3GJQB

Caspase-3 binds diverse p4 residues in peptides
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 20
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3gjqB00
1RWPB 3D6HB 3KJFB 2QL5B 2C2OB 3RJMB 3GJTB 3R7SB 3P4UB 2Y0BB 2DKOB 2CNOB 1BMQB 1RWKB 2C2ZB 4DCPB 1NMEB 2H4WB 2XZDB 2CNLB 1RHUB 1QDUB 1I3OB 1ICEB 2H54B 3QNWB 4ZVSB 2H48B 2C2KB 2FQQB 1RWMB 1RWWB 3R6GB 2HBZB 4ZVTB 3GJQB 3R6LB 2CJYB 5IC6B 2CNKB 4JB8B 1RHRB 2HBRB 1PYOB 3R7BB 1SC3B 2XYGB 1RHMB 2H65B 1SC1B 2P2CB 2QL9B 2XYHB 1F9EB 2QLBB 3GJRB 1IBCB 4DCOB 1RWVB 5K20B 3KJNB 1RHKB 2QLFB 1QTNB 2H5IB 3NS7B 4ZVRB 4ZVUB 2CDRB 3SIPB 2H4YB 4DCJB 2C2MB 4ZVOB 3EDQB 2H5JB 4LSZB 3IBFB 3R5JB 1GFWB 2XZTB 2CJXB 2Y1LB 2HBQB 3R7NB 2HBYB 3P45B 1I51B 2QLJB 3EDRB 3KJQB 2CNNB 1RWXB 5IC4B 3D6MB 2QL7B 3D6FB 4ZVPB 1RWNB 2C1EB 1RWOB 3GJSB 1PAUB 1RE1B 1RHQB 4ZVQB 2H51B 2XYPB 3IBCB 1SC4B 1RHJB
chains in the Genus database with same CATH superfamily
2IYGA 2UU9J 4OYAA 2FZCB 4K4XA 3Q83A 2RB7A 3O6QA 2XO7A 3R3TA 3ZZYA 1KONA 1NK5A 4LUBA 4USVA 3WC2A 5LM7E 3TAMB 2QYGA 2NR0A 2AJ2A 1Q8BA 2VG6A 3FBFA 3J7ZT 1T05A 4M5DB 2DR9A 2VONA 1HWLA 4QW9A 1VQ8S 1WOOA 2VL1A 2C3YA 1UEUA 1VQPS 1NSAA 3MTKA 2YY3A 2ZC3A 4NRTA 3R1HA 4X66F 1L3SA 2V4QA 1R6VA 3PW2A 3SI8A 3MMAA 3Q8RB 4QPXA 3SDEA 2XWXA 4A46A 4C8KA 3WQPA 4NYOA 2IJNA 4CNZA 1ITPA 5A0YB 2HFNA 2IA0A 4C4WA 2MB0B 5HK4A 3DU5A 4X66J 3FFIA 3AJDA 3T1HJ 3GJTB 4K0KJ 4JYAJ 2QSFA 4IR9A 3KK3A 4RNOA 2GVDB 2CA9A 4Q45A 3M8QB 4RW6B 1WTBA 4DR5J 2V2ZA 3AAWB 5EUHA 4M5GA 1YQHA 1YWXA 2KT5A 4KH0B 1XWLA 5T7LA 4OI1A 3KXDA 1T94A 1HQUB 1DAXA 1WKLA 4LF9F 1MROB 1UVIA 4AE5A 9ATCB 1MN9A 5IOLA 2H4YB 4ID8A 1B7FA 2EFGA 2XMAA 1TR0A 4YP3A 3THVA 3V6DA 4FPRA 3AOCA 5AT1B 1H38A 4FP9A 4QIGA 1HI0P 2JVRA 3GMGA 2C1EB 2EKYA 2LXFA 5FIIA 4DR7F 1SL0A 1SKRA 1Y5LB 1FJCA 4DL4A 2WCXA 5ETNA 3W8PA 3E01A 3KHGA 1DQ8A 1FDNA 2YVSA 2CADA 2V4RA 3MUMP 3MEEB 5LOQA 4X4PA 2KJVA 3J7Z5 3UCUP 2QIFA 4LBHA 4NCGA 1VLYA 2ALYB 4AXIA 5DLGA 1RTIB 4R8UA 3TVYA 4PQUA 4DR7J 3LP2A 2GMJA 4DZDA 3UN3A 1PYOB 4CO3A 3EWGA 3NGRA 2I2YA 3AODA 3PY8A 3KLHA 2ZWOA 4PQAA 1JLBA 3M2VA 2P6TA 5J2PB 2C2MB 2B4UA 2OPSB 3PW5A 2IRXA 4F25A 4O3QA 1HI8A 2JNJA 5JUMA 2RVJA 1RSCA 3HP6A 1R0CB 1RAJA 2ERRA 1NK9A 5KOXA 2HZAA 2XGQA 5K8NA 2Y1RI 2E9RX 1S12A 4DPYA 1RYRA 4NI2A 4FF3A 3SFUA 2DHSA 5C2CA 1ROFA 5C25B 1SB6A 3CJ2A 1XMBA 2MQQA 5HVGA 1PJ6A 2HHXA 3ZZ0A 4NLDA 3PM9A 3AT1B 1QUVA 2VFVA 1E6YA 4X4VA 3CMES 3R1LA 2V8GA 1HNIA 3CE8A 1RT3A 1GAOA 1SQGA 5HROB 4YOEA 2B8PA 3OL9A 1RHRB 5B0FA 2IC3A 3DRPA 1KQFB 1K47A 4F36A 3T41A 1UFWA 4ED0A 1RT2A 3SSQA 1GXLA 4FF2A 1QTNB 3OHBA 1IKVB 1R0BG 3DDIA 4K50A 4WFAQ 2GIQA 3H7HB 3KHLA 3TEHB 2WAQD 4YHHF 4BDPA 2IM3A 3LWMA 2JEFA 1QY7A 3MAAA 1DTTB 4FKYA 2K7KA 2N7YA 3NLCA 4HVZA 3PTWA 2BOPA 3DOKB 1TAQA 1T3OA 2CDQA 3IBCB 2W7PA 4ELTA 1HD1A 4A4JA 4MK8A 3FRZA 3ZO7A 1LW0B 4WIQA 1P27B 2HEKA 1AXQA 4YUDA 3ELHA 2GIFA 4WFNQ 4C11B 1CJKA 3O44A 1C4CA 1W25A 1ZOTA 2UXCJ 1ZH5A 4QIWD 4C48A 3SCIE 1FRIA 4YY3J 4PG4A 4P72A 2Z2YB 2XYGB 2I38A 4DV7F 2R7QA 4B9SA 1YJTA 1UEKA 4O4RA 1LWCB 3F73A 3FVYA 3LGNA 2LQ8A 4LIRA 4JV5F 2OD4A 2IRYA 2FIUA 2C3OA 2PA8D 3BBBA 1PO6A 4DV7J 1JLCA 3UN5A 1J5OB 3M8SA 1SJRA 4DQPA 1FXRA 4F2SA 1FKAF 3UO0A 3LALA 2RQ4A 2GAGC 2OMLA 3PJ9A 1WKJA 2WSFC 3R7SB 4O3OA 3K7RA 2W2PP 1LQ9A 1WC1A 1CQMA 3VVTA 2YX4A 3EVWA 4DV4F 5DETA 2VF3A 2MYFA 5E3AA 3BN7A 3RBZA 1KDNA 2Z2ZA 2L3MA 5CYMB 2MQOA 3QT6A 2YH0A 2J0QD 2FJAB 3DLKA 4M5MA 4NWBA 2GQ2A 1EX8A 3OR2B 2AZ1A 3TARA 1Q5VA 4MKAA 1LK5A 1R6YA 5AXKA 4JI4F 1FHTA 3W65A 2BQRA 5CZVA 1JXVA 3CCWA 2LQ9A 1HNXJ 2PFFB 4Q0BB 3D3CJ 1QM9A 1AYEA 1JLQA 3CCES 2KI2A 4I7FB 5FDLB 4Y0FA 3CCUS 2LFVA 3SSSA 4HI2A 5F8GA 5J2NB 4C0BA 3K5PA 4IRKA 1H98A 2JLFA 3LAMA 4JI4J 4JP8A 2ZKTA 4IO1A 1RWNB 4X4RA 5J2QB 3NGSA 4G1QB 4B3OB 3CT9A 3QSIA 3H2LA 2Z57B 3DN9A 2UUCF 2BW2A 3CJ5A 2XLJA 3MEGA 1IM4A 3PRBA 2VKZG 4LF8J 2VOPA 1BMQB 2AQ4A 1P1TA 1M5OC 4WFBQ 3R5AA 4RNNA 2KRBA 1ZPVA 2RUGA 3MURP 3HKWA 2P8IA 3HFVA 3O1LA 4J91A 3KLEA 5LL6d 2KFZA 2DGVA 5M2RA 4KR0B 5CQGA 1HWKA 2UUCJ 4ED7A 3NOGA 3HVTB 4KGMA 2C2DA 3PEJA 2PI4A 1UETA 3DYAA 3AXMA 1Q4RA 4DSIA 4YB5A 3AA9A 3A8IA 3MDFA 4LSNA 3OW2R 4OX6A 1CC8A 1U8SA 2HK2A 5KT2A 3IFEA 2AWZA 4MK7A 3IBFB 4U8VA 2LYVA 2HNZB 3HHLD 2VODA 1IBKF 3ILLA 3POTA 1VK8A 1YJRA 3OJSA 5I3QA 2EKNA 4DL7A 4Y2IA 2ADBA 4LR7A 1XIQA 2E5LF 4X64J 2KZMA 5KT4A 3PZPA 1Z1ZA 4IQXA 4DPOA 4CNYA 3FZ2A 4I56A 3T1AA 3BGFA 2DEJA 3TWZA 4MKVA 1U2RA 2IY5B 2N3OA 2M7SA 2XI3A 3OFEA 3MPUB 4MKYA 3TVKA 2VV5A 1PCAA 4IG0B 1D0EA 3JSMB 4EBEA 2K06A 2XBPA 5H9EJ 3GJRB 2G1HA 3HSJA 1YHQS 4LJMA 2N3LA 3ZZZA 1B0PA 5K20B 3D0HE 2OP5A 2VQFF 5ETLA 3HDSA 2HHVA 3T5LA 2FZKB 1S6PB 1A9NB 3P3DA 2UVRA 1M90T 3OL7A 1C0UB 1C4AA 1N34F 3VZHA 4ED3A 4DU7A 5HMZA 1EB0A 3PYFA 3MPWA 5KFPA 1XTZA 1L3KA 2VQFJ 2AJ1A 3I9V9 4YR0A 4MYUA 4QYZK 1MMLA 2NS1B 5EGYA 3GONA 3QQCD 3FSXA 1YITS 2XZDB 4NMLA 2YNIA 2B6AA 4DPTA 2PD1A 3N6LA 4MJKA 2GJIA 4NRUA 3C15A 3NGTA 2J8SA 4E98A 2EBEA 1IKWB 4KC5A 3NNCA 4X4OA 2D7SA 3UVJB 4DS5A 1H0HB 2CG4A 4UUXA 4JBCA 4PRFA 4Q7AA 4XDCA 5KFLA 4G3IA 1O51A 4UT4A 2BE2B 5K14A 3A12A 2C42A 4C3MA 5LJ3Y 4X4UA 2Q66A 2NXNA 4PXEA 3NS5A 3VGUA 1K9MT 4JI2F 4LF7F 1S1VB 4OHZA 2ZBIA 4NCAA 2KYXA 1T9XA 4S0MA 1SUQA 2JEIA 1KQSR 1WEYA 1LV5A 1KP6A 1KLNA 4DSLA 1CC7A 2PEBA 2A2DA 2BM1A 4H54A 2O66A 2C2OB 4WP9A 2HGLA 2MZSA 2UV8A 3V4IB 2KN4A 2HQDA 4LF7J 1TFWA 1PC5A 2F9DA 2CJAA 4KPCA 1FX4A 1FWKA 2MHNA 3GV7B 1M1HA 3SEOA 3MM8B 1U8WA 2XSJA 3HKZD 2GFFA 1Q86T 4FXVA 2MSSA 1DTQB 1R8HA 1DRZA 2ZBPA 5EWEA 1S59A 1I5OB 5KFJA 3GR1A 4WP8A 2E44A 3BYPA 2DNLA 2ZC4A 3I0RB 2XZWA 2Y0SD 2DGXA 3FK4A 3D68A 2DH9A 4OYWA 2RIJA 3E3XA 4JI5F 1LWEB 4ZVUB 4RNHA 3N79A 1AT1B 2I1RA 4C8OA 4P7TA 4DLEA 4CLWA 4TU7A 3TAMA 3EYZA 3GR0A 3TRGA 3D1OA 1SXLA 3TNVA 4DV3J 5KTQA 1J2VA 5KFEA 2J8AA 4JI5J 2QMUB 3QGPA 4Y2AA 2PGCA 5GAHI 2HVIA 2XNRA 4EZ9A 1UCNA 3RW6A 2FY8A 2V69A 5J1NA 2VA2A 1OYEA 2D3ZA 1KBRA 4U67Q 5A76A 1YDLA 4MFBB 4WYLA 3GV5B 1BWEA 1U6BA 4RR5A 4HEA9 2ZH5A 4YQWA 2OKQA 5FLXY 5A0YA 4NLXA 1NPRA 3H2UB 3FEYB 4QU7A 1XERA 3R97A 2Z8QA 2GVDA 5KFXA 2IVFB 3EUNA 1CEZA 4RW6A 2HGMA 4ES1A 3J7YU 4ZCKA 2PN6A 1T3NA 4LREA 4XAKA 4DFKA 1NH7A 3HHEA 1JWWA 1XEZA 4TN2A 4KKOB 1FKPA 1Z4UA 3JS9A 3IRXB 1X9MA 3CCVS 2FC9A 4YFUA 3OVSA 3GE9A 2H51B 1RA6A 1TKTA 2KRRA 1NSQA 4BHQA 2R2RA 3A1YG 3KWMA 1PBUA 5DGAA 1NMEB 1SCJB 1IBLF 1I3OB 5HJYA 4USMA 1CQNA 3DLGB 1T9WA 4ZPAA 1TZ0A 4CLFA 3IWNC 1FXDA 3RB4A 2MY7A 1V6HA 3MEEA 3ITHA 3T5KA 2CFXA 4MH8A 3U1NA 5D4PA 1TU0B 5A8RA 4M8LA 2RDDA 3NS7B 4ZVRB 1FFWB 3W60A 4C3KA 2EFNA 1S6QB 3PW7A 3RB3A 1RTIA 4KHPF 4NZ7A 2BRLA 3NXZA 4IG3B 2UXDJ 2BVZA 1S10A 2HBYB 2VHGA 3CJQA 2QA4S 2LA4A 2MHEA 4AUKA 4CRJA 4EFAC 3GP9A 2W8LA 4PZVA 4P74A 5EDWA 2ROPA 2ZJQQ 4RU2A 1XN9A 3GYNA 3FC9A 3TJ9A 4BBYA 1B70B 5HN0A 5E3RA 1B99A 5J2PA 3MCOA 2M52A 1S6OA 2M0GB 3CIZA 2OPSA 3A13A 1JJHA 1D9FA 2DNPA 2V6AA 2NXJA 4NE9C 1EHWA 2X3GA 2KXHA 3BM7A 4Q8FA 2AGQA 5LJ5Y 2CNLB 1EETB 2OD6A 1R8PA 1UW4A 2WONB 1C0TB 1TELA 4J9NA 3J80U 2HRTA 2A6OA 4ELUA 1SH2A 2A3JA 4UZCA 2KZZA 1TAUA 2CJYB 5H9FK 2WVDA 5C25A 3UWTA 4HH0A 2HHPA 1R3NA 4ZCMA 2DT9A 2JX2A 1DY3A 4ECZA 1GXUA 1TL3B 1F2GA 3RR8A 2AJ4A 1FFSB 2KXFA 4OJGA 2VBWA 4ZVGA 3FQKA 5ETKA 4IH5A 3I4HX 2UVUA 1G1XA 4DV6J 1DLOA 1H7XA 2HRYA 1S79A 3CJ3A 3GIRA 2ZUAA 1APSA 3H40A 2GS8A 5B0EA 3R5CA 4F04B 1RT6B 4OX8A 1UKUA 2P9CA 1IKYB 1PIEA 3QYYA 3OLAA 4A8FA 2EVZA 2YKNB 3SZ2A 1IKVA 4M95A 1RCOB 2MZ1A 5A8KB 1SJ1A 1L3VA 1TL1B 1QVFR 4DWIA 2R42A 3G8TA 2LEBA 2M5YA 1DTTA 3LTOA 5HATA 2ZH4A 3CXCR 3K58A 3DOKA 3BJYA 3KDOA 2DO0A 2LU1A 4HHUA 1SJQA 4N56A 4P2MA 1GT8A 3FRYA 2RILA 3UW1A 4ZK7M 1BQMB 2MKYA 1MLAA 3SV3A 5L1IA 5DLFA 4DR6F 5GADU 2LU2A 5E3CA 4F26A 3JQKA 1HBOB 3N5FA 1NZ8A 2R2SA 3TJ8A 4C11A 1D9DA 2FB0A 1ZZFA 3V81B 3M6VA 3LPYA 5G0RB 4LMZA 1RAFB 4O3PA 1VC5A 4FS2A 2YPZA 3OXLA 3NWRA 1AROP 2F4FA 1AW0A 1HQ2A 1YZ6A 2BQUA 5HBMB 3D6FB 1LWCA 2R8JA 5KOWA 5CCMA 3RRKA 2OGUA 4DV5J 4UQTA 2VPZB 3MAHA 3PO5A 4Y00A 1QAIA 2V5HG 1JKHB 2C3PA 2VG7B 2CNOB 4ZJOA 3GFZA 4HT5A 1S9GB 2XMMA 5HO4A 3C19A 1Q81T 3HVRA 1REGX 1CJUB 3H5YA 2C2RA 1J5OA 3W5XA 2HVDA 1EP4B 2XEXA 2PI5A 2VU5A 3LH2S 3PRDA 3N4WA 3WBZA 4B3MF 2Y8YA 4YN3B 2D9OA 2CZVC 4YR2A 5HQLA 3EE3A 2OPPB 1YKWA 1SVDA 1NAQA 2LQJA 4I2QB 2HG4A 1JXEA 1VBXA 4C0HA 2JL9A 1WHYA 4NA2A 5KG7A 1SIWB 3L7PA 2Z58B 3PYDA 2W8KA 5HMXA 5CYMA 3SQOP 5E7OB 4L3NA 1D09B 3OUYA 3FSIA 3HHNB 4B3MJ 4LIWA 3OXFA 4I69A 1NK8A 2QTWA 2B8QA 2WHOA 2BR0A 2DH8A 2R7XA 3OR2A 2UXBF 4J9QA 3I5AA 4J9OA 1X0PA 2R8HA 5D6GA 5LSOA 4QIVA 4NZ6A 1YX2A 1FI4A 5ETSA 2YNFB 4M1KA 4Q0BA 2VBXA 3FEZA 2VASA 5KFGA 4AL5A 2Z4PA 3QIPB 2C2NA 4UOGA 5E0OA 4I7FA 5CH7B 5FDLA 4DCPB 4ZA1A 2RRAA 5J2NA 1WI6A 1X4CA 3KKFA 1UZHA 1S1WB 2ASYA 1JK9B 2G2YA 2GW8A 5CXTA 1WG1A 5J2QA 4DSJA 5B0CA 2CQIA 2E1CA 3PJXA 3O3LA 5F8JA 2B9WA 4CIOA 2D69A 3FJ2A 2N82B 2V63A 5BYRA 3KJVB 1X31C 3PXGa 4DG1A 2R8GA 3KNAA 1WEXA 1RWVB 2YPYA 4F67A 5BXIA 3MHYA 4NCBA 1N5YA 4TU8A 3P45B 1U49A 3M6XA 4HTIA 3HVTA 1HHQA 1HNZF 1KHWA 4OX9J 1SJ4P 1VRUB 1FXLA 1F5BA 1JLFA 5KT3A 1RE1B 3D2WA 2AYEA 1RI7A 4C97A 3I56S 5E5NA 2ZBRA 2UV8G 1NPPA 1HFEL 2KM8C 1QTMA 5LT5A 2GGPB 4ECRA 4OHVA 2HNZA 4AXJA 1F5AA 5A6WA 2D74B 3G8SA 1XBWA 4Y2MA 1Q8LA 1HNZJ 2ZZNA 1NH8A 3VCDA 1RCXB 1JLEB 2NPIA 5ETQA 2LLZA 4ED1A 1N5TA 4RW7A 3MPDA 4ECQA 1NU4A 1UWBA 3MMCA 2W1BA 1F0XA 2IJFA 2LMIA 1RU1A 2PT0A 4USUA 3N6NA 3DGVA 3TUIC 3PDNA 1O6XA 2NPFA 1RGVA 1AA1B 3EGWB 1WG4A 5C2GA 4KFBB 3KLGB 2YWKA 1HNVB 1M5SA 3VHQA 2QJ3A 3GQCA 3DHWC 3KLIB 4IG0A 3LGHA 2RDIA 3QMQA 2W2MP 4DUZF 4LF6F 4PWUA 3NEKA 2EEYA 5L8RC 1S6PA 4NYPA 1S9EB 1W2IA 2L9WA 1KRPA 1C0UA 5E33A 3IAS9 1JJ2R 1N0VC 4WFZA 5LXYA 4DV0J 2Q1LA 4DUZJ 3HLUA 3MM5B 2HLTA 1TL7B 1CBKA 4O3SA 3UI3A 2CPJA 5IWAF 1MN7A 5KFHA 3WDOA 2J6UA 1HMVA 3IR7B 2V4JB 3UCGA 1JJCB 2DK2A 2WBRA 1IKWA 2DHXA 5FLXU 3LF0A 4E0DA 2QLJB 1VHFA 3UVJA 4EO6A 4OYPA 3D6MB 4OIXA 5IWAJ 1WI8A 2BE2A 2BKPA 2W2NP 2ZH7A 4CLTA 4E2FB 2D3OR 3W62A 1VIXA 3D54A 2FJVA 3JYTB 3MWBA 4ITSA 4FBTA 2BJ7A 4M5KA 2BV3A 3LW5C 3MD3A 2Y9HA 4LRDA 1WEZA 4V19X 2AD9A 2B5JB 4CO5A 3PACA 5KFFA 2MQMA 2FVPA 2KL8A 4UW2A 3R6GB 1X4DA 4BWJA 1B4SA 2EK1A 5F8HA 1BXNA 1DFDA 4KBIA 3R7BB 4ECVA 1FDDA 4MIWA 2QN6B 1ZZNA 4CO0A 3Q8UA 5K8PA 3VQSA 2QEXS 1GTHA 3V4IA 3U27A 4FYDA 4IOBA 4WBFA 1OO0B 1RHKB 3MM8A 3BYRA 4HACB 4OZ2A 3B4MA 3NMRA 2WOMA 3HJFA 2AGPA 3KUHA 5KFTA 1WUUA 3WC0A 3BSCA 2LXUA 4P52A 4LFBF 5SUHA 4I67A 3EX7B 5KFKA 3QO9B 3I0RA 1XR6A 1VQLS 3BPSP 3SQGB 1UAWA 4M5IA 4B02A 1LWEA 3TR5A 3DMJB 3AD8C 2VC0A 2QFJA 1JLAA 3U1LA 5HAOA 4C8MA 2XCAA 3JB9k 4QQBA 2QA2A 4CWBA 5CYQB 4USJC 2ZNZA 2HHQA 3TUJC 1RTZA 5GAEI 3NGKA 3NMAA 5K8MA 2ZH6A 3EZUA 3QRPA 1GMWD 1T02A 1CS4B 3GJQB 1KOOA 3HHLA 1S1XB 3R5GA 4P9SA 3HHKA 4L6V3 4OI6A 1X60A 1CULB 3QJLA 2HWIA 2VFRA 1RT1B 4DCOB 2DB1A 3TYTA 5BYQA 2DISA 1T0TV 5GVQA 1U2CA 1S48A 2XTJP 2XWYA 3PW4A 3NWGA 2NREA 1LWXA 3JSYA 3I32A 3DFEA 2DO4A 1Z2LA 1WTFA 3NL0A 2M88A 5HMWA 4OZNA 2NXEA 2LXIA 2CRLA 1N36F 1KD1T 2DHHA 1P9YA 3I6PA 5I3PA 5J1EA 3W9JA 4FVCA 3N5BA 5KFQA 4CYUB 2GNKA 3K57A 3M4XA 2RJZA 2PMZD 4PUOB 2AP6A 2JOQA 1QD1A 3OV7A 3GIMA 2DBBA 2BEFA 1Q7LB 2HW3A 2FY1A 1L5UA 5JVHQ 2H4WB 4A8YA 4KKOA 2GQCA 3IRXA 1NDPA 3TP2A 2MLYA 1RTDB 1SJ3P 3MR6A 1SIZA 4USTA 3MEKA 3CJSA 2FJDB 3HSDA 2FLPA 3PIPQ 1CPZA 3VAKA 4FYXB 3GWCA 4PG5A 3QT5A 2YKOA 3VWSA 1Q0NA 2F8EX 3F56A 3LP1B 1UJ5A 2N4DA 4OMFG 3FMWA 1V5IB 1A0OB 4A8XA 3QLHA 2G13A 5E3PA 2ZJPQ 1VQOS 1X4BA 3DLGA 2M8DB 2UVVA 3QJPA 1V5VA 4UTGA 3RU0A 3M8RA 4DR1F 2COLA 4ES2A 2VPWB 3BGOP 4XPCA 5KG0A 3GSIA 5IT4A 4FN5A 3ZZRA 3E51A 4MAKA 2IA6A 1Q95G 3CC7S 4DR4F 3PX4A 5HANA 3IS9B 3WIVA 3M2RB 3H42A 2JH3A 1S6QA 3C14B 4RBTA 4JI1F 4IG3A 5KG1A 3W66A 4DR1J 3THTA 3DDNA 3NCQA 1T9TA 5KT6A 2V34A 1VRQC 1F9FA 1HBMA 1D8ZA 2GHVC 3TA1A 4LR9A 4O0IA 3CIMA 3BBFA 4DR4J 4BWMA 3OVBA 2Y1IA 5IC6B 4N8OA 3R5BA 4GO7X 4JI1J 2ZWPA 2UUAJ 1IBCB 1OIAA 4ANDA 4QR2A 2CPYA 4U7CA 1TKZB 3BF4A 3OBIA 2WONA 1C0TA 2DIVA 5FJ4A 1VQ5S 3PEHA 2UZAA 1GMUA 4DBQA 1VI7A 4ZHRA 2W9CB 2XS2A 4FDFA 1HYSB 1S49A 3LGMA 1IN0A 3DXSX 2ZFHA 2RNEA 4UQGA 3CVKA 4IOCQ 1JLGA 3ZFVA 1TL3A 1KTVA 1OS5A 2XMTA 4WWSA 3DKDA 1OSDA 1H3DA 3KTQA 4MIAA 2EXUA 1H2UX 2EFQA 1IQZA 1OWXA 4CO1A 1FCAA 2AHOB 3G6XA 3G4SS 3SMZA 4YB7A 5DRKA 5DDPC 1U45A 1IKXB 1VMBA 2ALZA 1RT6A 5ETVA 1WSRA 3PR5B 2KVIA 3KK2A 2YKNA 4PPDA 3M05A 4RW9B 4U6PA 1NNDA 2MKCA 4Q2MA 4U95A 3HHDA 5A8KA 1TL1A 1JJ4A 5KFSA 4I6WA 3UR0A 2JC1A 1PG5B 4ZLJA 4RBVA 4K4VA 4K4ZA 4PG6A 3MM6B 5DO2A 4ECTA 2KG0A 3IWXA 3R7NB 1U47A 1VQ7S 3EXYA 5AE1A 5DG8A 2MY8A 4Q5VA 1UEVA 5LSLA 5DJBA 1NJZA 3DLJA 1FWLA 4NX9A 4IRCA 2R8KA 1VYAA 3I9ZA 2K1RB 5L1KA 4A8QA 1LXJA 4RO0A 2XO6A 2XB2D 4U9RA 4GVBA 2R7SA 1UL3A 1HBOA 4FYYB 4FS1A 4LRFA 1JX4A 1G3OA 1R27B 5CAAA 1KLMB 3V81A 5DQHA 2FVRA 2NCKL 5G0RA 2HK3A 2A10A 4L74A 3QZ8A 2DGTA 4F0KA 1Y5NB 2BMBA 4ICLB 2HRUA 4LT6A 4N5SA 3M6WA 4UF4A 1GXTA 4HYKA 3PFOA 4RUCA 5HBMA 2DCLA 1FD8A 2MEWA 1WELA 4TYBA 3IBWA 1C1BA 1FDBA 1RAGB 2FJWA 4PG7A 2AEFA 4FXDA 3N6MA 4ZPWR 2E7XA 3G2XA 2H3EB 1I6JA 1JKHA 2VG7A 2HQGA 3ZTSA 8RUCA 1S9GA 1Q78A 5HP1B 3ZZUA 5CD4A 4F3QA 1FJGJ 4JI3J 4RW8A 1CJUA 4EMDA 2CAJA 4CLKA 1EP4A 4W92B 1TVRB 1LFPA 3K5NA 4TNOA 4RBUA 2DNZA 2RH3A 4DX8H 1ZPWX 3BSOA 2XY5A 3TZYA 2ATCB 2GVZB 2OPPA 5GAHU 1Y00A 4W90B 1NKBA 1O8BA 4JI7F 3HZGA 5B08A 2NUHA 1ZTWA 1SQEA 3KG4A 4OJHA 2HHTA 2ZE2B 3CD5A 4B3RF 3N28A 4CTAB 4MKBA 5E41A 1VRTB 1KSPA 1YJNS 5T41A 3OVAA 1NKEA 1RHUB 2EG1A 1ACMB 4OYBA 2C3UA 4USHA 1VQNS 2BA9A 1UA0A 1NK7A 1HBUB 5K5MA 2YNFA 1AUSL 4LF4F 4QU6A 3H5SA 1MMDA 3QATA 3PG9A 4B3RJ 1XJWB 5L9NA 3PR4A 3M1VA 3QIPA 1WC0A 2OTJS 2E1RA 3L7UA 3HK2A 4KE5A 3W1YC 3W2VB 1NRKA 2NLWA 2AJFE 3GZ7A 4OZ5A 4HHJA 3CPWR 1U6ZA 2YXLA 4B3TF 2U2FA 2HYIB 3A3PB 4RZRA 3NGUA 1KHVA 4ZJLA 5LMNF 3KJVA 4DL2A 2CPZA 3AFGA 4IOAQ 2CWXA 4LFAF 4AD6A 2LQ5A 3DC2A 3DRSB 1KQGB 4DZ6A 5DS7A 1RACB 1UJ4A 2DR6A 5CYJA 3UFCX 5LSRA 2RSQA 4DV2J 3OXGA 1HNWF 2B9EA 4LF5F 4K4WA 3QNWB 3NY0A 1VRUA 3K2YA 3RGIA 4ECSA 4I68A 2QT7A 3H8YA 2I9SA 4PYAA 3VAGA 5D4LA 1N32J 3OTCA 3KK1B 2HVZA 1UVMA 1QAYA 3K17A 2GGPA 2QMWA 1UPPA 3DI6B 3PV8A 4F4XA 1HNWJ 3JQJA 3Q89A 5K9FA 1JLEA 1FX2A 4WP3A 1RUSA 4LQ9A 2WVBA 4G65A 1HW8A 4RPFA 7AT1B 4U7UD 4W4MA 3GG1A 3C6UB 2HMIA 2F65A 4OV6A 3RW7A 2J6TA 1GEHA 3T6BA 4UUWA 4I2PA 2V2VA 2A1BA 5T14A 4DV1F 2HHHF 1N0UA 4F4ZA 1Q8IA 4X65F 1K0VA 2XMJA 2HFUA 3DDKA 3MD1A 4KFBA 3KLGA 1HNVA 2YX1A 2ZBCA 4RUHA 1UP1A 3BBCA 2HNDA 4PYDA 2OIHA 1RTJB 4YS2A 1U1KA 3BH7B 2FQQB 4X65J 1LK7A 1VQYA 2V67A 4JB8B 2GAHC 1EQ0A 5IM0B 2Y3YA 2J0WA 5KAKA 1S9EA 4JV2A 1L3TA 1CLFA 3KLVA 1G2EA 2V2KA 2E9ZA 3OJUA 1BGXT 4B9MA 1VISA 2GX8A 3I82A 1VK3A 2L08A 3CCJS 4ZVOB 3O5TB 5U47A 2BJ8A 2ZJRQ 4Y3CA 3MM5A 1U1LA 1I51B 1NM2A 1ZA2B 3ZNJ1 4BC7A 1K0TA 1QVGR 3O2IA 3M32A 4F4YA 5D0GA 3T1YF 3M30A 3L9ZA 1RISA 1RT5B 2W9BB 5FD1A 4DHVA 1PILA 4QW8A 3J81U 1FRLA 2KTQA 2K8GA 3RR7A 4Y34A 4K59A 3SV4A 5AE2A 2RKIA 1AB8A 4JI6F 4FXWA 4A8WA 4OHWA 3T1YJ 1D1UA 3NRBA 2OHDA 4ZVSB 4P6QA 2PIIA 2CJ9A 3EICA 2J76E 1VBYA 1E6VB 3LOUA 5J1PA 3MM9B 3EJMA 3JAMY 4BC9A 6FD1A 1ZM2A 1W26A 2R7OA 3IMQJ 2POKA 5F8NA 1NXIA 4A8KA 4C8LA 2GV1A 5ETPA 1YBAA 2G0IA 5DQIA 4QIFA 4ZLLA 2E5IA 4J9MA 5KFNA 3ET6B 2XY7A 1IR1A 1B64A 1ZS6A 3KJQB 1RBAA 2RF2B 3HD1A 1UA1A 1ZYQA 2EBGA 1ELOA 5DZ7A 2AEMA 4RUBA 4ALZA 4HACA 4NA3A 4KSEB 5C42A 1HR0F 2HFVA 3Q22A 2Y0BB 1KWMA 2KHDA 3QO9A 4USWA 4KQZA 4FZVA 4L72B 4NLVA 1KEKA 2PMHA 4U7UK 4J9LA 2V8DA 1IJFB 3LAKA 4V19J 4EWTA 1FRMA 5KFYA 1TP7A 4ECWA 1HR0J 1NB2A 3I31A 4F0MA 2DNKA 2Q3PA 3BEGB 3CJ0A 1UFLA 3RBXA 4KB7A 5HJXA 2LP4A 4P73A 1FO1A 4ANCA 3IG1B 2HVEA 3CSKA 5D4OA 4LF9J 1M5VC 2MKSA 3BREA 1OY8A 3W2WB 1CS4A 2WVFA 2AGOA 3RBEA 1S1XA 2FLLA 4DQSA 2VDIA 2OPQA 2HIYA 1V3SA 1RT1A 3FFIB 2AZ3A 3MR2A 4R25A 2YTCA 4M5HA 2UP1A 3KG0A 4IFYB 2BQ3A 2E5HA 4OYXA 3ISZA 2NZ4A 4F2RA 3ISNC 4I1TA 4TLQA 4OYOA 3UNYA 2DRDA 5D8HB 3CDUA 4YB6A 1XMQF 4OJ3A 3TANA 3D1QA 3HHLC 2GC8A 3A3OB 5D77A 1H7WA 4MTPA 3SYZA 4UOCA 5C24B 4TY9A 1OPIA 2G0CA 2AYMA 4MIBA 1IM6A 1HPZB 1EKRA 2AV5A 1RTHA 1X5OA 1YGYA 3D6TB 4WK1A 1RAEB 2MPUA 1R8AA 2DY1A 2X3DA 4DX7A 4N76A 5B7WA 2CQ4A 3MUTP 4EYIB 4DI6A 3LP1A 2AYGA 4QYRA 5CABA 5IXUA 1LKZA 1WD6A 1VIOA 5GAGI 3CD0A 3E01B 1RWOB 5ETTA 3ADAC 3NGDA 2XYPB 1MWYA 4O3NA 3D66A 2OAUA 1VQ6S 1RJJA 1IUJA 4RLEA 1Y3KA 3CDAA 3M8PB 3AD9C 2CKWA 2X1BA 4NCGB 3T3FA 3GCXP 2HHUA 4J9VA 4CO4A 4PQUB 3LP2B 5HL7Q 3HX9A 2AX1A 4O44B 4IR1A 3S01A 1KVKA 2LA6A 3IS9A 4CQ1A 4ER8A 3KLHB 3M2RA 3C14A 3ZXWA 1RBOB 1JLBB 4R5PB 3V5RA 1Q1KA 2V2QA 3VAFA 1OY6A 1FTCA 4GKJF 2PC6A 4C2MA 1GH8A 1X4EA 3QSYB 2BKNA 1VS3A 1JNRB 1FVSA 3CCTA 1WOPA 2ZH2A 2YNHB 3HJVA 4JI0F 4PXDA 4RU9A 2M2BA 4YHHJ 5I3UB 1X4FA 2K7JA 1N6QB 1CJTB 1CVJA 5F8IA 3I4PA 4GKJJ 1M5HA 1SL2A 1TKZA 5JXSA 3ILJA 4KGZB 2YNGB 4NLUA 4P71A 3BDPA 2F40A 2XS5A 4DSFA 1NSKL 1BQXA 2W9CA 3V6HA 3BB5A 1REVB 1HYSA 4WKYA 1NDLA 1RT3B 1ICEB 3CTRA 2VFTA 4KO0B 1MU2B 3A8KA 4PKDB 1X5SA 3B6BA 2O01C 2CZ9A 1HBNA 2HAFA 1S72S 3FCHA 4V1Ak 1VBKA 1ZAVA 2DCUB 2FHOB 3J80Y 2A2CA 3HFKA 3RYLA 2ILYA 3E2EA 3I0SB 5BR8F 3S1TA 1IKXA 3B4DA 2JLEA 2AMCB 4IH6A 4FYVB 4YR3A 4JV5J 4KH1B 3HT0A 3K59A 3CNQP 3N9UC 2DHGA 2GIRA 5H9EK 5KFRA 3B54A 4ETXA 3PCOB 1R0AA 2DPIA 1EJ7L 3MM6A 5BR8J 4IDKB 1GMWA 2HS4A 7FD1A 4I0WA 4Y6IA 2XMUA 2KVQE 3DU6A 1U26A 2V68A 1QLNA 3R2CJ 4M5JA 4ED5A 2B7BB 1J5EF 2KG1A 1X5PA 4DV4J 3K0JA 4EZ6A 2YKMB 5F3ZA 1RBLA 4CH7A 2HKEA 2FJEB 4LRBA 1IWAA 1AZSB 4ZP6A 1FVQA 3DLEB 3FCVA 2FHJD 4ED6A 2OEMA 2VIHA 4ICLA 4O3RA 4CLLA 4L73A 1QSYA 3GPAA 2ZHAA 2GQQA 3DRYA 5B0GA 5DM6Q 1UWAA 2EFVA 2O1PA 2R2TA 1Y7PA 4UY8T 4OYZA 3UPFA 3MOZA 1KR4A 5HP1A 1JXLA 4PR6A 1IVZA 3HVAA 2AX0A 2J7WA 1XR5A 5KFIA 5GAEU 1HHSA 1IBMF 4K2XA 4RW4A 3HFZB 3PHTA 4OZ3A 2RQCA 4I6AA 1QAXA 5L1LA 2WTFA 1JB0C 3CMQA 3MMBB 1WKKA 1P8GA 4E8UA 1FEHA 1SC1B 4ILMA 4CTAA 1IBMJ 3PRVA 2FTRA 4ATNA 2BXJA 5DG7A 4X4TA 3W5ZA 2CG8A 4CM2A 1S1UB 3M9NB 5SZTA 3D0GE 1ZETA 3KNGA 2WSEC 4ELVA 5F9LA 2D3O1 1IBKJ 3DXBA 3VR1A 2J0XA 3CGIA 3KHHA 1U2FA 3OSNA 4OX7A 1D8YA 2KM8B 2AKWB 2E5LJ 5E2QA 3VVUA 3CO9A 2MTLA 5G4DA 2C2ZB 1OPZA 3VTIA 1U1PA 3H5UA 4PCQA 1TQLA 1P1LA 4DEZA 1BE4A 4USKA 2IAJB 4C3LA 4AQYF 1FWPA 3DYAB 3DRSA 3TX0A 3QAUA 1T95A 1KNZA 1PJ7A 5DQGA 2P2CB 1FKOB 4DU8A 3FEXB 1N33F 4UY85 4Y65A 4HR2A 2IVYA 2QZ8A 4NLQA 3R8YA 3X3UA 2OEKA 2CJXB 4NEYA 3HM9A 3FUYA 3F0NA 1FK9B 3G82B 1RKIA 3FKBA 2OEJA 3KK1A 3GIIA 3JAMU 4OI2A 1RWXB 3LO3A 5L46A 1N34J 1N33J 3DI6A 4NOHA 4ZN3A 1F6TA 2B4OA 1HWJA 1YRXA 2NZCA 2BKOA 2RQKA 3OFHA 4DQIA 1FNXH 2FC8A 2DITA 3CDEA 1BC6A 3MZIA 3C6UA 2W24A 1X8DA 4P7VA 1SKUB 2F7VA 2QMXA 4K4SA 1A7GE 3LANA 2C2KB 4ILLA 4C7QA 2DJWA 5J2MA 3BPDA 1Y3JA 1GMVA 3FSYA 3OTOF 3GYXB 1C1CB 4JOUA 3U7JA 2HFOA 3P49B 3H5XA 2W4DA 3R2DJ 1UJ6A 4ECUA 2KJWA 2J7KA 4KGXB 5L1JA 3I55S 3PX0A 4QOTA 2ACYA 5HSPA 4PWWA 3TO8A 4EYHB 4P2XA 1RLCL 1JQGA 1HIYA 3J7A1 5IM0A 1T9UA 4PG8A 4JI2J 3CW2C 1TUVA 2ACMA 2R7RA 2VBYA 2B6AB 1SC6A 3MFHA 2ABYA 2Y8WA 1DBDA 1RK8A 1RADB 1F9HA 1KKHA 2FVCA 1RT5A 2W9BA 2OFGX 4P2SA 5K14B 2UUBF 2ZOGA 2EWHA 3JSBA 3VALA 3OTBA 2Y1JA 2BJDA 3LP0B 5DG9A 1TKDA 5CHCB 3SCLE 5AJ3F 1U25A 2DR8A 3FMBA 3RAQA 4MT1A 3HO1A 4M5DA 1YLXA 4WK3A 4FNIA 1E6VA 2UUBJ 1NEEA 3PFEA 4Q44A 4P2FA 2OMOA 3FZBA 2OFHX 5F0WA 3W3SA 3WIUA 3OTDA 4QIEA 4HI1A 4JI8F 1SC4B 2NUUG 3L95X 3RAXA 1RWPB 2QE5A 1P9QC 1DQAA 2FJXA 3CJ8A 2ASJA 4ILRA 2M8HA 3ET6A 1M5PC 2VB6A 4AYBD 2YKAA 2RF2A 1FE0A 3US5A 3M8QA 1KFSA 5B0BA 4IFVB 1FESA 5CA5A 3WX4A 4DS4A 2VICA 1X9SA 5HQMA 4DDFA 2GMHA 3PJWA 1BUXA 2CJQA 2M9KA 3TW0A 5JVGQ 3MTJA 4ZPTR 2G2OA 1NDCA 2GZOA 2H5IB 1HQUA 2DNYA 2ASLA 1FNMA 4Q8EA 2JEJA 2VPXB 2QV6A 4YEAA 1RWUA 1MROA 3MF5A 4LSZB 3N0VA 1Z2ZA 2VA3A 2CQCA 4RJVA 4K2JA 4CZCA 2EFOA 4KYZA 2BBEA 3HZEA 1WWHA 1LEOA 2EK6A 5ITHA 3F41A 1MMNA 1X7VA 3T1HF 5L38A 4K0KF 3IG1A 4JYAF 3MCMA 4ETZA 3VAJA 3FBEA 3CJKB 4USIA 4DR5F 3W2WA 2MMYA 2DNMA 5B0AA 4DR2F 4DX5A 1R31A 2FHMA 2H48B 1VOMA 1IBLJ 2CQBA 4X4QA 1S0NA 1Y5IB 2ZITA 5A8WB 4QWEA 2MZTA 4IH7A 1PSDA 3IR6B 3DCAA 4ZLNA 1NHKL 1RHMB 2E7WA 2XHWA 3Q2SC 4CH1A 3BGRB 4IFYA 4DR2J 3IGVA 2QX0A 2ZH9A 4DQRA 2J6SA 4OYMA 1YRUA 2Q6BA 3IA0A 2FUG9 1O5JA 5A2QY 2E1MC 3UR3C 5KG4A 1FKPB 1NBEB 5E3QA 4DFJA 4KHPJ 2R4FA 1SKSA 1R43A 2J9EA 4PWDB 1FEEA 1NSPA 4LRCA 4OI0A 5C24A 3I5BA 2A6MA 3MFIA 2MQPA 3G96A 3H0PA 4JUZA 1TKTB 2WZ1A 3A4TA 1HPZA 5IFMA 2H9ZA 5BJRA 3UE2A 2JFKA 2ZHOA 5KFDA 3D6HB 2RMLA 1BHNA 3RJMB 2E7VA 2KHCA 4F4KA 1U09A 3PW0A 1ZBTA 2A18A 1IWGA 4URQU 3SBMA 1TUGB 3AA8A 3GYGA 4ID5B 3ITHB 5C5JA 2IDEA 3TA2A 2H65B 3EM1A 5A8RB 4DMZA 2XYHB 3OTEA 3M8PA 1SH0A 3MMJA 5HROA 2KKHA 3MOJB 4WXOA 1FT8A 2VFSA 2IFXA 2MKIA 3Q2TC 2F8MA 1F5CA 1H74A 4O44A 3DOMB 4OI4A 3UD5A 1FFGB 4DN9A 1WNEA 3FGVA 1SI9A 2MKJA 2J7UA 4MYTA 4RUAA 4R5PA 2HVHA 4XPEA 1LW2B 4K4YA 1VJQA 2X51A 3VGTA 2XMKA 3IRWP 3W61A 1WORA 4ZVQB 1H72C 4BLGA 3BO2A 2BRKA 5EHHA 4A47A 1FJ7A 4M63A 4G1IA 3RTVA 2O67A 2NSCA 2DVIA 1XNRF 1K44A 3D67A 4RWXA 2YNHA 3Q86A 2GO9A 3EVOA 1R8CA 1OQ6A 1LW0A 2RD5C 2LDIA 5I3UA 3BKTA 3ZTRA 2NYIA 4QBUA 1N6QA 2LKZA 1CJTA 4DF8A 3R9LA 2KB2A 1B0TA 3QGIA 4ED4A 2YNGA 1B7YB 4K7QA 1XNRJ 1CSJA 1FRJA 1JMTA 1ULRA 1XC9A 1V3ZA 1X4GA 3CWJA 2VQEF 1VBZA 1REVA 4ZOSA 2GHPA 3H90A 1DLOB 2HSEB 4KO0A 3C8YA 1MU2A 2IPOB 4DR6J 2XNQA 3A3NB 2DH7A 2EG2A 3LQVA 4N7TA 5KFVA 3DHXA 4ZJQA 3CUNA 1LNQA 2HQ3A 1UW9A 3BH6B 4Q43A 2ZZMA 4G6VB 2VQEJ 2AEJA 1YBTA 3T6JA 1SV5B 4LRAA 2H1YA 2OH2A 1RHQB 2PEHA 3RB0A 1OSCA 1H2TZ 4PXBA 3I0SA 2CPIA 3CMAS 1KC8T 2J9DE 4DFMA 1VQ9S 4XDDA 4F02A 3EGZA 3HSGA 2FPHX 2UXCF 1K8AT 1NKCA 3M9OB 4YY3F 2OUGA 5DGBA 4F3OA 3QWPA 4IDKA 1LOUA 1NJYA 3BR9A 2W7AA 2DNRA 2VD3A 3PX6A 1L3UA 2VJUA 2CJKA 2AYBA 3OPKA 5HI7A 3EDQB 2QA1A 2PFDA 1HWIA 4F7VA 3T19A 2AJ0A 2YKMA 3J81j 1TL5A 3UDCA 4GC6A 1AZSA 1LWFB 4C8YA 3UCZP 3DLEA 4WZMA 3CCZA 3BDEA 1XR7A 3KOAA 3IR5B 2IRUA 1UVLA 2RUSA 2UXBJ 4IO9Q 3QWUA 3EGVA 4B3OA 1OJ4A 4G1QA 4ZLPA 4B3SF 1YJVA 4ZPDA 4J9KA 1QSLA 2FYXA 2KO1A 1PKUA 2GO8A 1EQMA 2HBZB 2ADCA 2ZKUA 1F3FA 3Q24A 5D0HA 3IGNA 4B3SJ 2MGZB 4GC7A 2HZCA 2IYIA 1WF0A 1UTAA 3OFGA 2DNGA 4JV0A 3TOQA 3GSDA 1HNXF 1S0MA 1WACA 3OUYB 2VKRA 1RAOA 4CDIA 3QAEA 2HHWA 4I6YA 2A0FB 3MMBA 4FBUA 4NLRA 1B3TA 5L39A 2DRAA 2JFDA 1MNEA 2XS7A 1DQ9A 5KG3A 2HQFA 1DJ0A 2VOOA 3P96A 1WHWA 2E9TA 1YZ7A 1NJIT 2GJ2A 3JXOA 2ZM6F 1F1BB 2MZQA 2F5GA 2OSQA 4OQJA 2EI5A 2CQHA 4LF8F 2B51A 1Q7YT 2R7WA 3M8WA 1S1UA 3GFHA 4LFCF 3QJJA 4F50A 1URNA 1KN6A 2ROEA 4A8OA 2CQ1A 4DUTA 3NAHA 1FRHA 2HLUA 3T9NA 4NA1A 2L9NA 5KFBA 2ZM6J 1N48A 5L9XA 2DIUA 5D3GB 3MGJA 4DG1B 3RG6A 4LFCJ 4OZLA 4J9UE 3MECB 1NCLA 2UUTA 1G7CB 3C66A 1S7IA 1Q8KA 3OLBA 3KJNB 3UD4P 4QWAA 1N5YB 4URGA 3JSMA 2HIQA 4PPZA 4QJVA 1QSSA 3L3CA 1YBUA 3GIJA 2IAJA 2V8PA 4OZ1A 4ZMMA 6FDRA 2C22A 3KMQA 2XMVA 4M94A 4C8NA 3OL8A 2J5AA 5GAGU 4X2BA 4B9TA 1JLFB 2VUGA 2BYCA 2NSBA 1FKOA 3ISND 4H4MB 4X64F 2JWNA 2V9KA 1F60B 2GA7A 4KTQA 1UVNA 4LF6J 1DHMA 5HVFA 4A8MP 2E1AA 5JJBA 3NNHA 1FK9A 3G82A 4OL8A 4B9UA 3G86A 3BGUA 4WFYA 4RW7B 1P6TA 4ZVFA 4WIIA 1HHTP 1VC6A 1UWBB 3NCPA 3ENQA 3MMCB 4B08A 2XG8A 2R3VA 3X1LB 2BM0A 4Z7YA 2WVEA 9RUBA 2W25A 3AHPA 4DL6A 4L3KA 3HULA 2FJBB 1TK0A 5ADZA 5D4NA 4ED8A 1RT7B 2DD8S 1U0HB 4KY3A 1PAEX 2AF6A 2WRMA 4KHRA 5CCLA 1Y10A 2OPRB 3JTOA 3G6YA 1C1CA 3BR8A 3CJ4A 1S1VA 3GTYX 2YX7A 2YQ3A 4CT9A 4C8ZA 1T9YA 3WX8A 5D78A 3MR3A 2ZNYA 1X4AA 2QL5B 1ZM3A 3GILA 2JEGA 1NJWA 1NJXA 4ZIWA 3GIKA 1I94F 2FVQA 5CZXA 2FHJA 3D0IE 1TL4A 2CVIA 3JTNA 3OR1B 3AQPA 2C28A 2DXEA 2ZOMA 1KFDA 3S7RA 5KG5A 1RKJA 1DTQA 3RUBL 2BE9B 3ILOA 1SC3B 3BSNA 2BACA 4DPWA 1HMVB 2WB4A 2U1AA 1RZMA 1S6UA 2R2UA 3DNCA 1N5QA 1I94J 4K8RA 2CQPA 4MMOA 1I1GA 1AUDA 4KV8B 2QLFB 2ATLA 3G6VA 4CLSA 2ZH1A 4XO0A 2JZ5A 2HHSA 4FYWB 4DR3F 2RRNA 2KT3A 3WHIA 2B9YA 1EKSA 3K8VA 4X62F 1X5TA 5F3TA 1WDTA 2WB1D 4CLZA 4K5SA 4LFBJ 2F63A 5F9NA 1RLDA 1WJ9A 5IQ6A 3LP0A 3QT7A 1ZTTA 3MR5A 1BD6A 2JJ4D 3WZ0A 3D5MA 3TI0A 2YWHA 4DR3J 1MWQA 3KJFB 4NL5A 3S8SA 4X62J 1WDDA 3C2PA 5A2QU 2IM1A 1YIJS 4PEOA 2IDLA 2ZH8A 1JNZB 4DUYF 1GX6A 4Y2CA 4F8RA 1U1QA 2K3KA 1F2HA 2G2ZA 4MFBA 2ZH3A 3UDLA 5HLFB 2HWHA 3O8WA 3J81Y 5KG2A 3D4JA 1FRXA 2D9PA 4M5LA 5KFCA 1M1GA 2B0GA 2D1CA 2WOMB 4D3HA 3C3LA 5EN1A 3E8OA 4DUYJ 4B9VA 2AU0A 1S99A 4P10A 1S1TB 4OLPA 4IFVA 2JSXA 3W5YA 4CLPA 4DV3F 1DZ5A 2DGQA 2NXUA 3ZNUA 3LA0A 3KG1A 2EC2A 1KVJA 2CJBA 1JLAB 2EPIA 1N36J 3TQ1A 2QGFB 2VJVA 1Y11A 2Q79A 3P5TL 4YB1P 4NYZA 4N8NA 4GMKA 3OT9A 3BGLA 5HQ8A 2WBMA 3K8WA 4GKKF 3CD6S 5I42B 1UVKA 1TKXB 2F9JA 2FLNA 1G6BA 1YJ9S 3IXQA 4IRDA 3DOLB 4EO8A 1GTEA 3HHLB 3VAIA 4TYAA 4EBDA 5ETMA 4KGVB 3KLFB 4J37A 1FF2A 1OMSA 2F8HA 1K1SA 5IT9Y 1RT4B 1TV6B 4OFZA 2DRBA 1MWZA 3AJ1A 3CJKA 3NOCA 4GKKJ 4O4GB 3CCRS 3GFYA 2Z0GA 4Q2LA 1KS2A 2E5GA 3K5LA 1HARA 3EPGA 2LEPA 2IBKA 4QYZJ 3M6UA 2XGPA 4KRWA 1FDAA 3PO4A 2P9EA 5A8WA 4TQSA 5J1EB 2ZVIA 1FJEB 2RRBA 5KFUA 1Q16B 4NXNF 3F44A 1AFJA 4H4KA 3BGRA 2YWWA 1PGZA 5IC4B 2ZZTA 4DOZA 1PC4A 2WVCA 5KT5A 1OQ3A 3EVMA 3UDVA 2JDJA 2I0XA 2B9XA 5A6PA 1NHUA 4EI2A 2L9DA 3QRRA 4DPUA 2I5JB 1YRTA 4CLUA 2W01A 4NXNJ 3OL6A 2ZHBA 4PWDA 1R8BA 4ZPBA 2B43A 4BS2A 1G4CA 2L41A 1RAIB 3ENAA 2GJFA 2BJ3A 3BN4A 4J90A 3CJRA 3AQOA 1EETA 1T8EA 3R6LB 3CDBA 1N88A 4IUFA 4WFXA 3QLHB 1VQKS 2OTLS 2ZUGA 3CD7A 4WZQA 3DRRB 4DFPA 7FDRA 2OO4A 1U1OA 2AJQA 2YWFA 3H4DA 3DGPB 1MSWD 3P5BP 2MSTA 3CCMS 3UN2A 4ZDNA 3Q8PB 3SIPB 2UXDF 1SH3A 1CJVB 4ECYA 1S5ZA 4A48A 4YDDB 4ID5A 2ZVSA 3PHEA 4CCHA 3EZOA 2XM3A 1XK8A 4FPIA 3D7SB 4DN0A 4ZP9A 3KFWX 2VG5B 4DQQA 5BYSA 2CYYA 2MDAA 1TMJA 3N01A 3L7OA 3VQTA 1IKYA 3MM7B 3M8ZA 3DOMA 1HBMB 4QR0A 4TVAB 1S0VA 1U7LA 3R5DA 4WE1B 1WC4A 3ENWA 3G8QA 1QDUB 1YK9A 3HXMA 4DL5A 5DDOC 1LW2A 2MQ8A 3C16B 2HFSA 2L48A 3U1MA 3RZAA 4DL0C 2RE1A 2B7CB 2VPYB 2FZGB 2W4CA 2HBRB 2FDNA 1DARA 2W2OP 1T03B 3ZZPA 3IM9A 4M5NA 1OY9A 2X1AA 2FD2A 5HMYA 3M9MB 3DLHA 4ZHRB 4DV6F 1BQMA 2CDRB 1YVFA 2MXYA 2F4VF 3HVWA 1GFWB 2DXDA 2E29A 4MK9A 4TLRA 2RQMA 3TVZA 1JLGB 2R7UA 2HS3A 4ENOA 3ETOA 4Y2KA 4W98A 1S0OA 4ZP7A 1UVJA 2DY9A 2DNNA 3H98A 5AXMA 1PBAA 2EW9A 1VLOA 1B0VA 1M1KT 5LMUF 2F4VJ 3DM2B 3H4BA 2CQGA 3I96A 3H2VE 3J7AN 5MAOA 3CB4A 2X1FA 3PNIA 4X4NA 1K73T 4ES3A 4G1PA 3KK2B 1EAYC 3KHRA 3PKYA 1SV5A 3NNAA 1WOSA 5LMUJ 3CF5Q 2F1FA 3TZWA 1U6FA 3V6JA 4R0JA 2MZJA 2QRRA 2CWKA 4HTJA 2V50A 1S7HA 1KOHA 3K5MA 3KUEA 5KFAA 2ZBQA 5DM7Q 3AOAA 4WXWA 3HPOA 2QFIA 4I2QA 3VGVA 2H5JB 2IMOA 4NLGA 2I6WA 2ZOFA 2F3JA 2WW8A 4OZJA 3FNNA 2XSFA 3QRQA 5D0RA 4N77A 2BX6A 4TKTA 1PJ5A 3QBCA 4F0HA 4GVBB 4YMEA 2AIRB 1PYSB 3BO3A 4QPTA 3W7BA 4DV5F 4OV1A 4NLTA 1PAUB 2JC0A 2KFNA 4NLWA 4JI7J 4AL6A 1VDHA 3CJTA 4N41A 2HNYB 4O23A 3CCSS 4ZP8A 3QZ7A 3M2UB 3CO0P 4KGKA 4J9SA 4OZ0A 2HZVA 1LWFA 3Q0AA 2W4PA 1A6LA 2D41A 1C1BB 1NUEA 3S6EA 1YTYA 2N4CA 2BE7D 3CDWA 1S1WA 1RB0A 2XC9A 3HI9A 2JVOA 1YJ7A 4LF4J 3TZXA 2XI2A 4RW8B 1TUWA 3D1HA 5D0EA 1TK5A 1BQNB 5DDQC 1RQ0A 4JV1A 1RXOB 2FLOA 4OI3A 4WKRA 3QGGA 2DGUA 1HQEB 1J27A 2HPUA 3G71S 3Q8SB 3BKFA 3EDRB 3KUGA 2DNQA 8ATCB 2MGZA 2VFUA 1WF2A 4B3TJ 2D3UA 1S76D 3W9IA 4FVMA 5IT0A 5LMNJ 3TUZC 4DL3A 1RAHB 5H9FJ 4FNHA 4D3GA 4LFAJ 3HMJG 2DGSA 1S9FA 4QZVB 4WTOB 1U48A 2IBOA 5IV4A 2DKOB 2R8IA 2AW0A 5M2PA 1MG7A 5IS2A 4CLYA 1QE1B 1IJEB 1VQ4S 3HSZA 4LF5J 3THPA 5HVHA 3TQEA 3M1VB 4J5OA 3GB0A 2C2EA 4EBCA 2VBZA 4ERDA 2QL9B 3NBPB 3Q8VA 5H1SV 2G4BA 4HT7A 4ZCLA 1H6KX 3BO4A 3ZZOA 4ZCIA 2Z56B 1NK6A 2V9WA 4QWDA 2IVMA 4EGLA 4NLSA 1M5KC 3PKMA 3IC1A 1Y4ZB 4TY8B 2HBQB 3VAMA 5D3GA 4OX9F 3ZTOA 3QGHA 3MEDB 2BANB 1IXKA 3NG8A 1VC0A 4F4AA 1HL6A 2CIMA 3TAPA 1UFKA 2HFZA 3MECA 4ZVPB 2UVWA 2CQDA 3KLIA 4DV1J 2HHHJ 1HKAA 2VH7A 2XLKA 3M7VA 1FA0A 3G87A 3MXHP 2VZ9A 4H4OB 4X84A 3GU0A 2K2PA 3JTPA 2ZD1B 3MCSA 4DJBA 3I5CA 1TK8A 2ROGA 2BUNA 4H4MA 4OHXA 2HGNA 1WF1A 3UDEA 4L75A 4Y28C 1UMJA 4DSEA 1IR2A 1HD0A 2VC1A 2J9DA 3H25A 1U4BA 3D9BA 1F9EB 4ZIVA 4CH0S 1H73A 1TL7A 3AOBA 3Q8QB 1VQMS 4XIUA 5EX0A 4WF9Q 1RU2A 2HMIB 4KAIA 2Q43A 3CEDA 3LPEA 4I2PB 2YBVA 2KH9A 5IV3A 4HH1A 3EGNA 1ZM4A 3VZIA 2V4JA 4PABA 2W2QP 3ZC4A 2RS8A 3MUVP 4EU0A 5EWGA 3MAQA 2XQCA 1JIHA 2Z2MA 2HS0A 2KT2A 1RT7A 3VAHA 3DLBA 1U0HA 3SCKE 3I87A 2XHCA 2G9OA 2CPEA 3UNGC 4HDGA 2HNDB 4B17A 3AXKA 4NPOA 3FBBA 2DYAA 2CUYA 2HQCA 2ASDA 1SPBP 3HD2A 3JYTA 1UZDA 4DV0F 4N47A 1RP5A 4DPXA 2OPRA 1UPMB 2IM2A 4JI6J 2BJ9A 1TMMA 5THWA 5F8LA 2B5JA 1NZAA 2YWEA 2JRSA 4LSLB 3C6TB 1YJWS 2QLBB 3PYGA 3P8BB 2QA4G 4LVOP 1KQKA 3QFWA 2XULA 2V94A 4IKAA 4UOHA 3OQ2A 2LDYA 2RT3A 1T7PA 3OR1A 3Q23A 4OYIA 3M32B 3QIDA 4ED2A 3M30B 4AFFA 5IT9U 3W9HA 4K4UA 2MLZA 5ETOA 2JLGA 3GFXA 1HW9A 4KV8A 1NDKA 5GMKa 3ICLA 1NK4A 3SQGA 4LF1A 2VG6B 3KMSA 1URRA 1O0PA 2RKIB 4HLBA 3M8YA 1H2VZ 1VGYA 4U8YA 3TA0A 2G1DA 1T05B 3DMJA 2DR5A 2R7VA 3UQSA 1RA7A 3A8JA 3W64A 1C2PA 5CYQA 1YI2S 5IQQA 2IHR1 4HHHA 1NPKA 2E66A 1Q5YA 4O0NA 3MMAB 2GHWA 2DPJA 2AT1B 3SDEB 2BOAA 4ZN1A 4OHYA 4J9PA 2QC3A 3B82A 1N8RT 3DRXA 2QLWA 3BQ2A 3V4MA 2RHQB 5KFMA 2CPFA 4P75A 3W8GA 4KHMA 1N4LA 3B78A 2CQ2A 2KXNB 3NKYA 3L4BC 4YDXA 3CC4S 1MW7A 1CULA 4NEZA 5HLFA 5B0DA 3AJ2A 2CPDA 3KK3B 3JSRA 1LFWA 4PAAA 4C9DA 1U1NA 4ZVEA 1EZZB 1RDRA 3LWLA 3IM8A 4I64A 5MLCV 2CNNB 1ZAWA 2M70A 2UUWA 5C42B 1NO8A 4WCEQ 1HI1A 3HCXA 2PMWA 3EPIA 2B3TB 1S1TA 5T7LB 4CYUA 1QAJA 4WYWA 1U02A 2QYCA 2KDOA 4Z2XA 4PUOA 4LF2A 1SBRA 2PE8A 1NK0A 2LVWA 3MCNA 4UOFA 5GMDA 1U24A 3D3BJ 1GQEA 3SFGA 2CXEA 2DNHA 4J9RA 1NB7A 2HQIA 2ZDOA 1KVIA 2E5JA 3RB6A 3V6DB 1RTDA 1XMQJ 2NQPA 4DSKA 1HWUA 2MLXA 1Q53A 5I42A 1TKXA 2KFYA 2BW7A 1Y9OA 4U96A 3DOLA 2W9AA 4LR8A 1WC3A 2GCFA 4KIAA 2DTJA 3KLFA 2OPQB 2X1GA 4X4SA 2BJEA 5KG6A 1RT4A 1RABB 4CI0B 1TV6A 5RUBA 3TEGA 3BKUA 1Q79A 4AT1B 1KTQA 4O4GA 3CCLS 4R8UB 1S77D 4IQMA 3QT8A 3IO1A 3FDSA 2MJNA 1WHVA 3ZZTA 2NXCA 1BLUA 2CPHA 4DF4A 1NLKL 4CP5A 2R7TA 4I4BA 3QPIA 1GNKA 3M2VB 1YJUA 4PXCA 3ILIA 2QO3A 4RKUC 1RWMB 4BCAA 4ZVTB 5I4MA 3T5HA 8AT1B 1WSVA 3SXLA 3PIOQ 4UZBA 4FF4A 5LXRA 2XMWA 1W7WA 3EXCX 2I5JA 1RTHB 2DXFA 3T5JA 1SQFA 1SL1A 4NI2B 2V8VA 2Q6CA 2BZ2A 2QLXA 1D3WA 3BS9A 4B9LA 1SKWA 2G0JA 2HWTA 3TJAA 3V2UC 3OFFA 3MPYA 3OHAA 4ZPVR 5AXLA 4QWCA 4H4KC 1FERA 2M3DA 1E6YB 3TZZA 3DRRA 4JI0J 3MPVA 4EEYA 4GVLA 1HNIB 2DHAA 3DGPA 4AL7A 5AE3A 3NCRA 2IC3B 3DRPB 1N54B 3QFHA 1V3RA 4QCLA 4QWBA 1CJVA 1RT2B 1RWKB 1BY9A 1VR6A 4KT0C 1IR0A 4FKXA 1VCTA 2CPXA 2KU7A 1VQSA 2VG5A 3H59A 4NLPA 2P6SA 2EC0A 1XMOF 3SCJE 1NHVA 2BABA 5K8OA 2UUAF 2OJ3A 3IWLA 3MAAB 3MM7A 5F0UA 2IMWP 2XCPA 5C7PA 4RW9A 3RRGA 2V0NA 4F3MA 2LCWA 4WE1A 2OELA 5IZHA 2E1PA 1RAAB 3R5JB 3C16A 1XMOJ 1S4EA 1FNOA 2BDPA 1T9VA 4C0OC 3HT3A 2HURA 4TXSA 1T03A 1S4FA 1CJKB 2WK4A 1FTRA 4L76A 4XTTA 2EFPA 2P5VA 1S97A 1FE4A 4TQRA 2V8HA 4C6AA 1RYSA 1PYTA 1VJWA 2LQBA 2YQ1A 1N5VA 2K1RA 2HAIA 5KFWA 1D9AA 3BSAA 2B4VA 2CVEA 3RAMA 1KLMA 1ZA1B 1BWVA 2ZEJA 5B09A 2R9LA 2DNOA 2RDJA 1S57A 3ONQA 2YH1A 2YKQA 2PSZA 1HBNB 4WTYA 3Q8YA 4WPAA 1J5EJ 1WC5A 2FGOA 5EWFA 2OI2A 2N7CA 3DM2A 2P9GA 1JLCB 3NAIA 4LBPA 2ZDPA 1DURA 3FBCA 1F3VA 4ECXA 4K5RA 2OSRA 1X9WA 3B8HA 2FHKA 1LXNA 1YG0A 1N56A 5CD4H 4F4WA 3KYLA 3MR7A 4NZ0A 4ANEA 5DDRC 2MJUA 4A8SA 1TVRA 3FQLA 2WW4A 1R0AB 2B56A 3OSPA 3GLJA 1Q82T 4Z37A 3DLLQ 1TFYA 3K89A 2GVZA 3GJSB 3DLKB 3NS6A 4J7CA 2KYZA 2PO4A 2YQ0A 3PVXA 4LVNP 2RS2A 2RAQA 2C3MA 2MKKA 4RL1A 1T11A 2ZE2A 1GX5A 1VHIA 2IJRA 1VRTA 3UD3P 2BJ1A 3W63A 1VFJA 1RWWB 2J9CA 2B4PA 2CQ0A 1JLQB 3EMTA 4HKQA 2DR7A 2O3DA 3TX8A 3L09A 1GK8A 2HNYA 3FCWA 1HBUA 1U1RA 3U02A 1FJGF 2MQLA 3M2UA 4JI3F 3C46A 1OYDA 4GO5X 3G6ES 2XY6A 3AD7C 4URSA 2I8EA 2LECA 1WHXA 1CG2A 1AFIA 3H20A 4RNFA 4LBIA 3J7YI 3MEGB 2LEAA 2XZTB 3OD2A 3W2VA 1XQIA 4TU9A 2VDHA 2OLWA 3PYEA 3KDNA 4NASA 2XLIA 3GCWP 2IIHA 1FD2A 3KLEB 4KPYA 1V9OA 1BQNA 1R89A 2CZ4A 4ZVHA 3CULA 3IAM9 3TUPA 4RW4B 2J0SD 3RBDA 1TTHB 3ZTQA 3G9CA 4KJIA 1HQEA 4GRSA 3D28A 4RX6A 4DX6A 4OJ1A 1X4HA 2RU9A 4CT8A 4HL9A 4LSNB 2RU3A 4FF1A 4WU3A 3TAQA 3HF5A 4K4TA 3MI7X 3POTB 1SJFA 2W7OA 2JHEA 2PDAA 4DLGA 4AQYJ 3P6YC 5EX3A 4XK8C 4IYQA 3ETMA 3CC2S 1QE1A 3EZ5A 2DGOA 1W2BR 2MKHA 1ZAXA 2NYHA 6AT1B 1IQTA 2Y1LB 4B9NA 3VV2B 5DZ6A 2APOA 1U1MA 5KT7A 3NBPA 4HDHA 3LUYA 2QL7B 3NP5A 1R7IA 1HLWA 2Z30B 4QR1A 5F41A 2FVSA 4ZKAA 2X7IA 4DXLA 1WG5A 2K3IA 5JMNA 4NXMF 4TY8A 4DV2F 2YWGA 3BZQA 1FRKA 3MEDA 4NLYA 2BANA 2WSCC 2H54B 3CCQS 2IM0A 1EIYB 5KFZA 1QJHA 1N32F 5D15A 2H5EA 1RTJA 4CM0A 2CNKB 4H4OA 3GV8B 4NXMJ 3AB2B 1K1QA 2ZD1A 3AH6A 1HA1A 2O5DA 3VF0B 3AB4B 3OTOJ 3A8EA 4NMXA 4RWWA 4OLOA 1M0SA 2MZRA 4WU2A 2M4MA 5ETRA 3ULHA 1N52B 1XNQF 2SXLA 2YNIB 4ZS6A 3JQMA 4CO2A 3SSRA 3GG0A 2QSWA 4EK2A 2QG9B 1YSJA 3C15B 3ZTPA 4WJBA 1Y0HA 1RHJB 4R0EA 2YKPA 5M2UA 3P4UB 3BQ0A 1XNQJ 2RHSB 2ILZA 2MQNA 4NLOA 5J2MB 2GMLA 3T9ZA 1X0FA 3RRHA 1ZM9A 4Z7CA 3V6KA 1U0SA 4LQ3A 2DEIA 3BV8A 3IN5A 3MM9A 1SUQB 5AJ3J 2PA3A 4ZPCA 4DCJB 5GADI 2DGWA 2UU9F 1WC6A 1EARA 1QUPA 5KFOA 5GMEA 4LSLA 2Z2LA 4EUVA 3R27A 1N5SA 5AXNA 2XSJB 4ZITA 3BQ1A 3C6TA 3K5OA 3ENVA 4C98A 3VGSA 5F8MA 3AY0A 2CQ3A 2FGCA 3IP0A 4RNMA 4JI8J
chains in the Genus database with same CATH topology
1RWPB 3D6HB 3KJFB 2QL5B 2C2OB 3RJMB 3GJTB 3R7SB 3P4UB 2Y0BB 2DKOB 2CNOB 1BMQB 1RWKB 2C2ZB 4DCPB 1NMEB 2H4WB 2XZDB 2CNLB 1RHUB 1QDUB 1I3OB 1ICEB 2H54B 3QNWB 4ZVSB 2H48B 2C2KB 2FQQB 1RWMB 1RWWB 3R6GB 2HBZB 4ZVTB 3GJQB 3R6LB 2CJYB 5IC6B 2CNKB 4JB8B 1RHRB 2HBRB 1PYOB 3R7BB 1SC3B 2XYGB 1RHMB 2H65B 1SC1B 2P2CB 2QL9B 2XYHB 1F9EB 2QLBB 3GJRB 1IBCB 4DCOB 1RWVB 5K20B 3KJNB 1RHKB 2QLFB 1QTNB 2H5IB 3NS7B 4ZVRB 4ZVUB 2CDRB 3SIPB 2H4YB 4DCJB 2C2MB 4ZVOB 3EDQB 2H5JB 4LSZB 3IBFB 3R5JB 1GFWB 2XZTB 2CJXB 2Y1LB 2HBQB 3R7NB 2HBYB 3P45B 1I51B 2QLJB 3EDRB 3KJQB 2CNNB 1RWXB 5IC4B 3D6MB 2QL7B 3D6FB 4ZVPB 1RWNB 2C1EB 1RWOB 3GJSB 1PAUB 1RE1B 1RHQB 4ZVQB 2H51B 2XYPB 3IBCB 1SC4B 1RHJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWP B;  3D6H B;  3KJF B;  2QL5 B;  2C2O B;  3RJM B;  3GJT B;  3R7S B;  3P4U B;  2Y0B B;  2DKO B;  2CNO B;  1BMQ B;  1RWK B;  2C2Z B;  4DCP B;  1NME B;  2H4W B;  2XZD B;  2CNL B;  1RHU B;  1QDU B;  1I3O B;  1ICE B;  2H54 B;  3QNW B;  4ZVS B;  2H48 B;  2C2K B;  2FQQ B;  1RWM B;  1RWW B;  3R6G B;  2HBZ B;  4ZVT B;  3GJQ B;  3R6L B;  2CJY B;  5IC6 B;  2CNK B;  4JB8 B;  1RHR B;  2HBR B;  1PYO B;  3R7B B;  1SC3 B;  2XYG B;  1RHM B;  2H65 B;  1SC1 B;  2P2C B;  2QL9 B;  2XYH B;  1F9E B;  2QLB B;  3GJR B;  1IBC B;  4DCO B;  1RWV B;  5K20 B;  3KJN B;  1RHK B;  2QLF B;  1QTN B;  2H5I B;  3NS7 B;  4ZVR B;  4ZVU B;  2CDR B;  3SIP B;  2H4Y B;  4DCJ B;  2C2M B;  4ZVO B;  3EDQ B;  2H5J B;  4LSZ B;  3IBF B;  3R5J B;  1GFW B;  2XZT B;  2CJX B;  2Y1L B;  2HBQ B;  3R7N B;  2HBY B;  3P45 B;  1I51 B;  2QLJ B;  3EDR B;  3KJQ B;  2CNN B;  1RWX B;  5IC4 B;  3D6M B;  2QL7 B;  3D6F B;  4ZVP B;  1RWN B;  2C1E B;  1RWO B;  3GJS B;  1PAU B;  1RE1 B;  1RHQ B;  4ZVQ B;  2H51 B;  2XYP B;  3IBC B;  1SC4 B;  1RHJ B; 
#chains in the Genus database with same CATH topology
 2IYG A;  2UU9 J;  4OYA A;  2FZC B;  4K4X A;  3Q83 A;  2RB7 A;  3O6Q A;  2XO7 A;  3R3T A;  3ZZY A;  1KON A;  1NK5 A;  4LUB A;  4USV A;  3WC2 A;  5LM7 E;  3TAM B;  2QYG A;  2NR0 A;  2AJ2 A;  1Q8B A;  2VG6 A;  3FBF A;  3J7Z T;  1T05 A;  4M5D B;  2DR9 A;  2VON A;  1HWL A;  4QW9 A;  1VQ8 S;  1WOO A;  2VL1 A;  2C3Y A;  1UEU A;  1VQP S;  1NSA A;  3MTK A;  2YY3 A;  2ZC3 A;  4NRT A;  3R1H A;  4X66 F;  1L3S A;  2V4Q A;  1R6V A;  3PW2 A;  3SI8 A;  3MMA A;  3Q8R B;  4QPX A;  3SDE A;  2XWX A;  4A46 A;  4C8K A;  3WQP A;  4NYO A;  2IJN A;  4CNZ A;  1ITP A;  5A0Y B;  2HFN A;  2IA0 A;  4C4W A;  2MB0 B;  5HK4 A;  3DU5 A;  4X66 J;  3FFI A;  3AJD A;  3T1H J;  3GJT B;  4K0K J;  4JYA J;  2QSF A;  4IR9 A;  3KK3 A;  4RNO A;  2GVD B;  2CA9 A;  4Q45 A;  3M8Q B;  4RW6 B;  1WTB A;  4DR5 J;  2V2Z A;  3AAW B;  5EUH A;  4M5G A;  1YQH A;  1YWX A;  2KT5 A;  4KH0 B;  1XWL A;  5T7L A;  4OI1 A;  3KXD A;  1T94 A;  1HQU B;  1DAX A;  1WKL A;  4LF9 F;  1MRO B;  1UVI A;  4AE5 A;  9ATC B;  1MN9 A;  5IOL A;  2H4Y B;  4ID8 A;  1B7F A;  2EFG A;  2XMA A;  1TR0 A;  4YP3 A;  3THV A;  3V6D A;  4FPR A;  3AOC A;  5AT1 B;  1H38 A;  4FP9 A;  4QIG A;  1HI0 P;  2JVR A;  3GMG A;  2C1E B;  2EKY A;  2LXF A;  5FII A;  4DR7 F;  1SL0 A;  1SKR A;  1Y5L B;  1FJC A;  4DL4 A;  2WCX A;  5ETN A;  3W8P A;  3E01 A;  3KHG A;  1DQ8 A;  1FDN A;  2YVS A;  2CAD A;  2V4R A;  3MUM P;  3MEE B;  5LOQ A;  4X4P A;  2KJV A;  3J7Z 5;  3UCU P;  2QIF A;  4LBH A;  4NCG A;  1VLY A;  2ALY B;  4AXI A;  5DLG A;  1RTI B;  4R8U A;  3TVY A;  4PQU A;  4DR7 J;  3LP2 A;  2GMJ A;  4DZD A;  3UN3 A;  1PYO B;  4CO3 A;  3EWG A;  3NGR A;  2I2Y A;  3AOD A;  3PY8 A;  3KLH A;  2ZWO A;  4PQA A;  1JLB A;  3M2V A;  2P6T A;  5J2P B;  2C2M B;  2B4U A;  2OPS B;  3PW5 A;  2IRX A;  4F25 A;  4O3Q A;  1HI8 A;  2JNJ A;  5JUM A;  2RVJ A;  1RSC A;  3HP6 A;  1R0C B;  1RAJ A;  2ERR A;  1NK9 A;  5KOX A;  2HZA A;  2XGQ A;  5K8N A;  2Y1R I;  2E9R X;  1S12 A;  4DPY A;  1RYR A;  4NI2 A;  4FF3 A;  3SFU A;  2DHS A;  5C2C A;  1ROF A;  5C25 B;  1SB6 A;  3CJ2 A;  1XMB A;  2MQQ A;  5HVG A;  1PJ6 A;  2HHX A;  3ZZ0 A;  4NLD A;  3PM9 A;  3AT1 B;  1QUV A;  2VFV A;  1E6Y A;  4X4V A;  3CME S;  3R1L A;  2V8G A;  1HNI A;  3CE8 A;  1RT3 A;  1GAO A;  1SQG A;  5HRO B;  4YOE A;  2B8P A;  3OL9 A;  1RHR B;  5B0F A;  2IC3 A;  3DRP A;  1KQF B;  1K47 A;  4F36 A;  3T41 A;  1UFW A;  4ED0 A;  1RT2 A;  3SSQ A;  1GXL A;  4FF2 A;  1QTN B;  3OHB A;  1IKV B;  1R0B G;  3DDI A;  4K50 A;  4WFA Q;  2GIQ A;  3H7H B;  3KHL A;  3TEH B;  2WAQ D;  4YHH F;  4BDP A;  2IM3 A;  3LWM A;  2JEF A;  1QY7 A;  3MAA A;  1DTT B;  4FKY A;  2K7K A;  2N7Y A;  3NLC A;  4HVZ A;  3PTW A;  2BOP A;  3DOK B;  1TAQ A;  1T3O A;  2CDQ A;  3IBC B;  2W7P A;  4ELT A;  1HD1 A;  4A4J A;  4MK8 A;  3FRZ A;  3ZO7 A;  1LW0 B;  4WIQ A;  1P27 B;  2HEK A;  1AXQ A;  4YUD A;  3ELH A;  2GIF A;  4WFN Q;  4C11 B;  1CJK A;  3O44 A;  1C4C A;  1W25 A;  1ZOT A;  2UXC J;  1ZH5 A;  4QIW D;  4C48 A;  3SCI E;  1FRI A;  4YY3 J;  4PG4 A;  4P72 A;  2Z2Y B;  2XYG B;  2I38 A;  4DV7 F;  2R7Q A;  4B9S A;  1YJT A;  1UEK A;  4O4R A;  1LWC B;  3F73 A;  3FVY A;  3LGN A;  2LQ8 A;  4LIR A;  4JV5 F;  2OD4 A;  2IRY A;  2FIU A;  2C3O A;  2PA8 D;  3BBB A;  1PO6 A;  4DV7 J;  1JLC A;  3UN5 A;  1J5O B;  3M8S A;  1SJR A;  4DQP A;  1FXR A;  4F2S A;  1FKA F;  3UO0 A;  3LAL A;  2RQ4 A;  2GAG C;  2OML A;  3PJ9 A;  1WKJ A;  2WSF C;  3R7S B;  4O3O A;  3K7R A;  2W2P P;  1LQ9 A;  1WC1 A;  1CQM A;  3VVT A;  2YX4 A;  3EVW A;  4DV4 F;  5DET A;  2VF3 A;  2MYF A;  5E3A A;  3BN7 A;  3RBZ A;  1KDN A;  2Z2Z A;  2L3M A;  5CYM B;  2MQO A;  3QT6 A;  2YH0 A;  2J0Q D;  2FJA B;  3DLK A;  4M5M A;  4NWB A;  2GQ2 A;  1EX8 A;  3OR2 B;  2AZ1 A;  3TAR A;  1Q5V A;  4MKA A;  1LK5 A;  1R6Y A;  5AXK A;  4JI4 F;  1FHT A;  3W65 A;  2BQR A;  5CZV A;  1JXV A;  3CCW A;  2LQ9 A;  1HNX J;  2PFF B;  4Q0B B;  3D3C J;  1QM9 A;  1AYE A;  1JLQ A;  3CCE S;  2KI2 A;  4I7F B;  5FDL B;  4Y0F A;  3CCU S;  2LFV A;  3SSS A;  4HI2 A;  5F8G A;  5J2N B;  4C0B A;  3K5P A;  4IRK A;  1H98 A;  2JLF A;  3LAM A;  4JI4 J;  4JP8 A;  2ZKT A;  4IO1 A;  1RWN B;  4X4R A;  5J2Q B;  3NGS A;  4G1Q B;  4B3O B;  3CT9 A;  3QSI A;  3H2L A;  2Z57 B;  3DN9 A;  2UUC F;  2BW2 A;  3CJ5 A;  2XLJ A;  3MEG A;  1IM4 A;  3PRB A;  2VKZ G;  4LF8 J;  2VOP A;  1BMQ B;  2AQ4 A;  1P1T A;  1M5O C;  4WFB Q;  3R5A A;  4RNN A;  2KRB A;  1ZPV A;  2RUG A;  3MUR P;  3HKW A;  2P8I A;  3HFV A;  3O1L A;  4J91 A;  3KLE A;  5LL6 d;  2KFZ A;  2DGV A;  5M2R A;  4KR0 B;  5CQG A;  1HWK A;  2UUC J;  4ED7 A;  3NOG A;  3HVT B;  4KGM A;  2C2D A;  3PEJ A;  2PI4 A;  1UET A;  3DYA A;  3AXM A;  1Q4R A;  4DSI A;  4YB5 A;  3AA9 A;  3A8I A;  3MDF A;  4LSN A;  3OW2 R;  4OX6 A;  1CC8 A;  1U8S A;  2HK2 A;  5KT2 A;  3IFE A;  2AWZ A;  4MK7 A;  3IBF B;  4U8V A;  2LYV A;  2HNZ B;  3HHL D;  2VOD A;  1IBK F;  3ILL A;  3POT A;  1VK8 A;  1YJR A;  3OJS A;  5I3Q A;  2EKN A;  4DL7 A;  4Y2I A;  2ADB A;  4LR7 A;  1XIQ A;  2E5L F;  4X64 J;  2KZM A;  5KT4 A;  3PZP A;  1Z1Z A;  4IQX A;  4DPO A;  4CNY A;  3FZ2 A;  4I56 A;  3T1A A;  3BGF A;  2DEJ A;  3TWZ A;  4MKV A;  1U2R A;  2IY5 B;  2N3O A;  2M7S A;  2XI3 A;  3OFE A;  3MPU B;  4MKY A;  3TVK A;  2VV5 A;  1PCA A;  4IG0 B;  1D0E A;  3JSM B;  4EBE A;  2K06 A;  2XBP A;  5H9E J;  3GJR B;  2G1H A;  3HSJ A;  1YHQ S;  4LJM A;  2N3L A;  3ZZZ A;  1B0P A;  5K20 B;  3D0H E;  2OP5 A;  2VQF F;  5ETL A;  3HDS A;  2HHV A;  3T5L A;  2FZK B;  1S6P B;  1A9N B;  3P3D A;  2UVR A;  1M90 T;  3OL7 A;  1C0U B;  1C4A A;  1N34 F;  3VZH A;  4ED3 A;  4DU7 A;  5HMZ A;  1EB0 A;  3PYF A;  3MPW A;  5KFP A;  1XTZ A;  1L3K A;  2VQF J;  2AJ1 A;  3I9V 9;  4YR0 A;  4MYU A;  4QYZ K;  1MML A;  2NS1 B;  5EGY A;  3GON A;  3QQC D;  3FSX A;  1YIT S;  2XZD B;  4NML A;  2YNI A;  2B6A A;  4DPT A;  2PD1 A;  3N6L A;  4MJK A;  2GJI A;  4NRU A;  3C15 A;  3NGT A;  2J8S A;  4E98 A;  2EBE A;  1IKW B;  4KC5 A;  3NNC A;  4X4O A;  2D7S A;  3UVJ B;  4DS5 A;  1H0H B;  2CG4 A;  4UUX A;  4JBC A;  4PRF A;  4Q7A A;  4XDC A;  5KFL A;  4G3I A;  1O51 A;  4UT4 A;  2BE2 B;  5K14 A;  3A12 A;  2C42 A;  4C3M A;  5LJ3 Y;  4X4U A;  2Q66 A;  2NXN A;  4PXE A;  3NS5 A;  3VGU A;  1K9M T;  4JI2 F;  4LF7 F;  1S1V B;  4OHZ A;  2ZBI A;  4NCA A;  2KYX A;  1T9X A;  4S0M A;  1SUQ A;  2JEI A;  1KQS R;  1WEY A;  1LV5 A;  1KP6 A;  1KLN A;  4DSL A;  1CC7 A;  2PEB A;  2A2D A;  2BM1 A;  4H54 A;  2O66 A;  2C2O B;  4WP9 A;  2HGL A;  2MZS A;  2UV8 A;  3V4I B;  2KN4 A;  2HQD A;  4LF7 J;  1TFW A;  1PC5 A;  2F9D A;  2CJA A;  4KPC A;  1FX4 A;  1FWK A;  2MHN A;  3GV7 B;  1M1H A;  3SEO A;  3MM8 B;  1U8W A;  2XSJ A;  3HKZ D;  2GFF A;  1Q86 T;  4FXV A;  2MSS A;  1DTQ B;  1R8H A;  1DRZ A;  2ZBP A;  5EWE A;  1S59 A;  1I5O B;  5KFJ A;  3GR1 A;  4WP8 A;  2E44 A;  3BYP A;  2DNL A;  2ZC4 A;  3I0R B;  2XZW A;  2Y0S D;  2DGX A;  3FK4 A;  3D68 A;  2DH9 A;  4OYW A;  2RIJ A;  3E3X A;  4JI5 F;  1LWE B;  4ZVU B;  4RNH A;  3N79 A;  1AT1 B;  2I1R A;  4C8O A;  4P7T A;  4DLE A;  4CLW A;  4TU7 A;  3TAM A;  3EYZ A;  3GR0 A;  3TRG A;  3D1O A;  1SXL A;  3TNV A;  4DV3 J;  5KTQ A;  1J2V A;  5KFE A;  2J8A A;  4JI5 J;  2QMU B;  3QGP A;  4Y2A A;  2PGC A;  5GAH I;  2HVI A;  2XNR A;  4EZ9 A;  1UCN A;  3RW6 A;  2FY8 A;  2V69 A;  5J1N A;  2VA2 A;  1OYE A;  2D3Z A;  1KBR A;  4U67 Q;  5A76 A;  1YDL A;  4MFB B;  4WYL A;  3GV5 B;  1BWE A;  1U6B A;  4RR5 A;  4HEA 9;  2ZH5 A;  4YQW A;  2OKQ A;  5FLX Y;  5A0Y A;  4NLX A;  1NPR A;  3H2U B;  3FEY B;  4QU7 A;  1XER A;  3R97 A;  2Z8Q A;  2GVD A;  5KFX A;  2IVF B;  3EUN A;  1CEZ A;  4RW6 A;  2HGM A;  4ES1 A;  3J7Y U;  4ZCK A;  2PN6 A;  1T3N A;  4LRE A;  4XAK A;  4DFK A;  1NH7 A;  3HHE A;  1JWW A;  1XEZ A;  4TN2 A;  4KKO B;  1FKP A;  1Z4U A;  3JS9 A;  3IRX B;  1X9M A;  3CCV S;  2FC9 A;  4YFU A;  3OVS A;  3GE9 A;  2H51 B;  1RA6 A;  1TKT A;  2KRR A;  1NSQ A;  4BHQ A;  2R2R A;  3A1Y G;  3KWM A;  1PBU A;  5DGA A;  1NME B;  1SCJ B;  1IBL F;  1I3O B;  5HJY A;  4USM A;  1CQN A;  3DLG B;  1T9W A;  4ZPA A;  1TZ0 A;  4CLF A;  3IWN C;  1FXD A;  3RB4 A;  2MY7 A;  1V6H A;  3MEE A;  3ITH A;  3T5K A;  2CFX A;  4MH8 A;  3U1N A;  5D4P A;  1TU0 B;  5A8R A;  4M8L A;  2RDD A;  3NS7 B;  4ZVR B;  1FFW B;  3W60 A;  4C3K A;  2EFN A;  1S6Q B;  3PW7 A;  3RB3 A;  1RTI A;  4KHP F;  4NZ7 A;  2BRL A;  3NXZ A;  4IG3 B;  2UXD J;  2BVZ A;  1S10 A;  2HBY B;  2VHG A;  3CJQ A;  2QA4 S;  2LA4 A;  2MHE A;  4AUK A;  4CRJ A;  4EFA C;  3GP9 A;  2W8L A;  4PZV A;  4P74 A;  5EDW A;  2ROP A;  2ZJQ Q;  4RU2 A;  1XN9 A;  3GYN A;  3FC9 A;  3TJ9 A;  4BBY A;  1B70 B;  5HN0 A;  5E3R A;  1B99 A;  5J2P A;  3MCO A;  2M52 A;  1S6O A;  2M0G B;  3CIZ A;  2OPS A;  3A13 A;  1JJH A;  1D9F A;  2DNP A;  2V6A A;  2NXJ A;  4NE9 C;  1EHW A;  2X3G A;  2KXH A;  3BM7 A;  4Q8F A;  2AGQ A;  5LJ5 Y;  2CNL B;  1EET B;  2OD6 A;  1R8P A;  1UW4 A;  2WON B;  1C0T B;  1TEL A;  4J9N A;  3J80 U;  2HRT A;  2A6O A;  4ELU A;  1SH2 A;  2A3J A;  4UZC A;  2KZZ A;  1TAU A;  2CJY B;  5H9F K;  2WVD A;  5C25 A;  3UWT A;  4HH0 A;  2HHP A;  1R3N A;  4ZCM A;  2DT9 A;  2JX2 A;  1DY3 A;  4ECZ A;  1GXU A;  1TL3 B;  1F2G A;  3RR8 A;  2AJ4 A;  1FFS B;  2KXF A;  4OJG A;  2VBW A;  4ZVG A;  3FQK A;  5ETK A;  4IH5 A;  3I4H X;  2UVU A;  1G1X A;  4DV6 J;  1DLO A;  1H7X A;  2HRY A;  1S79 A;  3CJ3 A;  3GIR A;  2ZUA A;  1APS A;  3H40 A;  2GS8 A;  5B0E A;  3R5C A;  4F04 B;  1RT6 B;  4OX8 A;  1UKU A;  2P9C A;  1IKY B;  1PIE A;  3QYY A;  3OLA A;  4A8F A;  2EVZ A;  2YKN B;  3SZ2 A;  1IKV A;  4M95 A;  1RCO B;  2MZ1 A;  5A8K B;  1SJ1 A;  1L3V A;  1TL1 B;  1QVF R;  4DWI A;  2R42 A;  3G8T A;  2LEB A;  2M5Y A;  1DTT A;  3LTO A;  5HAT A;  2ZH4 A;  3CXC R;  3K58 A;  3DOK A;  3BJY A;  3KDO A;  2DO0 A;  2LU1 A;  4HHU A;  1SJQ A;  4N56 A;  4P2M A;  1GT8 A;  3FRY A;  2RIL A;  3UW1 A;  4ZK7 M;  1BQM B;  2MKY A;  1MLA A;  3SV3 A;  5L1I A;  5DLF A;  4DR6 F;  5GAD U;  2LU2 A;  5E3C A;  4F26 A;  3JQK A;  1HBO B;  3N5F A;  1NZ8 A;  2R2S A;  3TJ8 A;  4C11 A;  1D9D A;  2FB0 A;  1ZZF A;  3V81 B;  3M6V A;  3LPY A;  5G0R B;  4LMZ A;  1RAF B;  4O3P A;  1VC5 A;  4FS2 A;  2YPZ A;  3OXL A;  3NWR A;  1ARO P;  2F4F A;  1AW0 A;  1HQ2 A;  1YZ6 A;  2BQU A;  5HBM B;  3D6F B;  1LWC A;  2R8J A;  5KOW A;  5CCM A;  3RRK A;  2OGU A;  4DV5 J;  4UQT A;  2VPZ B;  3MAH A;  3PO5 A;  4Y00 A;  1QAI A;  2V5H G;  1JKH B;  2C3P A;  2VG7 B;  2CNO B;  4ZJO A;  3GFZ A;  4HT5 A;  1S9G B;  2XMM A;  5HO4 A;  3C19 A;  1Q81 T;  3HVR A;  1REG X;  1CJU B;  3H5Y A;  2C2R A;  1J5O A;  3W5X A;  2HVD A;  1EP4 B;  2XEX A;  2PI5 A;  2VU5 A;  3LH2 S;  3PRD A;  3N4W A;  3WBZ A;  4B3M F;  2Y8Y A;  4YN3 B;  2D9O A;  2CZV C;  4YR2 A;  5HQL A;  3EE3 A;  2OPP B;  1YKW A;  1SVD A;  1NAQ A;  2LQJ A;  4I2Q B;  2HG4 A;  1JXE A;  1VBX A;  4C0H A;  2JL9 A;  1WHY A;  4NA2 A;  5KG7 A;  1SIW B;  3L7P A;  2Z58 B;  3PYD A;  2W8K A;  5HMX A;  5CYM A;  3SQO P;  5E7O B;  4L3N A;  1D09 B;  3OUY A;  3FSI A;  3HHN B;  4B3M J;  4LIW A;  3OXF A;  4I69 A;  1NK8 A;  2QTW A;  2B8Q A;  2WHO A;  2BR0 A;  2DH8 A;  2R7X A;  3OR2 A;  2UXB F;  4J9Q A;  3I5A A;  4J9O A;  1X0P A;  2R8H A;  5D6G A;  5LSO A;  4QIV A;  4NZ6 A;  1YX2 A;  1FI4 A;  5ETS A;  2YNF B;  4M1K A;  4Q0B A;  2VBX A;  3FEZ A;  2VAS A;  5KFG A;  4AL5 A;  2Z4P A;  3QIP B;  2C2N A;  4UOG A;  5E0O A;  4I7F A;  5CH7 B;  5FDL A;  4DCP B;  4ZA1 A;  2RRA A;  5J2N A;  1WI6 A;  1X4C A;  3KKF A;  1UZH A;  1S1W B;  2ASY A;  1JK9 B;  2G2Y A;  2GW8 A;  5CXT A;  1WG1 A;  5J2Q A;  4DSJ A;  5B0C A;  2CQI A;  2E1C A;  3PJX A;  3O3L A;  5F8J A;  2B9W A;  4CIO A;  2D69 A;  3FJ2 A;  2N82 B;  2V63 A;  5BYR A;  3KJV B;  1X31 C;  3PXG a;  4DG1 A;  2R8G A;  3KNA A;  1WEX A;  1RWV B;  2YPY A;  4F67 A;  5BXI A;  3MHY A;  4NCB A;  1N5Y A;  4TU8 A;  3P45 B;  1U49 A;  3M6X A;  4HTI A;  3HVT A;  1HHQ A;  1HNZ F;  1KHW A;  4OX9 J;  1SJ4 P;  1VRU B;  1FXL A;  1F5B A;  1JLF A;  5KT3 A;  1RE1 B;  3D2W A;  2AYE A;  1RI7 A;  4C97 A;  3I56 S;  5E5N A;  2ZBR A;  2UV8 G;  1NPP A;  1HFE L;  2KM8 C;  1QTM A;  5LT5 A;  2GGP B;  4ECR A;  4OHV A;  2HNZ A;  4AXJ A;  1F5A A;  5A6W A;  2D74 B;  3G8S A;  1XBW A;  4Y2M A;  1Q8L A;  1HNZ J;  2ZZN A;  1NH8 A;  3VCD A;  1RCX B;  1JLE B;  2NPI A;  5ETQ A;  2LLZ A;  4ED1 A;  1N5T A;  4RW7 A;  3MPD A;  4ECQ A;  1NU4 A;  1UWB A;  3MMC A;  2W1B A;  1F0X A;  2IJF A;  2LMI A;  1RU1 A;  2PT0 A;  4USU A;  3N6N A;  3DGV A;  3TUI C;  3PDN A;  1O6X A;  2NPF A;  1RGV A;  1AA1 B;  3EGW B;  1WG4 A;  5C2G A;  4KFB B;  3KLG B;  2YWK A;  1HNV B;  1M5S A;  3VHQ A;  2QJ3 A;  3GQC A;  3DHW C;  3KLI B;  4IG0 A;  3LGH A;  2RDI A;  3QMQ A;  2W2M P;  4DUZ F;  4LF6 F;  4PWU A;  3NEK A;  2EEY A;  5L8R C;  1S6P A;  4NYP A;  1S9E B;  1W2I A;  2L9W A;  1KRP A;  1C0U A;  5E33 A;  3IAS 9;  1JJ2 R;  1N0V C;  4WFZ A;  5LXY A;  4DV0 J;  2Q1L A;  4DUZ J;  3HLU A;  3MM5 B;  2HLT A;  1TL7 B;  1CBK A;  4O3S A;  3UI3 A;  2CPJ A;  5IWA F;  1MN7 A;  5KFH A;  3WDO A;  2J6U A;  1HMV A;  3IR7 B;  2V4J B;  3UCG A;  1JJC B;  2DK2 A;  2WBR A;  1IKW A;  2DHX A;  5FLX U;  3LF0 A;  4E0D A;  2QLJ B;  1VHF A;  3UVJ A;  4EO6 A;  4OYP A;  3D6M B;  4OIX A;  5IWA J;  1WI8 A;  2BE2 A;  2BKP A;  2W2N P;  2ZH7 A;  4CLT A;  4E2F B;  2D3O R;  3W62 A;  1VIX A;  3D54 A;  2FJV A;  3JYT B;  3MWB A;  4ITS A;  4FBT A;  2BJ7 A;  4M5K A;  2BV3 A;  3LW5 C;  3MD3 A;  2Y9H A;  4LRD A;  1WEZ A;  4V19 X;  2AD9 A;  2B5J B;  4CO5 A;  3PAC A;  5KFF A;  2MQM A;  2FVP A;  2KL8 A;  4UW2 A;  3R6G B;  1X4D A;  4BWJ A;  1B4S A;  2EK1 A;  5F8H A;  1BXN A;  1DFD A;  4KBI A;  3R7B B;  4ECV A;  1FDD A;  4MIW A;  2QN6 B;  1ZZN A;  4CO0 A;  3Q8U A;  5K8P A;  3VQS A;  2QEX S;  1GTH A;  3V4I A;  3U27 A;  4FYD A;  4IOB A;  4WBF A;  1OO0 B;  1RHK B;  3MM8 A;  3BYR A;  4HAC B;  4OZ2 A;  3B4M A;  3NMR A;  2WOM A;  3HJF A;  2AGP A;  3KUH A;  5KFT A;  1WUU A;  3WC0 A;  3BSC A;  2LXU A;  4P52 A;  4LFB F;  5SUH A;  4I67 A;  3EX7 B;  5KFK A;  3QO9 B;  3I0R A;  1XR6 A;  1VQL S;  3BPS P;  3SQG B;  1UAW A;  4M5I A;  4B02 A;  1LWE A;  3TR5 A;  3DMJ B;  3AD8 C;  2VC0 A;  2QFJ A;  1JLA A;  3U1L A;  5HAO A;  4C8M A;  2XCA A;  3JB9 k;  4QQB A;  2QA2 A;  4CWB A;  5CYQ B;  4USJ C;  2ZNZ A;  2HHQ A;  3TUJ C;  1RTZ A;  5GAE I;  3NGK A;  3NMA A;  5K8M A;  2ZH6 A;  3EZU A;  3QRP A;  1GMW D;  1T02 A;  1CS4 B;  3GJQ B;  1KOO A;  3HHL A;  1S1X B;  3R5G A;  4P9S A;  3HHK A;  4L6V 3;  4OI6 A;  1X60 A;  1CUL B;  3QJL A;  2HWI A;  2VFR A;  1RT1 B;  4DCO B;  2DB1 A;  3TYT A;  5BYQ A;  2DIS A;  1T0T V;  5GVQ A;  1U2C A;  1S48 A;  2XTJ P;  2XWY A;  3PW4 A;  3NWG A;  2NRE A;  1LWX A;  3JSY A;  3I32 A;  3DFE A;  2DO4 A;  1Z2L A;  1WTF A;  3NL0 A;  2M88 A;  5HMW A;  4OZN A;  2NXE A;  2LXI A;  2CRL A;  1N36 F;  1KD1 T;  2DHH A;  1P9Y A;  3I6P A;  5I3P A;  5J1E A;  3W9J A;  4FVC A;  3N5B A;  5KFQ A;  4CYU B;  2GNK A;  3K57 A;  3M4X A;  2RJZ A;  2PMZ D;  4PUO B;  2AP6 A;  2JOQ A;  1QD1 A;  3OV7 A;  3GIM A;  2DBB A;  2BEF A;  1Q7L B;  2HW3 A;  2FY1 A;  1L5U A;  5JVH Q;  2H4W B;  4A8Y A;  4KKO A;  2GQC A;  3IRX A;  1NDP A;  3TP2 A;  2MLY A;  1RTD B;  1SJ3 P;  3MR6 A;  1SIZ A;  4UST A;  3MEK A;  3CJS A;  2FJD B;  3HSD A;  2FLP A;  3PIP Q;  1CPZ A;  3VAK A;  4FYX B;  3GWC A;  4PG5 A;  3QT5 A;  2YKO A;  3VWS A;  1Q0N A;  2F8E X;  3F56 A;  3LP1 B;  1UJ5 A;  2N4D A;  4OMF G;  3FMW A;  1V5I B;  1A0O B;  4A8X A;  3QLH A;  2G13 A;  5E3P A;  2ZJP Q;  1VQO S;  1X4B A;  3DLG A;  2M8D B;  2UVV A;  3QJP A;  1V5V A;  4UTG A;  3RU0 A;  3M8R A;  4DR1 F;  2COL A;  4ES2 A;  2VPW B;  3BGO P;  4XPC A;  5KG0 A;  3GSI A;  5IT4 A;  4FN5 A;  3ZZR A;  3E51 A;  4MAK A;  2IA6 A;  1Q95 G;  3CC7 S;  4DR4 F;  3PX4 A;  5HAN A;  3IS9 B;  3WIV A;  3M2R B;  3H42 A;  2JH3 A;  1S6Q A;  3C14 B;  4RBT A;  4JI1 F;  4IG3 A;  5KG1 A;  3W66 A;  4DR1 J;  3THT A;  3DDN A;  3NCQ A;  1T9T A;  5KT6 A;  2V34 A;  1VRQ C;  1F9F A;  1HBM A;  1D8Z A;  2GHV C;  3TA1 A;  4LR9 A;  4O0I A;  3CIM A;  3BBF A;  4DR4 J;  4BWM A;  3OVB A;  2Y1I A;  5IC6 B;  4N8O A;  3R5B A;  4GO7 X;  4JI1 J;  2ZWP A;  2UUA J;  1IBC B;  1OIA A;  4AND A;  4QR2 A;  2CPY A;  4U7C A;  1TKZ B;  3BF4 A;  3OBI A;  2WON A;  1C0T A;  2DIV A;  5FJ4 A;  1VQ5 S;  3PEH A;  2UZA A;  1GMU A;  4DBQ A;  1VI7 A;  4ZHR A;  2W9C B;  2XS2 A;  4FDF A;  1HYS B;  1S49 A;  3LGM A;  1IN0 A;  3DXS X;  2ZFH A;  2RNE A;  4UQG A;  3CVK A;  4IOC Q;  1JLG A;  3ZFV A;  1TL3 A;  1KTV A;  1OS5 A;  2XMT A;  4WWS A;  3DKD A;  1OSD A;  1H3D A;  3KTQ A;  4MIA A;  2EXU A;  1H2U X;  2EFQ A;  1IQZ A;  1OWX A;  4CO1 A;  1FCA A;  2AHO B;  3G6X A;  3G4S S;  3SMZ A;  4YB7 A;  5DRK A;  5DDP C;  1U45 A;  1IKX B;  1VMB A;  2ALZ A;  1RT6 A;  5ETV A;  1WSR A;  3PR5 B;  2KVI A;  3KK2 A;  2YKN A;  4PPD A;  3M05 A;  4RW9 B;  4U6P A;  1NND A;  2MKC A;  4Q2M A;  4U95 A;  3HHD A;  5A8K A;  1TL1 A;  1JJ4 A;  5KFS A;  4I6W A;  3UR0 A;  2JC1 A;  1PG5 B;  4ZLJ A;  4RBV A;  4K4V A;  4K4Z A;  4PG6 A;  3MM6 B;  5DO2 A;  4ECT A;  2KG0 A;  3IWX A;  3R7N B;  1U47 A;  1VQ7 S;  3EXY A;  5AE1 A;  5DG8 A;  2MY8 A;  4Q5V A;  1UEV A;  5LSL A;  5DJB A;  1NJZ A;  3DLJ A;  1FWL A;  4NX9 A;  4IRC A;  2R8K A;  1VYA A;  3I9Z A;  2K1R B;  5L1K A;  4A8Q A;  1LXJ A;  4RO0 A;  2XO6 A;  2XB2 D;  4U9R A;  4GVB A;  2R7S A;  1UL3 A;  1HBO A;  4FYY B;  4FS1 A;  4LRF A;  1JX4 A;  1G3O A;  1R27 B;  5CAA A;  1KLM B;  3V81 A;  5DQH A;  2FVR A;  2NCK L;  5G0R A;  2HK3 A;  2A10 A;  4L74 A;  3QZ8 A;  2DGT A;  4F0K A;  1Y5N B;  2BMB A;  4ICL B;  2HRU A;  4LT6 A;  4N5S A;  3M6W A;  4UF4 A;  1GXT A;  4HYK A;  3PFO A;  4RUC A;  5HBM A;  2DCL A;  1FD8 A;  2MEW A;  1WEL A;  4TYB A;  3IBW A;  1C1B A;  1FDB A;  1RAG B;  2FJW A;  4PG7 A;  2AEF A;  4FXD A;  3N6M A;  4ZPW R;  2E7X A;  3G2X A;  2H3E B;  1I6J A;  1JKH A;  2VG7 A;  2HQG A;  3ZTS A;  8RUC A;  1S9G A;  1Q78 A;  5HP1 B;  3ZZU A;  5CD4 A;  4F3Q A;  1FJG J;  4JI3 J;  4RW8 A;  1CJU A;  4EMD A;  2CAJ A;  4CLK A;  1EP4 A;  4W92 B;  1TVR B;  1LFP A;  3K5N A;  4TNO A;  4RBU A;  2DNZ A;  2RH3 A;  4DX8 H;  1ZPW X;  3BSO A;  2XY5 A;  3TZY A;  2ATC B;  2GVZ B;  2OPP A;  5GAH U;  1Y00 A;  4W90 B;  1NKB A;  1O8B A;  4JI7 F;  3HZG A;  5B08 A;  2NUH A;  1ZTW A;  1SQE A;  3KG4 A;  4OJH A;  2HHT A;  2ZE2 B;  3CD5 A;  4B3R F;  3N28 A;  4CTA B;  4MKB A;  5E41 A;  1VRT B;  1KSP A;  1YJN S;  5T41 A;  3OVA A;  1NKE A;  1RHU B;  2EG1 A;  1ACM B;  4OYB A;  2C3U A;  4USH A;  1VQN S;  2BA9 A;  1UA0 A;  1NK7 A;  1HBU B;  5K5M A;  2YNF A;  1AUS L;  4LF4 F;  4QU6 A;  3H5S A;  1MMD A;  3QAT A;  3PG9 A;  4B3R J;  1XJW B;  5L9N A;  3PR4 A;  3M1V A;  3QIP A;  1WC0 A;  2OTJ S;  2E1R A;  3L7U A;  3HK2 A;  4KE5 A;  3W1Y C;  3W2V B;  1NRK A;  2NLW A;  2AJF E;  3GZ7 A;  4OZ5 A;  4HHJ A;  3CPW R;  1U6Z A;  2YXL A;  4B3T F;  2U2F A;  2HYI B;  3A3P B;  4RZR A;  3NGU A;  1KHV A;  4ZJL A;  5LMN F;  3KJV A;  4DL2 A;  2CPZ A;  3AFG A;  4IOA Q;  2CWX A;  4LFA F;  4AD6 A;  2LQ5 A;  3DC2 A;  3DRS B;  1KQG B;  4DZ6 A;  5DS7 A;  1RAC B;  1UJ4 A;  2DR6 A;  5CYJ A;  3UFC X;  5LSR A;  2RSQ A;  4DV2 J;  3OXG A;  1HNW F;  2B9E A;  4LF5 F;  4K4W A;  3QNW B;  3NY0 A;  1VRU A;  3K2Y A;  3RGI A;  4ECS A;  4I68 A;  2QT7 A;  3H8Y A;  2I9S A;  4PYA A;  3VAG A;  5D4L A;  1N32 J;  3OTC A;  3KK1 B;  2HVZ A;  1UVM A;  1QAY A;  3K17 A;  2GGP A;  2QMW A;  1UPP A;  3DI6 B;  3PV8 A;  4F4X A;  1HNW J;  3JQJ A;  3Q89 A;  5K9F A;  1JLE A;  1FX2 A;  4WP3 A;  1RUS A;  4LQ9 A;  2WVB A;  4G65 A;  1HW8 A;  4RPF A;  7AT1 B;  4U7U D;  4W4M A;  3GG1 A;  3C6U B;  2HMI A;  2F65 A;  4OV6 A;  3RW7 A;  2J6T A;  1GEH A;  3T6B A;  4UUW A;  4I2P A;  2V2V A;  2A1B A;  5T14 A;  4DV1 F;  2HHH F;  1N0U A;  4F4Z A;  1Q8I A;  4X65 F;  1K0V A;  2XMJ A;  2HFU A;  3DDK A;  3MD1 A;  4KFB A;  3KLG A;  1HNV A;  2YX1 A;  2ZBC A;  4RUH A;  1UP1 A;  3BBC A;  2HND A;  4PYD A;  2OIH A;  1RTJ B;  4YS2 A;  1U1K A;  3BH7 B;  2FQQ B;  4X65 J;  1LK7 A;  1VQY A;  2V67 A;  4JB8 B;  2GAH C;  1EQ0 A;  5IM0 B;  2Y3Y A;  2J0W A;  5KAK A;  1S9E A;  4JV2 A;  1L3T A;  1CLF A;  3KLV A;  1G2E A;  2V2K A;  2E9Z A;  3OJU A;  1BGX T;  4B9M A;  1VIS A;  2GX8 A;  3I82 A;  1VK3 A;  2L08 A;  3CCJ S;  4ZVO B;  3O5T B;  5U47 A;  2BJ8 A;  2ZJR Q;  4Y3C A;  3MM5 A;  1U1L A;  1I51 B;  1NM2 A;  1ZA2 B;  3ZNJ 1;  4BC7 A;  1K0T A;  1QVG R;  3O2I A;  3M32 A;  4F4Y A;  5D0G A;  3T1Y F;  3M30 A;  3L9Z A;  1RIS A;  1RT5 B;  2W9B B;  5FD1 A;  4DHV A;  1PIL A;  4QW8 A;  3J81 U;  1FRL A;  2KTQ A;  2K8G A;  3RR7 A;  4Y34 A;  4K59 A;  3SV4 A;  5AE2 A;  2RKI A;  1AB8 A;  4JI6 F;  4FXW A;  4A8W A;  4OHW A;  3T1Y J;  1D1U A;  3NRB A;  2OHD A;  4ZVS B;  4P6Q A;  2PII A;  2CJ9 A;  3EIC A;  2J76 E;  1VBY A;  1E6V B;  3LOU A;  5J1P A;  3MM9 B;  3EJM A;  3JAM Y;  4BC9 A;  6FD1 A;  1ZM2 A;  1W26 A;  2R7O A;  3IMQ J;  2POK A;  5F8N A;  1NXI A;  4A8K A;  4C8L A;  2GV1 A;  5ETP A;  1YBA A;  2G0I A;  5DQI A;  4QIF A;  4ZLL A;  2E5I A;  4J9M A;  5KFN A;  3ET6 B;  2XY7 A;  1IR1 A;  1B64 A;  1ZS6 A;  3KJQ B;  1RBA A;  2RF2 B;  3HD1 A;  1UA1 A;  1ZYQ A;  2EBG A;  1ELO A;  5DZ7 A;  2AEM A;  4RUB A;  4ALZ A;  4HAC A;  4NA3 A;  4KSE B;  5C42 A;  1HR0 F;  2HFV A;  3Q22 A;  2Y0B B;  1KWM A;  2KHD A;  3QO9 A;  4USW A;  4KQZ A;  4FZV A;  4L72 B;  4NLV A;  1KEK A;  2PMH A;  4U7U K;  4J9L A;  2V8D A;  1IJF B;  3LAK A;  4V19 J;  4EWT A;  1FRM A;  5KFY A;  1TP7 A;  4ECW A;  1HR0 J;  1NB2 A;  3I31 A;  4F0M A;  2DNK A;  2Q3P A;  3BEG B;  3CJ0 A;  1UFL A;  3RBX A;  4KB7 A;  5HJX A;  2LP4 A;  4P73 A;  1FO1 A;  4ANC A;  3IG1 B;  2HVE A;  3CSK A;  5D4O A;  4LF9 J;  1M5V C;  2MKS A;  3BRE A;  1OY8 A;  3W2W B;  1CS4 A;  2WVF A;  2AGO A;  3RBE A;  1S1X A;  2FLL A;  4DQS A;  2VDI A;  2OPQ A;  2HIY A;  1V3S A;  1RT1 A;  3FFI B;  2AZ3 A;  3MR2 A;  4R25 A;  2YTC A;  4M5H A;  2UP1 A;  3KG0 A;  4IFY B;  2BQ3 A;  2E5H A;  4OYX A;  3ISZ A;  2NZ4 A;  4F2R A;  3ISN C;  4I1T A;  4TLQ A;  4OYO A;  3UNY A;  2DRD A;  5D8H B;  3CDU A;  4YB6 A;  1XMQ F;  4OJ3 A;  3TAN A;  3D1Q A;  3HHL C;  2GC8 A;  3A3O B;  5D77 A;  1H7W A;  4MTP A;  3SYZ A;  4UOC A;  5C24 B;  4TY9 A;  1OPI A;  2G0C A;  2AYM A;  4MIB A;  1IM6 A;  1HPZ B;  1EKR A;  2AV5 A;  1RTH A;  1X5O A;  1YGY A;  3D6T B;  4WK1 A;  1RAE B;  2MPU A;  1R8A A;  2DY1 A;  2X3D A;  4DX7 A;  4N76 A;  5B7W A;  2CQ4 A;  3MUT P;  4EYI B;  4DI6 A;  3LP1 A;  2AYG A;  4QYR A;  5CAB A;  5IXU A;  1LKZ A;  1WD6 A;  1VIO A;  5GAG I;  3CD0 A;  3E01 B;  1RWO B;  5ETT A;  3ADA C;  3NGD A;  2XYP B;  1MWY A;  4O3N A;  3D66 A;  2OAU A;  1VQ6 S;  1RJJ A;  1IUJ A;  4RLE A;  1Y3K A;  3CDA A;  3M8P B;  3AD9 C;  2CKW A;  2X1B A;  4NCG B;  3T3F A;  3GCX P;  2HHU A;  4J9V A;  4CO4 A;  4PQU B;  3LP2 B;  5HL7 Q;  3HX9 A;  2AX1 A;  4O44 B;  4IR1 A;  3S01 A;  1KVK A;  2LA6 A;  3IS9 A;  4CQ1 A;  4ER8 A;  3KLH B;  3M2R A;  3C14 A;  3ZXW A;  1RBO B;  1JLB B;  4R5P B;  3V5R A;  1Q1K A;  2V2Q A;  3VAF A;  1OY6 A;  1FTC A;  4GKJ F;  2PC6 A;  4C2M A;  1GH8 A;  1X4E A;  3QSY B;  2BKN A;  1VS3 A;  1JNR B;  1FVS A;  3CCT A;  1WOP A;  2ZH2 A;  2YNH B;  3HJV A;  4JI0 F;  4PXD A;  4RU9 A;  2M2B A;  4YHH J;  5I3U B;  1X4F A;  2K7J A;  1N6Q B;  1CJT B;  1CVJ A;  5F8I A;  3I4P A;  4GKJ J;  1M5H A;  1SL2 A;  1TKZ A;  5JXS A;  3ILJ A;  4KGZ B;  2YNG B;  4NLU A;  4P71 A;  3BDP A;  2F40 A;  2XS5 A;  4DSF A;  1NSK L;  1BQX A;  2W9C A;  3V6H A;  3BB5 A;  1REV B;  1HYS A;  4WKY A;  1NDL A;  1RT3 B;  1ICE B;  3CTR A;  2VFT A;  4KO0 B;  1MU2 B;  3A8K A;  4PKD B;  1X5S A;  3B6B A;  2O01 C;  2CZ9 A;  1HBN A;  2HAF A;  1S72 S;  3FCH A;  4V1A k;  1VBK A;  1ZAV A;  2DCU B;  2FHO B;  3J80 Y;  2A2C A;  3HFK A;  3RYL A;  2ILY A;  3E2E A;  3I0S B;  5BR8 F;  3S1T A;  1IKX A;  3B4D A;  2JLE A;  2AMC B;  4IH6 A;  4FYV B;  4YR3 A;  4JV5 J;  4KH1 B;  3HT0 A;  3K59 A;  3CNQ P;  3N9U C;  2DHG A;  2GIR A;  5H9E K;  5KFR A;  3B54 A;  4ETX A;  3PCO B;  1R0A A;  2DPI A;  1EJ7 L;  3MM6 A;  5BR8 J;  4IDK B;  1GMW A;  2HS4 A;  7FD1 A;  4I0W A;  4Y6I A;  2XMU A;  2KVQ E;  3DU6 A;  1U26 A;  2V68 A;  1QLN A;  3R2C J;  4M5J A;  4ED5 A;  2B7B B;  1J5E F;  2KG1 A;  1X5P A;  4DV4 J;  3K0J A;  4EZ6 A;  2YKM B;  5F3Z A;  1RBL A;  4CH7 A;  2HKE A;  2FJE B;  4LRB A;  1IWA A;  1AZS B;  4ZP6 A;  1FVQ A;  3DLE B;  3FCV A;  2FHJ D;  4ED6 A;  2OEM A;  2VIH A;  4ICL A;  4O3R A;  4CLL A;  4L73 A;  1QSY A;  3GPA A;  2ZHA A;  2GQQ A;  3DRY A;  5B0G A;  5DM6 Q;  1UWA A;  2EFV A;  2O1P A;  2R2T A;  1Y7P A;  4UY8 T;  4OYZ A;  3UPF A;  3MOZ A;  1KR4 A;  5HP1 A;  1JXL A;  4PR6 A;  1IVZ A;  3HVA A;  2AX0 A;  2J7W A;  1XR5 A;  5KFI A;  5GAE U;  1HHS A;  1IBM F;  4K2X A;  4RW4 A;  3HFZ B;  3PHT A;  4OZ3 A;  2RQC A;  4I6A A;  1QAX A;  5L1L A;  2WTF A;  1JB0 C;  3CMQ A;  3MMB B;  1WKK A;  1P8G A;  4E8U A;  1FEH A;  1SC1 B;  4ILM A;  4CTA A;  1IBM J;  3PRV A;  2FTR A;  4ATN A;  2BXJ A;  5DG7 A;  4X4T A;  3W5Z A;  2CG8 A;  4CM2 A;  1S1U B;  3M9N B;  5SZT A;  3D0G E;  1ZET A;  3KNG A;  2WSE C;  4ELV A;  5F9L A;  2D3O 1;  1IBK J;  3DXB A;  3VR1 A;  2J0X A;  3CGI A;  3KHH A;  1U2F A;  3OSN A;  4OX7 A;  1D8Y A;  2KM8 B;  2AKW B;  2E5L J;  5E2Q A;  3VVU A;  3CO9 A;  2MTL A;  5G4D A;  2C2Z B;  1OPZ A;  3VTI A;  1U1P A;  3H5U A;  4PCQ A;  1TQL A;  1P1L A;  4DEZ A;  1BE4 A;  4USK A;  2IAJ B;  4C3L A;  4AQY F;  1FWP A;  3DYA B;  3DRS A;  3TX0 A;  3QAU A;  1T95 A;  1KNZ A;  1PJ7 A;  5DQG A;  2P2C B;  1FKO B;  4DU8 A;  3FEX B;  1N33 F;  4UY8 5;  4Y65 A;  4HR2 A;  2IVY A;  2QZ8 A;  4NLQ A;  3R8Y A;  3X3U A;  2OEK A;  2CJX B;  4NEY A;  3HM9 A;  3FUY A;  3F0N A;  1FK9 B;  3G82 B;  1RKI A;  3FKB A;  2OEJ A;  3KK1 A;  3GII A;  3JAM U;  4OI2 A;  1RWX B;  3LO3 A;  5L46 A;  1N34 J;  1N33 J;  3DI6 A;  4NOH A;  4ZN3 A;  1F6T A;  2B4O A;  1HWJ A;  1YRX A;  2NZC A;  2BKO A;  2RQK A;  3OFH A;  4DQI A;  1FNX H;  2FC8 A;  2DIT A;  3CDE A;  1BC6 A;  3MZI A;  3C6U A;  2W24 A;  1X8D A;  4P7V A;  1SKU B;  2F7V A;  2QMX A;  4K4S A;  1A7G E;  3LAN A;  2C2K B;  4ILL A;  4C7Q A;  2DJW A;  5J2M A;  3BPD A;  1Y3J A;  1GMV A;  3FSY A;  3OTO F;  3GYX B;  1C1C B;  4JOU A;  3U7J A;  2HFO A;  3P49 B;  3H5X A;  2W4D A;  3R2D J;  1UJ6 A;  4ECU A;  2KJW A;  2J7K A;  4KGX B;  5L1J A;  3I55 S;  3PX0 A;  4QOT A;  2ACY A;  5HSP A;  4PWW A;  3TO8 A;  4EYH B;  4P2X A;  1RLC L;  1JQG A;  1HIY A;  3J7A 1;  5IM0 A;  1T9U A;  4PG8 A;  4JI2 J;  3CW2 C;  1TUV A;  2ACM A;  2R7R A;  2VBY A;  2B6A B;  1SC6 A;  3MFH A;  2ABY A;  2Y8W A;  1DBD A;  1RK8 A;  1RAD B;  1F9H A;  1KKH A;  2FVC A;  1RT5 A;  2W9B A;  2OFG X;  4P2S A;  5K14 B;  2UUB F;  2ZOG A;  2EWH A;  3JSB A;  3VAL A;  3OTB A;  2Y1J A;  2BJD A;  3LP0 B;  5DG9 A;  1TKD A;  5CHC B;  3SCL E;  5AJ3 F;  1U25 A;  2DR8 A;  3FMB A;  3RAQ A;  4MT1 A;  3HO1 A;  4M5D A;  1YLX A;  4WK3 A;  4FNI A;  1E6V A;  2UUB J;  1NEE A;  3PFE A;  4Q44 A;  4P2F A;  2OMO A;  3FZB A;  2OFH X;  5F0W A;  3W3S A;  3WIU A;  3OTD A;  4QIE A;  4HI1 A;  4JI8 F;  1SC4 B;  2NUU G;  3L95 X;  3RAX A;  1RWP B;  2QE5 A;  1P9Q C;  1DQA A;  2FJX A;  3CJ8 A;  2ASJ A;  4ILR A;  2M8H A;  3ET6 A;  1M5P C;  2VB6 A;  4AYB D;  2YKA A;  2RF2 A;  1FE0 A;  3US5 A;  3M8Q A;  1KFS A;  5B0B A;  4IFV B;  1FES A;  5CA5 A;  3WX4 A;  4DS4 A;  2VIC A;  1X9S A;  5HQM A;  4DDF A;  2GMH A;  3PJW A;  1BUX A;  2CJQ A;  2M9K A;  3TW0 A;  5JVG Q;  3MTJ A;  4ZPT R;  2G2O A;  1NDC A;  2GZO A;  2H5I B;  1HQU A;  2DNY A;  2ASL A;  1FNM A;  4Q8E A;  2JEJ A;  2VPX B;  2QV6 A;  4YEA A;  1RWU A;  1MRO A;  3MF5 A;  4LSZ B;  3N0V A;  1Z2Z A;  2VA3 A;  2CQC A;  4RJV A;  4K2J A;  4CZC A;  2EFO A;  4KYZ A;  2BBE A;  3HZE A;  1WWH A;  1LEO A;  2EK6 A;  5ITH A;  3F41 A;  1MMN A;  1X7V A;  3T1H F;  5L38 A;  4K0K F;  3IG1 A;  4JYA F;  3MCM A;  4ETZ A;  3VAJ A;  3FBE A;  3CJK B;  4USI A;  4DR5 F;  3W2W A;  2MMY A;  2DNM A;  5B0A A;  4DR2 F;  4DX5 A;  1R31 A;  2FHM A;  2H48 B;  1VOM A;  1IBL J;  2CQB A;  4X4Q A;  1S0N A;  1Y5I B;  2ZIT A;  5A8W B;  4QWE A;  2MZT A;  4IH7 A;  1PSD A;  3IR6 B;  3DCA A;  4ZLN A;  1NHK L;  1RHM B;  2E7W A;  2XHW A;  3Q2S C;  4CH1 A;  3BGR B;  4IFY A;  4DR2 J;  3IGV A;  2QX0 A;  2ZH9 A;  4DQR A;  2J6S A;  4OYM A;  1YRU A;  2Q6B A;  3IA0 A;  2FUG 9;  1O5J A;  5A2Q Y;  2E1M C;  3UR3 C;  5KG4 A;  1FKP B;  1NBE B;  5E3Q A;  4DFJ A;  4KHP J;  2R4F A;  1SKS A;  1R43 A;  2J9E A;  4PWD B;  1FEE A;  1NSP A;  4LRC A;  4OI0 A;  5C24 A;  3I5B A;  2A6M A;  3MFI A;  2MQP A;  3G96 A;  3H0P A;  4JUZ A;  1TKT B;  2WZ1 A;  3A4T A;  1HPZ A;  5IFM A;  2H9Z A;  5BJR A;  3UE2 A;  2JFK A;  2ZHO A;  5KFD A;  3D6H B;  2RML A;  1BHN A;  3RJM B;  2E7V A;  2KHC A;  4F4K A;  1U09 A;  3PW0 A;  1ZBT A;  2A18 A;  1IWG A;  4URQ U;  3SBM A;  1TUG B;  3AA8 A;  3GYG A;  4ID5 B;  3ITH B;  5C5J A;  2IDE A;  3TA2 A;  2H65 B;  3EM1 A;  5A8R B;  4DMZ A;  2XYH B;  3OTE A;  3M8P A;  1SH0 A;  3MMJ A;  5HRO A;  2KKH A;  3MOJ B;  4WXO A;  1FT8 A;  2VFS A;  2IFX A;  2MKI A;  3Q2T C;  2F8M A;  1F5C A;  1H74 A;  4O44 A;  3DOM B;  4OI4 A;  3UD5 A;  1FFG B;  4DN9 A;  1WNE A;  3FGV A;  1SI9 A;  2MKJ A;  2J7U A;  4MYT A;  4RUA A;  4R5P A;  2HVH A;  4XPE A;  1LW2 B;  4K4Y A;  1VJQ A;  2X51 A;  3VGT A;  2XMK A;  3IRW P;  3W61 A;  1WOR A;  4ZVQ B;  1H72 C;  4BLG A;  3BO2 A;  2BRK A;  5EHH A;  4A47 A;  1FJ7 A;  4M63 A;  4G1I A;  3RTV A;  2O67 A;  2NSC A;  2DVI A;  1XNR F;  1K44 A;  3D67 A;  4RWX A;  2YNH A;  3Q86 A;  2GO9 A;  3EVO A;  1R8C A;  1OQ6 A;  1LW0 A;  2RD5 C;  2LDI A;  5I3U A;  3BKT A;  3ZTR A;  2NYI A;  4QBU A;  1N6Q A;  2LKZ A;  1CJT A;  4DF8 A;  3R9L A;  2KB2 A;  1B0T A;  3QGI A;  4ED4 A;  2YNG A;  1B7Y B;  4K7Q A;  1XNR J;  1CSJ A;  1FRJ A;  1JMT A;  1ULR A;  1XC9 A;  1V3Z A;  1X4G A;  3CWJ A;  2VQE F;  1VBZ A;  1REV A;  4ZOS A;  2GHP A;  3H90 A;  1DLO B;  2HSE B;  4KO0 A;  3C8Y A;  1MU2 A;  2IPO B;  4DR6 J;  2XNQ A;  3A3N B;  2DH7 A;  2EG2 A;  3LQV A;  4N7T A;  5KFV A;  3DHX A;  4ZJQ A;  3CUN A;  1LNQ A;  2HQ3 A;  1UW9 A;  3BH6 B;  4Q43 A;  2ZZM A;  4G6V B;  2VQE J;  2AEJ A;  1YBT A;  3T6J A;  1SV5 B;  4LRA A;  2H1Y A;  2OH2 A;  1RHQ B;  2PEH A;  3RB0 A;  1OSC A;  1H2T Z;  4PXB A;  3I0S A;  2CPI A;  3CMA S;  1KC8 T;  2J9D E;  4DFM A;  1VQ9 S;  4XDD A;  4F02 A;  3EGZ A;  3HSG A;  2FPH X;  2UXC F;  1K8A T;  1NKC A;  3M9O B;  4YY3 F;  2OUG A;  5DGB A;  4F3O A;  3QWP A;  4IDK A;  1LOU A;  1NJY A;  3BR9 A;  2W7A A;  2DNR A;  2VD3 A;  3PX6 A;  1L3U A;  2VJU A;  2CJK A;  2AYB A;  3OPK A;  5HI7 A;  3EDQ B;  2QA1 A;  2PFD A;  1HWI A;  4F7V A;  3T19 A;  2AJ0 A;  2YKM A;  3J81 j;  1TL5 A;  3UDC A;  4GC6 A;  1AZS A;  1LWF B;  4C8Y A;  3UCZ P;  3DLE A;  4WZM A;  3CCZ A;  3BDE A;  1XR7 A;  3KOA A;  3IR5 B;  2IRU A;  1UVL A;  2RUS A;  2UXB J;  4IO9 Q;  3QWU A;  3EGV A;  4B3O A;  1OJ4 A;  4G1Q A;  4ZLP A;  4B3S F;  1YJV A;  4ZPD A;  4J9K A;  1QSL A;  2FYX A;  2KO1 A;  1PKU A;  2GO8 A;  1EQM A;  2HBZ B;  2ADC A;  2ZKU A;  1F3F A;  3Q24 A;  5D0H A;  3IGN A;  4B3S J;  2MGZ B;  4GC7 A;  2HZC A;  2IYI A;  1WF0 A;  1UTA A;  3OFG A;  2DNG A;  4JV0 A;  3TOQ A;  3GSD A;  1HNX F;  1S0M A;  1WAC A;  3OUY B;  2VKR A;  1RAO A;  4CDI A;  3QAE A;  2HHW A;  4I6Y A;  2A0F B;  3MMB A;  4FBU A;  4NLR A;  1B3T A;  5L39 A;  2DRA A;  2JFD A;  1MNE A;  2XS7 A;  1DQ9 A;  5KG3 A;  2HQF A;  1DJ0 A;  2VOO A;  3P96 A;  1WHW A;  2E9T A;  1YZ7 A;  1NJI T;  2GJ2 A;  3JXO A;  2ZM6 F;  1F1B B;  2MZQ A;  2F5G A;  2OSQ A;  4OQJ A;  2EI5 A;  2CQH A;  4LF8 F;  2B51 A;  1Q7Y T;  2R7W A;  3M8W A;  1S1U A;  3GFH A;  4LFC F;  3QJJ A;  4F50 A;  1URN A;  1KN6 A;  2ROE A;  4A8O A;  2CQ1 A;  4DUT A;  3NAH A;  1FRH A;  2HLU A;  3T9N A;  4NA1 A;  2L9N A;  5KFB A;  2ZM6 J;  1N48 A;  5L9X A;  2DIU A;  5D3G B;  3MGJ A;  4DG1 B;  3RG6 A;  4LFC J;  4OZL A;  4J9U E;  3MEC B;  1NCL A;  2UUT A;  1G7C B;  3C66 A;  1S7I A;  1Q8K A;  3OLB A;  3KJN B;  3UD4 P;  4QWA A;  1N5Y B;  4URG A;  3JSM A;  2HIQ A;  4PPZ A;  4QJV A;  1QSS A;  3L3C A;  1YBU A;  3GIJ A;  2IAJ A;  2V8P A;  4OZ1 A;  4ZMM A;  6FDR A;  2C22 A;  3KMQ A;  2XMV A;  4M94 A;  4C8N A;  3OL8 A;  2J5A A;  5GAG U;  4X2B A;  4B9T A;  1JLF B;  2VUG A;  2BYC A;  2NSB A;  1FKO A;  3ISN D;  4H4M B;  4X64 F;  2JWN A;  2V9K A;  1F60 B;  2GA7 A;  4KTQ A;  1UVN A;  4LF6 J;  1DHM A;  5HVF A;  4A8M P;  2E1A A;  5JJB A;  3NNH A;  1FK9 A;  3G82 A;  4OL8 A;  4B9U A;  3G86 A;  3BGU A;  4WFY A;  4RW7 B;  1P6T A;  4ZVF A;  4WII A;  1HHT P;  1VC6 A;  1UWB B;  3NCP A;  3ENQ A;  3MMC B;  4B08 A;  2XG8 A;  2R3V A;  3X1L B;  2BM0 A;  4Z7Y A;  2WVE A;  9RUB A;  2W25 A;  3AHP A;  4DL6 A;  4L3K A;  3HUL A;  2FJB B;  1TK0 A;  5ADZ A;  5D4N A;  4ED8 A;  1RT7 B;  2DD8 S;  1U0H B;  4KY3 A;  1PAE X;  2AF6 A;  2WRM A;  4KHR A;  5CCL A;  1Y10 A;  2OPR B;  3JTO A;  3G6Y A;  1C1C A;  3BR8 A;  3CJ4 A;  1S1V A;  3GTY X;  2YX7 A;  2YQ3 A;  4CT9 A;  4C8Z A;  1T9Y A;  3WX8 A;  5D78 A;  3MR3 A;  2ZNY A;  1X4A A;  2QL5 B;  1ZM3 A;  3GIL A;  2JEG A;  1NJW A;  1NJX A;  4ZIW A;  3GIK A;  1I94 F;  2FVQ A;  5CZX A;  2FHJ A;  3D0I E;  1TL4 A;  2CVI A;  3JTN A;  3OR1 B;  3AQP A;  2C28 A;  2DXE A;  2ZOM A;  1KFD A;  3S7R A;  5KG5 A;  1RKJ A;  1DTQ A;  3RUB L;  2BE9 B;  3ILO A;  1SC3 B;  3BSN A;  2BAC A;  4DPW A;  1HMV B;  2WB4 A;  2U1A A;  1RZM A;  1S6U A;  2R2U A;  3DNC A;  1N5Q A;  1I94 J;  4K8R A;  2CQP A;  4MMO A;  1I1G A;  1AUD A;  4KV8 B;  2QLF B;  2ATL A;  3G6V A;  4CLS A;  2ZH1 A;  4XO0 A;  2JZ5 A;  2HHS A;  4FYW B;  4DR3 F;  2RRN A;  2KT3 A;  3WHI A;  2B9Y A;  1EKS A;  3K8V A;  4X62 F;  1X5T A;  5F3T A;  1WDT A;  2WB1 D;  4CLZ A;  4K5S A;  4LFB J;  2F63 A;  5F9N A;  1RLD A;  1WJ9 A;  5IQ6 A;  3LP0 A;  3QT7 A;  1ZTT A;  3MR5 A;  1BD6 A;  2JJ4 D;  3WZ0 A;  3D5M A;  3TI0 A;  2YWH A;  4DR3 J;  1MWQ A;  3KJF B;  4NL5 A;  3S8S A;  4X62 J;  1WDD A;  3C2P A;  5A2Q U;  2IM1 A;  1YIJ S;  4PEO A;  2IDL A;  2ZH8 A;  1JNZ B;  4DUY F;  1GX6 A;  4Y2C A;  4F8R A;  1U1Q A;  2K3K A;  1F2H A;  2G2Z A;  4MFB A;  2ZH3 A;  3UDL A;  5HLF B;  2HWH A;  3O8W A;  3J81 Y;  5KG2 A;  3D4J A;  1FRX A;  2D9P A;  4M5L A;  5KFC A;  1M1G A;  2B0G A;  2D1C A;  2WOM B;  4D3H A;  3C3L A;  5EN1 A;  3E8O A;  4DUY J;  4B9V A;  2AU0 A;  1S99 A;  4P10 A;  1S1T B;  4OLP A;  4IFV A;  2JSX A;  3W5Y A;  4CLP A;  4DV3 F;  1DZ5 A;  2DGQ A;  2NXU A;  3ZNU A;  3LA0 A;  3KG1 A;  2EC2 A;  1KVJ A;  2CJB A;  1JLA B;  2EPI A;  1N36 J;  3TQ1 A;  2QGF B;  2VJV A;  1Y11 A;  2Q79 A;  3P5T L;  4YB1 P;  4NYZ A;  4N8N A;  4GMK A;  3OT9 A;  3BGL A;  5HQ8 A;  2WBM A;  3K8W A;  4GKK F;  3CD6 S;  5I42 B;  1UVK A;  1TKX B;  2F9J A;  2FLN A;  1G6B A;  1YJ9 S;  3IXQ A;  4IRD A;  3DOL B;  4EO8 A;  1GTE A;  3HHL B;  3VAI A;  4TYA A;  4EBD A;  5ETM A;  4KGV B;  3KLF B;  4J37 A;  1FF2 A;  1OMS A;  2F8H A;  1K1S A;  5IT9 Y;  1RT4 B;  1TV6 B;  4OFZ A;  2DRB A;  1MWZ A;  3AJ1 A;  3CJK A;  3NOC A;  4GKK J;  4O4G B;  3CCR S;  3GFY A;  2Z0G A;  4Q2L A;  1KS2 A;  2E5G A;  3K5L A;  1HAR A;  3EPG A;  2LEP A;  2IBK A;  4QYZ J;  3M6U A;  2XGP A;  4KRW A;  1FDA A;  3PO4 A;  2P9E A;  5A8W A;  4TQS A;  5J1E B;  2ZVI A;  1FJE B;  2RRB A;  5KFU A;  1Q16 B;  4NXN F;  3F44 A;  1AFJ A;  4H4K A;  3BGR A;  2YWW A;  1PGZ A;  5IC4 B;  2ZZT A;  4DOZ A;  1PC4 A;  2WVC A;  5KT5 A;  1OQ3 A;  3EVM A;  3UDV A;  2JDJ A;  2I0X A;  2B9X A;  5A6P A;  1NHU A;  4EI2 A;  2L9D A;  3QRR A;  4DPU A;  2I5J B;  1YRT A;  4CLU A;  2W01 A;  4NXN J;  3OL6 A;  2ZHB A;  4PWD A;  1R8B A;  4ZPB A;  2B43 A;  4BS2 A;  1G4C A;  2L41 A;  1RAI B;  3ENA A;  2GJF A;  2BJ3 A;  3BN4 A;  4J90 A;  3CJR A;  3AQO A;  1EET A;  1T8E A;  3R6L B;  3CDB A;  1N88 A;  4IUF A;  4WFX A;  3QLH B;  1VQK S;  2OTL S;  2ZUG A;  3CD7 A;  4WZQ A;  3DRR B;  4DFP A;  7FDR A;  2OO4 A;  1U1O A;  2AJQ A;  2YWF A;  3H4D A;  3DGP B;  1MSW D;  3P5B P;  2MST A;  3CCM S;  3UN2 A;  4ZDN A;  3Q8P B;  3SIP B;  2UXD F;  1SH3 A;  1CJV B;  4ECY A;  1S5Z A;  4A48 A;  4YDD B;  4ID5 A;  2ZVS A;  3PHE A;  4CCH A;  3EZO A;  2XM3 A;  1XK8 A;  4FPI A;  3D7S B;  4DN0 A;  4ZP9 A;  3KFW X;  2VG5 B;  4DQQ A;  5BYS A;  2CYY A;  2MDA A;  1TMJ A;  3N01 A;  3L7O A;  3VQT A;  1IKY A;  3MM7 B;  3M8Z A;  3DOM A;  1HBM B;  4QR0 A;  4TVA B;  1S0V A;  1U7L A;  3R5D A;  4WE1 B;  1WC4 A;  3ENW A;  3G8Q A;  1QDU B;  1YK9 A;  3HXM A;  4DL5 A;  5DDO C;  1LW2 A;  2MQ8 A;  3C16 B;  2HFS A;  2L48 A;  3U1M A;  3RZA A;  4DL0 C;  2RE1 A;  2B7C B;  2VPY B;  2FZG B;  2W4C A;  2HBR B;  2FDN A;  1DAR A;  2W2O P;  1T03 B;  3ZZP A;  3IM9 A;  4M5N A;  1OY9 A;  2X1A A;  2FD2 A;  5HMY A;  3M9M B;  3DLH A;  4ZHR B;  4DV6 F;  1BQM A;  2CDR B;  1YVF A;  2MXY A;  2F4V F;  3HVW A;  1GFW B;  2DXD A;  2E29 A;  4MK9 A;  4TLR A;  2RQM A;  3TVZ A;  1JLG B;  2R7U A;  2HS3 A;  4ENO A;  3ETO A;  4Y2K A;  4W98 A;  1S0O A;  4ZP7 A;  1UVJ A;  2DY9 A;  2DNN A;  3H98 A;  5AXM A;  1PBA A;  2EW9 A;  1VLO A;  1B0V A;  1M1K T;  5LMU F;  2F4V J;  3DM2 B;  3H4B A;  2CQG A;  3I96 A;  3H2V E;  3J7A N;  5MAO A;  3CB4 A;  2X1F A;  3PNI A;  4X4N A;  1K73 T;  4ES3 A;  4G1P A;  3KK2 B;  1EAY C;  3KHR A;  3PKY A;  1SV5 A;  3NNA A;  1WOS A;  5LMU J;  3CF5 Q;  2F1F A;  3TZW A;  1U6F A;  3V6J A;  4R0J A;  2MZJ A;  2QRR A;  2CWK A;  4HTJ A;  2V50 A;  1S7H A;  1KOH A;  3K5M A;  3KUE A;  5KFA A;  2ZBQ A;  5DM7 Q;  3AOA A;  4WXW A;  3HPO A;  2QFI A;  4I2Q A;  3VGV A;  2H5J B;  2IMO A;  4NLG A;  2I6W A;  2ZOF A;  2F3J A;  2WW8 A;  4OZJ A;  3FNN A;  2XSF A;  3QRQ A;  5D0R A;  4N77 A;  2BX6 A;  4TKT A;  1PJ5 A;  3QBC A;  4F0H A;  4GVB B;  4YME A;  2AIR B;  1PYS B;  3BO3 A;  4QPT A;  3W7B A;  4DV5 F;  4OV1 A;  4NLT A;  1PAU B;  2JC0 A;  2KFN A;  4NLW A;  4JI7 J;  4AL6 A;  1VDH A;  3CJT A;  4N41 A;  2HNY B;  4O23 A;  3CCS S;  4ZP8 A;  3QZ7 A;  3M2U B;  3CO0 P;  4KGK A;  4J9S A;  4OZ0 A;  2HZV A;  1LWF A;  3Q0A A;  2W4P A;  1A6L A;  2D41 A;  1C1B B;  1NUE A;  3S6E A;  1YTY A;  2N4C A;  2BE7 D;  3CDW A;  1S1W A;  1RB0 A;  2XC9 A;  3HI9 A;  2JVO A;  1YJ7 A;  4LF4 J;  3TZX A;  2XI2 A;  4RW8 B;  1TUW A;  3D1H A;  5D0E A;  1TK5 A;  1BQN B;  5DDQ C;  1RQ0 A;  4JV1 A;  1RXO B;  2FLO A;  4OI3 A;  4WKR A;  3QGG A;  2DGU A;  1HQE B;  1J27 A;  2HPU A;  3G71 S;  3Q8S B;  3BKF A;  3EDR B;  3KUG A;  2DNQ A;  8ATC B;  2MGZ A;  2VFU A;  1WF2 A;  4B3T J;  2D3U A;  1S76 D;  3W9I A;  4FVM A;  5IT0 A;  5LMN J;  3TUZ C;  4DL3 A;  1RAH B;  5H9F J;  4FNH A;  4D3G A;  4LFA J;  3HMJ G;  2DGS A;  1S9F A;  4QZV B;  4WTO B;  1U48 A;  2IBO A;  5IV4 A;  2DKO B;  2R8I A;  2AW0 A;  5M2P A;  1MG7 A;  5IS2 A;  4CLY A;  1QE1 B;  1IJE B;  1VQ4 S;  3HSZ A;  4LF5 J;  3THP A;  5HVH A;  3TQE A;  3M1V B;  4J5O A;  3GB0 A;  2C2E A;  4EBC A;  2VBZ A;  4ERD A;  2QL9 B;  3NBP B;  3Q8V A;  5H1S V;  2G4B A;  4HT7 A;  4ZCL A;  1H6K X;  3BO4 A;  3ZZO A;  4ZCI A;  2Z56 B;  1NK6 A;  2V9W A;  4QWD A;  2IVM A;  4EGL A;  4NLS A;  1M5K C;  3PKM A;  3IC1 A;  1Y4Z B;  4TY8 B;  2HBQ B;  3VAM A;  5D3G A;  4OX9 F;  3ZTO A;  3QGH A;  3MED B;  2BAN B;  1IXK A;  3NG8 A;  1VC0 A;  4F4A A;  1HL6 A;  2CIM A;  3TAP A;  1UFK A;  2HFZ A;  3MEC A;  4ZVP B;  2UVW A;  2CQD A;  3KLI A;  4DV1 J;  2HHH J;  1HKA A;  2VH7 A;  2XLK A;  3M7V A;  1FA0 A;  3G87 A;  3MXH P;  2VZ9 A;  4H4O B;  4X84 A;  3GU0 A;  2K2P A;  3JTP A;  2ZD1 B;  3MCS A;  4DJB A;  3I5C A;  1TK8 A;  2ROG A;  2BUN A;  4H4M A;  4OHX A;  2HGN A;  1WF1 A;  3UDE A;  4L75 A;  4Y28 C;  1UMJ A;  4DSE A;  1IR2 A;  1HD0 A;  2VC1 A;  2J9D A;  3H25 A;  1U4B A;  3D9B A;  1F9E B;  4ZIV A;  4CH0 S;  1H73 A;  1TL7 A;  3AOB A;  3Q8Q B;  1VQM S;  4XIU A;  5EX0 A;  4WF9 Q;  1RU2 A;  2HMI B;  4KAI A;  2Q43 A;  3CED A;  3LPE A;  4I2P B;  2YBV A;  2KH9 A;  5IV3 A;  4HH1 A;  3EGN A;  1ZM4 A;  3VZI A;  2V4J A;  4PAB A;  2W2Q P;  3ZC4 A;  2RS8 A;  3MUV P;  4EU0 A;  5EWG A;  3MAQ A;  2XQC A;  1JIH A;  2Z2M A;  2HS0 A;  2KT2 A;  1RT7 A;  3VAH A;  3DLB A;  1U0H A;  3SCK E;  3I87 A;  2XHC A;  2G9O A;  2CPE A;  3UNG C;  4HDG A;  2HND B;  4B17 A;  3AXK A;  4NPO A;  3FBB A;  2DYA A;  2CUY A;  2HQC A;  2ASD A;  1SPB P;  3HD2 A;  3JYT A;  1UZD A;  4DV0 F;  4N47 A;  1RP5 A;  4DPX A;  2OPR A;  1UPM B;  2IM2 A;  4JI6 J;  2BJ9 A;  1TMM A;  5THW A;  5F8L A;  2B5J A;  1NZA A;  2YWE A;  2JRS A;  4LSL B;  3C6T B;  1YJW S;  2QLB B;  3PYG A;  3P8B B;  2QA4 G;  4LVO P;  1KQK A;  3QFW A;  2XUL A;  2V94 A;  4IKA A;  4UOH A;  3OQ2 A;  2LDY A;  2RT3 A;  1T7P A;  3OR1 A;  3Q23 A;  4OYI A;  3M32 B;  3QID A;  4ED2 A;  3M30 B;  4AFF A;  5IT9 U;  3W9H A;  4K4U A;  2MLZ A;  5ETO A;  2JLG A;  3GFX A;  1HW9 A;  4KV8 A;  1NDK A;  5GMK a;  3ICL A;  1NK4 A;  3SQG A;  4LF1 A;  2VG6 B;  3KMS A;  1URR A;  1O0P A;  2RKI B;  4HLB A;  3M8Y A;  1H2V Z;  1VGY A;  4U8Y A;  3TA0 A;  2G1D A;  1T05 B;  3DMJ A;  2DR5 A;  2R7V A;  3UQS A;  1RA7 A;  3A8J A;  3W64 A;  1C2P A;  5CYQ A;  1YI2 S;  5IQQ A;  2IHR 1;  4HHH A;  1NPK A;  2E66 A;  1Q5Y A;  4O0N A;  3MMA B;  2GHW A;  2DPJ A;  2AT1 B;  3SDE B;  2BOA A;  4ZN1 A;  4OHY A;  4J9P A;  2QC3 A;  3B82 A;  1N8R T;  3DRX A;  2QLW A;  3BQ2 A;  3V4M A;  2RHQ B;  5KFM A;  2CPF A;  4P75 A;  3W8G A;  4KHM A;  1N4L A;  3B78 A;  2CQ2 A;  2KXN B;  3NKY A;  3L4B C;  4YDX A;  3CC4 S;  1MW7 A;  1CUL A;  4NEZ A;  5HLF A;  5B0D A;  3AJ2 A;  2CPD A;  3KK3 B;  3JSR A;  1LFW A;  4PAA A;  4C9D A;  1U1N A;  4ZVE A;  1EZZ B;  1RDR A;  3LWL A;  3IM8 A;  4I64 A;  5MLC V;  2CNN B;  1ZAW A;  2M70 A;  2UUW A;  5C42 B;  1NO8 A;  4WCE Q;  1HI1 A;  3HCX A;  2PMW A;  3EPI A;  2B3T B;  1S1T A;  5T7L B;  4CYU A;  1QAJ A;  4WYW A;  1U02 A;  2QYC A;  2KDO A;  4Z2X A;  4PUO A;  4LF2 A;  1SBR A;  2PE8 A;  1NK0 A;  2LVW A;  3MCN A;  4UOF A;  5GMD A;  1U24 A;  3D3B J;  1GQE A;  3SFG A;  2CXE A;  2DNH A;  4J9R A;  1NB7 A;  2HQI A;  2ZDO A;  1KVI A;  2E5J A;  3RB6 A;  3V6D B;  1RTD A;  1XMQ J;  2NQP A;  4DSK A;  1HWU A;  2MLX A;  1Q53 A;  5I42 A;  1TKX A;  2KFY A;  2BW7 A;  1Y9O A;  4U96 A;  3DOL A;  2W9A A;  4LR8 A;  1WC3 A;  2GCF A;  4KIA A;  2DTJ A;  3KLF A;  2OPQ B;  2X1G A;  4X4S A;  2BJE A;  5KG6 A;  1RT4 A;  1RAB B;  4CI0 B;  1TV6 A;  5RUB A;  3TEG A;  3BKU A;  1Q79 A;  4AT1 B;  1KTQ A;  4O4G A;  3CCL S;  4R8U B;  1S77 D;  4IQM A;  3QT8 A;  3IO1 A;  3FDS A;  2MJN A;  1WHV A;  3ZZT A;  2NXC A;  1BLU A;  2CPH A;  4DF4 A;  1NLK L;  4CP5 A;  2R7T A;  4I4B A;  3QPI A;  1GNK A;  3M2V B;  1YJU A;  4PXC A;  3ILI A;  2QO3 A;  4RKU C;  1RWM B;  4BCA A;  4ZVT B;  5I4M A;  3T5H A;  8AT1 B;  1WSV A;  3SXL A;  3PIO Q;  4UZB A;  4FF4 A;  5LXR A;  2XMW A;  1W7W A;  3EXC X;  2I5J A;  1RTH B;  2DXF A;  3T5J A;  1SQF A;  1SL1 A;  4NI2 B;  2V8V A;  2Q6C A;  2BZ2 A;  2QLX A;  1D3W A;  3BS9 A;  4B9L A;  1SKW A;  2G0J A;  2HWT A;  3TJA A;  3V2U C;  3OFF A;  3MPY A;  3OHA A;  4ZPV R;  5AXL A;  4QWC A;  4H4K C;  1FER A;  2M3D A;  1E6Y B;  3TZZ A;  3DRR A;  4JI0 J;  3MPV A;  4EEY A;  4GVL A;  1HNI B;  2DHA A;  3DGP A;  4AL7 A;  5AE3 A;  3NCR A;  2IC3 B;  3DRP B;  1N54 B;  3QFH A;  1V3R A;  4QCL A;  4QWB A;  1CJV A;  1RT2 B;  1RWK B;  1BY9 A;  1VR6 A;  4KT0 C;  1IR0 A;  4FKX A;  1VCT A;  2CPX A;  2KU7 A;  1VQS A;  2VG5 A;  3H59 A;  4NLP A;  2P6S A;  2EC0 A;  1XMO F;  3SCJ E;  1NHV A;  2BAB A;  5K8O A;  2UUA F;  2OJ3 A;  3IWL A;  3MAA B;  3MM7 A;  5F0U A;  2IMW P;  2XCP A;  5C7P A;  4RW9 A;  3RRG A;  2V0N A;  4F3M A;  2LCW A;  4WE1 A;  2OEL A;  5IZH A;  2E1P A;  1RAA B;  3R5J B;  3C16 A;  1XMO J;  1S4E A;  1FNO A;  2BDP A;  1T9V A;  4C0O C;  3HT3 A;  2HUR A;  4TXS A;  1T03 A;  1S4F A;  1CJK B;  2WK4 A;  1FTR A;  4L76 A;  4XTT A;  2EFP A;  2P5V A;  1S97 A;  1FE4 A;  4TQR A;  2V8H A;  4C6A A;  1RYS A;  1PYT A;  1VJW A;  2LQB A;  2YQ1 A;  1N5V A;  2K1R A;  2HAI A;  5KFW A;  1D9A A;  3BSA A;  2B4V A;  2CVE A;  3RAM A;  1KLM A;  1ZA1 B;  1BWV A;  2ZEJ A;  5B09 A;  2R9L A;  2DNO A;  2RDJ A;  1S57 A;  3ONQ A;  2YH1 A;  2YKQ A;  2PSZ A;  1HBN B;  4WTY A;  3Q8Y A;  4WPA A;  1J5E J;  1WC5 A;  2FGO A;  5EWF A;  2OI2 A;  2N7C A;  3DM2 A;  2P9G A;  1JLC B;  3NAI A;  4LBP A;  2ZDP A;  1DUR A;  3FBC A;  1F3V A;  4ECX A;  4K5R A;  2OSR A;  1X9W A;  3B8H A;  2FHK A;  1LXN A;  1YG0 A;  1N56 A;  5CD4 H;  4F4W A;  3KYL A;  3MR7 A;  4NZ0 A;  4ANE A;  5DDR C;  2MJU A;  4A8S A;  1TVR A;  3FQL A;  2WW4 A;  1R0A B;  2B56 A;  3OSP A;  3GLJ A;  1Q82 T;  4Z37 A;  3DLL Q;  1TFY A;  3K89 A;  2GVZ A;  3GJS B;  3DLK B;  3NS6 A;  4J7C A;  2KYZ A;  2PO4 A;  2YQ0 A;  3PVX A;  4LVN P;  2RS2 A;  2RAQ A;  2C3M A;  2MKK A;  4RL1 A;  1T11 A;  2ZE2 A;  1GX5 A;  1VHI A;  2IJR A;  1VRT A;  3UD3 P;  2BJ1 A;  3W63 A;  1VFJ A;  1RWW B;  2J9C A;  2B4P A;  2CQ0 A;  1JLQ B;  3EMT A;  4HKQ A;  2DR7 A;  2O3D A;  3TX8 A;  3L09 A;  1GK8 A;  2HNY A;  3FCW A;  1HBU A;  1U1R A;  3U02 A;  1FJG F;  2MQL A;  3M2U A;  4JI3 F;  3C46 A;  1OYD A;  4GO5 X;  3G6E S;  2XY6 A;  3AD7 C;  4URS A;  2I8E A;  2LEC A;  1WHX A;  1CG2 A;  1AFI A;  3H20 A;  4RNF A;  4LBI A;  3J7Y I;  3MEG B;  2LEA A;  2XZT B;  3OD2 A;  3W2V A;  1XQI A;  4TU9 A;  2VDH A;  2OLW A;  3PYE A;  3KDN A;  4NAS A;  2XLI A;  3GCW P;  2IIH A;  1FD2 A;  3KLE B;  4KPY A;  1V9O A;  1BQN A;  1R89 A;  2CZ4 A;  4ZVH A;  3CUL A;  3IAM 9;  3TUP A;  4RW4 B;  2J0S D;  3RBD A;  1TTH B;  3ZTQ A;  3G9C A;  4KJI A;  1HQE A;  4GRS A;  3D28 A;  4RX6 A;  4DX6 A;  4OJ1 A;  1X4H A;  2RU9 A;  4CT8 A;  4HL9 A;  4LSN B;  2RU3 A;  4FF1 A;  4WU3 A;  3TAQ A;  3HF5 A;  4K4T A;  3MI7 X;  3POT B;  1SJF A;  2W7O A;  2JHE A;  2PDA A;  4DLG A;  4AQY J;  3P6Y C;  5EX3 A;  4XK8 C;  4IYQ A;  3ETM A;  3CC2 S;  1QE1 A;  3EZ5 A;  2DGO A;  1W2B R;  2MKH A;  1ZAX A;  2NYH A;  6AT1 B;  1IQT A;  2Y1L B;  4B9N A;  3VV2 B;  5DZ6 A;  2APO A;  1U1M A;  5KT7 A;  3NBP A;  4HDH A;  3LUY A;  2QL7 B;  3NP5 A;  1R7I A;  1HLW A;  2Z30 B;  4QR1 A;  5F41 A;  2FVS A;  4ZKA A;  2X7I A;  4DXL A;  1WG5 A;  2K3I A;  5JMN A;  4NXM F;  4TY8 A;  4DV2 F;  2YWG A;  3BZQ A;  1FRK A;  3MED A;  4NLY A;  2BAN A;  2WSC C;  2H54 B;  3CCQ S;  2IM0 A;  1EIY B;  5KFZ A;  1QJH A;  1N32 F;  5D15 A;  2H5E A;  1RTJ A;  4CM0 A;  2CNK B;  4H4O A;  3GV8 B;  4NXM J;  3AB2 B;  1K1Q A;  2ZD1 A;  3AH6 A;  1HA1 A;  2O5D A;  3VF0 B;  3AB4 B;  3OTO J;  3A8E A;  4NMX A;  4RWW A;  4OLO A;  1M0S A;  2MZR A;  4WU2 A;  2M4M A;  5ETR A;  3ULH A;  1N52 B;  1XNQ F;  2SXL A;  2YNI B;  4ZS6 A;  3JQM A;  4CO2 A;  3SSR A;  3GG0 A;  2QSW A;  4EK2 A;  2QG9 B;  1YSJ A;  3C15 B;  3ZTP A;  4WJB A;  1Y0H A;  1RHJ B;  4R0E A;  2YKP A;  5M2U A;  3P4U B;  3BQ0 A;  1XNQ J;  2RHS B;  2ILZ A;  2MQN A;  4NLO A;  5J2M B;  2GML A;  3T9Z A;  1X0F A;  3RRH A;  1ZM9 A;  4Z7C A;  3V6K A;  1U0S A;  4LQ3 A;  2DEI A;  3BV8 A;  3IN5 A;  3MM9 A;  1SUQ B;  5AJ3 J;  2PA3 A;  4ZPC A;  4DCJ B;  5GAD I;  2DGW A;  2UU9 F;  1WC6 A;  1EAR A;  1QUP A;  5KFO A;  5GME A;  4LSL A;  2Z2L A;  4EUV A;  3R27 A;  1N5S A;  5AXN A;  2XSJ B;  4ZIT A;  3BQ1 A;  3C6T A;  3K5O A;  3ENV A;  4C98 A;  3VGS A;  5F8M A;  3AY0 A;  2CQ3 A;  2FGC A;  3IP0 A;  4RNM A;  4JI8 J; 
#chains in the Genus database with same CATH homology
 1RWP B;  3D6H B;  3KJF B;  2QL5 B;  2C2O B;  3RJM B;  3GJT B;  3R7S B;  3P4U B;  2Y0B B;  2DKO B;  2CNO B;  1BMQ B;  1RWK B;  2C2Z B;  4DCP B;  1NME B;  2H4W B;  2XZD B;  2CNL B;  1RHU B;  1QDU B;  1I3O B;  1ICE B;  2H54 B;  3QNW B;  4ZVS B;  2H48 B;  2C2K B;  2FQQ B;  1RWM B;  1RWW B;  3R6G B;  2HBZ B;  4ZVT B;  3GJQ B;  3R6L B;  2CJY B;  5IC6 B;  2CNK B;  4JB8 B;  1RHR B;  2HBR B;  1PYO B;  3R7B B;  1SC3 B;  2XYG B;  1RHM B;  2H65 B;  1SC1 B;  2P2C B;  2QL9 B;  2XYH B;  1F9E B;  2QLB B;  3GJR B;  1IBC B;  4DCO B;  1RWV B;  5K20 B;  3KJN B;  1RHK B;  2QLF B;  1QTN B;  2H5I B;  3NS7 B;  4ZVR B;  4ZVU B;  2CDR B;  3SIP B;  2H4Y B;  4DCJ B;  2C2M B;  4ZVO B;  3EDQ B;  2H5J B;  4LSZ B;  3IBF B;  3R5J B;  1GFW B;  2XZT B;  2CJX B;  2Y1L B;  2HBQ B;  3R7N B;  2HBY B;  3P45 B;  1I51 B;  2QLJ B;  3EDR B;  3KJQ B;  2CNN B;  1RWX B;  5IC4 B;  3D6M B;  2QL7 B;  3D6F B;  4ZVP B;  1RWN B;  2C1E B;  1RWO B;  3GJS B;  1PAU B;  1RE1 B;  1RHQ B;  4ZVQ B;  2H51 B;  2XYP B;  3IBC B;  1SC4 B;  1RHJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...