3GJQB

Caspase-3 binds diverse p4 residues in peptides
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Caspase-3 subunit p17
total genus 20
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3gjqB00
3GJTB 2XYGB 2QL7B 2H4WB 2CNNB 2C2MB 4ZVPB 3IBCB 3GJSB 2QL9B 2C1EB 1F9EB 1RWXB 3D6FB 3QNWB 1I3OB 2QLBB 4DCJB 2H51B 3P4UB 4JB8B 4ZVSB 1PYOB 3KJNB 4ZVOB 4DCPB 1I51B 5K20B 5IC6B 1SC1B 3R7SB 3D6MB 2QLJB 2C2ZB 2CJYB 4LSZB 1QDUB 2H5IB 3GJQB 2CNLB 2CJXB 3R5JB 1RWWB 2H65B 3GJRB 2XZTB 3SIPB 2XYHB 3R7NB 1RWVB 1RWPB 1ICEB 1SC3B 3RJMB 3R6LB 3R7BB 2CNKB 1SC4B 1RHQB 3EDQB 1NMEB 1RHKB 1QTNB 2P2CB 2C2OB 1RHRB 2Y1LB 1PAUB 1RHMB 4ZVTB 1RHJB 2HBZB 1BMQB 2H48B 2QLFB 3D6HB 5IC4B 2DKOB 1RHUB 2FQQB 3P45B 2Y0BB 1RE1B 2XZDB 3EDRB 2H54B 1RWOB 2XYPB 2HBRB 3KJQB 2HBYB 3NS7B 3R6GB 2C2KB 2H5JB 4ZVQB 4ZVRB 1RWKB 1GFWB 4DCOB 2CNOB 3IBFB 2CDRB 2H4YB 1RWNB 4ZVUB 2HBQB 1RWMB 1IBCB 2QL5B 3KJFB
chains in the Genus database with same CATH superfamily
4TYBA 1WKKA 2DIUA 4M5HA 1F2HA 2XS7A 2MQOA 3T1YF 3M8YA 1KC8T 3Q8PB 2BKOA 3ISZA 5E3AA 2RQCA 4UY8T 4P72A 1EZZB 2CPJA 2XMVA 4ID5A 1R7IA 4NLGA 3M1VB 1KVIA 2MSSA 3DDKA 1EB0A 1TL4A 5EX3A 3QO9B 3TO8A 3TARA 1RTJB 2OPPB 4ES3A 4DR7J 1F5BA 4X4SA 2M9KA 5E3RA 1R0BG 4EMDA 3U02A 1VRTB 3UI3A 3QSIA 3D6FB 4DPOA 1I3OB 3P5BP 1NM2A 2Z30B 4FZVA 1K1QA 4FBTA 4L6V3 3P6YC 5J2PA 3HX9A 4ZVGA 5J2NB 1T3NA 1LV5A 2I1RA 4ZPVR 2WVBA 4JI4J 3TI0A 4DFPA 3UDCA 4IH7A 2VFVA 3M6WA 2LA4A 3OTCA 3MM9B 3OR1B 3TWZA 2UUTA 1WI6A 4CM0A 2BE9B 4R5PA 4BS2A 2YNIB 1GX6A 1NK5A 3HJVA 4CTAA 3A8EA 3I0SA 2JFKA 5KFJA 4F8RA 1ZAVA 2MZJA 2W2NP 1S7HA 1CJKA 3GILA 1PGZA 5BR8J 4CLKA 4OJ3A 3W9HA 3UQSA 2BEFA 2JVRA 4CZCA 5J2MB 4K4TA 4KO0B 4DS4A 2ZOMA 1SJ3P 3WIVA 4MKVA 4EZ6A 3VAHA 2Z58B 2Y8YA 4CDIA 4K0KF 1OY9A 3TVYA 1EKSA 4UUXA 1F1BB 4C7QA 8AT1B 5I4MA 1M5OC 2C2NA 3EVMA 4G1QA 5AE3A 2GA7A 1HQUB 2VF3A 4CNYA 4X4TA 4C11B 2J0SD 2DGSA 4UTGA 2LQBA 2MZTA 3T1HJ 5IT9Y 4LFBJ 2WOMA 2RVJA 3DRPA 4HT7A 4NA3A 4B17A 3ADAC 4RNNA 3KLEA 4X4OA 2VQEF 2EVZA 5CA5A 1TKZA 3R7BB 1S5ZA 2KT3A 1D3WA 5DLGA 1ZETA 3OR2A 5GAEU 2LDIA 4F4XA 4IRDA 3C6TB 4F67A 5HLFB 1NKCA 4HYKA 5D77A 2NXJA 1F0XA 3GSIA 4MIWA 3NBPB 1MLAA 5LL6d 3O5TB 5DQIA 1XMOF 2C2OB 1AFJA 2CJQA 3PX0A 4NA1A 3RR8A 3DC2A 1Q5YA 2IRUA 2NLWA 3K17A 4IDKA 3CD0A 4S0MA 5K9FA 2R7RA 1JLAB 2E5HA 3GFXA 4BWMA 4DN9A 1PBAA 2ZHBA 1VFJA 2F65A 4M5KA 5A0YA 3BQ1A 1TL3B 3TUJC 1EQMA 1TU0B 2CJAA 1KFDA 4CNZA 2HLTA 3MM6B 3PX4A 3MUVP 3EUNA 1SKRA 3OPKA 2PEHA 4DU7A 2I2YA 2J6TA 1HD1A 4J9PA 4ED1A 3OUYA 3LP1A 1FRLA 3W5ZA 1SC6A 2W25A 4N77A 2FJEB 3MMAA 5EN1A 4B3TJ 2K7JA 3I6PA 3P96A 5A8WB 2NUUG 1JLGA 3EDRB 1GEHA 5KTQA 2QA4G 4OJHA 2AIRB 3I4PA 4FXWA 2CQ0A 1W26A 3TP2A 3KHHA 3BBCA 4LVNP 4ELTA 3DGPA 3J7AN 1S9FA 3R1LA 1FK9A 2E5IA 4ED6A 1IVZA 3FRZA 2GIRA 1PKUA 3M8QA 4XTTA 1CS4A 2UXBJ 2DRAA 2CQPA 4J9RA 2HVEA 1X5OA 4HHUA 2HAIA 3DOLA 3R5AA 3G6ES 4OI4A 5HP1A 1VQOS 4O0IA 2HS0A 2VU5A 4OIXA 2R7UA 1IJEB 5L38A 2XC9A 4NLTA 1BQNA 1VRUB 1SQFA 4NA2A 5L9XA 4ZLJA 4N56A 1VQ9S 1RKJA 2FUG9 4RNFA 4OX8A 1X4FA 3OVBA 4ZHRA 3JSRA 2FJVA 4Y28C 2AYMA 1OSCA 3I0SB 1S1VA 4F0HA 5A8KB 2GGPA 2JHEA 4R8UB 1IBMF 2BQUA 1SV5B 3PJXA 4ES2A 5DGAA 4KHPJ 1D09B 2N3LA 1WSRA 4FYWB 1N0UA 4DV2J 1H38A 1S9EA 3PHEA 3PIOQ 2W2MP 1YZ7A 4NLPA 1IN0A 2BABA 1C1BA 3DLGA 1LW2A 4LRBA 3HHLC 4ELVA 1B64A 3HM9A 5LXRA 4K7QA 1JJHA 1FWPA 3N0VA 3KNGA 1V5IB 2HSEB 4AXJA 1FRMA 3BYPA 4DFMA 2R8IA 1UEUA 2V4RA 4KH0B 3LGMA 1N48A 4LF6F 2BVZA 5IT4A 2QJ3A 3M1VA 1PYOB 3NGTA 2AX0A 2HFSA 1RLCL 3DYAB 4IOBA 4EO8A 1X5TA 5LMNJ 2F4VF 3Q8YA 4BHQA 4U95A 3HXMA 1GK8A 2CIMA 3AT1B 4DV3F 4QWEA 3IWXA 3LALA 2MY7A 4MIBA 1YGYA 2Z56B 3T9NA 1FT8A 4DV4J 3KFWX 5FJ4A 1L5UA 2VFSA 1RT7A 1S1TB 2ZUAA 3FRYA 2LXIA 3A8KA 3OD2A 4Q43A 1S72S 4USIA 3TEGA 2V8PA 2HHTA 2E1MC 1DTTB 2ZHOA 5J2MA 3U1NA 1L3VA 3I96A 4K0KJ 4I4BA 4LR9A 3VAGA 2DY1A 1ZH5A 1Z1ZA 2Y1RI 3TVZA 5SUHA 3GIIA 1JK9B 2DH8A 2CNLB 2YNIA 3IRWP 2CJXB 1RWWB 3OR1A 2L3MA 3W2WA 1FNOA 4NLWA 1Y3JA 1YWXA 2XI3A 3MEGA 4N8NA 3W66A 2LA6A 2BJEA 3D0HE 3GV5B 1U6BA 2M7SA 2OMOA 4FP9A 2VFTA 3JQMA 3PYGA 5DS7A 2QYGA 1VC0A 3GONA 3H8YA 4TKTA 2FHOB 1MMLA 3ZZUA 3MCMA 4OI1A 1FNXH 4GKKJ 1H0HB 2HIYA 5JVHQ 2ZOGA 2OP5A 2UXCF 1OSDA 2UV8G 5I3PA 3TANA 1TL1B 1DQ9A 3EMTA 4XDDA 5KFAA 2MPUA 5THWA 3BGRA 4RU9A 1HQEA 4O3QA 4DX8H 2HMIB 4IQXA 1FNMA 4LQ9A 2GQQA 4TY8A 2R2SA 4EBEA 4DV2F 2ALZA 2IRXA 1P1LA 2CQDA 1RACB 2NXUA 4WFYA 2Y1LB 5HVHA 1F9FA 1VBZA 1KRPA 2R8GA 5A2QU 3DHXA 4EU0A 3NL0A 4DFKA 3OFFA 5RUBA 2J9DA 5BXIA 4ETZA 2DK2A 1WF0A 3J7A1 1UWAA 3KNAA 3BYRA 1NSQA 2ZNYA 2R3VA 2QIFA 4CLTA 1UJ4A 2PDAA 4M5JA 2WAQD 4A8QA 2RRAA 2RQKA 4FDFA 2KFNA 4DG1A 2PI4A 1T9UA 1B0VA 2YX1A 2YH0A 3HDSA 1UVIA 3CE8A 2P9GA 1VCTA 3IG1A 3NS6A 4NLVA 1Q79A 1HPZB 4USUA 2LQJA 5CXTA 2WRMA 2HK3A 1FVSA 1UETA 2DNPA 3VTIA 4YDDB 3K5LA 5KFNA 1TK8A 4B08A 4M95A 3LP2B 4QPXA 3M8WA 1WEYA 4JI3J 1SB6A 2XQCA 1KS2A 2G2YA 5E3QA 4QWAA 3NS7B 3KLIA 3R6GB 1CJVB 2H5JB 3FFIA 4LBIA 3L95X 1NU4A 1FRHA 2POKA 2VPXB 3QIPA 5IQQA 5KFMA 4DU8A 5F8NA 3QJJA 2CQ3A 1Y11A 2CDQA 3I32A 2CDRB 2H4YB 2JNJA 4DLEA 2XSJA 1R0AB 4FS2A 1QSLA 1RWNB 3N01A 1NPPA 1JLQB 3AOBA 4LJMA 1L3TA 4MKYA 3DRSB 4FN5A 2VG7A 1NCLA 3KWMA 4Y3CA 2PMHA 4DX5A 3GIJA 4GKKF 2GMHA 5BYRA 5KT4A 3BS9A 1RYRA 3WC2A 3RRGA 4DL6A 2ZVIA 2JEGA 1X9SA 2IHR1 4HTIA 5CCLA 2QL7B 3NOGA 3C46A 5C7PA 1RBAA 3KMQA 3OJUA 2YKPA 4DR1J 3R2CJ 1SBRA 4TLRA 3K5NA 2CKWA 3EJMA 2DXDA 1SJ4P 4LFAJ 4KKOB 2VA2A 2FY8A 1BHNA 4Z7YA 1UA0A 3IGNA 3QATA 4LR8A 4R25A 4K2JA 5CQGA 4ZN1A 3H98A 2HIQA 3QNWB 4WJBA 4KGZB 1YX2A 3H2UB 4KC5A 4WZQA 1JLFB 2B5JA 1B3TA 2YTCA 4IOAQ 2A0FB 2VJVA 3N6MA 1S6PB 3C6UA 3EGVA 3HSJA 5JMNA 4XPEA 4C8LA 5KOWA 4J37A 5FIIA 3QJLA 2NZ4A 3EVOA 4F4KA 4F3QA 2F4VJ 4KFBA 4LF2A 2FIUA 4OQJA 1WDTA 1ZM4A 2P8IA 1I5OB 2AJFE 4O3PA 3R7SB 2BOAA 1UWBA 5D4LA 1S4FA 1R8AA 3N28A 5ETLA 4AE5A 4A46A 3CCZA 3SBMA 3Q8RB 3MFIA 5KFQA 3CUNA 3Q23A 1T03A 1J5OA 2R7SA 1WHVA 3B78A 1FRIA 2JLGA 3PJ9A 3DI6A 5KG2A 2DR7A 2KG1A 4RWWA 3C16B 2C2ZB 1HHTP 2IM3A 1BE4A 4J9VA 3CDAA 2F8EX 1WHWA 1DTTA 2B8QA 5B0GA 4OJGA 3M2RB 3PTWA 2WK4A 2LMIA 5E3CA 1ZM2A 1VC5A 2R7XA 3NEKA 4ERDA 4B3OB 2AX1A 4B9VA 3VGTA 5E2QA 4ZCLA 1N5SA 3CJSA 2YH1A 3BSOA 2UP1A 3VALA 4LF7J 1UFWA 4Q7AA 1C2PA 1C0UB 1P1TA 3V81A 3N5BA 1OMSA 2BX6A 2VONA 2HNDB 2HWIA 5KT3A 4GVBA 1X4CA 1YHQS 4ICLA 1F3FA 4YOEA 1RYSA 4JI4F 3W64A 6FD1A 1QAJA 3RAMA 2DEIA 2VC1A 4CI0B 1RLDA 1S6UA 3OL9A 3G4SS 2DNZA 4UOCA 1IBKF 1NK7A 1RHRB 3QZ8A 3HT0A 3RB4A 4LF5F 9ATCB 1GXTA 5F8MA 3R97A 2L9WA 2XWXA 3HD2A 2DNKA 3M2UA 3OXGA 3S01A 3GSDA 2W9BB 4RBUA 2QFJA 1KEKA 2JC1A 3OVSA 3FBFA 5KFUA 2L48A 3KK3B 3MUTP 2W2QP 4X62F 1N5YA 1X4EA 1CEZA 2ACMA 2G13A 2QSFA 1H73A 5HN0A 3KK1A 4WF9Q 3G8TA 3OXLA 1XTZA 1GTHA 1B0PA 1VR6A 3FSXA 3MECA 4I56A 3KG4A 2JEFA 4C0HA 1SL2A 2DGQA 1R6VA 5L39A 5SZTA 1TAQA 3U27A 4IRKA 2E1AA 4GVBB 3B82A 1UKUA 2ROGA 1RAJA 2HK2A 2VPYB 3EZOA 2X3GA 5J1NA 3HULA 4ETXA 2PO4A 4LFCJ 3PRBA 2FTRA 2IVMA 3MTKA 4HTJA 4I6AA 3MURP 4LF4J 3E01A 2EXUA 2EG1A 1MWYA 2YVSA 2ZM6F 1R8HA 4Y65A 2Z2ZA 3EXCX 4DL0C 2CQ2A 4WE1B 4DCOB 4O3NA 3C16A 1S1XA 3CCES 1WD6A 3J80Y 2UXCJ 4KGVB 3HHEA 5CYQB 4C8OA 2MJNA 4F4AA 5KT6A 2E9ZA 2B3TB 4P2FA 4U6PA 3KK3A 1I94F 3G8QA 2ZWOA 1CVJA 2M88A 2EFQA 2BJDA 3GJTB 2BBEA 2B4VA 1UW4A 2PD1A 1UJ6A 5D0RA 1L3UA 3IGVA 4OV1A 2BW7A 2HAFA 2NXEA 2WW4A 1V3ZA 1BWEA 1X4BA 2QEXS 3BJYA 1JLCA 2G2OA 3QGIA 1FE0A 4P2SA 2B7BB 1S1VB 5KFPA 5AXLA 2HNYB 4DL3A 5F8JA 1X4HA 1CG2A 2IAJA 1R89A 5IOLA 1DJ0A 2V9KA 5F0WA 4P2MA 1U4BA 1IR2A 2HNDA 2V4JB 1QVGR 1BUXA 5HVGA 2KTQA 2FC9A 1SI9A 1WSVA 2EPIA 3KJNB 2Z8QA 2FHKA 3Q2SC 2GZOA 2A3JA 4G6VB 2V4QA 3BSNA 2HHWA 2XMKA 2DNQA 4OHZA 2UUWA 1U6FA 3K2YA 4HR2A 1FK9B 2OSQA 2W1BA 4KGXB 4NLQA 1NXIA 4O44A 1FKOA 2A2DA 2KXFA 4F3MA 3SDEA 5CCMA 2XGQA 2BMBA 2NS1B 1UFLA 3MPYA 3NGDA 2V94A 5A8WA 3BZQA 1HWLA 5I42A 2X7IA 1VBXA 4O3SA 1TFYA 2RKIA 1FJ7A 2XSJB 1U8WA 3HKWA 4ZVFA 4OI3A 3O2IA 2N7CA 4DUYJ 4J9LA 4TN2A 1HNZJ 1JJCB 4NASA 1IR0A 4U96A 1LWFB 1YDLA 1D1UA 1QDUB 1UPPA 3AD7C 3DHWC 1CJTB 2CQ4A 3P3DA 4CLPA 1CJVA 3FFIB 1UEKA 3CDWA 1LWCA 3GJQB 3G71S 3HVWA 5LSOA 5B0CA 3VAMA 4NLRA 4NRTA 3WZ0A 4AQYJ 3BKUA 1RP5A 1TKXB 5CD4H 4ENOA 3LWMA 4FS1A 4NE9C 2R2TA 3B4MA 4L75A 2QLWA 3GIRA 3RU0A 3VF0B 1BY9A 3CJ0A 2CNKB 3ZZ0A 4IG0B 3Q22A 2RU3A 4DR2F 1HMVB 2QX0A 2M8DB 1RHQB 2DR6A 2BKPA 1HFEL 2H3EB 1VQYA 4TYAA 2HZCA 2EWHA 2ZBPA 2O3DA 3FZ2A 3QFWA 2I6WA 3ZNUA 3TQ1A 3K59A 1NK9A 1YRTA 4Q8EA 4FXVA 2OPRA 3TZWA 5F41A 2LDYA 4JI1F 2A2CA 4R0JA 2HQDA 1URNA 4BDPA 1RHJB 3D3CJ 3DLJA 4IQMA 4FKXA 2WVEA 4Q2MA 2GNKA 3D68A 3D0GE 5EWEA 3N6LA 1RI7A 3HKZD 3VGUA 4B3MF 3TUPA 1NUEA 1W2IA 3SSRA 4B3TF 5CH7B 1S57A 3QMQA 2HMIA 1K73T 2DKOB 2FB0A 3CJ4A 3MWBA 4ANEA 4DV1J 2AV5A 4MK9A 2RMLA 5LJ3Y 1FXRA 3CMES 2VA3A 1U0HA 2FLOA 2R8KA 2F3JA 9RUBA 3JTOA 4MIAA 1BD6A 4IH5A 3TQEA 1TAUA 1VQ5S 2GJFA 1SH0A 1RWUA 2HRUA 2BACA 3AD8C 3PW7A 1TP7A 4CLWA 4IG3A 1BWVA 4RWXA 1OY8A 4DPXA 1OYDA 3CTRA 1UPMB 1NJIT 2NXCA 1FFWB 2MDAA 3ENWA 4KBIA 4CLLA 1HLWA 3FDSA 1IBKJ 3NLCA 5J2QB 1VS3A 1U1KA 4PQAA 3BN7A 4NCGB 1F3VA 2V5HG 1V3SA 2EEYA 1JXVA 1MN7A 3CCTA 1LNQA 2MY8A 3L7PA 3LAKA 1JLBA 1JJ4A 1UVLA 1JIHA 2B4OA 3P8BB 3KKFA 4NLUA 1VOMA 4Y00A 3OJSA 5KFLA 3M8PA 1HQ2A 2XYGB 5H9FJ 4AQYF 4QYZK 3QFHA 4NRUA 3TA0A 1Q16B 3KXDA 3S7RA 5DDOC 3FBBA 2CNNB 2C2MB 1U1OA 4I68A 1RT1B 3PV8A 4QIEA 1KTVA 3QWUA 4ILLA 1DLOA 1RT6A 3DKDA 1HQEB 4OZJA 1MSWD 3KUEA 3PACA 1F9EB 4X4UA 4M8LA 1X8DA 4Q2LA 2ZKTA 3H25A 4DF8A 1RBLA 2COLA 2IIHA 3ZTSA 2RS8A 3MR2A 4ZPAA 3ILLA 4DJBA 1X7VA 3DMJB 3MR3A 4DV5J 5LOQA 1M5KC 2RDJA 1Q82T 1PSDA 1DURA 1HWJA 2RIJA 1RJJA 1UTAA 2W2PP 3LH2S 5KG6A 3MM8B 2DH7A 4H54A 4MMOA 2E9RX 2AJQA 4XPCA 1NNDA 1ZS6A 5EWFA 1VMBA 2DT9A 4DV0J 5C42B 2B4PA 2DNRA 1RAEB 4F26A 3AJ2A 1IKYB 3HHLA 3JTNA 2ASDA 4DLGA 3W61A 2EFNA 1AZSA 4ZIVA 2IMWP 1VBYA 1G6BA 1VYAA 2M4MA 2VL1A 2IM2A 4DOZA 1WORA 3M32B 3BO4A 1SQEA 1JMTA 2F63A 3FEXB 3UR3C 1QTMA 4IFVA 2CPYA 3MOJB 3BDPA 2MKKA 3NWGA 2QMXA 2YKQA 3GYGA 4RBTA 2KB2A 1FRJA 3R5GA 1YRUA 4O4GA 4X4QA 2GO9A 3I82A 2XZTB 3QGHA 1UVMA 2V67A 3IBWA 1FKOB 4PKDB 4HKQA 1RWVB 3JSYA 4OYMA 3POTB 4RW7A 4B02A 3KJVB 1JJ2R 1F5CA 3ZC4A 1B70B 2E5LJ 3C19A 1SQGA 1IKXB 2MMYA 1FXLA 4OLPA 5EHHA 4F4YA 1SC4B 4I2PB 2J6SA 4OZ2A 1FWLA 3AODA 2XLJA 1S1UA 3A1YG 3M2VA 1T05A 1Z2ZA 2LP4A 2DEJA 3M6VA 4ZJOA 4ECQA 1U7LA 4X84A 4NPOA 4OFZA 1FWKA 2WONA 1RAFB 4R8UA 2K1RB 5IQ6A 4PYAA 1BQMB 2J8AA 1S1WA 3H5UA 1YKWA 4N7TA 2ZUGA 1BQMA 3KG0A 4NLYA 3AB2B 3N79A 4G3IA 1JLCB 4IOCQ 1TKXA 2XSFA 3B54A 1D9FA 1I94J 4NXMF 2MHNA 1OYEA 2KYXA 4LIWA 3TAMA 2YWHA 5KFGA 3T9ZA 5CYJA 5GMKa 3OL8A 2R42A 4RW9A 5KFDA 2FJDB 3HVTB 3MCSA 4C0OC 1WOOA 2FQQB 1DTQB 1CULA 1E6YA 2V2VA 1MROB 3ZZOA 1SL0A 3WQPA 5GAHI 4JV5J 4YEAA 4N47A 1HHSA 4XK8C 1S1XB 3IA0A 4NXMJ 4UQGA 1P6TA 2CZ9A 2VASA 3RBZA 3SCJE 5HQ8A 1XNQF 4LSLA 2NQPA 3AOAA 2HZAA 5IT0A 2HBYB 3FVYA 5G0RB 3KLGB 3D1QA 5KFHA 3MMAB 2CXEA 1MWQA 3QGPA 1RAGB 2IA6A 3D9BA 3OUYB 2ZH3A 3IP0A 2RHQB 4WIIA 3DM2B 2AW0A 4LBHA 5KT5A 3SZ2A 3LUYA 2KYZA 2FD2A 3QT7A 2KHDA 4NI2A 3TUZC 4TU7A 3EE3A 2RT3A 4M5LA 2BJ8A 2XNQA 3QLHA 4MFBA 2MKJA 1Q81T 2JX2A 2OPQA 3BGOP 3DXSX 4QOTA 1ZZFA 5HMXA 1HNWJ 5GADU 3GLJA 3DRRB 2BXJA 3CCWA 1D8ZA 4DSFA 3GQCA 1NH8A 3FCWA 1H72C 4V1Ak 2E5JA 4OX9F 3MM9A 4A8OA 3K7RA 2ASLA 3G96A 1HR0J 4DBQA 2JEJA 3OXFA 2G9OA 1OPZA 3J7YI 3GCXP 4LRAA 2JVOA 4DQSA 1QLNA 3HSZA 2VV5A 3C6TA 5HLFA 4B9MA 1FJCA 2ZBQA 4IR1A 2LCWA 2P6SA 2QLBB 1TUVA 3OR2B 4QU7A 4M63A 3RAQA 1AROP 1AUDA 3T5JA 3P4UB 3K0JA 1YG0A 3I0RA 4QIVA 4WE1A 4DR2J 5LXYA 1RT2A 4PWWA 4DCPB 2V2KA 2VZ9A 2MQ8A 3LOUA 2MQPA 1XNRJ 1TMJA 3HK2A 2VFUA 3W8PA 1HNVB 1HQUA 2AWZA 3P49B 3CVKA 2DGVA 2B43A 3MOZA 2Y1JA 2MSTA 3CCSS 1F2GA 2GAHC 2YKMA 2Z57B 1KKHA 3MEEA 1MU2A 4I0WA 4F4WA 2CPEA 3GV7B 4B3SF 1JWWA 1E6VA 3IAM9 4H4MA 5DM6Q 2UUBF 3DLEB 4ZCMA 4Y34A 1EP4A 4H4OA 1DARA 4YY3F 2OHDA 4KIAA 1U1NA 4HL9A 4P75A 2FLNA 1NB2A 5C42A 2HG4A 4P10A 2ZH6A 3QYYA 4URQU 2OPSB 5KT7A 2OKQA 4JI6F 1S77D 4C4WA 4F0KA 1HNXF 2G0IA 3BM7A 3EZ5A 4IG3B 2W2OP 3PYFA 3R5BA 1RWPB 4NXNF 1WTBA 2EKNA 1B0TA 4RUBA 3HCXA 3V4MA 5ITHA 3JAMU 4NLOA 5JXSA 4KQZA 5KFXA 1D9DA 4F2RA 3G6VA 3G86A 3VVTA 2MGZB 1FJGJ 2HVHA 2ATCB 4X4RA 3CCRS 4BLGA 2Q3PA 2B5JB 1QTNB 1T3OA 2XMJA 2WVFA 1LOUA 4CLUA 4WP3A 4LFAF 1IR1A 3CJKB 5KOXA 5KFSA 2E1CA 4J9NA 3QAUA 5A6PA 1V3RA 2RRNA 1PAUB 2RB7A 4WIQA 3ENQA 2M8HA 3KDOA 2DNGA 1TKTB 3IC1A 3NGKA 4UF4A 1DAXA 4O3OA 3UCUP 5F9NA 3PW0A 2J7UA 4PPDA 5CAAA 2QA2A 4X2BA 3NS5A 1YSJA 2H48B 2HVZA 2VKRA 4OX7A 4YB5A 4X66F 3UNGC 4ZK7M 1RXOB 1NB7A 1A6LA 2IA0A 2HHSA 4WKYA 5HJYA 3H5SA 1UVJA 3E2EA 2XLIA 1IQZA 2LYVA 1ZTTA 4ZCIA 1KTQA 5J1EA 3CJTA 4D3GA 1Q1KA 1FD2A 2FDNA 1WACA 3OTBA 4RW6B 3KK2A 2ZBIA 1JQGA 1DQAA 3QIPB 4DSIA 1VRQC 4DR6J 2QGFB 4A8FA 1VQNS 3UDEA 3TZZA 1XNQJ 4L76A 2ZD1A 2DR8A 4F02A 4MAKA 2F8MA 2K3KA 3CWJA 4ECXA 2PI5A 3A3OB 3IBFB 2CA9A 4KPCA 2CQIA 1P8GA 1FD8A 1N8RT 3G2XA 3HMJG 5ETOA 2PFFB 1WUUA 4RNMA 3GCWP 1SH2A 2HHQA 4CLSA 3CC2S 4LREA 2GIFA 4I7FB 3HHNB 1FF2A 3HFZB 4RW4A 1U1LA 2XMMA 4WTYA 3OTOF 2IM0A 5MLCV 3VGVA 5KG5A 3CGIA 1IUJA 1M5HA 2CFXA 4K5SA 2E9TA 3WDOA 1R8CA 4OYBA 3M6XA 5F8IA 3D7SB 2I9SA 4EZ9A 2XMUA 3LPEA 4JI8F 1X5PA 1M5SA 3IBCB 3CCMS 3QJPA 2W24A 3A8JA 4YFUA 2C1EB 5DDRC 2QTWA 2ZKUA 1FFGB 3Q83A 3PR5B 2VG7B 1HMVA 5CYMA 3M30A 2V50A 3NMAA 3GR1A 5IWAF 5IM0A 4DR3J 3SSSA 3D54A 4X64J 3VZHA 2X1AA 5HQMA 2NPFA 1U2FA 2W9AA 4LF8J 1R43A 5HBMA 2LQ8A 2KT2A 2YKAA 3HHDA 4ECWA 5C24A 2ZITA 2A10A 1FRXA 4MJKA 1LWEB 2V69A 4CH0S 3OW2R 3V6HA 2XY5A 1KSPA 1Q5VA 2HQIA 2LLZA 4J90A 4DPWA 1X0FA 3ZFVA 4NXNJ 2B6AB 4M5IA 3H0PA 1WG1A 1XN9A 2QE5A 2ZWPA 2O67A 3R5DA 1N33J 3W2WB 2A1BA 2OGUA 2FPHX 4P7TA 4ED5A 3JTPA 2CZ4A 4DL7A 1VQPS 2D3ZA 1OY6A 2GMJA 4ED8A 1TUWA 1REVA 2EFGA 2O1PA 3CMAS 1IKVA 2ACYA 2CWXA 4X4NA 2YKOA 5KFTA 2VQFJ 1WC3A 3H7HB 4TU8A 2KHCA 2B8PA 2Y9HA 2EI5A 2V68A 3ZTOA 3H40A 2MLYA 1U8SA 4FNHA 4PXCA 3AXMA 3I9ZA 4FPIA 3TNVA 1H2UX 3BREA 2CQ1A 2W4CA 4UZCA 1TTHB 4EI2A 2VICA 2JDJA 1S4EA 3PYEA 4ZP9A 3K58A 3EDQB 4CQ1A 3I55S 1NMEB 3MXHP 3ZZTA 2HFUA 3KMSA 1OQ6A 3AJ1A 3BGRB 4URSA 3SCIE 3PEHA 3CULA 2XCAA 1FCAA 2YKNA 2V2ZA 2DXEA 4IFYA 5F9LA 4P7VA 2HNZA 4DSLA 3CJQA 3K89A 1VHFA 4HLBA 5BR8F 1IBLJ 1VJQA 3CO9A 1KNZA 1YJUA 1U09A 1RSCA 3HT3A 3OFHA 1HWIA 5C2GA 4HACB 1RAOA 3FEYB 4ECYA 4ED0A 1SL1A 4OX9J 2AZ3A 3D6HB 1QAYA 2F9JA 2A6OA 3TZYA 4FF2A 1FDNA 3W7BA 5HL7Q 5F8GA 2Q1LA 2OPQB 3LQVA 3DLEA 1HWUA 3G82A 1JXLA 2HQFA 5K8MA 1GMWA 4ECTA 5H9FK 2QLXA 1R3NA 2GV1A 2UVRA 1VIOA 2XHCA 4LSNA 1Y10A 2RF2A 4C8KA 1M0SA 1IWAA 1HBNA 3ZZPA 4LSNB 3MMBB 1TK5A 2V2QA 1NJWA 4RJVA 1OO0B 3HLUA 1GXUA 1SIWB 3KJQB 4AYBD 2EFPA 4JBCA 5IZHA 3K57A 5BJRA 5M2PA 1HKAA 3N4WA 4ZPWR 3CF5Q 2X1FA 2ABYA 2QC3A 2B51A 1NK0A 2RD5C 4N41A 2K06A 2DHSA 3ISND 4DV1F 2UZAA 2KXHA 4C8NA 1HBUA 4UQTA 4JI7J 1FJGF 1TL7B 4WXOA 2J9EA 1KBRA 2HBQB 3NWRA 1KOOA 4ZJQA 1QJHA 2LKZA 4C98A 5D6GA 1Z2LA 4HACA 4N76A 3UW1A 2OD4A 1L3KA 5FLXY 2HHXA 1M5PC 3RRKA 2HGMA 2ILZA 3CCJS 1EHWA 2FJWA 3PO5A 2R4FA 2VPZB 1FRKA 3RB0A 2J5AA 3SFUA 4AD6A 5F3ZA 3PKMA 3J80U 4CO3A 4DV7J 1Q7YT 3DRRA 2CPXA 4ZS6A 4EFAC 1IBLF 4L3KA 3J81Y 3PW2A 1NSPA 2F1FA 3I5BA 4DUZJ 2WONB 1NSKL 1SPBP 2B9EA 3L9ZA 3QLHB 4OYAA 4PEOA 2MB0B 1HNXJ 5DLFA 1KONA 4UOHA 1NEEA 1S1UB 3A8IA 3DM2A 4PG5A 4LMZA 3MTJA 2K7KA 3J81j 3GG1A 2GHPA 3CCLS 3TJ9A 5DDQC 3MF5A 3HVRA 2AMCB 1HI1A 3G6XA 2JSXA 4ZLLA 4NZ0A 3K5MA 4RNHA 1VQSA 4HVZA 2KH9A 4XO0A 2FVQA 1FA0A 3HD1A 2YPZA 3DGPB 4NYPA 3KLFB 4WP9A 3FQLA 3D6MB 1NZ8A 3AXKA 3SYZA 1NRKA 2E5GA 2GJ2A 4P9SA 4C8MA 4USHA 2X1BA 2F9DA 3SFGA 5EDWA 1KD1T 1WG4A 3PW4A 4LF9J 2X3DA 3K5OA 4K8RA 5GMDA 4Y2AA 1KR4A 1UWBB 3C14B 2ZVSA 3KUGA 1PJ6A 4PZVA 2A6MA 4RW9B 2B6AA 3BR9A 2H5IB 1YRXA 3NCRA 3NAIA 3W65A 4KPYA 2FLPA 1AZSB 1GTEA 3MUMP 2APOA 3R7NB 4CLYA 3QWPA 3OFGA 5A0YB 1H98A 4ED4A 5CZVA 5KFFA 3R6LB 3C66A 3MAQA 4M94A 1F6TA 1FTCA 2JRSA 2OEJA 5ADZA 3OHAA 4HH0A 4DF4A 1WKJA 1N36J 2F5GA 2XWYA 1GX5A 2VUGA 4MKBA 1ZTWA 2HQCA 2VJUA 1VI7A 1YJRA 3ILJA 4O4RA 2WB1D 4KSEB 3VQTA 5KFYA 3M05A 3GR0A 4CM2A 1R6YA 1U1QA 4O3RA 5IWAJ 2HS3A 2HFNA 2DO0A 2PSZA 4DR3F 5EX0A 1VQKS 1RT3B 3ZZZA 3MR5A 1IKXA 4FXDA 1U2CA 2KXNB 1NK8A 4K2XA 3TVKA 3BGLA 2KKHA 3H5YA 4DUZF 4JYAF 4OHWA 3QPIA 1UZDA 4J9UE 2NZCA 3EWGA 2DD8S 1FESA 4DFJA 2GVDB 2GO8A 2AD9A 2E1PA 1JX4A 2OLWA 2QLFB 1X9MA 1KQGB 1ROFA 3FKBA 2IC3B 5E41A 5AJ3F 1FDBA 4ECVA 1ZBTA 2D7SA 1SCJB 5EUHA 5HATA 1TZ0A 5GVQA 3CJ5A 3THPA 4EYHB 2NR0A 1O5JA 4ZVEA 2BJ1A 2IDEA 2YNHA 2ZBCA 4M5MA 3ETOA 1ZAXA 2WBRA 4P2XA 5KG1A 3S8SA 2N82B 3V5RA 4YP3A 2IY5B 4YS2A 2H54B 1BXNA 2CQBA 2QO3A 2XYPB 3ILIA 3C15B 2GJIA 5T41A 5BYSA 5IXUA 4WFNQ 3TA2A 2PE8A 2MQMA 3GYNA 1HNIA 2J6UA 3BKFA 1HPZA 4H4KC 1KP6A 3LGNA 5B0EA 4QR2A 3UR0A 1P27B 2FGCA 1RWKB 2GVZA 3KJFB 3MPUB 4ZVQB 3UVJA 2RDIA 4FF1A 3ILOA 1H7XA 4PWUA 3DMJA 2ERRA 3PDNA 3DOKB 3FCVA 3MR7A 2Q43A 1M1GA 4ZMMA 5C2CA 3KHGA 1V6HA 1JNZB 1MU2B 3MEEB 1N52B 2CQCA 1RWMB 1UFKA 2PA8D 3LP0B 4OI2A 2E5LF 4WPAA 4MT1A 4CO5A 4TQRA 2M70A 3ET6A 3QRRA 2IC3A 4KH1B 1M1HA 4LRDA 2HHHJ 2VHGA 4CCHA 2HEKA 4CLFA 5EWGA 3KUHA 3FJ2A 2ZDOA 3GB0A 4TY8B 5HANA 2I8EA 1DY3A 3OT9A 2ZDPA 4JI1J 3OLAA 3D67A 1N6QA 5A76A 4USVA 3QT6A 5M2UA 2OPRB 5KT2A 4B9LA 1NK4A 4QCLA 5DZ6A 1B99A 2QYCA 3M4XA 3VVUA 1BLUA 2Q79A 4OZ1A 1CJUA 5CZXA 3ZNJ1 4DQQA 3RBXA 4JI5J 2H5EA 1VLOA 3V6JA 3L7OA 3CSKA 5B0AA 2CQHA 4OJ1A 1MWZA 1S59A 2W9CB 3V6DB 1WF1A 1ZAWA 2QV6A 3BPDA 2QZ8A 1U45A 5DGBA 2FY1A 2WW8A 4KE5A 2IJRA 3DXBA 2WSCC 3MAHA 1REGX 3JYTA 1RTHB 3VR1A 4WFZA 2R8HA 1YZ6A 4X65J 5L1KA 4JV1A 2AF6A 4WP8A 4YB1P 1NJYA 4UY85 1O0PA 1RA7A 1FERA 4NI2B 3MEKA 1U0HB 3SCKE 2FJAB 2OEMA 5T7LB 2E7WA 4OZNA 4X4PA 1ZOTA 2J8SA 1GT8A 1HA1A 3RAXA 3PEJA 3QT8A 2YQ0A 4JI8J 1JKHB 2KJWA 3M8QB 4LSLB 5KG4A 2NSBA 3SIPB 2N7YA 3DYAA 2VG6B 5ETVA 3KLFA 3WC0A 1N34J 4FBUA 1SC3B 2XCPA 2XMWA 4AUKA 4DL2A 4LF6J 3NNAA 2CG8A 1LW0A 5ETNA 4RUCA 4PWDA 4UUWA 7FDRA 2MKYA 3LGHA 5D4OA 3D3BJ 3BSAA 5F8HA 2YY3A 3CD7A 3DNCA 5KAKA 3EX7B 2WTFA 5HROA 1I1GA 1N88A 1PJ5A 1RCOB 5IT9U 1YI2S 2V4JA 2VH7A 3I87A 3ISNC 4CO1A 3HPOA 2V8HA 3R3TA 2AKWB 5KFWA 5H9EK 1OQ3A 3EICA 4IO9Q 2DHXA 4ZIWA 4K4YA 2DNLA 4B3RF 1IBMJ 4FPRA 1VQ4S 3JSBA 1DBDA 4L72B 2P9EA 3QRPA 1TK0A 1WI8A 3HSDA 4IDKB 3RZAA 3WX8A 5T14A 3PR4A 3C2PA 2DHGA 1HYSB 4ZPBA 4XIUA 1NDKA 4Y6IA 4BWJA 1BGXT 3W5XA 5KG7A 1LWCB 1T11A 4P74A 1VC6A 2UXDJ 3OLBA 1KLNA 1QUPA 3OTEA 2VFRA 4OLOA 4RW8B 3SMZA 4I2PA 5GADI 2J76E 1HBMB 2Y0BB 3DRXA 1X4GA 3HSGA 1NPRA 4P52A 5KFBA 1HBUB 1CS4B 2CYYA 4ZDNA 3UN2A 1LKZA 3KLGA 4B3MJ 1U1PA 5AT1B 4DZ6A 4QPTA 2MZSA 1WKLA 5L46A 3KLVA 3VWSA 2WOMB 5FD1A 4QWBA 3ELHA 3NCPA 4WCEQ 4J9QA 2HHHF 2K3IA 4PG7A 4LF4F 2KZMA 1HBNB 4LVOP 4DUTA 2CZVC 5CD4A 1QY7A 1UZHA 4YN3B 5HO4A 3F41A 1X60A 3BF4A 3CDEA 5T7LA 4F3OA 4M5DA 5D4NA 4GVLA 1VQLS 4JV5F 3MM6A 3SV3A 1Q8BA 5KFVA 4ITSA 4KO0A 2W7OA 5B7WA 2DBBA 2PGCA 2F4FA 3R8YA 2VB6A 2XMTA 3UCZP 5L1IA 3BH6B 1PYSB 4KV8B 5D8HB 4JV2A 1Y5NB 2DIVA 4YR3A 3MFHA 4RNOA 2J7KA 4LUBA 3EM1A 1TKDA 3M2VB 5GAGI 2W4PA 3M2UB 4Q44A 2CJKA 2DYAA 3G8SA 2ZZNA 4WXWA 1FTRA 2J0WA 4NLDA 4IFYB 1T7PA 2VPWB 3PZPA 1LXNA 2EKYA 2DGUA 2V8GA 1LW0B 3A3NB 3V4IA 1NJZA 4PWDB 4BC9A 2DNNA 3IRXA 4FYYB 5MAOA 3CC7S 1T94A 2HFVA 3MPVA 4IRCA 4K50A 4ID5B 1N36F 2JLEA 4URGA 2C42A 1YIJS 2OEKA 4ZVOB 1SH3A 3IM8A 3L7UA 4LFBF 2GQ2A 3RUBL 3QQCD 2HS4A 1FO1A 3E01B 7FD1A 3OL6A 3UD4P 1UA1A 1C0UA 3M8PB 2HYIB 3FSIA 2AJ1A 4O0NA 3FNNA 3CNQP 2KT5A 3FQKA 4QIGA 2W4DA 1OJ4A 1HNZF 3ZTQA 5JJBA 4B3OA 2CQGA 2ILYA 5LJ5Y 3LPYA 2QG9B 1VIXA 3UN5A 4X65F 1RTHA 2XO6A 3LO3A 4LRCA 2Y8WA 2FC8A 3HFVA 1IKYA 2RAQA 1H2VZ 3HHLB 4MYUA 4E2FB 2GIQA 4PXEA 3OHBA 2OFHX 4ZLPA 1O8BA 1TMMA 4DQIA 2JC0A 3GJRB 3NY0A 2ADBA 4WK1A 2FZGB 3CO0P 1UCNA 3MD1A 1ICEB 2IMOA 2LU1A 5F3TA 2R7TA 4A47A 4PXDA 2EC2A 2MKIA 3JSMB 4DR4F 1RTZA 5A2QY 4HDHA 4ER8A 5J2NA 2UUCJ 1TUGB 3IMQJ 1V5VA 4NEZA 4GO7X 4JI6J 1NPKA 3O3LA 4FF3A 2XEXA 2AEJA 2AGOA 1ACMB 2MLZA 4CT9A 1RHKB 2FGOA 1AT1B 1K1SA 4DEZA 3Q8QB 2KRRA 1K47A 1R27B 1HBOA 2MKSA 3PNIA 4I2QA 5AE2A 5IM0B 1PC4A 1KLMA 3B4DA 3UFCX 5CYMB 5KFZA 4PAAA 3MHYA 1CBKA 2D1CA 3ENVA 4HI1A 4CLZA 1WEXA 4FYDA 2XB2D 3S1TA 3GU0A 2D3O1 3V81B 1K8AT 2ZBRA 4FNIA 4JYAJ 2Q66A 3Q8SB 3NGRA 1LEOA 2G0CA 2V8DA 1C1CB 4OZLA 3SI8A 3ITHB 4EYIB 1M1KT 4QYRA 3NMRA 4LR7A 2ASYA 4ZITA 2XO7A 1XBWA 3R1HA 4ZN3A 4NLSA 3O1LA 2AP6A 3D4JA 2AHOB 2GVZB 3MCNA 3GFHA 3FBCA 2BUNA 3UVJB 1L3SA 3MD3A 1JLQA 1RABB 1RE1B 1RKIA 1ZPVA 2XZDB 4OI0A 1VQ6S 2ZM6J 3NNHA 1B7FA 5C25A 4DR7F 3M8SA 1S6OA 3BKTA 4F36A 1TVRA 1U24A 3ENAA 1QAXA 1V9OA 1Y00A 4USWA 3TX8A 2D9OA 4C97A 2BE2A 4K4VA 5HMYA 3CC4S 4RU2A 4Q8FA 1AUSL 4K4ZA 3PRDA 1UVKA 3TEHB 2L9NA 3SV4A 4TU9A 4ED7A 3ULHA 2ZH4A 1TFWA 2AYBA 1RDRA 2DGOA 2IRYA 1Q0NA 3BEGB 5C24B 1S76D 3CCVS 1B4SA 1CQMA 1SXLA 5CHCB 2L41A 2FHJA 3O8WA 2H9ZA 3QZ7A 4QIWD 1DRZA 5E7OB 2GVDA 3OTDA 4YMEA 3SDEB 1IJFB 4NZ6A 3SXLA 1VQ8S 4QYZJ 4NWBA 2W8LA 4IUFA 1EETA 4UW2A 3T5HA 5K14A 5D15A 4LF7F 3U7JA 3W3SA 1FI4A 2VBWA 2OMLA 1NAQA 1UVNA 4ZVPB 1YJWS 4UOGA 3EZUA 4J9SA 2QL9B 4YUDA 3GWCA 4QR1A 2LXUA 4CO0A 2HHVA 4EBCA 2J9DE 4A4JA 4GKJJ 1KLMB 4I1TA 5HVFA 3PO4A 1GMWD 1X0PA 1U0SA 2HFZA 2H51B 2ZC3A 2MZ1A 2Y1IA 5L9NA 4KTQA 1XEZA 3GMGA 3W63A 1U1RA 2OO4A 2PA3A 4KR0B 1NHUA 1Q7LB 1T02A 2IYGA 3AA8A 2V8VA 3Q8VA 3TW0A 2N3OA 1S6QA 1TQLA 2BA9A 3VV2B 4FYVB 3ZXWA 1H74A 1LWFA 1H2TZ 1TVRB 3IFEA 1YK9A 5IC6B 4CP5A 3TZXA 3H2VE 3GE9A 4QR0A 4JI2J 4LF9F 4RLEA 5HI7A 2DPIA 1D9AA 3VHQA 2OPSA 3TOQA 3HZGA 1P9QC 2RE1A 4ATNA 2QLJB 4DHVA 2ZH5A 3MDFA 1T9VA 5DJBA 2VBZA 2G0JA 2DISA 4DSJA 2U2FA 2VBYA 1OWXA 2GC8A 3D28A 3NGUA 3FGVA 1SKSA 1G4CA 4C6AA 1RT7B 1S1TA 3LANA 3VZIA 2BZ2A 2XI2A 2CVEA 2ZEJA 3A4TA 3NP5A 2IM1A 3UDVA 1GH8A 2R8JA 3AA9A 3W2VB 1U49A 3JQJA 2BJ3A 2CPHA 3F73A 2VQFF 1Q8IA 1VGYA 2CPDA 2F7VA 3CJKA 3UD3P 4ANCA 5GMEA 4Y2CA 2JEIA 3KLHB 2E7XA 4ED2A 4FKYA 3PHTA 1WJ9A 2LQ5A 2WZ1A 2XHWA 2P2CB 1PG5B 3E8OA 4U7UD 1Q86T 1NHVA 1PC5A 3G87A 1YTYA 2JFDA 2BANB 2M5YA 3PFEA 2QA1A 4L74A 1KQKA 2EC0A 1MMDA 2HQGA 3WX4A 3DLGB 1C1BB 5E5NA 2ROEA 3T1YJ 2D3OR 2UXBF 4A8XA 3JSMA 2XGPA 3H4DA 2QRRA 4F04B 4WFXA 4KHRA 3SQOP 4NMLA 3VCDA 2YQ1A 3I5AA 4DX6A 4M5GA 1SJQA 4MYTA 4KGKA 2BJ9A 2BANA 3VAFA 5CYQA 1TL7A 1WHXA 2EW9A 1RT4B 1Y9OA 1FXDA 3MCOA 4C8ZA 1Q4RA 1DQ8A 1VLYA 1Y5IB 1Y3KA 1LQ9A 2I38A 3KG1A 1RHUB 1EKRA 1SUQB 2RUGA 4BC7A 3DLHA 1XERA 2WB4A 1XMQF 4CT8A 4B9UA 1APSA 3DN9A 2CJBA 4JOUA 5IFMA 2KU7A 1RWOB 1T9TA 2HGLA 2Q6CA 1QM9A 3M7VA 3TR5A 5HP1B 1DHMA 2J0QD 4ALZA 2IPOB 2MXYA 2XS5A 2BDPA 3T19A 3OSNA 4DV6J 3JQKA 3N6NA 1X31C 4KHMA 3WIUA 4MTPA 4AFFA 2CNOB 5KFRA 2ASJA 1HW9A 2G1HA 2OIHA 2DGXA 2HURA 2PC6A 2EFVA 4OYXA 3V4IB 4I69A 1XMQJ 1FFSB 3HJFA 4ZKAA 1T03B 1JNRB 1FDDA 3H59A 5HJXA 3KHLA 3BO2A 3P5TL 4CO4A 4RW8A 2LQ9A 5JUMA 4ZP7A 3I5CA 1U2RA 4KFBB 5L1JA 2UXDF 2H4WB 3MZIA 2B9XA 5ETTA 2AGPA 4WZMA 1NSAA 2WBMA 2JL9A 3N5FA 3GJSB 2KRBA 5HBMB 1S1WB 5BYQA 2O5DA 2K1RA 3GPAA 3QAEA 5HMZA 4DPUA 4GC7A 1I6JA 5B08A 5L1LA 2XBPA 5A6WA 3M30B 2N4DA 4NYZA 5FLXU 4NCAA 1XMOJ 2CPZA 3E3XA 5LM7E 2ZFHA 4LT6A 1H7WA 4M5DB 5B09A 1CQNA 3M9OB 4KKOA 2NXNA 2Y0SD 3EPGA 2Z2MA 5G4DA 4ANDA 2XM3A 3I56S 1J2VA 3KTQA 3DDIA 4A8SA 2ZH2A 2PIIA 1PO6A 1F9HA 5D3GB 1EETB 1WWHA 1I51B 1Q53A 2FVCA 3OBIA 4RW7B 1IKVB 3W1YC 3KJVA 1X9WA 3BBBA 3IWLA 2VG6A 4RW4B 3T6BA 4F0MA 4B3RJ 5EGYA 1S49A 3CMQA 3T1HF 2IYIA 4NL5A 1RTDA 4O4GB 4W92B 4RUAA 5F8LA 4JI0J 1U48A 1R0AA 4IFVB 4IO1A 4C0BA 5H9EJ 1N33F 1UMJA 4OV6A 1QAIA 4NX9A 2DR9A 2L9DA 4KT0C 4C3MA 1XR6A 1S6QB 1BQXA 4CRJA 4DL5A 2FJBB 1LFPA 2C3UA 2MEWA 3ZTPA 2BE2B 4QW8A 1YJTA 4ECRA 1S6PA 3C6UB 4ECZA 3R5CA 1FJEB 5DQGA 4RW6A 3KK2B 1PIEA 4QWCA 1JLFA 2NYIA 1YQHA 3EGWB 3Q8UA 4FVMA 1S10A 2OSRA 1NBEB 1H6KX 2BW2A 4N8OA 1RAHB 2C3OA 1HIYA 2XTJP 4U8VA 1XQIA 1WEZA 3I31A 1S99A 5J2PB 1UAWA 2EBGA 3PXGa 5L8RC 2E7VA 1OS5A 1RK8A 1RT5B 4KHPF 2XG8A 4HHJA 4J7CA 1N6QB 1X5SA 2MTLA 2AU0A 5K14B 2QA4S 2WHOA 5DZ7A 1U6ZA 3KLEB 4DR5F 2RQMA 3OTOJ 1NLKL 2NUHA 1KOHA 1SIZA 3GFZA 3Q24A 1PAEX 2A18A 2RS2A 2HWTA 1H3DA 4PCQA 3RGIA 2XY6A 1G2EA 2VOPA 2VG5A 1XK8A 3AFGA 1KDNA 1A7GE 2UVUA 2Q6BA 1VK8A 4DMZA 2HHPA 4NMXA 4ZPTR 4TVAB 5IV4A 3NCQA 1G7CB 3CDBA 2IVFB 2AJ0A 3K8VA 1IXKA 2CWKA 3KLIB 4E8UA 4KAIA 3H4BA 3EYZA 4A8KA 4JI7F 2AYGA 3Q2TC 3JYTB 1MG7A 4UOFA 3CCUS 2DHHA 1VISA 1RTIA 3H2LA 4OHVA 1AYEA 3UCGA 4B9TA 2FZCB 2D41A 2R9LA 6FDRA 3M9NB 5C25B 3UNYA 2DHAA 4OYIA 4OHYA 5J1EB 3AJDA 2OD6A 2PT0A 4JI3F 3HFKA 2R2RA 4K4UA 1C0TB 2CPIA 4GMKA 1RTIB 1GAOA 3IXQA 1CJUB 2EBEA 1UL3A 1ZA2B 5HMWA 1HW8A 1RADB 2DCUB 3T41A 4WK3A 4MK8A 3DLBA 2LXFA 1B7YB 2BOPA 1VRTA 2MQLA 2O01C 1KVKA 2AEFA 2MJUA 3J7ZT 5E0OA 3BGFA 5AE1A 1CPZA 1S0MA 1S12A 5KFIA 1TKTA 2VKZG 2VQEJ 2U1AA 3THVA 3D66A 2VG5B 3UDLA 2ALYB 4NEYA 2D74B 1AA1B 3MAAB 2C3MA 3IRXB 2NREA 2XZWA 2FZKB 4RBVA 3AY0A 4AL7A 3PX6A 3G6YA 4QU6A 2HZVA 2UU9F 3X3UA 2RJZA 1RWXB 3LP0A 3HP6A 1ZM3A 2ZZMA 1LW2B 4M1KA 3OL7A 4I67A 4Q45A 1GXLA 2V0NA 4DDFA 1SKUB 3E51A 1AXQA 5J2QA 1URRA 4V19J 1W7WA 3N9UC 1VDHA 1AFIA 3FUYA 4W4MA 2WCXA 1IWGA 2YWEA 4E98A 2W7PA 2R7WA 2GHVC 1RUSA 1K9MT 3W60A 2M3DA 3LAMA 4V19X 1Q8LA 5K20B 5U47A 4C9DA 3T5KA 2HLUA 2BE7D 2I5JB 4YY3J 2NCKL 1S48A 3IM9A 1BQNB 1RU1A 1VRUA 4RR5A 2UUAF 3UE2A 1G1XA 3S6EA 4OYPA 2YNHB 1R0CB 3SQGA 1R8BA 2PEBA 3MM5A 3C14A 3QRQA 2DY9A 4P73A 1NO8A 2JZ5A 4RUHA 2C2EA 1SJFA 3TAPA 4DX7A 2ZJRQ 3DOMA 2DPJA 4U8YA 2VC0A 2PFDA 1WOPA 1RT2B 3BDEA 2KVQE 3A3PB 4DV0F 3I0RB 1XR5A 4OL8A 1KN6A 5D3GA 4FF4A 4DV3J 4WKRA 2JLFA 2L08A 4PG8A 1AB8A 2DB1A 1KQFB 3RTVA 2C3PA 1CULB 1E6YB 1RT3A 2YBVA 3I9V9 4WU2A 5J1PA 2ROPA 4JI0F 4A8MP 4K4SA 2OJ3A 2ZE2A 3LTOA 1RBOB 1HHQA 2DNOA 4WWSA 3D6TB 4MK7A 4QQBA 2ZH9A 1T8EA 2FJXA 4HDGA 2DITA 2YX4A 1Y5LB 3MGJA 5D78A 4UT4A 2ZNZA 1QE1A 3QT5A 4IG0A 4RZRA 1HYSA 3A13A 4USMA 2IAJB 8RUCA 5DDPC 1N54B 4KGMA 2HNYA 1KVJA 2XLKA 4YHHF 4DN0A 2MHEA 3TJ8A 3DU6A 2HBZB 3RRHA 3IAS9 2F40A 4Y0FA 1BMQB 1Y4ZB 3CW2C 2QT7A 3PKYA 3GG0A 1QE1B 2BQRA 2DR5A 5F0UA 2QMWA 4YR0A 1KFSA 4NLXA 3MI7X 5IC4B 1CJTA 1VK3A 3FC9A 1EAYC 1MN9A 2DJWA 2Z4PA 3DRYA 5KFEA 4A8WA 2C22A 4PUOB 2WVCA 1JLEA 2GX8A 3DOLB 3TJAA 1T0TV 1WDDA 4FYXB 1YBAA 4BBYA 5GAEI 3D2WA 2RKIB 1FEHA 2M0GB 2R7OA 4O23A 5B0DA 5B0BA 5G0RA 1RTDB 4DS5A 4F2SA 4I6WA 3HVAA 5KFKA 4I64A 4IKAA 3KDNA 1IKWA 3IR7B 2G2ZA 1X4AA 2OH2A 2YXLA 4TNOA 3UN3A 3VAJA 2XNRA 4QIFA 1S0OA 2EFOA 2KG0A 2C2KB 1HBMA 2GFFA 4C2MA 1N4LA 4PG4A 3Q0AA 3DLKB 1O6XA 2RF2B 3K5PA 3BQ0A 3HVTA 1YJNS 1RISA 1UW9A 4J9KA 2OELA 4G1PA 4PPZA 4A48A 4ZOSA 3CCQS 3CD5A 3TAMB 4ZVHA 2RQ4A 2MQNA 3NG8A 3G82B 4QJVA 3AD9C 2I5JA 2GCFA 3QIDA 4Z37A 4YR2A 2KDOA 2CAJA 4LBPA 2M52A 4GO5X 4U7CA 3MM7A 2W01A 2KM8C 1C4AA 4CH1A 1RQ0A 3UD5A 2Z2YB 2VD3A 2RRBA 2HRTA 4USKA 1CLFA 3RBEA 1WNEA 5ETMA 1QVFR 1LK7A 2YNFA 2ZJPQ 3IO1A 4DWIA 2ZZTA 4OYZA 4KY3A 3MR6A 2UUCF 3HI9A 2DCLA 2QSWA 5K5MA 5HROB 2UV8A 5LMUJ 3PYDA 3SCLE 1N56A 2CADA 5KFOA 2YKNB 1W2BR 2MZRA 1EQ0A 3SEOA 2C28A 4UZBA 1GMVA 4TXSA 5D0HA 2FVPA 2AJ2A 1DLOB 1RT6B 2R2UA 1RA6A 1WC1A 4JB8B 4ZVSB 1IM6A 3JS9A 4NYOA 3Q89A 5KG3A 3GIKA 1NZAA 4J9MA 2Z2LA 1K0VA 3OVAA 4Z2XA 3NGSA 3DOMB 3F44A 3MMCB 4C11A 2M2BA 3NAHA 3MMBA 5M2RA 2KFYA 3GIMA 2RU9A 1HI0P 4G1QB 1N34F 1SC1B 1ULRA 3T5LA 4IR9A 1JLBB 4OZ3A 4AXIA 4Q5VA 3PW5A 4CYUB 2CVIA 4ZA1A 3DOKA 3EGNA 2UUAJ 4XDCA 2HRYA 1F60B 1REVB 2HWHA 1SUQA 3RW6A 1CJKB 4EWTA 3JB9k 4B9SA 1RU2A 3ONQA 4DV7F 2ADCA 2DNMA 3M8ZA 2E29A 4F50A 3KK1B 1DZ5A 3RR7A 3H20A 2QMUB 2W9CA 3V6DA 1J5OB 1FKAF 1N5YB 3ZO7A 3OFEA 3DGVA 4TY9A 3FCHA 1ZM9A 4USTA 2C3YA 3U1LA 2W9BA 1EARA 1S9GA 4ZP6A 1WTFA 4ZLNA 5KG0A 4DL4A 1ELOA 4PRFA 1LWEA 4WFBQ 2O66A 2PN6A 5AXKA 3IS9A 1EX8A 4HI2A 4C3LA 3KYLA 4PG6A 2KM8B 1J5EJ 1KWMA 4RL1A 2UU9J 4I6YA 3NRBA 4C3KA 4A8YA 3CT9A 3GV8B 2MKHA 3KLHA 3MAAA 5DRKA 1SJ1A 2E1RA 5K8NA 2EK6A 3NXZA 3WHIA 1M90T 3MEDB 4U7UK 3W9JA 1VHIA 2CUYA 2YWFA 1NDCA 3DU5A 1LXJA 5LMUF 3T3FA 1U25A 2KVIA 1FX2A 3RB3A 2DRBA 3W2VA 4KJIA 3JAMY 3CB4A 3FSYA 4ZVTB 4ECSA 1VQMS 1S0VA 1MNEA 3CDUA 5LSLA 3MPWA 1ZA1B 2BM1A 1WC6A 1YLXA 2IFXA 1RT5A 2VBXA 3MPDA 2KZZA 3U1MA 1TR0A 4CO2A 3DFEA 2LECA 3RYLA 1TV6B 1HNWF 1S0NA 4NCGA 4LF8F 2DGTA 2QN6B 4WBFA 5ETKA 3M8RA 5IV3A 4LFCF 3BO3A 2FYXA 1WF2A 5ETPA 4X64F 2YWGA 4AL6A 3P45B 1D0EA 6AT1B 2HW3A 1PBUA 1KHVA 1OPIA 4OHXA 3X1LB 3D5MA 2ZJQQ 2OI2A 3PJWA 4CWBA 2GAGC 2DH9A 4L73A 1N5VA 4QZVB 4WYLA 2ZH8A 4Q0BA 4OZ5A 2SXLA 2IDLA 5FDLB 4J91A 1YJ9S 3GFYA 1FE4A 2KJVA 5B0FA 2FVSA 2RSQA 1LWXA 4PABA 2CJ9A 4DZDA 1FHTA 5A8RA 2DGWA 1S79A 1GFWB 4W98A 2HGNA 2W8KA 2C2RA 3Q86A 2KFZA 4F4ZA 3RB6A 2UVWA 1FKPB 2QFIA 1WC0A 3O6QA 3VAIA 2FLLA 3L09A 3AAWB 3IG1B 2NSCA 1R8PA 4ZPDA 5JVGQ 3RBDA 2IBKA 4N5SA 4RPFA 4ZP8A 4O44B 3KHRA 1XJWB 1Q8KA 1X4DA 3H42A 2B9YA 4YQWA 5AJ3J 5DG7A 3T1AA 1TV6A 3LA0A 3ITHA 4P6QA 3ZTRA 4DV6F 3EXYA 4KRWA 4B9NA 5DG8A 4TQSA 2JH3A 4AL5A 4YHHJ 3CXCR 3QGGA 1RGVA 1VBKA 1U02A 3DLLQ 1NH7A 1XWLA 1IM4A 2DNHA 3CJ8A 4HHHA 2DTJA 3AQPA 4IYQA 4LRFA 1XC9A 3GP9A 3D1OA 3PM9A 4DV4F 2CRLA 2UUBJ 3CD6S 1IQTA 4GRSA 5H1SV 1S7IA 3ZZYA 1QSSA 1HBOB 4I2QB 4DCJB 1NKBA 1UP1A 3BN4A 5KFCA 1BC6A 3TYTA 1TL1A 1WC4A 3NKYA 2XMAA 5A8RB 1SJRA 3TUIC 1R31A 2BV3A 2VDHA 4MH8A 1JXEA 3RG6A 2AGQA 2LU2A 4X62J 1SVDA 1DFDA 1M5VC 3AQOA 5D0EA 1WOSA 3TA1A 1S9GB 2XULA 4E0DA 5K8PA 4EBDA 2I0XA 2RUSA 4BCAA 3EGZA 3HO1A 4QBUA 2YWKA 4IH6A 1PJ7A 4DUYF 2IBOA 1U47A 3F56A 4OX6A 2C2DA 2GS8A 2KI2A 5I42B 2VODA 3JXOA 5GAGU 3VQSA 1FDAA 5HK4A 3THTA 1AW0A 1UJ5A 3CJ2A 4ES1A 5E3PA 2V34A 1J5EF 1EP4B 3F0NA 3I4HX 2OTJS 4X4VA 1Z4UA 3GYXB 3H90A 4JV0A 3ZZRA 1E6VB 1QD1A 4ILRA 3R5JB 5I3UA 2H65B 3D0IE 2GQCA 4G1IA 2BM0A 3TRGA 5DQHA 4DXLA 2XYHB 2YNGA 3FK4A 3VAKA 2J0XA 4NOHA 4PR6A 4QWDA 3HZEA 2ATLA 2AEMA 2FVRA 1RZMA 2K8GA 3WBZA 1MW7A 3UO0A 3LF0A 3R2DJ 3PY8A 1G3OA 3NOCA 3FZBA 1T95A 2AT1B 3MEDA 3AB4B 3CJ3A 4NZ7A 4OI6A 3L3CA 4G65A 2J7WA 4DV5F 4NCBA 2RNEA 2HPUA 1WHYA 3MECB 4DQRA 1RT4A 4ED3A 2JJ4D 4GKJF 3T6JA 2MGZA 3W5YA 1SKWA 1YITS 4PQUA 3M9MB 3KOAA 2P5VA 2UVVA 1GNKA 3K8WA 2GW8A 1HD0A 2MYFA 1RHMB 4LIRA 1OIAA 2IJFA 5AXMA 2LEPA 2WSFC 2JWNA 1S9EB 3BB5A 3O44A 4DPYA 2G4BA 3IWNC 4L3NA 4AT1B 3PVXA 4Y2KA 3W62A 5ETQA 1SV5A 4PQUB 3GTYX 4KV8A 2KN4A 1MMNA 5A8KA 2B4UA 1PCAA 3HHKA 3BBFA 5D0GA 2F8HA 2GHWA 2DVIA 4JI5F 2K2PA 2LEBA 5HSPA 4ZHRB 2D3UA 2DNYA 2GMLA 3UPFA 3V6KA 1TL5A 4ICLB 3SSQA 4C48A 2MQQA 1YJVA 4X66J 2WSEC 4ZPCA 2E44A 1EIYB 3RW7A 4WU3A 4WYWA 2YKMB 3MMJA 2ZOFA 8ATCB 1PILA 4DPTA 5K8OA 4ILMA 2YNGB 5DETA 1HNVA 1WELA 2E66A 1PYTA 2HBRB 2IVYA 2RH3A 3MMCA 1YVFA 1FEEA 4M5NA 4KYZA 4Y2IA 5D4PA 4EGLA 1KQSR 4U9RA 2NPIA 3BPSP 3US5A 3CPWR 1D8YA 2HHUA 4XAKA 3TX0A 4TLQA 1IKWB 4ZVRB 4F25A 1WG5A 1Y7PA 3HHLD 2BRLA 2FHMA 4CIOA 3R27A 1ZPWX 1N32J 4ZVUB 4USJC 1IBCB 3LP1B 2DXFA 3OV7A 2QL5B 2BKNA 1JLEB 2HFOA 2AZ1A 2OPPA 1N0VC 2KO1A 2OUGA 3CIMA 2BYCA 1A0OB 1UEVA 2W7AA 4WTOB 5DO2A 2LVWA 5LT5A 4ELUA 4ZJLA 2YNFB 3M6UA 1ZYQA 2AYEA 2HNZB 3BH7B 3V2UC 2ZHAA 2HQ3A 2YWWA 3A12A 4YB6A 3LWLA 3G9CA 3L4BC 5E33A 2GGPB 4HT5A 3PCOB 4PXBA 4JUZA 5C5JA 3C3LA 2R7VA 3MM7B 4CH7A 1T9WA 2Z0GA 1GQEA 1VJWA 3BGUA 3IN5A 3FMBA 5ETRA 4RX6A 1CC7A 3QSYB 4MFBB 4D3HA 1YBTA 2PMWA 3PRVA 4K59A 1RAAB 4ECUA 2OAUA 3NBPA 1T05B 1TELA 1NDPA 2B7CB 2ZE2B 3QBCA 2HKEA 3DLKA 3BR8A 1CSJA 4RO0A 2JOQA 1XNRF 1YJ7A 1KHWA 3AOCA 3GZ7A 3LW5C 3W9IA 4R0EA 1U1MA 5I3UB 2ZC4A 1LK5A 1W25A 2OFGX 3CIZA 5HQLA 1TKZB 3J81U 1ZZNA 3M2RA 2HVIA 2EK1A 1VQ7S 2BR0A 2J9CA 2YX7A 3DRPB 5IS2A 4ID8A 2KL8A 2CG4A 3R9LA 1JLGB 2EG2A 3DI6B 4EEYA 2V9WA 4LF5J 2D9PA 1T9YA 4OYOA 2YPYA 4LQ3A 1MROA 1RCXB 1EJ7L 3EVWA 4B3SJ 1DTQA 2LEAA 3B6BA 4OYWA 4JI2F 4YB7A 2CJYB 2RDDA 3SQGB 4YDXA 4LSZB 4PUOA 2DO4A 1LFWA 2ZD1B 1QSYA 4WFAQ 1NDLA 4ZCKA 4QW9A 4K5RA 3EPIA 3TAQA 4DR1F 3AH6A 5LSRA 1WC5A 5FDLA 1TL3A 2G1DA 4DR4J 3D1HA 5ETSA 3RJMB 2BJ7A 4OZ0A 3VGSA 4CTAB 1GMUA 1C4CA 1JLAA 2DRDA 2RILA 2R7QA 4EO6A 4R5PB 1J27A 2MLXA 2V6AA 3MM8A 1A9NB 4HEA9 5LMNF 1NK6A 4RKUC 3IR6B 5GAHU 1U26A 3J7Z5 1S97A 1Q95G 3PIPQ 2OTLS 4DG1B 2IJNA 5CABA 4U67Q 1Q78A 1NJXA 4C8YA 3DCAA 1O51A 1XR7A 2D69A 2MKCA 3C8YA 1HI8A 1RB0A 2NYHA 4EK2A 2YQ3A 1YBUA 1QUVA 2WVDA 3AHPA 1HR0F 1T9XA 4H4KA 2PMZD 1NKEA 2N4CA 1N5QA 5DM7Q 3IR5B 3QO9A 3BQ2A 1JB0C 2B9WA 4LF1A 3POTA 4KB7A 3W8GA 3FBEA 2BQ3A 4F7VA 4FVCA 1RT1A 3PFOA 2B56A 1Y0HA 1XMBA 2V63A 4I7FA 4DSKA 3DRSA 4Y2MA 2H1YA 1JKHA 3BSCA 4GC6A 1RAIB 1HARA 2MZQA 2Y3YA 3ICLA 2P6TA 1FKPA 1P9YA 3ETMA 3HF5A 3ET6B 3OSPA 3BV8A 3MM5B 4DSEA 3B8HA 2AJ4A 3M32A 1FVQA 3IS9B 4K4WA 2B0GA 4PYDA 3OQ2A 3DDNA 3CEDA 2VIHA 4K4XA 3H5XA 4W90B 2VDIA 1ITPA 7AT1B 3FMWA 1NHKL 4Z7CA 2AQ4A 1K0TA 4DR5J 3LP2A 3NNCA 4P71A 1C0TA 4Q0BB 2X1GA 3MEGB 2CPFA 3J7YU 2RHSB 1HWKA 1HNIB 4JP8A 4EUVA 2XS2A 3CJRA 4HH1A 1HL6A 4DR6F 2X51A 1CC8A 5DG9A 2HVDA 2ZH1A 2XY7A 1F5AA 2FHJD 3C15A 3PG9A 2P9CA 4J9OA 4H4OB 3FEZA 1N5TA 2BRKA 4DI6A 5I3QA 4H4MB 2ZH7A 4OMFG 4DQPA 2VOOA 5AXNA 4MKAA 3UWTA 4J5OA 1K44A 5HAOA 4CYUA 1N32F 1FX4A 1C1CA 2LFVA 1XIQA 1RTJA
chains in the Genus database with same CATH topology
3GJTB 2XYGB 2QL7B 2H4WB 2CNNB 2C2MB 4ZVPB 3IBCB 3GJSB 2QL9B 2C1EB 1F9EB 1RWXB 3D6FB 3QNWB 1I3OB 2QLBB 4DCJB 2H51B 3P4UB 4JB8B 4ZVSB 1PYOB 3KJNB 4ZVOB 4DCPB 1I51B 5K20B 5IC6B 1SC1B 3R7SB 3D6MB 2QLJB 2C2ZB 2CJYB 4LSZB 1QDUB 2H5IB 3GJQB 2CNLB 2CJXB 3R5JB 1RWWB 2H65B 3GJRB 2XZTB 3SIPB 2XYHB 3R7NB 1RWVB 1RWPB 1ICEB 1SC3B 3RJMB 3R6LB 3R7BB 2CNKB 1SC4B 1RHQB 3EDQB 1NMEB 1RHKB 1QTNB 2P2CB 2C2OB 1RHRB 2Y1LB 1PAUB 1RHMB 4ZVTB 1RHJB 2HBZB 1BMQB 2H48B 2QLFB 3D6HB 5IC4B 2DKOB 1RHUB 2FQQB 3P45B 2Y0BB 1RE1B 2XZDB 3EDRB 2H54B 1RWOB 2XYPB 2HBRB 3KJQB 2HBYB 3NS7B 3R6GB 2C2KB 2H5JB 4ZVQB 4ZVRB 1RWKB 1GFWB 4DCOB 2CNOB 3IBFB 2CDRB 2H4YB 1RWNB 4ZVUB 2HBQB 1RWMB 1IBCB 2QL5B 3KJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJT B;  2XYG B;  2QL7 B;  2H4W B;  2CNN B;  2C2M B;  4ZVP B;  3IBC B;  3GJS B;  2QL9 B;  2C1E B;  1F9E B;  1RWX B;  3D6F B;  3QNW B;  1I3O B;  2QLB B;  4DCJ B;  2H51 B;  3P4U B;  4JB8 B;  4ZVS B;  1PYO B;  3KJN B;  4ZVO B;  4DCP B;  1I51 B;  5K20 B;  5IC6 B;  1SC1 B;  3R7S B;  3D6M B;  2QLJ B;  2C2Z B;  2CJY B;  4LSZ B;  1QDU B;  2H5I B;  3GJQ B;  2CNL B;  2CJX B;  3R5J B;  1RWW B;  2H65 B;  3GJR B;  2XZT B;  3SIP B;  2XYH B;  3R7N B;  1RWV B;  1RWP B;  1ICE B;  1SC3 B;  3RJM B;  3R6L B;  3R7B B;  2CNK B;  1SC4 B;  1RHQ B;  3EDQ B;  1NME B;  1RHK B;  1QTN B;  2P2C B;  2C2O B;  1RHR B;  2Y1L B;  1PAU B;  1RHM B;  4ZVT B;  1RHJ B;  2HBZ B;  1BMQ B;  2H48 B;  2QLF B;  3D6H B;  5IC4 B;  2DKO B;  1RHU B;  2FQQ B;  3P45 B;  2Y0B B;  1RE1 B;  2XZD B;  3EDR B;  2H54 B;  1RWO B;  2XYP B;  2HBR B;  3KJQ B;  2HBY B;  3NS7 B;  3R6G B;  2C2K B;  2H5J B;  4ZVQ B;  4ZVR B;  1RWK B;  1GFW B;  4DCO B;  2CNO B;  3IBF B;  2CDR B;  2H4Y B;  1RWN B;  4ZVU B;  2HBQ B;  1RWM B;  1IBC B;  2QL5 B;  3KJF B; 
#chains in the Genus database with same CATH topology
 4TYB A;  1WKK A;  2DIU A;  4M5H A;  1F2H A;  2XS7 A;  2MQO A;  3T1Y F;  3M8Y A;  1KC8 T;  3Q8P B;  2BKO A;  3ISZ A;  5E3A A;  2RQC A;  4UY8 T;  4P72 A;  1EZZ B;  2CPJ A;  2XMV A;  4ID5 A;  1R7I A;  4NLG A;  3M1V B;  1KVI A;  2MSS A;  3DDK A;  1EB0 A;  1TL4 A;  5EX3 A;  3QO9 B;  3TO8 A;  3TAR A;  1RTJ B;  2OPP B;  4ES3 A;  4DR7 J;  1F5B A;  4X4S A;  2M9K A;  5E3R A;  1R0B G;  4EMD A;  3U02 A;  1VRT B;  3UI3 A;  3QSI A;  3D6F B;  4DPO A;  1I3O B;  3P5B P;  1NM2 A;  2Z30 B;  4FZV A;  1K1Q A;  4FBT A;  4L6V 3;  3P6Y C;  5J2P A;  3HX9 A;  4ZVG A;  5J2N B;  1T3N A;  1LV5 A;  2I1R A;  4ZPV R;  2WVB A;  4JI4 J;  3TI0 A;  4DFP A;  3UDC A;  4IH7 A;  2VFV A;  3M6W A;  2LA4 A;  3OTC A;  3MM9 B;  3OR1 B;  3TWZ A;  2UUT A;  1WI6 A;  4CM0 A;  2BE9 B;  4R5P A;  4BS2 A;  2YNI B;  1GX6 A;  1NK5 A;  3HJV A;  4CTA A;  3A8E A;  3I0S A;  2JFK A;  5KFJ A;  4F8R A;  1ZAV A;  2MZJ A;  2W2N P;  1S7H A;  1CJK A;  3GIL A;  1PGZ A;  5BR8 J;  4CLK A;  4OJ3 A;  3W9H A;  3UQS A;  2BEF A;  2JVR A;  4CZC A;  5J2M B;  4K4T A;  4KO0 B;  4DS4 A;  2ZOM A;  1SJ3 P;  3WIV A;  4MKV A;  4EZ6 A;  3VAH A;  2Z58 B;  2Y8Y A;  4CDI A;  4K0K F;  1OY9 A;  3TVY A;  1EKS A;  4UUX A;  1F1B B;  4C7Q A;  8AT1 B;  5I4M A;  1M5O C;  2C2N A;  3EVM A;  4G1Q A;  5AE3 A;  2GA7 A;  1HQU B;  2VF3 A;  4CNY A;  4X4T A;  4C11 B;  2J0S D;  2DGS A;  4UTG A;  2LQB A;  2MZT A;  3T1H J;  5IT9 Y;  4LFB J;  2WOM A;  2RVJ A;  3DRP A;  4HT7 A;  4NA3 A;  4B17 A;  3ADA C;  4RNN A;  3KLE A;  4X4O A;  2VQE F;  2EVZ A;  5CA5 A;  1TKZ A;  3R7B B;  1S5Z A;  2KT3 A;  1D3W A;  5DLG A;  1ZET A;  3OR2 A;  5GAE U;  2LDI A;  4F4X A;  4IRD A;  3C6T B;  4F67 A;  5HLF B;  1NKC A;  4HYK A;  5D77 A;  2NXJ A;  1F0X A;  3GSI A;  4MIW A;  3NBP B;  1MLA A;  5LL6 d;  3O5T B;  5DQI A;  1XMO F;  2C2O B;  1AFJ A;  2CJQ A;  3PX0 A;  4NA1 A;  3RR8 A;  3DC2 A;  1Q5Y A;  2IRU A;  2NLW A;  3K17 A;  4IDK A;  3CD0 A;  4S0M A;  5K9F A;  2R7R A;  1JLA B;  2E5H A;  3GFX A;  4BWM A;  4DN9 A;  1PBA A;  2ZHB A;  1VFJ A;  2F65 A;  4M5K A;  5A0Y A;  3BQ1 A;  1TL3 B;  3TUJ C;  1EQM A;  1TU0 B;  2CJA A;  1KFD A;  4CNZ A;  2HLT A;  3MM6 B;  3PX4 A;  3MUV P;  3EUN A;  1SKR A;  3OPK A;  2PEH A;  4DU7 A;  2I2Y A;  2J6T A;  1HD1 A;  4J9P A;  4ED1 A;  3OUY A;  3LP1 A;  1FRL A;  3W5Z A;  1SC6 A;  2W25 A;  4N77 A;  2FJE B;  3MMA A;  5EN1 A;  4B3T J;  2K7J A;  3I6P A;  3P96 A;  5A8W B;  2NUU G;  1JLG A;  3EDR B;  1GEH A;  5KTQ A;  2QA4 G;  4OJH A;  2AIR B;  3I4P A;  4FXW A;  2CQ0 A;  1W26 A;  3TP2 A;  3KHH A;  3BBC A;  4LVN P;  4ELT A;  3DGP A;  3J7A N;  1S9F A;  3R1L A;  1FK9 A;  2E5I A;  4ED6 A;  1IVZ A;  3FRZ A;  2GIR A;  1PKU A;  3M8Q A;  4XTT A;  1CS4 A;  2UXB J;  2DRA A;  2CQP A;  4J9R A;  2HVE A;  1X5O A;  4HHU A;  2HAI A;  3DOL A;  3R5A A;  3G6E S;  4OI4 A;  5HP1 A;  1VQO S;  4O0I A;  2HS0 A;  2VU5 A;  4OIX A;  2R7U A;  1IJE B;  5L38 A;  2XC9 A;  4NLT A;  1BQN A;  1VRU B;  1SQF A;  4NA2 A;  5L9X A;  4ZLJ A;  4N56 A;  1VQ9 S;  1RKJ A;  2FUG 9;  4RNF A;  4OX8 A;  1X4F A;  3OVB A;  4ZHR A;  3JSR A;  2FJV A;  4Y28 C;  2AYM A;  1OSC A;  3I0S B;  1S1V A;  4F0H A;  5A8K B;  2GGP A;  2JHE A;  4R8U B;  1IBM F;  2BQU A;  1SV5 B;  3PJX A;  4ES2 A;  5DGA A;  4KHP J;  1D09 B;  2N3L A;  1WSR A;  4FYW B;  1N0U A;  4DV2 J;  1H38 A;  1S9E A;  3PHE A;  3PIO Q;  2W2M P;  1YZ7 A;  4NLP A;  1IN0 A;  2BAB A;  1C1B A;  3DLG A;  1LW2 A;  4LRB A;  3HHL C;  4ELV A;  1B64 A;  3HM9 A;  5LXR A;  4K7Q A;  1JJH A;  1FWP A;  3N0V A;  3KNG A;  1V5I B;  2HSE B;  4AXJ A;  1FRM A;  3BYP A;  4DFM A;  2R8I A;  1UEU A;  2V4R A;  4KH0 B;  3LGM A;  1N48 A;  4LF6 F;  2BVZ A;  5IT4 A;  2QJ3 A;  3M1V A;  1PYO B;  3NGT A;  2AX0 A;  2HFS A;  1RLC L;  3DYA B;  4IOB A;  4EO8 A;  1X5T A;  5LMN J;  2F4V F;  3Q8Y A;  4BHQ A;  4U95 A;  3HXM A;  1GK8 A;  2CIM A;  3AT1 B;  4DV3 F;  4QWE A;  3IWX A;  3LAL A;  2MY7 A;  4MIB A;  1YGY A;  2Z56 B;  3T9N A;  1FT8 A;  4DV4 J;  3KFW X;  5FJ4 A;  1L5U A;  2VFS A;  1RT7 A;  1S1T B;  2ZUA A;  3FRY A;  2LXI A;  3A8K A;  3OD2 A;  4Q43 A;  1S72 S;  4USI A;  3TEG A;  2V8P A;  2HHT A;  2E1M C;  1DTT B;  2ZHO A;  5J2M A;  3U1N A;  1L3V A;  3I96 A;  4K0K J;  4I4B A;  4LR9 A;  3VAG A;  2DY1 A;  1ZH5 A;  1Z1Z A;  2Y1R I;  3TVZ A;  5SUH A;  3GII A;  1JK9 B;  2DH8 A;  2CNL B;  2YNI A;  3IRW P;  2CJX B;  1RWW B;  3OR1 A;  2L3M A;  3W2W A;  1FNO A;  4NLW A;  1Y3J A;  1YWX A;  2XI3 A;  3MEG A;  4N8N A;  3W66 A;  2LA6 A;  2BJE A;  3D0H E;  3GV5 B;  1U6B A;  2M7S A;  2OMO A;  4FP9 A;  2VFT A;  3JQM A;  3PYG A;  5DS7 A;  2QYG A;  1VC0 A;  3GON A;  3H8Y A;  4TKT A;  2FHO B;  1MML A;  3ZZU A;  3MCM A;  4OI1 A;  1FNX H;  4GKK J;  1H0H B;  2HIY A;  5JVH Q;  2ZOG A;  2OP5 A;  2UXC F;  1OSD A;  2UV8 G;  5I3P A;  3TAN A;  1TL1 B;  1DQ9 A;  3EMT A;  4XDD A;  5KFA A;  2MPU A;  5THW A;  3BGR A;  4RU9 A;  1HQE A;  4O3Q A;  4DX8 H;  2HMI B;  4IQX A;  1FNM A;  4LQ9 A;  2GQQ A;  4TY8 A;  2R2S A;  4EBE A;  4DV2 F;  2ALZ A;  2IRX A;  1P1L A;  2CQD A;  1RAC B;  2NXU A;  4WFY A;  2Y1L B;  5HVH A;  1F9F A;  1VBZ A;  1KRP A;  2R8G A;  5A2Q U;  3DHX A;  4EU0 A;  3NL0 A;  4DFK A;  3OFF A;  5RUB A;  2J9D A;  5BXI A;  4ETZ A;  2DK2 A;  1WF0 A;  3J7A 1;  1UWA A;  3KNA A;  3BYR A;  1NSQ A;  2ZNY A;  2R3V A;  2QIF A;  4CLT A;  1UJ4 A;  2PDA A;  4M5J A;  2WAQ D;  4A8Q A;  2RRA A;  2RQK A;  4FDF A;  2KFN A;  4DG1 A;  2PI4 A;  1T9U A;  1B0V A;  2YX1 A;  2YH0 A;  3HDS A;  1UVI A;  3CE8 A;  2P9G A;  1VCT A;  3IG1 A;  3NS6 A;  4NLV A;  1Q79 A;  1HPZ B;  4USU A;  2LQJ A;  5CXT A;  2WRM A;  2HK3 A;  1FVS A;  1UET A;  2DNP A;  3VTI A;  4YDD B;  3K5L A;  5KFN A;  1TK8 A;  4B08 A;  4M95 A;  3LP2 B;  4QPX A;  3M8W A;  1WEY A;  4JI3 J;  1SB6 A;  2XQC A;  1KS2 A;  2G2Y A;  5E3Q A;  4QWA A;  3NS7 B;  3KLI A;  3R6G B;  1CJV B;  2H5J B;  3FFI A;  4LBI A;  3L95 X;  1NU4 A;  1FRH A;  2POK A;  2VPX B;  3QIP A;  5IQQ A;  5KFM A;  4DU8 A;  5F8N A;  3QJJ A;  2CQ3 A;  1Y11 A;  2CDQ A;  3I32 A;  2CDR B;  2H4Y B;  2JNJ A;  4DLE A;  2XSJ A;  1R0A B;  4FS2 A;  1QSL A;  1RWN B;  3N01 A;  1NPP A;  1JLQ B;  3AOB A;  4LJM A;  1L3T A;  4MKY A;  3DRS B;  4FN5 A;  2VG7 A;  1NCL A;  3KWM A;  4Y3C A;  2PMH A;  4DX5 A;  3GIJ A;  4GKK F;  2GMH A;  5BYR A;  5KT4 A;  3BS9 A;  1RYR A;  3WC2 A;  3RRG A;  4DL6 A;  2ZVI A;  2JEG A;  1X9S A;  2IHR 1;  4HTI A;  5CCL A;  2QL7 B;  3NOG A;  3C46 A;  5C7P A;  1RBA A;  3KMQ A;  3OJU A;  2YKP A;  4DR1 J;  3R2C J;  1SBR A;  4TLR A;  3K5N A;  2CKW A;  3EJM A;  2DXD A;  1SJ4 P;  4LFA J;  4KKO B;  2VA2 A;  2FY8 A;  1BHN A;  4Z7Y A;  1UA0 A;  3IGN A;  3QAT A;  4LR8 A;  4R25 A;  4K2J A;  5CQG A;  4ZN1 A;  3H98 A;  2HIQ A;  3QNW B;  4WJB A;  4KGZ B;  1YX2 A;  3H2U B;  4KC5 A;  4WZQ A;  1JLF B;  2B5J A;  1B3T A;  2YTC A;  4IOA Q;  2A0F B;  2VJV A;  3N6M A;  1S6P B;  3C6U A;  3EGV A;  3HSJ A;  5JMN A;  4XPE A;  4C8L A;  5KOW A;  4J37 A;  5FII A;  3QJL A;  2NZ4 A;  3EVO A;  4F4K A;  4F3Q A;  2F4V J;  4KFB A;  4LF2 A;  2FIU A;  4OQJ A;  1WDT A;  1ZM4 A;  2P8I A;  1I5O B;  2AJF E;  4O3P A;  3R7S B;  2BOA A;  1UWB A;  5D4L A;  1S4F A;  1R8A A;  3N28 A;  5ETL A;  4AE5 A;  4A46 A;  3CCZ A;  3SBM A;  3Q8R B;  3MFI A;  5KFQ A;  3CUN A;  3Q23 A;  1T03 A;  1J5O A;  2R7S A;  1WHV A;  3B78 A;  1FRI A;  2JLG A;  3PJ9 A;  3DI6 A;  5KG2 A;  2DR7 A;  2KG1 A;  4RWW A;  3C16 B;  2C2Z B;  1HHT P;  2IM3 A;  1BE4 A;  4J9V A;  3CDA A;  2F8E X;  1WHW A;  1DTT A;  2B8Q A;  5B0G A;  4OJG A;  3M2R B;  3PTW A;  2WK4 A;  2LMI A;  5E3C A;  1ZM2 A;  1VC5 A;  2R7X A;  3NEK A;  4ERD A;  4B3O B;  2AX1 A;  4B9V A;  3VGT A;  5E2Q A;  4ZCL A;  1N5S A;  3CJS A;  2YH1 A;  3BSO A;  2UP1 A;  3VAL A;  4LF7 J;  1UFW A;  4Q7A A;  1C2P A;  1C0U B;  1P1T A;  3V81 A;  3N5B A;  1OMS A;  2BX6 A;  2VON A;  2HND B;  2HWI A;  5KT3 A;  4GVB A;  1X4C A;  1YHQ S;  4ICL A;  1F3F A;  4YOE A;  1RYS A;  4JI4 F;  3W64 A;  6FD1 A;  1QAJ A;  3RAM A;  2DEI A;  2VC1 A;  4CI0 B;  1RLD A;  1S6U A;  3OL9 A;  3G4S S;  2DNZ A;  4UOC A;  1IBK F;  1NK7 A;  1RHR B;  3QZ8 A;  3HT0 A;  3RB4 A;  4LF5 F;  9ATC B;  1GXT A;  5F8M A;  3R97 A;  2L9W A;  2XWX A;  3HD2 A;  2DNK A;  3M2U A;  3OXG A;  3S01 A;  3GSD A;  2W9B B;  4RBU A;  2QFJ A;  1KEK A;  2JC1 A;  3OVS A;  3FBF A;  5KFU A;  2L48 A;  3KK3 B;  3MUT P;  2W2Q P;  4X62 F;  1N5Y A;  1X4E A;  1CEZ A;  2ACM A;  2G13 A;  2QSF A;  1H73 A;  5HN0 A;  3KK1 A;  4WF9 Q;  3G8T A;  3OXL A;  1XTZ A;  1GTH A;  1B0P A;  1VR6 A;  3FSX A;  3MEC A;  4I56 A;  3KG4 A;  2JEF A;  4C0H A;  1SL2 A;  2DGQ A;  1R6V A;  5L39 A;  5SZT A;  1TAQ A;  3U27 A;  4IRK A;  2E1A A;  4GVB B;  3B82 A;  1UKU A;  2ROG A;  1RAJ A;  2HK2 A;  2VPY B;  3EZO A;  2X3G A;  5J1N A;  3HUL A;  4ETX A;  2PO4 A;  4LFC J;  3PRB A;  2FTR A;  2IVM A;  3MTK A;  4HTJ A;  4I6A A;  3MUR P;  4LF4 J;  3E01 A;  2EXU A;  2EG1 A;  1MWY A;  2YVS A;  2ZM6 F;  1R8H A;  4Y65 A;  2Z2Z A;  3EXC X;  4DL0 C;  2CQ2 A;  4WE1 B;  4DCO B;  4O3N A;  3C16 A;  1S1X A;  3CCE S;  1WD6 A;  3J80 Y;  2UXC J;  4KGV B;  3HHE A;  5CYQ B;  4C8O A;  2MJN A;  4F4A A;  5KT6 A;  2E9Z A;  2B3T B;  4P2F A;  4U6P A;  3KK3 A;  1I94 F;  3G8Q A;  2ZWO A;  1CVJ A;  2M88 A;  2EFQ A;  2BJD A;  3GJT B;  2BBE A;  2B4V A;  1UW4 A;  2PD1 A;  1UJ6 A;  5D0R A;  1L3U A;  3IGV A;  4OV1 A;  2BW7 A;  2HAF A;  2NXE A;  2WW4 A;  1V3Z A;  1BWE A;  1X4B A;  2QEX S;  3BJY A;  1JLC A;  2G2O A;  3QGI A;  1FE0 A;  4P2S A;  2B7B B;  1S1V B;  5KFP A;  5AXL A;  2HNY B;  4DL3 A;  5F8J A;  1X4H A;  1CG2 A;  2IAJ A;  1R89 A;  5IOL A;  1DJ0 A;  2V9K A;  5F0W A;  4P2M A;  1U4B A;  1IR2 A;  2HND A;  2V4J B;  1QVG R;  1BUX A;  5HVG A;  2KTQ A;  2FC9 A;  1SI9 A;  1WSV A;  2EPI A;  3KJN B;  2Z8Q A;  2FHK A;  3Q2S C;  2GZO A;  2A3J A;  4G6V B;  2V4Q A;  3BSN A;  2HHW A;  2XMK A;  2DNQ A;  4OHZ A;  2UUW A;  1U6F A;  3K2Y A;  4HR2 A;  1FK9 B;  2OSQ A;  2W1B A;  4KGX B;  4NLQ A;  1NXI A;  4O44 A;  1FKO A;  2A2D A;  2KXF A;  4F3M A;  3SDE A;  5CCM A;  2XGQ A;  2BMB A;  2NS1 B;  1UFL A;  3MPY A;  3NGD A;  2V94 A;  5A8W A;  3BZQ A;  1HWL A;  5I42 A;  2X7I A;  1VBX A;  4O3S A;  1TFY A;  2RKI A;  1FJ7 A;  2XSJ B;  1U8W A;  3HKW A;  4ZVF A;  4OI3 A;  3O2I A;  2N7C A;  4DUY J;  4J9L A;  4TN2 A;  1HNZ J;  1JJC B;  4NAS A;  1IR0 A;  4U96 A;  1LWF B;  1YDL A;  1D1U A;  1QDU B;  1UPP A;  3AD7 C;  3DHW C;  1CJT B;  2CQ4 A;  3P3D A;  4CLP A;  1CJV A;  3FFI B;  1UEK A;  3CDW A;  1LWC A;  3GJQ B;  3G71 S;  3HVW A;  5LSO A;  5B0C A;  3VAM A;  4NLR A;  4NRT A;  3WZ0 A;  4AQY J;  3BKU A;  1RP5 A;  1TKX B;  5CD4 H;  4ENO A;  3LWM A;  4FS1 A;  4NE9 C;  2R2T A;  3B4M A;  4L75 A;  2QLW A;  3GIR A;  3RU0 A;  3VF0 B;  1BY9 A;  3CJ0 A;  2CNK B;  3ZZ0 A;  4IG0 B;  3Q22 A;  2RU3 A;  4DR2 F;  1HMV B;  2QX0 A;  2M8D B;  1RHQ B;  2DR6 A;  2BKP A;  1HFE L;  2H3E B;  1VQY A;  4TYA A;  2HZC A;  2EWH A;  2ZBP A;  2O3D A;  3FZ2 A;  3QFW A;  2I6W A;  3ZNU A;  3TQ1 A;  3K59 A;  1NK9 A;  1YRT A;  4Q8E A;  4FXV A;  2OPR A;  3TZW A;  5F41 A;  2LDY A;  4JI1 F;  2A2C A;  4R0J A;  2HQD A;  1URN A;  4BDP A;  1RHJ B;  3D3C J;  3DLJ A;  4IQM A;  4FKX A;  2WVE A;  4Q2M A;  2GNK A;  3D68 A;  3D0G E;  5EWE A;  3N6L A;  1RI7 A;  3HKZ D;  3VGU A;  4B3M F;  3TUP A;  1NUE A;  1W2I A;  3SSR A;  4B3T F;  5CH7 B;  1S57 A;  3QMQ A;  2HMI A;  1K73 T;  2DKO B;  2FB0 A;  3CJ4 A;  3MWB A;  4ANE A;  4DV1 J;  2AV5 A;  4MK9 A;  2RML A;  5LJ3 Y;  1FXR A;  3CME S;  2VA3 A;  1U0H A;  2FLO A;  2R8K A;  2F3J A;  9RUB A;  3JTO A;  4MIA A;  1BD6 A;  4IH5 A;  3TQE A;  1TAU A;  1VQ5 S;  2GJF A;  1SH0 A;  1RWU A;  2HRU A;  2BAC A;  3AD8 C;  3PW7 A;  1TP7 A;  4CLW A;  4IG3 A;  1BWV A;  4RWX A;  1OY8 A;  4DPX A;  1OYD A;  3CTR A;  1UPM B;  1NJI T;  2NXC A;  1FFW B;  2MDA A;  3ENW A;  4KBI A;  4CLL A;  1HLW A;  3FDS A;  1IBK J;  3NLC A;  5J2Q B;  1VS3 A;  1U1K A;  4PQA A;  3BN7 A;  4NCG B;  1F3V A;  2V5H G;  1V3S A;  2EEY A;  1JXV A;  1MN7 A;  3CCT A;  1LNQ A;  2MY8 A;  3L7P A;  3LAK A;  1JLB A;  1JJ4 A;  1UVL A;  1JIH A;  2B4O A;  3P8B B;  3KKF A;  4NLU A;  1VOM A;  4Y00 A;  3OJS A;  5KFL A;  3M8P A;  1HQ2 A;  2XYG B;  5H9F J;  4AQY F;  4QYZ K;  3QFH A;  4NRU A;  3TA0 A;  1Q16 B;  3KXD A;  3S7R A;  5DDO C;  3FBB A;  2CNN B;  2C2M B;  1U1O A;  4I68 A;  1RT1 B;  3PV8 A;  4QIE A;  1KTV A;  3QWU A;  4ILL A;  1DLO A;  1RT6 A;  3DKD A;  1HQE B;  4OZJ A;  1MSW D;  3KUE A;  3PAC A;  1F9E B;  4X4U A;  4M8L A;  1X8D A;  4Q2L A;  2ZKT A;  3H25 A;  4DF8 A;  1RBL A;  2COL A;  2IIH A;  3ZTS A;  2RS8 A;  3MR2 A;  4ZPA A;  3ILL A;  4DJB A;  1X7V A;  3DMJ B;  3MR3 A;  4DV5 J;  5LOQ A;  1M5K C;  2RDJ A;  1Q82 T;  1PSD A;  1DUR A;  1HWJ A;  2RIJ A;  1RJJ A;  1UTA A;  2W2P P;  3LH2 S;  5KG6 A;  3MM8 B;  2DH7 A;  4H54 A;  4MMO A;  2E9R X;  2AJQ A;  4XPC A;  1NND A;  1ZS6 A;  5EWF A;  1VMB A;  2DT9 A;  4DV0 J;  5C42 B;  2B4P A;  2DNR A;  1RAE B;  4F26 A;  3AJ2 A;  1IKY B;  3HHL A;  3JTN A;  2ASD A;  4DLG A;  3W61 A;  2EFN A;  1AZS A;  4ZIV A;  2IMW P;  1VBY A;  1G6B A;  1VYA A;  2M4M A;  2VL1 A;  2IM2 A;  4DOZ A;  1WOR A;  3M32 B;  3BO4 A;  1SQE A;  1JMT A;  2F63 A;  3FEX B;  3UR3 C;  1QTM A;  4IFV A;  2CPY A;  3MOJ B;  3BDP A;  2MKK A;  3NWG A;  2QMX A;  2YKQ A;  3GYG A;  4RBT A;  2KB2 A;  1FRJ A;  3R5G A;  1YRU A;  4O4G A;  4X4Q A;  2GO9 A;  3I82 A;  2XZT B;  3QGH A;  1UVM A;  2V67 A;  3IBW A;  1FKO B;  4PKD B;  4HKQ A;  1RWV B;  3JSY A;  4OYM A;  3POT B;  4RW7 A;  4B02 A;  3KJV B;  1JJ2 R;  1F5C A;  3ZC4 A;  1B70 B;  2E5L J;  3C19 A;  1SQG A;  1IKX B;  2MMY A;  1FXL A;  4OLP A;  5EHH A;  4F4Y A;  1SC4 B;  4I2P B;  2J6S A;  4OZ2 A;  1FWL A;  3AOD A;  2XLJ A;  1S1U A;  3A1Y G;  3M2V A;  1T05 A;  1Z2Z A;  2LP4 A;  2DEJ A;  3M6V A;  4ZJO A;  4ECQ A;  1U7L A;  4X84 A;  4NPO A;  4OFZ A;  1FWK A;  2WON A;  1RAF B;  4R8U A;  2K1R B;  5IQ6 A;  4PYA A;  1BQM B;  2J8A A;  1S1W A;  3H5U A;  1YKW A;  4N7T A;  2ZUG A;  1BQM A;  3KG0 A;  4NLY A;  3AB2 B;  3N79 A;  4G3I A;  1JLC B;  4IOC Q;  1TKX A;  2XSF A;  3B54 A;  1D9F A;  1I94 J;  4NXM F;  2MHN A;  1OYE A;  2KYX A;  4LIW A;  3TAM A;  2YWH A;  5KFG A;  3T9Z A;  5CYJ A;  5GMK a;  3OL8 A;  2R42 A;  4RW9 A;  5KFD A;  2FJD B;  3HVT B;  3MCS A;  4C0O C;  1WOO A;  2FQQ B;  1DTQ B;  1CUL A;  1E6Y A;  2V2V A;  1MRO B;  3ZZO A;  1SL0 A;  3WQP A;  5GAH I;  4JV5 J;  4YEA A;  4N47 A;  1HHS A;  4XK8 C;  1S1X B;  3IA0 A;  4NXM J;  4UQG A;  1P6T A;  2CZ9 A;  2VAS A;  3RBZ A;  3SCJ E;  5HQ8 A;  1XNQ F;  4LSL A;  2NQP A;  3AOA A;  2HZA A;  5IT0 A;  2HBY B;  3FVY A;  5G0R B;  3KLG B;  3D1Q A;  5KFH A;  3MMA B;  2CXE A;  1MWQ A;  3QGP A;  1RAG B;  2IA6 A;  3D9B A;  3OUY B;  2ZH3 A;  3IP0 A;  2RHQ B;  4WII A;  3DM2 B;  2AW0 A;  4LBH A;  5KT5 A;  3SZ2 A;  3LUY A;  2KYZ A;  2FD2 A;  3QT7 A;  2KHD A;  4NI2 A;  3TUZ C;  4TU7 A;  3EE3 A;  2RT3 A;  4M5L A;  2BJ8 A;  2XNQ A;  3QLH A;  4MFB A;  2MKJ A;  1Q81 T;  2JX2 A;  2OPQ A;  3BGO P;  3DXS X;  4QOT A;  1ZZF A;  5HMX A;  1HNW J;  5GAD U;  3GLJ A;  3DRR B;  2BXJ A;  3CCW A;  1D8Z A;  4DSF A;  3GQC A;  1NH8 A;  3FCW A;  1H72 C;  4V1A k;  2E5J A;  4OX9 F;  3MM9 A;  4A8O A;  3K7R A;  2ASL A;  3G96 A;  1HR0 J;  4DBQ A;  2JEJ A;  3OXF A;  2G9O A;  1OPZ A;  3J7Y I;  3GCX P;  4LRA A;  2JVO A;  4DQS A;  1QLN A;  3HSZ A;  2VV5 A;  3C6T A;  5HLF A;  4B9M A;  1FJC A;  2ZBQ A;  4IR1 A;  2LCW A;  2P6S A;  2QLB B;  1TUV A;  3OR2 B;  4QU7 A;  4M63 A;  3RAQ A;  1ARO P;  1AUD A;  3T5J A;  3P4U B;  3K0J A;  1YG0 A;  3I0R A;  4QIV A;  4WE1 A;  4DR2 J;  5LXY A;  1RT2 A;  4PWW A;  4DCP B;  2V2K A;  2VZ9 A;  2MQ8 A;  3LOU A;  2MQP A;  1XNR J;  1TMJ A;  3HK2 A;  2VFU A;  3W8P A;  1HNV B;  1HQU A;  2AWZ A;  3P49 B;  3CVK A;  2DGV A;  2B43 A;  3MOZ A;  2Y1J A;  2MST A;  3CCS S;  1F2G A;  2GAH C;  2YKM A;  2Z57 B;  1KKH A;  3MEE A;  1MU2 A;  4I0W A;  4F4W A;  2CPE A;  3GV7 B;  4B3S F;  1JWW A;  1E6V A;  3IAM 9;  4H4M A;  5DM6 Q;  2UUB F;  3DLE B;  4ZCM A;  4Y34 A;  1EP4 A;  4H4O A;  1DAR A;  4YY3 F;  2OHD A;  4KIA A;  1U1N A;  4HL9 A;  4P75 A;  2FLN A;  1NB2 A;  5C42 A;  2HG4 A;  4P10 A;  2ZH6 A;  3QYY A;  4URQ U;  2OPS B;  5KT7 A;  2OKQ A;  4JI6 F;  1S77 D;  4C4W A;  4F0K A;  1HNX F;  2G0I A;  3BM7 A;  3EZ5 A;  4IG3 B;  2W2O P;  3PYF A;  3R5B A;  1RWP B;  4NXN F;  1WTB A;  2EKN A;  1B0T A;  4RUB A;  3HCX A;  3V4M A;  5ITH A;  3JAM U;  4NLO A;  5JXS A;  4KQZ A;  5KFX A;  1D9D A;  4F2R A;  3G6V A;  3G86 A;  3VVT A;  2MGZ B;  1FJG J;  2HVH A;  2ATC B;  4X4R A;  3CCR S;  4BLG A;  2Q3P A;  2B5J B;  1QTN B;  1T3O A;  2XMJ A;  2WVF A;  1LOU A;  4CLU A;  4WP3 A;  4LFA F;  1IR1 A;  3CJK B;  5KOX A;  5KFS A;  2E1C A;  4J9N A;  3QAU A;  5A6P A;  1V3R A;  2RRN A;  1PAU B;  2RB7 A;  4WIQ A;  3ENQ A;  2M8H A;  3KDO A;  2DNG A;  1TKT B;  3IC1 A;  3NGK A;  4UF4 A;  1DAX A;  4O3O A;  3UCU P;  5F9N A;  3PW0 A;  2J7U A;  4PPD A;  5CAA A;  2QA2 A;  4X2B A;  3NS5 A;  1YSJ A;  2H48 B;  2HVZ A;  2VKR A;  4OX7 A;  4YB5 A;  4X66 F;  3UNG C;  4ZK7 M;  1RXO B;  1NB7 A;  1A6L A;  2IA0 A;  2HHS A;  4WKY A;  5HJY A;  3H5S A;  1UVJ A;  3E2E A;  2XLI A;  1IQZ A;  2LYV A;  1ZTT A;  4ZCI A;  1KTQ A;  5J1E A;  3CJT A;  4D3G A;  1Q1K A;  1FD2 A;  2FDN A;  1WAC A;  3OTB A;  4RW6 B;  3KK2 A;  2ZBI A;  1JQG A;  1DQA A;  3QIP B;  4DSI A;  1VRQ C;  4DR6 J;  2QGF B;  4A8F A;  1VQN S;  3UDE A;  3TZZ A;  1XNQ J;  4L76 A;  2ZD1 A;  2DR8 A;  4F02 A;  4MAK A;  2F8M A;  2K3K A;  3CWJ A;  4ECX A;  2PI5 A;  3A3O B;  3IBF B;  2CA9 A;  4KPC A;  2CQI A;  1P8G A;  1FD8 A;  1N8R T;  3G2X A;  3HMJ G;  5ETO A;  2PFF B;  1WUU A;  4RNM A;  3GCW P;  1SH2 A;  2HHQ A;  4CLS A;  3CC2 S;  4LRE A;  2GIF A;  4I7F B;  3HHN B;  1FF2 A;  3HFZ B;  4RW4 A;  1U1L A;  2XMM A;  4WTY A;  3OTO F;  2IM0 A;  5MLC V;  3VGV A;  5KG5 A;  3CGI A;  1IUJ A;  1M5H A;  2CFX A;  4K5S A;  2E9T A;  3WDO A;  1R8C A;  4OYB A;  3M6X A;  5F8I A;  3D7S B;  2I9S A;  4EZ9 A;  2XMU A;  3LPE A;  4JI8 F;  1X5P A;  1M5S A;  3IBC B;  3CCM S;  3QJP A;  2W24 A;  3A8J A;  4YFU A;  2C1E B;  5DDR C;  2QTW A;  2ZKU A;  1FFG B;  3Q83 A;  3PR5 B;  2VG7 B;  1HMV A;  5CYM A;  3M30 A;  2V50 A;  3NMA A;  3GR1 A;  5IWA F;  5IM0 A;  4DR3 J;  3SSS A;  3D54 A;  4X64 J;  3VZH A;  2X1A A;  5HQM A;  2NPF A;  1U2F A;  2W9A A;  4LF8 J;  1R43 A;  5HBM A;  2LQ8 A;  2KT2 A;  2YKA A;  3HHD A;  4ECW A;  5C24 A;  2ZIT A;  2A10 A;  1FRX A;  4MJK A;  1LWE B;  2V69 A;  4CH0 S;  3OW2 R;  3V6H A;  2XY5 A;  1KSP A;  1Q5V A;  2HQI A;  2LLZ A;  4J90 A;  4DPW A;  1X0F A;  3ZFV A;  4NXN J;  2B6A B;  4M5I A;  3H0P A;  1WG1 A;  1XN9 A;  2QE5 A;  2ZWP A;  2O67 A;  3R5D A;  1N33 J;  3W2W B;  2A1B A;  2OGU A;  2FPH X;  4P7T A;  4ED5 A;  3JTP A;  2CZ4 A;  4DL7 A;  1VQP S;  2D3Z A;  1OY6 A;  2GMJ A;  4ED8 A;  1TUW A;  1REV A;  2EFG A;  2O1P A;  3CMA S;  1IKV A;  2ACY A;  2CWX A;  4X4N A;  2YKO A;  5KFT A;  2VQF J;  1WC3 A;  3H7H B;  4TU8 A;  2KHC A;  2B8P A;  2Y9H A;  2EI5 A;  2V68 A;  3ZTO A;  3H40 A;  2MLY A;  1U8S A;  4FNH A;  4PXC A;  3AXM A;  3I9Z A;  4FPI A;  3TNV A;  1H2U X;  3BRE A;  2CQ1 A;  2W4C A;  4UZC A;  1TTH B;  4EI2 A;  2VIC A;  2JDJ A;  1S4E A;  3PYE A;  4ZP9 A;  3K58 A;  3EDQ B;  4CQ1 A;  3I55 S;  1NME B;  3MXH P;  3ZZT A;  2HFU A;  3KMS A;  1OQ6 A;  3AJ1 A;  3BGR B;  4URS A;  3SCI E;  3PEH A;  3CUL A;  2XCA A;  1FCA A;  2YKN A;  2V2Z A;  2DXE A;  4IFY A;  5F9L A;  4P7V A;  2HNZ A;  4DSL A;  3CJQ A;  3K89 A;  1VHF A;  4HLB A;  5BR8 F;  1IBL J;  1VJQ A;  3CO9 A;  1KNZ A;  1YJU A;  1U09 A;  1RSC A;  3HT3 A;  3OFH A;  1HWI A;  5C2G A;  4HAC B;  1RAO A;  3FEY B;  4ECY A;  4ED0 A;  1SL1 A;  4OX9 J;  2AZ3 A;  3D6H B;  1QAY A;  2F9J A;  2A6O A;  3TZY A;  4FF2 A;  1FDN A;  3W7B A;  5HL7 Q;  5F8G A;  2Q1L A;  2OPQ B;  3LQV A;  3DLE A;  1HWU A;  3G82 A;  1JXL A;  2HQF A;  5K8M A;  1GMW A;  4ECT A;  5H9F K;  2QLX A;  1R3N A;  2GV1 A;  2UVR A;  1VIO A;  2XHC A;  4LSN A;  1Y10 A;  2RF2 A;  4C8K A;  1M0S A;  1IWA A;  1HBN A;  3ZZP A;  4LSN B;  3MMB B;  1TK5 A;  2V2Q A;  1NJW A;  4RJV A;  1OO0 B;  3HLU A;  1GXU A;  1SIW B;  3KJQ B;  4AYB D;  2EFP A;  4JBC A;  5IZH A;  3K57 A;  5BJR A;  5M2P A;  1HKA A;  3N4W A;  4ZPW R;  3CF5 Q;  2X1F A;  2ABY A;  2QC3 A;  2B51 A;  1NK0 A;  2RD5 C;  4N41 A;  2K06 A;  2DHS A;  3ISN D;  4DV1 F;  2UZA A;  2KXH A;  4C8N A;  1HBU A;  4UQT A;  4JI7 J;  1FJG F;  1TL7 B;  4WXO A;  2J9E A;  1KBR A;  2HBQ B;  3NWR A;  1KOO A;  4ZJQ A;  1QJH A;  2LKZ A;  4C98 A;  5D6G A;  1Z2L A;  4HAC A;  4N76 A;  3UW1 A;  2OD4 A;  1L3K A;  5FLX Y;  2HHX A;  1M5P C;  3RRK A;  2HGM A;  2ILZ A;  3CCJ S;  1EHW A;  2FJW A;  3PO5 A;  2R4F A;  2VPZ B;  1FRK A;  3RB0 A;  2J5A A;  3SFU A;  4AD6 A;  5F3Z A;  3PKM A;  3J80 U;  4CO3 A;  4DV7 J;  1Q7Y T;  3DRR A;  2CPX A;  4ZS6 A;  4EFA C;  1IBL F;  4L3K A;  3J81 Y;  3PW2 A;  1NSP A;  2F1F A;  3I5B A;  4DUZ J;  2WON B;  1NSK L;  1SPB P;  2B9E A;  3L9Z A;  3QLH B;  4OYA A;  4PEO A;  2MB0 B;  1HNX J;  5DLF A;  1KON A;  4UOH A;  1NEE A;  1S1U B;  3A8I A;  3DM2 A;  4PG5 A;  4LMZ A;  3MTJ A;  2K7K A;  3J81 j;  3GG1 A;  2GHP A;  3CCL S;  3TJ9 A;  5DDQ C;  3MF5 A;  3HVR A;  2AMC B;  1HI1 A;  3G6X A;  2JSX A;  4ZLL A;  4NZ0 A;  3K5M A;  4RNH A;  1VQS A;  4HVZ A;  2KH9 A;  4XO0 A;  2FVQ A;  1FA0 A;  3HD1 A;  2YPZ A;  3DGP B;  4NYP A;  3KLF B;  4WP9 A;  3FQL A;  3D6M B;  1NZ8 A;  3AXK A;  3SYZ A;  1NRK A;  2E5G A;  2GJ2 A;  4P9S A;  4C8M A;  4USH A;  2X1B A;  2F9D A;  3SFG A;  5EDW A;  1KD1 T;  1WG4 A;  3PW4 A;  4LF9 J;  2X3D A;  3K5O A;  4K8R A;  5GMD A;  4Y2A A;  1KR4 A;  1UWB B;  3C14 B;  2ZVS A;  3KUG A;  1PJ6 A;  4PZV A;  2A6M A;  4RW9 B;  2B6A A;  3BR9 A;  2H5I B;  1YRX A;  3NCR A;  3NAI A;  3W65 A;  4KPY A;  2FLP A;  1AZS B;  1GTE A;  3MUM P;  2APO A;  3R7N B;  4CLY A;  3QWP A;  3OFG A;  5A0Y B;  1H98 A;  4ED4 A;  5CZV A;  5KFF A;  3R6L B;  3C66 A;  3MAQ A;  4M94 A;  1F6T A;  1FTC A;  2JRS A;  2OEJ A;  5ADZ A;  3OHA A;  4HH0 A;  4DF4 A;  1WKJ A;  1N36 J;  2F5G A;  2XWY A;  1GX5 A;  2VUG A;  4MKB A;  1ZTW A;  2HQC A;  2VJU A;  1VI7 A;  1YJR A;  3ILJ A;  4O4R A;  2WB1 D;  4KSE B;  3VQT A;  5KFY A;  3M05 A;  3GR0 A;  4CM2 A;  1R6Y A;  1U1Q A;  4O3R A;  5IWA J;  2HS3 A;  2HFN A;  2DO0 A;  2PSZ A;  4DR3 F;  5EX0 A;  1VQK S;  1RT3 B;  3ZZZ A;  3MR5 A;  1IKX A;  4FXD A;  1U2C A;  2KXN B;  1NK8 A;  4K2X A;  3TVK A;  3BGL A;  2KKH A;  3H5Y A;  4DUZ F;  4JYA F;  4OHW A;  3QPI A;  1UZD A;  4J9U E;  2NZC A;  3EWG A;  2DD8 S;  1FES A;  4DFJ A;  2GVD B;  2GO8 A;  2AD9 A;  2E1P A;  1JX4 A;  2OLW A;  2QLF B;  1X9M A;  1KQG B;  1ROF A;  3FKB A;  2IC3 B;  5E41 A;  5AJ3 F;  1FDB A;  4ECV A;  1ZBT A;  2D7S A;  1SCJ B;  5EUH A;  5HAT A;  1TZ0 A;  5GVQ A;  3CJ5 A;  3THP A;  4EYH B;  2NR0 A;  1O5J A;  4ZVE A;  2BJ1 A;  2IDE A;  2YNH A;  2ZBC A;  4M5M A;  3ETO A;  1ZAX A;  2WBR A;  4P2X A;  5KG1 A;  3S8S A;  2N82 B;  3V5R A;  4YP3 A;  2IY5 B;  4YS2 A;  2H54 B;  1BXN A;  2CQB A;  2QO3 A;  2XYP B;  3ILI A;  3C15 B;  2GJI A;  5T41 A;  5BYS A;  5IXU A;  4WFN Q;  3TA2 A;  2PE8 A;  2MQM A;  3GYN A;  1HNI A;  2J6U A;  3BKF A;  1HPZ A;  4H4K C;  1KP6 A;  3LGN A;  5B0E A;  4QR2 A;  3UR0 A;  1P27 B;  2FGC A;  1RWK B;  2GVZ A;  3KJF B;  3MPU B;  4ZVQ B;  3UVJ A;  2RDI A;  4FF1 A;  3ILO A;  1H7X A;  4PWU A;  3DMJ A;  2ERR A;  3PDN A;  3DOK B;  3FCV A;  3MR7 A;  2Q43 A;  1M1G A;  4ZMM A;  5C2C A;  3KHG A;  1V6H A;  1JNZ B;  1MU2 B;  3MEE B;  1N52 B;  2CQC A;  1RWM B;  1UFK A;  2PA8 D;  3LP0 B;  4OI2 A;  2E5L F;  4WPA A;  4MT1 A;  4CO5 A;  4TQR A;  2M70 A;  3ET6 A;  3QRR A;  2IC3 A;  4KH1 B;  1M1H A;  4LRD A;  2HHH J;  2VHG A;  4CCH A;  2HEK A;  4CLF A;  5EWG A;  3KUH A;  3FJ2 A;  2ZDO A;  3GB0 A;  4TY8 B;  5HAN A;  2I8E A;  1DY3 A;  3OT9 A;  2ZDP A;  4JI1 J;  3OLA A;  3D67 A;  1N6Q A;  5A76 A;  4USV A;  3QT6 A;  5M2U A;  2OPR B;  5KT2 A;  4B9L A;  1NK4 A;  4QCL A;  5DZ6 A;  1B99 A;  2QYC A;  3M4X A;  3VVU A;  1BLU A;  2Q79 A;  4OZ1 A;  1CJU A;  5CZX A;  3ZNJ 1;  4DQQ A;  3RBX A;  4JI5 J;  2H5E A;  1VLO A;  3V6J A;  3L7O A;  3CSK A;  5B0A A;  2CQH A;  4OJ1 A;  1MWZ A;  1S59 A;  2W9C B;  3V6D B;  1WF1 A;  1ZAW A;  2QV6 A;  3BPD A;  2QZ8 A;  1U45 A;  5DGB A;  2FY1 A;  2WW8 A;  4KE5 A;  2IJR A;  3DXB A;  2WSC C;  3MAH A;  1REG X;  3JYT A;  1RTH B;  3VR1 A;  4WFZ A;  2R8H A;  1YZ6 A;  4X65 J;  5L1K A;  4JV1 A;  2AF6 A;  4WP8 A;  4YB1 P;  1NJY A;  4UY8 5;  1O0P A;  1RA7 A;  1FER A;  4NI2 B;  3MEK A;  1U0H B;  3SCK E;  2FJA B;  2OEM A;  5T7L B;  2E7W A;  4OZN A;  4X4P A;  1ZOT A;  2J8S A;  1GT8 A;  1HA1 A;  3RAX A;  3PEJ A;  3QT8 A;  2YQ0 A;  4JI8 J;  1JKH B;  2KJW A;  3M8Q B;  4LSL B;  5KG4 A;  2NSB A;  3SIP B;  2N7Y A;  3DYA A;  2VG6 B;  5ETV A;  3KLF A;  3WC0 A;  1N34 J;  4FBU A;  1SC3 B;  2XCP A;  2XMW A;  4AUK A;  4DL2 A;  4LF6 J;  3NNA A;  2CG8 A;  1LW0 A;  5ETN A;  4RUC A;  4PWD A;  4UUW A;  7FDR A;  2MKY A;  3LGH A;  5D4O A;  3D3B J;  3BSA A;  5F8H A;  2YY3 A;  3CD7 A;  3DNC A;  5KAK A;  3EX7 B;  2WTF A;  5HRO A;  1I1G A;  1N88 A;  1PJ5 A;  1RCO B;  5IT9 U;  1YI2 S;  2V4J A;  2VH7 A;  3I87 A;  3ISN C;  4CO1 A;  3HPO A;  2V8H A;  3R3T A;  2AKW B;  5KFW A;  5H9E K;  1OQ3 A;  3EIC A;  4IO9 Q;  2DHX A;  4ZIW A;  4K4Y A;  2DNL A;  4B3R F;  1IBM J;  4FPR A;  1VQ4 S;  3JSB A;  1DBD A;  4L72 B;  2P9E A;  3QRP A;  1TK0 A;  1WI8 A;  3HSD A;  4IDK B;  3RZA A;  3WX8 A;  5T14 A;  3PR4 A;  3C2P A;  2DHG A;  1HYS B;  4ZPB A;  4XIU A;  1NDK A;  4Y6I A;  4BWJ A;  1BGX T;  3W5X A;  5KG7 A;  1LWC B;  1T11 A;  4P74 A;  1VC6 A;  2UXD J;  3OLB A;  1KLN A;  1QUP A;  3OTE A;  2VFR A;  4OLO A;  4RW8 B;  3SMZ A;  4I2P A;  5GAD I;  2J76 E;  1HBM B;  2Y0B B;  3DRX A;  1X4G A;  3HSG A;  1NPR A;  4P52 A;  5KFB A;  1HBU B;  1CS4 B;  2CYY A;  4ZDN A;  3UN2 A;  1LKZ A;  3KLG A;  4B3M J;  1U1P A;  5AT1 B;  4DZ6 A;  4QPT A;  2MZS A;  1WKL A;  5L46 A;  3KLV A;  3VWS A;  2WOM B;  5FD1 A;  4QWB A;  3ELH A;  3NCP A;  4WCE Q;  4J9Q A;  2HHH F;  2K3I A;  4PG7 A;  4LF4 F;  2KZM A;  1HBN B;  4LVO P;  4DUT A;  2CZV C;  5CD4 A;  1QY7 A;  1UZH A;  4YN3 B;  5HO4 A;  3F41 A;  1X60 A;  3BF4 A;  3CDE A;  5T7L A;  4F3O A;  4M5D A;  5D4N A;  4GVL A;  1VQL S;  4JV5 F;  3MM6 A;  3SV3 A;  1Q8B A;  5KFV A;  4ITS A;  4KO0 A;  2W7O A;  5B7W A;  2DBB A;  2PGC A;  2F4F A;  3R8Y A;  2VB6 A;  2XMT A;  3UCZ P;  5L1I A;  3BH6 B;  1PYS B;  4KV8 B;  5D8H B;  4JV2 A;  1Y5N B;  2DIV A;  4YR3 A;  3MFH A;  4RNO A;  2J7K A;  4LUB A;  3EM1 A;  1TKD A;  3M2V B;  5GAG I;  2W4P A;  3M2U B;  4Q44 A;  2CJK A;  2DYA A;  3G8S A;  2ZZN A;  4WXW A;  1FTR A;  2J0W A;  4NLD A;  4IFY B;  1T7P A;  2VPW B;  3PZP A;  1LXN A;  2EKY A;  2DGU A;  2V8G A;  1LW0 B;  3A3N B;  3V4I A;  1NJZ A;  4PWD B;  4BC9 A;  2DNN A;  3IRX A;  4FYY B;  5MAO A;  3CC7 S;  1T94 A;  2HFV A;  3MPV A;  4IRC A;  4K50 A;  4ID5 B;  1N36 F;  2JLE A;  4URG A;  2C42 A;  1YIJ S;  2OEK A;  4ZVO B;  1SH3 A;  3IM8 A;  3L7U A;  4LFB F;  2GQ2 A;  3RUB L;  3QQC D;  2HS4 A;  1FO1 A;  3E01 B;  7FD1 A;  3OL6 A;  3UD4 P;  1UA1 A;  1C0U A;  3M8P B;  2HYI B;  3FSI A;  2AJ1 A;  4O0N A;  3FNN A;  3CNQ P;  2KT5 A;  3FQK A;  4QIG A;  2W4D A;  1OJ4 A;  1HNZ F;  3ZTQ A;  5JJB A;  4B3O A;  2CQG A;  2ILY A;  5LJ5 Y;  3LPY A;  2QG9 B;  1VIX A;  3UN5 A;  4X65 F;  1RTH A;  2XO6 A;  3LO3 A;  4LRC A;  2Y8W A;  2FC8 A;  3HFV A;  1IKY A;  2RAQ A;  1H2V Z;  3HHL B;  4MYU A;  4E2F B;  2GIQ A;  4PXE A;  3OHB A;  2OFH X;  4ZLP A;  1O8B A;  1TMM A;  4DQI A;  2JC0 A;  3GJR B;  3NY0 A;  2ADB A;  4WK1 A;  2FZG B;  3CO0 P;  1UCN A;  3MD1 A;  1ICE B;  2IMO A;  2LU1 A;  5F3T A;  2R7T A;  4A47 A;  4PXD A;  2EC2 A;  2MKI A;  3JSM B;  4DR4 F;  1RTZ A;  5A2Q Y;  4HDH A;  4ER8 A;  5J2N A;  2UUC J;  1TUG B;  3IMQ J;  1V5V A;  4NEZ A;  4GO7 X;  4JI6 J;  1NPK A;  3O3L A;  4FF3 A;  2XEX A;  2AEJ A;  2AGO A;  1ACM B;  2MLZ A;  4CT9 A;  1RHK B;  2FGO A;  1AT1 B;  1K1S A;  4DEZ A;  3Q8Q B;  2KRR A;  1K47 A;  1R27 B;  1HBO A;  2MKS A;  3PNI A;  4I2Q A;  5AE2 A;  5IM0 B;  1PC4 A;  1KLM A;  3B4D A;  3UFC X;  5CYM B;  5KFZ A;  4PAA A;  3MHY A;  1CBK A;  2D1C A;  3ENV A;  4HI1 A;  4CLZ A;  1WEX A;  4FYD A;  2XB2 D;  3S1T A;  3GU0 A;  2D3O 1;  3V81 B;  1K8A T;  2ZBR A;  4FNI A;  4JYA J;  2Q66 A;  3Q8S B;  3NGR A;  1LEO A;  2G0C A;  2V8D A;  1C1C B;  4OZL A;  3SI8 A;  3ITH B;  4EYI B;  1M1K T;  4QYR A;  3NMR A;  4LR7 A;  2ASY A;  4ZIT A;  2XO7 A;  1XBW A;  3R1H A;  4ZN3 A;  4NLS A;  3O1L A;  2AP6 A;  3D4J A;  2AHO B;  2GVZ B;  3MCN A;  3GFH A;  3FBC A;  2BUN A;  3UVJ B;  1L3S A;  3MD3 A;  1JLQ A;  1RAB B;  1RE1 B;  1RKI A;  1ZPV A;  2XZD B;  4OI0 A;  1VQ6 S;  2ZM6 J;  3NNH A;  1B7F A;  5C25 A;  4DR7 F;  3M8S A;  1S6O A;  3BKT A;  4F36 A;  1TVR A;  1U24 A;  3ENA A;  1QAX A;  1V9O A;  1Y00 A;  4USW A;  3TX8 A;  2D9O A;  4C97 A;  2BE2 A;  4K4V A;  5HMY A;  3CC4 S;  4RU2 A;  4Q8F A;  1AUS L;  4K4Z A;  3PRD A;  1UVK A;  3TEH B;  2L9N A;  3SV4 A;  4TU9 A;  4ED7 A;  3ULH A;  2ZH4 A;  1TFW A;  2AYB A;  1RDR A;  2DGO A;  2IRY A;  1Q0N A;  3BEG B;  5C24 B;  1S76 D;  3CCV S;  1B4S A;  1CQM A;  1SXL A;  5CHC B;  2L41 A;  2FHJ A;  3O8W A;  2H9Z A;  3QZ7 A;  4QIW D;  1DRZ A;  5E7O B;  2GVD A;  3OTD A;  4YME A;  3SDE B;  1IJF B;  4NZ6 A;  3SXL A;  1VQ8 S;  4QYZ J;  4NWB A;  2W8L A;  4IUF A;  1EET A;  4UW2 A;  3T5H A;  5K14 A;  5D15 A;  4LF7 F;  3U7J A;  3W3S A;  1FI4 A;  2VBW A;  2OML A;  1NAQ A;  1UVN A;  4ZVP B;  1YJW S;  4UOG A;  3EZU A;  4J9S A;  2QL9 B;  4YUD A;  3GWC A;  4QR1 A;  2LXU A;  4CO0 A;  2HHV A;  4EBC A;  2J9D E;  4A4J A;  4GKJ J;  1KLM B;  4I1T A;  5HVF A;  3PO4 A;  1GMW D;  1X0P A;  1U0S A;  2HFZ A;  2H51 B;  2ZC3 A;  2MZ1 A;  2Y1I A;  5L9N A;  4KTQ A;  1XEZ A;  3GMG A;  3W63 A;  1U1R A;  2OO4 A;  2PA3 A;  4KR0 B;  1NHU A;  1Q7L B;  1T02 A;  2IYG A;  3AA8 A;  2V8V A;  3Q8V A;  3TW0 A;  2N3O A;  1S6Q A;  1TQL A;  2BA9 A;  3VV2 B;  4FYV B;  3ZXW A;  1H74 A;  1LWF A;  1H2T Z;  1TVR B;  3IFE A;  1YK9 A;  5IC6 B;  4CP5 A;  3TZX A;  3H2V E;  3GE9 A;  4QR0 A;  4JI2 J;  4LF9 F;  4RLE A;  5HI7 A;  2DPI A;  1D9A A;  3VHQ A;  2OPS A;  3TOQ A;  3HZG A;  1P9Q C;  2RE1 A;  4ATN A;  2QLJ B;  4DHV A;  2ZH5 A;  3MDF A;  1T9V A;  5DJB A;  2VBZ A;  2G0J A;  2DIS A;  4DSJ A;  2U2F A;  2VBY A;  1OWX A;  2GC8 A;  3D28 A;  3NGU A;  3FGV A;  1SKS A;  1G4C A;  4C6A A;  1RT7 B;  1S1T A;  3LAN A;  3VZI A;  2BZ2 A;  2XI2 A;  2CVE A;  2ZEJ A;  3A4T A;  3NP5 A;  2IM1 A;  3UDV A;  1GH8 A;  2R8J A;  3AA9 A;  3W2V B;  1U49 A;  3JQJ A;  2BJ3 A;  2CPH A;  3F73 A;  2VQF F;  1Q8I A;  1VGY A;  2CPD A;  2F7V A;  3CJK A;  3UD3 P;  4ANC A;  5GME A;  4Y2C A;  2JEI A;  3KLH B;  2E7X A;  4ED2 A;  4FKY A;  3PHT A;  1WJ9 A;  2LQ5 A;  2WZ1 A;  2XHW A;  2P2C B;  1PG5 B;  3E8O A;  4U7U D;  1Q86 T;  1NHV A;  1PC5 A;  3G87 A;  1YTY A;  2JFD A;  2BAN B;  2M5Y A;  3PFE A;  2QA1 A;  4L74 A;  1KQK A;  2EC0 A;  1MMD A;  2HQG A;  3WX4 A;  3DLG B;  1C1B B;  5E5N A;  2ROE A;  3T1Y J;  2D3O R;  2UXB F;  4A8X A;  3JSM A;  2XGP A;  3H4D A;  2QRR A;  4F04 B;  4WFX A;  4KHR A;  3SQO P;  4NML A;  3VCD A;  2YQ1 A;  3I5A A;  4DX6 A;  4M5G A;  1SJQ A;  4MYT A;  4KGK A;  2BJ9 A;  2BAN A;  3VAF A;  5CYQ A;  1TL7 A;  1WHX A;  2EW9 A;  1RT4 B;  1Y9O A;  1FXD A;  3MCO A;  4C8Z A;  1Q4R A;  1DQ8 A;  1VLY A;  1Y5I B;  1Y3K A;  1LQ9 A;  2I38 A;  3KG1 A;  1RHU B;  1EKR A;  1SUQ B;  2RUG A;  4BC7 A;  3DLH A;  1XER A;  2WB4 A;  1XMQ F;  4CT8 A;  4B9U A;  1APS A;  3DN9 A;  2CJB A;  4JOU A;  5IFM A;  2KU7 A;  1RWO B;  1T9T A;  2HGL A;  2Q6C A;  1QM9 A;  3M7V A;  3TR5 A;  5HP1 B;  1DHM A;  2J0Q D;  4ALZ A;  2IPO B;  2MXY A;  2XS5 A;  2BDP A;  3T19 A;  3OSN A;  4DV6 J;  3JQK A;  3N6N A;  1X31 C;  4KHM A;  3WIU A;  4MTP A;  4AFF A;  2CNO B;  5KFR A;  2ASJ A;  1HW9 A;  2G1H A;  2OIH A;  2DGX A;  2HUR A;  2PC6 A;  2EFV A;  4OYX A;  3V4I B;  4I69 A;  1XMQ J;  1FFS B;  3HJF A;  4ZKA A;  1T03 B;  1JNR B;  1FDD A;  3H59 A;  5HJX A;  3KHL A;  3BO2 A;  3P5T L;  4CO4 A;  4RW8 A;  2LQ9 A;  5JUM A;  4ZP7 A;  3I5C A;  1U2R A;  4KFB B;  5L1J A;  2UXD F;  2H4W B;  3MZI A;  2B9X A;  5ETT A;  2AGP A;  4WZM A;  1NSA A;  2WBM A;  2JL9 A;  3N5F A;  3GJS B;  2KRB A;  5HBM B;  1S1W B;  5BYQ A;  2O5D A;  2K1R A;  3GPA A;  3QAE A;  5HMZ A;  4DPU A;  4GC7 A;  1I6J A;  5B08 A;  5L1L A;  2XBP A;  5A6W A;  3M30 B;  2N4D A;  4NYZ A;  5FLX U;  4NCA A;  1XMO J;  2CPZ A;  3E3X A;  5LM7 E;  2ZFH A;  4LT6 A;  1H7W A;  4M5D B;  5B09 A;  1CQN A;  3M9O B;  4KKO A;  2NXN A;  2Y0S D;  3EPG A;  2Z2M A;  5G4D A;  4AND A;  2XM3 A;  3I56 S;  1J2V A;  3KTQ A;  3DDI A;  4A8S A;  2ZH2 A;  2PII A;  1PO6 A;  1F9H A;  5D3G B;  1EET B;  1WWH A;  1I51 B;  1Q53 A;  2FVC A;  3OBI A;  4RW7 B;  1IKV B;  3W1Y C;  3KJV A;  1X9W A;  3BBB A;  3IWL A;  2VG6 A;  4RW4 B;  3T6B A;  4F0M A;  4B3R J;  5EGY A;  1S49 A;  3CMQ A;  3T1H F;  2IYI A;  4NL5 A;  1RTD A;  4O4G B;  4W92 B;  4RUA A;  5F8L A;  4JI0 J;  1U48 A;  1R0A A;  4IFV B;  4IO1 A;  4C0B A;  5H9E J;  1N33 F;  1UMJ A;  4OV6 A;  1QAI A;  4NX9 A;  2DR9 A;  2L9D A;  4KT0 C;  4C3M A;  1XR6 A;  1S6Q B;  1BQX A;  4CRJ A;  4DL5 A;  2FJB B;  1LFP A;  2C3U A;  2MEW A;  3ZTP A;  2BE2 B;  4QW8 A;  1YJT A;  4ECR A;  1S6P A;  3C6U B;  4ECZ A;  3R5C A;  1FJE B;  5DQG A;  4RW6 A;  3KK2 B;  1PIE A;  4QWC A;  1JLF A;  2NYI A;  1YQH A;  3EGW B;  3Q8U A;  4FVM A;  1S10 A;  2OSR A;  1NBE B;  1H6K X;  2BW2 A;  4N8O A;  1RAH B;  2C3O A;  1HIY A;  2XTJ P;  4U8V A;  1XQI A;  1WEZ A;  3I31 A;  1S99 A;  5J2P B;  1UAW A;  2EBG A;  3PXG a;  5L8R C;  2E7V A;  1OS5 A;  1RK8 A;  1RT5 B;  4KHP F;  2XG8 A;  4HHJ A;  4J7C A;  1N6Q B;  1X5S A;  2MTL A;  2AU0 A;  5K14 B;  2QA4 S;  2WHO A;  5DZ7 A;  1U6Z A;  3KLE B;  4DR5 F;  2RQM A;  3OTO J;  1NLK L;  2NUH A;  1KOH A;  1SIZ A;  3GFZ A;  3Q24 A;  1PAE X;  2A18 A;  2RS2 A;  2HWT A;  1H3D A;  4PCQ A;  3RGI A;  2XY6 A;  1G2E A;  2VOP A;  2VG5 A;  1XK8 A;  3AFG A;  1KDN A;  1A7G E;  2UVU A;  2Q6B A;  1VK8 A;  4DMZ A;  2HHP A;  4NMX A;  4ZPT R;  4TVA B;  5IV4 A;  3NCQ A;  1G7C B;  3CDB A;  2IVF B;  2AJ0 A;  3K8V A;  1IXK A;  2CWK A;  3KLI B;  4E8U A;  4KAI A;  3H4B A;  3EYZ A;  4A8K A;  4JI7 F;  2AYG A;  3Q2T C;  3JYT B;  1MG7 A;  4UOF A;  3CCU S;  2DHH A;  1VIS A;  1RTI A;  3H2L A;  4OHV A;  1AYE A;  3UCG A;  4B9T A;  2FZC B;  2D41 A;  2R9L A;  6FDR A;  3M9N B;  5C25 B;  3UNY A;  2DHA A;  4OYI A;  4OHY A;  5J1E B;  3AJD A;  2OD6 A;  2PT0 A;  4JI3 F;  3HFK A;  2R2R A;  4K4U A;  1C0T B;  2CPI A;  4GMK A;  1RTI B;  1GAO A;  3IXQ A;  1CJU B;  2EBE A;  1UL3 A;  1ZA2 B;  5HMW A;  1HW8 A;  1RAD B;  2DCU B;  3T41 A;  4WK3 A;  4MK8 A;  3DLB A;  2LXF A;  1B7Y B;  2BOP A;  1VRT A;  2MQL A;  2O01 C;  1KVK A;  2AEF A;  2MJU A;  3J7Z T;  5E0O A;  3BGF A;  5AE1 A;  1CPZ A;  1S0M A;  1S12 A;  5KFI A;  1TKT A;  2VKZ G;  2VQE J;  2U1A A;  3THV A;  3D66 A;  2VG5 B;  3UDL A;  2ALY B;  4NEY A;  2D74 B;  1AA1 B;  3MAA B;  2C3M A;  3IRX B;  2NRE A;  2XZW A;  2FZK B;  4RBV A;  3AY0 A;  4AL7 A;  3PX6 A;  3G6Y A;  4QU6 A;  2HZV A;  2UU9 F;  3X3U A;  2RJZ A;  1RWX B;  3LP0 A;  3HP6 A;  1ZM3 A;  2ZZM A;  1LW2 B;  4M1K A;  3OL7 A;  4I67 A;  4Q45 A;  1GXL A;  2V0N A;  4DDF A;  1SKU B;  3E51 A;  1AXQ A;  5J2Q A;  1URR A;  4V19 J;  1W7W A;  3N9U C;  1VDH A;  1AFI A;  3FUY A;  4W4M A;  2WCX A;  1IWG A;  2YWE A;  4E98 A;  2W7P A;  2R7W A;  2GHV C;  1RUS A;  1K9M T;  3W60 A;  2M3D A;  3LAM A;  4V19 X;  1Q8L A;  5K20 B;  5U47 A;  4C9D A;  3T5K A;  2HLU A;  2BE7 D;  2I5J B;  4YY3 J;  2NCK L;  1S48 A;  3IM9 A;  1BQN B;  1RU1 A;  1VRU A;  4RR5 A;  2UUA F;  3UE2 A;  1G1X A;  3S6E A;  4OYP A;  2YNH B;  1R0C B;  3SQG A;  1R8B A;  2PEB A;  3MM5 A;  3C14 A;  3QRQ A;  2DY9 A;  4P73 A;  1NO8 A;  2JZ5 A;  4RUH A;  2C2E A;  1SJF A;  3TAP A;  4DX7 A;  2ZJR Q;  3DOM A;  2DPJ A;  4U8Y A;  2VC0 A;  2PFD A;  1WOP A;  1RT2 B;  3BDE A;  2KVQ E;  3A3P B;  4DV0 F;  3I0R B;  1XR5 A;  4OL8 A;  1KN6 A;  5D3G A;  4FF4 A;  4DV3 J;  4WKR A;  2JLF A;  2L08 A;  4PG8 A;  1AB8 A;  2DB1 A;  1KQF B;  3RTV A;  2C3P A;  1CUL B;  1E6Y B;  1RT3 A;  2YBV A;  3I9V 9;  4WU2 A;  5J1P A;  2ROP A;  4JI0 F;  4A8M P;  4K4S A;  2OJ3 A;  2ZE2 A;  3LTO A;  1RBO B;  1HHQ A;  2DNO A;  4WWS A;  3D6T B;  4MK7 A;  4QQB A;  2ZH9 A;  1T8E A;  2FJX A;  4HDG A;  2DIT A;  2YX4 A;  1Y5L B;  3MGJ A;  5D78 A;  4UT4 A;  2ZNZ A;  1QE1 A;  3QT5 A;  4IG0 A;  4RZR A;  1HYS A;  3A13 A;  4USM A;  2IAJ B;  8RUC A;  5DDP C;  1N54 B;  4KGM A;  2HNY A;  1KVJ A;  2XLK A;  4YHH F;  4DN0 A;  2MHE A;  3TJ8 A;  3DU6 A;  2HBZ B;  3RRH A;  3IAS 9;  2F40 A;  4Y0F A;  1BMQ B;  1Y4Z B;  3CW2 C;  2QT7 A;  3PKY A;  3GG0 A;  1QE1 B;  2BQR A;  2DR5 A;  5F0U A;  2QMW A;  4YR0 A;  1KFS A;  4NLX A;  3MI7 X;  5IC4 B;  1CJT A;  1VK3 A;  3FC9 A;  1EAY C;  1MN9 A;  2DJW A;  2Z4P A;  3DRY A;  5KFE A;  4A8W A;  2C22 A;  4PUO B;  2WVC A;  1JLE A;  2GX8 A;  3DOL B;  3TJA A;  1T0T V;  1WDD A;  4FYX B;  1YBA A;  4BBY A;  5GAE I;  3D2W A;  2RKI B;  1FEH A;  2M0G B;  2R7O A;  4O23 A;  5B0D A;  5B0B A;  5G0R A;  1RTD B;  4DS5 A;  4F2S A;  4I6W A;  3HVA A;  5KFK A;  4I64 A;  4IKA A;  3KDN A;  1IKW A;  3IR7 B;  2G2Z A;  1X4A A;  2OH2 A;  2YXL A;  4TNO A;  3UN3 A;  3VAJ A;  2XNR A;  4QIF A;  1S0O A;  2EFO A;  2KG0 A;  2C2K B;  1HBM A;  2GFF A;  4C2M A;  1N4L A;  4PG4 A;  3Q0A A;  3DLK B;  1O6X A;  2RF2 B;  3K5P A;  3BQ0 A;  3HVT A;  1YJN S;  1RIS A;  1UW9 A;  4J9K A;  2OEL A;  4G1P A;  4PPZ A;  4A48 A;  4ZOS A;  3CCQ S;  3CD5 A;  3TAM B;  4ZVH A;  2RQ4 A;  2MQN A;  3NG8 A;  3G82 B;  4QJV A;  3AD9 C;  2I5J A;  2GCF A;  3QID A;  4Z37 A;  4YR2 A;  2KDO A;  2CAJ A;  4LBP A;  2M52 A;  4GO5 X;  4U7C A;  3MM7 A;  2W01 A;  2KM8 C;  1C4A A;  4CH1 A;  1RQ0 A;  3UD5 A;  2Z2Y B;  2VD3 A;  2RRB A;  2HRT A;  4USK A;  1CLF A;  3RBE A;  1WNE A;  5ETM A;  1QVF R;  1LK7 A;  2YNF A;  2ZJP Q;  3IO1 A;  4DWI A;  2ZZT A;  4OYZ A;  4KY3 A;  3MR6 A;  2UUC F;  3HI9 A;  2DCL A;  2QSW A;  5K5M A;  5HRO B;  2UV8 A;  5LMU J;  3PYD A;  3SCL E;  1N56 A;  2CAD A;  5KFO A;  2YKN B;  1W2B R;  2MZR A;  1EQ0 A;  3SEO A;  2C28 A;  4UZB A;  1GMV A;  4TXS A;  5D0H A;  2FVP A;  2AJ2 A;  1DLO B;  1RT6 B;  2R2U A;  1RA6 A;  1WC1 A;  4JB8 B;  4ZVS B;  1IM6 A;  3JS9 A;  4NYO A;  3Q89 A;  5KG3 A;  3GIK A;  1NZA A;  4J9M A;  2Z2L A;  1K0V A;  3OVA A;  4Z2X A;  3NGS A;  3DOM B;  3F44 A;  3MMC B;  4C11 A;  2M2B A;  3NAH A;  3MMB A;  5M2R A;  2KFY A;  3GIM A;  2RU9 A;  1HI0 P;  4G1Q B;  1N34 F;  1SC1 B;  1ULR A;  3T5L A;  4IR9 A;  1JLB B;  4OZ3 A;  4AXI A;  4Q5V A;  3PW5 A;  4CYU B;  2CVI A;  4ZA1 A;  3DOK A;  3EGN A;  2UUA J;  4XDC A;  2HRY A;  1F60 B;  1REV B;  2HWH A;  1SUQ A;  3RW6 A;  1CJK B;  4EWT A;  3JB9 k;  4B9S A;  1RU2 A;  3ONQ A;  4DV7 F;  2ADC A;  2DNM A;  3M8Z A;  2E29 A;  4F50 A;  3KK1 B;  1DZ5 A;  3RR7 A;  3H20 A;  2QMU B;  2W9C A;  3V6D A;  1J5O B;  1FKA F;  1N5Y B;  3ZO7 A;  3OFE A;  3DGV A;  4TY9 A;  3FCH A;  1ZM9 A;  4UST A;  2C3Y A;  3U1L A;  2W9B A;  1EAR A;  1S9G A;  4ZP6 A;  1WTF A;  4ZLN A;  5KG0 A;  4DL4 A;  1ELO A;  4PRF A;  1LWE A;  4WFB Q;  2O66 A;  2PN6 A;  5AXK A;  3IS9 A;  1EX8 A;  4HI2 A;  4C3L A;  3KYL A;  4PG6 A;  2KM8 B;  1J5E J;  1KWM A;  4RL1 A;  2UU9 J;  4I6Y A;  3NRB A;  4C3K A;  4A8Y A;  3CT9 A;  3GV8 B;  2MKH A;  3KLH A;  3MAA A;  5DRK A;  1SJ1 A;  2E1R A;  5K8N A;  2EK6 A;  3NXZ A;  3WHI A;  1M90 T;  3MED B;  4U7U K;  3W9J A;  1VHI A;  2CUY A;  2YWF A;  1NDC A;  3DU5 A;  1LXJ A;  5LMU F;  3T3F A;  1U25 A;  2KVI A;  1FX2 A;  3RB3 A;  2DRB A;  3W2V A;  4KJI A;  3JAM Y;  3CB4 A;  3FSY A;  4ZVT B;  4ECS A;  1VQM S;  1S0V A;  1MNE A;  3CDU A;  5LSL A;  3MPW A;  1ZA1 B;  2BM1 A;  1WC6 A;  1YLX A;  2IFX A;  1RT5 A;  2VBX A;  3MPD A;  2KZZ A;  3U1M A;  1TR0 A;  4CO2 A;  3DFE A;  2LEC A;  3RYL A;  1TV6 B;  1HNW F;  1S0N A;  4NCG A;  4LF8 F;  2DGT A;  2QN6 B;  4WBF A;  5ETK A;  3M8R A;  5IV3 A;  4LFC F;  3BO3 A;  2FYX A;  1WF2 A;  5ETP A;  4X64 F;  2YWG A;  4AL6 A;  3P45 B;  1D0E A;  6AT1 B;  2HW3 A;  1PBU A;  1KHV A;  1OPI A;  4OHX A;  3X1L B;  3D5M A;  2ZJQ Q;  2OI2 A;  3PJW A;  4CWB A;  2GAG C;  2DH9 A;  4L73 A;  1N5V A;  4QZV B;  4WYL A;  2ZH8 A;  4Q0B A;  4OZ5 A;  2SXL A;  2IDL A;  5FDL B;  4J91 A;  1YJ9 S;  3GFY A;  1FE4 A;  2KJV A;  5B0F A;  2FVS A;  2RSQ A;  1LWX A;  4PAB A;  2CJ9 A;  4DZD A;  1FHT A;  5A8R A;  2DGW A;  1S79 A;  1GFW B;  4W98 A;  2HGN A;  2W8K A;  2C2R A;  3Q86 A;  2KFZ A;  4F4Z A;  3RB6 A;  2UVW A;  1FKP B;  2QFI A;  1WC0 A;  3O6Q A;  3VAI A;  2FLL A;  3L09 A;  3AAW B;  3IG1 B;  2NSC A;  1R8P A;  4ZPD A;  5JVG Q;  3RBD A;  2IBK A;  4N5S A;  4RPF A;  4ZP8 A;  4O44 B;  3KHR A;  1XJW B;  1Q8K A;  1X4D A;  3H42 A;  2B9Y A;  4YQW A;  5AJ3 J;  5DG7 A;  3T1A A;  1TV6 A;  3LA0 A;  3ITH A;  4P6Q A;  3ZTR A;  4DV6 F;  3EXY A;  4KRW A;  4B9N A;  5DG8 A;  4TQS A;  2JH3 A;  4AL5 A;  4YHH J;  3CXC R;  3QGG A;  1RGV A;  1VBK A;  1U02 A;  3DLL Q;  1NH7 A;  1XWL A;  1IM4 A;  2DNH A;  3CJ8 A;  4HHH A;  2DTJ A;  3AQP A;  4IYQ A;  4LRF A;  1XC9 A;  3GP9 A;  3D1O A;  3PM9 A;  4DV4 F;  2CRL A;  2UUB J;  3CD6 S;  1IQT A;  4GRS A;  5H1S V;  1S7I A;  3ZZY A;  1QSS A;  1HBO B;  4I2Q B;  4DCJ B;  1NKB A;  1UP1 A;  3BN4 A;  5KFC A;  1BC6 A;  3TYT A;  1TL1 A;  1WC4 A;  3NKY A;  2XMA A;  5A8R B;  1SJR A;  3TUI C;  1R31 A;  2BV3 A;  2VDH A;  4MH8 A;  1JXE A;  3RG6 A;  2AGQ A;  2LU2 A;  4X62 J;  1SVD A;  1DFD A;  1M5V C;  3AQO A;  5D0E A;  1WOS A;  3TA1 A;  1S9G B;  2XUL A;  4E0D A;  5K8P A;  4EBD A;  2I0X A;  2RUS A;  4BCA A;  3EGZ A;  3HO1 A;  4QBU A;  2YWK A;  4IH6 A;  1PJ7 A;  4DUY F;  2IBO A;  1U47 A;  3F56 A;  4OX6 A;  2C2D A;  2GS8 A;  2KI2 A;  5I42 B;  2VOD A;  3JXO A;  5GAG U;  3VQS A;  1FDA A;  5HK4 A;  3THT A;  1AW0 A;  1UJ5 A;  3CJ2 A;  4ES1 A;  5E3P A;  2V34 A;  1J5E F;  1EP4 B;  3F0N A;  3I4H X;  2OTJ S;  4X4V A;  1Z4U A;  3GYX B;  3H90 A;  4JV0 A;  3ZZR A;  1E6V B;  1QD1 A;  4ILR A;  3R5J B;  5I3U A;  2H65 B;  3D0I E;  2GQC A;  4G1I A;  2BM0 A;  3TRG A;  5DQH A;  4DXL A;  2XYH B;  2YNG A;  3FK4 A;  3VAK A;  2J0X A;  4NOH A;  4PR6 A;  4QWD A;  3HZE A;  2ATL A;  2AEM A;  2FVR A;  1RZM A;  2K8G A;  3WBZ A;  1MW7 A;  3UO0 A;  3LF0 A;  3R2D J;  3PY8 A;  1G3O A;  3NOC A;  3FZB A;  1T95 A;  2AT1 B;  3MED A;  3AB4 B;  3CJ3 A;  4NZ7 A;  4OI6 A;  3L3C A;  4G65 A;  2J7W A;  4DV5 F;  4NCB A;  2RNE A;  2HPU A;  1WHY A;  3MEC B;  4DQR A;  1RT4 A;  4ED3 A;  2JJ4 D;  4GKJ F;  3T6J A;  2MGZ A;  3W5Y A;  1SKW A;  1YIT S;  4PQU A;  3M9M B;  3KOA A;  2P5V A;  2UVV A;  1GNK A;  3K8W A;  2GW8 A;  1HD0 A;  2MYF A;  1RHM B;  4LIR A;  1OIA A;  2IJF A;  5AXM A;  2LEP A;  2WSF C;  2JWN A;  1S9E B;  3BB5 A;  3O44 A;  4DPY A;  2G4B A;  3IWN C;  4L3N A;  4AT1 B;  3PVX A;  4Y2K A;  3W62 A;  5ETQ A;  1SV5 A;  4PQU B;  3GTY X;  4KV8 A;  2KN4 A;  1MMN A;  5A8K A;  2B4U A;  1PCA A;  3HHK A;  3BBF A;  5D0G A;  2F8H A;  2GHW A;  2DVI A;  4JI5 F;  2K2P A;  2LEB A;  5HSP A;  4ZHR B;  2D3U A;  2DNY A;  2GML A;  3UPF A;  3V6K A;  1TL5 A;  4ICL B;  3SSQ A;  4C48 A;  2MQQ A;  1YJV A;  4X66 J;  2WSE C;  4ZPC A;  2E44 A;  1EIY B;  3RW7 A;  4WU3 A;  4WYW A;  2YKM B;  3MMJ A;  2ZOF A;  8ATC B;  1PIL A;  4DPT A;  5K8O A;  4ILM A;  2YNG B;  5DET A;  1HNV A;  1WEL A;  2E66 A;  1PYT A;  2HBR B;  2IVY A;  2RH3 A;  3MMC A;  1YVF A;  1FEE A;  4M5N A;  4KYZ A;  4Y2I A;  5D4P A;  4EGL A;  1KQS R;  4U9R A;  2NPI A;  3BPS P;  3US5 A;  3CPW R;  1D8Y A;  2HHU A;  4XAK A;  3TX0 A;  4TLQ A;  1IKW B;  4ZVR B;  4F25 A;  1WG5 A;  1Y7P A;  3HHL D;  2BRL A;  2FHM A;  4CIO A;  3R27 A;  1ZPW X;  1N32 J;  4ZVU B;  4USJ C;  1IBC B;  3LP1 B;  2DXF A;  3OV7 A;  2QL5 B;  2BKN A;  1JLE B;  2HFO A;  2AZ1 A;  2OPP A;  1N0V C;  2KO1 A;  2OUG A;  3CIM A;  2BYC A;  1A0O B;  1UEV A;  2W7A A;  4WTO B;  5DO2 A;  2LVW A;  5LT5 A;  4ELU A;  4ZJL A;  2YNF B;  3M6U A;  1ZYQ A;  2AYE A;  2HNZ B;  3BH7 B;  3V2U C;  2ZHA A;  2HQ3 A;  2YWW A;  3A12 A;  4YB6 A;  3LWL A;  3G9C A;  3L4B C;  5E33 A;  2GGP B;  4HT5 A;  3PCO B;  4PXB A;  4JUZ A;  5C5J A;  3C3L A;  2R7V A;  3MM7 B;  4CH7 A;  1T9W A;  2Z0G A;  1GQE A;  1VJW A;  3BGU A;  3IN5 A;  3FMB A;  5ETR A;  4RX6 A;  1CC7 A;  3QSY B;  4MFB B;  4D3H A;  1YBT A;  2PMW A;  3PRV A;  4K59 A;  1RAA B;  4ECU A;  2OAU A;  3NBP A;  1T05 B;  1TEL A;  1NDP A;  2B7C B;  2ZE2 B;  3QBC A;  2HKE A;  3DLK A;  3BR8 A;  1CSJ A;  4RO0 A;  2JOQ A;  1XNR F;  1YJ7 A;  1KHW A;  3AOC A;  3GZ7 A;  3LW5 C;  3W9I A;  4R0E A;  1U1M A;  5I3U B;  2ZC4 A;  1LK5 A;  1W25 A;  2OFG X;  3CIZ A;  5HQL A;  1TKZ B;  3J81 U;  1ZZN A;  3M2R A;  2HVI A;  2EK1 A;  1VQ7 S;  2BR0 A;  2J9C A;  2YX7 A;  3DRP B;  5IS2 A;  4ID8 A;  2KL8 A;  2CG4 A;  3R9L A;  1JLG B;  2EG2 A;  3DI6 B;  4EEY A;  2V9W A;  4LF5 J;  2D9P A;  1T9Y A;  4OYO A;  2YPY A;  4LQ3 A;  1MRO A;  1RCX B;  1EJ7 L;  3EVW A;  4B3S J;  1DTQ A;  2LEA A;  3B6B A;  4OYW A;  4JI2 F;  4YB7 A;  2CJY B;  2RDD A;  3SQG B;  4YDX A;  4LSZ B;  4PUO A;  2DO4 A;  1LFW A;  2ZD1 B;  1QSY A;  4WFA Q;  1NDL A;  4ZCK A;  4QW9 A;  4K5R A;  3EPI A;  3TAQ A;  4DR1 F;  3AH6 A;  5LSR A;  1WC5 A;  5FDL A;  1TL3 A;  2G1D A;  4DR4 J;  3D1H A;  5ETS A;  3RJM B;  2BJ7 A;  4OZ0 A;  3VGS A;  4CTA B;  1GMU A;  1C4C A;  1JLA A;  2DRD A;  2RIL A;  2R7Q A;  4EO6 A;  4R5P B;  1J27 A;  2MLX A;  2V6A A;  3MM8 A;  1A9N B;  4HEA 9;  5LMN F;  1NK6 A;  4RKU C;  3IR6 B;  5GAH U;  1U26 A;  3J7Z 5;  1S97 A;  1Q95 G;  3PIP Q;  2OTL S;  4DG1 B;  2IJN A;  5CAB A;  4U67 Q;  1Q78 A;  1NJX A;  4C8Y A;  3DCA A;  1O51 A;  1XR7 A;  2D69 A;  2MKC A;  3C8Y A;  1HI8 A;  1RB0 A;  2NYH A;  4EK2 A;  2YQ3 A;  1YBU A;  1QUV A;  2WVD A;  3AHP A;  1HR0 F;  1T9X A;  4H4K A;  2PMZ D;  1NKE A;  2N4C A;  1N5Q A;  5DM7 Q;  3IR5 B;  3QO9 A;  3BQ2 A;  1JB0 C;  2B9W A;  4LF1 A;  3POT A;  4KB7 A;  3W8G A;  3FBE A;  2BQ3 A;  4F7V A;  4FVC A;  1RT1 A;  3PFO A;  2B56 A;  1Y0H A;  1XMB A;  2V63 A;  4I7F A;  4DSK A;  3DRS A;  4Y2M A;  2H1Y A;  1JKH A;  3BSC A;  4GC6 A;  1RAI B;  1HAR A;  2MZQ A;  2Y3Y A;  3ICL A;  2P6T A;  1FKP A;  1P9Y A;  3ETM A;  3HF5 A;  3ET6 B;  3OSP A;  3BV8 A;  3MM5 B;  4DSE A;  3B8H A;  2AJ4 A;  3M32 A;  1FVQ A;  3IS9 B;  4K4W A;  2B0G A;  4PYD A;  3OQ2 A;  3DDN A;  3CED A;  2VIH A;  4K4X A;  3H5X A;  4W90 B;  2VDI A;  1ITP A;  7AT1 B;  3FMW A;  1NHK L;  4Z7C A;  2AQ4 A;  1K0T A;  4DR5 J;  3LP2 A;  3NNC A;  4P71 A;  1C0T A;  4Q0B B;  2X1G A;  3MEG B;  2CPF A;  3J7Y U;  2RHS B;  1HWK A;  1HNI B;  4JP8 A;  4EUV A;  2XS2 A;  3CJR A;  4HH1 A;  1HL6 A;  4DR6 F;  2X51 A;  1CC8 A;  5DG9 A;  2HVD A;  2ZH1 A;  2XY7 A;  1F5A A;  2FHJ D;  3C15 A;  3PG9 A;  2P9C A;  4J9O A;  4H4O B;  3FEZ A;  1N5T A;  2BRK A;  4DI6 A;  5I3Q A;  4H4M B;  2ZH7 A;  4OMF G;  4DQP A;  2VOO A;  5AXN A;  4MKA A;  3UWT A;  4J5O A;  1K44 A;  5HAO A;  4CYU A;  1N32 F;  1FX4 A;  1C1C A;  2LFV A;  1XIQ A;  1RTJ A; 
#chains in the Genus database with same CATH homology
 3GJT B;  2XYG B;  2QL7 B;  2H4W B;  2CNN B;  2C2M B;  4ZVP B;  3IBC B;  3GJS B;  2QL9 B;  2C1E B;  1F9E B;  1RWX B;  3D6F B;  3QNW B;  1I3O B;  2QLB B;  4DCJ B;  2H51 B;  3P4U B;  4JB8 B;  4ZVS B;  1PYO B;  3KJN B;  4ZVO B;  4DCP B;  1I51 B;  5K20 B;  5IC6 B;  1SC1 B;  3R7S B;  3D6M B;  2QLJ B;  2C2Z B;  2CJY B;  4LSZ B;  1QDU B;  2H5I B;  3GJQ B;  2CNL B;  2CJX B;  3R5J B;  1RWW B;  2H65 B;  3GJR B;  2XZT B;  3SIP B;  2XYH B;  3R7N B;  1RWV B;  1RWP B;  1ICE B;  1SC3 B;  3RJM B;  3R6L B;  3R7B B;  2CNK B;  1SC4 B;  1RHQ B;  3EDQ B;  1NME B;  1RHK B;  1QTN B;  2P2C B;  2C2O B;  1RHR B;  2Y1L B;  1PAU B;  1RHM B;  4ZVT B;  1RHJ B;  2HBZ B;  1BMQ B;  2H48 B;  2QLF B;  3D6H B;  5IC4 B;  2DKO B;  1RHU B;  2FQQ B;  3P45 B;  2Y0B B;  1RE1 B;  2XZD B;  3EDR B;  2H54 B;  1RWO B;  2XYP B;  2HBR B;  3KJQ B;  2HBY B;  3NS7 B;  3R6G B;  2C2K B;  2H5J B;  4ZVQ B;  4ZVR B;  1RWK B;  1GFW B;  4DCO B;  2CNO B;  3IBF B;  2CDR B;  2H4Y B;  1RWN B;  4ZVU B;  2HBQ B;  1RWM B;  1IBC B;  2QL5 B;  3KJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...