2IC3B

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with nonnucleoside inhibitor hby 097
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 97
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ic3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3B03
4O4RA 3FRZA 1RT6B 3CJ3A 4R0EA 4ECUA 5J1EB 3N6LA 5KFVA 1S6QA 3OHAA 2FVCA 4I2QB 3M9OB 2W9BA 4LSLB 5I42A 4MK7A 4DEZA 1J5OA 2UUWA 1TKZA 1TL3B 3DOLA 3MECA 2CKWA 4IOBA 2YNGA 1QAJA 2EC0A 1FK9A 1RDRA 3ICLA 5L1KA 1S0OA 1N5YB 2ZD1B 3KLIB 1TP7A 2BRLA 2GC8A 2YKNB 3KK2A 5KG7A 3IGVA 5DQHA 5KT3A 1DTQB 4ZPBA 4ICLB 1FKPB 3V81B 2AQ4A 3T5HA 1LWEB 3MEGA 1ZTWA 1S49A 4RU9A 5CYMB 4YR3A 2E9ZA 3GIIA 3LP0A 4PUOB 2V4QA 3KMSA 3BR9A 4EO8A 2IM2A 1LW0A 1U09A 3RAQA 2ILYA 1JLCB 2FVPA 4ZPCA 4B3OA 4FBTA 4PWDA 4RZRA 2R8HA 3KNAA 2JC1A 3BQ1A 1LW2A 4NLUA 1VRTB 1C0TB 3PHEA 1DTTA 1EETB 2HNZB 3GQCA 2XI2A 1S1XA 1TV6A 3OL8A 3RBEA 4K4VA 1RTIA 4O3NA 1TKTA 1RT6A 3H4DA 5KFSA 5J2NA 3I5CA 2JEIA 3IGNA 3IRXA 2VG5A 2ASLA 3V6DB 4IRDA 4I2QA 3EZUA 1MMLA 1D1UA 2XWYA 3BQ0A 4LSLA 1WNEA 2B5JA 4NZ0A 3KLHB 4OL8A 4MK8A 1TL3A 2YNFB 2V9WA 3KLFA 2FJVA 4QWAA 3KLVA 4EBEA 2WB4A 3IS9B 4NCGB 4DL7A 4J9LA 3BSOA 1S48A 2J6TA 4IDKB 4GC6A 1IKWB 4ECSA 3FDSA 3RAXA 3CDEA 4RW6B 2YKMB 3TAMB 1SH2A 4ECWA 2ZE2A 3DRRB 4XO0A 5F8JA 4ICLA 4RNHA 5KFQA 4YR2A 2QE5A 1IKXA 5KT2A 1LWEA 3QO9B 3KHRA 4IFYA 5KFFA 4NYZA 1RT1B 3IG1B 2R2SA 2HWIA 2OPPA 4H54A 2XGPA 4ZP6A 3HVTB 4IR1A 4PQUB 4WE1A 4NLVA 4KHMA 3DRPA 3PW2A 3CJ5A 3H5UA 5KG2A 4J9OA 2IJFA 4KV8B 4O3RA 1C0TA 3KLEA 5EWFA 2VG6B 4NLXA 2JEJA 4F50A 3DI6A 1EETA 3DLGB 4NLSA 4GC7A 2J6SA 4KO0A 4KB7A 2R8GA 4O3OA 3E51A 2XI3A 3V6JA 3QIPB 5C42B 1HNVA 3EPIA 2ILZA 5CYQA 1RT4B 3Q8QB 4K4YA 1LWCA 3LP1B 5F8IA 3I0SB 3OL9A 1Z4UA 1T94A 2OPQB 2IAJB 3LP2B 4QWDA 1LWFA 3PW5A 4G1QB 2WOMB 4ECRA 2HWHA 4R8UB 4Y3CA 1ZTTA 2BQ3A 3DLEA 1JLAB 2RDIA 4F4YA 1JLEA 3DRSA 3C6TB 4U6PA 1JLFA 4KHRA 2B6AA 2IA6A 5KFCA 1EP4B 1IKWA 3CWJA 5C5JA 2IJNA 4KSEB 5KG3A 3QGHA 4DG1A 5KFTA 2R2UA 1T05A 3OL7A 4ID5A 3BQ2A 4EBCA 1RT2A 1TKXB 3NBPA 4ZHRB 2IM3A 4ZVHA 5T14A 4EBDA 1D0EA 3QO9A 5HP1B 5J2QA 3MEEB 2I5JA 4URQU 1NHVA 3CJ0A 2OPRB 3MTKA 2C2DA 3H98A 2BRKA 4NRTA 3I5AA 2WTFA 3KJVA 1KHVA 1RTHB 1HPZB 2JLEA 1HYSB 3NKYA 5JUMA 3KK3A 5L1JA 4RW9A 1HQEB 4KKOB 2ATLA 4O44A 2GIRA 5F9LA 4KBIA 1SUQA 4J9QA 1UWBB 2YNIB 1IKYB 2IM1A 4I2PA 5DLFA 5C24A 5KFUA 3KMQA 1KHWA 2FJWA 5FDLB 4IFVA 1MU2A 1C1CB 4JV0A 3M9MB 2F8EX 3GV7B 3KOAA 5KFZA 4EO6A 4NLYA 2YNHA 5KFMA 4Q44A 2XC9A 3QGIA 5KFIA 2QV6A 4QW9A 3JSMB 5DQGA 1T03A 5KT7A 2R8IA 4IH7A 3QLHA 2C22A 2W9CA 5D3GB 5HROA 3NAHA 3CJ4A 2HNYB 4R8UA 1RTJA 4IH6A 1S6PB 3SFGA 4ZP8A 2VA2A 3D28A 4K4XA 4TN2A 2RF2B 3C6TA 4IRKA 1IKVA 4KFBA 2V4RA 3UDLA 2UUTA 3UPFA 3M8PA 4ZVGA 1HQUA 1TL1A 2OPSB 4K4UA 3FFIB 5DGBA 3E01B 3I0RB 4Y2AA 4NLGA 3DYAB 1RT3A 3MR3A 5KG0A 1REVA 2VG7A 1RT5A 4H4OA 2BR0A 1HMVB 5KT6A 4I7FB 3T19A 3HVAA 4MFBA 2WONA 4LSNA 3KK1B 3OSPA 4HYKA 2OPRA 4Q0BB 2O5DA 4MIBA 3MR5A 1HPZA 1JKHB 1R0AB 5C25A 3BGRB 4TQSA 1DLOB 3MR6A 5DG7A 3HKWA 3CDWA 2HNDA 5L1IA 3PW4A 4KKOA 3V4IA 1SV5B 2R2TA 4TY8B 1S97A 3ITHB 1N6QA 4LQ3A 3H5SA 5KFAA 4RW7B 3CJ2A 3GIMA 4NLWA 1K1SA 5J1EA 1QE1B 1IM4A 1C1CA 2HMIB 3H2LA 3BSCA 5J2MB 1C1BB 3G86A 4IKAA 1RAJA 4QW8A 3Q8RB 1FKOB 2BANB 1S1UB 4NLTA 4ECXA 1RYSA 2D3ZA 3GIJA 2WCXA 3G6YA 1JLQB 5I3UB 4IG3B 1N5YA 2ZD1A 3KLIA 1I6JA 2FVSA 1OS5A 3LALA 1QUVA 3QYYA 5KFEA 3MEDB 4RUCA 2YKNA 4ECZA 4IQXA 1DTQA 2AGOA 1FKPA 3V81A 4YMEA 4URGA 4WYWA 3DMJB 5KFRA 2E9RX 2IC3B 1JLGB 3HHKA 5CYMA 1SH3A 1HMVA 4PUOA 4IG0B 4YQWA 3T1AA 3CDUA 3RB0A 4IRCA 3BJYA 2UVWA 2XGQA 1HNIB 1KLMB 1RA6A 4MIAA 3CIZA 2CJQA 1JLCA 4EYHB 3PZPA 3PW0A 2UVUA 3QGGA 5KG1A 5F8LA 3OHBA 4ZMMA 5DGAA 3OLAA 4R5PB 1S9GB 1JLBB 1VRTA 3DM2B 2BE2B 5DG9A 1BQNB 3KLGB 4NLRA 2BQRA 4RW4B 1TVRB 2HNZA 1XR5A 3NAIA 3MR2A 4ECVA 3G6VA 5DLGA 3ISND 5KFWA 2D7SA 3DDKA 4QWBA 4FS1A 2AU0A 1S9EB 1TQLA 3Q8SB 3V6DA 2HMIA 1RTDB 4KAIA 3KLHA 3H40A 1FKOA 2YNFA 4J9KA 3H59A 3PJXA 3IS9A 4NCGA 4WXWA 4H4MB 2C28A 4IDKA 1JLQA 4DL2A 2JEFA 5I3UA 3LAKA 4IG3A 4X2BA 4RW6A 1N56A 2YKMA 3TAMA 3V6HA 3MEDA 4F4ZA 3DRRA 4URSA 4RW8B 4IH5A 1S6QB 4MH8A 3PR5B 3JYTB 2WRMA 3DMJA 5F8HA 1S0MA 2IC3A 5KFOA 2XCAA 5I42B 1S10A 3RBDA 1J5OB 2V0NA 2AGPA 4ZP9A 3VQSA 1RT1A 3DOLB 3IG1A 4J9NA 2E9TA 3HVWA 3MECB 4K4ZA 1N4LA 3HVTA 2YNGB 3DOKB 3FSIA 4NLDA 5KFDA 4MKBA 4Q43A 4FS2A 3T5LA 1FK9B 4PQUA 1ZETA 4TQRA 4DL4A 4MK9A 1S1WB 4KV8A 2BE2A 4Y2CA 4ED6A 4ECQA 2VG6A 3KK2B 3PR4A 3T5JA 3DLGA 4WYLA 5KFKA 4LQ9A 1VRUB 4JV1A 2B43A 4EYIB 2I1RA 4K4TA 4QWCA 4ECYA 3QIPA 2R8JA 2D3UA 5C42A 4Y34A 4ED7A 1RT4A 3LP0B 3M8QB 3LANA 3LP1A 3I0SA 1XR7A 5KG5A 3H4BA 1LW0B 2OPQA 3BSNA 2JC0A 2FLLA 2IAJA 3LP2A 4B3OB 4ZPAA 4G1QA 2WOMA 1RT7B 3FQLA 1JXLA 4RNFA 2W8KA 4ED8A 2C2EA 2RKIB 1JLAA 1DTTB 4TXSA 3M9NB 3ISNC 1C0UB 2W7PA 4ZP7A 1S1XB 1TV6B 5K14B 1JIHA 3RB3A 4H4MA 3NL0A 1EP4A 2R8KA 1RTIB 1S1VB 4QWEA 1TKTB 3FQKA 4M95A 5KFPA 4WFYA 5F8NA 4TY9A 4XPEA 4JUZA 5J2NB 2RDJA 4HKQA 4RW8A 3TVKA 3IRXB 2VG5B 1TKXA 4ZHRA 3I5BA 3JYTA 3TQ1A 3KHLA 3MF5A 5HP1A 2ASDA 3PW7A 5KFJA 4F4WA 3MEEA 2B5JB 3KHGA 3BSAA 4ED2A 5KFXA 2W8LA 3KLFB 4Q8FA 2R2RA 3SI8A 3NGDA 2ASJA 1RTHA 3DOKA 1HYSA 1SH0A 2IM0A 3CO9A 2GIQA 4NLOA 4DL3A 1HQEA 2AGQA 5EWGA 2AX0A 2J6UA 1S1WA 3RB6A 2ZE2B 3BREA 3DLKB 3C6UB 4Q45A 4J9MA 2DPJA 1UWBA 1VRUA 1IKYA 2YNIA 1IKXB 1YVFA 4QPXA 4IFYB 4O3PA 5F8MA 3NMAA 5FDLA 2XCPA 3M8QA 2OPPB 3UQSA 4U7CA 4O3SA 3MFHA 3JSMA 4O3QA 4FBUA 4G3IA 4WE1B 5KG4A 3DRPB 1RT7A 5D3GA 1C2PA 1K1QA 2HNYA 3KLEB 5KFYA 1S6PA 1S0NA 2RKIA 2OH2A 3DI6B 4O4GB 3V6KA 3LAMA 3PVXA 1C0UA 5L9XA 2RF2A 4KO0B 5K14A 3OLBA 5J2PB 5KFNA 4YR0A 1S1VA 5EDWA 1HARA 1HNVB 2OPSA 5CYQB 3FFIA 3E01A 3I0RA 1LWCB 2ZKUA 3DYAA 3OL6A 3GILA 4DL6A 2IMWP 5L1LA 2UVRA 2DPIA 3OSNA 1LWFB 1JX4A 4I7FA 5DG8A 3Q8PB 2FJXA 4ZVEA 3QZ7A 3QZ8A 3KK1A 1RYRA 5HBMB 2AX1A 4NLQA 4ED0A 4Q0BA 5JXSA 1W25A 5KT4A 2VA3A 3DLEB 2WK4A 1JKHA 1JLEB 3DRSB 1GX6A 1JLFB 1R0AA 2B6AB 4ECTA 3BGRA 5KFGA 1DLOA 3GYNA 5HLFB 3KHHA 4WFZA 4DG1B 1SV5A 4TY8A 3RB4A 2IBKA 3H5XA 3ITHA 1S1TB 3DLKA 3C6UA 1T05B 5EUHA 4ID5B 3CVKA 3GIKA 1RT2B 3NBPB 5DQIA 4RW7A 5J2QB 2BQUA 4RNOA 1QE1A 2I5JB 2FLPA 4RUAA 5J2MA 1C1BA 1T3NA 2FVQA 3KJVB 1BQMB 4J9SA 3KK3B 2BANA 1S1UA 3D5MA 4RW9B 4MKAA 1N48A 5F8GA 4ZVFA 2ALZA 2WHOA 4O44B 3MFIA 4ED1A 4JV2A 1SUQB 4O4GA 4XPCA 3T5KA 1CSJA 4I2PB 2D41A 5C24B 5J2PA 5KFBA 4TLRA 4IFVB 1MU2B 4K4WA 5KFHA 4Q8EA 4RNMA 2YNHB 4J9RA 4RNNA 2W9BB 1JLGA 1GX5A 3N6MA 1T03B 1TKZB 4IG0A 4KE5A 3QLHB 3QIDA 3SFUA 2W9CB 3G6XA 5HROB 2FLNA 1HNIA 1KLMA 5HBMA 5KG6A 4F4XA 1RTJB 4WXOA 4IR9A 4ZPDA 4R5PA 4YP3A 1IKVB 1S9GA 1JLBA 3DM2A 4KFBB 4J9PA 5HLFA 1BQNA 3M8PB 3KLGA 1HQUB 4RW4A 1TL1B 1TVRA 3N6NA 3UR0A 2W7OA 4NLPA 4NRUA 3GV8B 4WFXA 3EPGA 1RT3B 3MEGB 1S1TA 2JEGA 1REVB 2VG7B 1RT5B 4H4OB 4ED3A 4K50A 5KFLA 4K4SA 4M94A 4MFBB 1S9EA 2WONB 4LSNB 3PJWA 2FVRA 1S9FA 3GV5B 4WZQA 1RTDA 4PWDB 1BQMA 2AWZA 4TYBA 5EWEA 1LW2B 5C25B 1S4FA 4WZMA 1NNDA 1XR6A 1RA7A 2HAIA 2HNDB 1NHUA 2W9AA 4EEYA 1QAIA 4TYAA 5F9NA 3V4IB 3H5YA 2C2RA 4DL5A 3IN5A 2UVVA 5KT5A 1N6QB
chains in the Genus database with same CATH superfamily
2CA9A 3O2IA 5I42A 3KYLA 2ZITA 1SPBP 2DCLA 1S0OA 1N5YB 1NUEA 2PMZD 2VBWA 1QSSA 4KIAA 4NMLA 1WG5A 3RW6A 1LW2A 3DU5A 3PHEA 2MKHA 4ZK7M 3RBEA 3TARA 2ZH6A 1TKTA 3BYPA 2CDQA 2FJVA 4FKXA 2WB4A 4X84A 3M32A 1VBZA 2MQ8A 4J9LA 4DL7A 3NS6A 4GC6A 2HHSA 5J1PA 3TAMB 3L3CA 1S12A 3JTPA 4DR1J 2NPFA 5DZ6A 2APOA 1RCXB 1X9WA 3WX8A 3J81U 2UV8G 5EWFA 2JEJA 3DLGB 1CULA 1X5OA 4FVCA 3E51A 1F9EB 2H1YA 2JFDA 3AOCA 5C42B 4N5SA 1EIYB 1Z4UA 2V8VA 2CFXA 2WOMB 4QR2A 1KTQA 1EX8A 3I56S 2RDIA 3DRSA 3DU6A 5KFCA 3CB4A 3BB5A 4H4KA 3FVYA 5KFTA 4LFCF 3ILOA 4EU0A 2I38A 3N01A 1FWLA 4DS4A 3AODA 1I51B 2AEJA 3H8YA 3G8QA 4LF5J 2HVHA 4DFPA 3KUHA 4KBIA 3GFYA 4EO6A 2J5AA 4QW9A 2M8DB 2W9CA 3JQJA 4IH6A 3KDNA 3C6TA 2UXBF 1ELOA 3P49B 4AQYJ 2QZ8A 4WIQA 5DM6Q 3M8PA 3DYAB 1RT3A 4OYOA 3NNHA 1Q53A 2D9OA 2DGUA 3IR7B 3QBCA 5IOLA 3M1VB 2AZ1A 4TY8B 2RB7A 4GO5X 1YJNS 2VC1A 1C1CA 1WC4A 4PR6A 4JV5F 2AF6A 3PTWA 1RISA 3V81A 1WUUA 2LU1A 4L3NA 4QIGA 2FPHX 4CO2A 2DRDA 2JX2A 2X1AA 1JLCA 4KR0B 1N32J 2RMLA 4USIA 1REGX 1H7XA 4YB6A 3ISND 5CHCB 4ED5A 4DV0F 2QRRA 5H9EJ 4F26A 3Q8SB 1SC6A 2NLWA 2GMLA 1GEHA 1WELA 2GV1A 5E3CA 4F4ZA 3CTRA 5HMWA 2OTJS 5KFOA 4NZ6A 1RT1A 1L3SA 3HVTA 1FK9B 2G0JA 3UDVA 2BE2A 4ECQA 3OTEA 2UXCJ 5LMUJ 2IA0A 1U1OA 2CVIA 3W2VA 3BSNA 2OAUA 1IR2A 1U48A 1SQFA 2BJ9A 3L95X 5AE3A 1S1XB 1JJHA 3VVUA 4ETZA 2QYCA 3W3SA 3GB0A 2P9GA 5K8OA 3TVKA 3TZXA 3D68A 3HD2A 2JNJA 3BSAA 4W90B 3OR1A 4X4PA 2XZTB 4OQJA 4K0KJ 3P5BP 3THPA 4IFYB 1RGVA 2CQ1A 3MFHA 4DPUA 4DV3F 2YKQA 5D3GA 2GAGC 2W1BA 2OH2A 4NXMJ 2HBZB 3S6EA 1HNVB 3R7NB 5CYQB 4M5GA 3IXQA 1NK9A 4NLQA 2HEKA 3ETMA 4I69A 2WK4A 3AD8C 3GYNA 3CPWR 4WFZA 2MY7A 5IWAJ 1RWXB 4DL0C 1FTRA 3EYZA 2FLPA 3DHWC 4CRJA 3V2UC 2ZM6J 4TKTA 2A6MA 4A46A 3LTOA 3W9HA 3UCZP 1S7IA 2J7WA 4UZBA 5KFHA 4Q8EA 1PKUA 2F8HA 1U45A 1M5SA 4KE5A 4YB5A 3MDFA 5J1NA 2FC8A 3O5TB 3KLGA 2H65B 4AUKA 4EFAC 4ED3A 1RT5B 2QX0A 2R7XA 1JK9B 3TVYA 1BQMA 5C25B 2M7SA 1MWYA 2KN4A 4PXBA 2VHGA 2K1RB 1RKIA 4DV1J 4O4RA 4LUBA 3A3NB 1DBDA 2EK6A 3VGSA 2W9BA 3MECA 4IOBA 2RHSB 4CH0S 4D3GA 3ICLA 3GCWP 2XLKA 1KS2A 3IAM9 2ZBPA 3AJ1A 4C8OA 2G2YA 5FJ4A 4ZVRB 3A4TA 2ILYA 1KQGB 2CQDA 4N7TA 2R8HA 3NRBA 4DU8A 1OY9A 4X65F 4DV6J 1JXVA 1F0XA 1HBNB 5J2NA 1X9SA 2DXEA 1M1HA 3EZUA 3OTBA 4OL8A 3KLFA 1X60A 3PG9A 2PFFB 2PMHA 1X4EA 5D15A 3KHRA 4LSZB 1HD0A 2D9PA 3C8YA 1GXUA 2GJIA 3GR0A 3CC4S 1RJJA 1U24A 4OZ3A 4NLSA 5A76A 1FDBA 1XMBA 3K5LA 3NGRA 5F8IA 1YJUA 1KBRA 3EWGA 4USTA 5G0RA 2HGNA 4ECRA 2OSQA 4CH1A 1RU2A 1VQMS 1FFWB 1JLAB 1FJGF 3TUPA 1WWHA 4KHRA 2OMLA 2B4PA 5T14A 1T0TV 3QO9A 1IR0A 3VR1A 2L08A 1TZ0A 1IWAA 1MG7A 1SUQA 4J9QA 2R7TA 1HW8A 3KWMA 1Y7PA 3KOAA 3SSSA 2MSTA 4Q44A 2ADCA 2RQ4A 2CPXA 2KJVA 1RTJA 4IRKA 2XULA 2V8GA 3AB4B 1FI4A 1MW7A 4UOHA 4Q2MA 4RL1A 2FJBB 1RE1B 2W2OP 4DV7J 2RQKA 5J2MB 4N8NA 2QLWA 2UXDF 2DNZA 2KHDA 2GO9A 1CEZA 4UW2A 4DV5J 3DRXA 3PW0A 3PZPA 1RACB 2CZVC 4I1TA 1FDAA 3Q23A 4CZCA 3V6DA 2DHAA 2DO4A 4ZA1A 5AT1B 2C28A 4IDKA 1JLQA 1IR1A 1RU1A 3T6JA 3UNGC 1N56A 3SDEA 2HKEA 3PR5B 1OWXA 3K7RA 2LFVA 5C2CA 2VOPA 3T5LA 4Q43A 4MKBA 1RKJA 1UW9A 1WHXA 4MK9A 4X4RA 2GVDA 3AA9A 4QU6A 4QR1A 2EFGA 2NUHA 3C16A 1MN7A 4M5JA 1Y10A 4BS2A 2PC6A 3I0SA 5CQGA 3NCPA 4L74A 2VUGA 2PN6A 4DS5A 5FLXU 4RNFA 5DJBA 2VFRA 2CPEA 4ZP7A 5IZHA 1U2FA 2YVSA 4DFMA 5IFMA 1JWWA 3DLHA 8ATCB 3PX4A 3TQ1A 2DHHA 3IWXA 2BW2A 5IM0B 4Q8FA 4OZ1A 2GGPA 2RH3A 4Y2IA 3SBMA 2LQ9A 5LMNF 1HWLA 3TQEA 5HN0A 3C15A 1KOHA 3FBEA 2YNIA 4DSKA 1IQZA 1NJYA 3VWSA 4F7VA 4C0BA 3PIOQ 1C2PA 2JSXA 5IT4A 2X3GA 2ZH8A 5KFNA 1W2BR 2WSCC 2C3OA 4P10A 3K5MA 3MPDA 2K3KA 3QATA 3L9ZA 1TAQA 5HBMB 2W7AA 5D4LA 1CJTB 2BM0A 3WBZA 2DGTA 4MKVA 4OX9F 3TO8A 5EUHA 4ID5B 2CQ3A 4OX8A 1KR4A 2I5JB 2WZ1A 4ER8A 3PO5A 1TL7B 2NYIA 2MZ1A 1ZA2B 1FDDA 3VAIA 1KP6A 1WI6A 2KXFA 4U8YA 3DOMB 5D0HA 2DXDA 1UL3A 1GX5A 4DJBA 4AD6A 3Q8YA 1AXQA 4PXDA 3T3FA 3N9UC 1BQNA 3UDCA 4WFXA 1REVB 4OZLA 1KFDA 1L5UA 3ZZ0A 1U0HA 1RTDA 1HI1A 5ETMA 1VQ9S 4HH0A 1RBAA 4WFAQ 3WHIA 3N6LA 5T7LB 3IMQJ 3KG0A 1O8BA 1J5OA 1FXLA 3NGSA 3CMAS 2EK1A 3PM9A 1TK8A 2YNGA 2HHVA 3KLIB 2BRLA 4FF1A 2KFZA 5HO4A 1PAEX 1VQ5S 5K8NA 3SEOA 1Z2ZA 1U6ZA 2EI5A 3PFEA 2RQCA 1FRLA 4PWDA 3DNCA 1X4AA 4PZVA 2CVEA 3MAAB 1RTIA 2QFIA 2VJUA 3X3UA 5L38A 4PYDA 3PKMA 2E29A 5CZXA 4ZVSB 2ACYA 3FDSA 3ILIA 3BGLA 1XNRF 1RAAB 1U2CA 3AY0A 4YR2A 5KT2A 2XM3A 3W9JA 4H54A 3F44A 4U9RA 1C0TA 5L8RC 3DI6A 4GC7A 3UVJA 2VPWB 4WTYA 3OL9A 1FNMA 1ZAXA 4AT1B 1JLEA 4DPXA 2EBGA 1GTEA 1PILA 2W24A 1QSYA 4EBDA 1D0EA 4F3OA 1PYTA 3H98A 2HHUA 4ZS6A 2W2MP 2IM1A 2NR0A 5HJXA 2WAQD 4NLYA 2XY7A 2R7VA 4QPTA 1T03A 1HFEL 5EX0A 5ETOA 5HROA 4XAKA 1S6PB 4ZP8A 3UPFA 1OSCA 3GZ7A 1P8GA 3PX0A 3BH6B 2BR0A 3CD5A 2HQ3A 5GAGI 2OI2A 4I7FB 5F41A 4LRBA 3DGPB 1AROP 4LJMA 1IJFB 4N76A 4E8UA 3C46A 1YJWS 2LECA 2FJEB 2I6WA 3JXOA 3BDPA 1N33J 3W7BA 4IKAA 1PIEA 4JI3J 3Q8RB 3KJNB 2QA2A 5IQQA 3HZGA 4DLGA 4FF3A 1KFSA 4DFJA 5I3UB 4HH1A 2MZJA 2YKNA 1EB0A 1FKPA 1SBRA 4WYWA 4OI4A 4UOGA 4V19J 3CDUA 1T11A 1S0VA 1U1MA 3HHEA 3JQKA 2OP5A 3CDAA 2KXHA 4P73A 4PG4A 2D7SA 2EFVA 2ROPA 2HMIA 1R27B 3MURP 3FCVA 1OMSA 2HFOA 4OI2A 2JEFA 4CWBA 4RW8B 1PJ6A 3GP9A 2KH9A 1MLAA 1Z1ZA 4Y28C 5LL6d 3DOKB 4K59A 4YOEA 3I4HX 2VG6A 3KK2B 2YXLA 1LWXA 4EYIB 4QWCA 5AJ3J 5B0FA 1XR7A 5KG5A 4GKKJ 3P6YC 4YHHJ 1TV6B 2QSWA 1I3OB 2HVDA 2XTJP 3MEKA 4F4WA 2HIYA 4WP3A 2EC2A 4E98A 2DJWA 1HR0J 2HFNA 5EWGA 2UUAF 3C6UB 1VRUA 1IKYA 1YVFA 5HVGA 3UN2A 3BN4A 1KLNA 1G1XA 3AOAA 2Z8QA 5AXLA 3CCZA 3OW2R 3G82A 3KLEB 5B0DA 3V6KA 3NY0A 5K14A 1H3DA 1OYEA 1H0HB 3E01A 1LWCB 3OL6A 3SMZA 3MM5B 2Y3YA 3NS5A 1LWFB 4M5DA 3Q8PB 3HJVA 3NWRA 3QZ7A 1WEZA 2G4BA 3D67A 3GJTB 3UN5A 2XS5A 2HSEB 4A8SA 2MGZA 3Q83A 1FO1A 4RUAA 3M30A 3PRBA 4OZ5A 2HZAA 2BKOA 4DHVA 3DXBA 3MMCB 4DR4J 8AT1B 1S99A 2JRSA 3U1MA 2Z2LA 4IG0A 3QLHB 1WC5A 4F4XA 4MTPA 4WXOA 4WKYA 4KFBB 1Y5NB 1VRQC 2MYFA 3T1HF 4NRUA 5KFLA 2RRAA 2WONB 1U25A 2AYBA 3HFZB 2MDAA 4Q2LA 4C3LA 1LW2B 1S6UA 4KT0C 1CBKA 2HAFA 1DFDA 3U1NA 2KRBA 4JI5J 2IYGA 2UUWA 2HG4A 4ZOSA 4AE5A 3PY8A 4AL7A 3N0VA 2ZC4A 5DQHA 1DTQB 4ZPBA 4F3QA 1S49A 3H2UB 1FJEB 1LW0A 4ZPCA 4B3OA 5HQ8A 3SCLE 3I9V9 1UVIA 1YZ7A 2K8GA 1DQAA 2KXNB 2F1FA 2HQDA 4PWUA 1Y3KA 4OHYA 3VGUA 3IS9B 2ZH5A 3BSOA 2HIQA 2LVWA 5HJYA 3ZTOA 4ECWA 1Q5VA 5E3AA 2V8DA 1LWEA 2GAHC 1U1RA 3ZXWA 4NYZA 2R3VA 3W1YC 1U02A 4QIEA 1K8AT 5ETVA 2AJ0A 1ZPWX 2NXEA 4JI8F 4K5RA 2ILZA 1RHQB 3PACA 3EGWB 4G1QB 2XS2A 5AE1A 9ATCB 3C6TB 2HHTA 2KU7A 2IJNA 2VF3A 3J80Y 4DG1A 3KJQB 4JI4J 4EBCA 3PEJA 3ZTPA 4ZHRB 2IM3A 4KPYA 2MKCA 4HACA 3VV2B 4IOAQ 3J7A1 5A8WB 3CJ0A 5HMXA 1SKRA 4DR1F 3WC0A 2ATLA 2DK2A 1C1CB 3S01A 3SSQA 2UUBF 1UVMA 1HKAA 1OY6A 3W66A 3TA0A 4DR3J 3CJ4A 3D1QA 4R8UA 3DDNA 3OTCA 5GVQA 4WP8A 4Y2AA 4RU2A 1VQSA 3MM6A 3CJ8A 5KT6A 3TJ9A 3TZWA 4Q0BB 2CG4A 5L1IA 3UI3A 3TJAA 2JJ4D 4NLWA 4LF5F 2ZDOA 3G6ES 2N3LA 5L39A 4NLTA 4ECXA 3OJSA 3LPYA 4HT5A 4JI2J 2DR5A 2H54B 5H9FJ 1LK7A 2ZD1A 2FVSA 1FRKA 1A0OB 4YFUA 3F0NA 1X5TA 1C4CA 1JB0C 3P8BB 3MUVP 1KLMB 2KYXA 3RGIA 4QYRA 2BE2B 5T41A 1G4CA 3T9NA 1P27B 2V8PA 2CZ4A 1DARA 2F8MA 2MJUA 1R0CB 1S9EB 3W2WA 4Q7AA 2VQFJ 3R2CJ 2BABA 4TU8A 3H59A 1UJ6A 3Q8VA 2BJ1A 4K7QA 4A8OA 2AKWB 2HZCA 4UT4A 5GAEI 2PDAA 3H25A 1SXLA 4DWIA 2K06A 3QFHA 3HP6A 2H5IB 1ULRA 2I8EA 4LVNP 2E5HA 3K57A 3SQGA 2HLTA 1YWXA 2G1DA 2ZH3A 1FXRA 2PA8D 1GAOA 1JIHA 4JYAJ 1RBLA 4M5LA 1H72C 2HQCA 3JYTA 3J7YI 1Q5YA 2V50A 2I0XA 5KFXA 3ENAA 4DN0A 3NGDA 1ZZFA 3CO9A 2AX0A 4CP5A 1U1NA 1RSCA 1VJQA 1TU0B 1JMTA 4KGXB 2OPPB 4U7CA 1RWPB 1WC1A 4G3IA 8RUCA 2HNYA 4GO7X 1C0UA 1RHRB 4YR0A 1Q8IA 5L1LA 1WG1A 2K3IA 3AQOA 1NJZA 1B7YB 1GX6A 4WJBA 4LFCJ 5GMEA 1DLOA 1BUXA 2N3OA 1RHKB 3SV3A 2XY6A 2GMJA 2B8QA 1ICEB 1X4GA 1RHJB 2DNNA 1BQMB 5KOXA 4LF7F 5K8MA 4ZVFA 3MFIA 4FZVA 2HBYB 2CAJA 5C24B 2X1BA 4K4WA 4NXMF 5CZVA 4CT8A 4J9RA 4RNNA 4NMXA 2W9BB 4PABA 2W01A 2UXBJ 2YWEA 1WSVA 1K0VA 1JLBA 3C14A 2BVZA 5D4OA 2V9KA 1S1TA 4K4SA 3TYTA 1R89A 1NU4A 1VGYA 4QIFA 2HFUA 3V4IB 3IN5A 5J1EB 4L72B 2V2KA 2FLOA 1VHFA 3M9OB 4JV5J 3NP5A 3JAMY 4ZDNA 2O66A 1WC6A 3RYLA 2ZHAA 4WBFA 4L3KA 1J27A 2ZJPQ 2H3EB 1F5AA 2LEAA 4ZCKA 4X62F 2GNKA 2JC1A 4MT1A 2AT1B 3TP2A 2AW0A 4B3RJ 3CJRA 5KFSA 4IRDA 4I2QA 1D1UA 2B5JA 3I96A 4OYAA 2OKQA 1UVLA 4RW6B 2ZE2A 4RNHA 2ROEA 1X4FA 2QE5A 1IKXA 1NK6A 3QO9B 1LKZA 2FZGB 3IG1B 1KONA 1NSPA 5DDPC 4DX8H 2ZBCA 5C7PA 1WG4A 1RI7A 2C2OB 1H98A 1RT4B 1NO8A 3VQTA 2RUSA 4WWSA 4P52A 1YHQS 2B6AA 2GZOA 1OYDA 3ZZYA 1NEEA 2FUG9 2OFGX 3D9BA 3RR8A 3TX0A 3LQVA 1VIOA 1YDLA 2BRKA 3KJVA 1KHVA 1RTHB 3ELHA 3CJKA 3NKYA 1Y00A 1HQEB 2ERRA 1NJXA 2P6TA 4GVBB 1KVKA 4RX6A 3PIPQ 5KFUA 3VAMA 4DV3J 3FSYA 4PWWA 2QV6A 2QT7A 2N7YA 4F3MA 2C22A 3A12A 3M6VA 4K4XA 4JI1F 2U2FA 2WVEA 2LMIA 1E6VA 4IUFA 4M5HA 3T19A 2MKKA 1U7LA 3R5AA 1VQ8S 4ZLJA 3OSPA 2OPRA 1TAUA 1YBAA 4TQSA 4KKOA 2X51A 2QMXA 1FEEA 5KFAA 3MMBB 3BSCA 2RRNA 4LR9A 3O1LA 2Y1JA 1S79A 2Z2MA 2XB2D 1JLQB 1V5IB 2L48A 4ELVA 3RB0A 2VDHA 4C0HA 4P74A 4YMEA 2CPHA 1UVNA 2BE9B 2BUNA 2B4UA 4ANEA 3QGGA 5KG1A 2UP1A 3OLAA 4LMZA 1JJ4A 3WX4A 3QRPA 3MR2A 4DCOB 3THVA 2CQ4A 4FS1A 1WDTA 2ZEJA 2E7VA 1FKOA 4DOZA 3CCWA 3M8RA 1QTNB 2BJDA 2OEMA 1EZZB 4DPYA 2MQMA 1APSA 3OVBA 1S6QB 4Z2XA 3PYFA 1AUDA 4WU2A 3FBFA 2YY3A 5ITHA 4ZLLA 2QTWA 4Y2CA 1JNZB 2ZHOA 2E1AA 1RLDA 3FGVA 5D4NA 3MZIA 4NPOA 4N77A 1UA0A 5E3RA 4M5IA 4YEAA 2IAJA 3HT0A 4ZPAA 4X65J 4DDFA 3W64A 1JXLA 2Y1RI 1SI9A 4ANCA 5F8NA 1NPPA 4CH7A 1VJWA 3IRXB 4HR2A 1XBWA 4OYXA 2LP4A 3LWLA 3EICA 4O3PA 1TMMA 1FRJA 4FN5A 2XCPA 5CH7B 2VOOA 2FD2A 2R7UA 2RILA 3KFWX 3JTNA 3MOJB 5D77A 2RF2A 5I3QA 1RUSA 1K0TA 1R6YA 4NA1A 4M5KA 1FJGJ 1Q8KA 3HSGA 5E3QA 4P2XA 1RYRA 4RR5A 1PSDA 3M8WA 2WW4A 5KAKA 2ZH1A 3NBPB 2I2YA 2YBVA 3QNWB 1XNQF 2HK2A 4FXWA 4KH1B 5J2PA 4OFZA 4TLRA 3ZZRA 2OD4A 3TAQA 1NB7A 4LF9F 4YB1P 4YP3A 1FA0A 1ZBTA 1DAXA 1G6BA 2HHWA 2JEGA 4H4OB 2H4YB 3MMAB 4PWDB 4TYBA 2ZOMA 1H2TZ 1RP5A 3CNQP 1XR6A 4K8RA 2W9AA 1MROA 4DL5A 1WOPA 2UXDJ 5H1SV 3U27A 1SL0A 5A2QU 1UFWA 4QZVB 3MI7X 1BE4A 2J9CA 3R5JB 3RU0A 1I94F 2LEBA 4CDIA 2V4QA 2CXEA 1H73A 5F0WA 2Z4PA 3K8WA 2ZWPA 4NLUA 1C0TB 1DTTA 3GTYX 2LCWA 2HHHJ 4I67A 2N82B 1UEKA 4MAKA 4Z37A 4GMKA 2VG5A 2BZ2A 4DV2F 2ZOFA 2LYVA 2DR6A 3BKTA 2QJ3A 2D74B 1TUVA 3AQPA 1B0TA 1R43A 4YS2A 1F60B 4QU7A 3GG0A 2GW8A 2W4DA 4KO0A 1HA1A 1URNA 1Q81T 4RBUA 1NK8A 2OPQB 5E33A 2B3TB 4C3KA 2EFQA 3BPSP 4X66J 1F2HA 3NEKA 1X5SA 3GFXA 5C5JA 1MSWD 3QGHA 2BJ3A 1MN9A 3MEEB 1NCLA 5LMNJ 2JLEA 4LRFA 3RRGA 3NXZA 2HFSA 3FUYA 3KG1A 2YNHA 4A47A 2H9ZA 1S5ZA 3EVOA 5KT7A 1WJ9A 1UPMB 3W5ZA 4I4BA 2ZWOA 4OJGA 3BM7A 1Y4ZB 2V4RA 2UUTA 3D66A 1HQUA 5RUBA 1TL1A 3I0RB 3AH6A 2HWTA 3CJTA 1CC8A 3HVAA 2VH7A 4MFBA 4AFFA 4LSNA 4B9MA 3QSIA 4USJC 4U8VA 4OX9J 3GR1A 1CJVA 1K47A 2HNDA 4DF4A 2OEJA 3I82A 4X4NA 3KXDA 3MM9A 4RW7B 1ZAWA 3LH2S 2HMIB 2O3DA 1VHIA 3CULA 2ZBIA 3X1LB 2C1EB 3VTIA 1VQLS 1KEKA 4A8FA 1LFWA 4BC7A 2R9LA 4MIAA 4B3SF 3IM9A 5HK4A 2MZTA 1VRTA 3PHTA 4RW4B 4ZJLA 3NAIA 2V67A 1X0FA 3R1HA 3HI9A 4DZDA 3HSDA 2J76E 1F5BA 5IT9U 4UTGA 1F3VA 1SIZA 4R0JA 3OXLA 2G13A 2E9TA 3O6QA 4K4ZA 1PGZA 4PQUA 3AOBA 1YX2A 3MXHP 5MLCV 4KV8A 3T5JA 1VRUB 4CLUA 3KUGA 5EHHA 1H74A 2Z2ZA 3K59A 3H4BA 4ES1A 2AIRB 3M4XA 3ISNC 1U26A 5K14B 3IO1A 1YJTA 3OTOF 4EZ6A 4AXIA 1TKXA 2VJVA 4M5DB 4X4VA 5HP1A 2GA7A 2W8LA 4JI7F 2HZVA 1XNRJ 1BD6A 2IPOB 4RBTA 3TR5A 1HBUA 2QL7B 2J9EA 3W5XA 3NMAA 1YBTA 3ET6A 4U95A 4WE1B 3M6XA 4RWXA 2HFVA 3BGFA 1VOMA 1UVJA 4YHHF 3JSYA 1GK8A 5DG8A 3CD7A 2NXJA 4OX7A 3BGRA 1GXLA 3HF5A 3CF5Q 3UCUP 3RZAA 1KNZA 1SV5A 4QYZJ 4NOHA 4OHWA 3E3XA 3GIKA 4ILRA 4A8XA 1AZSA 1RTZA 1L3KA 2BQUA 5GMKa 3U02A 4CQ1A 3J7Z5 1TK0A 4J91A 4OX6A 1BLUA 4O44B 4CO0A 2VDIA 3ZNUA 4I2PB 2IIHA 5GMDA 1B7FA 4IFVB 1MU2B 1RAIB 4RUBA 4RNMA 1YSJA 4BLGA 1JLGA 5LT5A 2DNOA 4X4OA 4ZPDA 3MPWA 3JTOA 1WF0A 1TL4A 5EWEA 4WZMA 1JJCB 2MPUA 2WVBA 1ZOTA 2AYEA 4QOTA 4ECUA 5JMNA 3GJRB 2B7BB 4FYWB 1GMUA 2DHGA 2R7WA 2DXFA 5L1KA 1IBMF 1YGYA 4M1KA 2GC8A 5ETTA 3IGVA 3T5HA 3DFEA 1LWEB 1JQGA 2FY8A 3VAJA 1FT8A 3FMWA 2EPIA 2CQBA 2FVPA 3KNAA 4FPIA 3MM8A 1PCAA 2HNZB 1F9FA 1CC7A 4XDCA 2KDOA 3R2DJ 4DPWA 1IM6A 3I5CA 1L3VA 3SIPB 3OFEA 3M6UA 2A10A 4WK1A 1LQ9A 3D6HB 2V63A 2YKMB 4N56A 3QSYB 4HEA9 1W7WA 2I9SA 4LIWA 3I32A 4KHMA 1B64A 3HMJG 2J6SA 1FE4A 1ZZNA 1U6FA 2DBBA 3RG6A 4QWDA 4I68A 4UF4A 4R8UB 2BQ3A 3NGKA 2IA6A 1IKWA 4L6V3 4ZPVR 3K58A 1T05A 2UU9F 4PCQA 3NOCA 2VZ9A 2DH9A 3RAMA 2UUAJ 4CTAA 1ZAVA 3MTJA 3M2RA 5JUMA 2X7IA 4RW9A 3BO2A 3I87A 2LXFA 4CYUB 4OHZA 3LPEA 2MMYA 4IH7A 2VFTA 1MWQA 2BOAA 2LU2A 2OPSB 4K4UA 2HVIA 1FNOA 4P6QA 5K5MA 5H9FK 1YJVA 1HIYA 1HWJA 2O5DA 1R0AB 3CDWA 2G1HA 3ITHB 2W4PA 3GIMA 1SC1B 3H2VE 2DT9A 1IM4A 4HLBA 3ZC4A 1RAJA 3UN3A 2WVDA 4OV6A 3A8JA 1LXJA 5D0GA 1N5YA 2CQPA 3HLUA 1Q8BA 3TVZA 4A48A 4OIXA 4YQWA 3T1AA 1TFYA 3VHQA 2NPIA 2UVUA 3T1HJ 2NSBA 1S9GB 3DM2B 5DG9A 2N4CA 5KFWA 4CLFA 3Q0AA 2XY5A 3CJQA 4E0DA 2F40A 2LEPA 2LXUA 1W26A 1N36F 2DB1A 3ILLA 3ONQA 4NZ7A 4IG3A 1RHUB 1L3UA 3TAMA 3GJQB 4X64F 4DPOA 4NL5A 3JYTB 1SJFA 3R6GB 2XYPB 2BJEA 4E2FB 3DOLB 4I56A 1TFWA 1KWMA 2XBPA 4ILMA 1AW0A 2KFYA 3CCES 3L4BC 3H5XA 2OEKA 4PRFA 3DLGA 2DIVA 5M2PA 3K8VA 2XNRA 1FNXH 1CQMA 5C42A 4XIUA 2FLLA 2MHEA 3CCSS 3F73A 2WOMA 3ZZOA 2BJ7A 2C3MA 4DV4F 1C0UB 2J9DE 4ZN1A 1N34F 4QJVA 3MF5A 5B0BA 1F3FA 2HHXA 1VS3A 1ZM4A 2IM0A 1SJ3P 3QAUA 1FXDA 4USMA 3HPOA 4S0MA 3RB6A 5DZ7A 4CLKA 1N5VA 3TUZC 3K17A 5B08A 5IV4A 3GONA 2ZNYA 5KG4A 4LREA 4JI8J 1NKCA 2HGLA 3FMBA 2KVQE 3M8SA 3Q89A 1S1VA 4NYOA 1S76D 1VQ6S 4FYYB 3DYAA 2BJ8A 4JYAF 2C3YA 1FTCA 2QLJB 2QC3A 3M1VA 3RTVA 2D3O1 2IRYA 4UY85 4TY8A 4G1PA 1S1TB 1RT2B 5DQIA 5J2QB 3L7PA 4KPCA 3HDSA 4ZCLA 2CWXA 1B0PA 3UD5A 2ZZMA 2UUBJ 1YRUA 4PXEA 1CS4B 4FF4A 1K9MT 2KT3A 2AHOB 2VU5A 4PG7A 2PD1A 2LXIA 2VG7B 3ILJA 1UEVA 1X9MA 1Q86T 3DKDA 4CI0B 1UA1A 2OELA 5CD4H 1NZ8A 5AXNA 1IUJA 3BDEA 2C2NA 1N6QB 3W5YA 3A3PB 3FRZA 3BZQA 4R0EA 3CC2S 1URRA 2CNOB 2YQ3A 1WEYA 2B51A 4I2QB 3R7BB 1FERA 2EC0A 1PJ7A 1FK9A 1R3NA 2PSZA 3PX6A 3IBWA 4Q5VA 4LFBF 4IO9Q 2FJDB 3IR6B 2P9EA 4YR3A 3B8HA 4A8YA 1YG0A 3QT7A 1T9WA 4OYMA 5IC6B 4P75A 2DNRA 2XMMA 2DGXA 1S1XA 3S1TA 5CABA 2FZKB 3O3LA 2NXNA 3SZ2A 2BDPA 4NZ0A 2YNFB 2H4WB 3ENVA 4DX5A 4WPAA 4ECSA 2ZH4A 3ZO7A 3EZ5A 3FZ2A 1M1KT 1HNZF 3RRKA 5AXMA 1M90T 4IFYA 3VCDA 2XSJB 2R2SA 3D7SB 3H5UA 4HVZA 2JL9A 5A6PA 3QJPA 4O3OA 4WU3A 2MHNA 1T9VA 3QIPB 3G96A 1NPKA 2HRTA 1HNVA 5CYQA 4CLTA 1AT1B 3NLCA 1WACA 3LP2B 4B3RF 4Y3CA 1ZTTA 2GVZB 2QLFB 1U6BA 5KG3A 3CEDA 3D6MB 2IJRA 1E6VB 2JLGA 4ZVHA 2OPRB 2HGMA 1HYSB 4KKOB 3FJ2A 4C9DA 2C2KB 4P2SA 2FC9A 2LA6A 3GV7B 2VC0A 1QSLA 3JSMB 2YWGA 3UFCX 2Q3PA 1WI8A 1UTAA 1RWNB 2CNLB 3CCQS 1C4AA 2CDRB 3AAWB 1RT5A 3D1HA 1WHYA 2RRBA 3GYXB 1EJ7L 2IBOA 1V3RA 2M0GB 3DDIA 1JKHB 5C25A 5D78A 3MR6A 3KG4A 2R2TA 2L9NA 2K1RA 4C8LA 2AMCB 3NNCA 2DR9A 1NJIT 2XZDB 2M52A 4LF7J 3O8WA 3H2LA 4V1Ak 1FFGB 1FKOB 2KT5A 2JWNA 4J90A 1MMNA 1NRKA 5A8RB 1LEOA 1H2VZ 2JFKA 4ECZA 5LM7E 2AGOA 3K5NA 1E6YB 3UE2A 3NMRA 1VIXA 3A13A 1XC9A 2MQLA 2RT3A 1P1TA 1HBNA 1TTHB 4GRSA 4ERDA 4U96A 4DL2A 2ACMA 3D2WA 4EK2A 2RVJA 4CO3A 2CPIA 2Q1LA 3B54A 3CGIA 5LSLA 4UOFA 4TQRA 3PR4A 4KYZA 4ALZA 3IM8A 3HFKA 1HQ2A 2D3UA 4X62J 3LP0B 1Q7YT 3DC2A 2HBQB 2YQ1A 1K73T 3WZ0A 1JLAA 1S59A 2CQHA 2RDDA 2WVCA 3FQKA 4JUZA 1KKHA 2IFXA 3IC1A 3IRWP 4G1IA 1SQGA 1KN6A 4CNYA 3J81Y 2J6UA 3V4MA 5BJRA 1YJRA 4DUTA 3PFOA 4OHVA 5KFYA 4OHXA 2KYZA 1B0VA 5J2PB 3E8OA 2EG2A 1KQFB 5EDWA 3MAHA 5ETKA 3G8SA 3MHYA 3P45B 3TEGA 1FE0A 2VQEF 3P3DA 1D9DA 1WKJA 1JLFB 3T1YF 4F0HA 1DQ8A 1Q0NA 4ZVOB 4NYPA 3ZZUA 5J2MA 5KOWA 3KK3B 2A1BA 1MROB 2F65A 1Y3JA 4JV2A 3T5KA 2QO3A 3H0PA 3FC9A 2DO0A 2MQPA 4JI1J 2NUUG 1YTYA 2J8AA 4TLQA 5KG6A 2K2PA 4IR9A 3KKFA 1IKVB 1Q16B 2RNEA 1HLWA 1UEUA 2XMKA 3DRYA 4B9LA 4HT7A 1G2EA 3H7HB 1SKUB 4K5SA 3PJWA 1VYAA 1VQYA 4B9SA 2E1RA 3FZBA 2KI2A 1S4FA 4B3TF 1RA7A 3D6TB 2LQJA 2H5JB 5KT5A 3WQPA 1Q8LA 4J37A 3UNYA 3TAPA 1X31C 4HHUA 1TKZA 2JOQA 5HVHA 1FVQA 2ROGA 4HI2A 2HS0A 2MXYA 1YBUA 4LBHA 1VBYA 3SV4A 3KMSA 2G9OA 2HK3A 4NE9C 2CG8A 1IXKA 4LFAJ 3GQCA 1CJUA 2DGQA 5BXIA 1PYSB 3H4DA 1SQEA 1U1PA 1WNEA 2UV8A 4DR2F 2FHMA 1X4CA 1ZH5A 3VZIA 1D9AA 2KB2A 4L73A 4DQSA 1VK8A 4ICLA 5KFQA 2QLBB 2HWIA 3RBZA 4IR1A 2CQ0A 5D4PA 1AA1B 2KKHA 4ZPWR 2J8SA 1Q7LB 2NXUA 2DGWA 3A8IA 2HHHF 4K4YA 4DMZA 1YI2S 4OYWA 4H4KC 2CNNB 3I31A 4F4YA 4OI6A 4DX7A 4A8KA 4ID5A 4DQPA 2H51B 4C8NA 2I5JA 2FIUA 1CJVB 1TL7A 2YX4A 4B02A 4UQTA 3IBCB 3EX7B 4KHPF 1UWBB 1EKSA 5FDLB 3DOMA 5C2GA 3N5BA 4ED4A 5KFMA 3QGIA 2CJAA 1JJ2R 2RIJA 3MMJA 2MEWA 2CJXB 2XSFA 2V94A 2BKPA 2VPYB 1QY7A 4X66F 3GJSB 4ZLPA 3NOGA 1YK9A 2AJ1A 3FFIB 2B4VA 3B4MA 5KG0A 1REVA 2NYHA 2W2QP 2IVMA 3KNGA 3KK1B 1FJ7A 1R8BA 4JP8A 2R42A 4RUHA 1S97A 2ZBQA 2HRYA 1XNQJ 1FRIA 5T7LA 1QE1B 2LA4A 1C1BB 4QW8A 2O67A 2BANB 1S1UB 3PV8A 2M4MA 3MCMA 3GCXP 1M1GA 2WCXA 1GNKA 5L9NA 3KLIA 5A0YB 4LF9J 5K9FA 3CD6S 2YWWA 4DU7A 2YH1A 2DNYA 1HNIB 2CJQA 2RAQA 3OHBA 4ZMMA 1FHTA 4R5PB 1W2IA 4CLPA 1IBKF 2BQRA 1TVRB 3MAAA 1Y5LB 1OPZA 1HHSA 3DDKA 2IVYA 3OUYB 2C3UA 2HFZA 4KRWA 2Q66A 2KT2A 3MEDA 2KG1A 4URSA 4IH5A 5GAGU 4KQZA 4UUWA 2XCAA 1CJKB 2XLIA 3QT8A 3TUIC 4F04B 5B0CA 2GQ2A 3CIMA 1N8RT 5A6WA 2V2VA 2GIFA 1UZHA 2GJFA 1I94J 3G87A 2VFSA 4WF9Q 2B43A 3L7OA 4J5OA 4K2JA 1FFSB 1DQ9A 2DNMA 3H90A 2BM1A 1VC0A 5JJBA 5B0GA 4XTTA 4TXSA 4KGMA 3PDNA 3K2YA 1UJ4A 3HX9A 4DV2J 2GHPA 4BC9A 5LXRA 3EDQB 1T95A 5HVFA 3UD4P 1N0VC 1HHQA 3CW2C 1BXNA 4UZCA 1AZSB 3MAQA 3ZZPA 1UZDA 3ZFVA 3PO4A 1NAQA 3M8QA 3KJFB 2CADA 1BGXT 4QYZK 3HCXA 2GX8A 3DRPB 3BBBA 4CO4A 1S6PA 2RKIA 3HZEA 3PKYA 3M2VA 3PVXA 2V4JB 3GSDA 1T7PA 2AJ2A 3F41A 3GILA 2L9DA 1RAEB 4LF4F 1KVIA 2DPIA 4I7FA 4ZVEA 2J7UA 3DLEB 2FY1A 1BWEA 1U49A 2V68A 3MCSA 2PO4A 3DLKA 1T9TA 4I0WA 1YLXA 3K5OA 4RWWA 3GWCA 4X4TA 3QWUA 2OUGA 2OHDA 4WFNQ 2ALZA 3M2UA 5GADI 3CC7S 5KFBA 1GMWD 3R5BA 2PIIA 4R25A 2KL8A 1XEZA 2E5JA 5D0EA 1ZA1B 3M7VA 4CLLA 3GV5B 2Z0GA 2AEMA 2CIMA 1NNDA 1QD1A 4TYAA 2C2RA 2PMWA 2FGOA 1NK0A 4DEZA 2NZCA 1O51A 3UDEA 1U8WA 2UZAA 2R7OA 3CSKA 3KK2A 2ZJRQ 3MEGA 2HS3A 3B78A 2XQCA 1OO0B 3N5FA 4B3SJ 5CYMB 1B70B 4PUOB 5CD4A 2HHQA 4RZRA 3BQ1A 1NXIA 1WTBA 1TV6A 1D09B 1PBUA 2KRRA 4OZ2A 1HBMA 2JEIA 3I9ZA 4WTOB 3KLHB 2HVZA 3TUJC 3WIUA 3HKZD 4NCGB 3CCJS 3B82A 2J6TA 1IKWB 2HHPA 4XK8C 3DRRB 4XO0A 3LGHA 3Q22A 5F8JA 1VI7A 1M0SA 4ZP6A 5FLXY 2FGCA 5KG2A 4J9OA 1QAYA 3KLEA 1EETA 1ACMB 4KB7A 1D9FA 2IRXA 3SCKE 1LWCA 3LP1B 3MM5A 4C11B 1LWFA 2JZ5A 4JI0F 1AB8A 1GMVA 3Q2SC 3OTDA 4B3MF 1ITPA 3OTOJ 4DI6A 3R1LA 1EP4B 3CCUS 7FD1A 1UETA 2CQCA 5E5NA 3VAGA 4JI7J 3IR5B 4URQU 3MTKA 1QVGR 1OPIA 1T9XA 3FKBA 3TX8A 3R27A 3EDRB 1AFJA 2Z56B 5HAOA 2FJWA 2F7VA 3MMCA 4YUDA 3QLHA 3GMGA 4DUYF 2DR7A 2BOPA 2MKIA 3WC2A 4Y65A 4KFBA 3FNNA 1RWMB 4OI3A 2XO6A 1L3TA 4LF8F 2B8PA 3R5GA 2WONA 2QMWA 1WOOA 1HPZA 2VKZG 2FHJD 3TA2A 4LQ3A 1DRZA 1HBOB 3ZNJ1 4F2SA 3R6LB 4OJ3A 2YWKA 4Y2KA 1YKWA 2L3MA 1T9YA 1RYSA 3L09A 1WC3A 4IG3B 5KFEA 3LALA 2OGUA 4USKA 1DTQA 1PG5B 1SB6A 3POTB 3T41A 2F9DA 3HHLA 5DDRC 4DQQA 3UWTA 2C3PA 4NLRA 1XR5A 1VK3A 3NGTA 1SCJB 3NCQA 1R8AA 3US5A 3HM9A 2E7XA 3IS9A 2GO8A 2AJ4A 2V2QA 2IC3A 5I42B 2AGPA 3VQSA 1IBMJ 4F0MA 1ZETA 2OO4A 1PYOB 2F3JA 4ENOA 2MSSA 3OT9A 5KFKA 4LQ9A 3IWLA 1F2GA 1VLYA 2I1RA 4P7TA 4L76A 2JC0A 4QCLA 3OR2A 4G1QA 4ZVPB 4N47A 1EQMA 4ED8A 4ZJOA 4H4MA 2UUCF 2ZZTA 1S1VB 1TKTB 5KFPA 4BWJA 4XPEA 4HKQA 4ZHRA 1A9NB 4GKJJ 1HHTP 1CG2A 5ETNA 5B0EA 4ZPTR 3KHGA 5LJ5Y 5A8WA 3QT5A 3M32B 2YX1A 1SH0A 4NLOA 1S1WA 3BREA 2E5IA 1XERA 2DNGA 2GFFA 1KSPA 4DSJA 1WEXA 2EEYA 2JLFA 1CULB 3ZTQA 2CJYB 3GFZA 4AL6A 5GAEU 2IY5B 2XHWA 5HQMA 1IBCB 4B17A 3W65A 2E1PA 4Q0BA 3IP0A 3DRSB 2D69A 2UU9J 4PPDA 2DEIA 2DD8S 3PYDA 2W25A 4Z7YA 5M2RA 1OQ6A 2VICA 4RNOA 4FDFA 4OYBA 2FVQA 3AFGA 3BH7B 3B4DA 5B7WA 2J0SD 3CCMS 1Q95G 2WHOA 2EBEA 2BBEA 1UVKA 4NCBA 2OD6A 3H20A 3VALA 1F6TA 3J7YU 3SFUA 2W9CB 4LF1A 1KLMA 1V3ZA 3IBFB 2ZNZA 1NDKA 3D1OA 2IMOA 3M8PB 3EGNA 2F4FA 1RT3B 5CCMA 1S9EA 1S9FA 3TNVA 3AD9C 2G0IA 2UVVA 3NGUA 2E1CA 1N88A 3N4WA 3TOQA 1QLNA 4NEYA 1NK5A 2CKWA 1QAJA 2WBMA 2EVZA 3V81B 2DRBA 3G4SS 1JLCB 2CPDA 1CQNA 1AUSL 1HWIA 2F4VF 4OZJA 2Y0BB 1N36J 1XN9A 2P8IA 2XMJA 2QL5B 2CWKA 4X64J 3MPYA 3CDEA 1EKRA 4CLSA 2W2PP 4CM0A 2XMTA 4LVOP 1RT1B 2OPPA 3HVTB 2BEFA 4RKUC 2WVFA 1JNRB 1S72S 1WSRA 2K7KA 2R8GA 1V9OA 4U67Q 3EPIA 3W2VB 3Q8QB 3ZTRA 3UCGA 2AZ3A 2KM8C 4DV4J 5GAHU 1QAXA 3BKFA 3DN9A 4F0KA 1N34J 3R97A 4TVAB 1R8HA 4P72A 1B99A 4F25A 2GQQA 4HHHA 2BKNA 2C2DA 3OR1B 4A8WA 4NRTA 4BBYA 2OFHX 1WD6A 4NA3A 5HI7A 1X0PA 5C24A 1A6LA 4QR0A 5CCLA 3GPAA 1NSAA 2XC9A 5D3GB 5JVGQ 4TN2A 2P5VA 3UDLA 1X4BA 6FD1A 3BPDA 1NH8A 5IXUA 4OYPA 3BBFA 1BY9A 3QGPA 1YIJS 3LGMA 1RWOB 2D1CA 1GFWB 2XLJA 1UW4A 3V4IA 4B08A 5J1EA 2PI5A 3ZTSA 3G86A 1KVJA 3PCOB 4PPZA 2D3ZA 1OSDA 3FEZA 4XDDA 4IQXA 4F67A 4DN9A 1PO6A 2ATCB 3IFEA 2DNHA 3BJYA 2UVWA 1T8EA 3W60A 2V5HG 3KLGB 4ANDA 1WF2A 2O1PA 3FRYA 2F5GA 1V5VA 3OVAA 1S77D 4CM2A 3TEHB 1X4HA 1VMBA 3MOZA 3H40A 3UR3C 3EXCX 1OIAA 1U0SA 2VD3A 1XMOF 4PG6A 4RW6A 5BR8J 3V6HA 5IS2A 2GS8A 4MYTA 4USWA 1NH7A 5F8HA 1S10A 1NSQA 3IG1A 3MECB 1QVFR 1VQPS 4LFBJ 3OBIA 1T9UA 1FJCA 1HD1A 4FNHA 4ED7A 1RT4A 3J7AN 4NCAA 4USHA 2ZHBA 4IQMA 4B9VA 1M5VC 2C2EA 3N79A 2ZFHA 2M5YA 3Q8UA 3UD3P 4BHQA 2F63A 2RDJA 5J2NB 1PAUB 5A8KA 2LLZA 1NB2A 5KFJA 4ED2A 4C7QA 3KLFB 3SI8A 1NBEB 1JXEA 1RTHA 3DGVA 5GAHI 1HNZJ 3CUNA 2RD5C 3OVSA 1HQEA 4F02A 3HHNB 4AYBD 3G71S 4GVBA 2B7CB 2AEFA 5F8MA 1PBAA 4O3SA 4LT6A 1RT7A 4F8RA 3HHLC 2QYGA 1G3OA 2W2NP 1WHWA 2ZKUA 2IMWP 4C98A 4LF6F 5G0RB 3BGUA 2ZZNA 3P96A 2YWHA 3ULHA 2CQ2A 4F4AA 4J9VA 3MMBA 3BR8A 4YY3F 4FVMA 5DETA 2QEXS 2M70A 2BXJA 4J9SA 4JI6J 4YDDB 5F8GA 1QDUB 5B09A 1SUQB 2MQNA 3BO4A 1QJHA 3LW5C 3PYGA 1TKZB 1IJEB 2XHCA 3HHDA 3PRDA 1RTJB 3OFHA 1RWKB 4WFBQ 5I3PA 3UR0A 3QQCD 4IYQA 2DHSA 2XMVA 4K50A 3HK2A 2P2CB 4CIOA 4L75A 4DR5F 3D3BJ 2FVRA 2XMUA 3BV8A 2AD9A 2VPXB 5ETRA 3MD3A 1CJUB 1X4DA 4NX9A 1S6QA 1H6KX 5I4MA 2FVCA 4MK7A 5JVHQ 1V3SA 4W4MA 2EFNA 2WBRA 2PA3A 4ICLB 2QG9B 2AQ4A 4NWBA 1TUWA 1N54B 4RU9A 5DDOC 1F5CA 3BYRA 2COLA 4EI2A 4UOCA 2DNLA 2EWHA 4AXJA 2BE7D 1RT6A 4ZCMA 3IRXA 3V6DB 2XWYA 2JH3A 3BQ0A 2FQQB 2AJQA 3A8EA 1OY8A 4IDKB 2KFNA 2CUYA 4DUZF 3SDEB 5KFFA 1WTFA 3PNIA 4FXVA 1D3WA 4GVLA 5DM7Q 1PC5A 3CD0A 3PW2A 2IJFA 1Y5IB 5LXYA 2GVDB 4F50A 4WIIA 3C16B 3V6JA 5AXKA 4LFAF 3I0SB 1T94A 5D0RA 9RUBA 3PW5A 1IBLF 1RCOB 1WORA 1KQSR 2HWHA 2KZZA 2C42A 4NEZA 3W9IA 1VQKS 3MUTP 2R2UA 3NBPA 2R4FA 2VIHA 2VPZB 2GGPB 2PE8A 2DVIA 4DSEA 3FBBA 1FWKA 2EW9A 1HI8A 2J0WA 3C15B 5F9LA 4LRDA 2YNIB 2XYGB 2POKA 4UUXA 3M9MB 2NS1B 3RRHA 3DLJA 5KFIA 3D0HE 2R8IA 2JVRA 3EZOA 2KO1A 2L41A 6FDRA 1NK7A 3R5DA 4ZCIA 1IWGA 1VQ4S 2VQEJ 2VKRA 4H4OA 2E7WA 3T1YJ 3MMAA 3TJ8A 1FDNA 3HKWA 1QM9A 5M2UA 3H5SA 2XG8A 2QFJA 4QIWD 4UQGA 3MR7A 1UFLA 1EHWA 2CPJA 1VQOS 2CYYA 3MEDB 2YPYA 2WSFC 3CO0P 2DYAA 2XGQA 2QIFA 2YPZA 5F8LA 1BQNB 2IYIA 4LF2A 4BWMA 4G6VB 3G6VA 3QWPA 1TQLA 3QT6A 3GSIA 4B3TJ 1HNXJ 1U0HB 1RTDB 2OMOA 3BBCA 3C3LA 2GMHA 4OJ1A 5E3PA 3LAKA 4ZLNA 2DR8A 3EUNA 1WKLA 3DMJA 3FEYB 3RBDA 1J5OB 2V0NA 4FNIA 5CYJA 4J9NA 3HVWA 4BCAA 5KFDA 2YNGB 2FJAB 3RBXA 1WC0A 4NXNF 2CQGA 3O44A 4Y2MA 3TI0A 4CLZA 1Q82T 4ECYA 2R8JA 3DLBA 3M8QB 2OPQA 2DGOA 1NDPA 1NKBA 3W61A 5FIIA 2RKIB 3M2VB 4OI0A 3I6PA 1RTIB 5F0UA 3D0IE 4TY9A 2A2DA 5E7OB 4DR2J 2ASDA 1SKWA 2DITA 4C6AA 2OTLS 3MEEA 4ELUA 1R31A 4F4KA 2AV5A 2MKYA 1SJ4P 1VQ7S 2CPYA 2AGQA 3DLKB 4Q45A 1NHKL 3J80U 1TK5A 1VBXA 4KH0B 1TELA 2OJ3A 3M2UB 1K44A 2IRUA 3DI6B 3EGVA 2VB6A 1GTHA 1WKKA 2PEBA 3UVJB 2M8HA 3I0RA 1FRXA 2UVRA 2HLUA 1XMQF 4ED0A 2J7KA 3SXLA 1JLEB 1RADB 3KHHA 2KM8B 3I55S 3RW7A 4LIRA 4OYZA 4X4UA 4RW7A 2M88A 4KHPJ 3IWNC 2NXCA 3HT3A 3NNAA 1CSJA 1I1GA 3M8ZA 3TWZA 3HVRA 2N7CA 2P9CA 1T03B 2Y0SD 3NCRA 3QAEA 3GU0A 1FWPA 3A8KA 5HROB 2HQFA 2FLNA 4BDPA 2FHKA 5HLFA 4RW4A 2AP6A 3GV8B 3MEGB 1TKDA 1RAHB 1H2UX 3GIRA 2DTJA 4O0IA 4DR7F 1B4SA 3K89A 3W62A 4EEYA 1QAIA 3H5YA 5F9NA 3JS9A 5KFVA 1HBMB 2MJNA 3H42A 5F3TA 1YRTA 7AT1B 1QUPA 5ETSA 1RDRA 1KDNA 4W98A 3AJDA 2AYMA 2YKNB 2DHXA 4U7UK 3IAS9 1FKPB 3CCVS 1VC6A 2KTQA 4ILLA 1P1LA 4I6WA 2RU9A 2IM2A 1U09A 1IBKJ 5IQ6A 4N41A 2KVIA 3MGJA 1EETB 2LDYA 3OJUA 3AXKA 3LWMA 2HQIA 4P9SA 2D3OR 1MMLA 3DCAA 4LSLA 1TL3A 4EBEA 1WF1A 4OZNA 3QPIA 1I5OB 2J0XA 1SH2A 3W63A 3U7JA 1G7CB 2V8HA 3QMQA 2HW3A 4WE1A 4PG8A 1YJ9S 1RABB 2VG6B 4NLXA 2Q6CA 2E5LF 1HNWF 3OD2A 2HRUA 4FYVB 2E66A 3LA0A 7FDRA 1FEHA 4DR6F 2ZUGA 3NG8A 1RB0A 4C2MA 4TU9A 3CJSA 1EAYC 4PG5A 3GG1A 1NHVA 3DXSX 2QLXA 3J81j 1HPZB 4ES2A 2A3JA 2MZQA 4O44A 4K2XA 1RHMB 4J9UE 1IKYB 4I2PA 5DLFA 3P5TL 2R7QA 2MLZA 4IFVA 1MU2A 4JV0A 2ABYA 2F8EX 5DDQC 1NDLA 3VAFA 3FEXB 2JVOA 2MY8A 4KC5A 3G82B 3E2EA 4J7CA 3MD1A 4LF4J 1IQTA 4ZN3A 3E01B 1CLFA 4NLGA 1T02A 3HHLB 1YZ6A 3MR5A 2YWFA 3HULA 4NI2A 3U1LA 1J5EF 1LV5A 2J9DA 4ELTA 2MGZB 1PC4A 3VAHA 4LR7A 2YX7A 3VF0B 1P6TA 4OYIA 4LBPA 3M30B 4OI1A 1R8PA 4DPTA 2VL1A 4HL9A 2OSRA 2E9RX 2IC3B 4MJKA 1HMVA 1YITS 4IG0B 2IDEA 1AFIA 3JAMU 3VGTA 3QJJA 5EN1A 2HNZA 1X5PA 4Y0FA 3OR2B 2QGFB 5A2QY 2HS4A 3PJXA 2DH7A 4WXWA 4H4MB 2ZH2A 2LQBA 3TW0A 2YKMA 2L9WA 3UO0A 4ES3A 1KQKA 2GCFA 2AYGA 1KC8T 2B9YA 1UP1A 2SXLA 1SVDA 2MKJA 1S1WB 3T9ZA 3J7ZT 1LK5A 4Y6IA 4JB8B 4DCJB 1LW0B 2KJWA 4B3OB 1NLKL 3FQLA 4CO5A 1F1BB 3M9NB 3RB3A 3AT1B 3ZZTA 4OLOA 2R8KA 4QWEA 4ZVTB 4WFYA 4PEOA 3I5BA 3HXMA 2HVEA 3KHLA 2QMUB 3AHPA 5HANA 3D0GE 4KJIA 3CCLS 2DGVA 2GIQA 1BQXA 3C2PA 2YH0A 4J9MA 3N28A 1GMWA 3MM7A 4X4SA 2YKOA 4CYUA 4D3HA 5E0OA 2V69A 2EKYA 4O3QA 2Q79A 1K1QA 5H9EK 1Y9OA 4WK3A 3T6BA 4WCEQ 2VASA 2OPSA 3ENWA 4DL6A 1S4EA 4JI0J 4LRCA 4AQYF 3SCIE 4B3MJ 2QA4S 1W25A 4GKJF 1R0AA 4DG1B 3RB4A 3ITHA 3M8YA 1NK4A 4DX6A 3EM1A 1U1KA 4HACB 1VFJA 4PAAA 2H48B 2RUGA 4YB7A 1N48A 2XMAA 2CPZA 2W4CA 4O4GA 5EGYA 4HDGA 2XS7A 4DUYJ 3I4PA 3N6MA 4LR8A 3VZHA 2DISA 4M5MA 3LUYA 1B3TA 1DZ5A 1S9GA 3C66A 3DM2A 1MWZA 2RS2A 4LF8J 3TANA 1N32F 4RO0A 2CPFA 1R6VA 3MM6B 2LQ5A 4HTJA 3SCJE 5IV3A 2XMWA 2AWZA 4MMOA 3EVMA 3AXMA 1N5TA 3CJ3A 5AE2A 3OHAA 4C8MA 3DOLA 2VFVA 1SC3B 2ZD1B 1NZAA 1SL1A 2E9ZA 3OV7A 3GIIA 1DY3A 4EO8A 1IVZA 2UXCF 3JSRA 5LMUF 3CXCR 1RWUA 3OL8A 2YTCA 4PXCA 5IT9Y 1D8YA 3W2WB 5DRKA 3IGNA 2ASLA 4KY3A 3KLVA 4FXDA 1NPRA 1FX2A 4F36A 2DH8A 5ETPA 4K0KF 3G9CA 3KDOA 4PQAA 4O23A 4G65A 1SJQA 1YQHA 1H38A 1O6XA 4B9TA 3SQGB 2KZMA 3QFWA 1X7VA 2UUCJ 4NASA 4U6PA 2AJFE 2IVFB 1VDHA 2FHJA 3BQ2A 4ETXA 1RT2A 2A0FB 1NMEB 3CMQA 5J2QA 3A3OB 1FRMA 4LBIA 3TRGA 5IWAF 5LJ3Y 2ZM6F 4OJHA 3KMQA 1KHWA 3WDOA 2RJZA 1CS4A 2PI4A 5DQGA 1ZM9A 5ADZA 2HNYB 1YRXA 3ENQA 3D28A 2ADBA 3AB2B 4N8OA 5DGBA 2MB0B 5D8HB 2VG7A 2X1GA 2EFPA 4OLPA 2C2MB 2DIUA 3KUEA 4MIBA 2PFDA 1NJWA 1DLOB 3EVWA 5DG7A 5CXTA 3PW4A 4LRAA 1MMDA 4DV0J 1RLCL 5HL7Q 1N6QA 3WIVA 1UWAA 3GFHA 3D6FB 2LQ8A 2DRAA 1O0PA 4DV1F 2XZWA 2ZVSA 2P6SA 4AL5A 1S6OA 1KTVA 2QSFA 1I6JA 4A4JA 3QYYA 2MZSA 2ZC3A 2YKAA 1TL5A 4URGA 1LNQA 2XO7A 4ITSA 1XTZA 2VV5A 1UCNA 1AYEA 2FHOB 1JLBB 3PXGa 3C14B 4Y00A 4ECVA 5DLGA 4KTQA 4DV6F 4EWTA 4HHJA 2YNFA 4CT9A 3FBCA 2LKZA 1XWLA 4Z7CA 2WRMA 5A8KB 2RE1A 2XSJA 4ZP9A 3Q24A 4UY8T 1N4LA 1GXTA 4NLDA 1KOOA 1NDCA 2CNKB 3UW1A 1FESA 4DL4A 4OMFG 4F2RA 4JV1A 3QIPA 1DHMA 4EGLA 3LP2A 2U1AA 4EMDA 1RT7B 2F4VJ 2OIHA 2W8KA 2GVZA 1OJ4A 2W7PA 4M95A 4DXLA 2GJ2A 2HBRB 2EG1A 5BR8F 2B5JB 4ZVUB 4DF8A 4C0OC 2VBZA 1HYSA 1SJRA 3HD1A 1PJ5A 2E1MC 2ZE2B 2ZKTA 6AT1B 5HQLA 1IKXB 3SSRA 3UQSA 3CE8A 3K0JA 3JSMA 4FBUA 4A8MP 4I6YA 1V6HA 1HWKA 2RS8A 2VBYA 2YQ0A 4RJVA 1R7IA 1RAGB 1FKAF 2F9JA 1SC4B 1JX4A 2FJXA 2MQQA 2AX1A 2BA9A 4KGZB 1UPPA 2ZH9A 1JKHA 1ZPVA 2ZVIA 2B6AB 5IT0A 4PKDB 1HW9A 2K7JA 2B9XA 1DJ0A 1OQ3A 1T3NA 4DFKA 3KJVB 3CJKB 1F9HA 3A1YG 3D5MA 4DV7F 1UFKA 5A8RA 3FCHA 2DNQA 1RAFB 2MQOA 3MCOA 1E6YA 3FSXA 4DV5F 3G6XA 1NM2A 2JHEA 1BWVA 4J9PA 4RBVA 2NCKL 1FVSA 4M94A 5EX3A 2FDNA 2ZDPA 3C19A 3EXYA 4A8QA 5F3ZA 3JB9k 4WZQA 3OXGA 2JDJA 1TR0A 4P71A 2HAIA 2M9KA 1NHUA 3BKUA 3KTQA 1FD8A 1VLOA 5CA5A 4JI6F 1RT6B 3MCNA 1HI0P 2GQCA 4HI1A 2FTRA 3LOUA 1A7GE 5BYRA 2ZH7A 2CRLA 5KG7A 4C97A 5KT3A 1RQ0A 2FB0A 3LP0A 3BR9A 4P2MA 3RAQA 1FX4A 1VC5A 4P7VA 2PGCA 3BS9A 2NQPA 2XI2A 4K4VA 4O3NA 3SYZA 4C3MA 4ID8A 2ALYB 3MPUB 5B0AA 4OZ0A 4MK8A 2V9WA 1XMOJ 2KHCA 1N5QA 3CT9A 5L46A 1S48A 2NSCA 4EZ9A 5KTQA 2XNQA 1HWUA 4C8KA 4DQIA 4I64A 2DNPA 4NLVA 4DSIA 1GQEA 2QL9B 3CJ5A 2EXUA 2XI3A 1RZMA 4KGVB 2J0QD 5HATA 2IAJB 4DCPB 3AD7C 1SKSA 3CCRS 1JLFA 1BC6A 3OL7A 2Y8WA 3JSBA 2WTFA 4HDHA 1FCAA 2BMBA 3KK3A 1TUGB 1U4BA 2WB1D 2GIRA 3QRQA 1N5SA 2QA4G 1SIWB 3FK4A 3LF0A 5DS7A 5KFZA 4ZITA 3SFGA 2VA2A 2RF2B 2DKOB 1IKVA 4LF6J 3MR3A 3OPKA 1H7WA 3BF4A 3VAKA 3VVTA 3B6BA 1ZM2A 1VCTA 2B9EA 1RAOA 4DQRA 2Y1LB 4U7UD 2V6AA 4YY3J 5E41A 2M2BA 1K1SA 3CCTA 1Y0HA 1QUVA 4RUCA 1UKUA 3DMJB 2RHQB 3SQOP 3NWGA 1U47A 2BACA 2KG0A 5THWA 4ZIWA 5LOQA 4DR5J 3GLJA 3S8SA 4QIVA 2FYXA 4B9NA 3BN7A 2DY9A 2ASYA 3EMTA 2BV3A 4KAIA 1XJWB 1RK8A 4J9KA 2X1FA 4USVA 1LXNA 4C48A 4MH8A 1S0MA 4YDXA 3Q2TC 5FD1A 2LDIA 3TZYA 3G2XA 4FS2A 2HPUA 1ZM3A 4ED6A 5BYQA 4Y34A 4JOUA 4CO1A 3F56A 1BHNA 3R8YA 1UMJA 3OFGA 1HNXF 1DTTB 1XK8A 3NL0A 3THTA 2BYCA 2VG5B 3BGOP 3EE3A 2HYIB 4P2FA 4DUZJ 3IA0A 3DHXA 1S57A 2HURA 1X8DA 3PRVA 3P4UB 1IN0A 2DPJA 1UWBA 2R7RA 5FDLA 3TA1A 1M5OC 5ETLA 2VFUA 3HSZA 1FD2A 3D54A 4CLYA 1WHVA 5L9XA 4KO0B 2RU3A 3LGNA 1NSKL 4MKYA 2NZ4A 1IBLJ 3FFIA 4MIWA 2GHWA 3OSNA 2Y1IA 3KK1A 4DLEA 1J2VA 5IM0A 5KT4A 2FZCB 5D6GA 4ECTA 4M5NA 2CJKA 1U1QA 5HLFB 4JBCA 1O5JA 2IBKA 3CVKA 2VODA 3OXFA 1QE1A 1XQIA 1C1BA 1N33F 1RWWB 2ZOGA 2BANA 1S1UA 4ZKAA 5U47A 1Z2LA 2NREA 1BMQB 4JI3F 1TMJA 3VGVA 2MKSA 5A0YA 2D41A 5G4DA 2EFOA 1VR6A 2IDLA 1ZYQA 2YNHB 4FYXB 2A2CA 3QIDA 4W92B 4FP9A 1HNIA 5HBMA 3ISZA 1CJTA 4R5PA 1M5KC 1HQUB 2V34A 1TL1B 1TVRA 3N6NA 2W7OA 1Q4RA 1LOUA 4DSLA 3HHLD 1N0UA 3HFVA 4MFBB 1UJ5A 4LSNB 3OUYA 2H5EA 2HQGA 2HNDB 2IHR1 2YKPA 1KRPA 3Q86A 1NKEA 5ETQA 3MM9B 1S7HA 3FCWA 1VBKA 3QRRA 4LSLB 1CJKA 2MLXA 1U1LA 1TL3B 5IC4B 3BEGB 2CQIA 1M5PC 2B4OA 1TP7A 2B9WA 2MZRA 1ZTWA 3PEHA 5AJ3F 4FBTA 2G0CA 2QN6B 3M05A 2QA1A 1VRTB 4GKKF 4HTIA 5GADU 3GE9A 1R0BG 2RSQA 5E2QA 4QWAA 3R7SB 1RXOB 1ROFA 2O01C 3RAXA 1HR0F 3PJ9A 2ZBRA 5LSOA 3R3TA 4TNOA 1P9YA 1MNEA 1VQNS 2XGPA 4NXNJ 4PQUB 3DRPA 1XIQA 5SZTA 4KV8B 3MWBA 4O3RA 1T3OA 2V4JA 1EARA 4B9UA 3AJ2A 2BX6A 4CCHA 5K8PA 4I6AA 1WOSA 4PYAA 2GHVC 2Z57B 3DLEA 4X4QA 4FF2A 4CLWA 3CWJA 4KSEB 5LSRA 4OV1A 2EKNA 2ZJQQ 1CVJA 2WW8A 1TKXB 5HP1B 1N52B 2VBXA 3I5AA 3L7UA 4ATNA 3EGZA 4NI2B 5L1JA 2VONA 1HBUB 3AA8A 1R8CA 2R7SA 4WP9A 2CJ9A 4QBUA 3ET6B 4TU7A 4DR4F 4CNZA 3NAHA 4M63A 4C4WA 2C2ZB 5HMZA 4YN3B 3M6WA 1EQ0A 1U8SA 4ZVGA 3MPVA 3OFFA 5BYSA 1XMQJ 1HMVB 4HYKA 3D3CJ 1VISA 3BGRB 4FYDA 4RLEA 1SV5B 1UAWA 2BW7A 3ZZZA 3CJ2A 4ZVQB 5SUHA 1U2RA 4JI5F 4IO1A 3ETOA 3GIJA 3G6YA 1OS5A 2DCUB 2MTLA 5DO2A 3V5RA 4C8YA 4IOCQ 3G8TA 5KFRA 1JLGB 3HHKA 5CYMA 1SH3A 2M3DA 4PUOA 4FKYA 1SL2A 3DGPA 4IRCA 3CMES 1RA6A 3CIZA 4EYHB 1GT8A 3BO3A 5DGAA 3PYEA 2A6OA 2OLWA 2E44A 4MYUA 2B0GA 2G2OA 4DR7J 4O0NA 4QWBA 2AU0A 2DY1A 4ZIVA 3K5PA 1P9QC 4M8LA 5HSPA 3KLHA 4NCGA 1FF2A 5I3UA 4X2BA 3DRRA 3MUMP 2Q6BA 3FSIA 3RJMB 2V2ZA 3NS7B 2B56A 2DNKA 4WYLA 4C8ZA 4KGKA 4K4TA 3MM7B 3S7RA 3EJMA 3R9LA 2XWXA 3LANA 3LP1A 4C11A 1Q78A 2XYHB 2DEJA 2CJBA 3MM8B 1Q1KA 1FRHA 1EP4A 2E5GA 4RW8A 3TZZA 3PW7A 4JI4F 2MLYA 2R2RA 2PT0A 2ASJA 3DOKA 2ZUAA 4DL3A 3JQMA 1HL6A 2RQMA 4EUVA 3OQ2A 4QPXA 4DSFA 1Q79A 1GH8A 2X3DA 3QJLA 1Y11A 1HNWJ 2E5LJ 1S0NA 4O4GB 2DGSA 3LAMA 3OLBA 1YJ7A 4V19X 4DR3F 3HO1A 1HARA 1ZS6A 3HJFA 4DZ6A 4QQBA 4RPFA 3HSJA 3QZ8A 4DR6J 2VA3A 5JXSA 1D8ZA 2Y9HA 5KFGA 1SJ1A 3CDBA 3C6UA 1T05B 5HMYA 1WDDA 2Z30B 2XEXA 4USUA 1KD1T 1HBOA 3W8GA 1DURA 4CTAB 1RBOB 3M2RB 1RWVB 4MKAA 4RW9B 2Y8YA 2A18A 4ED1A 3ADAC 4XPCA 3R5CA 4FPRA 2N4DA 2CZ9A 4JI2F 3RR7A 3DLLQ 3D4JA 3POTA 3W8PA 3LO3A 5MAOA 1LFPA 4WKRA 2WSEC 2Z58B 1QTMA 3GYGA 4NA2A 5CAAA 1CPZA 5K20B 4NLPA 3EPGA 4ZJQA 3RUBL 2Z2YB 2PEHA 2G2ZA 4DBQA 1J5EJ 1M5HA 2Q43A 2VQFF
chains in the Genus database with same CATH topology
3O2IA 1Q8LA 4J37A 5J1EB 3TAPA 5KFVA 4L72B 1HBMB 2MJNA 2V2KA 2FLOA 5F3TA 1VHFA 1YRTA 3M9OB 5I42A 1TKZA 3KYLA 2ZITA 3NP5A 3JAMY 1QUPA 4ZDNA 2O66A 2DCLA 3RYLA 2ZHAA 2JOQA 1RDRA 1S0OA 1N5YB 1FVQA 2YKNB 2AYMA 2DHXA 2HS0A 2ROGA 3IAS9 4HI2A 4U7UK 2PMZD 2MXYA 1FKPB 2VBWA 2ZJPQ 3CCVS 1VC6A 2KTQA 1QSSA 4ILLA 1F5AA 1P1LA 4KIAA 1VBYA 4NMLA 3SV4A 1WG5A 3RW6A 4I6WA 3KMSA 2RU9A 2IM2A 2LEAA 4ZCKA 1U09A 2G9OA 5IQ6A 4N41A 4X62F 2GNKA 2JC1A 1LW2A 2KVIA 3DU5A 3MGJA 1IXKA 3PHEA 2MKHA 1EETB 4ZK7M 3GQCA 3TP2A 2LDYA 3TARA 3RBEA 2AW0A 3OJUA 2DGQA 3LWMA 1TKTA 2ZH6A 3H4DA 2HQIA 5KFSA 1SQEA 2D3OR 4IRDA 4I2QA 1U1PA 1MMLA 1D1UA 3DCAA 4LSLA 1WNEA 2B5JA 3I96A 1TL3A 2CDQA 2OKQA 2UV8A 2FJVA 4DR2F 4EBEA 1WF1A 4OZNA 2WB4A 2FHMA 3M32A 4X84A 1VBZA 4DL7A 4J9LA 3NS6A 3QPIA 4GC6A 2HHSA 1X4CA 2J0XA 5J1PA 1UVLA 4RW6B 1ZH5A 3VZIA 3TAMB 1D9AA 1SH2A 2KB2A 2ZE2A 3L3CA 4DQSA 1VK8A 4ICLA 4RNHA 2ROEA 5KFQA 1X4FA 2QE5A 1IKXA 1NK6A 3QO9B 3JTPA 3U7JA 1LKZA 1G7CB 2V8HA 3IG1B 2HWIA 3QMQA 2NPFA 1KONA 4IR1A 2APOA 2HW3A 2CQ0A 4WE1A 4DX8H 5DDPC 1X9WA 4PG8A 1YJ9S 5D4PA 2ZBCA 2UV8G 5EWFA 2VG6B 4NLXA 2KKHA 1WG4A 2JEJA 3DLGB 1X5OA 2Q6CA 4FVCA 4ZPWR 1RI7A 3E51A 1Q7LB 2NXUA 2E5LF 2JFDA 1HNWF 5C42B 4N5SA 1H98A 1RT4B 2DGWA 2HHHF 4K4YA 1NO8A 1Z4UA 2V8VA 4DMZA 2CFXA 2HRUA 3VQTA 1YI2S 2WOMB 4H4KC 2E66A 4QR2A 1KTQA 3I31A 3I56S 7FDRA 2RDIA 1FEHA 4F4YA 3DRSA 1YHQS 2B6AA 3DU6A 5KFCA 3CB4A 4DR6F 2ZUGA 4OI6A 3ZZYA 1NEEA 3NG8A 3BB5A 4A8KA 4H4KA 3FVYA 5KFTA 2FUG9 4C2MA 2OFGX 4LFCF 4ID5A 4DQPA 4TU9A 3RR8A 4EU0A 3LQVA 1VIOA 4C8NA 4PG5A 2I5JA 2I38A 1NHVA 3GG1A 3DXSX 2QLXA 3N01A 2BRKA 4DS4A 3KJVA 1KHVA 1RTHB 1HPZB 2FIUA 3CJKA 3NKYA 4ES2A 1Y00A 2A3JA 1HQEB 3H8YA 2ERRA 3G8QA 2YX4A 2MZQA 1NJXA 2P6TA 4B02A 4O44A 2HVHA 4DFPA 4UQTA 3EX7B 4KBIA 4KHPF 4K2XA 1UWBB 4RX6A 1IKYB 3PIPQ 4I2PA 5DLFA 3P5TL 5KFUA 2R7QA 5FDLB 4IFVA 1MU2A