3FCWA

Crystal structure of the mimivirus ndk n62l mutant complexed with udp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
131
structure length
131
Chain Sequence
GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 40
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fcwA00
4ANDA 1HHQA 1NSPA 1JXVA 3ELHA 1NDCA 2AZ1A 1VYAA 3PJ9A 2NCKL 3FC9A 2VU5A 1NHKL 3G2XA 1WKJA 3ZTQA 3B54A 1NDLA 3BBFA 1XIQA 1NB2A 1K44A 1WKLA 3Q86A 1HIYA 3ETMA 1NCLA 3EVOA 1F3FA 4F4AA 2DXDA 1KDNA 5CAAA 3BH7B 3NGUA 3R9LA 2B8QA 1ZS6A 4UOGA 2DXEA 3NGSA 3WX8A 4KPCA 3FKBA 4ENOA 1B99A 3PRVA 5C7PA 5IOLA 1NSQA 3FBFA 2DYAA 1S5ZA 1LEOA 1W7WA 3VGUA 1NUEA 1EHWA 4ANCA 1S59A 5BXIA 4EK2A 2DY9A 1XQIA 3Q8VA 3NGRA 3ZTSA 5CABA 2HVDA 1MN7A 1U8WA 3DKDA 3VGTA 4CP5A 4F36A 2B8PA 2DXFA 4W98A 4O0NA 3EE3A 4UOHA 3Q8YA 1BE4A 4FKXA 3EM1A 3BBBA 3VGVA 1B4SA 3Q89A 1HLWA 1BUXA 3EVWA 3MPDA 1NSKL 1WKKA 4DUTA 3L7UA 1PAEX 1F6TA 1LWXA 2HURA 3ZTOA 4DI6A 3GP9A 3ZTRA 3DDIA 2BX6A 1NDKA 3Q83A 1UCNA 4UOFA 2BEFA 3VVTA 3EMTA 4DZ6A 2ZUAA 3EICA 3BBCA 3FCWA 1BHNA 3BH6B 3GPAA 3FBEA 1MN9A 1NLKL 2AZ3A 4ANEA 1NPKA 3JS9A 2HVEA 3ENAA 3EVMA 1PKUA 3FBCA 3VVUA 3NGTA 4WBFA 1NDPA 3FBBA 3B6BA 3FCVA 4C6AA 2CWKA 3Q8UA 3EJMA 3ZTPA 3VGSA 4HR2A 1S57A 4S0MA 4FKYA
chains in the Genus database with same CATH superfamily
1RK8A 2X3GA 4C8YA 2G4BA 2HQCA 3PYGA 5B0CA 3J81j 1LXJA 2VASA 3G71S 2R7WA 4ECYA 2IDEA 2OMOA 4NZ6A 5J2QB 4B9NA 3DRSA 4OZ2A 2GVDB 4URGA 2BRKA 1TR0A 2YNHA 1NHKL 3KLGB 1N32F 3CCQS 4EU0A 2GAGC 3EDQB 3QGGA 2ZH3A 2NYIA 2H5IB 3BBFA 3MM8A 3KUHA 2RDDA 4Z7YA 4B02A 5EX0A 2ABYA 4DV4F 2HFNA 3AB4B 2PA3A 3CD5A 3I32A 3BO3A 1S0VA 3QAEA 1N5TA 4LBPA 2BKOA 1IBMF 1FO1A 2MZJA 3UO0A 4DR5J 3L9ZA 1UW9A 5A2QU 4JI1J 1PIEA 2M5YA 4RBTA 2B6AB 1F5AA 1RWNB 2H54B 2LMIA 3K0JA 3OXLA 1ZAWA 2OPRB 1M5SA 2B9WA 2LU1A 4PXBA 1Q7YT 2J0QD 5KT3A 4JI5J 1VJQA 4WXWA 1S76D 4KPCA 2YH0A 3CCUS 3MR6A 3TUJC 3V4IA 2LXIA 3TZXA 1WC5A 4P6QA 5C5JA 5C7PA 5DRKA 1NSQA 5M2UA 2ERRA 2MY8A 3DU6A 1DY3A 4DUYJ 1KVKA 5KT7A 1CJTB 3MMAA 1A7GE 2RDIA 1HNIA 3UN5A 4NLTA 4PWDB 4DL3A 1AUDA 2YWWA 1LK5A 3C15B 4TY9A 2KFNA 3H5YA 1VBXA 2OMLA 2RB7A 2MZSA 3SSQA 5KFMA 2EKYA 3BGRB 1TL7A 4HT7A 4HT5A 3CD7A 4Y2KA 2GC8A 3RR7A 4J9VA 1JXEA 3NGRA 2POKA 1AZSB 1C0TA 2RD5C 1REVA 4BWJA 3U02A 1TFWA 2KM8C 1HHSA 4WIQA 2CNOB 2UVVA 1RZMA 3ENQA 2H48B 2DH8A 2ROPA 3QFWA 4W98A 3O44A 4Z7CA 1YIJS 2KO1A 4P75A 3W5XA 1IUJA 1CJKB 2CRLA 4RW6A 3D6MB 4ZVHA 2ILZA 4LF4J 3IC1A 4E2FB 4IUFA 4IOBA 4QYZJ 2MLZA 2B56A 4Q5VA 3M6XA 4ZLLA 4KGXB 1R43A 2DO0A 1HLWA 3A3NB 3GIKA 2A2DA 2JJ4D 4GO7X 2VQEJ 2MQ8A 3LGHA 2IMOA 2ZUGA 3KG0A 1WEXA 4AT1B 4KGKA 3UI3A 1U26A 2JFKA 2RH3A 2RRNA 2WVFA 3I0SB 4V1Ak 3T6BA 2F40A 4DR1F 3QZ8A 2OPSB 4ILRA 3RW7A 3H5XA 2WB1D 1YRUA 4OIXA 3LP0B 2DEIA 3A8KA 4WFXA 4AL7A 3OL7A 3MM6B 1N6QA 3V6DA 2ZBCA 1IM6A 4HL9A 4NZ0A 3W3SA 1ZM3A 4IRDA 2HHQA 4HHJA 4ZVRB 2FVRA 4CO2A 3QJJA 3QRRA 1R8HA 1P9QC 4OYIA 4EBCA 1BHNA 3GPAA 1Q8BA 3GV5B 1ZM9A 2AZ3A 2MPUA 2W2NP 1M5VC 4GC6A 3PW4A 4CM0A 1XJWB 2CZ4A 5HJXA 1NO8A 2E9TA 2JNJA 2WONB 4OJHA 1IQZA 3FBCA 4NLVA 2FC9A 5KFJA 4UOCA 2W1BA 3QGHA 1S4EA 4OI6A 3SDEA 1I6JA 2VZ9A 3EXCX 5K14A 2CWKA 3D2WA 3GG1A 1HARA 3OW2R 2V50A 5HATA 4ED0A 1S6QA 3ZZZA 3H8YA 1Z2LA 1HI0P 1VYAA 2UUTA 4GKJJ 5LJ3Y 2GJ2A 2CJYB 1NK7A 1KOOA 4B3TF 1KFDA 3GMGA 1GMVA 3U7JA 2V69A 2CUYA 2D9OA 2VU5A 4KFBB 3AY0A 5KFHA 4K2XA 3PJXA 2OI2A 1S7HA 2E1RA 4C8MA 1UPPA 3N28A 4JYAF 3CCLS 2ZOGA 4I2QB 4GVBB 3JYTB 5HP1A 3GV8B 5KT4A 1FI4A 4HTJA 3TZWA 4X4RA 2HWTA 4A8MP 2QRRA 3MR7A 2VBWA 2PMZD 2B9EA 5D3GA 1S4FA 3SEOA 3DOKB 1WEYA 4DL6A 4YB1P 4DBQA 2VIHA 1QAJA 5JJBA 1AW0A 3BH7B 3NGUA 1IN0A 2IRXA 3BKFA 4K4XA 3W2WB 3Q8PB 3GTYX 3PACA 4F7VA 2HRUA 3GR0A 3LANA 5LXRA 3DOMA 1LWFB 1GEHA 1X4FA 2E5GA 3B82A 4IG0B 1BQNB 3W5YA 4X4SA 3RTVA 1K1QA 3HKWA 4YP3A 2YQ3A 4ZHRB 3HD2A 3THTA 2KT2A 2XHCA 3PYDA 2OPPA 4TQSA 1H2UX 5L9XA 1EARA 1S99A 3C16B 2XM3A 2DYAA 3GR1A 4FPIA 1YX2A 3MOJB 1FRMA 3LPYA 1JXLA 4Q8EA 2XQCA 4K4UA 2L9DA 3EGNA 4YB7A 4TU7A 3G6ES 4ZIVA 2WCXA 1X5PA 2BM0A 4XTTA 2P9GA 2M8DB 4LFCJ 1S6PA 2A18A 4NL5A 3K2YA 1PILA 1WI6A 1S1XA 3F56A 5KFEA 4FBTA 1NHUA 5EHHA 1RE1B 2KVIA 4LT6A 1OQ6A 1JB0C 4KB7A 2AIRB 4Y2IA 2QEXS 2GJIA 4DG1A 2QLBB 4LIWA 3B4MA 3KMQA 3PX0A 2UXDF 1OY9A 4MK8A 1KSPA 1CSJA 3DMJB 3D5MA 4I56A 4EO8A 1TAUA 1RT1B 4I0WA 4ZVTB 2D3O1 4F4KA 1D8YA 4NXNJ 2W4PA 2XWYA 4XAKA 4WFNQ 1WDDA 2KTQA 1BE4A 4FKXA 4ZOSA 2IHR1 5KFVA 3Q8QB 3HSZA 3H25A 2LEAA 3H40A 2HQFA 2OIHA 2VFSA 3BF4A 5B09A 1M90T 2J6SA 1KQKA 1PJ7A 3GV7B 2UU9J 4MFBA 3R5BA 1PAEX 2IFXA 2MKCA 3KHGA 2DPIA 4DI6A 4I4BA 3CF5Q 2YKMB 2X1AA 2DNOA 3H90A 1W26A 5C42A 1H2VZ 4RO0A 2ZD1B 3T1HF 1X8DA 5A8WB 1RBAA 3D68A 2KYXA 1FWLA 3I6PA 1QAYA 3IM9A 3N01A 2W8LA 2CJXB 4C8ZA 1NPPA 3KKFA 2FJVA 2HHWA 4B9VA 4WF9Q 3CIMA 3C6TA 2L48A 1FKOB 2I0XA 2ZFHA 1RDRA 2HVIA 3FGVA 3OD2A 3H20A 3N5FA 3PXGa 1ITPA 1TKTB 1NNDA 3M8SA 5KFUA 1XMBA 2XWXA 3RUBL 4OI4A 2A6OA 2CPXA 2XMJA 2GCFA 2HQGA 3POTA 1NPKA 3SI8A 1S9EA 2R2UA 2AJFE 2FHJD 1F9FA 4ED7A 2DR5A 1RACB 4IG3B 2RU9A 1AA1B 2BJDA 3PYFA 1RT3A 3OR1B 2LQ5A 1RA7A 2OEJA 4RW7A 2YWKA 3ILOA 2ZC3A 3TNVA 3B6BA 3HHKA 4OV1A 4DX7A 4EUVA 2HHXA 1TL1A 1NRKA 2HFVA 4LRFA 3DYAA 1Q53A 3CIZA 3H98A 1HBMA 3O6QA 4KKOB 3M2RA 5IV4A 5CHCB 5B0FA 4YHHJ 1AFJA 3VAFA 5LSOA 1YBAA 3KMSA 1U1LA 3O1LA 3A8EA 2GO9A 1PBAA 3A1YG 1KTQA 3CDWA 3D0IE 3GCXP 3NLCA 4KHMA 3KHHA 5L1KA 3OT9A 5A0YB 1H73A 1FE4A 2GVZA 3DOLB 4ETZA 2BZ2A 3MAHA 2RUSA 4FZVA 1RU2A 1F1BB 2R42A 4YY3F 3HPOA 1G1XA 3FSXA 2UXBF 5G0RA 1RUSA 3FDSA 1S10A 2RQMA 2YKQA 2WONA 3IN5A 2CXEA 4WU2A 3R1LA 2Q3PA 1YJWS 4CT9A 2O01C 1H0HB 2G1HA 1CLFA 5J1NA 2J7WA 4DPXA 4JI7J 5GAEI 5I3PA 3D6TB 3GIRA 1EZZB 3B4DA 3W1YC 2CQ3A 2G0IA 5KFOA 3W2VA 2CKWA 3FSYA 5HMXA 4A8OA 2FDNA 2WSCC 1EKRA 1TL1B 4LR7A 3VAJA 2WZ1A 1YLXA 4K2JA 2PI4A 2HS4A 1HQUA 1N5YB 1FJGJ 2VODA 2GGPB 3VV2B 3TUZC 1NJYA 3MUVP 3VAGA 1Y00A 2QL5B 3IWLA 4F04B 2DTJA 5CYQB 1VFJA 1ACMB 1DLOA 3I4PA 4QJVA 9RUBA 4IQXA 1S5ZA 1C0UB 3CO0P 4LF8J 1W7WA 3AT1B 2IJNA 1HBUA 4OZ5A 3C19A 1FFSB 1Y3KA 3OTBA 1LFWA 4X65F 2YH1A 3MECB 1SH2A 1UETA 5LL6d 1LV5A 1YJUA 2DIUA 2GAHC 2K7JA 3LP2A 1RYRA 2GIQA 2R8KA 4X84A 3T5HA 2DITA 4DJBA 4ID5B 4UZBA 2CDRB 3QIPB 4QQBA 4A48A 4RUHA 4LF7F 5CD4A 3NGDA 2Z2YB 1XQIA 3KDOA 4IFVB 3WHIA 1LW2B 3OTOF 1XNQF 2ZEJA 5DZ7A 4OL8A 1R0AA 3AD7C 3CMQA 5DO2A 2F9JA 4KE5A 4OLOA 4F36A 2RHSB 1FNMA 3BGRA 4KYZA 4RNMA 3PHTA 2NSCA 3B8HA 5JMNA 4NLXA 4JUZA 4DU7A 3MFIA 3RAXA 3CCJS 1NB7A 4CT8A 3HVAA 3VTIA 2FB0A 4NMLA 3R2DJ 1HQEB 4X66J 4BLGA 1EJ7L 4A8SA 1SXLA 4P2FA 3MPDA 1WSRA 1X31C 1RKIA 3DRYA 2LCWA 1F6TA 3IAS9 4M1KA 1Q79A 2HURA 3D6FB 2RKIA 4TY8B 4DX5A 4LVNP 3J81Y 4C0BA 2H65B 4CLYA 5LSRA 3CJSA 3NS5A 5CZXA 4ZVFA 2G2OA 4M5NA 4C2MA 5HLFB 2QA1A 5D3GB 4F25A 1UCNA 2X3DA 2DHAA 3G9CA 4C3LA 5BR8J 1CEZA 1V3RA 2ROGA 4YB6A 3KLIA 4OLPA 2ZUAA 4P9SA 3BBCA 1ZM4A 3M32A 3T19A 2VG5B 4X65J 2G9OA 1UPMB 2WVBA 3MM8B 1ZYQA 5AXMA 3ILJA 2WVEA 3IWXA 1YZ7A 2JC1A 4N77A 1XMQJ 1P1TA 4AFFA 1FF2A 1YSJA 1X4AA 1WORA 3D3BJ 2XS5A 1Y10A 5CXTA 3MEKA 3KK2A 1HBOB 3C6UB 1U8SA 4JB8B 3I0RB 3G4SS 5J1EB 2CQPA 4Q43A 2EWHA 4F67A 1JX4A 4JI8F 5K9FA 5D4OA 4EO6A 2YVSA 2AJ4A 1JJ4A 5A6PA 3VGSA 2ZH9A 2AYMA 1YGYA 4AUKA 1U1QA 3D9BA 4P2MA 1FERA 4ECWA 2Z2LA 3K8VA 2FGOA 1NSPA 2R2SA 1NK4A 4NLDA 2M9KA 2MMYA 4PAAA 4UZCA 3PR4A 3G96A 4ZVSB 5HJYA 1TKXB 2G2YA 2K3IA 2RAQA 3PHEA 3MD3A 3MEDA 4TXSA 4DN9A 5BYSA 2MQPA 1T7PA 1R8AA 3BJYA 3CJ5A 2D7SA 1PC5A 3EGWB 2KN4A 4NI2A 2M0GB 1NDLA 1R89A 1S1VA 2QLWA 1KRPA 2UUCF 2UXBJ 5LMUF 3W65A 1RTHA 5J2MA 1RAIB 3R1HA 2XTJP 1UEKA 1KNZA 1BY9A 1NCLA 4QIGA 4MFBB 4NPOA 1F0XA 3MM9B 4DV3J 4IH5A 5KFXA 2BW2A 2BE2A 3IBCB 5F8LA 1HNZF 2E5LJ 3T3FA 4H4KC 1J27A 4JI3F 1N0UA 1RTDA 2B8QA 3D4JA 3MEGB 4LREA 1IKXB 3L7OA 1J2VA 1FD8A 1LNQA 2WTFA 4K4VA 5HROA 2P6SA 3W64A 4LR9A 3DRXA 4W92B 4WP8A 4KRWA 2HAIA 1CULB 3IG1A 9ATCB 1HR0J 4E0DA 3NNAA 3CJTA 4O4RA 2OLWA 1K73T 1OYEA 2IIHA 1HNVB 4JI8J 3LO3A 3PJWA 1I5OB 4HACB 4N47A 4CQ1A 3D0HE 1M5KC 5DM6Q 1OYDA 1FEHA 2AWZA 3HZEA 3D6HB 2BANA 4UUXA 2APOA 2Y0SD 3TA2A 1SKSA 1WSVA 2C1EB 3MMBA 5ETNA 2DKOB 4LSNB 3KYLA 2Q6BA 1UVLA 2VDIA 3PZPA 3MECA 1NMEB 2K3KA 3QRQA 2W2PP 1FCAA 3KG1A 3Q8VA 4P52A 4ZJQA 1N4LA 4ECZA 2OGUA 5LT5A 3V6JA 1BMQB 2AF6A 3G8SA 3R6GB 2KZZA 4X4PA 4F3MA 2ACYA 1VIXA 1J5OB 2FUG9 3M8PB 4ES2A 1TVRA 1RB0A 1UWAA 1GTHA 4ZIWA 3ZFVA 4ELUA 2V0NA 3BBBA 3MR2A 1U1KA 4MKBA 3GB0A 1IM4A 2DJWA 5HLFA 1JIHA 2DVIA 2FPHX 1RJJA 1T9XA 1R8PA 4ZPAA 1N0VC 1VISA 4JI0J 2QSFA 2E29A 2MQLA 3ZTOA 2EXUA 4J90A 1MROB 4MYUA 1EETB 4JI3J 2IY5B 3H59A 4R5PA 3DI6B 2QV6A 3BR8A 3IS9B 4PYDA 4PYAA 3OVSA 2V2ZA 2FJAB 3QGIA 2UUAF 4ZPDA 4P7VA 3EPGA 4B9LA 4NCGB 5T7LB 2JHEA 5ETKA 4IRKA 3GIMA 2ASJA 2HBZB 2OELA 3C16A 3R8YA 3ADAC 4DPOA 5IWAJ 4DV0F 2V2QA 4IDKA 3RBEA 1TTHB 1L5UA 4MKYA 4LR8A 2GMLA 3AJDA 3AQPA 3DFEA 3K5MA 4J9SA 3FCWA 2CPJA 5E0OA 1QSYA 5BR8F 3TVYA 5ADZA 1QE1B 3O5TB 1OS5A 4CNYA 2Z2ZA 1JKHB 2W7AA 4OX7A 3HVRA 2ATLA 2XYGB 1IR0A 2P6TA 1FNXH 5D78A 3NNCA 1GX6A 4KGVB 1VQYA 1ZAXA 1K47A 2OP5A 2EEYA 3DOKA 5ETMA 1XMQF 2HZVA 4UY8T 4PKDB 2IVYA 3TEHB 2YWEA 2AMCB 2IJFA 4S0MA 3CEDA 1KHVA 4IFYA 2XI2A 2Y8WA 1RT5A 2RVJA 4ICLA 1UP1A 2RMLA 2B51A 4BHQA 3PO5A 3UDVA 1HW9A 1QTNB 3A12A 2F8HA 1RHQB 1R7IA 3AQOA 1QAIA 3M6UA 5HVHA 4ECRA 4YN3B 2OH2A 2CJ9A 4CYUA 2AEMA 5HO4A 1SIZA 1V3ZA 3BYRA 4USHA 5EUHA 4YMEA 2XYPB 3LP0A 2F9DA 1DQ9A 4RZRA 3MR3A 2GQQA 3FQKA 3KK2B 2B5JA 1NKCA 1VQ7S 1S97A 3HO1A 1F9HA 2VFVA 4DU8A 4V19J 3OUYB 2E9ZA 3M8QA 3P6YC 5A8RB 4F3OA 1F2HA 1X0PA 2JZ5A 4ED1A 2VOOA 4LSLB 3L7PA 3CUNA 1TUGB 4DSLA 2HBQB 3K5PA 1RHJB 1JJ2R 4PQUA 4F4AA 2DIVA 1U6ZA 2VG6B 2QFJA 3FNNA 3LGMA 3VAKA 3BGOP 1IBMJ 1ZS6A 1TKXA 2CQGA 1N8RT 1MMNA 3NP5A 4MAKA 2Y1LB 4IR1A 2RQ4A 1JNRB 2H4WB 3OTEA 3PW2A 2C2DA 3M1VB 1OPZA 3R5CA 4FDFA 2MZQA 1KLMB 3DLKA 3IGNA 3ITHB 3PRVA 5F8GA 3EYZA 2Z2MA 1BXNA 2SXLA 2VFUA 2ASLA 3QNWB 2M70A 3OHAA 4FBUA 2LQBA 3PFEA 1JQGA 2F7VA 2L08A 5FIIA 3NXZA 3D54A 3J7ZT 2YKOA 4ECXA 1TMJA 1KTVA 2MKYA 4PQAA 2ZWPA 2CPIA 4Y00A 4DUYF 1S12A 4N5SA 1FRKA 4DR4F 1SJ3P 2HHPA 1SKUB 3DLGA 4JV5J 3IRXA 2E7WA 2WW8A 1V6HA 2BABA 4CO4A 1R0AB 4QIEA 5IC4B 4QR2A 3KWMA 1MWQA 4DFKA 3ISNC 3HHLD 2MXYA 3POTB 1NKBA 2AEFA 3P5BP 1Y5LB 3RRKA 5GADI 4YHHF 2M8HA 1N34J 3MAQA 2V34A 3LP2B 4Q44A 3KLHA 4DMZA 5B0DA 1B4SA 3CC2S 5KFBA 2VBXA 3I5CA 2VA2A 2MGZB 2FVPA 1GX5A 1QSSA 1E6VA 1OJ4A 2QA4S 2AX0A 2FZKB 2ZBQA 2XGPA 3OBIA 4A46A 2QLXA 1TL7B 3KJVA 1VK3A 1HQUB 1SJ4P 1N5YA 4MMOA 2UXCJ 2JX2A 2BR0A 4KJIA 1U1NA 4RNHA 5E33A 4JI7F 3SSRA 1FJEB 3AXKA 2OPQB 3FEZA 3BN4A 1PC4A 3KHRA 3ETOA 3DNCA 1H3DA 2VBZA 3H0PA 1O51A 3JAMY 3DHXA 2XLJA 2CQ2A 3QT8A 5LOQA 3L4BC 3NRBA 1B70B 1SUQA 3D66A 3M2UB 1VBKA 3J7A1 1F2GA 2H4YB 5IWAF 2RU3A 4DV0J 4DSIA 1YZ6A 1HWLA 1NXIA 1Q16B 3GJSB 3RW6A 3TA1A 3RB6A 2FJXA 4CCHA 1GK8A 4FYVB 3IR6B 3T1HJ 1WTFA 4WE1B 5C25A 1AUSL 2V94A 1IWAA 3NGTA 3JQMA 1Q4RA 3HLUA 3M2VA 4I7FA 4TQRA 1T9WA 2KXNB 3IWNC 3FCVA 2BJ3A 1B7FA 2VV5A 1MMLA 2VL1A 1S1UA 4WXOA 2HVHA 5CZVA 1V9OA 1E6YB 5C2GA 4DL2A 4U8VA 1JXVA 2MLXA 3ELHA 1GXLA 2OFHX 4OYOA 4RUAA 3PV8A 1MMDA 4LF7J 4LFAJ 1RAGB 2VPYB 1X0FA 3OL9A 3QATA 4URSA 5DDPC 1TP7A 4N56A 2VICA 4C0OC 3NBPA 2CZVC 3CCZA 4M5DA 1XR6A 3MEEA 5I3QA 1FRIA 4FYWB 2Q6CA 1C1BA 4WZQA 5F8IA 3N6LA 4K59A 1DBDA 1FNOA 2PIIA 2NZ4A 1AXQA 1MROA 5L1LA 1TKTA 4IR9A 2VBYA 2ZOMA 2BACA 4JI2F 3HT3A 1UFLA 1FX2A 2HLUA 2QC3A 5KFPA 1VQKS 4PUOA 3H4DA 2IAJA 2L9NA 4JYAJ 4X66F 1RT2A 2CQHA 4Q2MA 4GMKA 1GH8A 2WAQD 3MDFA 2C3OA 2QG9B 4AD6A 1KDNA 2GNKA 4F4ZA 1TK8A 3R9LA 1TKZA 4RPFA 3P4UB 4R0JA 3QJPA 5I42A 4A8KA 4CLPA 1RTJB 3J7YU 2R7TA 5L38A 4TKTA 2VF3A 4LFBF 2A6MA 3HX9A 4UOGA 1JK9B 2YWFA 1IR1A 1H6KX 3RB4A 5A8WA 2XMAA 3R5JB 2QA2A 3GFZA 2KHCA 3OQ2A 2CAJA 1B99A 4LQ9A 2B5JB 3ZZRA 2VQEF 1IQTA 4PG7A 1TL4A 2HGMA 2YPZA 3FFIA 4J7CA 3H42A 4ELVA 3PFOA 3ZZPA 3H5UA 1DTTB 3DRPB 3DLLQ 1QD1A 2CPHA 1FXLA 1GTEA 1G7CB 4MTPA 2IC3B 1XN9A 4Q7AA 1YG0A 2DGWA 1H72C 3OPKA 3C46A 2BE9B 2EC0A 3FEYB 4ANCA 3NOGA 2GS8A 4K4TA 4V19X 1CVJA 1T94A 2AX1A 4TYAA 4UTGA 5CH7B 4WYLA 1FKAF 3Q8SB 1FK9A 2K1RB 5L46A 4AYBD 2MSTA 4M5JA 4ELTA 5D0HA 1X4HA 1DARA 4NEZA 2IJRA 2ZOFA 1SI9A 1TZ0A 5D4NA 1WC6A 4NLWA 5CABA 4EZ6A 1IBCB 1MN7A 2KJWA 4NEYA 5CQGA 2YY3A 3G82B 1XNRJ 1S48A 2HS3A 2MZ1A 4PG6A 1ZTTA 5GVQA 1U24A 2LP4A 5K8NA 1KVIA 4A8YA 2HZAA 1URNA 4HDGA 3CJQA 1Y0HA 2K8GA 3FEXB 5ETLA 2HWHA 2H51B 3DLEB 3VGVA 5IC6B 4F0KA 4ED5A 3V6DB 2C2ZB 2IM1A 3WIVA 3P49B 1UJ6A 5F8HA 1MWZA 5KG6A 1HPZA 2I5JB 4DUTA 3NG8A 4Z37A 4I6YA 4KY3A 2IA6A 1P27B 3HVTB 3IRWP 2QO3A 1XNQJ 1UZDA 2CJQA 2V4QA 2UU9F 3EDRB 2D9PA 2QSWA 5KFLA 1NU4A 1JLBA 1OO0B 4M5IA 5HMYA 2HHUA 2KL8A 3JQJA 2WB4A 3MUTP 2XZDB 2ZNYA 5KFDA 2XNQA 4WTOB 4P74A 3J7YI 5ETSA 1XERA 3W8PA 4OV6A 4XDCA 1OSDA 4ZPVR 3MXHP 2W2MP 2FHOB 2ZH2A 2LQ9A 4WWSA 1WD6A 5EGYA 2YKNA 5KT6A 3RU0A 1Y11A 3BGFA 3UNYA 3ENAA 4RLEA 5C24B 2VC1A 4ZP6A 3KLFA 3CD6S 4RU2A 5IT9U 3Q23A 3NCPA 1JLAA 3BKUA 3R27A 2RT3A 4Z2XA 4X64F 2E1AA 3G8TA 3HHEA 2ZD1A 1D9DA 1RXOB 1NH7A 4KFBA 4CNZA 3PNIA 4USWA 1CPZA 1T9VA 3CSKA 4IDKB 4J9OA 3LTOA 2W8KA 1VQLS 3CCES 5F3ZA 1LWEB 3NCRA 4WCEQ 2XMUA 3I5BA 1MG7A 3V4IB 3PJ9A 1MW7A 1T11A 3ZXWA 4UF4A 2XY5A 2MQOA 1SC1B 2L9WA 5IT0A 3K5NA 2WK4A 5D4PA 3T1AA 3UCGA 3VR1A 1WDTA 5DG8A 2ZHBA 2ZH4A 1SQGA 3DMJA 1SC4B 1K1SA 2F8MA 4FVMA 4DOZA 2XCAA 2YX4A 2NSBA 2ZBRA 1UFWA 2LVWA 2VKZG 3GIJA 5KFZA 1M0SA 1MU2A 2W24A 3JAMU 1QSLA 1RT7B 2LU2A 1Q82T 5J2PA 2O5DA 1L3TA 2YNIB 4OI0A 4LQ3A 1U47A 2I38A 4QW8A 1FDBA 3AH6A 3R7NB 2N3OA 3FSIA 3KLVA 1X9MA 1O5JA 5CAAA 1W25A 3MM9A 1ZPVA 3C6UA 3TAMB 4RNOA 4PUOB 4PXCA 4DQRA 4DL5A 2M3DA 2FLPA 4RJVA 3O8WA 3TAMA 2IM0A 4DLEA 1O8BA 4D3GA 2W9AA 1KHWA 3CDUA 4I68A 4NLSA 4JV0A 1P1LA 1WI8A 5IT9Y 4NMXA 3I4HX 2D41A 3E01A 3MF5A 1Q8IA 4JP8A 2RHQB 3HDSA 5IOLA 4WFBQ 4ZMMA 1HYSB 4ID5A 1CJKA 2FHMA 2C3MA 4D3HA 3GU0A 2O66A 2V4JA 2NXNA 1NUEA 2BJ8A 5HI7A 3WC2A 4X2BA 1S59A 1Y7PA 2ZNZA 3K5OA 4C0HA 2ZHAA 1AYEA 1NK6A 3LP1A 5B0AA 1Q95G 2EC2A 2Z56B 4OX9F 4EK2A 5LJ5Y 2QFIA 2ASDA 2NUHA 2OSQA 1KEKA 2NQPA 4FYDA 4GRSA 4N7TA 1U8WA 2W2QP 3W60A 4CP5A 5EDWA 2ZM6J 3M2RB 3VCDA 1S1WB 3OR2B 2BRLA 5C42B 2QT7A 1LWEA 1EB0A 4RUBA 1IKWB 1S1WA 2CVIA 3OR2A 3Q8YA 3SCLE 2DNKA 1XNRF 3IAM9 4DQIA 3UNGC 4KAIA 5EWFA 4M5MA 4FS2A 4DXLA 4KR0B 2BQUA 4U7CA 1MNEA 3HI9A 4DSFA 4C8OA 4LF6J 3EVWA 1KBRA 1RT1A 4DDFA 3BSAA 2B0GA 2OEMA 2YXLA 3W66A 1VQ6S 4J9LA 3TVZA 3CC4S 4PPZA 1N54B 2NPIA 3V5RA 3WX4A 2BV3A 2BQ3A 2HNDB 2RILA 4I69A 3BGLA 5IM0A 4IKAA 1S0OA 4RU9A 4OJGA 5K8MA 2EFVA 4LF4F 3GQCA 4J9MA 8ATCB 3H2LA 4HI2A 2N3LA 1KFSA 2AJ0A 1UEVA 2KT5A 2R7RA 4Q0BB 3EMTA 1X60A 2C3UA 3THVA 3EICA 3BPDA 3KUGA 1U09A 2OAUA 3HT0A 3DGPA 1YBTA 4PWWA 3UE2A 3ZC4A 4W90B 3AODA 3TX8A 3NAIA 2PA8D 5KG2A 2AD9A 1M5PC 2Z57B 4H4MA 2HEKA 3KFWX 1A6LA 2FZCB 2QTWA 1M1KT 3U1MA 1X4EA 3HP6A 4NZ7A 1VJWA 3V81A 3K8WA 3TRGA 2BJ9A 2ZJRQ 2CPEA 1U1OA 5KFTA 2MQQA 1NPRA 3CNQP 1HFEL 2DISA 3AD9C 3GJTB 4QIWD 4DR6F 3CCWA 2CNLB 3HFKA 3MEDB 1YK9A 4PXEA 2HFUA 4FKYA 2AW0A 4EWTA 4I7FB 1FRJA 2ZZTA 2RRAA 1ZAVA 3AD8C 4P73A 3ZO7A 5IM0B 1U1PA 1WHVA 4IFYB 4YFUA 3ONQA 2EPIA 7FDRA 4DFPA 4JV5F 2ROEA 5GMEA 1FTCA 1CS4B 2FQQB 2MY7A 4LUBA 3HHLB 3ZNUA 5GAEU 2BXJA 5LMNF 5KG1A 4ETXA 5EWGA 2BJ7A 4X4NA 1RGVA 5DQHA 2RS2A 2HW3A 3C14B 2AJ2A 4O0IA 1WEZA 3QRPA 1TK0A 1VCTA 4CI0B 1K0TA 4OJ3A 3TANA 5E7OB 4EFAC 3B54A 1UTAA 2V8HA 3BQ2A 4F8RA 1NB2A 2BE2B 3QSIA 2CDQA 2PEBA 4ECVA 3I31A 2MHNA 3D3CJ 2M52A 4MYTA 3DLBA 3JTNA 1HBMB 4KKOA 1IKWA 1R8BA 4DS5A 1S0MA 3R5AA 3AJ2A 2MSSA 8AT1B 5GMKa 2I5JA 2XCPA 2C28A 2AJQA 5H9FK 5THWA 6AT1B 1GXTA 2VFTA 1YJNS 5DGAA 3R2CJ 3MM5B 4USJC 1RAOA 2WOMB 4JBCA 2O67A 3PG9A 2A1BA 1ZOTA 4ES3A 1P8GA 2V4RA 1RAAB 2PE8A 4C97A 4QW9A 4DV3F 2JWNA 1EETA 1FA0A 1RU1A 2H3EB 2IYIA 5F0WA 4O3PA 2GIRA 2JLEA 2KB2A 5F9LA 3C2PA 1QUPA 4B3RJ 1QM9A 4WE1A 3CJRA 1P9YA 1X4GA 5C25B 2ZVSA 2V5HG 2DHGA 2MHEA 2NUUG 3D67A 3GFXA 3GG0A 3H2VE 3HHLA 2IAJB 3R5DA 3UCZP 1OWXA 2COLA 2DR6A 1LK7A 3EGVA 3M30B 1LEOA 2D1CA 2Z0GA 3E8OA 2F65A 4JOUA 4OI3A 5T41A 1S1TB 2DCUB 4DCJB 3KG4A 4K0KF 3ILIA 3NGKA 4KO0B 4L76A 4P2SA 4WYWA 4ZCKA 3VQTA 1CULA 4DX6A 4J9RA 4EZ9A 2HNYB 3MWBA 3SQOP 4I6AA 3VALA 1CBKA 1HBOA 2GGPA 2VOPA 3NKYA 2GJFA 4H4MB 1J5EF 4FVCA 2D69A 3A13A 4L3NA 3SIPB 4Y2CA 4ED6A 2HAFA 3OL6A 4FXVA 3IBFB 3ZTSA 1Y4ZB 3MTJA 4LF5F 4NE9C 1DRZA 1N5VA 4CTAB 2J6UA 3KTQA 3M7VA 2HSEB 4DV6J 1S9EB 2H9ZA 1R6YA 1SJ1A 2CFXA 2E1PA 3EE3A 2QIFA 2JRSA 1ZZFA 3SDEB 2MQNA 4DV5F 3RAQA 3HM9A 3T41A 4C9DA 2HNDA 1BQXA 2ZC4A 3X1LB 5K8OA 3LGNA 1VQ5S 3A4TA 3CW2C 1DHMA 1VHIA 1VC0A 1BQMB 1GNKA 1RT4B 3DDKA 5KFIA 4C11A 1NK8A 1SVDA 2BDPA 2ZVIA 4BBYA 2IRYA 2IRUA 1LWCB 2J0XA 2M7SA 4K7QA 1GMWD 4WU3A 5D4LA 2PN6A 3UVJB 5HMWA 4Y0FA 2KFYA 3SZ2A 2XS2A 1U7LA 1HQEA 3N9UC 5DETA 2R7VA 2DHHA 2J7UA 5IQ6A 4F4YA 5A6WA 2VB6A 1OPIA 3DYAB 5M2RA 1VS3A 2VKRA 1DTTA 3DRPA 3HFVA 1UJ5A 5FDLA 4DZDA 2AJ1A 1F3VA 1HPZB 3I96A 5IXUA 3A8JA 1JLQB 1RADB 2RS8A 4FYXB 2B9XA 4DV7J 2KXHA 1SV5A 3DCAA 2NR0A 1JLCB 1Q1KA 5I3UA 3NAHA 2HNZB 4WFYA 3DXBA 4ECUA 2UUWA 1J5EJ 1Z2ZA 4L72B 1Q78A 4ICLB 3OLBA 2XB2D 2BJEA 2V2KA 3M8YA 3TW0A 4B08A 4BC9A 1Y5NB 5KFQA 2XO6A 4C11B 2VHGA 4OZNA 3QBCA 3PKMA 2AQ4A 2NXEA 1YWXA 5HMZA 2CWXA 2KU7A 2CA9A 1H74A 2XHWA 4A8XA 2ACMA 3NOCA 4IRCA 3M4XA 3DGVA 3PW7A 2MYFA 4ZVPB 1FT8A 4CLTA 4CWBA 4DSJA 4O23A 1RKJA 1UWBA 3JSYA 4CLSA 1WKJA 1Y9OA 3PTWA 1MSWD 5HAOA 4H4OA 1UWBB 3CVKA 5E2QA 4EBDA 2HMIA 5K14B 4MKVA 3PRDA 2W7OA 3E2EA 2GA7A 5D0GA 4USUA 4K5SA 5BJRA 2DEJA 4GKKJ 2BKNA 2C2OB 2FJBB 3L95X 5J1PA 3U1NA 5AE2A 3W7BA 1RT2B 5JXSA 1H7XA 4DR6J 3SFUA 2G1DA 1WF1A 1CS4A 1WG4A 3M8WA 3NGSA 2DR9A 4NLUA 2C2MB 3TR5A 3S8SA 2M4MA 1FKPB 2VDHA 4L75A 4RW8A 3W8GA 4DPTA 1S49A 5KT2A 3BN7A 1ZZNA 2IMWP 4DFJA 1ZBTA 3HZGA 4NOHA 4KGMA 2XEXA 2XY7A 4JI2J 2ILYA 1U02A 2RF2B 1IKXA 2Y1JA 1FWKA 3K5LA 1HQ2A 3CD0A 1LKZA 4NYPA 4PRFA 2EFQA 3BM7A 3FFIB 3MCNA 2ASYA 3TARA 2ZJPQ 1Q81T 2DGVA 2OPQA 1YJ7A 1XR7A 1DTQA 1TQLA 4RW9A 2W9BA 6FDRA 4E8UA 3X3UA 3MGJA 1FEEA 3R3TA 4ITSA 5L8RC 3OVBA 1EP4A 1VBYA 4K0KJ 5HSPA 4P10A 2RSQA 3Q2TC 3GFYA 4YR3A 2LKZA 1GFWB 1RABB 3LA0A 5BYQA 4Q45A 3M1VA 3DKDA 2CIMA 5KFYA 4MIBA 1YJTA 3CDAA 2P2CB 4R5PB 1T3NA 1UVJA 3PEHA 1U0HB 2YKNB 2V4JB 4DR3J 5DJBA 1CJVA 4ZPTR 2NPFA 3KLEB 1RT4A 1VLOA 2G0CA 2KVQE 1FVSA 2N4DA 3GSDA 1U0HA 3ENVA 1S9FA 2QE5A 1U6FA 2IM2A 4I6WA 4LBHA 4R8UA 3UDCA 1K0VA 4B3SF 5CYMB 3B78A 4HH1A 1CQMA 1WKKA 1J5OA 2YKMA 1U2CA 2BM1A 1G6BA 2XYHB 2ZJQQ 4DV5J 2XC9A 3GJRB 3DLGB 2BW7A 2LFVA 4IH7A 5JUMA 3TQEA 3N6MA 2CVEA 5E3AA 3OUYA 4M94A 2Y9HA 4ERDA 5KFCA 5J1EA 1KD1T 2W9BB 1JLFB 1GQEA 4P72A 3SQGB 4FYYB 3U1LA 3UD5A 3EX7B 2FYXA 2FLNA 4DF4A 4C98A 4RW4B 2UV8A 4K8RA 4UOFA 1SH3A 1VLYA 3QLHB 2NYHA 1D9AA 3DRSB 2JLFA 3H7HB 1WNEA 1KWMA 1RA6A 1RTIA 2EVZA 3TVKA 3FQLA 5HN0A 3OV7A 4GC7A 1N33F 4IFVA 3KLIB 1MU2B 1U49A 1VOMA 4ANEA 1KQSR 3M6WA 1RT7A 2I1RA 3G82A 1BQMA 3EZ5A 1N48A 4PWDA 2DNYA 3R5GA 1NZ8A 4AXIA 2OTJS 1S6UA 3MOZA 5BYRA 3GFHA 4KHRA 2F8EX 4OHVA 3IG1B 4TYBA 2AV5A 1N5SA 2DHSA 1NDPA 2U2FA 3KXDA 3MM7A 1WHWA 4ZVEA 3TEGA 1YDLA 1YJRA 3KNAA 1U0SA 3BR9A 4JI6F 4P71A 3UR3C 1XBWA 2XMMA 3MEGA 5KFRA 3NBPB 4U67Q 3LPEA 3M8QB 2KKHA 4NLQA 4P7TA 2QYCA 4NX9A 4ALZA 1JLFA 1DTQB 2M88A 4RW9B 2JDJA 1X7VA 1RSCA 2J9EA 1N36F 1XWLA 2LQJA 2B4PA 4QR1A 1WC1A 2FVCA 1S9GA 3PYEA 1H7WA 2MJNA 2YTCA 4B9UA 2I2YA 2BQRA 5J2QA 1PAUB 4KH0B 4DR4J 1M5OC 4F0HA 3WZ0A 2EFNA 3M2VB 3KLHB 1FHTA 1HIYA 1V3SA 2DCLA 2V63A 4NXMF 2BYCA 1HNVA 3EVOA 1AROP 3W9JA 1BD6A 1RWWB 4OMFG 3I9V9 5LSLA 4X4QA 3K59A 2CJKA 3HSDA 2J7KA 2X51A 4QPTA 3DRRB 3F73A 4DFMA 1R27B 1QLNA 3BPSP 2CQDA 5A0YA 4MH8A 1RHKB 2DNQA 3TJ9A 1YRXA 2UUBJ 3KK1B 4OX8A 2MLYA 4HVZA 3JB9k 5ETVA 2YX7A 1JLCA 3FKBA 3QPIA 4ENOA 5KG5A 1UKUA 1QDUB 1U2RA 2ZHOA 3FZBA 5FLXY 5LMUJ 4DCPB 2C22A 3HVTA 3BYPA 4IH6A 4IO9Q 4ZCMA 2E5JA 4O4GA 4J91A 2PT0A 4W4MA 1T03A 5KT5A 4B3TJ 2HG4A 4USKA 2VJUA 4ECTA 3CT9A 1RYSA 1ICEB 1KLMA 3DLKB 3QO9A 2AEJA 2GQCA 1RBLA 3T9NA 4FP9A 4URQU 5D15A 1KONA 3W2VB 4U95A 4DQPA 3KLFB 2LYVA 2CQ4A 4ZCIA 2VJVA 1HW8A 4ED8A 2B43A 4PCQA 4G1PA 4DL0C 2VD3A 3RYLA 4DLGA 3SV3A 1CC7A 1NEEA 3TAQA 2NREA 2IM3A 2QGFB 3LUYA 4DEZA 3UR0A 4IOAQ 2RUGA 5E5NA 3MHYA 5ETPA 3BGUA 1K9MT 1UW4A 1KLNA 2EW9A 1AZSA 3CMAS 4FF1A 2H5EA 1U1RA 2XLKA 1X9SA 1N6QB 1WC0A 2OFGX 4XK8C 4J37A 2CJBA 5KG3A 5L1JA 1YTYA 3O3LA 4NXMJ 4QYZK 1JWWA 2LLZA 4M95A 2B9YA 4LRAA 2BUNA 2LQ8A 2MKHA 2QL9B 2WW4A 3G6VA 1ZPWX 2BBEA 1BUXA 3MURP 4QWAA 3RR8A 2CADA 3CWJA 4OX9J 2FY8A 2A0FB 3DDNA 4I67A 1T9TA 2XSJB 4B3SJ 2G0JA 2W25A 3MCMA 4DR2F 4JV2A 1Q5YA 1WACA 1F9EB 1FFGB 3W2WA 1YVFA 4LFAF 3DOMB 1FJ7A 4ZN3A 3QIPA 4DPUA 4LSZB 8RUCA 3HJVA 1VGYA 1CJVB 4FXWA 3VVTA 3KLEA 2F3JA 4ZPCA 4J9UE 3UDEA 4ZJOA 1GT8A 3SMZA 1NBEB 2AYGA 4LF6F 2EG2A 1H98A 3AAWB 1RLCL 1Z4UA 2FVSA 4JI0F 2HFSA 3S6EA 4ATNA 1IBKJ 2MZRA 3DXSX 3KJQB 1DURA 1DLOB 5H1SV 2JC0A 3BDPA 1YHQS 4PEOA 4J9NA 2D3OR 2Q1LA 4MT1A 5IZHA 3CCRS 1PKUA 2YBVA 3VVUA 1N32J 3SCKE 4ID8A 3O2IA 4QWBA 1VR6A 2XSFA 1SB6A 2RJZA 3A8IA 2N4CA 5FDLB 3I56S 4DV1J 3HJFA 3EJMA 3ZTPA 4DV4J 5AXLA 2D3UA 4PABA 5EN1A 3CTRA 1F60B 1VRUA 3HF5A 4L74A 1RISA 2XMTA 4I2PB 5F8MA 5JVGQ 4PZVA 3R97A 3TX0A 2P8IA 2JEGA 2XS7A 3HD1A 4ZN1A 1S7IA 3BQ0A 2CPYA 2QYGA 3H2UB 3TI0A 5U47A 1P6TA 3RZAA 5GAGU 5B08A 4OZJA 5AJ3J 2FY1A 2DGTA 1RWOB 2MEWA 2WVCA 2GHVC 1TKZB 3T5JA 2E5IA 1TKDA 5DLGA 3QJLA 4USIA 2RQCA 1HNWF 2NLWA 2E9RX 4OYMA 1W2BR 2WSFC 4BCAA 2VG7A 1T9YA 4LF2A 2Q43A 3UN3A 1WKLA 3ZZOA 2JSXA 4DR2J 5A76A 3LWLA 3OSNA 4B9MA 4DWIA 1TVRB 4ZP8A 4J9QA 4C8KA 1I51B 5CCMA 3MM6A 3AHPA 2UVWA 3I0RA 3TP2A 3J81U 1RI7A 1TL5A 2XBPA 2PD1A 3LOUA 4MIAA 2HS0A 1Y3JA 2DPJA 1S77D 1VQMS 2ALZA 1B0VA 4DHVA 2KG0A 2KYZA 2NXCA 3IP0A 2FJWA 4OQJA 2OTLS 2X1BA 3DHWC 1YITS 2AYEA 3AFGA 4AE5A 4FN5A 4LRBA 5IFMA 1FRXA 4N8OA 1IBKF 1WC4A 4A8FA 3BEGB 4WPAA 2ZBPA 3UPFA 1CQNA 1LW2A 2PEHA 5ETQA 4A8QA 4KPYA 3E3XA 4HACA 5F9NA 1DQAA 1FTRA 1AFIA 3N5BA 4F26A 3JXOA 4YY3J 4U7UD 2BVZA 2BOPA 4HHHA 1NHVA 4HI1A 1O0PA 2DO4A 2ZE2A 1D1UA 1WUUA 1JLGA 2HRTA 1RQ0A 2CG8A 1HWJA 1RWVB 2Q79A 2YNFA 3C66A 1DQ8A 1FDAA 3EWGA 4NYZA 4X62F 4YR2A 4UQGA 3S1TA 4EMDA 4QBUA 1YI2S 5C2CA 5FD1A 3E51A 3TOQA 1NK5A 1VQ8S 1QE1A 1L3SA 2FGCA 5GAHU 1ULRA 1M1GA 1T9UA 3G87A 1B64A 4OYBA 1PCAA 4Y28C 4WK1A 4ZITA 4YUDA 1X4BA 4NASA 2GX8A 3K17A 2HIQA 4HH0A 5ETRA 1SC3B 3VQSA 4RNFA 2JEJA 4LF1A 3MMAB 3MAAB 3BZQA 1JLEA 2KI2A 1FJCA 3MZIA 4CRJA 4DSKA 4LJMA 4KH1B 2PSZA 4X4UA 1Q8LA 1HHTP 1WJ9A 2N7YA 1IJFB 1QJHA 4DUZJ 3N6NA 1R31A 4Y34A 2HVZA 3LP1B 1FESA 2O1PA 5IS2A 2R8IA 1PYOB 5H9EJ 1SL1A 4XPEA 3GP9A 5D77A 2ZE2B 3HVWA 2W4CA 4ZLJA 1FKPA 2YKAA 3AOBA 4DL7A 2QX0A 3PIPQ 2F4VF 2V8PA 3CJ2A 3FVYA 3M9OB 3DDIA 2A10A 1VRTA 1HBNB 4K4YA 1N34F 2R2RA 4ZDNA 4LSLA 4ZVQB 3L09A 1S1XB 5CYQA 1Q8KA 1C0TB 2E7XA 2EG1A 1VMBA 2ADCA 1OQ3A 3IRXB 5D0RA 5GADU 1T03B 1MN9A 3NEKA 3HULA 1UVMA 1WG5A 2HMIB 3A3PB 3RJMB 4KV8B 1MLAA 3OHBA 4DR7J 3EXYA 2OEKA 1JJCB 1R8CA 1HNZJ 1IKVB 2HPUA 2ZWOA 4B3OB 3I0SA 4DV2J 1HA1A 3DC2A 2IBOA 4EYHB 3IFEA 2W4DA 4RR5A 4NI2B 1QVGR 2V9WA 4IG0A 5E3QA 4ZLNA 1RT5B 2XMWA 1TAQA 5JVHQ 1S57A 5AXKA 4R25A 3OXFA 4ZPWR 4ANDA 1OY8A 4RW8B 3AA8A 1Q86T 1VDHA 3M30A 3RRGA 1Z1ZA 4PWUA 4U8YA 2OD4A 2V9KA 4DL4A 3HCXA 1RT6A 2NCKL 3FMWA 1TFYA 2AP6A 4TLRA 3NMRA 3BKTA 2E44A 1S6PB 2HLTA 2GHPA 2RDJA 2G13A 3H5SA 3KNGA 3MM5A 2XI3A 2ZZMA 4I1TA 1JLQA 1KR4A 4ED4A 3QSYB 1PSDA 2J76E 3Q24A 3NMAA 2NS1B 1SKWA 1SBRA 2WRMA 3WQPA 4K5RA 2BE7D 5D6GA 1XTZA 3IM8A 4U96A 2P9CA 1VBZA 2GMHA 2V8DA 4C8LA 3IS9A 3I87A 3HKZD 4NA3A 2VONA 1ZA2B 1LWCA 3UVJA 2DXEA 4F3QA 3HSJA 2H1YA 3G8QA 4XO0A 4EEYA 1SL2A 1U45A 4OZLA 4ZVUB 3Q22A 4M5HA 1LQ9A 2QLJB 2NXJA 3TZYA 3BDEA 1PBUA 1UVKA 5ITHA 4G1QB 4CO3A 3NL0A 4CLWA 4F02A 4K50A 5F3TA 3T1YJ 3DLHA 5A8KB 1XR5A 4DV2F 4F2SA 4ZVOB 1HI8A 4KQZA 5HL7Q 1BLUA 3KK3A 4P2XA 2I8EA 3GSIA 1SUQB 3VGUA 4ZP7A 3BREA 3UQSA 4B9TA 1X5OA 3V6HA 4PG4A 2DT9A 3S01A 3M9MB 2UUCJ 4TNOA 3ET6B 4MJKA 2PFFB 4KV8A 3V81B 1S9GB 4H54A 4YDDB 1XC9A 2F63A 2FVQA 3ET6A 3DM2A 4DR5F 2DBBA 4X62J 3D1HA 4HTIA 2MTLA 2E5LF 2DXFA 1SQEA 4CO5A 1S1UB 1SJRA 3BSNA 2GIFA 4I64A 2EFOA 5I42B 4U9RA 2MGZA 1T3OA 2B7CB 2EK6A 3N4WA 4PG8A 2VA3A 2R7UA 4RX6A 5F8JA 4Q0BA 5CD4H 3Q89A 1TELA 4PG5A 1AT1B 1XK8A 2CPZA 2VPWB 2WHOA 2F4FA 1T05A 1SKRA 2L41A 3H4BA 3ZNJ1 4KIAA 1RWXB 1VQ4S 3MPWA 1RTDB 1G2EA 3MI7X 3QT7A 2FZGB 3MR5A 1VQ9S 5E41A 1Q5VA 3ZTRA 5KFSA 5LMNJ 1ELOA 4QWCA 1VHFA 5LXYA 1SL0A 4MK7A 3TJAA 1RAHB 2NXUA 1HNXJ 2V68A 4NRTA 3SSSA 4ZLPA 2F5GA 3KJFB 2QJ3A 4IOCQ 3CCVS 3OXGA 1JLEB 2FJEB 2KG1A 3JTPA 4TVAB 4O3NA 3D1QA 2Y8YA 4ILLA 3CULA 1RAJA 1I94F 2AYBA 1NLKL 2ZH6A 4CDIA 3CB4A 2HVEA 3WIUA 1U48A 3RBZA 5L9NA 3QZ7A 1G3OA 2BJ1A 4WKYA 1UL3A 2R7SA 2J9DE 3IR7B 4DQQA 4HHUA 1SC6A 4A47A 3VAIA 3FBBA 2MZTA 2LDIA 3UW1A 4RNNA 1QY7A 2VC0A 2KT3A 5D0EA 1RHUB 1VRQC 1IKYB 3Q8UA 3THPA 4ED2A 1BWEA 1R0CB 3J80Y 2BOAA 2RQKA 4B17A 2OO4A 4NLRA 3AOCA 1UFKA 3MMCB 5HK4A 3RGIA 2XZWA 2XGQA 1HHQA 4NA1A 4Y3CA 4JI4F 2DNGA 2VUGA 4QIVA 4IO1A 3ISZA 5HQ8A 3UCUP 3K89A 1UEUA 3MEEB 1NSAA 4ZS6A 3J7Z5 2HBRB 2CJAA 3DLJA 3CCSS 1VRUB 4OFZA 4NCAA 1KP6A 1C4CA 4O4GB 2DGSA 4RW4A 1FE0A 2GV1A 5DDOC 1CC8A 2PMHA 3LQVA 4H4KA 2KFZA 2JLGA 1UAWA 3J80U 3F44A 4OYAA 3IGVA 1NJIT 2DK2A 1C1CB 4LIRA 4QPXA 4N8NA 5ETOA 1QAXA 4DN0A 1L3KA 2GHWA 2GVDA 5I4MA 4DSEA 4UY85 4KHPF 3V2UC 3KLGA 2J6TA 2MQMA 2BKPA 2P9EA 1G4CA 4IG3A 4YEAA 1E6VB 2IVFB 4CLUA 3F0NA 2NZCA 3UD3P 3JQKA 1F3FA 3OTDA 1U4BA 4RWXA 3IO1A 4Y65A 3T6JA 2ZDOA 5GAGI 4ZJLA 2HQIA 1EX8A 2M2BA 4QOTA 4DV6F 5D8HB 2C3PA 1VQOS 1GXUA 5A8KA 1B0TA 3HK2A 1I94J 1CJUB 1M1HA 4GVBA 3OL8A 1D0EA 2E5HA 2AKWB 1RHRB 2DGOA 1MWYA 3GLJA 4WIIA 4OI1A 1UZHA 1NK0A 1U1MA 1C4AA 4TY8A 2GVZB 2IC3A 3QQCD 5EWEA 5B0EA 3M8PA 3KHLA 3VAMA 2Y1RI 5KG0A 4M5DB 3WBZA 2KZMA 1RLDA 1SV5B 1HWIA 1T95A 3SQGA 2RIJA 4CM2A 1YRTA 1B0PA 3AB2B 3QT5A 1PJ6A 5F8NA 3DM2B 4RUCA 4B3MF 3JSMB 4GO5X 1TL3A 3RAMA 4XPCA 1HMVA 3CJ3A 3HMJG 1CJTA 4ES1A 4X4OA 3PW0A 4MKAA 3CJ8A 5DGBA 1S6OA 2YKPA 4LSNA 2LEPA 2VG5A 4DS4A 4KHPJ 2OHDA 1YJVA 1OY6A 3M6VA 1VC6A 2UP1A 2HVDA 3VGTA 4R8UB 3UWTA 2VQFJ 2C2KB 1HWUA 4FS1A 4LFBJ 1BWVA 3CCTA 4YR0A 4N41A 2OUGA 4O0NA 3BO4A 4C48A 4UOHA 4BC7A 1JLGB 1WHXA 3C3LA 4I2QA 3JYTA 7AT1B 1RWPB 4USVA 1FKOA 3PKYA 4DR3F 3JSBA 1I1GA 2QN6B 1C1BB 1FRHA 4OX6A 5DS7A 4G3IA 5DLFA 1HNWJ 1NSKL 1C0UA 2DNHA 4DR1J 1U25A 2EFGA 1VIOA 1QVFR 2EKNA 1IWGA 1EP4B 1JLBB 2HKEA 1V5IB 2FHKA 2IDLA 3OFHA 3W61A 4FF3A 3I5AA 3W63A 5ETTA 2QA4G 3GWCA 2KXFA 5AXNA 3BQ1A 1NDKA 4LFCF 2YNHB 5KAKA 4F4XA 5E3CA 2DNPA 4Y2MA 4CO1A 3W5ZA 5HQMA 2BEFA 1F5BA 2HQDA 1LW0A 3D1OA 4ZPBA 3TJ8A 1HI1A 1N52B 1U6BA 5FLXU 5T7LA 1D09B 3ITHA 5KFAA 4ECSA 2HZCA 4DZ6A 4L3KA 3M9NB 1FRLA 4KT0C 3DRRA 3SCIE 3ZZ0A 5F41A 2FIUA 4QCLA 1FVQA 4UT4A 1JJHA 4CLZA 3JS9A 5CA5A 3KK3B 2YNFB 2F1FA 2HHTA 2K7KA 1N56A 3EVMA 1RCOB 4GKKF 2BA9A 1FXDA 1TU0B 2WSEC 3PX4A 2B3TB 2CQ1A 2U1AA 2YWHA 2DHXA 2DRDA 1N5QA 4O3SA 1REVB 1HL6A 1PO6A 3VHQA 2AHOB 4C3MA 3PEJA 2A3JA 5A8RA 4HDHA 1TK5A 2ZH7A 4GKJF 3JTOA 1ZM2A 1X4DA 2PO4A 4F2RA 3QO9B 5DZ6A 2DGUA 2MKKA 2E1CA 3GZ7A 2OJ3A 1NDCA 1PG5B 2CNKB 2AZ1A 4DPWA 4PXDA 4F0MA 2CG4A 1ZTWA 3SV4A 3CJKB 1HNIB 3NY0A 1RT3B 3OR1A 4HEA9 1LWFA 1H38A 4JI5F 4NCGA 1S1VB 3QMQA 1T0TV 2J8SA 4YOEA 3M32B 3ZTQA 1RCXB 3PR5B 2G2ZA 3PW5A 3DI6A 3PIOQ 4HKQA 3MPVA 4FNHA 1W2IA 1K44A 3QWUA 4J5OA 3T5LA 1WTBA 1T05B 3P8BB 5C24A 4CLFA 1IKYA 1HBNA 2FLLA 3PCOB 4PPDA 1WOPA 1NH8A 5MAOA 2B4VA 1X5SA 1HKAA 2E7VA 3D0GE 5DDRC 1RHMB 4DUZF 1FFWB 2DXDA 3AXMA 3HHLC 1XEZA 3KJNB 3MTKA 3IXQA 4CZCA 4BWMA 5IT4A 4KC5A 4YB5A 2O3DA 4M5KA 1GMWA 4TU8A 4MK9A 4NA2A 3VZIA 4WFZA 4ZKAA 1S0NA 1JKHA 5F0UA 1HD0A 1KQFB 5T14A 2W7PA 4DF8A 2IVMA 3NWRA 3WX8A 1KVJA 4EBEA 1ZH5A 4H4OB 3W9HA 2IPOB 1Q0NA 3FK4A 2CPFA 2DH9A 3MCSA 4M8LA 1I3OB 4NLPA 5K5MA 3VAHA 4XDDA 2XLIA 2GQ2A 2PI5A 2LA4A 3S7RA 2R8GA 4UW2A 3EUNA 2J0SD 4G6VB 2UVUA 3SFGA 5FJ4A 3R7BB 3CPWR 4FNIA 2XNRA 1YJ9S 2R7XA 2LXFA 2E66A 3LAMA 3HXMA 3NNHA 2KRRA 2HGLA 4ZVGA 1V5VA 1KOHA 4Y2AA 3LWMA 4J9KA 1YBUA 3QGPA 1B3TA 4QU6A 2VPXB 1WF0A 2HGNA 2EBGA 2JFDA 3C8YA 2JL9A 4HYKA 1X9WA 2JH3A 1JMTA 4Q8FA 2XMKA 2WVDA 3MMJA 4G1QA 4O44A 3UD4P 4NXNF 4DQSA 2GW8A 5KFGA 2DRBA 3R7SB 3M2UA 1B7YB 3SYZA 2HHHF 4OHZA 4TLQA 3EGZA 2JVRA 2DB1A 1OSCA 3SCJE 3TWZA 3PVXA 2RE1A 2PMWA 1FDDA 1PYTA 1FJGF 1ZA1B 1TMMA 1YQHA 3RB3A 1C1CA 4X64J 2HYIB 2FD2A 2XULA 2AT1B 1XMOJ 1C2PA 1HWKA 4AL5A 2EI5A 1EAYC 1LOUA 4HLBA 3ZZUA 3MAAA 4KBIA 3CGIA 3HSGA 5MLCV 3MUMP 2PDAA 3U27A 2ZH5A 1F5CA 3FZ2A 1SH0A 4PQUB 3RG6A 4JI6J 2YPYA 3I9ZA 2VQFF 1LWXA 4C4WA 1U2FA 2OD6A 5KTQA 4YS2A 1X4CA 1UMJA 2UZAA 2DD8S 2GO8A 3CDEA 2BANB 2UV8G 4C3KA 5KG7A 1N36J 1IBLF 1DJ0A 4CLKA 3KDNA 4O3RA 3IA0A 2ZDPA 5KOXA 3WDOA 5K20B 4AQYJ 3AOAA 2MB0B 2UVRA 1RWMB 1SQFA 2HHVA 2CQBA 1VQPS 2VG7B 2CQCA 4RBUA 3GIIA 3CO9A 3BO2A 3BH6B 3IBWA 4LBIA 1PJ5A 1HBUB 2R7OA 2DRAA 2H5JB 1EKSA 2YWGA 2DNMA 3MCOA 1X5TA 3BS9A 3TA0A 5KFWA 5I3UB 4CH1A 3E01B 3BV8A 1FDNA 1HMVB 1WWHA 4A4JA 2PC6A 5E3RA 3TUPA 5HANA 1REGX 3M8ZA 4OHWA 3T9ZA 5IV3A 3OVAA 2QZ8A 4IYQA 1L3UA 2HIYA 5B0GA 5KG4A 3P45B 5J2NA 3JSRA 5RUBA 3LALA 3CJKA 4R0EA 1RTZA 4HR2A 3OSPA 1BC6A 5J2NB 2J9CA 1URRA 3ICLA 2HNYA 4KGZB 2N7CA 4DV7F 2V67A 2V6AA 3TQ1A 1KQGB 4QWDA 4EI2A 2LDYA 3R6LB 1UJ4A 1VI7A 3MPUB 4TN2A 2C42A 2MKSA 3KOAA 4DPYA 1S72S 2ZITA 5DM7Q 2B4UA 3G2XA 5AJ3F 1EQMA 5KFNA 3US5A 3M05A 2B6AA 3BSCA 5HROB 3Q86A 4WP9A 3MFHA 1IBLJ 3ETMA 1VQNS 3CE8A 3PDNA 4WFAQ 3FRZA 3HHDA 4ZK7M 4U7UK 3LAKA 4LMZA 3FJ2A 1T02A 3I82A 3K7RA 4AQYF 2CNNB 2WOMA 4K4WA 4F4WA 3T5KA 1KC8T 4JV1A 1FX4A 1WHYA 1UVNA 2XO7A 2EK1A 4B3OA 4J9PA 5HVFA 5L1IA 1WELA 2K06A 1RWKB 4UUWA 2GMJA 4DX8H 3GONA 3OFFA 3TO8A 3GYNA 4OZ1A 3W9IA 3DLEA 3F41A 4Y6IA 5GAHI 2KHDA 1IVZA 4CH7A 2UXDJ 2CZ9A 4KTQA 1S1TA 4M5GA 4KSEB 2HFZA 5E3PA 4WKRA 3GYGA 3G6XA 1Q7LB 1TUWA 2R3VA 2Z4PA 1KS2A 2KRBA 2GZOA 2XMVA 4USMA 3LH2S 2W9CA 1VRTB 2GFFA 3MMCA 4C7QA 1H2TZ 3V6KA 3FCHA 4RW6B 5KFFA 1LFPA 2X1GA 3OFEA 3OTOJ 1WC3A 4AXJA 1APSA 3MPYA 5BXIA 5EX3A 5HVGA 3OLAA 2AU0A 4FF2A 2Q66A 2DY1A 2DY9A 2R4FA 2WBMA 3DOLA 1RWUA 5GMDA 4CIOA 3L3CA 3RB0A 2LXUA 3OTCA 5H9EK 2UXCF 4ZA1A 1KKHA 2HRYA 2YQ0A 2CPDA 4RBVA 1ZETA 1TL3B 4OJ1A 2HK2A 1FXRA 2C3YA 5SZTA 4ECQA 4U6PA 1WOSA 3QLHA 1GMUA 4OYXA 4OHYA 3K57A 5HBMA 2ZZNA 2D74B 3W62A 4JI4J 4M5LA 2VH7A 3DU5A 3JSMA 2ZKTA 3EM1A 2HHHJ 3HFZB 2Y1IA 3WC0A 5G4DA 4Q2LA 5KFKA 4O3OA 1RAFB 1RBOB 4DV1F 1S79A 2YQ1A 5DG9A 4ED3A 3L7UA 4X4VA 1RTJA 4ZP9A 5CYJA 1XMOF 2EBEA 2KM8B 4OI2A 3NS7B 1R3NA 2J0WA 1PYSB 2L3MA 3NCQA 2QMUB 2ALYB 1R0BG 1VK8A 2BX6A 2CYYA 3Q83A 2VPZB 3A3OB 1AB8A 3PM9A 2RKIB 1FWPA 2IA0A 3ENWA 1GAOA 5M2PA 3EPIA 1RP5A 4ER8A 2F4VJ 3AA9A 1FK9B 2MJUA 3QYYA 2AGPA 1KN6A 4L73A 4LVOP 1T8EA 2OSRA 2IBKA 1IJEB 3UN2A 3PX6A 1IKVA 4LRDA 3CC7S 4I2PA 3BB5A 3EZUA 3FBEA 2ADBA 2FTRA 2ZM6F 3P96A 4CTAA 2XSJA 1D9FA 3CXCR 3OFGA 1LW0B 2AGQA 3D7SB 3PO4A 1UVIA 2DH7A 3PRBA 3ZZTA 5AE1A 3M8RA 3C15A 1DAXA 2C2RA 2D3ZA 2JOQA 3NS6A 2ZH8A 4CYUB 1EIYB 2K2PA 3UDLA 4RL1A 2XZTB 5KOWA 3N0VA 1S6QB 2V2VA 2DNRA 2LA6A 4EYIB 1VC5A 1JLAB 4KO0A 4DR7F 2YNIA 3KJVB 1HNXF 2Z30B 3V4MA 2DR8A 3CJ0A 1D8ZA 3TZZA 2ZH1A 3VWSA 3K58A 4B3MJ 2N82B 4BDPA 2CQ0A 2KDOA 2QMXA 2HBYB 3ILLA 3MD1A 5H9FJ 2KH9A 1N33J 4OYPA 2XG8A 4K4ZA 1WG1A 2J8AA 4O44B 2UUAJ 3P5TL 2Y0BB 3SXLA 1SIWB 5DDQC 5G0RB 5IQQA 3C6TB 2HQ3A 3ISND 5CCLA 5A2QY 3Q2SC 2FHJA 2HFOA 3I55S 1QTMA 4M63A 2R8JA 2DGQA 3FC9A 4RKUC 5K8PA 3ULHA 2FJDB 3QWPA 3LF0A 4NLYA 1NAQA 2I9SA 4AL6A 1XIQA 1RTIB 3CMES 1NKEA 3VZHA 4JI1F 2I6WA 2HNZA 1YKWA 2RNEA 1SJFA 2YX1A 3HHNB 1SCJB 3AJ1A 3QFHA 4OYZA 2C2EA 3GJQB 1NJXA 1DZ5A 1NK9A 1N88A 2DR7A 1VQSA 3KUEA 4LF5J 4LRCA 5DQIA 4WJBA 4ZHRA 5DQGA 4NRUA 3C14A 4ZCLA 2XY6A 5B0BA 2W2OP 3RRHA 5SUHA 2P5VA 1HR0F 3VF0B 1RT6B 2CQIA 3OJSA 2KJVA 2OKQA 5CYMA 4GVLA 1SPBP 3N79A 4WTYA 4FXDA 4MIWA 3D28A 1UA1A 2C2NA 4USTA 2R7QA 3UFCX 4C8NA 1CJUA 4DG1B 3GILA 3J7AN 1NJZA 3FBFA 2QMWA 4QZVB 4NCBA 1UA0A 4N76A 3GE9A 4LF9F 1OMSA 4XIUA 4OYWA 1SJQA 3Q8RB 2V8VA 4QR0A 4QU7A 3QT6A 3TUIC 2BMBA 3GCWP 4F50A 2X7IA 4PR6A 2JEIA 1EQ0A 1EHWA 3FMBA 1WOOA 1IR2A 4NYOA 2RRBA 3T1YF 4BS2A 2HK3A 3G6YA 5AE3A 2J9DA 4A8WA 3SBMA 2UUBF 2PGCA 3TYTA 3RBXA 1ROFA 2E1MC 1Y5IB 4DCOB 4OHXA 5HBMB 3OJUA 2LEBA 4YQWA 2EFPA 4WZMA 3P3DA 3MMBB 4YDXA 1L3VA 1HD1A 3IMQJ 4E98A 2B8PA 4OZ3A 3DGPB 2AGOA 4IQMA 4QIFA 2RF2A 5B7WA 1K8AT 4QYRA 5J2PB 3TAPA 2QL7B 2IYGA 4L6V3 2A2CA 1NJWA 2DGXA 2J5AA 2JEFA 4B3RF 1JNZB 3QIDA 2WBRA 4UQTA 2YNGA 2B7BB 3GYXB 3IR5B 2R8HA 4EGLA 4RWWA 4FPRA 2MDAA 4X4TA 4CH0S 2K1RA 1TV6B 2YNGB 4WK3A 4TU9A 5HP1B 4O3QA 2VG6A 2JVOA 2MKJA 2R9LA 2FC8A 1A9NB 2R2TA 5AT1B 1HYSA 1IXKA 1M5HA 1RAEB 6FD1A 3G86A 2FLOA 2ZBIA 2W01A 3QAUA 3NWGA 3Q0AA 3BSOA 2LECA 2HHSA 1WF2A 2DNLA 2V8GA 3CDBA 2Z58B 3EZOA 3CJ4A 3FUYA 2ZKUA 1OIAA 4G1IA 4CO0A 2OPPB 5L39A 4ILMA 4LF8F 2OPSA 1O6XA 1RTHB 2Y3YA 1NZAA 4NWBA 1TUVA 4RW7B 5J2MB 4LF9J 1BQNA 1E6YA 4K4SA 1BGXT 1LXNA 1PGZA 4B9SA 3KK1A 2MKIA 4FF4A 2HWIA 5LM7E 5DG7A 4NLGA 2DNNA 2DNZA 3MM7B 2X1FA 3RBDA 2VFRA 2Z8QA 3FRYA 4WBFA 3DN9A 2PFDA 3ZZYA 2W9CB 4C6AA 4CLLA 1FD2A 1QUVA 1TV6A 1CG2A 2OPRA 2QLFB 4QWEA 3PY8A 1DFDA 2B4OA 4G65A 4NLOA 4WP3A 5HQLA 2ATCB 1A0OB 7FD1A 1R6VA 1D3WA 3LW5C 4OZ0A 3CCMS 1NM2A
chains in the Genus database with same CATH topology
4ANDA 1HHQA 1NSPA 1JXVA 3ELHA 1NDCA 2AZ1A 1VYAA 3PJ9A 2NCKL 3FC9A 2VU5A 1NHKL 3G2XA 1WKJA 3ZTQA 3B54A 1NDLA 3BBFA 1XIQA 1NB2A 1K44A 1WKLA 3Q86A 1HIYA 3ETMA 1NCLA 3EVOA 1F3FA 4F4AA 2DXDA 1KDNA 5CAAA 3BH7B 3NGUA 3R9LA 2B8QA 1ZS6A 4UOGA 2DXEA 3NGSA 3WX8A 4KPCA 3FKBA 4ENOA 1B99A 3PRVA 5C7PA 5IOLA 1NSQA 3FBFA 2DYAA 1S5ZA 1LEOA 1W7WA 3VGUA 1NUEA 1EHWA 4ANCA 1S59A 5BXIA 4EK2A 2DY9A 1XQIA 3Q8VA 3NGRA 3ZTSA 5CABA 2HVDA 1MN7A 1U8WA 3DKDA 3VGTA 4CP5A 4F36A 2B8PA 2DXFA 4W98A 4O0NA 3EE3A 4UOHA 3Q8YA 1BE4A 4FKXA 3EM1A 3BBBA 3VGVA 1B4SA 3Q89A 1HLWA 1BUXA 3EVWA 3MPDA 1NSKL 1WKKA 4DUTA 3L7UA 1PAEX 1F6TA 1LWXA 2HURA 3ZTOA 4DI6A 3GP9A 3ZTRA 3DDIA 2BX6A 1NDKA 3Q83A 1UCNA 4UOFA 2BEFA 3VVTA 3EMTA 4DZ6A 2ZUAA 3EICA 3BBCA 3FCWA 1BHNA 3BH6B 3GPAA 3FBEA 1MN9A 1NLKL 2AZ3A 4ANEA 1NPKA 3JS9A 2HVEA 3ENAA 3EVMA 1PKUA 3FBCA 3VVUA 3NGTA 4WBFA 1NDPA 3FBBA 3B6BA 3FCVA 4C6AA 2CWKA 3Q8UA 3EJMA 3ZTPA 3VGSA 4HR2A 1S57A 4S0MA 4FKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AND A;  1HHQ A;  1NSP A;  1JXV A;  3ELH A;  1NDC A;  2AZ1 A;  1VYA A;  3PJ9 A;  2NCK L;  3FC9 A;  2VU5 A;  1NHK L;  3G2X A;  1WKJ A;  3ZTQ A;  3B54 A;  1NDL A;  3BBF A;  1XIQ A;  1NB2 A;  1K44 A;  1WKL A;  3Q86 A;  1HIY A;  3ETM A;  1NCL A;  3EVO A;  1F3F A;  4F4A A;  2DXD A;  1KDN A;  5CAA A;  3BH7 B;  3NGU A;  3R9L A;  2B8Q A;  1ZS6 A;  4UOG A;  2DXE A;  3NGS A;  3WX8 A;  4KPC A;  3FKB A;  4ENO A;  1B99 A;  3PRV A;  5C7P A;  5IOL A;  1NSQ A;  3FBF A;  2DYA A;  1S5Z A;  1LEO A;  1W7W A;  3VGU A;  1NUE A;  1EHW A;  4ANC A;  1S59 A;  5BXI A;  4EK2 A;  2DY9 A;  1XQI A;  3Q8V A;  3NGR A;  3ZTS A;  5CAB A;  2HVD A;  1MN7 A;  1U8W A;  3DKD A;  3VGT A;  4CP5 A;  4F36 A;  2B8P A;  2DXF A;  4W98 A;  4O0N A;  3EE3 A;  4UOH A;  3Q8Y A;  1BE4 A;  4FKX A;  3EM1 A;  3BBB A;  3VGV A;  1B4S A;  3Q89 A;  1HLW A;  1BUX A;  3EVW A;  3MPD A;  1NSK L;  1WKK A;  4DUT A;  3L7U A;  1PAE X;  1F6T A;  1LWX A;  2HUR A;  3ZTO A;  4DI6 A;  3GP9 A;  3ZTR A;  3DDI A;  2BX6 A;  1NDK A;  3Q83 A;  1UCN A;  4UOF A;  2BEF A;  3VVT A;  3EMT A;  4DZ6 A;  2ZUA A;  3EIC A;  3BBC A;  3FCW A;  1BHN A;  3BH6 B;  3GPA A;  3FBE A;  1MN9 A;  1NLK L;  2AZ3 A;  4ANE A;  1NPK A;  3JS9 A;  2HVE A;  3ENA A;  3EVM A;  1PKU A;  3FBC A;  3VVU A;  3NGT A;  4WBF A;  1NDP A;  3FBB A;  3B6B A;  3FCV A;  4C6A A;  2CWK A;  3Q8U A;  3EJM A;  3ZTP A;  3VGS A;  4HR2 A;  1S57 A;  4S0M A;  4FKY A; 
#chains in the Genus database with same CATH topology
 1RK8 A;  2X3G A;  4C8Y A;  2G4B A;  2HQC A;  3PYG A;  5B0C A;  3J81 j;  1LXJ A;  2VAS A;  3G71 S;  2R7W A;  4ECY A;  2IDE A;  2OMO A;  4NZ6 A;  5J2Q B;  4B9N A;  3DRS A;  4OZ2 A;  2GVD B;  4URG A;  2BRK A;  1TR0 A;  2YNH A;  1NHK L;  3KLG B;  1N32 F;  3CCQ S;  4EU0 A;  2GAG C;  3EDQ B;  3QGG A;  2ZH3 A;  2NYI A;  2H5I B;  3BBF A;  3MM8 A;  3KUH A;  2RDD A;  4Z7Y A;  4B02 A;  5EX0 A;  2ABY A;  4DV4 F;  2HFN A;  3AB4 B;  2PA3 A;  3CD5 A;  3I32 A;  3BO3 A;  1S0V A;  3QAE A;  1N5T A;  4LBP A;  2BKO A;  1IBM F;  1FO1 A;  2MZJ A;  3UO0 A;  4DR5 J;  3L9Z A;  1UW9 A;  5A2Q U;  4JI1 J;  1PIE A;  2M5Y A;  4RBT A;  2B6A B;  1F5A A;  1RWN B;  2H54 B;  2LMI A;  3K0J A;  3OXL A;  1ZAW A;  2OPR B;  1M5S A;  2B9W A;  2LU1 A;  4PXB A;  1Q7Y T;  2J0Q D;  5KT3 A;  4JI5 J;  1VJQ A;  4WXW A;  1S76 D;  4KPC A;  2YH0 A;  3CCU S;  3MR6 A;  3TUJ C;  3V4I A;  2LXI A;  3TZX A;  1WC5 A;  4P6Q A;  5C5J A;  5C7P A;  5DRK A;  1NSQ A;  5M2U A;  2ERR A;  2MY8 A;  3DU6 A;  1DY3 A;  4DUY J;  1KVK A;  5KT7 A;  1CJT B;  3MMA A;  1A7G E;  2RDI A;  1HNI A;  3UN5 A;  4NLT A;  4PWD B;  4DL3 A;  1AUD A;  2YWW A;  1LK5 A;  3C15 B;  4TY9 A;  2KFN A;  3H5Y A;  1VBX A;  2OML A;  2RB7 A;  2MZS A;  3SSQ A;  5KFM A;  2EKY A;  3BGR B;  1TL7 A;  4HT7 A;  4HT5 A;  3CD7 A;  4Y2K A;  2GC8 A;  3RR7 A;  4J9V A;  1JXE A;  3NGR A;  2POK A;  1AZS B;  1C0T A;  2RD5 C;  1REV A;  4BWJ A;  3U02 A;  1TFW A;  2KM8 C;  1HHS A;  4WIQ A;  2CNO B;  2UVV A;  1RZM A;  3ENQ A;  2H48 B;  2DH8 A;  2ROP A;  3QFW A;  4W98 A;  3O44 A;  4Z7C A;  1YIJ S;  2KO1 A;  4P75 A;  3W5X A;  1IUJ A;  1CJK B;  2CRL A;  4RW6 A;  3D6M B;  4ZVH A;  2ILZ A;  4LF4 J;  3IC1 A;  4E2F B;  4IUF A;  4IOB A;  4QYZ J;  2MLZ A;  2B56 A;  4Q5V A;  3M6X A;  4ZLL A;  4KGX B;  1R43 A;  2DO0 A;  1HLW A;  3A3N B;  3GIK A;  2A2D A;  2JJ4 D;  4GO7 X;  2VQE J;  2MQ8 A;  3LGH A;  2IMO A;  2ZUG A;  3KG0 A;  1WEX A;  4AT1 B;  4KGK A;  3UI3 A;  1U26 A;  2JFK A;  2RH3 A;  2RRN A;  2WVF A;  3I0S B;  4V1A k;  3T6B A;  2F40 A;  4DR1 F;  3QZ8 A;  2OPS B;  4ILR A;  3RW7 A;  3H5X A;  2WB1 D;  1YRU A;  4OIX A;  3LP0 B;  2DEI A;  3A8K A;  4WFX A;  4AL7 A;  3OL7 A;  3MM6 B;  1N6Q A;  3V6D A;  2ZBC A;  1IM6 A;  4HL9 A;  4NZ0 A;  3W3S A;  1ZM3 A;  4IRD A;  2HHQ A;  4HHJ A;  4ZVR B;  2FVR A;  4CO2 A;  3QJJ A;  3QRR A;  1R8H A;  1P9Q C;  4OYI A;  4EBC A;  1BHN A;  3GPA A;  1Q8B A;  3GV5 B;  1ZM9 A;  2AZ3 A;  2MPU A;  2W2N P;  1M5V C;  4GC6 A;  3PW4 A;  4CM0 A;  1XJW B;  2CZ4 A;  5HJX A;  1NO8 A;  2E9T A;  2JNJ A;  2WON B;  4OJH A;  1IQZ A;  3FBC A;  4NLV A;  2FC9 A;  5KFJ A;  4UOC A;  2W1B A;  3QGH A;  1S4E A;  4OI6 A;  3SDE A;  1I6J A;  2VZ9 A;  3EXC X;  5K14 A;  2CWK A;  3D2W A;  3GG1 A;  1HAR A;  3OW2 R;  2V50 A;  5HAT A;  4ED0 A;  1S6Q A;  3ZZZ A;  3H8Y A;  1Z2L A;  1HI0 P;  1VYA A;  2UUT A;  4GKJ J;  5LJ3 Y;  2GJ2 A;  2CJY B;  1NK7 A;  1KOO A;  4B3T F;  1KFD A;  3GMG A;  1GMV A;  3U7J A;  2V69 A;  2CUY A;  2D9O A;  2VU5 A;  4KFB B;  3AY0 A;  5KFH A;  4K2X A;  3PJX A;  2OI2 A;  1S7H A;  2E1R A;  4C8M A;  1UPP A;  3N28 A;  4JYA F;  3CCL S;  2ZOG A;  4I2Q B;  4GVB B;  3JYT B;  5HP1 A;  3GV8 B;  5KT4 A;  1FI4 A;  4HTJ A;  3TZW A;  4X4R A;  2HWT A;  4A8M P;  2QRR A;  3MR7 A;  2VBW A;  2PMZ D;  2B9E A;  5D3G A;  1S4F A;  3SEO A;  3DOK B;  1WEY A;  4DL6 A;  4YB1 P;  4DBQ A;  2VIH A;  1QAJ A;  5JJB A;  1AW0 A;  3BH7 B;  3NGU A;  1IN0 A;  2IRX A;  3BKF A;  4K4X A;  3W2W B;  3Q8P B;  3GTY X;  3PAC A;  4F7V A;  2HRU A;  3GR0 A;  3LAN A;  5LXR A;  3DOM A;  1LWF B;  1GEH A;  1X4F A;  2E5G A;  3B82 A;  4IG0 B;  1BQN B;  3W5Y A;  4X4S A;  3RTV A;  1K1Q A;  3HKW A;  4YP3 A;  2YQ3 A;  4ZHR B;  3HD2 A;  3THT A;  2KT2 A;  2XHC A;  3PYD A;  2OPP A;  4TQS A;  1H2U X;  5L9X A;  1EAR A;  1S99 A;  3C16 B;  2XM3 A;  2DYA A;  3GR1 A;  4FPI A;  1YX2 A;  3MOJ B;  1FRM A;  3LPY A;  1JXL A;  4Q8E A;  2XQC A;  4K4U A;  2L9D A;  3EGN A;  4YB7 A;  4TU7 A;  3G6E S;  4ZIV A;  2WCX A;  1X5P A;  2BM0 A;  4XTT A;  2P9G A;  2M8D B;  4LFC J;  1S6P A;  2A18 A;  4NL5 A;  3K2Y A;  1PIL A;  1WI6 A;  1S1X A;  3F56 A;  5KFE A;  4FBT A;  1NHU A;  5EHH A;  1RE1 B;  2KVI A;  4LT6 A;  1OQ6 A;  1JB0 C;  4KB7 A;  2AIR B;  4Y2I A;  2QEX S;  2GJI A;  4DG1 A;  2QLB B;  4LIW A;  3B4M A;  3KMQ A;  3PX0 A;  2UXD F;  1OY9 A;  4MK8 A;  1KSP A;  1CSJ A;  3DMJ B;  3D5M A;  4I56 A;  4EO8 A;  1TAU A;  1RT1 B;  4I0W A;  4ZVT B;  2D3O 1;  4F4K A;  1D8Y A;  4NXN J;  2W4P A;  2XWY A;  4XAK A;  4WFN Q;  1WDD A;  2KTQ A;  1BE4 A;  4FKX A;  4ZOS A;  2IHR 1;  5KFV A;  3Q8Q B;  3HSZ A;  3H25 A;  2LEA A;  3H40 A;  2HQF A;  2OIH A;  2VFS A;  3BF4 A;  5B09 A;  1M90 T;  2J6S A;  1KQK A;  1PJ7 A;  3GV7 B;  2UU9 J;  4MFB A;  3R5B A;  1PAE X;  2IFX A;  2MKC A;  3KHG A;  2DPI A;  4DI6 A;  4I4B A;  3CF5 Q;  2YKM B;  2X1A A;  2DNO A;  3H90 A;  1W26 A;  5C42 A;  1H2V Z;  4RO0 A;  2ZD1 B;  3T1H F;  1X8D A;  5A8W B;  1RBA A;  3D68 A;  2KYX A;  1FWL A;  3I6P A;  1QAY A;  3IM9 A;  3N01 A;  2W8L A;  2CJX B;  4C8Z A;  1NPP A;  3KKF A;  2FJV A;  2HHW A;  4B9V A;  4WF9 Q;  3CIM A;  3C6T A;  2L48 A;  1FKO B;  2I0X A;  2ZFH A;  1RDR A;  2HVI A;  3FGV A;  3OD2 A;  3H20 A;  3N5F A;  3PXG a;  1ITP A;  1TKT B;  1NND A;  3M8S A;  5KFU A;  1XMB A;  2XWX A;  3RUB L;  4OI4 A;  2A6O A;  2CPX A;  2XMJ A;  2GCF A;  2HQG A;  3POT A;  1NPK A;  3SI8 A;  1S9E A;  2R2U A;  2AJF E;  2FHJ D;  1F9F A;  4ED7 A;  2DR5 A;  1RAC B;  4IG3 B;  2RU9 A;  1AA1 B;  2BJD A;  3PYF A;  1RT3 A;  3OR1 B;  2LQ5 A;  1RA7 A;  2OEJ A;  4RW7 A;  2YWK A;  3ILO A;  2ZC3 A;  3TNV A;  3B6B A;  3HHK A;  4OV1 A;  4DX7 A;  4EUV A;  2HHX A;  1TL1 A;  1NRK A;  2HFV A;  4LRF A;  3DYA A;  1Q53 A;  3CIZ A;  3H98 A;  1HBM A;  3O6Q A;  4KKO B;  3M2R A;  5IV4 A;  5CHC B;  5B0F A;  4YHH J;  1AFJ A;  3VAF A;  5LSO A;  1YBA A;  3KMS A;  1U1L A;  3O1L A;  3A8E A;  2GO9 A;  1PBA A;  3A1Y G;  1KTQ A;  3CDW A;  3D0I E;  3GCX P;  3NLC A;  4KHM A;  3KHH A;  5L1K A;  3OT9 A;  5A0Y B;  1H73 A;  1FE4 A;  2GVZ A;  3DOL B;  4ETZ A;  2BZ2 A;  3MAH A;  2RUS A;  4FZV A;  1RU2 A;  1F1B B;  2R42 A;  4YY3 F;  3HPO A;  1G1X A;  3FSX A;  2UXB F;  5G0R A;  1RUS A;  3FDS A;  1S10 A;  2RQM A;  2YKQ A;  2WON A;  3IN5 A;  2CXE A;  4WU2 A;  3R1L A;  2Q3P A;  1YJW S;  4CT9 A;  2O01 C;  1H0H B;  2G1H A;  1CLF A;  5J1N A;  2J7W A;  4DPX A;  4JI7 J;  5GAE I;  5I3P A;  3D6T B;  3GIR A;  1EZZ B;  3B4D A;  3W1Y C;  2CQ3 A;  2G0I A;  5KFO A;  3W2V A;  2CKW A;  3FSY A;  5HMX A;  4A8O A;  2FDN A;  2WSC C;  1EKR A;  1TL1 B;  4LR7 A;  3VAJ A;  2WZ1 A;  1YLX A;  4K2J A;  2PI4 A;  2HS4 A;  1HQU A;  1N5Y B;  1FJG J;  2VOD A;  2GGP B;  3VV2 B;  3TUZ C;  1NJY A;  3MUV P;  3VAG A;  1Y00 A;  2QL5 B;  3IWL A;  4F04 B;  2DTJ A;  5CYQ B;  1VFJ A;  1ACM B;  1DLO A;  3I4P A;  4QJV A;  9RUB A;  4IQX A;  1S5Z A;  1C0U B;  3CO0 P;  4LF8 J;  1W7W A;  3AT1 B;  2IJN A;  1HBU A;  4OZ5 A;  3C19 A;  1FFS B;  1Y3K A;  3OTB A;  1LFW A;  4X65 F;  2YH1 A;  3MEC B;  1SH2 A;  1UET A;  5LL6 d;  1LV5 A;  1YJU A;  2DIU A;  2GAH C;  2K7J A;  3LP2 A;  1RYR A;  2GIQ A;  2R8K A;  4X84 A;  3T5H A;  2DIT A;  4DJB A;  4ID5 B;  4UZB A;  2CDR B;  3QIP B;  4QQB A;  4A48 A;  4RUH A;  4LF7 F;  5CD4 A;  3NGD A;  2Z2Y B;  1XQI A;  3KDO A;  4IFV B;  3WHI A;  1LW2 B;  3OTO F;  1XNQ F;  2ZEJ A;  5DZ7 A;  4OL8 A;  1R0A A;  3AD7 C;  3CMQ A;  5DO2 A;  2F9J A;  4KE5 A;  4OLO A;  4F36 A;  2RHS B;  1FNM A;  3BGR A;  4KYZ A;  4RNM A;  3PHT A;  2NSC A;  3B8H A;  5JMN A;  4NLX A;  4JUZ A;  4DU7 A;  3MFI A;  3RAX A;  3CCJ S;  1NB7 A;  4CT8 A;  3HVA A;  3VTI A;  2FB0 A;  4NML A;  3R2D J;  1HQE B;  4X66 J;  4BLG A;  1EJ7 L;  4A8S A;  1SXL A;  4P2F A;  3MPD A;  1WSR A;  1X31 C;  1RKI A;  3DRY A;  2LCW A;  1F6T A;  3IAS 9;  4M1K A;  1Q79 A;  2HUR A;  3D6F B;  2RKI A;  4TY8 B;  4DX5 A;  4LVN P;  3J81 Y;  4C0B A;  2H65 B;  4CLY A;  5LSR A;  3CJS A;  3NS5 A;  5CZX A;  4ZVF A;  2G2O A;  4M5N A;  4C2M A;  5HLF B;  2QA1 A;  5D3G B;  4F25 A;  1UCN A;  2X3D A;  2DHA A;  3G9C A;  4C3L A;  5BR8 J;  1CEZ A;  1V3R A;  2ROG A;  4YB6 A;  3KLI A;  4OLP A;  2ZUA A;  4P9S A;  3BBC A;  1ZM4 A;  3M32 A;  3T19 A;  2VG5 B;  4X65 J;  2G9O A;  1UPM B;  2WVB A;  3MM8 B;  1ZYQ A;  5AXM A;  3ILJ A;  2WVE A;  3IWX A;  1YZ7 A;  2JC1 A;  4N77 A;  1XMQ J;  1P1T A;  4AFF A;  1FF2 A;  1YSJ A;  1X4A A;  1WOR A;  3D3B J;  2XS5 A;  1Y10 A;  5CXT A;  3MEK A;  3KK2 A;  1HBO B;  3C6U B;  1U8S A;  4JB8 B;  3I0R B;  3G4S S;  5J1E B;  2CQP A;  4Q43 A;  2EWH A;  4F67 A;  1JX4 A;  4JI8 F;  5K9F A;  5D4O A;  4EO6 A;  2YVS A;  2AJ4 A;  1JJ4 A;  5A6P A;  3VGS A;  2ZH9 A;  2AYM A;  1YGY A;  4AUK A;  1U1Q A;  3D9B A;  4P2M A;  1FER A;  4ECW A;  2Z2L A;  3K8V A;  2FGO A;  1NSP A;  2R2S A;  1NK4 A;  4NLD A;  2M9K A;  2MMY A;  4PAA A;  4UZC A;  3PR4 A;  3G96 A;  4ZVS B;  5HJY A;  1TKX B;  2G2Y A;  2K3I A;  2RAQ A;  3PHE A;  3MD3 A;  3MED A;  4TXS A;  4DN9 A;  5BYS A;  2MQP A;  1T7P A;  1R8A A;  3BJY A;  3CJ5 A;  2D7S A;  1PC5 A;  3EGW B;  2KN4 A;  4NI2 A;  2M0G B;  1NDL A;  1R89 A;  1S1V A;  2QLW A;  1KRP A;  2UUC F;  2UXB J;  5LMU F;  3W65 A;  1RTH A;  5J2M A;  1RAI B;  3R1H A;  2XTJ P;  1UEK A;  1KNZ A;  1BY9 A;  1NCL A;  4QIG A;  4MFB B;  4NPO A;  1F0X A;  3MM9 B;  4DV3 J;  4IH5 A;  5KFX A;  2BW2 A;  2BE2 A;  3IBC B;  5F8L A;  1HNZ F;  2E5L J;  3T3F A;  4H4K C;  1J27 A;  4JI3 F;  1N0U A;  1RTD A;  2B8Q A;  3D4J A;  3MEG B;  4LRE A;  1IKX B;  3L7O A;  1J2V A;  1FD8 A;  1LNQ A;  2WTF A;  4K4V A;  5HRO A;  2P6S A;  3W64 A;  4LR9 A;  3DRX A;  4W92 B;  4WP8 A;  4KRW A;  2HAI A;  1CUL B;  3IG1 A;  9ATC B;  1HR0 J;  4E0D A;  3NNA A;  3CJT A;  4O4R A;  2OLW A;  1K73 T;  1OYE A;  2IIH A;  1HNV B;  4JI8 J;  3LO3 A;  3PJW A;  1I5O B;  4HAC B;  4N47 A;  4CQ1 A;  3D0H E;  1M5K C;  5DM6 Q;  1OYD A;  1FEH A;  2AWZ A;  3HZE A;  3D6H B;  2BAN A;  4UUX A;  2APO A;  2Y0S D;  3TA2 A;  1SKS A;  1WSV A;  2C1E B;  3MMB A;  5ETN A;  2DKO B;  4LSN B;  3KYL A;  2Q6B A;  1UVL A;  2VDI A;  3PZP A;  3MEC A;  1NME B;  2K3K A;  3QRQ A;  2W2P P;  1FCA A;  3KG1 A;  3Q8V A;  4P52 A;  4ZJQ A;  1N4L A;  4ECZ A;  2OGU A;  5LT5 A;  3V6J A;  1BMQ B;  2AF6 A;  3G8S A;  3R6G B;  2KZZ A;  4X4P A;  4F3M A;  2ACY A;  1VIX A;  1J5O B;  2FUG 9;  3M8P B;  4ES2 A;  1TVR A;  1RB0 A;  1UWA A;  1GTH A;  4ZIW A;  3ZFV A;  4ELU A;  2V0N A;  3BBB A;  3MR2 A;  1U1K A;  4MKB A;  3GB0 A;  1IM4 A;  2DJW A;  5HLF A;  1JIH A;  2DVI A;  2FPH X;  1RJJ A;  1T9X A;  1R8P A;  4ZPA A;  1N0V C;  1VIS A;  4JI0 J;  2QSF A;  2E29 A;  2MQL A;  3ZTO A;  2EXU A;  4J90 A;  1MRO B;  4MYU A;  1EET B;  4JI3 J;  2IY5 B;  3H59 A;  4R5P A;  3DI6 B;  2QV6 A;  3BR8 A;  3IS9 B;  4PYD A;  4PYA A;  3OVS A;  2V2Z A;  2FJA B;  3QGI A;  2UUA F;  4ZPD A;  4P7V A;  3EPG A;  4B9L A;  4NCG B;  5T7L B;  2JHE A;  5ETK A;  4IRK A;  3GIM A;  2ASJ A;  2HBZ B;  2OEL A;  3C16 A;  3R8Y A;  3ADA C;  4DPO A;  5IWA J;  4DV0 F;  2V2Q A;  4IDK A;  3RBE A;  1TTH B;  1L5U A;  4MKY A;  4LR8 A;  2GML A;  3AJD A;  3AQP A;  3DFE A;  3K5M A;  4J9S A;  3FCW A;  2CPJ A;  5E0O A;  1QSY A;  5BR8 F;  3TVY A;  5ADZ A;  1QE1 B;  3O5T B;  1OS5 A;  4CNY A;  2Z2Z A;  1JKH B;  2W7A A;  4OX7 A;  3HVR A;  2ATL A;  2XYG B;  1IR0 A;  2P6T A;  1FNX H;  5D78 A;  3NNC A;  1GX6 A;  4KGV B;  1VQY A;  1ZAX A;  1K47 A;  2OP5 A;  2EEY A;  3DOK A;  5ETM A;  1XMQ F;  2HZV A;  4UY8 T;  4PKD B;  2IVY A;  3TEH B;  2YWE A;  2AMC B;  2IJF A;  4S0M A;  3CED A;  1KHV A;  4IFY A;  2XI2 A;  2Y8W A;  1RT5 A;  2RVJ A;  4ICL A;  1UP1 A;  2RML A;  2B51 A;  4BHQ A;  3PO5 A;  3UDV A;  1HW9 A;  1QTN B;  3A12 A;  2F8H A;  1RHQ B;  1R7I A;  3AQO A;  1QAI A;  3M6U A;  5HVH A;  4ECR A;  4YN3 B;  2OH2 A;  2CJ9 A;  4CYU A;  2AEM A;  5HO4 A;  1SIZ A;  1V3Z A;  3BYR A;  4USH A;  5EUH A;  4YME A;  2XYP B;  3LP0 A;  2F9D A;  1DQ9 A;  4RZR A;  3MR3 A;  2GQQ A;  3FQK A;  3KK2 B;  2B5J A;  1NKC A;  1VQ7 S;  1S97 A;  3HO1 A;  1F9H A;  2VFV A;  4DU8 A;  4V19 J;  3OUY B;  2E9Z A;  3M8Q A;  3P6Y C;  5A8R B;  4F3O A;  1F2H A;  1X0P A;  2JZ5 A;  4ED1 A;  2VOO A;  4LSL B;  3L7P A;  3CUN A;  1TUG B;  4DSL A;  2HBQ B;  3K5P A;  1RHJ B;  1JJ2 R;  4PQU A;  4F4A A;  2DIV A;  1U6Z A;  2VG6 B;  2QFJ A;  3FNN A;  3LGM A;  3VAK A;  3BGO P;  1IBM J;  1ZS6 A;  1TKX A;  2CQG A;  1N8R T;  1MMN A;  3NP5 A;  4MAK A;  2Y1L B;  4IR1 A;  2RQ4 A;  1JNR B;  2H4W B;  3OTE A;  3PW2 A;  2C2D A;  3M1V B;  1OPZ A;  3R5C A;  4FDF A;  2MZQ A;  1KLM B;  3DLK A;  3IGN A;  3ITH B;  3PRV A;  5F8G A;  3EYZ A;  2Z2M A;  1BXN A;  2SXL A;  2VFU A;  2ASL A;  3QNW B;  2M70 A;  3OHA A;  4FBU A;  2LQB A;  3PFE A;  1JQG A;  2F7V A;  2L08 A;  5FII A;  3NXZ A;  3D54 A;  3J7Z T;  2YKO A;  4ECX A;  1TMJ A;  1KTV A;  2MKY A;  4PQA A;  2ZWP A;  2CPI A;  4Y00 A;  4DUY F;  1S12 A;  4N5S A;  1FRK A;  4DR4 F;  1SJ3 P;  2HHP A;  1SKU B;  3DLG A;  4JV5 J;  3IRX A;  2E7W A;  2WW8 A;  1V6H A;  2BAB A;  4CO4 A;  1R0A B;  4QIE A;  5IC4 B;  4QR2 A;  3KWM A;  1MWQ A;  4DFK A;  3ISN C;  3HHL D;  2MXY A;  3POT B;  1NKB A;  2AEF A;  3P5B P;  1Y5L B;  3RRK A;  5GAD I;  4YHH F;  2M8H A;  1N34 J;  3MAQ A;  2V34 A;  3LP2 B;  4Q44 A;  3KLH A;  4DMZ A;  5B0D A;  1B4S A;  3CC2 S;  5KFB A;  2VBX A;  3I5C A;  2VA2 A;  2MGZ B;  2FVP A;  1GX5 A;  1QSS A;  1E6V A;  1OJ4 A;  2QA4 S;  2AX0 A;  2FZK B;  2ZBQ A;  2XGP A;  3OBI A;  4A46 A;  2QLX A;  1TL7 B;  3KJV A;  1VK3 A;  1HQU B;  1SJ4 P;  1N5Y A;  4MMO A;  2UXC J;  2JX2 A;  2BR0 A;  4KJI A;  1U1N A;  4RNH A;  5E33 A;  4JI7 F;  3SSR A;  1FJE B;  3AXK A;  2OPQ B;  3FEZ A;  3BN4 A;  1PC4 A;  3KHR A;  3ETO A;  3DNC A;  1H3D A;  2VBZ A;  3H0P A;  1O51 A;  3JAM Y;  3DHX A;  2XLJ A;  2CQ2 A;  3QT8 A;  5LOQ A;  3L4B C;  3NRB A;  1B70 B;  1SUQ A;  3D66 A;  3M2U B;  1VBK A;  3J7A 1;  1F2G A;  2H4Y B;  5IWA F;  2RU3 A;  4DV0 J;  4DSI A;  1YZ6 A;  1HWL A;  1NXI A;  1Q16 B;  3GJS B;  3RW6 A;  3TA1 A;  3RB6 A;  2FJX A;  4CCH A;  1GK8 A;  4FYV B;  3IR6 B;  3T1H J;  1WTF A;  4WE1 B;  5C25 A;  1AUS L;  2V94 A;  1IWA A;  3NGT A;  3JQM A;  1Q4R A;  3HLU A;  3M2V A;  4I7F A;  4TQR A;  1T9W A;  2KXN B;  3IWN C;  3FCV A;  2BJ3 A;  1B7F A;  2VV5 A;  1MML A;  2VL1 A;  1S1U A;  4WXO A;  2HVH A;  5CZV A;  1V9O A;  1E6Y B;  5C2G A;  4DL2 A;  4U8V A;  1JXV A;  2MLX A;  3ELH A;  1GXL A;  2OFH X;  4OYO A;  4RUA A;  3PV8 A;  1MMD A;  4LF7 J;  4LFA J;  1RAG B;  2VPY B;  1X0F A;  3OL9 A;  3QAT A;  4URS A;  5DDP C;  1TP7 A;  4N56 A;  2VIC A;  4C0O C;  3NBP A;  2CZV C;  3CCZ A;  4M5D A;  1XR6 A;  3MEE A;  5I3Q A;  1FRI A;  4FYW B;  2Q6C A;  1C1B A;  4WZQ A;  5F8I A;  3N6L A;  4K59 A;  1DBD A;  1FNO A;  2PII A;  2NZ4 A;  1AXQ A;  1MRO A;  5L1L A;  1TKT A;  4IR9 A;  2VBY A;  2ZOM A;  2BAC A;  4JI2 F;  3HT3 A;  1UFL A;  1FX2 A;  2HLU A;  2QC3 A;  5KFP A;  1VQK S;  4PUO A;  3H4D A;  2IAJ A;  2L9N A;  4JYA J;  4X66 F;  1RT2 A;  2CQH A;  4Q2M A;  4GMK A;  1GH8 A;  2WAQ D;  3MDF A;  2C3O A;  2QG9 B;  4AD6 A;  1KDN A;  2GNK A;  4F4Z A;  1TK8 A;  3R9L A;  1TKZ A;  4RPF A;  3P4U B;  4R0J A;  3QJP A;  5I42 A;  4A8K A;  4CLP A;  1RTJ B;  3J7Y U;  2R7T A;  5L38 A;  4TKT A;  2VF3 A;  4LFB F;  2A6M A;  3HX9 A;  4UOG A;  1JK9 B;  2YWF A;  1IR1 A;  1H6K X;  3RB4 A;  5A8W A;  2XMA A;  3R5J B;  2QA2 A;  3GFZ A;  2KHC A;  3OQ2 A;  2CAJ A;  1B99 A;  4LQ9 A;  2B5J B;  3ZZR A;  2VQE F;  1IQT A;  4PG7 A;  1TL4 A;  2HGM A;  2YPZ A;  3FFI A;  4J7C A;  3H42 A;  4ELV A;  3PFO A;  3ZZP A;  3H5U A;  1DTT B;  3DRP B;  3DLL Q;  1QD1 A;  2CPH A;  1FXL A;  1GTE A;  1G7C B;  4MTP A;  2IC3 B;  1XN9 A;  4Q7A A;  1YG0 A;  2DGW A;  1H72 C;  3OPK A;  3C46 A;  2BE9 B;  2EC0 A;  3FEY B;  4ANC A;  3NOG A;  2GS8 A;  4K4T A;  4V19 X;  1CVJ A;  1T94 A;  2AX1 A;  4TYA A;  4UTG A;  5CH7 B;  4WYL A;  1FKA F;  3Q8S B;  1FK9 A;  2K1R B;  5L46 A;  4AYB D;  2MST A;  4M5J A;  4ELT A;  5D0H A;  1X4H A;  1DAR A;  4NEZ A;  2IJR A;  2ZOF A;  1SI9 A;  1TZ0 A;  5D4N A;  1WC6 A;  4NLW A;  5CAB A;  4EZ6 A;  1IBC B;  1MN7 A;  2KJW A;  4NEY A;  5CQG A;  2YY3 A;  3G82 B;  1XNR J;  1S48 A;  2HS3 A;  2MZ1 A;  4PG6 A;  1ZTT A;  5GVQ A;  1U24 A;  2LP4 A;  5K8N A;  1KVI A;  4A8Y A;  2HZA A;  1URN A;  4HDG A;  3CJQ A;  1Y0H A;  2K8G A;  3FEX B;  5ETL A;  2HWH A;  2H51 B;  3DLE B;  3VGV A;  5IC6 B;  4F0K A;  4ED5 A;  3V6D B;  2C2Z B;  2IM1 A;  3WIV A;  3P49 B;  1UJ6 A;  5F8H A;  1MWZ A;  5KG6 A;  1HPZ A;  2I5J B;  4DUT A;  3NG8 A;  4Z37 A;  4I6Y A;  4KY3 A;  2IA6 A;  1P27 B;  3HVT B;  3IRW P;  2QO3 A;  1XNQ J;  1UZD A;  2CJQ A;  2V4Q A;  2UU9 F;  3EDR B;  2D9P A;  2QSW A;  5KFL A;  1NU4 A;  1JLB A;  1OO0 B;  4M5I A;  5HMY A;  2HHU A;  2KL8 A;  3JQJ A;  2WB4 A;  3MUT P;  2XZD B;  2ZNY A;  5KFD A;  2XNQ A;  4WTO B;  4P74 A;  3J7Y I;  5ETS A;  1XER A;  3W8P A;  4OV6 A;  4XDC A;  1OSD A;  4ZPV R;  3MXH P;  2W2M P;  2FHO B;  2ZH2 A;  2LQ9 A;  4WWS A;  1WD6 A;  5EGY A;  2YKN A;  5KT6 A;  3RU0 A;  1Y11 A;  3BGF A;  3UNY A;  3ENA A;  4RLE A;  5C24 B;  2VC1 A;  4ZP6 A;  3KLF A;  3CD6 S;  4RU2 A;  5IT9 U;  3Q23 A;  3NCP A;  1JLA A;  3BKU A;  3R27 A;  2RT3 A;  4Z2X A;  4X64 F;  2E1A A;  3G8T A;  3HHE A;  2ZD1 A;  1D9D A;  1RXO B;  1NH7 A;  4KFB A;  4CNZ A;  3PNI A;  4USW A;  1CPZ A;  1T9V A;  3CSK A;  4IDK B;  4J9O A;  3LTO A;  2W8K A;  1VQL S;  3CCE S;  5F3Z A;  1LWE B;  3NCR A;  4WCE Q;  2XMU A;  3I5B A;  1MG7 A;  3V4I B;  3PJ9 A;  1MW7 A;  1T11 A;  3ZXW A;  4UF4 A;  2XY5 A;  2MQO A;  1SC1 B;  2L9W A;  5IT0 A;  3K5N A;  2WK4 A;  5D4P A;  3T1A A;  3UCG A;  3VR1 A;  1WDT A;  5DG8 A;  2ZHB A;  2ZH4 A;  1SQG A;  3DMJ A;  1SC4 B;  1K1S A;  2F8M A;  4FVM A;  4DOZ A;  2XCA A;  2YX4 A;  2NSB A;  2ZBR A;  1UFW A;  2LVW A;  2VKZ G;  3GIJ A;  5KFZ A;  1M0S A;  1MU2 A;  2W24 A;  3JAM U;  1QSL A;  1RT7 B;  2LU2 A;  1Q82 T;  5J2P A;  2O5D A;  1L3T A;  2YNI B;  4OI0 A;  4LQ3 A;  1U47 A;  2I38 A;  4QW8 A;  1FDB A;  3AH6 A;  3R7N B;  2N3O A;  3FSI A;  3KLV A;  1X9M A;  1O5J A;  5CAA A;  1W25 A;  3MM9 A;  1ZPV A;  3C6U A;  3TAM B;  4RNO A;  4PUO B;  4PXC A;  4DQR A;  4DL5 A;  2M3D A;  2FLP A;  4RJV A;  3O8W A;  3TAM A;  2IM0 A;  4DLE A;  1O8B A;  4D3G A;  2W9A A;  1KHW A;  3CDU A;  4I68 A;  4NLS A;  4JV0 A;  1P1L A;  1WI8 A;  5IT9 Y;  4NMX A;  3I4H X;  2D41 A;  3E01 A;  3MF5 A;  1Q8I A;  4JP8 A;  2RHQ B;  3HDS A;  5IOL A;  4WFB Q;  4ZMM A;  1HYS B;  4ID5 A;  1CJK A;  2FHM A;  2C3M A;  4D3H A;  3GU0 A;  2O66 A;  2V4J A;  2NXN A;  1NUE A;  2BJ8 A;  5HI7 A;  3WC2 A;  4X2B A;  1S59 A;  1Y7P A;  2ZNZ A;  3K5O A;  4C0H A;  2ZHA A;  1AYE A;  1NK6 A;  3LP1 A;  5B0A A;  1Q95 G;  2EC2 A;  2Z56 B;  4OX9 F;  4EK2 A;  5LJ5 Y;  2QFI A;  2ASD A;  2NUH A;  2OSQ A;  1KEK A;  2NQP A;  4FYD A;  4GRS A;  4N7T A;  1U8W A;  2W2Q P;  3W60 A;  4CP5 A;  5EDW A;  2ZM6 J;  3M2R B;  3VCD A;  1S1W B;  3OR2 B;  2BRL A;  5C42 B;  2QT7 A;  1LWE A;  1EB0 A;  4RUB A;  1IKW B;  1S1W A;  2CVI A;  3OR2 A;  3Q8Y A;  3SCL E;  2DNK A;  1XNR F;  3IAM 9;  4DQI A;  3UNG C;  4KAI A;  5EWF A;  4M5M A;  4FS2 A;  4DXL A;  4KR0 B;  2BQU A;  4U7C A;  1MNE A;  3HI9 A;  4DSF A;  4C8O A;  4LF6 J;  3EVW A;  1KBR A;  1RT1 A;  4DDF A;  3BSA A;  2B0G A;  2OEM A;  2YXL A;  3W66 A;  1VQ6 S;  4J9L A;  3TVZ A;  3CC4 S;  4PPZ A;  1N54 B;  2NPI A;  3V5R A;  3WX4 A;  2BV3 A;  2BQ3 A;  2HND B;  2RIL A;  4I69 A;  3BGL A;  5IM0 A;  4IKA A;  1S0O A;  4RU9 A;  4OJG A;  5K8M A;  2EFV A;  4LF4 F;  3GQC A;  4J9M A;  8ATC B;  3H2L A;  4HI2 A;  2N3L A;  1KFS A;  2AJ0 A;  1UEV A;  2KT5 A;  2R7R A;  4Q0B B;  3EMT A;  1X60 A;  2C3U A;  3THV A;  3EIC A;  3BPD A;  3KUG A;  1U09 A;  2OAU A;  3HT0 A;  3DGP A;  1YBT A;  4PWW A;  3UE2 A;  3ZC4 A;  4W90 B;  3AOD A;  3TX8 A;  3NAI A;  2PA8 D;  5KG2 A;  2AD9 A;  1M5P C;  2Z57 B;  4H4M A;  2HEK A;  3KFW X;  1A6L A;  2FZC B;  2QTW A;  1M1K T;  3U1M A;  1X4E A;  3HP6 A;  4NZ7 A;  1VJW A;  3V81 A;  3K8W A;  3TRG A;  2BJ9 A;  2ZJR Q;  2CPE A;  1U1O A;  5KFT A;  2MQQ A;  1NPR A;  3CNQ P;  1HFE L;  2DIS A;  3AD9 C;  3GJT B;  4QIW D;  4DR6 F;  3CCW A;  2CNL B;  3HFK A;  3MED B;  1YK9 A;  4PXE A;  2HFU A;  4FKY A;  2AW0 A;  4EWT A;  4I7F B;  1FRJ A;  2ZZT A;  2RRA A;  1ZAV A;  3AD8 C;  4P73 A;  3ZO7 A;  5IM0 B;  1U1P A;  1WHV A;  4IFY B;  4YFU A;  3ONQ A;  2EPI A;  7FDR A;  4DFP A;  4JV5 F;  2ROE A;  5GME A;  1FTC A;  1CS4 B;  2FQQ B;  2MY7 A;  4LUB A;  3HHL B;  3ZNU A;  5GAE U;  2BXJ A;  5LMN F;  5KG1 A;  4ETX A;  5EWG A;  2BJ7 A;  4X4N A;  1RGV A;  5DQH A;  2RS2 A;  2HW3 A;  3C14 B;  2AJ2 A;  4O0I A;  1WEZ A;  3QRP A;  1TK0 A;  1VCT A;  4CI0 B;  1K0T A;  4OJ3 A;  3TAN A;  5E7O B;  4EFA C;  3B54 A;  1UTA A;  2V8H A;  3BQ2 A;  4F8R A;  1NB2 A;  2BE2 B;  3QSI A;  2CDQ A;  2PEB A;  4ECV A;  3I31 A;  2MHN A;  3D3C J;  2M52 A;  4MYT A;  3DLB A;  3JTN A;  1HBM B;  4KKO A;  1IKW A;  1R8B A;  4DS5 A;  1S0M A;  3R5A A;  3AJ2 A;  2MSS A;  8AT1 B;  5GMK a;  2I5J A;  2XCP A;  2C28 A;  2AJQ A;  5H9F K;  5THW A;  6AT1 B;  1GXT A;  2VFT A;  1YJN S;  5DGA A;  3R2C J;  3MM5 B;  4USJ C;  1RAO A;  2WOM B;  4JBC A;  2O67 A;  3PG9 A;  2A1B A;  1ZOT A;  4ES3 A;  1P8G A;  2V4R A;  1RAA B;  2PE8 A;  4C97 A;  4QW9 A;  4DV3 F;  2JWN A;  1EET A;  1FA0 A;  1RU1 A;  2H3E B;  2IYI A;  5F0W A;  4O3P A;  2GIR A;  2JLE A;  2KB2 A;  5F9L A;  3C2P A;  1QUP A;  4B3R J;  1QM9 A;  4WE1 A;  3CJR A;  1P9Y A;  1X4G A;  5C25 B;  2ZVS A;  2V5H G;  2DHG A;  2MHE A;  2NUU G;  3D67 A;  3GFX A;  3GG0 A;  3H2V E;  3HHL A;  2IAJ B;  3R5D A;  3UCZ P;  1OWX A;  2COL A;  2DR6 A;  1LK7 A;  3EGV A;  3M30 B;  1LEO A;  2D1C A;  2Z0G A;  3E8O A;  2F65 A;  4JOU A;  4OI3 A;  5T41 A;  1S1T B;  2DCU B;  4DCJ B;  3KG4 A;  4K0K F;  3ILI A;  3NGK A;  4KO0 B;  4L76 A;  4P2S A;  4WYW A;  4ZCK A;  3VQT A;  1CUL A;  4DX6 A;  4J9R A;  4EZ9 A;  2HNY B;  3MWB A;  3SQO P;  4I6A A;  3VAL A;  1CBK A;  1HBO A;  2GGP A;  2VOP A;  3NKY A;  2GJF A;  4H4M B;  1J5E F;  4FVC A;  2D69 A;  3A13 A;  4L3N A;  3SIP B;  4Y2C A;  4ED6 A;  2HAF A;  3OL6 A;  4FXV A;  3IBF B;  3ZTS A;  1Y4Z B;  3MTJ A;  4LF5 F;  4NE9 C;  1DRZ A;  1N5V A;  4CTA B;  2J6U A;  3KTQ A;  3M7V A;  2HSE B;  4DV6 J;  1S9E B;  2H9Z A;  1R6Y A;  1SJ1 A;  2CFX A;  2E1P A;  3EE3 A;  2QIF A;  2JRS A;  1ZZF A;  3SDE B;  2MQN A;  4DV5 F;  3RAQ A;  3HM9 A;  3T41 A;  4C9D A;  2HND A;  1BQX A;  2ZC4 A;  3X1L B;  5K8O A;  3LGN A;  1VQ5 S;  3A4T A;  3CW2 C;  1DHM A;  1VHI A;  1VC0 A;  1BQM B;  1GNK A;  1RT4 B;  3DDK A;  5KFI A;  4C11 A;  1NK8 A;  1SVD A;  2BDP A;  2ZVI A;  4BBY A;  2IRY A;  2IRU A;  1LWC B;  2J0X A;  2M7S A;  4K7Q A;  1GMW D;  4WU3 A;  5D4L A;  2PN6 A;  3UVJ B;  5HMW A;  4Y0F A;  2KFY A;  3SZ2 A;  2XS2 A;  1U7L A;  1HQE A;  3N9U C;  5DET A;  2R7V A;  2DHH A;  2J7U A;  5IQ6 A;  4F4Y A;  5A6W A;  2VB6 A;  1OPI A;  3DYA B;  5M2R A;  1VS3 A;  2VKR A;  1DTT A;  3DRP A;  3HFV A;  1UJ5 A;  5FDL A;  4DZD A;  2AJ1 A;  1F3V A;  1HPZ B;  3I96 A;  5IXU A;  3A8J A;  1JLQ B;  1RAD B;  2RS8 A;  4FYX B;  2B9X A;  4DV7 J;  2KXH A;  1SV5 A;  3DCA A;  2NR0 A;  1JLC B;  1Q1K A;  5I3U A;  3NAH A;  2HNZ B;  4WFY A;  3DXB A;  4ECU A;  2UUW A;  1J5E J;  1Z2Z A;  4L72 B;  1Q78 A;  4ICL B;  3OLB A;  2XB2 D;  2BJE A;  2V2K A;  3M8Y A;  3TW0 A;  4B08 A;  4BC9 A;  1Y5N B;  5KFQ A;  2XO6 A;  4C11 B;  2VHG A;  4OZN A;  3QBC A;  3PKM A;  2AQ4 A;  2NXE A;  1YWX A;  5HMZ A;  2CWX A;  2KU7 A;  2CA9 A;  1H74 A;  2XHW A;  4A8X A;  2ACM A;  3NOC A;  4IRC A;  3M4X A;  3DGV A;  3PW7 A;  2MYF A;  4ZVP B;  1FT8 A;  4CLT A;  4CWB A;  4DSJ A;  4O23 A;  1RKJ A;  1UWB A;  3JSY A;  4CLS A;  1WKJ A;  1Y9O A;  3PTW A;  1MSW D;  5HAO A;  4H4O A;  1UWB B;  3CVK A;  5E2Q A;  4EBD A;  2HMI A;  5K14 B;  4MKV A;  3PRD A;  2W7O A;  3E2E A;  2GA7 A;  5D0G A;  4USU A;  4K5S A;  5BJR A;  2DEJ A;  4GKK J;  2BKN A;  2C2O B;  2FJB B;  3L95 X;  5J1P A;  3U1N A;  5AE2 A;  3W7B A;  1RT2 B;  5JXS A;  1H7X A;  4DR6 J;  3SFU A;  2G1D A;  1WF1 A;  1CS4 A;  1WG4 A;  3M8W A;  3NGS A;  2DR9 A;  4NLU A;  2C2M B;  3TR5 A;  3S8S A;  2M4M A;  1FKP B;  2VDH A;  4L75 A;  4RW8 A;  3W8G A;  4DPT A;  1S49 A;  5KT2 A;  3BN7 A;  1ZZN A;  2IMW P;  4DFJ A;  1ZBT A;  3HZG A;  4NOH A;  4KGM A;  2XEX A;  2XY7 A;  4JI2 J;  2ILY A;  1U02 A;  2RF2 B;  1IKX A;  2Y1J A;  1FWK A;  3K5L A;  1HQ2 A;  3CD0 A;  1LKZ A;  4NYP A;  4PRF A;  2EFQ A;  3BM7 A;  3FFI B;  3MCN A;  2ASY A;  3TAR A;  2ZJP Q;  1Q81 T;  2DGV A;  2OPQ A;  1YJ7 A;  1XR7 A;  1DTQ A;  1TQL A;  4RW9 A;  2W9B A;  6FDR A;  4E8U A;  3X3U A;  3MGJ A;  1FEE A;  3R3T A;  4ITS A;  5L8R C;  3OVB A;  1EP4 A;  1VBY A;  4K0K J;  5HSP A;  4P10 A;  2RSQ A;  3Q2T C;  3GFY A;  4YR3 A;  2LKZ A;  1GFW B;  1RAB B;  3LA0 A;  5BYQ A;  4Q45 A;  3M1V A;  3DKD A;  2CIM A;  5KFY A;  4MIB A;  1YJT A;  3CDA A;  2P2C B;  4R5P B;  1T3N A;  1UVJ A;  3PEH A;  1U0H B;  2YKN B;  2V4J B;  4DR3 J;  5DJB A;  1CJV A;  4ZPT R;  2NPF A;  3KLE B;  1RT4 A;  1VLO A;  2G0C A;  2KVQ E;  1FVS A;  2N4D A;  3GSD A;  1U0H A;  3ENV A;  1S9F A;  2QE5 A;  1U6F A;  2IM2 A;  4I6W A;  4LBH A;  4R8U A;  3UDC A;  1K0V A;  4B3S F;  5CYM B;  3B78 A;  4HH1 A;  1CQM A;  1WKK A;  1J5O A;  2YKM A;  1U2C A;  2BM1 A;  1G6B A;  2XYH B;  2ZJQ Q;  4DV5 J;  2XC9 A;  3GJR B;  3DLG B;  2BW7 A;  2LFV A;  4IH7 A;  5JUM A;  3TQE A;  3N6M A;  2CVE A;  5E3A A;  3OUY A;  4M94 A;  2Y9H A;  4ERD A;  5KFC A;  5J1E A;  1KD1 T;  2W9B B;  1JLF B;  1GQE A;  4P72 A;  3SQG B;  4FYY B;  3U1L A;  3UD5 A;  3EX7 B;  2FYX A;  2FLN A;  4DF4 A;  4C98 A;  4RW4 B;  2UV8 A;  4K8R A;  4UOF A;  1SH3 A;  1VLY A;  3QLH B;  2NYH A;  1D9A A;  3DRS B;  2JLF A;  3H7H B;  1WNE A;  1KWM A;  1RA6 A;  1RTI A;  2EVZ A;  3TVK A;  3FQL A;  5HN0 A;  3OV7 A;  4GC7 A;  1N33 F;  4IFV A;  3KLI B;  1MU2 B;  1U49 A;  1VOM A;  4ANE A;  1KQS R;  3M6W A;  1RT7 A;  2I1R A;  3G82 A;  1BQM A;  3EZ5 A;  1N48 A;  4PWD A;  2DNY A;  3R5G A;  1NZ8 A;  4AXI A;  2OTJ S;  1S6U A;  3MOZ A;  5BYR A;  3GFH A;  4KHR A;  2F8E X;  4OHV A;  3IG1 B;  4TYB A;  2AV5 A;  1N5S A;  2DHS A;  1NDP A;  2U2F A;  3KXD A;  3MM7 A;  1WHW A;  4ZVE A;  3TEG A;  1YDL A;  1YJR A;  3KNA A;  1U0S A;  3BR9 A;  4JI6 F;  4P71 A;  3UR3 C;  1XBW A;  2XMM A;  3MEG A;  5KFR A;  3NBP B;  4U67 Q;  3LPE A;  3M8Q B;  2KKH A;  4NLQ A;  4P7T A;  2QYC A;  4NX9 A;  4ALZ A;  1JLF A;  1DTQ B;  2M88 A;  4RW9 B;  2JDJ A;  1X7V A;  1RSC A;  2J9E A;  1N36 F;  1XWL A;  2LQJ A;  2B4P A;  4QR1 A;  1WC1 A;  2FVC A;  1S9G A;  3PYE A;  1H7W A;  2MJN A;  2YTC A;  4B9U A;  2I2Y A;  2BQR A;  5J2Q A;  1PAU B;  4KH0 B;  4DR4 J;  1M5O C;  4F0H A;  3WZ0 A;  2EFN A;  3M2V B;  3KLH B;  1FHT A;  1HIY A;  1V3S A;  2DCL A;  2V63 A;  4NXM F;  2BYC A;  1HNV A;  3EVO A;  1ARO P;  3W9J A;  1BD6 A;  1RWW B;  4OMF G;  3I9V 9;  5LSL A;  4X4Q A;  3K59 A;  2CJK A;  3HSD A;  2J7K A;  2X51 A;  4QPT A;  3DRR B;  3F73 A;  4DFM A;  1R27 B;  1QLN A;  3BPS P;  2CQD A;  5A0Y A;  4MH8 A;  1RHK B;  2DNQ A;  3TJ9 A;  1YRX A;  2UUB J;  3KK1 B;  4OX8 A;  2MLY A;  4HVZ A;  3JB9 k;  5ETV A;  2YX7 A;  1JLC A;  3FKB A;  3QPI A;  4ENO A;  5KG5 A;  1UKU A;  1QDU B;  1U2R A;  2ZHO A;  3FZB A;  5FLX Y;  5LMU J;  4DCP B;  2C22 A;  3HVT A;  3BYP A;  4IH6 A;  4IO9 Q;  4ZCM A;  2E5J A;  4O4G A;  4J91 A;  2PT0 A;  4W4M A;  1T03 A;  5KT5 A;  4B3T J;  2HG4 A;  4USK A;  2VJU A;  4ECT A;  3CT9 A;  1RYS A;  1ICE B;  1KLM A;  3DLK B;  3QO9 A;  2AEJ A;  2GQC A;  1RBL A;  3T9N A;  4FP9 A;  4URQ U;  5D15 A;  1KON A;  3W2V B;  4U95 A;  4DQP A;  3KLF B;  2LYV A;  2CQ4 A;  4ZCI A;  2VJV A;  1HW8 A;  4ED8 A;  2B43 A;  4PCQ A;  4G1P A;  4DL0 C;  2VD3 A;  3RYL A;  4DLG A;  3SV3 A;  1CC7 A;  1NEE A;  3TAQ A;  2NRE A;  2IM3 A;  2QGF B;  3LUY A;  4DEZ A;  3UR0 A;  4IOA Q;  2RUG A;  5E5N A;  3MHY A;  5ETP A;  3BGU A;  1K9M T;  1UW4 A;  1KLN A;  2EW9 A;  1AZS A;  3CMA S;  4FF1 A;  2H5E A;  1U1R A;  2XLK A;  1X9S A;  1N6Q B;  1WC0 A;  2OFG X;  4XK8 C;  4J37 A;  2CJB A;  5KG3 A;  5L1J A;  1YTY A;  3O3L A;  4NXM J;  4QYZ K;  1JWW A;  2LLZ A;  4M95 A;  2B9Y A;  4LRA A;  2BUN A;  2LQ8 A;  2MKH A;  2QL9 B;  2WW4 A;  3G6V A;  1ZPW X;  2BBE A;  1BUX A;  3MUR P;  4QWA A;  3RR8 A;  2CAD A;  3CWJ A;  4OX9 J;  2FY8 A;  2A0F B;  3DDN A;  4I67 A;  1T9T A;  2XSJ B;  4B3S J;  2G0J A;  2W25 A;  3MCM A;  4DR2 F;  4JV2 A;  1Q5Y A;  1WAC A;  1F9E B;  1FFG B;  3W2W A;  1YVF A;  4LFA F;  3DOM B;  1FJ7 A;  4ZN3 A;  3QIP A;  4DPU A;  4LSZ B;  8RUC A;  3HJV A;  1VGY A;  1CJV B;  4FXW A;  3VVT A;  3KLE A;  2F3J A;  4ZPC A;  4J9U E;  3UDE A;  4ZJO A;  1GT8 A;  3SMZ A;  1NBE B;  2AYG A;  4LF6 F;  2EG2 A;  1H98 A;  3AAW B;  1RLC L;  1Z4U A;  2FVS A;  4JI0 F;  2HFS A;  3S6E A;  4ATN A;  1IBK J;  2MZR A;  3DXS X;  3KJQ B;  1DUR A;  1DLO B;  5H1S V;  2JC0 A;  3BDP A;  1YHQ S;  4PEO A;  4J9N A;  2D3O R;  2Q1L A;  4MT1 A;  5IZH A;  3CCR S;  1PKU A;  2YBV A;  3VVU A;  1N32 J;  3SCK E;  4ID8 A;  3O2I A;  4QWB A;  1VR6 A;  2XSF A;  1SB6 A;  2RJZ A;  3A8I A;  2N4C A;  5FDL B;  3I56 S;  4DV1 J;  3HJF A;  3EJM A;  3ZTP A;  4DV4 J;  5AXL A;  2D3U A;  4PAB A;  5EN1 A;  3CTR A;  1F60 B;  1VRU A;  3HF5 A;  4L74 A;  1RIS A;  2XMT A;  4I2P B;  5F8M A;  5JVG Q;  4PZV A;  3R97 A;  3TX0 A;  2P8I A;  2JEG A;  2XS7 A;  3HD1 A;  4ZN1 A;  1S7I A;  3BQ0 A;  2CPY A;  2QYG A;  3H2U B;  3TI0 A;  5U47 A;  1P6T A;  3RZA A;  5GAG U;  5B08 A;  4OZJ A;  5AJ3 J;  2FY1 A;  2DGT A;  1RWO B;  2MEW A;  2WVC A;  2GHV C;  1TKZ B;  3T5J A;  2E5I A;  1TKD A;  5DLG A;  3QJL A;  4USI A;  2RQC A;  1HNW F;  2NLW A;  2E9R X;  4OYM A;  1W2B R;  2WSF C;  4BCA A;  2VG7 A;  1T9Y A;  4LF2 A;  2Q43 A;  3UN3 A;  1WKL A;  3ZZO A;  2JSX A;  4DR2 J;  5A76 A;  3LWL A;  3OSN A;  4B9M A;  4DWI A;  1TVR B;  4ZP8 A;  4J9Q A;  4C8K A;  1I51 B;  5CCM A;  3MM6 A;  3AHP A;  2UVW A;  3I0R A;  3TP2 A;  3J81 U;  1RI7 A;  1TL5 A;  2XBP A;  2PD1 A;  3LOU A;  4MIA A;  2HS0 A;  1Y3J A;  2DPJ A;  1S77 D;  1VQM S;  2ALZ A;  1B0V A;  4DHV A;  2KG0 A;  2KYZ A;  2NXC A;  3IP0 A;  2FJW A;  4OQJ A;  2OTL S;  2X1B A;  3DHW C;  1YIT S;  2AYE A;  3AFG A;  4AE5 A;  4FN5 A;  4LRB A;  5IFM A;  1FRX A;  4N8O A;  1IBK F;  1WC4 A;  4A8F A;  3BEG B;  4WPA A;  2ZBP A;  3UPF A;  1CQN A;  1LW2 A;  2PEH A;  5ETQ A;  4A8Q A;  4KPY A;  3E3X A;  4HAC A;  5F9N A;  1DQA A;  1FTR A;  1AFI A;  3N5B A;  4F26 A;  3JXO A;  4YY3 J;  4U7U D;  2BVZ A;  2BOP A;  4HHH A;  1NHV A;  4HI1 A;  1O0P A;  2DO4 A;  2ZE2 A;  1D1U A;  1WUU A;  1JLG A;  2HRT A;  1RQ0 A;  2CG8 A;  1HWJ A;  1RWV B;  2Q79 A;  2YNF A;  3C66 A;  1DQ8 A;  1FDA A;  3EWG A;  4NYZ A;  4X62 F;  4YR2 A;  4UQG A;  3S1T A;  4EMD A;  4QBU A;  1YI2 S;  5C2C A;  5FD1 A;  3E51 A;  3TOQ A;  1NK5 A;  1VQ8 S;  1QE1 A;  1L3S A;  2FGC A;  5GAH U;  1ULR A;  1M1G A;  1T9U A;  3G87 A;  1B64 A;  4OYB A;  1PCA A;  4Y28 C;  4WK1 A;  4ZIT A;  4YUD A;  1X4B A;  4NAS A;  2GX8 A;  3K17 A;  2HIQ A;  4HH0 A;  5ETR A;  1SC3 B;  3VQS A;  4RNF A;  2JEJ A;  4LF1 A;  3MMA B;  3MAA B;  3BZQ A;  1JLE A;  2KI2 A;  1FJC A;  3MZI A;  4CRJ A;  4DSK A;  4LJM A;  4KH1 B;  2PSZ A;  4X4U A;  1Q8L A;  1HHT P;  1WJ9 A;  2N7Y A;  1IJF B;  1QJH A;  4DUZ J;  3N6N A;  1R31 A;  4Y34 A;  2HVZ A;  3LP1 B;  1FES A;  2O1P A;  5IS2 A;  2R8I A;  1PYO B;  5H9E J;  1SL1 A;  4XPE A;  3GP9 A;  5D77 A;  2ZE2 B;  3HVW A;  2W4C A;  4ZLJ A;  1FKP A;  2YKA A;  3AOB A;  4DL7 A;  2QX0 A;  3PIP Q;  2F4V F;  2V8P A;  3CJ2 A;  3FVY A;  3M9O B;  3DDI A;  2A10 A;  1VRT A;  1HBN B;  4K4Y A;  1N34 F;  2R2R A;  4ZDN A;  4LSL A;  4ZVQ B;  3L09 A;  1S1X B;  5CYQ A;  1Q8K A;  1C0T B;  2E7X A;  2EG1 A;  1VMB A;  2ADC A;  1OQ3 A;  3IRX B;  5D0R A;  5GAD U;  1T03 B;  1MN9 A;  3NEK A;  3HUL A;  1UVM A;  1WG5 A;  2HMI B;  3A3P B;  3RJM B;  4KV8 B;  1MLA A;  3OHB A;  4DR7 J;  3EXY A;  2OEK A;  1JJC B;  1R8C A;  1HNZ J;  1IKV B;  2HPU A;  2ZWO A;  4B3O B;  3I0S A;  4DV2 J;  1HA1 A;  3DC2 A;  2IBO A;  4EYH B;  3IFE A;  2W4D A;  4RR5 A;  4NI2 B;  1QVG R;  2V9W A;  4IG0 A;  5E3Q A;  4ZLN A;  1RT5 B;  2XMW A;  1TAQ A;  5JVH Q;  1S57 A;  5AXK A;  4R25 A;  3OXF A;  4ZPW R;  4AND A;  1OY8 A;  4RW8 B;  3AA8 A;  1Q86 T;  1VDH A;  3M30 A;  3RRG A;  1Z1Z A;  4PWU A;  4U8Y A;  2OD4 A;  2V9K A;  4DL4 A;  3HCX A;  1RT6 A;  2NCK L;  3FMW A;  1TFY A;  2AP6 A;  4TLR A;  3NMR A;  3BKT A;  2E44 A;  1S6P B;  2HLT A;  2GHP A;  2RDJ A;  2G13 A;  3H5S A;  3KNG A;  3MM5 A;  2XI3 A;  2ZZM A;  4I1T A;  1JLQ A;  1KR4 A;  4ED4 A;  3QSY B;  1PSD A;  2J76 E;  3Q24 A;  3NMA A;  2NS1 B;  1SKW A;  1SBR A;  2WRM A;  3WQP A;  4K5R A;  2BE7 D;  5D6G A;  1XTZ A;  3IM8 A;  4U96 A;  2P9C A;  1VBZ A;  2GMH A;  2V8D A;  4C8L A;  3IS9 A;  3I87 A;  3HKZ D;  4NA3 A;  2VON A;  1ZA2 B;  1LWC A;  3UVJ A;  2DXE A;  4F3Q A;  3HSJ A;  2H1Y A;  3G8Q A;  4XO0 A;  4EEY A;  1SL2 A;  1U45 A;  4OZL A;  4ZVU B;  3Q22 A;  4M5H A;  1LQ9 A;  2QLJ B;  2NXJ A;  3TZY A;  3BDE A;  1PBU A;  1UVK A;  5ITH A;  4G1Q B;  4CO3 A;  3NL0 A;  4CLW A;  4F02 A;  4K50 A;  5F3T A;  3T1Y J;  3DLH A;  5A8K B;  1XR5 A;  4DV2 F;  4F2S A;  4ZVO B;  1HI8 A;  4KQZ A;  5HL7 Q;  1BLU A;  3KK3 A;  4P2X A;  2I8E A;  3GSI A;  1SUQ B;  3VGU A;  4ZP7 A;  3BRE A;  3UQS A;  4B9T A;  1X5O A;  3V6H A;  4PG4 A;  2DT9 A;  3S01 A;  3M9M B;  2UUC J;  4TNO A;  3ET6 B;  4MJK A;  2PFF B;  4KV8 A;  3V81 B;  1S9G B;  4H54 A;  4YDD B;  1XC9 A;  2F63 A;  2FVQ A;  3ET6 A;  3DM2 A;  4DR5 F;  2DBB A;  4X62 J;  3D1H A;  4HTI A;  2MTL A;  2E5L F;  2DXF A;  1SQE A;  4CO5 A;  1S1U B;  1SJR A;  3BSN A;  2GIF A;  4I64 A;  2EFO A;  5I42 B;  4U9R A;  2MGZ A;  1T3O A;  2B7C B;  2EK6 A;  3N4W A;  4PG8 A;  2VA3 A;  2R7U A;  4RX6 A;  5F8J A;  4Q0B A;  5CD4 H;  3Q89 A;  1TEL A;  4PG5 A;  1AT1 B;  1XK8 A;  2CPZ A;  2VPW B;  2WHO A;  2F4F A;  1T05 A;  1SKR A;  2L41 A;  3H4B A;  3ZNJ 1;  4KIA A;  1RWX B;  1VQ4 S;  3MPW A;  1RTD B;  1G2E A;  3MI7 X;  3QT7 A;  2FZG B;  3MR5 A;  1VQ9 S;  5E41 A;  1Q5V A;  3ZTR A;  5KFS A;  5LMN J;  1ELO A;  4QWC A;  1VHF A;  5LXY A;  1SL0 A;  4MK7 A;  3TJA A;  1RAH B;  2NXU A;  1HNX J;  2V68 A;  4NRT A;  3SSS A;  4ZLP A;  2F5G A;  3KJF B;  2QJ3 A;  4IOC Q;  3CCV S;  3OXG A;  1JLE B;  2FJE B;  2KG1 A;  3JTP A;  4TVA B;  4O3N A;  3D1Q A;  2Y8Y A;  4ILL A;  3CUL A;  1RAJ A;  1I94 F;  2AYB A;  1NLK L;  2ZH6 A;  4CDI A;  3CB4 A;  2HVE A;  3WIU A;  1U48 A;  3RBZ A;  5L9N A;  3QZ7 A;  1G3O A;  2BJ1 A;  4WKY A;  1UL3 A;  2R7S A;  2J9D E;  3IR7 B;  4DQQ A;  4HHU A;  1SC6 A;  4A47 A;  3VAI A;  3FBB A;  2MZT A;  2LDI A;  3UW1 A;  4RNN A;  1QY7 A;  2VC0 A;  2KT3 A;  5D0E A;  1RHU B;  1VRQ C;  1IKY B;  3Q8U A;  3THP A;  4ED2 A;  1BWE A;  1R0C B;  3J80 Y;  2BOA A;  2RQK A;  4B17 A;  2OO4 A;  4NLR A;  3AOC A;  1UFK A;  3MMC B;  5HK4 A;  3RGI A;  2XZW A;  2XGQ A;  1HHQ A;  4NA1 A;  4Y3C A;  4JI4 F;  2DNG A;  2VUG A;  4QIV A;  4IO1 A;  3ISZ A;  5HQ8 A;  3UCU P;  3K89 A;  1UEU A;  3MEE B;  1NSA A;  4ZS6 A;  3J7Z 5;  2HBR B;  2CJA A;  3DLJ A;  3CCS S;  1VRU B;  4OFZ A;  4NCA A;  1KP6 A;  1C4C A;  4O4G B;  2DGS A;  4RW4 A;  1FE0 A;  2GV1 A;  5DDO C;  1CC8 A;  2PMH A;  3LQV A;  4H4K A;  2KFZ A;  2JLG A;  1UAW A;  3J80 U;  3F44 A;  4OYA A;  3IGV A;  1NJI T;  2DK2 A;  1C1C B;  4LIR A;  4QPX A;  4N8N A;  5ETO A;  1QAX A;  4DN0 A;  1L3K A;  2GHW A;  2GVD A;  5I4M A;  4DSE A;  4UY8 5;  4KHP F;  3V2U C;  3KLG A;  2J6T A;  2MQM A;  2BKP A;  2P9E A;  1G4C A;  4IG3 A;  4YEA A;  1E6V B;  2IVF B;  4CLU A;  3F0N A;  2NZC A;  3UD3 P;  3JQK A;  1F3F A;  3OTD A;  1U4B A;  4RWX A;  3IO1 A;  4Y65 A;  3T6J A;  2ZDO A;  5GAG I;  4ZJL A;  2HQI A;  1EX8 A;  2M2B A;  4QOT A;  4DV6 F;  5D8H B;  2C3P A;  1VQO S;  1GXU A;  5A8K A;  1B0T A;  3HK2 A;  1I94 J;  1CJU B;  1M1H A;  4GVB A;  3OL8 A;  1D0E A;  2E5H A;  2AKW B;  1RHR B;  2DGO A;  1MWY A;  3GLJ A;  4WII A;  4OI1 A;  1UZH A;  1NK0 A;  1U1M A;  1C4A A;  4TY8 A;  2GVZ B;  2IC3 A;  3QQC D;  5EWE A;  5B0E A;  3M8P A;  3KHL A;  3VAM A;  2Y1R I;  5KG0 A;  4M5D B;  3WBZ A;  2KZM A;  1RLD A;  1SV5 B;  1HWI A;  1T95 A;  3SQG A;  2RIJ A;  4CM2 A;  1YRT A;  1B0P A;  3AB2 B;  3QT5 A;  1PJ6 A;  5F8N A;  3DM2 B;  4RUC A;  4B3M F;  3JSM B;  4GO5 X;  1TL3 A;  3RAM A;  4XPC A;  1HMV A;  3CJ3 A;  3HMJ G;  1CJT A;  4ES1 A;  4X4O A;  3PW0 A;  4MKA A;  3CJ8 A;  5DGB A;  1S6O A;  2YKP A;  4LSN A;  2LEP A;  2VG5 A;  4DS4 A;  4KHP J;  2OHD A;  1YJV A;  1OY6 A;  3M6V A;  1VC6 A;  2UP1 A;  2HVD A;  3VGT A;  4R8U B;  3UWT A;  2VQF J;  2C2K B;  1HWU A;  4FS1 A;  4LFB J;  1BWV A;  3CCT A;  4YR0 A;  4N41 A;  2OUG A;  4O0N A;  3BO4 A;  4C48 A;  4UOH A;  4BC7 A;  1JLG B;  1WHX A;  3C3L A;  4I2Q A;  3JYT A;  7AT1 B;  1RWP B;  4USV A;  1FKO A;  3PKY A;  4DR3 F;  3JSB A;  1I1G A;  2QN6 B;  1C1B B;  1FRH A;  4OX6 A;  5DS7 A;  4G3I A;  5DLF A;  1HNW J;  1NSK L;  1C0U A;  2DNH A;  4DR1 J;  1U25 A;  2EFG A;  1VIO A;  1QVF R;  2EKN A;  1IWG A;  1EP4 B;  1JLB B;  2HKE A;  1V5I B;  2FHK A;  2IDL A;  3OFH A;  3W61 A;  4FF3 A;  3I5A A;  3W63 A;  5ETT A;  2QA4 G;  3GWC A;  2KXF A;  5AXN A;  3BQ1 A;  1NDK A;  4LFC F;  2YNH B;  5KAK A;  4F4X A;  5E3C A;  2DNP A;  4Y2M A;  4CO1 A;  3W5Z A;  5HQM A;  2BEF A;  1F5B A;  2HQD A;  1LW0 A;  3D1O A;  4ZPB A;  3TJ8 A;  1HI1 A;  1N52 B;  1U6B A;  5FLX U;  5T7L A;  1D09 B;  3ITH A;  5KFA A;  4ECS A;  2HZC A;  4DZ6 A;  4L3K A;  3M9N B;  1FRL A;  4KT0 C;  3DRR A;  3SCI E;  3ZZ0 A;  5F41 A;  2FIU A;  4QCL A;  1FVQ A;  4UT4 A;  1JJH A;  4CLZ A;  3JS9 A;  5CA5 A;  3KK3 B;  2YNF B;  2F1F A;  2HHT A;  2K7K A;  1N56 A;  3EVM A;  1RCO B;  4GKK F;  2BA9 A;  1FXD A;  1TU0 B;  2WSE C;  3PX4 A;  2B3T B;  2CQ1 A;  2U1A A;  2YWH A;  2DHX A;  2DRD A;  1N5Q A;  4O3S A;  1REV B;  1HL6 A;  1PO6 A;  3VHQ A;  2AHO B;  4C3M A;  3PEJ A;  2A3J A;  5A8R A;  4HDH A;  1TK5 A;  2ZH7 A;  4GKJ F;  3JTO A;  1ZM2 A;  1X4D A;  2PO4 A;  4F2R A;  3QO9 B;  5DZ6 A;  2DGU A;  2MKK A;  2E1C A;  3GZ7 A;  2OJ3 A;  1NDC A;  1PG5 B;  2CNK B;  2AZ1 A;  4DPW A;  4PXD A;  4F0M A;  2CG4 A;  1ZTW A;  3SV4 A;  3CJK B;  1HNI B;  3NY0 A;  1RT3 B;  3OR1 A;  4HEA 9;  1LWF A;  1H38 A;  4JI5 F;  4NCG A;  1S1V B;  3QMQ A;  1T0T V;  2J8S A;  4YOE A;  3M32 B;  3ZTQ A;  1RCX B;  3PR5 B;  2G2Z A;  3PW5 A;  3DI6 A;  3PIO Q;  4HKQ A;  3MPV A;  4FNH A;  1W2I A;  1K44 A;  3QWU A;  4J5O A;  3T5L A;  1WTB A;  1T05 B;  3P8B B;  5C24 A;  4CLF A;  1IKY A;  1HBN A;  2FLL A;  3PCO B;  4PPD A;  1WOP A;  1NH8 A;  5MAO A;  2B4V A;  1X5S A;  1HKA A;  2E7V A;  3D0G E;  5DDR C;  1RHM B;  4DUZ F;  1FFW B;  2DXD A;  3AXM A;  3HHL C;  1XEZ A;  3KJN B;  3MTK A;  3IXQ A;  4CZC A;  4BWM A;  5IT4 A;  4KC5 A;  4YB5 A;  2O3D A;  4M5K A;  1GMW A;  4TU8 A;  4MK9 A;  4NA2 A;  3VZI A;  4WFZ A;  4ZKA A;  1S0N A;  1JKH A;  5F0U A;  1HD0 A;  1KQF B;  5T14 A;  2W7P A;  4DF8 A;  2IVM A;  3NWR A;  3WX8 A;  1KVJ A;  4EBE A;  1ZH5 A;  4H4O B;  3W9H A;  2IPO B;  1Q0N A;  3FK4 A;  2CPF A;  2DH9 A;  3MCS A;  4M8L A;  1I3O B;  4NLP A;  5K5M A;  3VAH A;  4XDD A;  2XLI A;  2GQ2 A;  2PI5 A;  2LA4 A;  3S7R A;  2R8G A;  4UW2 A;  3EUN A;  2J0S D;  4G6V B;  2UVU A;  3SFG A;  5FJ4 A;  3R7B B;  3CPW R;  4FNI A;  2XNR A;  1YJ9 S;  2R7X A;  2LXF A;  2E66 A;  3LAM A;  3HXM A;  3NNH A;  2KRR A;  2HGL A;  4ZVG A;  1V5V A;  1KOH A;  4Y2A A;  3LWM A;  4J9K A;  1YBU A;  3QGP A;  1B3T A;  4QU6 A;  2VPX B;  1WF0 A;  2HGN A;  2EBG A;  2JFD A;  3C8Y A;  2JL9 A;  4HYK A;  1X9W A;  2JH3 A;  1JMT A;  4Q8F A;  2XMK A;  2WVD A;  3MMJ A;  4G1Q A;  4O44 A;  3UD4 P;  4NXN F;  4DQS A;  2GW8 A;  5KFG A;  2DRB A;  3R7S B;  3M2U A;  1B7Y B;  3SYZ A;  2HHH F;  4OHZ A;  4TLQ A;  3EGZ A;  2JVR A;  2DB1 A;  1OSC A;  3SCJ E;  3TWZ A;  3PVX A;  2RE1 A;  2PMW A;  1FDD A;  1PYT A;  1FJG F;  1ZA1 B;  1TMM A;  1YQH A;  3RB3 A;  1C1C A;  4X64 J;  2HYI B;  2FD2 A;  2XUL A;  2AT1 B;  1XMO J;  1C2P A;  1HWK A;  4AL5 A;  2EI5 A;  1EAY C;  1LOU A;  4HLB A;  3ZZU A;  3MAA A;  4KBI A;  3CGI A;  3HSG A;  5MLC V;  3MUM P;  2PDA A;  3U27 A;  2ZH5 A;  1F5C A;  3FZ2 A;  1SH0 A;  4PQU B;  3RG6 A;  4JI6 J;  2YPY A;  3I9Z A;  2VQF F;  1LWX A;  4C4W A;  1U2F A;  2OD6 A;  5KTQ A;  4YS2 A;  1X4C A;  1UMJ A;  2UZA A;  2DD8 S;  2GO8 A;  3CDE A;  2BAN B;  2UV8 G;  4C3K A;  5KG7 A;  1N36 J;  1IBL F;  1DJ0 A;  4CLK A;  3KDN A;  4O3R A;  3IA0 A;  2ZDP A;  5KOX A;  3WDO A;  5K20 B;  4AQY J;  3AOA A;  2MB0 B;  2UVR A;  1RWM B;  1SQF A;  2HHV A;  2CQB A;  1VQP S;  2VG7 B;  2CQC A;  4RBU A;  3GII A;  3CO9 A;  3BO2 A;  3BH6 B;  3IBW A;  4LBI A;  1PJ5 A;  1HBU B;  2R7O A;  2DRA A;  2H5J B;  1EKS A;  2YWG A;  2DNM A;  3MCO A;  1X5T A;  3BS9 A;  3TA0 A;  5KFW A;  5I3U B;  4CH1 A;  3E01 B;  3BV8 A;  1FDN A;  1HMV B;  1WWH A;  4A4J A;  2PC6 A;  5E3R A;  3TUP A;  5HAN A;  1REG X;  3M8Z A;  4OHW A;  3T9Z A;  5IV3 A;  3OVA A;  2QZ8 A;  4IYQ A;  1L3U A;  2HIY A;  5B0G A;  5KG4 A;  3P45 B;  5J2N A;  3JSR A;  5RUB A;  3LAL A;  3CJK A;  4R0E A;  1RTZ A;  4HR2 A;  3OSP A;  1BC6 A;  5J2N B;  2J9C A;  1URR A;  3ICL A;  2HNY A;  4KGZ B;  2N7C A;  4DV7 F;  2V67 A;  2V6A A;  3TQ1 A;  1KQG B;  4QWD A;  4EI2 A;  2LDY A;  3R6L B;  1UJ4 A;  1VI7 A;  3MPU B;  4TN2 A;  2C42 A;  2MKS A;  3KOA A;  4DPY A;  1S72 S;  2ZIT A;  5DM7 Q;  2B4U A;  3G2X A;  5AJ3 F;  1EQM A;  5KFN A;  3US5 A;  3M05 A;  2B6A A;  3BSC A;  5HRO B;  3Q86 A;  4WP9 A;  3MFH A;  1IBL J;  3ETM A;  1VQN S;  3CE8 A;  3PDN A;  4WFA Q;  3FRZ A;  3HHD A;  4ZK7 M;  4U7U K;  3LAK A;  4LMZ A;  3FJ2 A;  1T02 A;  3I82 A;  3K7R A;  4AQY F;  2CNN B;  2WOM A;  4K4W A;  4F4W A;  3T5K A;  1KC8 T;  4JV1 A;  1FX4 A;  1WHY A;  1UVN A;  2XO7 A;  2EK1 A;  4B3O A;  4J9P A;  5HVF A;  5L1I A;  1WEL A;  2K06 A;  1RWK B;  4UUW A;  2GMJ A;  4DX8 H;  3GON A;  3OFF A;  3TO8 A;  3GYN A;  4OZ1 A;  3W9I A;  3DLE A;  3F41 A;  4Y6I A;  5GAH I;  2KHD A;  1IVZ A;  4CH7 A;  2UXD J;  2CZ9 A;  4KTQ A;  1S1T A;  4M5G A;  4KSE B;  2HFZ A;  5E3P A;  4WKR A;  3GYG A;  3G6X A;  1Q7L B;  1TUW A;  2R3V A;  2Z4P A;  1KS2 A;  2KRB A;  2GZO A;  2XMV A;  4USM A;  3LH2 S;  2W9C A;  1VRT B;  2GFF A;  3MMC A;  4C7Q A;  1H2T Z;  3V6K A;  3FCH A;  4RW6 B;  5KFF A;  1LFP A;  2X1G A;  3OFE A;  3OTO J;  1WC3 A;  4AXJ A;  1APS A;  3MPY A;  5BXI A;  5EX3 A;  5HVG A;  3OLA A;  2AU0 A;  4FF2 A;  2Q66 A;  2DY1 A;  2DY9 A;  2R4F A;  2WBM A;  3DOL A;  1RWU A;  5GMD A;  4CIO A;  3L3C A;  3RB0 A;  2LXU A;  3OTC A;  5H9E K;  2UXC F;  4ZA1 A;  1KKH A;  2HRY A;  2YQ0 A;  2CPD A;  4RBV A;  1ZET A;  1TL3 B;  4OJ1 A;  2HK2 A;  1FXR A;  2C3Y A;  5SZT A;  4ECQ A;  4U6P A;  1WOS A;  3QLH A;  1GMU A;  4OYX A;  4OHY A;  3K57 A;  5HBM A;  2ZZN A;  2D74 B;  3W62 A;  4JI4 J;  4M5L A;  2VH7 A;  3DU5 A;  3JSM A;  2ZKT A;  3EM1 A;  2HHH J;  3HFZ B;  2Y1I A;  3WC0 A;  5G4D A;  4Q2L A;  5KFK A;  4O3O A;  1RAF B;  1RBO B;  4DV1 F;  1S79 A;  2YQ1 A;  5DG9 A;  4ED3 A;  3L7U A;  4X4V A;  1RTJ A;  4ZP9 A;  5CYJ A;  1XMO F;  2EBE A;  2KM8 B;  4OI2 A;  3NS7 B;  1R3N A;  2J0W A;  1PYS B;  2L3M A;  3NCQ A;  2QMU B;  2ALY B;  1R0B G;  1VK8 A;  2BX6 A;  2CYY A;  3Q83 A;  2VPZ B;  3A3O B;  1AB8 A;  3PM9 A;  2RKI B;  1FWP A;  2IA0 A;  3ENW A;  1GAO A;  5M2P A;  3EPI A;  1RP5 A;  4ER8 A;  2F4V J;  3AA9 A;  1FK9 B;  2MJU A;  3QYY A;  2AGP A;  1KN6 A;  4L73 A;  4LVO P;  1T8E A;  2OSR A;  2IBK A;  1IJE B;  3UN2 A;  3PX6 A;  1IKV A;  4LRD A;  3CC7 S;  4I2P A;  3BB5 A;  3EZU A;  3FBE A;  2ADB A;  2FTR A;  2ZM6 F;  3P96 A;  4CTA A;  2XSJ A;  1D9F A;  3CXC R;  3OFG A;  1LW0 B;  2AGQ A;  3D7S B;  3PO4 A;  1UVI A;  2DH7 A;  3PRB A;  3ZZT A;  5AE1 A;  3M8R A;  3C15 A;  1DAX A;  2C2R A;  2D3Z A;  2JOQ A;  3NS6 A;  2ZH8 A;  4CYU B;  1EIY B;  2K2P A;  3UDL A;  4RL1 A;  2XZT B;  5KOW A;  3N0V A;  1S6Q B;  2V2V A;  2DNR A;  2LA6 A;  4EYI B;  1VC5 A;  1JLA B;  4KO0 A;  4DR7 F;  2YNI A;  3KJV B;  1HNX F;  2Z30 B;  3V4M A;  2DR8 A;  3CJ0 A;  1D8Z A;  3TZZ A;  2ZH1 A;  3VWS A;  3K58 A;  4B3M J;  2N82 B;  4BDP A;  2CQ0 A;  2KDO A;  2QMX A;  2HBY B;  3ILL A;  3MD1 A;  5H9F J;  2KH9 A;  1N33 J;  4OYP A;  2XG8 A;  4K4Z A;  1WG1 A;  2J8A A;  4O44 B;  2UUA J;  3P5T L;  2Y0B B;  3SXL A;  1SIW B;  5DDQ C;  5G0R B;  5IQQ A;  3C6T B;  2HQ3 A;  3ISN D;  5CCL A;  5A2Q Y;  3Q2S C;  2FHJ A;  2HFO A;  3I55 S;  1QTM A;  4M63 A;  2R8J A;  2DGQ A;  3FC9 A;  4RKU C;  5K8P A;  3ULH A;  2FJD B;  3QWP A;  3LF0 A;  4NLY A;  1NAQ A;  2I9S A;  4AL6 A;  1XIQ A;  1RTI B;  3CME S;  1NKE A;  3VZH A;  4JI1 F;  2I6W A;  2HNZ A;  1YKW A;  2RNE A;  1SJF A;  2YX1 A;  3HHN B;  1SCJ B;  3AJ1 A;  3QFH A;  4OYZ A;  2C2E A;  3GJQ B;  1NJX A;  1DZ5 A;  1NK9 A;  1N88 A;  2DR7 A;  1VQS A;  3KUE A;  4LF5 J;  4LRC A;  5DQI A;  4WJB A;  4ZHR A;  5DQG A;  4NRU A;  3C14 A;  4ZCL A;  2XY6 A;  5B0B A;  2W2O P;  3RRH A;  5SUH A;  2P5V A;  1HR0 F;  3VF0 B;  1RT6 B;  2CQI A;  3OJS A;  2KJV A;  2OKQ A;  5CYM A;  4GVL A;  1SPB P;  3N79 A;  4WTY A;  4FXD A;  4MIW A;  3D28 A;  1UA1 A;  2C2N A;  4UST A;  2R7Q A;  3UFC X;  4C8N A;  1CJU A;  4DG1 B;  3GIL A;  3J7A N;  1NJZ A;  3FBF A;  2QMW A;  4QZV B;  4NCB A;  1UA0 A;  4N76 A;  3GE9 A;  4LF9 F;  1OMS A;  4XIU A;  4OYW A;  1SJQ A;  3Q8R B;  2V8V A;  4QR0 A;  4QU7 A;  3QT6 A;  3TUI C;  2BMB A;  3GCW P;  4F50 A;  2X7I A;  4PR6 A;  2JEI A;  1EQ0 A;  1EHW A;  3FMB A;  1WOO A;  1IR2 A;  4NYO A;  2RRB A;  3T1Y F;  4BS2 A;  2HK3 A;  3G6Y A;  5AE3 A;  2J9D A;  4A8W A;  3SBM A;  2UUB F;  2PGC A;  3TYT A;  3RBX A;  1ROF A;  2E1M C;  1Y5I B;  4DCO B;  4OHX A;  5HBM B;  3OJU A;  2LEB A;  4YQW A;  2EFP A;  4WZM A;  3P3D A;  3MMB B;  4YDX A;  1L3V A;  1HD1 A;  3IMQ J;  4E98 A;  2B8P A;  4OZ3 A;  3DGP B;  2AGO A;  4IQM A;  4QIF A;  2RF2 A;  5B7W A;  1K8A T;  4QYR A;  5J2P B;  3TAP A;  2QL7 B;  2IYG A;  4L6V 3;  2A2C A;  1NJW A;  2DGX A;  2J5A A;  2JEF A;  4B3R F;  1JNZ B;  3QID A;  2WBR A;  4UQT A;  2YNG A;  2B7B B;  3GYX B;  3IR5 B;  2R8H A;  4EGL A;  4RWW A;  4FPR A;  2MDA A;  4X4T A;  4CH0 S;  2K1R A;  1TV6 B;  2YNG B;  4WK3 A;  4TU9 A;  5HP1 B;  4O3Q A;  2VG6 A;  2JVO A;  2MKJ A;  2R9L A;  2FC8 A;  1A9N B;  2R2T A;  5AT1 B;  1HYS A;  1IXK A;  1M5H A;  1RAE B;  6FD1 A;  3G86 A;  2FLO A;  2ZBI A;  2W01 A;  3QAU A;  3NWG A;  3Q0A A;  3BSO A;  2LEC A;  2HHS A;  1WF2 A;  2DNL A;  2V8G A;  3CDB A;  2Z58 B;  3EZO A;  3CJ4 A;  3FUY A;  2ZKU A;  1OIA A;  4G1I A;  4CO0 A;  2OPP B;  5L39 A;  4ILM A;  4LF8 F;  2OPS A;  1O6X A;  1RTH B;  2Y3Y A;  1NZA A;  4NWB A;  1TUV A;  4RW7 B;  5J2M B;  4LF9 J;  1BQN A;  1E6Y A;  4K4S A;  1BGX T;  1LXN A;  1PGZ A;  4B9S A;  3KK1 A;  2MKI A;  4FF4 A;  2HWI A;  5LM7 E;  5DG7 A;  4NLG A;  2DNN A;  2DNZ A;  3MM7 B;  2X1F A;  3RBD A;  2VFR A;  2Z8Q A;  3FRY A;  4WBF A;  3DN9 A;  2PFD A;  3ZZY A;  2W9C B;  4C6A A;  4CLL A;  1FD2 A;  1QUV A;  1TV6 A;  1CG2 A;  2OPR A;  2QLF B;  4QWE A;  3PY8 A;  1DFD A;  2B4O A;  4G65 A;  4NLO A;  4WP3 A;  5HQL A;  2ATC B;  1A0O B;  7FD1 A;  1R6V A;  1D3W A;  3LW5 C;  4OZ0 A;  3CCM S;  1NM2 A; 
#chains in the Genus database with same CATH homology
 4AND A;  1HHQ A;  1NSP A;  1JXV A;  3ELH A;  1NDC A;  2AZ1 A;  1VYA A;  3PJ9 A;  2NCK L;  3FC9 A;  2VU5 A;  1NHK L;  3G2X A;  1WKJ A;  3ZTQ A;  3B54 A;  1NDL A;  3BBF A;  1XIQ A;  1NB2 A;  1K44 A;  1WKL A;  3Q86 A;  1HIY A;  3ETM A;  1NCL A;  3EVO A;  1F3F A;  4F4A A;  2DXD A;  1KDN A;  5CAA A;  3BH7 B;  3NGU A;  3R9L A;  2B8Q A;  1ZS6 A;  4UOG A;  2DXE A;  3NGS A;  3WX8 A;  4KPC A;  3FKB A;  4ENO A;  1B99 A;  3PRV A;  5C7P A;  5IOL A;  1NSQ A;  3FBF A;  2DYA A;  1S5Z A;  1LEO A;  1W7W A;  3VGU A;  1NUE A;  1EHW A;  4ANC A;  1S59 A;  5BXI A;  4EK2 A;  2DY9 A;  1XQI A;  3Q8V A;  3NGR A;  3ZTS A;  5CAB A;  2HVD A;  1MN7 A;  1U8W A;  3DKD A;  3VGT A;  4CP5 A;  4F36 A;  2B8P A;  2DXF A;  4W98 A;  4O0N A;  3EE3 A;  4UOH A;  3Q8Y A;  1BE4 A;  4FKX A;  3EM1 A;  3BBB A;  3VGV A;  1B4S A;  3Q89 A;  1HLW A;  1BUX A;  3EVW A;  3MPD A;  1NSK L;  1WKK A;  4DUT A;  3L7U A;  1PAE X;  1F6T A;  1LWX A;  2HUR A;  3ZTO A;  4DI6 A;  3GP9 A;  3ZTR A;  3DDI A;  2BX6 A;  1NDK A;  3Q83 A;  1UCN A;  4UOF A;  2BEF A;  3VVT A;  3EMT A;  4DZ6 A;  2ZUA A;  3EIC A;  3BBC A;  3FCW A;  1BHN A;  3BH6 B;  3GPA A;  3FBE A;  1MN9 A;  1NLK L;  2AZ3 A;  4ANE A;  1NPK A;  3JS9 A;  2HVE A;  3ENA A;  3EVM A;  1PKU A;  3FBC A;  3VVU A;  3NGT A;  4WBF A;  1NDP A;  3FBB A;  3B6B A;  3FCV A;  4C6A A;  2CWK A;  3Q8U A;  3EJM A;  3ZTP A;  3VGS A;  4HR2 A;  1S57 A;  4S0M A;  4FKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...