3FCWA

Crystal structure of the mimivirus ndk n62l mutant complexed with udp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
131
structure length
131
Chain Sequence
GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 40
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fcwA00
2NCKL 3ZTQA 1NSQA 1F6TA 4W98A 1S5ZA 3NGRA 3NGUA 2VU5A 3ZTPA 1B4SA 3FBBA 3BBBA 3VGUA 1NCLA 2HVDA 3VVTA 4DZ6A 3Q8VA 5CAAA 4ENOA 4FKXA 3B6BA 1LEOA 1HHQA 1BUXA 2BEFA 3VGTA 3B54A 1BE4A 1WKLA 4ANEA 1NDPA 3JS9A 4ANDA 2B8QA 2DXEA 3FCVA 3EICA 1MN9A 5CABA 1NHKL 5C7PA 3FKBA 3BBFA 2AZ3A 1HIYA 1ZS6A 1PKUA 3EMTA 4S0MA 1NDLA 3BH6B 4F36A 2DY9A 4UOHA 4DI6A 1BHNA 3VGSA 3FBEA 1VYAA 4UOGA 4O0NA 1WKKA 1PAEX 3VVUA 1XIQA 4F4AA 3Q86A 1F3FA 1MN7A 1NUEA 4EK2A 1S59A 3EVWA 1NB2A 4HR2A 2HVEA 3DDIA 3FC9A 3PRVA 1U8WA 1EHWA 1NDCA 4CP5A 1NSPA 4UOFA 2DXFA 1HLWA 3FCWA 3ZTOA 3ZTSA 2HURA 3ETMA 3NGTA 4DUTA 3PJ9A 2DYAA 1K44A 1NLKL 1NPKA 3FBCA 3L7UA 4ANCA 1XQIA 2ZUAA 4C6AA 3EVOA 1LWXA 3Q83A 3BBCA 1WKJA 1NDKA 5BXIA 2BX6A 1W7WA 1KDNA 3VGVA 1NSKL 2AZ1A 3MPDA 1UCNA 4WBFA 3NGSA 3BH7B 3G2XA 3Q89A 5IOLA 3Q8YA 3ELHA 2DXDA 1S57A 2B8PA 3EM1A 1JXVA 3R9LA 3GP9A 3EVMA 3DKDA 4FKYA 3FBFA 2CWKA 3EE3A 3ENAA 3ZTRA 4KPCA 3Q8UA 3WX8A 1B99A 3EJMA 3GPAA
chains in the Genus database with same CATH superfamily
4ZVGA 2V4RA 3K8VA 4KKOA 4KRWA 4TVAB 1QVGR 3SQGA 3U1LA 1KP6A 2G4BA 3ZTQA 4C97A 1F6TA 3I0RA 4H4KC 4J37A 4J91A 4ZVQB 3ITHA 3CCVS 1D8YA 3PNIA 1Z4UA 2DNKA 4G1PA 4PABA 1VLOA 2Z8QA 3ONQA 3I31A 1PJ7A 3IM8A 3BR9A 3UO0A 3W5YA 4B9TA 3TAPA 4ECWA 1RBLA 1WI8A 4K4ZA 4LF4F 2VPWB 4PWDA 1KVJA 3HVTB 2K1RB 4DPXA 1V5VA 5D4PA 1RTIA 1VQYA 1PSDA 2B9XA 2BM1A 1WKLA 2DCUB 1Y7PA 3K0JA 3JS9A 4B3SJ 1CG2A 1S9GA 4F3MA 1F1BB 3N28A 5CYJA 1LOUA 2JEIA 3DRSA 4OYOA 3C16A 2W2NP 4RBTA 3TWZA 4ZITA 2X1GA 3G86A 4M5HA 4ZVFA 2OGUA 2V5HG 4DL3A 2DPJA 3RAQA 1EB0A 1UZDA 2QLBB 4MIAA 4ELUA 3QRRA 5DLFA 3SSQA 4PR6A 1NB7A 1S49A 2HBQB 1UFKA 4LR9A 4KFBB 4LR7A 2DRBA 1EP4B 3DRXA 3MM6B 1N52B 1TV6A 2CQIA 1PBAA 5F0WA 5KOWA 2HWHA 4D3GA 4XK8C 4J9SA 2C2KB 2AKWB 3I9ZA 3LF0A 1FRKA 3N01A 4LFAJ 4EUVA 1YVFA 4YFUA 4A8MP 1B0TA 1UFLA 3TAQA 2KVIA 4DX7A 2M5YA 4FYXB 5LJ3Y 3LGHA 1RUSA 2NXUA 1OYDA 2OFGX 3KHGA 4Q8FA 4ZPWR 1K1SA 2J7WA 4IDKB 4LT6A 4OI3A 4K0KF 2RE1A 4NLTA 3I9V9 3ULHA 5K8NA 1U47A 3JYTB 1FWKA 1C4AA 1C0TB 3UVJB 3JYTA 3OTCA 3CCUS 1IBKF 1JKHA 2HRTA 4YY3F 1TKZA 3H4BA 4BDPA 5A8KA 3TUJC 4UOFA 1MNEA 2Q43A 1NNDA 4IKAA 4ZJLA 3CO0P 2OJ3A 3G6ES 4Q45A 5SUHA 2EI5A 2VBZA 4TYBA 1F2HA 1FKOB 3VTIA 2ZZTA 3BM7A 2CDRB 4ID5A 4RW6A 1VQ8S 2V8HA 3PJ9A 3C14B 5ETNA 2UVRA 3KWMA 4OHWA 2JDJA 1RK8A 3PYEA 4ZCIA 3MAQA 4ETXA 4DS5A 1S12A 4YEAA 1FKAF 3THVA 1WWHA 4DL6A 2KXNB 1OSCA 3TZXA 3WX4A 3TZYA 2DD8S 3BBCA 1WKJA 3TEHB 1M1KT 2HVIA 2XZDB 4WZQA 2KDOA 4LF6J 2R8KA 3V2UC 2VG7A 2PMWA 5J2QA 4K0KJ 2CFXA 2MQLA 3SYZA 3AJDA 1FRHA 1XMQJ 1M5SA 2DTJA 2DNMA 4HEA9 4ITSA 4L75A 2R3VA 3T1AA 1A9NB 3LPEA 1RJJA 3OT9A 2VOOA 2IVMA 1VC0A 3C46A 1VRUA 2IMWP 5HMYA 3NWGA 3TA1A 3ZZPA 4JI7J 1UEUA 3R9LA 3QJPA 4X65J 2VG5B 3N4WA 3OTOF 4WTYA 4DL2A 4HH0A 3EE3A 2KKHA 1RTIB 4RNFA 4P10A 1RT2A 1YWXA 2FDNA 4C3LA 1P1LA 4CYUB 2W9AA 4IDKA 4UW2A 3W60A 2JWNA 2HFVA 4C8KA 2DGWA 3RUBL 2DVIA 1X31C 1HQEA 4JV5J 4ILRA 3TQEA 4FYDA 2QJ3A 2H5IB 5F41A 3HT3A 1T0TV 3J7ZT 4RW7B 5EX0A 1OYEA 2CG4A 1MROA 3MM5B 2CIMA 3DC2A 1HWIA 1GQEA 4KB7A 5GMEA 3P5BP 2IIHA 2EKYA 1VBZA 2C3PA 2DGSA 1LEOA 1VCTA 3KG4A 2H65B 3R27A 2ZEJA 3HM9A 2BACA 1N34J 4LF6F 2HHTA 4I64A 1N33F 3VHQA 2V94A 2W4DA 5IWAJ 3W9IA 4F04B 2GGPB 2A2DA 9ATCB 1VJQA 2C42A 3OFEA 5GVQA 3W8PA 2J6SA 1HWLA 4Y2KA 1VQKS 4F26A 2XS2A 4I67A 1DFDA 3ENQA 2LEBA 1PYOB 2K3KA 4ZVEA 2MPUA 1EZZB 1ZM3A 2XI3A 3QT8A 2VB6A 4ECYA 3TQ1A 3AJ2A 4HI2A 1IBLJ 2VA3A 1TVRA 4JYAF 4L72B 2QA1A 2Q3PA 3LWLA 1QAXA 1TMMA 2E44A 3C8YA 3ZZUA 2P6SA 3EMTA 3HPOA 4M94A 2GHPA 2FLPA 3RU0A 2IJFA 3DLKB 1YJ7A 4C7QA 4DLEA 1HR0J 1PG5B 1UKUA 3DYAB 1IWGA 5J2NB 3O5TB 3BO2A 2JL9A 3R6GB 2RRNA 5FIIA 4WIIA 2BANA 1ACMB 1EAYC 1DTTB 2GMLA 1RGVA 1WKKA 4NCGB 2QGFB 5LM7E 3DNCA 3T1HF 2PN6A 2XZWA 4DR4J 1S7IA 2MDAA 2L3MA 4OHVA 2YH1A 1SJQA 4DUZJ 1IVZA 4EK2A 1U0HB 4C3MA 2CA9A 3DU6A 3CDWA 5GAHU 1WTBA 2NUUG 2IRYA 2V8GA 2M3DA 2B7CB 4QWDA 4ECXA 2ZKUA 1WOOA 3D1OA 3CSKA 2XZTB 4NEYA 4TKTA 1U8SA 3MFIA 3A4TA 4U7UD 2J76E 3F56A 4WXOA 3IBWA 5JVGQ 2F8MA 1L3SA 2EC0A 1WHYA 2Y9HA 3DHWC 2R4FA 1NSPA 3HD2A 2D3OR 2MXYA 4FBTA 2IVYA 2YKNB 3HSGA 2DGOA 4USHA 2CPJA 1DTQB 3ETMA 4RUAA 4IFYB 1OQ3A 4RW9B 3CPWR 2B6AB 3AB2B 4NPOA 3GIKA 4U7UK 1X0FA 3NMRA 3TA2A 2YQ1A 3DHXA 2VA2A 4F50A 4F4KA 3EZ5A 1NMEB 2C3YA 5LMNF 2D3O1 4A46A 4LRDA 4X2BA 3IWNC 1AZSB 1AYEA 4QIWD 5AXKA 2BQRA 4N41A 4Y34A 5KFGA 2K2PA 2IBKA 1AXQA 3CJ8A 5ETKA 2AX0A 3K5NA 2WB4A 1QM9A 4OYWA 3NAIA 4K5SA 2ZZMA 1RTJA 2Z56B 1Q5VA 1TKZB 4OIXA 5J2MA 4DR5J 3DRSB 4K5RA 4KH1B 4OYAA 3J7A1 3QFHA 4ECTA 4G3IA 3UQSA 2L08A 4ZPBA 1U6BA 3G6VA 3VQSA 4IG3A 2DIUA 2E1CA 2C3MA 4ZHRA 1IKWB 2YQ0A 4ED5A 3A1YG 2KO1A 1DTQA 3C66A 2X1FA 3AJ1A 2HGLA 2W9BB 4RU2A 1CJUB 4PYDA 1RSCA 4RUHA 1S4EA 1LNQA 2KJWA 3H40A 3Q8UA 3VALA 1G7CB 1FFGB 1NHUA 1JLQA 3NOGA 1D09B 1AUSL 2NXEA 3MM8B 1IWAA 3R97A 3K8WA 1K1QA 3T1YF 1JQGA 5E2QA 3PW4A 2I2YA 3CJ2A 2Y3YA 3HULA 1QAIA 1FA0A 3GSIA 4ID8A 4ZDNA 2DITA 4M5JA 3CC7S 3KLIA 3MTKA 2PE8A 2YX7A 2IVFB 2VV5A 2ZJPQ 3H2LA 5KG0A 2FTRA 5C5JA 2M7SA 1TL5A 2UUWA 3SV4A 1G2EA 2IAJA 3BYPA 1CJVA 1NJIT 4OQJA 5A6WA 4GKKJ 3LP2B 4EWTA 2HIYA 2JZ5A 3THPA 1VBKA 3B6BA 3TX8A 2IAJB 1NK5A 2UXDF 2MZTA 1HHQA 1VIXA 4M5KA 1SJ4P 1X4CA 2YWGA 1N32F 2R7SA 2QE5A 4OI1A 4QWEA 3JQKA 2XTJP 1BE4A 1N5VA 1BC6A 3CJKB 4K4VA 2OMLA 1YG0A 4MIWA 1IJEB 3K89A 4UUXA 3HHLD 1NRKA 1N33J 3MEGB 3MR6A 4C48A 2ASLA 1IXKA 1U0SA 2HWTA 4DQIA 1JLGB 2HHPA 3QQCD 1YX2A 2YNFB 5EDWA 5I42B 2J9EA 1U1RA 1S9FA 1HD1A 3P5TL 3G8SA 3Q2TC 2XY5A 3BGRB 3KHHA 2XSJB 4HTJA 1S0OA 3BQ2A 4C0HA 2DY9A 1YBTA 1UWBA 1Q79A 4UOHA 2JLGA 2CPYA 3MMBB 3C2PA 4C8ZA 1VRUB 4H4KA 5LOQA 1FJGF 1VYAA 4TN2A 3C6UB 2NQPA 3CDEA 4DX6A 1NKCA 4O0NA 1BY9A 2HIQA 4WU2A 3OTEA 2AV5A 1N6QB 5LXRA 1JJ4A 4B3MF 1XIQA 4F4AA 1KLMB 2OPQB 2DKOB 2C22A 2E1AA 4DQPA 1HI1A 2DNLA 2P2CB 1N6QA 4O3RA 1S76D 2V68A 1TK0A 5IXUA 4BC9A 4U7CA 2AYBA 3IWLA 2RSQA 3M05A 3J80U 1SJFA 1AZSA 2ZJQQ 1TKXB 3PRVA 1LW0B 4HVZA 2FJAB 1X0PA 1YSJA 2HNYA 2PMHA 2XSFA 4C98A 3OFHA 2OELA 1SC3B 2NR0A 4K4YA 4QCLA 4J9MA 5K9FA 1HI0P 1N36F 4OZNA 2CRLA 1M1GA 5A8WA 1KS2A 3LP1B 4I6WA 3PR4A 3EYZA 1IBKJ 3V4MA 3M8WA 2RS2A 4NZ0A 4KYZA 2AYEA 3H2VE 1OMSA 3NGKA 2C2OB 2O66A 1Y00A 3QBCA 2ERRA 1FD8A 4DHVA 4DOZA 1HR0F 4DCPB 4NRUA 3L7UA 4BWJA 3QT5A 3FSIA 1XQIA 5ETVA 5IQ6A 1QTMA 1SB6A 3H42A 5C25B 3IP0A 2VQEJ 1UVLA 4FF1A 2LLZA 1BQXA 3DMJA 2DCLA 4K59A 3TUIC 4CLLA 3G6YA 2ACYA 1HKAA 2JOQA 3CWJA 4OYXA 4WK3A 4CO2A 2Y8YA 4Y2CA 5HI7A 4ECUA 2RDDA 3KLHA 5F8NA 3EZOA 1E6YA 1RCOB 3H0PA 3SFGA 3CCLS 4P74A 4A8FA 2HNYB 1X8DA 3K7RA 3NGSA 2R7QA 1BQNB 3W2VB 4YY3J 2HRUA 3BN7A 4ZIWA 2ZHAA 1F5BA 3SDEA 5H1SV 2DGUA 4U67Q 2RS8A 4E98A 4G6VB 1SIWB 3GZ7A 4NLGA 3EX7B 3VWSA 5CYMB 4ID5B 3OD2A 4RW6B 2QN6B 1CJKB 2AJFE 4YOEA 5E5NA 4DCOB 2WHOA 5KFXA 1UJ4A 2R42A 3TZWA 1S1TA 1WC5A 1FX2A 3HI9A 3IR5B 4QZVB 4CIOA 2XCPA 3MR2A 4RNMA 5D0EA 4NLPA 3VF0B 4X64J 1AFJA 1EETA 5HATA 4ZCMA 2R8GA 4DR7F 3KUGA 4DFMA 3V6HA 2XYGB 4WCEQ 2PI4A 1C0UB 3BGRA 3MM7B 3KK3A 2MHNA 4DEZA 4J9QA 1RCXB 1SH2A 3NRBA 2GJIA 5AXNA 4WE1B 1ULRA 1FWPA 2HYIB 1Q8KA 3D54A 1U1MA 3W5ZA 2RUGA 3G6XA 2KYZA 1NKBA 1UA1A 4ENOA 1VMBA 1RU1A 1FCAA 2R7RA 2AEFA 2KYXA 2VBYA 3D4JA 3IWXA 5KFQA 4RBUA 2OIHA 4JI7F 3VAIA 1ZETA 1T3NA 5IT9U 2JH3A 5DQGA 2A2CA 2LECA 4RW9A 1SL1A 1J27A 1OS5A 4J9NA 2OEKA 1N4LA 1NDPA 4R8UB 4I2PA 5L8RC 4HYKA 3N6LA 1PC5A 3NKYA 1M5KC 1L3KA 1RADB 1AA1B 4R5PA 3M8SA 2HS4A 1T03A 5C7PA 3UVJA 4ZVUB 2VHGA 4DV3F 3MDFA 1HNVB 2HS3A 2QC3A 4ZS6A 3BBFA 2AZ3A 3WZ0A 3D1HA 4L76A 1DQ8A 4EMDA 4DQRA 2PA3A 1KWMA 4S0MA 3ICLA 4RLEA 1F2GA 4HI1A 4ZPAA 4Z7CA 4DQQA 3FFIB 4DLGA 2BA9A 2DNPA 4MFBB 2XSJA 2G0JA 1LQ9A 1D9FA 1HPZB 2JLFA 3AD8C 1FDAA 4PAAA 2XCAA 3IN5A 2DT9A 4DV4F 4DL5A 1S48A 2WSFC 2FY8A 3I5AA 1RXOB 3L4BC 1TAQA 4X62F 1JIHA 2ROPA 4K2JA 3M8RA 5K14A 1U1LA 1TV6B 2B6AA 2V69A 3BGLA 1JK9B 2YKPA 3GJSB 3MEGA 1KTQA 4NLRA 5F8MA 3GV5B 3PW7A 2LDIA 2FVQA 3P49B 3AB4B 1HBOA 1QTNB 4RW8A 5A8RA 4F7VA 3HO1A 2Y1RI 4G65A 3I0RB 3UR0A 1HHTP 3T3FA 1T05A 4JV2A 4P2MA 1Q78A 1TQLA 2MLXA 3G8QA 4DSEA 5K8OA 4FVCA 4TY8B 4F02A 5DGBA 1LW0A 4YDXA 3PKMA 3B78A 1N5QA 3DOMB 3HDSA 4RUBA 2NUHA 4WFXA 4ES3A 2J8AA 1WI6A 1SQEA 4OLPA 1N5SA 4CO0A 3C6UA 2V0NA 2IHR1 2Y0SD 4KHMA 4ED8A 4CO5A 1FVQA 4I0WA 2G0IA 1X5TA 2DYAA 3IAS9 3R5CA 4DPWA 2CPIA 3D6FB 4QW9A 1XERA 1RTDB 3BDPA 1NPKA 1ZZFA 2BBEA 2BANB 4FF3A 2HK3A 1DBDA 1S9GB 2IDEA 3M8PB 3HF5A 3NCRA 3QATA 3R5BA 3IRWP 1WDDA 3TW0A 2E1PA 2F65A 1Y3KA 2B9EA 2ZBRA 2N82B 3J80Y 2WOMB 4DF4A 5D0HA 3CDBA 3GIRA 1EQ0A 1RT5A 2F8EX 3M8YA 3C15B 4LF5F 1R3NA 1RT5B 2YPZA 2YNFA 3UD3P 3QJLA 5HMZA 4KV8B 1QUVA 4FNHA 4JI3J 1DLOB 5HMWA 2ZH3A 4IG3B 4XDCA 3D67A 3U1NA 4CH7A 3MD1A 2QLJB 1ZM9A 3G2XA 4KFBA 5K20B 1OWXA 2XULA 2G1HA 3D5MA 3EM1A 3T6BA 3UNGC 1CJVB 1RHMB 1TL7B 3M4XA 1RYRA 4FKYA 3HSJA 5M2PA 1GNKA 1HBUA 4TU7A 4CO3A 4JV5F 4V1Ak 4JI8J 1WC1A 3W5XA 1HBUB 5K8MA 1UFWA 4AL7A 1HMVA 2KL8A 1U26A 1RKIA 2F8HA 1VI7A 2FZCB 2R7OA 3HSZA 3OR2B 3J7YU 3KLVA 3RRHA 2EK1A 2I6WA 1Q86T 2V50A 3TUPA 1R43A 4UUWA 2DJWA 2QO3A 4LREA 5JXSA 4ZN3A 3TYTA 3H20A 2VQFJ 3DI6A 4P7TA 1KNZA 5MAOA 4HKQA 2VKRA 3FEXB 2GVZA 4HHJA 2CKWA 1J5EF 1S4FA 3CTRA 4DR4F 4JI8F 2Q6CA 2IJNA 1TR0A 1U49A 4BWMA 4RBVA 3FEYB 1S9EA 2M52A 1GXTA 3SIPB 4UY85 5CAAA 3AT1B 4MKYA 4JB8B 4P9SA 1PBUA 1RAOA 3R2CJ 3C6TB 4DDFA 1H2TZ 4B17A 2UUCJ 2F7VA 2QA4S 3RG6A 1T3OA 2E29A 3JAMY 1K73T 3CE8A 4NCBA 1IKWA 1T9VA 2AF6A 4OV1A 4B3SF 3CJ5A 3GFHA 4F0HA 1HBNB 4FBUA 4DXLA 4KKOB 4RU9A 4M5MA 3QT7A 3SQGB 2BXJA 2DXEA 1PCAA 4KGKA 1TK5A 1GTHA 5B09A 1VS3A 4J9KA 1MN9A 4FPRA 4C8NA 3BSAA 3W9HA 2HAFA 3JSRA 5DZ7A 3DOMA 2HQ3A 5F8HA 1R0BG 1RTHB 1U09A 3FRZA 1U24A 1YJTA 3M32B 4TLRA 4C2MA 3R5AA 4DFJA 1DHMA 5HROA 2D1CA 2G2OA 2BKNA 1NDLA 1UWBB 3AHPA 2MQNA 5U47A 5H9FK 1YDLA 3BKTA 2W2QP 3GIIA 4YP3A 2GFFA 2WSEC 1N88A 2FC8A 5HVFA 3A3NB 3W2WB 3T5HA 4ECVA 2CJAA 3DDKA 2KHCA 2QSWA 2ZBQA 4IH7A 1YZ6A 2D74B 5E3AA 3SFUA 1TAUA 3KDNA 1N0VC 1W25A 1BMQB 2DGTA 3MR7A 1I5OB 1Q5YA 3AD7C 3FEZA 2QFJA 2J8SA 1Q8LA 4NLVA 4RNNA 5KFIA 1SQGA 1CBKA 1GMWD 3OL9A 3U1MA 3DXSX 1ELOA 2VODA 5DLGA 3LAKA 1TKXA 2HRYA 1Y5IB 4DSIA 1NB2A 4CLZA 5HANA 3JSMA 2HWIA 1N0UA 4DV6F 5F3ZA 3PZPA 2HFZA 2QLFB 2YWFA 2PMZD 2LU1A 3MI7X 4GVBB 2J9CA 1PAUB 5DDRC 2KFNA 2KFZA 5L9XA 4DX5A 1F60B 2WCXA 1N5TA 4MTPA 1B7YB 2XHWA 3F44A 2V6AA 3M6XA 1X5PA 4TY9A 4CZCA 3KK3B 4QIEA 2FVPA 3V4IA 1ZAWA 2QLWA 2BJEA 1IBLF 4DSKA 2F9JA 4J9VA 4JI5F 3UPFA 4KGXB 3VAFA 1NK7A 2DHGA 4CLFA 5L38A 2BR0A 1LWEA 4P7VA 1DQAA 2YNIB 3ILIA 5L1KA 3E51A 1CC7A 3KJQB 4KT0C 2DHXA 2E5HA 1XMQF 1KSPA 2K7JA 4H4OA 4L73A 4ED6A 1TFWA 2AEJA 4USJC 1O5JA 4ALZA 1U1QA 1IQTA 1N5YB 3KJFB 4WYWA 2R2SA 3SSSA 3HHDA 2KG1A 4C8OA 2AX1A 5CZXA 4M5LA 2V2KA 4OI6A 5EHHA 1NEEA 3HLUA 5KFPA 3R2DJ 1WC6A 3IC1A 1NSAA 3LO3A 1JXLA 1AUDA 4IR1A 1CPZA 3GCXP 3Q8YA 2B8PA 1B0PA 1Q0NA 2BRKA 2YVSA 1JXVA 3GE9A 1QSLA 3BKFA 3QT6A 1LXNA 2BKPA 1WG5A 3DKDA 5ETMA 2CWKA 1VRQC 4C0OC 1TL7A 4GC6A 2RHQB 2H48B 4JI4F 1UW9A 5AXMA 4DR2F 5EX3A 3W63A 4BBYA 3KLEA 2I38A 3BDEA 4I2QA 5I3UA 4LFCF 2FJEB 3NMAA 3IBFB 1KOOA 4Z2XA 2OPSA 2UVUA 1CULB 2C1EB 3MCMA 2CQGA 1XR6A 4KV8A 4OMFG 2KM8B 2AMCB 2VPYB 2EFGA 1X4GA 3PHEA 4HDGA 2RILA 3SEOA 3K5PA 5EWFA 4QOTA 2LYVA 3RB4A 1B70B 3V81A 1Z2LA 1HNZF 3BBBA 4FPIA 2VG6A 3CC2S 4NYZA 3RB0A 2BOPA 1MWQA 4U95A 2M8DB 9RUBA 1AT1B 1J5OB 4N76A 2YKQA 5ETSA 3TRGA 1GMUA 3F73A 5L1IA 3KHLA 3SBMA 1RTDA 1RWXB 5FDLB 3JTOA 4CLUA 1L5UA 1RQ0A 1UMJA 2PGCA 5C42A 1BD6A 2YY3A 1KFSA 2C2NA 1HBNA 1UVJA 3QO9B 3NS7B 5KFNA 4DV2F 1LWFB 2CPHA 1OY6A 2MQQA 4FDFA 2CJBA 1FNXH 2CPEA 2UXBJ 2MSTA 1S6PB 3FZ2A 1MROB 3MM5A 4BS2A 2Z0GA 1HQUA 4DG1A 1K47A 2MQMA 4Y6IA 4PWUA 1RA7A 2VDHA 1G3OA 2V8PA 3JXOA 2H5JB 4YDDB 5GADU 4B9SA 4E8UA 3EPGA 1KLNA 1QSSA 4F36A 2W9CA 2KZZA 5LMUJ 2UXCJ 1R6VA 2RF2B 2ZC3A 4CLTA 2YKNA 4ILLA 1QE1B 5CD4H 2BJ7A 2KXHA 5K14B 4O44B 3DRRB 3UN2A 1U25A 2GQCA 4NI2B 2D3UA 4J9PA 3KK1A 4B3RF 3EPIA 2R2RA 3OSNA 3IR6B 6AT1B 4EBCA 2EW9A 2H4YB 4HT7A 4R0EA 2VBWA 4WP9A 1TUVA 3T41A 3UN5A 4M5GA 1TELA 1S59A 3W66A 3VZIA 1XWLA 2B4UA 2W4CA 4QR2A 4XO0A 4ZN1A 3Q8RB 2ZH1A 1WOPA 3CCMS 2M88A 1MW7A 1RHUB 2OPRA 4MH8A 2RKIB 3H2UB 2KXFA 2PDAA 3D2WA 3MECB 3UCUP 4LF9J 2PT0A 1Z2ZA 3GJTB 2MKKA 2OO4A 1FE4A 1T03B 4IYQA 1ZH5A 3OBIA 3GYXB 1ZZNA 1GAOA 4OX9F 2E5LJ 3A12A 3H98A 1YJUA 2KT5A 2ZVSA 3BN4A 3D9BA 3LW5C 1HLWA 4AXJA 4H54A 4DV1F 1SKRA 3TEGA 2CQBA 4B3MJ 4WFBQ 2BKOA 3B4DA 1JMTA 5D77A 4EFAC 2HZVA 2AIRB 3CD0A 3LGNA 3HHKA 1NLKL 3MM6A 1X5SA 4USVA 2BE7D 4HACA 1X9WA 2OPSB 2CQDA 4WJBA 1UL3A 2MQPA 2XGPA 2XY7A 4A8KA 1C1BA 2UU9J 2RT3A 4ZK7M 4J9LA 3QRPA 3W8GA 5A2QY 4LQ9A 3DLEB 4YMEA 2HVHA 4WIQA 4WXWA 2E66A 3I4PA 2MZJA 4HT5A 3X1LB 2OPPA 2UUAF 2NYIA 2UV8A 1L3VA 4EI2A 2YNGA 1KR4A 2OSQA 1TL3B 2DNZA 2UZAA 1QAYA 4MJKA 2NXNA 2DXDA 1IKVB 4FNIA 1S57A 2VJUA 2KN4A 1S9EB 2HGMA 2GAGC 3GG0A 3AXKA 3KG1A 5F8LA 2XLIA 1RT6B 2AHOB 4UZCA 1WHWA 5AT1B 2JVRA 4PXBA 2I9SA 5B0DA 4F4ZA 2OTLS 2YPYA 4I2PB 3IRXA 3CC4S 3IBCB 1XJWB 1R6YA 5DZ6A 3OTDA 1FK9A 4PPDA 3BKUA 2B51A 3HHLA 3M2RB 3M30A 2QMUB 4DU7A 2YBVA 2HGNA 3IM9A 3KXDA 3MEDA 5C24B 4F2SA 2KHDA 1RAEB 3H5SA 4ZCKA 2NCKL 3BQ1A 3KLFA 2WK4A 5KG4A 2RDJA 5HLFB 1NSQA 2CNLB 4LMZA 2NS1B 2XMAA 4ZP9A 4A8SA 2MKCA 5ETRA 4AL6A 5KG6A 2F1FA 2D9OA 3I87A 2DGVA 2OPPB 1IKYB 1WOSA 2RU9A 2FGOA 3NGUA 4FXWA 4LVOP 5E7OB 5ETPA 2DR7A 2IPOB 3M9NB 2VOPA 2W8KA 4KIAA 4GVBA 1Y5NB 3WBZA 1XMOF 3DLBA 1DQ9A 2KT2A 5B0EA 1H0HB 4LSNB 2J6TA 3FRYA 3MOZA 1UPPA 4WWSA 3I55S 4ZVOB 3VAJA 4XDDA 4PEOA 1S6UA 3O44A 2JFDA 2FJBB 1DAXA 4ZPVR 1JLAA 3LUYA 5FD1A 1AB8A 3QYYA 4Q0BA 3IXQA 3G82A 6FD1A 1VHIA 1D9AA 4YHHF 3W62A 2CJYB 2E9RX 4B02A 4WZMA 4K50A 4DL7A 2LXUA 4E2FB 2XO7A 2L41A 3NBPB 3I56S 5LMNJ 3MGJA 5T7LA 1RAGB 3C3LA 3BH6B 1FRMA 3HXMA 2ZJRQ 2QEXS 1GTEA 4KR0B 2ASDA 5DDOC 1G6BA 2DO4A 4P2FA 1OJ4A 2FHJD 3MUTP 2CYYA 3AFGA 3CMES 1UP1A 4N8OA 1CS4A 2GQQA 2G1DA 1WEYA 4BC7A 4FYYB 3CJ0A 1F3FA 4HACB 4PRFA 5GMDA 3M2VB 5G0RA 4DR6F 2DR6A 2HNZB 1JLQB 1G4CA 4HR2A 2HVEA 3O1LA 3POTB 5KFMA 2IYGA 3NOCA 4RW8B 3SV3A 3G82B 4KO0A 4I4BA 1MMDA 1IJFB 2GNKA 1NDCA 2KG0A 3PV8A 2ALZA 2IRXA 4PG6A 4MKAA 4CP5A 1JLEA 3M9MB 2I0XA 3DI6B 3H59A 2K3IA 2FC9A 4N56A 2C2MB 2QSFA 3SCIE 2XGQA 1RKJA 2NLWA 2F63A 3P6YC 1Y4ZB 1WSRA 3MEEB 2R2TA 3UW1A 3NGTA 3BGFA 2RQCA 2VJVA 4MMOA 4CCHA 2IYIA 4MKBA 1REVA 1H74A 4ZOSA 2PEBA 2ASJA 4ZJOA 2DR8A 2ATCB 1T8EA 1VQ9S 1FXDA 5ADZA 2BOAA 3GYNA 1FJCA 2VFRA 2MLYA 2MGZB 2A6OA 1U48A 4KQZA 4NMXA 2FJXA 3MR5A 2CWXA 1VK8A 2BYCA 5C24A 3E01A 5D78A 5CD4A 4RNOA 1ZM2A 2F3JA 3LTOA 3ET6A 2VQEF 2IRUA 3K5LA 2UP1A 4OI2A 3OJSA 4DUYF 1HNXF 1GK8A 3BREA 2HBRB 2XMKA 3I32A 4WBFA 5A8WB 1IBMF 1FJ7A 2FHOB 3Q89A 5DDPC 3W1YC 4J90A 1DLOA 4YB7A 3KUEA 1RB0A 1S1UB 2ZOGA 5CZVA 5LSOA 1CJUA 1HHSA 1RWVB 2GHWA 3KLEB 4P73A 5IV3A 3ENAA 2ZE2A 1SUQB 5AJ3J 4RNHA 2F4VF 2HNZA 1T9UA 2J5AA 3SMZA 1FWLA 4ZLJA 1S6QB 2H4WB 2J7UA 2X3GA 2GIQA 2VDIA 3WQPA 3JSBA 1NBEB 3SQOP 8RUCA 1MG7A 2MY8A 3OR2A 3HVWA 3HFKA 4O0IA 4JI2J 2IJRA 2VH7A 1S72S 2JFKA 2XS5A 3EDQB 3VQTA 4F0KA 4AUKA 3BO4A 1WDTA 5BJRA 4ECRA 5HP1A 1VOMA 3VAGA 3RRKA 3QAEA 4UF4A 3FQLA 5B0GA 4UT4A 1RT1B 4KJIA 3CMQA 4DZ6A 2AP6A 1RWKB 1RYSA 5GADI 1Q16B 4N5SA 4NCGA 5FLXU 4RZRA 4OYBA 3GONA 3U7JA 1RT3B 4NZ6A 4ERDA 1Y11A 2DH9A 5JJBA 3NNAA 4OX8A 5BR8F 4OZ5A 2CZ9A 3GV7B 4OZLA 2HHVA 3QO9A 4DS4A 4PG8A 2V2VA 2VUGA 2W8LA 4X4PA 1JLAB 5DG9A 2BMBA 3FCVA 2Z57B 3EICA 4TLQA 4ZA1A 5CABA 4DV6J 2OTJS 3MCOA 1UVIA 3L7OA 1C0UA 1UTAA 3MM7A 2M2BA 3NS5A 4OZ1A 4UOCA 4DN9A 4QIGA 1NU4A 1O0PA 2MLZA 2ZOFA 4HDHA 4Q7AA 4IRKA 1NZ8A 1HNWF 1HIYA 2ZWOA 4I56A 5E3CA 3FUYA 1PKUA 4OYZA 2ALYB 3NEKA 2EWHA 2D69A 1I51B 2V67A 4R0JA 1N8RT 4PUOA 7FD1A 4OYMA 2B9WA 3CF5Q 5KFVA 4O44A 1WD6A 2KFYA 2AJ2A 2VASA 1DY3A 5DETA 1KEKA 1KRPA 4TU9A 2X1BA 2PC6A 1UWAA 3KMQA 5F0UA 4X4SA 1L3UA 4PWDB 4NRTA 4YR3A 1BGXT 2RNEA 2Z2YB 4C3KA 2CUYA 1DTTA 2BZ2A 3ADAC 4PZVA 3UR3C 4LRCA 2ZM6F 3MPWA 2G13A 1YBUA 4ED3A 5LSLA 2JLEA 2C2ZB 1HYSA 5AE3A 3GSDA 4DZDA 3GV8B 4I2QB 5I3UB 1FK9B 1T02A 4M5DA 2JJ4D 5LSRA 2HMIB 4WYLA 5IT4A 4AL5A 2GJ2A 2GVZB 4WK1A 3R5DA 4P75A 4DJBA 5AE1A 5CCMA 1Q7LB 2Q66A 1E6VA 4KPYA 3C16B 3AXMA 4LRAA 2GJFA 3PXGa 2W7OA 4Q44A 5IM0B 3HP6A 2UUBJ 2DXFA 3BV8A 4LFAF 1TP7A 2YNGB 4NXMJ 4DPOA 1I3OB 1FO1A 2HURA 4DUTA 2W4PA 1VQMS 1JXEA 5RUBA 4DFPA 1RDRA 2E1RA 1O8BA 2VFTA 4OYIA 3CD7A 3A8EA 2GAHC 2YQ3A 3QNWB 4GKJF 1GH8A 1TK8A 2QYGA 4K4TA 1F9FA 3ILOA 1YRUA 1NXIA 1MWZA 2WZ1A 2DRDA 3TP2A 4URGA 2PO4A 1X9MA 3QJJA 2DEIA 1SXLA 3R7SB 4XPCA 3T6JA 1W26A 2F40A 3VCDA 2VPZB 4CO4A 2IFXA 1L3TA 2YNHB 1HYSB 1DARA 3MEDB 4QBUA 3H5YA 1XR5A 4QR0A 3VGVA 4WKYA 2HMIA 3FK4A 1NM2A 4NMLA 4AD6A 2ZNYA 5KFFA 4EEYA 2FJVA 3BSCA 1QUPA 3SDEB 1NK9A 1DURA 1HQUB 1U7LA 1RLDA 1OSDA 2XMVA 4LUBA 4CNZA 4CDIA 2DR5A 2RH3A 1F3VA 2YWHA 1HQ2A 5A8KB 3PR5B 4OHXA 1TU0B 3JQJA 3M6WA 5A6PA 3Q23A 5KG5A 3AD9C 2R9LA 5HVGA 2ZH2A 2DNOA 3ZZTA 3MURP 3M8PA 5L1LA 2BQ3A 2CNOB 3N9UC 4OJ1A 2FVSA 3D0IE 3PYGA 1YLXA 2BJDA 3ZTRA 1JJ2R 2I8EA 2MKIA 2ZH4A 2VC1A 2W2PP 4JI3F 4I7FB 4X4NA 1Y5LB 1RT7A 1YK9A 2FD2A 3OFGA 2UXBF 4CI0B 4K4XA 3E8OA 3NGDA 3CCTA 4C8LA 2Z30B 2OP5A 3MPUB 1KQKA 2RJZA 2GO9A 3V5RA 5KFWA 1VQ4S 2MB0B 1WACA 3FCHA 3ZTPA 1B4SA 1WHVA 4PQAA 3AA9A 3O3LA 3HVTA 3S6EA 1NCLA 3VGUA 3FSXA 2HVZA 3GFXA 3Q8VA 4KH0B 2NPFA 1IM4A 2BUNA 5KTQA 1QLNA 2OFHX 2EBEA 2JC0A 2Q1LA 1LKZA 2A18A 3HKZD 1VGYA 3M1VB 3R7NB 5DM6Q 3DLJA 3HVAA 1T7PA 5KFTA 7FDRA 1R89A 3RAMA 1WF0A 2KJVA 1CS4B 1Y0HA 2MEWA 3MTJA 3N6NA 4Y65A 5KFJA 2HHHF 4ANDA 1HWUA 2BE2B 5IZHA 3OPKA 1FX4A 3D6TB 2YX1A 5ETTA 2VFSA 2AJQA 2DH7A 3QMQA 1P1TA 3L95X 3JTNA 1SH3A 3M8QA 3P4UB 4QIVA 3TJ9A 5HN0A 4KSEB 1VC6A 1H38A 1WUUA 2HFUA 4UQGA 3GFYA 2E7WA 4PG4A 4LFCJ 4MAKA 1SJRA 3MMJA 4JI1F 5M2RA 3QGHA 2GVDA 2HPUA 3CCWA 3ETOA 4LF1A 4NA1A 2G0CA 1NJYA 5FLXY 2HKEA 1HNIA 2G9OA 2XMWA 5K5MA 2W7PA 3FBEA 3S7RA 2RVJA 1T94A 1HNIB 4M8LA 1NJXA 3P3DA 3IMQJ 1HWKA 4GC7A 4USIA 4L3NA 2DGXA 5DRKA 5HMXA 1KVKA 2DIVA 2FZKB 2ZNZA 1HA1A 3EWGA 2CPXA 1MN7A 4OJHA 5G0RB 5B0AA 1Q82T 2B5JA 4P2XA 1C2PA 3BR8A 2POKA 3DOKA 4IUFA 1HMVB 2K8GA 4PXDA 2IC3B 4URQU 1LXJA 3CCES 1FRJA 1GFWB 4A8YA 3P96A 5HROB 4AQYF 2CQ1A 1SBRA 2Z58B 5C2CA 2H3EB 4MK7A 4N8NA 2LQ5A 1HNVA 4YN3B 2BQUA 1TKDA 2B0GA 3O2IA 1C0TA 2MKHA 2MQOA 2GA7A 3MEEA 2V4JA 5BR8J 1UEVA 1P8GA 4RWXA 1X60A 5T7LB 2FHJA 2VONA 4F3QA 3AH6A 1XNQF 5HAOA 2PA8D 3HCXA 1TMJA 3P45B 3CJSA 4KY3A 5AXLA 1CJKA 4WTOB 1GMWA 4MYTA 4USUA 2XWYA 4LVNP 1FEEA 2FLNA 5BYSA 1EKRA 3IAM9 1WEZA 1UA0A 1S1VA 2HHSA 4GKJJ 4KGZB 3EUNA 1IR1A 2BJ1A 4OJGA 3ZNUA 5EWGA 1ZM4A 4NLQA 2H9ZA 3QWPA 2R7WA 2JEJA 1FNMA 1D1UA 2QA2A 1KD1T 1FNOA 1R31A 2CQ0A 4JOUA 5IV4A 5GAHI 3ZO7A 3PACA 5D15A 3E3XA 3HSDA 5KG7A 1PGZA 1RWMB 3W65A 3T19A 2DK2A 3CCQS 3J7YI 3P8BB 5F8IA 4NLUA 2V9KA 3GP9A 3WC0A 2Y1IA 2N4DA 1FEHA 1H2UX 1HARA 1HW8A 5HK4A 2L48A 3BEGB 3UI3A 3M9OB 2HLUA 1REVB 3BJYA 4OL8A 1WF2A 2AT1B 2NXCA 4HL9A 4MIBA 5B0CA 5GAGU 5A8RB 2APOA 3GR0A 2WTFA 2EXUA 2RB7A 2ZM6J 3HVRA 4QR1A 2Y8WA 3N0VA 1PJ6A 3TVKA 3PIOQ 4KBIA 2ZDOA 4Y2IA 4O3SA 1K9MT 4NXNJ 1C1CA 1WC4A 3TVZA 1SC4B 1KQFB 2E9ZA 1JLGA 1SKSA 3OFFA 3IS9B 1D9DA 1GXLA 3DGPA 4ZVRB 5M2UA 4NA3A 3DDNA 4YQWA 3PY8A 2W01A 3J7Z5 4MFBA 3CCRS 1FRXA 1HPZA 1PYTA 5J1NA 2GVDB 2MKSA 2P5VA 3UNYA 3GTYX 4IR9A 1FI4A 3OXFA 2IA0A 4Q43A 3M6VA 2K7KA 1BUXA 4ER8A 1P9QC 4LSNA 2BEFA 4QW8A 1N36J 3I0SA 5KAKA 2BDPA 2R7TA 3HFVA 4FS2A 3D66A 1CEZA 1OIAA 4CT8A 1LWCA 2B8QA 2EFNA 4I1TA 3HMJG 2CQPA 4R8UA 4A8QA 1S6QA 2YKAA 4CLPA 3MHYA 3QPIA 2Q79A 3RBDA 1SL0A 1NHKL 1UPMB 5KFEA 4EO8A 2O5DA 2YNHA 3VR1A 1GEHA 4IQXA 3PX6A 2DB1A 2U1AA 5KG3A 1WF1A 2ZH9A 3L09A 3ILLA 4AT1B 1M0SA 2ILZA 1VBYA 1R8HA 2CQ3A 2GX8A 3I96A 3NY0A 2ASYA 4NYPA 4Q2MA 2ZWPA 1XMBA 5F3TA 2B43A 2FQQB 2DY1A 4ZKAA 5A0YB 3QZ7A 3TARA 3VVUA 4DSJA 1P6TA 2NYHA 2F5GA 2VFVA 5SZTA 2WBMA 2MZQA 2K06A 1G1XA 1T9WA 4WFNQ 1F5CA 1WORA 4I7FA 3BF4A 3MAAA 4XIUA 1YBAA 3D0HE 4ZCLA 4ZPCA 3WIUA 3QFWA 4BCAA 2QMWA 2VG7B 5J2QB 1T05B 4B3OA 3CD6S 2EPIA 3U27A 3TJ8A 2MSSA 2W9CB 4LBPA 4OV6A 5J1PA 1TUWA 5KT4A 1GMVA 1VK3A 3OVBA 2B4PA 3KTQA 1S1UA 2DEJA 3KDOA 1LW2B 2IM3A 3PRDA 1NO8A 3FCWA 4PPZA 3OVSA 1TTHB 1HWJA 2DNYA 4A48A 3PHTA 4I69A 5KT2A 4PG5A 5E0OA 1KC8T 4WF9Q 1RT2B 5DQHA 4IFYA 2VFUA 3NWRA 3V6DA 1UJ5A 2V8DA 3MZIA 5K8PA 4DMZA 2HHHJ 4F8RA 4DBQA 1FDNA 3CVKA 4CT9A 2EFPA 4NEZA 2JEFA 2PI5A 4LIWA 2J9DA 1LWXA 5FDLA 5T14A 2AGOA 3RW6A 2BE9B 5GAEI 5JUMA 3MECA 4TXSA 3K5OA 1H98A 2ZD1A 5DQIA 3PKYA 2VIHA 4DR1F 1KDNA 3FGVA 2MHEA 3M8QB 1U1PA 2ZH5A 1ZOTA 1JJCB 1XK8A 5A76A 1HBMA 3A8JA 5IQQA 2J6UA 3PJWA 3ISND 2QYCA 1M5PC 5GAEU 1X7VA 1R8AA 1IR0A 2RU3A 3CMAS 5F8GA 4EYHB 3ENVA 4ETZA 4V19X 1QE1A 1EP4A 2O01C 1VQOS 5EN1A 4OFZA 5I3QA 4ELVA 2LU2A 2HBYB 3HJFA 2B4OA 2A1BA 4USKA 3GCWP 4DV0J 1RA6A 1OPZA 2KVQE 4X4RA 2EKNA 3UD4P 4M95A 4FP9A 1KFDA 3NAHA 3ZZ0A 3RB6A 3PX0A 2BVZA 2MY7A 3HZEA 3KUHA 2LEAA 3DMJB 4ECQA 3B8HA 4O3NA 3TNVA 4ED7A 1SL2A 3DLLQ 3LP0A 3OL7A 1Y3JA 1KVIA 3AOBA 1UVKA 4K2XA 1NH7A 2EG2A 2CQHA 2LFVA 4FYWB 3PW5A 4URSA 5IC6B 1VQ5S 2FB0A 2KM8C 1HFEL 1N48A 2GV1A 4BLGA 4UY8T 4M63A 2HVDA 4K4WA 4DSLA 4NCAA 3X3UA 2H1YA 4DCJB 2ZUGA 1WC0A 3O8WA 4MYUA 4W4MA 3UCZP 1R0AB 3PEHA 1X4DA 2GC8A 3C19A 4ZP7A 3VGTA 4ZLNA 2XY6A 1M90T 2BRLA 3B54A 3KK2B 4B3TJ 2CQ4A 2UUBF 2E5LF 1KTVA 1NPRA 1Y10A 1ZPVA 2I5JB 3A8IA 4FYVB 2QL5B 5KG1A 3PYFA 2FPHX 1R27B 2V4QA 3AQOA 4M1KA 3E2EA 4KE5A 4JYAJ 2MTLA 1H6KX 3UDCA 1QSYA 1YQHA 3CCSS 2KU7A 1CQMA 3FKBA 1SJ3P 2W7AA 3HT0A 1U1NA 4DPTA 4K4SA 4NLYA 2V63A 4DL0C 3ISNC 3OSPA 3CDAA 2VL1A 2ZOMA 3M2UA 1S7HA 3KLHB 3NXZA 1T11A 5AJ3F 2DGQA 4NLOA 4Y28C 1TL3A 4WE1A 3VZHA 3BPSP 4UOGA 4U96A 4ZPTR 5D4LA 2B4VA 3MMBA 5KFDA 3CJRA 3MEKA 1KLMA 2OPQA 4U6PA 3MUVP 3PX4A 5D3GB 4DR6J 4CLKA 5DDQC 2QZ8A 1W2BR 2HW3A 3L9ZA 1I94J 3Q86A 4G1QA 1NUEA 4K8RA 2PFFB 1SJ1A 2XMJA 4H4OB 2E7VA 1H73A 2AJ1A 4LF8J 5CH7B 1RWPB 1FT8A 1S1TB 1VIOA 2ABYA 3DDIA 3M2RA 4LSZB 5LL6d 1EIYB 4DR3J 3J81U 1U8WA 4PXEA 4YS2A 2WW8A 4DF8A 1ZAVA 1RE1B 4J7CA 1RHKB 4YB6A 4B08A 4ZIVA 1RLCL 4ZJQA 1TKTB 2DHHA 3W2WA 2ZC4A 3CIMA 5ETLA 4EBEA 1HNWJ 4PQUB 1HI8A 2F9DA 5DO2A 1NK6A 2QLXA 3I5BA 1RT3A 4DR1J 2VPXB 2E5IA 3JAMU 3PFOA 3Q24A 4LRFA 1LW2A 1N34F 2WBRA 3PTWA 2MZRA 2AEMA 4ES2A 5GAGI 4RPFA 4F3OA 1U0HA 2VG5A 2PEHA 2W2MP 3FVYA 4KGMA 3LOUA 4PWWA 5ETQA 3EGNA 4KGVB 4JI0F 4ANCA 2ZUAA 1VJWA 4EU0A 4C6AA 3V6JA 2AGPA 3FSYA 2CADA 1ZA1B 2X7IA 4EGLA 2QL9B 2WAQD 3HZGA 1RACB 4RO0A 1S97A 4RWWA 2OKQA 1RWOB 4XAKA 4DV1J 4P71A 3PW2A 1FDDA 1KBRA 5KFAA 3K2YA 1C1CB 4F25A 3KLGB 1N5YA 5HSPA 2DNNA 1MU2B 3GU0A 3W61A 4RW4A 4OLOA 3DM2B 1VC5A 5HJYA 2DNGA 5KFSA 3KNAA 2QA4G 5IOLA 3ENWA 4ZP6A 2SXLA 3UWTA 5CCLA 5KFHA 1U6FA 2CPFA 2GMJA 2RIJA 1CJTB 1A6LA 1JNRB 2QX0A 3KK2A 3QIPA 4CYUA 5T41A 4B9LA 1YJVA 4N77A 3CJKA 1VR6A 1D0EA 4KPCA 3QAUA 3CO9A 3N79A 2GGPA 4ZLPA 3RB3A 2AGQA 3J81j 3CJTA 2XI2A 1JLFA 3W7BA 1DRZA 2R8JA 2EK6A 1JLCB 2JNJA 3LALA 3LWMA 4DR3F 1LWCB 1RU2A 1JLFB 1UETA 2H5EA 3TO8A 3ZZRA 2HHUA 1U2CA 1WTFA 2DR9A 4HHUA 3TANA 5CQGA 5E41A 2WVBA 4B9VA 2OHDA 2Z4PA 3RZAA 3CJQA 3FBBA 4X66F 3IG1B 2YKOA 2G2ZA 5L46A 3OHBA 4YB5A 3CNQP 3V81B 1RT4B 4FKXA 4WP8A 5JMNA 3RBEA 2FIUA 3FMBA 3R5JB 4L74A 1SUQA 3G87A 3UE2A 4DV2J 1TUGB 2CPZA 1SV5B 2K1RA 2CQCA 4AYBD 4C8YA 3MM8A 4J9RA 1RT6A 1R8BA 4CM0A 2NZ4A 2EG1A 2NXJA 2YNIA 4M5IA 2O1PA 2OD6A 2Z2ZA 3NS6A 1R7IA 3JSYA 2R8HA 3A3OB 3MF5A 3QZ8A 2LQ8A 2UUCF 1NHVA 4RX6A 5J1EB 4LF8F 8AT1B 2J9DE 3CB4A 4LF2A 1YKWA 3BPDA 3MAAB 4P72A 3W9JA 2V4JB 1GXUA 3DLGA 1RZMA 4ZPDA 5LXYA 4O3QA 1FFWB 1YHQS 1J5EJ 2V34A 4CO1A 5E3RA 4R25A 1FVSA 4NXNF 2ZH6A 1XNQJ 1VISA 7AT1B 2YTCA 3S01A 1KKHA 3M8ZA 2O67A 2Y1LB 1PO6A 2LA6A 1QVFR 3Q8SB 1SQFA 3CIZA 4QYZJ 1HBOB 4DR2J 2L9DA 2LDYA 1TZ0A 3T5KA 1RHRB 3HJVA 1KOHA 4DR5F 1IM6A 3H5UA 3R3TA 4ZVSB 1VQNS 1S77D 1WHXA 3W64A 3H90A 2XNRA 4OZ2A 1NKEA 2CDQA 4NLWA 1EHWA 1JLEB 3QGPA 4WP3A 3L7PA 2A10A 2D3ZA 4LRBA 4RW4B 2OPRB 4O3PA 3GMGA 4AFFA 4D3HA 2PIIA 4DV0F 2ADBA 1S0NA 2UU9F 3HD1A 1Q7YT 3D1QA 5JVHQ 3DFEA 4H4MB 1JLBA 5HBMB 3K17A 4Q8EA 1UZHA 1WG4A 8ATCB 3ZTSA 4YR0A 2BJ8A 2WRMA 5H9EK 3KK1B 3WC2A 1AW0A 2B9YA 2D41A 3DN9A 2EVZA 2HQFA 3FQKA 3FBCA 3ZZOA 3RRGA 4JI1J 4V19J 1IN0A 2BE2A 3M6UA 2CJXB 2R7XA 4IG0A 4DV5J 2OSRA 3GJRB 4M5DB 3DU5A 3EVOA 4JI5J 2BV3A 3KLFB 4C4WA 1OY8A 3MM9A 1RABB 2Y0BB 3IS9A 2BX6A 3MM9B 3G9CA 5HQLA 3EGVA 3A8KA 4IRDA 3R6LB 4CQ1A 1IQZA 2QIFA 2Y1JA 1YJWS 2OUGA 1V3RA 2OLWA 3BH7B 3US5A 5J2PA 1X5OA 3QSIA 3D68A 3V4IB 2FVRA 2UVWA 3DM2A 2CNKB 1VRTB 3T5LA 3BSOA 3IG1A 4NE9C 4AE5A 4ELTA 2XLKA 2ZBCA 4EYIB 4F4WA 4B9MA 3BGUA 2J0XA 2FGCA 3RYLA 3FBFA 4DSFA 2OH2A 3QRQA 3CJ3A 1XBWA 2FHKA 2P8IA 1YTYA 4OX7A 2B7BB 4I6AA 1NK4A 3BGOP 3I5CA 2X1AA 3GPAA 1IR2A 4DU8A 3AOCA 5E33A 2N3LA 4WFYA 3UDVA 3GILA 4R5PB 4K4UA 2HHQA 1RI7A 5HLFA 2MKJA 2V2ZA 1S5ZA 1WC3A 2AJ4A 4QPXA 3SXLA 2Z2MA 3DYAA 5IC4B 3LAMA 5CA5A 2HQGA 2M0GB 3GIMA 1PC4A 3C14A 3LQVA 5F9LA 2AQ4A 1QD1A 2XHCA 4KTQA 1FD2A 3MPVA 1F9EB 2KZMA 4ED1A 4P6QA 4DQSA 3PG9A 3K59A 1U1OA 2P9GA 5ETOA 1FTCA 2FZGB 4C0BA 3KJVB 4DV7J 1Q81T 3RJMB 1S0VA 1M5OC 2CJ9A 4FVMA 2HNDB 5A2QU 2AD9A 1JWWA 1LWFA 1PIEA 3F41A 3L3CA 1Z1ZA 2WONB 4USTA 4G1QB 2DPIA 2HNDA 2L9WA 3LH2S 4IO1A 1S10A 2BJ9A 2IY5B 1URRA 4PG7A 4LBIA 5D0RA 1IKYA 4CLWA 4DPUA 2CJKA 3RBXA 2IA6A 4QYZK 1B3TA 1RHQB 1VLYA 3HFZB 1RAFB 2ZBPA 2ILYA 3CCZA 4CH0S 3LGMA 1QDUB 2FUG9 2ZHBA 4U8VA 1AFIA 5C2GA 2VQFF 2A6MA 3U02A 4DI6A 1A0OB 4AQYJ 2G2YA 3RR8A 3M1VA 1ITPA 1RBAA 3OXGA 3MMCA 6FDRA 3GIJA 2GMHA 3PJXA 1EX8A 2PD1A 4IOBA 3V6DB 3DLHA 3DRPA 3K57A 3H25A 2V8VA 2OMOA 3MMCB 2JSXA 4MT1A 5H9FJ 3EXCX 1VQ6S 3ZZZA 5KT7A 4B3RJ 1RHJB 2JRSA 1N56A 3OLAA 2I5JA 2RAQA 4RKUC 2BW2A 3PYDA 5H9EJ 3NNCA 5CYQB 3N5BA 4MKVA 2C2RA 5J2MB 4ES1A 2UXCF 2CVEA 1MMLA 4I6YA 1X4AA 3DLGB 5LJ5Y 4X4TA 2IM2A 4U8YA 1WSVA 1WELA 5DS7A 1U1KA 3OXLA 1QY7A 2LA4A 5IFMA 1TFYA 3MMAB 5E3PA 2E9TA 2MJUA 1KN6A 3K58A 1RAHB 2D7SA 1C4CA 1BQMA 3LA0A 4EBDA 4WFAQ 1HW9A 4FXVA 1JNZB 2BW7A 3ZTOA 5J2PB 3PEJA 2XMTA 4F2RA 4C11B 2WVDA 5B08A 2HAIA 2VG6B 4F4XA 2CG8A 1EKSA 1K44A 2CZ4A 1SCJB 2E7XA 4KAIA 4CTAA 2YH0A 5IS2A 4CLYA 1VQPS 1S79A 3JB9k 2LQJA 1FFSB 5CYMA 1SV5A 4B9NA 4EZ9A 3TUZC 2J0QD 4WU3A 2OD4A 3POTA 2XC9A 4NX9A 3Q83A 1NJWA 1GX6A 4IG0B 3H4DA 1LWEB 1M5HA 3OUYB 1RTHA 3M32A 4F0MA 2MKYA 3TX0A 5HP1B 1E6YB 2HFOA 3SI8A 2WVFA 3QWUA 1K0TA 2FY1A 3DOLA 2CZVC 2DRAA 4NASA 3UDEA 2RRAA 1NSKL 2EC2A 1RT1A 1RTJB 4IH6A 2CPDA 3S8SA 5KT5A 2C2EA 3PCOB 4TNOA 3ZNJ1 4ZHRB 1FKOA 1SI9A 3FNNA 3QGGA 2ZH7A 5B7WA 2HHXA 1FKPB 1FJEB 3ELHA 1AROP 1X4FA 4P2SA 3QSYB 2CNNB 3W3SA 1UAWA 1T95A 2N4CA 5IT0A 2HEKA 2QMXA 2C28A 4FF2A 4O4GA 3GYGA 4QWAA 3JQMA 1U2RA 1LK5A 3DCAA 3C6TA 3NCPA 2ZHOA 4ZVTB 4Y2MA 3IA0A 4GRSA 2AYMA 2CJQA 2OEJA 3AOAA 4NLSA 1SKWA 4ICLB 1FRLA 1U2FA 3SZ2A 1U45A 1S1WB 2VD3A 3GR1A 4X62J 3C15A 3OHAA 4DV4J 3RBZA 4Q0BB 4J5OA 1T9YA 1IUJA 2RUSA 2RQKA 1FJGJ 1EARA 2CQ2A 2HQIA 1Q8IA 2JX2A 3OVAA 2FLLA 1OY9A 2CAJA 5BYRA 4DX8H 1V5IB 2ZVIA 3D6MB 1XC9A 1FXLA 3NP5A 1SH0A 1ZBTA 4USMA 1U4BA 3D3BJ 4Y00A 2KRRA 3KHRA 2RD5C 4QQBA 1OO0B 2BM0A 1S99A 4DL4A 2O3DA 3G96A 2WVCA 5L1JA 3QIDA 3HHNB 1FKPA 2UVVA 1RAAB 1P9YA 1WJ9A 5CHCB 1DJ0A 4LSLB 2XM3A 1Q53A 4NYOA 1PILA 4PXCA 2R7VA 4LF7F 4F67A 2MZ1A 3HKWA 4ANEA 2W24A 5KOXA 3QLHB 5KFCA 1JX4A 1FF2A 3OUYA 3JSMB 1XEZA 4ATNA 4DWIA 4ECSA 3HHLB 3A3PB 5GMKa 3SCKE 1RISA 1XMOJ 2XWXA 3OR1B 3J81Y 2HZCA 1TKTA 3ILJA 3O6QA 5HO4A 4CH1A 4RJVA 2GZOA 3BYRA 3TOQA 1FESA 4JI0J 1ZS6A 4YUDA 5I42A 2C2DA 2CXEA 5AE2A 2EFQA 4FXDA 2D9PA 2QTWA 3KLGA 5EUHA 5THWA 4IFVA 5KFZA 1HD0A 4C11A 1RAJA 2RMLA 4RL1A 3I4HX 3MPYA 4OZ0A 3W2VA 3Q8PB 1R0CB 1VHFA 3DRYA 2W9BA 3D7SB 3NL0A 2R8IA 3CUNA 1RT4A 2C3UA 4A4JA 3MOJB 1SPBP 3KNGA 5B0BA 5D3GA 4PCQA 1RTZA 1W2IA 2Z2LA 4GVLA 2GS8A 5DM7Q 5HQMA 4ZVPB 3MR3A 4LFBJ 4OYPA 2J7KA 4DUZF 3RTVA 3GWCA 2IC3A 4BHQA 5DGAA 2MGZA 5L9NA 4LF5J 2MJNA 4CRJA 3KJNB 4TY8A 1LK7A 2WB1D 3DOLB 3M7VA 1JLCA 2HK2A 4DN0A 4RUCA 4QIFA 3BZQA 5EGYA 3LANA 4N7TA 2NREA 2AW0A 2HSEB 1LFPA 3AA8A 1YZ7A 2WSCC 2YKMA 3TVYA 1XNRF 3NBPA 4NOHA 3CDUA 2YWWA 4DPYA 2E5JA 2B56A 4X4UA 3CD5A 1M5VC 5IT9Y 3F0NA 4IFVB 2ACMA 3IO1A 2R2UA 3GG1A 4OHYA 1LV5A 2NSCA 2E1MC 5ITHA 2IM0A 1B7FA 1S1VB 1SKUB 2M4MA 5KFUA 1NH8A 1KQSR 1JB0C 3AAWB 1DZ5A 1YRXA 1S1WA 1P27B 1XTZA 3PO4A 1XR7A 2GIRA 3EDRB 3LPYA 5KFBA 2DISA 4GO7X 5EWEA 1NK0A 2GIFA 2KRBA 1UVNA 4OZJA 4XPEA 4RR5A 1M1HA 2QL7B 5C25A 3M2VA 3SCLE 2WONA 1YITS 2IDLA 4QWCA 1H3DA 3OLBA 1U6ZA 3IFEA 2XNQA 2IMOA 3CXCR 4DV5F 3MPDA 1F5AA 1QJHA 1CLFA 3FJ2A 1MLAA 1UCNA 1VDHA 1EQMA 2RQMA 3LP0B 1VRTA 5KFRA 1K8AT 2HQDA 2MQ8A 1KONA 1I1GA 1N54B 4NLXA 1FERA 3DLKA 2ROEA 3ZZYA 2V2QA 2W2OP 3FMWA 1Y9OA 2ZE2B 4JI2F 4A8OA 2DBBA 3IRXB 4NLDA 3PVXA 4OI0A 1WG1A 2DHAA 1APSA 2KT3A 3UD5A 2BJ3A 2N3OA 1NJZA 3QIPB 3M30B 3NG8A 4ZLLA 1XN9A 3PRBA 2LVWA 2YXLA 3NNHA 2F4FA 4IOCQ 4DV3J 5C42B 4LR8A 4Y0FA 4JP8A 1RT7B 2DNRA 1VQ7S 1JKHB 2VZ9A 2LKZA 2RHSB 2A3JA 3CT9A 3NGRA 3OQ2A 4DR7J 2UUTA 1YIJS 1V3ZA 2VU5A 2ZDPA 2DNHA 1UJ6A 5KFYA 4NL5A 2YWKA 1VQSA 3MD3A 2XLJA 1YRTA 3MMAA 3M2UB 4H4MA 3J7AN 1IKXA 3CULA 4FN5A 4NI2A 3K5MA 5F9NA 1RBOB 3Q8QB 1UEKA 3WDOA 3N5FA 3NCQA 3MCSA 1FDBA 1K0VA 4NA2A 4CWBA 1C1BB 4C8MA 5HVHA 2EEYA 3DOKB 3KYLA 1O6XA 3R5GA 1I6JA 5BYQA 2LMIA 1CULA 4HLBA 4PKDB 4CNYA 5KFLA 4KC5A 5IWAF 1X4BA 4CLSA 4LBHA 2VBXA 1YGYA 1QAJA 2H54B 3ITHB 3TZZA 1SIZA 3UDLA 4NXMF 2HZAA 4YB1P 1MWYA 5D0GA 1H2VZ 2RKIA 1WEXA 3E01B 3OR1A 2P9CA 4ZP8A 4A47A 1NZAA 3G71S 2QRRA 1TL1B 4B9UA 1TL4A 4IRCA 3UCGA 5KFKA 2OAUA 5HQ8A 2XB2D 3KMSA 4O23A 2DO0A 3FDSA 3VGSA 1R0AA 1BQMB 3N6MA 4TYAA 5L39A 1S1XB 2Q6BA 4OI4A 2EFVA 1J5OA 4ILMA 1HL6A 2FLOA 5F8JA 1BXNA 1PAEX 4X66J 2VICA 3DRRA 4J9OA 4IO9Q 3H7HB 3IGNA 3CW2C 2ZH8A 1PYSB 3GQCA 3A13A 2VC0A 4HH1A 4QU6A 2HHWA 1EETB 4K7QA 4P52A 4LF9F 3DLEA 1FTRA 3ZC4A 1FRIA 2L9NA 2J0SD 1B64A 3GB0A 4FZVA 2EBGA 4Q2LA 1E6VB 3GLJA 4DG1B 1FE0A 2GHVC 2HLTA 3NLCA 4RW7A 2X3DA 3PW0A 4ZVHA 3RAXA 4Y2AA 3OW2R 1VQLS 5DG8A 2AYGA 1ZTWA 3CJ4A 4KO0B 4YR2A 1YJNS 1ZTTA 2F4VJ 3BO3A 2KH9A 4IOAQ 5D4NA 3ISZA 4U9RA 3VAKA 4LF7J 4ED2A 2H51B 4WPAA 2W25A 1BQNA 4X4OA 2XYPB 4QYRA 1KHVA 3TAMA 4YHHJ 3WIVA 3LP2A 3I0SB 4ED4A 1RWNB 2ZFHA 3V6KA 4N47A 1S1XA 3Q0AA 5DG7A 5E3QA 4O4GB 4XTTA 5FJ4A 4X84A 2LCWA 4WFZA 1VBXA 3BQ0A 4DUYJ 1HNXJ 3WHIA 3R1LA 5J1EA 4EO6A 2XEXA 2KI2A 3MCNA 4IH5A 1CQNA 2JEGA 2OEMA 3EGWB 2VKZG 1N32J 5BXIA 2M8HA 2C3OA 3TJAA 1W7WA 2HFSA 2JHEA 2M70A 5KFOA 2QG9B 4UTGA 5IM0A 3SCJE 2KB2A 4JV0A 4FS1A 4GKKF 3PM9A 4UZBA 1IBCB 5HJXA 5LT5A 3GFZA 3AQPA 4USWA 3RR7A 4A8XA 4F4YA 4QWBA 1SC6A 5I4MA 4PYAA 4AXIA 1YI2S 3D28A 4MK9A 1V3SA 2JC1A 4UQTA 4W90B 4Q5VA 1WNEA 1ICEB 4X64F 4CM2A 1CSJA 4W92B 2GQ2A 2QT7A 4G1IA 2FHMA 2N7CA 1S0MA 1CVJA 3MXHP 2MZSA 3G4SS 1BWEA 4O3OA 4GMKA 4GO5X 3CGIA 3AY0A 3BSNA 2ZBIA 1SC1B 3S1TA 2I1RA 3OTBA 2XBPA 1UW4A 2LXIA 1H7XA 2E5GA 2ROGA 2U2FA 1BLUA 3G8TA 3CCJS 4LQ3A 2AJ0A 3KFWX 3PDNA 4NZ7A 3OJUA 4X4QA 5LMUF 3KKFA 1F0XA 4W98A 5KT3A 4WKRA 3T9ZA 2ZD1B 2WW4A 4FF4A 1Q1KA 1RP5A 1I94F 1MSWD 1URNA 2FVCA 2LP4A 5KT6A 5G4DA 3TI0A 1X4HA 2HBZB 3DGPB 3HHEA 4JI4J 2GO8A 3H5XA 2XS7A 1F9HA 1TL1A 2XG8A 3HX9A 1Q4RA 4Y3CA 3TAMB 3VVTA 3IGVA 5A0YA 2UUAJ 4PQUA 3PIPQ 2PSZA 3LP1A 3RW7A 4JBCA 1Q95G 2RF2A 3OL8A 1S6OA 3UN3A 3THTA 1REGX 4HTIA 2JVOA 3EZUA 2P6TA 4CTAB 2WOMA 4E0DA 1OPIA 2V9WA 4A8WA 2HG4A 2IM1A 2VF3A 4EZ6A 1U02A 1RWUA 2DHSA 3JTPA 3KOAA 2MMYA 1JJHA 5D8HB 2N7YA 3VAMA 4DFKA 4LF4J 2A0FB 3MUMP 1SVDA 1UVMA 2RRBA 3CEDA 3PO5A 2EFOA 3I82A 1GX5A 4OHZA 4QU7A 2XMMA 3H8YA 1T9TA 3MWBA 3KLIB 4B3TF 1IKXB 1VFJA 1KQGB 3TR5A 4PUOB 1FXRA 2CVIA 1BHNA 1D8ZA 1KHWA 4LJMA 2YWEA 3QGIA 4ED0A 1JLBB 1D3WA 5HBMA 1MMNA 3Q2SC 2AU0A 4I68A 4B3OB 5J2NA 4HHHA 1RAIB 3UFCX 2KTQA 1CJTA 3DGVA 4X4VA 2HFNA 3EGZA 4QPTA 1A7GE 3DRPB 3HHLC 1XNRJ 1OQ6A 2M9KA 2XYHB 3OV7A 3T5JA 2DH8A 2R7UA 3PFEA 3EVWA 2X51A 1LFWA 2FYXA 1ROFA 1NAQA 4ICLA 4Z37A 1TVRB 2LEPA 4X65F 2ZKTA 3OTOJ 3FC9A 3MFHA 4KHPJ 1ZAXA 2AWZA 2BABA 2P9EA 1Q8BA 3IR7B 1RWWB 4Z7YA 2COLA 4ZMMA 2LQ9A 1R8PA 3OL6A 5D6GA 2GW8A 2ZZNA 4TU8A 3EXYA 1T9XA 3VAHA 1PJ5A 3D6HB 1ZPWX 2ADCA 4JI6J 3ET6B 2YX4A 4OX6A 1X9SA 2J0WA 2QFIA 5B0FA 3TA0A 2XMUA 2XQCA 4DV7F 4ECZA 5DJBA 1B0VA 2DNQA 1CC8A 5I3PA 1GT8A 1YJRA 2NSBA 4JUZA 2UV8G 2HQCA 2RDIA 3R8YA 4TQSA 4C9DA 3B82A 1H7WA 1EJ7L 3I6PA 4O4RA 2GCFA 2MYFA 3D0GE 2B5JB 1O51A 1V6HA 4LSLA 5D4OA 4IQMA 4QJVA 4MK8A 2PFDA 3AODA 4J9UE 3HK2A 1X4EA 1BWVA 1R8CA 2HS0A 2OI2A 4NWBA 4OJ3A 1H72C 2LQBA 3ZFVA 5KG2A 3Q22A 1NDKA 3BS9A 2W1BA 4KHRA 5HL7Q 3D3CJ 3DXBA 1HQEB 2UXDJ 3VV2B 1MU2A 2B3TB 3T9NA 1S6PA 2AZ1A 3MAHA 1NK8A 1HNZJ 4LFBF 2QV6A 3SSRA 4JI6F 1IKVA 1ZA2B 1FHTA 3FZBA 4JV1A 3T1HJ 2NZCA 1NPPA 2RQ4A 5MLCV 2ATLA 1J2VA 1HBMB 2YKMB 3R1HA 3FFIA 4LIRA 4M5NA 2FJDB 5CXTA 2ZITA 3B4MA 3EVMA 3KG0A 3ZXWA 1ZYQA 3T1YJ 2LXFA 1YJ9S 3BB5A 4TQRA 2FJWA 2NPIA 4KHPF 2WVEA 3R7BB 1IBMJ 4OZ3A 1V9OA 3QLHA 3RGIA 4OX9J 2XO6A 3WX8A 1B99A 4L3KA 3EJMA 3KJVA 5CYQA 2IBOA 4L6V3 3GJQB
chains in the Genus database with same CATH topology
2NCKL 3ZTQA 1NSQA 1F6TA 4W98A 1S5ZA 3NGRA 3NGUA 2VU5A 3ZTPA 1B4SA 3FBBA 3BBBA 3VGUA 1NCLA 2HVDA 3VVTA 4DZ6A 3Q8VA 5CAAA 4ENOA 4FKXA 3B6BA 1LEOA 1HHQA 1BUXA 2BEFA 3VGTA 3B54A 1BE4A 1WKLA 4ANEA 1NDPA 3JS9A 4ANDA 2B8QA 2DXEA 3FCVA 3EICA 1MN9A 5CABA 1NHKL 5C7PA 3FKBA 3BBFA 2AZ3A 1HIYA 1ZS6A 1PKUA 3EMTA 4S0MA 1NDLA 3BH6B 4F36A 2DY9A 4UOHA 4DI6A 1BHNA 3VGSA 3FBEA 1VYAA 4UOGA 4O0NA 1WKKA 1PAEX 3VVUA 1XIQA 4F4AA 3Q86A 1F3FA 1MN7A 1NUEA 4EK2A 1S59A 3EVWA 1NB2A 4HR2A 2HVEA 3DDIA 3FC9A 3PRVA 1U8WA 1EHWA 1NDCA 4CP5A 1NSPA 4UOFA 2DXFA 1HLWA 3FCWA 3ZTOA 3ZTSA 2HURA 3ETMA 3NGTA 4DUTA 3PJ9A 2DYAA 1K44A 1NLKL 1NPKA 3FBCA 3L7UA 4ANCA 1XQIA 2ZUAA 4C6AA 3EVOA 1LWXA 3Q83A 3BBCA 1WKJA 1NDKA 5BXIA 2BX6A 1W7WA 1KDNA 3VGVA 1NSKL 2AZ1A 3MPDA 1UCNA 4WBFA 3NGSA 3BH7B 3G2XA 3Q89A 5IOLA 3Q8YA 3ELHA 2DXDA 1S57A 2B8PA 3EM1A 1JXVA 3R9LA 3GP9A 3EVMA 3DKDA 4FKYA 3FBFA 2CWKA 3EE3A 3ENAA 3ZTRA 4KPCA 3Q8UA 3WX8A 1B99A 3EJMA 3GPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCK L;  3ZTQ A;  1NSQ A;  1F6T A;  4W98 A;  1S5Z A;  3NGR A;  3NGU A;  2VU5 A;  3ZTP A;  1B4S A;  3FBB A;  3BBB A;  3VGU A;  1NCL A;  2HVD A;  3VVT A;  4DZ6 A;  3Q8V A;  5CAA A;  4ENO A;  4FKX A;  3B6B A;  1LEO A;  1HHQ A;  1BUX A;  2BEF A;  3VGT A;  3B54 A;  1BE4 A;  1WKL A;  4ANE A;  1NDP A;  3JS9 A;  4AND A;  2B8Q A;  2DXE A;  3FCV A;  3EIC A;  1MN9 A;  5CAB A;  1NHK L;  5C7P A;  3FKB A;  3BBF A;  2AZ3 A;  1HIY A;  1ZS6 A;  1PKU A;  3EMT A;  4S0M A;  1NDL A;  3BH6 B;  4F36 A;  2DY9 A;  4UOH A;  4DI6 A;  1BHN A;  3VGS A;  3FBE A;  1VYA A;  4UOG A;  4O0N A;  1WKK A;  1PAE X;  3VVU A;  1XIQ A;  4F4A A;  3Q86 A;  1F3F A;  1MN7 A;  1NUE A;  4EK2 A;  1S59 A;  3EVW A;  1NB2 A;  4HR2 A;  2HVE A;  3DDI A;  3FC9 A;  3PRV A;  1U8W A;  1EHW A;  1NDC A;  4CP5 A;  1NSP A;  4UOF A;  2DXF A;  1HLW A;  3FCW A;  3ZTO A;  3ZTS A;  2HUR A;  3ETM A;  3NGT A;  4DUT A;  3PJ9 A;  2DYA A;  1K44 A;  1NLK L;  1NPK A;  3FBC A;  3L7U A;  4ANC A;  1XQI A;  2ZUA A;  4C6A A;  3EVO A;  1LWX A;  3Q83 A;  3BBC A;  1WKJ A;  1NDK A;  5BXI A;  2BX6 A;  1W7W A;  1KDN A;  3VGV A;  1NSK L;  2AZ1 A;  3MPD A;  1UCN A;  4WBF A;  3NGS A;  3BH7 B;  3G2X A;  3Q89 A;  5IOL A;  3Q8Y A;  3ELH A;  2DXD A;  1S57 A;  2B8P A;  3EM1 A;  1JXV A;  3R9L A;  3GP9 A;  3EVM A;  3DKD A;  4FKY A;  3FBF A;  2CWK A;  3EE3 A;  3ENA A;  3ZTR A;  4KPC A;  3Q8U A;  3WX8 A;  1B99 A;  3EJM A;  3GPA A; 
#chains in the Genus database with same CATH topology
 4ZVG A;  2V4R A;  3K8V A;  4KKO A;  4KRW A;  4TVA B;  1QVG R;  3SQG A;  3U1L A;  1KP6 A;  2G4B A;  3ZTQ A;  4C97 A;  1F6T A;  3I0R A;  4H4K C;  4J37 A;  4J91 A;  4ZVQ B;  3ITH A;  3CCV S;  1D8Y A;  3PNI A;  1Z4U A;  2DNK A;  4G1P A;  4PAB A;  1VLO A;  2Z8Q A;  3ONQ A;  3I31 A;  1PJ7 A;  3IM8 A;  3BR9 A;  3UO0 A;  3W5Y A;  4B9T A;  3TAP A;  4ECW A;  1RBL A;  1WI8 A;  4K4Z A;  4LF4 F;  2VPW B;  4PWD A;  1KVJ A;  3HVT B;  2K1R B;  4DPX A;  1V5V A;  5D4P A;  1RTI A;  1VQY A;  1PSD A;  2B9X A;  2BM1 A;  1WKL A;  2DCU B;  1Y7P A;  3K0J A;  3JS9 A;  4B3S J;  1CG2 A;  1S9G A;  4F3M A;  1F1B B;  3N28 A;  5CYJ A;  1LOU A;  2JEI A;  3DRS A;  4OYO A;  3C16 A;  2W2N P;  4RBT A;  3TWZ A;  4ZIT A;  2X1G A;  3G86 A;  4M5H A;  4ZVF A;  2OGU A;  2V5H G;  4DL3 A;  2DPJ A;  3RAQ A;  1EB0 A;  1UZD A;  2QLB B;  4MIA A;  4ELU A;  3QRR A;  5DLF A;  3SSQ A;  4PR6 A;  1NB7 A;  1S49 A;  2HBQ B;  1UFK A;  4LR9 A;  4KFB B;  4LR7 A;  2DRB A;  1EP4 B;  3DRX A;  3MM6 B;  1N52 B;  1TV6 A;  2CQI A;  1PBA A;  5F0W A;  5KOW A;  2HWH A;  4D3G A;  4XK8 C;  4J9S A;  2C2K B;  2AKW B;  3I9Z A;  3LF0 A;  1FRK A;  3N01 A;  4LFA J;  4EUV A;  1YVF A;  4YFU A;  4A8M P;  1B0T A;  1UFL A;  3TAQ A;  2KVI A;  4DX7 A;  2M5Y A;  4FYX B;  5LJ3 Y;  3LGH A;  1RUS A;  2NXU A;  1OYD A;  2OFG X;  3KHG A;  4Q8F A;  4ZPW R;  1K1S A;  2J7W A;  4IDK B;  4LT6 A;  4OI3 A;  4K0K F;  2RE1 A;  4NLT A;  3I9V 9;  3ULH A;  5K8N A;  1U47 A;  3JYT B;  1FWK A;  1C4A A;  1C0T B;  3UVJ B;  3JYT A;  3OTC A;  3CCU S;  1IBK F;  1JKH A;  2HRT A;  4YY3 F;  1TKZ A;  3H4B A;  4BDP A;  5A8K A;  3TUJ C;  4UOF A;  1MNE A;  2Q43 A;  1NND A;  4IKA A;  4ZJL A;  3CO0 P;  2OJ3 A;  3G6E S;  4Q45 A;  5SUH A;  2EI5 A;  2VBZ A;  4TYB A;  1F2H A;  1FKO B;  3VTI A;  2ZZT A;  3BM7 A;  2CDR B;  4ID5 A;  4RW6 A;  1VQ8 S;  2V8H A;  3PJ9 A;  3C14 B;  5ETN A;  2UVR A;  3KWM A;  4OHW A;  2JDJ A;  1RK8 A;  3PYE A;  4ZCI A;  3MAQ A;  4ETX A;  4DS5 A;  1S12 A;  4YEA A;  1FKA F;  3THV A;  1WWH A;  4DL6 A;  2KXN B;  1OSC A;  3TZX A;  3WX4 A;  3TZY A;  2DD8 S;  3BBC A;  1WKJ A;  3TEH B;  1M1K T;  2HVI A;  2XZD B;  4WZQ A;  2KDO A;  4LF6 J;  2R8K A;  3V2U C;  2VG7 A;  2PMW A;  5J2Q A;  4K0K J;  2CFX A;  2MQL A;  3SYZ A;  3AJD A;  1FRH A;  1XMQ J;  1M5S A;  2DTJ A;  2DNM A;  4HEA 9;  4ITS A;  4L75 A;  2R3V A;  3T1A A;  1A9N B;  3LPE A;  1RJJ A;  3OT9 A;  2VOO A;  2IVM A;  1VC0 A;  3C46 A;  1VRU A;  2IMW P;  5HMY A;  3NWG A;  3TA1 A;  3ZZP A;  4JI7 J;  1UEU A;  3R9L A;  3QJP A;  4X65 J;  2VG5 B;  3N4W A;  3OTO F;  4WTY A;  4DL2 A;  4HH0 A;  3EE3 A;  2KKH A;  1RTI B;  4RNF A;  4P10 A;  1RT2 A;  1YWX A;  2FDN A;  4C3L A;  1P1L A;  4CYU B;  2W9A A;  4IDK A;  4UW2 A;  3W60 A;  2JWN A;  2HFV A;  4C8K A;  2DGW A;  3RUB L;  2DVI A;  1X31 C;  1HQE A;  4JV5 J;  4ILR A;  3TQE A;  4FYD A;  2QJ3 A;  2H5I B;  5F41 A;  3HT3 A;  1T0T V;  3J7Z T;  4RW7 B;  5EX0 A;  1OYE A;  2CG4 A;  1MRO A;  3MM5 B;  2CIM A;  3DC2 A;  1HWI A;  1GQE A;  4KB7 A;  5GME A;  3P5B P;  2IIH A;  2EKY A;  1VBZ A;  2C3P A;  2DGS A;  1LEO A;  1VCT A;  3KG4 A;  2H65 B;  3R27 A;  2ZEJ A;  3HM9 A;  2BAC A;  1N34 J;  4LF6 F;  2HHT A;  4I64 A;  1N33 F;  3VHQ A;  2V94 A;  2W4D A;  5IWA J;  3W9I A;  4F04 B;  2GGP B;  2A2D A;  9ATC B;  1VJQ A;  2C42 A;  3OFE A;  5GVQ A;  3W8P A;  2J6S A;  1HWL A;  4Y2K A;  1VQK S;  4F26 A;  2XS2 A;  4I67 A;  1DFD A;  3ENQ A;  2LEB A;  1PYO B;  2K3K A;  4ZVE A;  2MPU A;  1EZZ B;  1ZM3 A;  2XI3 A;  3QT8 A;  2VB6 A;  4ECY A;  3TQ1 A;  3AJ2 A;  4HI2 A;  1IBL J;  2VA3 A;  1TVR A;  4JYA F;  4L72 B;  2QA1 A;  2Q3P A;  3LWL A;  1QAX A;  1TMM A;  2E44 A;  3C8Y A;  3ZZU A;  2P6S A;  3EMT A;  3HPO A;  4M94 A;  2GHP A;  2FLP A;  3RU0 A;  2IJF A;  3DLK B;  1YJ7 A;  4C7Q A;  4DLE A;  1HR0 J;  1PG5 B;  1UKU A;  3DYA B;  1IWG A;  5J2N B;  3O5T B;  3BO2 A;  2JL9 A;  3R6G B;  2RRN A;  5FII A;  4WII A;  2BAN A;  1ACM B;  1EAY C;  1DTT B;  2GML A;  1RGV A;  1WKK A;  4NCG B;  2QGF B;  5LM7 E;  3DNC A;  3T1H F;  2PN6 A;  2XZW A;  4DR4 J;  1S7I A;  2MDA A;  2L3M A;  4OHV A;  2YH1 A;  1SJQ A;  4DUZ J;  1IVZ A;  4EK2 A;  1U0H B;  4C3M A;  2CA9 A;  3DU6 A;  3CDW A;  5GAH U;  1WTB A;  2NUU G;  2IRY A;  2V8G A;  2M3D A;  2B7C B;  4QWD A;  4ECX A;  2ZKU A;  1WOO A;  3D1O A;  3CSK A;  2XZT B;  4NEY A;  4TKT A;  1U8S A;  3MFI A;  3A4T A;  4U7U D;  2J76 E;  3F56 A;  4WXO A;  3IBW A;  5JVG Q;  2F8M A;  1L3S A;  2EC0 A;  1WHY A;  2Y9H A;  3DHW C;  2R4F A;  1NSP A;  3HD2 A;  2D3O R;  2MXY A;  4FBT A;  2IVY A;  2YKN B;  3HSG A;  2DGO A;  4USH A;  2CPJ A;  1DTQ B;  3ETM A;  4RUA A;  4IFY B;  1OQ3 A;  4RW9 B;  3CPW R;  2B6A B;  3AB2 B;  4NPO A;  3GIK A;  4U7U K;  1X0F A;  3NMR A;  3TA2 A;  2YQ1 A;  3DHX A;  2VA2 A;  4F50 A;  4F4K A;  3EZ5 A;  1NME B;  2C3Y A;  5LMN F;  2D3O 1;  4A46 A;  4LRD A;  4X2B A;  3IWN C;  1AZS B;  1AYE A;  4QIW D;  5AXK A;  2BQR A;  4N41 A;  4Y34 A;  5KFG A;  2K2P A;  2IBK A;  1AXQ A;  3CJ8 A;  5ETK A;  2AX0 A;  3K5N A;  2WB4 A;  1QM9 A;  4OYW A;  3NAI A;  4K5S A;  2ZZM A;  1RTJ A;  2Z56 B;  1Q5V A;  1TKZ B;  4OIX A;  5J2M A;  4DR5 J;  3DRS B;  4K5R A;  4KH1 B;  4OYA A;  3J7A 1;  3QFH A;  4ECT A;  4G3I A;  3UQS A;  2L08 A;  4ZPB A;  1U6B A;  3G6V A;  3VQS A;  4IG3 A;  2DIU A;  2E1C A;  2C3M A;  4ZHR A;  1IKW B;  2YQ0 A;  4ED5 A;  3A1Y G;  2KO1 A;  1DTQ A;  3C66 A;  2X1F A;  3AJ1 A;  2HGL A;  2W9B B;  4RU2 A;  1CJU B;  4PYD A;  1RSC A;  4RUH A;  1S4E A;  1LNQ A;  2KJW A;  3H40 A;  3Q8U A;  3VAL A;  1G7C B;  1FFG B;  1NHU A;  1JLQ A;  3NOG A;  1D09 B;  1AUS L;  2NXE A;  3MM8 B;  1IWA A;  3R97 A;  3K8W A;  1K1Q A;  3T1Y F;  1JQG A;  5E2Q A;  3PW4 A;  2I2Y A;  3CJ2 A;  2Y3Y A;  3HUL A;  1QAI A;  1FA0 A;  3GSI A;  4ID8 A;  4ZDN A;  2DIT A;  4M5J A;  3CC7 S;  3KLI A;  3MTK A;  2PE8 A;  2YX7 A;  2IVF B;  2VV5 A;  2ZJP Q;  3H2L A;  5KG0 A;  2FTR A;  5C5J A;  2M7S A;  1TL5 A;  2UUW A;  3SV4 A;  1G2E A;  2IAJ A;  3BYP A;  1CJV A;  1NJI T;  4OQJ A;  5A6W A;  4GKK J;  3LP2 B;  4EWT A;  2HIY A;  2JZ5 A;  3THP A;  1VBK A;  3B6B A;  3TX8 A;  2IAJ B;  1NK5 A;  2UXD F;  2MZT A;  1HHQ A;  1VIX A;  4M5K A;  1SJ4 P;  1X4C A;  2YWG A;  1N32 F;  2R7S A;  2QE5 A;  4OI1 A;  4QWE A;  3JQK A;  2XTJ P;  1BE4 A;  1N5V A;  1BC6 A;  3CJK B;  4K4V A;  2OML A;  1YG0 A;  4MIW A;  1IJE B;  3K89 A;  4UUX A;  3HHL D;  1NRK A;  1N33 J;  3MEG B;  3MR6 A;  4C48 A;  2ASL A;  1IXK A;  1U0S A;  2HWT A;  4DQI A;  1JLG B;  2HHP A;  3QQC D;  1YX2 A;  2YNF B;  5EDW A;  5I42 B;  2J9E A;  1U1R A;  1S9F A;  1HD1 A;  3P5T L;  3G8S A;  3Q2T C;  2XY5 A;  3BGR B;  3KHH A;  2XSJ B;  4HTJ A;  1S0O A;  3BQ2 A;  4C0H A;  2DY9 A;  1YBT A;  1UWB A;  1Q79 A;  4UOH A;  2JLG A;  2CPY A;  3MMB B;  3C2P A;  4C8Z A;  1VRU B;  4H4K A;  5LOQ A;  1FJG F;  1VYA A;  4TN2 A;  3C6U B;  2NQP A;  3CDE A;  4DX6 A;  1NKC A;  4O0N A;  1BY9 A;  2HIQ A;  4WU2 A;  3OTE A;  2AV5 A;  1N6Q B;  5LXR A;  1JJ4 A;  4B3M F;  1XIQ A;  4F4A A;  1KLM B;  2OPQ B;  2DKO B;  2C22 A;  2E1A A;  4DQP A;  1HI1 A;  2DNL A;  2P2C B;  1N6Q A;  4O3R A;  1S76 D;  2V68 A;  1TK0 A;  5IXU A;  4BC9 A;  4U7C A;  2AYB A;  3IWL A;  2RSQ A;  3M05 A;  3J80 U;  1SJF A;  1AZS A;  2ZJQ Q;  1TKX B;  3PRV A;  1LW0 B;  4HVZ A;  2FJA B;  1X0P A;  1YSJ A;  2HNY A;  2PMH A;  2XSF A;  4C98 A;  3OFH A;  2OEL A;  1SC3 B;  2NR0 A;  4K4Y A;  4QCL A;  4J9M A;  5K9F A;  1HI0 P;  1N36 F;  4OZN A;  2CRL A;  1M1G A;  5A8W A;  1KS2 A;  3LP1 B;  4I6W A;  3PR4 A;  3EYZ A;  1IBK J;  3V4M A;  3M8W A;  2RS2 A;  4NZ0 A;  4KYZ A;  2AYE A;  3H2V E;  1OMS A;  3NGK A;  2C2O B;  2O66 A;  1Y00 A;  3QBC A;  2ERR A;  1FD8 A;  4DHV A;  4DOZ A;  1HR0 F;  4DCP B;  4NRU A;  3L7U A;  4BWJ A;  3QT5 A;  3FSI A;  1XQI A;  5ETV A;  5IQ6 A;  1QTM A;  1SB6 A;  3H42 A;  5C25 B;  3IP0 A;  2VQE J;  1UVL A;  4FF1 A;  2LLZ A;  1BQX A;  3DMJ A;  2DCL A;  4K59 A;  3TUI C;  4CLL A;  3G6Y A;  2ACY A;  1HKA A;  2JOQ A;  3CWJ A;  4OYX A;  4WK3 A;  4CO2 A;  2Y8Y A;  4Y2C A;  5HI7 A;  4ECU A;  2RDD A;  3KLH A;  5F8N A;  3EZO A;  1E6Y A;  1RCO B;  3H0P A;  3SFG A;  3CCL S;  4P74 A;  4A8F A;  2HNY B;  1X8D A;  3K7R A;  3NGS A;  2R7Q A;  1BQN B;  3W2V B;  4YY3 J;  2HRU A;  3BN7 A;  4ZIW A;  2ZHA A;  1F5B A;  3SDE A;  5H1S V;  2DGU A;  4U67 Q;  2RS8 A;  4E98 A;  4G6V B;  1SIW B;  3GZ7 A;  4NLG A;  3EX7 B;  3VWS A;  5CYM B;  4ID5 B;  3OD2 A;  4RW6 B;  2QN6 B;  1CJK B;  2AJF E;  4YOE A;  5E5N A;  4DCO B;  2WHO A;  5KFX A;  1UJ4 A;  2R42 A;  3TZW A;  1S1T A;  1WC5 A;  1FX2 A;  3HI9 A;  3IR5 B;  4QZV B;  4CIO A;  2XCP A;  3MR2 A;  4RNM A;  5D0E A;  4NLP A;  3VF0 B;  4X64 J;  1AFJ A;  1EET A;  5HAT A;  4ZCM A;  2R8G A;  4DR7 F;  3KUG A;  4DFM A;  3V6H A;  2XYG B;  4WCE Q;  2PI4 A;  1C0U B;  3BGR A;  3MM7 B;  3KK3 A;  2MHN A;  4DEZ A;  4J9Q A;  1RCX B;  1SH2 A;  3NRB A;  2GJI A;  5AXN A;  4WE1 B;  1ULR A;  1FWP A;  2HYI B;  1Q8K A;  3D54 A;  1U1M A;  3W5Z A;  2RUG A;  3G6X A;  2KYZ A;  1NKB A;  1UA1 A;  4ENO A;  1VMB A;  1RU1 A;  1FCA A;  2R7R A;  2AEF A;  2KYX A;  2VBY A;  3D4J A;  3IWX A;  5KFQ A;  4RBU A;  2OIH A;  4JI7 F;  3VAI A;  1ZET A;  1T3N A;  5IT9 U;  2JH3 A;  5DQG A;  2A2C A;  2LEC A;  4RW9 A;  1SL1 A;  1J27 A;  1OS5 A;  4J9N A;  2OEK A;  1N4L A;  1NDP A;  4R8U B;  4I2P A;  5L8R C;  4HYK A;  3N6L A;  1PC5 A;  3NKY A;  1M5K C;  1L3K A;  1RAD B;  1AA1 B;  4R5P A;  3M8S A;  2HS4 A;  1T03 A;  5C7P A;  3UVJ A;  4ZVU B;  2VHG A;  4DV3 F;  3MDF A;  1HNV B;  2HS3 A;  2QC3 A;  4ZS6 A;  3BBF A;  2AZ3 A;  3WZ0 A;  3D1H A;  4L76 A;  1DQ8 A;  4EMD A;  4DQR A;  2PA3 A;  1KWM A;  4S0M A;  3ICL A;  4RLE A;  1F2G A;  4HI1 A;  4ZPA A;  4Z7C A;  4DQQ A;  3FFI B;  4DLG A;  2BA9 A;  2DNP A;  4MFB B;  2XSJ A;  2G0J A;  1LQ9 A;  1D9F A;  1HPZ B;  2JLF A;  3AD8 C;  1FDA A;  4PAA A;  2XCA A;  3IN5 A;  2DT9 A;  4DV4 F;  4DL5 A;  1S48 A;  2WSF C;  2FY8 A;  3I5A A;  1RXO B;  3L4B C;  1TAQ A;  4X62 F;  1JIH A;  2ROP A;  4K2J A;  3M8R A;  5K14 A;  1U1L A;  1TV6 B;  2B6A A;  2V69 A;  3BGL A;  1JK9 B;  2YKP A;  3GJS B;  3MEG A;  1KTQ A;  4NLR A;  5F8M A;  3GV5 B;  3PW7 A;  2LDI A;  2FVQ A;  3P49 B;  3AB4 B;  1HBO A;  1QTN B;  4RW8 A;  5A8R A;  4F7V A;  3HO1 A;  2Y1R I;  4G65 A;  3I0R B;  3UR0 A;  1HHT P;  3T3F A;  1T05 A;  4JV2 A;  4P2M A;  1Q78 A;  1TQL A;  2MLX A;  3G8Q A;  4DSE A;  5K8O A;  4FVC A;  4TY8 B;  4F02 A;  5DGB A;  1LW0 A;  4YDX A;  3PKM A;  3B78 A;  1N5Q A;  3DOM B;  3HDS A;  4RUB A;  2NUH A;  4WFX A;  4ES3 A;  2J8A A;  1WI6 A;  1SQE A;  4OLP A;  1N5S A;  4CO0 A;  3C6U A;  2V0N A;  2IHR 1;  2Y0S D;  4KHM A;  4ED8 A;  4CO5 A;  1FVQ A;  4I0W A;  2G0I A;  1X5T A;  2DYA A;  3IAS 9;  3R5C A;  4DPW A;  2CPI A;  3D6F B;  4QW9 A;  1XER A;  1RTD B;  3BDP A;  1NPK A;  1ZZF A;  2BBE A;  2BAN B;  4FF3 A;  2HK3 A;  1DBD A;  1S9G B;  2IDE A;  3M8P B;  3HF5 A;  3NCR A;  3QAT A;  3R5B A;  3IRW P;  1WDD A;  3TW0 A;  2E1P A;  2F65 A;  1Y3K A;  2B9E A;  2ZBR A;  2N82 B;  3J80 Y;  2WOM B;  4DF4 A;  5D0H A;  3CDB A;  3GIR A;  1EQ0 A;  1RT5 A;  2F8E X;  3M8Y A;  3C15 B;  4LF5 F;  1R3N A;  1RT5 B;  2YPZ A;  2YNF A;  3UD3 P;  3QJL A;  5HMZ A;  4KV8 B;  1QUV A;  4FNH A;  4JI3 J;  1DLO B;  5HMW A;  2ZH3 A;  4IG3 B;  4XDC A;  3D67 A;  3U1N A;  4CH7 A;  3MD1 A;  2QLJ B;  1ZM9 A;  3G2X A;  4KFB A;  5K20 B;  1OWX A;  2XUL A;  2G1H A;  3D5M A;  3EM1 A;  3T6B A;  3UNG C;  1CJV B;  1RHM B;  1TL7 B;  3M4X A;  1RYR A;  4FKY A;  3HSJ A;  5M2P A;  1GNK A;  1HBU A;  4TU7 A;  4CO3 A;  4JV5 F;  4V1A k;  4JI8 J;  1WC1 A;  3W5X A;  1HBU B;  5K8M A;  1UFW A;  4AL7 A;  1HMV A;  2KL8 A;  1U26 A;  1RKI A;  2F8H A;  1VI7 A;  2FZC B;  2R7O A;  3HSZ A;  3OR2 B;  3J7Y U;  3KLV A;  3RRH A;  2EK1 A;  2I6W A;  1Q86 T;  2V50 A;  3TUP A;  1R43 A;  4UUW A;  2DJW A;  2QO3 A;  4LRE A;  5JXS A;  4ZN3 A;  3TYT A;  3H20 A;  2VQF J;  3DI6 A;  4P7T A;  1KNZ A;  5MAO A;  4HKQ A;  2VKR A;  3FEX B;  2GVZ A;  4HHJ A;  2CKW A;  1J5E F;  1S4F A;  3CTR A;  4DR4 F;  4JI8 F;  2Q6C A;  2IJN A;  1TR0 A;  1U49 A;  4BWM A;  4RBV A;  3FEY B;  1S9E A;  2M52 A;  1GXT A;  3SIP B;  4UY8 5;  5CAA A;  3AT1 B;  4MKY A;  4JB8 B;  4P9S A;  1PBU A;  1RAO A;  3R2C J;  3C6T B;  4DDF A;  1H2T Z;  4B17 A;  2UUC J;  2F7V A;  2QA4 S;  3RG6 A;  1T3O A;  2E29 A;  3JAM Y;  1K73 T;  3CE8 A;  4NCB A;  1IKW A;  1T9V A;  2AF6 A;  4OV1 A;  4B3S F;  3CJ5 A;  3GFH A;  4F0H A;  1HBN B;  4FBU A;  4DXL A;  4KKO B;  4RU9 A;  4M5M A;  3QT7 A;  3SQG B;  2BXJ A;  2DXE A;  1PCA A;  4KGK A;  1TK5 A;  1GTH A;  5B09 A;  1VS3 A;  4J9K A;  1MN9 A;  4FPR A;  4C8N A;  3BSA A;  3W9H A;  2HAF A;  3JSR A;  5DZ7 A;  3DOM A;  2HQ3 A;  5F8H A;  1R0B G;  1RTH B;  1U09 A;  3FRZ A;  1U24 A;  1YJT A;  3M32 B;  4TLR A;  4C2M A;  3R5A A;  4DFJ A;  1DHM A;  5HRO A;  2D1C A;  2G2O A;  2BKN A;  1NDL A;  1UWB B;  3AHP A;  2MQN A;  5U47 A;  5H9F K;  1YDL A;  3BKT A;  2W2Q P;  3GII A;  4YP3 A;  2GFF A;  2WSE C;  1N88 A;  2FC8 A;  5HVF A;  3A3N B;  3W2W B;  3T5H A;  4ECV A;  2CJA A;  3DDK A;  2KHC A;  2QSW A;  2ZBQ A;  4IH7 A;  1YZ6 A;  2D74 B;  5E3A A;  3SFU A;  1TAU A;  3KDN A;  1N0V C;  1W25 A;  1BMQ B;  2DGT A;  3MR7 A;  1I5O B;  1Q5Y A;  3AD7 C;  3FEZ A;  2QFJ A;  2J8S A;  1Q8L A;  4NLV A;  4RNN A;  5KFI A;  1SQG A;  1CBK A;  1GMW D;  3OL9 A;  3U1M A;  3DXS X;  1ELO A;  2VOD A;  5DLG A;  3LAK A;  1TKX A;  2HRY A;  1Y5I B;  4DSI A;  1NB2 A;  4CLZ A;  5HAN A;  3JSM A;  2HWI A;  1N0U A;  4DV6 F;  5F3Z A;  3PZP A;  2HFZ A;  2QLF B;  2YWF A;  2PMZ D;  2LU1 A;  3MI7 X;  4GVB B;  2J9C A;  1PAU B;  5DDR C;  2KFN A;  2KFZ A;  5L9X A;  4DX5 A;  1F60 B;  2WCX A;  1N5T A;  4MTP A;  1B7Y B;  2XHW A;  3F44 A;  2V6A A;  3M6X A;  1X5P A;  4TY9 A;  4CZC A;  3KK3 B;  4QIE A;  2FVP A;  3V4I A;  1ZAW A;  2QLW A;  2BJE A;  1IBL F;  4DSK A;  2F9J A;  4J9V A;  4JI5 F;  3UPF A;  4KGX B;  3VAF A;  1NK7 A;  2DHG A;  4CLF A;  5L38 A;  2BR0 A;  1LWE A;  4P7V A;  1DQA A;  2YNI B;  3ILI A;  5L1K A;  3E51 A;  1CC7 A;  3KJQ B;  4KT0 C;  2DHX A;  2E5H A;  1XMQ F;  1KSP A;  2K7J A;  4H4O A;  4L73 A;  4ED6 A;  1TFW A;  2AEJ A;  4USJ C;  1O5J A;  4ALZ A;  1U1Q A;  1IQT A;  1N5Y B;  3KJF B;  4WYW A;  2R2S A;  3SSS A;  3HHD A;  2KG1 A;  4C8O A;  2AX1 A;  5CZX A;  4M5L A;  2V2K A;  4OI6 A;  5EHH A;  1NEE A;  3HLU A;  5KFP A;  3R2D J;  1WC6 A;  3IC1 A;  1NSA A;  3LO3 A;  1JXL A;  1AUD A;  4IR1 A;  1CPZ A;  3GCX P;  3Q8Y A;  2B8P A;  1B0P A;  1Q0N A;  2BRK A;  2YVS A;  1JXV A;  3GE9 A;  1QSL A;  3BKF A;  3QT6 A;  1LXN A;  2BKP A;  1WG5 A;  3DKD A;  5ETM A;  2CWK A;  1VRQ C;  4C0O C;  1TL7 A;  4GC6 A;  2RHQ B;  2H48 B;  4JI4 F;  1UW9 A;  5AXM A;  4DR2 F;  5EX3 A;  3W63 A;  4BBY A;  3KLE A;  2I38 A;  3BDE A;  4I2Q A;  5I3U A;  4LFC F;  2FJE B;  3NMA A;  3IBF B;  1KOO A;  4Z2X A;  2OPS A;  2UVU A;  1CUL B;  2C1E B;  3MCM A;  2CQG A;  1XR6 A;  4KV8 A;  4OMF G;  2KM8 B;  2AMC B;  2VPY B;  2EFG A;  1X4G A;  3PHE A;  4HDG A;  2RIL A;  3SEO A;  3K5P A;  5EWF A;  4QOT A;  2LYV A;  3RB4 A;  1B70 B;  3V81 A;  1Z2L A;  1HNZ F;  3BBB A;  4FPI A;  2VG6 A;  3CC2 S;  4NYZ A;  3RB0 A;  2BOP A;  1MWQ A;  4U95 A;  2M8D B;  9RUB A;  1AT1 B;  1J5O B;  4N76 A;  2YKQ A;  5ETS A;  3TRG A;  1GMU A;  3F73 A;  5L1I A;  3KHL A;  3SBM A;  1RTD A;  1RWX B;  5FDL B;  3JTO A;  4CLU A;  1L5U A;  1RQ0 A;  1UMJ A;  2PGC A;  5C42 A;  1BD6 A;  2YY3 A;  1KFS A;  2C2N A;  1HBN A;  1UVJ A;  3QO9 B;  3NS7 B;  5KFN A;  4DV2 F;  1LWF B;  2CPH A;  1OY6 A;  2MQQ A;  4FDF A;  2CJB A;  1FNX H;  2CPE A;  2UXB J;  2MST A;  1S6P B;  3FZ2 A;  1MRO B;  3MM5 A;  4BS2 A;  2Z0G A;  1HQU A;  4DG1 A;  1K47 A;  2MQM A;  4Y6I A;  4PWU A;  1RA7 A;  2VDH A;  1G3O A;  2V8P A;  3JXO A;  2H5J B;  4YDD B;  5GAD U;  4B9S A;  4E8U A;  3EPG A;  1KLN A;  1QSS A;  4F36 A;  2W9C A;  2KZZ A;  5LMU J;  2UXC J;  1R6V A;  2RF2 B;  2ZC3 A;  4CLT A;  2YKN A;  4ILL A;  1QE1 B;  5CD4 H;  2BJ7 A;  2KXH A;  5K14 B;  4O44 B;  3DRR B;  3UN2 A;  1U25 A;  2GQC A;  4NI2 B;  2D3U A;  4J9P A;  3KK1 A;  4B3R F;  3EPI A;  2R2R A;  3OSN A;  3IR6 B;  6AT1 B;  4EBC A;  2EW9 A;  2H4Y B;  4HT7 A;  4R0E A;  2VBW A;  4WP9 A;  1TUV A;  3T41 A;  3UN5 A;  4M5G A;  1TEL A;  1S59 A;  3W66 A;  3VZI A;  1XWL A;  2B4U A;  2W4C A;  4QR2 A;  4XO0 A;  4ZN1 A;  3Q8R B;  2ZH1 A;  1WOP A;  3CCM S;  2M88 A;  1MW7 A;  1RHU B;  2OPR A;  4MH8 A;  2RKI B;  3H2U B;  2KXF A;  2PDA A;  3D2W A;  3MEC B;  3UCU P;  4LF9 J;  2PT0 A;  1Z2Z A;  3GJT B;  2MKK A;  2OO4 A;  1FE4 A;  1T03 B;  4IYQ A;  1ZH5 A;  3OBI A;  3GYX B;  1ZZN A;  1GAO A;  4OX9 F;  2E5L J;  3A12 A;  3H98 A;  1YJU A;  2KT5 A;  2ZVS A;  3BN4 A;  3D9B A;  3LW5 C;  1HLW A;  4AXJ A;  4H54 A;  4DV1 F;  1SKR A;  3TEG A;  2CQB A;  4B3M J;  4WFB Q;  2BKO A;  3B4D A;  1JMT A;  5D77 A;  4EFA C;  2HZV A;  2AIR B;  3CD0 A;  3LGN A;  3HHK A;  1NLK L;  3MM6 A;  1X5S A;  4USV A;  2BE7 D;  4HAC A;  1X9W A;  2OPS B;  2CQD A;  4WJB A;  1UL3 A;  2MQP A;  2XGP A;  2XY7 A;  4A8K A;  1C1B A;  2UU9 J;  2RT3 A;  4ZK7 M;  4J9L A;  3QRP A;  3W8G A;  5A2Q Y;  4LQ9 A;  3DLE B;  4YME A;  2HVH A;  4WIQ A;  4WXW A;  2E66 A;  3I4P A;  2MZJ A;  4HT5 A;  3X1L B;  2OPP A;  2UUA F;  2NYI A;  2UV8 A;  1L3V A;  4EI2 A;  2YNG A;  1KR4 A;  2OSQ A;  1TL3 B;  2DNZ A;  2UZA A;  1QAY A;  4MJK A;  2NXN A;  2DXD A;  1IKV B;  4FNI A;  1S57 A;  2VJU A;  2KN4 A;  1S9E B;  2HGM A;  2GAG C;  3GG0 A;  3AXK A;  3KG1 A;  5F8L A;  2XLI A;  1RT6 B;  2AHO B;  4UZC A;  1WHW A;  5AT1 B;  2JVR A;  4PXB A;  2I9S A;  5B0D A;  4F4Z A;  2OTL S;  2YPY A;  4I2P B;  3IRX A;  3CC4 S;  3IBC B;  1XJW B;  1R6Y A;  5DZ6 A;  3OTD A;  1FK9 A;  4PPD A;  3BKU A;  2B51 A;  3HHL A;  3M2R B;  3M30 A;  2QMU B;  4DU7 A;  2YBV A;  2HGN A;  3IM9 A;  3KXD A;  3MED A;  5C24 B;  4F2S A;  2KHD A;  1RAE B;  3H5S A;  4ZCK A;  2NCK L;  3BQ1 A;  3KLF A;  2WK4 A;  5KG4 A;  2RDJ A;  5HLF B;  1NSQ A;  2CNL B;  4LMZ A;  2NS1 B;  2XMA A;  4ZP9 A;  4A8S A;  2MKC A;  5ETR A;  4AL6 A;  5KG6 A;  2F1F A;  2D9O A;  3I87 A;  2DGV A;  2OPP B;  1IKY B;  1WOS A;  2RU9 A;  2FGO A;  3NGU A;  4FXW A;  4LVO P;  5E7O B;  5ETP A;  2DR7 A;  2IPO B;  3M9N B;  2VOP A;  2W8K A;  4KIA A;  4GVB A;  1Y5N B;  3WBZ A;  1XMO F;  3DLB A;  1DQ9 A;  2KT2 A;  5B0E A;  1H0H B;  4LSN B;  2J6T A;  3FRY A;  3MOZ A;  1UPP A;  4WWS A;  3I55 S;  4ZVO B;  3VAJ A;  4XDD A;  4PEO A;  1S6U A;  3O44 A;  2JFD A;  2FJB B;  1DAX A;  4ZPV R;  1JLA A;  3LUY A;  5FD1 A;  1AB8 A;  3QYY A;  4Q0B A;  3IXQ A;  3G82 A;  6FD1 A;  1VHI A;  1D9A A;  4YHH F;  3W62 A;  2CJY B;  2E9R X;  4B02 A;  4WZM A;  4K50 A;  4DL7 A;  2LXU A;  4E2F B;  2XO7 A;  2L41 A;  3NBP B;  3I56 S;  5LMN J;  3MGJ A;  5T7L A;  1RAG B;  3C3L A;  3BH6 B;  1FRM A;  3HXM A;  2ZJR Q;  2QEX S;  1GTE A;  4KR0 B;  2ASD A;  5DDO C;  1G6B A;  2DO4 A;  4P2F A;  1OJ4 A;  2FHJ D;  3MUT P;  2CYY A;  3AFG A;  3CME S;  1UP1 A;  4N8O A;  1CS4 A;  2GQQ A;  2G1D A;  1WEY A;  4BC7 A;  4FYY B;  3CJ0 A;  1F3F A;  4HAC B;  4PRF A;  5GMD A;  3M2V B;  5G0R A;  4DR6 F;  2DR6 A;  2HNZ B;  1JLQ B;  1G4C A;  4HR2 A;  2HVE A;  3O1L A;  3POT B;  5KFM A;  2IYG A;  3NOC A;  4RW8 B;  3SV3 A;  3G82 B;  4KO0 A;  4I4B A;  1MMD A;  1IJF B;  2GNK A;  1NDC A;  2KG0 A;  3PV8 A;  2ALZ A;  2IRX A;  4PG6 A;  4MKA A;  4CP5 A;  1JLE A;  3M9M B;  2I0X A;  3DI6 B;  3H59 A;  2K3I A;  2FC9 A;  4N56 A;  2C2M B;  2QSF A;  3SCI E;  2XGQ A;  1RKJ A;  2NLW A;  2F63 A;  3P6Y C;  1Y4Z B;  1WSR A;  3MEE B;  2R2T A;  3UW1 A;  3NGT A;  3BGF A;  2RQC A;  2VJV A;  4MMO A;  4CCH A;  2IYI A;  4MKB A;  1REV A;  1H74 A;  4ZOS A;  2PEB A;  2ASJ A;  4ZJO A;  2DR8 A;  2ATC B;  1T8E A;  1VQ9 S;  1FXD A;  5ADZ A;  2BOA A;  3GYN A;  1FJC A;  2VFR A;  2MLY A;  2MGZ B;  2A6O A;  1U48 A;  4KQZ A;  4NMX A;  2FJX A;  3MR5 A;  2CWX A;  1VK8 A;  2BYC A;  5C24 A;  3E01 A;  5D78 A;  5CD4 A;  4RNO A;  1ZM2 A;  2F3J A;  3LTO A;  3ET6 A;  2VQE F;  2IRU A;  3K5L A;  2UP1 A;  4OI2 A;  3OJS A;  4DUY F;  1HNX F;  1GK8 A;  3BRE A;  2HBR B;  2XMK A;  3I32 A;  4WBF A;  5A8W B;  1IBM F;  1FJ7 A;  2FHO B;  3Q89 A;  5DDP C;  3W1Y C;  4J90 A;  1DLO A;  4YB7 A;  3KUE A;  1RB0 A;  1S1U B;  2ZOG A;  5CZV A;  5LSO A;  1CJU A;  1HHS A;  1RWV B;  2GHW A;  3KLE B;  4P73 A;  5IV3 A;  3ENA A;  2ZE2 A;  1SUQ B;  5AJ3 J;  4RNH A;  2F4V F;  2HNZ A;  1T9U A;  2J5A A;  3SMZ A;  1FWL A;  4ZLJ A;  1S6Q B;  2H4W B;  2J7U A;  2X3G A;  2GIQ A;  2VDI A;  3WQP A;  3JSB A;  1NBE B;  3SQO P;  8RUC A;  1MG7 A;  2MY8 A;  3OR2 A;  3HVW A;  3HFK A;  4O0I A;  4JI2 J;  2IJR A;  2VH7 A;  1S72 S;  2JFK A;  2XS5 A;  3EDQ B;  3VQT A;  4F0K A;  4AUK A;  3BO4 A;  1WDT A;  5BJR A;  4ECR A;  5HP1 A;  1VOM A;  3VAG A;  3RRK A;  3QAE A;  4UF4 A;  3FQL A;  5B0G A;  4UT4 A;  1RT1 B;  4KJI A;  3CMQ A;  4DZ6 A;  2AP6 A;  1RWK B;  1RYS A;  5GAD I;  1Q16 B;  4N5S A;  4NCG A;  5FLX U;  4RZR A;  4OYB A;  3GON A;  3U7J A;  1RT3 B;  4NZ6 A;  4ERD A;  1Y11 A;  2DH9 A;  5JJB A;  3NNA A;  4OX8 A;  5BR8 F;  4OZ5 A;  2CZ9 A;  3GV7 B;  4OZL A;  2HHV A;  3QO9 A;  4DS4 A;  4PG8 A;  2V2V A;  2VUG A;  2W8L A;  4X4P A;  1JLA B;  5DG9 A;  2BMB A;  3FCV A;  2Z57 B;  3EIC A;  4TLQ A;  4ZA1 A;  5CAB A;  4DV6 J;  2OTJ S;  3MCO A;  1UVI A;  3L7O A;  1C0U A;  1UTA A;  3MM7 A;  2M2B A;  3NS5 A;  4OZ1 A;  4UOC A;  4DN9 A;  4QIG A;  1NU4 A;  1O0P A;  2MLZ A;  2ZOF A;  4HDH A;  4Q7A A;  4IRK A;  1NZ8 A;  1HNW F;  1HIY A;  2ZWO A;  4I56 A;  5E3C A;  3FUY A;  1PKU A;  4OYZ A;  2ALY B;  3NEK A;  2EWH A;  2D69 A;  1I51 B;  2V67 A;  4R0J A;  1N8R T;  4PUO A;  7FD1 A;  4OYM A;  2B9W A;  3CF5 Q;  5KFV A;  4O44 A;  1WD6 A;  2KFY A;  2AJ2 A;  2VAS A;  1DY3 A;  5DET A;  1KEK A;  1KRP A;  4TU9 A;  2X1B A;  2PC6 A;  1UWA A;  3KMQ A;  5F0U A;  4X4S A;  1L3U A;  4PWD B;  4NRT A;  4YR3 A;  1BGX T;  2RNE A;  2Z2Y B;  4C3K A;  2CUY A;  1DTT A;  2BZ2 A;  3ADA C;  4PZV A;  3UR3 C;  4LRC A;  2ZM6 F;  3MPW A;  2G13 A;  1YBU A;  4ED3 A;  5LSL A;  2JLE A;  2C2Z B;  1HYS A;  5AE3 A;  3GSD A;  4DZD A;  3GV8 B;  4I2Q B;  5I3U B;  1FK9 B;  1T02 A;  4M5D A;  2JJ4 D;  5LSR A;  2HMI B;  4WYL A;  5IT4 A;  4AL5 A;  2GJ2 A;  2GVZ B;  4WK1 A;  3R5D A;  4P75 A;  4DJB A;  5AE1 A;  5CCM A;  1Q7L B;  2Q66 A;  1E6V A;  4KPY A;  3C16 B;  3AXM A;  4LRA A;  2GJF A;  3PXG a;  2W7O A;  4Q44 A;  5IM0 B;  3HP6 A;  2UUB J;  2DXF A;  3BV8 A;  4LFA F;  1TP7 A;  2YNG B;  4NXM J;  4DPO A;  1I3O B;  1FO1 A;  2HUR A;  4DUT A;  2W4P A;  1VQM S;  1JXE A;  5RUB A;  4DFP A;  1RDR A;  2E1R A;  1O8B A;  2VFT A;  4OYI A;  3CD7 A;  3A8E A;  2GAH C;  2YQ3 A;  3QNW B;  4GKJ F;  1GH8 A;  1TK8 A;  2QYG A;  4K4T A;  1F9F A;  3ILO A;  1YRU A;  1NXI A;  1MWZ A;  2WZ1 A;  2DRD A;  3TP2 A;  4URG A;  2PO4 A;  1X9M A;  3QJJ A;  2DEI A;  1SXL A;  3R7S B;  4XPC A;  3T6J A;  1W26 A;  2F40 A;  3VCD A;  2VPZ B;  4CO4 A;  2IFX A;  1L3T A;  2YNH B;  1HYS B;  1DAR A;  3MED B;  4QBU A;  3H5Y A;  1XR5 A;  4QR0 A;  3VGV A;  4WKY A;  2HMI A;  3FK4 A;  1NM2 A;  4NML A;  4AD6 A;  2ZNY A;  5KFF A;  4EEY A;  2FJV A;  3BSC A;  1QUP A;  3SDE B;  1NK9 A;  1DUR A;  1HQU B;  1U7L A;  1RLD A;  1OSD A;  2XMV A;  4LUB A;  4CNZ A;  4CDI A;  2DR5 A;  2RH3 A;  1F3V A;  2YWH A;  1HQ2 A;  5A8K B;  3PR5 B;  4OHX A;  1TU0 B;  3JQJ A;  3M6W A;  5A6P A;  3Q23 A;  5KG5 A;  3AD9 C;  2R9L A;  5HVG A;  2ZH2 A;  2DNO A;  3ZZT A;  3MUR P;  3M8P A;  5L1L A;  2BQ3 A;  2CNO B;  3N9U C;  4OJ1 A;  2FVS A;  3D0I E;  3PYG A;  1YLX A;  2BJD A;  3ZTR A;  1JJ2 R;  2I8E A;  2MKI A;  2ZH4 A;  2VC1 A;  2W2P P;  4JI3 F;  4I7F B;  4X4N A;  1Y5L B;  1RT7 A;  1YK9 A;  2FD2 A;  3OFG A;  2UXB F;  4CI0 B;  4K4X A;  3E8O A;  3NGD A;  3CCT A;  4C8L A;  2Z30 B;  2OP5 A;  3MPU B;  1KQK A;  2RJZ A;  2GO9 A;  3V5R A;  5KFW A;  1VQ4 S;  2MB0 B;  1WAC A;  3FCH A;  3ZTP A;  1B4S A;  1WHV A;  4PQA A;  3AA9 A;  3O3L A;  3HVT A;  3S6E A;  1NCL A;  3VGU A;  3FSX A;  2HVZ A;  3GFX A;  3Q8V A;  4KH0 B;  2NPF A;  1IM4 A;  2BUN A;  5KTQ A;  1QLN A;  2OFH X;  2EBE A;  2JC0 A;  2Q1L A;  1LKZ A;  2A18 A;  3HKZ D;  1VGY A;  3M1V B;  3R7N B;  5DM6 Q;  3DLJ A;  3HVA A;  1T7P A;  5KFT A;  7FDR A;  1R89 A;  3RAM A;  1WF0 A;  2KJV A;  1CS4 B;  1Y0H A;  2MEW A;  3MTJ A;  3N6N A;  4Y65 A;  5KFJ A;  2HHH F;  4AND A;  1HWU A;  2BE2 B;  5IZH A;  3OPK A;  1FX4 A;  3D6T B;  2YX1 A;  5ETT A;  2VFS A;  2AJQ A;  2DH7 A;  3QMQ A;  1P1T A;  3L95 X;  3JTN A;  1SH3 A;  3M8Q A;  3P4U B;  4QIV A;  3TJ9 A;  5HN0 A;  4KSE B;  1VC6 A;  1H38 A;  1WUU A;  2HFU A;  4UQG A;  3GFY A;  2E7W A;  4PG4 A;  4LFC J;  4MAK A;  1SJR A;  3MMJ A;  4JI1 F;  5M2R A;  3QGH A;  2GVD A;  2HPU A;  3CCW A;  3ETO A;  4LF1 A;  4NA1 A;  2G0C A;  1NJY A;  5FLX Y;  2HKE A;  1HNI A;  2G9O A;  2XMW A;  5K5M A;  2W7P A;  3FBE A;  3S7R A;  2RVJ A;  1T94 A;  1HNI B;  4M8L A;  1NJX A;  3P3D A;  3IMQ J;  1HWK A;  4GC7 A;  4USI A;  4L3N A;  2DGX A;  5DRK A;  5HMX A;  1KVK A;  2DIV A;  2FZK B;  2ZNZ A;  1HA1 A;  3EWG A;  2CPX A;  1MN7 A;  4OJH A;  5G0R B;  5B0A A;  1Q82 T;  2B5J A;  4P2X A;  1C2P A;  3BR8 A;  2POK A;  3DOK A;  4IUF A;  1HMV B;  2K8G A;  4PXD A;  2IC3 B;  4URQ U;  1LXJ A;  3CCE S;  1FRJ A;  1GFW B;  4A8Y A;  3P96 A;  5HRO B;  4AQY F;  2CQ1 A;  1SBR A;  2Z58 B;  5C2C A;  2H3E B;  4MK7 A;  4N8N A;  2LQ5 A;  1HNV A;  4YN3 B;  2BQU A;  1TKD A;  2B0G A;  3O2I A;  1C0T A;  2MKH A;  2MQO A;  2GA7 A;  3MEE A;  2V4J A;  5BR8 J;  1UEV A;  1P8G A;  4RWX A;  1X60 A;  5T7L B;  2FHJ A;  2VON A;  4F3Q A;  3AH6 A;  1XNQ F;  5HAO A;  2PA8 D;  3HCX A;  1TMJ A;  3P45 B;  3CJS A;  4KY3 A;  5AXL A;  1CJK A;  4WTO B;  1GMW A;  4MYT A;  4USU A;  2XWY A;  4LVN P;  1FEE A;  2FLN A;  5BYS A;  1EKR A;  3IAM 9;  1WEZ A;  1UA0 A;  1S1V A;  2HHS A;  4GKJ J;  4KGZ B;  3EUN A;  1IR1 A;  2BJ1 A;  4OJG A;  3ZNU A;  5EWG A;  1ZM4 A;  4NLQ A;  2H9Z A;  3QWP A;  2R7W A;  2JEJ A;  1FNM A;  1D1U A;  2QA2 A;  1KD1 T;  1FNO A;  1R31 A;  2CQ0 A;  4JOU A;  5IV4 A;  5GAH I;  3ZO7 A;  3PAC A;  5D15 A;  3E3X A;  3HSD A;  5KG7 A;  1PGZ A;  1RWM B;  3W65 A;  3T19 A;  2DK2 A;  3CCQ S;  3J7Y I;  3P8B B;  5F8I A;  4NLU A;  2V9K A;  3GP9 A;  3WC0 A;  2Y1I A;  2N4D A;  1FEH A;  1H2U X;  1HAR A;  1HW8 A;  5HK4 A;  2L48 A;  3BEG B;  3UI3 A;  3M9O B;  2HLU A;  1REV B;  3BJY A;  4OL8 A;  1WF2 A;  2AT1 B;  2NXC A;  4HL9 A;  4MIB A;  5B0C A;  5GAG U;  5A8R B;  2APO A;  3GR0 A;  2WTF A;  2EXU A;  2RB7 A;  2ZM6 J;  3HVR A;  4QR1 A;  2Y8W A;  3N0V A;  1PJ6 A;  3TVK A;  3PIO Q;  4KBI A;  2ZDO A;  4Y2I A;  4O3S A;  1K9M T;  4NXN J;  1C1C A;  1WC4 A;  3TVZ A;  1SC4 B;  1KQF B;  2E9Z A;  1JLG A;  1SKS A;  3OFF A;  3IS9 B;  1D9D A;  1GXL A;  3DGP A;  4ZVR B;  5M2U A;  4NA3 A;  3DDN A;  4YQW A;  3PY8 A;  2W01 A;  3J7Z 5;  4MFB A;  3CCR S;  1FRX A;  1HPZ A;  1PYT A;  5J1N A;  2GVD B;  2MKS A;  2P5V A;  3UNY A;  3GTY X;  4IR9 A;  1FI4 A;  3OXF A;  2IA0 A;  4Q43 A;  3M6V A;  2K7K A;  1BUX A;  4ER8 A;  1P9Q C;  4LSN A;  2BEF A;  4QW8 A;  1N36 J;  3I0S A;  5KAK A;  2BDP A;  2R7T A;  3HFV A;  4FS2 A;  3D66 A;  1CEZ A;  1OIA A;  4CT8 A;  1LWC A;  2B8Q A;  2EFN A;  4I1T A;  3HMJ G;  2CQP A;  4R8U A;  4A8Q A;  1S6Q A;  2YKA A;  4CLP A;  3MHY A;  3QPI A;  2Q79 A;  3RBD A;  1SL0 A;  1NHK L;  1UPM B;  5KFE A;  4EO8 A;  2O5D A;  2YNH A;  3VR1 A;  1GEH A;  4IQX A;  3PX6 A;  2DB1 A;  2U1A A;  5KG3 A;  1WF1 A;  2ZH9 A;  3L09 A;  3ILL A;  4AT1 B;  1M0S A;  2ILZ A;  1VBY A;  1R8H A;  2CQ3 A;  2GX8 A;  3I96 A;  3NY0 A;  2ASY A;  4NYP A;  4Q2M A;  2ZWP A;  1XMB A;  5F3T A;  2B43 A;  2FQQ B;  2DY1 A;  4ZKA A;  5A0Y B;  3QZ7 A;  3TAR A;  3VVU A;  4DSJ A;  1P6T A;  2NYH A;  2F5G A;  2VFV A;  5SZT A;  2WBM A;  2MZQ A;  2K06 A;  1G1X A;  1T9W A;  4WFN Q;  1F5C A;  1WOR A;  4I7F A;  3BF4 A;  3MAA A;  4XIU A;  1YBA A;  3D0H E;  4ZCL A;  4ZPC A;  3WIU A;  3QFW A;  4BCA A;  2QMW A;  2VG7 B;  5J2Q B;  1T05 B;  4B3O A;  3CD6 S;  2EPI A;  3U27 A;  3TJ8 A;  2MSS A;  2W9C B;  4LBP A;  4OV6 A;  5J1P A;  1TUW A;  5KT4 A;  1GMV A;  1VK3 A;  3OVB A;  2B4P A;  3KTQ A;  1S1U A;  2DEJ A;  3KDO A;  1LW2 B;  2IM3 A;  3PRD A;  1NO8 A;  3FCW A;  4PPZ A;  3OVS A;  1TTH B;  1HWJ A;  2DNY A;  4A48 A;  3PHT A;  4I69 A;  5KT2 A;  4PG5 A;  5E0O A;  1KC8 T;  4WF9 Q;  1RT2 B;  5DQH A;  4IFY A;  2VFU A;  3NWR A;  3V6D A;  1UJ5 A;  2V8D A;  3MZI A;  5K8P A;  4DMZ A;  2HHH J;  4F8R A;  4DBQ A;  1FDN A;  3CVK A;  4CT9 A;  2EFP A;  4NEZ A;  2JEF A;  2PI5 A;  4LIW A;  2J9D A;  1LWX A;  5FDL A;  5T14 A;  2AGO A;  3RW6 A;  2BE9 B;  5GAE I;  5JUM A;  3MEC A;  4TXS A;  3K5O A;  1H98 A;  2ZD1 A;  5DQI A;  3PKY A;  2VIH A;  4DR1 F;  1KDN A;  3FGV A;  2MHE A;  3M8Q B;  1U1P A;  2ZH5 A;  1ZOT A;  1JJC B;  1XK8 A;  5A76 A;  1HBM A;  3A8J A;  5IQQ A;  2J6U A;  3PJW A;  3ISN D;  2QYC A;  1M5P C;  5GAE U;  1X7V A;  1R8A A;  1IR0 A;  2RU3 A;  3CMA S;  5F8G A;  4EYH B;  3ENV A;  4ETZ A;  4V19 X;  1QE1 A;  1EP4 A;  2O01 C;  1VQO S;  5EN1 A;  4OFZ A;  5I3Q A;  4ELV A;  2LU2 A;  2HBY B;  3HJF A;  2B4O A;  2A1B A;  4USK A;  3GCW P;  4DV0 J;  1RA6 A;  1OPZ A;  2KVQ E;  4X4R A;  2EKN A;  3UD4 P;  4M95 A;  4FP9 A;  1KFD A;  3NAH A;  3ZZ0 A;  3RB6 A;  3PX0 A;  2BVZ A;  2MY7 A;  3HZE A;  3KUH A;  2LEA A;  3DMJ B;  4ECQ A;  3B8H A;  4O3N A;  3TNV A;  4ED7 A;  1SL2 A;  3DLL Q;  3LP0 A;  3OL7 A;  1Y3J A;  1KVI A;  3AOB A;  1UVK A;  4K2X A;  1NH7 A;  2EG2 A;  2CQH A;  2LFV A;  4FYW B;  3PW5 A;  4URS A;  5IC6 B;  1VQ5 S;  2FB0 A;  2KM8 C;  1HFE L;  1N48 A;  2GV1 A;  4BLG A;  4UY8 T;  4M63 A;  2HVD A;  4K4W A;  4DSL A;  4NCA A;  3X3U A;  2H1Y A;  4DCJ B;  2ZUG A;  1WC0 A;  3O8W A;  4MYU A;  4W4M A;  3UCZ P;  1R0A B;  3PEH A;  1X4D A;  2GC8 A;  3C19 A;  4ZP7 A;  3VGT A;  4ZLN A;  2XY6 A;  1M90 T;  2BRL A;  3B54 A;  3KK2 B;  4B3T J;  2CQ4 A;  2UUB F;  2E5L F;  1KTV A;  1NPR A;  1Y10 A;  1ZPV A;  2I5J B;  3A8I A;  4FYV B;  2QL5 B;  5KG1 A;  3PYF A;  2FPH X;  1R27 B;  2V4Q A;  3AQO A;  4M1K A;  3E2E A;  4KE5 A;  4JYA J;  2MTL A;  1H6K X;  3UDC A;  1QSY A;  1YQH A;  3CCS S;  2KU7 A;  1CQM A;  3FKB A;  1SJ3 P;  2W7A A;  3HT0 A;  1U1N A;  4DPT A;  4K4S A;  4NLY A;  2V63 A;  4DL0 C;  3ISN C;  3OSP A;  3CDA A;  2VL1 A;  2ZOM A;  3M2U A;  1S7H A;  3KLH B;  3NXZ A;  1T11 A;  5AJ3 F;  2DGQ A;  4NLO A;  4Y28 C;  1TL3 A;  4WE1 A;  3VZH A;  3BPS P;  4UOG A;  4U96 A;  4ZPT R;  5D4L A;  2B4V A;  3MMB A;  5KFD A;  3CJR A;  3MEK A;  1KLM A;  2OPQ A;  4U6P A;  3MUV P;  3PX4 A;  5D3G B;  4DR6 J;  4CLK A;  5DDQ C;  2QZ8 A;  1W2B R;  2HW3 A;  3L9Z A;  1I94 J;  3Q86 A;  4G1Q A;  1NUE A;  4K8R A;  2PFF B;  1SJ1 A;  2XMJ A;  4H4O B;  2E7V A;  1H73 A;  2AJ1 A;  4LF8 J;  5CH7 B;  1RWP B;  1FT8 A;  1S1T B;  1VIO A;  2ABY A;  3DDI A;  3M2R A;  4LSZ B;  5LL6 d;  1EIY B;  4DR3 J;  3J81 U;  1U8W A;  4PXE A;  4YS2 A;  2WW8 A;  4DF8 A;  1ZAV A;  1RE1 B;  4J7C A;  1RHK B;  4YB6 A;  4B08 A;  4ZIV A;  1RLC L;  4ZJQ A;  1TKT B;  2DHH A;  3W2W A;  2ZC4 A;  3CIM A;  5ETL A;  4EBE A;  1HNW J;  4PQU B;  1HI8 A;  2F9D A;  5DO2 A;  1NK6 A;  2QLX A;  3I5B A;  1RT3 A;  4DR1 J;  2VPX B;  2E5I A;  3JAM U;  3PFO A;  3Q24 A;  4LRF A;  1LW2 A;  1N34 F;  2WBR A;  3PTW A;  2MZR A;  2AEM A;  4ES2 A;  5GAG I;  4RPF A;  4F3O A;  1U0H A;  2VG5 A;  2PEH A;  2W2M P;  3FVY A;  4KGM A;  3LOU A;  4PWW A;  5ETQ A;  3EGN A;  4KGV B;  4JI0 F;  4ANC A;  2ZUA A;  1VJW A;  4EU0 A;  4C6A A;  3V6J A;  2AGP A;  3FSY A;  2CAD A;  1ZA1 B;  2X7I A;  4EGL A;  2QL9 B;  2WAQ D;  3HZG A;  1RAC B;  4RO0 A;  1S97 A;  4RWW A;  2OKQ A;  1RWO B;  4XAK A;  4DV1 J;  4P71 A;  3PW2 A;  1FDD A;  1KBR A;  5KFA A;  3K2Y A;  1C1C B;  4F25 A;  3KLG B;  1N5Y A;  5HSP A;  2DNN A;  1MU2 B;  3GU0 A;  3W61 A;  4RW4 A;  4OLO A;  3DM2 B;  1VC5 A;  5HJY A;  2DNG A;  5KFS A;  3KNA A;  2QA4 G;  5IOL A;  3ENW A;  4ZP6 A;  2SXL A;  3UWT A;  5CCL A;  5KFH A;  1U6F A;  2CPF A;  2GMJ A;  2RIJ A;  1CJT B;  1A6L A;  1JNR B;  2QX0 A;  3KK2 A;  3QIP A;  4CYU A;  5T41 A;  4B9L A;  1YJV A;  4N77 A;  3CJK A;  1VR6 A;  1D0E A;  4KPC A;  3QAU A;  3CO9 A;  3N79 A;  2GGP A;  4ZLP A;  3RB3 A;  2AGQ A;  3J81 j;  3CJT A;  2XI2 A;  1JLF A;  3W7B A;  1DRZ A;  2R8J A;  2EK6 A;  1JLC B;  2JNJ A;  3LAL A;  3LWM A;  4DR3 F;  1LWC B;  1RU2 A;  1JLF B;  1UET A;  2H5E A;  3TO8 A;  3ZZR A;  2HHU A;  1U2C A;  1WTF A;  2DR9 A;  4HHU A;  3TAN A;  5CQG A;  5E41 A;  2WVB A;  4B9V A;  2OHD A;  2Z4P A;  3RZA A;  3CJQ A;  3FBB A;  4X66 F;  3IG1 B;  2YKO A;  2G2Z A;  5L46 A;  3OHB A;  4YB5 A;  3CNQ P;  3V81 B;  1RT4 B;  4FKX A;  4WP8 A;  5JMN A;  3RBE A;  2FIU A;  3FMB A;  3R5J B;  4L74 A;  1SUQ A;  3G87 A;  3UE2 A;  4DV2 J;  1TUG B;  2CPZ A;  1SV5 B;  2K1R A;  2CQC A;  4AYB D;  4C8Y A;  3MM8 A;  4J9R A;  1RT6 A;  1R8B A;  4CM0 A;  2NZ4 A;  2EG1 A;  2NXJ A;  2YNI A;  4M5I A;  2O1P A;  2OD6 A;  2Z2Z A;  3NS6 A;  1R7I A;  3JSY A;  2R8H A;  3A3O B;  3MF5 A;  3QZ8 A;  2LQ8 A;  2UUC F;  1NHV A;  4RX6 A;  5J1E B;  4LF8 F;  8AT1 B;  2J9D E;  3CB4 A;  4LF2 A;  1YKW A;  3BPD A;  3MAA B;  4P72 A;  3W9J A;  2V4J B;  1GXU A;  3DLG A;  1RZM A;  4ZPD A;  5LXY A;  4O3Q A;  1FFW B;  1YHQ S;  1J5E J;  2V34 A;  4CO1 A;  5E3R A;  4R25 A;  1FVS A;  4NXN F;  2ZH6 A;  1XNQ J;  1VIS A;  7AT1 B;  2YTC A;  3S01 A;  1KKH A;  3M8Z A;  2O67 A;  2Y1L B;  1PO6 A;  2LA6 A;  1QVF R;  3Q8S B;  1SQF A;  3CIZ A;  4QYZ J;  1HBO B;  4DR2 J;  2L9D A;  2LDY A;  1TZ0 A;  3T5K A;  1RHR B;  3HJV A;  1KOH A;  4DR5 F;  1IM6 A;  3H5U A;  3R3T A;  4ZVS B;  1VQN S;  1S77 D;  1WHX A;  3W64 A;  3H90 A;  2XNR A;  4OZ2 A;  1NKE A;  2CDQ A;  4NLW A;  1EHW A;  1JLE B;  3QGP A;  4WP3 A;  3L7P A;  2A10 A;  2D3Z A;  4LRB A;  4RW4 B;  2OPR B;  4O3P A;  3GMG A;  4AFF A;  4D3H A;  2PII A;  4DV0 F;  2ADB A;  1S0N A;  2UU9 F;  3HD1 A;  1Q7Y T;  3D1Q A;  5JVH Q;  3DFE A;  4H4M B;  1JLB A;  5HBM B;  3K17 A;  4Q8E A;  1UZH A;  1WG4 A;  8ATC B;  3ZTS A;  4YR0 A;  2BJ8 A;  2WRM A;  5H9E K;  3KK1 B;  3WC2 A;  1AW0 A;  2B9Y A;  2D41 A;  3DN9 A;  2EVZ A;  2HQF A;  3FQK A;  3FBC A;  3ZZO A;  3RRG A;  4JI1 J;  4V19 J;  1IN0 A;  2BE2 A;  3M6U A;  2CJX B;  2R7X A;  4IG0 A;  4DV5 J;  2OSR A;  3GJR B;  4M5D B;  3DU5 A;  3EVO A;  4JI5 J;  2BV3 A;  3KLF B;  4C4W A;  1OY8 A;  3MM9 A;  1RAB B;  2Y0B B;  3IS9 A;  2BX6 A;  3MM9 B;  3G9C A;  5HQL A;  3EGV A;  3A8K A;  4IRD A;  3R6L B;  4CQ1 A;  1IQZ A;  2QIF A;  2Y1J A;  1YJW S;  2OUG A;  1V3R A;  2OLW A;  3BH7 B;  3US5 A;  5J2P A;  1X5O A;  3QSI A;  3D68 A;  3V4I B;  2FVR A;  2UVW A;  3DM2 A;  2CNK B;  1VRT B;  3T5L A;  3BSO A;  3IG1 A;  4NE9 C;  4AE5 A;  4ELT A;  2XLK A;  2ZBC A;  4EYI B;  4F4W A;  4B9M A;  3BGU A;  2J0X A;  2FGC A;  3RYL A;  3FBF A;  4DSF A;  2OH2 A;  3QRQ A;  3CJ3 A;  1XBW A;  2FHK A;  2P8I A;  1YTY A;  4OX7 A;  2B7B B;  4I6A A;  1NK4 A;  3BGO P;  3I5C A;  2X1A A;  3GPA A;  1IR2 A;  4DU8 A;  3AOC A;  5E33 A;  2N3L A;  4WFY A;  3UDV A;  3GIL A;  4R5P B;  4K4U A;  2HHQ A;  1RI7 A;  5HLF A;  2MKJ A;  2V2Z A;  1S5Z A;  1WC3 A;  2AJ4 A;  4QPX A;  3SXL A;  2Z2M A;  3DYA A;  5IC4 B;  3LAM A;  5CA5 A;  2HQG A;  2M0G B;  3GIM A;  1PC4 A;  3C14 A;  3LQV A;  5F9L A;  2AQ4 A;  1QD1 A;  2XHC A;  4KTQ A;  1FD2 A;  3MPV A;  1F9E B;  2KZM A;  4ED1 A;  4P6Q A;  4DQS A;  3PG9 A;  3K59 A;  1U1O A;  2P9G A;  5ETO A;  1FTC A;  2FZG B;  4C0B A;  3KJV B;  4DV7 J;  1Q81 T;  3RJM B;  1S0V A;  1M5O C;  2CJ9 A;  4FVM A;  2HND B;  5A2Q U;  2AD9 A;  1JWW A;  1LWF A;  1PIE A;  3F41 A;  3L3C A;  1Z1Z A;  2WON B;  4UST A;  4G1Q B;  2DPI A;  2HND A;  2L9W A;  3LH2 S;  4IO1 A;  1S10 A;  2BJ9 A;  2IY5 B;  1URR A;  4PG7 A;  4LBI A;  5D0R A;  1IKY A;  4CLW A;  4DPU A;  2CJK A;  3RBX A;  2IA6 A;  4QYZ K;  1B3T A;  1RHQ B;  1VLY A;  3HFZ B;  1RAF B;  2ZBP A;  2ILY A;  3CCZ A;  4CH0 S;  3LGM A;  1QDU B;  2FUG 9;  2ZHB A;  4U8V A;  1AFI A;  5C2G A;  2VQF F;  2A6M A;  3U02 A;  4DI6 A;  1A0O B;  4AQY J;  2G2Y A;  3RR8 A;  3M1V A;  1ITP A;  1RBA A;  3OXG A;  3MMC A;  6FDR A;  3GIJ A;  2GMH A;  3PJX A;  1EX8 A;  2PD1 A;  4IOB A;  3V6D B;  3DLH A;  3DRP A;  3K57 A;  3H25 A;  2V8V A;  2OMO A;  3MMC B;  2JSX A;  4MT1 A;  5H9F J;  3EXC X;  1VQ6 S;  3ZZZ A;  5KT7 A;  4B3R J;  1RHJ B;  2JRS A;  1N56 A;  3OLA A;  2I5J A;  2RAQ A;  4RKU C;  2BW2 A;  3PYD A;  5H9E J;  3NNC A;  5CYQ B;  3N5B A;  4MKV A;  2C2R A;  5J2M B;  4ES1 A;  2UXC F;  2CVE A;  1MML A;  4I6Y A;  1X4A A;  3DLG B;  5LJ5 Y;  4X4T A;  2IM2 A;  4U8Y A;  1WSV A;  1WEL A;  5DS7 A;  1U1K A;  3OXL A;  1QY7 A;  2LA4 A;  5IFM A;  1TFY A;  3MMA B;  5E3P A;  2E9T A;  2MJU A;  1KN6 A;  3K58 A;  1RAH B;  2D7S A;  1C4C A;  1BQM A;  3LA0 A;  4EBD A;  4WFA Q;  1HW9 A;  4FXV A;  1JNZ B;  2BW7 A;  3ZTO A;  5J2P B;  3PEJ A;  2XMT A;  4F2R A;  4C11 B;  2WVD A;  5B08 A;  2HAI A;  2VG6 B;  4F4X A;  2CG8 A;  1EKS A;  1K44 A;  2CZ4 A;  1SCJ B;  2E7X A;  4KAI A;  4CTA A;  2YH0 A;  5IS2 A;  4CLY A;  1VQP S;  1S79 A;  3JB9 k;  2LQJ A;  1FFS B;  5CYM A;  1SV5 A;  4B9N A;  4EZ9 A;  3TUZ C;  2J0Q D;  4WU3 A;  2OD4 A;  3POT A;  2XC9 A;  4NX9 A;  3Q83 A;  1NJW A;  1GX6 A;  4IG0 B;  3H4D A;  1LWE B;  1M5H A;  3OUY B;  1RTH A;  3M32 A;  4F0M A;  2MKY A;  3TX0 A;  5HP1 B;  1E6Y B;  2HFO A;  3SI8 A;  2WVF A;  3QWU A;  1K0T A;  2FY1 A;  3DOL A;  2CZV C;  2DRA A;  4NAS A;  3UDE A;  2RRA A;  1NSK L;  2EC2 A;  1RT1 A;  1RTJ B;  4IH6 A;  2CPD A;  3S8S A;  5KT5 A;  2C2E A;  3PCO B;  4TNO A;  3ZNJ 1;  4ZHR B;  1FKO A;  1SI9 A;  3FNN A;  3QGG A;  2ZH7 A;  5B7W A;  2HHX A;  1FKP B;  1FJE B;  3ELH A;  1ARO P;  1X4F A;  4P2S A;  3QSY B;  2CNN B;  3W3S A;  1UAW A;  1T95 A;  2N4C A;  5IT0 A;  2HEK A;  2QMX A;  2C28 A;  4FF2 A;  4O4G A;  3GYG A;  4QWA A;  3JQM A;  1U2R A;  1LK5 A;  3DCA A;  3C6T A;  3NCP A;  2ZHO A;  4ZVT B;  4Y2M A;  3IA0 A;  4GRS A;  2AYM A;  2CJQ A;  2OEJ A;  3AOA A;  4NLS A;  1SKW A;  4ICL B;  1FRL A;  1U2F A;  3SZ2 A;  1U45 A;  1S1W B;  2VD3 A;  3GR1 A;  4X62 J;  3C15 A;  3OHA A;  4DV4 J;  3RBZ A;  4Q0B B;  4J5O A;  1T9Y A;  1IUJ A;  2RUS A;  2RQK A;  1FJG J;  1EAR A;  2CQ2 A;  2HQI A;  1Q8I A;  2JX2 A;  3OVA A;  2FLL A;  1OY9 A;  2CAJ A;  5BYR A;  4DX8 H;  1V5I B;  2ZVI A;  3D6M B;  1XC9 A;  1FXL A;  3NP5 A;  1SH0 A;  1ZBT A;  4USM A;  1U4B A;  3D3B J;  4Y00 A;  2KRR A;  3KHR A;  2RD5 C;  4QQB A;  1OO0 B;  2BM0 A;  1S99 A;  4DL4 A;  2O3D A;  3G96 A;  2WVC A;  5L1J A;  3QID A;  3HHN B;  1FKP A;  2UVV A;  1RAA B;  1P9Y A;  1WJ9 A;  5CHC B;  1DJ0 A;  4LSL B;  2XM3 A;  1Q53 A;  4NYO A;  1PIL A;  4PXC A;  2R7V A;  4LF7 F;  4F67 A;  2MZ1 A;  3HKW A;  4ANE A;  2W24 A;  5KOX A;  3QLH B;  5KFC A;  1JX4 A;  1FF2 A;  3OUY A;  3JSM B;  1XEZ A;  4ATN A;  4DWI A;  4ECS A;  3HHL B;  3A3P B;  5GMK a;  3SCK E;  1RIS A;  1XMO J;  2XWX A;  3OR1 B;  3J81 Y;  2HZC A;  1TKT A;  3ILJ A;  3O6Q A;  5HO4 A;  4CH1 A;  4RJV A;  2GZO A;  3BYR A;  3TOQ A;  1FES A;  4JI0 J;  1ZS6 A;  4YUD A;  5I42 A;  2C2D A;  2CXE A;  5AE2 A;  2EFQ A;  4FXD A;  2D9P A;  2QTW A;  3KLG A;  5EUH A;  5THW A;  4IFV A;  5KFZ A;  1HD0 A;  4C11 A;  1RAJ A;  2RML A;  4RL1 A;  3I4H X;  3MPY A;  4OZ0 A;  3W2V A;  3Q8P B;  1R0C B;  1VHF A;  3DRY A;  2W9B A;  3D7S B;  3NL0 A;  2R8I A;  3CUN A;  1RT4 A;  2C3U A;  4A4J A;  3MOJ B;  1SPB P;  3KNG A;  5B0B A;  5D3G A;  4PCQ A;  1RTZ A;  1W2I A;  2Z2L A;  4GVL A;  2GS8 A;  5DM7 Q;  5HQM A;  4ZVP B;  3MR3 A;  4LFB J;  4OYP A;  2J7K A;  4DUZ F;  3RTV A;  3GWC A;  2IC3 A;  4BHQ A;  5DGA A;  2MGZ A;  5L9N A;  4LF5 J;  2MJN A;  4CRJ A;  3KJN B;  4TY8 A;  1LK7 A;  2WB1 D;  3DOL B;  3M7V A;  1JLC A;  2HK2 A;  4DN0 A;  4RUC A;  4QIF A;  3BZQ A;  5EGY A;  3LAN A;  4N7T A;  2NRE A;  2AW0 A;  2HSE B;  1LFP A;  3AA8 A;  1YZ7 A;  2WSC C;  2YKM A;  3TVY A;  1XNR F;  3NBP A;  4NOH A;  3CDU A;  2YWW A;  4DPY A;  2E5J A;  2B56 A;  4X4U A;  3CD5 A;  1M5V C;  5IT9 Y;  3F0N A;  4IFV B;  2ACM A;  3IO1 A;  2R2U A;  3GG1 A;  4OHY A;  1LV5 A;  2NSC A;  2E1M C;  5ITH A;  2IM0 A;  1B7F A;  1S1V B;  1SKU B;  2M4M A;  5KFU A;  1NH8 A;  1KQS R;  1JB0 C;  3AAW B;  1DZ5 A;  1YRX A;  1S1W A;  1P27 B;  1XTZ A;  3PO4 A;  1XR7 A;  2GIR A;  3EDR B;  3LPY A;  5KFB A;  2DIS A;  4GO7 X;  5EWE A;  1NK0 A;  2GIF A;  2KRB A;  1UVN A;  4OZJ A;  4XPE A;  4RR5 A;  1M1H A;  2QL7 B;  5C25 A;  3M2V A;  3SCL E;  2WON A;  1YIT S;  2IDL A;  4QWC A;  1H3D A;  3OLB A;  1U6Z A;  3IFE A;  2XNQ A;  2IMO A;  3CXC R;  4DV5 F;  3MPD A;  1F5A A;  1QJH A;  1CLF A;  3FJ2 A;  1MLA A;  1UCN A;  1VDH A;  1EQM A;  2RQM A;  3LP0 B;  1VRT A;  5KFR A;  1K8A T;  2HQD A;  2MQ8 A;  1KON A;  1I1G A;  1N54 B;  4NLX A;  1FER A;  3DLK A;  2ROE A;  3ZZY A;  2V2Q A;  2W2O P;  3FMW A;  1Y9O A;  2ZE2 B;  4JI2 F;  4A8O A;  2DBB A;  3IRX B;  4NLD A;  3PVX A;  4OI0 A;  1WG1 A;  2DHA A;  1APS A;  2KT3 A;  3UD5 A;  2BJ3 A;  2N3O A;  1NJZ A;  3QIP B;  3M30 B;  3NG8 A;  4ZLL A;  1XN9 A;  3PRB A;  2LVW A;  2YXL A;  3NNH A;  2F4F A;  4IOC Q;  4DV3 J;  5C42 B;  4LR8 A;  4Y0F A;  4JP8 A;  1RT7 B;  2DNR A;  1VQ7 S;  1JKH B;  2VZ9 A;  2LKZ A;  2RHS B;  2A3J A;  3CT9 A;  3NGR A;  3OQ2 A;  4DR7 J;  2UUT A;  1YIJ S;  1V3Z A;  2VU5 A;  2ZDP A;  2DNH A;  1UJ6 A;  5KFY A;  4NL5 A;  2YWK A;  1VQS A;  3MD3 A;  2XLJ A;  1YRT A;  3MMA A;  3M2U B;  4H4M A;  3J7A N;  1IKX A;  3CUL A;  4FN5 A;  4NI2 A;  3K5M A;  5F9N A;  1RBO B;  3Q8Q B;  1UEK A;  3WDO A;  3N5F A;  3NCQ A;  3MCS A;  1FDB A;  1K0V A;  4NA2 A;  4CWB A;  1C1B B;  4C8M A;  5HVH A;  2EEY A;  3DOK B;  3KYL A;  1O6X A;  3R5G A;  1I6J A;  5BYQ A;  2LMI A;  1CUL A;  4HLB A;  4PKD B;  4CNY A;  5KFL A;  4KC5 A;  5IWA F;  1X4B A;  4CLS A;  4LBH A;  2VBX A;  1YGY A;  1QAJ A;  2H54 B;  3ITH B;  3TZZ A;  1SIZ A;  3UDL A;  4NXM F;  2HZA A;  4YB1 P;  1MWY A;  5D0G A;  1H2V Z;  2RKI A;  1WEX A;  3E01 B;  3OR1 A;  2P9C A;  4ZP8 A;  4A47 A;  1NZA A;  3G71 S;  2QRR A;  1TL1 B;  4B9U A;  1TL4 A;  4IRC A;  3UCG A;  5KFK A;  2OAU A;  5HQ8 A;  2XB2 D;  3KMS A;  4O23 A;  2DO0 A;  3FDS A;  3VGS A;  1R0A A;  1BQM B;  3N6M A;  4TYA A;  5L39 A;  1S1X B;  2Q6B A;  4OI4 A;  2EFV A;  1J5O A;  4ILM A;  1HL6 A;  2FLO A;  5F8J A;  1BXN A;  1PAE X;  4X66 J;  2VIC A;  3DRR A;  4J9O A;  4IO9 Q;  3H7H B;  3IGN A;  3CW2 C;  2ZH8 A;  1PYS B;  3GQC A;  3A13 A;  2VC0 A;  4HH1 A;  4QU6 A;  2HHW A;  1EET B;  4K7Q A;  4P52 A;  4LF9 F;  3DLE A;  1FTR A;  3ZC4 A;  1FRI A;  2L9N A;  2J0S D;  1B64 A;  3GB0 A;  4FZV A;  2EBG A;  4Q2L A;  1E6V B;  3GLJ A;  4DG1 B;  1FE0 A;  2GHV C;  2HLT A;  3NLC A;  4RW7 A;  2X3D A;  3PW0 A;  4ZVH A;  3RAX A;  4Y2A A;  3OW2 R;  1VQL S;  5DG8 A;  2AYG A;  1ZTW A;  3CJ4 A;  4KO0 B;  4YR2 A;  1YJN S;  1ZTT A;  2F4V J;  3BO3 A;  2KH9 A;  4IOA Q;  5D4N A;  3ISZ A;  4U9R A;  3VAK A;  4LF7 J;  4ED2 A;  2H51 B;  4WPA A;  2W25 A;  1BQN A;  4X4O A;  2XYP B;  4QYR A;  1KHV A;  3TAM A;  4YHH J;  3WIV A;  3LP2 A;  3I0S B;  4ED4 A;  1RWN B;  2ZFH A;  3V6K A;  4N47 A;  1S1X A;  3Q0A A;  5DG7 A;  5E3Q A;  4O4G B;  4XTT A;  5FJ4 A;  4X84 A;  2LCW A;  4WFZ A;  1VBX A;  3BQ0 A;  4DUY J;  1HNX J;  3WHI A;  3R1L A;  5J1E A;  4EO6 A;  2XEX A;  2KI2 A;  3MCN A;  4IH5 A;  1CQN A;  2JEG A;  2OEM A;  3EGW B;  2VKZ G;  1N32 J;  5BXI A;  2M8H A;  2C3O A;  3TJA A;  1W7W A;  2HFS A;  2JHE A;  2M70 A;  5KFO A;  2QG9 B;  4UTG A;  5IM0 A;  3SCJ E;  2KB2 A;  4JV0 A;  4FS1 A;  4GKK F;  3PM9 A;  4UZB A;  1IBC B;  5HJX A;  5LT5 A;  3GFZ A;  3AQP A;  4USW A;  3RR7 A;  4A8X A;  4F4Y A;  4QWB A;  1SC6 A;  5I4M A;  4PYA A;  4AXI A;  1YI2 S;  3D28 A;  4MK9 A;  1V3S A;  2JC1 A;  4UQT A;  4W90 B;  4Q5V A;  1WNE A;  1ICE B;  4X64 F;  4CM2 A;  1CSJ A;  4W92 B;  2GQ2 A;  2QT7 A;  4G1I A;  2FHM A;  2N7C A;  1S0M A;  1CVJ A;  3MXH P;  2MZS A;  3G4S S;  1BWE A;  4O3O A;  4GMK A;  4GO5 X;  3CGI A;  3AY0 A;  3BSN A;  2ZBI A;  1SC1 B;  3S1T A;  2I1R A;  3OTB A;  2XBP A;  1UW4 A;  2LXI A;  1H7X A;  2E5G A;  2ROG A;  2U2F A;  1BLU A;  3G8T A;  3CCJ S;  4LQ3 A;  2AJ0 A;  3KFW X;  3PDN A;  4NZ7 A;  3OJU A;  4X4Q A;  5LMU F;  3KKF A;  1F0X A;  4W98 A;  5KT3 A;  4WKR A;  3T9Z A;  2ZD1 B;  2WW4 A;  4FF4 A;  1Q1K A;  1RP5 A;  1I94 F;  1MSW D;  1URN A;  2FVC A;  2LP4 A;  5KT6 A;  5G4D A;  3TI0 A;  1X4H A;  2HBZ B;  3DGP B;  3HHE A;  4JI4 J;  2GO8 A;  3H5X A;  2XS7 A;  1F9H A;  1TL1 A;  2XG8 A;  3HX9 A;  1Q4R A;  4Y3C A;  3TAM B;  3VVT A;  3IGV A;  5A0Y A;  2UUA J;  4PQU A;  3PIP Q;  2PSZ A;  3LP1 A;  3RW7 A;  4JBC A;  1Q95 G;  2RF2 A;  3OL8 A;  1S6O A;  3UN3 A;  3THT A;  1REG X;  4HTI A;  2JVO A;  3EZU A;  2P6T A;  4CTA B;  2WOM A;  4E0D A;  1OPI A;  2V9W A;  4A8W A;  2HG4 A;  2IM1 A;  2VF3 A;  4EZ6 A;  1U02 A;  1RWU A;  2DHS A;  3JTP A;  3KOA A;  2MMY A;  1JJH A;  5D8H B;  2N7Y A;  3VAM A;  4DFK A;  4LF4 J;  2A0F B;  3MUM P;  1SVD A;  1UVM A;  2RRB A;  3CED A;  3PO5 A;  2EFO A;  3I82 A;  1GX5 A;  4OHZ A;  4QU7 A;  2XMM A;  3H8Y A;  1T9T A;  3MWB A;  3KLI B;  4B3T F;  1IKX B;  1VFJ A;  1KQG B;  3TR5 A;  4PUO B;  1FXR A;  2CVI A;  1BHN A;  1D8Z A;  1KHW A;  4LJM A;  2YWE A;  3QGI A;  4ED0 A;  1JLB B;  1D3W A;  5HBM A;  1MMN A;  3Q2S C;  2AU0 A;  4I68 A;  4B3O B;  5J2N A;  4HHH A;  1RAI B;  3UFC X;  2KTQ A;  1CJT A;  3DGV A;  4X4V A;  2HFN A;  3EGZ A;  4QPT A;  1A7G E;  3DRP B;  3HHL C;  1XNR J;  1OQ6 A;  2M9K A;  2XYH B;  3OV7 A;  3T5J A;  2DH8 A;  2R7U A;  3PFE A;  3EVW A;  2X51 A;  1LFW A;  2FYX A;  1ROF A;  1NAQ A;  4ICL A;  4Z37 A;  1TVR B;  2LEP A;  4X65 F;  2ZKT A;  3OTO J;  3FC9 A;  3MFH A;  4KHP J;  1ZAX A;  2AWZ A;  2BAB A;  2P9E A;  1Q8B A;  3IR7 B;  1RWW B;  4Z7Y A;  2COL A;  4ZMM A;  2LQ9 A;  1R8P A;  3OL6 A;  5D6G A;  2GW8 A;  2ZZN A;  4TU8 A;  3EXY A;  1T9X A;  3VAH A;  1PJ5 A;  3D6H B;  1ZPW X;  2ADC A;  4JI6 J;  3ET6 B;  2YX4 A;  4OX6 A;  1X9S A;  2J0W A;  2QFI A;  5B0F A;  3TA0 A;  2XMU A;  2XQC A;  4DV7 F;  4ECZ A;  5DJB A;  1B0V A;  2DNQ A;  1CC8 A;  5I3P A;  1GT8 A;  1YJR A;  2NSB A;  4JUZ A;  2UV8 G;  2HQC A;  2RDI A;  3R8Y A;  4TQS A;  4C9D A;  3B82 A;  1H7W A;  1EJ7 L;  3I6P A;  4O4R A;  2GCF A;  2MYF A;  3D0G E;  2B5J B;  1O51 A;  1V6H A;  4LSL A;  5D4O A;  4IQM A;  4QJV A;  4MK8 A;  2PFD A;  3AOD A;  4J9U E;  3HK2 A;  1X4E A;  1BWV A;  1R8C A;  2HS0 A;  2OI2 A;  4NWB A;  4OJ3 A;  1H72 C;  2LQB A;  3ZFV A;  5KG2 A;  3Q22 A;  1NDK A;  3BS9 A;  2W1B A;  4KHR A;  5HL7 Q;  3D3C J;  3DXB A;  1HQE B;  2UXD J;  3VV2 B;  1MU2 A;  2B3T B;  3T9N A;  1S6P A;  2AZ1 A;  3MAH A;  1NK8 A;  1HNZ J;  4LFB F;  2QV6 A;  3SSR A;  4JI6 F;  1IKV A;  1ZA2 B;  1FHT A;  3FZB A;  4JV1 A;  3T1H J;  2NZC A;  1NPP A;  2RQ4 A;  5MLC V;  2ATL A;  1J2V A;  1HBM B;  2YKM B;  3R1H A;  3FFI A;  4LIR A;  4M5N A;  2FJD B;  5CXT A;  2ZIT A;  3B4M A;  3EVM A;  3KG0 A;  3ZXW A;  1ZYQ A;  3T1Y J;  2LXF A;  1YJ9 S;  3BB5 A;  4TQR A;  2FJW A;  2NPI A;  4KHP F;  2WVE A;  3R7B B;  1IBM J;  4OZ3 A;  1V9O A;  3QLH A;  3RGI A;  4OX9 J;  2XO6 A;  3WX8 A;  1B99 A;  4L3K A;  3EJM A;  3KJV A;  5CYQ A;  2IBO A;  4L6V 3;  3GJQ B; 
#chains in the Genus database with same CATH homology
 2NCK L;  3ZTQ A;  1NSQ A;  1F6T A;  4W98 A;  1S5Z A;  3NGR A;  3NGU A;  2VU5 A;  3ZTP A;  1B4S A;  3FBB A;  3BBB A;  3VGU A;  1NCL A;  2HVD A;  3VVT A;  4DZ6 A;  3Q8V A;  5CAA A;  4ENO A;  4FKX A;  3B6B A;  1LEO A;  1HHQ A;  1BUX A;  2BEF A;  3VGT A;  3B54 A;  1BE4 A;  1WKL A;  4ANE A;  1NDP A;  3JS9 A;  4AND A;  2B8Q A;  2DXE A;  3FCV A;  3EIC A;  1MN9 A;  5CAB A;  1NHK L;  5C7P A;  3FKB A;  3BBF A;  2AZ3 A;  1HIY A;  1ZS6 A;  1PKU A;  3EMT A;  4S0M A;  1NDL A;  3BH6 B;  4F36 A;  2DY9 A;  4UOH A;  4DI6 A;  1BHN A;  3VGS A;  3FBE A;  1VYA A;  4UOG A;  4O0N A;  1WKK A;  1PAE X;  3VVU A;  1XIQ A;  4F4A A;  3Q86 A;  1F3F A;  1MN7 A;  1NUE A;  4EK2 A;  1S59 A;  3EVW A;  1NB2 A;  4HR2 A;  2HVE A;  3DDI A;  3FC9 A;  3PRV A;  1U8W A;  1EHW A;  1NDC A;  4CP5 A;  1NSP A;  4UOF A;  2DXF A;  1HLW A;  3FCW A;  3ZTO A;  3ZTS A;  2HUR A;  3ETM A;  3NGT A;  4DUT A;  3PJ9 A;  2DYA A;  1K44 A;  1NLK L;  1NPK A;  3FBC A;  3L7U A;  4ANC A;  1XQI A;  2ZUA A;  4C6A A;  3EVO A;  1LWX A;  3Q83 A;  3BBC A;  1WKJ A;  1NDK A;  5BXI A;  2BX6 A;  1W7W A;  1KDN A;  3VGV A;  1NSK L;  2AZ1 A;  3MPD A;  1UCN A;  4WBF A;  3NGS A;  3BH7 B;  3G2X A;  3Q89 A;  5IOL A;  3Q8Y A;  3ELH A;  2DXD A;  1S57 A;  2B8P A;  3EM1 A;  1JXV A;  3R9L A;  3GP9 A;  3EVM A;  3DKD A;  4FKY A;  3FBF A;  2CWK A;  3EE3 A;  3ENA A;  3ZTR A;  4KPC A;  3Q8U A;  3WX8 A;  1B99 A;  3EJM A;  3GPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...