 A;  2BAN A;  3NBP A;  1WC6 A;  3Q8Q B;  3LA0 A;  4UUX A;  3G96 A;  4YR2 A;  2GMJ A;  2B4P A;  4EYH B;  3GV5 B;  2MKY A;  3UN5 A;  1TKT A;  2DNY A;  3D28 A;  3T41 A;  3MAA B;  4J9O A;  3CJS A;  2FDN A;  3PR5 B;  2EFG A;  3IRX A;  2DPJ A;  2YQ0 A;  1F0X A;  2DH7 A;  2DGQ A;  2DK2 A;  3W2W B;  4X2B A;  4HT5 A;  1EET B;  1CJV B;  2DT9 A;  2BE9 B;  1X0P A;  4I7F B;  4IDK B;  1HNW J;  3QQC D;  3UD4 P;  2NPI A;  5GAG I;  3OLB A;  2P6S A;  2ZJP Q;  1RTD A;  3A3O B;  3W64 A;  2E9T A;  3BQ1 A;  1H98 A;  4ELT A;  2KM8 B;  1YBT A;  5E3P A;  1Q5Y A;  1OSD A;  3HD1 A;  1NJW A;  4IO9 Q;  2HUR A;  1KLM A;  1JLA B;  4DLG A;  2HFO A;  2K3I A;  2EG1 A;  2LCW A;  3QIP B;  3KWM A;  1FO1 A;  3Q0A A;  1B99 A;  3B8H A;  5A2Q Y;  1Y11 A;  4MKV A;  5AXN A;  4P75 A;  3B54 A;  1P9Q C;  4X4U A;  3DOL A;  2YNF A;  2NXU A;  2W9B A;  5C24 B;  4OMF G;  3SQG A;  2VU5 A;  4M5D B;  2IVM A;  3PRV A;  4FPI A;  2R9L A;  3JS9 A;  3I9V 9;  2AJQ A;  2OI2 A;  2IJN A;  4PUO B;  3W3S A;  2AYM A;  1RJJ A;  4I6A A;  3IWX A;  1PC5 A;  1U0S A;  2EBE A;  2B51 A;  5F3T A;  2Q6C A;  1FJC A;  1UMJ A;  2CJY B;  3CXC R;  1OYD A;  1PG5 B;  2EFN A;  4DV1 F;  4DBQ A;  4OZ2 A;  2ZHO A;  1C1C B;  4QWC A;  3QZ8 A;  1LXN A;  3M32 A;  4ZP8 A;  3THT A;  4LF5 J;  4NLW A;  5FII A;  3I0S B;  3CD6 S;  3OV7 A;  1XMO J;  4NX9 A;  3EVW A;  1KLN A;  5KFQ A;  2OFH X;  4OYA A;  5JXS A;  4N41 A;  2HHH J;  3TOQ A;  2WW4 A;  2YKP A;  3F41 A;  1SVD A;  2YNH B;  1R6V A;  4KBI A;  2XZD B;  1SC6 A;  2CDQ A;  1F5B A;  1WOR A;  5I42 B;  2B43 A;  2DXF A;  4USM A;  2ZM6 F;  1WG4 A;  1F5A A;  4N76 A;  3D7S B;  1FXR A;  2R8K A;  2RF2 A;  1CQM A;  2XYG B;  2VBZ A;  4M95 A;  1RI7 A;  1WDD A;  3BR8 A;  1T05 B;  3KUE A;  3BEG B;  3DLG B;  1H73 A;  1MMN A;  5DGA A;  2EC2 A;  3BPD A;  2BJ9 A;  1BD6 A;  3IXQ A;  5BYS A;  2C22 A;  3DU5 A;  3AOC A;  4ZLN A;  2HVZ A;  2MQL A;  3TO8 A;  3PYE A;  3KK3 B;  1WKL A;  4O4R A;  2HWI A;  4ZVG A;  1R8C A;  2PE8 A;  4AE5 A;  2JZ5 A;  3IG1 B;  1IBM J;  4DUT A;  1N48 A;  4ZP6 A;  4RW8 A;  2M7S A;  1B3T A;  3WQP A;  4KQZ A;  1RHU B;  4V19 X;  1WOP A;  4U8Y A;  2B0G A;  1KBR A;  2OPR B;  4ECX A;  3SSQ A;  1YDL A;  4HAC A;  4K4X A;  4PAB A;  3W5Y A;  2IAJ B;  2RDI A;  3FZ2 A;  3T1Y F;  1RWP B;  3M8Q A;  3V6D A;  1TV6 B;  4EO8 A;  3G2X A;  5C25 A;  2NZC A;  4A8K A;  1ZPW X;  2GHP A;  4OX6 A;  1UTA A;  3I4H X;  2G0C A;  1UJ5 A;  1UKU A;  4RW7 B;  2BE2 A;  4KJI A;  1F5C A;  2VFR A;  3V6H A;  2EFP A;  3QSY B;  4CO3 A;  4DPY A;  2JRS A;  2H3E B;  3AH6 A;  2HIQ A;  2K7J A;  2GZO A;  3K8W A;  1RT5 A;  4X65 J;  5E3C A;  2DNR A;  4CYU B;  1DLO A;  1NSP A;  1HMV A;  1D9A A;  3TW0 A;  2BZ2 A;  4A8M P;  4IRK A;  3G6X A;  1S5Z A;  2V8V A;  5EN1 A;  1D9F A;  1YJT A;  3FK4 A;  4WYW A;  4LF6 F;  3JQJ A;  4ILR A;  3MAQ A;  2QL7 B;  1ZM4 A;  1SPB P;  2KT5 A;  3MAH A;  2GGP B;  1R8P A;  3CCV S;  4ZCK A;  1EKS A;  2HWT A;  3LP0 B;  2KHC A;  1M5O C;  4IQM A;  1S6U A;  1SKR A;  3KHH A;  2A1B A;  2VPY B;  3BJY A;  1S76 D;  2K06 A;  4PXD A;  1CJT A;  3CME S;  4QOT A;  1LWE B;  1N6Q B;  2BAB A;  3ILJ A;  5GAE U;  4O3P A;  2DGU A;  3OHA A;  3QRP A;  4AL5 A;  1HQ2 A;  2E1C A;  4DR2 F;  4XPE A;  2BA9 A;  5A2Q U;  4PG5 A;  4B3S F;  2YWG A;  4WJB A;  3KYL A;  3V6K A;  2CFX A;  4LF8 F;  1G2E A;  3NAH A;  5T14 A;  4BC9 A;  4OLP A;  3KNA A;  4OLO A;  2J0S D;  2RQC A;  1RT1 B;  1H72 C;  2F8M A;  2FD2 A;  4BLG A;  1GMW D;  1DTQ A;  1YBA A;  2ZH9 A;  4K4S A;  3H2V E;  3G82 A;  3QT6 A;  1BE4 A;  2RS2 A;  2Z2M A;  4HDH A;  3TAR A;  1IBK J;  1ZAW A;  4O4G A;  3VVT A;  4LQ3 A;  1RYS A;  5AE3 A;  1FWP A;  2BOP A;  5HRO B;  1NJI T;  4JI1 J;  3CCQ S;  1HPZ B;  1RSC A;  2XMT A;  4U6P A;  1UVI A;  2D9O A;  2R8I A;  3V81 B;  3GIR A;  2C2M B;  4RW9 A;  4CM2 A;  2E1A A;  2ZEJ A;  2DNN A;  2E1P A;  3DM2 B;  3KJN B;  1S9G A;  4OYM A;  4P2S A;  3Q22 A;  5F8M A;  4RKU C;  2E9R X;  4QWA A;  1VGY A;  3BSO A;  4RBV A;  4B3O A;  2DB1 A;  1T9X A;  4DPX A;  1RB0 A;  3A4T A;  1HBU B;  3PM9 A;  1PAU B;  3U7J A;  2ERR A;  3KK1 A;  1WEL A;  2MJU A;  3D6F B;  4X4N A;  3A13 A;  1S57 A;  5M2R A;  3ENW A;  1VI7 A;  4NMX A;  5B09 A;  1CUL A;  4H4O B;  3UI3 A;  1U1N A;  4CO1 A;  2HZC A;  5D8H B;  3TZX A;  1HBM B;  4DN9 A;  1RAA B;  1PJ7 A;  5DGB A;  5L1J A;  4X4O A;  5DDQ C;  5A8R B;  4FDF A;  1BWE A;  2WON B;  2AMC B;  3JQK A;  3RTV A;  4F4Y A;  2E66 A;  4OZJ A;  2RHQ B;  5CHC B;  1SH0 A;  5I3Q A;  4PQA A;  1LWC B;  2ZOM A;  3TAM B;  7FDR A;  3LPE A;  4CT8 A;  3UQS A;  5DET A;  2B56 A;  1FKA F;  4ALZ A;  2JX2 A;  2DVI A;  1TP7 A;  4PG8 A;  1HNZ J;  1RHM B;  2XLI A;  4B3M F;  2DRB A;  1LEO A;  5IS2 A;  1Q79 A;  5HSP A;  5D0R A;  5I3U B;  3ZTS A;  3MM5 A;  3W1Y C;  2J9C A;  1Q82 T;  1C0T A;  1NCL A;  1U2F A;  2D3O 1;  3UDE A;  1TU0 B;  1RU1 A;  5ETP A;  1NPK A;  2DY9 A;  1SQE A;  1BXN A;  2DPI A;  5KFS A;  4PWD A;  1UZD A;  1J5O A;  1KOH A;  4A8Y A;  1U1O A;  5C2C A;  2RNE A;  1QAJ A;  1TVR A;  1AFI A;  3IBF B;  3QFH A;  4XTT A;  1X4E A;  5B0G A;  3MR6 A;  3N79 A;  4H4K A;  1JNR B;  1HWU A;  1T7P A;  2AZ1 A;  3EGN A;  3CO0 P;  1H2V Z;  1S1W B;  4TYA A;  1X60 A;  2FYX A;  2LEA A;  1Q4R A;  4Y34 A;  3ZC4 A;  1IR0 A;  4I68 A;  3RRH A;  4FXD A;  4PQU B;  1I51 B;  5T41 A;  4UST A;  4C8O A;  2G13 A;  4B3T F;  3TJ9 A;  2CPI A;  2DCU B;  4JI0 F;  5KFF A;  2ROE A;  1N88 A;  2D3U A;  1X7V A;  4HTI A;  2JNJ A;  3MUR P;  4ECZ A;  1JXE A;  4DR3 J;  2WOM B;  1S9F A;  5CYQ A;  3TNV A;  2UUT A;  2HHT A;  3VAF A;  3D6T B;  3Q2T C;  3FC9 A;  4TKT A;  1VRT A;  3TAQ A;  3CUL A;  3M9N B;  2XCP A;  1SC1 B;  1K47 A;  2KDO A;  2RD5 C;  2VUG A;  3HJV A;  4DL0 C;  4QQB A;  4NLX A;  2RH3 A;  4U96 A;  1P1L A;  1MRO B;  1L3V A;  6FDR A;  1RLC L;  1N36 J;  1TUW A;  4ZDN A;  1HR0 J;  4UF4 A;  4Y2I A;  3M8P A;  1WD6 A;  4R25 A;  4NXM F;  3BGF A;  2OTJ S;  2MZ1 A;  2XS7 A;  4C8Z A;  4Y2M A;  1Y3J A;  1KFD A;  4I0W A;  4WF9 Q;  1S9E A;  3ZZP A;  1RZM A;  2IM0 A;  3O3L A;  3KK2 B;  1IR2 A;  4JI7 J;  5KG2 A;  3MD1 A;  2HIY A;  4DR7 J;  2B9E A;  1S0O A;  2F3J A;  2AJ2 A;  3N5F A;  2IC3 A;  1NM2 A;  3Q8P B;  1YRU A;  3NOC A;  1S97 A;  1ITP A;  2IYI A;  2NQP A;  3SQO P;  5ETO A;  5K9F A;  4BDP A;  2CPZ A;  2AQ4 A;  2J9D A;  2M5Y A;  2MGZ A;  3DRY A;  1SJQ A;  1RT6 A;  1TFY A;  5AE2 A;  1R43 A;  2HFS A;  3HFZ B;  3N4W A;  2G2O A;  3FKB A;  3T5H A;  4S0M A;  2GVZ A;  4KH0 B;  4HEA 9;  5HAN A;  3MEC A;  3M2R B;  2HS3 A;  4LIR A;  3W8G A;  3WC2 A;  1DBD A;  3I5A A;  4WE1 A;  1U2R A;  2XZT B;  1NKC A;  3ZZO A;  4ZIT A;  2MKS A;  1TZ0 A;  1JKH A;  1YVF A;  2L48 A;  4PRF A;  2QLF B;  1TL5 A;  2CNO B;  4MIW A;  3I55 S;  1NKB A;  3GMG A;  3OVA A;  4OHV A;  3B78 A;  3LPY A;  3LWM A;  4ZIV A;  3QSI A;  3NL0 A;  2ASY A;  1H0H B;  2AD9 A;  4DF8 A;  3EPG A;  2A2C A;  4AQY J;  1UEK A;  3N28 A;  3KMS A;  3JYT A;  2W7A A;  2FLP A;  4URQ U;  4NOH A;  5ETS A;  3CIM A;  2FUG 9;  4K5S A;  4LF1 A;  2PMZ D;  2VJU A;  2GAH C;  1VBY A;  3U1N A;  1T3O A;  3NEK A;  2VOD A;  2GJF A;  1L3T A;  2LYV A;  4DG1 A;  3MCM A;  3BO3 A;  7FD1 A;  2F8E X;  3HHK A;  4MMO A;  2J0Q D;  4EBE A;  2CPX A;  4QIW D;  3LAM A;  2CQG A;  3J81 j;  1RU2 A;  3LQV A;  5KFJ A;  1UFK A;  3MMJ A;  2HRY A;  4PG6 A;  5F8G A;  2ZWP A;  1REV B;  2YNG B;  1UW9 A;  4FYY B;  3IS9 A;  3JAM Y;  1N32 J;  2NYH A;  3OHB A;  3M4X A;  1FRL A;  3QAE A;  4KHR A;  5EDW A;  1JX4 A;  3BZQ A;  2AJ4 A;  3TX0 A;  2KL8 A;  4WTY A;  2VQE J;  1IM6 A;  2MQM A;  2KZZ A;  2VBX A;  1L3K A;  2XS5 A;  3OJU A;  2VC1 A;  2BJ7 A;  3KMQ A;  3JB9 k;  3E01 A;  2BBE A;  2L08 A;  4YHH F;  1AB8 A;  2RML A;  2HZA A;  4ATN A;  3KXD A;  4DL7 A;  4DR1 F;  1M5S A;  5J2P B;  2GHV C;  4DCJ B;  4KB7 A;  3CDB A;  2YKQ A;  4DV0 J;  1FDB A;  4FYW B;  1RWU A;  1MWY A;  3GPA A;  1P8G A;  2DIS A;  2ZDO A;  3HPO A;  3I5B A;  5HMX A;  1PO6 A;  4LFC F;  4DFJ A;  2DNH A;  4ER8 A;  3CCT A;  3HSG A;  5HQL A;  5E2Q A;  3PJW A;  3AY0 A;  3OVS A;  1LW0 A;  3MEG B;  3EZO A;  4RNO A;  1N34 J;  3HVA A;  3BSC A;  1FTC A;  2VG5 A;  1JB0 C;  1DUR A;  3Q8R B;  4UOC A;  1YJW S;  1IKV B;  2QLW A;  2M3D A;  5T7L A;  2OML A;  1FFS B;  1JNZ B;  2VHG A;  3U27 A;  4UZB A;  2NUH A;  1RTJ B;  2DXE A;  3AJD A;  5E0O A;  3FFI B;  2MXY A;  2CRL A;  3FSY A;  5L1I A;  3PTW A;  1UA1 A;  3AB4 B;  2VDI A;  2R7T A;  5BR8 F;  4Q45 A;  5A8K A;  3G8T A;  4DJB A;  3DXB A;  4IQX A;  4TU9 A;  4AUK A;  4YQW A;  1V6H A;  4YB6 A;  4YB1 P;  2MY7 A;  3SDE B;  5B08 A;  1T94 A;  4DFP A;  5EWE A;  1S1V B;  1VJQ A;  2AYG A;  1KQS R;  4DR6 F;  2GIR A;  1ELO A;  2AIR B;  4USW A;  4QBU A;  3Q2S C;  3FRZ A;  3N6L A;  2E5H A;  3HKZ D;  3W60 A;  4CIO A;  3BO4 A;  4MYT A;  4NA2 A;  3LUY A;  4ZLJ A;  3VAM A;  3BKT A;  4FKX A;  3PFO A;  4WKY A;  4ECR A;  2CJK A;  1OY9 A;  1QE1 A;  2HFN A;  1JLE B;  1SL1 A;  4O3R A;  1EB0 A;  1MNE A;  2LFV A;  3DLK A;  4HI1 A;  2Q43 A;  1FER A;  2V4Q A;  2OEL A;  1RHK B;  2K1R B;  2DH9 A;  1HW9 A;  3VZH A;  3NGD A;  4USV A;  5LL6 d;  2IMO A;  2J0W A;  1J27 A;  2F9D A;  3DOK B;  4ZVQ B;  3M8W A;  1WHY A;  2ZKU A;  1P6T A;  1PJ6 A;  2PFD A;  4MKY A;  5IWA F;  2H4Y B;  4DV2 F;  2W9C A;  5IM0 A;  1QSY A;  4LRE A;  4HDG A;  4KRW A;  4LF4 F;  2W8L A;  3VQS A;  2R7U A;  5F0U A;  2X3D A;  2V69 A;  3MUT P;  2BV3 A;  2BAN B;  3LAK A;  3UCU P;  2OIH A;  3HHL C;  3NCP A;  1JLF A;  1ZTW A;  4IRC A;  2VDH A;  3SZ2 A;  2NXE A;  3ZO7 A;  3HVT A;  1JJ2 R;  3HFK A;  2VKZ G;  2KT2 A;  1KVJ A;  2E5I A;  3IRX B;  2B9Y A;  3MM9 A;  1WEZ A;  1HHQ A;  2J7U A;  4B9V A;  1M1G A;  5JVH Q;  2FJD B;  1S59 A;  4BWJ A;  5DG9 A;  4A4J A;  3UO0 A;  3ZZZ A;  2NSB A;  4C3M A;  5DG8 A;  1VFJ A;  3AHP A;  2NUU G;  1B7Y B;  3JSB A;  2GO9 A;  2Z4P A;  3D4J A;  1IWG A;  2W24 A;  4LF7 J;  3SEO A;  3B4D A;  4I1T A;  1VQN S;  1YBU A;  4HI2 A;  4JI2 J;  3JAM U;  2QSW A;  2RS8 A;  2UUC J;  2HK2 A;  3MDF A;  3OFE A;  4C48 A;  4DR4 J;  4J9N A;  3TA2 A;  4NLP A;  2ZE2 A;  4O3S A;  2OGU A;  2XC9 A;  3PY8 A;  3QPI A;  5HO4 A;  1SJF A;  2R8H A;  4F7V A;  2XMV A;  4QIE A;  4UOH A;  3QYY A;  2HSE B;  4J9L A;  5DZ7 A;  1EIY B;  2GFF A;  2YNF B;  3UW1 A;  2W9B B;  2N7Y A;  4F3O A;  2R8G A;  3A3N B;  5CCM A;  2XI2 A;  2C3Y A;  1TL1 A;  4QCL A;  5FDL B;  4G3I A;  3AD9 C;  1E6Y A;  1NB7 A;  3H8Y A;  3UCZ P;  1LK7 A;  1RAD B;  3JXO A;  4AL7 A;  2ZNY A;  1YG0 A;  1XWL A;  2FGO A;  2MKI A;  3TEH B;  1B0T A;  4ZVF A;  4HYK A;  2KFN A;  4TY8 A;  1OWX A;  4OI2 A;  2ZD1 A;  1S0M A;  2MTL A;  1DJ0 A;  2EC0 A;  2C2E A;  3TA1 A;  4NCG A;  2BQR A;  2JVR A;  2V9K A;  4ZPB A;  3U1L A;  2E44 A;  2XY6 A;  3SFG A;  4Z2X A;  1Q8L A;  2JC1 A;  4ZPW R;  4OJG A;  1R7I A;  2A3J A;  2FLO A;  4ZPD A;  3SFU A;  4IH5 A;  3TQE A;  2RHS B;  5FJ4 A;  4LFB J;  1NSA A;  1JLG A;  2V67 A;  4XDD A;  1FX2 A;  4TN2 A;  5HLF A;  3HM9 A;  2RF2 B;  4W98 A;  3DXS X;  1R0A A;  4LMZ A;  2AEM A;  2Y1L B;  5EHH A;  4ELV A;  1T11 A;  2OPS B;  3FCW A;  1W2I A;  4RWW A;  3O8W A;  3F73 A;  1DY3 A;  1PC4 A;  5JUM A;  2X1F A;  1YZ7 A;  1NHK L;  3LWL A;  2L3M A;  5E3A A;  2DRD A;  4M1K A;  2I2Y A;  3MTK A;  2B3T B;  3G8S A;  4JYA F;  1VHI A;  4OHW A;  3T1A A;  4JV5 F;  2FLL A;  2WZ1 A;  2RIJ A;  2ASJ A;  2E1R A;  3J7A N;  3TP2 A;  1SXL A;  3VGU A;  1ZA2 B;  4J9K A;  4Y6I A;  1NDK A;  1I5O B;  4GVB A;  4RW8 B;  3OJS A;  3GIK A;  5J2Q A;  1S4E A;  4C3K A;  1CS4 B;  3K57 A;  2W7O A;  1SJR A;  2QRR A;  1VRU A;  2IFX A;  1RAO A;  3UDL A;  3DLH A;  1SH3 A;  1S72 S;  3HUL A;  3BF4 A;  4W90 B;  4URG A;  2GX8 A;  2RSQ A;  1G7C B;  3OTO F;  1G4C A;  2WB1 D;  3DMJ A;  2C2K B;  4Y2C A;  3C15 A;  4HT7 A;  5M2P A;  4OX9 J;  3CC4 S;  4K4V A;  3FSI A;  2VG7 A;  5C25 B;  4RU2 A;  4ECQ A;  1RHR B;  1X4H A;  2RIL A;  3HHD A;  1RT4 B;  4X4P A;  3PYD A;  3ZTR A;  3P5T L;  5B0F A;  4EWT A;  2JFD A;  4P2X A;  1RBL A;  2HNZ B;  3CJ8 A;  4ELU A;  4QPX A;  1UVK A;  4LSZ B;  1K8A T;  3WHI A;  3Q86 A;  4C2M A;  4MAK A;  4C9D A;  3OXG A;  1VIS A;  2CA9 A;  2ACM A;  1F3F A;  4Q0B A;  2OEJ A;  1WTF A;  1TQL A;  2UXD J;  3EDR B;  4PR6 A;  3DDN A;  1VIO A;  1HL6 A;  4ZVO B;  2M2B A;  4NEZ A;  1VQ6 S;  3GTY X;  4C11 B;  3M6U A;  1RTZ A;  2VFS A;  4JI8 F;  4PG4 A;  4N77 A;  2HMI A;  1PYT A;  4K2X A;  3GQC A;  4IR1 A;  2BDP A;  5GME A;  3HX9 A;  4J9Q A;  2XY7 A;  3PCO B;  2KT3 A;  4IFY B;  1W25 A;  2N4C A;  1S7H A;  4DX8 H;  2FJW A;  2BRL A;  2GVD A;  2FHJ D;  4DPU A;  3CCM S;  3EZU A;  4LRD A;  4IG0 B;  3MM6 A;  3TYT A;  1T9T A;  3H2L A;  4EZ6 A;  4Z7C A;  3T6B A;  3MD3 A;  1DTQ B;  3W62 A;  4NA1 A;  1HQE B;  1BWV A;  1U0H A;  1V3R A;  2B4V A;  4YY3 J;  3JSM A;  3G82 B;  1OIA A;  3T9N A;  2DHS A;  5D0G A;  3ONQ A;  4N56 A;  2R7W A;  3Q8S B;  2DIT A;  4DL3 A;  1VC0 A;  2MSS A;  1N5Y A;  2C2R A;  2E5L F;  3RZA A;  1NK9 A;  2ZBC A;  1M0S A;  2MYF A;  3CSK A;  4RNF A;  2N7C A;  3H2U B;  5A6P A;  2ZH7 A;  2D41 A;  2O66 A;  1R3N A;  4TU8 A;  3L95 X;  4H54 A;  4OYZ A;  2IMW P;  4RW9 B;  2QL9 B;  4PXC A;  4KKO B;  1WWH A;  3CJK A;  3IAS 9;  2XMK A;  4FP9 A;  2JJ4 D;  1SL2 A;  3NG8 A;  1VQ9 S;  2DR5 A;  3D0G E;  2DGV A;  2VD3 A;  4B08 A;  4QWB A;  2KU7 A;  3ZNU A;  1VK8 A;  3R5B A;  4D3H A;  2E9Z A;  4R8U A;  3VGS A;  2DR6 A;  3U1M A;  3D5M A;  1IN0 A;  1WNE A;  3FDS A;  1KQK A;  4ECY A;  5K14 A;  1Q81 T;  3EVO A;  4LF5 F;  3RG6 A;  3W7B A;  4FKY A;  1Y3K A;  1HI1 A;  2HHH F;  5E7O B;  1V5I B;  1H2T Z;  3C6U A;  1VBK A;  4OI0 A;  1PYS B;  1YZ6 A;  2IJR A;  4LIW A;  2OPP A;  4USI A;  1P1T A;  4X4V A;  3KLF A;  4KHP F;  2BJE A;  3P6Y C;  4OZN A;  2B6A A;  3IGV A;  2ZBR A;  2DRA A;  2QJ3 A;  3C46 A;  3HF5 A;  3KOA A;  2YBV A;  1FVS A;  3KLV A;  2W1B A;  3RB6 A;  3DGP B;  4A8S A;  3BBC A;  2DEI A;  3PYF A;  1D8Z A;  2MLZ A;  1VHF A;  4ZVU B;  3E3X A;  4B9N A;  4XPC A;  5AT1 B;  3O44 A;  3MEE A;  1NND A;  4IFV B;  1RTH A;  1FJG J;  1IBM F;  4DV5 J;  3CCS S;  2XBP A;  1UEU A;  1H7X A;  1WOS A;  2JEJ A;  2OMO A;  1G3O A;  1C0U A;  2X1A A;  3BGO P;  4OHX A;  4MKA A;  1XTZ A;  4I56 A;  3UN3 A;  2XG8 A;  3BH7 B;  4FBT A;  3TRG A;  2POK A;  4CLS A;  4J5O A;  4YR0 A;  2R7X A;  4ZP7 A;  1JXV A;  2DGX A;  3IA0 A;  2KZM A;  3RRG A;  5DS7 A;  4IRD A;  2FY8 A;  1E6V B;  2Z56 B;  1UJ4 A;  4OYB A;  1TVR B;  4OYX A;  2IVF B;  1SV5 B;  1IVZ A;  3D9B A;  1FRJ A;  2V8G A;  2GJ2 A;  2Z2Y B;  4C0B A;  4ZN1 A;  4WP9 A;  1DZ5 A;  3RBZ A;  2HVD A;  2NXC A;  5IQ6 A;  2HLT A;  4QJV A;  2GML A;  2DHH A;  2XSF A;  3I5C A;  5F9L A;  4K0K F;  4DV7 F;  3EPI A;  2WRM A;  3QO9 A;  4X65 F;  3KJV A;  1RTI B;  2WBR A;  3VAI A;  1QUP A;  3ILO A;  5C5J A;  3K5P A;  1URR A;  3T9Z A;  3NS7 B;  1UPP A;  1F3V A;  2OSQ A;  3J7A 1;  2CUY A;  2DNL A;  3R6G B;  1X4A A;  3FSX A;  5HBM A;  5CYQ B;  3Q89 A;  3GYG A;  2LDY A;  2CQI A;  1U6Z A;  1Y0H A;  2JVO A;  2G1H A;  4WK1 A;  2M8D B;  2CNL B;  3AXM A;  4CM0 A;  1U6B A;  4MFB A;  3RBD A;  5F8I A;  2KHD A;  2MQN A;  2WB4 A;  3DRP B;  1RHJ B;  1S49 A;  2UVV A;  1SJ3 P;  1NB2 A;  4DL2 A;  4A8O A;  3R5J B;  3M8P B;  2FVR A;  4C97 A;  2XSJ A;  4C8L A;  1K0T A;  3O2I A;  2F8H A;  3V4I A;  1N33 F;  3G86 A;  4P72 A;  1X9M A;  2XGQ A;  5KOW A;  2DHX A;  1NSK L;  2CVI A;  1TKZ A;  1KVK A;  1XBW A;  2XLJ A;  5JVG Q;  5F3Z A;  4B9L A;  2KXH A;  5EX0 A;  1T8E A;  1NJY A;  1LV5 A;  3RW6 A;  2MQO A;  5G0R B;  4O0N A;  5DDO C;  2GIF A;  4ED7 A;  4NLQ A;  1RT6 B;  4R5P A;  1ZM3 A;  4IKA A;  4P6Q A;  2G9O A;  3KDO A;  1ZAX A;  2YQ1 A;  2CZV C;  3IP0 A;  2XI3 A;  3M05 A;  4JB8 B;  4WCE Q;  2OEM A;  2WK4 A;  2CPE A;  3FNN A;  1TL3 B;  4DV3 J;  1S1X A;  4FVM A;  2G0I A;  3X1L B;  3MR3 A;  3N5B A;  4DV6 J;  1LW2 B;  1FJE B;  3CDE A;  2DR7 A;  5ETN A;  4WE1 B;  2ABY A;  2XO7 A;  4F2S A;  2CJ9 A;  4IOB A;  4B17 A;  2G4B A;  4KO0 B;  1QUV A;  4G65 A;  2NXN A;  1AZS B;  3QJP A;  3IFE A;  1HQU A;  2DYA A;  1RA7 A;  3MFH A;  5C42 B;  2CQ4 A;  4IUF A;  3RW7 A;  3D1H A;  2ALY B;  3DGV A;  2ZVS A;  1T95 A;  3MPV A;  1OJ4 A;  1HNX J;  1UZH A;  2HBR B;  2JLE A;  3QZ7 A;  3KHL A;  4GO5 X;  2XYP B;  5K8O A;  2ZM6 J;  3OL9 A;  3DHW C;  2KG0 A;  3R5D A;  2HLU A;  4M5H A;  4DL6 A;  4K4U A;  3HT3 A;  4ID5 B;  1NHV A;  3GSD A;  2QIF A;  4RW4 B;  3TVZ A;  4B9M A;  3FCH A;  3RUB L;  3A8K A;  3R1L A;  2EG2 A;  3SYZ A;  4WBF A;  1FWL A;  2WAQ D;  2R2R A;  5DJB A;  3OFH A;  3KLE A;  3ZZT A;  1TK8 A;  1F9H A;  1UVM A;  4DG1 B;  2EFV A;  1FDA A;  3DRX A;  3CPW R;  4LBI A;  3HP6 A;  3THP A;  3OXL A;  5J1E B;  2V2V A;  1R89 A;  2QA2 A;  3MED B;  1OS5 A;  5HJY A;  3H5X A;  4ES3 A;  4QWD A;  1SKS A;  4PKD B;  4ZVR B;  4LSN A;  3GCX P;  1MWZ A;  1NXI A;  3CED A;  4M94 A;  3K2Y A;  2C1E B;  3H5U A;  1VQO S;  3KLG A;  2YKM A;  1QM9 A;  3ICL A;  2JEF A;  3TEG A;  4UOF A;  3OUY A;  3GFH A;  3OT9 A;  3OTD A;  4UT4 A;  4DSL A;  4JOU A;  1X5T A;  2WSC C;  1I1G A;  2A18 A;  3T1Y J;  2O3D A;  2IRU A;  2ZUA A;  1RA6 A;  4MH8 A;  1HNI A;  1XN9 A;  3HO1 A;  5CD4 H;  4QU6 A;  2WSF C;  3C16 A;  4NYP A;  4F3Q A;  4F4W A;  3CJ3 A;  1YIJ S;  4YFU A;  2HBZ B;  1S6P A;  2XYH B;  3ZTQ A;  2FJA B;  2XMU A;  2F1F A;  2YPZ A;  2A2D A;  1T9Y A;  1X9W A;  1RQ0 A;  3TI0 A;  3P96 A;  2E7W A;  4LVO P;  1TTH B;  2IBK A;  4X62 J;  1TAU A;  4EMD A;  3CJT A;  3ZTP A;  3NRB A;  3DI6 A;  1N56 A;  1J5E F;  4WKR A;  3IRW P;  3N9U C;  3D67 A;  5DQI A;  2ZNZ A;  2HYI B;  4NLD A;  2F9J A;  2DBB A;  2HGL A;  2BM0 A;  3ITH A;  2CQ3 A;  1KEK A;  4O3O A;  1U47 A;  3HJF A;  2RQK A;  3MAA A;  1R27 B;  3PRB A;  1UWB A;  4TLQ A;  3O5T B;  1TUG B;  2HW3 A;  2Q79 A;  3W2W A;  2HHP A;  4J9P A;  4ICL A;  1EET A;  1CJV A;  2J7W A;  2R3V A;  2ZH8 A;  4B3S J;  5B7W A;  3AOB A;  1FRM A;  3NGR A;  3A8J A;  3D3C J;  2GQQ A;  4IDK A;  4WWS A;  4P2M A;  1X5O A;  3CCR S;  4LF8 J;  4HKQ A;  4UOG A;  1DTT B;  4I2Q A;  2LXU A;  3OFG A;  1VQP S;  2HQF A;  4B3R J;  1S1U B;  1N36 F;  2HQI A;  3EX7 B;  5F8N A;  4KH1 B;  2UV8 A;  4OYI A;  4Y0F A;  5CYM B;  1NK8 A;  1V9O A;  3W9J A;  1JLA A;  2Y0B B;  2HHW A;  1MWQ A;  2BX6 A;  2RJZ A;  4PYD A;  2ZH3 A;  2GC8 A;  4CNY A;  4JI7 F;  3MI7 X;  2J8S A;  1SUQ A;  4KC5 A;  4DR7 F;  3QIP A;  4U67 Q;  2HZV A;  2W9C B;  5IM0 B;  2Y1I A;  2QA4 S;  2YWH A;  3NKY A;  1X5S A;  5HK4 A;  2HAF A;  1WEY A;  2M4M A;  4YME A;  4QYR A;  3R1H A;  2AGQ A;  5C24 A;  1VQY A;  2XNQ A;  2JFK A;  4M5D A;  2DNK A;  4MK8 A;  3FBB A;  3MOZ A;  4NLR A;  2VPW B;  4NA3 A;  1JLF B;  2E1M C;  4DPW A;  2RUS A;  3CC7 S;  4OZ1 A;  4X66 F;  5CD4 A;  3PEJ A;  2R7Q A;  5ETM A;  1U1M A;  4DU8 A;  5CZV A;  4RUC A;  4E2F B;  2JSX A;  2JLF A;  3MM9 B;  3T6J A;  1U25 A;  2VKR A;  1RAG B;  1ZA1 B;  2EXU A;  4ZCI A;  1NPP A;  1URN A;  2FHK A;  2FIU A;  5IC4 B;  3MMC B;  4N5S A;  2OUG A;  4H4K C;  1C1C A;  1WC3 A;  3W2V B;  5L1K A;  4EK2 A;  3FEY B;  5AXL A;  2ZOG A;  3UNY A;  2EKN A;  5J1N A;  1JLC B;  1RT7 B;  2R42 A;  1WTB A;  2XWX A;  3PZP A;  1VK3 A;  5BXI A;  3IM9 A;  2YNH A;  3TJ8 A;  2OSR A;  2A6O A;  1T3N A;  4J37 A;  5I42 A;  2PEH A;  4GKJ F;  3TAP A;  1C4C A;  4LVN P;  1GXL A;  3MM7 A;  3W8P A;  4NXN J;  3FGV A;  1W2B R;  2V2K A;  1HI8 A;  1VQK S;  4IG3 B;  1FA0 A;  1DHM A;  1T05 A;  2DR8 A;  3D66 A;  3DLG A;  4FF2 A;  2ALZ A;  3PJ9 A;  4GMK A;  3QFW A;  3PKM A;  1NBE B;  3NCQ A;  4KAI A;  2X1G A;  3EZ5 A;  1TKX B;  4M5M A;  2MZJ A;  1LKZ A;  4DSI A;  4QPT A;  3DDK A;  3IBC B;  1QTM A;  4RW6 A;  3R7B B;  2V63 A;  1BMQ B;  5KT3 A;  2L41 A;  3VGT A;  4HL9 A;  1TL1 B;  2QMX A;  3IG1 A;  2CQ2 A;  3BB5 A;  4GKK J;  3OSN A;  2ZVI A;  3JSY A;  1NK6 A;  1N32 F;  3WC0 A;  1W7W A;  1NH8 A;  2KVQ E;  4LF9 F;  5D4P A;  1N52 B;  3OQ2 A;  4FBU A;  1N0U A;  2VOO A;  2I1R A;  4ZP9 A;  2KB2 A;  1O8B A;  3UE2 A;  3MTJ A;  4TY8 B;  1TL4 A;  1PCA A;  4ES2 A;  4RO0 A;  1TEL A;  3QMQ A;  2EVZ A;  5EGY A;  3T5L A;  2OPR A;  3CE8 A;  2DD8 S;  1KON A;  2IAJ A;  1B0V A;  4GC7 A;  2CYY A;  4DMZ A;  1WG1 A;  4DV0 F;  3BH6 B;  4G6V B;  2U2F A;  2RRB A;  1G1X A;  3A8I A;  1TV6 A;  3T1H F;  3J81 Y;  3MUV P;  4EUV A;  2FVS A;  4RW7 A;  3ZZU A;  1ZET A;  1SKU B;  2LQJ A;  6AT1 B;  4JI3 F;  1N34 F;  4Y2A A;  1SIZ A;  5HLF B; 
#chains in the Genus database with same CATH homology
 3BBF A;  3NGT A;  4UOG A;  3FKB A;  3ZTO A;  1LWX A;  3VVT A;  1PKU A;  3FCV A;  4S0M A;  3FC9 A;  1PAE X;  3EE3 A;  1B99 A;  3VGT A;  3ZTQ A;  1EHW A;  1WKK A;  1NB2 A;  4W98 A;  4F4A A;  2DXF A;  4EK2 A;  4CP5 A;  3ETM A;  1HHQ A;  2DXD A;  3WX8 A;  3Q8V A;  3B54 A;  1W7W A;  1S59 A;  3NGU A;  3BBC A;  2CWK A;  2BX6 A;  1NDC A;  3FCW A;  2AZ3 A;  2VU5 A;  3PRV A;  1UCN A;  1ZS6 A;  2DXE A;  2DYA A;  2HVD A;  4ENO A;  1HLW A;  3JS9 A;  3ENA A;  3VVU A;  4DI6 A;  1KDN A;  4ANE A;  3G2X A;  1NSQ A;  4DZ6 A;  5BXI A;  3EMT A;  3EIC A;  3ZTP A;  3BBB A;  1NHK L;  1HIY A;  1WKJ A;  1NSK L;  3L7U A;  2AZ1 A;  4HR2 A;  3ZTR A;  1U8W A;  3DKD A;  5CAA A;  3VGS A;  1MN9 A;  5CAB A;  1F6T A;  4UOF A;  1B4S A;  3DDI A;  1XQI A;  3EJM A;  3Q8Y A;  1XIQ A;  2HVE A;  1BUX A;  1WKL A;  3VGU A;  1BHN A;  1LEO A;  5C7P A;  3BH6 B;  4O0N A;  3EVO A;  3B6B A;  3MPD A;  4KPC A;  1NDK A;  3EVM A;  1NLK L;  4AND A;  3Q86 A;  5IOL A;  3FBB A;  3ZTS A;  4FKY A;  2ZUA A;  3Q83 A;  3EM1 A;  4C6A A;  3BH7 B;  2HUR A;  3ELH A;  1NSP A;  1NDP A;  1NUE A;  3PJ9 A;  1MN7 A;  2NCK L;  4DUT A;  4WBF A;  1NCL A;  3FBF A;  1NDL A;  1S5Z A;  4ANC A;  1K44 A;  3GP9 A;  1F3F A;  3GPA A;  3FBC A;  3NGS A;  1VYA A;  2BEF A;  1JXV A;  3Q89 A;  3EVW A;  1BE4 A;  3Q8U A;  3R9L A;  4F36 A;  3NGR A;  3FBE A;  3VGV A;  4UOH A;  1NPK A;  2B8P A;  1S57 A;  2B8Q A;  2DY9 A;  4FKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...