3FCWA

Crystal structure of the mimivirus ndk n62l mutant complexed with udp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
131
structure length
131
Chain Sequence
b'GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 40
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fcwA00
1XIQA 4ANCA 4CP5A 1PKUA 3BH6B 3Q86A 3FBCA 3B6BA 1VYAA 3VGSA 3FC9A 2BX6A 1HIYA 4ANDA 1NSPA 4W98A 2B8QA 3ELHA 3JS9A 1S5ZA 1LEOA 3ZTRA 1XQIA 3FBBA 5CAAA 3ZTQA 2HVEA 1F6TA 3VVTA 4F4AA 2DXEA 3VGUA 1LWXA 4EK2A 1NHKL 3NGSA 1NB2A 4DZ6A 3EVMA 1ZS6A 2DY9A 1B99A 3ETMA 1WKLA 3FCVA 3BBCA 3EJMA 1JXVA 4UOFA 1PAEX 3NGUA 1NLKL 4ANEA 2NCKL 2BEFA 3Q8UA 1MN7A 4WBFA 5IOLA 1F3FA 3FBFA 3L7UA 1HLWA 3EE3A 1NDCA 3BBBA 3DDIA 3BBFA 1U8WA 4F36A 3PJ9A 4DI6A 2AZ3A 3EICA 4S0MA 1W7WA 1HHQA 3VGTA 1BUXA 1NCLA 3EVOA 3ZTPA 3MPDA 1NPKA 1NDLA 2AZ1A 1NDKA 1WKKA 1S59A 4ENOA 3NGRA 1B4SA 2DXDA 5C7PA 3PRVA 1NUEA 3FKBA 3B54A 1NSQA 1MN9A 2B8PA 4KPCA 1NDPA 3Q83A 5CABA 1WKJA 3EVWA 2DXFA 2HVDA 4UOHA 4DUTA 4UOGA 4C6AA 2HURA 1NSKL 3ZTSA 3G2XA 3NGTA 2CWKA 3Q89A 3Q8VA 3Q8YA 4FKXA 2ZUAA 1BHNA 4FKYA 5BXIA 3EM1A 3ENAA 1KDNA 1UCNA 3BH7B 3GPAA 4HR2A 2DYAA 3R9LA 3ZTOA 3GP9A 3FCWA 4O0NA 1K44A 2VU5A 1EHWA 3WX8A 3VGVA 3VVUA 3DKDA 3EMTA 3FBEA 1S57A 1BE4A
chains in the Genus database with same CATH superfamily
3G6VA 4NPOA 4C3LA 3ILOA 1NJIT 4GRSA 2UUBJ 1YJVA 4KGVB 4WKYA 2C22A 1HBUB 1S6QB 1QVFR 1RP5A 5ETRA 1FDAA 4ICLA 4LT6A 4A8WA 2WAQD 1FESA 4W90B 3C14A 5DQGA 3MOZA 4DZ6A 4NYZA 2P9GA 1S9EA 4NMLA 1TVRB 1FRLA 2OJ3A 1GAOA 5GAHI 1W7WA 3KHHA 5GAGI 4A8OA 3W9HA 2K3KA 4ZS6A 3V4MA 2RB7A 3CCTA 5KFWA 4RW9A 4RJVA 4A48A 2DEIA 1UVIA 3Q2SC 4TYBA 1X4GA 3IRXB 1UTAA 2XM3A 3Q8PB 4QCLA 4ZPWR 2UP1A 5THWA 3F44A 2QA4S 2M88A 4P73A 4ECWA 1S57A 5LXYA 2B9XA 2BQ3A 4FN5A 2WVFA 2APOA 3R8YA 3KLHB 3KJNB 4IQXA 3N01A 2DNGA 5KFYA 3X3UA 2KDOA 2YKNA 3ZTQA 3DRSB 5LJ5Y 1ZTTA 2HHXA 5T41A 4LFCJ 1OQ3A 5E3AA 4KFBB 2UXCJ 1NHKL 1C2PA 3JXOA 1KQFB 1FX4A 2C3MA 3F56A 3UNYA 3KK2B 4ILRA 4AYBD 3DYAA 5ETSA 2R8JA 2RD5C 3SCJE 4P74A 1X31C 2RU9A 2BJ1A 2AZ1A 3G6XA 2MKIA 1RT4B 1CSJA 1FE0A 2BQRA 4JI8J 3L95X 4AL6A 3POTA 2QMXA 1O6XA 2VBYA 3G2XA 1UWBA 1FVQA 2IVFB 1WELA 1UEUA 4O44B 3OHAA 1UZDA 2CJQA 4K59A 3FQLA 4HH0A 1UVLA 1XBWA 2HKEA 3I87A 2QEXS 4CTAB 4M5KA 5HP1B 2GS8A 1C1CB 1T9YA 2WTFA 3HKZD 3T1YJ 3P8BB 1RAAB 4B3MJ 2HEKA 3M6XA 3GZ7A 1YRUA 3NWGA 1W25A 2DGXA 2HNDB 2CJXB 2RF2A 1OS5A 3MI7X 4USUA 5IC4B 4EYHB 1WF0A 1PAEX 3AAWB 2DBBA 4ZVFA 1IJFB 1CC7A 1JK9B 5F8JA 1ZPVA 2G13A 2EEYA 2KFZA 2DNKA 4DFMA 2DGSA 2DO0A 2KH9A 3EZ5A 4WP9A 2HRTA 1T11A 3T9ZA 1AXQA 1K0TA 2DIUA 2VG5B 2ZZNA 4DR7F 2KT5A 2MZSA 4C6AA 4FS1A 2FGCA 5HVGA 2WOMB 1LW0B 2Z56B 3DOLA 2RT3A 4CO4A 4C98A 3T3FA 1OPIA 3CTRA 2CZ4A 2Y0SD 2CQIA 2RS2A 4KO0A 4YHHJ 2XMWA 3KG1A 4I2QA 2XQCA 2OELA 3CDWA 1T95A 1MWZA 4B3SF 2CZVC 3DDNA 2OKQA 5C5JA 5B0FA 3MF5A 3N0VA 2AEMA 4KGZB 3KLGB 2P2CB 4WE1B 1REVA 2YBVA 3NS7B 3QZ7A 5HLFA 2KFYA 1BGXT 2DNRA 2RNEA 5J1EA 1Q78A 3ZNUA 1HHSA 1V9OA 3GV5B 2UV8A 2DH8A 1LW2B 2ZH3A 3HHDA 2MQ8A 2EWHA 3KJVA 2XSFA 4KHMA 1TMJA 1R6YA 3UR3C 5SUHA 4C0BA 1LKZA 5F3TA 1Z2ZA 1CS4A 4OL8A 1WWHA 1Q16B 4A47A 3DOMA 1S99A 5DZ6A 5E5NA 3FSXA 3TX8A 2B9EA 3BGOP 2FJDB 2WVDA 4RNNA 5B7WA 4RX6A 5IM0A 2RRBA 3BGFA 5F9LA 3KUGA 5B0BA 1Q4RA 1Y10A 2P6SA 1NEEA 1X5PA 2J9EA 2H1YA 2X3DA 1WKLA 4Q8EA 2GX8A 1IBCB 3NWRA 3DHWC 2J6UA 3J7ZT 2Q6CA 2Q66A 3CJTA 3DLGA 5I4MA 1XWLA 2IJRA 4JV2A 2FLOA 3KK3A 1WC3A 4MKYA 3OLAA 3W2VA 2GHWA 2FJEB 3WZ0A 4O23A 2JOQA 3NNCA 2ZOFA 3M30A 3R27A 5D6GA 2DK2A 1FNOA 3CCLS 1TL3B 1VHFA 3RTVA 2CKWA 2V6AA 5L8RC 2FVCA 1KD1T 2BE2B 3OT9A 4LSLA 2BMBA 3DGVA 2IA0A 1KRPA 5HBMB 4LF6J 3QGPA 3MAHA 3D9BA 3IR7B 1CEZA 1OJ4A 1RTDA 1R89A 4R8UA 2EFQA 3E01A 1KS2A 2CQBA 2ZZTA 1S12A 1REGX 1N5QA 3R7SB 2AU0A 2VFTA 1HBMB 3HCXA 4KR0B 2KG0A 3R5JB 4KIAA 2BM1A 1B99A 1VK3A 4MAKA 1IKVB 1U1LA 4LRAA 2A18A 1QJHA 4DR5F 3KNAA 1HLWA 3EE3A 4OX6A 1S48A 1KEKA 2J76E 1JLCB 3B78A 3TZXA 1FWLA 2G0CA 1YWXA 2GQ2A 3MEEB 2AJQA 3ZNJ1 2XGQA 3M8PB 4HEA9 4TY9A 4ZHRB 1HPZA 1DTTB 4ED7A 1R27B 1U6FA 2RIJA 5A8RA 2LA4A 2H5IB 2UUTA 1NSKL 4OZ0A 4DEZA 1M1GA 4ZLLA 2BACA 1WG5A 1MROA 2ASLA 3MPWA 2VOPA 4RUBA 3PACA 3IAM9 1I3OB 5FD1A 1RACB 3Q24A 1YRTA 3D67A 1RAEB 3N9UC 3ITHB 4MJKA 4IRDA 2KXHA 7FD1A 4RWXA 1F0XA 3QLHB 5HROA 2LA6A 5IV4A 4NXNJ 2QC3A 2CG4A 2J0SD 3PIOQ 3O6QA 4Y2CA 2LQJA 3O2IA 1XC9A 1RT5B 1J2VA 1VQ5S 2ROPA 2ZE2A 3HSDA 1VQNS 2KI2A 1Q95G 2W9CA 2ZDPA 4X65J 4A46A 4RBUA 4ITSA 1YBAA 4EBEA 1FTCA 4NLYA 1Q7YT 3BEGB 1WKJA 5ETPA 3PR5B 2QLWA 1S1VA 1TKTB 4NI2A 4OHZA 5J2MB 3LP2B 1AUDA 2ZJQQ 1DARA 5MLCV 2XHWA 3W1YC 4DR7J 2UVRA 2FUG9 4L3NA 4DX8H 2V9KA 4AD6A 4F4WA 4M5GA 5ADZA 2IDLA 3VVUA 2WCXA 1HWUA 2OIHA 4JI3J 1V5IB 2HBRB 5CXTA 4LFAF 3VGSA 3JSMB 1P27B 1U09A 1UJ6A 2V4JB 3BDPA 1NAQA 1R8CA 4KY3A 2EG2A 3UN5A 3KFWX 1EQMA 4B3SJ 4OHVA 1LXJA 1RTZA 4X64J 5D77A 4U8YA 3MM5B 3R5DA 1HI0P 2VBWA 2BEFA 3GG0A 2V34A 4P2SA 3NP5A 1NDCA 4F02A 5CYQB 4RU2A 3MPDA 3KLEA 2DTJA 4Q0BB 2YKMB 3GV7B 4RKUC 2BJ9A 4USWA 3V2UC 5IWAJ 3I32A 4UQGA 2ZNYA 2HS0A 1W26A 4ZVHA 3R2DJ 1TELA 4ATNA 1KDNA 1S7HA 5D0EA 4QIGA 3HHLC 4I2PA 3NCQA 1LEOA 1VQSA 1DURA 1BXNA 4Z7CA 2QLXA 2PMZD 1IR2A 1Y5IB 2H5EA 3OTCA 2FZCB 4IDKB 5EHHA 4F0MA 1QAYA 2PD1A 1N34F 2WW8A 4TYAA 3WDOA 1QY7A 2CFXA 1PYOB 4I6AA 4B9NA 1YHQS 3J80U 1SV5A 4FNIA 4YB6A 4WYLA 4NYPA 3MR5A 2VASA 2F1FA 2AMCB 1UJ4A 4ZLJA 4YY3F 4HI1A 4IRKA 3QAUA 4X66F 3WIVA 5IV3A 3M2RB 2CNLB 4RUHA 3MM8B 3KLFB 1LWCB 1EP4B 3AJ2A 2MZQA 1MG7A 1RTIA 2V63A 2BOAA 3BKTA 3PFOA 2ROEA 4EWTA 1YI2S 3I5CA 4C8OA 5IS2A 2JC1A 1L3VA 4FZVA 1TL7B 4FYXB 3RB6A 1S9FA 1UEKA 4AL5A 5BR8J 1XNRJ 4O0NA 4XPEA 4MIBA 3MPUB 3W64A 2RHQB 1EHWA 2PE8A 1OIAA 4HDGA 4ICLB 2Y1JA 1X9SA 3DCAA 3C14B 4OZLA 1RADB 1GTHA 3P3DA 5A0YA 3J7A1 2NSBA 1Q86T 2XEXA 3PW2A 1UP1A 1KHVA 1S9EB 1CC8A 1UL3A 3ZC4A 1X4CA 4RW7A 5DQHA 2L3MA 4G1IA 2CVIA 1NKBA 4DR1J 2GFFA 1QAJA 3HSGA 3O8WA 5D4NA 5LT5A 1H72C 1KLMA 2LEAA 2MJUA 4RW9B 1U1QA 3HSZA 4RU9A 2E5LF 1AB8A 4JI6F 2PEBA 1TP7A 3VR1A 1B0VA 4ZLNA 3QRRA 4ECUA 2B7BB 1RYRA 1WI6A 2NQPA 1H7XA 4HDHA 4F50A 2E29A 4A8MP 1HR0F 4MMOA 3ZXWA 2HNZA 2KVIA 2J9DA 4PABA 1IQTA 3MPVA 2VF3A 3HP6A 2GO8A 5CZVA 5KG1A 3EPIA 4RBVA 1UMJA 4Q7AA 4ES3A 1HNIA 2X1AA 3M8WA 2JX2A 3C8YA 1F5BA 4Q43A 4NOHA 1GX6A 3QGHA 2IRUA 1VGYA 5CCMA 1JWWA 2DPIA 3DYAB 2RQCA 2AP6A 1KSPA 3QAEA 3VAHA 1AFJA 1M5KC 2P9CA 1HA1A 1RHUB 5HANA 3GYNA 3MR6A 4IG3A 1CG2A 2CQPA 2QLJB 3G82A 3TJAA 3L7UA 2CQ2A 2KM8C 3BN4A 3VGTA 3GSDA 1PAUB 2GW8A 1CLFA 2ZOGA 3QGGA 4G1PA 2XNQA 1UWBB 3QIPA 3CD7A 3KG4A 3D4JA 5C24A 2ACYA 2ZH6A 3T5JA 5J2NA 1Z4UA 1RHJB 1AYEA 4DL4A 4WIIA 2E5IA 2DNZA 4NLPA 5ETLA 3W66A 1X7VA 3CCUS 5B0DA 4ZP9A 4DR6F 4QW8A 2MZJA 3CMAS 1JQGA 4E98A 5L38A 4JI2J 3ENQA 1H3DA 2Z0GA 1FRXA 3QT6A 2R7WA 1NSPA 1WEYA 1M1HA 1HD1A 1RAGB 2RF2B 2GHVC 4DL0C 4B3OA 4C3MA 4L75A 2QN6B 3PRDA 3UQSA 4HL9A 4YDXA 1RYSA 4K7QA 1HNXJ 3SI8A 4USVA 3EDRB 4NXMJ 3CSKA 4C9DA 2F7VA 3RAXA 2RSQA 5LMNF 3QGIA 4I69A 2W2MP 1URRA 3DDKA 1YBUA 2ALZA 1FTRA 2YNHA 2DD8S 2WB1D 5C7PA 4NEZA 1HNWJ 3DOLB 2Z2YB 2VJVA 3E8OA 4KE5A 4OIXA 1NSQA 4P52A 1TV6A 4PYAA 1NJYA 3VAIA 2ZWPA 1CJKA 4Y6IA 2JH3A 4UQTA 4ELTA 3KXDA 2DR8A 3TYTA 4B9TA 1BHNA 3GIIA 4KO0B 5DG8A 4I2QB 5K8NA 2D1CA 3DU5A 3GIJA 3OTOJ 2HHSA 2KXNB 4LRBA 3U1LA 3NCRA 2JRSA 3PKMA 3ZZTA 1OPZA 4FBUA 5SZTA 2KXFA 1REVB 5RUBA 3OSNA 3OL7A 3W5YA 3MEDA 4C48A 4A4JA 4ZITA 5HLFB 1PBAA 2W4PA 5DGBA 3UDEA 2XWYA 1FJCA 5J1EB 2FYXA 4N8OA 3OL9A 1GXLA 2YTCA 5DM6Q 1Y5NB 3JSYA 4QR1A 1F3FA 1U2FA 1HWKA 3KJVB 2IA6A 4QWDA 1BUXA 3QSIA 3J7YU 2O67A 1NDLA 4CCHA 1BQMA 3TEGA 3J7AN 4K5RA 2C2EA 1F60B 4BCAA 2VDHA 1CS4B 3UCUP 5I3UA 1D9DA 4YS2A 3DOMB 3PX4A 1A7GE 2OPRA 2XI2A 3OFFA 3IWNC 2HHWA 5D4PA 1VBXA 4OJ1A 4DV5F 2I6WA 4LMZA 4NA3A 3C3LA 4OYWA 1NK4A 4MK9A 3OXGA 5IM0B 3KJFB 1QAXA 1VI7A 2J6SA 2VA3A 5D8HB 4N41A 4DLGA 4FF3A 5AJ3F 5A8KA 1RKJA 3ZO7A 1AZSA 3LGMA 1SUQA 3H7HB 4Q2LA 4RL1A 2MQLA 4TNOA 3RG6A 3HFVA 3DLGB 2WSFC 3SFGA 2HAFA 3F41A 4J9PA 3KK3B 3CMES 1U2RA 4P2FA 3KOAA 1HI8A 3W2VB 2RDDA 3NOGA 2W8LA 3PEHA 3M30B 1ZM4A 3GV8B 1AA1B 2F4VJ 1T3OA 5F8GA 3NRBA 2H4YB 3LPYA 4B9SA 4LSLB 3MCNA 2V2KA 3K2YA 4QPTA 4P6QA 4IR1A 4DV4F 2QTWA 4GO7X 1RTDB 4OX8A 3HHKA 2J8SA 4DV7J 4R8UB 3NBPA 3E01B 4CLZA 3M8SA 9RUBA 2DR9A 2QMWA 4HTIA 1S4FA 1YK9A 1UA1A 2F4FA 5B09A 1H7WA 1W2BR 2V8GA 3ZTRA 4ZPCA 4ZN3A 4XDCA 2EI5A 1NJZA 3T9NA 2KG1A 4NRTA 3M8ZA 1PYSB 1SQFA 5EX0A 4M5LA 2MSTA 3C46A 4NCAA 2B4VA 3DLKA 3Q0AA 5T14A 2KB2A 1A9NB 1UVNA 3R5CA 1HPZB 1TL5A 2P9EA 4ZJOA 2G0JA 2BDPA 2EK1A 5A8RB 3VV2B 3NCPA 3BO3A 3GIKA 1MROB 5AE1A 2NSCA 4NLVA 2Z2LA 3SSQA 2ZVSA 4CIOA 4CQ1A 5KFCA 5L46A 2GVZA 3RGIA 3GFXA 4P2XA 1UFKA 4O3OA 3OVBA 5ETOA 4HHUA 2VPYB 4I64A 3ICLA 1LOUA 3DKDA 4CDIA 3H59A 1XIQA 2FZKB 2HZAA 4RNFA 4LF2A 5HROB 1DBDA 4K4TA 1WTFA 4ZPTR 2HQFA 3EGVA 2ZE2B 3VVTA 2W9CB 2DH7A 2M9KA 2CNNB 3B82A 1HFEL 1VC6A 4DL7A 3UO0A 4B3TJ 1N0VC 4ANEA 4DDFA 3EDQB 1NKEA 3ET6A 2H65B 3T6JA 1HHQA 1S1VB 3TWZA 3CUNA 2XMAA 1F2HA 4NI2B 3CNQP 5EWGA 4WP8A 5LMNJ 4MK7A 4J9KA 4BHQA 3RB0A 3HLUA 1ZH5A 2AX1A 4F25A 4DG1A 1URNA 4RW8A 2Y1LB 2AYGA 1R3NA 2HFOA 2M70A 2MQQA 4DV2J 1A6LA 2F65A 1RT6A 2KL8A 5KG3A 1GMVA 3IR5B 1SH2A 1E6YA 1FKPA 4H4KC 3IM8A 2P6TA 2ZDOA 5JVGQ 1KVJA 3MR7A 1IBLF 3UDVA 3MD3A 1SIWB 1CULA 1RLCL 1T7PA 4NYOA 3PDNA 3JTOA 1IWAA 2FD2A 2GJIA 4A8QA 3TA2A 2ZBRA 2EFVA 3D1HA 2E66A 3BKUA 2XY7A 3DRXA 2H5JB 1U02A 3M9OB 1OMSA 1UFWA 3D1QA 1BLUA 3KLEB 4O3QA 2O66A 2IPOB 5J2PA 1RHMB 3VALA 2K06A 2ADCA 4CNYA 4ZVQB 4IQMA 1R43A 4DFKA 2CJKA 1CPZA 1FWKA 4DF4A 1FHTA 4ZVSB 2C1EB 3BB5A 4DV3J 2CNOB 4I2PB 1LXNA 1NB7A 2ILYA 4DV1F 5F0UA 4NCBA 3ENAA 4ZVGA 3Q8QB 4E8UA 1ZBTA 1WTBA 3JQKA 1FKAF 2FVRA 1UEVA 3FK4A 3I9V9 4RNMA 3TJ8A 1KP6A 1RWOB 2HQIA 3Q22A 2DISA 4WXOA 3OBIA 3TAQA 4ECQA 3GCXP 1SV5B 1K0VA 3EYZA 1G1XA 2UV8G 2XLJA 2EKYA 2F3JA 1VQ4S 2ZBQA 3KUHA 4GO5X 2ZJRQ 3I4HX 1K1QA 5KG0A 2AGOA 4GKJJ 3HJFA 5DS7A 4JI4J 4PWUA 1S6PA 2B43A 2AW0A 4ZJQA 5CZXA 3KMSA 3OTDA 1RTIB 4DCOB 1NH8A 5KFFA 5CCLA 1S0VA 2NZ4A 3NEKA 3PKYA 2DXDA 4L3KA 2D9PA 3NAHA 3K59A 2KZMA 2EC2A 1KQSR 1DTQA 2HMIA 3CC2S 1RAIB 1RAFB 5ETMA 1Y00A 2ATLA 2G4BA 4P71A 1T9TA 5E2QA 2XMTA 3UPFA 5A0YB 1WDTA 2M0GB 3KNGA 1RT7A 2QA1A 1FFGB 1HMVA 1AT1B 3AD8C 1JLAA 2RKIA 1Q0NA 2A1BA 4RW7B 3QPIA 3I82A 1XN9A 1P1LA 5ETVA 1PILA 4QU6A 4M5DA 4C97A 3SQOP 4EO8A 1KLMB 3FCHA 3ENWA 3FMBA 1VFJA 5IZHA 3AHPA 3THVA 1LWEA 1R8BA 1ZAXA 3FMWA 1H74A 4IO9Q 4N56A 2ASDA 4JV0A 6FDRA 2DGTA 2R3VA 1WUUA 2UVVA 1YG0A 3OFGA 3WQPA 4K2XA 4KHPJ 2PMWA 1O8BA 4JI0F 2LQ9A 5L1KA 4LSNA 2HNZB 5CABA 3PJXA 2E9ZA 3UDLA 3N6MA 4WK3A 2YWHA 2MLYA 4ECYA 4ECRA 4L74A 4HR2A 2YQ0A 3CO9A 3X1LB 4LBPA 1N5TA 4QWAA 4P10A 2DY1A 1HNIB 1KTVA 4DV6J 1WG4A 2AJ4A 1Y4ZB 4WFNQ 1RAHB 3GYXB 1RWNB 2VPXB 4DLEA 3MOJB 1RBOB 3IO1A 1Q1KA 2KN4A 4IG3B 2QL9B 3G82B 2DR5A 4DN9A 2L9DA 3EGWB 3FEXB 4IG0A 4KGXB 3UD5A 3D6FB 2E44A 2JVRA 2Y9HA 4NLOA 4I0WA 3LP0A 3HXMA 3QIPB 3K5PA 2MKKA 3PJ9A 2LQ5A 5C24B 4KT0C 4KKOA 5J2NB 4LF8J 4WKRA 5KFBA 2AHOB 3NMAA 5E3PA 2JC0A 4DSFA 2KZZA 2DNPA 4HHJA 4EEYA 1FI4A 1WD6A 2XLKA 2K2PA 3P5TL 2LKZA 3VWSA 2FPHX 3Q8VA 3GJQB 1VQLS 2DPJA 2AGQA 2FVPA 4DBQA 2CWXA 1TUGB 1HARA 1O5JA 4B3OB 2QSWA 1S7IA 5H9EK 3H0PA 5FIIA 2I1RA 1S5ZA 2XYGB 1F9HA 1PC4A 4BC7A 4HKQA 2C42A 1KBRA 4QBUA 1U8SA 4DSEA 2X3GA 5EGYA 3TRGA 1QUPA 2W1BA 1RWPB 1HNVA 2CQ3A 1YZ7A 3Q8SB 2YNHB 3IRWP 1RWKB 4NA2A 3ILLA 3CMQA 4RW4A 2RE1A 2R7UA 4J9SA 1TV6B 2E1CA 2AJ0A 2W01A 1CJKB 3MMBA 2KVQE 2HHUA 4ZVOB 2F8HA 3VF0B 3K89A 2BRKA 3ZTSA 4KYZA 5CA5A 4DL6A 1LWFA 2VQFF 2Y8WA 4NLRA 4DV1J 4OJGA 1WDDA 5DDOC 2KYXA 4LBIA 3UD4P 4UZCA 4IO1A 4Q5VA 3MEDB 3RUBL 3CO0P 5KFPA 4ZPBA 4MFBA 4G1QA 5KFGA 1PIEA 4PCQA 4EO6A 3MUVP 5GMDA 2QRRA 1KQGB 3SFUA 3AOAA 2Y8YA 2HVEA 4IOAQ 4O3RA 4M5JA 1UVJA 1RISA 1ZTWA 2CAJA 4ED8A 4OHXA 1PO6A 4YUDA 1SVDA 1Y0HA 4Y34A 5CYJA 1C1BA 2B7CB 1NBEB 2KYZA 1BQMB 3RAQA 1RB0A 4B9MA 5IQQA 3G96A 2F8MA 1FJGF 2J9CA 4OZ1A 2KHCA 3M1VA 1RGVA 3PM9A 4ZPVR 3L7PA 5I3UB 2OPRB 3TQ1A 2BR0A 4DR3F 2VD3A 2IHR1 3L7OA 1YSJA 4XTTA 4NLWA 4X4VA 2ZKTA 2CWKA 1R8HA 1NK8A 3T1AA 1WOPA 2PI4A 5DGAA 2VU5A 4CO3A 3TVKA 5A8KB 3WHIA 1AZSB 1SUQB 2G1DA 1IBKJ 2ZH4A 1VQPS 3HF5A 4ETZA 5ITHA 1TKZA 5M2PA 3FBBA 4AFFA 3PYDA 1S1XA 2AKWB 3MEGA 5K5MA 2BQUA 1QLNA 2VFSA 3AXKA 2CG8A 1NSAA 3D1OA 4I67A 4QW9A 2YY3A 3PTWA 4KV8A 2LEBA 4DX6A 2HBQB 1QSSA 4IRCA 2PGCA 3FSYA 1D8ZA 4WPAA 2B9YA 1SBRA 4S0MA 4QR2A 5AT1B 3MMCA 2CPDA 3BF4A 2ZH8A 1Q8KA 3E3XA 5EWEA 2XSJA 1UFLA 2ZH9A 3B8HA 4ILLA 3NBPB 3UN3A 2CUYA 5KFJA 1SIZA 1SKRA 5CH7B 4UTGA 4I7FA 3LANA 5K8MA 2YX7A 2UXBJ 4QU7A 2XZDB 1IM6A 1YLXA 3KHLA 3W65A 4CT9A 3T5HA 2W4DA 1QTMA 2WVEA 2G0IA 2HQDA 2IVYA 4UOCA 1U25A 1Y5LB 2BOPA 2NXUA 2AQ4A 2VBZA 5HN0A 2R8GA 2RMLA 3BDEA 3DLKB 4KB7A 1KVKA 3UW1A 1HQ2A 4AXJA 4FNHA 2BM0A 2XLIA 3IC1A 3PYEA 5HQLA 3IS9A 3TAMA 2ATCB 3KDOA 2HHHJ 2C2DA 2E7VA 4USIA 3GFYA 3AOCA 3ISND 5LL6d 2QZ8A 4DQQA 2HS3A 3A8JA 4CM2A 4ZP8A 2GVZB 1HNZF 3QWPA 4GVBA 2GIFA 3U1NA 4HI2A 2NPFA 2VQEJ 3HMJG 2R7XA 3H5UA 2QA2A 3CCZA 2M3DA 4OJ3A 3O44A 3MECA 4NLDA 2XS5A 2IC3A 2FY1A 3IBFB 3QFHA 3DM2A 2J7WA 2X1FA 4K0KF 2KM8B 1O0PA 3JB9k 4WYWA 2JZ5A 4DSIA 2FHMA 3L3CA 4JI5F 3BS9A 4OI6A 4B08A 3Q2TC 5GAGU 1NRKA 5F8IA 4U6PA 2CPFA 2IJNA 3DI6A 4JV5F 4I6WA 4YR3A 2W7PA 1FEHA 4OHWA 1RAJA 1S1WA 3TUZC 2PFFB 3ET6B 2OAUA 2RDJA 1QVGR 4USMA 1OSCA 1N6QA 2J7KA 5KFEA 4R0EA 3OQ2A 1U0HA 3UCGA 1WF1A 4DG1B 4RW8B 3P45B 3VAMA 5E7OB 5IXUA 3HFKA 3TZZA 2B6AA 4TN2A 3CT9A 1EZZB 3PRVA 3W8GA 2PFDA 2XMKA 1E6YB 4PWWA 2ZITA 1FKPB 1X4AA 1Z1ZA 3R3TA 1ZAWA 2X1GA 4C11A 1CULB 3FSIA 1MNEA 3IBCB 4ZJLA 1R31A 1JLBA 3CJKA 1MLAA 1OSDA 3SYZA 1FJEB 2DVIA 1DFDA 1VCTA 2KU7A 3IGVA 4QOTA 3MM7A 3A1YG 4WFZA 1CQMA 5E41A 1SQEA 1IBMF 3K17A 3N6LA 4ECXA 2LYVA 3AODA 1TUWA 4NASA 4R5PA 3NL0A 2MLZA 3A4TA 5J2PB 1NU4A 2ZBPA 2IRXA 2XZWA 3V6DA 5IOLA 3LALA 3L09A 2OMOA 5K8OA 5H9FK 5E3CA 4L6V3 5B0CA 1MWYA 3IP0A 3V5RA 2DRDA 4KQZA 4EUVA 4W92B 2D3OR 4YOEA 1X0FA 3OTEA 1YZ6A 1EB0A 2B8PA 2DRBA 1PC5A 1RSCA 2Q43A 3I31A 2Z2MA 1V3RA 2HFNA 2RQMA 1VK8A 4ECVA 1X4DA 2BE7D 2YKQA 4LF7J 3GILA 4F4ZA 4ANCA 2HFUA 5HAOA 3D6HB 4NLTA 4TLRA 2DHXA 3LQVA 2HHQA 1JLFA 5LMUF 3IFEA 5M2RA 3MAAA 2OPSA 1XQIA 2HSEB 2HWTA 3G6ES 1S6PB 1HL6A 4FBTA 3CE8A 2V68A 1NB2A 3J7YI 3F73A 1OQ6A 2NUUG 4FPRA 3EJMA 5L9XA 4CT8A 3OUYA 4OYZA 3AD7C 1U0SA 3BBBA 2EFNA 4USTA 1DTQB 2HMIB 2QMUB 5IT9U 1U47A 2MYFA 2EBGA 3BYRA 5KOXA 5KFLA 2A6MA 2E5JA 2YWEA 5EX3A 1RWWB 2UVUA 5CD4A 5DG7A 3RRHA 3VQSA 4WP3A 4USJC 1RT7B 4EU0A 1HMVB 1MWQA 2D3O1 1JLAB 4O4RA 2RKIB 4QIWD 1Q8BA 1ZPWX 4ERDA 2BW7A 1SC6A 1SC1B 3VQTA 3TVZA 4DR4J 2K3IA 4M5DB 4IUFA 2V2ZA 2M2BA 3HX9A 4J9RA 1RCOB 2GCFA 3L4BC 2DNYA 3DGPA 4EYIB 1JJHA 1S79A 2XBPA 3R1LA 1LWEB 2I0XA 4LF5F 1TL1A 4DUZJ 4C8LA 4ZKAA 1RHRB 2JVOA 5LSLA 4C8ZA 3LWLA 2YXLA 3FVYA 3PYGA 4QIEA 4TY8A 4F36A 1FXLA 4LSNB 4ID8A 1YTYA 4LQ9A 2V67A 2DNOA 2HRUA 4RO0A 3W9IA 2K7KA 3FKBA 1WACA 1TKXA 4DUYF 2R42A 3VAFA 1HBOA 3JTNA 1X4HA 3SBMA 1JLEA 4FF1A 3G8QA 3NG8A 3Q8YA 4JUZA 3EM1A 2DYAA 1TQLA 3CULA 4FXDA 2ZM6J 4PPZA 2FB0A 1SC3B 3RW7A 1XR7A 1AROP 4DS5A 5KFTA 1SJ4P 3HT3A 3HVWA 4K0KJ 2IDEA 2HQGA 4NX9A 3ELHA 4JI5J 4IG0B 2XYHB 4TQSA 1BMQB 3LP0B 3DOKA 4ILMA 4DL3A 4JV5J 1NJWA 3PR4A 1U26A 4KKOB 1RTHA 2M4MA 5MAOA 1IVZA 1NLKL 3OFEA 4QYZK 1S97A 2V69A 2EKNA 3QT7A 6AT1B 3DDIA 3AQOA 2JEIA 1RT3A 3J81Y 2POKA 4LFBJ 3TZYA 1YRXA 3QRQA 3GONA 3QWUA 4CLYA 3N5BA 2VPWB 2HLTA 2J0QD 2V94A 2YX4A 4DQRA 2HZCA 4LRFA 1KOOA 4OZNA 3E51A 4PZVA 1N36F 1SI9A 1MU2A 3UR0A 1Y9OA 2Z30B 1S72S 4C8NA 4EZ6A 3VCDA 3AOBA 5AE2A 1OYEA 4OYAA 3MM6A 2R7TA 3FGVA 4TKTA 2JWNA 3OR2A 1R8AA 2R2UA 3FBCA 2MHEA 4D3HA 2KKHA 2XS2A 3GLJA 5GMKa 4JB8B 2JEFA 1XNQF 1QSYA 3EPGA 2E9RX 5BYSA 4OI1A 4PQUA 1HNVB 2XULA 3BZQA 2CQGA 4RW4B 1VQMS 3NGSA 3EVMA 1T03A 2UUWA 4XDDA 4I68A 1I5OB 1VQ7S 1I51B 2A3JA 2OSQA 2PC6A 3MMBB 8ATCB 2GNKA 4X4PA 4OYXA 1U1KA 4KAIA 4X4OA 1VRTA 4YP3A 1LWFB 4ZMMA 1NH7A 2KT2A 3I55S 3KDNA 5KFXA 1G3OA 2MQOA 1AUSL 1RHQB 1IKYA 2BKNA 4ED3A 2VDIA 4NZ0A 2YH1A 4MFBB 4G1QB 2OPQA 2RU3A 2U1AA 4B9UA 3D0HE 1J5OA 5KFNA 2XHCA 1GXUA 1F9FA 2K1RA 1D9AA 1FFSB 4IFVA 2EG1A 1KTQA 1EQ0A 3C6TA 5I3PA 2KRRA 1GEHA 3K8VA 5DQIA 4TU9A 3OXFA 5B0EA 2CDQA 2MZRA 5AXKA 3S01A 4YEAA 1C1BB 4N77A 2XS7A 2B4PA 2C2OB 5LMUJ 4MH8A 3R6LB 4DR2F 4LSZB 1VS3A 1WC5A 3I0SA 4MYUA 1BQNA 1N33F 2B3TB 3M1VB 1U48A 4U7CA 3B4DA 2NXJA 2CQCA 2MKYA 2C3UA 3AH6A 4IH5A 1UW9A 3O5TB 2ZBIA 3GMGA 2X7IA 3M9NB 2JLFA 2UUCJ 3LUYA 4OV6A 3W5XA 3GTYX 2IYIA 2JFKA 5KT5A 4JI7F 2GAHC 1I94J 4RW6A 3FRZA 1KFDA 3T6BA 3WBZA 1XMBA 1YJTA 1GT8A 1RCXB 4ZVRB 4DPWA 1U1MA 3K5MA 2J6TA 5KG7A 5A76A 1TKZB 1HQEA 1SJRA 3EUNA 1S1XB 4UY8T 3JSRA 4A8SA 3MEGB 1FVSA 1K73T 2HYIB 4IKAA 2VG7A 2HFZA 4D3GA 3AY0A 1RUSA 1LFWA 1P6TA 4NRUA 4DU7A 1TK0A 1F6TA 4KV8B 2C3PA 3M2UA 2OEKA 2EFPA 4WTYA 2DY9A 3MMCB 4U7UD 5F9NA 4K4ZA 2OO4A 2XSJB 2GMJA 1H73A 3FJ2A 4G65A 4Y65A 3R2CJ 2B4OA 2R7SA 1NK9A 4HACA 3H5XA 2M8DB 3R5GA 3SDEA 3CXCR 2HVDA 4UOHA 1YJRA 2GQCA 2Y1IA 1B0PA 4ECZA 3H42A 2W8KA 1S1TA 2X51A 1U45A 1ZM2A 3KG0A 2PDAA 2DR6A 3CD5A 3ZZRA 5F8MA 1KVIA 5L1IA 2EW9A 3P96A 3MUMP 4CRJA 4LIWA 5HK4A 2YWFA 2PO4A 1HIYA 4W98A 2OTLS 3CDEA 4GC7A 3IS9B 3TAMB 1SJ1A 4YN3B 3N6NA 5B0GA 2D74B 3K0JA 2XMVA 1PJ7A 5GADI 1HQUA 2G2ZA 1OY6A 1HWIA 3R5AA 2DGWA 1ZM9A 1FX2A 1RI7A 1FRMA 1DRZA 1NKCA 2UU9F 3P6YC 2HQ3A 2ROGA 4GVBB 3WC0A 1Q5YA 4AQYF 1SKUB 1EJ7L 4GKKF 1WI8A 3J80Y 4PXCA 3G87A 2GAGC 3GCWP 2RVJA 3MECB 3GJRB 3A3NB 2E9TA 2HFSA 2LCWA 2IC3B 4OZJA 3DM2B 5EDWA 2MY7A 4F0HA 3N4WA 3G8SA 1Y11A 4TQRA 5D0RA 1VQYA 3IGNA 2W4CA 3DLBA 2WK4A 4FKYA 3V81A 2KT3A 1N36J 1RJJA 3M05A 5KT6A 4NLGA 4NZ7A 2UUAF 4AXIA 2OPPA 4CLUA 2FY8A 3W61A 3DI6B 4JI1F 4JYAF 1J5EF 1S1WB 3LH2S 2C3OA 2W2QP 2JHEA 2CDRB 2HWIA 2UUBF 3DLHA 1N6QB 1ELOA 1XNQJ 2FVQA 4C8KA 5F41A 3PW7A 3RR7A 4DU8A 2BJ7A 1U0HB 4Y0FA 3DXSX 1YGYA 2CPHA 2XMMA 2QFJA 3MMAA 2B6AB 4MTPA 1KWMA 4U67Q 1HBNA 4F04B 2HNYA 4XIUA 4W4MA 4P9SA 1UZHA 2YKAA 1Y3JA 4WFYA 2DRAA 1UPPA 3C6UA 4C11B 3JAMU 5KTQA 4CLLA 1GNKA 3CB4A 2DHAA 4IR9A 1JLBB 1PBUA 3CJKB 3D6TB 2ZJPQ 3TNVA 2DNQA 1UVKA 1Q79A 4PG5A 2FJWA 3MEKA 5KT7A 4Z2XA 3VGVA 3U02A 3J81j 5DDPC 1RLDA 3UE2A 3Q8RB 4K8RA 5F3ZA 4EBDA 4LR8A 5IC6B 3TVYA 2F9DA 2Q79A 1SH0A 3I96A 1KFSA 2CJAA 4B17A 3V6DB 1GXTA 2HAIA 3VGUA 3R6GB 3PNIA 3TUJC 1XEZA 2DCUB 2FJBB 2UXDF 1MMLA 3U27A 3PXGa 2IBOA 2F63A 2R7QA 4QIFA 4DR2J 3CDAA 4LFCF 3AA8A 3NOCA 2UXCF 4C0OC 4C4WA 4DX5A 3F0NA 3MZIA 2GJFA 3I5AA 1IM4A 3CCRS 4ZP7A 2GMLA 1T0TV 4F2SA 3BSCA 3MUTP 1S76D 1F9EB 3QLHA 4ES2A 2KJVA 3K5OA 1APSA 4Y00A 2AYEA 2GJ2A 4M95A 4OV1A 2HRYA 3C15A 5BXIA 3PIPQ 1H0HB 4JI8F 2GVDA 2FLPA 1RK8A 4J9NA 5DJBA 1S1UA 1JLFB 1CJVA 3IBWA 5HATA 3MAAB 2OPSB 3P5BP 1GMWD 3BPSP 5HO4A 3QRPA 2GZOA 3DRRA 4WU2A 4J9VA 5EWFA 4NEYA 4RBTA 4RUAA 3SQGA 3H40A 2RILA 5CYMA 2YQ1A 4FF2A 2M8HA 3OUYB 3I9ZA 2V9WA 3TA0A 2L08A 2LDYA 2VH7A 4U95A 4QJVA 2NREA 4B3MF 2FDNA 5KOWA 2V8HA 2LXFA 2OTJS 3MTJA 4LQ3A 5AXMA 3RB3A 1YX2A 1JXLA 4CZCA 1EETA 2ZH1A 2C2MB 1SKSA 2HS4A 3AJDA 3EZUA 1TK5A 2AEFA 4IYQA 4WIQA 2EK6A 2FIUA 4IFYA 2ZEJA 5L1JA 3ZFVA 1YDLA 2JSXA 1J27A 3DGPB 4HT5A 2UVWA 3AB4B 3K5LA 3R7NB 3PW0A 2G2YA 1C4CA 3AJ1A 1TL1B 3UVJA 1X8DA 4LF4F 2I8EA 5BYRA 4YHHF 4DPUA 2QX0A 4Y2AA 3DRPA 1EAYC 4DR5J 4I1TA 1WJ9A 4TY8B 2NS1B 2O3DA 4IH6A 1JNRB 4OI4A 4PG8A 3V6KA 1S0MA 3CJRA 3S6EA 4J91A 4P75A 1RT2A 3K5NA 1G2EA 1IWGA 4OI3A 4CNZA 5K14A 1MSWD 3HJVA 5LXRA 4J9QA 1TKXB 3FZ2A 1T9UA 1TTHB 3RBDA 3DFEA 3W7BA 1HBOB 3AQPA 4A8YA 1JLEB 2E5HA 3CJSA 4C0HA 1BC6A 2DGOA 1EIYB 4GKKJ 2OH2A 3SMZA 2YKNB 2AJ1A 2YKPA 3HVAA 2FHKA 2ZZMA 3JQJA 2DGUA 2NZCA 4JBCA 3HZEA 2UUAJ 3R1HA 1CVJA 2QLBB 3DOKB 1N5SA 3V4IA 4JI1J 4JYAJ 2J9DE 4PKDB 3OR1A 4MIWA 2ADBA 1RTHB 3BGRA 4MYTA 1YBTA 1FCAA 4X4SA 3CCJS 2DB1A 1KC8T 2RS8A 4KC5A 4ZCMA 1RT3B 3POTB 1HHTP 2ZH5A 3LAMA 2MQPA 3BSOA 3PG9A 3GR1A 4ZCLA 4YDDB 1JKHA 5B0AA 1SKWA 3BBFA 3UN2A 4I4BA 4URSA 3CCES 2VKRA 2A6OA 4BC9A 2LU1A 5HVHA 1MU2B 2ZWOA 4K50A 1NPRA 5EUHA 2MXYA 5KFQA 3W5ZA 1RXOB 4ZVEA 3ZZUA 3MM6B 3KJQB 1AW0A 4TU7A 5IT0A 2PN6A 4DQIA 2ZFHA 3ILJA 3OR2B 2WZ1A 5AXNA 3R7BB 3OSPA 4DPXA 4LFAJ 1R8PA 1FDNA 1QM9A 4USHA 1IN0A 2XMJA 1ZAVA 2WONA 4DCJB 4PQUB 3FZBA 4LF6F 5JJBA 3AA9A 2L41A 2XY5A 2N3OA 4CLFA 1T03B 3T19A 4LREA 1P1TA 1X9WA 2QLFB 3D66A 4RUCA 3HI9A 2O5DA 1FKOA 2WSCC 2V8VA 1SC4B 2VFVA 3M9MB 3AFGA 1DJ0A 2YWKA 4ED6A 2ZH2A 3QT5A 4X4QA 1VRTB 3M4XA 2UXDJ 1NMEB 2IVMA 1VJQA 1WC0A 2LLZA 1FDDA 1T9VA 3MCOA 3PRBA 3WIUA 3EX7B 4ENOA 2XI3A 1Q53A 1IKYB 4QYZJ 1V5VA 1DQAA 5DLGA 1D3WA 2OPQB 1JNZB 2BANA 2OMLA 2VJUA 2HGMA 3NKYA 2ZUAA 1J5OB 2OEMA 2CQDA 5T7LA 1Q5VA 4L73A 2K1RB 2DHSA 4FVCA 4IFVB 3LGNA 3S7RA 4F8RA 2AGPA 3C6TB 4MKBA 2HIQA 3B4MA 1GMUA 4K4XA 1N34J 1DQ9A 3GG1A 3IG1A 4ELUA 2B56A 3WX4A 1BWEA 1Q8IA 2CJYB 2WBMA 3WC2A 3I0SB 4ED2A 1BQNB 4ER8A 4R0JA 1UPMB 2ZC3A 5G4DA 4YY3J 4EK2A 3ISNC 4RLEA 5D4LA 1L5UA 3JSBA 1ZS6A 5LM7E 5JMNA 4X66J 4UT4A 3BBCA 4CLWA 2OSRA 2GMHA 4UOFA 4NXNF 1IXKA 4M5MA 3MTKA 3DU6A 4NLQA 3TAPA 3W62A 1RBLA 1KN6A 2ZUGA 2HK3A 4RW6B 3PW5A 1N88A 4X65F 2E1RA 2BJDA 2W7OA 3SSRA 5KFKA 4LF9F 2ZNZA 2CQ1A 3H2VE 2Z58B 4N7TA 5KG5A 2O01C 1V3ZA 3NGTA 1M5HA 1HQEB 4WF9Q 4OZ3A 2DCLA 3ZTOA 4CO5A 2MQMA 5K20B 1E6VA 1XERA 1U1PA 2VG7B 4UY85 2V50A 4U7UK 2ZVIA 4J9UE 2EVZA 2VKZG 3GQCA 2DHHA 4P7TA 2V4RA 2YKOA 2MDAA 1WNEA 3M2UB 3J7Z5 2VC1A 2WHOA 4JI3F 4NWBA 5D15A 3KHRA 2QJ3A 3V6HA 4LF4J 1IKXA 4L72B 3N28A 1NHUA 4PXEA 3I6PA 1L3KA 4ZVPB 2MSSA 4X64F 2E5LJ 2AYBA 4FDFA 2HHTA 1IR0A 4HACB 4JI6J 1RA6A 4DL2A 2CQ4A 3EICA 4HLBA 3U7JA 3SDEB 2PT0A 2B9WA 2CIMA 2Q6BA 4CLKA 4NZ6A 1S1TB 1HR0J 4K5SA 1FD2A 1XR5A 2NYHA 4Y2MA 3M8QA 3UWTA 1DHMA 4EI2A 2I5JA 5IWAF 1UKUA 4MIAA 5KT3A 3FCWA 1B3TA 4HH1A 2CZ9A 4ETXA 1H2TZ 1VLOA 2ZD1A 4CH1A 2HGLA 1U2CA 1FRHA 1HI1A 3W2WA 1HQUB 2ZKUA 3HHNB 1RA7A 4V1Ak 3ZZOA 1TL4A 3RBZA 3SCLE 2JJ4D 4BBYA 4F3OA 1KR4A 2J8AA 2IRYA 3IR6B 2MJNA 1FRIA 2CVEA 3BSAA 3PY8A 2AX0A 2GV1A 3BREA 4ZLPA 1JLQA 4ED4A 2LXIA 2YWWA 1SH3A 1TMMA 1JX4A 3J81U 1TAUA 4FVMA 2KHDA 1NPPA 2LU2A 3MFIA 3JYTA 3V81B 4WU3A 3I0RA 2BXJA 5KT4A 4DR6J 4WCEQ 2MEWA 5GMEA 1VMBA 2OPPB 5KFDA 3SIPB 3RRKA 3TJ9A 5KFHA 5L1LA 3QIDA 3KWMA 2VONA 1V6HA 1TAQA 3HK2A 3DC2A 3EMTA 3DLEA 5DDQC 2IIHA 5BR8F 1XNRF 1HW9A 4FF4A 2HWHA 4IOBA 1RAOA 4Z37A 2K7JA 3FUYA 3MMAB 4MKAA 1HBNB 2HNYB 5E3RA 3IWXA 1KKHA 2JEGA 1JLGA 1N48A 2L9NA 4K4WA 5DETA 2LQ8A 3ISZA 1L3TA 3TX0A 5HMWA 3C6UB 3GWCA 3W63A 1N4LA 4AL7A 2EXUA 4LIRA 4OHYA 2W9AA 4DV0F 4DR1F 4L76A 5D3GA 4CO2A 4XK8C 3NXZA 2D9OA 2GQQA 1KQKA 4DOZA 2DR7A 1F2GA 1C0UA 1WHXA 2CNKB 4ZOSA 2AEJA 1FFWB 3EVWA 2BZ2A 5HI7A 5FLXY 1F3VA 2Y1RI 2YNGA 4DJBA 1MMDA 3RBXA 4FKXA 4O3NA 1ZETA 4N5SA 1C0TA 1Q8LA 3HT0A 4J90A 5DLFA 3QJLA 2OHDA 3QATA 3IMQJ 1QTNB 5GAEU 4CP5A 3THTA 4DPYA 4C2MA 2HVIA 1XK8A 4CYUA 1RBAA 1CBKA 2Q1LA 3KK1A 3IA0A 3QQCD 4F67A 4KJIA 7AT1B 4ELVA 2J0XA 5I42A 4WFAQ 2HIYA 1FNXH 3A8KA 2WB4A 1OYDA 3FCVA 5A8WA 4PEOA 3G86A 1VDHA 3QMQA 4DSLA 1M1KT 2NXCA 1F1BB 3H25A 5H1SV 4DI6A 2W9BA 3A12A 1NPKA 1S59A 4BWJA 4E0DA 3A8IA 3C15B 4FYYB 5CD4H 1VHIA 5KFRA 3BO2A 5HVFA 2GVDB 3CGIA 1NK5A 5E33A 2V0NA 4LF9J 4UOGA 1R0AA 1S1UB 1CJVB 3CIZA 1RWUA 4DV5J 4K2JA 1YJNS 2V8DA 2F8EX 3DRRB 4ID5A 4URQU 2BE9B 2LXUA 2A10A 3SQGB 2B4UA 5CYMB 5AJ3J 1YJUA 2AWZA 4Z7YA 4CM0A 1CJUA 2F5GA 2WRMA 4JI2F 4NL5A 3OFHA 2B8QA 5IFMA 3JS9A 1S9GA 3OTBA 2D7SA 3LPEA 3ZZPA 2IAJA 1TUVA 3T41A 1LWXA 3THPA 5F0WA 4H4OA 3MR2A 3VTIA 1CQNA 3NGUA 1EETB 1YJ7A 3IN5A 3FBFA 3ULHA 1HNXF 4GMKA 1VQ6S 2XB2D 2H54B 2N4CA 4NXMF 4CH7A 4O0IA 5K9FA 3H90A 3PO4A 5ETNA 1T05A 3FRYA 4IFYB 5LSRA 4DV4J 5A2QY 4P72A 3U1MA 1UW4A 2D69A 4DPTA 4KPCA 1ZA1B 2BJ3A 3RU0A 2IY5B 1FERA 1U1RA 3CCVS 1HNWF 2FC9A 5CHCB 2FJAB 2VC0A 3S8SA 1D1UA 2FC8A 2N3LA 3BN7A 1EKSA 2D41A 4N76A 3UVJB 1TK8A 4MT1A 2ILZA 4CI0B 1PKUA 4F4KA 5C2GA 3DRPB 2FZGB 3MM9A 2VHGA 3E2EA 3OTOF 5E0OA 4UZBA 1WG1A 5DRKA 2DNNA 5KG6A 1RT2B 2E5GA 5K14B 3FFIA 3SXLA 2RJZA 2YVSA 2VZ9A 4U96A 1GFWB 3CCMS 1VRUA 2F9JA 3SV3A 2RRAA 1RE1B 1ZZNA 3CDUA 3W60A 1TU0B 2G1HA 2ABYA 3ETOA 3AB2B 2OD4A 5JXSA 2G9OA 3HPOA 5C42A 1NDPA 2D3UA 4DPOA 3LA0A 1VIOA 2JLGA 1YKWA 3BYPA 3HVRA 2ERRA 1OWXA 2A0FB 5JVHQ 4FYVB 2HQCA 2BJ8A 1ULRA 3V4IB 2J7UA 4LUBA 2YQ3A 3OR1B 1HYSA 3MCMA 4HYKA 3BGRB 4M8LA 5DO2A 4YMEA 2VIHA 3TI0A 2R8HA 3VZIA 2MKCA 1K1SA 2AJFE 3LP1A 1JKHB 1GK8A 3IAS9 2DGVA 5D0GA 1QAIA 4QPXA 2HFVA 2MGZA 1RKIA 2OI2A 9ATCB 1X60A 4TXSA 1U1NA 2C2NA 1D09B 2YNIA 2LVWA 2I2YA 4Q44A 2BBEA 4FXVA 8RUCA 5IQ6A 4DV0J 3NNAA 1GQEA 3AD9C 2MZ1A 4KGKA 1MN9A 1YJWS 4RNOA 2B5JA 3TZWA 4DWIA 5J1NA 2F4VF 4XO0A 2QFIA 5HMZA 2WONB 1IBLJ 1DLOA 2FJXA 1H38A 2WVCA 4ZP6A 1BE4A 3M6VA 4PR6A 1T9XA 3CCWA 4KBIA 3TW0A 4PRFA 4DV7F 2UZAA 5HJXA 2XCAA 3MXHP 3FC9A 4PWDA 1RTJA 1DZ5A 1FKOB 1V3SA 4FP9A 3T1HF 2R8KA 2QA4G 5M2UA 3DHXA 4OJHA 2QYCA 2MPUA 4B3RF 7FDRA 2FGOA 4ES1A 1X4EA 1I6JA 4DQSA 4ED1A 1WSRA 4A8FA 1FJ7A 1FD8A 2ZBCA 2C2RA 2BANB 3RYLA 1WORA 5DG9A 1QDUB 1BY9A 4A8XA 3LTOA 5T7LB 3FEYB 2R7OA 3VAJA 4J5OA 1MW7A 4ZCKA 5K8PA 3CPWR 5L39A 4TLQA 3RJMB 1QSLA 3FNNA 2P5VA 3IG1B 4M63A 4DS4A 1D0EA 4QZVB 2GA7A 2AJ2A 3OL6A 2R8IA 2RRNA 3KKFA 4UUWA 3R97A 4DMZA 4YB1P 4ZCIA 1X5OA 3D0GE 4NE9C 3RZAA 2OFHX 3TR5A 2BYCA 2BABA 2YNFA 3ZZYA 5HQ8A 2XZTB 3IXQA 1UA0A 5HMYA 1B0TA 2FHJA 4OZ2A 3PCOB 4TU8A 3OJSA 1MN7A 2NXNA 5F8LA 4DL5A 3G6YA 4LJMA 2OLWA 3CCQS 4B3TF 4DXLA 2FJVA 4YR2A 1IUJA 3BO4A 1NZAA 1AFIA 4PUOA 2HLUA 3B54A 1R0BG 3CJ4A 4DFPA 1E6VB 3MWBA 1S4EA 4M5HA 3PJWA 2P8IA 4WZQA 4DV2F 3ENVA 1K44A 4KSEB 3PX6A 1VC5A 1RWVB 5KFOA 3W9JA 1IKWA 4YB7A 2PSZA 3Q86A 1R0CB 4YB5A 3M6UA 4K4SA 1TFYA 1IKXB 4QWBA 3MMJA 1PG5B 2GIRA 3H98A 1ZM3A 3PFEA 3MPYA 3M32A 3DXBA 1X5SA 4U8VA 3NGDA 3MR3A 2CQHA 2CPJA 1Y7PA 4WFBQ 2BW2A 4WTOB 2VV5A 1XJWB 3DLLQ 2X1BA 3OVSA 4JI0J 2XGPA 2BKPA 3OXLA 5FDLA 1ITPA 4HT7A 3M8QB 1SXLA 3VHQA 3I5BA 1QE1A 5LOQA 3IWLA 2I5JB 1Q81T 1G6BA 1SJFA 4WXWA 2KTQA 2HBZB 3NAIA 4ZPAA 1HW8A 2KFNA 1XMQF 2VG6A 3Q89A 4ECTA 1M5PC 2R9LA 4HHHA 4DV3F 3C2PA 3HHLA 3KTQA 2ZD1B 5ETKA 5DM7Q 2LFVA 3GP9A 3W2WB 1JJ4A 1N5YA 1Y3KA 1VYAA 2Y0BB 5E3QA 4ANDA 1JB0C 3PVXA 2AYMA 2N4DA 1IR1A 1XTZA 4OYPA 2K8GA 2VB6A 1JLQB 3LAKA 4OYBA 2IBKA 4B9LA 4NCGA 1SCJB 2DNMA 3HVTA 4QQBA 3W8PA 1JXVA 5AE3A 1U7LA 3Q8UA 4C8YA 3JYTB 2IM1A 2C28A 4HVZA 2MKSA 3I0RB 1KONA 3GR0A 4TVAB 4GKJF 3D5MA 2PIIA 3ZTPA 4KRWA 4JI4F 1NDKA 1FDBA 4M1KA 1M5VC 5C25A 4FYDA 1PJ6A 2V2VA 2WW4A 4X4RA 5GAHU 2ZHAA 5AXLA 4J7CA 2PA8D 5F8HA 3DLEB 1UVMA 4K4VA 2PEHA 2VPZB 3HD2A 3KLIA 2XO7A 5IT9Y 1I1GA 2F40A 2A2DA 3MDFA 1P9QC 3A3OB 1M90T 1WF2A 2HGNA 4X4NA 4O3SA 1JMTA 2CYYA 2VA2A 4OZ5A 1JLGB 4EMDA 1X5TA 4ECSA 3HD1A 4CLPA 4RPFA 1YVFA 2XG8A 3M2VA 3NMRA 2IM2A 3T1HJ 1B7FA 3BPDA 2OD6A 1N54B 3PX0A 1TKDA 4ZPDA 1RT6B 1NK0A 3DMJA 3H2LA 5D3GB 4KTQA 2M52A 4B3RJ 2PMHA 4KHRA 2BKOA 2EC0A 2XYPB 4J9LA 4MK8A 5KAKA 2Y3YA 2RHSB 3NY0A 2OP5A 4AT1B 1L3SA 2RH3A 1C0UB 1YIJS 3V6JA 1MMNA 2VUGA 1P9YA 1SJ3P 2YNGB 2BRLA 1LK7A 4FYWB 1RU2A 1M0SA 4BLGA 4LBHA 4LVNP 5KG4A 1C0TB 4O4GA 2VQFJ 4OYMA 4F26A 1S0OA 1HWJA 4ZIWA 4ALZA 4KHPF 2R7VA 3QO9A 1LQ9A 3O1LA 4CYUB 1L3UA 5A6WA 3NS6A 4WFXA 3QNWB 1RT1A 1D8YA 4Q8FA 3KK1B 3PHTA 4X4TA 1ACMB 1T9WA 2YPYA 4ZK7M 2GIQA 1ZA2B 2DNLA 4G3IA 1B70B 2MLXA 4KH1B 4CWBA 5I42B 3H2UB 4DV6F 4X2BA 5KG2A 4KH0B 1SB6A 3GB0A 3TP2A 3K7RA 1EARA 5CAAA 5A8WB 4Y3CA 1VQ9S 3C19A 4F4AA 1SL2A 1NO8A 5G0RA 3KMQA 3H4DA 3G9CA 3P49B 1FE4A 5D4OA 1TZ0A 2W9BB 1FJGJ 2VBXA 2IFXA 5KFUA 4OLPA 4DR3J 3RB4A 2M5YA 4ZVUB 1UJ5A 3GFHA 2BJEA 1R0AB 1X0PA 2DO4A 2CPEA 3BQ0A 3SV4A 4RR5A 1PCAA 1BD6A 2E1PA 4PXBA 4PYDA 1U1OA 1NUEA 4DX7A 4LF8F 3CF5Q 2XTJP 4UUXA 4ID5B 3VAGA 1U4BA 1X4BA 1N32F 3GJTB 1P8GA 1GTEA 2XC9A 3OJUA 5U47A 1CJUB 2CA9A 5KFZA 2QIFA 1S9GB 5ETTA 4DSKA 4OFZA 1UWAA 3BV8A 1CJTA 2IAJB 4J37A 3H5YA 4H4OB 4FS2A 5LSOA 1WHVA 2FQQB 2DITA 5KFVA 3CD6S 3QBCA 1H2VZ 4ZN1A 2A2CA 2Z2ZA 5IT4A 2XMUA 2N7YA 2WVBA 2J5AA 3QJPA 4J9MA 4HTJA 3TOQA 3ETMA 4CLSA 3PO5A 1S77D 1VJWA 1FK9A 2JLEA 2HZVA 1T05B 1RWMB 1VBKA 1WSVA 3C16A 5KFMA 1VRQC 4A8KA 4IH7A 2HHPA 3EVOA 1NM2A 3D7SB 3OHBA 2N7CA 2QL7B 3D6MB 3UFCX 3BSNA 4B02A 1SL1A 3AT1B 3VAKA 2QV6A 3MURP 5LJ3Y 4CO1A 3TUPA 1UAWA 2EFGA 3LF0A 2AIRB 1NK7A 5J1PA 5DDRC 2CXEA 2XWXA 2JNJA 3MM9B 3OL8A 1XMQJ 1EX8A 1SPBP 3EWGA 4PQAA 4F2RA 5D78A 3QSYB 4N47A 3FFIB 2ZOMA 1ROFA 5J2QA 4OX9F 2IMWP 3K58A 1WHYA 4WJBA 2W24A 1DY3A 2HBYB 5ETQA 1WEXA 3UNGC 1VRUB 1R6VA 2IMOA 3FQKA 1SL0A 2BUNA 1RU1A 1N8RT 3GSIA 4LR7A 3QT8A 2AF6A 2CPXA 1KHWA 2G2OA 4PG6A 1HNZJ 1HD0A 5C42B 1K9MT 2CJ9A 1NHVA 3CC4S 4E2FB 3GYGA 2FHJD 5HJYA 3D2WA 2R2RA 3TQEA 2CPYA 5BYQA 4DUTA 4DFJA 3EGNA 2HW3A 1HYSB 3OW2R 4I6YA 1NK6A 3KLVA 3QYYA 3A13A 2GGPA 4QWCA 4Y2KA 4H4MA 4BWMA 2W7AA 2CADA 1BQXA 2BV3A 4LVOP 2NLWA 3UD3P 3B6BA 2V2QA 3LP1B 1BWVA 2BVZA 1U6ZA 3RBEA 2W2OP 3UI3A 3K57A 1IJEB 1D9FA 4U9RA 2MGZB 3CJ2A 1T94A 3N79A 1VQ8S 1IBKF 1OY9A 2COLA 2MB0B 4RNHA 2YNIB 4K4UA 4URGA 3CD0A 4X4UA 4BS2A 1IQZA 2RDIA 5KFSA 1HBUA 1S6QA 2B51A 3I4PA 1JJ2R 2NCKL 3DN9A 2WBRA 1KLNA 4X84A 1QUVA 2NR0A 4EBCA 3OD2A 1FXDA 2DT9A 1GMWA 2B5JB 2H51B 4M5NA 4X62F 3CDBA 3I56S 3Q23A 3O3LA 3NGRA 5GVQA 1TVRA 2LMIA 2W2PP 3H8YA 4J9OA 1DLOB 5CQGA 2MQNA 5FLXU 1OO0B 3BJYA 2RUSA 2HURA 4P7VA 2C2KB 3GU0A 1WC4A 5GADU 4H54A 2QT7A 1UCNA 2ZHBA 3L9ZA 1WHWA 3UDCA 3US5A 4ED0A 4PWDB 1RTJB 3KUEA 1Q82T 3IRXA 3GJSB 3PW4A 3PYFA 4QIVA 2UXBF 4CLTA 1K47A 1WEZA 1IBMJ 2OFGX 1HWLA 3OV7A 3HHLD 4JV1A 4KGMA 1YJ9S 4NLXA 4OYOA 2DEJA 3CJ0A 4B9VA 3KLHA 2ZHOA 2HVHA 4IOCQ 3RR8A 2GC8A 4OLOA 4QWEA 3QFWA 1VC0A 4ED5A 3DRSA 1ZOTA 2HVZA 3H4BA 1FT8A 4KFBA 3EXYA 1ZZFA 2H4WB 2AT1B 1B7YB 2KJWA 2BA9A 2HHHF 1LK5A 4XAKA 3D3BJ 4DSJA 4WK1A 3KK2A 2V8PA 5D0HA 1FF2A 2CRLA 2VFRA 2CPZA 1H2UX 5GAEI 3CJQA 2JDJA 3OLBA 2GO9A 2VL1A 1WC1A 2QL5B 3EXCX 4JOUA 1RT4A 2XCPA 2VQEF 1N32J 2J0WA 4LRDA 3BGLA 1NXIA 3KYLA 2QG9B 5HSPA 4F7VA 1VQOS 4O44A 5H9EJ 4OMFG 2RUGA 2YNFB 2QYGA 3OVAA 4AUKA 2LP4A 3D68A 2YH0A 3LOUA 1S6UA 4EGLA 3P4UB 3FEZA 8AT1B 2MY8A 3PV8A 4CTAA 3LW5C 5HP1A 2R2TA 1PYTA 3SZ2A 3HM9A 1C1CA 2SXLA 2DKOB 2EBEA 2LEPA 4LF1A 4LR9A 4F3MA 2U2FA 4PUOB 4O3PA 4PXDA 2HNDA 3ZZ0A 3C66A 4OI0A 2DHGA 1T8EA 3EGZA 4P2MA 4R25A 3SSSA 2FVSA 1XR6A 6FD1A 4GC6A 5A2QU 1RZMA 4LRCA 2OUGA 1GX5A 3CW2C 3HKWA 2IM0A 3RRGA 2AV5A 2IYGA 5F8NA 1FRJA 1IKWB 2VG5A 2YWGA 2Q3PA 3R9LA 4H4KA 1VLYA 3JAMY 3M7VA 2Z4PA 3CWJA 2WOMA 1LW0A 2EFOA 3QZ8A 3M32B 2XY6A 1U6BA 2E7WA 2MKJA 3SEOA 4LF5J 4FPIA 2RQ4A 3ILIA 2QSFA 3GIRA 5B08A 3MD1A 1A0OB 4F0KA 3HDSA 3TUIC 4OX7A 3HSJA 3S1TA 4M5IA 1N5VA 4ZA1A 4OX9J 3BR9A 2C3YA 4I7FB 1VOMA 3CC7S 5FDLB 4AE5A 3VZHA 1N52B 1QE1B 2IM3A 3KLGA 4WE1A 4PG7A 4DUYJ 3MFHA 3H20A 3JQMA 4DZDA 4G6VB 1VBZA 4DCPB 2O1PA 3TANA 2CQ0A 2VG6B 4ZDNA 1VQKS 2NXEA 4PPDA 3PZPA 1RHKB 1F5CA 3HHLB 5JUMA 2QE5A 4EZ9A 4GVLA 3M6WA 1LW2A 1N5YB 3CVKA 3N5FA 3SCIE 2KRBA 3G4SS 1G4CA 1OY8A 2HPUA 4QYRA 3FBEA 4C7QA 2VFUA 3A8EA 4I56A 2HG4A 1R7IA 1RABB 4LF7F 2BX6A 3G8TA 2HHVA 3TA1A 3D3CJ 4NCGB 3HVTB 4MKVA 2LDIA 1TR0A 2DIVA 2HK2A 4Y28C 3PEJA 3QJJA 5BJRA 3TEHB 4Q2MA 3MHYA 2XO6A 4YR0A 2W25A 4WBFA 3HULA 2VODA 1U8WA 5C25B 1U24A 3GFZA 4EFAC 3GIMA 1TFWA 2V4QA 1WKKA 1ICEB 1N0UA 1PSDA 1LV5A 4NA1A 4UW2A 2B0GA 2LECA 4YQWA 3ADAC 1W2IA 4X62J 3KLIB 5HMXA 1XMOF 1WOSA 3DRYA 2EPIA 1FWPA 3CCSS 1DQ8A 1B64A 3GPAA 3BQ1A 4UF4A 1VR6A 3WX8A 3HZGA 1NNDA 5I3QA 3LGHA 1TL3A 4DN0A 1RQ0A 2BE2A 2FHOB 2N82B 1VIXA 3M2VB 5HBMA 3NGKA 2FTRA 3KHGA 2E1MC 1EKRA 3DMJB 4DR4F 2R2SA 4Q45A 2MMYA 1ZYQA 1S6OA 2VICA 1H6KX 3BM7A 1T3NA 2DH9A 2E1AA 2R4FA 4K4YA 1SJQA 2RQKA 4USKA 4DUZF 1HBMA 2QO3A 5KT2A 2H48B 4O4GB 2MZTA 4XPCA 1IKVA 3T5LA 3SCKE 4OYIA 3D54A 1HKAA 4RZRA 1JLCA 2KO1A 3QO9B 3MM7B 2DXFA 1RT1B 2QGFB 2DNHA 3MEEA 3M8PA 4DHVA 2NUHA 4ZHRA 4R5PB 1DTTA 2L9WA 1FXRA 1WOOA 2D3ZA 2CPIA 3M8YA 2R7RA 1FA0A 3DNCA 2VOOA 3BKFA 2YX1A 2PA3A 2I9SA 5HQMA 3NS5A 2ZM6F 1RWXB 5G0RB 4V19J 3GE9A 1RDRA 2PI5A 2DGQA 4ZVTB 3A3PB 4DF8A 1N33J 3IM9A 4QR0A 2CJBA 4Y2IA 3CJ5A 3ITHA 1SQGA 1JIHA 3H5SA 1UETA 2ACMA 4CO0A 2FLNA 1S10A 3CIMA 3PHEA 2AZ3A 4OQJA 3BGUA 3BQ2A 4F4YA 1RT5A 4N8NA 4JI7J 3HHEA 2ALYB 4C8MA 5KFIA 4LFBF 4YFUA 3MGJA 3T5KA 1M5SA 2ASYA 2IJFA 2OGUA 1CJTB 3NNHA 3G71S 1K8AT 1NZ8A 1TKTA 4FXWA 3HO1A 3BR8A 5J2MA 3LP2A 5EN1A 1VISA 1JXEA 5L9NA 3RW6A 2ASJA 1C4AA 1LNQA 2DJWA 3M8RA 3T1YF 4NMXA 1FEEA 1G7CB 1F5AA 1Q7LB 1GH8A 2GHPA 2E7XA 1QD1A 3MAQA 1FNMA 2WSEC 3UCZP 1FK9B 3JSMA 2V4JA 2DXEA 3C16B 1S0NA 1S49A 1YQHA 2FLLA 3NLCA 4BDPA 3JTPA 1H98A 5H9FJ 3TARA 3D0IE 2MHNA 2Z57B 3MM5A 1X4FA 1NCLA 3TO8A 2JEJA 1PGZA 2OEJA 2Z8QA 2LQBA 1B4SA 4WWSA 5KFAA 4V19X 3LO3A 1VBYA 5CYQA 1PJ5A 3ONQA 3ZZZA 3HFZB 4C3KA 4Q0BA 4ZIVA 1U49A 1O51A 5DZ7A 2YKMA 2JL9A 4DQPA 2XNRA 4PG4A 2H3EB 3FDSA 5HL7Q 4M94A 1KOHA 1M5OC 3RAMA 2ZH7A 3K8WA 2AD9A 5J2QB 3BH6B 5FJ4A 1N56A 1X9MA 1T02A 3CJ3A 3R5BA 4CH0S 1YITS 2NPIA 4NLUA 1NJXA 2C2ZB 4IDKA 5A6PA 2UU9J 4PAAA 3LWMA 5C2CA 2L48A 3DLJA 4RWWA 2RAQA 4AQYJ 1KNZA 3D28A 3W3SA 4WZMA 3CEDA 1FRKA 4NLSA 4OI2A 2JFDA 1Z2LA 2ZC4A 2NYIA 3EZOA 2YPZA 4F3QA 3Q83A 3M2RA 4JP8A 3MM8A 2M7SA 2GGPB 2UUCF 3KLFA 1LWCA 1EP4A 1LFPA 1JJCB 4H4MB 4F4XA 1WC6A 1FO1A 2W2NP 1XMOJ 3MCSA 3BH7B 2MKHA 2MTLA 3OPKA 3AXMA 1I94F 2H9ZA 4KPYA 1J5EJ 3CJ8A 2V5HG 1DAXA 1TL7A 2I38A
chains in the Genus database with same CATH topology
1XIQA 4ANCA 4CP5A 1PKUA 3BH6B 3Q86A 3FBCA 3B6BA 1VYAA 3VGSA 3FC9A 2BX6A 1HIYA 4ANDA 1NSPA 4W98A 2B8QA 3ELHA 3JS9A 1S5ZA 1LEOA 3ZTRA 1XQIA 3FBBA 5CAAA 3ZTQA 2HVEA 1F6TA 3VVTA 4F4AA 2DXEA 3VGUA 1LWXA 4EK2A 1NHKL 3NGSA 1NB2A 4DZ6A 3EVMA 1ZS6A 2DY9A 1B99A 3ETMA 1WKLA 3FCVA 3BBCA 3EJMA 1JXVA 4UOFA 1PAEX 3NGUA 1NLKL 4ANEA 2NCKL 2BEFA 3Q8UA 1MN7A 4WBFA 5IOLA 1F3FA 3FBFA 3L7UA 1HLWA 3EE3A 1NDCA 3BBBA 3DDIA 3BBFA 1U8WA 4F36A 3PJ9A 4DI6A 2AZ3A 3EICA 4S0MA 1W7WA 1HHQA 3VGTA 1BUXA 1NCLA 3EVOA 3ZTPA 3MPDA 1NPKA 1NDLA 2AZ1A 1NDKA 1WKKA 1S59A 4ENOA 3NGRA 1B4SA 2DXDA 5C7PA 3PRVA 1NUEA 3FKBA 3B54A 1NSQA 1MN9A 2B8PA 4KPCA 1NDPA 3Q83A 5CABA 1WKJA 3EVWA 2DXFA 2HVDA 4UOHA 4DUTA 4UOGA 4C6AA 2HURA 1NSKL 3ZTSA 3G2XA 3NGTA 2CWKA 3Q89A 3Q8VA 3Q8YA 4FKXA 2ZUAA 1BHNA 4FKYA 5BXIA 3EM1A 3ENAA 1KDNA 1UCNA 3BH7B 3GPAA 4HR2A 2DYAA 3R9LA 3ZTOA 3GP9A 3FCWA 4O0NA 1K44A 2VU5A 1EHWA 3WX8A 3VGVA 3VVUA 3DKDA 3EMTA 3FBEA 1S57A 1BE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIQ A;  4ANC A;  4CP5 A;  1PKU A;  3BH6 B;  3Q86 A;  3FBC A;  3B6B A;  1VYA A;  3VGS A;  3FC9 A;  2BX6 A;  1HIY A;  4AND A;  1NSP A;  4W98 A;  2B8Q A;  3ELH A;  3JS9 A;  1S5Z A;  1LEO A;  3ZTR A;  1XQI A;  3FBB A;  5CAA A;  3ZTQ A;  2HVE A;  1F6T A;  3VVT A;  4F4A A;  2DXE A;  3VGU A;  1LWX A;  4EK2 A;  1NHK L;  3NGS A;  1NB2 A;  4DZ6 A;  3EVM A;  1ZS6 A;  2DY9 A;  1B99 A;  3ETM A;  1WKL A;  3FCV A;  3BBC A;  3EJM A;  1JXV A;  4UOF A;  1PAE X;  3NGU A;  1NLK L;  4ANE A;  2NCK L;  2BEF A;  3Q8U A;  1MN7 A;  4WBF A;  5IOL A;  1F3F A;  3FBF A;  3L7U A;  1HLW A;  3EE3 A;  1NDC A;  3BBB A;  3DDI A;  3BBF A;  1U8W A;  4F36 A;  3PJ9 A;  4DI6 A;  2AZ3 A;  3EIC A;  4S0M A;  1W7W A;  1HHQ A;  3VGT A;  1BUX A;  1NCL A;  3EVO A;  3ZTP A;  3MPD A;  1NPK A;  1NDL A;  2AZ1 A;  1NDK A;  1WKK A;  1S59 A;  4ENO A;  3NGR A;  1B4S A;  2DXD A;  5C7P A;  3PRV A;  1NUE A;  3FKB A;  3B54 A;  1NSQ A;  1MN9 A;  2B8P A;  4KPC A;  1NDP A;  3Q83 A;  5CAB A;  1WKJ A;  3EVW A;  2DXF A;  2HVD A;  4UOH A;  4DUT A;  4UOG A;  4C6A A;  2HUR A;  1NSK L;  3ZTS A;  3G2X A;  3NGT A;  2CWK A;  3Q89 A;  3Q8V A;  3Q8Y A;  4FKX A;  2ZUA A;  1BHN A;  4FKY A;  5BXI A;  3EM1 A;  3ENA A;  1KDN A;  1UCN A;  3BH7 B;  3GPA A;  4HR2 A;  2DYA A;  3R9L A;  3ZTO A;  3GP9 A;  3FCW A;  4O0N A;  1K44 A;  2VU5 A;  1EHW A;  3WX8 A;  3VGV A;  3VVU A;  3DKD A;  3EMT A;  3FBE A;  1S57 A;  1BE4 A; 
#chains in the Genus database with same CATH topology
 3G6V A;  4NPO A;  4C3L A;  3ILO A;  1NJI T;  4GRS A;  2UUB J;  1YJV A;  4KGV B;  4WKY A;  2C22 A;  1HBU B;  1S6Q B;  1QVF R;  1RP5 A;  5ETR A;  1FDA A;  4ICL A;  4LT6 A;  4A8W A;  2WAQ D;  1FES A;  4W90 B;  3C14 A;  5DQG A;  3MOZ A;  4DZ6 A;  4NYZ A;  2P9G A;  1S9E A;  4NML A;  1TVR B;  1FRL A;  2OJ3 A;  1GAO A;  5GAH I;  1W7W A;  3KHH A;  5GAG I;  4A8O A;  3W9H A;  2K3K A;  4ZS6 A;  3V4M A;  2RB7 A;  3CCT A;  5KFW A;  4RW9 A;  4RJV A;  4A48 A;  2DEI A;  1UVI A;  3Q2S C;  4TYB A;  1X4G A;  3IRX B;  1UTA A;  2XM3 A;  3Q8P B;  4QCL A;  4ZPW R;  2UP1 A;  5THW A;  3F44 A;  2QA4 S;  2M88 A;  4P73 A;  4ECW A;  1S57 A;  5LXY A;  2B9X A;  2BQ3 A;  4FN5 A;  2WVF A;  2APO A;  3R8Y A;  3KLH B;  3KJN B;  4IQX A;  3N01 A;  2DNG A;  5KFY A;  3X3U A;  2KDO A;  2YKN A;  3ZTQ A;  3DRS B;  5LJ5 Y;  1ZTT A;  2HHX A;  5T41 A;  4LFC J;  1OQ3 A;  5E3A A;  4KFB B;  2UXC J;  1NHK L;  1C2P A;  3JXO A;  1KQF B;  1FX4 A;  2C3M A;  3F56 A;  3UNY A;  3KK2 B;  4ILR A;  4AYB D;  3DYA A;  5ETS A;  2R8J A;  2RD5 C;  3SCJ E;  4P74 A;  1X31 C;  2RU9 A;  2BJ1 A;  2AZ1 A;  3G6X A;  2MKI A;  1RT4 B;  1CSJ A;  1FE0 A;  2BQR A;  4JI8 J;  3L95 X;  4AL6 A;  3POT A;  2QMX A;  1O6X A;  2VBY A;  3G2X A;  1UWB A;  1FVQ A;  2IVF B;  1WEL A;  1UEU A;  4O44 B;  3OHA A;  1UZD A;  2CJQ A;  4K59 A;  3FQL A;  4HH0 A;  1UVL A;  1XBW A;  2HKE A;  3I87 A;  2QEX S;  4CTA B;  4M5K A;  5HP1 B;  2GS8 A;  1C1C B;  1T9Y A;  2WTF A;  3HKZ D;  3T1Y J;  3P8B B;  1RAA B;  4B3M J;  2HEK A;  3M6X A;  3GZ7 A;  1YRU A;  3NWG A;  1W25 A;  2DGX A;  2HND B;  2CJX B;  2RF2 A;  1OS5 A;  3MI7 X;  4USU A;  5IC4 B;  4EYH B;  1WF0 A;  1PAE X;  3AAW B;  2DBB A;  4ZVF A;  1IJF B;  1CC7 A;  1JK9 B;  5F8J A;  1ZPV A;  2G13 A;  2EEY A;  2KFZ A;  2DNK A;  4DFM A;  2DGS A;  2DO0 A;  2KH9 A;  3EZ5 A;  4WP9 A;  2HRT A;  1T11 A;  3T9Z A;  1AXQ A;  1K0T A;  2DIU A;  2VG5 B;  2ZZN A;  4DR7 F;  2KT5 A;  2MZS A;  4C6A A;  4FS1 A;  2FGC A;  5HVG A;  2WOM B;  1LW0 B;  2Z56 B;  3DOL A;  2RT3 A;  4CO4 A;  4C98 A;  3T3F A;  1OPI A;  3CTR A;  2CZ4 A;  2Y0S D;  2CQI A;  2RS2 A;  4KO0 A;  4YHH J;  2XMW A;  3KG1 A;  4I2Q A;  2XQC A;  2OEL A;  3CDW A;  1T95 A;  1MWZ A;  4B3S F;  2CZV C;  3DDN A;  2OKQ A;  5C5J A;  5B0F A;  3MF5 A;  3N0V A;  2AEM A;  4KGZ B;  3KLG B;  2P2C B;  4WE1 B;  1REV A;  2YBV A;  3NS7 B;  3QZ7 A;  5HLF A;  2KFY A;  1BGX T;  2DNR A;  2RNE A;  5J1E A;  1Q78 A;  3ZNU A;  1HHS A;  1V9O A;  3GV5 B;  2UV8 A;  2DH8 A;  1LW2 B;  2ZH3 A;  3HHD A;  2MQ8 A;  2EWH A;  3KJV A;  2XSF A;  4KHM A;  1TMJ A;  1R6Y A;  3UR3 C;  5SUH A;  4C0B A;  1LKZ A;  5F3T A;  1Z2Z A;  1CS4 A;  4OL8 A;  1WWH A;  1Q16 B;  4A47 A;  3DOM A;  1S99 A;  5DZ6 A;  5E5N A;  3FSX A;  3TX8 A;  2B9E A;  3BGO P;  2FJD B;  2WVD A;  4RNN A;  5B7W A;  4RX6 A;  5IM0 A;  2RRB A;  3BGF A;  5F9L A;  3KUG A;  5B0B A;  1Q4R A;  1Y10 A;  2P6S A;  1NEE A;  1X5P A;  2J9E A;  2H1Y A;  2X3D A;  1WKL A;  4Q8E A;  2GX8 A;  1IBC B;  3NWR A;  3DHW C;  2J6U A;  3J7Z T;  2Q6C A;  2Q66 A;  3CJT A;  3DLG A;  5I4M A;  1XWL A;  2IJR A;  4JV2 A;  2FLO A;  3KK3 A;  1WC3 A;  4MKY A;  3OLA A;  3W2V A;  2GHW A;  2FJE B;  3WZ0 A;  4O23 A;  2JOQ A;  3NNC A;  2ZOF A;  3M30 A;  3R27 A;  5D6G A;  2DK2 A;  1FNO A;  3CCL S;  1TL3 B;  1VHF A;  3RTV A;  2CKW A;  2V6A A;  5L8R C;  2FVC A;  1KD1 T;  2BE2 B;  3OT9 A;  4LSL A;  2BMB A;  3DGV A;  2IA0 A;  1KRP A;  5HBM B;  4LF6 J;  3QGP A;  3MAH A;  3D9B A;  3IR7 B;  1CEZ A;  1OJ4 A;  1RTD A;  1R89 A;  4R8U A;  2EFQ A;  3E01 A;  1KS2 A;  2CQB A;  2ZZT A;  1S12 A;  1REG X;  1N5Q A;  3R7S B;  2AU0 A;  2VFT A;  1HBM B;  3HCX A;  4KR0 B;  2KG0 A;  3R5J B;  4KIA A;  2BM1 A;  1B99 A;  1VK3 A;  4MAK A;  1IKV B;  1U1L A;  4LRA A;  2A18 A;  1QJH A;  4DR5 F;  3KNA A;  1HLW A;  3EE3 A;  4OX6 A;  1S48 A;  1KEK A;  2J76 E;  1JLC B;  3B78 A;  3TZX A;  1FWL A;  2G0C A;  1YWX A;  2GQ2 A;  3MEE B;  2AJQ A;  3ZNJ 1;  2XGQ A;  3M8P B;  4HEA 9;  4TY9 A;  4ZHR B;  1HPZ A;  1DTT B;  4ED7 A;  1R27 B;  1U6F A;  2RIJ A;  5A8R A;  2LA4 A;  2H5I B;  2UUT A;  1NSK L;  4OZ0 A;  4DEZ A;  1M1G A;  4ZLL A;  2BAC A;  1WG5 A;  1MRO A;  2ASL A;  3MPW A;  2VOP A;  4RUB A;  3PAC A;  3IAM 9;  1I3O B;  5FD1 A;  1RAC B;  3Q24 A;  1YRT A;  3D67 A;  1RAE B;  3N9U C;  3ITH B;  4MJK A;  4IRD A;  2KXH A;  7FD1 A;  4RWX A;  1F0X A;  3QLH B;  5HRO A;  2LA6 A;  5IV4 A;  4NXN J;  2QC3 A;  2CG4 A;  2J0S D;  3PIO Q;  3O6Q A;  4Y2C A;  2LQJ A;  3O2I A;  1XC9 A;  1RT5 B;  1J2V A;  1VQ5 S;  2ROP A;  2ZE2 A;  3HSD A;  1VQN S;  2KI2 A;  1Q95 G;  2W9C A;  2ZDP A;  4X65 J;  4A46 A;  4RBU A;  4ITS A;  1YBA A;  4EBE A;  1FTC A;  4NLY A;  1Q7Y T;  3BEG B;  1WKJ A;  5ETP A;  3PR5 B;  2QLW A;  1S1V A;  1TKT B;  4NI2 A;  4OHZ A;  5J2M B;  3LP2 B;  1AUD A;  2ZJQ Q;  1DAR A;  5MLC V;  2XHW A;  3W1Y C;  4DR7 J;  2UVR A;  2FUG 9;  4L3N A;  4DX8 H;  2V9K A;  4AD6 A;  4F4W A;  4M5G A;  5ADZ A;  2IDL A;  3VVU A;  2WCX A;  1HWU A;  2OIH A;  4JI3 J;  1V5I B;  2HBR B;  5CXT A;  4LFA F;  3VGS A;  3JSM B;  1P27 B;  1U09 A;  1UJ6 A;  2V4J B;  3BDP A;  1NAQ A;  1R8C A;  4KY3 A;  2EG2 A;  3UN5 A;  3KFW X;  1EQM A;  4B3S J;  4OHV A;  1LXJ A;  1RTZ A;  4X64 J;  5D77 A;  4U8Y A;  3MM5 B;  3R5D A;  1HI0 P;  2VBW A;  2BEF A;  3GG0 A;  2V34 A;  4P2S A;  3NP5 A;  1NDC A;  4F02 A;  5CYQ B;  4RU2 A;  3MPD A;  3KLE A;  2DTJ A;  4Q0B B;  2YKM B;  3GV7 B;  4RKU C;  2BJ9 A;  4USW A;  3V2U C;  5IWA J;  3I32 A;  4UQG A;  2ZNY A;  2HS0 A;  1W26 A;  4ZVH A;  3R2D J;  1TEL A;  4ATN A;  1KDN A;  1S7H A;  5D0E A;  4QIG A;  3HHL C;  4I2P A;  3NCQ A;  1LEO A;  1VQS A;  1DUR A;  1BXN A;  4Z7C A;  2QLX A;  2PMZ D;  1IR2 A;  1Y5I B;  2H5E A;  3OTC A;  2FZC B;  4IDK B;  5EHH A;  4F0M A;  1QAY A;  2PD1 A;  1N34 F;  2WW8 A;  4TYA A;  3WDO A;  1QY7 A;  2CFX A;  1PYO B;  4I6A A;  4B9N A;  1YHQ S;  3J80 U;  1SV5 A;  4FNI A;  4YB6 A;  4WYL A;  4NYP A;  3MR5 A;  2VAS A;  2F1F A;  2AMC B;  1UJ4 A;  4ZLJ A;  4YY3 F;  4HI1 A;  4IRK A;  3QAU A;  4X66 F;  3WIV A;  5IV3 A;  3M2R B;  2CNL B;  4RUH A;  3MM8 B;  3KLF B;  1LWC B;  1EP4 B;  3AJ2 A;  2MZQ A;  1MG7 A;  1RTI A;  2V63 A;  2BOA A;  3BKT A;  3PFO A;  2ROE A;  4EWT A;  1YI2 S;  3I5C A;  4C8O A;  5IS2 A;  2JC1 A;  1L3V A;  4FZV A;  1TL7 B;  4FYX B;  3RB6 A;  1S9F A;  1UEK A;  4AL5 A;  5BR8 J;  1XNR J;  4O0N A;  4XPE A;  4MIB A;  3MPU B;  3W64 A;  2RHQ B;  1EHW A;  2PE8 A;  1OIA A;  4HDG A;  4ICL B;  2Y1J A;  1X9S A;  3DCA A;  3C14 B;  4OZL A;  1RAD B;  1GTH A;  3P3D A;  5A0Y A;  3J7A 1;  2NSB A;  1Q86 T;  2XEX A;  3PW2 A;  1UP1 A;  1KHV A;  1S9E B;  1CC8 A;  1UL3 A;  3ZC4 A;  1X4C A;  4RW7 A;  5DQH A;  2L3M A;  4G1I A;  2CVI A;  1NKB A;  4DR1 J;  2GFF A;  1QAJ A;  3HSG A;  3O8W A;  5D4N A;  5LT5 A;  1H72 C;  1KLM A;  2LEA A;  2MJU A;  4RW9 B;  1U1Q A;  3HSZ A;  4RU9 A;  2E5L F;  1AB8 A;  4JI6 F;  2PEB A;  1TP7 A;  3VR1 A;  1B0V A;  4ZLN A;  3QRR A;  4ECU A;  2B7B B;  1RYR A;  1WI6 A;  2NQP A;  1H7X A;  4HDH A;  4F50 A;  2E29 A;  4A8M P;  1HR0 F;  4MMO A;  3ZXW A;  2HNZ A;  2KVI A;  2J9D A;  4PAB A;  1IQT A;  3MPV A;  2VF3 A;  3HP6 A;  2GO8 A;  5CZV A;  5KG1 A;  3EPI A;  4RBV A;  1UMJ A;  4Q7A A;  4ES3 A;  1HNI A;  2X1A A;  3M8W A;  2JX2 A;  3C8Y A;  1F5B A;  4Q43 A;  4NOH A;  1GX6 A;  3QGH A;  2IRU A;  1VGY A;  5CCM A;  1JWW A;  2DPI A;  3DYA B;  2RQC A;  2AP6 A;  1KSP A;  3QAE A;  3VAH A;  1AFJ A;  1M5K C;  2P9C A;  1HA1 A;  1RHU B;  5HAN A;  3GYN A;  3MR6 A;  4IG3 A;  1CG2 A;  2CQP A;  2QLJ B;  3G82 A;  3TJA A;  3L7U A;  2CQ2 A;  2KM8 C;  3BN4 A;  3VGT A;  3GSD A;  1PAU B;  2GW8 A;  1CLF A;  2ZOG A;  3QGG A;  4G1P A;  2XNQ A;  1UWB B;  3QIP A;  3CD7 A;  3KG4 A;  3D4J A;  5C24 A;  2ACY A;  2ZH6 A;  3T5J A;  5J2N A;  1Z4U A;  1RHJ B;  1AYE A;  4DL4 A;  4WII A;  2E5I A;  2DNZ A;  4NLP A;  5ETL A;  3W66 A;  1X7V A;  3CCU S;  5B0D A;  4ZP9 A;  4DR6 F;  4QW8 A;  2MZJ A;  3CMA S;  1JQG A;  4E98 A;  5L38 A;  4JI2 J;  3ENQ A;  1H3D A;  2Z0G A;  1FRX A;  3QT6 A;  2R7W A;  1NSP A;  1WEY A;  1M1H A;  1HD1 A;  1RAG B;  2RF2 B;  2GHV C;  4DL0 C;  4B3O A;  4C3M A;  4L75 A;  2QN6 B;  3PRD A;  3UQS A;  4HL9 A;  4YDX A;  1RYS A;  4K7Q A;  1HNX J;  3SI8 A;  4USV A;  3EDR B;  4NXM J;  3CSK A;  4C9D A;  2F7V A;  3RAX A;  2RSQ A;  5LMN F;  3QGI A;  4I69 A;  2W2M P;  1URR A;  3DDK A;  1YBU A;  2ALZ A;  1FTR A;  2YNH A;  2DD8 S;  2WB1 D;  5C7P A;  4NEZ A;  1HNW J;  3DOL B;  2Z2Y B;  2VJV A;  3E8O A;  4KE5 A;  4OIX A;  1NSQ A;  4P52 A;  1TV6 A;  4PYA A;  1NJY A;  3VAI A;  2ZWP A;  1CJK A;  4Y6I A;  2JH3 A;  4UQT A;  4ELT A;  3KXD A;  2DR8 A;  3TYT A;  4B9T A;  1BHN A;  3GII A;  4KO0 B;  5DG8 A;  4I2Q B;  5K8N A;  2D1C A;  3DU5 A;  3GIJ A;  3OTO J;  2HHS A;  2KXN B;  4LRB A;  3U1L A;  3NCR A;  2JRS A;  3PKM A;  3ZZT A;  1OPZ A;  4FBU A;  5SZT A;  2KXF A;  1REV B;  5RUB A;  3OSN A;  3OL7 A;  3W5Y A;  3MED A;  4C48 A;  4A4J A;  4ZIT A;  5HLF B;  1PBA A;  2W4P A;  5DGB A;  3UDE A;  2XWY A;  1FJC A;  5J1E B;  2FYX A;  4N8O A;  3OL9 A;  1GXL A;  2YTC A;  5DM6 Q;  1Y5N B;  3JSY A;  4QR1 A;  1F3F A;  1U2F A;  1HWK A;  3KJV B;  2IA6 A;  4QWD A;  1BUX A;  3QSI A;  3J7Y U;  2O67 A;  1NDL A;  4CCH A;  1BQM A;  3TEG A;  3J7A N;  4K5R A;  2C2E A;  1F60 B;  4BCA A;  2VDH A;  1CS4 B;  3UCU P;  5I3U A;  1D9D A;  4YS2 A;  3DOM B;  3PX4 A;  1A7G E;  2OPR A;  2XI2 A;  3OFF A;  3IWN C;  2HHW A;  5D4P A;  1VBX A;  4OJ1 A;  4DV5 F;  2I6W A;  4LMZ A;  4NA3 A;  3C3L A;  4OYW A;  1NK4 A;  4MK9 A;  3OXG A;  5IM0 B;  3KJF B;  1QAX A;  1VI7 A;  2J6S A;  2VA3 A;  5D8H B;  4N41 A;  4DLG A;  4FF3 A;  5AJ3 F;  5A8K A;  1RKJ A;  3ZO7 A;  1AZS A;  3LGM A;  1SUQ A;  3H7H B;  4Q2L A;  4RL1 A;  2MQL A;  4TNO A;  3RG6 A;  3HFV A;  3DLG B;  2WSF C;  3SFG A;  2HAF A;  3F41 A;  4J9P A;  3KK3 B;  3CME S;  1U2R A;  4P2F A;  3KOA A;  1HI8 A;  3W2V B;  2RDD A;  3NOG A;  2W8L A;  3PEH A;  3M30 B;  1ZM4 A;  3GV8 B;  1AA1 B;  2F4V J;  1T3O A;  5F8G A;  3NRB A;  2H4Y B;  3LPY A;  4B9S A;  4LSL B;  3MCN A;  2V2K A;  3K2Y A;  4QPT A;  4P6Q A;  4IR1 A;  4DV4 F;  2QTW A;  4GO7 X;  1RTD B;  4OX8 A;  3HHK A;  2J8S A;  4DV7 J;  4R8U B;  3NBP A;  3E01 B;  4CLZ A;  3M8S A;  9RUB A;  2DR9 A;  2QMW A;  4HTI A;  1S4F A;  1YK9 A;  1UA1 A;  2F4F A;  5B09 A;  1H7W A;  1W2B R;  2V8G A;  3ZTR A;  4ZPC A;  4ZN3 A;  4XDC A;  2EI5 A;  1NJZ A;  3T9N A;  2KG1 A;  4NRT A;  3M8Z A;  1PYS B;  1SQF A;  5EX0 A;  4M5L A;  2MST A;  3C46 A;  4NCA A;  2B4V A;  3DLK A;  3Q0A A;  5T14 A;  2KB2 A;  1A9N B;  1UVN A;  3R5C A;  1HPZ B;  1TL5 A;  2P9E A;  4ZJO A;  2G0J A;  2BDP A;  2EK1 A;  5A8R B;  3VV2 B;  3NCP A;  3BO3 A;  3GIK A;  1MRO B;  5AE1 A;  2NSC A;  4NLV A;  2Z2L A;  3SSQ A;  2ZVS A;  4CIO A;  4CQ1 A;  5KFC A;  5L46 A;  2GVZ A;  3RGI A;  3GFX A;  4P2X A;  1UFK A;  4O3O A;  3OVB A;  5ETO A;  4HHU A;  2VPY B;  4I64 A;  3ICL A;  1LOU A;  3DKD A;  4CDI A;  3H59 A;  1XIQ A;  2FZK B;  2HZA A;  4RNF A;  4LF2 A;  5HRO B;  1DBD A;  4K4T A;  1WTF A;  4ZPT R;  2HQF A;  3EGV A;  2ZE2 B;  3VVT A;  2W9C B;  2DH7 A;  2M9K A;  2CNN B;  3B82 A;  1HFE L;  1VC6 A;  4DL7 A;  3UO0 A;  4B3T J;  1N0V C;  4ANE A;  4DDF A;  3EDQ B;  1NKE A;  3ET6 A;  2H65 B;  3T6J A;  1HHQ A;  1S1V B;  3TWZ A;  3CUN A;  2XMA A;  1F2H A;  4NI2 B;  3CNQ P;  5EWG A;  4WP8 A;  5LMN J;  4MK7 A;  4J9K A;  4BHQ A;  3RB0 A;  3HLU A;  1ZH5 A;  2AX1 A;  4F25 A;  4DG1 A;  1URN A;  4RW8 A;  2Y1L B;  2AYG A;  1R3N A;  2HFO A;  2M70 A;  2MQQ A;  4DV2 J;  1A6L A;  2F65 A;  1RT6 A;  2KL8 A;  5KG3 A;  1GMV A;  3IR5 B;  1SH2 A;  1E6Y A;  1FKP A;  4H4K C;  3IM8 A;  2P6T A;  2ZDO A;  5JVG Q;  1KVJ A;  3MR7 A;  1IBL F;  3UDV A;  3MD3 A;  1SIW B;  1CUL A;  1RLC L;  1T7P A;  4NYO A;  3PDN A;  3JTO A;  1IWA A;  2FD2 A;  2GJI A;  4A8Q A;  3TA2 A;  2ZBR A;  2EFV A;  3D1H A;  2E66 A;  3BKU A;  2XY7 A;  3DRX A;  2H5J B;  1U02 A;  3M9O B;  1OMS A;  1UFW A;  3D1Q A;  1BLU A;  3KLE B;  4O3Q A;  2O66 A;  2IPO B;  5J2P A;  1RHM B;  3VAL A;  2K06 A;  2ADC A;  4CNY A;  4ZVQ B;  4IQM A;  1R43 A;  4DFK A;  2CJK A;  1CPZ A;  1FWK A;  4DF4 A;  1FHT A;  4ZVS B;  2C1E B;  3BB5 A;  4DV3 J;  2CNO B;  4I2P B;  1LXN A;  1NB7 A;  2ILY A;  4DV1 F;  5F0U A;  4NCB A;  3ENA A;  4ZVG A;  3Q8Q B;  4E8U A;  1ZBT A;  1WTB A;  3JQK A;  1FKA F;  2FVR A;  1UEV A;  3FK4 A;  3I9V 9;  4RNM A;  3TJ8 A;  1KP6 A;  1RWO B;  2HQI A;  3Q22 A;  2DIS A;  4WXO A;  3OBI A;  3TAQ A;  4ECQ A;  3GCX P;  1SV5 B;  1K0V A;  3EYZ A;  1G1X A;  2UV8 G;  2XLJ A;  2EKY A;  2F3J A;  1VQ4 S;  2ZBQ A;  3KUH A;  4GO5 X;  2ZJR Q;  3I4H X;  1K1Q A;  5KG0 A;  2AGO A;  4GKJ J;  3HJF A;  5DS7 A;  4JI4 J;  4PWU A;  1S6P A;  2B43 A;  2AW0 A;  4ZJQ A;  5CZX A;  3KMS A;  3OTD A;  1RTI B;  4DCO B;  1NH8 A;  5KFF A;  5CCL A;  1S0V A;  2NZ4 A;  3NEK A;  3PKY A;  2DXD A;  4L3K A;  2D9P A;  3NAH A;  3K59 A;  2KZM A;  2EC2 A;  1KQS R;  1DTQ A;  2HMI A;  3CC2 S;  1RAI B;  1RAF B;  5ETM A;  1Y00 A;  2ATL A;  2G4B A;  4P71 A;  1T9T A;  5E2Q A;  2XMT A;  3UPF A;  5A0Y B;  1WDT A;  2M0G B;  3KNG A;  1RT7 A;  2QA1 A;  1FFG B;  1HMV A;  1AT1 B;  3AD8 C;  1JLA A;  2RKI A;  1Q0N A;  2A1B A;  4RW7 B;  3QPI A;  3I82 A;  1XN9 A;  1P1L A;  5ETV A;  1PIL A;  4QU6 A;  4M5D A;  4C97 A;  3SQO P;  4EO8 A;  1KLM B;  3FCH A;  3ENW A;  3FMB A;  1VFJ A;  5IZH A;  3AHP A;  3THV A;  1LWE A;  1R8B A;  1ZAX A;  3FMW A;  1H74 A;  4IO9 Q;  4N56 A;  2ASD A;  4JV0 A;  6FDR A;  2DGT A;  2R3V A;  1WUU A;  2UVV A;  1YG0 A;  3OFG A;  3WQP A;  4K2X A;  4KHP J;  2PMW A;  1O8B A;  4JI0 F;  2LQ9 A;  5L1K A;  4LSN A;  2HNZ B;  5CAB A;  3PJX A;  2E9Z A;  3UDL A;  3N6M A;  4WK3 A;  2YWH A;  2MLY A;  4ECY A;  4ECR A;  4L74 A;  4HR2 A;  2YQ0 A;  3CO9 A;  3X1L B;  4LBP A;  1N5T A;  4QWA A;  4P10 A;  2DY1 A;  1HNI B;  1KTV A;  4DV6 J;  1WG4 A;  2AJ4 A;  1Y4Z B;  4WFN Q;  1RAH B;  3GYX B;  1RWN B;  2VPX B;  4DLE A;  3MOJ B;  1RBO B;  3IO1 A;  1Q1K A;  2KN4 A;  4IG3 B;  2QL9 B;  3G82 B;  2DR5 A;  4DN9 A;  2L9D A;  3EGW B;  3FEX B;  4IG0 A;  4KGX B;  3UD5 A;  3D6F B;  2E44 A;  2JVR A;  2Y9H A;  4NLO A;  4I0W A;  3LP0 A;  3HXM A;  3QIP B;  3K5P A;  2MKK A;  3PJ9 A;  2LQ5 A;  5C24 B;  4KT0 C;  4KKO A;  5J2N B;  4LF8 J;  4WKR A;  5KFB A;  2AHO B;  3NMA A;  5E3P A;  2JC0 A;  4DSF A;  2KZZ A;  2DNP A;  4HHJ A;  4EEY A;  1FI4 A;  1WD6 A;  2XLK A;  2K2P A;  3P5T L;  2LKZ A;  3VWS A;  2FPH X;  3Q8V A;  3GJQ B;  1VQL S;  2DPJ A;  2AGQ A;  2FVP A;  4DBQ A;  2CWX A;  1TUG B;  1HAR A;  1O5J A;  4B3O B;  2QSW A;  1S7I A;  5H9E K;  3H0P A;  5FII A;  2I1R A;  1S5Z A;  2XYG B;  1F9H A;  1PC4 A;  4BC7 A;  4HKQ A;  2C42 A;  1KBR A;  4QBU A;  1U8S A;  4DSE A;  2X3G A;  5EGY A;  3TRG A;  1QUP A;  2W1B A;  1RWP B;  1HNV A;  2CQ3 A;  1YZ7 A;  3Q8S B;  2YNH B;  3IRW P;  1RWK B;  4NA2 A;  3ILL A;  3CMQ A;  4RW4 A;  2RE1 A;  2R7U A;  4J9S A;  1TV6 B;  2E1C A;  2AJ0 A;  2W01 A;  1CJK B;  3MMB A;  2KVQ E;  2HHU A;  4ZVO B;  2F8H A;  3VF0 B;  3K89 A;  2BRK A;  3ZTS A;  4KYZ A;  5CA5 A;  4DL6 A;  1LWF A;  2VQF F;  2Y8W A;  4NLR A;  4DV1 J;  4OJG A;  1WDD A;  5DDO C;  2KYX A;  4LBI A;  3UD4 P;  4UZC A;  4IO1 A;  4Q5V A;  3MED B;  3RUB L;  3CO0 P;  5KFP A;  4ZPB A;  4MFB A;  4G1Q A;  5KFG A;  1PIE A;  4PCQ A;  4EO6 A;  3MUV P;  5GMD A;  2QRR A;  1KQG B;  3SFU A;  3AOA A;  2Y8Y A;  2HVE A;  4IOA Q;  4O3R A;  4M5J A;  1UVJ A;  1RIS A;  1ZTW A;  2CAJ A;  4ED8 A;  4OHX A;  1PO6 A;  4YUD A;  1SVD A;  1Y0H A;  4Y34 A;  5CYJ A;  1C1B A;  2B7C B;  1NBE B;  2KYZ A;  1BQM B;  3RAQ A;  1RB0 A;  4B9M A;  5IQQ A;  3G96 A;  2F8M A;  1FJG F;  2J9C A;  4OZ1 A;  2KHC A;  3M1V A;  1RGV A;  3PM9 A;  4ZPV R;  3L7P A;  5I3U B;  2OPR B;  3TQ1 A;  2BR0 A;  4DR3 F;  2VD3 A;  2IHR 1;  3L7O A;  1YSJ A;  4XTT A;  4NLW A;  4X4V A;  2ZKT A;  2CWK A;  1R8H A;  1NK8 A;  3T1A A;  1WOP A;  2PI4 A;  5DGA A;  2VU5 A;  4CO3 A;  3TVK A;  5A8K B;  3WHI A;  1AZS B;  1SUQ B;  2G1D A;  1IBK J;  2ZH4 A;  1VQP S;  3HF5 A;  4ETZ A;  5ITH A;  1TKZ A;  5M2P A;  3FBB A;  4AFF A;  3PYD A;  1S1X A;  2AKW B;  3MEG A;  5K5M A;  2BQU A;  1QLN A;  2VFS A;  3AXK A;  2CG8 A;  1NSA A;  3D1O A;  4I67 A;  4QW9 A;  2YY3 A;  3PTW A;  4KV8 A;  2LEB A;  4DX6 A;  2HBQ B;  1QSS A;  4IRC A;  2PGC A;  3FSY A;  1D8Z A;  4WPA A;  2B9Y A;  1SBR A;  4S0M A;  4QR2 A;  5AT1 B;  3MMC A;  2CPD A;  3BF4 A;  2ZH8 A;  1Q8K A;  3E3X A;  5EWE A;  2XSJ A;  1UFL A;  2ZH9 A;  3B8H A;  4ILL A;  3NBP B;  3UN3 A;  2CUY A;  5KFJ A;  1SIZ A;  1SKR A;  5CH7 B;  4UTG A;  4I7F A;  3LAN A;  5K8M A;  2YX7 A;  2UXB J;  4QU7 A;  2XZD B;  1IM6 A;  1YLX A;  3KHL A;  3W65 A;  4CT9 A;  3T5H A;  2W4D A;  1QTM A;  2WVE A;  2G0I A;  2HQD A;  2IVY A;  4UOC A;  1U25 A;  1Y5L B;  2BOP A;  2NXU A;  2AQ4 A;  2VBZ A;  5HN0 A;  2R8G A;  2RML A;  3BDE A;  3DLK B;  4KB7 A;  1KVK A;  3UW1 A;  1HQ2 A;  4AXJ A;  4FNH A;  2BM0 A;  2XLI A;  3IC1 A;  3PYE A;  5HQL A;  3IS9 A;  3TAM A;  2ATC B;  3KDO A;  2HHH J;  2C2D A;  2E7V A;  4USI A;  3GFY A;  3AOC A;  3ISN D;  5LL6 d;  2QZ8 A;  4DQQ A;  2HS3 A;  3A8J A;  4CM2 A;  4ZP8 A;  2GVZ B;  1HNZ F;  3QWP A;  4GVB A;  2GIF A;  3U1N A;  4HI2 A;  2NPF A;  2VQE J;  3HMJ G;  2R7X A;  3H5U A;  2QA2 A;  3CCZ A;  2M3D A;  4OJ3 A;  3O44 A;  3MEC A;  4NLD A;  2XS5 A;  2IC3 A;  2FY1 A;  3IBF B;  3QFH A;  3DM2 A;  2J7W A;  2X1F A;  4K0K F;  2KM8 B;  1O0P A;  3JB9 k;  4WYW A;  2JZ5 A;  4DSI A;  2FHM A;  3L3C A;  4JI5 F;  3BS9 A;  4OI6 A;  4B08 A;  3Q2T C;  5GAG U;  1NRK A;  5F8I A;  4U6P A;  2CPF A;  2IJN A;  3DI6 A;  4JV5 F;  4I6W A;  4YR3 A;  2W7P A;  1FEH A;  4OHW A;  1RAJ A;  1S1W A;  3TUZ C;  2PFF B;  3ET6 B;  2OAU A;  2RDJ A;  1QVG R;  4USM A;  1OSC A;  1N6Q A;  2J7K A;  5KFE A;  4R0E A;  3OQ2 A;  1U0H A;  3UCG A;  1WF1 A;  4DG1 B;  4RW8 B;  3P45 B;  3VAM A;  5E7O B;  5IXU A;  3HFK A;  3TZZ A;  2B6A A;  4TN2 A;  3CT9 A;  1EZZ B;  3PRV A;  3W8G A;  2PFD A;  2XMK A;  1E6Y B;  4PWW A;  2ZIT A;  1FKP B;  1X4A A;  1Z1Z A;  3R3T A;  1ZAW A;  2X1G A;  4C11 A;  1CUL B;  3FSI A;  1MNE A;  3IBC B;  4ZJL A;  1R31 A;  1JLB A;  3CJK A;  1MLA A;  1OSD A;  3SYZ A;  1FJE B;  2DVI A;  1DFD A;  1VCT A;  2KU7 A;  3IGV A;  4QOT A;  3MM7 A;  3A1Y G;  4WFZ A;  1CQM A;  5E41 A;  1SQE A;  1IBM F;  3K17 A;  3N6L A;  4ECX A;  2LYV A;  3AOD A;  1TUW A;  4NAS A;  4R5P A;  3NL0 A;  2MLZ A;  3A4T A;  5J2P B;  1NU4 A;  2ZBP A;  2IRX A;  2XZW A;  3V6D A;  5IOL A;  3LAL A;  3L09 A;  2OMO A;  5K8O A;  5H9F K;  5E3C A;  4L6V 3;  5B0C A;  1MWY A;  3IP0 A;  3V5R A;  2DRD A;  4KQZ A;  4EUV A;  4W92 B;  2D3O R;  4YOE A;  1X0F A;  3OTE A;  1YZ6 A;  1EB0 A;  2B8P A;  2DRB A;  1PC5 A;  1RSC A;  2Q43 A;  3I31 A;  2Z2M A;  1V3R A;  2HFN A;  2RQM A;  1VK8 A;  4ECV A;  1X4D A;  2BE7 D;  2YKQ A;  4LF7 J;  3GIL A;  4F4Z A;  4ANC A;  2HFU A;  5HAO A;  3D6H B;  4NLT A;  4TLR A;  2DHX A;  3LQV A;  2HHQ A;  1JLF A;  5LMU F;  3IFE A;  5M2R A;  3MAA A;  2OPS A;  1XQI A;  2HSE B;  2HWT A;  3G6E S;  1S6P B;  1HL6 A;  4FBT A;  3CE8 A;  2V68 A;  1NB2 A;  3J7Y I;  3F73 A;  1OQ6 A;  2NUU G;  4FPR A;  3EJM A;  5L9X A;  4CT8 A;  3OUY A;  4OYZ A;  3AD7 C;  1U0S A;  3BBB A;  2EFN A;  4UST A;  1DTQ B;  2HMI B;  2QMU B;  5IT9 U;  1U47 A;  2MYF A;  2EBG A;  3BYR A;  5KOX A;  5KFL A;  2A6M A;  2E5J A;  2YWE A;  5EX3 A;  1RWW B;  2UVU A;  5CD4 A;  5DG7 A;  3RRH A;  3VQS A;  4WP3 A;  4USJ C;  1RT7 B;  4EU0 A;  1HMV B;  1MWQ A;  2D3O 1;  1JLA B;  4O4R A;  2RKI B;  4QIW D;  1Q8B A;  1ZPW X;  4ERD A;  2BW7 A;  1SC6 A;  1SC1 B;  3VQT A;  3TVZ A;  4DR4 J;  2K3I A;  4M5D B;  4IUF A;  2V2Z A;  2M2B A;  3HX9 A;  4J9R A;  1RCO B;  2GCF A;  3L4B C;  2DNY A;  3DGP A;  4EYI B;  1JJH A;  1S79 A;  2XBP A;  3R1L A;  1LWE B;  2I0X A;  4LF5 F;  1TL1 A;  4DUZ J;  4C8L A;  4ZKA A;  1RHR B;  2JVO A;  5LSL A;  4C8Z A;  3LWL A;  2YXL A;  3FVY A;  3PYG A;  4QIE A;  4TY8 A;  4F36 A;  1FXL A;  4LSN B;  4ID8 A;  1YTY A;  4LQ9 A;  2V67 A;  2DNO A;  2HRU A;  4RO0 A;  3W9I A;  2K7K A;  3FKB A;  1WAC A;  1TKX A;  4DUY F;  2R42 A;  3VAF A;  1HBO A;  3JTN A;  1X4H A;  3SBM A;  1JLE A;  4FF1 A;  3G8Q A;  3NG8 A;  3Q8Y A;  4JUZ A;  3EM1 A;  2DYA A;  1TQL A;  3CUL A;  4FXD A;  2ZM6 J;  4PPZ A;  2FB0 A;  1SC3 B;  3RW7 A;  1XR7 A;  1ARO P;  4DS5 A;  5KFT A;  1SJ4 P;  3HT3 A;  3HVW A;  4K0K J;  2IDE A;  2HQG A;  4NX9 A;  3ELH A;  4JI5 J;  4IG0 B;  2XYH B;  4TQS A;  1BMQ B;  3LP0 B;  3DOK A;  4ILM A;  4DL3 A;  4JV5 J;  1NJW A;  3PR4 A;  1U26 A;  4KKO B;  1RTH A;  2M4M A;  5MAO A;  1IVZ A;  1NLK L;  3OFE A;  4QYZ K;  1S97 A;  2V69 A;  2EKN A;  3QT7 A;  6AT1 B;  3DDI A;  3AQO A;  2JEI A;  1RT3 A;  3J81 Y;  2POK A;  4LFB J;  3TZY A;  1YRX A;  3QRQ A;  3GON A;  3QWU A;  4CLY A;  3N5B A;  2VPW B;  2HLT A;  2J0Q D;  2V94 A;  2YX4 A;  4DQR A;  2HZC A;  4LRF A;  1KOO A;  4OZN A;  3E51 A;  4PZV A;  1N36 F;  1SI9 A;  1MU2 A;  3UR0 A;  1Y9O A;  2Z30 B;  1S72 S;  4C8N A;  4EZ6 A;  3VCD A;  3AOB A;  5AE2 A;  1OYE A;  4OYA A;  3MM6 A;  2R7T A;  3FGV A;  4TKT A;  2JWN A;  3OR2 A;  1R8A A;  2R2U A;  3FBC A;  2MHE A;  4D3H A;  2KKH A;  2XS2 A;  3GLJ A;  5GMK a;  4JB8 B;  2JEF A;  1XNQ F;  1QSY A;  3EPG A;  2E9R X;  5BYS A;  4OI1 A;  4PQU A;  1HNV B;  2XUL A;  3BZQ A;  2CQG A;  4RW4 B;  1VQM S;  3NGS A;  3EVM A;  1T03 A;  2UUW A;  4XDD A;  4I68 A;  1I5O B;  1VQ7 S;  1I51 B;  2A3J A;  2OSQ A;  2PC6 A;  3MMB B;  8ATC B;  2GNK A;  4X4P A;  4OYX A;  1U1K A;  4KAI A;  4X4O A;  1VRT A;  4YP3 A;  1LWF B;  4ZMM A;  1NH7 A;  2KT2 A;  3I55 S;  3KDN A;  5KFX A;  1G3O A;  2MQO A;  1AUS L;  1RHQ B;  1IKY A;  2BKN A;  4ED3 A;  2VDI A;  4NZ0 A;  2YH1 A;  4MFB B;  4G1Q B;  2OPQ A;  2RU3 A;  2U1A A;  4B9U A;  3D0H E;  1J5O A;  5KFN A;  2XHC A;  1GXU A;  1F9F A;  2K1R A;  1D9A A;  1FFS B;  4IFV A;  2EG1 A;  1KTQ A;  1EQ0 A;  3C6T A;  5I3P A;  2KRR A;  1GEH A;  3K8V A;  5DQI A;  4TU9 A;  3OXF A;  5B0E A;  2CDQ A;  2MZR A;  5AXK A;  3S01 A;  4YEA A;  1C1B B;  4N77 A;  2XS7 A;  2B4P A;  2C2O B;  5LMU J;  4MH8 A;  3R6L B;  4DR2 F;  4LSZ B;  1VS3 A;  1WC5 A;  3I0S A;  4MYU A;  1BQN A;  1N33 F;  2B3T B;  3M1V B;  1U48 A;  4U7C A;  3B4D A;  2NXJ A;  2CQC A;  2MKY A;  2C3U A;  3AH6 A;  4IH5 A;  1UW9 A;  3O5T B;  2ZBI A;  3GMG A;  2X7I A;  3M9N B;  2JLF A;  2UUC J;  3LUY A;  4OV6 A;  3W5X A;  3GTY X;  2IYI A;  2JFK A;  5KT5 A;  4JI7 F;  2GAH C;  1I94 J;  4RW6 A;  3FRZ A;  1KFD A;  3T6B A;  3WBZ A;  1XMB A;  1YJT A;  1GT8 A;  1RCX B;  4ZVR B;  4DPW A;  1U1M A;  3K5M A;  2J6T A;  5KG7 A;  5A76 A;  1TKZ B;  1HQE A;  1SJR A;  3EUN A;  1S1X B;  4UY8 T;  3JSR A;  4A8S A;  3MEG B;  1FVS A;  1K73 T;  2HYI B;  4IKA A;  2VG7 A;  2HFZ A;  4D3G A;  3AY0 A;  1RUS A;  1LFW A;  1P6T A;  4NRU A;  4DU7 A;  1TK0 A;  1F6T A;  4KV8 B;  2C3P A;  3M2U A;  2OEK A;  2EFP A;  4WTY A;  2DY9 A;  3MMC B;  4U7U D;  5F9N A;  4K4Z A;  2OO4 A;  2XSJ B;  2GMJ A;  1H73 A;  3FJ2 A;  4G65 A;  4Y65 A;  3R2C J;  2B4O A;  2R7S A;  1NK9 A;  4HAC A;  3H5X A;  2M8D B;  3R5G A;  3SDE A;  3CXC R;  2HVD A;  4UOH A;  1YJR A;  2GQC A;  2Y1I A;  1B0P A;  4ECZ A;  3H42 A;  2W8K A;  1S1T A;  2X51 A;  1U45 A;  1ZM2 A;  3KG0 A;  2PDA A;  2DR6 A;  3CD5 A;  3ZZR A;  5F8M A;  1KVI A;  5L1I A;  2EW9 A;  3P96 A;  3MUM P;  4CRJ A;  4LIW A;  5HK4 A;  2YWF A;  2PO4 A;  1HIY A;  4W98 A;  2OTL S;  3CDE A;  4GC7 A;  3IS9 B;  3TAM B;  1SJ1 A;  4YN3 B;  3N6N A;  5B0G A;  2D74 B;  3K0J A;  2XMV A;  1PJ7 A;  5GAD I;  1HQU A;  2G2Z A;  1OY6 A;  1HWI A;  3R5A A;  2DGW A;  1ZM9 A;  1FX2 A;  1RI7 A;  1FRM A;  1DRZ A;  1NKC A;  2UU9 F;  3P6Y C;  2HQ3 A;  2ROG A;  4GVB B;  3WC0 A;  1Q5Y A;  4AQY F;  1SKU B;  1EJ7 L;  4GKK F;  1WI8 A;  3J80 Y;  4PXC A;  3G87 A;  2GAG C;  3GCW P;  2RVJ A;  3MEC B;  3GJR B;  3A3N B;  2E9T A;  2HFS A;  2LCW A;  2IC3 B;  4OZJ A;  3DM2 B;  5EDW A;  2MY7 A;  4F0H A;  3N4W A;  3G8S A;  1Y11 A;  4TQR A;  5D0R A;  1VQY A;  3IGN A;  2W4C A;  3DLB A;  2WK4 A;  4FKY A;  3V81 A;  2KT3 A;  1N36 J;  1RJJ A;  3M05 A;  5KT6 A;  4NLG A;  4NZ7 A;  2UUA F;  4AXI A;  2OPP A;  4CLU A;  2FY8 A;  3W61 A;  3DI6 B;  4JI1 F;  4JYA F;  1J5E F;  1S1W B;  3LH2 S;  2C3O A;  2W2Q P;  2JHE A;  2CDR B;  2HWI A;  2UUB F;  3DLH A;  1N6Q B;  1ELO A;  1XNQ J;  2FVQ A;  4C8K A;  5F41 A;  3PW7 A;  3RR7 A;  4DU8 A;  2BJ7 A;  1U0H B;  4Y0F A;  3DXS X;  1YGY A;  2CPH A;  2XMM A;  2QFJ A;  3MMA A;  2B6A B;  4MTP A;  1KWM A;  4U67 Q;  1HBN A;  4F04 B;  2HNY A;  4XIU A;  4W4M A;  4P9S A;  1UZH A;  2YKA A;  1Y3J A;  4WFY A;  2DRA A;  1UPP A;  3C6U A;  4C11 B;  3JAM U;  5KTQ A;  4CLL A;  1GNK A;  3CB4 A;  2DHA A;  4IR9 A;  1JLB B;  1PBU A;  3CJK B;  3D6T B;  2ZJP Q;  3TNV A;  2DNQ A;  1UVK A;  1Q79 A;  4PG5 A;  2FJW A;  3MEK A;  5KT7 A;  4Z2X A;  3VGV A;  3U02 A;  3J81 j;  5DDP C;  1RLD A;  3UE2 A;  3Q8R B;  4K8R A;  5F3Z A;  4EBD A;  4LR8 A;  5IC6 B;  3TVY A;  2F9D A;  2Q79 A;  1SH0 A;  3I96 A;  1KFS A;  2CJA A;  4B17 A;  3V6D B;  1GXT A;  2HAI A;  3VGU A;  3R6G B;  3PNI A;  3TUJ C;  1XEZ A;  2DCU B;  2FJB B;  2UXD F;  1MML A;  3U27 A;  3PXG a;  2IBO A;  2F63 A;  2R7Q A;  4QIF A;  4DR2 J;  3CDA A;  4LFC F;  3AA8 A;  3NOC A;  2UXC F;  4C0O C;  4C4W A;  4DX5 A;  3F0N A;  3MZI A;  2GJF A;  3I5A A;  1IM4 A;  3CCR S;  4ZP7 A;  2GML A;  1T0T V;  4F2S A;  3BSC A;  3MUT P;  1S76 D;  1F9E B;  3QLH A;  4ES2 A;  2KJV A;  3K5O A;  1APS A;  4Y00 A;  2AYE A;  2GJ2 A;  4M95 A;  4OV1 A;  2HRY A;  3C15 A;  5BXI A;  3PIP Q;  1H0H B;  4JI8 F;  2GVD A;  2FLP A;  1RK8 A;  4J9N A;  5DJB A;  1S1U A;  1JLF B;  1CJV A;  3IBW A;  5HAT A;  3MAA B;  2OPS B;  3P5B P;  1GMW D;  3BPS P;  5HO4 A;  3QRP A;  2GZO A;  3DRR A;  4WU2 A;  4J9V A;  5EWF A;  4NEY A;  4RBT A;  4RUA A;  3SQG A;  3H40 A;  2RIL A;  5CYM A;  2YQ1 A;  4FF2 A;  2M8H A;  3OUY B;  3I9Z A;  2V9W A;  3TA0 A;  2L08 A;  2LDY A;  2VH7 A;  4U95 A;  4QJV A;  2NRE A;  4B3M F;  2FDN A;  5KOW A;  2V8H A;  2LXF A;  2OTJ S;  3MTJ A;  4LQ3 A;  5AXM A;  3RB3 A;  1YX2 A;  1JXL A;  4CZC A;  1EET A;  2ZH1 A;  2C2M B;  1SKS A;  2HS4 A;  3AJD A;  3EZU A;  1TK5 A;  2AEF A;  4IYQ A;  4WIQ A;  2EK6 A;  2FIU A;  4IFY A;  2ZEJ A;  5L1J A;  3ZFV A;  1YDL A;  2JSX A;  1J27 A;  3DGP B;  4HT5 A;  2UVW A;  3AB4 B;  3K5L A;  3R7N B;  3PW0 A;  2G2Y A;  1C4C A;  3AJ1 A;  1TL1 B;  3UVJ A;  1X8D A;  4LF4 F;  2I8E A;  5BYR A;  4YHH F;  4DPU A;  2QX0 A;  4Y2A A;  3DRP A;  1EAY C;  4DR5 J;  4I1T A;  1WJ9 A;  4TY8 B;  2NS1 B;  2O3D A;  4IH6 A;  1JNR B;  4OI4 A;  4PG8 A;  3V6K A;  1S0M A;  3CJR A;  3S6E A;  4J91 A;  4P75 A;  1RT2 A;  3K5N A;  1G2E A;  1IWG A;  4OI3 A;  4CNZ A;  5K14 A;  1MSW D;  3HJV A;  5LXR A;  4J9Q A;  1TKX B;  3FZ2 A;  1T9U A;  1TTH B;  3RBD A;  3DFE A;  3W7B A;  1HBO B;  3AQP A;  4A8Y A;  1JLE B;  2E5H A;  3CJS A;  4C0H A;  1BC6 A;  2DGO A;  1EIY B;  4GKK J;  2OH2 A;  3SMZ A;  2YKN B;  2AJ1 A;  2YKP A;  3HVA A;  2FHK A;  2ZZM A;  3JQJ A;  2DGU A;  2NZC A;  4JBC A;  3HZE A;  2UUA J;  3R1H A;  1CVJ A;  2QLB B;  3DOK B;  1N5S A;  3V4I A;  4JI1 J;  4JYA J;  2J9D E;  4PKD B;  3OR1 A;  4MIW A;  2ADB A;  1RTH B;  3BGR A;  4MYT A;  1YBT A;  1FCA A;  4X4S A;  3CCJ S;  2DB1 A;  1KC8 T;  2RS8 A;  4KC5 A;  4ZCM A;  1RT3 B;  3POT B;  1HHT P;  2ZH5 A;  3LAM A;  2MQP A;  3BSO A;  3PG9 A;  3GR1 A;  4ZCL A;  4YDD B;  1JKH A;  5B0A A;  1SKW A;  3BBF A;  3UN2 A;  4I4B A;  4URS A;  3CCE S;  2VKR A;  2A6O A;  4BC9 A;  2LU1 A;  5HVH A;  1MU2 B;  2ZWO A;  4K50 A;  1NPR A;  5EUH A;  2MXY A;  5KFQ A;  3W5Z A;  1RXO B;  4ZVE A;  3ZZU A;  3MM6 B;  3KJQ B;  1AW0 A;  4TU7 A;  5IT0 A;  2PN6 A;  4DQI A;  2ZFH A;  3ILJ A;  3OR2 B;  2WZ1 A;  5AXN A;  3R7B B;  3OSP A;  4DPX A;  4LFA J;  1R8P A;  1FDN A;  1QM9 A;  4USH A;  1IN0 A;  2XMJ A;  1ZAV A;  2WON A;  4DCJ B;  4PQU B;  3FZB A;  4LF6 F;  5JJB A;  3AA9 A;  2L41 A;  2XY5 A;  2N3O A;  4CLF A;  1T03 B;  3T19 A;  4LRE A;  1P1T A;  1X9W A;  2QLF B;  3D66 A;  4RUC A;  3HI9 A;  2O5D A;  1FKO A;  2WSC C;  2V8V A;  1SC4 B;  2VFV A;  3M9M B;  3AFG A;  1DJ0 A;  2YWK A;  4ED6 A;  2ZH2 A;  3QT5 A;  4X4Q A;  1VRT B;  3M4X A;  2UXD J;  1NME B;  2IVM A;  1VJQ A;  1WC0 A;  2LLZ A;  1FDD A;  1T9V A;  3MCO A;  3PRB A;  3WIU A;  3EX7 B;  4ENO A;  2XI3 A;  1Q53 A;  1IKY B;  4QYZ J;  1V5V A;  1DQA A;  5DLG A;  1D3W A;  2OPQ B;  1JNZ B;  2BAN A;  2OML A;  2VJU A;  2HGM A;  3NKY A;  2ZUA A;  1J5O B;  2OEM A;  2CQD A;  5T7L A;  1Q5V A;  4L73 A;  2K1R B;  2DHS A;  4FVC A;  4IFV B;  3LGN A;  3S7R A;  4F8R A;  2AGP A;  3C6T B;  4MKB A;  2HIQ A;  3B4M A;  1GMU A;  4K4X A;  1N34 J;  1DQ9 A;  3GG1 A;  3IG1 A;  4ELU A;  2B56 A;  3WX4 A;  1BWE A;  1Q8I A;  2CJY B;  2WBM A;  3WC2 A;  3I0S B;  4ED2 A;  1BQN B;  4ER8 A;  4R0J A;  1UPM B;  2ZC3 A;  5G4D A;  4YY3 J;  4EK2 A;  3ISN C;  4RLE A;  5D4L A;  1L5U A;  3JSB A;  1ZS6 A;  5LM7 E;  5JMN A;  4X66 J;  4UT4 A;  3BBC A;  4CLW A;  2OSR A;  2GMH A;  4UOF A;  4NXN F;  1IXK A;  4M5M A;  3MTK A;  3DU6 A;  4NLQ A;  3TAP A;  3W62 A;  1RBL A;  1KN6 A;  2ZUG A;  2HK3 A;  4RW6 B;  3PW5 A;  1N88 A;  4X65 F;  2E1R A;  2BJD A;  2W7O A;  3SSR A;  5KFK A;  4LF9 F;  2ZNZ A;  2CQ1 A;  3H2V E;  2Z58 B;  4N7T A;  5KG5 A;  2O01 C;  1V3Z A;  3NGT A;  1M5H A;  1HQE B;  4WF9 Q;  4OZ3 A;  2DCL A;  3ZTO A;  4CO5 A;  2MQM A;  5K20 B;  1E6V A;  1XER A;  1U1P A;  2VG7 B;  4UY8 5;  2V50 A;  4U7U K;  2ZVI A;  4J9U E;  2EVZ A;  2VKZ G;  3GQC A;  2DHH A;  4P7T A;  2V4R A;  2YKO A;  2MDA A;  1WNE A;  3M2U B;  3J7Z 5;  2VC1 A;  2WHO A;  4JI3 F;  4NWB A;  5D15 A;  3KHR A;  2QJ3 A;  3V6H A;  4LF4 J;  1IKX A;  4L72 B;  3N28 A;  1NHU A;  4PXE A;  3I6P A;  1L3K A;  4ZVP B;  2MSS A;  4X64 F;  2E5L J;  2AYB A;  4FDF A;  2HHT A;  1IR0 A;  4HAC B;  4JI6 J;  1RA6 A;  4DL2 A;  2CQ4 A;  3EIC A;  4HLB A;  3U7J A;  3SDE B;  2PT0 A;  2B9W A;  2CIM A;  2Q6B A;  4CLK A;  4NZ6 A;  1S1T B;  1HR0 J;  4K5S A;  1FD2 A;  1XR5 A;  2NYH A;  4Y2M A;  3M8Q A;  3UWT A;  1DHM A;  4EI2 A;  2I5J A;  5IWA F;  1UKU A;  4MIA A;  5KT3 A;  3FCW A;  1B3T A;  4HH1 A;  2CZ9 A;  4ETX A;  1H2T Z;  1VLO A;  2ZD1 A;  4CH1 A;  2HGL A;  1U2C A;  1FRH A;  1HI1 A;  3W2W A;  1HQU B;  2ZKU A;  3HHN B;  1RA7 A;  4V1A k;  3ZZO A;  1TL4 A;  3RBZ A;  3SCL E;  2JJ4 D;  4BBY A;  4F3O A;  1KR4 A;  2J8A A;  2IRY A;  3IR6 B;  2MJN A;  1FRI A;  2CVE A;  3BSA A;  3PY8 A;  2AX0 A;  2GV1 A;  3BRE A;  4ZLP A;  1JLQ A;  4ED4 A;  2LXI A;  2YWW A;  1SH3 A;  1TMM A;  1JX4 A;  3J81 U;  1TAU A;  4FVM A;  2KHD A;  1NPP A;  2LU2 A;  3MFI A;  3JYT A;  3V81 B;  4WU3 A;  3I0R A;  2BXJ A;  5KT4 A;  4DR6 J;  4WCE Q;  2MEW A;  5GME A;  1VMB A;  2OPP B;  5KFD A;  3SIP B;  3RRK A;  3TJ9 A;  5KFH A;  5L1L A;  3QID A;  3KWM A;  2VON A;  1V6H A;  1TAQ A;  3HK2 A;  3DC2 A;  3EMT A;  3DLE A;  5DDQ C;  2IIH A;  5BR8 F;  1XNR F;  1HW9 A;  4FF4 A;  2HWH A;  4IOB A;  1RAO A;  4Z37 A;  2K7J A;  3FUY A;  3MMA B;  4MKA A;  1HBN B;  2HNY B;  5E3R A;  3IWX A;  1KKH A;  2JEG A;  1JLG A;  1N48 A;  2L9N A;  4K4W A;  5DET A;  2LQ8 A;  3ISZ A;  1L3T A;  3TX0 A;  5HMW A;  3C6U B;  3GWC A;  3W63 A;  1N4L A;  4AL7 A;  2EXU A;  4LIR A;  4OHY A;  2W9A A;  4DV0 F;  4DR1 F;  4L76 A;  5D3G A;  4CO2 A;  4XK8 C;  3NXZ A;  2D9O A;  2GQQ A;  1KQK A;  4DOZ A;  2DR7 A;  1F2G A;  1C0U A;  1WHX A;  2CNK B;  4ZOS A;  2AEJ A;  1FFW B;  3EVW A;  2BZ2 A;  5HI7 A;  5FLX Y;  1F3V A;  2Y1R I;  2YNG A;  4DJB A;  1MMD A;  3RBX A;  4FKX A;  4O3N A;  1ZET A;  4N5S A;  1C0T A;  1Q8L A;  3HT0 A;  4J90 A;  5DLF A;  3QJL A;  2OHD A;  3QAT A;  3IMQ J;  1QTN B;  5GAE U;  4CP5 A;  3THT A;  4DPY A;  4C2M A;  2HVI A;  1XK8 A;  4CYU A;  1RBA A;  1CBK A;  2Q1L A;  3KK1 A;  3IA0 A;  3QQC D;  4F67 A;  4KJI A;  7AT1 B;  4ELV A;  2J0X A;  5I42 A;  4WFA Q;  2HIY A;  1FNX H;  3A8K A;  2WB4 A;  1OYD A;  3FCV A;  5A8W A;  4PEO A;  3G86 A;  1VDH A;  3QMQ A;  4DSL A;  1M1K T;  2NXC A;  1F1B B;  3H25 A;  5H1S V;  4DI6 A;  2W9B A;  3A12 A;  1NPK A;  1S59 A;  4BWJ A;  4E0D A;  3A8I A;  3C15 B;  4FYY B;  5CD4 H;  1VHI A;  5KFR A;  3BO2 A;  5HVF A;  2GVD B;  3CGI A;  1NK5 A;  5E33 A;  2V0N A;  4LF9 J;  4UOG A;  1R0A A;  1S1U B;  1CJV B;  3CIZ A;  1RWU A;  4DV5 J;  4K2J A;  1YJN S;  2V8D A;  2F8E X;  3DRR B;  4ID5 A;  4URQ U;  2BE9 B;  2LXU A;  2A10 A;  3SQG B;  2B4U A;  5CYM B;  5AJ3 J;  1YJU A;  2AWZ A;  4Z7Y A;  4CM0 A;  1CJU A;  2F5G A;  2WRM A;  4JI2 F;  4NL5 A;  3OFH A;  2B8Q A;  5IFM A;  3JS9 A;  1S9G A;  3OTB A;  2D7S A;  3LPE A;  3ZZP A;  2IAJ A;  1TUV A;  3T41 A;  1LWX A;  3THP A;  5F0W A;  4H4O A;  3MR2 A;  3VTI A;  1CQN A;  3NGU A;  1EET B;  1YJ7 A;  3IN5 A;  3FBF A;  3ULH A;  1HNX F;  4GMK A;  1VQ6 S;  2XB2 D;  2H54 B;  2N4C A;  4NXM F;  4CH7 A;  4O0I A;  5K9F A;  3H90 A;  3PO4 A;  5ETN A;  1T05 A;  3FRY A;  4IFY B;  5LSR A;  4DV4 J;  5A2Q Y;  4P72 A;  3U1M A;  1UW4 A;  2D69 A;  4DPT A;  4KPC A;  1ZA1 B;  2BJ3 A;  3RU0 A;  2IY5 B;  1FER A;  1U1R A;  3CCV S;  1HNW F;  2FC9 A;  5CHC B;  2FJA B;  2VC0 A;  3S8S A;  1D1U A;  2FC8 A;  2N3L A;  3BN7 A;  1EKS A;  2D41 A;  4N76 A;  3UVJ B;  1TK8 A;  4MT1 A;  2ILZ A;  4CI0 B;  1PKU A;  4F4K A;  5C2G A;  3DRP B;  2FZG B;  3MM9 A;  2VHG A;  3E2E A;  3OTO F;  5E0O A;  4UZB A;  1WG1 A;  5DRK A;  2DNN A;  5KG6 A;  1RT2 B;  2E5G A;  5K14 B;  3FFI A;  3SXL A;  2RJZ A;  2YVS A;  2VZ9 A;  4U96 A;  1GFW B;  3CCM S;  1VRU A;  2F9J A;  3SV3 A;  2RRA A;  1RE1 B;  1ZZN A;  3CDU A;  3W60 A;  1TU0 B;  2G1H A;  2ABY A;  3ETO A;  3AB2 B;  2OD4 A;  5JXS A;  2G9O A;  3HPO A;  5C42 A;  1NDP A;  2D3U A;  4DPO A;  3LA0 A;  1VIO A;  2JLG A;  1YKW A;  3BYP A;  3HVR A;  2ERR A;  1OWX A;  2A0F B;  5JVH Q;  4FYV B;  2HQC A;  2BJ8 A;  1ULR A;  3V4I B;  2J7U A;  4LUB A;  2YQ3 A;  3OR1 B;  1HYS A;  3MCM A;  4HYK A;  3BGR B;  4M8L A;  5DO2 A;  4YME A;  2VIH A;  3TI0 A;  2R8H A;  3VZI A;  2MKC A;  1K1S A;  2AJF E;  3LP1 A;  1JKH B;  1GK8 A;  3IAS 9;  2DGV A;  5D0G A;  1QAI A;  4QPX A;  2HFV A;  2MGZ A;  1RKI A;  2OI2 A;  9ATC B;  1X60 A;  4TXS A;  1U1N A;  2C2N A;  1D09 B;  2YNI A;  2LVW A;  2I2Y A;  4Q44 A;  2BBE A;  4FXV A;  8RUC A;  5IQ6 A;  4DV0 J;  3NNA A;  1GQE A;  3AD9 C;  2MZ1 A;  4KGK A;  1MN9 A;  1YJW S;  4RNO A;  2B5J A;  3TZW A;  4DWI A;  5J1N A;  2F4V F;  4XO0 A;  2QFI A;  5HMZ A;  2WON B;  1IBL J;  1DLO A;  2FJX A;  1H38 A;  2WVC A;  4ZP6 A;  1BE4 A;  3M6V A;  4PR6 A;  1T9X A;  3CCW A;  4KBI A;  3TW0 A;  4PRF A;  4DV7 F;  2UZA A;  5HJX A;  2XCA A;  3MXH P;  3FC9 A;  4PWD A;  1RTJ A;  1DZ5 A;  1FKO B;  1V3S A;  4FP9 A;  3T1H F;  2R8K A;  2QA4 G;  5M2U A;  3DHX A;  4OJH A;  2QYC A;  2MPU A;  4B3R F;  7FDR A;  2FGO A;  4ES1 A;  1X4E A;  1I6J A;  4DQS A;  4ED1 A;  1WSR A;  4A8F A;  1FJ7 A;  1FD8 A;  2ZBC A;  2C2R A;  2BAN B;  3RYL A;  1WOR A;  5DG9 A;  1QDU B;  1BY9 A;  4A8X A;  3LTO A;  5T7L B;  3FEY B;  2R7O A;  3VAJ A;  4J5O A;  1MW7 A;  4ZCK A;  5K8P A;  3CPW R;  5L39 A;  4TLQ A;  3RJM B;  1QSL A;  3FNN A;  2P5V A;  3IG1 B;  4M63 A;  4DS4 A;  1D0E A;  4QZV B;  2GA7 A;  2AJ2 A;  3OL6 A;  2R8I A;  2RRN A;  3KKF A;  4UUW A;  3R97 A;  4DMZ A;  4YB1 P;  4ZCI A;  1X5O A;  3D0G E;  4NE9 C;  3RZA A;  2OFH X;  3TR5 A;  2BYC A;  2BAB A;  2YNF A;  3ZZY A;  5HQ8 A;  2XZT B;  3IXQ A;  1UA0 A;  5HMY A;  1B0T A;  2FHJ A;  4OZ2 A;  3PCO B;  4TU8 A;  3OJS A;  1MN7 A;  2NXN A;  5F8L A;  4DL5 A;  3G6Y A;  4LJM A;  2OLW A;  3CCQ S;  4B3T F;  4DXL A;  2FJV A;  4YR2 A;  1IUJ A;  3BO4 A;  1NZA A;  1AFI A;  4PUO A;  2HLU A;  3B54 A;  1R0B G;  3CJ4 A;  4DFP A;  1E6V B;  3MWB A;  1S4E A;  4M5H A;  3PJW A;  2P8I A;  4WZQ A;  4DV2 F;  3ENV A;  1K44 A;  4KSE B;  3PX6 A;  1VC5 A;  1RWV B;  5KFO A;  3W9J A;  1IKW A;  4YB7 A;  2PSZ A;  3Q86 A;  1R0C B;  4YB5 A;  3M6U A;  4K4S A;  1TFY A;  1IKX B;  4QWB A;  3MMJ A;  1PG5 B;  2GIR A;  3H98 A;  1ZM3 A;  3PFE A;  3MPY A;  3M32 A;  3DXB A;  1X5S A;  4U8V A;  3NGD A;  3MR3 A;  2CQH A;  2CPJ A;  1Y7P A;  4WFB Q;  2BW2 A;  4WTO B;  2VV5 A;  1XJW B;  3DLL Q;  2X1B A;  3OVS A;  4JI0 J;  2XGP A;  2BKP A;  3OXL A;  5FDL A;  1ITP A;  4HT7 A;  3M8Q B;  1SXL A;  3VHQ A;  3I5B A;  1QE1 A;  5LOQ A;  3IWL A;  2I5J B;  1Q81 T;  1G6B A;  1SJF A;  4WXW A;  2KTQ A;  2HBZ B;  3NAI A;  4ZPA A;  1HW8 A;  2KFN A;  1XMQ F;  2VG6 A;  3Q89 A;  4ECT A;  1M5P C;  2R9L A;  4HHH A;  4DV3 F;  3C2P A;  3HHL A;  3KTQ A;  2ZD1 B;  5ETK A;  5DM7 Q;  2LFV A;  3GP9 A;  3W2W B;  1JJ4 A;  1N5Y A;  1Y3K A;  1VYA A;  2Y0B B;  5E3Q A;  4AND A;  1JB0 C;  3PVX A;  2AYM A;  2N4D A;  1IR1 A;  1XTZ A;  4OYP A;  2K8G A;  2VB6 A;  1JLQ B;  3LAK A;  4OYB A;  2IBK A;  4B9L A;  4NCG A;  1SCJ B;  2DNM A;  3HVT A;  4QQB A;  3W8P A;  1JXV A;  5AE3 A;  1U7L A;  3Q8U A;  4C8Y A;  3JYT B;  2IM1 A;  2C28 A;  4HVZ A;  2MKS A;  3I0R B;  1KON A;  3GR0 A;  4TVA B;  4GKJ F;  3D5M A;  2PII A;  3ZTP A;  4KRW A;  4JI4 F;  1NDK A;  1FDB A;  4M1K A;  1M5V C;  5C25 A;  4FYD A;  1PJ6 A;  2V2V A;  2WW4 A;  4X4R A;  5GAH U;  2ZHA A;  5AXL A;  4J7C A;  2PA8 D;  5F8H A;  3DLE B;  1UVM A;  4K4V A;  2PEH A;  2VPZ B;  3HD2 A;  3KLI A;  2XO7 A;  5IT9 Y;  1I1G A;  2F40 A;  2A2D A;  3MDF A;  1P9Q C;  3A3O B;  1M90 T;  1WF2 A;  2HGN A;  4X4N A;  4O3S A;  1JMT A;  2CYY A;  2VA2 A;  4OZ5 A;  1JLG B;  4EMD A;  1X5T A;  4ECS A;  3HD1 A;  4CLP A;  4RPF A;  1YVF A;  2XG8 A;  3M2V A;  3NMR A;  2IM2 A;  3T1H J;  1B7F A;  3BPD A;  2OD6 A;  1N54 B;  3PX0 A;  1TKD A;  4ZPD A;  1RT6 B;  1NK0 A;  3DMJ A;  3H2L A;  5D3G B;  4KTQ A;  2M52 A;  4B3R J;  2PMH A;  4KHR A;  2BKO A;  2EC0 A;  2XYP B;  4J9L A;  4MK8 A;  5KAK A;  2Y3Y A;  2RHS B;  3NY0 A;  2OP5 A;  4AT1 B;  1L3S A;  2RH3 A;  1C0U B;  1YIJ S;  3V6J A;  1MMN A;  2VUG A;  1P9Y A;  1SJ3 P;  2YNG B;  2BRL A;  1LK7 A;  4FYW B;  1RU2 A;  1M0S A;  4BLG A;  4LBH A;  4LVN P;  5KG4 A;  1C0T B;  4O4G A;  2VQF J;  4OYM A;  4F26 A;  1S0O A;  1HWJ A;  4ZIW A;  4ALZ A;  4KHP F;  2R7V A;  3QO9 A;  1LQ9 A;  3O1L A;  4CYU B;  1L3U A;  5A6W A;  3NS6 A;  4WFX A;  3QNW B;  1RT1 A;  1D8Y A;  4Q8F A;  3KK1 B;  3PHT A;  4X4T A;  1ACM B;  1T9W A;  2YPY A;  4ZK7 M;  2GIQ A;  1ZA2 B;  2DNL A;  4G3I A;  1B70 B;  2MLX A;  4KH1 B;  4CWB A;  5I42 B;  3H2U B;  4DV6 F;  4X2B A;  5KG2 A;  4KH0 B;  1SB6 A;  3GB0 A;  3TP2 A;  3K7R A;  1EAR A;  5CAA A;  5A8W B;  4Y3C A;  1VQ9 S;  3C19 A;  4F4A A;  1SL2 A;  1NO8 A;  5G0R A;  3KMQ A;  3H4D A;  3G9C A;  3P49 B;  1FE4 A;  5D4O A;  1TZ0 A;  2W9B B;  1FJG J;  2VBX A;  2IFX A;  5KFU A;  4OLP A;  4DR3 J;  3RB4 A;  2M5Y A;  4ZVU B;  1UJ5 A;  3GFH A;  2BJE A;  1R0A B;  1X0P A;  2DO4 A;  2CPE A;  3BQ0 A;  3SV4 A;  4RR5 A;  1PCA A;  1BD6 A;  2E1P A;  4PXB A;  4PYD A;  1U1O A;  1NUE A;  4DX7 A;  4LF8 F;  3CF5 Q;  2XTJ P;  4UUX A;  4ID5 B;  3VAG A;  1U4B A;  1X4B A;  1N32 F;  3GJT B;  1P8G A;  1GTE A;  2XC9 A;  3OJU A;  5U47 A;  1CJU B;  2CA9 A;  5KFZ A;  2QIF A;  1S9G B;  5ETT A;  4DSK A;  4OFZ A;  1UWA A;  3BV8 A;  1CJT A;  2IAJ B;  4J37 A;  3H5Y A;  4H4O B;  4FS2 A;  5LSO A;  1WHV A;  2FQQ B;  2DIT A;  5KFV A;  3CD6 S;  3QBC A;  1H2V Z;  4ZN1 A;  2A2C A;  2Z2Z A;  5IT4 A;  2XMU A;  2N7Y A;  2WVB A;  2J5A A;  3QJP A;  4J9M A;  4HTJ A;  3TOQ A;  3ETM A;  4CLS A;  3PO5 A;  1S77 D;  1VJW A;  1FK9 A;  2JLE A;  2HZV A;  1T05 B;  1RWM B;  1VBK A;  1WSV A;  3C16 A;  5KFM A;  1VRQ C;  4A8K A;  4IH7 A;  2HHP A;  3EVO A;  1NM2 A;  3D7S B;  3OHB A;  2N7C A;  2QL7 B;  3D6M B;  3UFC X;  3BSN A;  4B02 A;  1SL1 A;  3AT1 B;  3VAK A;  2QV6 A;  3MUR P;  5LJ3 Y;  4CO1 A;  3TUP A;  1UAW A;  2EFG A;  3LF0 A;  2AIR B;  1NK7 A;  5J1P A;  5DDR C;  2CXE A;  2XWX A;  2JNJ A;  3MM9 B;  3OL8 A;  1XMQ J;  1EX8 A;  1SPB P;  3EWG A;  4PQA A;  4F2R A;  5D78 A;  3QSY B;  4N47 A;  3FFI B;  2ZOM A;  1ROF A;  5J2Q A;  4OX9 F;  2IMW P;  3K58 A;  1WHY A;  4WJB A;  2W24 A;  1DY3 A;  2HBY B;  5ETQ A;  1WEX A;  3UNG C;  1VRU B;  1R6V A;  2IMO A;  3FQK A;  1SL0 A;  2BUN A;  1RU1 A;  1N8R T;  3GSI A;  4LR7 A;  3QT8 A;  2AF6 A;  2CPX A;  1KHW A;  2G2O A;  4PG6 A;  1HNZ J;  1HD0 A;  5C42 B;  1K9M T;  2CJ9 A;  1NHV A;  3CC4 S;  4E2F B;  3GYG A;  2FHJ D;  5HJY A;  3D2W A;  2R2R A;  3TQE A;  2CPY A;  5BYQ A;  4DUT A;  4DFJ A;  3EGN A;  2HW3 A;  1HYS B;  3OW2 R;  4I6Y A;  1NK6 A;  3KLV A;  3QYY A;  3A13 A;  2GGP A;  4QWC A;  4Y2K A;  4H4M A;  4BWM A;  2W7A A;  2CAD A;  1BQX A;  2BV3 A;  4LVO P;  2NLW A;  3UD3 P;  3B6B A;  2V2Q A;  3LP1 B;  1BWV A;  2BVZ A;  1U6Z A;  3RBE A;  2W2O P;  3UI3 A;  3K57 A;  1IJE B;  1D9F A;  4U9R A;  2MGZ B;  3CJ2 A;  1T94 A;  3N79 A;  1VQ8 S;  1IBK F;  1OY9 A;  2COL A;  2MB0 B;  4RNH A;  2YNI B;  4K4U A;  4URG A;  3CD0 A;  4X4U A;  4BS2 A;  1IQZ A;  2RDI A;  5KFS A;  1HBU A;  1S6Q A;  2B51 A;  3I4P A;  1JJ2 R;  2NCK L;  3DN9 A;  2WBR A;  1KLN A;  4X84 A;  1QUV A;  2NR0 A;  4EBC A;  3OD2 A;  1FXD A;  2DT9 A;  1GMW A;  2B5J B;  2H51 B;  4M5N A;  4X62 F;  3CDB A;  3I56 S;  3Q23 A;  3O3L A;  3NGR A;  5GVQ A;  1TVR A;  2LMI A;  2W2P P;  3H8Y A;  4J9O A;  1DLO B;  5CQG A;  2MQN A;  5FLX U;  1OO0 B;  3BJY A;  2RUS A;  2HUR A;  4P7V A;  2C2K B;  3GU0 A;  1WC4 A;  5GAD U;  4H54 A;  2QT7 A;  1UCN A;  2ZHB A;  3L9Z A;  1WHW A;  3UDC A;  3US5 A;  4ED0 A;  4PWD B;  1RTJ B;  3KUE A;  1Q82 T;  3IRX A;  3GJS B;  3PW4 A;  3PYF A;  4QIV A;  2UXB F;  4CLT A;  1K47 A;  1WEZ A;  1IBM J;  2OFG X;  1HWL A;  3OV7 A;  3HHL D;  4JV1 A;  4KGM A;  1YJ9 S;  4NLX A;  4OYO A;  2DEJ A;  3CJ0 A;  4B9V A;  3KLH A;  2ZHO A;  2HVH A;  4IOC Q;  3RR8 A;  2GC8 A;  4OLO A;  4QWE A;  3QFW A;  1VC0 A;  4ED5 A;  3DRS A;  1ZOT A;  2HVZ A;  3H4B A;  1FT8 A;  4KFB A;  3EXY A;  1ZZF A;  2H4W B;  2AT1 B;  1B7Y B;  2KJW A;  2BA9 A;  2HHH F;  1LK5 A;  4XAK A;  3D3B J;  4DSJ A;  4WK1 A;  3KK2 A;  2V8P A;  5D0H A;  1FF2 A;  2CRL A;  2VFR A;  2CPZ A;  1H2U X;  5GAE I;  3CJQ A;  2JDJ A;  3OLB A;  2GO9 A;  2VL1 A;  1WC1 A;  2QL5 B;  3EXC X;  4JOU A;  1RT4 A;  2XCP A;  2VQE F;  1N32 J;  2J0W A;  4LRD A;  3BGL A;  1NXI A;  3KYL A;  2QG9 B;  5HSP A;  4F7V A;  1VQO S;  4O44 A;  5H9E J;  4OMF G;  2RUG A;  2YNF B;  2QYG A;  3OVA A;  4AUK A;  2LP4 A;  3D68 A;  2YH0 A;  3LOU A;  1S6U A;  4EGL A;  3P4U B;  3FEZ A;  8AT1 B;  2MY8 A;  3PV8 A;  4CTA A;  3LW5 C;  5HP1 A;  2R2T A;  1PYT A;  3SZ2 A;  3HM9 A;  1C1C A;  2SXL A;  2DKO B;  2EBE A;  2LEP A;  4LF1 A;  4LR9 A;  4F3M A;  2U2F A;  4PUO B;  4O3P A;  4PXD A;  2HND A;  3ZZ0 A;  3C66 A;  4OI0 A;  2DHG A;  1T8E A;  3EGZ A;  4P2M A;  4R25 A;  3SSS A;  2FVS A;  1XR6 A;  6FD1 A;  4GC6 A;  5A2Q U;  1RZM A;  4LRC A;  2OUG A;  1GX5 A;  3CW2 C;  3HKW A;  2IM0 A;  3RRG A;  2AV5 A;  2IYG A;  5F8N A;  1FRJ A;  1IKW B;  2VG5 A;  2YWG A;  2Q3P A;  3R9L A;  4H4K A;  1VLY A;  3JAM Y;  3M7V A;  2Z4P A;  3CWJ A;  2WOM A;  1LW0 A;  2EFO A;  3QZ8 A;  3M32 B;  2XY6 A;  1U6B A;  2E7W A;  2MKJ A;  3SEO A;  4LF5 J;  4FPI A;  2RQ4 A;  3ILI A;  2QSF A;  3GIR A;  5B08 A;  3MD1 A;  1A0O B;  4F0K A;  3HDS A;  3TUI C;  4OX7 A;  3HSJ A;  3S1T A;  4M5I A;  1N5V A;  4ZA1 A;  4OX9 J;  3BR9 A;  2C3Y A;  4I7F B;  1VOM A;  3CC7 S;  5FDL B;  4AE5 A;  3VZH A;  1N52 B;  1QE1 B;  2IM3 A;  3KLG A;  4WE1 A;  4PG7 A;  4DUY J;  3MFH A;  3H20 A;  3JQM A;  4DZD A;  4G6V B;  1VBZ A;  4DCP B;  2O1P A;  3TAN A;  2CQ0 A;  2VG6 B;  4ZDN A;  1VQK S;  2NXE A;  4PPD A;  3PZP A;  1RHK B;  1F5C A;  3HHL B;  5JUM A;  2QE5 A;  4EZ9 A;  4GVL A;  3M6W A;  1LW2 A;  1N5Y B;  3CVK A;  3N5F A;  3SCI E;  2KRB A;  3G4S S;  1G4C A;  1OY8 A;  2HPU A;  4QYR A;  3FBE A;  4C7Q A;  2VFU A;  3A8E A;  4I56 A;  2HG4 A;  1R7I A;  1RAB B;  4LF7 F;  2BX6 A;  3G8T A;  2HHV A;  3TA1 A;  3D3C J;  4NCG B;  3HVT B;  4MKV A;  2LDI A;  1TR0 A;  2DIV A;  2HK2 A;  4Y28 C;  3PEJ A;  3QJJ A;  5BJR A;  3TEH B;  4Q2M A;  3MHY A;  2XO6 A;  4YR0 A;  2W25 A;  4WBF A;  3HUL A;  2VOD A;  1U8W A;  5C25 B;  1U24 A;  3GFZ A;  4EFA C;  3GIM A;  1TFW A;  2V4Q A;  1WKK A;  1ICE B;  1N0U A;  1PSD A;  1LV5 A;  4NA1 A;  4UW2 A;  2B0G A;  2LEC A;  4YQW A;  3ADA C;  1W2I A;  4X62 J;  3KLI B;  5HMX A;  1XMO F;  1WOS A;  3DRY A;  2EPI A;  1FWP A;  3CCS S;  1DQ8 A;  1B64 A;  3GPA A;  3BQ1 A;  4UF4 A;  1VR6 A;  3WX8 A;  3HZG A;  1NND A;  5I3Q A;  3LGH A;  1TL3 A;  4DN0 A;  1RQ0 A;  2BE2 A;  2FHO B;  2N82 B;  1VIX A;  3M2V B;  5HBM A;  3NGK A;  2FTR A;  3KHG A;  2E1M C;  1EKR A;  3DMJ B;  4DR4 F;  2R2S A;  4Q45 A;  2MMY A;  1ZYQ A;  1S6O A;  2VIC A;  1H6K X;  3BM7 A;  1T3N A;  2DH9 A;  2E1A A;  2R4F A;  4K4Y A;  1SJQ A;  2RQK A;  4USK A;  4DUZ F;  1HBM A;  2QO3 A;  5KT2 A;  2H48 B;  4O4G B;  2MZT A;  4XPC A;  1IKV A;  3T5L A;  3SCK E;  4OYI A;  3D54 A;  1HKA A;  4RZR A;  1JLC A;  2KO1 A;  3QO9 B;  3MM7 B;  2DXF A;  1RT1 B;  2QGF B;  2DNH A;  3MEE A;  3M8P A;  4DHV A;  2NUH A;  4ZHR A;  4R5P B;  1DTT A;  2L9W A;  1FXR A;  1WOO A;  2D3Z A;  2CPI A;  3M8Y A;  2R7R A;  1FA0 A;  3DNC A;  2VOO A;  3BKF A;  2YX1 A;  2PA3 A;  2I9S A;  5HQM A;  3NS5 A;  2ZM6 F;  1RWX B;  5G0R B;  4V19 J;  3GE9 A;  1RDR A;  2PI5 A;  2DGQ A;  4ZVT B;  3A3P B;  4DF8 A;  1N33 J;  3IM9 A;  4QR0 A;  2CJB A;  4Y2I A;  3CJ5 A;  3ITH A;  1SQG A;  1JIH A;  3H5S A;  1UET A;  2ACM A;  4CO0 A;  2FLN A;  1S10 A;  3CIM A;  3PHE A;  2AZ3 A;  4OQJ A;  3BGU A;  3BQ2 A;  4F4Y A;  1RT5 A;  4N8N A;  4JI7 J;  3HHE A;  2ALY B;  4C8M A;  5KFI A;  4LFB F;  4YFU A;  3MGJ A;  3T5K A;  1M5S A;  2ASY A;  2IJF A;  2OGU A;  1CJT B;  3NNH A;  3G71 S;  1K8A T;  1NZ8 A;  1TKT A;  4FXW A;  3HO1 A;  3BR8 A;  5J2M A;  3LP2 A;  5EN1 A;  1VIS A;  1JXE A;  5L9N A;  3RW6 A;  2ASJ A;  1C4A A;  1LNQ A;  2DJW A;  3M8R A;  3T1Y F;  4NMX A;  1FEE A;  1G7C B;  1F5A A;  1Q7L B;  1GH8 A;  2GHP A;  2E7X A;  1QD1 A;  3MAQ A;  1FNM A;  2WSE C;  3UCZ P;  1FK9 B;  3JSM A;  2V4J A;  2DXE A;  3C16 B;  1S0N A;  1S49 A;  1YQH A;  2FLL A;  3NLC A;  4BDP A;  3JTP A;  1H98 A;  5H9F J;  3TAR A;  3D0I E;  2MHN A;  2Z57 B;  3MM5 A;  1X4F A;  1NCL A;  3TO8 A;  2JEJ A;  1PGZ A;  2OEJ A;  2Z8Q A;  2LQB A;  1B4S A;  4WWS A;  5KFA A;  4V19 X;  3LO3 A;  1VBY A;  5CYQ A;  1PJ5 A;  3ONQ A;  3ZZZ A;  3HFZ B;  4C3K A;  4Q0B A;  4ZIV A;  1U49 A;  1O51 A;  5DZ7 A;  2YKM A;  2JL9 A;  4DQP A;  2XNR A;  4PG4 A;  2H3E B;  3FDS A;  5HL7 Q;  4M94 A;  1KOH A;  1M5O C;  3RAM A;  2ZH7 A;  3K8W A;  2AD9 A;  5J2Q B;  3BH6 B;  5FJ4 A;  1N56 A;  1X9M A;  1T02 A;  3CJ3 A;  3R5B A;  4CH0 S;  1YIT S;  2NPI A;  4NLU A;  1NJX A;  2C2Z B;  4IDK A;  5A6P A;  2UU9 J;  4PAA A;  3LWM A;  5C2C A;  2L48 A;  3DLJ A;  4RWW A;  2RAQ A;  4AQY J;  1KNZ A;  3D28 A;  3W3S A;  4WZM A;  3CED A;  1FRK A;  4NLS A;  4OI2 A;  2JFD A;  1Z2L A;  2ZC4 A;  2NYI A;  3EZO A;  2YPZ A;  4F3Q A;  3Q83 A;  3M2R A;  4JP8 A;  3MM8 A;  2M7S A;  2GGP B;  2UUC F;  3KLF A;  1LWC A;  1EP4 A;  1LFP A;  1JJC B;  4H4M B;  4F4X A;  1WC6 A;  1FO1 A;  2W2N P;  1XMO J;  3MCS A;  3BH7 B;  2MKH A;  2MTL A;  3OPK A;  3AXM A;  1I94 F;  2H9Z A;  4KPY A;  1J5E J;  3CJ8 A;  2V5H G;  1DAX A;  1TL7 A;  2I38 A; 
#chains in the Genus database with same CATH homology
 1XIQ A;  4ANC A;  4CP5 A;  1PKU A;  3BH6 B;  3Q86 A;  3FBC A;  3B6B A;  1VYA A;  3VGS A;  3FC9 A;  2BX6 A;  1HIY A;  4AND A;  1NSP A;  4W98 A;  2B8Q A;  3ELH A;  3JS9 A;  1S5Z A;  1LEO A;  3ZTR A;  1XQI A;  3FBB A;  5CAA A;  3ZTQ A;  2HVE A;  1F6T A;  3VVT A;  4F4A A;  2DXE A;  3VGU A;  1LWX A;  4EK2 A;  1NHK L;  3NGS A;  1NB2 A;  4DZ6 A;  3EVM A;  1ZS6 A;  2DY9 A;  1B99 A;  3ETM A;  1WKL A;  3FCV A;  3BBC A;  3EJM A;  1JXV A;  4UOF A;  1PAE X;  3NGU A;  1NLK L;  4ANE A;  2NCK L;  2BEF A;  3Q8U A;  1MN7 A;  4WBF A;  5IOL A;  1F3F A;  3FBF A;  3L7U A;  1HLW A;  3EE3 A;  1NDC A;  3BBB A;  3DDI A;  3BBF A;  1U8W A;  4F36 A;  3PJ9 A;  4DI6 A;  2AZ3 A;  3EIC A;  4S0M A;  1W7W A;  1HHQ A;  3VGT A;  1BUX A;  1NCL A;  3EVO A;  3ZTP A;  3MPD A;  1NPK A;  1NDL A;  2AZ1 A;  1NDK A;  1WKK A;  1S59 A;  4ENO A;  3NGR A;  1B4S A;  2DXD A;  5C7P A;  3PRV A;  1NUE A;  3FKB A;  3B54 A;  1NSQ A;  1MN9 A;  2B8P A;  4KPC A;  1NDP A;  3Q83 A;  5CAB A;  1WKJ A;  3EVW A;  2DXF A;  2HVD A;  4UOH A;  4DUT A;  4UOG A;  4C6A A;  2HUR A;  1NSK L;  3ZTS A;  3G2X A;  3NGT A;  2CWK A;  3Q89 A;  3Q8V A;  3Q8Y A;  4FKX A;  2ZUA A;  1BHN A;  4FKY A;  5BXI A;  3EM1 A;  3ENA A;  1KDN A;  1UCN A;  3BH7 B;  3GPA A;  4HR2 A;  2DYA A;  3R9L A;  3ZTO A;  3GP9 A;  3FCW A;  4O0N A;  1K44 A;  2VU5 A;  1EHW A;  3WX8 A;  3VGV A;  3VVU A;  3DKD A;  3EMT A;  3FBE A;  1S57 A;  1BE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...