3GJQB

Caspase-3 binds diverse p4 residues in peptides
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Caspase-3 subunit p17
total genus 20
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3gjqB00
2C1EB 2H54B 4ZVSB 2XYGB 2HBRB 2XYPB 3GJTB 3GJQB 2HBQB 3RJMB 1RHQB 1RWNB 2CNNB 2P2CB 2H65B 2XZDB 2H5JB 1ICEB 2Y1LB 1RWWB 2CJYB 3IBFB 3R6LB 2FQQB 2QL7B 3P4UB 2HBYB 3NS7B 1RWMB 4DCPB 1PYOB 3IBCB 1I3OB 2QLFB 2CJXB 1RHJB 1BMQB 2DKOB 1RWXB 2H51B 4ZVQB 3EDRB 2XZTB 1RHKB 1QTNB 1PAUB 3R7BB 4LSZB 1RHMB 2HBZB 3SIPB 2QLJB 2H5IB 2C2KB 4DCJB 1RWOB 2QL9B 3D6HB 3GJSB 3KJQB 5IC4B 3KJFB 1RHUB 3D6FB 3P45B 4ZVUB 1SC3B 4ZVTB 4JB8B 1RWPB 2C2OB 2CNKB 2CDRB 4ZVOB 2CNLB 3GJRB 5K20B 2C2ZB 1QDUB 3R5JB 4ZVRB 2H4WB 3R7NB 2CNOB 3KJNB 3D6MB 1IBCB 2XYHB 1RWKB 1SC4B 1RWVB 2H48B 4DCOB 3R7SB 1NMEB 1SC1B 1RE1B 1F9EB 5IC6B 3QNWB 1GFWB 1RHRB 4ZVPB 2QL5B 1I51B 2C2MB 3EDQB 2H4YB 2QLBB 3R6GB 2Y0BB
chains in the Genus database with same CATH superfamily
1IQTA 3LPEA 3F0NA 1B0PA 1QAYA 3UD3P 3IR7B 4ZIWA 5H9EJ 3PV8A 3MM9A 3E8OA 5AXKA 5I3PA 3J81Y 1DURA 2WSCC 5E3QA 4A8XA 2YKNA 2G2YA 1V3RA 3GJQB 3J7A1 3E2EA 1Q53A 2L08A 1RHQB 1SUQB 5F9NA 1SJ1A 3NAIA 3QFHA 3TX0A 2NYIA 4DS5A 4F4KA 1C4CA 3EGWB 1YDLA 5IM0A 1NDKA 2XMKA 3OTDA 5L38A 2HFZA 4MJKA 3VGSA 1M90T 2H65B 1VRUA 3JQMA 2YNGA 1MU2B 3LPYA 2RQ4A 2KDOA 1LOUA 2PGCA 1P9QC 1UJ6A 3MECB 1N56A 4ZJQA 1GMVA 2ASDA 2DR6A 5JUMA 4FVMA 2DITA 1DRZA 2UXCJ 1LV5A 3R5BA 1FK9A 2V2QA 1QAXA 2YKNB 1HNIA 2YPYA 3BKTA 2N4CA 2GVDA 3IA0A 5J2MB 1L3UA 3IBCB 1HNWF 4ZPWR 4IH6A 2QYCA 4EI2A 1TAQA 4DR6F 2VG7B 3AOBA 1T94A 3CTRA 2W2MP 5FLXY 1NJYA 1F1BB 3DLEA 3M8QA 2QLXA 1JLFB 3R1HA 4ZA1A 2K8GA 2VC1A 1X4GA 5LJ5Y 4TU8A 2FYXA 2XCAA 1V9OA 2GQ2A 1VHIA 3WC0A 1MU2A 4O44A 2IBOA 3NS6A 4PXDA 5J1EB 1U1NA 1TKXA 1QTNB 3IRXB 2VBZA 3Q86A 3QAEA 4C8OA 4LF7F 2ZD1A 5DQIA 3LP1B 4YP3A 2IMWP 2VFRA 2RF2B 3CIZA 4CM2A 5HQ8A 2ZBQA 1NDLA 3T5LA 3HK2A 1IJEB 1DBDA 2NYHA 3OR2B 4QQBA 4KE5A 3M2VB 3W65A 5GAEU 4TQSA 5KFTA 4A8MP 3D1QA 3ETMA 4RW7B 4PR6A 3EE3A 4OQJA 1JLFA 1U2CA 1RHUB 1YJVA 1IKYB 4NI2B 2MPUA 2OPRA 2JFKA 3DLKB 4OI2A 4C48A 1MMDA 1S7IA 1CJVA 2ZE2A 1N88A 4HT7A 5CYQB 5I42A 1FX4A 1YZ7A 3GIRA 1IKVB 2HQ3A 3MPVA 3PTWA 4OHXA 4YEAA 4ZVOB 3HM9A 1AW0A 3MPDA 4U7CA 4M95A 3PO5A 3T41A 2CQIA 4K50A 6AT1B 3BGLA 2L9WA 3L7UA 3JS9A 2HVHA 3IFEA 3RBDA 3M6VA 3W8PA 4ATNA 5F8JA 4JI3F 1DTTB 3VAJA 1Q7YT 1RK8A 2IMOA 4DJBA 5KFNA 5KT4A 1RU1A 5D6GA 6FDRA 3KLIB 4GVBB 3TAMA 5J2NA 3HHNB 2WB1D 2XY5A 4NXNF 2FHJA 3CCTA 2IRYA 1F5CA 4QIEA 5ETSA 4Y34A 3O5TB 5GADI 4USIA 1T03A 2YX4A 4QYZJ 5D0GA 1RT2A 4WK1A 2Q3PA 5LT5A 2VQEF 2IRUA 2NZ4A 3GMGA 2ROPA 3CCWA 4XDDA 3UQSA 5F8GA 4NA3A 4DL0C 5B08A 2AJ1A 1RT3B 4Y6IA 2AYGA 1CEZA 4ZPDA 2P9GA 2YNHA 2I2YA 3H5UA 4OYWA 2WRMA 2UXBJ 1NK4A 2MHEA 4B3SF 3SSSA 4NL5A 1CQMA 2LQBA 1SL2A 4ELVA 1AROP 2XSJB 4C3LA 2V2ZA 3QYYA 5BR8J 1KLNA 1JLBB 5ETLA 4PPDA 4I0WA 2W9BA 1U47A 4OZ5A 1SJ4P 4ILLA 2EG2A 2HLUA 4LR9A 4RW6B 1NHVA 4URSA 3BBFA 1UETA 3SSQA 2MKKA 1B0TA 3HHLD 3WX8A 3M9OB 3TAPA 4JI4J 1YWXA 3CT9A 5E33A 4CI0B 5EWEA 4YY3J 4QYRA 4G6VB 1QLNA 3LGMA 2R8JA 3FNNA 2GJFA 3DU6A 2V4JA 4WYWA 4K4WA 2DD8S 3JSRA 1IKXB 5F8MA 3DRRB 3H2LA 5EHHA 3I55S 1EZZB 1RTHB 3JTNA 4PEOA 1JNZB 3W9HA 2HRTA 1CS4A 2CQGA 2HGMA 4XTTA 3PEJA 4X65J 4ZK7M 2OPSA 3CEDA 4DUZF 3ZZ0A 2YX1A 1H38A 4QIVA 1LWXA 2JHEA 4A48A 1RTJB 2DNNA 3D4JA 3L95X 2JLEA 4LRCA 4J9MA 4ETZA 2ERRA 4W90B 1M1GA 2GVZB 3LQVA 5IT4A 4ZHRA 2DHGA 1BQNA 3LTOA 2ZD1B 2BXJA 4U9RA 2DISA 4O3NA 3P4UB 1Y3JA 5ADZA 4ZITA 2Y1JA 1N34J 5F3ZA 1S77D 4JI6J 4E2FB 3GPAA 1XK8A 3G96A 3S8SA 3ZO7A 4JI3J 4I6WA 1I3OB 1VYAA 1XERA 1VMBA 2VD3A 3RRGA 1FO1A 1SPBP 2MKSA 2RKIB 5C42B 2Y1IA 2UU9J 1RHJB 4BDPA 3BGUA 4PQAA 1GH8A 2PFFB 1FERA 2EFPA 1UFKA 2M4MA 2YNIA 4I69A 5D0EA 2HAFA 4HHJA 3CD6S 2HVIA 2J6UA 2DJWA 1DLOA 4TU7A 1MN7A 1VK3A 4QR0A 1RBLA 3AB4B 3W63A 3R5DA 1FFSB 2K1RA 2J76E 2Z0GA 1L5UA 1HQUB 4PCQA 5B0BA 2CPZA 1XMQF 1Y7PA 4IOCQ 4DF4A 3MMJA 2J8AA 3KK2B 2VQFJ 1TUVA 4OJ3A 1N5YA 3V6DA 1T8EA 1UTAA 4OX7A 4ILRA 4OYZA 4KHPJ 3TO8A 2YNIB 3P45B 3Q89A 1SJ3P 2BOPA 3SMZA 1Q8IA 2GS8A 2C3PA 3CJSA 3GFYA 5D3GA 1RWPB 4KR0B 2C2OB 2VOPA 1RABB 1BXNA 2C2DA 4DPOA 1F6TA 2HNYB 3OR2A 1TL3B 2MQNA 4G65A 1Q86T 4RW7A 1KQSR 1H0HB 1XMOJ 1S5ZA 2ZWOA 3PYGA 4CH0S 1FVQA 2GIQA 4PXCA 1ZM2A 2WSFC 2OFGX 2GW8A 5LSRA 1BUXA 3DXSX 4J7CA 4EO8A 2BJ3A 3DRPA 3QMQA 4P6QA 4NOHA 3EVMA 3Q8UA 1SKUB 1H7XA 4M5LA 4HL9A 2HWTA 2V69A 4RNOA 1YJTA 1HWIA 5DS7A 4U6PA 1VQLS 1LW0A 1FWLA 1RTDA 4K4ZA 4IOAQ 5D15A 2XMAA 1C4AA 1WG5A 2WVFA 1EQMA 4LREA 3ENWA 4NASA 3TNVA 2HQFA 2BW2A 5C7PA 3TX8A 4R5PB 3BSNA 2DHHA 4O4RA 2W9AA 4UQGA 4ER8A 4DHVA 4B3TJ 4V19J 4ES2A 2QV6A 5FD1A 4F7VA 4RNMA 3DM2A 1NH8A 3UDEA 2ZC3A 2V34A 2H48B 5LM7E 4U67Q 1T95A 2XM3A 1K9MT 2Y9HA 1BC6A 1Q1KA 3OXLA 2BA9A 1TP7A 1R6YA 5DDQC 1DTQA 1X4BA 2B4OA 4JI5J 3P6YC 4B3RJ 4ZVPB 4FDFA 5IS2A 2XO7A 4B3RF 2RUGA 1U1LA 4LF6F 5A76A 2IJNA 1GX6A 2V5HG 4C0BA 3LALA 2VC0A 1GMWA 3HVAA 4R5PA 4MMOA 2UUBJ 3RR7A 1E6YA 2WBMA 1NSAA 3FJ2A 4CDIA 2ATCB 4RLEA 3R5GA 4I6YA 5I4MA 2WBRA 3W66A 1WSRA 1R0BG 1AT1B 1S1WB 5D4NA 3UVJA 2QIFA 3KJVB 3AD7C 3RRHA 2W7OA 1IKWA 3MTKA 3O3LA 3BQ0A 3DOKB 1BY9A 1IBKF 2ZJQQ 4JV0A 2W9CA 1O0PA 1GXUA 2C2RA 1GXTA 1D9AA 2ROGA 1CJKB 3MAQA 1R0AB 1X4DA 3R6LB 4PG4A 5KFUA 4F0MA 1WHXA 4PYAA 1UAWA 3ET6A 3G71S 4E0DA 4UW2A 3H5SA 4JI8F 3TANA 5B0FA 3GIIA 5IWAJ 4GKJJ 3THPA 3IG1A 5IWAF 2B4UA 5B0GA 3UNYA 4LFCF 1H2UX 1YRXA 1N5YB 4LQ3A 1NXIA 1U09A 5IT9Y 1PYSB 2VA2A 2OHDA 4WXOA 1BQNB 1X5PA 2J8SA 4PUOB 3MEDB 1X4FA 4HHUA 4NLOA 2XMMA 2K3KA 4DL2A 5KFJA 2XZTB 2PI4A 4KGKA 1KOHA 2IDEA 1OPIA 1X5OA 2ADCA 4V1Ak 2HHTA 1QE1A 1Y9OA 5AJ3J 4ECTA 1EARA 2P6TA 2UUWA 1G2EA 1AZSA 2EFGA 2CPDA 3A1YG 3NG8A 4OLOA 2DGVA 2LP4A 4BC9A 1RWOB 2NREA 4N8OA 5DG8A 3L7PA 4JI0J 1DLOB 2F40A 3ZTSA 5C24B 4JI0F 1C2PA 3OLBA 3RBEA 2AT1B 1NH7A 1RT4B 3NGKA 4EYHB 3K58A 1XR5A 4WFBQ 3PR5B 1TVRB 2RQCA 1YG0A 3BR8A 4U8VA 4ZVTB 3F41A 4X4OA 4LRBA 4DR1F 2VONA 2FGCA 4PQUA 1KSPA 2YKPA 4DR1J 3AA9A 4G1PA 2CFXA 4JI4F 1V5IB 1VI7A 1X4EA 3V81A 1R7IA 3CJ3A 3NGTA 4YDXA 3NGDA 4B9TA 1ZA1B 4M63A 3ZNUA 2BKNA 3R5AA 3MR6A 4J9SA 1YZ6A 1B7YB 3ENVA 2WTFA 1U24A 1VQMS 4IG0B 4QIGA 5L1KA 2HHHF 2HZVA 2JEJA 4OHZA 4J9QA 4WK3A 1FNXH 1KN6A 4YN3B 2JL9A 3FSXA 3CCSS 2DVIA 1X9SA 3SFGA 4ED0A 3H98A 3AA8A 4NLXA 2QE5A 3EZUA 3UN3A 2J9DA 3A4TA 2FTRA 1FFGB 1S79A 1WI6A 2LXFA 3BPSP 3WHIA 3D67A 4EMDA 4YHHF 3AJ2A 3PX6A 3N6MA 2HNZB 1ZAXA 4JI1F 1OIAA 2IFXA 4R8UA 1WF0A 3VAIA 4JI1J 5BYRA 2FUG9 4KHRA 1SI9A 3PHEA 2VHGA 5CH7B 3NP5A 2E1AA 5EUHA 4DX6A 3IR6B 5KAKA 4DV6J 4PABA 1SQGA 2WVDA 2AYEA 3UR3C 1B64A 2JNJA 3HPOA 3HJVA 3KLHA 2OMLA 3GIJA 2DR8A 5C25A 1SC6A 2Z2ZA 3PJ9A 2BZ2A 5KFVA 5GAHI 3PYEA 2JLGA 3LO3A 4LVOP 8ATCB 3I96A 4X84A 4DI6A 2MGZA 3E51A 3NXZA 4CLTA 2B6AA 2IAJB 2DH9A 4ED2A 3T1HJ 4ECYA 2BVZA 2FJVA 3BEGB 4E8UA 2J5AA 4MT1A 2CG8A 2HYIB 1UWBA 1M5HA 1TV6A 2DIUA 2JH3A 4LSLA 3TA0A 2XYGB 4WU2A 3ET6B 3QGIA 2EPIA 2XZWA 1RAFB 3QLHA 5KG2A 1D8YA 1FRKA 3ETOA 4DQIA 2XYPB 2YWHA 3UI3A 2FGOA 5DJBA 1VQ8S 2JEGA 4ECVA 2V8DA 2HBQB 1EETA 1CQNA 3PKYA 1WTBA 3U1MA 4OJGA 2MGZB 4X4TA 2EFOA 4F26A 3D68A 1O51A 5CQGA 3RB0A 2ASLA 4ECWA 4HH1A 5HL7Q 1BWEA 3JQJA 2DHXA 4QR1A 3GE9A 4TLQA 4QPXA 3BQ1A 1MW7A 2A18A 3M9NB 3FQKA 3W5ZA 4ID8A 3SV4A 3GYGA 2ZKUA 4JV1A 2LXIA 1HPZB 2CXEA 4OV6A 3QLHB 2HWHA 1H98A 2UV8A 3K8VA 1X9MA 1FTCA 5E3RA 1T05B 4YQWA 4M5HA 1R8CA 2YQ1A 5D0HA 3ZZZA 3BDEA 2GFFA 4ELTA 3O8WA 2YQ3A 3GCWP 2EC0A 2J7WA 1QTMA 2CZ9A 2N7YA 2AZ3A 1DARA 5HSPA 5FLXU 2UXDJ 5DM7Q 1N4LA 5A6PA 4DQSA 1YSJA 4CH1A 4K0KJ 1Q8KA 2YBVA 3L09A 5DZ6A 4P2XA 4MKYA 2OGUA 3CNQP 3J7YI 2VH7A 4OJ1A 3UVJB 1OYEA 3LOUA 2GQCA 4DPTA 1RTJA 4PRFA 4H4KC 1RA7A 2VKZG 2LA6A 1IR1A 4AXIA 2V50A 2YTCA 1HWLA 3FSYA 3V2UC 2QFJA 2OELA 1K1QA 1Y4ZB 3FUYA 3BZQA 1K8AT 2DRBA 1ITPA 3EXYA 3THVA 4JI7J 2N4DA 2LXUA 1HHQA 1FK9B 1F9HA 2MMYA 4LBHA 4ZPTR 3ISZA 4JB8B 5SUHA 3DOLA 2NXUA 3DDNA 4CLZA 5EDWA 4NLVA 2XMVA 4KC5A 3UDVA 4EU0A 3I32A 5AXLA 4X66F 2R7OA 1PCAA 2AX1A 1WDTA 2NR0A 4J5OA 4NCGA 3W2VB 5KT3A 2MXYA 5HJYA 2AEFA 1JK9B 1Z2ZA 4NRUA 3MD1A 4GC7A 3T19A 1HA1A 4AL7A 4GVLA 1WEXA 3TZZA 4KHPF 3A3PB 1GK8A 4J90A 4OYXA 3ZZPA 4CYUA 2RRBA 1K0TA 2VJVA 4NLSA 1T9WA 3OT9A 4QCLA 3QWUA 4JBCA 2YXLA 4KIAA 5B0CA 2J9CA 3MMAA 3P49B 2CPXA 4IH5A 1NUEA 1T9VA 1HBMA 4ECZA 2HQDA 2IVYA 4OZLA 3K0JA 4LFBJ 2OPQB 2B7CB 2CQ0A 2FB0A 3D6TB 3PCOB 5LL6d 3WDOA 2I38A 2ZUAA 2M70A 4YDDB 4CT9A 3MGJA 4YR0A 4QW9A 5C24A 3KMSA 1VGYA 3O2IA 3G2XA 5J2MA 3HX9A 1RADB 2MZTA 2A2DA 1SVDA 5HVGA 2XY6A 3RB6A 2IC3A 1HMVB 3DGPB 2ZH1A 2Z2MA 1NDCA 4K5RA 2ZBIA 3I31A 3OHAA 3DI6B 3HFVA 1KQFB 3D0IE 3RBXA 1HWUA 3HJFA 2IYIA 2HRYA 3M1VB 2JZ5A 1RB0A 1S59A 1B3TA 5CYMA 4P2SA 3V81B 3EZOA 5IC6B 2GJ2A 3K5MA 2FD2A 3Q8SB 1XN9A 1L3KA 3DN9A 3CCMS 3OFFA 4OL8A 3PHTA 5G4DA 5EWGA 2LA4A 5EN1A 2Y8WA 3QJPA 1D0EA 2ZBRA 4ZCKA 2BOAA 3OSPA 1K73T 2OUGA 1KC8T 1V5VA 1FXRA 2RUSA 4P2FA 3TA2A 3D5MA 3HSGA 2MY8A 3TVYA 3VGUA 1QAJA 1LEOA 4K4VA 4PG5A 5E3CA 4JV5F 4OI0A 2F9DA 1YHQS 3D28A 1NJIT 3LF0A 2RDDA 2OPRB 2N82B 1X5SA 1Q7LB 4B9SA 3TVKA 4H4KA 4RW8B 2CQ2A 1C0TB 4PWWA 1FFWB 2A2CA 2DNOA 3EVWA 1JKHA 5RUBA 3BM7A 3AXMA 3IMQJ 3N0VA 1LXJA 1TKXB 2XZDB 5E3AA 1RKJA 3NNAA 2CZ4A 2XMWA 3MDFA 2WW8A 3PX4A 3UNGC 5CZVA 5FDLB 1YBUA 2IM3A 2ZHAA 4ZPBA 3SQOP 4K4YA 3PRVA 2PI5A 4NLGA 1I5OB 3NGUA 1KTVA 3MFIA 3IAS9 4EO6A 4LSNA 3K57A 1CPZA 4N47A 4A8KA 4M5GA 2YH0A 4JYAF 3FFIA 2R7VA 2HGNA 2KJWA 3JTPA 2WVBA 3MPWA 2ZNZA 4C0OC 4USKA 1IBKJ 4YHHJ 4NI2A 1BMQB 1NU4A 2DR5A 3W3SA 3EGZA 2CWKA 4LF2A 3DYAA 2MSTA 3CUNA 4N76A 5L46A 4N77A 1U0HA 1CLFA 3VWSA 4I67A 2FJAB 2AZ1A 4NX9A 4B08A 1IKWB 2PD1A 4DV4J 5CD4H 3C8YA 2O5DA 4Z2XA 4HVZA 1TZ0A 2NPIA 2MZQA 4YFUA 3FBEA 4OYIA 1RSCA 2FJDB 3P8BB 3I5AA 5E2QA 1IR0A 1JJ4A 1S1VA 4EBDA 3PRDA 4KYZA 3FBFA 1X5TA 5IC4B 3RU0A 3U02A 4BC7A 2ZH8A 4FPRA 3CC4S 2VOOA 4ZVUB 3MURP 1ZAWA 4B3OA 2IJFA 1S6PA 4Y2KA 1ZH5A 3QATA 4QWDA 1NJZA 3TJAA 1EKRA 4UOCA 3M8RA 4RX6A 1JLCA 4I2QB 4KGVB 4F3QA 2VF3A 3CWJA 5KFZA 2B9EA 4ERDA 3CMES 3HT0A 4ZVHA 2J0WA 2KXHA 1EHWA 1X7VA 2BE2A 2BABA 3GCXP 1FKPA 1HNXJ 2KT2A 1HQUA 1IWGA 4WCEQ 4I56A 2HFUA 4HR2A 3WIUA 4X4RA 1HBUA 1B70B 3U27A 3U7JA 4DV1F 1HYSA 1KQKA 1R8HA 3HULA 3AXKA 4WP3A 1FRHA 2DYAA 4WTYA 5CYJA 5HQMA 2MQOA 3C16A 3R5CA 1HQEB 2J9EA 1JNRB 1TL1B 2KI2A 4HACB 3DLEB 2MYFA 3M8QB 4WU3A 5D78A 3WQPA 3B82A 3G82A 2WVCA 4RBVA 5F3TA 2C2EA 2OIHA 4OZ1A 1MROA 2R7QA 1XMBA 1IBMF 1WSVA 2XO6A 1RXOB 1Q0NA 3TUJC 2E44A 1XNRJ 1DTTA 3KXDA 5IM0B 1HBUB 2Z57B 4OI6A 5KFMA 5GAGI 3M9MB 4PWDA 1ZA2B 1W25A 5GAGU 4C3KA 2FVRA 3I9V9 3J7AN 2KXFA 2QMUB 4KGZB 4O3OA 4AFFA 2OPSB 1I94F 5D8HB 1RE1B 1JLGB 3HVWA 3QZ8A 3MMBA 4CO0A 4MKAA 3R1LA 5H9EK 1I51B 1SCJB 2NSBA 1KFSA 2QJ3A 5IQQA 1Y3KA 2V8VA 2AMCB 1FTRA 2PMWA 5J2QB 1AYEA 1NSKL 3NRBA 2Y0BB 4TXSA 2F8HA 1PYTA 3M32A 3HP6A 1YIJS 2IM2A 2YY3A 2VA3A 2LU1A 4WP8A 3PKMA 3H42A 3N9UC 2V9KA 4YOEA 1OQ6A 2AYMA 1RT5B 2HBRB 3DLGB 4H4OA 4Y28C 1TK0A 1M5PC 2HFOA 3HFZB 2HMIA 2CQCA 1M5VC 5L9NA 1AXQA 1N54B 5G0RA 4CZCA 1RWNB 2YKOA 5KFEA 1SIZA 4KFBA 4PZVA 1S0NA 3FCHA 1S1XB 3I0SB 1KBRA 1NO8A 2X1AA 2JSXA 3CC2S 2VZ9A 3DM2B 5L1JA 4DFMA 1OO0B 4DL7A 4RW6A 2OO4A 3ENQA 2RDJA 1W2BR 2PSZA 5C25B 1S4EA 1IR2A 1BLUA 3IS9B 4L72B 3IBFB 3I4PA 2DNLA 3CJ5A 3CO9A 3DGPA 3LWLA 5DG7A 5E41A 2E1CA 4B3TF 1KNZA 2X7IA 4HYKA 1G1XA 4H4OB 3HKWA 4A46A 3G87A 3OTEA 4WFXA 2ABYA 4YB5A 1PBAA 1IKXA 2MY7A 3IO1A 1RT3A 5G0RB 3FCVA 3DLJA 3QSYB 5E5NA 2WB4A 2G1HA 2ZOMA 3O44A 4F02A 1S9EB 2VIHA 3ISND 4IOBA 5J1PA 4ZDNA 3NGSA 1SB6A 4NXNJ 4LF9J 3K5PA 4M8LA 5BJRA 1WJ9A 3JAMU 4DSKA 4IR1A 4LF6J 2FZKB 4CLSA 4LF9F 3IS9A 2UZAA 3OLAA 2CQBA 4IRCA 4IDKA 2HZAA 2K3IA 3MMCB 5HMWA 1U1QA 5JMNA 2WOMB 2OEKA 4P72A 3J80Y 3ZTQA 3D2WA 1PAUB 1SBRA 1KDNA 1OQ3A 4IR9A 3SSRA 1MMNA 1DQAA 1PSDA 1BD6A 1JXVA 1FNOA 1U7LA 3MR2A 4URGA 1Q78A 2HRUA 3CVKA 2LQJA 2M7SA 1UKUA 4KY3A 4GKKF 5KFPA 3MUMP 1ULRA 2HLTA 1FXLA 3TQEA 3MM6B 3VHQA 5HMYA 2MJUA 4WPAA 2M8DB 2RAQA 1O6XA 3BJYA 1EB0A 1Y11A 1BHNA 5ETKA 8AT1B 2CNKB 2GMLA 5FDLA 4RO0A 3UCZP 4L76A 3HT3A 1P1TA 2RJZA 4DV2J 4KPCA 2DGTA 2PE8A 3A8IA 4P74A 1S0OA 3I5BA 2B3TB 1UZHA 2HQCA 3EPGA 2QTWA 2DO0A 1D1UA 1A7GE 3C15B 3H2UB 1Y0HA 2BANB 1TU0B 3AB2B 3KFWX 2IVFB 3KK2A 2OP5A 3KHRA 1UA1A 1VQ4S 1QE1B 1WELA 2LKZA 1NZ8A 4FF4A 4WJBA 1JLCB 4I2QA 1RZMA 3C2PA 2RDIA 5HMZA 4OZ0A 1JLAA 5GMKa 3OHBA 2ZH9A 4YMEA 1VRTB 2IHR1 1ZM4A 2BDPA 1UZDA 4K2XA 4RW9A 3BDPA 1UW4A 2HFNA 1P1LA 4MYUA 4NEZA 3ONQA 2CADA 2N3OA 4RUAA 2NXEA 3OTOF 3R7NB 1NPKA 3OTOJ 1NK6A 4FYDA 1RAIB 4J9NA 4HDHA 2VUGA 4EEYA 4I1TA 3NAHA 4DPYA 2MHNA 3RW6A 3QT7A 1FJEB 4ZPAA 4BBYA 3MOZA 2V63A 1WHYA 3B4DA 5DDPC 3SZ2A 1D9FA 2UVRA 2R4FA 3VAHA 4MAKA 1HQEA 5HLFB 4ZCIA 2Y3YA 2B4PA 3D66A 4DSJA 1ZPVA 3I0RB 1JLAB 4DL5A 1RBOB 5CA5A 2F3JA 2AGPA 3G8SA 3I5CA 2CQ3A 2RVJA 3F44A 3M8YA 4BHQA 5GAHU 2MKCA 2ZHOA 4UQTA 2W2PP 2W9CB 2BM0A 2IRXA 4F4WA 3CW2C 2NS1B 3QGHA 4OJHA 4WFZA 4ICLA 1UVKA 4C8MA 3POTA 3IGNA 1FJCA 5K8NA 3OTCA 2C1EB 4J9VA 2ZOGA 3GSIA 4X66J 4DMZA 1R27B 3W9IA 2VG7A 3CXCR 5T41A 4C8LA 2PEBA 3MD3A 4GC6A 2BQ3A 4ECRA 1KRPA 2Q6BA 3TYTA 2D41A 4Q8EA 1GMWD 2YWKA 1NK5A 1S6QB 1WUUA 3BBCA 4P7VA 4USVA 2GHVC 4OFZA 4IUFA 5T7LB 1XBWA 2F4FA 3DU5A 3MM7B 1T0TV 5DGBA 2KRBA 5I3UA 1AUDA 2AWZA 2K1RB 2Q79A 4PXBA 4ED4A 3KLHB 3E3XA 1Y5IB 3Q23A 5AE1A 2ZZNA 1S76D 3M1VA 4URQU 3IWNC 2DNGA 5DQGA 4U8YA 3S6EA 4IRKA 1UJ4A 3VAKA 2LMIA 2PDAA 5D0RA 2UVWA 2KM8C 2EI5A 1VQYA 2RRNA 4F2RA 4RKUC 4DFKA 2JJ4D 3V4IA 5HATA 1X60A 3PFEA 4OYBA 3RAMA 2DNMA 5LOQA 4LFCJ 2AV5A 4NLDA 3BBBA 3V4IB 1WKLA 4OMFG 2G1DA 2MKHA 3B6BA 2YWGA 3KWMA 3W64A 4WKYA 3TUIC 4RNFA 5LJ3Y 3Q8PB 1U1RA 2ZNYA 1AA1B 3BKUA 3JB9k 1KHWA 3K5NA 2F1FA 3S1TA 2UUAF 4DUTA 5BXIA 4XO0A 1NNDA 4I64A 1T9TA 2JLFA 3GSDA 3SDEA 1D3WA 3B78A 5M2UA 2NCKL 4CLUA 3W2WB 2MQQA 3TAQA 1HR0F 2UXBF 3EWGA 2Y0SD 2BJDA 2C2KB 1NB7A 4GRSA 2D7SA 2QL9B 1FESA 5HROA 3MHYA 2HFSA 3CO0P 3I0SA 3NEKA 3HZGA 3MMCA 4RPFA 3SEOA 3D1HA 4NZ0A 4X64F 3NWRA 1KEKA 4KT0C 5J2PB 3TJ8A 2HHSA 2PMZD 4JI2F 3DRXA 3OUYA 1FD8A 2DH8A 4M5JA 1CC8A 2WONA 1WC5A 4DEZA 3H8YA 2KZMA 3FFIB 2KZZA 2BKOA 2HNZA 2J6SA 5K9FA 1FRJA 1VISA 1JLQA 4UF4A 3DNCA 3F73A 1BQMB 2R2RA 2XWXA 2VFUA 3M2UB 1VQPS 3HD1A 1TKTA 3BYPA 1I1GA 3FBCA 1U6FA 1XTZA 4IG3B 1Q95G 4O4GB 3JYTA 5K20B 2JVRA 1XNQJ 4ZMMA 2DCUB 3GR1A 2O01C 2IVMA 5A0YA 5KFWA 1NAQA 2W9BB 5A8WA 1X0FA 4YS2A 4B3MJ 3RUBL 3UW1A 4DV7J 4ECQA 1YX2A 4IDKB 3D3BJ 1VIOA 1N6QA 4ZP9A 3HO1A 1S9GB 1F9FA 2QO3A 4DR7F 4PQUB 4QPTA 3BQ2A 3KUGA 2PA8D 3MEDA 4WIQA 5BYQA 1OY9A 2XLIA 2PO4A 2ZM6J 2JOQA 1TR0A 2DNQA 1N36J 3OFGA 3CJ8A 3CJKB 1S7HA 5K8MA 1QVFR 2F5GA 1N5QA 2CG4A 4DX8H 3RR8A 1UA0A 4ANEA 3DXBA 4YUDA 3BSOA 2AU0A 1M1KT 4ZS6A 4EZ9A 2V68A 1VQ5S 1UMJA 4USTA 1NB2A 2R7XA 5L9XA 1RWVB 4DV0J 4AE5A 3MI7X 3H25A 1CJKA 4CT8A 3T5KA 2YKAA 3GG1A 3PNIA 4A8FA 3C6TB 2FJWA 3HHLB 2EFNA 4KO0B 1OS5A 2CQDA 4Y2CA 1GFWB 4DUZJ 2C2MB 2JVOA 3E01B 5DDOC 2JC1A 2GGPB 2P6SA 3W5YA 4TN2A 2FHMA 1PJ7A 4ID5A 1SUQA 1VC6A 2UUCF 3RB4A 1RT1A 3FDSA 2DNKA 4F8RA 3OJSA 2XNRA 3LA0A 4TVAB 2DXDA 5AJ3F 4OYOA 4OYMA 1VK8A 3GFXA 3K89A 5KOXA 1AB8A 5E0OA 2F63A 4KQZA 3N01A 1VBZA 3GJTB 1S1UB 1Z4UA 1M5OC 3C6TA 3GWCA 4M5MA 3MWBA 2DEIA 2ZH5A 3VZIA 1PKUA 1HNXF 1TK8A 1J5OB 1HIYA 1N48A 3M2VA 4MK8A 2E9ZA 2L48A 4ECXA 1F2HA 1WTFA 3HVTA 4LFBF 1NK9A 2X3DA 4MTPA 4JI2J 5LSOA 3SCIE 1HL6A 1UW9A 2VKRA 2Y1LB 3PIOQ 3I6PA 3FQLA 1KS2A 3LGNA 3KYLA 5FJ4A 4HI2A 2JC0A 4U7UD 4QBUA 1X31C 5I3UB 1VCTA 3MPYA 2V4QA 1TVRA 2KFYA 2V2KA 3IBWA 1SL0A 2UVVA 1XNQF 3HF5A 2V8PA 3V6JA 2HNYA 1ZM3A 4UOFA 4DN9A 1KFDA 2QLFB 1T9XA 3IM9A 2I5JB 2J0QD 4C9DA 1PO6A 3KLIA 4GVBA 1WORA 1TUGB 3K7RA 4M1KA 4QWBA 2A1BA 2AW0A 3TAMB 2OMOA 4ZVQB 4DBQA 2W25A 2YNGB 3DGVA 4ANCA 1SJRA 4IG0A 3JSMB 4NZ7A 3QT6A 5IV4A 2B6AB 4PG8A 4JOUA 3KG0A 2B5JB 1IWAA 2XGPA 2R7SA 1BQMA 3GLJA 2KG0A 1FEHA 1D8ZA 1GEHA 2HGLA 3J7ZT 1R89A 1QY7A 4DOZA 1UEVA 1HBNA 2BRLA 3KJQB 2RQMA 4UY85 4R8UB 1N33F 3GTYX 4AD6A 4CLLA 3UN2A 2IM0A 2Z30B 3MMAB 1VFJA 3I82A 2R2UA 2IDLA 1ZTTA 2XEXA 2QA4G 1T3OA 1YKWA 2VPZB 2F65A 2J9DE 4O23A 4KPYA 4BWJA 1HNVA 2VL1A 3AY0A 1OJ4A 1PC4A 3FKBA 4K4UA 3QO9A 2RF2A 3B4MA 2VV5A 3NGRA 3W60A 2AJFE 1KVJA 3LAKA 5KFHA 3KTQA 4TYBA 2C2ZB 2E5LJ 3UD4P 4RW4A 3MAHA 2OAUA 4HDGA 4CCHA 3CMAS 4UOGA 1ELOA 4WF9Q 1K44A 2CJQA 3VAGA 2CPEA 1EAYC 3PYDA 1PGZA 2EK6A 3GFHA 4IO9Q 1QSLA 4KV8A 3T6JA 1XR6A 4X4NA 4Q43A 1LW2B 4OV1A 3H4DA 3R3TA 3QSIA 2DGWA 2XS5A 1RAHB 2E1RA 1CJTA 2FZCB 4R25A 3R97A 5EWFA 2W4DA 2ATLA 3VZHA 2B9WA 3IWLA 2V6AA 1OY8A 4DX7A 3HSZA 4K4SA 1H73A 1S6PB 2HS0A 4PXEA 5HROB 3ZNJ1 4K8RA 2DR7A 4X2BA 1SQFA 1UP1A 2EKYA 1YBAA 2MSSA 2GVZA 2NXCA 4Q44A 3A8JA 2A6MA 2EW9A 2LQ8A 3GONA 1RT7A 1VHFA 3K2YA 3OL6A 2Q43A 2CQPA 1M1HA 2W2QP 2DGQA 1R0AA 2HHXA 1C1CB 1UFLA 3BGRB 2KH9A 1S4FA 4Z37A 4DLEA 5GMDA 2XWYA 4O3PA 2MLXA 1Q8BA 1ROFA 1U1KA 4DFPA 3EDQB 2XMTA 1WKKA 5DM6Q 1WOSA 1RAJA 4B9UA 2KYZA 1WI8A 2VASA 1U2RA 2L9DA 2FVPA 1YI2S 4X4UA 2HHVA 2HNDB 5CAAA 2B9XA 2MLYA 3UDLA 4OHWA 4ZP7A 2YQ0A 2A6OA 4ZOSA 5KFXA 2FIUA 2PC6A 1U6BA 4CRJA 3CJ4A 3DRYA 1G4CA 4CNYA 3IGVA 4FKYA 1H3DA 4B02A 4DUYF 4OZNA 1LWEB 1JLBA 2E5HA 3GYNA 4Q8FA 1F3VA 1IBLF 3KOAA 3NNCA 3EYZA 4DV3J 1AZSB 2BJ9A 2KT3A 5HBMB 1U0HB 2COLA 5HP1A 2ALZA 4Z7CA 3PG9A 2CJBA 1Q8LA 3VGTA 1FRIA 1YVFA 2LDYA 2V94A 2L9NA 2MLZA 3L3CA 2DH7A 1SKWA 4IYQA 2QZ8A 3MM9B 4NYOA 4J9LA 4ED8A 1F2GA 2YWWA 5KFYA 4B3MF 2WW4A 1JQGA 1WKJA 4NLRA 1F3FA 3F56A 4KKOB 3CDAA 1XJWB 3M32B 1HBNB 4K0KF 3A8EA 4DU8A 3AAWB 2ZH4A 1IXKA 3MR7A 4NEYA 1LWCB 1HNZJ 4NCAA 2DIVA 4B3OB 2DKOB 4L73A 3TZYA 3K5OA 3HI9A 4ID5B 4NA2A 2QMXA 1UFWA 3FCWA 4TY9A 4LBIA 5IT0A 3QRPA 4L74A 2DK2A 4WE1B 1LWFA 2RD5C 1V3ZA 1UL3A 4NMLA 3I56S 2XS7A 3A13A 3RYLA 3AT1B 4IFYA 1FWKA 3L7OA 4K7QA 5ETQA 2XCPA 2G9OA 3KLGA 2OKQA 3ULHA 2VG5B 1FJGF 3VR1A 1RI7A 3TRGA 4WFAQ 4DV0F 1RYRA 1NKEA 1Q79A 3GJSB 5CXTA 1KVIA 4LRAA 4RNNA 4L3KA 4X65F 1WG1A 2IPOB 3C66A 1ZZNA 5KFCA 4BS2A 4RUBA 1KHVA 1QD1A 1CJUB 1JLEB 4EBCA 4DR4F 5A6WA 3PYFA 2MB0B 3TP2A 2J6TA 2R7TA 5LMUJ 1KLMA 4X4VA 5J2QA 4QU6A 1T03B 1NCLA 2R7UA 2I0XA 4MYTA 2AIRB 3SFUA 2J7UA 1RT2B 3WIVA 3G6ES 1B0VA 3M30B 1RAOA 2ZH2A 5ITHA 3KG4A 2KU7A 3LGHA 2EFVA 4LIRA 2RRAA 2XMUA 2FC8A 3JQKA 5LSLA 5HK4A 1J5EF 2H9ZA 3CB4A 5KFGA 5FIIA 3DDIA 7FDRA 5KG5A 1Z1ZA 2L41A 2FLLA 2LECA 1MNEA 3M7VA 4IO1A 3CDBA 1LNQA 1DJ0A 2GNKA 4DDFA 4UUWA 2KYXA 3CJ2A 3OV7A 1S97A 1RBAA 5KFOA 3QO9B 1KLMB 1JIHA 4ZVRB 2H4WB 2KHDA 2M52A 2M2BA 2PA3A 4DUYJ 1RA6A 1RLDA 1F60B 1K0VA 2BX6A 2V67A 2WK4A 4J9UE 4RR5A 2ZDOA 3VCDA 4J9PA 3C6UA 2BQRA 4ZLNA 2QMWA 1RDRA 5GMEA 4DV5J 4E98A 2XYHB 3GG0A 3Q83A 2VQFF 1DTQB 3O6QA 4P7TA 1ACMB 2HWIA 1RT6B 4LF5J 3BN7A 2MZJA 3DRPB 1T11A 1FKPB 3MM5B 1FVSA 3CDUA 4F0HA 2C3UA 4PYDA 4DQQA 2CJKA 1NSQA 1APSA 4F50A 4A8SA 4FP9A 1SC1B 1CS4B 4ZCLA 1T02A 2A10A 3M8PA 1ZAVA 2PMHA 1RWUA 4GO5X 2DXEA 1HLWA 2VBWA 4ENOA 1S99A 2OPPB 2R8HA 4LF4F 4FKXA 1RCOB 1S1TA 2DNRA 2JEIA 3HMJG 4MFBB 5IOLA 2VBXA 3KJVA 1W7WA 1CULA 1YLXA 1MROB 2R2SA 4K4TA 2OJ3A 1RUSA 2GIFA 2GMJA 2YNFB 2DGOA 2DY1A 4DV4F 2CQ1A 2DB1A 4CNZA 2APOA 4Y2IA 5F0UA 2BE9B 3GV7B 1S57A 4OX9F 4JI7F 1HNIB 1X8DA 3SCKE 4Q45A 2CPIA 3MEGB 2AD9A 3RJMB 5A8KB 2DNZA 4B9VA 2GHPA 3M8PB 3SXLA 3TUPA 1F0XA 2OPPA 2RU9A 4FBTA 1HKAA 4WWSA 2VB6A 4C11A 3I0RA 5KT6A 3IC1A 2W2NP 2ZITA 4HH0A 2HSEB 3H2VE 4ANDA 2XULA 1ICEB 3J80U 4DLGA 1MN9A 2CJYB 2KT5A 2UUCJ 4QOTA 3D0HE 3N5FA 4CTAB 4ED5A 4CO1A 1SH2A 1N32F 3CPWR 1J2VA 4DL4A 3QGPA 1N34F 3AOCA 5EX0A 3H4BA 3CCUS 2B9YA 4KH1B 4WFYA 5CCLA 2MKIA 3NMAA 2VICA 4ZLPA 1HW9A 3T9NA 2BM1A 3CULA 4D3GA 1FXDA 1O5JA 3QPIA 2CRLA 1SKRA 4ZLJA 4DZ6A 1P27B 4DR5F 4QU7A 3HSDA 1W26A 4P9SA 3TJ9A 4K4XA 3MM6A 3PW4A 1FKOA 1JLEA 4KTQA 4MKVA 2OEMA 5M2RA 3RAXA 1FDAA 3EDRB 1RHKB 3BS9A 4YB1P 3FEZA 3NWGA 2HURA 2ZBCA 3FK4A 4IQMA 2O67A 2M0GB 3U1NA 2AQ4A 1A9NB 1IVZA 1M0SA 1RHMB 1TUWA 2HS4A 4I7FB 2AF6A 2RB7A 4ELUA 4L6V3 2ZBPA 3C15A 4RZRA 2Q66A 4TNOA 5B0EA 3PW5A 2RHSB 3P5TL 4AYBD 3SYZA 1MSWD 2RKIA 2KTQA 2ACYA 3MCNA 4F4AA 3CD7A 2VJUA 3FZ2A 1R8PA 1G6BA 4RW9B 3H7HB 1WC1A 4OX6A 4X62F 2G0JA 1JMTA 2M3DA 1LK5A 2PN6A 5DETA 2HW3A 2CNLB 3GFZA 2NQPA 1XC9A 4WXWA 5HI7A 1PC5A 3DMJA 4C8YA 2ZVSA 2GIRA 3UO0A 5H1SV 4ZN1A 3SCJE 2YWFA 2IA0A 4LIWA 4MIAA 1JLGA 5DLGA 2BYCA 2RU3A 3Q8QB 3MFHA 2DRAA 5CABA 1FJ7A 1RYSA 4XAKA 1SV5A 2DNHA 2F9JA 3TZXA 4NLYA 5AXMA 1H74A 1HHSA 3IRXA 3JSBA 2B7BB 3CDWA 2HHWA 1NKCA 1EETB 2AX0A 2BJ7A 2DHSA 4X4SA 2HIYA 5JVGQ 3ADAC 5HJXA 2DY9A 4O0IA 2OH2A 2CDQA 3DLGA 5HMXA 3OUYB 4X4PA 2HMIB 3Q2SC 3FMWA 2AKWB 2WONB 3D6MB 4F25A 1TELA 3ITHB 2N7CA 3M8SA 2CVIA 3GV8B 2R8IA 1MLAA 2YNFA 3DHXA 1Y00A 1E6YB 3QJJA 3V4MA 2KFZA 4LRFA 3ZZYA 3RGIA 1HNZF 5KFKA 3HHKA 4H4MB 3OFHA 3LW5C 5A0YB 2ZH7A 2PIIA 3M30A 1F9EB 3W8GA 3QRRA 2EG1A 2HKEA 1R3NA 4PPZA 3DOKA 4ZPCA 5CZXA 2R9LA 1N33J 3EXCX 2WCXA 2B8PA 2YNHB 5DRKA 2D3UA 5M2PA 3ILOA 1RWMB 1MG7A 3R6GB 5MAOA 1UPPA 3OR1A 4XK8C 3H0PA 1NK7A 1IJFB 2GQQA 2MQMA 2W4PA 2C3YA 2CQHA 2CZVC 1CJTB 2MJNA 3CJTA 5A8RB 2VFVA 2LQ9A 2Z2YB 5F0WA 2ASYA 1S1TB 3PJXA 1SJQA 4DG1B 1NJWA 5LXRA 3GIMA 3DFEA 4CH7A 1KVKA 5CHCB 3CD5A 5D77A 3VQSA 3RW7A 1FE0A 2AEMA 2MZRA 2QG9B 4F36A 5AXNA 2GZOA 5THWA 5DGAA 1VQ7S 4DR6J 1VLOA 2XHWA 4CLYA 4FNIA 2DNYA 4UUXA 1N36F 5H9FJ 4PG7A 2BW7A 1MWZA 2DT9A 2NZCA 3MEKA 4HHHA 3HVRA 4WZQA 1TKTB 3AJDA 4ZJOA 2DR9A 2FY8A 2EBEA 1J5EJ 4FYXB 1AFJA 5ETRA 1WACA 4NLPA 2CQ4A 3BYRA 3P3DA 2GA7A 3LAMA 3NS7B 1ZOTA 1XEZA 4MKBA 2KHCA 5ETNA 3AD8C 3AH6A 1NPPA 4Y65A 2VBYA 1OYDA 4DL3A 4LRDA 3TQ1A 4F2SA 1S6QA 1HWJA 2LFVA 2RHQB 1S9GA 1O8BA 2HG4A 3AD9C 3M05A 5CCMA 3CCJS 2HNDA 3AFGA 2Z8QA 2RT3A 4CTAA 2CJXB 4O3QA 2MQPA 3OW2R 4N41A 1UVNA 4DR2F 2JEFA 1Y10A 1CULB 2X51A 3GIKA 2V9WA 1RWXB 3GP9A 2JDJA 5KG7A 4NA1A 4DSEA 3KNAA 4OHYA 4L3NA 2BE2B 5KFSA 2QSWA 2DTJA 2HPUA 2XI3A 1B4SA 1FEEA 5KOWA 1NEEA 2VPXB 3M2UA 1GTEA 2GO8A 3EM1A 5F8HA 2R8KA 3MEGA 1EP4B 1F5BA 3CDEA 1VS3A 2BE7D 4O0NA 4MIBA 4DCJB 4EGLA 5A8KA 1U4BA 1Q81T 2HK3A 3ISNC 4OLPA 4N7TA 3UN5A 2VFSA 3G82B 4DSFA 3JAMY 1VQKS 2HAIA 2FJBB 4S0MA 5ETPA 5K8PA 2J7KA 2KL8A 3GZ7A 3OQ2A 1TL5A 4RWWA 2ALYB 3KG1A 3MZIA 1DQ9A 2CDRB 4GO7X 5EX3A 5KT2A 2EK1A 4N5SA 2I1RA 4LF7J 1VQNS 4QJVA 4C4WA 3V6DB 3KMQA 3LH2S 3QAUA 1NM2A 2O1PA 1EP4A 3ILIA 2HHQA 4ZJLA 3IRWP 3NMRA 1H6KX 2K7KA 4DV5F 4ZPVR 2ILZA 1QJHA 1U26A 5KG1A 3CCLS 2DXFA 2E1PA 1CC7A 2KG1A 4MK7A 2B5JA 1RQ0A 2E7WA 1J5OA 1TL3A 1U6ZA 1VLYA 1SKSA 4H4MA 1WC6A 3NS5A 1RACB 1UWAA 3R5JB 3KHHA 1HFEL 5DG9A 2ZJRQ 2QGFB 2ZKTA 3FEYB 3H5XA 5AE3A 1FKAF 4QIWD 4CM0A 3MCOA 5T14A 2LEBA 1U1OA 3I9ZA 1FI4A 1CJUA 1QM9A 4M94A 2CNOB 3KJNB 3Q8RB 4Y0FA 4NYZA 4YB7A 4ETXA 2H5EA 3PZPA 1Z2LA 2C3MA 4K5SA 3X1LB 2E1MC 2VDHA 1I6JA 1DZ5A 1FE4A 2KM8B 2IJRA 2ROEA 2EVZA 1KOOA 1WC4A 3BF4A 5KG4A 1N52B 1BQXA 2GAHC 1TL7B 5A8WB 1VBYA 2D9PA 3T5HA 3MM8A 4A47A 4A8WA 4F3OA 2CUYA 4OHVA 3RAQA 4IFVB 4JV2A 2QFIA 2CKWA 4LJMA 1HW8A 2O66A 1JB0C 2DEJA 4J9RA 3M2RB 5C2CA 1PIEA 3PEHA 3QNWB 3T1HF 5U47A 2ZEJA 3TVZA 4USWA 3NNHA 5L1IA 4DQPA 3FZBA 3VVUA 5KFAA 2H4YB 5IZHA 1S12A 4EWTA 1X4HA 2YKMA 3H90A 3K17A 4FZVA 5C2GA 4ED1A 2FLNA 4QWEA 3DLBA 4ALZA 3ZTPA 2MKYA 3RRKA 1BWVA 3R9LA 1HR0J 4B3SJ 4KHMA 3BB5A 4Q2LA 3IP0A 3MUTP 4ILMA 2XSFA 3A3OB 2V0NA 1XIQA 2F7VA 3UDCA 3UWTA 5DZ7A 3M2RA 5IFMA 5AT1B 2CNNB 5CYMB 4W92B 1YRUA 1XQIA 2D9OA 4FPIA 4X4QA 3R27A 2W01A 1L3SA 3SDEB 3T1YF 4NLWA 1LKZA 3QIDA 2A3JA 4F4ZA 3V6HA 1T9UA 3MCMA 2N3LA 5KG0A 4FF2A 4A4JA 2G2ZA 2EEYA 4ZIVA 1C1CA 2G13A 1S48A 3BGRA 4DG1A 5F8IA 1HI1A 4AXJA 4BWMA 2FQQB 3ENAA 3TW0A 3G6XA 2XI2A 3UCGA 4LF8J 5L39A 1IBMJ 4NXMF 3PY8A 2LCWA 1FD2A 3OXFA 3M6WA 4QWAA 2MDAA 3IN5A 3OVBA 3KKFA 1FRXA 3OL8A 2LEAA 2QC3A 3CCQS 2ASJA 1S6UA 4XDCA 4HKQA 4F0KA 2CWXA 3OTBA 1LFWA 5HO4A 1I94J 3QBCA 1LXNA 3MEEB 3H59A 2UXDF 1S1VB 3LP0A 4X62J 1WNEA 1HPZA 2HHPA 3ZXWA 4MH8A 2ZM6F 1TAUA 3R7BB 2DRDA 4JI6F 4U95A 5HBMA 5A2QY 1XMOF 1VRUB 3Q24A 1KTQA 1VJWA 2Y1RI 3OBIA 4LFAF 4PAAA 4DV6F 1NBEB 4DV7F 4OYPA 4DWIA 2V8GA 4ITSA 4Q2MA 4ZN3A 3OFEA 2BQUA 3NCRA 2UVUA 3HCXA 1HBOA 2DCLA 4DV3F 2C22A 1SC3B 1U8SA 3DYAB 2RMLA 3H40A 4AQYJ 3CJKA 1YJ9S 4IRDA 4RBUA 4CYUB 3LP2B 2KKHA 2W1BA 3MPUB 4UY8T 1YK9A 2C2NA 2E29A 2Z2LA 4W98A 3RG6A 2IYGA 2AGOA 2ZH6A 3FSIA 1HBMB 3TUZC 2E7XA 1NK0A 4UZBA 1E6VA 4A8YA 1GTHA 5JVHQ 3AQPA 3FRYA 1Q16B 2GCFA 2QT7A 1LWFB 3DLHA 3UCUP 4FF1A 5AE2A 3ZZUA 1RT7B 3HSJA 1S0VA 4IKAA 2BJ8A 2BJ1A 2KJVA 1RT5A 2JFDA 2OEJA 3PACA 5KG3A 4RUHA 2RIJA 4WIIA 3PJWA 2XLJA 4ED3A 2UP1A 1IN0A 2EKNA 1RKIA 1E6VB 2W8LA 2AYBA 2DPIA 2POKA 1IKYA 4UOHA 3WX4A 4DN0A 2G2OA 4G1IA 1GNKA 4KGXB 5GADU 4ZKAA 1EX8A 2Z58B 1DY3A 2K06A 1IBCB 3S7RA 2OD6A 3VGVA 2BR0A 1YBTA 4GKJF 4KKOA 1UWBB 4F04B 2H1YA 1YJRA 4OI3A 2IBKA 2HK2A 4RW4B 1V6HA 2GJIA 2I9SA 1SC4B 3QZ7A 2Z4PA 1FT8A 1RTIA 2WVEA 5JJBA 1S6OA 3DMJB 5I3QA 3IM8A 1LWEA 4ZCMA 5J1EA 4C6AA 1H7WA 1NMEB 3I87A 2AJ2A 3U1LA 5KFBA 1P8GA 1CSJA 1ZPWX 5LMUF 1QSYA 3HDSA 2GAGC 1R8AA 4RWXA 4NCBA 1S9EA 2D1CA 1P9YA 2P9CA 2ZOFA 5B0DA 5KT5A 3MR5A 1U8WA 3CCRS 2QA2A 3K5LA 3RB3A 4AL5A 2GO9A 4ES1A 1KR4A 1YJWS 1TFYA 2YKQA 1F5AA 1VBXA 4IQXA 4FXWA 3NKYA 2LLZA 4OYAA 1QUPA 3PM9A 4ZVSB 2JWNA 1QUVA 5HQLA 3BKFA 5DLFA 1C1BA 2LU2A 3C6UB 4EZ6A 1B99A 1N5TA 3W5XA 2X1FA 2GVDB 2OSRA 1UJ5A 4USUA 3PW7A 4JI8J 4LSNB 4KJIA 1H2VZ 4C8ZA 3R8YA 2AP6A 4MIWA 1DFDA 1KQGB 2M5YA 2YKMB 3N6NA 4PWUA 2IA6A 4JI5F 1U25A 3ILLA 3Q8VA 2BJEA 2P2CB 3MM5A 1KONA 1FDNA 4NYPA 2OI2A 4O44B 2QSFA 4A8QA 4WE1A 4BLGA 4WKRA 4J91A 3QGGA 4U7UK 4DFJA 3ZTOA 2UUAJ 1VDHA 2QYGA 4AUKA 1C1BB 3M8ZA 4QYZK 1YRTA 1FDBA 3UR0A 4XPCA 1H2TZ 5KFQA 3KLFB 1X4CA 3UPFA 3DC2A 5D4LA 2V4RA 4LR7A 5DO2A 4EBEA 4Q0BA 3NBPB 3GILA 3MTJA 1N0UA 2FHJD 4DZDA 4O3RA 1TKDA 1WF2A 1JJHA 3KK3B 4KBIA 4TYAA 1HNWJ 3RZAA 2IAJA 2CVEA 1U02A 3QQCD 4NZ6A 4X64J 3DLKA 5ETVA 5J1NA 3ZC4A 4RUCA 3EVOA 1ZYQA 2XQCA 2YX7A 3CJRA 4HT5A 4F4YA 4KSEB 3LANA 4P75A 3IXQA 2MTLA 3R2DJ 1MMLA 1RT6A 2R3VA 2HBZB 2W7AA 3CJ0A 3QFWA 2QLJB 5B09A 1G3OA 4QR2A 4N8NA 2XB2D 3KNGA 2LEPA 3IR5B 1NK8A 2W2OP 2QLWA 1G7CB 3PXGa 2DHAA 2RS2A 1REGX 3C46A 1VQ6S 2A0FB 1X9WA 4LVNP 3PW2A 2D3OR 1LK7A 3KJFB 3S01A 4EUVA 2W7PA 4Z7YA 3MF5A 1LWCA 1VQSA 1VOMA 4OZ2A 1PG5B 2VDIA 4RL1A 5C5JA 4C2MA 3G6VA 3EGVA 1KP6A 1WC3A 3B8HA 3EJMA 2R2TA 4DF8A 1EQ0A 5L1LA 2FVCA 3N79A 2D3ZA 4I2PA 3VTIA 4IH7A 4UZCA 3FMBA 1YJNS 2FY1A 5KFIA 4FF3A 2D74B 1TKZB 2HQIA 3GJRB 1T05A 4TQRA 4KAIA 2PT0A 2P8IA 4ZP8A 3OVSA 3BGFA 2DPJA 2VG5A 3HHLA 2P5VA 2PFDA 3HKZD 4OIXA 4DR5J 2KXNB 4WTOB 2QX0A 3M4XA 5KTQA 2HS3A 3DHWC 2MZSA 3BPDA 3IAM9 3MEEA 4QZVB 3K8WA 2BBEA 2LQ5A 3IWXA 4HEA9 4I2PB 2RSQA 5IQ6A 3HD2A 1A0OB 3MM7A 3G6YA 3EICA 5I42B 3T1AA 4PUOA 3KUHA 4LQ9A 3V5RA 4DXLA 3KK1B 3HZEA 4ES3A 5HANA 2F4VF 2HZCA 2RQKA 3CIMA 2LDIA 4I68A 1NRKA 3FC9A 4CO4A 2WZ1A 2LYVA 1NZAA 1Q5VA 2ZJPQ 1RWKB 1SQEA 2MEWA 4CO2A 3T5JA 4IFYB 1NLKL 3AOAA 4KH0B 3HVTB 3EZ5A 4ICLB 2G0CA 1SJFA 2Q1LA 5LMNJ 1UEUA 2R7WA 5E3PA 4FVCA 3PRBA 1BGXT 2DNPA 3SI8A 4DR7J 1DAXA 2BKPA 1RAGB 5K8OA 2IIHA 4CP5A 1S1XA 4FXVA 2QL5B 4NCGB 1REVA 4TY8A 4Q5VA 3QJLA 3KDNA 1WOPA 1CJVB 1RCXB 2PEHA 2QN6B 2ZE2B 2UV8G 3Q8YA 3NOCA 3D54A 3MAAB 3O1LA 1GT8A 2B8QA 2H54B 3W62A 1U48A 1VC5A 3R2CJ 1HWKA 3P96A 1TFWA 2I5JA 4C8KA 1N5VA 1OSCA 1A6LA 2NXJA 1HARA 3A8KA 3TOQA 2KFNA 3CE8A 4B9MA 4RBTA 1LQ9A 4D3HA 1EJ7L 3NY0A 3W1YC 2HVZA 2CJ9A 2LVWA 2X3GA 1FA0A 1GX5A 5F8LA 1W2IA 3K59A 2CA9A 3MMBB 2CIMA 5A2QU 3LP1A 1REVB 1XR7A 3EMTA 1TL7A 1AUSL 1SH3A 4FS1A 1RU2A 3ILJA 4K59A 1P6TA 4DR3J 2X1GA 3TZWA 3CC7S 7AT1B 4CO3A 4B17A 4QWCA 4YR3A 4YB6A 1N32J 1RTIB 4LBPA 1PJ5A 5KFLA 3TARA 3SV3A 3W9JA 4CLFA 2FHOB 1URNA 3QIPB 4FBUA 3SBMA 4HTJA 1YTYA 1SH0A 1YJ7A 4PG6A 3PVXA 1ZTWA 1UVJA 1TV6B 4LSLB 1AFIA 2RILA 1LW0B 1WC0A 1RAEB 2V2VA 2KVQE 3PR4A 4I6AA 1RTDB 3D7SB 4UT4A 2CPYA 3KLFA 5F41A 4A8OA 2XSJA 5KFDA 1VRQC 2B0GA 4CLPA 1VQOS 1FX2A 4ZVGA 4C97A 1J27A 1OSDA 1SIWB 1S0MA 4ZHRB 5J2PA 3J81U 4OX8A 2QA4S 2F4VJ 1JWWA 2AGQA 2DGSA 2H5IB 1UCNA 4CQ1A 2FLPA 3WC2A 5GAEI 2HVDA 3D6HB 5IXUA 2AJ4A 1K1SA 1NJXA 1OPZA 1LFPA 3OPKA 1C0TA 2MQ8A 1XNRF 3CD0A 2BV3A 1S49A 2FPHX 4I4BA 4M5NA 3X3UA 4M5DA 4Y2MA 3OL7A 1MWQA 1M5SA 2DGUA 1RTHA 4Q7AA 2JRSA 3MXHP 2GV1A 1S10A 2GC8A 2RNEA 1R6VA 3OXGA 1WEYA 1VRTA 1OMSA 4CIOA 1Y5NB 1RJJA 1VC0A 2WSEC 3OR1B 3T1YJ 3FEXB 3OJUA 4P10A 3UD5A 3M8WA 3OL9A 3W2WA 3BH6B 9ATCB 2OLWA 3KDOA 3TWZA 5HN0A 3T3FA 3ZTRA 2OFHX 1VBKA 3JXOA 3G86A 3LP0B 3BN4A 2M88A 3GU0A 4ECSA 5HLFA 1QVGR 1IBLJ 2ZZMA 4ZVEA 3NL0A 1QDUB 3C14A 2QRRA 4FYYB 4XIUA 3KHGA 3VAFA 4TU9A 2ADBA 3A12A 1D09B 4EK2A 1S1UA 3BO3A 4CLKA 4NPOA 5ETTA 2HHUA 2KN4A 5E7OB 1RLCL 2ACMA 3RBZA 3M6UA 1FDDA 2V4JB 2E66A 4KB7A 2EC2A 2R42A 1HYSB 3DOLB 3MAAA 2AJ0A 4WYLA 2C3OA 2HQGA 3IG1B 3GQCA 2XG8A 2CPFA 1GXLA 5ETMA 3ZZOA 1VIXA 3E01A 1TQLA 2VFTA 3DLLQ 3B54A 5GVQA 5HP1B 1GAOA 2NUHA 1WOOA 4JV5J 1WWHA 2DGXA 4J9KA 1N5SA 1WG4A 3LUYA 3R7SB 1VJQA 1R8BA 5T7LA 2QA1A 1TKZA 2H3EB 4W4MA 5JXSA 4NMXA 1WD6A 4OZ3A 2E5IA 3DCAA 3WBZA 2HFVA 3BGOP 5MLCV 2G4BA 2QLBB 3DRSA 4Y3CA 4G1QB 4DPWA 1HI8A 3BO2A 5KFRA 2UUBF 1L3VA 4USJC 3BSCA 1RT4A 1D9DA 2VG6A 4BCAA 1KD1T 2OPQA 3HHDA 2C42A 3NOGA 3QIPA 3KUEA 2W4CA 4WP9A 2J0SD 1TL1A 4G3IA 5K14B 2I6WA 1PAEX 4JP8A 3UE2A 2E5GA 3BH7B 3OD2A 4ED6A 3CF5Q 5KT7A 3KLGB 3GB0A 4I7FA 3GV5B 1TL4A 4IFVA 5BYSA 1PILA 4RU2A 4YR2A 4RJVA 3EX7B 3TR5A 3N6LA 2QL7B 4DV2F 2GHWA 4PWDB 1YJUA 2FZGB 2VG6B 3VAMA 4KRWA 3KLEA 7FD1A 1TK5A 3Q22A 3PW0A 3ITHA 1X0PA 2YWEA 3DDKA 1U1MA 2IM1A 1S1WA 4UTGA 1PYOB 5CYQA 4C98A 2BRKA 4V19X 5B0AA 1BE4A 4NRTA 3SQGB 2YH1A 9RUBA 4TY8B 2XNQA 4QW8A 2P9EA 4DR4J 5D4PA 4HLBA 3AJ1A 3MCSA 4U96A 2XMJA 4AT1B 5IV3A 1HD1A 2E7VA 4GMKA 1RISA 3QT8A 4AL6A 2XY7A 4WZMA 1LW2A 1IUJA 1C0UA 1K47A 1NDPA 3NCPA 4OI4A 1YQHA 1SL1A 2FHKA 4RW8A 2R7RA 2B56A 1FF2A 2RE1A 4DL6A 3SIPB 4R0EA 1HQ2A 2F8EX 3SCLE 3GYXB 3MM8B 2D3O1 1FRLA 4J37A 4O4GA 2BANA 4Y2AA 4KFBB 3FVYA 1IQZA 3GR0A 3SQGA 2YVSA 3T9ZA 2AEJA 1N6QB 1T7PA 5BR8F 2XHCA 3TA1A 3FGVA 3ZZRA 5LXYA 3BREA 2ZUGA 4QIFA 3PIPQ 1S9FA 2BMBA 1CBKA 2NSCA 2IY5B 2GX8A 4DS4A 3CJQA 4DPXA 4ED7A 3AQOA 1IM6A 3CMQA 3NLCA 2OSQA 1S72S 3VALA 2VQEJ 4TKTA 3ICLA 2X1BA 2XGQA 3RTVA 1QAIA 3CGIA 1CVJA 2FC9A 3LWMA 4LF1A 3G8TA 1JXLA 1FJGJ 1T9YA 2WAQD 3MUVP 1VQ9S 5L8RC 4NE9C 2VPWB 3PO4A 2V8HA 4CWBA 4DU7A 3KLVA 3H5YA 2HHHJ 3BO4A 2EBGA 4LF5F 4Y00A 2CPJA 2ILYA 2ZVIA 3JYTB 4JYAJ 2K2PA 2OTLS 1YITS 2EWHA 4F67A 2F8MA 3BSAA 2EFQA 1FWPA 2E5JA 3W7BA 1T3NA 1UVMA 1NKBA 4C0HA 5DQHA 2NXNA 3N28A 3VVTA 4B9LA 3TI0A 2CAJA 1QSSA 3POTB 3D0GE 2GMHA 3LP2A 3C14B 4NLQA 4DX5A 2C28A 4ECUA 5IT9U 1RT1B 3Q2TC 4R0JA 1OY6A 1TTHB 1ZZFA 3VV2B 2D69A 4KGMA 3MECA 3AODA 4C11B 2VU5A 3US5A 3QWPA 2OD4A 4CLWA 3V6KA 1DQ8A 1Y5LB 2UU9F 2XTJP 1Q4RA 1SXLA 3H20A 5ETOA 1U0SA 4DCOB 4AQYF 5KG6A 1NHUA 2BEFA 4NLTA 1GMUA 1R31A 1URRA 4FYWB 2VPYB 2XBPA 4USHA 1PJ6A 1RHRB 3CCZA 2ZHBA 1RP5A 8RUCA 3HFKA 3THTA 3C19A 2SXLA 2Q6CA 3D9BA 3G4SS 3CCVS 2MKJA 4EYIB 4ZLLA 1PBUA 2J0XA 3C16B 4HACA 3T6BA 4F3MA 3Q0AA 2R8GA 3FRZA 2ZDPA 5K5MA 1FNMA 2AJQA 3CCES 2Z56B 3KK1A 1HBOB 1MWYA 5LMNF 4DSLA 1M5KC 2CJAA 4M5KA 1TMJA 3D1OA 2B51A 3L9ZA 3DRSB 4KO0A 4FNHA 1XWLA 3J7YU 1NSPA 2QEXS 3PX0A 3VF0B 1FRMA 3PFOA 4DV1J 2ZZTA 1DHMA 4L75A 3DI6A 1YGYA 1R43A 1NPRA 1UPMB 1X4AA 2HVEA 2M9KA 2H5JB 1CG2A 2DBBA 3N4WA 2KRRA 4RU9A 1U49A 1RWWB 4FN5A 4YY3F 4MK9A 1C0UB 4OZJA 4M5IA 3OVAA 3JSMA 3ZZTA 3G9CA 4EFAC 2E9RX 5K14A 1ZBTA 2HBYB 4P52A 4NXMJ 2Y8YA 1OWXA 4PKDB 4OX9J 1V3SA 5DDRC 4HI1A 1L3TA 3HXMA 5D3GB 1UVIA 3ZFVA 4DCPB 2MZ1A 3G8QA 3QT5A 4P73A 2KB2A 4FYVB 1JJ2R 1U1PA 4FXDA 1WHVA 5F9LA 1WHWA 4WFNQ 1UEKA 3WZ0A 1Q82T 2FVSA 2M8HA 4O3SA 4TLRA 4ZVFA 4FS2A 3MOJB 1JXEA 1KWMA 3DOMA 1ZS6A 1U2FA 1WDDA 2H51B 2YPZA 4G1QA 4WBFA 2K7JA 3D3CJ 3J81j 2CYYA 1JX4A 1EIYB 2AHOB 3CSKA 1VR6A 4XPEA 4NWBA 4OI1A 4LF4J 5SZTA 2ZH3A 1JJCB 1H72C 4LSZB 5B7WA 1SV5B 4C8NA 4JUZA 4USMA 2MQLA 1HNVB 2DO4A 1HMVA 1HD0A 3AHPA 3P5BP 4RNHA 3W2VA 2KO1A 6FD1A 2W8KA 4LFAJ 2NPFA 1U45A 4ZP6A 2E9TA 5HAOA 2I8EA 1ZM9A 3J7Z5 1Q5YA 1EKSA 3W61A 3JSYA 3A3NB 3JTOA 5HVHA 3D6FB 2ZFHA 2UUTA 2FJEB 3DOMB 3EUNA 2U2FA 4H54A 1FCAA 2FDNA 5EGYA 4LT6A 2OTJS 1IM4A 2O3DA 3DKDA 3PDNA 3KK3A 1ZETA 3M6XA 3TEGA 2XLKA 3KLEB 4J9OA 2NUUG 1B7FA 3BV8A 2KVIA 3NCQA 3QRQA 2FJXA 4DR3F 2ZWPA 4LUBA 4DPUA 2G0IA 1R0CB 4K2JA 1HI0P 5F8NA 1WF1A 5KFFA 2IC3B 2HIQA 2WOMA 2HEKA 3N5BA 2E5LF 4GKKJ 1HHTP 3C3LA 3TEHB 4LR8A 3KHLA 3EPIA 3UFCX 4B9NA 3DRRA 1UVLA 2U1AA 2UXCF 3HHEA 4DQRA 5A8RA 2CPHA 1N0VC 2RS8A 2XC9A 1IKVA 3I4HX 2VODA 4P2MA 1FHTA 2B4VA 4C3MA 4P71A 4M5DB 1NHKL 2GGPA 3VQTA 4Q0BB 1N8RT 2FVQA 2BUNA 4NLUA 1RGVA 4HTIA 3HHLC 3NBPA 1TMMA 4F4XA 2EXUA 1KKHA 2B43A 1RAAB 2FLOA 2WHOA 4LF8F 5J2NB 4CO5A 2W24A 3EGNA 3BR9A 4MFBA 4C7QA 3L4BC 1XMQJ 4DR2J 4KV8B 4LMZA 2NLWA 2ZC4A 5H9FK 5HVFA 2BACA 1JLQB 2L3MA 3OSNA 1RTZA 2JX2A 1JKHB 2RH3A 4DSIA 5CD4A 5C42A 4IG3A 1WEZA 2XS2A 3FBBA 1FKOB 5D4OA 4N56A 1GQEA 3ELHA 3MR3A 3HLUA
chains in the Genus database with same CATH topology
2C1EB 2H54B 4ZVSB 2XYGB 2HBRB 2XYPB 3GJTB 3GJQB 2HBQB 3RJMB 1RHQB 1RWNB 2CNNB 2P2CB 2H65B 2XZDB 2H5JB 1ICEB 2Y1LB 1RWWB 2CJYB 3IBFB 3R6LB 2FQQB 2QL7B 3P4UB 2HBYB 3NS7B 1RWMB 4DCPB 1PYOB 3IBCB 1I3OB 2QLFB 2CJXB 1RHJB 1BMQB 2DKOB 1RWXB 2H51B 4ZVQB 3EDRB 2XZTB 1RHKB 1QTNB 1PAUB 3R7BB 4LSZB 1RHMB 2HBZB 3SIPB 2QLJB 2H5IB 2C2KB 4DCJB 1RWOB 2QL9B 3D6HB 3GJSB 3KJQB 5IC4B 3KJFB 1RHUB 3D6FB 3P45B 4ZVUB 1SC3B 4ZVTB 4JB8B 1RWPB 2C2OB 2CNKB 2CDRB 4ZVOB 2CNLB 3GJRB 5K20B 2C2ZB 1QDUB 3R5JB 4ZVRB 2H4WB 3R7NB 2CNOB 3KJNB 3D6MB 1IBCB 2XYHB 1RWKB 1SC4B 1RWVB 2H48B 4DCOB 3R7SB 1NMEB 1SC1B 1RE1B 1F9EB 5IC6B 3QNWB 1GFWB 1RHRB 4ZVPB 2QL5B 1I51B 2C2MB 3EDQB 2H4YB 2QLBB 3R6GB 2Y0BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1E B;  2H54 B;  4ZVS B;  2XYG B;  2HBR B;  2XYP B;  3GJT B;  3GJQ B;  2HBQ B;  3RJM B;  1RHQ B;  1RWN B;  2CNN B;  2P2C B;  2H65 B;  2XZD B;  2H5J B;  1ICE B;  2Y1L B;  1RWW B;  2CJY B;  3IBF B;  3R6L B;  2FQQ B;  2QL7 B;  3P4U B;  2HBY B;  3NS7 B;  1RWM B;  4DCP B;  1PYO B;  3IBC B;  1I3O B;  2QLF B;  2CJX B;  1RHJ B;  1BMQ B;  2DKO B;  1RWX B;  2H51 B;  4ZVQ B;  3EDR B;  2XZT B;  1RHK B;  1QTN B;  1PAU B;  3R7B B;  4LSZ B;  1RHM B;  2HBZ B;  3SIP B;  2QLJ B;  2H5I B;  2C2K B;  4DCJ B;  1RWO B;  2QL9 B;  3D6H B;  3GJS B;  3KJQ B;  5IC4 B;  3KJF B;  1RHU B;  3D6F B;  3P45 B;  4ZVU B;  1SC3 B;  4ZVT B;  4JB8 B;  1RWP B;  2C2O B;  2CNK B;  2CDR B;  4ZVO B;  2CNL B;  3GJR B;  5K20 B;  2C2Z B;  1QDU B;  3R5J B;  4ZVR B;  2H4W B;  3R7N B;  2CNO B;  3KJN B;  3D6M B;  1IBC B;  2XYH B;  1RWK B;  1SC4 B;  1RWV B;  2H48 B;  4DCO B;  3R7S B;  1NME B;  1SC1 B;  1RE1 B;  1F9E B;  5IC6 B;  3QNW B;  1GFW B;  1RHR B;  4ZVP B;  2QL5 B;  1I51 B;  2C2M B;  3EDQ B;  2H4Y B;  2QLB B;  3R6G B;  2Y0B B; 
#chains in the Genus database with same CATH topology
 1IQT A;  3LPE A;  3F0N A;  1B0P A;  1QAY A;  3UD3 P;  3IR7 B;  4ZIW A;  5H9E J;  3PV8 A;  3MM9 A;  3E8O A;  5AXK A;  5I3P A;  3J81 Y;  1DUR A;  2WSC C;  5E3Q A;  4A8X A;  2YKN A;  2G2Y A;  1V3R A;  3GJQ B;  3J7A 1;  3E2E A;  1Q53 A;  2L08 A;  1RHQ B;  1SUQ B;  5F9N A;  1SJ1 A;  3NAI A;  3QFH A;  3TX0 A;  2NYI A;  4DS5 A;  4F4K A;  1C4C A;  3EGW B;  1YDL A;  5IM0 A;  1NDK A;  2XMK A;  3OTD A;  5L38 A;  2HFZ A;  4MJK A;  3VGS A;  1M90 T;  2H65 B;  1VRU A;  3JQM A;  2YNG A;  1MU2 B;  3LPY A;  2RQ4 A;  2KDO A;  1LOU A;  2PGC A;  1P9Q C;  1UJ6 A;  3MEC B;  1N56 A;  4ZJQ A;  1GMV A;  2ASD A;  2DR6 A;  5JUM A;  4FVM A;  2DIT A;  1DRZ A;  2UXC J;  1LV5 A;  3R5B A;  1FK9 A;  2V2Q A;  1QAX A;  2YKN B;  1HNI A;  2YPY A;  3BKT A;  2N4C A;  2GVD A;  3IA0 A;  5J2M B;  1L3U A;  3IBC B;  1HNW F;  4ZPW R;  4IH6 A;  2QYC A;  4EI2 A;  1TAQ A;  4DR6 F;  2VG7 B;  3AOB A;  1T94 A;  3CTR A;  2W2M P;  5FLX Y;  1NJY A;  1F1B B;  3DLE A;  3M8Q A;  2QLX A;  1JLF B;  3R1H A;  4ZA1 A;  2K8G A;  2VC1 A;  1X4G A;  5LJ5 Y;  4TU8 A;  2FYX A;  2XCA A;  1V9O A;  2GQ2 A;  1VHI A;  3WC0 A;  1MU2 A;  4O44 A;  2IBO A;  3NS6 A;  4PXD A;  5J1E B;  1U1N A;  1TKX A;  1QTN B;  3IRX B;  2VBZ A;  3Q86 A;  3QAE A;  4C8O A;  4LF7 F;  2ZD1 A;  5DQI A;  3LP1 B;  4YP3 A;  2IMW P;  2VFR A;  2RF2 B;  3CIZ A;  4CM2 A;  5HQ8 A;  2ZBQ A;  1NDL A;  3T5L A;  3HK2 A;  1IJE B;  1DBD A;  2NYH A;  3OR2 B;  4QQB A;  4KE5 A;  3M2V B;  3W65 A;  5GAE U;  4TQS A;  5KFT A;  4A8M P;  3D1Q A;  3ETM A;  4RW7 B;  4PR6 A;  3EE3 A;  4OQJ A;  1JLF A;  1U2C A;  1RHU B;  1YJV A;  1IKY B;  4NI2 B;  2MPU A;  2OPR A;  2JFK A;  3DLK B;  4OI2 A;  4C48 A;  1MMD A;  1S7I A;  1CJV A;  2ZE2 A;  1N88 A;  4HT7 A;  5CYQ B;  5I42 A;  1FX4 A;  1YZ7 A;  3GIR A;  1IKV B;  2HQ3 A;  3MPV A;  3PTW A;  4OHX A;  4YEA A;  4ZVO B;  3HM9 A;  1AW0 A;  3MPD A;  4U7C A;  4M95 A;  3PO5 A;  3T41 A;  2CQI A;  4K50 A;  6AT1 B;  3BGL A;  2L9W A;  3L7U A;  3JS9 A;  2HVH A;  3IFE A;  3RBD A;  3M6V A;  3W8P A;  4ATN A;  5F8J A;  4JI3 F;  1DTT B;  3VAJ A;  1Q7Y T;  1RK8 A;  2IMO A;  4DJB A;  5KFN A;  5KT4 A;  1RU1 A;  5D6G A;  6FDR A;  3KLI B;  4GVB B;  3TAM A;  5J2N A;  3HHN B;  2WB1 D;  2XY5 A;  4NXN F;  2FHJ A;  3CCT A;  2IRY A;  1F5C A;  4QIE A;  5ETS A;  4Y34 A;  3O5T B;  5GAD I;  4USI A;  1T03 A;  2YX4 A;  4QYZ J;  5D0G A;  1RT2 A;  4WK1 A;  2Q3P A;  5LT5 A;  2VQE F;  2IRU A;  2NZ4 A;  3GMG A;  2ROP A;  3CCW A;  4XDD A;  3UQS A;  5F8G A;  4NA3 A;  4DL0 C;  5B08 A;  2AJ1 A;  1RT3 B;  4Y6I A;  2AYG A;  1CEZ A;  4ZPD A;  2P9G A;  2YNH A;  2I2Y A;  3H5U A;  4OYW A;  2WRM A;  2UXB J;  1NK4 A;  2MHE A;  4B3S F;  3SSS A;  4NL5 A;  1CQM A;  2LQB A;  1SL2 A;  4ELV A;  1ARO P;  2XSJ B;  4C3L A;  2V2Z A;  3QYY A;  5BR8 J;  1KLN A;  1JLB B;  5ETL A;  4PPD A;  4I0W A;  2W9B A;  1U47 A;  4OZ5 A;  1SJ4 P;  4ILL A;  2EG2 A;  2HLU A;  4LR9 A;  4RW6 B;  1NHV A;  4URS A;  3BBF A;  1UET A;  3SSQ A;  2MKK A;  1B0T A;  3HHL D;  3WX8 A;  3M9O B;  3TAP A;  4JI4 J;  1YWX A;  3CT9 A;  5E33 A;  4CI0 B;  5EWE A;  4YY3 J;  4QYR A;  4G6V B;  1QLN A;  3LGM A;  2R8J A;  3FNN A;  2GJF A;  3DU6 A;  2V4J A;  4WYW A;  4K4W A;  2DD8 S;  3JSR A;  1IKX B;  5F8M A;  3DRR B;  3H2L A;  5EHH A;  3I55 S;  1EZZ B;  1RTH B;  3JTN A;  4PEO A;  1JNZ B;  3W9H A;  2HRT A;  1CS4 A;  2CQG A;  2HGM A;  4XTT A;  3PEJ A;  4X65 J;  4ZK7 M;  2OPS A;  3CED A;  4DUZ F;  3ZZ0 A;  2YX1 A;  1H38 A;  4QIV A;  1LWX A;  2JHE A;  4A48 A;  1RTJ B;  2DNN A;  3D4J A;  3L95 X;  2JLE A;  4LRC A;  4J9M A;  4ETZ A;  2ERR A;  4W90 B;  1M1G A;  2GVZ B;  3LQV A;  5IT4 A;  4ZHR A;  2DHG A;  1BQN A;  3LTO A;  2ZD1 B;  2BXJ A;  4U9R A;  2DIS A;  4O3N A;  3P4U B;  1Y3J A;  5ADZ A;  4ZIT A;  2Y1J A;  1N34 J;  5F3Z A;  1S77 D;  4JI6 J;  4E2F B;  3GPA A;  1XK8 A;  3G96 A;  3S8S A;  3ZO7 A;  4JI3 J;  4I6W A;  1I3O B;  1VYA A;  1XER A;  1VMB A;  2VD3 A;  3RRG A;  1FO1 A;  1SPB P;  2MKS A;  2RKI B;  5C42 B;  2Y1I A;  2UU9 J;  1RHJ B;  4BDP A;  3BGU A;  4PQA A;  1GH8 A;  2PFF B;  1FER A;  2EFP A;  1UFK A;  2M4M A;  2YNI A;  4I69 A;  5D0E A;  2HAF A;  4HHJ A;  3CD6 S;  2HVI A;  2J6U A;  2DJW A;  1DLO A;  4TU7 A;  1MN7 A;  1VK3 A;  4QR0 A;  1RBL A;  3AB4 B;  3W63 A;  3R5D A;  1FFS B;  2K1R A;  2J76 E;  2Z0G A;  1L5U A;  1HQU B;  4PCQ A;  5B0B A;  2CPZ A;  1XMQ F;  1Y7P A;  4IOC Q;  4DF4 A;  3MMJ A;  2J8A A;  3KK2 B;  2VQF J;  1TUV A;  4OJ3 A;  1N5Y A;  3V6D A;  1T8E A;  1UTA A;  4OX7 A;  4ILR A;  4OYZ A;  4KHP J;  3TO8 A;  2YNI B;  3P45 B;  3Q89 A;  1SJ3 P;  2BOP A;  3SMZ A;  1Q8I A;  2GS8 A;  2C3P A;  3CJS A;  3GFY A;  5D3G A;  1RWP B;  4KR0 B;  2C2O B;  2VOP A;  1RAB B;  1BXN A;  2C2D A;  4DPO A;  1F6T A;  2HNY B;  3OR2 A;  1TL3 B;  2MQN A;  4G65 A;  1Q86 T;  4RW7 A;  1KQS R;  1H0H B;  1XMO J;  1S5Z A;  2ZWO A;  3PYG A;  4CH0 S;  1FVQ A;  2GIQ A;  4PXC A;  1ZM2 A;  2WSF C;  2OFG X;  2GW8 A;  5LSR A;  1BUX A;  3DXS X;  4J7C A;  4EO8 A;  2BJ3 A;  3DRP A;  3QMQ A;  4P6Q A;  4NOH A;  3EVM A;  3Q8U A;  1SKU B;  1H7X A;  4M5L A;  4HL9 A;  2HWT A;  2V69 A;  4RNO A;  1YJT A;  1HWI A;  5DS7 A;  4U6P A;  1VQL S;  1LW0 A;  1FWL A;  1RTD A;  4K4Z A;  4IOA Q;  5D15 A;  2XMA A;  1C4A A;  1WG5 A;  2WVF A;  1EQM A;  4LRE A;  3ENW A;  4NAS A;  3TNV A;  2HQF A;  2BW2 A;  5C7P A;  3TX8 A;  4R5P B;  3BSN A;  2DHH A;  4O4R A;  2W9A A;  4UQG A;  4ER8 A;  4DHV A;  4B3T J;  4V19 J;  4ES2 A;  2QV6 A;  5FD1 A;  4F7V A;  4RNM A;  3DM2 A;  1NH8 A;  3UDE A;  2ZC3 A;  2V34 A;  2H48 B;  5LM7 E;  4U67 Q;  1T95 A;  2XM3 A;  1K9M T;  2Y9H A;  1BC6 A;  1Q1K A;  3OXL A;  2BA9 A;  1TP7 A;  1R6Y A;  5DDQ C;  1DTQ A;  1X4B A;  2B4O A;  4JI5 J;  3P6Y C;  4B3R J;  4ZVP B;  4FDF A;  5IS2 A;  2XO7 A;  4B3R F;  2RUG A;  1U1L A;  4LF6 F;  5A76 A;  2IJN A;  1GX6 A;  2V5H G;  4C0B A;  3LAL A;  2VC0 A;  1GMW A;  3HVA A;  4R5P A;  4MMO A;  2UUB J;  3RR7 A;  1E6Y A;  2WBM A;  1NSA A;  3FJ2 A;  4CDI A;  2ATC B;  4RLE A;  3R5G A;  4I6Y A;  5I4M A;  2WBR A;  3W66 A;  1WSR A;  1R0B G;  1AT1 B;  1S1W B;  5D4N A;  3UVJ A;  2QIF A;  3KJV B;  3AD7 C;  3RRH A;  2W7O A;  1IKW A;  3MTK A;  3O3L A;  3BQ0 A;  3DOK B;  1BY9 A;  1IBK F;  2ZJQ Q;  4JV0 A;  2W9C A;  1O0P A;  1GXU A;  2C2R A;  1GXT A;  1D9A A;  2ROG A;  1CJK B;  3MAQ A;  1R0A B;  1X4D A;  3R6L B;  4PG4 A;  5KFU A;  4F0M A;  1WHX A;  4PYA A;  1UAW A;  3ET6 A;  3G71 S;  4E0D A;  4UW2 A;  3H5S A;  4JI8 F;  3TAN A;  5B0F A;  3GII A;  5IWA J;  4GKJ J;  3THP A;  3IG1 A;  5IWA F;  2B4U A;  5B0G A;  3UNY A;  4LFC F;  1H2U X;  1YRX A;  1N5Y B;  4LQ3 A;  1NXI A;  1U09 A;  5IT9 Y;  1PYS B;  2VA2 A;  2OHD A;  4WXO A;  1BQN B;  1X5P A;  2J8S A;  4PUO B;  3MED B;  1X4F A;  4HHU A;  4NLO A;  2XMM A;  2K3K A;  4DL2 A;  5KFJ A;  2XZT B;  2PI4 A;  4KGK A;  1KOH A;  2IDE A;  1OPI A;  1X5O A;  2ADC A;  4V1A k;  2HHT A;  1QE1 A;  1Y9O A;  5AJ3 J;  4ECT A;  1EAR A;  2P6T A;  2UUW A;  1G2E A;  1AZS A;  2EFG A;  2CPD A;  3A1Y G;  3NG8 A;  4OLO A;  2DGV A;  2LP4 A;  4BC9 A;  1RWO B;  2NRE A;  4N8O A;  5DG8 A;  3L7P A;  4JI0 J;  1DLO B;  2F40 A;  3ZTS A;  5C24 B;  4JI0 F;  1C2P A;  3OLB A;  3RBE A;  2AT1 B;  1NH7 A;  1RT4 B;  3NGK A;  4EYH B;  3K58 A;  1XR5 A;  4WFB Q;  3PR5 B;  1TVR B;  2RQC A;  1YG0 A;  3BR8 A;  4U8V A;  4ZVT B;  3F41 A;  4X4O A;  4LRB A;  4DR1 F;  2VON A;  2FGC A;  4PQU A;  1KSP A;  2YKP A;  4DR1 J;  3AA9 A;  4G1P A;  2CFX A;  4JI4 F;  1V5I B;  1VI7 A;  1X4E A;  3V81 A;  1R7I A;  3CJ3 A;  3NGT A;  4YDX A;  3NGD A;  4B9T A;  1ZA1 B;  4M63 A;  3ZNU A;  2BKN A;  3R5A A;  3MR6 A;  4J9S A;  1YZ6 A;  1B7Y B;  3ENV A;  2WTF A;  1U24 A;  1VQM S;  4IG0 B;  4QIG A;  5L1K A;  2HHH F;  2HZV A;  2JEJ A;  4OHZ A;  4J9Q A;  4WK3 A;  1FNX H;  1KN6 A;  4YN3 B;  2JL9 A;  3FSX A;  3CCS S;  2DVI A;  1X9S A;  3SFG A;  4ED0 A;  3H98 A;  3AA8 A;  4NLX A;  2QE5 A;  3EZU A;  3UN3 A;  2J9D A;  3A4T A;  2FTR A;  1FFG B;  1S79 A;  1WI6 A;  2LXF A;  3BPS P;  3WHI A;  3D67 A;  4EMD A;  4YHH F;  3AJ2 A;  3PX6 A;  3N6M A;  2HNZ B;  1ZAX A;  4JI1 F;  1OIA A;  2IFX A;  4R8U A;  1WF0 A;  3VAI A;  4JI1 J;  5BYR A;  2FUG 9;  4KHR A;  1SI9 A;  3PHE A;  2VHG A;  5CH7 B;  3NP5 A;  2E1A A;  5EUH A;  4DX6 A;  3IR6 B;  5KAK A;  4DV6 J;  4PAB A;  1SQG A;  2WVD A;  2AYE A;  3UR3 C;  1B64 A;  2JNJ A;  3HPO A;  3HJV A;  3KLH A;  2OML A;  3GIJ A;  2DR8 A;  5C25 A;  1SC6 A;  2Z2Z A;  3PJ9 A;  2BZ2 A;  5KFV A;  5GAH I;  3PYE A;  2JLG A;  3LO3 A;  4LVO P;  8ATC B;  3I96 A;  4X84 A;  4DI6 A;  2MGZ A;  3E51 A;  3NXZ A;  4CLT A;  2B6A A;  2IAJ B;  2DH9 A;  4ED2 A;  3T1H J;  4ECY A;  2BVZ A;  2FJV A;  3BEG B;  4E8U A;  2J5A A;  4MT1 A;  2CG8 A;  2HYI B;  1UWB A;  1M5H A;  1TV6 A;  2DIU A;  2JH3 A;  4LSL A;  3TA0 A;  2XYG B;  4WU2 A;  3ET6 B;  3QGI A;  2EPI A;  2XZW A;  1RAF B;  3QLH A;  5KG2 A;  1D8Y A;  1FRK A;  3ETO A;  4DQI A;  2XYP B;  2YWH A;  3UI3 A;  2FGO A;  5DJB A;  1VQ8 S;  2JEG A;  4ECV A;  2V8D A;  2HBQ B;  1EET A;  1CQN A;  3PKY A;  1WTB A;  3U1M A;  4OJG A;  2MGZ B;  4X4T A;  2EFO A;  4F26 A;  3D68 A;  1O51 A;  5CQG A;  3RB0 A;  2ASL A;  4ECW A;  4HH1 A;  5HL7 Q;  1BWE A;  3JQJ A;  2DHX A;  4QR1 A;  3GE9 A;  4TLQ A;  4QPX A;  3BQ1 A;  1MW7 A;  2A18 A;  3M9N B;  3FQK A;  3W5Z A;  4ID8 A;  3SV4 A;  3GYG A;  2ZKU A;  4JV1 A;  2LXI A;  1HPZ B;  2CXE A;  4OV6 A;  3QLH B;  2HWH A;  1H98 A;  2UV8 A;  3K8V A;  1X9M A;  1FTC A;  5E3R A;  1T05 B;  4YQW A;  4M5H A;  1R8C A;  2YQ1 A;  5D0H A;  3ZZZ A;  3BDE A;  2GFF A;  4ELT A;  3O8W A;  2YQ3 A;  3GCW P;  2EC0 A;  2J7W A;  1QTM A;  2CZ9 A;  2N7Y A;  2AZ3 A;  1DAR A;  5HSP A;  5FLX U;  2UXD J;  5DM7 Q;  1N4L A;  5A6P A;  4DQS A;  1YSJ A;  4CH1 A;  4K0K J;  1Q8K A;  2YBV A;  3L09 A;  5DZ6 A;  4P2X A;  4MKY A;  2OGU A;  3CNQ P;  3J7Y I;  2VH7 A;  4OJ1 A;  3UVJ B;  1OYE A;  3LOU A;  2GQC A;  4DPT A;  1RTJ A;  4PRF A;  4H4K C;  1RA7 A;  2VKZ G;  2LA6 A;  1IR1 A;  4AXI A;  2V50 A;  2YTC A;  1HWL A;  3FSY A;  3V2U C;  2QFJ A;  2OEL A;  1K1Q A;  1Y4Z B;  3FUY A;  3BZQ A;  1K8A T;  2DRB A;  1ITP A;  3EXY A;  3THV A;  4JI7 J;  2N4D A;  2LXU A;  1HHQ A;  1FK9 B;  1F9H A;  2MMY A;  4LBH A;  4ZPT R;  3ISZ A;  4JB8 B;  5SUH A;  3DOL A;  2NXU A;  3DDN A;  4CLZ A;  5EDW A;  4NLV A;  2XMV A;  4KC5 A;  3UDV A;  4EU0 A;  3I32 A;  5AXL A;  4X66 F;  2R7O A;  1PCA A;  2AX1 A;  1WDT A;  2NR0 A;  4J5O A;  4NCG A;  3W2V B;  5KT3 A;  2MXY A;  5HJY A;  2AEF A;  1JK9 B;  1Z2Z A;  4NRU A;  3MD1 A;  4GC7 A;  3T19 A;  1HA1 A;  4AL7 A;  4GVL A;  1WEX A;  3TZZ A;  4KHP F;  3A3P B;  1GK8 A;  4J90 A;  4OYX A;  3ZZP A;  4CYU A;  2RRB A;  1K0T A;  2VJV A;  4NLS A;  1T9W A;  3OT9 A;  4QCL A;  3QWU A;  4JBC A;  2YXL A;  4KIA A;  5B0C A;  2J9C A;  3MMA A;  3P49 B;  2CPX A;  4IH5 A;  1NUE A;  1T9V A;  1HBM A;  4ECZ A;  2HQD A;  2IVY A;  4OZL A;  3K0J A;  4LFB J;  2OPQ B;  2B7C B;  2CQ0 A;  2FB0 A;  3D6T B;  3PCO B;  5LL6 d;  3WDO A;  2I38 A;  2ZUA A;  2M70 A;  4YDD B;  4CT9 A;  3MGJ A;  4YR0 A;  4QW9 A;  5C24 A;  3KMS A;  1VGY A;  3O2I A;  3G2X A;  5J2M A;  3HX9 A;  1RAD B;  2MZT A;  2A2D A;  1SVD A;  5HVG A;  2XY6 A;  3RB6 A;  2IC3 A;  1HMV B;  3DGP B;  2ZH1 A;  2Z2M A;  1NDC A;  4K5R A;  2ZBI A;  3I31 A;  3OHA A;  3DI6 B;  3HFV A;  1KQF B;  3D0I E;  3RBX A;  1HWU A;  3HJF A;  2IYI A;  2HRY A;  3M1V B;  2JZ5 A;  1RB0 A;  1S59 A;  1B3T A;  5CYM A;  4P2S A;  3V81 B;  3EZO A;  5IC6 B;  2GJ2 A;  3K5M A;  2FD2 A;  3Q8S B;  1XN9 A;  1L3K A;  3DN9 A;  3CCM S;  3OFF A;  4OL8 A;  3PHT A;  5G4D A;  5EWG A;  2LA4 A;  5EN1 A;  2Y8W A;  3QJP A;  1D0E A;  2ZBR A;  4ZCK A;  2BOA A;  3OSP A;  1K73 T;  2OUG A;  1KC8 T;  1V5V A;  1FXR A;  2RUS A;  4P2F A;  3TA2 A;  3D5M A;  3HSG A;  2MY8 A;  3TVY A;  3VGU A;  1QAJ A;  1LEO A;  4K4V A;  4PG5 A;  5E3C A;  4JV5 F;  4OI0 A;  2F9D A;  1YHQ S;  3D28 A;  1NJI T;  3LF0 A;  2RDD A;  2OPR B;  2N82 B;  1X5S A;  1Q7L B;  4B9S A;  3TVK A;  4H4K A;  4RW8 B;  2CQ2 A;  1C0T B;  4PWW A;  1FFW B;  2A2C A;  2DNO A;  3EVW A;  1JKH A;  5RUB A;  3BM7 A;  3AXM A;  3IMQ J;  3N0V A;  1LXJ A;  1TKX B;  2XZD B;  5E3A A;  1RKJ A;  3NNA A;  2CZ4 A;  2XMW A;  3MDF A;  2WW8 A;  3PX4 A;  3UNG C;  5CZV A;  5FDL B;  1YBU A;  2IM3 A;  2ZHA A;  4ZPB A;  3SQO P;  4K4Y A;  3PRV A;  2PI5 A;  4NLG A;  1I5O B;  3NGU A;  1KTV A;  3MFI A;  3IAS 9;  4EO6 A;  4LSN A;  3K57 A;  1CPZ A;  4N47 A;  4A8K A;  4M5G A;  2YH0 A;  4JYA F;  3FFI A;  2R7V A;  2HGN A;  2KJW A;  3JTP A;  2WVB A;  3MPW A;  2ZNZ A;  4C0O C;  4USK A;  1IBK J;  4YHH J;  4NI2 A;  1BMQ B;  1NU4 A;  2DR5 A;  3W3S A;  3EGZ A;  2CWK A;  4LF2 A;  3DYA A;  2MST A;  3CUN A;  4N76 A;  5L46 A;  4N77 A;  1U0H A;  1CLF A;  3VWS A;  4I67 A;  2FJA B;  2AZ1 A;  4NX9 A;  4B08 A;  1IKW B;  2PD1 A;  4DV4 J;  5CD4 H;  3C8Y A;  2O5D A;  4Z2X A;  4HVZ A;  1TZ0 A;  2NPI A;  2MZQ A;  4YFU A;  3FBE A;  4OYI A;  1RSC A;  2FJD B;  3P8B B;  3I5A A;  5E2Q A;  1IR0 A;  1JJ4 A;  1S1V A;  4EBD A;  3PRD A;  4KYZ A;  3FBF A;  1X5T A;  5IC4 B;  3RU0 A;  3U02 A;  4BC7 A;  2ZH8 A;  4FPR A;  3CC4 S;  2VOO A;  4ZVU B;  3MUR P;  1ZAW A;  4B3O A;  2IJF A;  1S6P A;  4Y2K A;  1ZH5 A;  3QAT A;  4QWD A;  1NJZ A;  3TJA A;  1EKR A;  4UOC A;  3M8R A;  4RX6 A;  1JLC A;  4I2Q B;  4KGV B;  4F3Q A;  2VF3 A;  3CWJ A;  5KFZ A;  2B9E A;  4ERD A;  3CME S;  3HT0 A;  4ZVH A;  2J0W A;  2KXH A;  1EHW A;  1X7V A;  2BE2 A;  2BAB A;  3GCX P;  1FKP A;  1HNX J;  2KT2 A;  1HQU A;  1IWG A;  4WCE Q;  4I56 A;  2HFU A;  4HR2 A;  3WIU A;  4X4R A;  1HBU A;  1B70 B;  3U27 A;  3U7J A;  4DV1 F;  1HYS A;  1KQK A;  1R8H A;  3HUL A;  3AXK A;  4WP3 A;  1FRH A;  2DYA A;  4WTY A;  5CYJ A;  5HQM A;  2MQO A;  3C16 A;  3R5C A;  1HQE B;  2J9E A;  1JNR B;  1TL1 B;  2KI2 A;  4HAC B;  3DLE B;  2MYF A;  3M8Q B;  4WU3 A;  5D78 A;  3WQP A;  3B82 A;  3G82 A;  2WVC A;  4RBV A;  5F3T A;  2C2E A;  2OIH A;  4OZ1 A;  1MRO A;  2R7Q A;  1XMB A;  1IBM F;  1WSV A;  2XO6 A;  1RXO B;  1Q0N A;  3TUJ C;  2E44 A;  1XNR J;  1DTT A;  3KXD A;  5IM0 B;  1HBU B;  2Z57 B;  4OI6 A;  5KFM A;  5GAG I;  3M9M B;  4PWD A;  1ZA2 B;  1W25 A;  5GAG U;  4C3K A;  2FVR A;  3I9V 9;  3J7A N;  2KXF A;  2QMU B;  4KGZ B;  4O3O A;  4AFF A;  2OPS B;  1I94 F;  5D8H B;  1RE1 B;  1JLG B;  3HVW A;  3QZ8 A;  3MMB A;  4CO0 A;  4MKA A;  3R1L A;  5H9E K;  1I51 B;  1SCJ B;  2NSB A;  1KFS A;  2QJ3 A;  5IQQ A;  1Y3K A;  2V8V A;  2AMC B;  1FTR A;  2PMW A;  5J2Q B;  1AYE A;  1NSK L;  3NRB A;  2Y0B B;  4TXS A;  2F8H A;  1PYT A;  3M32 A;  3HP6 A;  1YIJ S;  2IM2 A;  2YY3 A;  2VA3 A;  2LU1 A;  4WP8 A;  3PKM A;  3H42 A;  3N9U C;  2V9K A;  4YOE A;  1OQ6 A;  2AYM A;  1RT5 B;  2HBR B;  3DLG B;  4H4O A;  4Y28 C;  1TK0 A;  1M5P C;  2HFO A;  3HFZ B;  2HMI A;  2CQC A;  1M5V C;  5L9N A;  1AXQ A;  1N54 B;  5G0R A;  4CZC A;  1RWN B;  2YKO A;  5KFE A;  1SIZ A;  4KFB A;  4PZV A;  1S0N A;  3FCH A;  1S1X B;  3I0S B;  1KBR A;  1NO8 A;  2X1A A;  2JSX A;  3CC2 S;  2VZ9 A;  3DM2 B;  5L1J A;  4DFM A;  1OO0 B;  4DL7 A;  4RW6 A;  2OO4 A;  3ENQ A;  2RDJ A;  1W2B R;  2PSZ A;  5C25 B;  1S4E A;  1IR2 A;  1BLU A;  3IS9 B;  4L72 B;  3IBF B;  3I4P A;  2DNL A;  3CJ5 A;  3CO9 A;  3DGP A;  3LWL A;  5DG7 A;  5E41 A;  2E1C A;  4B3T F;  1KNZ A;  2X7I A;  4HYK A;  1G1X A;  4H4O B;  3HKW A;  4A46 A;  3G87 A;  3OTE A;  4WFX A;  2ABY A;  4YB5 A;  1PBA A;  1IKX A;  2MY7 A;  3IO1 A;  1RT3 A;  5G0R B;  3FCV A;  3DLJ A;  3QSY B;  5E5N A;  2WB4 A;  2G1H A;  2ZOM A;  3O44 A;  4F02 A;  1S9E B;  2VIH A;  3ISN D;  4IOB A;  5J1P A;  4ZDN A;  3NGS A;  1SB6 A;  4NXN J;  4LF9 J;  3K5P A;  4M8L A;  5BJR A;  1WJ9 A;  3JAM U;  4DSK A;  4IR1 A;  4LF6 J;  2FZK B;  4CLS A;  4LF9 F;  3IS9 A;  2UZA A;  3OLA A;  2CQB A;  4IRC A;  4IDK A;  2HZA A;  2K3I A;  3MMC B;  5HMW A;  1U1Q A;  5JMN A;  2WOM B;  2OEK A;  4P72 A;  3J80 Y;  3ZTQ A;  3D2W A;  1PAU B;  1SBR A;  1KDN A;  1OQ3 A;  4IR9 A;  3SSR A;  1MMN A;  1DQA A;  1PSD A;  1BD6 A;  1JXV A;  1FNO A;  1U7L A;  3MR2 A;  4URG A;  1Q78 A;  2HRU A;  3CVK A;  2LQJ A;  2M7S A;  1UKU A;  4KY3 A;  4GKK F;  5KFP A;  3MUM P;  1ULR A;  2HLT A;  1FXL A;  3TQE A;  3MM6 B;  3VHQ A;  5HMY A;  2MJU A;  4WPA A;  2M8D B;  2RAQ A;  1O6X A;  3BJY A;  1EB0 A;  1Y11 A;  1BHN A;  5ETK A;  8AT1 B;  2CNK B;  2GML A;  5FDL A;  4RO0 A;  3UCZ P;  4L76 A;  3HT3 A;  1P1T A;  2RJZ A;  4DV2 J;  4KPC A;  2DGT A;  2PE8 A;  3A8I A;  4P74 A;  1S0O A;  3I5B A;  2B3T B;  1UZH A;  2HQC A;  3EPG A;  2QTW A;  2DO0 A;  1D1U A;  1A7G E;  3C15 B;  3H2U B;  1Y0H A;  2BAN B;  1TU0 B;  3AB2 B;  3KFW X;  2IVF B;  3KK2 A;  2OP5 A;  3KHR A;  1UA1 A;  1VQ4 S;  1QE1 B;  1WEL A;  2LKZ A;  1NZ8 A;  4FF4 A;  4WJB A;  1JLC B;  4I2Q A;  1RZM A;  3C2P A;  2RDI A;  5HMZ A;  4OZ0 A;  1JLA A;  5GMK a;  3OHB A;  2ZH9 A;  4YME A;  1VRT B;  2IHR 1;  1ZM4 A;  2BDP A;  1UZD A;  4K2X A;  4RW9 A;  3BDP A;  1UW4 A;  2HFN A;  1P1L A;  4MYU A;  4NEZ A;  3ONQ A;  2CAD A;  2N3O A;  4RUA A;  2NXE A;  3OTO F;  3R7N B;  1NPK A;  3OTO J;  1NK6 A;  4FYD A;  1RAI B;  4J9N A;  4HDH A;  2VUG A;  4EEY A;  4I1T A;  3NAH A;  4DPY A;  2MHN A;  3RW6 A;  3QT7 A;  1FJE B;  4ZPA A;  4BBY A;  3MOZ A;  2V63 A;  1WHY A;  3B4D A;  5DDP C;  3SZ2 A;  1D9F A;  2UVR A;  2R4F A;  3VAH A;  4MAK A;  1HQE A;  5HLF B;  4ZCI A;  2Y3Y A;  2B4P A;  3D66 A;  4DSJ A;  1ZPV A;  3I0R B;  1JLA B;  4DL5 A;  1RBO B;  5CA5 A;  2F3J A;  2AGP A;  3G8S A;  3I5C A;  2CQ3 A;  2RVJ A;  3F44 A;  3M8Y A;  4BHQ A;  5GAH U;  2MKC A;  2ZHO A;  4UQT A;  2W2P P;  2W9C B;  2BM0 A;  2IRX A;  4F4W A;  3CW2 C;  2NS1 B;  3QGH A;  4OJH A;  4WFZ A;  4ICL A;  1UVK A;  4C8M A;  3POT A;  3IGN A;  1FJC A;  5K8N A;  3OTC A;  2C1E B;  4J9V A;  2ZOG A;  3GSI A;  4X66 J;  4DMZ A;  1R27 B;  3W9I A;  2VG7 A;  3CXC R;  5T41 A;  4C8L A;  2PEB A;  3MD3 A;  4GC6 A;  2BQ3 A;  4ECR A;  1KRP A;  2Q6B A;  3TYT A;  2D41 A;  4Q8E A;  1GMW D;  2YWK A;  1NK5 A;  1S6Q B;  1WUU A;  3BBC A;  4P7V A;  4USV A;  2GHV C;  4OFZ A;  4IUF A;  5T7L B;  1XBW A;  2F4F A;  3DU5 A;  3MM7 B;  1T0T V;  5DGB A;  2KRB A;  5I3U A;  1AUD A;  2AWZ A;  2K1R B;  2Q79 A;  4PXB A;  4ED4 A;  3KLH B;  3E3X A;  1Y5I B;  3Q23 A;  5AE1 A;  2ZZN A;  1S76 D;  3M1V A;  4URQ U;  3IWN C;  2DNG A;  5DQG A;  4U8Y A;  3S6E A;  4IRK A;  1UJ4 A;  3VAK A;  2LMI A;  2PDA A;  5D0R A;  2UVW A;  2KM8 C;  2EI5 A;  1VQY A;  2RRN A;  4F2R A;  4RKU C;  4DFK A;  2JJ4 D;  3V4I A;  5HAT A;  1X60 A;  3PFE A;  4OYB A;  3RAM A;  2DNM A;  5LOQ A;  4LFC J;  2AV5 A;  4NLD A;  3BBB A;  3V4I B;  1WKL A;  4OMF G;  2G1D A;  2MKH A;  3B6B A;  2YWG A;  3KWM A;  3W64 A;  4WKY A;  3TUI C;  4RNF A;  5LJ3 Y;  3Q8P B;  1U1R A;  2ZNY A;  1AA1 B;  3BKU A;  3JB9 k;  1KHW A;  3K5N A;  2F1F A;  3S1T A;  2UUA F;  4DUT A;  5BXI A;  4XO0 A;  1NND A;  4I64 A;  1T9T A;  2JLF A;  3GSD A;  3SDE A;  1D3W A;  3B78 A;  5M2U A;  2NCK L;  4CLU A;  3W2W B;  2MQQ A;  3TAQ A;  1HR0 F;  2UXB F;  3EWG A;  2Y0S D;  2BJD A;  2C2K B;  1NB7 A;  4GRS A;  2D7S A;  2QL9 B;  1FES A;  5HRO A;  3MHY A;  2HFS A;  3CO0 P;  3I0S A;  3NEK A;  3HZG A;  3MMC A;  4RPF A;  3SEO A;  3D1H A;  4NZ0 A;  4X64 F;  3NWR A;  1KEK A;  4KT0 C;  5J2P B;  3TJ8 A;  2HHS A;  2PMZ D;  4JI2 F;  3DRX A;  3OUY A;  1FD8 A;  2DH8 A;  4M5J A;  1CC8 A;  2WON A;  1WC5 A;  4DEZ A;  3H8Y A;  2KZM A;  3FFI B;  2KZZ A;  2BKO A;  2HNZ A;  2J6S A;  5K9F A;  1FRJ A;  1VIS A;  1JLQ A;  4UF4 A;  3DNC A;  3F73 A;  1BQM B;  2R2R A;  2XWX A;  2VFU A;  3M2U B;  1VQP S;  3HD1 A;  1TKT A;  3BYP A;  1I1G A;  3FBC A;  1U6F A;  1XTZ A;  4IG3 B;  1Q95 G;  4O4G B;  3JYT A;  5K20 B;  2JVR A;  1XNQ J;  4ZMM A;  2DCU B;  3GR1 A;  2O01 C;  2IVM A;  5A0Y A;  5KFW A;  1NAQ A;  2W9B B;  5A8W A;  1X0F A;  4YS2 A;  4B3M J;  3RUB L;  3UW1 A;  4DV7 J;  4ECQ A;  1YX2 A;  4IDK B;  3D3B J;  1VIO A;  1N6Q A;  4ZP9 A;  3HO1 A;  1S9G B;  1F9F A;  2QO3 A;  4DR7 F;  4PQU B;  4QPT A;  3BQ2 A;  3KUG A;  2PA8 D;  3MED A;  4WIQ A;  5BYQ A;  1OY9 A;  2XLI A;  2PO4 A;  2ZM6 J;  2JOQ A;  1TR0 A;  2DNQ A;  1N36 J;  3OFG A;  3CJ8 A;  3CJK B;  1S7H A;  5K8M A;  1QVF R;  2F5G A;  1N5Q A;  2CG4 A;  4DX8 H;  3RR8 A;  1UA0 A;  4ANE A;  3DXB A;  4YUD A;  3BSO A;  2AU0 A;  1M1K T;  4ZS6 A;  4EZ9 A;  2V68 A;  1VQ5 S;  1UMJ A;  4UST A;  1NB2 A;  2R7X A;  5L9X A;  1RWV B;  4DV0 J;  4AE5 A;  3MI7 X;  3H25 A;  1CJK A;  4CT8 A;  3T5K A;  2YKA A;  3GG1 A;  3PNI A;  4A8F A;  3C6T B;  2FJW A;  3HHL B;  2EFN A;  4KO0 B;  1OS5 A;  2CQD A;  4Y2C A;  1GFW B;  4DUZ J;  2C2M B;  2JVO A;  3E01 B;  5DDO C;  2JC1 A;  2GGP B;  2P6S A;  3W5Y A;  4TN2 A;  2FHM A;  1PJ7 A;  4ID5 A;  1SUQ A;  1VC6 A;  2UUC F;  3RB4 A;  1RT1 A;  3FDS A;  2DNK A;  4F8R A;  3OJS A;  2XNR A;  3LA0 A;  4TVA B;  2DXD A;  5AJ3 F;  4OYO A;  4OYM A;  1VK8 A;  3GFX A;  3K89 A;  5KOX A;  1AB8 A;  5E0O A;  2F63 A;  4KQZ A;  3N01 A;  1VBZ A;  3GJT B;  1S1U B;  1Z4U A;  1M5O C;  3C6T A;  3GWC A;  4M5M A;  3MWB A;  2DEI A;  2ZH5 A;  3VZI A;  1PKU A;  1HNX F;  1TK8 A;  1J5O B;  1HIY A;  1N48 A;  3M2V A;  4MK8 A;  2E9Z A;  2L48 A;  4ECX A;  1F2H A;  1WTF A;  3HVT A;  4LFB F;  1NK9 A;  2X3D A;  4MTP A;  4JI2 J;  5LSO A;  3SCI E;  1HL6 A;  1UW9 A;  2VKR A;  2Y1L B;  3PIO Q;  3I6P A;  3FQL A;  1KS2 A;  3LGN A;  3KYL A;  5FJ4 A;  4HI2 A;  2JC0 A;  4U7U D;  4QBU A;  1X31 C;  5I3U B;  1VCT A;  3MPY A;  2V4Q A;  1TVR A;  2KFY A;  2V2K A;  3IBW A;  1SL0 A;  2UVV A;  1XNQ F;  3HF5 A;  2V8P A;  3V6J A;  2HNY A;  1ZM3 A;  4UOF A;  4DN9 A;  1KFD A;  2QLF B;  1T9X A;  3IM9 A;  2I5J B;  2J0Q D;  4C9D A;  1PO6 A;  3KLI A;  4GVB A;  1WOR A;  1TUG B;  3K7R A;  4M1K A;  4QWB A;  2A1B A;  2AW0 A;  3TAM B;  2OMO A;  4ZVQ B;  4DBQ A;  2W25 A;  2YNG B;  3DGV A;  4ANC A;  1SJR A;  4IG0 A;  3JSM B;  4NZ7 A;  3QT6 A;  5IV4 A;  2B6A B;  4PG8 A;  4JOU A;  3KG0 A;  2B5J B;  1IWA A;  2XGP A;  2R7S A;  1BQM A;  3GLJ A;  2KG0 A;  1FEH A;  1D8Z A;  1GEH A;  2HGL A;  3J7Z T;  1R89 A;  1QY7 A;  4DOZ A;  1UEV A;  1HBN A;  2BRL A;  3KJQ B;  2RQM A;  4UY8 5;  4R8U B;  1N33 F;  3GTY X;  4AD6 A;  4CLL A;  3UN2 A;  2IM0 A;  2Z30 B;  3MMA B;  1VFJ A;  3I82 A;  2R2U A;  2IDL A;  1ZTT A;  2XEX A;  2QA4 G;  1T3O A;  1YKW A;  2VPZ B;  2F65 A;  2J9D E;  4O23 A;  4KPY A;  4BWJ A;  1HNV A;  2VL1 A;  3AY0 A;  1OJ4 A;  1PC4 A;  3FKB A;  4K4U A;  3QO9 A;  2RF2 A;  3B4M A;  2VV5 A;  3NGR A;  3W60 A;  2AJF E;  1KVJ A;  3LAK A;  5KFH A;  3KTQ A;  4TYB A;  2C2Z B;  2E5L J;  3UD4 P;  4RW4 A;  3MAH A;  2OAU A;  4HDG A;  4CCH A;  3CMA S;  4UOG A;  1ELO A;  4WF9 Q;  1K44 A;  2CJQ A;  3VAG A;  2CPE A;  1EAY C;  3PYD A;  1PGZ A;  2EK6 A;  3GFH A;  4IO9 Q;  1QSL A;  4KV8 A;  3T6J A;  1XR6 A;  4X4N A;  4Q43 A;  1LW2 B;  4OV1 A;  3H4D A;  3R3T A;  3QSI A;  2DGW A;  2XS5 A;  1RAH B;  2E1R A;  1CJT A;  2FZC B;  4R25 A;  3R97 A;  5EWF A;  2W4D A;  2ATL A;  3VZH A;  2B9W A;  3IWL A;  2V6A A;  1OY8 A;  4DX7 A;  3HSZ A;  4K4S A;  1H73 A;  1S6P B;  2HS0 A;  4PXE A;  5HRO B;  3ZNJ 1;  4K8R A;  2DR7 A;  4X2B A;  1SQF A;  1UP1 A;  2EKY A;  1YBA A;  2MSS A;  2GVZ A;  2NXC A;  4Q44 A;  3A8J A;  2A6M A;  2EW9 A;  2LQ8 A;  3GON A;  1RT7 A;  1VHF A;  3K2Y A;  3OL6 A;  2Q43 A;  2CQP A;  1M1H A;  2W2Q P;  2DGQ A;  1R0A A;  2HHX A;  1C1C B;  1UFL A;  3BGR B;  2KH9 A;  1S4F A;  4Z37 A;  4DLE A;  5GMD A;  2XWY A;  4O3P A;  2MLX A;  1Q8B A;  1ROF A;  1U1K A;  4DFP A;  3EDQ B;  2XMT A;  1WKK A;  5DM6 Q;  1WOS A;  1RAJ A;  4B9U A;  2KYZ A;  1WI8 A;  2VAS A;  1U2R A;  2L9D A;  2FVP A;  1YI2 S;  4X4U A;  2HHV A;  2HND B;  5CAA A;  2B9X A;  2MLY A;  3UDL A;  4OHW A;  4ZP7 A;  2YQ0 A;  2A6O A;  4ZOS A;  5KFX A;  2FIU A;  2PC6 A;  1U6B A;  4CRJ A;  3CJ4 A;  3DRY A;  1G4C A;  4CNY A;  3IGV A;  4FKY A;  1H3D A;  4B02 A;  4DUY F;  4OZN A;  1LWE B;  1JLB A;  2E5H A;  3GYN A;  4Q8F A;  1F3V A;  1IBL F;  3KOA A;  3NNC A;  3EYZ A;  4DV3 J;  1AZS B;  2BJ9 A;  2KT3 A;  5HBM B;  1U0H B;  2COL A;  5HP1 A;  2ALZ A;  4Z7C A;  3PG9 A;  2CJB A;  1Q8L A;  3VGT A;  1FRI A;  1YVF A;  2LDY A;  2V94 A;  2L9N A;  2MLZ A;  3L3C A;  2DH7 A;  1SKW A;  4IYQ A;  2QZ8 A;  3MM9 B;  4NYO A;  4J9L A;  4ED8 A;  1F2G A;  2YWW A;  5KFY A;  4B3M F;  2WW4 A;  1JQG A;  1WKJ A;  4NLR A;  1F3F A;  3F56 A;  4KKO B;  3CDA A;  1XJW B;  3M32 B;  1HBN B;  4K0K F;  3A8E A;  4DU8 A;  3AAW B;  2ZH4 A;  1IXK A;  3MR7 A;  4NEY A;  1LWC B;  1HNZ J;  4NCA A;  2DIV A;  4B3O B;  2DKO B;  4L73 A;  3TZY A;  3K5O A;  3HI9 A;  4ID5 B;  4NA2 A;  2QMX A;  1UFW A;  3FCW A;  4TY9 A;  4LBI A;  5IT0 A;  3QRP A;  4L74 A;  2DK2 A;  4WE1 B;  1LWF A;  2RD5 C;  1V3Z A;  1UL3 A;  4NML A;  3I56 S;  2XS7 A;  3A13 A;  3RYL A;  3AT1 B;  4IFY A;  1FWK A;  3L7O A;  4K7Q A;  5ETQ A;  2XCP A;  2G9O A;  3KLG A;  2OKQ A;  3ULH A;  2VG5 B;  1FJG F;  3VR1 A;  1RI7 A;  3TRG A;  4WFA Q;  4DV0 F;  1RYR A;  1NKE A;  1Q79 A;  3GJS B;  5CXT A;  1KVI A;  4LRA A;  4RNN A;  4L3K A;  4X65 F;  1WG1 A;  2IPO B;  3C66 A;  1ZZN A;  5KFC A;  4BS2 A;  4RUB A;  1KHV A;  1QD1 A;  1CJU B;  1JLE B;  4EBC A;  4DR4 F;  5A6W A;  3PYF A;  2MB0 B;  3TP2 A;  2J6T A;  2R7T A;  5LMU J;  1KLM A;  4X4V A;  5J2Q A;  4QU6 A;  1T03 B;  1NCL A;  2R7U A;  2I0X A;  4MYT A;  2AIR B;  3SFU A;  2J7U A;  1RT2 B;  3WIV A;  3G6E S;  1B0V A;  3M30 B;  1RAO A;  2ZH2 A;  5ITH A;  3KG4 A;  2KU7 A;  3LGH A;  2EFV A;  4LIR A;  2RRA A;  2XMU A;  2FC8 A;  3JQK A;  5LSL A;  5HK4 A;  1J5E F;  2H9Z A;  3CB4 A;  5KFG A;  5FII A;  3DDI A;  7FDR A;  5KG5 A;  1Z1Z A;  2L41 A;  2FLL A;  2LEC A;  1MNE A;  3M7V A;  4IO1 A;  3CDB A;  1LNQ A;  1DJ0 A;  2GNK A;  4DDF A;  4UUW A;  2KYX A;  3CJ2 A;  3OV7 A;  1S97 A;  1RBA A;  5KFO A;  3QO9 B;  1KLM B;  1JIH A;  4ZVR B;  2H4W B;  2KHD A;  2M52 A;  2M2B A;  2PA3 A;  4DUY J;  1RA6 A;  1RLD A;  1F60 B;  1K0V A;  2BX6 A;  2V67 A;  2WK4 A;  4J9U E;  4RR5 A;  2ZDO A;  3VCD A;  4J9P A;  3C6U A;  2BQR A;  4ZLN A;  2QMW A;  1RDR A;  5GME A;  4DV5 J;  4E98 A;  2XYH B;  3GG0 A;  3Q83 A;  2VQF F;  1DTQ B;  3O6Q A;  4P7T A;  1ACM B;  2HWI A;  1RT6 B;  4LF5 J;  3BN7 A;  2MZJ A;  3DRP B;  1T11 A;  1FKP B;  3MM5 B;  1FVS A;  3CDU A;  4F0H A;  2C3U A;  4PYD A;  4DQQ A;  2CJK A;  1NSQ A;  1APS A;  4F50 A;  4A8S A;  4FP9 A;  1SC1 B;  1CS4 B;  4ZCL A;  1T02 A;  2A10 A;  3M8P A;  1ZAV A;  2PMH A;  1RWU A;  4GO5 X;  2DXE A;  1HLW A;  2VBW A;  4ENO A;  1S99 A;  2OPP B;  2R8H A;  4LF4 F;  4FKX A;  1RCO B;  1S1T A;  2DNR A;  2JEI A;  3HMJ G;  4MFB B;  5IOL A;  2VBX A;  3KJV A;  1W7W A;  1CUL A;  1YLX A;  1MRO B;  2R2S A;  4K4T A;  2OJ3 A;  1RUS A;  2GIF A;  2GMJ A;  2YNF B;  2DGO A;  2DY1 A;  4DV4 F;  2CQ1 A;  2DB1 A;  4CNZ A;  2APO A;  4Y2I A;  5F0U A;  2BE9 B;  3GV7 B;  1S57 A;  4OX9 F;  4JI7 F;  1HNI B;  1X8D A;  3SCK E;  4Q45 A;  2CPI A;  3MEG B;  2AD9 A;  3RJM B;  5A8K B;  2DNZ A;  4B9V A;  2GHP A;  3M8P B;  3SXL A;  3TUP A;  1F0X A;  2OPP A;  2RU9 A;  4FBT A;  1HKA A;  4WWS A;  2VB6 A;  4C11 A;  3I0R A;  5KT6 A;  3IC1 A;  2W2N P;  2ZIT A;  4HH0 A;  2HSE B;  3H2V E;  4AND A;  2XUL A;  1ICE B;  3J80 U;  4DLG A;  1MN9 A;  2CJY B;  2KT5 A;  2UUC J;  4QOT A;  3D0H E;  3N5F A;  4CTA B;  4ED5 A;  4CO1 A;  1SH2 A;  1N32 F;  3CPW R;  1J2V A;  4DL4 A;  3QGP A;  1N34 F;  3AOC A;  5EX0 A;  3H4B A;  3CCU S;  2B9Y A;  4KH1 B;  4WFY A;  5CCL A;  2MKI A;  3NMA A;  2VIC A;  4ZLP A;  1HW9 A;  3T9N A;  2BM1 A;  3CUL A;  4D3G A;  1FXD A;  1O5J A;  3QPI A;  2CRL A;  1SKR A;  4ZLJ A;  4DZ6 A;  1P27 B;  4DR5 F;  4QU7 A;  3HSD A;  1W26 A;  4P9S A;  3TJ9 A;  4K4X A;  3MM6 A;  3PW4 A;  1FKO A;  1JLE A;  4KTQ A;  4MKV A;  2OEM A;  5M2R A;  3RAX A;  1FDA A;  3EDR B;  1RHK B;  3BS9 A;  4YB1 P;  3FEZ A;  3NWG A;  2HUR A;  2ZBC A;  3FK4 A;  4IQM A;  2O67 A;  2M0G B;  3U1N A;  2AQ4 A;  1A9N B;  1IVZ A;  1M0S A;  1RHM B;  1TUW A;  2HS4 A;  4I7F B;  2AF6 A;  2RB7 A;  4ELU A;  4L6V 3;  2ZBP A;  3C15 A;  4RZR A;  2Q66 A;  4TNO A;  5B0E A;  3PW5 A;  2RHS B;  3P5T L;  4AYB D;  3SYZ A;  1MSW D;  2RKI A;  2KTQ A;  2ACY A;  3MCN A;  4F4A A;  3CD7 A;  2VJU A;  3FZ2 A;  1R8P A;  1G6B A;  4RW9 B;  3H7H B;  1WC1 A;  4OX6 A;  4X62 F;  2G0J A;  1JMT A;  2M3D A;  1LK5 A;  2PN6 A;  5DET A;  2HW3 A;  2CNL B;  3GFZ A;  2NQP A;  1XC9 A;  4WXW A;  5HI7 A;  1PC5 A;  3DMJ A;  4C8Y A;  2ZVS A;  2GIR A;  3UO0 A;  5H1S V;  4ZN1 A;  3SCJ E;  2YWF A;  2IA0 A;  4LIW A;  4MIA A;  1JLG A;  5DLG A;  2BYC A;  2RU3 A;  3Q8Q B;  3MFH A;  2DRA A;  5CAB A;  1FJ7 A;  1RYS A;  4XAK A;  1SV5 A;  2DNH A;  2F9J A;  3TZX A;  4NLY A;  5AXM A;  1H74 A;  1HHS A;  3IRX A;  3JSB A;  2B7B B;  3CDW A;  2HHW A;  1NKC A;  1EET B;  2AX0 A;  2BJ7 A;  2DHS A;  4X4S A;  2HIY A;  5JVG Q;  3ADA C;  5HJX A;  2DY9 A;  4O0I A;  2OH2 A;  2CDQ A;  3DLG A;  5HMX A;  3OUY B;  4X4P A;  2HMI B;  3Q2S C;  3FMW A;  2AKW B;  2WON B;  3D6M B;  4F25 A;  1TEL A;  3ITH B;  2N7C A;  3M8S A;  2CVI A;  3GV8 B;  2R8I A;  1MLA A;  2YNF A;  3DHX A;  1Y00 A;  1E6Y B;  3QJJ A;  3V4M A;  2KFZ A;  4LRF A;  3ZZY A;  3RGI A;  1HNZ F;  5KFK A;  3HHK A;  4H4M B;  3OFH A;  3LW5 C;  5A0Y B;  2ZH7 A;  2PII A;  3M30 A;  1F9E B;  3W8G A;  3QRR A;  2EG1 A;  2HKE A;  1R3N A;  4PPZ A;  3DOK A;  4ZPC A;  5CZX A;  2R9L A;  1N33 J;  3EXC X;  2WCX A;  2B8P A;  2YNH B;  5DRK A;  2D3U A;  5M2P A;  3ILO A;  1RWM B;  1MG7 A;  3R6G B;  5MAO A;  1UPP A;  3OR1 A;  4XK8 C;  3H0P A;  1NK7 A;  1IJF B;  2GQQ A;  2MQM A;  2W4P A;  2C3Y A;  2CQH A;  2CZV C;  1CJT B;  2MJN A;  3CJT A;  5A8R B;  2VFV A;  2LQ9 A;  2Z2Y B;  5F0W A;  2ASY A;  1S1T B;  3PJX A;  1SJQ A;  4DG1 B;  1NJW A;  5LXR A;  3GIM A;  3DFE A;  4CH7 A;  1KVK A;  5CHC B;  3CD5 A;  5D77 A;  3VQS A;  3RW7 A;  1FE0 A;  2AEM A;  2MZR A;  2QG9 B;  4F36 A;  5AXN A;  2GZO A;  5THW A;  5DGA A;  1VQ7 S;  4DR6 J;  1VLO A;  2XHW A;  4CLY A;  4FNI A;  2DNY A;  4UUX A;  1N36 F;  5H9F J;  4PG7 A;  2BW7 A;  1MWZ A;  2DT9 A;  2NZC A;  3MEK A;  4HHH A;  3HVR A;  4WZQ A;  1TKT B;  3AJD A;  4ZJO A;  2DR9 A;  2FY8 A;  2EBE A;  1J5E J;  4FYX B;  1AFJ A;  5ETR A;  1WAC A;  4NLP A;  2CQ4 A;  3BYR A;  3P3D A;  2GA7 A;  3LAM A;  3NS7 B;  1ZOT A;  1XEZ A;  4MKB A;  2KHC A;  5ETN A;  3AD8 C;  3AH6 A;  1NPP A;  4Y65 A;  2VBY A;  1OYD A;  4DL3 A;  4LRD A;  3TQ1 A;  4F2S A;  1S6Q A;  1HWJ A;  2LFV A;  2RHQ B;  1S9G A;  1O8B A;  2HG4 A;  3AD9 C;  3M05 A;  5CCM A;  3CCJ S;  2HND A;  3AFG A;  2Z8Q A;  2RT3 A;  4CTA A;  2CJX B;  4O3Q A;  2MQP A;  3OW2 R;  4N41 A;  1UVN A;  4DR2 F;  2JEF A;  1Y10 A;  1CUL B;  2X51 A;  3GIK A;  2V9W A;  1RWX B;  3GP9 A;  2JDJ A;  5KG7 A;  4NA1 A;  4DSE A;  3KNA A;  4OHY A;  4L3N A;  2BE2 B;  5KFS A;  2QSW A;  2DTJ A;  2HPU A;  2XI3 A;  1B4S A;  1FEE A;  5KOW A;  1NEE A;  2VPX B;  3M2U A;  1GTE A;  2GO8 A;  3EM1 A;  5F8H A;  2R8K A;  3MEG A;  1EP4 B;  1F5B A;  3CDE A;  1VS3 A;  2BE7 D;  4O0N A;  4MIB A;  4DCJ B;  4EGL A;  5A8K A;  1U4B A;  1Q81 T;  2HK3 A;  3ISN C;  4OLP A;  4N7T A;  3UN5 A;  2VFS A;  3G82 B;  4DSF A;  3JAM Y;  1VQK S;  2HAI A;  2FJB B;  4S0M A;  5ETP A;  5K8P A;  2J7K A;  2KL8 A;  3GZ7 A;  3OQ2 A;  1TL5 A;  4RWW A;  2ALY B;  3KG1 A;  3MZI A;  1DQ9 A;  2CDR B;  4GO7 X;  5EX3 A;  5KT2 A;  2EK1 A;  4N5S A;  2I1R A;  4LF7 J;  1VQN S;  4QJV A;  4C4W A;  3V6D B;  3KMQ A;  3LH2 S;  3QAU A;  1NM2 A;  2O1P A;  1EP4 A;  3ILI A;  2HHQ A;  4ZJL A;  3IRW P;  3NMR A;  1H6K X;  2K7K A;  4DV5 F;  4ZPV R;  2ILZ A;  1QJH A;  1U26 A;  5KG1 A;  3CCL S;  2DXF A;  2E1P A;  1CC7 A;  2KG1 A;  4MK7 A;  2B5J A;  1RQ0 A;  2E7W A;  1J5O A;  1TL3 A;  1U6Z A;  1VLY A;  1SKS A;  4H4M A;  1WC6 A;  3NS5 A;  1RAC B;  1UWA A;  3R5J B;  3KHH A;  1HFE L;  5DG9 A;  2ZJR Q;  2QGF B;  2ZKT A;  3FEY B;  3H5X A;  5AE3 A;  1FKA F;  4QIW D;  4CM0 A;  3MCO A;  5T14 A;  2LEB A;  1U1O A;  3I9Z A;  1FI4 A;  1CJU A;  1QM9 A;  4M94 A;  2CNO B;  3KJN B;  3Q8R B;  4Y0F A;  4NYZ A;  4YB7 A;  4ETX A;  2H5E A;  3PZP A;  1Z2L A;  2C3M A;  4K5S A;  3X1L B;  2E1M C;  2VDH A;  1I6J A;  1DZ5 A;  1FE4 A;  2KM8 B;  2IJR A;  2ROE A;  2EVZ A;  1KOO A;  1WC4 A;  3BF4 A;  5KG4 A;  1N52 B;  1BQX A;  2GAH C;  1TL7 B;  5A8W B;  1VBY A;  2D9P A;  3T5H A;  3MM8 A;  4A47 A;  4A8W A;  4F3O A;  2CUY A;  4OHV A;  3RAQ A;  4IFV B;  4JV2 A;  2QFI A;  2CKW A;  4LJM A;  1HW8 A;  2O66 A;  1JB0 C;  2DEJ A;  4J9R A;  3M2R B;  5C2C A;  1PIE A;  3PEH A;  3QNW B;  3T1H F;  5U47 A;  2ZEJ A;  3TVZ A;  4USW A;  3NNH A;  5L1I A;  4DQP A;  3FZB A;  3VVU A;  5KFA A;  2H4Y B;  5IZH A;  1S12 A;  4EWT A;  1X4H A;  2YKM A;  3H90 A;  3K17 A;  4FZV A;  5C2G A;  4ED1 A;  2FLN A;  4QWE A;  3DLB A;  4ALZ A;  3ZTP A;  2MKY A;  3RRK A;  1BWV A;  3R9L A;  1HR0 J;  4B3S J;  4KHM A;  3BB5 A;  4Q2L A;  3IP0 A;  3MUT P;  4ILM A;  2XSF A;  3A3O B;  2V0N A;  1XIQ A;  2F7V A;  3UDC A;  3UWT A;  5DZ7 A;  3M2R A;  5IFM A;  5AT1 B;  2CNN B;  5CYM B;  4W92 B;  1YRU A;  1XQI A;  2D9O A;  4FPI A;  4X4Q A;  3R27 A;  2W01 A;  1L3S A;  3SDE B;  3T1Y F;  4NLW A;  1LKZ A;  3QID A;  2A3J A;  4F4Z A;  3V6H A;  1T9U A;  3MCM A;  2N3L A;  5KG0 A;  4FF2 A;  4A4J A;  2G2Z A;  2EEY A;  4ZIV A;  1C1C A;  2G13 A;  1S48 A;  3BGR A;  4DG1 A;  5F8I A;  1HI1 A;  4AXJ A;  4BWM A;  2FQQ B;  3ENA A;  3TW0 A;  3G6X A;  2XI2 A;  3UCG A;  4LF8 J;  5L39 A;  1IBM J;  4NXM F;  3PY8 A;  2LCW A;  1FD2 A;  3OXF A;  3M6W A;  4QWA A;  2MDA A;  3IN5 A;  3OVB A;  3KKF A;  1FRX A;  3OL8 A;  2LEA A;  2QC3 A;  3CCQ S;  2ASJ A;  1S6U A;  4XDC A;  4HKQ A;  4F0K A;  2CWX A;  3OTB A;  1LFW A;  5HO4 A;  1I94 J;  3QBC A;  1LXN A;  3MEE B;  3H59 A;  2UXD F;  1S1V B;  3LP0 A;  4X62 J;  1WNE A;  1HPZ A;  2HHP A;  3ZXW A;  4MH8 A;  2ZM6 F;  1TAU A;  3R7B B;  2DRD A;  4JI6 F;  4U95 A;  5HBM A;  5A2Q Y;  1XMO F;  1VRU B;  3Q24 A;  1KTQ A;  1VJW A;  2Y1R I;  3OBI A;  4LFA F;  4PAA A;  4DV6 F;  1NBE B;  4DV7 F;  4OYP A;  4DWI A;  2V8G A;  4ITS A;  4Q2M A;  4ZN3 A;  3OFE A;  2BQU A;  3NCR A;  2UVU A;  3HCX A;  1HBO A;  2DCL A;  4DV3 F;  2C22 A;  1SC3 B;  1U8S A;  3DYA B;  2RML A;  3H40 A;  4AQY J;  3CJK A;  1YJ9 S;  4IRD A;  4RBU A;  4CYU B;  3LP2 B;  2KKH A;  2W1B A;  3MPU B;  4UY8 T;  1YK9 A;  2C2N A;  2E29 A;  2Z2L A;  4W98 A;  3RG6 A;  2IYG A;  2AGO A;  2ZH6 A;  3FSI A;  1HBM B;  3TUZ C;  2E7X A;  1NK0 A;  4UZB A;  1E6V A;  4A8Y A;  1GTH A;  5JVH Q;  3AQP A;  3FRY A;  1Q16 B;  2GCF A;  2QT7 A;  1LWF B;  3DLH A;  3UCU P;  4FF1 A;  5AE2 A;  3ZZU A;  1RT7 B;  3HSJ A;  1S0V A;  4IKA A;  2BJ8 A;  2BJ1 A;  2KJV A;  1RT5 A;  2JFD A;  2OEJ A;  3PAC A;  5KG3 A;  4RUH A;  2RIJ A;  4WII A;  3PJW A;  2XLJ A;  4ED3 A;  2UP1 A;  1IN0 A;  2EKN A;  1RKI A;  1E6V B;  2W8L A;  2AYB A;  2DPI A;  2POK A;  1IKY A;  4UOH A;  3WX4 A;  4DN0 A;  2G2O A;  4G1I A;  1GNK A;  4KGX B;  5GAD U;  4ZKA A;  1EX8 A;  2Z58 B;  1DY3 A;  2K06 A;  1IBC B;  3S7R A;  2OD6 A;  3VGV A;  2BR0 A;  1YBT A;  4GKJ F;  4KKO A;  1UWB B;  4F04 B;  2H1Y A;  1YJR A;  4OI3 A;  2IBK A;  2HK2 A;  4RW4 B;  1V6H A;  2GJI A;  2I9S A;  1SC4 B;  3QZ7 A;  2Z4P A;  1FT8 A;  1RTI A;  2WVE A;  5JJB A;  1S6O A;  3DMJ B;  5I3Q A;  3IM8 A;  1LWE A;  4ZCM A;  5J1E A;  4C6A A;  1H7W A;  1NME B;  3I87 A;  2AJ2 A;  3U1L A;  5KFB A;  1P8G A;  1CSJ A;  1ZPW X;  5LMU F;  1QSY A;  3HDS A;  2GAG C;  1R8A A;  4RWX A;  4NCB A;  1S9E A;  2D1C A;  1P9Y A;  2P9C A;  2ZOF A;  5B0D A;  5KT5 A;  3MR5 A;  1U8W A;  3CCR S;  2QA2 A;  3K5L A;  3RB3 A;  4AL5 A;  2GO9 A;  4ES1 A;  1KR4 A;  1YJW S;  1TFY A;  2YKQ A;  1F5A A;  1VBX A;  4IQX A;  4FXW A;  3NKY A;  2LLZ A;  4OYA A;  1QUP A;  3PM9 A;  4ZVS B;  2JWN A;  1QUV A;  5HQL A;  3BKF A;  5DLF A;  1C1B A;  2LU2 A;  3C6U B;  4EZ6 A;  1B99 A;  1N5T A;  3W5X A;  2X1F A;  2GVD B;  2OSR A;  1UJ5 A;  4USU A;  3PW7 A;  4JI8 J;  4LSN B;  4KJI A;  1H2V Z;  4C8Z A;  3R8Y A;  2AP6 A;  4MIW A;  1DFD A;  1KQG B;  2M5Y A;  2YKM B;  3N6N A;  4PWU A;  2IA6 A;  4JI5 F;  1U25 A;  3ILL A;  3Q8V A;  2BJE A;  2P2C B;  3MM5 A;  1KON A;  1FDN A;  4NYP A;  2OI2 A;  4O44 B;  2QSF A;  4A8Q A;  4WE1 A;  4BLG A;  4WKR A;  4J91 A;  3QGG A;  4U7U K;  4DFJ A;  3ZTO A;  2UUA J;  1VDH A;  2QYG A;  4AUK A;  1C1B B;  3M8Z A;  4QYZ K;  1YRT A;  1FDB A;  3UR0 A;  4XPC A;  1H2T Z;  5KFQ A;  3KLF B;  1X4C A;  3UPF A;  3DC2 A;  5D4L A;  2V4R A;  4LR7 A;  5DO2 A;  4EBE A;  4Q0B A;  3NBP B;  3GIL A;  3MTJ A;  1N0U A;  2FHJ D;  4DZD A;  4O3R A;  1TKD A;  1WF2 A;  1JJH A;  3KK3 B;  4KBI A;  4TYA A;  1HNW J;  3RZA A;  2IAJ A;  2CVE A;  1U02 A;  3QQC D;  4NZ6 A;  4X64 J;  3DLK A;  5ETV A;  5J1N A;  3ZC4 A;  4RUC A;  3EVO A;  1ZYQ A;  2XQC A;  2YX7 A;  3CJR A;  4HT5 A;  4F4Y A;  4KSE B;  3LAN A;  4P75 A;  3IXQ A;  2MTL A;  3R2D J;  1MML A;  1RT6 A;  2R3V A;  2HBZ B;  2W7A A;  3CJ0 A;  3QFW A;  2QLJ B;  5B09 A;  1G3O A;  4QR2 A;  4N8N A;  2XB2 D;  3KNG A;  2LEP A;  3IR5 B;  1NK8 A;  2W2O P;  2QLW A;  1G7C B;  3PXG a;  2DHA A;  2RS2 A;  1REG X;  3C46 A;  1VQ6 S;  2A0F B;  1X9W A;  4LVN P;  3PW2 A;  2D3O R;  1LK7 A;  3KJF B;  3S01 A;  4EUV A;  2W7P A;  4Z7Y A;  3MF5 A;  1LWC A;  1VQS A;  1VOM A;  4OZ2 A;  1PG5 B;  2VDI A;  4RL1 A;  5C5J A;  4C2M A;  3G6V A;  3EGV A;  1KP6 A;  1WC3 A;  3B8H A;  3EJM A;  2R2T A;  4DF8 A;  1EQ0 A;  5L1L A;  2FVC A;  3N79 A;  2D3Z A;  4I2P A;  3VTI A;  4IH7 A;  4UZC A;  3FMB A;  1YJN S;  2FY1 A;  5KFI A;  4FF3 A;  2D74 B;  1TKZ B;  2HQI A;  3GJR B;  1T05 A;  4TQR A;  4KAI A;  2PT0 A;  2P8I A;  4ZP8 A;  3OVS A;  3BGF A;  2DPJ A;  2VG5 A;  3HHL A;  2P5V A;  2PFD A;  3HKZ D;  4OIX A;  4DR5 J;  2KXN B;  4WTO B;  2QX0 A;  3M4X A;  5KTQ A;  2HS3 A;  3DHW C;  2MZS A;  3BPD A;  3IAM 9;  3MEE A;  4QZV B;  3K8W A;  2BBE A;  2LQ5 A;  3IWX A;  4HEA 9;  4I2P B;  2RSQ A;  5IQ6 A;  3HD2 A;  1A0O B;  3MM7 A;  3G6Y A;  3EIC A;  5I42 B;  3T1A A;  4PUO A;  3KUH A;  4LQ9 A;  3V5R A;  4DXL A;  3KK1 B;  3HZE A;  4ES3 A;  5HAN A;  2F4V F;  2HZC A;  2RQK A;  3CIM A;  2LDI A;  4I68 A;  1NRK A;  3FC9 A;  4CO4 A;  2WZ1 A;  2LYV A;  1NZA A;  1Q5V A;  2ZJP Q;  1RWK B;  1SQE A;  2MEW A;  4CO2 A;  3T5J A;  4IFY B;  1NLK L;  3AOA A;  4KH0 B;  3HVT B;  3EZ5 A;  4ICL B;  2G0C A;  1SJF A;  2Q1L A;  5LMN J;  1UEU A;  2R7W A;  5E3P A;  4FVC A;  3PRB A;  1BGX T;  2DNP A;  3SI8 A;  4DR7 J;  1DAX A;  2BKP A;  1RAG B;  5K8O A;  2IIH A;  4CP5 A;  1S1X A;  4FXV A;  2QL5 B;  4NCG B;  1REV A;  4TY8 A;  4Q5V A;  3QJL A;  3KDN A;  1WOP A;  1CJV B;  1RCX B;  2PEH A;  2QN6 B;  2ZE2 B;  2UV8 G;  3Q8Y A;  3NOC A;  3D54 A;  3MAA B;  3O1L A;  1GT8 A;  2B8Q A;  2H54 B;  3W62 A;  1U48 A;  1VC5 A;  3R2C J;  1HWK A;  3P96 A;  1TFW A;  2I5J A;  4C8K A;  1N5V A;  1OSC A;  1A6L A;  2NXJ A;  1HAR A;  3A8K A;  3TOQ A;  2KFN A;  3CE8 A;  4B9M A;  4RBT A;  1LQ9 A;  4D3H A;  1EJ7 L;  3NY0 A;  3W1Y C;  2HVZ A;  2CJ9 A;  2LVW A;  2X3G A;  1FA0 A;  1GX5 A;  5F8L A;  1W2I A;  3K59 A;  2CA9 A;  3MMB B;  2CIM A;  5A2Q U;  3LP1 A;  1REV B;  1XR7 A;  3EMT A;  1TL7 A;  1AUS L;  1SH3 A;  4FS1 A;  1RU2 A;  3ILJ A;  4K59 A;  1P6T A;  4DR3 J;  2X1G A;  3TZW A;  3CC7 S;  7AT1 B;  4CO3 A;  4B17 A;  4QWC A;  4YR3 A;  4YB6 A;  1N32 J;  1RTI B;  4LBP A;  1PJ5 A;  5KFL A;  3TAR A;  3SV3 A;  3W9J A;  4CLF A;  2FHO B;  1URN A;  3QIP B;  4FBU A;  3SBM A;  4HTJ A;  1YTY A;  1SH0 A;  1YJ7 A;  4PG6 A;  3PVX A;  1ZTW A;  1UVJ A;  1TV6 B;  4LSL B;  1AFI A;  2RIL A;  1LW0 B;  1WC0 A;  1RAE B;  2V2V A;  2KVQ E;  3PR4 A;  4I6A A;  1RTD B;  3D7S B;  4UT4 A;  2CPY A;  3KLF A;  5F41 A;  4A8O A;  2XSJ A;  5KFD A;  1VRQ C;  2B0G A;  4CLP A;  1VQO S;  1FX2 A;  4ZVG A;  4C97 A;  1J27 A;  1OSD A;  1SIW B;  1S0M A;  4ZHR B;  5J2P A;  3J81 U;  4OX8 A;  2QA4 S;  2F4V J;  1JWW A;  2AGQ A;  2DGS A;  2H5I B;  1UCN A;  4CQ1 A;  2FLP A;  3WC2 A;  5GAE I;  2HVD A;  3D6H B;  5IXU A;  2AJ4 A;  1K1S A;  1NJX A;  1OPZ A;  1LFP A;  3OPK A;  1C0T A;  2MQ8 A;  1XNR F;  3CD0 A;  2BV3 A;  1S49 A;  2FPH X;  4I4B A;  4M5N A;  3X3U A;  4M5D A;  4Y2M A;  3OL7 A;  1MWQ A;  1M5S A;  2DGU A;  1RTH A;  4Q7A A;  2JRS A;  3MXH P;  2GV1 A;  1S10 A;  2GC8 A;  2RNE A;  1R6V A;  3OXG A;  1WEY A;  1VRT A;  1OMS A;  4CIO A;  1Y5N B;  1RJJ A;  1VC0 A;  2WSE C;  3OR1 B;  3T1Y J;  3FEX B;  3OJU A;  4P10 A;  3UD5 A;  3M8W A;  3OL9 A;  3W2W A;  3BH6 B;  9ATC B;  2OLW A;  3KDO A;  3TWZ A;  5HN0 A;  3T3F A;  3ZTR A;  2OFH X;  1VBK A;  3JXO A;  3G86 A;  3LP0 B;  3BN4 A;  2M88 A;  3GU0 A;  4ECS A;  5HLF A;  1QVG R;  1IBL J;  2ZZM A;  4ZVE A;  3NL0 A;  1QDU B;  3C14 A;  2QRR A;  4FYY B;  4XIU A;  3KHG A;  3VAF A;  4TU9 A;  2ADB A;  3A12 A;  1D09 B;  4EK2 A;  1S1U A;  3BO3 A;  4CLK A;  4NPO A;  5ETT A;  2HHU A;  2KN4 A;  5E7O B;  1RLC L;  2ACM A;  3RBZ A;  3M6U A;  1FDD A;  2V4J B;  2E66 A;  4KB7 A;  2EC2 A;  2R42 A;  1HYS B;  3DOL B;  3MAA A;  2AJ0 A;  4WYL A;  2C3O A;  2HQG A;  3IG1 B;  3GQC A;  2XG8 A;  2CPF A;  1GXL A;  5ETM A;  3ZZO A;  1VIX A;  3E01 A;  1TQL A;  2VFT A;  3DLL Q;  3B54 A;  5GVQ A;  5HP1 B;  1GAO A;  2NUH A;  1WOO A;  4JV5 J;  1WWH A;  2DGX A;  4J9K A;  1N5S A;  1WG4 A;  3LUY A;  3R7S B;  1VJQ A;  1R8B A;  5T7L A;  2QA1 A;  1TKZ A;  2H3E B;  4W4M A;  5JXS A;  4NMX A;  1WD6 A;  4OZ3 A;  2E5I A;  3DCA A;  3WBZ A;  2HFV A;  3BGO P;  5MLC V;  2G4B A;  2QLB B;  3DRS A;  4Y3C A;  4G1Q B;  4DPW A;  1HI8 A;  3BO2 A;  5KFR A;  2UUB F;  1L3V A;  4USJ C;  3BSC A;  1RT4 A;  1D9D A;  2VG6 A;  4BCA A;  1KD1 T;  2OPQ A;  3HHD A;  2C42 A;  3NOG A;  3QIP A;  3KUE A;  2W4C A;  4WP9 A;  2J0S D;  1TL1 A;  4G3I A;  5K14 B;  2I6W A;  1PAE X;  4JP8 A;  3UE2 A;  2E5G A;  3BH7 B;  3OD2 A;  4ED6 A;  3CF5 Q;  5KT7 A;  3KLG B;  3GB0 A;  4I7F A;  3GV5 B;  1TL4 A;  4IFV A;  5BYS A;  1PIL A;  4RU2 A;  4YR2 A;  4RJV A;  3EX7 B;  3TR5 A;  3N6L A;  2QL7 B;  4DV2 F;  2GHW A;  4PWD B;  1YJU A;  2FZG B;  2VG6 B;  3VAM A;  4KRW A;  3KLE A;  7FD1 A;  1TK5 A;  3Q22 A;  3PW0 A;  3ITH A;  1X0P A;  2YWE A;  3DDK A;  1U1M A;  2IM1 A;  1S1W A;  4UTG A;  1PYO B;  5CYQ A;  4C98 A;  2BRK A;  4V19 X;  5B0A A;  1BE4 A;  4NRT A;  3SQG B;  2YH1 A;  9RUB A;  4TY8 B;  2XNQ A;  4QW8 A;  2P9E A;  4DR4 J;  5D4P A;  4HLB A;  3AJ1 A;  3MCS A;  4U96 A;  2XMJ A;  4AT1 B;  5IV3 A;  1HD1 A;  2E7V A;  4GMK A;  1RIS A;  3QT8 A;  4AL6 A;  2XY7 A;  4WZM A;  1LW2 A;  1IUJ A;  1C0U A;  1K47 A;  1NDP A;  3NCP A;  4OI4 A;  1YQH A;  1SL1 A;  2FHK A;  4RW8 A;  2R7R A;  2B56 A;  1FF2 A;  2RE1 A;  4DL6 A;  3SIP B;  4R0E A;  1HQ2 A;  2F8E X;  3SCL E;  3GYX B;  3MM8 B;  2D3O 1;  1FRL A;  4J37 A;  4O4G A;  2BAN A;  4Y2A A;  4KFB B;  3FVY A;  1IQZ A;  3GR0 A;  3SQG A;  2YVS A;  3T9Z A;  2AEJ A;  1N6Q B;  1T7P A;  5BR8 F;  2XHC A;  3TA1 A;  3FGV A;  3ZZR A;  5LXY A;  3BRE A;  2ZUG A;  4QIF A;  3PIP Q;  1S9F A;  2BMB A;  1CBK A;  2NSC A;  2IY5 B;  2GX8 A;  4DS4 A;  3CJQ A;  4DPX A;  4ED7 A;  3AQO A;  1IM6 A;  3CMQ A;  3NLC A;  2OSQ A;  1S72 S;  3VAL A;  2VQE J;  4TKT A;  3ICL A;  2X1B A;  2XGQ A;  3RTV A;  1QAI A;  3CGI A;  1CVJ A;  2FC9 A;  3LWM A;  4LF1 A;  3G8T A;  1JXL A;  1FJG J;  1T9Y A;  2WAQ D;  3MUV P;  1VQ9 S;  5L8R C;  4NE9 C;  2VPW B;  3PO4 A;  2V8H A;  4CWB A;  4DU7 A;  3KLV A;  3H5Y A;  2HHH J;  3BO4 A;  2EBG A;  4LF5 F;  4Y00 A;  2CPJ A;  2ILY A;  2ZVI A;  3JYT B;  4JYA J;  2K2P A;  2OTL S;  1YIT S;  2EWH A;  4F67 A;  2F8M A;  3BSA A;  2EFQ A;  1FWP A;  2E5J A;  3W7B A;  1T3N A;  1UVM A;  1NKB A;  4C0H A;  5DQH A;  2NXN A;  3N28 A;  3VVT A;  4B9L A;  3TI0 A;  2CAJ A;  1QSS A;  3POT B;  3D0G E;  2GMH A;  3LP2 A;  3C14 B;  4NLQ A;  4DX5 A;  2C28 A;  4ECU A;  5IT9 U;  1RT1 B;  3Q2T C;  4R0J A;  1OY6 A;  1TTH B;  1ZZF A;  3VV2 B;  2D69 A;  4KGM A;  3MEC A;  3AOD A;  4C11 B;  2VU5 A;  3US5 A;  3QWP A;  2OD4 A;  4CLW A;  3V6K A;  1DQ8 A;  1Y5L B;  2UU9 F;  2XTJ P;  1Q4R A;  1SXL A;  3H20 A;  5ETO A;  1U0S A;  4DCO B;  4AQY F;  5KG6 A;  1NHU A;  2BEF A;  4NLT A;  1GMU A;  1R31 A;  1URR A;  4FYW B;  2VPY B;  2XBP A;  4USH A;  1PJ6 A;  1RHR B;  3CCZ A;  2ZHB A;  1RP5 A;  8RUC A;  3HFK A;  3THT A;  3C19 A;  2SXL A;  2Q6C A;  3D9B A;  3G4S S;  3CCV S;  2MKJ A;  4EYI B;  4ZLL A;  1PBU A;  2J0X A;  3C16 B;  4HAC A;  3T6B A;  4F3M A;  3Q0A A;  2R8G A;  3FRZ A;  2ZDP A;  5K5M A;  1FNM A;  2AJQ A;  3CCE S;  2Z56 B;  3KK1 A;  1HBO B;  1MWY A;  5LMN F;  4DSL A;  1M5K C;  2CJA A;  4M5K A;  1TMJ A;  3D1O A;  2B51 A;  3L9Z A;  3DRS B;  4KO0 A;  4FNH A;  1XWL A;  3J7Y U;  1NSP A;  2QEX S;  3PX0 A;  3VF0 B;  1FRM A;  3PFO A;  4DV1 J;  2ZZT A;  1DHM A;  4L75 A;  3DI6 A;  1YGY A;  1R43 A;  1NPR A;  1UPM B;  1X4A A;  2HVE A;  2M9K A;  2H5J B;  1CG2 A;  2DBB A;  3N4W A;  2KRR A;  4RU9 A;  1U49 A;  1RWW B;  4FN5 A;  4YY3 F;  4MK9 A;  1C0U B;  4OZJ A;  4M5I A;  3OVA A;  3JSM A;  3ZZT A;  3G9C A;  4EFA C;  2E9R X;  5K14 A;  1ZBT A;  2HBY B;  4P52 A;  4NXM J;  2Y8Y A;  1OWX A;  4PKD B;  4OX9 J;  1V3S A;  5DDR C;  4HI1 A;  1L3T A;  3HXM A;  5D3G B;  1UVI A;  3ZFV A;  4DCP B;  2MZ1 A;  3G8Q A;  3QT5 A;  4P73 A;  2KB2 A;  4FYV B;  1JJ2 R;  1U1P A;  4FXD A;  1WHV A;  5F9L A;  1WHW A;  4WFN Q;  1UEK A;  3WZ0 A;  1Q82 T;  2FVS A;  2M8H A;  4O3S A;  4TLR A;  4ZVF A;  4FS2 A;  3MOJ B;  1JXE A;  1KWM A;  3DOM A;  1ZS6 A;  1U2F A;  1WDD A;  2H51 B;  2YPZ A;  4G1Q A;  4WBF A;  2K7J A;  3D3C J;  3J81 j;  2CYY A;  1JX4 A;  1EIY B;  2AHO B;  3CSK A;  1VR6 A;  4XPE A;  4NWB A;  4OI1 A;  4LF4 J;  5SZT A;  2ZH3 A;  1JJC B;  1H72 C;  4LSZ B;  5B7W A;  1SV5 B;  4C8N A;  4JUZ A;  4USM A;  2MQL A;  1HNV B;  2DO4 A;  1HMV A;  1HD0 A;  3AHP A;  3P5B P;  4RNH A;  3W2V A;  2KO1 A;  6FD1 A;  2W8K A;  4LFA J;  2NPF A;  1U45 A;  4ZP6 A;  2E9T A;  5HAO A;  2I8E A;  1ZM9 A;  3J7Z 5;  1Q5Y A;  1EKS A;  3W61 A;  3JSY A;  3A3N B;  3JTO A;  5HVH A;  3D6F B;  2ZFH A;  2UUT A;  2FJE B;  3DOM B;  3EUN A;  2U2F A;  4H54 A;  1FCA A;  2FDN A;  5EGY A;  4LT6 A;  2OTJ S;  1IM4 A;  2O3D A;  3DKD A;  3PDN A;  3KK3 A;  1ZET A;  3M6X A;  3TEG A;  2XLK A;  3KLE B;  4J9O A;  2NUU G;  1B7F A;  3BV8 A;  2KVI A;  3NCQ A;  3QRQ A;  2FJX A;  4DR3 F;  2ZWP A;  4LUB A;  4DPU A;  2G0I A;  1R0C B;  4K2J A;  1HI0 P;  5F8N A;  1WF1 A;  5KFF A;  2IC3 B;  2HIQ A;  2WOM A;  2HEK A;  3N5B A;  2E5L F;  4GKK J;  1HHT P;  3C3L A;  3TEH B;  4LR8 A;  3KHL A;  3EPI A;  3UFC X;  4B9N A;  3DRR A;  1UVL A;  2U1A A;  2UXC F;  3HHE A;  4DQR A;  5A8R A;  2CPH A;  1N0V C;  2RS8 A;  2XC9 A;  1IKV A;  3I4H X;  2VOD A;  4P2M A;  1FHT A;  2B4V A;  4C3M A;  4P71 A;  4M5D B;  1NHK L;  2GGP A;  3VQT A;  4Q0B B;  1N8R T;  2FVQ A;  2BUN A;  4NLU A;  1RGV A;  4HTI A;  3HHL C;  3NBP A;  1TMM A;  4F4X A;  2EXU A;  1KKH A;  2B43 A;  1RAA B;  2FLO A;  2WHO A;  4LF8 F;  5J2N B;  4CO5 A;  2W24 A;  3EGN A;  3BR9 A;  4MFB A;  4C7Q A;  3L4B C;  1XMQ J;  4DR2 J;  4KV8 B;  4LMZ A;  2NLW A;  2ZC4 A;  5H9F K;  5HVF A;  2BAC A;  1JLQ B;  2L3M A;  3OSN A;  1RTZ A;  2JX2 A;  1JKH B;  2RH3 A;  4DSI A;  5CD4 A;  5C42 A;  4IG3 A;  1WEZ A;  2XS2 A;  3FBB A;  1FKO B;  5D4O A;  4N56 A;  1GQE A;  3ELH A;  3MR3 A;  3HLU A; 
#chains in the Genus database with same CATH homology
 2C1E B;  2H54 B;  4ZVS B;  2XYG B;  2HBR B;  2XYP B;  3GJT B;  3GJQ B;  2HBQ B;  3RJM B;  1RHQ B;  1RWN B;  2CNN B;  2P2C B;  2H65 B;  2XZD B;  2H5J B;  1ICE B;  2Y1L B;  1RWW B;  2CJY B;  3IBF B;  3R6L B;  2FQQ B;  2QL7 B;  3P4U B;  2HBY B;  3NS7 B;  1RWM B;  4DCP B;  1PYO B;  3IBC B;  1I3O B;  2QLF B;  2CJX B;  1RHJ B;  1BMQ B;  2DKO B;  1RWX B;  2H51 B;  4ZVQ B;  3EDR B;  2XZT B;  1RHK B;  1QTN B;  1PAU B;  3R7B B;  4LSZ B;  1RHM B;  2HBZ B;  3SIP B;  2QLJ B;  2H5I B;  2C2K B;  4DCJ B;  1RWO B;  2QL9 B;  3D6H B;  3GJS B;  3KJQ B;  5IC4 B;  3KJF B;  1RHU B;  3D6F B;  3P45 B;  4ZVU B;  1SC3 B;  4ZVT B;  4JB8 B;  1RWP B;  2C2O B;  2CNK B;  2CDR B;  4ZVO B;  2CNL B;  3GJR B;  5K20 B;  2C2Z B;  1QDU B;  3R5J B;  4ZVR B;  2H4W B;  3R7N B;  2CNO B;  3KJN B;  3D6M B;  1IBC B;  2XYH B;  1RWK B;  1SC4 B;  1RWV B;  2H48 B;  4DCO B;  3R7S B;  1NME B;  1SC1 B;  1RE1 B;  1F9E B;  5IC6 B;  3QNW B;  1GFW B;  1RHR B;  4ZVP B;  2QL5 B;  1I51 B;  2C2M B;  3EDQ B;  2H4Y B;  2QLB B;  3R6G B;  2Y0B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...