3FCWA

Crystal structure of the mimivirus ndk n62l mutant complexed with udp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
131
structure length
131
Chain Sequence
GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 40
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fcwA00
2ZUAA 3ENAA 4HR2A 1F6TA 3FCWA 3Q83A 4DI6A 2B8PA 1NSKL 1NUEA 3NGTA 3B6BA 3ZTRA 4FKXA 2DYAA 2DY9A 3ZTOA 4EK2A 1PKUA 3FBEA 1NDPA 3Q89A 2NCKL 3FKBA 1NSQA 2AZ1A 3VGVA 3VGSA 5C7PA 3BH6B 3VGTA 3B54A 4UOGA 3PRVA 3EJMA 3NGSA 1PAEX 3GPAA 3NGUA 1B99A 4O0NA 3BBCA 3MPDA 1HIYA 3WX8A 4FKYA 3ZTSA 1NLKL 1ZS6A 3EICA 4ENOA 3FBCA 3VGUA 4C6AA 3EVMA 1BHNA 1LWXA 1B4SA 3FC9A 4W98A 5CABA 4S0MA 3FCVA 4KPCA 3Q86A 3ELHA 3BH7B 3R9LA 1XIQA 3ETMA 3Q8YA 1F3FA 1NB2A 3GP9A 1JXVA 3BBBA 5BXIA 1U8WA 3FBBA 3EMTA 3DKDA 1NHKL 3DDIA 1NDKA 1VYAA 4ANCA 3Q8UA 4WBFA 2BEFA 1K44A 1HHQA 1WKKA 4CP5A 4UOFA 3VVUA 2B8QA 1NSPA 3BBFA 1W7WA 1BE4A 2DXDA 1MN9A 3Q8VA 1KDNA 3G2XA 1NCLA 1WKJA 2HVDA 3EE3A 3PJ9A 1HLWA 3VVTA 1NDLA 3L7UA 2CWKA 1S5ZA 5CAAA 4DUTA 1NDCA 1S57A 3FBFA 4ANEA 2AZ3A 2BX6A 4DZ6A 3EM1A 2VU5A 1EHWA 1LEOA 3ZTQA 1UCNA 3EVOA 1MN7A 1WKLA 3EVWA 3JS9A 1S59A 1XQIA 4F36A 4UOHA 5IOLA 4F4AA 2DXEA 4ANDA 3ZTPA 2HVEA 2DXFA 3NGRA 2HURA 1BUXA 1NPKA
chains in the Genus database with same CATH superfamily
3H8YA 4AQYF 3NP5A 2L3MA 2XGQA 1SKUB 2DNZA 3GTYX 1GMVA 4EZ6A 4AE5A 2ADBA 1GFWB 5KFIA 1VBXA 3CD0A 3FFIB 4E8UA 5I3UB 1VR6A 4PZVA 2HWIA 1T3OA 1AT1B 2UUTA 1TUWA 3GV7B 3KG4A 4N5SA 4DR4J 2W7OA 2VUGA 2C1EB 3R5AA 2EFPA 2ASDA 2AP6A 1S97A 1L5UA 3M32B 1UVJA 3NS7B 3LPYA 5C5JA 1EB0A 2KFNA 2QIFA 3BYPA 1NDLA 2JWNA 1FDBA 3HHKA 4DV6F 3VTIA 3GFHA 5IS2A 3F56A 2C2RA 3RW7A 2VF3A 3PM9A 4LVNP 5A6WA 4QIGA 2A6MA 1BD6A 2FIUA 4U95A 1CC8A 5D3GB 4LF5J 3RB6A 1WDTA 2P8IA 1HPZA 2Z8QA 4ZVSB 1X4CA 2B4UA 4QCLA 2HZVA 3W3SA 4PABA 4X4RA 4OHVA 5G0RA 3X3UA 2VG7B 2RH3A 3BGUA 3FJ2A 3V81A 1TMJA 1QE1B 2IAJA 3TQEA 2YX4A 2V68A 3NNAA 2QA2A 3GFYA 4XDDA 2RRBA 2MMYA 3MAQA 1FWPA 4H4OA 4WPAA 2UUCJ 4J90A 1H2TZ 2YKNA 3A1YG 3KJVA 4NXMF 4KGKA 2KZZA 4WP9A 4X64F 5K8NA 2KFYA 2QRRA 2IMWP 4CQ1A 3UI3A 5ETLA 3V6DB 5K8PA 1U24A 4OLOA 1FX4A 3ITHA 1OPIA 3TW0A 2ACYA 2KYXA 5C42A 2HQIA 4QR1A 2YWEA 5AE1A 3KJQB 2ZM6J 4P72A 5LMNF 3SMZA 4IOCQ 1SPBP 2B4OA 1ACMB 4USKA 1P6TA 2V69A 1FJGF 1SV5B 3T3FA 4QJVA 3VZIA 1VQOS 4ICLB 1X4BA 4XK8C 1C1BA 1KONA 3KMSA 2HAFA 1JXVA 2F40A 1SKSA 2VPXB 1XN9A 4DSLA 3FBBA 4DV4F 2WSCC 2D7SA 2ROPA 2EC0A 1HNWF 2BJ7A 3CE8A 1GXUA 3HVWA 4ZVRB 2CPEA 2NZCA 5GMKa 2BANB 1V5VA 3DCAA 1IKYA 1GH8A 4NCBA 2AZ3A 5EX0A 4Z2XA 3FZBA 5I42B 2B9EA 2IC3A 1C4CA 5J2MA 5KFDA 1YTYA 5DZ6A 1FXRA 4NXMJ 5EWGA 1HWLA 3ENAA 3VCDA 3B6BA 3BEGB 3EX7B 2W2NP 2H5JB 4K4WA 4ZMMA 3PRDA 1D3WA 4A48A 3ENQA 3M7VA 2X7IA 1S1TA 3GPAA 4C11A 4KR0B 4OZ0A 2MGZB 4DXLA 4ED1A 4F50A 1S9FA 3W65A 4AUKA 4NASA 1VQ4S 1N32F 3D54A 1FWLA 3A8KA 3QGGA 1PG5B 5A8KB 1NDKA 1X8DA 4WTYA 4WFZA 1KWMA 3O44A 5I3PA 3PJWA 4PG7A 1TMMA 4O44A 2KM8C 5A8RB 2DGOA 1KEKA 4RW9A 2AYGA 1J2VA 3KK3B 2PD1A 4FDFA 2XBPA 4A8FA 5MLCV 2FZKB 1Q8IA 2FVCA 2AEJA 1FRXA 2HIQA 1I5OB 4ELTA 1SUQB 3D66A 2HFUA 4LF9F 1FI4A 1FKOA 1UCNA 3MAAB 1DQ9A 3WIVA 3P8BB 2A10A 2B9XA 4RW7B 5GAGI 2W4DA 2M52A 2GGPA 2EFQA 2YWFA 4OZ5A 1HNXF 3WC2A 4MAKA 1SC1B 4EU0A 3C6UA 2J7UA 3OL6A 3W9IA 1TL1A 3BO3A 1CJUA 3V6KA 3W60A 4B3SJ 2WBMA 4G1PA 3M2UA 1WC6A 1V3ZA 3WQPA 3UWTA 1TUVA 1XWLA 2MY8A 4RUBA 4FF2A 4B9VA 2RU9A 4DX6A 1CQNA 4PXCA 5AXNA 2MQOA 2VDHA 2VQFJ 3QIPB 3NAIA 3HCXA 4ZA1A 2KXNB 3BSOA 2VBXA 3FFIA 2L48A 4DMZA 2DNPA 2OD4A 3KLIB 2VG6A 1WKJA 2PIIA 4BWMA 2Q3PA 1QJHA 3GR1A 3J7AN 1B3TA 2CG8A 4DUYF 1EZZB 1O8BA 4JYAF 1X4EA 3M6WA 4K5SA 4BHQA 4ES3A 4DQPA 4PWUA 2HQ3A 2YX7A 2BDPA 2IA0A 3DGVA 3I6PA 1UWAA 1S10A 1RHRB 4DL5A 3ISND 4HTIA 4PCQA 3NCPA 3RZAA 5KG1A 1Q8LA 3M2RB 1CBKA 1X4AA 3MI7X 3E8OA 4FYYB 2D9OA 3DLGA 5D77A 2V8GA 4C6AA 2FVSA 4U7CA 3C3LA 3BGRA 9RUBA 2MYFA 4J9SA 2KHCA 5D3GA 3Q86A 1WELA 3DXBA 2P6SA 5K8MA 2XZWA 2QZ8A 1SJRA 4OMFG 5EX3A 4P73A 4RU9A 4QBUA 3U1LA 4L3NA 1Z4UA 2COLA 5DETA 2VG7A 4B17A 2XY7A 2IJNA 5GAEI 1QE1A 5KFCA 4MKYA 4TN2A 1P27B 4M5KA 4LFAJ 1Q5YA 2DVIA 2JZ5A 3LA0A 1DZ5A 4RKUC 5C24B 2I1RA 2Q6CA 2CPHA 4KHRA 4Y2IA 3H59A 1JLFB 2DGWA 2DXEA 3DFEA 1F0XA 5DQHA 4JYAJ 3QNWB 2HFVA 4L6V3 3LGNA 2J0XA 1X0PA 1S49A 1TK0A 3AOCA 1RTHB 3BV8A 3FBEA 3DRPB 1N5YB 4PXEA 1YJ9S 1H7XA 4WU3A 2NREA 1KFDA 2W8KA 2XYPB 2MZJA 1NK4A 3QT5A 3WDOA 4QPTA 3G9CA 1S9GB 2QO3A 3NLCA 3K59A 5ADZA 2LFVA 4OHXA 2QA4S 1RYRA 4KRWA 2E5JA 4LR9A 5SZTA 2PGCA 1YJNS 3CULA 2M2BA 3LP0B 3HT3A 1SV5A 4RNNA 3RBXA 1Y5NB 4ICLA 1MMNA 3M8ZA 4PEOA 2ZH9A 5M2PA 4OYMA 1MROB 2DR8A 2M88A 2OSRA 4N76A 1YX2A 1N0VC 2YBVA 3S6EA 2CQ0A 4FF3A 4A8WA 5KT7A 3IR5B 3LP2B 5CHCB 4DUZJ 3JB9k 2KRBA 4K4ZA 1FWKA 3HK2A 2BANA 2RS8A 5D4LA 3PO5A 2LU1A 3OVAA 2KO1A 2V0NA 4NMLA 3DC2A 3MWBA 5I42A 1HNZJ 4CCHA 4DLEA 2DNYA 3CO9A 2FLNA 2CQBA 3OR1B 2UVUA 5HSPA 3BDEA 1Y9OA 5DGBA 2OSQA 2DGSA 5DJBA 3K8VA 1LV5A 3GB0A 2UU9F 4ZCKA 1RWOB 2IBKA 1N33F 2OH2A 2FZCB 1UAWA 1SQFA 2XS2A 2ZBPA 2E5LF 2ZUGA 3JSBA 4PXDA 3CC2S 3M2VB 2XCPA 3MM6A 2DEJA 5GAEU 3ETOA 5A8KA 1I94J 3UCZP 1X9SA 2VA2A 5CCMA 4AL7A 1R0BG 2DKOB 1VI7A 2LA4A 5A8RA 3MM7B 2Q43A 4N77A 2ZUAA 3KK3A 3TRGA 1RYSA 1UEKA 4Q0BB 2HLTA 5L1LA 2LQ5A 1SUQA 3JQJA 2HEKA 3MR2A 4UOGA 3MAAA 1B99A 3GYNA 1AYEA 3IN5A 3A3PB 2QA4G 2EFOA 2RS2A 3NL0A 4RW7A 1CULA 3K0JA 1SQEA 2HPUA 1XC9A 5ETVA 4DL0C 3ZZOA 2AV5A 4ED0A 2V8DA 1FDAA 5DM7Q 5C25B 1U1LA 4HHJA 4DX8H 2V8VA 2VB6A 4QWBA 3MCOA 4H4MB 1R6VA 4IH7A 2KVIA 4AFFA 3GJSB 3DDNA 3ZZZA 4Q8EA 2I2YA 4BDPA 5HI7A 3R1HA 7AT1B 3ENWA 2RMLA 5AE3A 3QIPA 2F3JA 1T05B 2VU5A 4NYOA 1U1KA 4DV3J 1VHFA 3WHIA 4LBHA 3KLIA 5CH7B 1FCAA 3OTOF 2M4MA 2P6TA 4ECYA 1VISA 2QEXS 1SBRA 4X66F 4B3MJ 2HNZB 2Y9HA 4KBIA 3QGIA 4J9QA 3TZYA 3Q89A 3CJ4A 2WVEA 4J9LA 1RBOB 2W4CA 3KOAA 4I7FB 3N28A 4JI8F 1RA6A 4ENOA 2RAQA 5E0OA 5IT9U 1YZ6A 4FP9A 2EKYA 3CO0P 1HBMB 3BGOP 1YWXA 4I67A 5BXIA 4J5OA 3CCJS 1DJ0A 2MTLA 3W8PA 4HDGA 3RBEA 4IFYA 5L1KA 3E01B 2BQUA 3M2RA 3H4BA 4NA2A 2OD6A 1IKVA 4N47A 2GVZB 2EVZA 5H9FK 3ZFVA 1U0HB 1Q81T 1UKUA 2HNDA 3MMCB 2KFZA 4TY8B 2IM0A 1P9YA 3VZHA 2HK3A 4AL5A 2GC8A 5DG9A 1J5OB 2EW9A 2HFSA 3CCLS 1YKWA 5L8RC 4JI7J 4DI6A 2ZH1A 2XM3A 1XJWB 5J2NB 2XMMA 4J9MA 2EPIA 5C24A 3HHNB 4OYWA 5KFOA 4FPIA 2FUG9 1JLFA 4KB7A 4UY8T 2YKAA 5DQGA 1ZM3A 2XG8A 2FHOB 1FRKA 1RTHA 2IFXA 4DX5A 3R7BB 4PG5A 5F9NA 2CNNB 1DLOB 3BR9A 3BS9A 1Q7YT 3M8WA 2G0CA 3OTEA 1S72S 3GZ7A 4IYQA 4OZNA 1VBZA 1S9GA 2ZITA 2Z2MA 4NLGA 1U6FA 1SH3A 4ZVFA 3KJFB 4IH5A 3CMES 3DXSX 2CQ1A 1L3KA 1KQGB 2I9SA 3Q24A 3LP0A 5CZXA 1SKWA 4Q5VA 1QAIA 3W7BA 3PJXA 4CTAB 4Q7AA 4ID5B 1DFDA 2ZH4A 4OI4A 2DR5A 3ILOA 1ZM4A 1Q82T 1MROA 1VC6A 2H4WB 1ZM2A 4C4WA 1U2RA 4QYRA 4LVOP 2V4JB 2UXBJ 4JI5J 4FZVA 3LP2A 3K17A 5CXTA 2CQ3A 2A0FB 1TU0B 4Z37A 4NLWA 4M5LA 1TUGB 1X0FA 4ZCMA 3OD2A 4UTGA 4YDXA 1K0TA 1D1UA 4ZP7A 5A2QY 2FVQA 3QWPA 1ITPA 4CLUA 2RNEA 1Y4ZB 3OR1A 2HSEB 1ICEB 2ALYB 3A3NB 2V6AA 2XI2A 4CLKA 1HARA 4MIAA 1RGVA 1SL0A 3TARA 1JXLA 1YZ7A 3T41A 1SJQA 1U2FA 3BSAA 3PG9A 1QUPA 2AMCB 1IBMF 4KGZB 4NEZA 3W62A 2NUHA 4WTOB 4OHZA 3HJFA 4DPOA 4P7TA 1NSKL 1AW0A 2BR0A 3R1LA 3M2VA 1NJXA 3HFZB 2NCKL 2CJ9A 2GX8A 5DDOC 4A8KA 1U7LA 5D0HA 4EYHB 4GRSA 4YB1P 3MM7A 2QMXA 4JV5J 3UO0A 4DCPB 4WU2A 2B6AA 3C15B 2XQCA 2IVMA 3F44A 4Q0BA 4DPXA 3TUIC 3KMQA 3Q8SB 2DNOA 3KUEA 1UPPA 4ANCA 2VICA 1F60B 4CT9A 4QZVB 3VHQA 1N34F 3VVUA 3RBDA 2HAIA 1QLNA 1VQNS 3I4PA 3U1NA 2N3LA 3M8SA 3VVTA 3PKYA 2R7RA 1TL7B 4JI6J 2BW7A 5HMYA 4ZLJA 3R7NB 2Y0SD 1YGYA 5C25A 5CYQB 3SCIE 4H4MA 4DV0J 4PUOA 5LXRA 2RUSA 2BMBA 4KH0B 3CDWA 2ZC4A 4QWDA 1X9MA 2QSFA 4XIUA 2LQBA 1IBMJ 1RU2A 3OJSA 1TK5A 1FXLA 3UFCX 4ZPTR 4B9NA 2PC6A 3DLBA 5F8GA 1T05A 1S0OA 2DCUB 2E1CA 4R25A 5T7LA 2BM1A 2R7QA 5EGYA 4HTJA 3SCJE 4Q2MA 3CJ5A 3KK1B 5DDRC 2HNZA 5LSLA 3BH7B 3FMWA 3UNGC 3TWZA 1BY9A 4HKQA 5HBMB 3HHDA 1UJ5A 2N82B 4CLFA 4I7FA 3JYTA 2E9ZA 3DM2B 4NA3A 2O1PA 4JI1J 3EE3A 3UD3P 1GMWD 4NE9C 1REVB 3GV5B 1HNIB 1HBMA 1RXOB 1S5ZA 1W26A 3MHYA 1BWEA 4FYWB 5KT4A 1IBKJ 1N34J 2BOAA 4IO9Q 1WUUA 5J1EB 2JLGA 1KKHA 3E01A 1CEZA 2WK4A 1O51A 4NRUA 3HT0A 3BR8A 1BQXA 3P6YC 1XMQJ 1IQTA 3GIRA 3U7JA 1BUXA 3L3CA 3MPUB 4U8VA 1Y10A 3VR1A 4DOZA 2GVZA 2F7VA 3D4JA 4KPYA 3DN9A 3GG0A 3MMCA 4TY8A 1OSDA 3SSSA 2BRKA 3T9ZA 1ZAWA 2X1FA 4H54A 1PYSB 4O0NA 2O5DA 4OI6A 3FEYB 4ZHRA 5KT2A 1J5OA 1FKAF 1LWFA 1YBTA 2E5HA 2RB7A 2KT2A 3HKWA 5J2NA 3KG0A 1WNEA 4X4UA 4EEYA 1F2GA 1KOOA 2R8HA 2DGXA 2KI2A 4XAKA 2BA9A 1ZA1B 2VFRA 4DCJB 1FF2A 4ZVEA 2DNNA 3MGJA 2V2QA 4DZDA 3HI9A 2V94A 3CJ3A 2IJRA 4MH8A 3MEEB 1BMQB 4DUTA 2WCXA 1J5EF 1EIYB 4NCGB 5DDQC 3MECB 3MUMP 3OFEA 3IG1B 5KFHA 2VA3A 2XEXA 1T11A 4H4KC 5LSOA 3CJTA 2R3VA 5MAOA 3IWLA 1GX5A 4HR2A 1SIZA 3R7SB 3CCUS 2CZ4A 2MQ8A 3GILA 3SXLA 1FTCA 3HLUA 2DJWA 2V2ZA 2ADCA 1RAAB 3SCKE 1SH0A 3PXGa 1N48A 2AGPA 1KVIA 3LQVA 4CTAA 4PRFA 4ID5A 5B0BA 4KPCA 3R9LA 4XPCA 3AA9A 5F8MA 4HACB 3CCQS 1O5JA 2FJAB 4B3TF 1CLFA 2UXDF 2FDNA 3K89A 2BW2A 2V4JA 2OMLA 2A18A 4BWJA 1MN9A 4NLUA 5IC6B 3AXKA 5B0GA 3HVAA 3IM8A 9ATCB 4PQAA 2HWTA 3EZOA 1YJ7A 1YI2S 1K0VA 3TANA 3W5YA 2R2SA 1RA7A 3EVWA 4HVZA 2RDDA 2CNOB 2H1YA 4X65F 2BKNA 8AT1B 5HN0A 3PIPQ 3DU5A 3GSIA 1UEUA 3TZXA 3PW4A 2UV8A 2AZ1A 3I5CA 4OHYA 3K5MA 1VK8A 4I69A 1UVNA 1RAFB 4WF9Q 4LF2A 3JXOA 2WSEC 2KHDA 3EXCX 2ZJPQ 1IBLF 5BYSA 2HQCA 1R0CB 1KVKA 3DGPA 4CT8A 1M5HA 3BKFA 4QWEA 3EDQB 5L46A 1NJZA 5K14B 2HHSA 2HVZA 5CYMB 3L7OA 1KFSA 1YJUA 3UD5A 1T03B 2DIUA 1CSJA 1H98A 2K2PA 2V8PA 4Y6IA 1R27B 3GIMA 2B3TB 4DQIA 2CQ4A 1AUDA 4B3TJ 3C15A 3HHLD 3FRZA 4C8LA 4EUVA 4CWBA 2G0IA 4JI3F 5KG5A 1OWXA 2CQDA 4ECSA 1KLMB 1FT8A 3R27A 1VJWA 3IO1A 4ZK7M 4LT6A 5IM0B 2UUBJ 3I82A 1PYTA 3GQCA 1Q5VA 4CO1A 1TL7A 2J8AA 3CJQA 2VG5B 3BO2A 1XMOF 1RTIA 1RWUA 3EJMA 2QGFB 3TUZC 5CYQA 5KG7A 2VD3A 2G0JA 2Q79A 2E1RA 1KRPA 3GYGA 1UFWA 3AH6A 4R5PB 4HLBA 2F4VJ 2DRAA 3QWUA 1AUSL 3OSPA 4DV5F 1V3SA 4CO3A 3SSQA 2LU2A 2ZEJA 1D0EA 2HFNA 1S76D 1EKSA 3R3TA 3BQ0A 4M95A 3KHLA 1VC0A 2HHPA 4OX8A 2CQHA 1G4CA 4ECWA 2GAHC 3MURP 3KK1A 3GR0A 5G4DA 2NYIA 1CJKB 5HBMA 3M9OB 4ECZA 3MEDB 2DNQA 5E2QA 5F41A 4OJ1A 1J27A 3N0VA 2M8HA 4Q2LA 2J9DA 4TLRA 3DM2A 2VFSA 2ACMA 1JXEA 1REVA 3S7RA 1HNIA 1LXNA 4NPOA 4GKKF 2KDOA 2QA1A 3ZZUA 3PNIA 5C7PA 5J1EA 4LSZB 5HROA 3H98A 3GU0A 4UZBA 1WORA 5L1JA 4MMOA 2OPRB 2U1AA 4JV1A 3RR8A 3A12A 1HL6A 3CCES 2IYGA 1REGX 2AEFA 2RJZA 3M1VA 4KGVB 4DPTA 3S01A 3LF0A 3D6MB 4MKBA 2R7OA 2QLFB 2JJ4D 1LNQA 1P1TA 4M1KA 5U47A 3FNNA 2YKQA 2ASYA 2OPQB 2WRMA 3DDKA 5BR8J 2R7XA 2AKWB 4ZJLA 2XMTA 5M2RA 4NLYA 1N4LA 2XULA 3FQLA 2NQPA 2OTLS 2YVSA 4OFZA 3O8WA 2QT7A 2XS7A 4OZJA 3ULHA 5LJ3Y 2JHEA 1RADB 2EBEA 4DR7J 3SQGA 2HURA 4FNIA 2KVQE 1KOHA 3TJAA 3IWXA 5KFAA 4LFCJ 5KFZA 2MB0B 3TR5A 2R8KA 1PJ5A 3MEEA 1M5OC 4Y34A 1DURA 3FKBA 4NCGA 1XNQJ 2FGCA 2XY6A 3IG1A 4OLPA 4B9LA 5A8WB 2BKPA 4JI4F 5IT0A 3NWGA 4RX6A 4ERDA 2DBBA 4TLQA 1KNZA 1WG4A 1XNRJ 3DKDA 1HR0F 3B82A 2MHEA 1DAXA 2FHMA 3BN7A 1ZPWX 3CJ2A 2XSJB 4UOFA 1KN6A 4K59A 3BSCA 4X84A 3M6XA 3KNGA 1OMSA 2FJBB 1VRQC 3MR5A 4JI2F 4Y2CA 1NNDA 5J1NA 3L09A 4EMDA 2NPFA 4KTQA 4M5JA 1S9EB 1A9NB 3TUJC 4HACA 2Z2YB 4IQXA 4ZP9A 1EHWA 1NU4A 3W9HA 2GA7A 5KOWA 3U02A 4NLQA 3ISNC 1Y11A 1JKHB 2YWWA 3MD1A 1RHUB 2FY8A 4PXBA 3TUPA 1RB0A 1TVRB 4YMEA 3EUNA 4USUA 1FVSA 1GAOA 3W8GA 4OI3A 3D9BA 4WFXA 3MR7A 2MKJA 1RT7B 1YRUA 4K4SA 4ED7A 2MPUA 2H5IB 3U1MA 1RABB 1ROFA 3GIIA 1T7PA 2VKZG 4KKOB 3UN3A 1SKRA 4Y0FA 4P74A 2AJ1A 3TVZA 2GW8A 1IWAA 4IOAQ 4X4OA 3ZZTA 5L39A 1UVIA 4JB8B 2GJIA 2E5IA 4HYKA 2YQ0A 4CH0S 2DHHA 2H65B 3CJ0A 2FJEB 1HWIA 4PYAA 2QFJA 1TKTB 3PJ9A 2DB1A 1OIAA 1U2CA 2B43A 4KYZA 3M9NB 5K14A 2QN6B 4EO8A 2LEBA 2FJDB 4F02A 1WHWA 4LRAA 5CYMA 2D69A 1T03A 3DRRB 2N4CA 3W64A 1TKZB 3LPEA 2CZ9A 3R5DA 3AHPA 5B08A 2BZ2A 4I64A 1WI8A 1T02A 5B0FA 2UXCJ 1L3SA 1MMDA 3OLBA 1UL3A 1CG2A 1NK6A 3TEGA 2NXCA 3MXHP 5B0AA 3OHAA 1S1XA 3T1AA 1NKCA 3WX4A 1KLMA 4CLZA 2EFNA 4DR5F 1VLOA 5HMXA 3TJ8A 4ZLPA 3EVMA 2LXUA 2XLIA 4QIWD 3RJMB 3H5SA 1QAYA 4RLEA 4OIXA 1UVMA 2VG5A 2DPJA 3EMTA 4DR2F 1E6YB 4QIVA 3W63A 3V6HA 1OO0B 2CXEA 2C3YA 2HRYA 3T5JA 2JFDA 4R5PA 1SH2A 2RIJA 2D3OR 3OTCA 2UUWA 3TA1A 3THPA 5FD1A 2EG2A 5LL6d 2DGTA 1FEEA 1W2IA 3SFUA 2CWKA 3NKYA 5H9FJ 1FFGB 2E7WA 3OHBA 1R3NA 2QL9B 1N6QB 4HL9A 2UUAF 5KFRA 1RTZA 5C2GA 2LMIA 3ET6B 4C97A 1Q0NA 1QTMA 4WZQA 1WC0A 1MSWD 3POTB 3G96A 3IRWP 1S99A 3KHRA 1CJKA 1D9AA 1YLXA 1GNKA 1YVFA 1DBDA 1ZM9A 2HZCA 2F4FA 2J76E 2IA6A 3AA8A 3VAIA 4K0KF 4USJC 1JNRB 1K1QA 1T3NA 3KKFA 3B4DA 3WBZA 3B8HA 3SBMA 1S0MA 4ZVTB 3OL9A 4DR1F 4DR5J 1BQNB 3HHLB 4YOEA 4DV7J 1JWWA 4PQUB 4DJBA 3K8WA 1QM9A 1B0TA 2RQCA 1IQZA 2PDAA 4MYUA 2VQEJ 3NOGA 2W9AA 3MZIA 1Q86T 2I8EA 4NL5A 5KFXA 4OYBA 1YJWS 4OL8A 1VCTA 2J9EA 3ZC4A 4DR3F 1LEOA 2RSQA 4L76A 3R5JB 4XPEA 5FIIA 5HK4A 1N5QA 3QT7A 2V8HA 2WSFC 1UA1A 3QYYA 4M8LA 3IAM9 1F9HA 4HHHA 1WC3A 2B51A 4X4VA 4KHPF 2F8EX 3FVYA 2OPQA 2N7CA 3IBWA 1HBNB 2CVIA 2DY9A 4OYIA 2GJ2A 4L74A 1SJFA 3LP1B 2IRUA 1RE1B 4LF4F 2UV8G 1U25A 4WXWA 2RRNA 4I0WA 4OV6A 2FLLA 1HHSA 5A2QU 2GHVC 2CPFA 2Z2LA 4CNYA 2OPSB 2ZZTA 2E1AA 3ETMA 1N8RT 2V63A 3SYZA 3BZQA 3MM5B 2XLJA 3OBIA 1DY3A 4LF7F 4ZP6A 4Y2MA 5A8WA 2AW0A 2LDYA 4ZVOB 2HVDA 1KD1T 3MR6A 3HMJG 2CIMA 4A46A 4YFUA 4JI0J 2F1FA 1WG1A 2JEGA 1FEHA 2P5VA 4OJHA 4RNMA 4F25A 1H3DA 2QV6A 1UTAA 1GMWA 3OR2B 1G3OA 4DFKA 2XMUA 2XSJA 2MLZA 3TNVA 3BN4A 2R8JA 2D1CA 4Y28C 1JJCB 2KG1A 3TVKA 4YY3J 1F9EB 3N4WA 1OQ3A 1O0PA 3ZTOA 4DPYA 2ZWOA 1PKUA 1QAXA 3QSIA 2RDJA 3UPFA 4A8OA 4DR6J 1B0PA 1TL4A 4LBPA 5HJYA 3BBCA 5IT9Y 4N56A 4LFBF 2FC9A 1JKHA 2J0WA 3A8EA 2VV5A 4P6QA 4ZLLA 2LQ9A 2W9CA 5E5NA 5LJ5Y 1TAUA 1XR6A 3QFHA 4CDIA 5D0EA 2QYCA 2BE9B 4P2FA 2V9KA 3FGVA 1RT7A 1T9TA 2DHGA 4UW2A 3AD9C 3EDRB 1IUJA 2X3DA 4FF4A 3TA0A 4KKOA 3CIMA 4A8YA 2C3PA 1WOOA 1E6VB 2DK2A 2A1BA 1R31A 1U02A 2QG9B 4D3GA 3H5UA 1TKTA 4O3QA 3OXFA 1NJWA 2RQMA 1PBAA 1NXIA 3EGNA 4ED2A 3NGDA 4QQBA 1S6PA 4X4NA 4R0EA 5THWA 3OLAA 4LRCA 3TYTA 1H74A 2C2EA 4L75A 3DRRA 1MU2B 5ITHA 1TKZA 4FKYA 2J9DE 1KTQA 4A47A 5DO2A 3BPDA 3I5AA 1RT4B 2ZH8A 1B4SA 4I2QB 4NEYA 1GK8A 3ZNJ1 2H48B 1JK9B 1URRA 4IRKA 5LMUF 1F3FA 1HD1A 1HNVB 4LFBJ 2B0GA 4DQQA 2Y1RI 4P9SA 4KV8B 2DD8S 3BBFA 4K4XA 4BLGA 2PI5A 3H40A 2XWXA 3CCRS 4AXIA 1Q8KA 2V5HG 2AYEA 5GAHI 1RKIA 2D3ZA 1FRHA 3SZ2A 3BQ1A 1KHWA 3OL8A 2BYCA 2BABA 3HSZA 3M8PA 2OPPB 4DR4F 2DXFA 2KKHA 3FZ2A 1IXKA 1R43A 1PC4A 1F6TA 4ED6A 3M9MB 1Q8BA 5KFSA 3C19A 3CD6S 4DL6A 3MEKA 4OX7A 3H25A 5FJ4A 2VJUA 3QMQA 5J1PA 2H9ZA 1N6QA 4DS4A 3MCMA 3K5LA 2DO0A 3CF5Q 3ET6A 3P49B 2XMJA 4K7QA 3TEHB 1PCAA 3D3CJ 5B09A 3HDSA 5CABA 3K7RA 5E3PA 3POTA 1Z2ZA 3TP2A 2WW4A 2HHUA 2AX0A 5IWAJ 1DTTB 4N7TA 2Z4PA 2HWHA 3D6FB 3WC0A 2U2FA 4LF5F 3F41A 2A2CA 1X4FA 3MTJA 1R6YA 4DN9A 1WHVA 4Q43A 3T1YJ 2MLYA 4DWIA 2WONA 1K8AT 3KLHB 3HHLA 1EP4B 2LKZA 4ZPAA 2QMWA 1V5IB 4ZPDA 3JTPA 1XQIA 5AJ3J 3CNQP 3AY0A 4WK3A 4FVMA 1VRUB 4RU2A 1GXTA 2ZNYA 2GVDA 3ZTRA 3PW2A 2B5JB 1FD2A 4OI1A 2C2KB 3L4BC 2UUCF 3HPOA 2HHQA 2CWXA 4ECTA 2Y1LB 2XO7A 3THTA 3MTKA 3K58A 1VQ6S 2VOPA 2E44A 3VWSA 3KK2B 1BHNA 3DMJA 4IRDA 3ONQA 2PE8A 3PIOQ 3AJDA 2ZH2A 4KAIA 2VONA 3KJNB 3LP1A 1ZETA 1DRZA 3PR5B 3CCTA 2XNRA 2HHVA 2F9JA 4LSLB 2ZM6F 5J2QB 4OHWA 4CLWA 5EUHA 4WP8A 2OPSA 1BQMA 2W2PP 1IR0A 1N36J 3VAGA 1FJEB 3MM5A 2BX6A 4F3OA 5GAHU 3IAS9 1EKRA 4JBCA 2FPHX 5F3TA 1NH7A 5IC4B 5GMEA 5K20B 3RTVA 5J2PB 2FJWA 3NGTA 2BJ3A 1OPZA 4Y65A 1T9XA 2Z2ZA 1EETB 3LANA 3A8IA 4I6YA 5JUMA 1IM4A 5HLFB 4OX6A 4FXWA 2W01A 3GV8B 4UUWA 1NAQA 4U9RA 1ZZNA 2GZOA 2KN4A 1UJ4A 2PMHA 2GS8A 3MPVA 2RILA 2DT9A 2BQ3A 3S1TA 3EGVA 5JMNA 1WF0A 2CPXA 5CYJA 3O5TB 3PDNA 2HHHJ 2MJNA 3UDEA 4USWA 4LF6F 2AYBA 1FRMA 1QDUB 1S57A 3AOAA 2MKKA 1U09A 2MJUA 3W2VB 4AD6A 4B9UA 3O6QA 2QLJB 1S6QB 2KTQA 2XY5A 4C48A 3GWCA 3VQTA 3LUYA 4FKXA 2W1BA 5CZVA 1QVGR 1NDPA 3J7Z5 1T0TV 4FYDA 2WVBA 3ILJA 4DX7A 4G1IA 3I0SB 3AB2B 2CQGA 3A8JA 1TTHB 4AXJA 2KB2A 2ILYA 4O3RA 1CPZA 1U1PA 3JTOA 4ZVGA 4NZ6A 3MMAB 4ZPVR 1CS4B 1VYAA 2BBEA 4DFPA 4C0HA 1R7IA 5DLGA 1MU2A 1PSDA 4K4VA 4C8MA 3OW2R 1RT4A 1BLUA 2G2ZA 4I2QA 2MQQA 4X4SA 3PW7A 4B3SF 1HNVA 2E7XA 1YJTA 2R7UA 5DRKA 3VAFA 4MIBA 1X7VA 4TU9A 3FDSA 1WEXA 1RUSA 4KV8A 3IRXB 3DRSB 3PACA 2VQFF 1KC8T 3MEGB 1ZOTA 4LF6J 2C42A 3Q8RB 2KXFA 4TKTA 5E33A 1FNXH 1K9MT 4QR0A 5L9XA 2JVRA 3PV8A 3NEKA 1KQKA 3QRPA 4NI2B 3HFVA 1C2PA 1H6KX 3A4TA 3DLLQ 3Q2TC 3CDAA 3FK4A 1ULRA 3SSRA 3HSJA 1RK8A 3CMAS 4RUCA 2IM3A 1C0UB 1U8WA 2PA3A 2CNLB 4CLLA 2RF2A 2CJXB 3RAXA 3PY8A 1BXNA 2CJBA 1XTZA 1KSPA 1IJFB 3O1LA 1UVKA 1T94A 2O01C 4DU7A 3QQCD 1EQMA 3J81Y 1GTHA 1MNEA 3KDOA 4YEAA 1DTTA 1YHQS 3OXLA 3KUGA 1TV6A 1MN7A 4P7VA 1PAUB 4O3OA 3HD2A 4IG0B 4QU6A 2OO4A 3M8YA 2WBRA 3A3OB 2YXLA 3EZUA 3IC1A 2XGPA 2N3OA 2DYAA 3THVA 4DSJA 4JV0A 2YWKA 4QR2A 1S48A 3KLHA 1EP4A 2FVRA 4EBCA 4YS2A 1RI7A 1W25A 1Y7PA 3UDVA 4IG3B 4DBQA 5I3UA 4LFAF 1IBCB 1VRUA 4F67A 4LMZA 4J91A 4DSEA 3NMAA 1C1CB 3I0RB 2GO8A 2B5JA 4CO5A 3G71S 2JX2A 4O23A 2MZTA 2ZWPA 2NXNA 3GCWP 1IKXB 2HHWA 4IO1A 3M32A 1TR0A 3KK2A 1WC5A 1HWUA 5GADI 4KGXB 4JP8A 4CLYA 3HVRA 2KM8B 4QYZK 2ZBQA 4WK1A 5B0EA 3FBFA 3D28A 4ER8A 2PO4A 3BREA 1LWCB 2J7KA 4E2FB 3KHGA 4HT5A 5HATA 2I5JB 3UNYA 4PPDA 2HHXA 1WOPA 3PR4A 1H2VZ 1M5VC 5J2QA 2ABYA 2V4QA 4NLSA 4B3OB 5HMZA 4ED3A 5KG2A 2ZDOA 2DNKA 5IZHA 2W7AA 5LXYA 4ZVHA 3VV2B 3CD7A 1S1UB 2YH0A 3DU6A 2YX1A 3JQKA 1NK9A 2HS0A 4USTA 2DNMA 1N54B 3GG1A 2A6OA 1ZPVA 5J2PA 3GIJA 2BJEA 1PJ6A 2PA8D 3PFEA 4C3KA 3DHXA 4WFAQ 1EETA 3GIKA 5AXKA 2R42A 2R2UA 4F0HA 2H51B 2ZVIA 4F26A 4DUZF 2ATLA 4R0JA 4MK8A 2I6WA 1O6XA 1JLQB 3QAEA 2EXUA 1HNZF 2YNFB 5F8LA 2HS3A 5GAGU 2VOOA 5JXSA 4BCAA 1FKPB 3MPWA 4ANDA 5KFPA 4F4AA 1NBEB 3T1HJ 4M63A 3V6DA 1NMEB 4N8NA 5E3RA 3CXCR 3H42A 3R2DJ 1RACB 2J6SA 4W90B 1DQAA 3I4HX 2MHNA 2PFFB 2AGQA 5BYQA 3W2VA 1SL2A 4OYOA 3E2EA 2QTWA 5D0GA 1TELA 2YQ3A 4HDHA 3ENVA 1W2BR 3W2WB 4P2MA 1YIJS 1I94F 1UW4A 5F8JA 1NHVA 1F2HA 2EK1A 1RLCL 3RB3A 4WZMA 3T19A 1SI9A 2GV1A 1NK8A 2MSTA 1C0TB 4P10A 3MF5A 4P75A 1RAHB 3Q8UA 2XCAA 3KTQA 2GIFA 2RVJA 3KUHA 3NNCA 3QT8A 5DDPC 4ZS6A 2B4PA 1IM6A 1BE4A 2LYVA 2QYGA 3CJ8A 3MMBB 1H0HB 4LRFA 1CJVB 3CCWA 4DV2J 3MMAA 4ZOSA 5GADU 1CQMA 1CS4A 4CYUB 1L3TA 5DZ7A 3CJKB 1FFSB 5D4OA 3IFEA 5L9NA 1HPZB 1H7WA 3PYGA 4V19X 3H0PA 2BM0A 4EK2A 2OIHA 1Q7LB 2L9WA 3C14B 5G0RB 3NGUA 2ZD1B 1QVFR 3IRXA 2CJAA 4P2XA 2GFFA 5ETQA 3MEGA 2E66A 1RQ0A 1RLDA 4B3RJ 2G2OA 3ZZ0A 1TP7A 2MGZA 1FJCA 1F5BA 1R8CA 3CC7S 4DV3F 3IGVA 2LDIA 5E3CA 1RWNB 3QO9B 4NI2A 3TO8A 4B3MF 1K47A 4EO6A 2RKIB 1G6BA 5LT5A 4I2PB 4DCOB 3GFXA 3W61A 1HWJA 4YB7A 2HLUA 4A4JA 1C0UA 2OAUA 4FS1A 2DR7A 1RCOB 4EGLA 1RT1B 4UQTA 3I87A 2WVCA 4UOCA 4BBYA 4NLTA 3ZZYA 3E51A 1TK8A 4RBTA 5IV4A 3DRXA 3MCSA 1JLBB 4DPUA 1WJ9A 1X60A 2JDJA 2F65A 2O67A 4RBUA 1HI0P 3OTBA 2CG4A 2W7PA 4C0OC 2OJ3A 2LVWA 2A3JA 3HO1A 1NPRA 3HULA 4RNHA 1APSA 4I6WA 2DGVA 4OI0A 5HQMA 2G2YA 4ITSA 4B02A 2BOPA 3IS9B 5DQIA 3QT6A 5I4MA 4J37A 2MZQA 2ZE2B 3R6GB 1GEHA 5KOXA 5H1SV 4LSNB 4FN5A 5B0CA 2FQQB 4NXNJ 2M70A 1WF2A 4JI7F 1VQKS 1YJRA 1M5KC 5HVHA 1JMTA 3N6LA 4NMXA 4IG3A 4X62J 1D09B 4ZKAA 1Y3JA 2X1GA 3VALA 2FHJD 1C1CA 3I0RA 4BC9A 2IC3B 5FLXU 2W8LA 1IKXA 1UA0A 2ZNZA 3HZGA 3P45B 3L95X 2FB0A 4WFBQ 2VIHA 3V2UC 4QOTA 4ZVQB 3M8RA 1PGZA 2RUGA 3GONA 1SVDA 1VQSA 2OI2A 3RRHA 4J9UE 2J6TA 5HVGA 4DHVA 4I68A 4J9NA 1B0VA 3RB4A 1S1TB 3N9UC 4PWWA 2PEHA 1QSSA 2L41A 1LWCA 2ERRA 1PILA 2VFTA 4NLDA 3V4IB 2I5JA 3R97A 1IN0A 6AT1B 2FY1A 3SFGA 3CIZA 1VQ9S 4B3OA 5KFJA 2DY1A 2CUYA 1S1UA 3T6BA 3IBFB 2O3DA 3TVYA 4DL4A 3KDNA 3MCNA 5HQ8A 2IVYA 1XEZA 4DDFA 2LECA 2M7SA 2HNYB 4QW9A 2IY5B 2GAGC 1TKXB 3J80U 2UXBF 1HHTP 4JI5F 4KH1B 1RT3B 2DHXA 3JS9A 4PYDA 1Q95G 2HVEA 3IP0A 2BJDA 4GKJJ 2W4PA 2RU3A 1JLQA 3C66A 1MMLA 3OUYB 4O4GB 2CADA 3WIUA 4U7UD 4KFBB 1FDDA 2YNFA 1TL1B 3CUNA 3QGHA 3QRRA 1YRXA 5KT6A 3NNHA 3DRPA 2FYXA 1N5YA 3QSYB 1YK9A 3NRBA 1FKPA 4GMKA 1WWHA 4LIRA 2L9NA 3D67A 4CIOA 3HSGA 3CDBA 3FC9A 1RAOA 1Y00A 3DLEB 3MOZA 4ZLNA 1UFLA 1RSCA 3GE9A 1RAEB 1R8PA 4YUDA 1SC3B 4EI2A 1RHQB 1U48A 3AT1B 2KH9A 3BO4A 2H4YB 4TQSA 4UUXA 2G9OA 3CEDA 4KO0B 4EWTA 1HBOB 5IQQA 5KFLA 4X4TA 5JJBA 2VG6B 4CM0A 2WB1D 1L3VA 3ZNUA 4K8RA 3W2WA 2IHR1 1RWXB 4OZLA 1C0TA 2KT5A 2J0QD 4OJGA 2JRSA 4JV5F 2IM1A 4NWBA 3RGIA 4TYAA 2AHOB 5CD4H 2LXIA 1FX2A 2D41A 2QSWA 3PO4A 3D1OA 5DS7A 2XTJP 2DR6A 3MMBA 2EFVA 1CJVA 3AFGA 3PEJA 4CYUA 5T14A 1B7FA 3DLGB 3CJKA 4E0DA 3BGRB 1ZS6A 4JI6F 4CO4A 3OVBA 3DOKB 2X1AA 2KZMA 2D74B 2VL1A 3CDEA 3HVTB 2M0GB 2YPZA 4Z7CA 1S1WB 1NKEA 4DV0F 4AQYJ 3C14A 1NSAA 4DL3A 2HQFA 2ZD1A 4J9OA 1DTQB 1WTBA 3KYLA 3K57A 1LK5A 2OFHX 1KBRA 1H73A 2PT0A 1BC6A 1WC4A 2AJFE 3QRQA 1UFKA 1RAGB 2AIRB 3QO9A 2JH3A 3MDFA 4OJ3A 2WAQD 3G8SA 5IOLA 2ZOGA 4G3IA 3MAHA 2RKIA 4I2PA 5SUHA 4ED8A 4ZCLA 4EZ9A 1RISA 5ETOA 2IVFB 2ZKUA 2CDQA 3PVXA 5ETSA 2CQPA 1RT1A 4JI1F 4USVA 5BJRA 2ZH6A 4ECUA 4DV6J 1IBKF 5KT3A 2R2RA 2XZTB 4IH6A 1JLBA 2JNJA 4RNOA 1XERA 5AXMA 2FTRA 1GQEA 1S6UA 1XMQF 2HMIB 1NHKL 4KQZA 5IFMA 3HXMA 4K4YA 1MW7A 1T8EA 4CZCA 1WKKA 2G4BA 4M5GA 1ZYQA 3D1HA 1KVJA 5D15A 2VC1A 2R7SA 4F4XA 2BV3A 1HLWA 4M5HA 3IS9A 2ZE2A 1S12A 2P2CB 4LSNA 3T5HA 4JOUA 3SV3A 1YRTA 1HQ2A 1R8AA 8ATCB 2W2OP 4M5IA 2XI3A 3NS5A 1RBLA 2N4DA 4DL7A 1PC5A 3SIPB 2E5GA 1RT2B 3C2PA 2MZRA 2E1PA 1RTJB 2QL5B 3C6TB 3H2UB 4YDDB 5KFMA 3KLVA 5E3QA 1WSRA 1S4EA 4FNHA 4DG1B 5H9EK 3CB4A 4X64J 1Q16B 2GNKA 1FNMA 3ZZRA 1VQPS 1FESA 4NYZA 2VFUA 1UW9A 1U1RA 1M90T 1OYEA 3AQOA 3TZWA 1HHQA 4ES1A 2RD5C 2UVRA 3V4IA 2B8QA 5B7WA 5LMNJ 3D6TB 5D8HB 7FDRA 3G6YA 4LREA 1SXLA 3MM6B 1FJGJ 2CYYA 2XNQA 5HL7Q 2WOMB 1KLNA 2W2MP 4CH7A 1U0HA 4ANEA 5F8NA 3AAWB 1V9OA 3W5ZA 4ZPCA 4F7VA 3RYLA 5KFBA 4DV4J 1HNWJ 2CVEA 2HNYA 2AX1A 4P52A 4WKYA 2DO4A 1LXJA 1TKXA 3HSDA 2ATCB 3T9NA 4OYXA 3QZ8A 1D9FA 1HA1A 1RT3A 4XTTA 5D4PA 2V50A 3P4UB 4YHHF 3BJYA 4D3HA 1I1GA 2RE1A 5GMDA 1FXDA 1Y0HA 4WCEQ 2XO6A 2P9GA 1CULB 2KU7A 3AJ1A 4MFBB 3HM9A 2F8HA 4N41A 5A0YB 4WE1B 1Z2LA 3OUYA 4O4GA 2X1BA 4V19J 1NO8A 1NK0A 4KFBA 3UN2A 4XDCA 2EKNA 3L9ZA 1T9YA 1UJ6A 2ZOFA 1FD8A 1DLOA 2GCFA 2BEFA 4ED5A 3SI8A 3QLHB 4P71A 3LGHA 1VQMS 1FRJA 2HIYA 2XMKA 3PW5A 1RHJB 1TL3B 2W24A 3R5BA 1IKWB 3PW0A 3GCXP 3DLEA 1X5OA 4CNZA 4GO7X 1N32J 3KNAA 1Q78A 4LJMA 4KO0A 4B9SA 3UE2A 1HBOA 4F2RA 1S59A 3NMRA 2RHSB 3IR6B 4U8YA 4DF4A 2C2OB 4RW6B 1RTDB 4LIWA 5KFFA 3M8QB 2G1HA 3C46A 1LW2B 4LF9J 2XMWA 2Y3YA 3FBCA 2ZJQQ 4GVLA 3D1QA 3LAMA 1LWXA 3VAMA 3D2WA 4YHHJ 3C8YA 5HAOA 2WVFA 3GP9A 4IFYB 1C4AA 3BBBA 4M5DB 2QLWA 3TA2A 3DDIA 2UUBF 2YH1A 1HNXJ 2WHOA 5LSRA 1Y5IB 3J81U 1IKVB 5F9LA 3DOKA 2Z57B 4ZDNA 3A13A 1PJ7A 1LW0B 4J9KA 1AROP 2HNDB 2EK6A 2PEBA 3HVTA 3TX8A 2QMUB 1U6ZA 1S1WA 4NCAA 5B0DA 1VBKA 2YNHB 2F4VF 1VOMA 2W9BB 2CDRB 1HKAA 2K1RB 2V4RA 2R2TA 2PI4A 1QY7A 4NLOA 2ZH7A 2WZ1A 1YQHA 2K7KA 2BJ1A 1DTQA 1S0VA 2CQ2A 3F73A 4KC5A 3H5XA 3D7SB 2HHTA 4WIIA 3NGKA 1IR1A 1TKDA 1TFYA 1RWWB 1WC1A 2GQQA 1I51B 3D5MA 3BH6B 2AJQA 5KG6A 4ZIWA 4DUYJ 3PX4A 4C98A 4OZ1A 3ZTSA 2VKRA 4IKAA 4DF8A 4KGMA 1UWBB 2R7VA 3B4MA 3GJTB 1UPMB 2MKYA 3DYAB 3AXMA 4B9TA 1X5TA 1T9UA 1Q4RA 2D3O1 2EBGA 4O3PA 4YR2A 4GC6A 2LQJA 5DM6Q 2GIRA 1VQLS 3OTDA 2DRDA 5BYRA 2AU0A 4IR1A 2KRRA 3UDCA 5AE2A 4QYZJ 2HMIA 1RWVB 4DZ6A 1S7IA 2AJ4A 3D0HE 4F0MA 3OFGA 2HGNA 2PSZA 2VPYB 2KT3A 3BKUA 2MQLA 5KG0A 2AJ0A 3OXGA 2C3MA 3Q83A 1BGXT 2H3EB 2DH9A 1U6BA 2L08A 4FXVA 3G6XA 4DFMA 1M1GA 1X31C 1TAQA 5BR8F 3R2CJ 4MYTA 4B08A 1RWMB 1RT2A 2ZC3A 2IDEA 2N7YA 3FMBA 3BB5A 1RTJA 1R8BA 3C6TA 4IRCA 3EPIA 4DR7F 4IFVB 1U49A 2UP1A 1AA1B 4LFCF 3UVJB 4DG1A 2J5AA 1B70B 2VBYA 5KFTA 5RUBA 2YKOA 4QPXA 3EPGA 5KG4A 2CJKA 4C3LA 2FC8A 1XNQF 1S0NA 2C28A 3CW2C 1NDCA 3DRYA 1I6JA 3BPSP 4IDKB 1RT5B 3Q0AA 3IR7B 2IRXA 1XNRF 3FCWA 2R7TA 4PAAA 2ZH3A 3G86A 1UZHA 1Z1ZA 2WOMA 4F4ZA 2GHPA 4RO0A 3LTOA 2GO9A 2DNGA 2MLXA 1UVLA 4HI2A 2NR0A 1R89A 5D78A 4RL1A 2DISA 3MUTP 1NLKL 2B6AB 4ID8A 3TZZA 2HYIB 3I96A 1XK8A 1EX8A 1S1VB 7FD1A 1HMVB 6FDRA 3Q8YA 5JVHQ 1SL1A 1LFPA 4I4BA 1NRKA 3D68A 3NS6A 4B9MA 2RHQB 1WHYA 4YR0A 4MFBA 4TU7A 1HWKA 2QX0A 4WE1A 5A0YA 4KIAA 2EI5A 2ZOMA 2H54B 1M5PC 2CFXA 2PMWA 2GJFA 2G13A 2M9KA 2HBQB 2R8GA 1AZSB 3QIDA 2FHJA 4TQRA 4PUOB 3QLHA 3MECA 1V6HA 2ZHOA 2XC9A 1P8GA 2DCLA 1TL3A 1IKWA 4ZITA 1RCXB 3AOBA 1VC5A 2KYZA 4ZVPB 2UU9J 4U67Q 1U47A 2W2QP 3IXQA 4ETXA 4HH0A 1N33J 4Y2KA 2YQ1A 5T7LB 5CA5A 1OQ6A 1VS3A 2C2MB 1FRLA 2E5LJ 2E9RX 3I56S 1Y3KA 4N8OA 3TAMB 3QAUA 3OSNA 4CLSA 2OEKA 3EZ5A 4DN0A 1N56A 1NK7A 5EWEA 2GMJA 5K9FA 3ILIA 4ZN3A 4FS2A 4RW6A 2VH7A 1U0SA 3NBPB 3JYTB 1RTDA 2DRBA 2Z30B 3KXDA 1A6LA 4I56A 3M8QA 2UXCF 1RHKB 2UVVA 1LW2A 2OFGX 3FCHA 4A8QA 1NHUA 3QZ7A 2MKIA 4F3MA 4PG4A 4KE5A 2AGOA 4KJIA 4C8ZA 5KFQA 3FEXB 4C3MA 2DNLA 3R5GA 4G1QB 3PEHA 2VJVA 1SIWB 4DSIA 4M5DA 2J7WA 3CCVS 1SJ4P 1IJEB 3DLJA 2RT3A 2FLOA 2OUGA 2JEIA 1YBAA 5FDLB 4ALZA 2K06A 5EN1A 2V67A 3K2YA 3CJRA 5D0RA 3ZTPA 3TI0A 3NGRA 5L38A 4J9VA 2HZAA 1LW0A 5EDWA 4OQJA 4OZ2A 3CJSA 1IR2A 2YNHA 3VGSA 4NZ0A 2DEIA 2P9EA 4ZHRB 2W9BA 1WG5A 2K1RA 4PR6A 1LWFB 2BXJA 4U96A 3LO3A 5T41A 2LEPA 2QJ3A 3DOMB 3EICA 3VGUA 2V2VA 2QE5A 3RAMA 3HJVA 2Y8WA 4OI2A 1RKJA 4H4KA 4TXSA 3OTOJ 4P2SA 3H5YA 4X66J 1OY9A 1NKBA 2F63A 2X3GA 2MZSA 1L3UA 4F04B 1ZTTA 4DSKA 4QIEA 4F0KA 2Z56B 4FBUA 1UWBA 4JI8J 4YB5A 3DYAA 3BF4A 4TNOA 2YNIB 4MKAA 4ES2A 1GT8A 3HF5A 2DR9A 2BACA 3BYRA 4OV1A 1WKLA 4LF8F 2O66A 4HHUA 4UOHA 2BUNA 2B9YA 3HX9A 3SCLE 1VIXA 3BGLA 2B56A 3AB4B 3H7HB 4FXDA 2D9PA 2CA9A 3QPIA 3T6JA 5IM0A 3KFWX 2B8PA 4DV7F 2DHSA 4YR3A 3BDPA 5A6PA 5KFVA 3LGMA 4EFAC 3JSRA 1MLAA 2Y0BB 2VQEF 5HQLA 2APOA 3VAHA 2RRAA 2MXYA 5F3ZA 2CJYB 3J7ZT 3OT9A 1YSJA 2Q66A 4TYBA 1XIQA 4X4QA 4WWSA 4V1Ak 3U27A 2DH8A 2NSCA 3M6VA 2V9WA 1U1OA 2W25A 1UETA 4KY3A 1X4HA 3OFHA 1S7HA 1N88A 1DQ8A 3PTWA 2JVOA 3QJPA 3N5BA 1G7CB 3H20A 4IFVA 1M0SA 5HVFA 4ZPBA 3UVJA 3MEDA 1ZAVA 1KR4A 2XB2D 1Q79A 3NCQA 2MKCA 3K5OA 2IPOB 2B7BB 2C3OA 2ZZMA 4LF8J 3DLKB 3CCZA 1FRIA 4JI0F 3RB0A 4C9DA 4MIWA 1WHXA 4J9RA 3DGPB 3KLFB 4IDKA 1NK5A 1RT5A 4YN3B 1PBUA 4FYVB 2VC0A 2OPRA 3EXYA 4CLPA 3UD4P 1VMBA 4PPZA 1WOSA 2C3UA 4DS5A 4LQ3A 3JQMA 4YY3F 1K44A 3FQKA 5IT4A 3LWLA 2MQPA 2IDLA 3G2XA 4O3SA 3MFIA 3SEOA 1S1VA 2BE2B 4DR6F 2E1MC 1HMVA 3EGWB 5CAAA 2EEYA 2HRTA 2VPZB 3O2IA 2VBWA 2GQ2A 1QAJA 1JQGA 1VQ8S 1T95A 4WFYA 3M30B 2IMOA 3Q2SC 3Q23A 2BKOA 1RTIB 1VK3A 4DU8A 1B7YB 1EJ7L 1AZSA 3G82B 3KHHA 1PAEX 3HKZD 4K4TA 2K3IA 4LF1A 2AWZA 1JIHA 3UCUP 2IYIA 5F0WA 1V3RA 4TU8A 5K5MA 3CSKA 2XMAA 3JAMY 3I5BA 3RRKA 2NPIA 2F5GA 3LAKA 3J7YI 1QD1A 1QTNB 1VDHA 1FERA 2R4FA 3H2VE 2JOQA 3PCOB 5E41A 4CP5A 4RJVA 3TAMA 2VODA 4ILRA 1MG7A 1KDNA 4ECVA 1NCLA 4F4YA 3CT9A 2UVWA 2B9WA 5FLXY 3P5BP 2DITA 2ZBIA 1OYDA 4K5RA 2DNHA 4IQMA 2CPDA 1S9EA 3NBPA 3T5KA 4K50A 2OLWA 1KQSR 4LQ9A 1SC6A 1WTFA 2HVHA 2XZDB 2UZAA 5K8OA 2VBZA 2H5EA 3G4SS 1GXLA 2PFDA 2BQRA 1RZMA 4G1QA 1SCJB 5HROB 1TVRA 4LRDA 2PN6A 1X4GA 3CC4S 2Y1JA 2YKPA 5KFUA 4UQGA 5FDLA 4L72B 3ZXWA 1U26A 2EWHA 3DI6B 1FE0A 2QFIA 3RRGA 3VF0B 3MR3A 2WTFA 1QSYA 3M1VB 3DNCA 2POKA 2WB4A 2OTJS 2SXLA 4GO5X 4JV2A 1H72C 3AODA 3G6VA 1H38A 4WP3A 1LFWA 1U1MA 2B7CB 2R8IA 2BE7D 3DOMA 2XLKA 2V34A 3O3LA 3OV7A 1SJ3P 3J80Y 2JEJA 5HP1B 2Q6BA 3I9V9 2ZJRQ 1VQ5S 1FHTA 1I3OB 2ILZA 3SQGB 3NCRA 1ELOA 2IBOA 4RNFA 3BSNA 1XBWA 5IWAF 2AEMA 1VGYA 1U4BA 3R5CA 1JLAB 2I0XA 1K1SA 2YNIA 4QIFA 3HHEA 2MZ1A 3TX0A 3N6MA 3PRVA 4OYAA 3QFWA 1D8YA 3MPDA 2NXUA 3W9JA 3T1YF 4CM2A 5H9EJ 1FO1A 1H2UX 8RUCA 3W1YC 4NLPA 2JEFA 1RT6B 3QGPA 4ILLA 2CPIA 3MD3A 1TFWA 2ASLA 4GVBB 5AJ3F 1VHIA 2DHAA 2JSXA 1HI1A 2NSBA 2HW3A 3J7YU 1E6YA 5CCLA 4PWDB 1MWZA 3JTNA 2EC2A 2YY3A 2GIQA 2E29A 3BQ2A 4RW8B 5ETPA 3NY0A 1RHMB 1WEYA 4ZP8A 3HFKA 4LR8A 1M1KT 5D6GA 4UZCA 4K4UA 1A7GE 1WD6A 2AJ2A 2VASA 1RWKB 2LXFA 1N5SA 1XMBA 3PFOA 1WEZA 3CGIA 1NSQA 2DGQA 5DLFA 3KG1A 1Q53A 3NXZA 3MM9B 3LWMA 1J5EJ 1NPPA 2CKWA 4WJBA 5IV3A 1N36F 2BRLA 1U45A 3RBZA 2QLXA 3EYZA 3GSDA 1TL5A 2C2DA 3DLKA 3BM7A 4HT7A 3V5RA 4QU7A 3R8YA 2KL8A 1T9VA 1SQGA 1BQNA 1FFWB 4EYIB 1JB0C 3KLFA 4PQUA 1W7WA 3S8SA 1KP6A 3DHWC 4RUAA 4X2BA 4W92B 4ZIVA 6FD1A 3L7UA 2K3KA 5DGAA 2DGUA 3OQ2A 4ECQA 3K5PA 3GMGA 4F36A 1KQFB 2YTCA 2CAJA 2UXDJ 4C8KA 1UMJA 3IA0A 2BE2A 2EG1A 1S1XB 1HBNA 3VGVA 2GHWA 2RQKA 3V4MA 1N52B 1CJTB 2HHHF 2Q1LA 3ISZA 3CVKA 1RP5A 4RWWA 3AJ2A 3SV4A 4NZ7A 3M30A 1OSCA 2WW8A 4KT0C 5KFEA 2IIHA 4W98A 3OL7A 1U1NA 4X65J 2HFZA 4IR9A 1HQEB 2ZH5A 3G82A 1CVJA 2R7WA 3MMJA 2MY7A 4FBTA 2PMZD 1IBLJ 2HBYB 3CMQA 2KXHA 1URNA 3G87A 2ZFHA 2JC1A 1FK9B 3IMQJ 1JLEB 4NLXA 4F3QA 3OR2A 2AYMA 4ELUA 3QJJA 4Y00A 4UY85 4HEA9 1P1LA 1D8ZA 3Q22A 2DIVA 4DPWA 5KAKA 1HD0A 3FSXA 2CZVC 2OHDA 4JI3J 1HI8A 5IXUA 2AF6A 3GJRB 3FUYA 1FA0A 3EWGA 4LBIA 3FCVA 5CD4A 3TOQA 4URQU 4NLVA 3HZEA 1NM2A 1JJ4A 1VFJA 1TZ0A 3AQPA 2ZZNA 1RAJA 3DI6A 2QC3A 1XMOJ 1VRTB 4A8MP 2OMOA 4A8SA 1OJ4A 1RU1A 3N01A 4OYPA 2CRLA 3EGZA 4R8UB 4UT4A 1Q1KA 3OJUA 4ZJQA 3QBCA 4YB6A 5F0UA 3TAPA 1JLCB 4DV5J 2LQ8A 3SQOP 4F8RA 2ALZA 4ECXA 1E6VA 1NH8A 1T9WA 1GMUA 5EHHA 3ADAC 4J7CA 5KG3A 2CQIA 2I38A 4ATNA 3PX6A 4C2MA 3BGFA 4WXOA 2AQ4A 3G6ES 1NUEA 3G8QA 5HP1A 2IJFA 2VZ9A 2GMHA 4YP3A 1ZH5A 1HYSB 2HS4A 3C16B 2XS5A 1NB7A 5ETRA 3VGTA 2GQCA 1VIOA 4L73A 1JX4A 4O0IA 4ZPWR 3BKTA 3JSMB 5KT5A 1JJHA 1QUVA 1YITS 4NOHA 3QATA 1JLAA 4FVCA 1JLGB 5KFKA 4DV1F 4F2SA 5ETMA 2HQDA 1ZBTA 1B64A 2YKMB 4GKKJ 4DLGA 4ED4A 2YWHA 1LWEB 2FD2A 5ETNA 4J9PA 1RDRA 1F1BB 2CPZA 4OZ3A 1RT6A 2CJQA 1NJYA 4GVBA 3KLGB 3UDLA 3PHEA 5E3AA 1LOUA 4MKVA 4PKDB 4Q45A 4RW4B 4PWDA 4TVAB 3LALA 2HGMA 2NYHA 1S77D 1WDDA 3D6HB 2OPPA 2LCWA 1ZZFA 2RQ4A 2HK2A 4Q8FA 4DSFA 2YWGA 3PHTA 4RW8A 1Y5LB 3DOLB 4TY9A 4E98A 3P5TL 2IRYA 3WX8A 3PZPA 3RR7A 3Q8PB 3IM9A 2FJXA 4DFJA 2W9CB 2LLZA 1R0AB 1P9QC 2ZHBA 2OP5A 2HKEA 4XO0A 2JL9A 1VLYA 1F5CA 4WBFA 4HH1A 4BS2A 1JNZB 5A76A 3MM9A 4Z7YA 2E9TA 1NSPA 1SC4B 4MTPA 4UF4A 1R8HA 4DV1J 2E7VA 4DEZA 4OX9F 1S6OA 2OEMA 3H90A 3PYEA 2YNGB 4JI4J 2ZBRA 3I31A 1HBUB 1F5AA 3QJLA 1WSVA 4FF1A 4C7QA 3MM8B 1HQUB 2M5YA 4WYLA 5LOQA 1EARA 1HR0J 3I9ZA 4PG8A 4OYZA 1KHVA 3FRYA 4U6PA 5HANA 1YG0A 1JJ2R 1EAYC 4C8NA 3F0NA 4QWCA 1S6PB 3FSYA 1HFEL 4F4WA 4G65A 4LRBA 1FE4A 4JI2J 1QSLA 3B54A 5I3QA 4ECRA 1HIYA 4X4PA 3HD1A 4U7UK 2ROGA 5ETKA 5F8HA 3HHLC 5JVGQ 1RBAA 1VQYA 2AT1B 1UZDA 3ELHA 2LEAA 2J0SD 2XHCA 3WZ0A 4CO0A 3G8TA 2M8DB 1CJTA 3T1HF 2MDAA 2QLBB 2NS1B 3MPYA 2NUUG 4CH1A 2M3DA 1OS5A 5DG7A 3M4XA 1X5PA 1PO6A 4WYWA 4LUBA 4I1TA 4G6VB 1VBYA 1UEVA 3VAKA 1K73T 4LSLA 4ZJOA 2Y1IA 4RZRA 1M5SA 2XHWA 1D9DA 1YDLA 1HQEA 4CRJA 3M8PB 4OX9J 2HBZB 2GMLA 2C2NA 2ROEA 2AD9A 3N6NA 2OKQA 3RAQA 4K2JA 2RDIA 5HMWA 4JUZA 1FDNA 1X4DA 5D4NA 3KLEB 4EBDA 4YQWA 2YPYA 1X5SA 4LR7A 1UP1A 3X1LB 1G1XA 3CTRA 3CWJA 1F3VA 1AB8A 1TQLA 1FK9A 1JLEA 3AD7C 4IOBA 1S4FA 5EWFA 5HLFA 4CI0B 5KFGA 2MKHA 4DV2F 1M1HA 3N79A 1HW8A 3SDEB 2F8MA 1WI6A 1ZA2B 1OY8A 4S0MA 3UR0A 2A2DA 3K5NA 3MUVP 1GTEA 4NRTA 3UQSA 2DPIA 4USHA 3TJ9A 1DHMA 4K2XA 1KS2A 4KSEB 4EBEA 1AFIA 2WONB 4W4MA 3HP6A 2NLWA 4KHMA 4MT1A 1VQ7S 4Y2AA 3H4DA 4RR5A 3M6UA 1S79A 3ZTQA 4B3RF 3EVOA 3NG8A 4WFNQ 2LA6A 3US5A 2VDIA 2XWYA 3CDUA 2NXEA 2HQGA 4DR2J 1VRTA 2GVDB 4QWAA 5KTQA 1S6QA 2BVZA 3RUBL 4R8UA 4AT1B 2MEWA 1SB6A 4HI1A 4CLTA 1JLCA 3NGSA 5GVQA 1A0OB 2MKSA 3I0SA 1N5VA 4ETZA 2JFKA 3CCSS 3DMJB 2ZBCA 1U1QA 2UUAJ 2FZGB 2C2ZB 3J7A1 2KJVA 2G1DA 3W5XA 2HG4A 1HYSA 1XR7A 3C16A 2FVPA 2JLEA 5M2UA 1FTRA 2DNRA 2NZ4A 4O3NA 4M94A 2CQCA 1YBUA 3PKMA 1LKZA 5HO4A 1LK7A 2B4VA 3JSMA 3I55S 2Y8YA 1GX6A 1BQMB 3NOCA 2J6UA 4MK9A 2JLFA 1JLGA 4K0KJ 1IVZA 4PG6A 3L7PA 1DARA 2YKMA 4FYXB 1LQ9A 3PYDA 4ZCIA 5L1IA 3V6JA 3OVSA 1X9WA 4L3KA 4RWXA 1NEEA 1RAIB 1LWEA 1PYOB 1WF1A 2HVIA 3D0IE 1FNOA 4DR1J 4WKRA 3DRSA 2ZHAA 2FLPA 1CC7A 1YJVA 3FEZA 2L9DA 3V81B 2IAJB 2ZDPA 1EQ0A 4IUFA 2MQNA 4NXNF 4DQSA 5LM7E 4M5MA 3KLGA 5ETTA 2FGOA 1ZTWA 4NA1A 4ELVA 4X62F 3TAQA 2OEJA 4RW4A 2CPYA 4H4OB 3GFZA 3P96A 4A8XA 3D3BJ 4Q44A 4DR3J 2J9CA 2F9DA 2KJWA 1AFJA 2YKNB 3KJVB 3UR3C 3NAHA 2V2KA 1NZ8A 4ILMA 3IBCB 4KHPJ 4F4KA 3DOLA 5KFYA 4NX9A 2FHKA 4Y3CA 2HBRB 2CPJA 4C0BA 3ILLA 3B78A 1FVQA 3UW1A 2DXDA 4LF4J 3IWNC 3ITHB 3FSIA 3CPWR 1R0AA 5C42B 2OELA 2Z58B 5IQ6A 1F9FA 3R6LB 2K8GA 3T5LA 4NYPA 3RW6A 3NWRA 2X51A 3I32A 2C22A 2VHGA 4M5NA 3CCMS 4USIA 2NXJA 4WIQA 4CO2A 1RJJA 4ZVUB 4IG0A 3DLHA 3N5FA 4LF7J 2BJ8A 3D0GE 1C1BB 2XSFA 1RWPB 1AXQA 2YNGA 3RU0A 4USMA 5C2CA 3GJQB 1MWYA 1HBUA 4URSA 1MWQA 3ICLA 3LOUA 3JAMU 3GLJA 3LW5C 3MM8A 1HQUA 4RBVA 2DH7A 5F8IA 4FPRA 5AXLA 1N0UA 2HGLA 1PIEA 2BJ9A 1SJ1A 2MQMA 1NB2A 5KFWA 1IKYB 3VQSA 3UCGA 4MK7A 3TQ1A 1G2EA 4GKJF 2VPWB 4RPFA 5AT1B 5J2MB 5CQGA 2XMVA 3PX0A 3CD5A 2FJVA 4URGA 4DQRA 2KG0A 2QL7B 3KWMA 4AYBD 5DG8A 2IM2A 4NLRA 4BC7A 3EM1A 1ZAXA 2XYGB 5HJXA 3UN5A 3ZO7A 3RG6A 4AL6A 3VAJA 3OFFA 2ASJA 4C11B 1OY6A 4QW8A 4MJKA 3MFHA 2HRUA 4I6AA 2ZKTA 2XYHB 1KTVA 4RUHA 2P9CA 4O4RA 2J8SA 2EFGA 1BWVA 4ZN1A 3JSYA 1U8SA 3E3XA 4O44B 2D3UA 2MSSA 1NZAA 1FJ7A 4RW9B 3KLEA 2ZVSA 2LP4A 1NJIT 3LH2S 3ZZPA 2VFVA 2HFOA 4GC7A 1N5TA 3PYFA 3OPKA 3W66A 2OGUA 1FKOB 3AD8C 2K7JA 2RF2B 4DL2A 1WACA 2DTJA 2WVDA 3Q8VA 2Z0GA 3SDEA 5KFNA 1VJQA 3Q8QB 2CNKB 2GGPB 2JC0A 3J81j 3PRBA 1TV6B 2R9LA 3C6UB 3M05A 1XR5A 1CJUB 3MOJB 4C8OA 3H2LA 4C8YA 3M2UB 5E7OB 5LMUJ 1IWGA 3P3DA 3IGNA 1HW9A 3GYXB 1NPKA
chains in the Genus database with same CATH topology
2ZUAA 3ENAA 4HR2A 1F6TA 3FCWA 3Q83A 4DI6A 2B8PA 1NSKL 1NUEA 3NGTA 3B6BA 3ZTRA 4FKXA 2DYAA 2DY9A 3ZTOA 4EK2A 1PKUA 3FBEA 1NDPA 3Q89A 2NCKL 3FKBA 1NSQA 2AZ1A 3VGVA 3VGSA 5C7PA 3BH6B 3VGTA 3B54A 4UOGA 3PRVA 3EJMA 3NGSA 1PAEX 3GPAA 3NGUA 1B99A 4O0NA 3BBCA 3MPDA 1HIYA 3WX8A 4FKYA 3ZTSA 1NLKL 1ZS6A 3EICA 4ENOA 3FBCA 3VGUA 4C6AA 3EVMA 1BHNA 1LWXA 1B4SA 3FC9A 4W98A 5CABA 4S0MA 3FCVA 4KPCA 3Q86A 3ELHA 3BH7B 3R9LA 1XIQA 3ETMA 3Q8YA 1F3FA 1NB2A 3GP9A 1JXVA 3BBBA 5BXIA 1U8WA 3FBBA 3EMTA 3DKDA 1NHKL 3DDIA 1NDKA 1VYAA 4ANCA 3Q8UA 4WBFA 2BEFA 1K44A 1HHQA 1WKKA 4CP5A 4UOFA 3VVUA 2B8QA 1NSPA 3BBFA 1W7WA 1BE4A 2DXDA 1MN9A 3Q8VA 1KDNA 3G2XA 1NCLA 1WKJA 2HVDA 3EE3A 3PJ9A 1HLWA 3VVTA 1NDLA 3L7UA 2CWKA 1S5ZA 5CAAA 4DUTA 1NDCA 1S57A 3FBFA 4ANEA 2AZ3A 2BX6A 4DZ6A 3EM1A 2VU5A 1EHWA 1LEOA 3ZTQA 1UCNA 3EVOA 1MN7A 1WKLA 3EVWA 3JS9A 1S59A 1XQIA 4F36A 4UOHA 5IOLA 4F4AA 2DXEA 4ANDA 3ZTPA 2HVEA 2DXFA 3NGRA 2HURA 1BUXA 1NPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZUA A;  3ENA A;  4HR2 A;  1F6T A;  3FCW A;  3Q83 A;  4DI6 A;  2B8P A;  1NSK L;  1NUE A;  3NGT A;  3B6B A;  3ZTR A;  4FKX A;  2DYA A;  2DY9 A;  3ZTO A;  4EK2 A;  1PKU A;  3FBE A;  1NDP A;  3Q89 A;  2NCK L;  3FKB A;  1NSQ A;  2AZ1 A;  3VGV A;  3VGS A;  5C7P A;  3BH6 B;  3VGT A;  3B54 A;  4UOG A;  3PRV A;  3EJM A;  3NGS A;  1PAE X;  3GPA A;  3NGU A;  1B99 A;  4O0N A;  3BBC A;  3MPD A;  1HIY A;  3WX8 A;  4FKY A;  3ZTS A;  1NLK L;  1ZS6 A;  3EIC A;  4ENO A;  3FBC A;  3VGU A;  4C6A A;  3EVM A;  1BHN A;  1LWX A;  1B4S A;  3FC9 A;  4W98 A;  5CAB A;  4S0M A;  3FCV A;  4KPC A;  3Q86 A;  3ELH A;  3BH7 B;  3R9L A;  1XIQ A;  3ETM A;  3Q8Y A;  1F3F A;  1NB2 A;  3GP9 A;  1JXV A;  3BBB A;  5BXI A;  1U8W A;  3FBB A;  3EMT A;  3DKD A;  1NHK L;  3DDI A;  1NDK A;  1VYA A;  4ANC A;  3Q8U A;  4WBF A;  2BEF A;  1K44 A;  1HHQ A;  1WKK A;  4CP5 A;  4UOF A;  3VVU A;  2B8Q A;  1NSP A;  3BBF A;  1W7W A;  1BE4 A;  2DXD A;  1MN9 A;  3Q8V A;  1KDN A;  3G2X A;  1NCL A;  1WKJ A;  2HVD A;  3EE3 A;  3PJ9 A;  1HLW A;  3VVT A;  1NDL A;  3L7U A;  2CWK A;  1S5Z A;  5CAA A;  4DUT A;  1NDC A;  1S57 A;  3FBF A;  4ANE A;  2AZ3 A;  2BX6 A;  4DZ6 A;  3EM1 A;  2VU5 A;  1EHW A;  1LEO A;  3ZTQ A;  1UCN A;  3EVO A;  1MN7 A;  1WKL A;  3EVW A;  3JS9 A;  1S59 A;  1XQI A;  4F36 A;  4UOH A;  5IOL A;  4F4A A;  2DXE A;  4AND A;  3ZTP A;  2HVE A;  2DXF A;  3NGR A;  2HUR A;  1BUX A;  1NPK A; 
#chains in the Genus database with same CATH topology
 3H8Y A;  4AQY F;  3NP5 A;  2L3M A;  2XGQ A;  1SKU B;  2DNZ A;  3GTY X;  1GMV A;  4EZ6 A;  4AE5 A;  2ADB A;  1GFW B;  5KFI A;  1VBX A;  3CD0 A;  3FFI B;  4E8U A;  5I3U B;  1VR6 A;  4PZV A;  2HWI A;  1T3O A;  1AT1 B;  2UUT A;  1TUW A;  3GV7 B;  3KG4 A;  4N5S A;  4DR4 J;  2W7O A;  2VUG A;  2C1E B;  3R5A A;  2EFP A;  2ASD A;  2AP6 A;  1S97 A;  1L5U A;  3M32 B;  1UVJ A;  3NS7 B;  3LPY A;  5C5J A;  1EB0 A;  2KFN A;  2QIF A;  3BYP A;  1NDL A;  2JWN A;  1FDB A;  3HHK A;  4DV6 F;  3VTI A;  3GFH A;  5IS2 A;  3F56 A;  2C2R A;  3RW7 A;  2VF3 A;  3PM9 A;  4LVN P;  5A6W A;  4QIG A;  2A6M A;  1BD6 A;  2FIU A;  4U95 A;  1CC8 A;  5D3G B;  4LF5 J;  3RB6 A;  1WDT A;  2P8I A;  1HPZ A;  2Z8Q A;  4ZVS B;  1X4C A;  2B4U A;  4QCL A;  2HZV A;  3W3S A;  4PAB A;  4X4R A;  4OHV A;  5G0R A;  3X3U A;  2VG7 B;  2RH3 A;  3BGU A;  3FJ2 A;  3V81 A;  1TMJ A;  1QE1 B;  2IAJ A;  3TQE A;  2YX4 A;  2V68 A;  3NNA A;  2QA2 A;  3GFY A;  4XDD A;  2RRB A;  2MMY A;  3MAQ A;  1FWP A;  4H4O A;  4WPA A;  2UUC J;  4J90 A;  1H2T Z;  2YKN A;  3A1Y G;  3KJV A;  4NXM F;  4KGK A;  2KZZ A;  4WP9 A;  4X64 F;  5K8N A;  2KFY A;  2QRR A;  2IMW P;  4CQ1 A;  3UI3 A;  5ETL A;  3V6D B;  5K8P A;  1U24 A;  4OLO A;  1FX4 A;  3ITH A;  1OPI A;  3TW0 A;  2ACY A;  2KYX A;  5C42 A;  2HQI A;  4QR1 A;  2YWE A;  5AE1 A;  3KJQ B;  2ZM6 J;  4P72 A;  5LMN F;  3SMZ A;  4IOC Q;  1SPB P;  2B4O A;  1ACM B;  4USK A;  1P6T A;  2V69 A;  1FJG F;  1SV5 B;  3T3F A;  4QJV A;  3VZI A;  1VQO S;  4ICL B;  1X4B A;  4XK8 C;  1C1B A;  1KON A;  3KMS A;  2HAF A;  1JXV A;  2F40 A;  1SKS A;  2VPX B;  1XN9 A;  4DSL A;  3FBB A;  4DV4 F;  2WSC C;  2D7S A;  2ROP A;  2EC0 A;  1HNW F;  2BJ7 A;  3CE8 A;  1GXU A;  3HVW A;  4ZVR B;  2CPE A;  2NZC A;  5GMK a;  2BAN B;  1V5V A;  3DCA A;  1IKY A;  1GH8 A;  4NCB A;  2AZ3 A;  5EX0 A;  4Z2X A;  3FZB A;  5I42 B;  2B9E A;  2IC3 A;  1C4C A;  5J2M A;  5KFD A;  1YTY A;  5DZ6 A;  1FXR A;  4NXM J;  5EWG A;  1HWL A;  3ENA A;  3VCD A;  3B6B A;  3BEG B;  3EX7 B;  2W2N P;  2H5J B;  4K4W A;  4ZMM A;  3PRD A;  1D3W A;  4A48 A;  3ENQ A;  3M7V A;  2X7I A;  1S1T A;  3GPA A;  4C11 A;  4KR0 B;  4OZ0 A;  2MGZ B;  4DXL A;  4ED1 A;  4F50 A;  1S9F A;  3W65 A;  4AUK A;  4NAS A;  1VQ4 S;  1N32 F;  3D54 A;  1FWL A;  3A8K A;  3QGG A;  1PG5 B;  5A8K B;  1NDK A;  1X8D A;  4WTY A;  4WFZ A;  1KWM A;  3O44 A;  5I3P A;  3PJW A;  4PG7 A;  1TMM A;  4O44 A;  2KM8 C;  5A8R B;  2DGO A;  1KEK A;  4RW9 A;  2AYG A;  1J2V A;  3KK3 B;  2PD1 A;  4FDF A;  2XBP A;  4A8F A;  5MLC V;  2FZK B;  1Q8I A;  2FVC A;  2AEJ A;  1FRX A;  2HIQ A;  1I5O B;  4ELT A;  1SUQ B;  3D66 A;  2HFU A;  4LF9 F;  1FI4 A;  1FKO A;  1UCN A;  3MAA B;  1DQ9 A;  3WIV A;  3P8B B;  2A10 A;  2B9X A;  4RW7 B;  5GAG I;  2W4D A;  2M52 A;  2GGP A;  2EFQ A;  2YWF A;  4OZ5 A;  1HNX F;  3WC2 A;  4MAK A;  1SC1 B;  4EU0 A;  3C6U A;  2J7U A;  3OL6 A;  3W9I A;  1TL1 A;  3BO3 A;  1CJU A;  3V6K A;  3W60 A;  4B3S J;  2WBM A;  4G1P A;  3M2U A;  1WC6 A;  1V3Z A;  3WQP A;  3UWT A;  1TUV A;  1XWL A;  2MY8 A;  4RUB A;  4FF2 A;  4B9V A;  2RU9 A;  4DX6 A;  1CQN A;  4PXC A;  5AXN A;  2MQO A;  2VDH A;  2VQF J;  3QIP B;  3NAI A;  3HCX A;  4ZA1 A;  2KXN B;  3BSO A;  2VBX A;  3FFI A;  2L48 A;  4DMZ A;  2DNP A;  2OD4 A;  3KLI B;  2VG6 A;  1WKJ A;  2PII A;  4BWM A;  2Q3P A;  1QJH A;  3GR1 A;  3J7A N;  1B3T A;  2CG8 A;  4DUY F;  1EZZ B;  1O8B A;  4JYA F;  1X4E A;  3M6W A;  4K5S A;  4BHQ A;  4ES3 A;  4DQP A;  4PWU A;  2HQ3 A;  2YX7 A;  2BDP A;  2IA0 A;  3DGV A;  3I6P A;  1UWA A;  1S10 A;  1RHR B;  4DL5 A;  3ISN D;  4HTI A;  4PCQ A;  3NCP A;  3RZA A;  5KG1 A;  1Q8L A;  3M2R B;  1CBK A;  1X4A A;  3MI7 X;  3E8O A;  4FYY B;  2D9O A;  3DLG A;  5D77 A;  2V8G A;  4C6A A;  2FVS A;  4U7C A;  3C3L A;  3BGR A;  9RUB A;  2MYF A;  4J9S A;  2KHC A;  5D3G A;  3Q86 A;  1WEL A;  3DXB A;  2P6S A;  5K8M A;  2XZW A;  2QZ8 A;  1SJR A;  4OMF G;  5EX3 A;  4P73 A;  4RU9 A;  4QBU A;  3U1L A;  4L3N A;  1Z4U A;  2COL A;  5DET A;  2VG7 A;  4B17 A;  2XY7 A;  2IJN A;  5GAE I;  1QE1 A;  5KFC A;  4MKY A;  4TN2 A;  1P27 B;  4M5K A;  4LFA J;  1Q5Y A;  2DVI A;  2JZ5 A;  3LA0 A;  1DZ5 A;  4RKU C;  5C24 B;  2I1R A;  2Q6C A;  2CPH A;  4KHR A;  4Y2I A;  3H59 A;  1JLF B;  2DGW A;  2DXE A;  3DFE A;  1F0X A;  5DQH A;  4JYA J;  3QNW B;  2HFV A;  4L6V 3;  3LGN A;  2J0X A;  1X0P A;  1S49 A;  1TK0 A;  3AOC A;  1RTH B;  3BV8 A;  3FBE A;  3DRP B;  1N5Y B;  4PXE A;  1YJ9 S;  1H7X A;  4WU3 A;  2NRE A;  1KFD A;  2W8K A;  2XYP B;  2MZJ A;  1NK4 A;  3QT5 A;  3WDO A;  4QPT A;  3G9C A;  1S9G B;  2QO3 A;  3NLC A;  3K59 A;  5ADZ A;  2LFV A;  4OHX A;  2QA4 S;  1RYR A;  4KRW A;  2E5J A;  4LR9 A;  5SZT A;  2PGC A;  1YJN S;  3CUL A;  2M2B A;  3LP0 B;  3HT3 A;  1SV5 A;  4RNN A;  3RBX A;  1Y5N B;  4ICL A;  1MMN A;  3M8Z A;  4PEO A;  2ZH9 A;  5M2P A;  4OYM A;  1MRO B;  2DR8 A;  2M88 A;  2OSR A;  4N76 A;  1YX2 A;  1N0V C;  2YBV A;  3S6E A;  2CQ0 A;  4FF3 A;  4A8W A;  5KT7 A;  3IR5 B;  3LP2 B;  5CHC B;  4DUZ J;  3JB9 k;  2KRB A;  4K4Z A;  1FWK A;  3HK2 A;  2BAN A;  2RS8 A;  5D4L A;  3PO5 A;  2LU1 A;  3OVA A;  2KO1 A;  2V0N A;  4NML A;  3DC2 A;  3MWB A;  5I42 A;  1HNZ J;  4CCH A;  4DLE A;  2DNY A;  3CO9 A;  2FLN A;  2CQB A;  3OR1 B;  2UVU A;  5HSP A;  3BDE A;  1Y9O A;  5DGB A;  2OSQ A;  2DGS A;  5DJB A;  3K8V A;  1LV5 A;  3GB0 A;  2UU9 F;  4ZCK A;  1RWO B;  2IBK A;  1N33 F;  2OH2 A;  2FZC B;  1UAW A;  1SQF A;  2XS2 A;  2ZBP A;  2E5L F;  2ZUG A;  3JSB A;  4PXD A;  3CC2 S;  3M2V B;  2XCP A;  3MM6 A;  2DEJ A;  5GAE U;  3ETO A;  5A8K A;  1I94 J;  3UCZ P;  1X9S A;  2VA2 A;  5CCM A;  4AL7 A;  1R0B G;  2DKO B;  1VI7 A;  2LA4 A;  5A8R A;  3MM7 B;  2Q43 A;  4N77 A;  2ZUA A;  3KK3 A;  3TRG A;  1RYS A;  1UEK A;  4Q0B B;  2HLT A;  5L1L A;  2LQ5 A;  1SUQ A;  3JQJ A;  2HEK A;  3MR2 A;  4UOG A;  3MAA A;  1B99 A;  3GYN A;  1AYE A;  3IN5 A;  3A3P B;  2QA4 G;  2EFO A;  2RS2 A;  3NL0 A;  4RW7 A;  1CUL A;  3K0J A;  1SQE A;  2HPU A;  1XC9 A;  5ETV A;  4DL0 C;  3ZZO A;  2AV5 A;  4ED0 A;  2V8D A;  1FDA A;  5DM7 Q;  5C25 B;  1U1L A;  4HHJ A;  4DX8 H;  2V8V A;  2VB6 A;  4QWB A;  3MCO A;  4H4M B;  1R6V A;  4IH7 A;  2KVI A;  4AFF A;  3GJS B;  3DDN A;  3ZZZ A;  4Q8E A;  2I2Y A;  4BDP A;  5HI7 A;  3R1H A;  7AT1 B;  3ENW A;  2RML A;  5AE3 A;  3QIP A;  2F3J A;  1T05 B;  2VU5 A;  4NYO A;  1U1K A;  4DV3 J;  1VHF A;  3WHI A;  4LBH A;  3KLI A;  5CH7 B;  1FCA A;  3OTO F;  2M4M A;  2P6T A;  4ECY A;  1VIS A;  2QEX S;  1SBR A;  4X66 F;  4B3M J;  2HNZ B;  2Y9H A;  4KBI A;  3QGI A;  4J9Q A;  3TZY A;  3Q89 A;  3CJ4 A;  2WVE A;  4J9L A;  1RBO B;  2W4C A;  3KOA A;  4I7F B;  3N28 A;  4JI8 F;  1RA6 A;  4ENO A;  2RAQ A;  5E0O A;  5IT9 U;  1YZ6 A;  4FP9 A;  2EKY A;  3CO0 P;  1HBM B;  3BGO P;  1YWX A;  4I67 A;  5BXI A;  4J5O A;  3CCJ S;  1DJ0 A;  2MTL A;  3W8P A;  4HDG A;  3RBE A;  4IFY A;  5L1K A;  3E01 B;  2BQU A;  3M2R A;  3H4B A;  4NA2 A;  2OD6 A;  1IKV A;  4N47 A;  2GVZ B;  2EVZ A;  5H9F K;  3ZFV A;  1U0H B;  1Q81 T;  1UKU A;  2HND A;  3MMC B;  2KFZ A;  4TY8 B;  2IM0 A;  1P9Y A;  3VZH A;  2HK3 A;  4AL5 A;  2GC8 A;  5DG9 A;  1J5O B;  2EW9 A;  2HFS A;  3CCL S;  1YKW A;  5L8R C;  4JI7 J;  4DI6 A;  2ZH1 A;  2XM3 A;  1XJW B;  5J2N B;  2XMM A;  4J9M A;  2EPI A;  5C24 A;  3HHN B;  4OYW A;  5KFO A;  4FPI A;  2FUG 9;  1JLF A;  4KB7 A;  4UY8 T;  2YKA A;  5DQG A;  1ZM3 A;  2XG8 A;  2FHO B;  1FRK A;  1RTH A;  2IFX A;  4DX5 A;  3R7B B;  4PG5 A;  5F9N A;  2CNN B;  1DLO B;  3BR9 A;  3BS9 A;  1Q7Y T;  3M8W A;  2G0C A;  3OTE A;  1S72 S;  3GZ7 A;  4IYQ A;  4OZN A;  1VBZ A;  1S9G A;  2ZIT A;  2Z2M A;  4NLG A;  1U6F A;  1SH3 A;  4ZVF A;  3KJF B;  4IH5 A;  3CME S;  3DXS X;  2CQ1 A;  1L3K A;  1KQG B;  2I9S A;  3Q24 A;  3LP0 A;  5CZX A;  1SKW A;  4Q5V A;  1QAI A;  3W7B A;  3PJX A;  4CTA B;  4Q7A A;  4ID5 B;  1DFD A;  2ZH4 A;  4OI4 A;  2DR5 A;  3ILO A;  1ZM4 A;  1Q82 T;  1MRO A;  1VC6 A;  2H4W B;  1ZM2 A;  4C4W A;  1U2R A;  4QYR A;  4LVO P;  2V4J B;  2UXB J;  4JI5 J;  4FZV A;  3LP2 A;  3K17 A;  5CXT A;  2CQ3 A;  2A0F B;  1TU0 B;  4Z37 A;  4NLW A;  4M5L A;  1TUG B;  1X0F A;  4ZCM A;  3OD2 A;  4UTG A;  4YDX A;  1K0T A;  1D1U A;  4ZP7 A;  5A2Q Y;  2FVQ A;  3QWP A;  1ITP A;  4CLU A;  2RNE A;  1Y4Z B;  3OR1 A;  2HSE B;  1ICE B;  2ALY B;  3A3N B;  2V6A A;  2XI2 A;  4CLK A;  1HAR A;  4MIA A;  1RGV A;  1SL0 A;  3TAR A;  1JXL A;  1YZ7 A;  3T41 A;  1SJQ A;  1U2F A;  3BSA A;  3PG9 A;  1QUP A;  2AMC B;  1IBM F;  4KGZ B;  4NEZ A;  3W62 A;  2NUH A;  4WTO B;  4OHZ A;  3HJF A;  4DPO A;  4P7T A;  1NSK L;  1AW0 A;  2BR0 A;  3R1L A;  3M2V A;  1NJX A;  3HFZ B;  2NCK L;  2CJ9 A;  2GX8 A;  5DDO C;  4A8K A;  1U7L A;  5D0H A;  4EYH B;  4GRS A;  4YB1 P;  3MM7 A;  2QMX A;  4JV5 J;  3UO0 A;  4DCP B;  4WU2 A;  2B6A A;  3C15 B;  2XQC A;  2IVM A;  3F44 A;  4Q0B A;  4DPX A;  3TUI C;  3KMQ A;  3Q8S B;  2DNO A;  3KUE A;  1UPP A;  4ANC A;  2VIC A;  1F60 B;  4CT9 A;  4QZV B;  3VHQ A;  1N34 F;  3VVU A;  3RBD A;  2HAI A;  1QLN A;  1VQN S;  3I4P A;  3U1N A;  2N3L A;  3M8S A;  3VVT A;  3PKY A;  2R7R A;  1TL7 B;  4JI6 J;  2BW7 A;  5HMY A;  4ZLJ A;  3R7N B;  2Y0S D;  1YGY A;  5C25 A;  5CYQ B;  3SCI E;  4H4M A;  4DV0 J;  4PUO A;  5LXR A;  2RUS A;  2BMB A;  4KH0 B;  3CDW A;  2ZC4 A;  4QWD A;  1X9M A;  2QSF A;  4XIU A;  2LQB A;  1IBM J;  1RU2 A;  3OJS A;  1TK5 A;  1FXL A;  3UFC X;  4ZPT R;  4B9N A;  2PC6 A;  3DLB A;  5F8G A;  1T05 A;  1S0O A;  2DCU B;  2E1C A;  4R25 A;  5T7L A;  2BM1 A;  2R7Q A;  5EGY A;  4HTJ A;  3SCJ E;  4Q2M A;  3CJ5 A;  3KK1 B;  5DDR C;  2HNZ A;  5LSL A;  3BH7 B;  3FMW A;  3UNG C;  3TWZ A;  1BY9 A;  4HKQ A;  5HBM B;  3HHD A;  1UJ5 A;  2N82 B;  4CLF A;  4I7F A;  3JYT A;  2E9Z A;  3DM2 B;  4NA3 A;  2O1P A;  4JI1 J;  3EE3 A;  3UD3 P;  1GMW D;  4NE9 C;  1REV B;  3GV5 B;  1HNI B;  1HBM A;  1RXO B;  1S5Z A;  1W26 A;  3MHY A;  1BWE A;  4FYW B;  5KT4 A;  1IBK J;  1N34 J;  2BOA A;  4IO9 Q;  1WUU A;  5J1E B;  2JLG A;  1KKH A;  3E01 A;  1CEZ A;  2WK4 A;  1O51 A;  4NRU A;  3HT0 A;  3BR8 A;  1BQX A;  3P6Y C;  1XMQ J;  1IQT A;  3GIR A;  3U7J A;  1BUX A;  3L3C A;  3MPU B;  4U8V A;  1Y10 A;  3VR1 A;  4DOZ A;  2GVZ A;  2F7V A;  3D4J A;  4KPY A;  3DN9 A;  3GG0 A;  3MMC A;  4TY8 A;  1OSD A;  3SSS A;  2BRK A;  3T9Z A;  1ZAW A;  2X1F A;  4H54 A;  1PYS B;  4O0N A;  2O5D A;  4OI6 A;  3FEY B;  4ZHR A;  5KT2 A;  1J5O A;  1FKA F;  1LWF A;  1YBT A;  2E5H A;  2RB7 A;  2KT2 A;  3HKW A;  5J2N A;  3KG0 A;  1WNE A;  4X4U A;  4EEY A;  1F2G A;  1KOO A;  2R8H A;  2DGX A;  2KI2 A;  4XAK A;  2BA9 A;  1ZA1 B;  2VFR A;  4DCJ B;  1FF2 A;  4ZVE A;  2DNN A;  3MGJ A;  2V2Q A;  4DZD A;  3HI9 A;  2V94 A;  3CJ3 A;  2IJR A;  4MH8 A;  3MEE B;  1BMQ B;  4DUT A;  2WCX A;  1J5E F;  1EIY B;  4NCG B;  5DDQ C;  3MEC B;  3MUM P;  3OFE A;  3IG1 B;  5KFH A;  2VA3 A;  2XEX A;  1T11 A;  4H4K C;  5LSO A;  3CJT A;  2R3V A;  5MAO A;  3IWL A;  1GX5 A;  4HR2 A;  1SIZ A;  3R7S B;  3CCU S;  2CZ4 A;  2MQ8 A;  3GIL A;  3SXL A;  1FTC A;  3HLU A;  2DJW A;  2V2Z A;  2ADC A;  1RAA B;  3SCK E;  1SH0 A;  3PXG a;  1N48 A;  2AGP A;  1KVI A;  3LQV A;  4CTA A;  4PRF A;  4ID5 A;  5B0B A;  4KPC A;  3R9L A;  4XPC A;  3AA9 A;  5F8M A;  4HAC B;  3CCQ S;  1O5J A;  2FJA B;  4B3T F;  1CLF A;  2UXD F;  2FDN A;  3K89 A;  2BW2 A;  2V4J A;  2OML A;  2A18 A;  4BWJ A;  1MN9 A;  4NLU A;  5IC6 B;  3AXK A;  5B0G A;  3HVA A;  3IM8 A;  9ATC B;  4PQA A;  2HWT A;  3EZO A;  1YJ7 A;  1YI2 S;  1K0V A;  3TAN A;  3W5Y A;  2R2S A;  1RA7 A;  3EVW A;  4HVZ A;  2RDD A;  2CNO B;  2H1Y A;  4X65 F;  2BKN A;  8AT1 B;  5HN0 A;  3PIP Q;  3DU5 A;  3GSI A;  1UEU A;  3TZX A;  3PW4 A;  2UV8 A;  2AZ1 A;  3I5C A;  4OHY A;  3K5M A;  1VK8 A;  4I69 A;  1UVN A;  1RAF B;  4WF9 Q;  4LF2 A;  3JXO A;  2WSE C;  2KHD A;  3EXC X;  2ZJP Q;  1IBL F;  5BYS A;  2HQC A;  1R0C B;  1KVK A;  3DGP A;  4CT8 A;  1M5H A;  3BKF A;  4QWE A;  3EDQ B;  5L46 A;  1NJZ A;  5K14 B;  2HHS A;  2HVZ A;  5CYM B;  3L7O A;  1KFS A;  1YJU A;  3UD5 A;  1T03 B;  2DIU A;  1CSJ A;  1H98 A;  2K2P A;  2V8P A;  4Y6I A;  1R27 B;  3GIM A;  2B3T B;  4DQI A;  2CQ4 A;  1AUD A;  4B3T J;  3C15 A;  3HHL D;  3FRZ A;  4C8L A;  4EUV A;  4CWB A;  2G0I A;  4JI3 F;  5KG5 A;  1OWX A;  2CQD A;  4ECS A;  1KLM B;  1FT8 A;  3R27 A;  1VJW A;  3IO1 A;  4ZK7 M;  4LT6 A;  5IM0 B;  2UUB J;  3I82 A;  1PYT A;  3GQC A;  1Q5V A;  4CO1 A;  1TL7 A;  2J8A A;  3CJQ A;  2VG5 B;  3BO2 A;  1XMO F;  1RTI A;  1RWU A;  3EJM A;  2QGF B;  3TUZ C;  5CYQ A;  5KG7 A;  2VD3 A;  2G0J A;  2Q79 A;  2E1R A;  1KRP A;  3GYG A;  1UFW A;  3AH6 A;  4R5P B;  4HLB A;  2F4V J;  2DRA A;  3QWU A;  1AUS L;  3OSP A;  4DV5 F;  1V3S A;  4CO3 A;  3SSQ A;  2LU2 A;  2ZEJ A;  1D0E A;  2HFN A;  1S76 D;  1EKS A;  3R3T A;  3BQ0 A;  4M95 A;  3KHL A;  1VC0 A;  2HHP A;  4OX8 A;  2CQH A;  1G4C A;  4ECW A;  2GAH C;  3MUR P;  3KK1 A;  3GR0 A;  5G4D A;  2NYI A;  1CJK B;  5HBM A;  3M9O B;  4ECZ A;  3MED B;  2DNQ A;  5E2Q A;  5F41 A;  4OJ1 A;  1J27 A;  3N0V A;  2M8H A;  4Q2L A;  2J9D A;  4TLR A;  3DM2 A;  2VFS A;  2ACM A;  1JXE A;  1REV A;  3S7R A;  1HNI A;  1LXN A;  4NPO A;  4GKK F;  2KDO A;  2QA1 A;  3ZZU A;  3PNI A;  5C7P A;  5J1E A;  4LSZ B;  5HRO A;  3H98 A;  3GU0 A;  4UZB A;  1WOR A;  5L1J A;  4MMO A;  2OPR B;  2U1A A;  4JV1 A;  3RR8 A;  3A12 A;  1HL6 A;  3CCE S;  2IYG A;  1REG X;  2AEF A;  2RJZ A;  3M1V A;  4KGV B;  4DPT A;  3S01 A;  3LF0 A;  3D6M B;  4MKB A;  2R7O A;  2QLF B;  2JJ4 D;  1LNQ A;  1P1T A;  4M1K A;  5U47 A;  3FNN A;  2YKQ A;  2ASY A;  2OPQ B;  2WRM A;  3DDK A;  5BR8 J;  2R7X A;  2AKW B;  4ZJL A;  2XMT A;  5M2R A;  4NLY A;  1N4L A;  2XUL A;  3FQL A;  2NQP A;  2OTL S;  2YVS A;  4OFZ A;  3O8W A;  2QT7 A;  2XS7 A;  4OZJ A;  3ULH A;  5LJ3 Y;  2JHE A;  1RAD B;  2EBE A;  4DR7 J;  3SQG A;  2HUR A;  4FNI A;  2KVQ E;  1KOH A;  3TJA A;  3IWX A;  5KFA A;  4LFC J;  5KFZ A;  2MB0 B;  3TR5 A;  2R8K A;  1PJ5 A;  3MEE A;  1M5O C;  4Y34 A;  1DUR A;  3FKB A;  4NCG A;  1XNQ J;  2FGC A;  2XY6 A;  3IG1 A;  4OLP A;  4B9L A;  5A8W B;  2BKP A;  4JI4 F;  5IT0 A;  3NWG A;  4RX6 A;  4ERD A;  2DBB A;  4TLQ A;  1KNZ A;  1WG4 A;  1XNR J;  3DKD A;  1HR0 F;  3B82 A;  2MHE A;  1DAX A;  2FHM A;  3BN7 A;  1ZPW X;  3CJ2 A;  2XSJ B;  4UOF A;  1KN6 A;  4K59 A;  3BSC A;  4X84 A;  3M6X A;  3KNG A;  1OMS A;  2FJB B;  1VRQ C;  3MR5 A;  4JI2 F;  4Y2C A;  1NND A;  5J1N A;  3L09 A;  4EMD A;  2NPF A;  4KTQ A;  4M5J A;  1S9E B;  1A9N B;  3TUJ C;  4HAC A;  2Z2Y B;  4IQX A;  4ZP9 A;  1EHW A;  1NU4 A;  3W9H A;  2GA7 A;  5KOW A;  3U02 A;  4NLQ A;  3ISN C;  1Y11 A;  1JKH B;  2YWW A;  3MD1 A;  1RHU B;  2FY8 A;  4PXB A;  3TUP A;  1RB0 A;  1TVR B;  4YME A;  3EUN A;  4USU A;  1FVS A;  1GAO A;  3W8G A;  4OI3 A;  3D9B A;  4WFX A;  3MR7 A;  2MKJ A;  1RT7 B;  1YRU A;  4K4S A;  4ED7 A;  2MPU A;  2H5I B;  3U1M A;  1RAB B;  1ROF A;  3GII A;  1T7P A;  2VKZ G;  4KKO B;  3UN3 A;  1SKR A;  4Y0F A;  4P74 A;  2AJ1 A;  3TVZ A;  2GW8 A;  1IWA A;  4IOA Q;  4X4O A;  3ZZT A;  5L39 A;  1UVI A;  4JB8 B;  2GJI A;  2E5I A;  4HYK A;  2YQ0 A;  4CH0 S;  2DHH A;  2H65 B;  3CJ0 A;  2FJE B;  1HWI A;  4PYA A;  2QFJ A;  1TKT B;  3PJ9 A;  2DB1 A;  1OIA A;  1U2C A;  2B43 A;  4KYZ A;  3M9N B;  5K14 A;  2QN6 B;  4EO8 A;  2LEB A;  2FJD B;  4F02 A;  1WHW A;  4LRA A;  5CYM A;  2D69 A;  1T03 A;  3DRR B;  2N4C A;  3W64 A;  1TKZ B;  3LPE A;  2CZ9 A;  3R5D A;  3AHP A;  5B08 A;  2BZ2 A;  4I64 A;  1WI8 A;  1T02 A;  5B0F A;  2UXC J;  1L3S A;  1MMD A;  3OLB A;  1UL3 A;  1CG2 A;  1NK6 A;  3TEG A;  2NXC A;  3MXH P;  5B0A A;  3OHA A;  1S1X A;  3T1A A;  1NKC A;  3WX4 A;  1KLM A;  4CLZ A;  2EFN A;  4DR5 F;  1VLO A;  5HMX A;  3TJ8 A;  4ZLP A;  3EVM A;  2LXU A;  2XLI A;  4QIW D;  3RJM B;  3H5S A;  1QAY A;  4RLE A;  4OIX A;  1UVM A;  2VG5 A;  2DPJ A;  3EMT A;  4DR2 F;  1E6Y B;  4QIV A;  3W63 A;  3V6H A;  1OO0 B;  2CXE A;  2C3Y A;  2HRY A;  3T5J A;  2JFD A;  4R5P A;  1SH2 A;  2RIJ A;  2D3O R;  3OTC A;  2UUW A;  3TA1 A;  3THP A;  5FD1 A;  2EG2 A;  5LL6 d;  2DGT A;  1FEE A;  1W2I A;  3SFU A;  2CWK A;  3NKY A;  5H9F J;  1FFG B;  2E7W A;  3OHB A;  1R3N A;  2QL9 B;  1N6Q B;  4HL9 A;  2UUA F;  5KFR A;  1RTZ A;  5C2G A;  2LMI A;  3ET6 B;  4C97 A;  1Q0N A;  1QTM A;  4WZQ A;  1WC0 A;  1MSW D;  3POT B;  3G96 A;  3IRW P;  1S99 A;  3KHR A;  1CJK A;  1D9A A;  1YLX A;  1GNK A;  1YVF A;  1DBD A;  1ZM9 A;  2HZC A;  2F4F A;  2J76 E;  2IA6 A;  3AA8 A;  3VAI A;  4K0K F;  4USJ C;  1JNR B;  1K1Q A;  1T3N A;  3KKF A;  3B4D A;  3WBZ A;  3B8H A;  3SBM A;  1S0M A;  4ZVT B;  3OL9 A;  4DR1 F;  4DR5 J;  1BQN B;  3HHL B;  4YOE A;  4DV7 J;  1JWW A;  4PQU B;  4DJB A;  3K8W A;  1QM9 A;  1B0T A;  2RQC A;  1IQZ A;  2PDA A;  4MYU A;  2VQE J;  3NOG A;  2W9A A;  3MZI A;  1Q86 T;  2I8E A;  4NL5 A;  5KFX A;  4OYB A;  1YJW S;  4OL8 A;  1VCT A;  2J9E A;  3ZC4 A;  4DR3 F;  1LEO A;  2RSQ A;  4L76 A;  3R5J B;  4XPE A;  5FII A;  5HK4 A;  1N5Q A;  3QT7 A;  2V8H A;  2WSF C;  1UA1 A;  3QYY A;  4M8L A;  3IAM 9;  1F9H A;  4HHH A;  1WC3 A;  2B51 A;  4X4V A;  4KHP F;  2F8E X;  3FVY A;  2OPQ A;  2N7C A;  3IBW A;  1HBN B;  2CVI A;  2DY9 A;  4OYI A;  2GJ2 A;  4L74 A;  1SJF A;  3LP1 B;  2IRU A;  1RE1 B;  4LF4 F;  2UV8 G;  1U25 A;  4WXW A;  2RRN A;  4I0W A;  4OV6 A;  2FLL A;  1HHS A;  5A2Q U;  2GHV C;  2CPF A;  2Z2L A;  4CNY A;  2OPS B;  2ZZT A;  2E1A A;  3ETM A;  1N8R T;  2V63 A;  3SYZ A;  3BZQ A;  3MM5 B;  2XLJ A;  3OBI A;  1DY3 A;  4LF7 F;  4ZP6 A;  4Y2M A;  5A8W A;  2AW0 A;  2LDY A;  4ZVO B;  2HVD A;  1KD1 T;  3MR6 A;  3HMJ G;  2CIM A;  4A46 A;  4YFU A;  4JI0 J;  2F1F A;  1WG1 A;  2JEG A;  1FEH A;  2P5V A;  4OJH A;  4RNM A;  4F25 A;  1H3D A;  2QV6 A;  1UTA A;  1GMW A;  3OR2 B;  1G3O A;  4DFK A;  2XMU A;  2XSJ A;  2MLZ A;  3TNV A;  3BN4 A;  2R8J A;  2D1C A;  4Y28 C;  1JJC B;  2KG1 A;  3TVK A;  4YY3 J;  1F9E B;  3N4W A;  1OQ3 A;  1O0P A;  3ZTO A;  4DPY A;  2ZWO A;  1PKU A;  1QAX A;  3QSI A;  2RDJ A;  3UPF A;  4A8O A;  4DR6 J;  1B0P A;  1TL4 A;  4LBP A;  5HJY A;  3BBC A;  5IT9 Y;  4N56 A;  4LFB F;  2FC9 A;  1JKH A;  2J0W A;  3A8E A;  2VV5 A;  4P6Q A;  4ZLL A;  2LQ9 A;  2W9C A;  5E5N A;  5LJ5 Y;  1TAU A;  1XR6 A;  3QFH A;  4CDI A;  5D0E A;  2QYC A;  2BE9 B;  4P2F A;  2V9K A;  3FGV A;  1RT7 A;  1T9T A;  2DHG A;  4UW2 A;  3AD9 C;  3EDR B;  1IUJ A;  2X3D A;  4FF4 A;  3TA0 A;  4KKO A;  3CIM A;  4A8Y A;  2C3P A;  1WOO A;  1E6V B;  2DK2 A;  2A1B A;  1R31 A;  1U02 A;  2QG9 B;  4D3G A;  3H5U A;  1TKT A;  4O3Q A;  3OXF A;  1NJW A;  2RQM A;  1PBA A;  1NXI A;  3EGN A;  4ED2 A;  3NGD A;  4QQB A;  1S6P A;  4X4N A;  4R0E A;  5THW A;  3OLA A;  4LRC A;  3TYT A;  1H74 A;  2C2E A;  4L75 A;  3DRR A;  1MU2 B;  5ITH A;  1TKZ A;  4FKY A;  2J9D E;  1KTQ A;  4A47 A;  5DO2 A;  3BPD A;  3I5A A;  1RT4 B;  2ZH8 A;  1B4S A;  4I2Q B;  4NEY A;  1GK8 A;  3ZNJ 1;  2H48 B;  1JK9 B;  1URR A;  4IRK A;  5LMU F;  1F3F A;  1HD1 A;  1HNV B;  4LFB J;  2B0G A;  4DQQ A;  2Y1R I;  4P9S A;  4KV8 B;  2DD8 S;  3BBF A;  4K4X A;  4BLG A;  2PI5 A;  3H40 A;  2XWX A;  3CCR S;  4AXI A;  1Q8K A;  2V5H G;  2AYE A;  5GAH I;  1RKI A;  2D3Z A;  1FRH A;  3SZ2 A;  3BQ1 A;  1KHW A;  3OL8 A;  2BYC A;  2BAB A;  3HSZ A;  3M8P A;  2OPP B;  4DR4 F;  2DXF A;  2KKH A;  3FZ2 A;  1IXK A;  1R43 A;  1PC4 A;  1F6T A;  4ED6 A;  3M9M B;  1Q8B A;  5KFS A;  3C19 A;  3CD6 S;  4DL6 A;  3MEK A;  4OX7 A;  3H25 A;  5FJ4 A;  2VJU A;  3QMQ A;  5J1P A;  2H9Z A;  1N6Q A;  4DS4 A;  3MCM A;  3K5L A;  2DO0 A;  3CF5 Q;  3ET6 A;  3P49 B;  2XMJ A;  4K7Q A;  3TEH B;  1PCA A;  3D3C J;  5B09 A;  3HDS A;  5CAB A;  3K7R A;  5E3P A;  3POT A;  1Z2Z A;  3TP2 A;  2WW4 A;  2HHU A;  2AX0 A;  5IWA J;  1DTT B;  4N7T A;  2Z4P A;  2HWH A;  3D6F B;  3WC0 A;  2U2F A;  4LF5 F;  3F41 A;  2A2C A;  1X4F A;  3MTJ A;  1R6Y A;  4DN9 A;  1WHV A;  4Q43 A;  3T1Y J;  2MLY A;  4DWI A;  2WON A;  1K8A T;  3KLH B;  3HHL A;  1EP4 B;  2LKZ A;  4ZPA A;  2QMW A;  1V5I B;  4ZPD A;  3JTP A;  1XQI A;  5AJ3 J;  3CNQ P;  3AY0 A;  4WK3 A;  4FVM A;  1VRU B;  4RU2 A;  1GXT A;  2ZNY A;  2GVD A;  3ZTR A;  3PW2 A;  2B5J B;  1FD2 A;  4OI1 A;  2C2K B;  3L4B C;  2UUC F;  3HPO A;  2HHQ A;  2CWX A;  4ECT A;  2Y1L B;  2XO7 A;  3THT A;  3MTK A;  3K58 A;  1VQ6 S;  2VOP A;  2E44 A;  3VWS A;  3KK2 B;  1BHN A;  3DMJ A;  4IRD A;  3ONQ A;  2PE8 A;  3PIO Q;  3AJD A;  2ZH2 A;  4KAI A;  2VON A;  3KJN B;  3LP1 A;  1ZET A;  1DRZ A;  3PR5 B;  3CCT A;  2XNR A;  2HHV A;  2F9J A;  4LSL B;  2ZM6 F;  5J2Q B;  4OHW A;  4CLW A;  5EUH A;  4WP8 A;  2OPS A;  1BQM A;  2W2P P;  1IR0 A;  1N36 J;  3VAG A;  1FJE B;  3MM5 A;  2BX6 A;  4F3O A;  5GAH U;  3IAS 9;  1EKR A;  4JBC A;  2FPH X;  5F3T A;  1NH7 A;  5IC4 B;  5GME A;  5K20 B;  3RTV A;  5J2P B;  2FJW A;  3NGT A;  2BJ3 A;  1OPZ A;  4Y65 A;  1T9X A;  2Z2Z A;  1EET B;  3LAN A;  3A8I A;  4I6Y A;  5JUM A;  1IM4 A;  5HLF B;  4OX6 A;  4FXW A;  2W01 A;  3GV8 B;  4UUW A;  1NAQ A;  4U9R A;  1ZZN A;  2GZO A;  2KN4 A;  1UJ4 A;  2PMH A;  2GS8 A;  3MPV A;  2RIL A;  2DT9 A;  2BQ3 A;  3S1T A;  3EGV A;  5JMN A;  1WF0 A;  2CPX A;  5CYJ A;  3O5T B;  3PDN A;  2HHH J;  2MJN A;  3UDE A;  4USW A;  4LF6 F;  2AYB A;  1FRM A;  1QDU B;  1S57 A;  3AOA A;  2MKK A;  1U09 A;  2MJU A;  3W2V B;  4AD6 A;  4B9U A;  3O6Q A;  2QLJ B;  1S6Q B;  2KTQ A;  2XY5 A;  4C48 A;  3GWC A;  3VQT A;  3LUY A;  4FKX A;  2W1B A;  5CZV A;  1QVG R;  1NDP A;  3J7Z 5;  1T0T V;  4FYD A;  2WVB A;  3ILJ A;  4DX7 A;  4G1I A;  3I0S B;  3AB2 B;  2CQG A;  3A8J A;  1TTH B;  4AXJ A;  2KB2 A;  2ILY A;  4O3R A;  1CPZ A;  1U1P A;  3JTO A;  4ZVG A;  4NZ6 A;  3MMA B;  4ZPV R;  1CS4 B;  1VYA A;  2BBE A;  4DFP A;  4C0H A;  1R7I A;  5DLG A;  1MU2 A;  1PSD A;  4K4V A;  4C8M A;  3OW2 R;  1RT4 A;  1BLU A;  2G2Z A;  4I2Q A;  2MQQ A;  4X4S A;  3PW7 A;  4B3S F;  1HNV A;  2E7X A;  1YJT A;  2R7U A;  5DRK A;  3VAF A;  4MIB A;  1X7V A;  4TU9 A;  3FDS A;  1WEX A;  1RUS A;  4KV8 A;  3IRX B;  3DRS B;  3PAC A;  2VQF F;  1KC8 T;  3MEG B;  1ZOT A;  4LF6 J;  2C42 A;  3Q8R B;  2KXF A;  4TKT A;  5E33 A;  1FNX H;  1K9M T;  4QR0 A;  5L9X A;  2JVR A;  3PV8 A;  3NEK A;  1KQK A;  3QRP A;  4NI2 B;  3HFV A;  1C2P A;  1H6K X;  3A4T A;  3DLL Q;  3Q2T C;  3CDA A;  3FK4 A;  1ULR A;  3SSR A;  3HSJ A;  1RK8 A;  3CMA S;  4RUC A;  2IM3 A;  1C0U B;  1U8W A;  2PA3 A;  2CNL B;  4CLL A;  2RF2 A;  2CJX B;  3RAX A;  3PY8 A;  1BXN A;  2CJB A;  1XTZ A;  1KSP A;  1IJF B;  3O1L A;  1UVK A;  1T94 A;  2O01 C;  4DU7 A;  3QQC D;  1EQM A;  3J81 Y;  1GTH A;  1MNE A;  3KDO A;  4YEA A;  1DTT A;  1YHQ S;  3OXL A;  3KUG A;  1TV6 A;  1MN7 A;  4P7V A;  1PAU B;  4O3O A;  3HD2 A;  4IG0 B;  4QU6 A;  2OO4 A;  3M8Y A;  2WBR A;  3A3O B;  2YXL A;  3EZU A;  3IC1 A;  2XGP A;  2N3O A;  2DYA A;  3THV A;  4DSJ A;  4JV0 A;  2YWK A;  4QR2 A;  1S48 A;  3KLH A;  1EP4 A;  2FVR A;  4EBC A;  4YS2 A;  1RI7 A;  1W25 A;  1Y7P A;  3UDV A;  4IG3 B;  4DBQ A;  5I3U A;  4LFA F;  1IBC B;  1VRU A;  4F67 A;  4LMZ A;  4J91 A;  4DSE A;  3NMA A;  1C1C B;  3I0R B;  2GO8 A;  2B5J A;  4CO5 A;  3G71 S;  2JX2 A;  4O23 A;  2MZT A;  2ZWP A;  2NXN A;  3GCW P;  1IKX B;  2HHW A;  4IO1 A;  3M32 A;  1TR0 A;  3KK2 A;  1WC5 A;  1HWU A;  5GAD I;  4KGX B;  4JP8 A;  4CLY A;  3HVR A;  2KM8 B;  4QYZ K;  2ZBQ A;  4WK1 A;  5B0E A;  3FBF A;  3D28 A;  4ER8 A;  2PO4 A;  3BRE A;  1LWC B;  2J7K A;  4E2F B;  3KHG A;  4HT5 A;  5HAT A;  2I5J B;  3UNY A;  4PPD A;  2HHX A;  1WOP A;  3PR4 A;  1H2V Z;  1M5V C;  5J2Q A;  2ABY A;  2V4Q A;  4NLS A;  4B3O B;  5HMZ A;  4ED3 A;  5KG2 A;  2ZDO A;  2DNK A;  5IZH A;  2W7A A;  5LXY A;  4ZVH A;  3VV2 B;  3CD7 A;  1S1U B;  2YH0 A;  3DU6 A;  2YX1 A;  3JQK A;  1NK9 A;  2HS0 A;  4UST A;  2DNM A;  1N54 B;  3GG1 A;  2A6O A;  1ZPV A;  5J2P A;  3GIJ A;  2BJE A;  1PJ6 A;  2PA8 D;  3PFE A;  4C3K A;  3DHX A;  4WFA Q;  1EET A;  3GIK A;  5AXK A;  2R42 A;  2R2U A;  4F0H A;  2H51 B;  2ZVI A;  4F26 A;  4DUZ F;  2ATL A;  4R0J A;  4MK8 A;  2I6W A;  1O6X A;  1JLQ B;  3QAE A;  2EXU A;  1HNZ F;  2YNF B;  5F8L A;  2HS3 A;  5GAG U;  2VOO A;  5JXS A;  4BCA A;  1FKP B;  3MPW A;  4AND A;  5KFP A;  4F4A A;  1NBE B;  3T1H J;  4M63 A;  3V6D A;  1NME B;  4N8N A;  5E3R A;  3CXC R;  3H42 A;  3R2D J;  1RAC B;  2J6S A;  4W90 B;  1DQA A;  3I4H X;  2MHN A;  2PFF B;  2AGQ A;  5BYQ A;  3W2V A;  1SL2 A;  4OYO A;  3E2E A;  2QTW A;  5D0G A;  1TEL A;  2YQ3 A;  4HDH A;  3ENV A;  1W2B R;  3W2W B;  4P2M A;  1YIJ S;  1I94 F;  1UW4 A;  5F8J A;  1NHV A;  1F2H A;  2EK1 A;  1RLC L;  3RB3 A;  4WZM A;  3T19 A;  1SI9 A;  2GV1 A;  1NK8 A;  2MST A;  1C0T B;  4P10 A;  3MF5 A;  4P75 A;  1RAH B;  3Q8U A;  2XCA A;  3KTQ A;  2GIF A;  2RVJ A;  3KUH A;  3NNC A;  3QT8 A;  5DDP C;  4ZS6 A;  2B4P A;  1IM6 A;  1BE4 A;  2LYV A;  2QYG A;  3CJ8 A;  3MMB B;  1H0H B;  4LRF A;  1CJV B;  3CCW A;  4DV2 J;  3MMA A;  4ZOS A;  5GAD U;  1CQM A;  1CS4 A;  4CYU B;  1L3T A;  5DZ7 A;  3CJK B;  1FFS B;  5D4O A;  3IFE A;  5L9N A;  1HPZ B;  1H7W A;  3PYG A;  4V19 X;  3H0P A;  2BM0 A;  4EK2 A;  2OIH A;  1Q7L B;  2L9W A;  3C14 B;  5G0R B;  3NGU A;  2ZD1 B;  1QVF R;  3IRX A;  2CJA A;  4P2X A;  2GFF A;  5ETQ A;  3MEG A;  2E66 A;  1RQ0 A;  1RLD A;  4B3R J;  2G2O A;  3ZZ0 A;  1TP7 A;  2MGZ A;  1FJC A;  1F5B A;  1R8C A;  3CC7 S;  4DV3 F;  3IGV A;  2LDI A;  5E3C A;  1RWN B;  3QO9 B;  4NI2 A;  3TO8 A;  4B3M F;  1K47 A;  4EO6 A;  2RKI B;  1G6B A;  5LT5 A;  4I2P B;  4DCO B;  3GFX A;  3W61 A;  1HWJ A;  4YB7 A;  2HLU A;  4A4J A;  1C0U A;  2OAU A;  4FS1 A;  2DR7 A;  1RCO B;  4EGL A;  1RT1 B;  4UQT A;  3I87 A;  2WVC A;  4UOC A;  4BBY A;  4NLT A;  3ZZY A;  3E51 A;  1TK8 A;  4RBT A;  5IV4 A;  3DRX A;  3MCS A;  1JLB B;  4DPU A;  1WJ9 A;  1X60 A;  2JDJ A;  2F65 A;  2O67 A;  4RBU A;  1HI0 P;  3OTB A;  2CG4 A;  2W7P A;  4C0O C;  2OJ3 A;  2LVW A;  2A3J A;  3HO1 A;  1NPR A;  3HUL A;  4RNH A;  1APS A;  4I6W A;  2DGV A;  4OI0 A;  5HQM A;  2G2Y A;  4ITS A;  4B02 A;  2BOP A;  3IS9 B;  5DQI A;  3QT6 A;  5I4M A;  4J37 A;  2MZQ A;  2ZE2 B;  3R6G B;  1GEH A;  5KOX A;  5H1S V;  4LSN B;  4FN5 A;  5B0C A;  2FQQ B;  4NXN J;  2M70 A;  1WF2 A;  4JI7 F;  1VQK S;  1YJR A;  1M5K C;  5HVH A;  1JMT A;  3N6L A;  4NMX A;  4IG3 A;  4X62 J;  1D09 B;  4ZKA A;  1Y3J A;  2X1G A;  3VAL A;  2FHJ D;  1C1C A;  3I0R A;  4BC9 A;  2IC3 B;  5FLX U;  2W8L A;  1IKX A;  1UA0 A;  2ZNZ A;  3HZG A;  3P45 B;  3L95 X;  2FB0 A;  4WFB Q;  2VIH A;  3V2U C;  4QOT A;  4ZVQ B;  3M8R A;  1PGZ A;  2RUG A;  3GON A;  1SVD A;  1VQS A;  2OI2 A;  3RRH A;  4J9U E;  2J6T A;  5HVG A;  4DHV A;  4I68 A;  4J9N A;  1B0V A;  3RB4 A;  1S1T B;  3N9U C;  4PWW A;  2PEH A;  1QSS A;  2L41 A;  1LWC A;  2ERR A;  1PIL A;  2VFT A;  4NLD A;  3V4I B;  2I5J A;  3R97 A;  1IN0 A;  6AT1 B;  2FY1 A;  3SFG A;  3CIZ A;  1VQ9 S;  4B3O A;  5KFJ A;  2DY1 A;  2CUY A;  1S1U A;  3T6B A;  3IBF B;  2O3D A;  3TVY A;  4DL4 A;  3KDN A;  3MCN A;  5HQ8 A;  2IVY A;  1XEZ A;  4DDF A;  2LEC A;  2M7S A;  2HNY B;  4QW9 A;  2IY5 B;  2GAG C;  1TKX B;  3J80 U;  2UXB F;  1HHT P;  4JI5 F;  4KH1 B;  1RT3 B;  2DHX A;  3JS9 A;  4PYD A;  1Q95 G;  2HVE A;  3IP0 A;  2BJD A;  4GKJ J;  2W4P A;  2RU3 A;  1JLQ A;  3C66 A;  1MML A;  3OUY B;  4O4G B;  2CAD A;  3WIU A;  4U7U D;  4KFB B;  1FDD A;  2YNF A;  1TL1 B;  3CUN A;  3QGH A;  3QRR A;  1YRX A;  5KT6 A;  3NNH A;  3DRP A;  2FYX A;  1N5Y A;  3QSY B;  1YK9 A;  3NRB A;  1FKP A;  4GMK A;  1WWH A;  4LIR A;  2L9N A;  3D67 A;  4CIO A;  3HSG A;  3CDB A;  3FC9 A;  1RAO A;  1Y00 A;  3DLE B;  3MOZ A;  4ZLN A;  1UFL A;  1RSC A;  3GE9 A;  1RAE B;  1R8P A;  4YUD A;  1SC3 B;  4EI2 A;  1RHQ B;  1U48 A;  3AT1 B;  2KH9 A;  3BO4 A;  2H4Y B;  4TQS A;  4UUX A;  2G9O A;  3CED A;  4KO0 B;  4EWT A;  1HBO B;  5IQQ A;  5KFL A;  4X4T A;  5JJB A;  2VG6 B;  4CM0 A;  2WB1 D;  1L3V A;  3ZNU A;  4K8R A;  3W2W A;  2IHR 1;  1RWX B;  4OZL A;  1C0T A;  2KT5 A;  2J0Q D;  4OJG A;  2JRS A;  4JV5 F;  2IM1 A;  4NWB A;  3RGI A;  4TYA A;  2AHO B;  5CD4 H;  2LXI A;  1FX2 A;  2D41 A;  2QSW A;  3PO4 A;  3D1O A;  5DS7 A;  2XTJ P;  2DR6 A;  3MMB A;  2EFV A;  1CJV A;  3AFG A;  3PEJ A;  4CYU A;  5T14 A;  1B7F A;  3DLG B;  3CJK A;  4E0D A;  3BGR B;  1ZS6 A;  4JI6 F;  4CO4 A;  3OVB A;  3DOK B;  2X1A A;  2KZM A;  2D74 B;  2VL1 A;  3CDE A;  3HVT B;  2M0G B;  2YPZ A;  4Z7C A;  1S1W B;  1NKE A;  4DV0 F;  4AQY J;  3C14 A;  1NSA A;  4DL3 A;  2HQF A;  2ZD1 A;  4J9O A;  1DTQ B;  1WTB A;  3KYL A;  3K57 A;  1LK5 A;  2OFH X;  1KBR A;  1H73 A;  2PT0 A;  1BC6 A;  1WC4 A;  2AJF E;  3QRQ A;  1UFK A;  1RAG B;  2AIR B;  3QO9 A;  2JH3 A;  3MDF A;  4OJ3 A;  2WAQ D;  3G8S A;  5IOL A;  2ZOG A;  4G3I A;  3MAH A;  2RKI A;  4I2P A;  5SUH A;  4ED8 A;  4ZCL A;  4EZ9 A;  1RIS A;  5ETO A;  2IVF B;  2ZKU A;  2CDQ A;  3PVX A;  5ETS A;  2CQP A;  1RT1 A;  4JI1 F;  4USV A;  5BJR A;  2ZH6 A;  4ECU A;  4DV6 J;  1IBK F;  5KT3 A;  2R2R A;  2XZT B;  4IH6 A;  1JLB A;  2JNJ A;  4RNO A;  1XER A;  5AXM A;  2FTR A;  1GQE A;  1S6U A;  1XMQ F;  2HMI B;  1NHK L;  4KQZ A;  5IFM A;  3HXM A;  4K4Y A;  1MW7 A;  1T8E A;  4CZC A;  1WKK A;  2G4B A;  4M5G A;  1ZYQ A;  3D1H A;  1KVJ A;  5D15 A;  2VC1 A;  2R7S A;  4F4X A;  2BV3 A;  1HLW A;  4M5H A;  3IS9 A;  2ZE2 A;  1S12 A;  2P2C B;  4LSN A;  3T5H A;  4JOU A;  3SV3 A;  1YRT A;  1HQ2 A;  1R8A A;  8ATC B;  2W2O P;  4M5I A;  2XI3 A;  3NS5 A;  1RBL A;  2N4D A;  4DL7 A;  1PC5 A;  3SIP B;  2E5G A;  1RT2 B;  3C2P A;  2MZR A;  2E1P A;  1RTJ B;  2QL5 B;  3C6T B;  3H2U B;  4YDD B;  5KFM A;  3KLV A;  5E3Q A;  1WSR A;  1S4E A;  4FNH A;  4DG1 B;  5H9E K;  3CB4 A;  4X64 J;  1Q16 B;  2GNK A;  1FNM A;  3ZZR A;  1VQP S;  1FES A;  4NYZ A;  2VFU A;  1UW9 A;  1U1R A;  1M90 T;  1OYE A;  3AQO A;  3TZW A;  1HHQ A;  4ES1 A;  2RD5 C;  2UVR A;  3V4I A;  2B8Q A;  5B7W A;  5LMN J;  3D6T B;  5D8H B;  7FDR A;  3G6Y A;  4LRE A;  1SXL A;  3MM6 B;  1FJG J;  2CYY A;  2XNQ A;  5HL7 Q;  2WOM B;  1KLN A;  2W2M P;  4CH7 A;  1U0H A;  4ANE A;  5F8N A;  3AAW B;  1V9O A;  3W5Z A;  4ZPC A;  4F7V A;  3RYL A;  5KFB A;  4DV4 J;  1HNW J;  2CVE A;  2HNY A;  2AX1 A;  4P52 A;  4WKY A;  2DO4 A;  1LXJ A;  1TKX A;  3HSD A;  2ATC B;  3T9N A;  4OYX A;  3QZ8 A;  1D9F A;  1HA1 A;  1RT3 A;  4XTT A;  5D4P A;  2V50 A;  3P4U B;  4YHH F;  3BJY A;  4D3H A;  1I1G A;  2RE1 A;  5GMD A;  1FXD A;  1Y0H A;  4WCE Q;  2XO6 A;  2P9G A;  1CUL B;  2KU7 A;  3AJ1 A;  4MFB B;  3HM9 A;  2F8H A;  4N41 A;  5A0Y B;  4WE1 B;  1Z2L A;  3OUY A;  4O4G A;  2X1B A;  4V19 J;  1NO8 A;  1NK0 A;  4KFB A;  3UN2 A;  4XDC A;  2EKN A;  3L9Z A;  1T9Y A;  1UJ6 A;  2ZOF A;  1FD8 A;  1DLO A;  2GCF A;  2BEF A;  4ED5 A;  3SI8 A;  3QLH B;  4P71 A;  3LGH A;  1VQM S;  1FRJ A;  2HIY A;  2XMK A;  3PW5 A;  1RHJ B;  1TL3 B;  2W24 A;  3R5B A;  1IKW B;  3PW0 A;  3GCX P;  3DLE A;  1X5O A;  4CNZ A;  4GO7 X;  1N32 J;  3KNA A;  1Q78 A;  4LJM A;  4KO0 A;  4B9S A;  3UE2 A;  1HBO A;  4F2R A;  1S59 A;  3NMR A;  2RHS B;  3IR6 B;  4U8Y A;  4DF4 A;  2C2O B;  4RW6 B;  1RTD B;  4LIW A;  5KFF A;  3M8Q B;  2G1H A;  3C46 A;  1LW2 B;  4LF9 J;  2XMW A;  2Y3Y A;  3FBC A;  2ZJQ Q;  4GVL A;  3D1Q A;  3LAM A;  1LWX A;  3VAM A;  3D2W A;  4YHH J;  3C8Y A;  5HAO A;  2WVF A;  3GP9 A;  4IFY B;  1C4A A;  3BBB A;  4M5D B;  2QLW A;  3TA2 A;  3DDI A;  2UUB F;  2YH1 A;  1HNX J;  2WHO A;  5LSR A;  1Y5I B;  3J81 U;  1IKV B;  5F9L A;  3DOK A;  2Z57 B;  4ZDN A;  3A13 A;  1PJ7 A;  1LW0 B;  4J9K A;  1ARO P;  2HND B;  2EK6 A;  2PEB A;  3HVT A;  3TX8 A;  2QMU B;  1U6Z A;  1S1W A;  4NCA A;  5B0D A;  1VBK A;  2YNH B;  2F4V F;  1VOM A;  2W9B B;  2CDR B;  1HKA A;  2K1R B;  2V4R A;  2R2T A;  2PI4 A;  1QY7 A;  4NLO A;  2ZH7 A;  2WZ1 A;  1YQH A;  2K7K A;  2BJ1 A;  1DTQ A;  1S0V A;  2CQ2 A;  3F73 A;  4KC5 A;  3H5X A;  3D7S B;  2HHT A;  4WII A;  3NGK A;  1IR1 A;  1TKD A;  1TFY A;  1RWW B;  1WC1 A;  2GQQ A;  1I51 B;  3D5M A;  3BH6 B;  2AJQ A;  5KG6 A;  4ZIW A;  4DUY J;  3PX4 A;  4C98 A;  4OZ1 A;  3ZTS A;  2VKR A;  4IKA A;  4DF8 A;  4KGM A;  1UWB B;  2R7V A;  3B4M A;  3GJT B;  1UPM B;  2MKY A;  3DYA B;  3AXM A;  4B9T A;  1X5T A;  1T9U A;  1Q4R A;  2D3O 1;  2EBG A;  4O3P A;  4YR2 A;  4GC6 A;  2LQJ A;  5DM6 Q;  2GIR A;  1VQL S;  3OTD A;  2DRD A;  5BYR A;  2AU0 A;  4IR1 A;  2KRR A;  3UDC A;  5AE2 A;  4QYZ J;  2HMI A;  1RWV B;  4DZ6 A;  1S7I A;  2AJ4 A;  3D0H E;  4F0M A;  3OFG A;  2HGN A;  2PSZ A;  2VPY B;  2KT3 A;  3BKU A;  2MQL A;  5KG0 A;  2AJ0 A;  3OXG A;  2C3M A;  3Q83 A;  1BGX T;  2H3E B;  2DH9 A;  1U6B A;  2L08 A;  4FXV A;  3G6X A;  4DFM A;  1M1G A;  1X31 C;  1TAQ A;  5BR8 F;  3R2C J;  4MYT A;  4B08 A;  1RWM B;  1RT2 A;  2ZC3 A;  2IDE A;  2N7Y A;  3FMB A;  3BB5 A;  1RTJ A;  1R8B A;  3C6T A;  4IRC A;  3EPI A;  4DR7 F;  4IFV B;  1U49 A;  2UP1 A;  1AA1 B;  4LFC F;  3UVJ B;  4DG1 A;  2J5A A;  1B70 B;  2VBY A;  5KFT A;  5RUB A;  2YKO A;  4QPX A;  3EPG A;  5KG4 A;  2CJK A;  4C3L A;  2FC8 A;  1XNQ F;  1S0N A;  2C28 A;  3CW2 C;  1NDC A;  3DRY A;  1I6J A;  3BPS P;  4IDK B;  1RT5 B;  3Q0A A;  3IR7 B;  2IRX A;  1XNR F;  3FCW A;  2R7T A;  4PAA A;  2ZH3 A;  3G86 A;  1UZH A;  1Z1Z A;  2WOM A;  4F4Z A;  2GHP A;  4RO0 A;  3LTO A;  2GO9 A;  2DNG A;  2MLX A;  1UVL A;  4HI2 A;  2NR0 A;  1R89 A;  5D78 A;  4RL1 A;  2DIS A;  3MUT P;  1NLK L;  2B6A B;  4ID8 A;  3TZZ A;  2HYI B;  3I96 A;  1XK8 A;  1EX8 A;  1S1V B;  7FD1 A;  1HMV B;  6FDR A;  3Q8Y A;  5JVH Q;  1SL1 A;  1LFP A;  4I4B A;  1NRK A;  3D68 A;  3NS6 A;  4B9M A;  2RHQ B;  1WHY A;  4YR0 A;  4MFB A;  4TU7 A;  1HWK A;  2QX0 A;  4WE1 A;  5A0Y A;  4KIA A;  2EI5 A;  2ZOM A;  2H54 B;  1M5P C;  2CFX A;  2PMW A;  2GJF A;  2G13 A;  2M9K A;  2HBQ B;  2R8G A;  1AZS B;  3QID A;  2FHJ A;  4TQR A;  4PUO B;  3QLH A;  3MEC A;  1V6H A;  2ZHO A;  2XC9 A;  1P8G A;  2DCL A;  1TL3 A;  1IKW A;  4ZIT A;  1RCX B;  3AOB A;  1VC5 A;  2KYZ A;  4ZVP B;  2UU9 J;  4U67 Q;  1U47 A;  2W2Q P;  3IXQ A;  4ETX A;  4HH0 A;  1N33 J;  4Y2K A;  2YQ1 A;  5T7L B;  5CA5 A;  1OQ6 A;  1VS3 A;  2C2M B;  1FRL A;  2E5L J;  2E9R X;  3I56 S;  1Y3K A;  4N8O A;  3TAM B;  3QAU A;  3OSN A;  4CLS A;  2OEK A;  3EZ5 A;  4DN0 A;  1N56 A;  1NK7 A;  5EWE A;  2GMJ A;  5K9F A;  3ILI A;  4ZN3 A;  4FS2 A;  4RW6 A;  2VH7 A;  1U0S A;  3NBP B;  3JYT B;  1RTD A;  2DRB A;  2Z30 B;  3KXD A;  1A6L A;  4I56 A;  3M8Q A;  2UXC F;  1RHK B;  2UVV A;  1LW2 A;  2OFG X;  3FCH A;  4A8Q A;  1NHU A;  3QZ7 A;  2MKI A;  4F3M A;  4PG4 A;  4KE5 A;  2AGO A;  4KJI A;  4C8Z A;  5KFQ A;  3FEX B;  4C3M A;  2DNL A;  3R5G A;  4G1Q B;  3PEH A;  2VJV A;  1SIW B;  4DSI A;  4M5D A;  2J7W A;  3CCV S;  1SJ4 P;  1IJE B;  3DLJ A;  2RT3 A;  2FLO A;  2OUG A;  2JEI A;  1YBA A;  5FDL B;  4ALZ A;  2K06 A;  5EN1 A;  2V67 A;  3K2Y A;  3CJR A;  5D0R A;  3ZTP A;  3TI0 A;  3NGR A;  5L38 A;  4J9V A;  2HZA A;  1LW0 A;  5EDW A;  4OQJ A;  4OZ2 A;  3CJS A;  1IR2 A;  2YNH A;  3VGS A;  4NZ0 A;  2DEI A;  2P9E A;  4ZHR B;  2W9B A;  1WG5 A;  2K1R A;  4PR6 A;  1LWF B;  2BXJ A;  4U96 A;  3LO3 A;  5T41 A;  2LEP A;  2QJ3 A;  3DOM B;  3EIC A;  3VGU A;  2V2V A;  2QE5 A;  3RAM A;  3HJV A;  2Y8W A;  4OI2 A;  1RKJ A;  4H4K A;  4TXS A;  3OTO J;  4P2S A;  3H5Y A;  4X66 J;  1OY9 A;  1NKB A;  2F63 A;  2X3G A;  2MZS A;  1L3U A;  4F04 B;  1ZTT A;  4DSK A;  4QIE A;  4F0K A;  2Z56 B;  4FBU A;  1UWB A;  4JI8 J;  4YB5 A;  3DYA A;  3BF4 A;  4TNO A;  2YNI B;  4MKA A;  4ES2 A;  1GT8 A;  3HF5 A;  2DR9 A;  2BAC A;  3BYR A;  4OV1 A;  1WKL A;  4LF8 F;  2O66 A;  4HHU A;  4UOH A;  2BUN A;  2B9Y A;  3HX9 A;  3SCL E;  1VIX A;  3BGL A;  2B56 A;  3AB4 B;  3H7H B;  4FXD A;  2D9P A;  2CA9 A;  3QPI A;  3T6J A;  5IM0 A;  3KFW X;  2B8P A;  4DV7 F;  2DHS A;  4YR3 A;  3BDP A;  5A6P A;  5KFV A;  3LGM A;  4EFA C;  3JSR A;  1MLA A;  2Y0B B;  2VQE F;  5HQL A;  2APO A;  3VAH A;  2RRA A;  2MXY A;  5F3Z A;  2CJY B;  3J7Z T;  3OT9 A;  1YSJ A;  2Q66 A;  4TYB A;  1XIQ A;  4X4Q A;  4WWS A;  4V1A k;  3U27 A;  2DH8 A;  2NSC A;  3M6V A;  2V9W A;  1U1O A;  2W25 A;  1UET A;  4KY3 A;  1X4H A;  3OFH A;  1S7H A;  1N88 A;  1DQ8 A;  3PTW A;  2JVO A;  3QJP A;  3N5B A;  1G7C B;  3H20 A;  4IFV A;  1M0S A;  5HVF A;  4ZPB A;  3UVJ A;  3MED A;  1ZAV A;  1KR4 A;  2XB2 D;  1Q79 A;  3NCQ A;  2MKC A;  3K5O A;  2IPO B;  2B7B B;  2C3O A;  2ZZM A;  4LF8 J;  3DLK B;  3CCZ A;  1FRI A;  4JI0 F;  3RB0 A;  4C9D A;  4MIW A;  1WHX A;  4J9R A;  3DGP B;  3KLF B;  4IDK A;  1NK5 A;  1RT5 A;  4YN3 B;  1PBU A;  4FYV B;  2VC0 A;  2OPR A;  3EXY A;  4CLP A;  3UD4 P;  1VMB A;  4PPZ A;  1WOS A;  2C3U A;  4DS5 A;  4LQ3 A;  3JQM A;  4YY3 F;  1K44 A;  3FQK A;  5IT4 A;  3LWL A;  2MQP A;  2IDL A;  3G2X A;  4O3S A;  3MFI A;  3SEO A;  1S1V A;  2BE2 B;  4DR6 F;  2E1M C;  1HMV A;  3EGW B;  5CAA A;  2EEY A;  2HRT A;  2VPZ B;  3O2I A;  2VBW A;  2GQ2 A;  1QAJ A;  1JQG A;  1VQ8 S;  1T95 A;  4WFY A;  3M30 B;  2IMO A;  3Q2S C;  3Q23 A;  2BKO A;  1RTI B;  1VK3 A;  4DU8 A;  1B7Y B;  1EJ7 L;  1AZS A;  3G82 B;  3KHH A;  1PAE X;  3HKZ D;  4K4T A;  2K3I A;  4LF1 A;  2AWZ A;  1JIH A;  3UCU P;  2IYI A;  5F0W A;  1V3R A;  4TU8 A;  5K5M A;  3CSK A;  2XMA A;  3JAM Y;  3I5B A;  3RRK A;  2NPI A;  2F5G A;  3LAK A;  3J7Y I;  1QD1 A;  1QTN B;  1VDH A;  1FER A;  2R4F A;  3H2V E;  2JOQ A;  3PCO B;  5E41 A;  4CP5 A;  4RJV A;  3TAM A;  2VOD A;  4ILR A;  1MG7 A;  1KDN A;  4ECV A;  1NCL A;  4F4Y A;  3CT9 A;  2UVW A;  2B9W A;  5FLX Y;  3P5B P;  2DIT A;  2ZBI A;  1OYD A;  4K5R A;  2DNH A;  4IQM A;  2CPD A;  1S9E A;  3NBP A;  3T5K A;  4K50 A;  2OLW A;  1KQS R;  4LQ9 A;  1SC6 A;  1WTF A;  2HVH A;  2XZD B;  2UZA A;  5K8O A;  2VBZ A;  2H5E A;  3G4S S;  1GXL A;  2PFD A;  2BQR A;  1RZM A;  4G1Q A;  1SCJ B;  5HRO B;  1TVR A;  4LRD A;  2PN6 A;  1X4G A;  3CC4 S;  2Y1J A;  2YKP A;  5KFU A;  4UQG A;  5FDL A;  4L72 B;  3ZXW A;  1U26 A;  2EWH A;  3DI6 B;  1FE0 A;  2QFI A;  3RRG A;  3VF0 B;  3MR3 A;  2WTF A;  1QSY A;  3M1V B;  3DNC A;  2POK A;  2WB4 A;  2OTJ S;  2SXL A;  4GO5 X;  4JV2 A;  1H72 C;  3AOD A;  3G6V A;  1H38 A;  4WP3 A;  1LFW A;  1U1M A;  2B7C B;  2R8I A;  2BE7 D;  3DOM A;  2XLK A;  2V34 A;  3O3L A;  3OV7 A;  1SJ3 P;  3J80 Y;  2JEJ A;  5HP1 B;  2Q6B A;  3I9V 9;  2ZJR Q;  1VQ5 S;  1FHT A;  1I3O B;  2ILZ A;  3SQG B;  3NCR A;  1ELO A;  2IBO A;  4RNF A;  3BSN A;  1XBW A;  5IWA F;  2AEM A;  1VGY A;  1U4B A;  3R5C A;  1JLA B;  2I0X A;  1K1S A;  2YNI A;  4QIF A;  3HHE A;  2MZ1 A;  3TX0 A;  3N6M A;  3PRV A;  4OYA A;  3QFW A;  1D8Y A;  3MPD A;  2NXU A;  3W9J A;  3T1Y F;  4CM2 A;  5H9E J;  1FO1 A;  1H2U X;  8RUC A;  3W1Y C;  4NLP A;  2JEF A;  1RT6 B;  3QGP A;  4ILL A;  2CPI A;  3MD3 A;  1TFW A;  2ASL A;  4GVB B;  5AJ3 F;  1VHI A;  2DHA A;  2JSX A;  1HI1 A;  2NSB A;  2HW3 A;  3J7Y U;  1E6Y A;  5CCL A;  4PWD B;  1MWZ A;  3JTN A;  2EC2 A;  2YY3 A;  2GIQ A;  2E29 A;  3BQ2 A;  4RW8 B;  5ETP A;  3NY0 A;  1RHM B;  1WEY A;  4ZP8 A;  3HFK A;  4LR8 A;  1M1K T;  5D6G A;  4UZC A;  4K4U A;  1A7G E;  1WD6 A;  2AJ2 A;  2VAS A;  1RWK B;  2LXF A;  1N5S A;  1XMB A;  3PFO A;  1WEZ A;  3CGI A;  1NSQ A;  2DGQ A;  5DLF A;  3KG1 A;  1Q53 A;  3NXZ A;  3MM9 B;  3LWM A;  1J5E J;  1NPP A;  2CKW A;  4WJB A;  5IV3 A;  1N36 F;  2BRL A;  1U45 A;  3RBZ A;  2QLX A;  3EYZ A;  3GSD A;  1TL5 A;  2C2D A;  3DLK A;  3BM7 A;  4HT7 A;  3V5R A;  4QU7 A;  3R8Y A;  2KL8 A;  1T9V A;  1SQG A;  1BQN A;  1FFW B;  4EYI B;  1JB0 C;  3KLF A;  4PQU A;  1W7W A;  3S8S A;  1KP6 A;  3DHW C;  4RUA A;  4X2B A;  4W92 B;  4ZIV A;  6FD1 A;  3L7U A;  2K3K A;  5DGA A;  2DGU A;  3OQ2 A;  4ECQ A;  3K5P A;  3GMG A;  4F36 A;  1KQF B;  2YTC A;  2CAJ A;  2UXD J;  4C8K A;  1UMJ A;  3IA0 A;  2BE2 A;  2EG1 A;  1S1X B;  1HBN A;  3VGV A;  2GHW A;  2RQK A;  3V4M A;  1N52 B;  1CJT B;  2HHH F;  2Q1L A;  3ISZ A;  3CVK A;  1RP5 A;  4RWW A;  3AJ2 A;  3SV4 A;  4NZ7 A;  3M30 A;  1OSC A;  2WW8 A;  4KT0 C;  5KFE A;  2IIH A;  4W98 A;  3OL7 A;  1U1N A;  4X65 J;  2HFZ A;  4IR9 A;  1HQE B;  2ZH5 A;  3G82 A;  1CVJ A;  2R7W A;  3MMJ A;  2MY7 A;  4FBT A;  2PMZ D;  1IBL J;  2HBY B;  3CMQ A;  2KXH A;  1URN A;  3G87 A;  2ZFH A;  2JC1 A;  1FK9 B;  3IMQ J;  1JLE B;  4NLX A;  4F3Q A;  3OR2 A;  2AYM A;  4ELU A;  3QJJ A;  4Y00 A;  4UY8 5;  4HEA 9;  1P1L A;  1D8Z A;  3Q22 A;  2DIV A;  4DPW A;  5KAK A;  1HD0 A;  3FSX A;  2CZV C;  2OHD A;  4JI3 J;  1HI8 A;  5IXU A;  2AF6 A;  3GJR B;  3FUY A;  1FA0 A;  3EWG A;  4LBI A;  3FCV A;  5CD4 A;  3TOQ A;  4URQ U;  4NLV A;  3HZE A;  1NM2 A;  1JJ4 A;  1VFJ A;  1TZ0 A;  3AQP A;  2ZZN A;  1RAJ A;  3DI6 A;  2QC3 A;  1XMO J;  1VRT B;  4A8M P;  2OMO A;  4A8S A;  1OJ4 A;  1RU1 A;  3N01 A;  4OYP A;  2CRL A;  3EGZ A;  4R8U B;  4UT4 A;  1Q1K A;  3OJU A;  4ZJQ A;  3QBC A;  4YB6 A;  5F0U A;  3TAP A;  1JLC B;  4DV5 J;  2LQ8 A;  3SQO P;  4F8R A;  2ALZ A;  4ECX A;  1E6V A;  1NH8 A;  1T9W A;  1GMU A;  5EHH A;  3ADA C;  4J7C A;  5KG3 A;  2CQI A;  2I38 A;  4ATN A;  3PX6 A;  4C2M A;  3BGF A;  4WXO A;  2AQ4 A;  3G6E S;  1NUE A;  3G8Q A;  5HP1 A;  2IJF A;  2VZ9 A;  2GMH A;  4YP3 A;  1ZH5 A;  1HYS B;  2HS4 A;  3C16 B;  2XS5 A;  1NB7 A;  5ETR A;  3VGT A;  2GQC A;  1VIO A;  4L73 A;  1JX4 A;  4O0I A;  4ZPW R;  3BKT A;  3JSM B;  5KT5 A;  1JJH A;  1QUV A;  1YIT S;  4NOH A;  3QAT A;  1JLA A;  4FVC A;  1JLG B;  5KFK A;  4DV1 F;  4F2S A;  5ETM A;  2HQD A;  1ZBT A;  1B64 A;  2YKM B;  4GKK J;  4DLG A;  4ED4 A;  2YWH A;  1LWE B;  2FD2 A;  5ETN A;  4J9P A;  1RDR A;  1F1B B;  2CPZ A;  4OZ3 A;  1RT6 A;  2CJQ A;  1NJY A;  4GVB A;  3KLG B;  3UDL A;  3PHE A;  5E3A A;  1LOU A;  4MKV A;  4PKD B;  4Q45 A;  4RW4 B;  4PWD A;  4TVA B;  3LAL A;  2HGM A;  2NYH A;  1S77 D;  1WDD A;  3D6H B;  2OPP A;  2LCW A;  1ZZF A;  2RQ4 A;  2HK2 A;  4Q8F A;  4DSF A;  2YWG A;  3PHT A;  4RW8 A;  1Y5L B;  3DOL B;  4TY9 A;  4E98 A;  3P5T L;  2IRY A;  3WX8 A;  3PZP A;  3RR7 A;  3Q8P B;  3IM9 A;  2FJX A;  4DFJ A;  2W9C B;  2LLZ A;  1R0A B;  1P9Q C;  2ZHB A;  2OP5 A;  2HKE A;  4XO0 A;  2JL9 A;  1VLY A;  1F5C A;  4WBF A;  4HH1 A;  4BS2 A;  1JNZ B;  5A76 A;  3MM9 A;  4Z7Y A;  2E9T A;  1NSP A;  1SC4 B;  4MTP A;  4UF4 A;  1R8H A;  4DV1 J;  2E7V A;  4DEZ A;  4OX9 F;  1S6O A;  2OEM A;  3H90 A;  3PYE A;  2YNG B;  4JI4 J;  2ZBR A;  3I31 A;  1HBU B;  1F5A A;  3QJL A;  1WSV A;  4FF1 A;  4C7Q A;  3MM8 B;  1HQU B;  2M5Y A;  4WYL A;  5LOQ A;  1EAR A;  1HR0 J;  3I9Z A;  4PG8 A;  4OYZ A;  1KHV A;  3FRY A;  4U6P A;  5HAN A;  1YG0 A;  1JJ2 R;  1EAY C;  4C8N A;  3F0N A;  4QWC A;  1S6P B;  3FSY A;  1HFE L;  4F4W A;  4G65 A;  4LRB A;  1FE4 A;  4JI2 J;  1QSL A;  3B54 A;  5I3Q A;  4ECR A;  1HIY A;  4X4P A;  3HD1 A;  4U7U K;  2ROG A;  5ETK A;  5F8H A;  3HHL C;  5JVG Q;  1RBA A;  1VQY A;  2AT1 B;  1UZD A;  3ELH A;  2LEA A;  2J0S D;  2XHC A;  3WZ0 A;  4CO0 A;  3G8T A;  2M8D B;  1CJT A;  3T1H F;  2MDA A;  2QLB B;  2NS1 B;  3MPY A;  2NUU G;  4CH1 A;  2M3D A;  1OS5 A;  5DG7 A;  3M4X A;  1X5P A;  1PO6 A;  4WYW A;  4LUB A;  4I1T A;  4G6V B;  1VBY A;  1UEV A;  3VAK A;  1K73 T;  4LSL A;  4ZJO A;  2Y1I A;  4RZR A;  1M5S A;  2XHW A;  1D9D A;  1YDL A;  1HQE A;  4CRJ A;  3M8P B;  4OX9 J;  2HBZ B;  2GML A;  2C2N A;  2ROE A;  2AD9 A;  3N6N A;  2OKQ A;  3RAQ A;  4K2J A;  2RDI A;  5HMW A;  4JUZ A;  1FDN A;  1X4D A;  5D4N A;  3KLE B;  4EBD A;  4YQW A;  2YPY A;  1X5S A;  4LR7 A;  1UP1 A;  3X1L B;  1G1X A;  3CTR A;  3CWJ A;  1F3V A;  1AB8 A;  1TQL A;  1FK9 A;  1JLE A;  3AD7 C;  4IOB A;  1S4F A;  5EWF A;  5HLF A;  4CI0 B;  5KFG A;  2MKH A;  4DV2 F;  1M1H A;  3N79 A;  1HW8 A;  3SDE B;  2F8M A;  1WI6 A;  1ZA2 B;  1OY8 A;  4S0M A;  3UR0 A;  2A2D A;  3K5N A;  3MUV P;  1GTE A;  4NRT A;  3UQS A;  2DPI A;  4USH A;  3TJ9 A;  1DHM A;  4K2X A;  1KS2 A;  4KSE B;  4EBE A;  1AFI A;  2WON B;  4W4M A;  3HP6 A;  2NLW A;  4KHM A;  4MT1 A;  1VQ7 S;  4Y2A A;  3H4D A;  4RR5 A;  3M6U A;  1S79 A;  3ZTQ A;  4B3R F;  3EVO A;  3NG8 A;  4WFN Q;  2LA6 A;  3US5 A;  2VDI A;  2XWY A;  3CDU A;  2NXE A;  2HQG A;  4DR2 J;  1VRT A;  2GVD B;  4QWA A;  5KTQ A;  1S6Q A;  2BVZ A;  3RUB L;  4R8U A;  4AT1 B;  2MEW A;  1SB6 A;  4HI1 A;  4CLT A;  1JLC A;  3NGS A;  5GVQ A;  1A0O B;  2MKS A;  3I0S A;  1N5V A;  4ETZ A;  2JFK A;  3CCS S;  3DMJ B;  2ZBC A;  1U1Q A;  2UUA J;  2FZG B;  2C2Z B;  3J7A 1;  2KJV A;  2G1D A;  3W5X A;  2HG4 A;  1HYS A;  1XR7 A;  3C16 A;  2FVP A;  2JLE A;  5M2U A;  1FTR A;  2DNR A;  2NZ4 A;  4O3N A;  4M94 A;  2CQC A;  1YBU A;  3PKM A;  1LKZ A;  5HO4 A;  1LK7 A;  2B4V A;  3JSM A;  3I55 S;  2Y8Y A;  1GX6 A;  1BQM B;  3NOC A;  2J6U A;  4MK9 A;  2JLF A;  1JLG A;  4K0K J;  1IVZ A;  4PG6 A;  3L7P A;  1DAR A;  2YKM A;  4FYX B;  1LQ9 A;  3PYD A;  4ZCI A;  5L1I A;  3V6J A;  3OVS A;  1X9W A;  4L3K A;  4RWX A;  1NEE A;  1RAI B;  1LWE A;  1PYO B;  1WF1 A;  2HVI A;  3D0I E;  1FNO A;  4DR1 J;  4WKR A;  3DRS A;  2ZHA A;  2FLP A;  1CC7 A;  1YJV A;  3FEZ A;  2L9D A;  3V81 B;  2IAJ B;  2ZDP A;  1EQ0 A;  4IUF A;  2MQN A;  4NXN F;  4DQS A;  5LM7 E;  4M5M A;  3KLG A;  5ETT A;  2FGO A;  1ZTW A;  4NA1 A;  4ELV A;  4X62 F;  3TAQ A;  2OEJ A;  4RW4 A;  2CPY A;  4H4O B;  3GFZ A;  3P96 A;  4A8X A;  3D3B J;  4Q44 A;  4DR3 J;  2J9C A;  2F9D A;  2KJW A;  1AFJ A;  2YKN B;  3KJV B;  3UR3 C;  3NAH A;  2V2K A;  1NZ8 A;  4ILM A;  3IBC B;  4KHP J;  4F4K A;  3DOL A;  5KFY A;  4NX9 A;  2FHK A;  4Y3C A;  2HBR B;  2CPJ A;  4C0B A;  3ILL A;  3B78 A;  1FVQ A;  3UW1 A;  2DXD A;  4LF4 J;  3IWN C;  3ITH B;  3FSI A;  3CPW R;  1R0A A;  5C42 B;  2OEL A;  2Z58 B;  5IQ6 A;  1F9F A;  3R6L B;  2K8G A;  3T5L A;  4NYP A;  3RW6 A;  3NWR A;  2X51 A;  3I32 A;  2C22 A;  2VHG A;  4M5N A;  3CCM S;  4USI A;  2NXJ A;  4WIQ A;  4CO2 A;  1RJJ A;  4ZVU B;  4IG0 A;  3DLH A;  3N5F A;  4LF7 J;  2BJ8 A;  3D0G E;  1C1B B;  2XSF A;  1RWP B;  1AXQ A;  2YNG A;  3RU0 A;  4USM A;  5C2C A;  3GJQ B;  1MWY A;  1HBU A;  4URS A;  1MWQ A;  3ICL A;  3LOU A;  3JAM U;  3GLJ A;  3LW5 C;  3MM8 A;  1HQU A;  4RBV A;  2DH7 A;  5F8I A;  4FPR A;  5AXL A;  1N0U A;  2HGL A;  1PIE A;  2BJ9 A;  1SJ1 A;  2MQM A;  1NB2 A;  5KFW A;  1IKY B;  3VQS A;  3UCG A;  4MK7 A;  3TQ1 A;  1G2E A;  4GKJ F;  2VPW B;  4RPF A;  5AT1 B;  5J2M B;  5CQG A;  2XMV A;  3PX0 A;  3CD5 A;  2FJV A;  4URG A;  4DQR A;  2KG0 A;  2QL7 B;  3KWM A;  4AYB D;  5DG8 A;  2IM2 A;  4NLR A;  4BC7 A;  3EM1 A;  1ZAX A;  2XYG B;  5HJX A;  3UN5 A;  3ZO7 A;  3RG6 A;  4AL6 A;  3VAJ A;  3OFF A;  2ASJ A;  4C11 B;  1OY6 A;  4QW8 A;  4MJK A;  3MFH A;  2HRU A;  4I6A A;  2ZKT A;  2XYH B;  1KTV A;  4RUH A;  2P9C A;  4O4R A;  2J8S A;  2EFG A;  1BWV A;  4ZN1 A;  3JSY A;  1U8S A;  3E3X A;  4O44 B;  2D3U A;  2MSS A;  1NZA A;  1FJ7 A;  4RW9 B;  3KLE A;  2ZVS A;  2LP4 A;  1NJI T;  3LH2 S;  3ZZP A;  2VFV A;  2HFO A;  4GC7 A;  1N5T A;  3PYF A;  3OPK A;  3W66 A;  2OGU A;  1FKO B;  3AD8 C;  2K7J A;  2RF2 B;  4DL2 A;  1WAC A;  2DTJ A;  2WVD A;  3Q8V A;  2Z0G A;  3SDE A;  5KFN A;  1VJQ A;  3Q8Q B;  2CNK B;  2GGP B;  2JC0 A;  3J81 j;  3PRB A;  1TV6 B;  2R9L A;  3C6U B;  3M05 A;  1XR5 A;  1CJU B;  3MOJ B;  4C8O A;  3H2L A;  4C8Y A;  3M2U B;  5E7O B;  5LMU J;  1IWG A;  3P3D A;  3IGN A;  1HW9 A;  3GYX B;  1NPK A; 
#chains in the Genus database with same CATH homology
 2ZUA A;  3ENA A;  4HR2 A;  1F6T A;  3FCW A;  3Q83 A;  4DI6 A;  2B8P A;  1NSK L;  1NUE A;  3NGT A;  3B6B A;  3ZTR A;  4FKX A;  2DYA A;  2DY9 A;  3ZTO A;  4EK2 A;  1PKU A;  3FBE A;  1NDP A;  3Q89 A;  2NCK L;  3FKB A;  1NSQ A;  2AZ1 A;  3VGV A;  3VGS A;  5C7P A;  3BH6 B;  3VGT A;  3B54 A;  4UOG A;  3PRV A;  3EJM A;  3NGS A;  1PAE X;  3GPA A;  3NGU A;  1B99 A;  4O0N A;  3BBC A;  3MPD A;  1HIY A;  3WX8 A;  4FKY A;  3ZTS A;  1NLK L;  1ZS6 A;  3EIC A;  4ENO A;  3FBC A;  3VGU A;  4C6A A;  3EVM A;  1BHN A;  1LWX A;  1B4S A;  3FC9 A;  4W98 A;  5CAB A;  4S0M A;  3FCV A;  4KPC A;  3Q86 A;  3ELH A;  3BH7 B;  3R9L A;  1XIQ A;  3ETM A;  3Q8Y A;  1F3F A;  1NB2 A;  3GP9 A;  1JXV A;  3BBB A;  5BXI A;  1U8W A;  3FBB A;  3EMT A;  3DKD A;  1NHK L;  3DDI A;  1NDK A;  1VYA A;  4ANC A;  3Q8U A;  4WBF A;  2BEF A;  1K44 A;  1HHQ A;  1WKK A;  4CP5 A;  4UOF A;  3VVU A;  2B8Q A;  1NSP A;  3BBF A;  1W7W A;  1BE4 A;  2DXD A;  1MN9 A;  3Q8V A;  1KDN A;  3G2X A;  1NCL A;  1WKJ A;  2HVD A;  3EE3 A;  3PJ9 A;  1HLW A;  3VVT A;  1NDL A;  3L7U A;  2CWK A;  1S5Z A;  5CAA A;  4DUT A;  1NDC A;  1S57 A;  3FBF A;  4ANE A;  2AZ3 A;  2BX6 A;  4DZ6 A;  3EM1 A;  2VU5 A;  1EHW A;  1LEO A;  3ZTQ A;  1UCN A;  3EVO A;  1MN7 A;  1WKL A;  3EVW A;  3JS9 A;  1S59 A;  1XQI A;  4F36 A;  4UOH A;  5IOL A;  4F4A A;  2DXE A;  4AND A;  3ZTP A;  2HVE A;  2DXF A;  3NGR A;  2HUR A;  1BUX A;  1NPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...