2IC3B

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with nonnucleoside inhibitor hby 097
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 97
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ic3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3B03
3PW2A 1HQEA 1HYSA 2OPQB 3GQCA 2HNZB 4QW8A 1N6QB 2BRKA 3KLHA 1RA7A 1S0OA 2JEIA 2OPQA 2HNZA 3KLVA 2IAJB 1S0MA 4IQXA 2C2DA 2R8GA 4O3NA 1NHUA 3RB3A 4MK7A 4IH7A 5DLGA 2XCAA 4RNMA 5F8IA 4ECTA 5KFVA 2UUTA 3DMJB 4ZPBA 3PW5A 3LP0A 3GILA 3OL6A 1ZTWA 5DQGA 3NKYA 4O3QA 2VG6B 4YQWA 3DMJA 4O3OA 5KG0A 5KFPA 5DG8A 2UUWA 4RU9A 4TLRA 4TY9A 4ZPAA 5JUMA 5CYQB 1TKTB 2VG6A 5C42B 2AX0A 4RUAA 2FVRA 2FLNA 2IM2A 1KHVA 5C42A 2RDIA 5L9XA 4H4MA 2BQ3A 3CJ4A 5KFYA 3GV5B 3IS9B 3E01B 2IMWP 3GV8B 2B43A 4IFVB 3IS9A 3E01A 1D1UA 1S1VB 4IFVA 3GV7B 4ZHRB 2C22A 2OPSB 5L1LA 1TQLA 4J9SA 1S1VA 2ZE2B 3NMAA 2OPPB 4ZHRA 3FQLA 3Q8SB 2ZD1B 2RDJA 4ED1A 2CJQA 3FSIA 1BQNB 2OPPA 5KFGA 2QE5A 2ZD1A 4URSA 3DLEB 4XPEA 1S1UB 3QGHA 4Q0BB 1S1UA 4KFBB 5J2PB 3V81A 1HNIA 4Q0BA 5DGAA 4KFBA 3T19A 4ZVGA 5KG7A 3RAXA 1ZETA 4KE5A 4WFXA 4Y34A 2R2UA 3C6TA 4PUOA 2V0NA 5F8HA 3MECA 2WRMA 4I7FB 4YP3A 5HBMB 4JUZA 3KJVB 5HBMA 4RW7A 4K4WA 5KG5A 2JLEA 4DL6A 3LAMA 4EBEA 3TAMB 2JEFA 5C24B 4MFBA 2R2SA 3PW0A 3TAMA 5C5JA 3KLIB 4KHRA 1MMLA 5C24A 4O4GA 1LWEB 4M94A 3KLIA 2IA6A 2YNHA 2ASLA 1LWEA 4RNOA 4TYAA 2W9AA 3LALA 2XI3A 3BR9A 1Z4UA 2FLPA 3I0RB 4URQU 2FVCA 4QWDA 4M95A 3MTKA 2YKMB 3QYYA 2UVUA 3KLGB 4NLXA 1TVRB 2YKMA 3Q8QB 3KLGA 5EDWA 2AU0A 5KFSA 4IG0B 4LSLB 1S9FA 2CKWA 2R2TA 3N6NA 4K4VA 5KFFA 3SFUA 4IG0A 4NLYA 4LSLA 5CYMB 4WZQA 3H5SA 4NLQA 5CYMA 2XGQA 3T5HA 1C2PA 3BGRB 2YNIB 1EP4A 2AGPA 3CDEA 3IRXB 1HQUB 3BGRA 2YNIA 3MEEB 4RZRA 3RB4A 2ATLA 2BE2B 2BR0A 2VG7A 3IRXA 1HQUA 3FQKA 2VA3A 2R8IA 2HNYB 4EYIB 1S0NA 3DRPB 5I42B 3M9NB 1TL3A 3DOLB 1FKPB 2HNYA 4DG1B 3UDLA 2DPIA 3DRPA 5I42A 4ED3A 3DOLA 4DG1A 2ZKUA 3MR5A 3GIIA 2E9ZA 3KHRA 3M9MB 4QWAA 1RT5B 3NAHA 4ICLB 4DL5A 1IKXB 5KFDA 4ZP8A 1RT5A 4WE1B 4ICLA 3MEDB 1NNDA 3HVTB 1IKXA 1QAJA 4WE1A 5C25B 5J2NB 1RT4B 2YKNB 3HVTA 3MEDA 3V6DA 2W9CB 1REVB 5C25A 4J9OA 4ECQA 1RT4A 2YKNA 4IFYB 4PQUA 5KT3A 4IR9A 2W9CA 1REVA 2IC3B 2YNGA 4F4XA 4IFYA 1IKWA 1HYSB 2B5JB 2IC3A 3LAKA 3KLHB 5KFKA 2B5JA 4ZPDA 3GIMA 4ZVHA 1FKOB 2W8LA 3KLFB 3CVKA 2DPJA 1DLOA 1FKOA 1S9EB 3JYTA 3CDUA 3KLFA 4J9KA 2ILZA 3PW7A 4NYZA 3CWJA 1S9EA 5EWEA 2V4RA 2RKIA 4Q43A 1TP7A 5EWGA 4IR1A 1S49A 3LP0B 5KFBA 4IKAA 3DDKA 3DI6B 1RYRA 3UQSA 5KG2A 3I5CA 4O44B 3GIJA 3DI6A 2IM3A 4GC7A 4ED8A 3KHHA 3BREA 3G86A 5J1EB 2IM0A 1IKYB 4O44A 1U09A 3LP1B 3IG1B 1TL1B 5I3UB 5K14B 4H4MB 5J1EA 1JLAB 1IKYA 1VRTB 2GIRA 3LP1A 1RTIA 3IG1A 1TL1A 5I3UA 5K14A 4NLOA 4NLSA 5DG7A 1JLAA 4MK9A 1VRTA 2E9TA 2RF2A 3H5XA 1W25A 1RTDB 1VRUB 3CO9A 4NLWA 2W7PA 3TVKA 3QO9B 4IH5A 3BSOA 4EBDA 4ED7A 5F8LA 1RTDA 1VRUA 4WXOA 4GC6A 1SH0A 4TXSA 3QO9A 4Q45A 4HKQA 1ZTTA 4K4XA 1DTQB 3KK3A 1UWBA 3QLHB 4KKOA 1XR7A 4ZP9A 3BQ0A 1DTQA 3QLHA 4WYLA 5KFQA 4J9PA 4ECYA 3V6JA 2HNDB 2OPRB 1S9GB 1T05B 3PJWA 4G3IA 2HNDA 2OPRA 1S9GA 1TV6A 3V81B 1HNIB 3BQ1A 1T05A 3BSNA 4PWDB 1S1TB 4RUCA 1T94A 4WFZA 4ECWA 2WB4A 1JLGA 2OH2A 2C2RA 4IRKA 4PWDA 1S1TA 4IDKA 3C6UB 3C6TB 4PUOB 4O4RA 3MECB 4YR3A 5EWFA 4EBCA 4ECZA 4O3RA 4ECSA 3C6UA 3HVAA 4O3PA 3OSPA 1RT6A 4RW7B 1RTJB 4FS1A 1SV5A 4IOBA 2IBKA 1S6PB 1QUVA 1RTJA 5KG1A 2ASDA 3KLEB 3DLGB 3UR0A 4JV2A 1JXLA 3CJ5A 4URGA 1S6PA 5HLFA 4MFBB 1N5YA 2XWYA 3KLEA 3DLGA 4TY8B 1KLMA 4RNNA 4J9LA 2C2EA 4O4GB 2YNFB 1RDRA 4TY8A 5KG4A 4J9NA 4ID5B 2YNHB 2JEJA 3OLBA 4WZMA 2YNFA 3RBDA 3QIPB 3OHAA 4ID5A 4TN2A 1RYSA 4DL2A 1RT7A 3DYAB 3QIPA 5KFRA 5KFAA 4U7CA 3DYAA 3QGIA 4TQSA 4NZ0A 1LWCB 5KFNA 1JLQB 1S10A 3KNAA 2HMIB 1LWCA 1XR5A 3HHKA 1JLQA 4MIBA 2HMIA 5KT5A 1KHWA 2VG5B 2J6TA 3DRSB 3OL8A 1C1BB 5D3GB 4O3SA 1EP4B 1IKVB 1CSJA 2VG5A 1S48A 3BJYA 2WONB 3DRSA 1C1BA 5D3GA 3MEGB 4KO0B 1JKHA 2JC0A 1IKVA 4ZVEA 4XO0A 2WONA 2VG7B 1BQMA 4QWEA 3MEGA 4KO0A 3SFGA 3UPFA 4QWCA 3MF5A 2IJNA 4FBUA 5EUHA 3NAIA 4NLTA 5HP1A 4NLUA 1TL3B 4LQ3A 4MK8A 3KMSA 1QE1B 3PW4A 4DL3A 3EPIA 1QE1A 3LP2B 4U6PA 1SUQB 4NRTA 3LP2A 4ED6A 2WTFA 1I6JA 1SUQA 3OSNA 3QGGA 3VQSA 3V6DB 2AWZA 2WHOA 1EETA 3QIDA 2BQRA 4FS2A 4KAIA 3V4IB 3V6KA 4PQUB 2XI2A 4Y2CA 3H4BA 2VA2A 4IRDA 1HNVB 2YNGB 3V4IA 5KFLA 3OLAA 2V4QA 1IKWB 5J2QB 1SH3A 4J9QA 1RA6A 4J9MA 5L1JA 1HNVA 4RNHA 2W8KA 5J2QA 3PZPA 2UVVA 4KV8B 1S1WB 4K50A 4K4ZA 5F8JA 2QV6A 1C0UB 5KFEA 4KV8A 2D3UA 4MKAA 3Q8RB 1S1WA 1DLOB 5JXSA 2GIQA 4ECRA 4H4OB 1C0UA 3JYTB 1RAJA 2W9BB 5J2MA 2HAIA 4NCGB 3T5LA 1GX6A 3GYNA 4H4OA 1TKXB 3QZ7A 2RKIB 2W9BA 2FLLA 2AGQA 3LANA 4NCGA 2AGOA 4LQ9A 3RAQA 1TKXA 1JIHA 4TYBA 3MR6A 2WOMB 4ZVFA 3ISNC 4NLVA 5F8NA 1JX4A 2WOMA 1JLEB 5KFZA 1K1SA 4K4TA 3MFIA 1T03B 1JLEA 2D7SA 3DOKA 1RTIB 1HPZB 3EZUA 4ECUA 1T03A 4KHMA 5HROB 2RF2B 3HVWA 1HPZA 5KT6A 4TQRA 4MH8A 5HROA 1N6QA 4G1QB 4F4ZA 3NL0A 4KSEB 3T1AA 4NLPA 5KFCA 4J9RA 5DLFA 4DL7A 4G1QA 3IGVA 2IAJA 3KK3B 1UWBB 3MFHA 4KKOB 3SI8A 1JLFB 1XR6A 4QPXA 4K4UA 4F4WA 4RW6B 3KHGA 4F50A 3T5KA 3HKWA 1JLFA 3H40A 3CDWA 4YR2A 1C1CB 4RW6A 4MIAA 3RB0A 1N48A 4K4YA 3EPGA 1C1CA 3BSCA 1DTTB 3E51A 5KG3A 1TV6B 4I2PB 4KB7A 5KFWA 5KFOA 1DTTA 3KMQA 1JLGB 1JLBB 1TKTA 5CYQA 1LW2B 4I2PA 4KBIA 4Y3CA 4OL8A 1NHVA 5F9NA 4IDKB 1JLBA 1LW2A 5KT7A 1T3NA 1WNEA 1RTHB 3N6MA 2E9RX 5KT2A 3CJ3A 4NLGA 4IG3B 1RT6B 1RTHA 3M8PB 2O5DA 3FDSA 2FVPA 4Q8EA 5F8MA 1SV5B 4IG3A 4NLDA 3M8PA 4ED0A 2AX1A 4R0EA 5DQHA 3JSMB 2OPSA 4RW8B 2EC0A 5DQIA 3H98A 1RT2B 2ZE2A 5HLFB 3I5AA 3H4DA 1N5YB 3JSMA 4QW9A 4RW8A 3PVXA 1KLMB 4EO6A 5T14A 1RT2A 1BQNA 3PR5B 3MR2A 3D28A 4F4YA 3DM2B 5L1KA 3KK1B 4Q44A 3DLEA 3T5JA 3DM2A 4RNFA 3KK1A 1RT7B 2IM1A 3M9OB 5KT4A 4DL4A 5J2PA 4EYHB 1LWFB 2XCPA 4YMEA 1MU2B 1S6QB 2FVSA 2R2RA 3CIZA 4WFYA 4RW9B 2FVQA 4IRCA 3KOAA 5F8GA 1LWFA 3I0SB 1MU2A 1S6QA 3DLKB 3M8QB 1YVFA 4ZP6A 4RW9A 5KFTA 4DEZA 4I7FA 3V6HA 1OS5A 4WYWA 3H2LA 3I0SA 3M8QA 3TQ1A 3DLKA 3KHLA 3RB6A 2UVWA 3PHEA 4K4SA 4ZP7A 3KJVA 4R8UB 5DGBA 4X2BA 5KFHA 3GIKA 3BQ2A 4NLRA 3CJ0A 3N6LA 4R8UA 3I5BA 2AQ4A 1FK9B 3IN5A 3DRRB 1QAIA 2BANB 1HARA 1N4LA 1JKHB 2B6AB 1FK9A 3DRRA 5DG9A 2BANA 1BQMB 3FRZA 4ECVA 2B6AA 2V9WA 4IH6A 2J6SA 5HP1B 3BSAA 2ILYA 3NBPB 2ALZA 3IGNA 5KFUA 4MKBA 3I0RA 4I2QB 1K1QA 3NBPA 2I5JB 4I2QA 4LSNB 4YR0A 1TVRA 2FJWA 1HMVB 5FDLB 2I5JA 4LSNA 3OHBA 3RBEA 3H59A 2ASJA 3ISND 2HWHA 1HMVA 5FDLA 3PJXA 1RT3B 3FFIB 4HYKA 4NRUA 1R0AB 3D5MA 3Q8PB 4RW4B 5KFXA 1EETB 2WCXA 1RT3A 3FFIA 1IM4A 5KFMA 2FJXA 4JV1A 2WK4A 1R0AA 1D0EA 2R8KA 4RW4A 1C0TB 2JC1A 4ZPCA 3QZ8A 3G6XA 2R8JA 2D41A 2XGPA 4JV0A 1C0TA 1J5OB 2F8EX 1GX5A 1RT1B 2JEGA 3MEEA 3PR4A 3ITHB 1J5OA 1TKZB 2D3ZA 2BE2A 1RT1A 4Y2AA 4FBTA 3OL7A 4EEYA 2HWIA 3ITHA 1S97A 1TKZA 5L1IA 4EO8A 2FJVA 4ECXA 5KG6A 4ZMMA 1FKPA 5J2MB 4XPCA 1N56A 3ICLA 3NGDA 4WXWA 3OL9A 2I1RA 2J6UA 1SH2A 2BRLA 1JLCB 5F9LA 2R8HA 5KFJA 3H5YA 1S1XB 4B3OB 1JLCA 3G6YA 4ED2A 2XC9A 1S1XA 1S4FA 4B3OA 3MR3A 1LW0B 3KK2B 5J2NA 2IJFA 2GC8A 3CJ2A 4R5PB 4H54A 5KFIA 2C28A 3H5UA 4QWBA 3G6VA 2W7OA 1LW0A 3KK2A 4R5PA 3DOKB 1HQEB 2UVRA 2BQUA 4Q8FA
chains in the Genus database with same CATH superfamily
3I87A 1VQNS 1S0OA 2M2BA 1M5VC 2PMZD 2IAJB 2E5GA 3FUYA 1CQMA 2F65A 2V94A 4ZPBA 4DR5F 2WVCA 3QPIA 4RUAA 5C42B 3SEOA 5KFYA 4CDIA 3TUIC 2QMXA 3E01A 4DCPB 2CZ4A 3GZ7A 4ZHRA 3NGUA 2RDJA 2IRYA 1EJ7L 3U1LA 2OPPA 1R7IA 4PYDA 4URSA 3S7RA 4I6AA 1RACB 1X60A 4Q0BA 3OTEA 4DV5J 2ADCA 3C6TA 4LF8F 3MECA 1LEOA 2B8PA 3DRYA 1D8YA 4YS2A 3ZFVA 2CQIA 1U1MA 4JI0J 4MFBA 3CF5Q 2E5LF 4DOZA 2CIMA 2HVIA 3LALA 2N3OA 1YSJA 3TP2A 2UVUA 2ASYA 4B02A 3ET6B 4DV0F 5A8WA 1NKBA 2UXCJ 1VJWA 3Q83A 4MJKA 2HZVA 2YNIB 4ES3A 2YX1A 3CDEA 1W26A 2IVMA 4RZRA 1NMEB 3M2RA 2GAHC 1HQUA 1UMJA 2ZKUA 2E9ZA 1WC6A 2AJ1A 3JSYA 1S0VA 2POKA 1RT5A 1CQNA 5G0RA 3MEDB 3HVTB 4DV2F 4DR4F 5C25B 4ZS6A 2BM1A 2W9CB 4A48A 1RT4A 4PXCA 4PQUA 2YNGA 5KFKA 4MMOA 1URRA 3GIMA 3ZZZA 1OMSA 4KGZB 3U7JA 1Q8KA 1SC3B 1OSCA 5KFBA 3R1HA 2JDJA 2J76E 2ZWOA 5HI7A 2CVIA 1OIAA 2LQ9A 1IKYB 1EKRA 1X8DA 5I3UB 3THPA 3VAHA 1AZSB 3H25A 4MK9A 4WIQA 1X31C 4IH5A 5F8LA 1YTYA 2Z2ZA 1ZTTA 4Q2LA 4WYLA 3V6JA 4DUZJ 3LWMA 1AFJA 2GMHA 4G1IA 1W2IA 1H2TZ 4ECWA 1GTHA 1JLGA 3POTA 3TRGA 3W60A 4DX8H 4CO1A 3K5PA 1DQ9A 4TY8B 3KG0A 5IWAF 4ID5A 2C3UA 1ZAWA 2EG2A 2VQFF 1WKJA 2RILA 1DARA 1Z2LA 5HSPA 2AJ0A 4TNOA 1B70B 3DLHA 3G87A 5DM7Q 4CO2A 2A6MA 2BKNA 4LF9F 4HACA 5FLXU 4WTOB 1FTCA 2HRTA 2AWZA 3W8PA 1YIJS 2R7RA 1KWMA 1RWOB 4IRDA 4CM2A 4J9QA 2B4PA 3VGSA 2KXFA 4X64J 1RBLA 2P8IA 1TKXB 4I67A 1PSDA 2NUUG 1SQFA 4OI0A 3CC4S 1Q78A 4K4TA 3MFIA 4DCOB 2PEBA 3HVWA 1OQ6A 4LF6J 1Y0HA 4B3SJ 1F9HA 4NLPA 3UCUP 4DL7A 4JYAF 3PIPQ 4LFAJ 1JLFA 1S5ZA 4MIAA 4C0HA 2HLUA 2I8EA 4LRCA 5KFOA 3DGPA 1TKTA 3CEDA 3B82A 2I38A 1JLBA 1S77D 1RT6B 4Q8EA 4LF5F 2F1FA 2FHJD 3I6PA 3CJRA 1P9YA 4KPCA 3BO4A 3TNVA 4Q44A 3J80U 1RT7B 2IM1A 3GONA 4XAKA 4B3TF 4TVAB 2XCPA 1S6QB 2FVSA 2J0SD 3EM1A 1ZM2A 3S01A 4ZP6A 2F4VF 2XNQA 1UZDA 5DGBA 2GVDA 1RBAA 4OI6A 2DHXA 3D6HB 1HARA 1Y5NB 3GPAA 4M1KA 1BQMB 2B6AA 3UNGC 5HP1B 1SJQA 2ALZA 3GYGA 1OJ4A 3P8BB 1WOOA 2XMAA 2ZDPA 1PC4A 1NJXA 1RE1B 3HFKA 2YQ3A 4JV1A 2WK4A 1GXUA 1S59A 4HT5A 5BYQA 4Y2AA 2J9DE 2L41A 2K8GA 1FKPA 4DV6J 3NGDA 1RU1A 5ETKA 1RHKB 3CC2S 2NR0A 3CD0A 4CI0B 3D1HA 4QWBA 4OYWA 3D2WA 1WDTA 4FXWA 4LFBF 1GEHA 3H0PA 1FRJA 1NJZA 2MSSA 3O2IA 1K73T 2LCWA 1M1GA 2C2DA 4O3NA 1DHMA 4IH7A 4P10A 1B7FA 2Y3YA 3QT7A 4ELTA 4NI2B 3P96A 3VGUA 4FKXA 1XK8A 2FLNA 2RDIA 4HI2A 3L95X 4DQPA 1D1UA 2F5GA 2HZAA 4J9SA 3FCWA 1SC1B 3DRXA 3OTBA 4FPRA 3MPVA 3CCVS 1ITPA 1VBKA 2VJVA 4N77A 2ZH7A 3C8YA 2QYCA 1HNZJ 1G3OA 5E3RA 4RW7A 3ISZA 4DL6A 3CO0P 3I4PA 3PO5A 4B9SA 2FLOA 4CZCA 2BJ7A 3EVWA 1IJEB 3OQ2A 3BKUA 2QJ3A 4DR2J 2CJXB 3S8SA 4DR5J 4IG0A 4P7TA 4IOAQ 1N54B 1HNXJ 3MGJA 3BN4A 2NZ4A 2H48B 3JQMA 3WC0A 4DL5A 4OZ3A 4P72A 4YUDA 2CPJA 3NCQA 3D9BA 1FJEB 4LVNP 3E3XA 2CNOB 3PRBA 4ITSA 3G9CA 3DLJA 3MMJA 1EQMA 4CO0A 4UOFA 4ES1A 3PW7A 4NYZA 5EWGA 2E5LJ 1KFDA 2AJ2A 3I9ZA 3DI6B 5KG2A 2DH7A 3QSYB 1JLAB 3NRBA 3D0GE 4L75A 2CJBA 3NGTA 3MD1A 2DGWA 4KKOA 4CNYA 3R2CJ 3BYRA 5BYSA 2DT9A 6FD1A 3GE9A 4KRWA 1S1TA 2EKYA 4O4RA 4O3RA 4X66J 4QYZK 3GFZA 1LK7A 3GR1A 5KG1A 4JV2A 4HEA9 4HDHA 4M5DA 3W3SA 1TK0A 5DDRC 1R3NA 5A6WA 2J0QD 3IR5B 5LM7E 5GAGI 4DS4A 4P74A 2E5IA 3RZAA 1YGYA 1KONA 4ZVEA 1B7YB 2GS8A 5EUHA 3EX7B 4LQ3A 3D1OA 1Q81T 3OTOF 1ULRA 1S99A 1UEVA 1E6VA 2XBPA 3OSNA 1NAQA 3N4WA 4DF8A 2XI2A 4LF4F 2COLA 4OYMA 1RA6A 4JI4J 5D0GA 2HBRB 2QV6A 5KFEA 2IMOA 1RAJA 3MHYA 1RXOB 1R8PA 2VFTA 2DY1A 4DSLA 4DR7F 3IM9A 1U6FA 5LMUJ 2G0JA 5D78A 1FD2A 1IJFB 2FDNA 4DSKA 4K2XA 2MKYA 1Y5IB 1X7VA 5D4LA 2XWXA 3H40A 4OHWA 3CGIA 1N48A 2BW2A 3BSCA 4DSFA 4JI3F 1WHXA 1N8RT 3BV8A 2GHPA 3M1VB 3TR5A 4IG3B 1S12A 2KDOA 3TAPA 1XMOF 1HD0A 4DSIA 2AX1A 2J9DA 1UEUA 3FNNA 1N5YB 3JSMA 1S4EA 2ZBPA 1CJUB 3MR2A 4EUVA 2BVZA 2CDQA 2FQQB 4NA2A 2WW4A 3IBFB 1JXVA 1F5CA 3HHLD 4RW9B 2W7AA 2GZOA 1T0TV 2HFZA 3KHLA 5B0AA 4E2FB 5HQMA 2NXNA 5J1NA 4HT7A 4Z2XA 3RUBL 4HHHA 1U2CA 4E8UA 4OLOA 3NBPA 1YJNS 4I2QA 2HIQA 2ZH5A 3Q8UA 5BXIA 1PAUB 2AZ1A 2GJ2A 4RW4B 3PFOA 1RT3A 4CTAB 3CCSS 2JC1A 1J5OB 3GG1A 5F0UA 5GAEI 4GVLA 4FBTA 3IBCB 1S97A 2XTJP 3E8OA 4H4KA 4C8LA 2BA9A 2V8VA 3RGIA 3HSGA 3DHXA 4B3OA 4ED5A 4QIWD 1YJUA 4CT9A 1HYSA 1PCAA 1RA7A 2A2CA 1IBKF 1J5EF 1S0MA 3UD3P 4FYXB 4OYBA 2QC3A 3LW5C 4Q2MA 3R7SB 3OL6A 2RUGA 2XS5A 1FT8A 3OV7A 3IO1A 2V2KA 3GV8B 1X4BA 3T1HF 2FC8A 1TK5A 3IR7B 1NDCA 3W66A 4N41A 4CQ1A 1G7CB 2XMWA 2I2YA 3I9V9 5AE3A 5F8HA 4KPYA 2VQEF 1HR0F 1KQFB 2JVOA 2CQ3A 2VPWB 3FGVA 4USIA 3C14B 4F67A 1OYEA 5C5JA 5BR8J 3DXBA 4JI8J 3EICA 1XC9A 2ROGA 3C15A 2YKMA 3MAAA 4DFPA 2V68A 5EDWA 2PE8A 1IR0A 4CO5A 1WC0A 1VYAA 2QX0A 2LDIA 3I32A 3BDPA 1H7WA 2AGPA 5H9FK 4ZK7M 2L08A 1N33F 4YHHF 4EGLA 3RRGA 1KC8T 3IP0A 3G2XA 4ICLB 2IDEA 3HI9A 2GGPA 3V6DA 1GK8A 4LMZA 4IR9A 3LAKA 2E5JA 4ZVHA 3CVKA 3NGKA 3MM6B 2K1RB 4ID8A 3GSIA 3CJKA 3DCAA 2RKIA 2IM0A 3QJLA 1PYOB 5J1EA 1UETA 4LRAA 2MKSA 5K14A 3JTPA 4DXLA 2W7PA 5EGYA 4YY3J 1RISA 1DTQB 1Q7LB 5LSRA 2MMYA 5KFQA 2GO8A 4K2JA 3KKFA 4WFZA 2KRRA 2MZRA 5EWFA 2CQ2A 1VIXA 4CWBA 2P6SA 1UVLA 3KG4A 2HK2A 3QMQA 4OLPA 3AJDA 1Y7PA 3R3TA 3M30A 2UP1A 3OUYA 4DWIA 4DV1J 2CPFA 2L9NA 3S6EA 1R6VA 3FCVA 3RRKA 4U7CA 3OJSA 2CFXA 1JLQB 4UF4A 4GVBA 3HHKA 2YVSA 5KT5A 1NDLA 2ZH4A 1WKLA 3EXYA 1AXQA 3DRSA 3MEGB 1U25A 2JC0A 4XO0A 3HSJA 3VALA 4C48A 4K8RA 1M1KT 2RQMA 3LP2A 2V5HG 2MGZB 2DEIA 3M4XA 1WF0A 4KAIA 1MMNA 1CC8A 1T9WA 2KRBA 4YEAA 1IKWB 4AFFA 1WTFA 2CPHA 2YWEA 3ZTQA 1D09B 2ZVIA 3J81j 2D3UA 1DQ8A 1GFWB 3FMBA 4H4OA 2AGOA 1KVJA 4FYYB 3MM9B 1FERA 2YX4A 1Q5VA 3Q86A 1T03B 5ITHA 3FBEA 3DOKA 1QSSA 4ECUA 2HFVA 1CPZA 4DQSA 3EJMA 5CZVA 1AT1B 4F4WA 4UOGA 1C1CB 3TVYA 1HL6A 2CZ9A 2GO9A 4USHA 4C4WA 2DH9A 3SQOP 1RTHB 1FF2A 1M90T 4A8YA 2CUYA 2G4BA 2OPSA 3MMCA 4CH0S 3I5AA 2ZEJA 2MY7A 2QL5B 5DM6Q 2E5HA 1MU2B 2E7VA 2G2YA 1YVFA 2HYIB 4DN0A 3OT9A 4RLEA 3CMAS 1N4LA 4ILLA 3HHNB 2JLGA 1VCTA 1FRMA 4FF1A 2V9WA 4HR2A 1AROP 3ENVA 2CVEA 2CG8A 2MKJA 3DOMA 2LXUA 4OX6A 4E0DA 1HW8A 4DF4A 4ANEA 5CD4H 2V67A 1RADB 3NNAA 2FJVA 3MMBB 1FRIA 4CLSA 4ZCKA 2DNKA 4DX5A 1LQ9A 5CYJA 1Q16B 2OJ3A 4H54A 5KFIA 5JVHQ 1HBMA 2OEJA 3JTNA 2ZOFA 2XLKA 2RMLA 3GILA 2KM8C 1PYTA 2V69A 4RWXA 3DDIA 3E01B 4JOUA 2C3YA 5U47A 4GRSA 4ZHRB 1T95A 1R27B 1TUGB 2OPPB 2XSFA 4QPTA 2Q3PA 3B4DA 4Q0BB 3ILOA 5DGAA 1AA1B 3HX9A 2XYPB 3VAKA 3P3DA 4PUOA 4YP3A 2IY5B 1WC5A 4M63A 3GYXB 3D6TB 2YKPA 1VBYA 4NPOA 4DZDA 2BBEA 4NMXA 2YWGA 4QIGA 2ZHBA 4RBTA 2UUBJ 3TEGA 3SYZA 2ASLA 3B54A 2BXJA 2BMBA 5A8WB 1QVGR 1VK3A 2EFPA 1BY9A 1S9FA 4K4VA 4J37A 3T1YJ 1URNA 2DHHA 4DSEA 3T5HA 4OYZA 3J7YI 4MYUA 1HQUB 2WVEA 2KT5A 1NH8A 3DKDA 3FQKA 2VFUA 2LU1A 2H1YA 2BJ8A 2N4DA 3HHLC 3MR5A 4ES2A 1RT5B 3GFYA 2EBGA 5G0RB 4BWJA 5E2QA 3CIMA 2KN4A 1RT4B 2KTQA 1PJ7A 2BKPA 1FFGB 4LIWA 1TR0A 1N5VA 4ILRA 2PA8D 1DLOA 3AH6A 3KLFA 2DNMA 1RKJA 2J0XA 4FKYA 4V19X 2IM3A 3PX6A 5JVGQ 2ZOGA 4J5OA 1F5BA 1Y5LB 3ZZTA 4Q45A 1UVNA 3ZTSA 1HLWA 2IYIA 1LKZA 4X4QA 1HWUA 2OPRA 1IR2A 4IRKA 2Y8WA 1NKCA 2ZZTA 3POTB 1YI2S 1VQOS 4KH1B 2BABA 3PIOQ 2NPFA 4GKKJ 1HI8A 1QUVA 2UXBJ 1NJWA 4ID5B 1FJCA 2YNFA 2PEHA 1RYSA 4DL2A 2X51A 1HQ2A 2JHEA 4M5IA 3LPEA 4M5GA 3WX8A 5RUBA 2BKOA 1FI4A 2J6TA 2HHQA 2QMWA 3KUHA 1CSJA 2DXFA 3BJYA 4F3OA 4WK1A 1SIWB 4NZ6A 4QWCA 4YDDB 2IJNA 1BXNA 3PG9A 2NXCA 3EPIA 3SCLE 1CJVA 3Q0AA 2VC1A 4OYOA 2DGOA 1FDAA 1VMBA 1MNEA 4X62F 3OFHA 5BYRA 4PKDB 5IXUA 4I56A 1L3KA 2ZC4A 4K5SA 4CLKA 2MQLA 1C4AA 3TZWA 2C2OB 2HAIA 1SJ3P 4DPOA 3VZHA 3AD9C 2V34A 4LQ9A 3W62A 4ZVFA 2JFDA 4DV4F 2X1GA 3DN9A 4L74A 1JLEA 1RWPB 1S6OA 2NXEA 3CT9A 2IFXA 2HGNA 4J9RA 5DLFA 2IAJA 3JXOA 1JXEA 2WW8A 1JLFB 2NPIA 4CO3A 2V8DA 3F41A 3MM8B 3EPGA 1TV6B 2QZ8A 2Z8QA 3D6FB 1DTTA 2GQ2A 1JLBB 1UJ4A 4KBIA 2QLJB 3BH7B 4QZVB 2LQJA 1M1HA 1AUDA 3LTOA 2RT3A 1NK4A 2V8HA 5DQHA 3RW7A 2AYBA 1KLMB 4OYAA 2YQ0A 3V2UC 3VAGA 5K8NA 2WBRA 4WP9A 1JK9B 4DL4A 2GMJA 3VAJA 2BW7A 4IRCA 4WFYA 3FBCA 4NMLA 3FBFA 4DFJA 4Q7AA 3RB6A 4ZVPB 1X5TA 4USVA 2GVDB 5D8HB 3BH6B 2G9OA 2K7KA 1HHQA 3G96A 2B6AB 1O8BA 3UD4P 4LBHA 1WG1A 2F8HA 3BSAA 4LRDA 4PXEA 1PIEA 4GMKA 3LUYA 4XK8C 3H59A 4Z7YA 2ZH3A 3Q8PB 2ZH2A 2CNKB 3PFEA 3G6XA 1GX5A 1RABB 1XNRF 4EO8A 5F9LA 3H5YA 5ETMA 2LECA 2GC8A 2V6AA 1YWXA 2RU3A 3KK2A 4R5PA 4CLLA 3PW2A 1HQEA 3GQCA 4HHJA 1XMQF 2O66A 2HHWA 3I82A 1G4CA 2M4MA 2EI5A 3N28A 1FE4A 2UUTA 1BQXA 4O3QA 2EFGA 3I4HX 2CWXA 4X4TA 1UL3A 3NS5A 1JJCB 3NMAA 3FSIA 2KVQE 3A8EA 3GTYX 5M2PA 3ZZ0A 3X3UA 2W1BA 2HHSA 3AJ2A 5F0WA 4K4WA 5KG5A 4UZBA 4ILMA 3A12A 4C0BA 2UUAF 1GQEA 4J9UE 1LWEA 2QGFB 2WSFC 2Z2LA 3K57A 2XI3A 2JOQA 4ER8A 4N5SA 2M8DB 1TVRB 2PDAA 3Q8QB 4IG0B 1FCAA 3SFUA 4ZLNA 1EKSA 5GADI 2YPYA 3BGRA 2BE2B 1GMVA 3CNQP 2IRXA 4M5HA 3NXZA 2XB2D 5J1PA 4E98A 2KG0A 1DRZA 3W9IA 2GFFA 1RHMB 1EAYC 5H9EK 3PRDA 2NSCA 5M2UA 3HMJG 3MUMP 2XY7A 3TOQA 2HFUA 2JRSA 1N88A 1HBOA 5EWEA 5D4PA 3Q24A 4C3LA 2AD9A 1RUSA 3MM5A 4O44A 5A8RA 3AJ1A 3NP5A 1W25A 1FNOA 3M05A 4LF1A 4NLWA 3I31A 1SH0A 1YBTA 2D3O1 2HURA 1XR7A 4M5LA 2J5AA 2RS8A 3QLHA 2KXNB 4J9PA 1CJKA 2Z0GA 2LQ5A 1ZAXA 1HNIB 1T05A 1S1TB 1T94A 3CCUS 4PPZA 1RT6A 2J7WA 4URGA 5GAHU 4M5DB 4WZMA 2QLWA 3MPWA 3HPOA 1SKSA 1RT7A 2XMVA 3AA8A 1T9UA 3DYAA 8AT1B 4QIVA 3VZIA 1IBMJ 1LWCA 5LXRA 2PT0A 3ZTOA 1OQ3A 1MN7A 1KBRA 1T9YA 2PI5A 5IT9Y 2QL7B 1BQMA 3BBBA 5HP1A 4MK8A 4A8XA 1E6VB 2OGUA 4BHQA 4NASA 2A1BA 2C2ZB 4YB7A 4QU7A 1SUQA 1WOPA 4KQZA 1SXLA 5C2CA 2WHOA 3EZ5A 4C8OA 3UE2A 1RWXB 2A2DA 2RB7A 4DMZA 1GXLA 4KV8A 3A3OB 3G8TA 2GIQA 2OELA 3PRVA 2VH7A 3T5LA 1GX6A 2FLLA 2VDIA 1NLKL 1Y10A 3SDEA 2W4PA 3Q89A 3CJTA 1U0HB 1SC4B 4I69A 1K1SA 2RNEA 1G6BA 1UPPA 1CLFA 1RWNB 4F2RA 2BJ9A 2LU2A 4G1QA 2OD6A 4NCBA 1UA1A 3BKFA 4DHVA 4RX6A 1NSKL 2MZQA 3RR8A 3GJQB 2MZ1A 3JSBA 5A6PA 1LW2A 5KT7A 1R8CA 2DNNA 4UY85 3FDSA 2ZJPQ 3M8YA 3JSMB 3RJMB 1H0HB 2BJ1A 2RUSA 2CNLB 5SUHA 2Q79A 4RNFA 3IFEA 5ETTA 2APOA 4QR1A 3JS9A 4JI5F 2DHAA 1FO1A 1RHUB 4WYWA 1VHIA 3CULA 3DDNA 1H72C 1IBLJ 4LFCF 3TUZC 1Q4RA 4ZLPA 4CH7A 4K59A 2RE1A 3NBPB 4I2QB 1ZZFA 2XHWA 1DFDA 2FIUA 3OHBA 1RT3B 1R0CB 1XERA 4CLYA 4ZJOA 4JV0A 1BLUA 3ITHA 2L3MA 4F0HA 3UDVA 3ICLA 1IUJA 4B3OB 1Y9OA 3G6YA 4UQTA 1S1XA 1LW0A 5HO4A 2NCKL 4W90B 2BV3A 1N6QB 2LLZA 4X4SA 1NXIA 1U8SA 3LF0A 4USTA 5C7PA 1WHVA 2XZTB 3QT5A 1UAWA 3KJFB 1T9TA 4AUKA 1HIYA 3THVA 3LGMA 2IMWP 3H7HB 4XTTA 4P9SA 1BQNB 2HPUA 4MYTA 3BGUA 2YY3A 5L9NA 1XNRJ 4LR7A 4DN9A 2V8PA 4K5RA 4KE5A 4WFXA 4DV3F 3DU5A 1K0VA 3KJVB 2RRNA 2JLEA 4EBEA 4BC7A 1QY7A 4N7TA 3KLIA 5G4DA 4RNOA 3C15B 3AOAA 2YKMB 3MAAB 4A46A 1UA0A 5DS7A 2JWNA 2MZSA 5B09A 4DQQA 2CKWA 2HQFA 2B51A 5MLCV 2ATLA 4USJC 3HT3A 4NXNF 3VV2B 2HNYA 3DRPA 4ED3A 3GIIA 1TU0B 3VQTA 3TZYA 2GGPB 1U0SA 3K5OA 3N5FA 4ECQA 3CB4A 2YKNA 5HK4A 1NJYA 2KJVA 2DO0A 3CJKB 1G2EA 2ZNZA 2UUCJ 3LGNA 2KFYA 5J1EB 2DGVA 5K14B 4QU6A 2X7IA 2LKZA 3LP1A 4P2SA 2XO7A 3RAMA 3CO9A 2JJ4D 1RTDA 4WXOA 4WU2A 1VLOA 3Q22A 3PV8A 1FKAF 1TFYA 1U1RA 1YJVA 2EBEA 1FDDA 2ABYA 4DR6F 2KZMA 4P7VA 3M1VA 4YR3A 4OMFG 4CLUA 1ELOA 3L7PA 3M30B 3OUYB 1N5YA 3HLUA 4O4GB 1RDRA 1YJRA 1TTHB 4YOEA 3AD8C 4TN2A 4CLFA 1JJHA 2W2PP 2YX7A 4AXIA 4B08A 3MWBA 1Q8LA 4GVBB 2CA9A 5CZXA 3R7BB 2MYFA 2VU5A 4X84A 3DRSB 1RWUA 1EP4B 1F2HA 3SQGA 1OO0B 5THWA 2RRBA 1A0OB 1NZ8A 2R7XA 1U7LA 4NLTA 3PW4A 1ZM3A 1JNZB 3LP2B 4OZ2A 1RAAB 3FEXB 3R97A 2MQPA 2DYAA 3JAMY 3H4BA 1RU2A 8ATCB 3JQKA 2B3TB 1MMDA 1HNVA 4RNHA 2W8KA 3D68A 2EFVA 4O0NA 4H4OB 3JYTB 4A8KA 3GYNA 3QZ7A 4MKVA 1PAEX 3TUPA 4Z37A 2FHKA 4B3MF 3FBBA 3SSSA 1B3TA 1R31A 5D0RA 4TQRA 4F4AA 2OSRA 2QA1A 2MQ8A 4LJMA 3T1AA 3IGVA 1UWBB 2H4WB 4DPYA 2MLZA 4QPXA 1IVZA 3JQJA 5LSOA 2M0GB 1P27B 2H4YB 3OPKA 4FNHA 4P6QA 2NUHA 3PACA 2AYGA 3W5ZA 3MMCB 4R0EA 1GMUA 3IR6B 3H4DA 1VI7A 4IQMA 5GVQA 4LRFA 4A8MP 1QM9A 1TAUA 2E7XA 1AFIA 3L9ZA 3CIZA 4ZPTR 3VF0B 1JJ2R 3M8QA 2KB2A 5ETSA 2DNRA 5IS2A 5AJ3F 2AQ4A 2X1BA 3FRZA 4OYIA 1HNWJ 4C6AA 3AHPA 3K5MA 4Z7CA 3TI0A 1N34F 4HYKA 1YJWS 5FLXY 3FFIA 2BZ2A 1TL7B 2AIRB 3M2VA 4CRJA 2JFKA 4KJIA 1GT8A 1NB2A 4EEYA 3P6YC 4ZCIA 2NXUA 2OTJS 2BRLA 3AFGA 2FB0A 2XC9A 1I94F 1HBMB 2IJFA 3GB0A 4ATNA 2W7OA 3IA0A 1XNQJ 1WTBA 3UN5A 5KOXA 2UXDF 2B9EA 1HBNA 1VGYA 5LXYA 1FX2A 1NHUA 1UJ5A 5KFVA 2HQ3A 1S76D 2VICA 5JUMA 2VG6A 2FVRA 3CCLS 1KHVA 1PILA 1RCOB 4C98A 1ZS6A 4J9VA 3CSKA 3GV7B 2W24A 1S1VA 3P45B 2CQ1A 1YZ7A 1V3RA 2HLTA 2EW9A 4PQAA 4PG7A 4KFBA 3T19A 4DUYF 4N8NA 3UFCX 3HDSA 2WRMA 3MUTP 2VKRA 1R43A 2UU9F 3MMAA 3Q8YA 4PAAA 2MSTA 3TAMA 2Z58B 4X65J 1VQPS 4X4UA 3FEYB 1WI6A 1NSPA 2HHTA 2AHOB 2FLPA 1Z4UA 3WHIA 3M6WA 3KLGA 1PBAA 2J9EA 3V5RA 4WJBA 2YKOA 2KT3A 3IRXA 2QYGA 3JTOA 3TEHB 2ZBRA 3VAFA 3QQCD 4RPFA 3A8IA 5KFDA 3H2UB 3X1LB 4WE1A 3DXSX 4WBFA 3FC9A 1FVSA 1J2VA 1U47A 1IKWA 4KHPJ 3N5BA 1U49A 3AB4B 2YKQA 3KLFB 2Y1IA 2PSZA 2R3VA 2CQ4A 2V63A 2AEJA 3G86A 3B6BA 1O5JA 3U27A 4C3MA 3EDRB 4EBDA 2H5IB 2V8GA 1NSAA 2ZH8A 2MQMA 2CDRB 4ZP9A 3CCZA 4QOTA 2OEKA 3VVTA 4AXJA 2OPRB 1FVQA 3VR1A 1UW4A 4WP8A 4QR0A 2HVEA 1A6LA 2J0WA 4NA3A 4V1Ak 3QFWA 5LJ5Y 3UR0A 2RJZA 2YNFB 4M8LA 5KG4A 2QLBB 3GCXP 4C7QA 1WEZA 3SXLA 3CDBA 2W25A 3J7ZT 4FN5A 4X4OA 2DRAA 2HMIA 3LQVA 1FE0A 2QA2A 3VVUA 2WONA 2VG7B 2Y0BB 3UPFA 1NDKA 1JWWA 2X3DA 1I1GA 2W4CA 2DCUB 3ZZOA 1YRXA 2JSXA 5ETLA 4I1TA 2F63A 2Z56B 2NS1B 3QRQA 4FS2A 1U26A 3OTDA 3PNIA 2ZWPA 4USMA 1NUEA 5L1JA 2CJYB 1BD6A 2VV5A 4AD6A 2R7QA 1OPZA 3MMBA 4DPWA 4RJVA 3ILJA 1KOHA 5JJBA 2G13A 2Z2MA 1JLEB 2DTJA 2XS2A 2E1PA 3CUNA 2HBZB 2GMLA 3UD5A 4F50A 3T9ZA 4RW6A 7AT1B 1DTTB 2OD4A 5KFWA 2ZZNA 4Y3CA 3MR7A 3R5AA 4IDKB 3LO3A 2E66A 4NLGA 3BEGB 2LA6A 1X9MA 2UVVA 1KDNA 4RW8A 4CLWA 3OVSA 1QJHA 4LIRA 1FESA 4C0OC 2BM0A 5IM0A 3PY8A 3CPWR 4EYHB 2QL9B 3KOAA 5FIIA 1YJTA 1N36F 3DLKA 1M5KC 3CC7S 1KOOA 4X2BA 4NLRA 2AJQA 1JKHB 3DRRA 3R6GB 3OFGA 5IOLA 3UO0A 3TJ9A 3FSYA 3A4TA 3U1NA 4HHUA 4YR0A 2N82B 2E44A 1VQ8S 4C8ZA 4D3GA 4WCEQ 1R0AA 2JVRA 1F2GA 1SQGA 2FUG9 2GIFA 4QJVA 3TANA 4DU8A 1KVKA 1RAHB 4LRBA 2ZUAA 1H2VZ 4HTJA 4LR8A 4ELVA 4LBIA 1VQYA 2G1HA 2WVFA 5KFJA 4AQYF 1HFEL 2OI2A 2HVZA 2V4JA 3KK2B 4R5PB 1X0PA 1HQEB 2UVRA 5EN1A 3CJ8A 1FEEA 3AB2B 2BJEA 2OPQA 2IA0A 3R5DA 1WEXA 4L6V3 5DLGA 2DNHA 3TJ8A 4F7VA 4CIOA 5CHCB 4OIXA 4L72B 3DMJA 5KG0A 4OJ3A 4NXMF 3BBCA 3T3FA 5B7WA 3GV5B 4JI2J 4DPUA 1VLYA 1LXJA 1PKUA 1KNZA 3GIRA 3DGVA 1XIQA 4I7FB 4ZVTB 3D0IE 1SJ4P 4DV7J 5HBMA 4DR1F 4LREA 1FNMA 3D1QA 3CD7A 5C24A 1LWEB 4M94A 1PO6A 5CAAA 3UWTA 3I0RB 2FVCA 1WC3A 5KFSA 3CW2C 2CPDA 1WI8A 1UFKA 1Z2ZA 3BGRB 2MJUA 2EC2A 2VA3A 3HO1A 3PKYA 2M3DA 2KZZA 3KHRA 2KU7A 1T8EA 4W4MA 4CLZA 2M7SA 3MTJA 5KT3A 4RKUC 2QG9B 2ZBQA 3KLHB 2B5JA 1TELA 1Q86T 3GR0A 2W8LA 1FKOA 1HBOB 3UNYA 5AE1A 1TZ0A 2ZJQQ 2FJAB 5E3PA 2DR9A 3MM5B 2ZDOA 1FJGF 2AT1B 3VGTA 2MTLA 2VOOA 2AV5A 4O44B 3K59A 4GC7A 5AXNA 1FX4A 3BPDA 3KHHA 5LMNJ 5A8RB 1REGX 1U09A 2NZCA 2NLWA 3N0VA 1QLNA 3IG1A 4NLOA 4P75A 4OI4A 4P52A 4HKQA 2HBYB 3QLHB 4KGXB 3BQ0A 5ADZA 1CJKB 3H90A 1F0XA 4RUBA 2YBVA 1T05B 3MM8A 4FF3A 4R25A 4FYWB 3BYPA 4OQJA 5B0FA 1TV6A 1CBKA 1P6TA 4FZVA 1YLXA 3ZTPA 3HVAA 4O3PA 1UWAA 3Q23A 9RUBA 1MSWD 1WEYA 5ETRA 4RNNA 1KLMA 3DFEA 3HULA 1BWEA 5GMDA 4LSZB 2YNHB 3DYAB 4M5KA 4ZOSA 1YZ6A 1LWCB 2RIJA 3CCRS 4JI1J 2DXDA 4FYVB 1R0BG 4A4JA 2YQ1A 4O3SA 1VISA 3R27A 1SB6A 4EWTA 4NLUA 5HVHA 3JSRA 1OY9A 1RAIB 3WDOA 1SUQB 2WTFA 4DR3F 4V19J 4LF7F 3V4IA 1VQMS 4KV8B 4ED4A 1C0UA 3SDEB 2W9BA 2QTWA 3VTIA 5E33A 2FHJA 1U6ZA 3ISNC 2IBOA 2XULA 1D9FA 4ZA1A 2MY8A 1I5OB 2XMTA 4DCJB 5HROA 4I68A 3ETMA 4ZIWA 4G1QB 3KK3B 4K4UA 4YR2A 1Q8IA 4ZJLA 5K8MA 2XM3A 1LW2B 3MCMA 2VPYB 1PG5B 2FVPA 5F8MA 1U6BA 3M8SA 4RR5A 3B4MA 5L1KA 3HM9A 4OFZA 2EWHA 1FXRA 4IYQA 2W4DA 5L46A 2AMCB 5KFTA 3H2LA 5ETVA 4NEYA 4KH0B 4ZP7A 3RYLA 3I5BA 1FK9A 4EK2A 4N76A 2OLWA 2CJ9A 3IGNA 1FWKA 3WC2A 1ZAVA 1TVRA 1EB0A 3UN3A 3GJRB 3PJXA 4CLTA 4NRUA 5KFXA 3D4JA 1NHKL 2XGPA 2R8JA 2JEGA 3OTCA 3ITHB 2BE2A 3AOBA 4MKYA 2RD5C 1Y11A 1AW0A 4JV5F 1SH2A 3TVZA 1XBWA 2V50A 1FTRA 1S1XB 2V2ZA 1LW0B 3R9LA 4A8FA 1UKUA 3BS9A 4LF8J 2JEIA 2D3OR 2QRRA 3FZBA 2XMJA 4IUFA 2VPZB 4MK7A 4RNMA 1MWQA 1VFJA 2G0CA 1L3VA 4TY9A 4LF2A 4ZCLA 2HQGA 5DDPC 4DV0J 2AEFA 2GX8A 4WFAQ 3QRRA 4OV6A 3OR2B 5KAKA 5DDQC 2HHHF 2CQ0A 1FFSB 1HNIA 4W92B 1YJ7A 5LOQA 3ZXWA 2VOPA 4WU3A 4B9LA 3NS7B 2CQHA 2XSJA 4DV2J 4DR4J 2R7SA 1S72S 3EYZA 4N56A 5HMWA 4EMDA 3KLIB 4QQBA 5ETPA 4Y0FA 1MROA 5A76A 4OHVA 3QYYA 1PGZA 3OW2R 5K8OA 2KXHA 1K8AT 2L48A 3NNCA 5A0YA 3ENQA 1OY6A 3GFXA 1JQGA 3FSXA 1YKWA 2HNYB 3DRPB 1JMTA 3O5TB 4DV5F 1YBUA 4DG1A 2EFOA 4NEZA 1X4FA 3IWXA 4ZP8A 3GWCA 2PMWA 1NNDA 2GNKA 1RSCA 2CADA 3HP6A 2YKNB 2C2KB 2HKEA 5AXKA 3TARA 4JI0F 1E6YA 2Y0SD 3CDAA 1WSVA 5D0EA 2ERRA 2CJAA 3C66A 1VQ5S 2DPJA 3W63A 4A8QA 1S9EA 2V4RA 5B08A 4Q43A 1RWWB 5IWAJ 1RYRA 3NY0A 1U0HA 1GMWD 1N5TA 2UXCF 1B0TA 3LP1B 2HQDA 2VQFJ 3WIUA 4QIFA 1UVIA 1RTDB 2FC9A 3VAIA 3TW0A 3MEKA 1FWLA 4B9TA 4LF9J 1SIZA 4G3IA 3PJWA 3IC1A 3BSNA 4RUCA 2NSBA 2FYXA 4PWDA 2N7YA 2ACYA 1VIOA 3C6UA 1P1LA 1VOMA 3BM7A 5DZ7A 4NA1A 1NPRA 1JXLA 1R89A 5HMXA 1FHTA 2DR8A 3NGRA 1TKDA 3GU0A 1RLCL 4PEOA 2XQCA 3L4BC 4Q5VA 1MWZA 3AAWB 3K58A 4Y2KA 5IT9U 4MIBA 1KHWA 3OL8A 3FVYA 3VHQA 3SQGB 4N47A 2VG5A 1C1BA 1IKVA 2BACA 2DITA 4KO0A 1B99A 2HHVA 4DUZF 2MQNA 4KTQA 1TL3B 1H98A 4JYAJ 5IC6B 1QE1A 3ADAC 2DHSA 1WORA 3QGGA 1RB0A 3AOCA 1U8WA 1WJ9A 1HNVB 3OVAA 1UPMB 1UFLA 4WFNQ 4OHZA 4LF5J 4HL9A 5AE2A 1S1WA 5JXSA 1U24A 1WC4A 3M2UA 3W9JA 3AT1B 4NCGA 5E3CA 3U1MA 1M5HA 4M5MA 3ZZUA 7FD1A 4B3TJ 5KFZA 2C3MA 2HWTA 3K8VA 2F4VJ 2QLXA 3OXGA 1N6QA 2HQCA 3BZQA 3HHLA 1ROFA 2LYVA 3UCGA 5T41A 3US5A 1S7HA 5EHHA 1X5OA 3E51A 5KG3A 2ZH6A 2ZBCA 1WSRA 2GW8A 2DK2A 4X64F 5E3QA 2MQQA 1GNKA 3H98A 1S6UA 3KUEA 5T14A 1BQNA 3EMTA 4DX7A 3KK1A 3HSDA 3PYFA 1XQIA 2HBQB 1H6KX 5F8GA 3M8QB 3VGVA 2UVWA 3I0SA 2ZBIA 4K4SA 3PHEA 4LF6F 4F25A 3KJVA 1OY8A 4B3SF 5KFHA 3CJ0A 4LFBJ 4LFAF 1QAIA 2AYMA 2B4UA 2ZHAA 4IH6A 1SPBP 2GHVC 4XDCA 1K1QA 1GXTA 3PEJA 2QSFA 2I5JA 1MLAA 2E29A 3RBEA 2OO4A 5FDLA 3EGVA 3FFIB 1AUSL 2WCXA 4ZPCA 3M2VB 4F04B 1D9DA 5IV4A 1C0TA 4DDFA 1H7XA 3PR4A 2D3ZA 1WG4A 1RT1A 1TKZA 5L1IA 2B0GA 5J2MB 3OL9A 3T6BA 1ZA1B 3W1YC 4BS2A 4LUBA 2QEXS 5AXMA 1HA1A 4RL1A 3TX8A 1HBNB 3MCSA 2DGXA 4ECTA 2VF3A 2Q6BA 3GJTB 3NKYA 4NYPA 2VG6B 4O3OA 2XY6A 4ZPAA 2IM2A 3WX4A 1RKIA 2KH9A 1S1VB 2G0IA 2HGLA 4DV6F 4ED1A 2CJQA 2ZD1A 3W64A 2XMKA 3QJPA 3QGHA 1M5OC 4IO9Q 4KFBB 3HK2A 3MZIA 3W2VB 3RAXA 2C2MB 2KO1A 3MMAB 1NK0A 2MJNA 4JUZA 2LP4A 1NPPA 2MB0B 2DIVA 3TAMB 2JEFA 1YRTA 2QN6B 4KHRA 4O4GA 1Q0NA 4U95A 1RHRB 1CVJA 1FDBA 4QWDA 3KLGB 1RWMB 1KRPA 1LK5A 5KFFA 1EZZB 2H51B 1EP4A 2DCLA 3IRXB 4OYXA 4WF9Q 4EYIB 5GAGU 2IVFB 3G8QA 3HHEA 3PYDA 3BGOP 4OX8A 4WTYA 1RAOA 3NAHA 2JX2A 2ZZMA 1HNZF 2OFGX 4WE1B 1V9OA 5J2NB 4RO0A 2BOPA 2ZUGA 2YH0A 1SJ1A 1FRXA 1NPKA 4NZ7A 2GA7A 3JYTA 2L9DA 4J9KA 3HD1A 3M32A 2HQIA 4DR2F 1YITS 3T6JA 1U1KA 4DLEA 1L3TA 1HNXF 3H5XA 1VRTA 4ZLJA 4O0IA 3T41A 3TVKA 4AE5A 3QO9A 3LA0A 1UWBA 1X9WA 3KJNB 1A7GE 1H2UX 4MT1A 2DJWA 3SV4A 3V81B 3RW6A 4CYUB 4UZCA 1SL2A 3OTOJ 4HI1A 3HJVA 1Q1KA 3CJSA 3M8RA 3HSZA 1RTJA 2JNJA 3P5TL 2HEKA 1KD1T 4LF4J 2VFRA 2C2EA 4O23A 3OHAA 4PXBA 5KFAA 2XYGB 1HW9A 4TQSA 2HK3A 2HMIB 4DR7J 1TUWA 1S48A 3A8KA 2WONB 2LDYA 4I6YA 3MF5A 3GG0A 4DL3A 1VQLS 2H5EA 3K5NA 2D9PA 1RQ0A 2M8HA 5MAOA 3JAMU 1NRKA 4X66F 4JI3J 3V6KA 1TL7A 2R9LA 3CCES 4X4PA 2IJRA 5J2QA 1WWHA 1XMOJ 1KS2A 2QSWA 5F8JA 2OIHA 3Q8RB 4PWWA 4IO1A 1Y3JA 5KOWA 5CH7B 5GAEU 4F3MA 3HXMA 1KKHA 1RHQB 3HT0A 4KYZA 2M52A 1HWJA 4DQRA 5IT0A 1HPZA 4MH8A 2Z30B 5KFCA 2D74B 3SI8A 1KTVA 1WELA 4RW6B 3HKWA 3SIPB 5HL7Q 2H3EB 4DU7A 1KSPA 4DLGA 1NH7A 2NYHA 4JI4F 2O5DA 3B78A 1T9XA 4DS5A 2OUGA 4RW8B 4D3HA 5HLFB 4EU0A 3PR5B 5IFMA 5A8KA 1SKWA 5IM0B 2LXIA 1KQKA 1HWIA 2MHNA 3CCTA 4CM0A 3G6ES 3SBMA 5LMUF 3DLKB 3K8WA 4K0KF 3TQ1A 1YJ9S 2I0XA 3R5JB 3F73A 1X4AA 4ZJQA 2VBWA 3PXGa 4R8UA 5LSLA 3DRRB 3CD5A 5F41A 1NBEB 5DG9A 3P4UB 1QVFR 2ILYA 1IBKJ 1J5EJ 4MKBA 3K0JA 2FJWA 4LSNA 1R0AB 1EETB 2FJXA 1TMJA 2EFNA 2BYCA 3T1HJ 1OPIA 3OL7A 2CPIA 1FRLA 4KR0B 4ZMMA 2VC0A 3CTRA 1VS3A 4JI7F 1UVMA 2V4JB 2NREA 2PN6A 1IQTA 3VCDA 3OJUA 2BQUA 2OPQB 3W7BA 2VQEJ 1HR0J 3BDEA 1KQSR 5F3TA 4RBUA 2R8GA 2M9KA 3DMJB 3QATA 4CT8A 5DQGA 4YQWA 3RR7A 2DY9A 5DG8A 4RU9A 4ZVUB 1RCXB 5CYQB 3RTVA 2XYHB 3EGWB 4XDDA 5L9XA 1YQHA 5DJBA 4TU7A 2VIHA 1R8AA 3W2WA 3ZNUA 3IS9A 1GH8A 5B0CA 4GKJF 1N33J 4YHHJ 3BF4A 2VUGA 5J2PB 4FF4A 4FP9A 3K7RA 2V0NA 4HDGA 4UOHA 2GHWA 2Q43A 5HBMB 1DBDA 2FTRA 3G71S 4UOCA 4OI3A 3UR3C 2FZKB 5C24B 1GAOA 1RWKB 5H1SV 2FGOA 4C11A 4ANDA 3BR9A 1D8ZA 2FY8A 5L38A 1UEKA 1N5SA 4C8NA 1KVIA 2FY1A 4EZ9A 2AU0A 2IVYA 4A8OA 1HI1A 5IQ6A 1X4HA 5CYMA 2K3KA 4B17A 2VG7A 4FF2A 3ZZPA 3M9NB 4LR9A 3J7A1 2VL1A 3DOLA 1N0VC 2CQPA 3A1YG 4Y2IA 4F02A 2E1CA 2F9JA 2EK1A 4DSJA 4F4XA 4IFYA 2B5JB 3FRYA 5BR8F 2IC3A 2JLFA 2MKHA 4BBYA 4JI8F 2EFQA 1FKOB 4UQGA 2CQBA 4ZIVA 1O51A 3ILIA 3CDUA 3QAUA 1H74A 2YXLA 3LP0B 3DDKA 2K06A 2VPXB 3NLCA 4DL0C 2AP6A 3TQEA 1DZ5A 2Q6CA 1APSA 3IG1B 2MKIA 3HKZD 2YWFA 3NMRA 1TL1A 1V3SA 2E9TA 3KG1A 3MUVP 3AXMA 2QIFA 3BSOA 3CCJS 2CZVC 3H8YA 4K4XA 2FD2A 4ECYA 1SJFA 3BR8A 2P9EA 1EHWA 2C42A 2HNDA 4AYBD 2OH2A 4Y65A 2OMLA 4IDKA 4EBCA 1ZZNA 4IOBA 2ASDA 3D67A 5JMNA 4Y6IA 2XWYA 3KLEA 3DLGA 3CXCR 4FXDA 5KFRA 3TJAA 1KTQA 2F40A 3L09A 3DLLQ 2XNRA 3KNAA 1LFWA 4YY3F 2VFVA 3H42A 5D3GA 1JKHA 3FK4A 1BC6A 3SFGA 1NCLA 5HQLA 1K0TA 1TFWA 3ENWA 3KMSA 4USKA 1SQEA 2HIYA 4NRTA 5ETQA 1SKRA 4L3KA 5IT4A 3NS6A 3V4IB 1NM2A 3W9HA 2DNZA 4K50A 4QYRA 4DV1F 1C0UB 4MKAA 2W9BB 5HVFA 4P2XA 1RHJB 3IXQA 1JIHA 3W5XA 4B9MA 4BDPA 4DPTA 2B9XA 2K7JA 5B0BA 4OX9F 4KHMA 5HROB 3F0NA 3EVMA 2J8SA 3NL0A 3CJQA 2VZ9A 3EGNA 4U8YA 1W7WA 1CS4A 4YFUA 3MOJB 3RB0A 2JL9A 3PDNA 3FKBA 4I2PA 2F4FA 1X4EA 2KT2A 4A47A 4PCQA 3IWLA 1WD6A 1SV5B 3R6LB 4ZDNA 4ED0A 1QD1A 4FXVA 4QW9A 1L3UA 2CPYA 4F4YA 3TUJC 5DETA 1NSQA 4CLPA 4F26A 4J91A 5KT4A 2UV8G 2R2RA 2RHQB 2Z4PA 4I7FA 5FD1A 2EEYA 3EZOA 1H38A 1JB0C 3GIKA 3BQ2A 3VWSA 3N6LA 1FK9B 2ROEA 1U2FA 4U7UD 4WPAA 2AZ3A 5KFUA 3I0RA 1ZM4A 3F56A 2ASJA 2HWHA 1HMVA 3D5MA 1AB8A 2VDHA 2F9DA 1SL1A 1UVKA 2NXJA 5LL6d 3LOUA 1FFWB 3A8JA 3C46A 2ZJRQ 1N56A 3J7YU 4UT4A 2R8HA 1S4FA 3RBZA 4Q8FA 1UP1A 4K0KJ 2BRKA 3KLHA 2IPOB 2HNZA 3KLVA 7FDRA 4UUWA 2XCAA 3N01A 2C2NA 3QRPA 4MAKA 2AX0A 2MKKA 2JH3A 5L39A 4BC9A 2Q1LA 3KTQA 4ERDA 4IFVA 4OV1A 3BGFA 1TQLA 3OR1B 2ZE2B 3FQLA 3OBIA 4OJGA 5DO2A 2G1DA 3SCKE 2IIHA 1ZETA 3QSIA 4BCAA 4Y34A 2DBBA 3HFZB 2XSJB 4JI7J 2R7OA 2ZOMA 4KGMA 3TO8A 3QNWB 5K8PA 1MN9A 1OYDA 3M8ZA 1BUXA 2E1AA 2DVIA 2HS0A 2O01C 1U45A 2XHCA 2CWKA 1MROB 3UI3A 2YNHA 2RDDA 3J81Y 1Q82T 3TWZA 1MW7A 4C8KA 3N6NA 5A0YB 3EUNA 4NLQA 4DJBA 2Y1JA 1T02A 3ZNJ1 2A10A 3MEEB 3N79A 4DG1B 1QUPA 3HFVA 4GKJJ 1IKXA 4R0JA 2DB1A 1E6YB 4IOCQ 1F6TA 2UUBF 4ZPDA 3J7Z5 3A3NB 3TA1A 1WHWA 3Q8VA 1S9EB 1X5PA 2WVDA 5CA5A 2D69A 2D1CA 2LMIA 4IR1A 2DEJA 4TKTA 4ZN3A 3NOCA 3T1YF 3GIJA 4TU9A 4QBUA 4ED8A 1WF1A 3DLBA 4H4MB 2BEFA 1TUVA 4M5JA 3PCOB 3MM7B 4DI6A 3KK3A 3NEKA 3MPDA 2UV8A 2O67A 5B0GA 2QO3A 2B56A 1S9GA 2RS2A 4PWDB 1IBCB 3C6UB 1U1PA 4OX7A 1NK5A 4X62J 1V5VA 3G4SS 3CJ5A 3KWMA 2KM8B 3G82A 1DQAA 4J9LA 2C3PA 1SKUB 3QWPA 4J9NA 3RBDA 3HZGA 2MEWA 2FZGB 5HANA 1UCNA 3EGZA 1U1OA 1ZM9A 3TZXA 3Q2SC 2VG5B 4DV4J 2DGSA 1C1BB 5K20B 2H54B 1IKVB 3D66A 4KO0B 1F5AA 8RUCA 2DNGA 4FBUA 3NAIA 2LEBA 3GMGA 1QE1B 5BJRA 4U6PA 2Y1LB 4ED6A 1I6JA 4ZCMA 4X4RA 2H9ZA 4GKKF 3LH2S 3PX0A 1G1XA 2UXBF 5KFLA 6FDRA 4F36A 4C2MA 3QWUA 1S1WB 3PM9A 1BE4A 4YN3B 4PYAA 3M2UB 4C97A 1VQKS 4NCGB 1IXKA 4USWA 2KL8A 3TX0A 1V5IB 5HJXA 2N3LA 3GLJA 3ELHA 4ZPVR 1JX4A 2WOMA 2AJFE 5IV3A 1RTIB 3RBXA 3F44A 2RF2B 3HHLB 2HS4A 4F4ZA 2K3IA 1P8GA 4LVOP 3T5KA 1ACMB 3BKTA 4WIIA 2U1AA 1Q79A 2QT7A 2GCFA 4KB7A 3CMES 1PBUA 2F7VA 1NHVA 1WNEA 2B4VA 2E9RX 5KT2A 4KC5A 3IWNC 2BJDA 1F3FA 4NLDA 3M8PA 2EC0A 1WHYA 2ZHOA 4QYZJ 3PVXA 3OR2A 1RT2A 4NYOA 3UW1A 2H5JB 3KK1B 1SI9A 1MG7A 3DM2A 4C9DA 2PIIA 1K9MT 2QFIA 1LWFA 3I0SB 3WZ0A 3CMQA 4YB5A 1R8HA 2P5VA 1HHSA 1EIYB 2HFSA 4OX9J 1XMQJ 5AXLA 5EX3A 2MXYA 3BPSP 4MIWA 2DNQA 1SC6A 2A3JA 2K2PA 2KYXA 2I5JB 3D3CJ 1HWLA 2XY5A 5FDLB 1QSYA 1I51B 1C0TB 1RT1B 1TKZB 3AQOA 5A2QY 5KG6A 4XPCA 1DURA 3UVJA 5GADU 3MURP 3FZ2A 1JLCA 4YDXA 4WKYA 3MR3A 4ZVRB 4P71A 2Y8YA 4CP5A 2FPHX 4S0MA 4TU8A 1O6XA 4ETZA 2VONA 2KJWA 1ZPWX 2MLYA 2KHDA 1AYEA 2UUAJ 1BHNA 2EG1A 4YB6A 2B7BB 2YWHA 2OP5A 1WKKA 2UUWA 2VB6A 4KGVB 1VBXA 4OJHA 1P9QC 5L1LA 2HRYA 2ZD1B 5T7LB 3DLEB 4XPEA 3NGSA 5DDOC 1S1UA 2QMUB 4JBCA 1Z1ZA 1RAFB 1T7PA 5KG7A 2HW3A 2R2UA 4PG4A 3B8HA 3O6QA 2XZDB 4NL5A 2I9SA 3AODA 1YX2A 2IA6A 4X4VA 4TYAA 3MTKA 2ZITA 2Y9HA 1CULA 4LSLA 4WZQA 3H5SA 2XGQA 4GO5X 1NKEA 2BR0A 4FDFA 5E5NA 1TL3A 3UDLA 5I42A 3AA9A 1VQSA 3FCHA 3M9MB 1TAQA 1QAJA 2J9CA 1REVA 1VRQC 5E41A 2MLXA 1UTAA 4DBQA 1WDDA 1PC5A 1RWVB 3M32B 2R7WA 1S49A 2BUNA 3R1LA 3UQSA 4I4BA 3I5CA 1HBUA 3BREA 1VDHA 4UTGA 1VRTB 4NLSA 3QO9B 1TMMA 4ED7A 1VRUA 4GC6A 3IM8A 3OXFA 2E1MC 1FEHA 1O0PA 3MAQA 3S1TA 3GJSB 3BQ1A 4G6VB 2XEXA 3D0HE 3BBFA 3O3LA 3C6TB 3MECB 2ZKTA 3OSPA 2PD1A 1RTJB 1N5QA 2CRLA 2RQKA 3NCRA 1S6PA 4MFBB 2HHXA 3W8GA 5AT1B 2OHDA 3CCMS 2KI2A 3OLBA 1FRHA 3QIPA 3SSRA 4H4KC 4OI2A 1FJ7A 1S10A 2W2QP 4ENOA 2GV1A 4L73A 2GVZA 2VASA 2B4OA 1U02A 4FPIA 4U9RA 3M2RB 1KP6A 4QWEA 2C1EB 2IDLA 5H9FJ 2WSEC 5B0EA 2AEMA 2G2OA 4ZLLA 1HD1A 4GO7X 3N9UC 1U1QA 2PI4A 4PQUB 2FJEB 2N4CA 2YNGB 5J2QB 3Q2TC 3VAMA 4OHXA 3PZPA 1NK7A 1M5PC 3BB5A 5J2MA 1NB7A 1NU4A 2L9WA 3RAQA 2GQCA 4PG8A 3L7UA 1IBMF 5ETOA 3MR6A 1FNXH 2CNNB 4EZ6A 1LWXA 4JI5J 1HPZB 3W5YA 4OZ1A 3D7SB 2MKCA 1ZBTA 1NEEA 1FDNA 3D54A 1YG0A 1X5SA 4LFCJ 4K4YA 5HMZA 2ZH9A 1JLGB 3C16A 3QAEA 2DISA 4FYDA 3SCJE 3PKMA 1DJ0A 3CJ3A 3PYEA 5GAHI 2F3JA 1WG5A 3MXHP 1MWYA 1KQGB 4HLBA 4UUXA 1IWGA 4RBVA 3J7AN 5A8KB 3D28A 5D6GA 3T5JA 5E3AA 2LQ8A 4CO4A 1QAYA 5CD4A 2KYZA 4KGKA 2NYIA 3W2VA 4YMEA 2ZM6F 4A8SA 3J80Y 3ONQA 3V6HA 1VQ7S 1OS5A 1D3WA 4Y28C 4FVMA 2W2OP 4R8UB 1F9EB 3AD7C 2HG4A 1CJTA 3C2PA 2BANA 1VC0A 4HACB 3IBWA 4JP8A 5CQGA 2YH1A 4LSNB 4PG5A 4HH1A 3ISND 2HSEB 2FHOB 2KHCA 1D0EA 2R8KA 3QZ8A 3IMQJ 1K47A 3A3PB 2HWIA 3KXDA 1VC5A 4ZVQB 4PRFA 5HATA 2PA3A 3M6XA 4EI2A 1W2BR 4KT0C 1NJIT 4ED2A 2DO4A 5J2NA 4QR2A 4B3RF 4DV3J 1IBLF 3CE8A 4K7QA 3W61A 1ZH5A 4QW8A 3OFFA 1QSLA 2DD8S 2P9GA 3O1LA 1KFSA 3MOZA 5M2RA 3PW5A 3I96A 5KFPA 2FJBB 1WOSA 2XMUA 3DGPB 4TLRA 5HN0A 1TKTB 5C42A 3W2WB 3IS9B 2B43A 2EK6A 2OSQA 3UN2A 3EWGA 2C22A 4OZNA 5LT5A 4UW2A 2IHR1 2LXFA 5KFGA 2QA4G 1B0PA 4AL5A 4NXNJ 2HRUA 3AQPA 3V81A 4F2SA 3M7VA 4CYUA 1I3OB 1Q5YA 3EE3A 5HAOA 2RHSB 2VODA 4LT6A 3SCIE 2A0FB 2W01A 2ALYB 2R2SA 3PW0A 2UZAA 1MMLA 3R8YA 4C11B 3IAM9 4NE9C 3MD3A 1X4CA 2LQBA 1DAXA 4USUA 2B9YA 4M95A 3BO2A 4NLXA 1XN9A 5E7OB 3ET6A 4B9UA 5I4MA 2CPZA 2R2TA 5CYMB 3MDFA 1KEKA 3BGLA 5IZHA 1S57A 2YNIA 4RUHA 2R8IA 3MCNA 1S0NA 3DOLB 1FKPB 2C3OA 1VHFA 4QWAA 3UCZP 3OXLA 4DR6J 3MEDA 3HVTA 5C25A 3PJ9A 4IFYB 2M70A 2W9CA 2IC3B 2RQCA 4RU2A 2F8MA 3HD2A 4PZVA 4WKRA 1TL1B 3V4MA 1IKYA 4C8YA 4NWBA 5I3UA 1AZSA 4RWWA 1WUUA 3L3CA 1RBOB 4WWSA 1LOUA 2RSQA 2ZC3A 3KFWX 2HNDB 2J8AA 2VBZA 3GFHA 2VFSA 1NK6A 3R2DJ 2LA4A 4PWUA 5SZTA 1VJQA 1R6YA 3E2EA 4RW7B 1B4SA 2X1FA 2B8QA 4L76A 3R5GA 3KLEB 3DLGB 5HLFA 2UUCF 4TY8A 4U7UK 2EKNA 2KKHA 2LVWA 3SSQA 3PYGA 2OTLS 3QGIA 1VQ9S 3K2YA 2DNYA 3GCWP 4KIAA 1UW9A 5KFNA 4B3MJ 2DR6A 2DXEA 5D3GB 4QCLA 4CCHA 2BDPA 3K5LA 1BGXT 2AKWB 2O1PA 2PGCA 2VHGA 2QLFB 4C3KA 2G2ZA 3HVRA 1BWVA 4PG6A 2BE9B 2H65B 1RZMA 1EETA 3QIDA 3QT6A 4I64A 2SXLA 4Y2CA 2KFZA 3OLAA 1RGVA 2DGQA 4J9MA 4OYPA 4K4ZA 1IWAA 1QTNB 4U67Q 4ECRA 2B9WA 2AGQA 3OFEA 1TKXA 3EDQB 5DZ6A 4TYBA 4Y00A 1Y3KA 2R7VA 1F1BB 5F8NA 3GP9A 3A13A 2M5YA 3MAHA 5KT6A 4HH0A 4W98A 3M6VA 4ZVOB 4KSEB 5AJ3J 1FWPA 2CQGA 4KKOB 1CS4B 6AT1B 5HVGA 3KHGA 3CDWA 3U02A 3FEZA 4F8RA 4I2PB 5CYQA 2RVJA 3JB9k 3I56S 3N6MA 2A18A 4DX6A 2ZH1A 1N34J 2DNOA 1H3DA 4DFKA 3DC2A 5DQIA 2AJ4A 2QA4S 4CNZA 2PO4A 2DR5A 1X4GA 2RQ4A 4F0KA 1OSDA 1EARA 1T11A 5J2PA 2GAGC 5K9FA 2J7KA 1S6QA 2O3DA 1HI0P 3RRHA 3MPYA 1EX8A 1I94J 4TLQA 2HVDA 1H73A 3IN5A 1N0UA 3MI7X 4P2MA 1D9AA 2UXDJ 2DH8A 1VK8A 1XJWB 1HMVB 2EPIA 1VQ4S 2VJUA 1NK8A 5KFMA 4F4KA 1VQ6S 1ZA2B 3PO4A 1K44A 3G8SA 1A9NB 4ECXA 1FXLA 2J6UA 1XEZA 3WBZA 2NQPA 2R7TA 3QT8A 2PMHA 4X4NA 1RI7A 2ACMA 3TZZA 3G6VA 4DUYJ 2GQQA 2ZM6J 1NK9A 2UU9J 2HNZB 3C19A 3PTWA 5DRKA 1HNWF 3T9NA 1QTMA 2DKOB 3RB3A 5F8IA 4QIEA 3LP0A 1B64A 3R5CA 5CXTA 4C8MA 4NI2A 2BQ3A 3CJ4A 2AYEA 5CABA 2I6WA 2WSCC 4OJ1A 4IFVB 2D9OA 2WBMA 1ICEB 4M5NA 2E7WA 2R7UA 5KTQA 3QGPA 4OZ0A 1RTZA 2ATCB 1Q7YT 1JJ4A 4ZVGA 1XNQF 1UZHA 1N32F 3THTA 4DPXA 2R42A 3IAS9 4B3RJ 2CYYA 3WQPA 4DFMA 2HVHA 2AF6A 2A6OA 3P49B 2BE7D 1Y4ZB 5D15A 3GSDA 2EXUA 4NLYA 1C2PA 3M8WA 1IM6A 3RB4A 1U2RA 3DU6A 3HJFA 3PHTA 5B0DA 3QFHA 1XWLA 1IKXB 2YWWA 1J27A 2YPZA 4J9OA 4AL7A 1T3OA 1HYSB 4X65F 2BOAA 2IRUA 4J90A 4HVZA 2DRBA 3CWJA 1UVJA 4IKAA 1X0FA 3DI6A 2PFDA 3RU0A 1V3ZA 2GIRA 1VC6A 5DG7A 1JLAA 2DNPA 4JI6F 2VD3A 3NNHA 1KLNA 2N7CA 4FVCA 3QJJA 1KR4A 1S9GB 2E1RA 3FJ2A 3KUGA 4B9NA 4ZVSB 1IQZA 2WB4A 3BO3A 2C2RA 4ECZA 1V6HA 4P2FA 4ECSA 1CC7A 4A8WA 2P9CA 4KHPF 1SJRA 1YBAA 1SV5A 2IBKA 2W2MP 3G82B 4F0MA 1WF2A 1U4BA 1M5SA 2CJKA 2JEJA 1ZPVA 4WK3A 1Q53A 2FHMA 1XR5A 4G65A 1N52B 4U8VA 2DR7A 2CPXA 3KYLA 1U1NA 3ULHA 3UDEA 4PPDA 1RK8A 4PABA 4PXDA 2PFFB 2CAJA 1HWKA 3ZO7A 2EVZA 3VQSA 3V6DB 2HZCA 1NZAA 2VA2A 2V4QA 1C4CA 1XMBA 3NG8A 2CPEA 1TL5A 1JNRB 2Y1RI 5GMEA 3NWRA 5H9EJ 3O8WA 2RKIB 1RP5A 2DNLA 2XLIA 4OZLA 1SL0A 3KDOA 2P2CB 3W65A 2WOMB 5HMYA 4I0WA 2CQCA 2HFNA 1TK8A 4ANCA 2MHEA 3PEHA 2R4FA 4EFAC 3LGHA 1UFWA 3OVBA 1U48A 3RG6A 2D7SA 2CXEA 3EZUA 1N36J 2MDAA 2V2VA 3D3BJ 5FJ4A 3MFHA 1IN0A 1XR6A 1LV5A 2V9KA 1EQ0A 2CQDA 2DHGA 4P73A 1PJ6A 4F3QA 1M0SA 3KMQA 2LEPA 3DHWC 1ZYQA 3UDCA 2VKZG 1T3NA 3M8PB 4IG3A 2RAQA 3OR1A 1RT2B 2ZE2A 4EO6A 3DM2B 1CJUA 4AL6A 1YDLA 2FJDB 1LWFB 1PYSB 4HTIA 4DEZA 4RW9A 4AQYJ 3NWGA 2Q66A 2YTCA 3HHDA 2Z2YB 2WB1D 4ECVA 1R8BA 3ZC4A 2KVIA 4KY3A 3HCXA 1BMQB 5F3ZA 3EVOA 5LJ3Y 5D77A 4NXMJ 2ZVSA 1IM4A 4RW4A 2OMOA 2XLJA 4CTAA 1F9FA 1P1TA 1RLDA 3MEEA 1J5OA 2CG4A 3ETOA 5E0OA 4DQIA 5GMKa 3UVJB 2X3GA 4G1PA 2FZCB 1NO8A 1L3SA 1JLCB 2J7UA 3CJ2A 2FGCA 3DOKB 1FD8A 4N8OA 4OZ5A 3HZEA 3AY0A 4DR1J 3H20A 4ELUA 2WVBA 4IQXA 1CEZA 1ZTWA 2OFHX 1U1LA 3CCQS 2DRDA 1QAXA 2Z57B 4H4MA 4ALZA 2U2FA 2HHPA 5D4NA 3MM7A 2OPSB 2W2NP 3Q8SB 3K17A 2QE5A 2OKQA 3KNGA 1X9SA 1S1UB 4YB1P 2XMMA 2B7CB 2OEMA 3ENAA 1B0VA 3O44A 4I6WA 2XZWA 1S79A 3LAMA 4DUTA 2X1AA 3C14A 3J81U 2RH3A 3SZ2A 2WAQD 3KDNA 3M6UA 2W9AA 4URQU 3NOGA 2M88A 9ATCB 1CULB 2DGTA 4JI2F 4LSLB 3ILLA 1VBZA 1FJGJ 3DOMB 5L8RC 1YHQS 2VBXA 5HJYA 3CD6S 1UJ6A 1GMWA 3I55S 1LXNA 5I42B 2ZNYA 2ZFHA 4WP3A 2DPIA 1XTZA 3EXCX 3OD2A 4DV7F 4ICLA 1LFPA 3KJQB 1REVB 4XIUA 2VBYA 2XO6A 2GJFA 2HHUA 2AW0A 1GTEA 1N32J 3FMWA 4NCAA 1RAEB 1SBRA 1CG2A 5IC4B 2ILZA 3MM6A 2K1RA 4ZPWR 1TP7A 2YWKA 3H2VE 1HBUB 1SCJB 1X4DA 1PJ5A 2DGUA 4WFBQ 5K5MA 2KG1A 3WIVA 1RTIA 2RF2A 1VRUB 5I3PA 4TXSA 2XG8A 2V2QA 2LFVA 1DTQA 3TA2A 4Y2MA 4NX9A 4AT1B 2YKAA 2IYGA 2GJIA 2HFOA 4PUOB 1FXDA 5ETNA 1Q95G 4DR3J 4FS1A 3LWLA 1S6PB 4LF7J 2MZJA 1HKAA 4ZITA 2RU9A 3QIPB 5LMNF 4JB8B 4NZ0A 3QBCA 4PR6A 1JLQA 2GVZB 1HHTP 3BN7A 1SVDA 4ZN1A 1QDUB 4BLGA 1Y00A 3MEGA 1L5UA 4JI6J 1VR6A 3K89A 3MCOA 3NCPA 2ADBA 3R7NB 2MGZA 2BQRA 3SV3A 3D6MB 3ZZRA 2BX6A 1SH3A 1WACA 1YRUA 3MPUB 3AXKA 1DLOB 1F3VA 2PC6A 2KFNA 3CCWA 2HAFA 3LANA 2WZ1A 4U96A 4NLVA 4JI1F 2DIUA 3MM9A 3TAQA 1DY3A 2ROPA 4MTPA 1T03A 1WC1A 1S7IA 2BJ3A 3HF5A 5CCMA 1T9VA 2P6TA 3C3LA 5CCLA 4OI1A 1C1CA 3C16B 3ZZYA 3TYTA 4OL8A 5F9NA 5IQQA 1KN6A 3LPYA 1RTHA 3SMZA 4CH1A 5D4OA 4B9VA 4ETXA 5T7LA 2RRAA 5EX0A 4L3NA 3DLEA 3P5BP 4BWMA 3M9OB 5C2GA 2JZ5A 5I3QA 4JV5J 1F60B 2FVQA 1MU2A 2QFJA 2HS3A 2LEAA 2MPUA 1RAGB 1Q8BA 1CJTB 3L7OA 1IR1A 2XS7A 2BANB 2HGMA 5D0HA 1FA0A 2J6SA 3ZTRA 1ZOTA 1FRKA 1CJVB 1RJJA 1TL4A 4J7CA 1OWXA 3R5BA 3PX4A 1NDPA 5A2QU 2D41A 4FNIA 2F8EX 4OZJA 4OHYA 2MQOA 5HQ8A 3DNCA 2OAUA 2MZTA 4WXWA 2I1RA 2HHHJ 3TA0A 4UY8T 1LNQA 4LBPA 4NOHA 2C28A 3H5UA 4DZ6A 4ZKAA 3IRWP 1YK9A
chains in the Genus database with same CATH topology
3PW2A 1HQEA 3I87A 1VQNS 2FPHX 3GQCA 4HHJA 1XMQF 1S0OA 4TU8A 2JEIA 2O66A 2D3OR 2M2BA 1M5VC 2QRRA 3FZBA 4ETZA 2PMZD 2VONA 2XMJA 2KJWA 2IAJB 1ZPWX 2E5GA 4IUFA 2HHWA 2VPZB 3I82A 2M4MA 2KHDA 2EI5A 4MK7A 3N28A 4RNMA 1FE4A 2EG1A 4YB6A 1CQMA 2UUTA 2B7BB 2YWHA 2V94A 4ZPBA 4DR5F 2OP5A 1BQXA 3QPIA 1VFJA 2EFGA 4O3QA 2G0CA 3I4HX 2UUWA 1L3VA 4TY9A 4ZCLA 4RUAA 5C42B 5DDPC 2VB6A 3SEOA 5KFYA 1VBXA 4X4TA 1UL3A 3NS5A 3TUIC 2QMXA 2GX8A 3E01A 4OJHA 1P9QC 4WFAQ 5L1LA 2HRYA 2CZ4A 3NMAA 3GZ7A 4ZHRA 2ZD1B 2IRYA 3OR2B 5KAKA 5DDQC 2RDJA 5T7LB 3FSIA 3U1LA 2OPPA 1R7IA 2HHHF 4URSA 2CQ0A 3DLEB 3S7RA 4XPEA 3A8EA 5M2PA 4I6AA 3ZZ0A 5DDOC 3X3UA 1S1UA 4JBCA 4Q0BA 3OTEA 1HNIA 1Z1ZA 4W92B 2ADCA 1T7PA 5KG7A 2HW3A 2R2UA 3C6TA 4LF8F 3MECA 2VOPA 4WU3A 2HHSA 4B9LA 4PG4A 2CQHA 3B8HA 3DRYA 2XSJA 1D8YA 2R7SA 3O6QA 3AJ2A 5F0WA 3ZFVA 4K4WA 1S72S 3EYZA 5KG5A 2CQIA 1U1MA 4NL5A 4N56A 4ILMA 5HMWA 4MFBA 4C0BA 3CF5Q 2E5LF 2UUAF 4DOZA 3KLIB 1GQEA 2I9SA 2CIMA 4QQBA 2IA6A 4X4VA 1LWEA 4Y0FA 1MROA 4TYAA 2WSFC 2Z2LA 3K57A 2HVIA 3LALA 2XI3A 2N3OA 1YSJA 4OHVA 2JOQA 3TP2A 3MTKA 3QYYA 4N5SA 2ASYA 2UVUA 4B02A 1PGZA 2M8DB 2ZITA 1TVRB 2PDAA 3OW2R 5K8OA 3Q8QB 4DV0F 2KXHA 4IG0B 5A8WA 1FCAA 3SFUA 1NKBA 1K8AT 4LSLA 2L48A 4WZQA 3H5SA 3NNCA 1VJWA 5A0YA 2XGQA 3ENQA 4MJKA 5GADI 3GFXA 2YNIB 4ES3A 2YX1A 3CDEA 2IVMA 3BGRA 4RZRA 4GO5X 3M2RA 2BE2B 2BR0A 1NKEA 3FSXA 1HQUA 2HNYB 3DRPB 1JMTA 1UMJA 2IRXA 5E5NA 3O5TB 1TL3A 3UDLA 2XB2D 4DV5F 5J1PA 5I42A 3AA9A 1VQSA 3FCHA 4DG1A 2EFOA 2ZKUA 2E9ZA 3M9MB 1X4FA 2AJ1A 3JSYA 1S0VA 2POKA 1TAQA 3IWXA 1RT5A 1CQNA 3GWCA 4ZP8A 5G0RA 3MEDB 1NNDA 3HVTB 2GNKA 4DV2F 4DR4F 1QAJA 4E98A 5C25B 3HP6A 2KG0A 1DRZA 2YKNB 4ZS6A 2BM1A 2W9CB 5AXKA 4A48A 2J9CA 1RT4A 3TARA 4PXCA 4JI0F 4PQUA 1E6YA 2Y0SD 3CDAA 1REVA 2YNGA 5E41A 2GFFA 2ERRA 2CJAA 3C66A 5KFKA 1VQ5S 4MMOA 1URRA 3GIMA 3ZZZA 4DBQA 3PRDA 2DPJA