3GJQB

Caspase-3 binds diverse p4 residues in peptides
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3gjqB00
2C2OB 1BMQB 3SIPB 2C2KB 2HBRB 1ICEB 2CNOB 1RWKB 1RWPB 3R5JB 4DCJB 1RWXB 2QLFB 1RHRB 3GJRB 2H4WB 2C1EB 3IBFB 3R7BB 3KJFB 1QDUB 3P4UB 4ZVRB 1I3OB 5K20B 1F9EB 4LSZB 5IC4B 2XZTB 2Y1LB 3QNWB 3R6GB 2CJXB 2H65B 3EDRB 3GJSB 3KJQB 1RE1B 3D6FB 3P45B 3R6LB 4ZVPB 4JB8B 2XZDB 2FQQB 3GJQB 2H5IB 2QL7B 2CNLB 1SC3B 2DKOB 2HBQB 1RHMB 4DCPB 3D6MB 3RJMB 2HBZB 4ZVQB 3IBCB 2QL5B 2QLJB 2C2MB 3D6HB 3EDQB 2Y0BB 2HBYB 1RHQB 2QL9B 4ZVUB 1GFWB 4ZVTB 2H51B 1RWWB 4ZVOB 1SC1B 2XYGB 4DCOB 3R7SB 2QLBB 3R7NB 3NS7B 2H48B 3KJNB 1RHJB 1PYOB 2CNNB 1QTNB 2CNKB 2XYPB 2CJYB 1SC4B 2P2CB 2H54B 2CDRB 2H4YB 3GJTB 1RHKB 1NMEB 1RWVB 2XYHB 1I51B 1RHUB 4ZVSB 1PAUB 1RWOB 1RWNB 2C2ZB 5IC6B 1RWMB 2H5JB 1IBCB
chains in the Genus database with same CATH superfamily
1YSJA 2V8VA 2B56A 2ZBCA 1LFWA 1VDHA 3ISNC 2IA0A 5GAHI 1VMBA 4P72A 3GG0A 1OPIA 3IP0A 1T05A 3WHIA 4QWDA 1UPMB 1B3TA 1TL4A 4X4SA 4LR7A 2YWGA 3AOBA 4H4MA 4NOHA 3UR3C 1AA1B 3Q89A 1URRA 1LWFA 1RBOB 4KR0B 1S0VA 4AD6A 2XZWA 4JI4J 3AQPA 3M2RB 2QSWA 3LGMA 3NY0A 2CPHA 2RUSA 5EN1A 4C8LA 4ITSA 1VYAA 3MPWA 4L6V3 4ZP6A 3I6PA 5KFGA 4O4GA 3K5LA 2KFNA 2H4YB 4ECSA 4HLBA 2YKNA 4DFJA 1OY6A 2H9ZA 2IPOB 4C2MA 1RWKB 4Q7AA 5D6GA 1YZ6A 8RUCA 4O0IA 4JUZA 2DK2A 3HFKA 2FTRA 1N32F 1X4FA 4JI5F 5D3GB 3QFWA 4ED1A 1VC5A 2FVPA 3C6UA 4MAKA 2GC8A 1RJJA 3JSMB 1IBKJ 1S1UB 2JEGA 1U0HB 3D9BA 1U49A 4ELVA 2KDOA 3D6MB 4K4WA 5I4MA 5IZHA 1D3WA 2D9OA 1FNMA 4DV0J 1FKPA 2QSFA 2VC0A 3W9HA 1M1HA 1HPZB 1RB0A 3JYTB 3V4IB 2DTJA 2WCXA 1FJGF 3LAKA 1X5OA 4CO0A 2E1CA 2BQ3A 3TAQA 8AT1B 2CNKB 1Q78A 2XMMA 2MKSA 2GJ2A 1SC6A 1YQHA 2QRRA 3MR3A 3H5XA 3TUPA 3NMRA 3UDEA 4LF2A 2RQ4A 1FI4A 4BLGA 5FJ4A 3FC9A 1S9EB 1Q16B 3LPEA 2R7WA 2HQCA 1HQ2A 1HYSA 4NYOA 4ZKAA 3I0RB 3GJRB 3FQKA 1LV5A 2JLGA 2BRLA 1IVZA 1ZTWA 4I2QB 5AJ3J 2J0WA 3CD5A 2EFOA 2NYIA 2IDEA 1D9AA 5D15A 1RSCA 5KFVA 3FRZA 1JXLA 2RHQB 5K8MA 4WK1A 1S6QA 3KG0A 2W2MP 5IV4A 4RL1A 3IAM9 2V2ZA 1TL7B 3WZ0A 1TUVA 1RTDA 3H0PA 1JKHA 1TR0A 2YH1A 5GAHU 3K58A 5CCMA 3M8QA 2VBWA 1FESA 3QLHA 2B6AB 1CULA 1N33F 1HBUB 4L74A 4QW9A 5HSPA 1UZDA 4CP5A 4BWJA 1LW2B 2HZVA 2RF2A 1NKCA 4ELTA 2RUGA 3N5FA 1JLGB 2XGQA 3NXZA 3NGUA 4NL5A 4HHUA 3K5PA 4NXMF 1FXRA 3MECA 3SQGA 4YOEA 4ED7A 3KHLA 3VV2B 1XIQA 2CG8A 1H74A 7FD1A 1WG4A 4ZJLA 4CLLA 2JJ4D 3MCMA 2KU7A 2RKIA 2ZH3A 4DV5F 4LIWA 1R43A 3KLFB 2VG5B 4L3KA 4EUVA 4ZHRB 4GMKA 4M5KA 1FDAA 5M2RA 3LP2B 1SV5A 2QA2A 2NS1B 4GO7X 3NMAA 4LFBF 4NXNF 5AXMA 3P45B 3W60A 4DI6A 1G4CA 1GT8A 1H0HB 2E7XA 3VGTA 1HQUB 2RQKA 4DG1B 1VQYA 1DLOB 5H1SV 5GADI 3L4BC 2BM0A 4K5RA 5GVQA 4JI1F 3FCVA 1RTJA 5KG1A 3OL9A 3PX6A 3P96A 2JC0A 2DEJA 4I69A 3JS9A 2UVUA 1S48A 2V4JA 3DI6A 3R7SB 2DB1A 1UCNA 2MXYA 1SXLA 4MFBA 2EFQA 5KFRA 1KD1T 2AF6A 3I0SA 5KFSA 4DR4J 5HBMB 3D6TB 1RBLA 5J1EB 3W2VB 3G86A 5FDLB 2VH7A 2VD3A 4X64F 3B8HA 1JLEA 4ZITA 1FHTA 4E8UA 3M8WA 1PC5A 5LOQA 3NNCA 4KFBB 4J90A 3OD2A 4S0MA 4KPYA 4DBQA 4ED5A 4DCJB 3M32A 4YY3J 1YRXA 1YWXA 1L5UA 3BV8A 2BE7D 1P8GA 4UQGA 3MURP 4DQIA 1Y0HA 2IDLA 2IYIA 3BKUA 2VU5A 4A8WA 2UUCJ 4ATNA 2RB7A 5KFDA 5C2GA 1H6KX 4J91A 1AXQA 3J7Z5 3G87A 4H54A 2OH2A 1BUXA 4FBUA 4UF4A 5HVFA 2YQ0A 4F3QA 4DSKA 4C4WA 4WYLA 3KMSA 4U67Q 2B0GA 2HQGA 4USHA 2GVZA 1MROA 1NJZA 5C24A 3VVUA 2R7TA 1QD1A 3PYDA 1CJKA 2AD9A 2B3TB 3HK2A 1Y4ZB 5E41A 1VQ9S 3VHQA 1TL3A 3G8SA 2C3PA 4RUBA 3T6BA 3OUYA 2QT7A 2GIQA 2BJDA 1TAUA 4ZCMA 2E7VA 2C2ZB 1VBZA 3QRRA 1I94J 3OR2B 4NLGA 5F8GA 1GMWA 4YB6A 4MKYA 3G82A 1PGZA 2FZKB 4QIGA 4WPAA 1S72S 1QSLA 3QJJA 2DRDA 3O44A 5F3ZA 2UU9J 2R7XA 1NXIA 1VCTA 4K2JA 1S9FA 4W90B 2NXUA 2M52A 2X1FA 3SCLE 4N5SA 1URNA 4KV8A 2Z57B 4JB8B 4WTOB 1N56A 2E9TA 3GJQB 5E3AA 2CPZA 1XMOF 1X60A 3FBEA 1JJCB 4DPWA 3MM5A 2LECA 3HT3A 3OVAA 1UVKA 2CPYA 3CMAS 2BJ9A 4KHMA 2WVFA 3THPA 3OXFA 1D0EA 2DY9A 5IQQA 1B0VA 1EX8A 1HWLA 3K89A 4RBVA 3KDNA 2MJUA 4C3LA 1SVDA 2AT1B 4H4KC 4Q43A 5GADU 2HHXA 3E8OA 5LJ3Y 1M5KC 1A9NB 5DJBA 2DHXA 1RT7B 3NGDA 1S1XA 2WONB 1WDDA 4ETXA 2EPIA 3D4JA 3T1YF 3Q22A 4GVBB 1FX2A 2R7UA 1ITPA 4W92B 1F5AA 2VBYA 2BEFA 2LEBA 2MQOA 2MY7A 3FKBA 4YHHF 4WE1A 1P6TA 5KFPA 4QIWD 4D3GA 2YPYA 3BKFA 4K0KJ 5A8WB 3E2EA 3W9JA 3NOGA 1VHFA 4A8SA 5F3TA 1REVB 2Q3PA 2BR0A 2AGPA 2OAUA 4Q2MA 1CLFA 5DZ6A 1WSVA 3R2DJ 3MUMP 5BR8F 4DCOB 3MEGA 3BSAA 5DG7A 3RAXA 1NH7A 2QTWA 2YNIA 3I9ZA 2KT3A 4LF5F 2LU2A 1CJUB 5E5NA 3LGNA 1DFDA 2P5VA 1XMQF 5AE1A 4CWBA 1RWOB 1K1SA 4PWUA 1HMVB 2DEIA 3TW0A 1LQ9A 4NCGB 4X62F 4A46A 1FX4A 4MKVA 1IKVB 2R3VA 4WFYA 1ZETA 1BWEA 2FLLA 3GR0A 1M0SA 1F5CA 4CM0A 3O1LA 3BS9A 4AL5A 1UJ4A 4PXEA 1Y5LB 2GAHC 3O5TB 2QZ8A 2MQ8A 3BREA 1A7GE 3B6BA 5LXRA 2W9AA 3NS6A 3DLKA 3R9LA 4G6VB 4AQYJ 1Z4UA 4DUYJ 1IKXB 2OPQB 3SEOA 2DNHA 2FDNA 3QIPA 1NJWA 4YMEA 2BKPA 1RU2A 3MMAB 2OSQA 2C2RA 1S0OA 2IAJB 3PY8A 2GJFA 2MQQA 3MI7X 1DQAA 5HQLA 1VQLS 5KFJA 6FD1A 4QIEA 5A6WA 3G96A 3UI3A 4O3OA 4UY8T 1UWAA 2BX6A 1S57A 3T6JA 4B9SA 2JC1A 4P2SA 1NK9A 2NZ4A 1HBNB 4YQWA 3V6DA 3W3SA 2OMLA 1APSA 2G2ZA 4HL9A 2KZMA 2MZJA 2OFHX 2FHJD 3T1HF 5J2PA 3SDEB 1VK8A 4HR2A 4Y2CA 2AQ4A 1TK0A 5EX3A 4RW8A 3GPAA 2M8HA 2AZ1A 3ADAC 4NMXA 1KRPA 5A8KA 2KJWA 3UDVA 2KHDA 2FJWA 1NPKA 2XEXA 2APOA 1OY9A 1FFSB 4DMZA 1FRLA 2ATLA 4LR9A 3ETOA 3NNHA 1LWEB 2ADCA 1N0UA 1RAEB 2ACMA 2F8MA 3PW7A 1U2CA 4OZLA 2U1AA 2MKHA 3O6QA 2JFDA 4ID5A 4CRJA 3MEDB 4Y28C 2V50A 1C0TB 3GLJA 1SC4B 2P2CB 5I3QA 2B5JA 4NI2A 2PMZD 4QW8A 2D3ZA 3AA8A 1WC0A 4HDHA 4LF6F 3M9OB 1DAXA 1S10A 1Y3JA 1VQ7S 3MPVA 5CYQB 3HHLA 1NSQA 1RAIB 2J9CA 1VGYA 1T05B 2H3EB 2FLNA 4LRAA 5LM7E 4IH5A 2ZUAA 3EZOA 2BDPA 3OL7A 2K7KA 4IDKA 3CDUA 4V19X 2ZE2A 3OXGA 3KJQB 2JVRA 4P52A 2P9CA 3AFGA 1HWUA 2YNGB 3FRYA 4DZDA 1PYTA 2QEXS 2C2NA 3GFXA 5KFTA 3MXHP 2YQ1A 4X2BA 2W9CA 4ELUA 4OJ3A 4ZVTB 1KWMA 1HQEA 1HW9A 1SJ1A 1KTQA 1Z2LA 2CJAA 4O4GB 1HI0P 4A8FA 4Q0BA 3DNCA 1T3NA 3AD7C 1MWYA 2YKNB 2RT3A 4C7QA 4PYDA 1ZTTA 1VK3A 5FIIA 4FZVA 3KHHA 4CH1A 3HT0A 2FVSA 4WP8A 3H59A 2MSSA 1YI2S 2AZ3A 1SH2A 4R0JA 1U1NA 1HNZJ 3C6UB 1XEZA 1LNQA 1ZH5A 2JH3A 1CBKA 4JI8F 4OJGA 2C42A 2WRMA 3RAQA 3FFIA 2V4QA 2GHPA 3QYYA 4AT1B 2HW3A 2BVZA 4LBIA 3DGPA 3MAAA 4LVNP 2XSJA 3GE9A 3OW2R 1DURA 1A0OB 2A2CA 1U48A 5HJXA 1FXDA 1M5OC 4N56A 1F60B 1J2VA 3KWMA 2ADBA 3RBZA 2MQPA 2VOPA 2RIJA 1MU2B 5HMYA 1TVRA 2YNHA 1FRKA 4YFUA 3ZNUA 3PV8A 3AJDA 3ENQA 2UXBJ 4USIA 4ZOSA 2Q79A 3K57A 3RW7A 4DUZF 2ZH2A 3QSYB 3ZC4A 4URQU 4Z7CA 4O3NA 4RW4B 1X4GA 2V69A 1IR1A 2FIUA 2CZ4A 3DCAA 1YJ9S 3L09A 1FJEB 1HYSB 5IT0A 4NE9C 2C28A 1PILA 1H2VZ 2ZFHA 2QLFB 1AZSA 4B3SF 4QR2A 2ZH8A 3UD5A 5KFEA 3TRGA 1FDBA 3H8YA 2FHMA 3D54A 3CIZA 2HNDA 5C25B 1S6QB 3M9NB 1N8RT 2CKWA 2F4FA 3DOMA 2M7SA 1JKHB 1LWXA 3ILLA 3M8QB 1U0SA 1CULB 3X1LB 3OFGA 2VKRA 1ZM2A 3HJVA 5F8IA 5KFBA 3VGUA 4E98A 1XNRJ 3AT1B 3B78A 3I96A 2H51B 2A10A 4JI6F 4MT1A 2B8QA 3D68A 2BE9B 1ACMB 3FSYA 2LEPA 3MECB 3SQGB 3LP0A 1GTHA 1O6XA 2BOPA 4KHRA 4EZ6A 3T9ZA 1X5PA 1LWCA 3UPFA 2UUAJ 2RKIB 2HQIA 3A8JA 4MIBA 3KNAA 2I9SA 3NLCA 4OJHA 2YKQA 1XWLA 1WKKA 1SV5B 1SJRA 1LEOA 2D69A 1VC0A 2AYBA 4PKDB 2KRBA 2G9OA 3SCKE 2CJXB 2ZDOA 3H20A 1VRTA 1X4CA 1BD6A 3PHTA 2DKOB 3CCES 1S79A 3OL6A 3I32A 1RTJB 3VAIA 2Q6CA 1P9YA 2V4JB 1LXNA 1LFPA 1XQIA 4OYMA 3TJAA 2LQBA 4MFBB 3W8PA 4ZVOB 3NCPA 1PJ7A 4WU3A 2OMOA 1VBXA 3I0SB 2WVEA 2VICA 4UUXA 4I7FA 2A18A 2KG0A 4YB5A 1D9DA 3CJSA 5KTQA 4YP3A 1JLEB 2UUCF 3NBPA 1RT5A 1GAOA 4CYUB 1F2GA 3M32B 3ZTOA 1VRUA 2ROEA 4ZVGA 2MQMA 3DLBA 2MKYA 1XNQJ 2DR8A 1J5EF 3LWMA 2QN6B 2GGPB 2AGOA 2HMIA 1HD1A 2E1RA 1H7XA 2V63A 1VOMA 2M3DA 4F67A 2W4PA 2J6UA 3DRRA 4RKUC 3N01A 1VQ5S 3VGSA 2IRUA 5LMUF 1Q82T 1GH8A 3TX0A 1B99A 3EM1A 1N5SA 2LLZA 1TMJA 1X4DA 3TA0A 1RZMA 5KFFA 3CCUS 2GVZB 4ZP8A 3GR1A 4QIFA 4RZRA 4LBPA 5KT4A 1ZPWX 2RDDA 2I0XA 2FHOB 1CJKB 2Q66A 3UN5A 4DR3F 3T19A 1L3KA 1TL3B 4V19J 4DV6J 3OUYB 3DOKA 1NLKL 2MPUA 2FZCB 2J6TA 2RS2A 2J9DA 2DRAA 4OX6A 3QRQA 1N5QA 2YXLA 2LQ5A 3RRHA 3G4SS 2HKEA 3G82B 3GSIA 3R5AA 3HF5A 1F0XA 3ONQA 1ICEB 4IRCA 1TKTB 1Q7LB 1HNXJ 4Y6IA 1YKWA 4F2SA 3OFHA 2QYGA 4TY9A 3KHGA 3IBFB 1ZZNA 5ETNA 1M5VC 4FN5A 5CQGA 2B9WA 2K2PA 2HVDA 4O4RA 4DV7F 1HNIB 2CQ0A 2HRTA 2X7IA 3CW2C 1QAIA 2I5JA 2ZEJA 3MM5B 3P3DA 4CLKA 5KFHA 1WF0A 2GIRA 1WOPA 1ZPVA 2B4VA 2IC3B 1NK4A 1OMSA 2FGCA 4ZVEA 2LFVA 4AXIA 1IR0A 1RYRA 4FDFA 2LA6A 3IS9A 1RWWB 3FZ2A 4NEZA 3IWLA 2EK6A 2Y1RI 4CZCA 3KLGA 2DR9A 1NSKL 1X8DA 3AJ1A 2KXHA 2DIUA 4TQSA 4ES1A 1RYSA 2IFXA 2HURA 2WB4A 2LQ8A 2JFKA 1HBOA 1YJRA 5D0RA 5HO4A 1R89A 1HW8A 1LOUA 2BW2A 3VR1A 3MM6A 5DQGA 3IR7B 4EWTA 1WEZA 4K4ZA 3N6MA 3OLAA 2CYYA 2E9RX 4XPCA 2EW9A 2PE8A 4WE1B 2WAQD 2CJ9A 4Y0FA 3GU0A 1DZ5A 1S1VA 2VQEJ 2N7CA 1K0VA 3R1HA 3PG9A 3LA0A 3IRXA 2P9EA 4HH1A 1DTTA 3FCWA 3K59A 5IWAJ 2A6MA 5KFZA 2J8AA 5D0EA 2CXEA 3UN3A 3ZZRA 3T5KA 4X4RA 4WWSA 1MMDA 3FQLA 4CTAA 1U47A 1RDRA 4DV2J 3PHEA 2BJEA 3MEGB 1NM2A 1U1QA 1JJ4A 2K3KA 3GFZA 3P8BB 4DF4A 2YNIB 5ITHA 3DKDA 4FF2A 5DZ7A 3H5YA 4WXOA 2CVEA 2ZWOA 2D74B 3O2IA 2AYEA 3DFEA 3PDNA 3OV7A 3TZWA 1ZAWA 4DV4F 2D3O1 2ACYA 3WC2A 5K14A 2HWTA 1PAUB 3U1MA 3NP5A 1IJEB 3BGOP 1S1WA 3UR0A 4CT8A 3PYGA 4UOFA 2KL8A 4QQBA 1KQGB 4LFCJ 3DYAA 1V9OA 1SQFA 2E7WA 2J0SD 4P7TA 4U9RA 2XSFA 3KK1B 2NSBA 4NLSA 4K4TA 3PO4A 4KGZB 1U1LA 1IR2A 4RLEA 1Q53A 3H2VE 2F8EX 1DY3A 4UUWA 3DLKB 3TO8A 3D2WA 3DXBA 2GZOA 4P71A 1R8PA 2OSRA 2EKNA 3S1TA 3QIPB 2NR0A 3TUIC 2HGNA 1FE0A 4KQZA 5F8MA 1SC1B 5A8RA 4OHZA 4FKXA 3N6NA 5DM7Q 3PNIA 4DR1F 2G2OA 3IA0A 4B3TF 1HNVA 5CAAA 1JXVA 4PCQA 4M95A 1Q0NA 3NAIA 3GB0A 1HR0J 4Y2IA 3OVBA 3V5RA 2V2QA 3D28A 2DGWA 4H4KA 3I55S 5CD4H 3PKYA 4YN3B 2F1FA 3V6JA 3CC2S 3AD8C 1WORA 4ES2A 3M8SA 4K4SA 5J2PB 1SH0A 1ZYQA 4OI3A 1SKUB 1WI6A 1VIXA 3P4UB 4BHQA 5KFUA 4LSZB 1DARA 4RW8B 4HI2A 3W64A 3NKYA 5A8KB 4UOGA 2O5DA 2DNOA 4CH7A 3PR5B 3KK3B 1IBMF 1R8CA 3C8YA 1H7WA 2BOAA 2ZJRQ 3U1LA 2HGMA 3RB0A 3HFVA 5JXSA 5DDPC 4UY85 3FEZA 3GTYX 3D6HB 1U1KA 5U47A 2OIHA 3UD3P 2H5EA 2RE1A 2XYGB 2ILZA 1SQGA 2WBMA 3OFFA 3EPGA 2E5HA 2C3YA 1Q95G 2HVZA 1HFEL 4NI2B 2W7AA 2JEFA 2WW8A 1C2PA 3UN2A 1S76D 3VAJA 2MHEA 3S6EA 3NG8A 4C11A 1DTQB 2XHWA 2QLWA 3EGZA 1WUUA 2R2TA 5HP1A 1Q5YA 3H42A 2IMWP 2C2KB 2ASLA 4DPYA 4FYDA 4IDKB 1F3FA 3I4HX 3D0IE 4B3RJ 1U24A 1JLFA 3TP2A 1JLAA 1HI1A 4NASA 3BBBA 1B70B 2J8SA 2VHGA 2EBEA 1Y11A 2LYVA 3QT7A 3QJPA 4A4JA 3E01A 3M2RA 1QY7A 1RT3B 5KT3A 2Y0BB 5F8LA 4Q0BB 1BHNA 3IGNA 1ULRA 2DXEA 3CT9A 5HMXA 2QE5A 3RB4A 1S6UA 2NCKL 3DLGA 4K2XA 4LMZA 3TVKA 4PPDA 5DLGA 1W2IA 3FDSA 4I64A 1NMEB 3OFEA 5D4NA 4IQMA 1QAYA 4ALZA 4HHJA 1TK8A 3JXOA 5D3GA 4OIXA 3UDLA 1FFGB 3R8YA 4X65F 2B4PA 4RO0A 1QDUB 5I42A 3THTA 1HLWA 3MM7B 1S1UA 1U09A 4ECQA 3FFIB 4DV1F 1P1LA 3FGVA 1JLCA 1U0HA 5KG7A 2BUNA 3DGPB 3MAAB 3LTOA 3EDRB 1REGX 3DN9A 2DNRA 2NREA 2IM1A 3C15B 2F7VA 3MTJA 4OYIA 3JYTA 2OI2A 3BN4A 4OZJA 4DFMA 3RRKA 4DPUA 4TY8B 1BQNA 1I5OB 3BN7A 5L38A 1Z1ZA 4YEAA 1IJFB 3SSRA 2PI5A 5KOWA 2YNHB 4ZLJA 5KOXA 2J0QD 4GO5X 3TWZA 4WYWA 4ZPAA 1H2TZ 3IC1A 2NXCA 4KH1B 1MLAA 1YVFA 1N52B 4OJ1A 3I5BA 2SXLA 2RNEA 2OEMA 4K59A 2RMLA 4FYXB 2Y1IA 3R5CA 4M8LA 3I0RA 3J81U 3H4DA 1HWIA 1Q79A 1TFWA 3SIPB 1AZSB 1N0VC 2AJ1A 3Q8QB 1SKRA 4ZMMA 3AOAA 5E3PA 3DU5A 1K73T 4NLQA 2HHTA 1NO8A 3RBXA 4C3MA 5LXYA 1YRUA 3DOMB 2DYAA 4DN9A 2AGQA 2F65A 3G8TA 3WC0A 3C2PA 2B6AA 1P9QC 4J9RA 1HBUA 3AXMA 1OPZA 5KFXA 5K8PA 3KLEB 5EGYA 2ZKUA 2U2FA 1H98A 2VQFJ 4WP3A 2D1CA 2YX7A 3LP0B 2PN6A 1KQSR 3UE2A 1SQEA 3BPDA 2ROGA 1FXLA 1LWCB 3CEDA 2A3JA 4I6AA 1RADB 1RHKB 2COLA 2P8IA 1V3ZA 3OTOF 5HLFB 2HFOA 4OX7A 4Y65A 3BQ0A 1HNWF 3UO0A 3MMCB 3MD3A 2EXUA 4PEOA 2ZOFA 4WU2A 2AJ2A 1SJ3P 4ENOA 3G6XA 1M1KT 2YWHA 1PKUA 2KZZA 3HCXA 4Q8FA 1AFJA 4HVZA 1KOOA 3JTOA 5B0GA 1HQUA 1VRTB 2VODA 2CQGA 4J9MA 2QA4G 4DEZA 2ZVIA 3MR7A 3R3TA 4C8OA 1S49A 5DDQC 1T94A 3HKWA 1NHVA 1S97A 4DOZA 1RHMB 1RI7A 3LGHA 4P9SA 1QUPA 4X66J 4JYAF 4PZVA 4RNNA 4F8RA 2MDAA 3IBCB 1AT1B 1TKZB 1L3TA 1I1GA 4NYZA 4CLWA 1OIAA 4HACA 1GXTA 2G2YA 4KB7A 5L46A 4CO3A 4MTPA 4I7FB 4I68A 3OXLA 3W2VA 5FDLA 2LXIA 3NBPB 3L9ZA 3NL0A 1FNXH 3BH7B 4DL0C 2BRKA 1YJNS 4KFBA 3MEEA 2WW4A 3D5MA 3U1NA 1LK5A 2XULA 1ZAVA 3DLEB 4UT4A 3RU0A 2WVBA 2HMIB 3HPOA 2I2YA 2MZTA 3KDOA 1GMWD 1IQZA 2XS5A 2DD8S 1XN9A 4KKOA 4ZVRB 3HM9A 2D41A 3DRRB 1R0CB 2B43A 2RU3A 2V8PA 2QMUB 2IVFB 3RBDA 1SC3B 4P2MA 3ZZUA 4CLTA 2ZKTA 2NSCA 2G1HA 2UVRA 3D7SB 4XDDA 3V81A 4WXWA 2OELA 4MMOA 2DIVA 2IJRA 2FHKA 2KG1A 5KFKA 4IO1A 1TELA 4ANCA 3LF0A 3CB4A 1GFWB 2AP6A 3DOKB 1HNXF 3SV3A 4EFAC 2E5LJ 1WD6A 4NLVA 3BSOA 2Z58B 4ICLA 4LBHA 2CFXA 1K1QA 3PW5A 3FMWA 2QJ3A 1TTHB 1KS2A 3D66A 3OJUA 4P6QA 5DDRC 4DR6F 4OYBA 4XTTA 2AJ4A 4WZQA 4GKKJ 4JV5J 2EVZA 1UWBA 1KLNA 4ZVHA 4EMDA 1OWXA 4OV1A 1X9SA 4WBFA 2IHR1 2BE2A 2KHCA 3FBBA 1EETA 3PRVA 4LF8J 1NHUA 1M1GA 3KYLA 3DRYA 1IM6A 4RBTA 5J2MA 3KLVA 3MHYA 1UJ5A 3HHEA 2XB2D 1Q1KA 4IH7A 3P6YC 3VAKA 1R0AA 1KVIA 3PJXA 1V5VA 1HBMB 3C6TA 2XY7A 2C2MB 3IS9B 2AHOB 4F4KA 2OLWA 4LF4F 1Q86T 1X31C 1Y7PA 2DGTA 1CEZA 3KG1A 2Z30B 3ZTQA 2WSCC 4ZVFA 3TYTA 3IAS9 1S0MA 4V1Ak 3HULA 2WONA 1HBOB 1FFWB 1U1OA 1VQ8S 3HFZB 4QR1A 3M4XA 3SCIE 4GVBA 1X9MA 3MM6B 1EZZB 1UA1A 5C2CA 7AT1B 3P49B 3BF4A 2MEWA 2V8GA 2M8DB 4FF1A 5CCLA 3ZZ0A 1S1VB 4JI7F 1BC6A 1QE1B 3IRXB 1R6VA 1UA0A 1DTTB 1S9GB 5DQHA 4DR5J 3JTPA 3PR4A 4Z7YA 3HSGA 1KEKA 3PW2A 1O0PA 1RT4A 2XLKA 2ZBQA 2VPWB 4CTAB 3IFEA 4DXLA 3HKZD 2UXCJ 7FDRA 3OVSA 3M6WA 3I31A 3QZ7A 3S01A 2ZHOA 2ZM6F 5F8HA 1FE4A 4RUCA 2KRRA 2F63A 4C3KA 2UUWA 4UTGA 4DL4A 2HHHF 2DGXA 3F41A 3CCWA 4LSNA 2MLXA 3LO3A 3HZEA 4LQ9A 5E0OA 1RHJB 3BR8A 4IFVB 3MPYA 1VI7A 4OFZA 1HMVA 3K2YA 4JBCA 5ETMA 2O1PA 2HFUA 1S1WB 3IR5B 4DR2F 2FY8A 2HGLA 3PYFA 5ETSA 1RWNB 2LA4A 4HEA9 3JSBA 5MAOA 5F0WA 1N54B 4IRDA 1SIWB 4QIVA 3DYAB 4I1TA 4IO9Q 3HVTB 1B0TA 2YNFB 5ETVA 3EGNA 3DU6A 2ALYB 3QT5A 1N36J 2R2UA 2EC0A 5E33A 3MCSA 3Q2SC 2Y9HA 3MR5A 1T8EA 2GX8A 3MMBA 2ZJQQ 1RK8A 1RT6A 2DR7A 3V6KA 1NDKA 1OSDA 1NHKL 5EWEA 2QL5B 5A8RB 2ROPA 2V2VA 1BXNA 4J9VA 3MMAA 4NLTA 2EFVA 4PWDA 1ZA2B 4M5DA 3KLHA 3MR6A 1M5PC 2BA9A 2G4BA 2V67A 1KFSA 4E2FB 1HNVB 4LFAF 4ILRA 3G6YA 2BMBA 4FP9A 4TKTA 2AEJA 2XM3A 2E44A 2LDYA 3A3OB 1NAQA 3OTEA 5JJBA 4DV3J 2D3OR 2EFGA 3FCHA 5IV3A 1WC5A 2HAIA 4RX6A 1RHUB 1RLDA 4UQTA 5JMNA 3DDKA 4GC7A 1NZAA 1UP1A 3BYPA 3VQSA 1WG5A 4ED4A 2E1AA 2C2EA 3HHLD 5LSOA 2LQJA 3JAMY 4U8VA 2HS4A 2M4MA 1EAYC 2I8EA 2XCAA 2HIQA 1P1TA 4Z37A 4Q8EA 3AB4B 5KFAA 3PIOQ 2EI5A 3ZTRA 1YJTA 2RAQA 1HIYA 3TANA 4EGLA 5IOLA 3QAUA 4PXBA 1RAHB 1WKJA 4UW2A 4B17A 2ZBRA 4WKYA 3MCOA 3M9MB 1Q8BA 4H4OB 3N79A 1RABB 3GV5B 4TU9A 3KNGA 2W25A 5KG0A 2KKHA 5HI7A 1BY9A 5B0CA 2PT0A 3Q86A 1BQMA 1JLQB 3MCNA 1MWZA 2ZNYA 4IFYB 4D3HA 3FK4A 4C11B 4B3MF 5HP1B 3DOLB 5CYQA 1JLBB 3GYGA 4CO1A 3MFIA 2DNQA 1C0UB 2YKOA 3BGUA 5G0RA 1F1BB 3I87A 2IM0A 3JSYA 5KFMA 1F2HA 1RWPB 4K8RA 2EFPA 2ZDPA 1JLFB 1JLAB 3HJFA 3DC2A 2DHGA 3M30B 1UEVA 4MYTA 2IM2A 4RU2A 2YNGA 3QZ8A 2BANA 1IWGA 2XO6A 3SCJE 4WIIA 1NK8A 3MM9A 4LF7F 3BO2A 2HK2A 3E01B 2DHSA 3CC7S 2HVHA 1WJ9A 4DQRA 2HQFA 2BABA 1AUSL 4ZPTR 3SSSA 2YKMA 3SSQA 4OYPA 4Q5VA 2N82B 2OKQA 3DLGB 1YITS 5CZVA 4DPTA 2YQ3A 4U8YA 1VRQC 3IM9A 3TI0A 3B54A 2CNNB 1HL6A 5CA5A 2IJFA 4LF9J 5F9NA 2JDJA 1I6JA 1KR4A 1K9MT 3HP6A 4A8YA 2XI3A 2MZ1A 5L9NA 4JV1A 4DSJA 2LCWA 3M7VA 5E3RA 2Z0GA 2XMWA 3VTIA 2YVSA 3MPUB 5A2QY 3LPYA 1FTRA 2GHWA 2C2OB 2CUYA 1H72C 2OUGA 3RG6A 4ZCLA 5I42B 2VUGA 3BGFA 1RWXB 1JLCB 4B9LA 1KLMA 2M2BA 4EYHB 3OBIA 3QNWB 1R8HA 2Q1LA 4KJIA 3ISND 5F8NA 2H65B 3D6FB 2KYXA 4WJBA 3PXGa 2V6AA 4QYRA 1BQNB 3ZTPA 1T9TA 1ZS6A 3CD0A 1MU2A 2VJUA 4MKAA 4WK3A 4EI2A 3PW0A 4J9OA 4WFNQ 1FK9A 1PIEA 3WDOA 1Q8IA 1WELA 1VR6A 2BXJA 1RP5A 1Q8LA 3TUZC 1N6QA 2QGFB 1VQPS 4GKJJ 5BXIA 4FYWB 4FXDA 3EVOA 3W5XA 1FRJA 4RW4A 2A0FB 1EQMA 2XTJP 3AD9C 2KM8C 2Z56B 3Q8UA 1RGVA 1IBCB 2V4RA 1U8WA 1NUEA 2AYGA 4NYPA 3Q8RB 2C3MA 4MK7A 3JTNA 1KHVA 3KXDA 5EX0A 5C25A 4ZIVA 4NLPA 2HZCA 1RCXB 1YLXA 3T9NA 4RW6A 3MD1A 2FC9A 2ZOMA 2CG4A 1V3RA 3DLLQ 1MW7A 3ENVA 4EO6A 3ET6A 5ETTA 3ZNJ1 5CYJA 3CMES 3LOUA 2XLIA 3G6VA 4FPIA 2QFJA 5E2QA 4Q45A 2HBZB 3QQCD 3DRSB 1YJVA 3EJMA 3ISZA 3W65A 1CS4B 1OS5A 1HI8A 4OYZA 5HQMA 4NLYA 4RR5A 3CD6S 4BS2A 1PSDA 4E0DA 4U7UD 1WF1A 2JX2A 5CYMA 2ZJPQ 2GA7A 3OTDA 3MFHA 1N32J 4URGA 2X1BA 3WQPA 4JI5J 2LVWA 1KP6A 2IIHA 2PD1A 1ZBTA 1JMTA 1HARA 1RTZA 5AXNA 4DJBA 4X66F 3PRBA 2AEMA 2OFGX 4MKBA 3VAFA 4EEYA 2G13A 2CQ2A 2F40A 1RACB 1WSRA 4J5OA 3QSIA 3M6XA 2N3OA 2Y0SD 2X1GA 1FJGJ 2NLWA 2AX0A 2OPRB 2K06A 4OMFG 2DJWA 2E1MC 3R5GA 2MZRA 4HACB 4TXSA 2ASJA 4LUBA 4CT9A 4WTYA 4NRTA 2OD6A 3D67A 5M2UA 2IVYA 3EZ5A 1VHIA 2GMHA 3D1QA 1Y00A 2V5HG 3IO1A 5EDWA 4W4MA 4O3PA 4CO2A 3QJLA 3GIMA 4CYUA 1T95A 2FY1A 1WC4A 1OQ3A 3MEEB 4G65A 2DR6A 2OPSA 2AWZA 3L7PA 3M1VA 3Q0AA 4QR0A 4A47A 5D4OA 3J7A1 4IH6A 2GGPA 2L08A 3A13A 4DSFA 1CJVA 3CWJA 1T9XA 1C1CA 2R4FA 4KKOB 2Y1JA 3PO5A 3B4DA 2CAJA 4NZ6A 3P5TL 5L9XA 1JK9B 3QWUA 3GSDA 3VAMA 4NA3A 3PYEA 3AXKA 2V8HA 3RUBL 3AHPA 2XZTB 1S77D 3VAGA 3UD4P 1N33J 1WKLA 4RNMA 3RB3A 3V81B 5BYSA 3MF5A 1IKYA 2E5LF 1NDPA 4C0HA 2Y8WA 4O44B 4FYVB 1IKWA 4NXMJ 1JJHA 1MMLA 2HVIA 2DNKA 1UTAA 1CVJA 5KFLA 4DSLA 4NLXA 1VJWA 4KE5A 5IT4A 2ZH6A 4BDPA 2GVDA 2IRXA 3X3UA 3VZIA 1FNOA 2GQCA 1TZ0A 4XPEA 4DV5J 4QZVB 1YG0A 4ICLB 2VZ9A 2L3MA 4LJMA 3R27A 1FJ7A 2QIFA 5C42B 2YWKA 1TKTA 4LFBJ 2JRSA 4NXNJ 3JQJA 4JV0A 2HVEA 3GIRA 1UW4A 1UWBB 3N5BA 3SFGA 4WFAQ 1YK9A 4FF4A 1Q4RA 1C4AA 1GMVA 1VJQA 2O3DA 2HYIB 1HNIA 2BE2B 2XG8A 1T02A 2NPFA 1EETB 1O51A 3ITHA 5IC4B 4ID8A 4X4NA 5J2MB 4RUAA 2IC3A 5DGAA 2MYFA 3QT8A 2CWKA 5IT9Y 1R0AB 3C6TB 4JI0F 1H3DA 2YY3A 3TVYA 1VS3A 4XDCA 3UWTA 4X64J 3SQOP 3J81j 4MYUA 5ETKA 4B9VA 2PFDA 4PXCA 3CO0P 1FRIA 5L1JA 5B0AA 4LRDA 3PFOA 5HQ8A 2PC6A 2X3DA 4FXVA 1JJ2R 5J2NA 1NBEB 4GRSA 2VOOA 2HHSA 3LW5C 3VZHA 3NRBA 3G71S 3CJTA 2ZZNA 3HD2A 4OX9F 3Q8SB 3PKMA 4X4VA 5K20B 3J80Y 2UXDJ 1PBAA 2Y1LB 4OQJA 2IBKA 3QAEA 1RT4B 3VCDA 3AODA 4OI1A 2A6OA 3QGHA 4A8XA 2OP5A 1FWLA 3W2WA 1XC9A 4I2PA 2DBBA 3IXQA 3K5NA 3RR8A 2QV6A 3TJ8A 3GG1A 5JUMA 4FYYB 3GV7B 3H98A 4LSNB 2HBYB 4OYXA 1PO6A 2GNKA 4QWEA 4PQUB 1YRTA 1MNEA 2DPIA 1B4SA 3BPSP 1N88A 1K47A 2HIYA 5D77A 2GIFA 2DVIA 2WOMA 4DX5A 2FJXA 1X0PA 2XMTA 4PG8A 3A8EA 3FSIA 2BJ1A 3QIDA 5M2PA 2PI4A 2CPXA 3TEGA 4Y3CA 1XMOJ 2HWHA 1FKAF 4QU6A 3KK1A 5ADZA 3DHXA 2J9EA 2MLYA 1KN6A 2F3JA 3I56S 3MMBB 4HH0A 1L3VA 1RT6B 3CCQS 1QUVA 4JI2F 3DXSX 1OQ6A 2UUBF 4ECVA 4HDGA 4QCLA 4X4UA 2FD2A 4QPTA 5DQIA 1GEHA 5DLFA 4OYOA 1EIYB 4I6WA 1BLUA 4LR8A 1M5SA 5EWFA 3A12A 4CO4A 4PWDB 4DU7A 2M5YA 4M5DB 3KLHB 1G7CB 1Z2ZA 1T9YA 2V34A 1NK0A 5J2QB 3DLHA 2N3LA 2XMJA 2C3UA 3FEXB 3K17A 1TUWA 2BJ3A 1IBLF 5KFNA 4A8OA 1RQ0A 4L73A 2R7VA 4YR3A 1H73A 1JIHA 4YHHJ 4ZVSB 2POKA 4FVMA 3D0HE 1J27A 1RT2A 4NLWA 5BYQA 3EXCX 3M2VA 1PC4A 2KYZA 3KK3A 5A76A 1SPBP 4YB7A 2GMJA 2HNYB 5T7LB 4AFFA 1GX6A 4OZ0A 4OL8A 1YBAA 4OZ3A 2HBQB 1NH8A 5CABA 2CPFA 4LF5J 4MK8A 2J9DE 3WBZA 3KTQA 3GZ7A 1KONA 1XMQJ 2UUTA 1BQMB 2VPYB 1WC3A 3EGVA 4RJVA 3UFCX 5D4PA 5LL6d 3PX0A 2DNGA 4X62J 4C48A 1VISA 4RBUA 1FRHA 4USUA 2AEFA 4CLSA 1BGXT 1DTQA 1HD0A 3MPDA 1X7VA 4I0WA 4RW9B 4F4XA 2M88A 2F9DA 2VIHA 1EQ0A 1X9WA 2M0GB 5G0RB 3HHDA 5LMNJ 3H25A 4JI4F 3MWBA 4J9KA 5H9FK 3TAMB 3W5ZA 3DRXA 3KUGA 1F9FA 1W26A 3T5JA 2VG7B 4K50A 9RUBA 2D9PA 2BANB 3SZ2A 1ZAXA 3Q2TC 1EP4B 3MM9B 4ANEA 4DDFA 1R6YA 1HWJA 2V9KA 2RU9A 2HHQA 3RTVA 1U8SA 2KO1A 4G1PA 2HG4A 1RT3A 4QPXA 3ZZOA 2K1RB 2YKMB 4NLUA 1RAOA 4XO0A 4ZVQB 4TQRA 5THWA 3JQMA 3ILJA 2KXFA 4C0BA 3NOCA 3EVWA 2IM3A 4ZA1A 1IBKF 4KGXB 3U27A 4HHHA 2BJ8A 4HTIA 2MMYA 3T1HJ 4CI0B 3HDSA 1NKBA 5F41A 2RRBA 4DV0F 2HHPA 1N34J 3K8VA 5KFCA 2NUUG 5L1IA 1CQNA 3NGKA 1N4LA 1JNZB 3MM7A 3H4BA 2HBRB 1FF2A 1KLMB 4DL6A 3G2XA 2VBXA 1TL1A 1DJ0A 1ZA1B 3LWLA 4RUHA 4KSEB 3TA2A 3C15A 2AJQA 2KFYA 4GKJF 2VFTA 4TY8A 4F0MA 3Q8YA 5MLCV 2X3GA 5IM0A 2GQQA 2MGZA 2AV5A 2ALZA 1FK9B 4X84A 1SL2A 4ES3A 2RJZA 1N6QB 1Q8KA 3QBCA 4LF6J 5AJ3F 3BSNA 2XWYA 4N41A 5AT1B 5HAOA 2AMCB 1VBKA 2RD5C 2CZVC 1OYDA 2J5AA 3TZYA 4ZCIA 1Q5VA 3I82A 3NWGA 5A6PA 2NYHA 4WZMA 3HZGA 4F50A 3CMQA 5D0HA 5K8OA 1S4FA 4U7UK 4F0KA 2DT9A 2BKOA 2XBPA 1WTBA 5B7WA 4WFXA 2HQ3A 2YPZA 2UP1A 1T0TV 1KNZA 1KBRA 1R31A 2J7UA 4C8KA 2FJAB 4ER8A 3OT9A 4RW6B 2FVCA 5HVHA 6AT1B 1VQ4S 4LQ3A 2F4VJ 3ET6B 4P7VA 3TARA 5FD1A 3TA1A 4PWWA 1D9FA 2RVJA 1RE1B 4R5PB 3HVWA 4M5NA 1J5OA 3KLEA 4I56A 2CNLB 2DNYA 2DO0A 3AB2B 4OX8A 2GFFA 3TEHB 3RB6A 4DPOA 3K5OA 3ZXWA 3CIMA 2EC2A 5CYMB 5LJ5Y 1YIJS 4IR9A 1YJ7A 2HRUA 2HLTA 1NRKA 5G4DA 3PRDA 4FPRA 3NS7B 4XAKA 2R42A 2E66A 2W2QP 2H48B 3ENAA 5HLFA 4KPCA 1SIZA 4IG0B 4MJKA 4TYAA 2E9ZA 2YWFA 3MMCA 4JI8J 4PG4A 2O01C 1NCLA 4BC7A 2W2NP 1FDNA 2ZC4A 1SI9A 1ROFA 2W7PA 4X4PA 2OPPB 3RRGA 3U7JA 4B3OB 3TZXA 5AXLA 2ZH1A 2AW0A 3DRPA 2PA3A 1YDLA 3POTB 1N48A 4K4XA 3R5BA 4DR4F 1XTZA 2OJ3A 2FYXA 2DNNA 1TKZA 4PPZA 2VG6A 3BH6B 2WB1D 5L8RC 1VQOS 4YY3F 2YH0A 3CNQP 1NKEA 4K4VA 2HPUA 4DUZJ 3BBFA 4ILMA 1NZ8A 3NWRA 4MIAA 3KG4A 2W9BB 1PYOB 2OPSB 2GAGC 1X4HA 4KGMA 4B3SJ 2XYPB 4F4WA 4PXDA 3UVJA 4QYZK 2QA1A 3M1VB 3K5MA 3DLEA 2Y3YA 2XNRA 1V5IB 1CJVB 5ETOA 5KT7A 2FJVA 1C1CB 3PEHA 2XHCA 5I3PA 4PG5A 1ZOTA 4NMLA 2VPXB 4B08A 2CIMA 1MWQA 4TVAB 2VF3A 4CLYA 3GV8B 2VC1A 2JLFA 2AKWB 2GHVC 4NA1A 4N8NA 3EWGA 4WFZA 4M5JA 5EHHA 3PEJA 1IKYB 1VBYA 5D8HB 4JI6J 1XERA 3M8YA 2G0CA 4PUOA 1I94F 3A3NB 1IKWB 4IQXA 4TLRA 2ZZMA 4DL7A 2EKYA 3G8QA 4A48A 1D8ZA 3D3CJ 2UU9F 2NUHA 2HFSA 1UEKA 2GVDB 2MLZA 2ZVSA 4CH0S 2XMVA 1X4BA 1CC8A 2DH8A 2DNLA 3PFEA 3R2CJ 4DL3A 3HO1A 3UCUP 1E6VA 2MKIA 1YHQS 4AUKA 4JOUA 3B4MA 3HI9A 4K7QA 2OGUA 5ETQA 3HX9A 4F4YA 1GTEA 2IMOA 1U4BA 1FERA 3ITHB 1PBUA 1LXJA 1CJTA 3O8WA 1P27B 1S6PA 1K0TA 3QATA 4C6AA 3W61A 4WFBQ 2LXUA 2X1AA 4CO5A 2H1YA 1RKJA 1SL1A 4XK8C 4ANDA 5L39A 3SI8A 3S8SA 1HBMA 2K3IA 1S5ZA 1WHWA 3Q23A 2FLPA 2RDJA 3MAHA 4F25A 2O67A 3MEKA 2UVVA 2YKPA 1T9UA 4DX8H 4F04B 5HROB 3MZIA 4IG3A 3CXCR 1R3NA 3A1YG 2QLBB 3KUEA 2R8JA 5KFYA 4K0KF 1GXUA 3OTCA 5ETLA 1J5EJ 1QSSA 4N47A 1UVMA 3VALA 3DMJB 4G1IA 2UXDF 2DISA 5FLXY 3CPWR 2B9YA 5AE2A 3SYZA 5ETPA 5J2NB 4R0EA 4A8MP 3DM2B 1WC1A 4G1QA 1WHYA 3A8IA 1N5VA 2VKZG 3Q24A 4DHVA 4ED0A 5LMUJ 3CJ3A 1RT1A 1QAJA 1AYEA 2E5GA 1QE1A 2PEBA 1U25A 2OO4A 1S9GA 5L1KA 4B9UA 4LSLA 1MN7A 2PMWA 1F9EB 3WIVA 3HMJG 4RW7A 1YGYA 3TVZA 1UFKA 4BBYA 5D78A 4DR3J 2MZQA 4KYZA 2W4DA 3AJ2A 4ZPWR 3W2WB 4P74A 4RNOA 2QMWA 4I2PB 2YTCA 1KDNA 1U45A 2MQNA 1VIOA 1RAAB 4EBEA 1K44A 2BZ2A 3I4PA 2L9WA 3N28A 4U96A 4ILLA 4DLEA 4J9PA 4IFVA 4ZVUB 2CQPA 4URSA 4LREA 1U2RA 1EHWA 1F3VA 2WOMB 3ZZZA 1UZHA 1HWKA 4DN0A 4QWBA 2ASDA 1M90T 2R8GA 2MZSA 2KT2A 1WNEA 2UV8G 2HFNA 3F73A 3QFHA 4ZJOA 4AQYF 1C1BA 4DV7J 3MDFA 3HVTA 4DUYF 2YNFA 1RWMB 1G6BA 4BWMA 4Y2AA 1R27B 1JX4A 1A6LA 4P10A 3KLIA 2LU1A 4ED6A 1SJQA 3GYNA 3R7BB 2FVRA 3OL8A 4FS1A 4USWA 1QSYA 3GYXB 1T03A 4OI4A 3M2UB 4KY3A 1X5SA 3VQTA 1VQMS 3AA9A 1UEUA 3KMQA 3QO9A 1S1TB 3OPKA 3QGPA 3D1HA 1T9VA 3F44A 4Q44A 2RQCA 1WEYA 4NWBA 2GMLA 2WVCA 3CSKA 4R25A 3DDNA 2QL9B 3LALA 3V2UC 2IRYA 2NXJA 4ZIWA 2EEYA 2LMIA 3OLBA 4USMA 3TOQA 2DITA 4IYQA 1WTFA 4RPFA 4IRKA 2DPJA 4CNYA 1UJ6A 3MMJA 5DG9A 3D3BJ 1RT2B 1U1RA 1FEEA 1SBRA 1V6HA 3UW1A 3M2VB 2MSTA 2GW8A 2R8HA 3TUJC 3I5CA 4NLOA 2DGVA 3TJ9A 2DXFA 4WP9A 1X0FA 2CJBA 3MTKA 3IG1A 1R8AA 1XJWB 2XZDB 4H4OA 4OYWA 5HVGA 3M6VA 1E6YA 1UW9A 2HS0A 4TU7A 1B7FA 2ZHAA 2HHVA 2JLEA 3QGIA 4DV4J 3ZTSA 4OLPA 4DQSA 1JLQA 1NSAA 2XMAA 3QMQA 5LMNF 3VF0B 2NPIA 4IFYA 4DF8A 2VA2A 1TP7A 2RDIA 3T41A 4ZK7M 3UNGC 1L3SA 3DOLA 3NGTA 2RHSB 1JLBA 2JL9A 1C0UA 1NK6A 5B0FA 4OZ2A 3CTRA 3NGSA 1D1UA 4FBTA 1FWPA 1LW0A 2XYHB 4HI1A 3R5DA 3Q8VA 3M30A 3QRPA 2FGOA 3J7AN 4DLGA 3R5JB 1KOHA 1OYEA 3L7OA 4M5LA 3TNVA 1R7IA 3ULHA 2HFVA 4C97A 4CNZA 2KXNB 5H9FJ 3VAHA 2BQUA 1KFDA 2ILYA 2PSZA 1UVLA 4C8NA 2W8KA 4X4TA 4DL5A 2KB2A 4F3OA 1XR5A 3LAMA 1F9HA 3CE8A 5KT6A 4CLZA 4DR1J 1TQLA 5HMWA 4B3TJ 5B0DA 3A3PB 1S7HA 2M70A 3I9V9 1HNZF 4N76A 1N34F 3U02A 1YBTA 4C8MA 3OR1A 3CJQA 3AOCA 3HXMA 5HK4A 4OV6A 1WWHA 4PAAA 3CJRA 4HT5A 5DETA 2PIIA 4TNOA 2B7CB 3IGVA 2VDIA 1TV6B 3SBMA 4ZPCA 2OTLS 2PDAA 3SV4A 4ECYA 4NA2A 2W01A 3C14A 3T5LA 3CGIA 2VFUA 2HLUA 1I51B 3EVMA 1UAWA 1IBMJ 1TL1B 2JEJA 5GMEA 2VL1A 2CZ9A 1TK5A 3NCRA 2VFRA 2UXBF 1UKUA 4K4YA 1RA6A 5IM0B 4PG7A 2MGZB 1SUQA 4F26A 1IN0A 3HSZA 4B02A 4ETZA 5J1NA 2B9XA 4B9TA 4RNFA 2EBGA 3GMGA 1ZZFA 3M8ZA 1SL0A 4H4MB 1X4AA 1LWFB 5B08A 2I38A 2HWIA 3TX8A 3A4TA 2MJNA 3CCVS 5C7PA 1GNKA 1LK7A 1R0BG 3L95X 3OQ2A 1R8BA 1UVNA 1F5BA 1B7YB 2IY5B 2F4VF 2ZHBA 4OI6A 4ZLLA 3JAMU 1HKAA 3C19A 1XNRF 4ED3A 4Y2MA 2R2SA 4JI3J 1NB7A 3FBCA 2DXDA 2YX1A 1FD8A 4C8ZA 2AIRB 1VLOA 5CZXA 2GCFA 3H5SA 1VQKS 2P9GA 4DFPA 4UZBA 1X5TA 2Z2ZA 1WACA 3I5AA 2L41A 1J5OB 5HATA 4ZN1A 1GXLA 1RLCL 4DZ6A 2W24A 3TR5A 2XMKA 2UUAF 2J7WA 3DRSA 2Z8QA 1NB2A 1FCAA 2WHOA 2C22A 1UMJA 1CS4A 1DBDA 3RJMB 1O8BA 3IN5A 2B7BB 1SKSA 3MUTP 3CCTA 5DG8A 4GVLA 4YDXA 4CM2A 3ELHA 3UCZP 3J7YI 3BGLA 2IBOA 6FDRA 3BR9A 4B9MA 4OZ5A 4J7CA 2CQCA 1FKPB 2WSEC 4WIQA 1Y10A 4QWAA 2ZD1A 4X65J 3CDEA 2ZH9A 1WOSA 2PFFB 1DRZA 3KK2A 1FRMA 4B9NA 1NK7A 4DV1J 3Q83A 2UZAA 4OZNA 1FJCA 3W66A 3UDCA 2FVQA 4OHVA 4KHPJ 4ECXA 4NEYA 1YJUA 3DRPB 3ZO7A 4QOTA 2CPJA 2EK1A 2R7SA 3VWSA 2KFZA 5DGBA 4EBCA 2BKNA 2IVMA 4IOAQ 2Q43A 3C16A 2OPRA 4Y2KA 3UQSA 3SFUA 2VG6B 4ZLNA 3R6LB 1UVJA 1JXEA 2DNZA 4O3SA 1RU1A 1VQNS 3TQEA 9ATCB 4UZCA 5A0YA 4HKQA 3W9IA 2CJKA 1XNQF 4O3RA 3BO4A 2E29A 4ECZA 3CDBA 3EDQB 3CCSS 3JQKA 2BBEA 3H2UB 5KT5A 1SJ4P 5A2QU 1RTDB 1CQMA 2MHNA 2M9KA 1W2BR 3UVJB 5J1PA 3QLHB 1JQGA 2AYMA 2ZOGA 2FB0A 1NDLA 2KM8B 2EG2A 2RF2B 2J0XA 5BJRA 2Z2YB 4M5HA 1U02A 2CNOB 3HD1A 4QYZJ 4DV6F 4OI0A 4ECUA 1NPRA 4X4OA 4DQPA 2Z2LA 3N6LA 5EWGA 1FD2A 4PUOB 2C3OA 1G2EA 4MH8A 3ETMA 4O44A 5B0BA 5CXTA 4CLPA 5KG6A 2FC8A 2FQQB 1EB0A 1VQ6S 3GCXP 1FRXA 3PIPQ 2WVDA 1U6BA 3QGGA 2JWNA 4ECTA 3R1LA 4DUTA 5K5MA 4J37A 2KH9A 1HHTP 2QG9B 2QO3A 4ZLPA 4QBUA 3OTOJ 2LKZA 4F4ZA 3FEYB 3M8RA 2V8DA 4OZ1A 1HNWJ 2D7SA 2FJBB 1NPPA 3ILIA 3MAQA 1U26A 5C42A 1E6VB 1KKHA 3WX4A 1TKDA 3EZUA 1IUJA 3BZQA 3DI6B 4N7TA 4AYBD 4ED8A 4ZS6A 3F56A 2I6WA 4CLUA 2J76E 2FJDB 2W7OA 2DY1A 3W62A 5GAEI 3J7YU 2OHDA 1CJTB 3AY0A 1NDCA 1B0PA 4CDIA 3GFHA 4XIUA 2DGQA 2V68A 4JYAJ 1S6PB 2ZC3A 1SB6A 2H4WB 3CJ0A 3PACA 1CPZA 3KFWX 2XLJA 3PJWA 1SKWA 3F0NA 2XGPA 3EPIA 3GWCA 2V9WA 3LP1A 4DR7J 2HHUA 4N8OA 2CADA 2ERRA 4ZP9A 2WK4A 2B4UA 4CIOA 4IG3B 3RZAA 2XMUA 4C8YA 2L48A 3PM9A 2FUG9 2HFZA 3CCJS 1NSPA 1QJHA 5IXUA 3EGWB 2VQEF 3CF5Q 2AJFE 4P2XA 5IWAF 1YX2A 3Q8PB 2ASYA 4PABA 1IQTA 2MKKA 2VBZA 1MROB 5C24B 4G1QB 2XY5A 1FEHA 1T11A 5DO2A 1RT1B 4DV2F 1T9WA 3BGRA 1TKXA 3KUHA 5CD4A 4LSLB 2VV5A 3G9CA 5KFQA 4RW7B 1S0NA 1MG7A 2CJQA 5KG4A 1K8AT 1YZ7A 3W8GA 2C2DA 2DGUA 3SXLA 2ZH7A 4EU0A 1ZM3A 3D1OA 2ABYA 3HHKA 3MR2A 1VFJA 3KJVA 2Z2MA 1OSCA 4KV8B 2XCPA 4LFCF 4PQUA 3IR6B 2VFVA 3BDEA 4ZDNA 1GQEA 2XWXA 3FVYA 1V3SA 1N5YA 4UOHA 3RBEA 1HHQA 2R7QA 2A1BA 4KT0C 4DR6J 1IWAA 1KVKA 3WX8A 3BJYA 3N9UC 2KT5A 1EKSA 5L1LA 4QJVA 2D3UA 5RUBA 2MY8A 4KIAA 2WZ1A 1QTNB 2EWHA 5KFIA 4NCBA 2HNZA 2HAFA 1C1BB 2V94A 4F3MA 1EARA 2B4OA 4BCAA 3PVXA 3GIKA 2G0IA 3CCZA 1UETA 4OLOA 1KC8T 1BMQB 3KLIB 2BQRA 3CJKA 2QFIA 1GX5A 2FZGB 2NQPA 1S6OA 3BBCA 4DS4A 3UNYA 2DR5A 1S1XB 5JVHQ 1T03B 1YJWS 3BM7A 1UFWA 1HR0F 3MM8A 4LF4J 2VONA 3QO9B 3RGIA 3W7BA 2L9DA 5GAEU 1RTHA 4TLQA 2AX1A 1BWVA 3S7RA 5J2QA 1OJ4A 2CQIA 4Q2LA 3CCRS 2RRAA 3FBFA 2OD4A 2YWEA 2XS2A 3CCMS 2E5JA 3KJNB 2KN4A 1GMUA 1RTIA 4KRWA 1YTYA 2XO7A 4JI7J 4C98A 1RXOB 5I3UA 1XMBA 4NLRA 3CJ2A 2BJ7A 1XK8A 4M5MA 4L3NA 3WIUA 5K8NA 3OHAA 1IM4A 5LSLA 2HNYA 4WKRA 5IT9U 5T7LA 2CDQA 1VC6A 2NXNA 2G0JA 3GP9A 3IMQJ 3KJFB 1HHSA 3IG1B 4KO0A 2ZH4A 2CVIA 1MSWD 4J9SA 2ZM6J 8ATCB 3OSNA 1E6YB 4ZJQA 2BW7A 2HHHJ 2P6TA 2B8PA 4FNIA 1U6FA 4R8UA 3M8PA 2FLOA 2QA4S 4M5IA 1FVQA 2E5IA 4B3RF 1UPPA 2ZNZA 5KG3A 4DR2J 2RS8A 1RHQB 3BSCA 3LQVA 4RW9A 3EUNA 1QVFR 3CJ8A 1AB8A 3PW4A 4F2RA 1RISA 3G6ES 1Y3KA 1G3OA 2R7OA 2BACA 1LW0B 4EZ9A 3TAMA 2CDRB 4FNHA 1S12A 1MMNA 2HK3A 3C66A 3J80U 4LF1A 2W1BA 2VG7A 3EMTA 2CQBA 2UV8A 4K4UA 1EP4A 3MOZA 5H9EK 1UVIA 1YBUA 3HHNB 3QWPA 4USJC 1DQ9A 5HJYA 3V6DB 3K8WA 2K1RA 5T41A 4ZVPB 4DX7A 3DHWC 3CC4S 4AL6A 1KHWA 3ZZPA 4LFAJ 1CG2A 3H2LA 4HTJA 3V4MA 3OR1B 3E3XA 1FA0A 5GMDA 5SUHA 3EE3A 2QLJB 3KKFA 2DNMA 2VA3A 2NXEA 3ZZTA 2DCLA 3E51A 5SZTA 3LUYA 3PX4A 4JV2A 1Q81T 2RILA 3R7NB 3C14B 4Z2XA 5D4LA 1W25A 3CD7A 2CQ4A 3ILOA 4ZPVR 1FT8A 2GV1A 4JP8A 5IFMA 2KI2A 4NRUA 1Q7YT 5IQ6A 4ID5B 2HRYA 4P73A 2L9NA 1FKOA 2B5JB 2FJEB 2FHJA 4A8QA 2RSQA 2HSEB 4FXWA 1QLNA 1S4EA 3EYZA 5F9LA 1I3OB 4UOCA 1SUQB 1Y9OA 2QC3A 1SH3A 5HL7Q 3HHLB 2GO8A 4LIRA 3R6GB 2XS7A 4P75A 3IWNC 2E1PA 1NJIT 4NPOA 3NEKA 2ZZTA 5E3CA 4I6YA 2BV3A 2ZE2B 2WBRA 2I1RA 5K9FA 3EX7B 4B3MJ 3GFYA 4ECRA 2DHAA 1JNRB 4JI3F 2CA9A 1PJ6A 2CQ1A 3LH2S 4U95A 1NEEA 4WCEQ 2N4DA 5LT5A 1NJXA 1PYSB 2W9CB 4OYAA 1BQXA 5DDOC 1ZM4A 2LP4A 1HQEB 3FNNA 4FS2A 1SJFA 3HLUA 4PQAA 3BQ1A 2VQFF 2Y8YA 4LF7J 3ZZYA 4USVA 2OEJA 4YUDA 3PJ9A 1EKRA 4GC6A 4QU7A 2MTLA 2XNQA 4DFKA 4R5PA 3T1AA 2P6SA 4TU8A 3T3FA 3MGJA 1F6TA 5KFWA 2VJVA 4KGVB 1TL5A 1PG5B 2LQ9A 3JSMA 2WTFA 2CWXA 3NCQA 4PRFA 2N4CA 2XSJB 4KHPF 2DRBA 4LRCA 4IG0A 1U1MA 2ZD1B 4M94A 1HPZA 4U7CA 4USKA 5T14A 2YWWA 3V4IA 1RKIA 3KK2B 3RR7A 2IYGA 4EO8A 4KBIA 5C5JA 1RCOB 5KG2A 2J7KA 1TVRB 2GO9A 3K7RA 3HVAA 1XBWA 1JWWA 4B3OA 2OPPA 5IS2A 1B64A 4ED2A 5ETRA 2VPZB 2HHWA 4DU8A 3POTA 4TYBA 4DL2A 4EBDA 3C16B 1RAFB 5GAGI 1S9EA 1QTMA 2C1EB 3CJ4A 4LVOP 4AL7A 1KQFB 1XR7A 2YX4A 4ZN3A 1U1PA 3NS5A 5A0YB 2QYCA 2RH3A 3K0JA 2ZWPA 3ENWA 4I2QA 5LSRA 2QL7B 3N0VA 1ELOA 3HSDA 3JB9k 5BYRA 2K7JA 2HNDB 2F8HA 3FMBA 3A8KA 3DLJA 4IR1A 3HSJA 2MQLA 4LRFA 1FO1A 1TL7A 2W9BA 4NLDA 3DDIA 2CPEA 4YR2A 1TAQA 4YS2A 4J9LA 4CCHA 3UCGA 1RAGB 3L3CA 5B0EA 3GONA 2EG1A 1SCJB 4USTA 4EK2A 3PTWA 4AXJA 2W4CA 2H54B 1LW2A 3BEGB 1AFIA 2KTQA 4KGKA 1JLGA 1U6ZA 4X4QA 2PGCA 2JZ5A 2CQHA 3R97A 4P2FA 3BB5A 4PR6A 1WHXA 3NGRA 1O5JA 2VASA 2PO4A 2MB0B 3KOAA 1PCAA 2DGOA 3KLFA 2VG5A 4ZHRA 3FSXA 1KVJA 2DGSA 3LP2A 4U6PA 2H5IB 2V0NA 3GILA 2CQ3A 4DSEA 3H5UA 3EICA 4GKKF 2W2OP 2QLXA 4JV5F 3QPIA 4DG1A 1TU0B 2CRLA 2HZAA 1DLOA 2K8GA 3EXYA 4LRBA 4A8KA 2DH7A 1S7IA 4BC9A 4LF8F 4F0HA 3BO3A 4PYAA 4IKAA 4ECWA 2VB6A 3ICLA 4F36A 1M5HA 3J7ZT 1G1XA 5HN0A 4JI1J 2PMHA 2DO4A 4F02A 2GJIA 4FF3A 3VGVA 2BM1A 5HBMA 4DR7F 5J1EA 1KSPA 2EFNA 2R8IA 2QMXA 2DCUB 1BE4A 1U2FA 2PA8D 5AE3A 1UL3A 1RT5B 2XY6A 3NNAA 1RWUA 2R2RA 4RU9A 2JSXA 1VRUB 1RUSA 3LP1B 2YBVA 1CC7A 3CUNA 5CHCB 1WDTA 3FUYA 4Y34A 4W98A 3CCLS 4M1KA 5HROA 1NK5A 2JVOA 4KAIA 1KTVA 4L75A 4C0OC 5GAGU 4L76A 4KC5A 3M6UA 4NX9A 4IUFA 3W63A 3TZZA 4DR5F 3RYLA 3DMJA 3T5HA 2A2DA 3DM2A 3ZFVA 5E3QA 1PAEX 2UVWA 3C46A 2DHHA 2UXCF 4O3QA 3GIJA 1H2UX 3BGRB 1TKXB 4RWXA 3GJTB 3HVRA 1WEXA 2NZCA 2CPDA 5HMZA 2H5JB 4AE5A 3AAWB 2BYCA 2HEKA 1WF2A 2O66A 4OHYA 1TUGB 4ZCKA 3OR2A 1W7WA 2XC9A 3IM8A 3AQOA 1RHRB 2W2PP 2JNJA 3FJ2A 4HYKA 3PZPA 2JHEA 2Z4PA 1UFLA 2VDHA 3GJSB 4O0NA 5EUHA 2QX0A 4F4AA 5KAKA 3KJVB 1MN9A 1EJ7L 4F7VA 2LDIA 3N4WA 2N7YA 1WC6A 1S59A 4K5SA 1N5YB 2DNPA 3OJSA 1OY8A 2I5JB 1VLYA 3BKTA 2ZH5A 3GIIA 1CSJA 1N36F 2V2KA 1PJ5A 3W5YA 4J9QA 5KT2A 2HNZB 1QVGR 1FVSA 4PG6A 3LANA 5GMKa 2Q6BA 3SMZA 1T7PA 2XQCA 4RNHA 5KFOA 4LT6A 3AH6A 2RQMA 3KLGB 3VVTA 4IOBA 4FVCA 1QAXA 4ZPBA 3CJKB 4O23A 5D0GA 5IC6B 2OTJS 4CQ1A 4CLFA 2VFSA 1GK8A 2X51A 4DS5A 1RT7A 3FZBA 4ZP7A 1WOOA 4JI0J 2YKAA 4DSIA 3MUVP 3M2UA 3MM8B 2G1DA 3BYRA 2CQDA 4OHXA 1S1TA 4DV3F 2R8KA 1Y5NB 1RTHB 2GQ2A 5E7OB 1FTCA 1NNDA 4M5GA 4DX6A 4TN2A 2AJ0A 3T1YJ 3O3LA 5A8WA 3H90A 3IRWP 4EYIB 1FDDA 4J9UE 1TFYA 1AW0A 1XR6A 4QWCA 5DS7A 1FWKA 2KVQE 1REVA 1DQ8A 2CPIA 5CH7B 1NJYA 4HT7A 1KQKA 1RTIB 4IOCQ 2ZBIA 1X4EA 3BQ2A 3L7UA 4DPXA 5I3UB 4OX9J 4YB1P 1Y5IB 2JOQA 4Y00A 4N77A 4I67A 1D09B 2KJVA 1RAJA 3BDPA 1TMMA 2LXFA 1JB0C 3TQ1A 1RWVB 1C4CA 1CJUA 3HHLC 3H40A 4NZ7A 1VQSA 1WG1A 5BR8J 2B9EA 3RAMA 3PCOB 1AROP 4KO0B 5K14B 4NCGA 4NZ0A 2DH9A 2WSFC 1IKVA 2PEHA 3QT6A 1RBAA 5KG5A 4KH0B 1IXKA 1NU4A 3CULA 2ZBPA 2MKJA 4R8UB 2JEIA 3M8PB 4NCAA 3D0GE 2IA6A 3IBWA 3GCWP 4OI2A 4DCPB 3CJ5A 1DHMA 4DWIA 5F8JA 5AXKA 4OHWA 2F9JA 4FKYA 3THVA 3TAPA 2HQDA 5FLXU 3CDAA 4YR0A 4ERDA 3DGVA 2ZUGA 2KVIA 1U7LA 1IKXA 2AU0A 3RW6A 2OPQA 1WHVA 3CO9A 3H7HB 2CJYB 1D8YA 1S99A 2FPHX 2IAJA 1H38A 2XI2A 4JI2J 1AUDA 3M05A 4ZPDA 1T3OA 2UUBJ 2ATCB 5DM6Q 5F0UA 3OHBA 4WF9Q 3P5BP 1RA7A 3KHRA 5HANA 3CDWA 4L72B 1LKZA 3CVKA 3JSRA 4LF9F 1HBNA 2IJNA 2LEAA 4I4BA 4YDDB 3J81Y 5B09A 2W8LA 3SDEA 2F5GA 3B82A 3MOJB 2OEKA 5H9EJ 1OO0B 4MK9A 1IBLJ 2HS3A 2RRNA 4RWWA 4C9DA 1TV6A 3C3LA 2J6SA 3NAHA 1QM9A 5DRKA 1ZM9A 3V6HA 1LWEA 3US5A 4KTQA 1L3UA 1WI8A 2R7RA 3W1YC 2B51A 2ZITA 4MIWA 2GS8A 2MKCA 1N5TA 3MEDA 3IWXA 4G3IA 3OTBA 1FKOB 1C0TA 5JVGQ 1HA1A 3OSPA 4M63A 2R9LA 4J9NA 4DQQA 3GQCA
chains in the Genus database with same CATH topology
2C2OB 1BMQB 3SIPB 2C2KB 2HBRB 1ICEB 2CNOB 1RWKB 1RWPB 3R5JB 4DCJB 1RWXB 2QLFB 1RHRB 3GJRB 2H4WB 2C1EB 3IBFB 3R7BB 3KJFB 1QDUB 3P4UB 4ZVRB 1I3OB 5K20B 1F9EB 4LSZB 5IC4B 2XZTB 2Y1LB 3QNWB 3R6GB 2CJXB 2H65B 3EDRB 3GJSB 3KJQB 1RE1B 3D6FB 3P45B 3R6LB 4ZVPB 4JB8B 2XZDB 2FQQB 3GJQB 2H5IB 2QL7B 2CNLB 1SC3B 2DKOB 2HBQB 1RHMB 4DCPB 3D6MB 3RJMB 2HBZB 4ZVQB 3IBCB 2QL5B 2QLJB 2C2MB 3D6HB 3EDQB 2Y0BB 2HBYB 1RHQB 2QL9B 4ZVUB 1GFWB 4ZVTB 2H51B 1RWWB 4ZVOB 1SC1B 2XYGB 4DCOB 3R7SB 2QLBB 3R7NB 3NS7B 2H48B 3KJNB 1RHJB 1PYOB 2CNNB 1QTNB 2CNKB 2XYPB 2CJYB 1SC4B 2P2CB 2H54B 2CDRB 2H4YB 3GJTB 1RHKB 1NMEB 1RWVB 2XYHB 1I51B 1RHUB 4ZVSB 1PAUB 1RWOB 1RWNB 2C2ZB 5IC6B 1RWMB 2H5JB 1IBCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2O B;  1BMQ B;  3SIP B;  2C2K B;  2HBR B;  1ICE B;  2CNO B;  1RWK B;  1RWP B;  3R5J B;  4DCJ B;  1RWX B;  2QLF B;  1RHR B;  3GJR B;  2H4W B;  2C1E B;  3IBF B;  3R7B B;  3KJF B;  1QDU B;  3P4U B;  4ZVR B;  1I3O B;  5K20 B;  1F9E B;  4LSZ B;  5IC4 B;  2XZT B;  2Y1L B;  3QNW B;  3R6G B;  2CJX B;  2H65 B;  3EDR B;  3GJS B;  3KJQ B;  1RE1 B;  3D6F B;  3P45 B;  3R6L B;  4ZVP B;  4JB8 B;  2XZD B;  2FQQ B;  3GJQ B;  2H5I B;  2QL7 B;  2CNL B;  1SC3 B;  2DKO B;  2HBQ B;  1RHM B;  4DCP B;  3D6M B;  3RJM B;  2HBZ B;  4ZVQ B;  3IBC B;  2QL5 B;  2QLJ B;  2C2M B;  3D6H B;  3EDQ B;  2Y0B B;  2HBY B;  1RHQ B;  2QL9 B;  4ZVU B;  1GFW B;  4ZVT B;  2H51 B;  1RWW B;  4ZVO B;  1SC1 B;  2XYG B;  4DCO B;  3R7S B;  2QLB B;  3R7N B;  3NS7 B;  2H48 B;  3KJN B;  1RHJ B;  1PYO B;  2CNN B;  1QTN B;  2CNK B;  2XYP B;  2CJY B;  1SC4 B;  2P2C B;  2H54 B;  2CDR B;  2H4Y B;  3GJT B;  1RHK B;  1NME B;  1RWV B;  2XYH B;  1I51 B;  1RHU B;  4ZVS B;  1PAU B;  1RWO B;  1RWN B;  2C2Z B;  5IC6 B;  1RWM B;  2H5J B;  1IBC B; 
#chains in the Genus database with same CATH topology
 1YSJ A;  2V8V A;  2B56 A;  2ZBC A;  1LFW A;  1VDH A;  3ISN C;  2IA0 A;  5GAH I;  1VMB A;  4P72 A;  3GG0 A;  1OPI A;  3IP0 A;  1T05 A;  3WHI A;  4QWD A;  1UPM B;  1B3T A;  1TL4 A;  4X4S A;  4LR7 A;  2YWG A;  3AOB A;  4H4M A;  4NOH A;  3UR3 C;  1AA1 B;  3Q89 A;  1URR A;  1LWF A;  1RBO B;  4KR0 B;  1S0V A;  4AD6 A;  2XZW A;  4JI4 J;  3AQP A;  3M2R B;  2QSW A;  3LGM A;  3NY0 A;  2CPH A;  2RUS A;  5EN1 A;  4C8L A;  4ITS A;  1VYA A;  3MPW A;  4L6V 3;  4ZP6 A;  3I6P A;  5KFG A;  4O4G A;  3K5L A;  2KFN A;  2H4Y B;  4ECS A;  4HLB A;  2YKN A;  4DFJ A;  1OY6 A;  2H9Z A;  2IPO B;  4C2M A;  1RWK B;  4Q7A A;  5D6G A;  1YZ6 A;  8RUC A;  4O0I A;  4JUZ A;  2DK2 A;  3HFK A;  2FTR A;  1N32 F;  1X4F A;  4JI5 F;  5D3G B;  3QFW A;  4ED1 A;  1VC5 A;  2FVP A;  3C6U A;  4MAK A;  2GC8 A;  1RJJ A;  3JSM B;  1IBK J;  1S1U B;  2JEG A;  1U0H B;  3D9B A;  1U49 A;  4ELV A;  2KDO A;  3D6M B;  4K4W A;  5I4M A;  5IZH A;  1D3W A;  2D9O A;  1FNM A;  4DV0 J;  1FKP A;  2QSF A;  2VC0 A;  3W9H A;  1M1H A;  1HPZ B;  1RB0 A;  3JYT B;  3V4I B;  2DTJ A;  2WCX A;  1FJG F;  3LAK A;  1X5O A;  4CO0 A;  2E1C A;  2BQ3 A;  3TAQ A;  8AT1 B;  2CNK B;  1Q78 A;  2XMM A;  2MKS A;  2GJ2 A;  1SC6 A;  1YQH A;  2QRR A;  3MR3 A;  3H5X A;  3TUP A;  3NMR A;  3UDE A;  4LF2 A;  2RQ4 A;  1FI4 A;  4BLG A;  5FJ4 A;  3FC9 A;  1S9E B;  1Q16 B;  3LPE A;  2R7W A;  2HQC A;  1HQ2 A;  1HYS A;  4NYO A;  4ZKA A;  3I0R B;  3GJR B;  3FQK A;  1LV5 A;  2JLG A;  2BRL A;  1IVZ A;  1ZTW A;  4I2Q B;  5AJ3 J;  2J0W A;  3CD5 A;  2EFO A;  2NYI A;  2IDE A;  1D9A A;  5D15 A;  1RSC A;  5KFV A;  3FRZ A;  1JXL A;  2RHQ B;  5K8M A;  4WK1 A;  1S6Q A;  3KG0 A;  2W2M P;  5IV4 A;  4RL1 A;  3IAM 9;  2V2Z A;  1TL7 B;  3WZ0 A;  1TUV A;  1RTD A;  3H0P A;  1JKH A;  1TR0 A;  2YH1 A;  5GAH U;  3K58 A;  5CCM A;  3M8Q A;  2VBW A;  1FES A;  3QLH A;  2B6A B;  1CUL A;  1N33 F;  1HBU B;  4L74 A;  4QW9 A;  5HSP A;  1UZD A;  4CP5 A;  4BWJ A;  1LW2 B;  2HZV A;  2RF2 A;  1NKC A;  4ELT A;  2RUG A;  3N5F A;  1JLG B;  2XGQ A;  3NXZ A;  3NGU A;  4NL5 A;  4HHU A;  3K5P A;  4NXM F;  1FXR A;  3MEC A;  3SQG A;  4YOE A;  4ED7 A;  3KHL A;  3VV2 B;  1XIQ A;  2CG8 A;  1H74 A;  7FD1 A;  1WG4 A;  4ZJL A;  4CLL A;  2JJ4 D;  3MCM A;  2KU7 A;  2RKI A;  2ZH3 A;  4DV5 F;  4LIW A;  1R43 A;  3KLF B;  2VG5 B;  4L3K A;  4EUV A;  4ZHR B;  4GMK A;  4M5K A;  1FDA A;  5M2R A;  3LP2 B;  1SV5 A;  2QA2 A;  2NS1 B;  4GO7 X;  3NMA A;  4LFB F;  4NXN F;  5AXM A;  3P45 B;  3W60 A;  4DI6 A;  1G4C A;  1GT8 A;  1H0H B;  2E7X A;  3VGT A;  1HQU B;  2RQK A;  4DG1 B;  1VQY A;  1DLO B;  5H1S V;  5GAD I;  3L4B C;  2BM0 A;  4K5R A;  5GVQ A;  4JI1 F;  3FCV A;  1RTJ A;  5KG1 A;  3OL9 A;  3PX6 A;  3P96 A;  2JC0 A;  2DEJ A;  4I69 A;  3JS9 A;  2UVU A;  1S48 A;  2V4J A;  3DI6 A;  3R7S B;  2DB1 A;  1UCN A;  2MXY A;  1SXL A;  4MFB A;  2EFQ A;  5KFR A;  1KD1 T;  2AF6 A;  3I0S A;  5KFS A;  4DR4 J;  5HBM B;  3D6T B;  1RBL A;  5J1E B;  3W2V B;  3G86 A;  5FDL B;  2VH7 A;  2VD3 A;  4X64 F;  3B8H A;  1JLE A;  4ZIT A;  1FHT A;  4E8U A;  3M8W A;  1PC5 A;  5LOQ A;  3NNC A;  4KFB B;  4J90 A;  3OD2 A;  4S0M A;  4KPY A;  4DBQ A;  4ED5 A;  4DCJ B;  3M32 A;  4YY3 J;  1YRX A;  1YWX A;  1L5U A;  3BV8 A;  2BE7 D;  1P8G A;  4UQG A;  3MUR P;  4DQI A;  1Y0H A;  2IDL A;  2IYI A;  3BKU A;  2VU5 A;  4A8W A;  2UUC J;  4ATN A;  2RB7 A;  5KFD A;  5C2G A;  1H6K X;  4J91 A;  1AXQ A;  3J7Z 5;  3G87 A;  4H54 A;  2OH2 A;  1BUX A;  4FBU A;  4UF4 A;  5HVF A;  2YQ0 A;  4F3Q A;  4DSK A;  4C4W A;  4WYL A;  3KMS A;  4U67 Q;  2B0G A;  2HQG A;  4USH A;  2GVZ A;  1MRO A;  1NJZ A;  5C24 A;  3VVU A;  2R7T A;  1QD1 A;  3PYD A;  1CJK A;  2AD9 A;  2B3T B;  3HK2 A;  1Y4Z B;  5E41 A;  1VQ9 S;  3VHQ A;  1TL3 A;  3G8S A;  2C3P A;  4RUB A;  3T6B A;  3OUY A;  2QT7 A;  2GIQ A;  2BJD A;  1TAU A;  4ZCM A;  2E7V A;  2C2Z B;  1VBZ A;  3QRR A;  1I94 J;  3OR2 B;  4NLG A;  5F8G A;  1GMW A;  4YB6 A;  4MKY A;  3G82 A;  1PGZ A;  2FZK B;  4QIG A;  4WPA A;  1S72 S;  1QSL A;  3QJJ A;  2DRD A;  3O44 A;  5F3Z A;  2UU9 J;  2R7X A;  1NXI A;  1VCT A;  4K2J A;  1S9F A;  4W90 B;  2NXU A;  2M52 A;  2X1F A;  3SCL E;  4N5S A;  1URN A;  4KV8 A;  2Z57 B;  4JB8 B;  4WTO B;  1N56 A;  2E9T A;  3GJQ B;  5E3A A;  2CPZ A;  1XMO F;  1X60 A;  3FBE A;  1JJC B;  4DPW A;  3MM5 A;  2LEC A;  3HT3 A;  3OVA A;  1UVK A;  2CPY A;  3CMA S;  2BJ9 A;  4KHM A;  2WVF A;  3THP A;  3OXF A;  1D0E A;  2DY9 A;  5IQQ A;  1B0V A;  1EX8 A;  1HWL A;  3K89 A;  4RBV A;  3KDN A;  2MJU A;  4C3L A;  1SVD A;  2AT1 B;  4H4K C;  4Q43 A;  5GAD U;  2HHX A;  3E8O A;  5LJ3 Y;  1M5K C;  1A9N B;  5DJB A;  2DHX A;  1RT7 B;  3NGD A;  1S1X A;  2WON B;  1WDD A;  4ETX A;  2EPI A;  3D4J A;  3T1Y F;  3Q22 A;  4GVB B;  1FX2 A;  2R7U A;  1ITP A;  4W92 B;  1F5A A;  2VBY A;  2BEF A;  2LEB A;  2MQO A;  2MY7 A;  3FKB A;  4YHH F;  4WE1 A;  1P6T A;  5KFP A;  4QIW D;  4D3G A;  2YPY A;  3BKF A;  4K0K J;  5A8W B;  3E2E A;  3W9J A;  3NOG A;  1VHF A;  4A8S A;  5F3T A;  1REV B;  2Q3P A;  2BR0 A;  2AGP A;  2OAU A;  4Q2M A;  1CLF A;  5DZ6 A;  1WSV A;  3R2D J;  3MUM P;  5BR8 F;  4DCO B;  3MEG A;  3BSA A;  5DG7 A;  3RAX A;  1NH7 A;  2QTW A;  2YNI A;  3I9Z A;  2KT3 A;  4LF5 F;  2LU2 A;  1CJU B;  5E5N A;  3LGN A;  1DFD A;  2P5V A;  1XMQ F;  5AE1 A;  4CWB A;  1RWO B;  1K1S A;  4PWU A;  1HMV B;  2DEI A;  3TW0 A;  1LQ9 A;  4NCG B;  4X62 F;  4A46 A;  1FX4 A;  4MKV A;  1IKV B;  2R3V A;  4WFY A;  1ZET A;  1BWE A;  2FLL A;  3GR0 A;  1M0S A;  1F5C A;  4CM0 A;  3O1L A;  3BS9 A;  4AL5 A;  1UJ4 A;  4PXE A;  1Y5L B;  2GAH C;  3O5T B;  2QZ8 A;  2MQ8 A;  3BRE A;  1A7G E;  3B6B A;  5LXR A;  2W9A A;  3NS6 A;  3DLK A;  3R9L A;  4G6V B;  4AQY J;  1Z4U A;  4DUY J;  1IKX B;  2OPQ B;  3SEO A;  2DNH A;  2FDN A;  3QIP A;  1NJW A;  4YME A;  2BKP A;  1RU2 A;  3MMA B;  2OSQ A;  2C2R A;  1S0O A;  2IAJ B;  3PY8 A;  2GJF A;  2MQQ A;  3MI7 X;  1DQA A;  5HQL A;  1VQL S;  5KFJ A;  6FD1 A;  4QIE A;  5A6W A;  3G96 A;  3UI3 A;  4O3O A;  4UY8 T;  1UWA A;  2BX6 A;  1S57 A;  3T6J A;  4B9S A;  2JC1 A;  4P2S A;  1NK9 A;  2NZ4 A;  1HBN B;  4YQW A;  3V6D A;  3W3S A;  2OML A;  1APS A;  2G2Z A;  4HL9 A;  2KZM A;  2MZJ A;  2OFH X;  2FHJ D;  3T1H F;  5J2P A;  3SDE B;  1VK8 A;  4HR2 A;  4Y2C A;  2AQ4 A;  1TK0 A;  5EX3 A;  4RW8 A;  3GPA A;  2M8H A;  2AZ1 A;  3ADA C;  4NMX A;  1KRP A;  5A8K A;  2KJW A;  3UDV A;  2KHD A;  2FJW A;  1NPK A;  2XEX A;  2APO A;  1OY9 A;  1FFS B;  4DMZ A;  1FRL A;  2ATL A;  4LR9 A;  3ETO A;  3NNH A;  1LWE B;  2ADC A;  1N0U A;  1RAE B;  2ACM A;  2F8M A;  3PW7 A;  1U2C A;  4OZL A;  2U1A A;  2MKH A;  3O6Q A;  2JFD A;  4ID5 A;  4CRJ A;  3MED B;  4Y28 C;  2V50 A;  1C0T B;  3GLJ A;  1SC4 B;  2P2C B;  5I3Q A;  2B5J A;  4NI2 A;  2PMZ D;  4QW8 A;  2D3Z A;  3AA8 A;  1WC0 A;  4HDH A;  4LF6 F;  3M9O B;  1DAX A;  1S10 A;  1Y3J A;  1VQ7 S;  3MPV A;  5CYQ B;  3HHL A;  1NSQ A;  1RAI B;  2J9C A;  1VGY A;  1T05 B;  2H3E B;  2FLN A;  4LRA A;  5LM7 E;  4IH5 A;  2ZUA A;  3EZO A;  2BDP A;  3OL7 A;  2K7K A;  4IDK A;  3CDU A;  4V19 X;  2ZE2 A;  3OXG A;  3KJQ B;  2JVR A;  4P52 A;  2P9C A;  3AFG A;  1HWU A;  2YNG B;  3FRY A;  4DZD A;  1PYT A;  2QEX S;  2C2N A;  3GFX A;  5KFT A;  3MXH P;  2YQ1 A;  4X2B A;  2W9C A;  4ELU A;  4OJ3 A;  4ZVT B;  1KWM A;  1HQE A;  1HW9 A;  1SJ1 A;  1KTQ A;  1Z2L A;  2CJA A;  4O4G B;  1HI0 P;  4A8F A;  4Q0B A;  3DNC A;  1T3N A;  3AD7 C;  1MWY A;  2YKN B;  2RT3 A;  4C7Q A;  4PYD A;  1ZTT A;  1VK3 A;  5FII A;  4FZV A;  3KHH A;  4CH1 A;  3HT0 A;  2FVS A;  4WP8 A;  3H59 A;  2MSS A;  1YI2 S;  2AZ3 A;  1SH2 A;  4R0J A;  1U1N A;  1HNZ J;  3C6U B;  1XEZ A;  1LNQ A;  1ZH5 A;  2JH3 A;  1CBK A;  4JI8 F;  4OJG A;  2C42 A;  2WRM A;  3RAQ A;  3FFI A;  2V4Q A;  2GHP A;  3QYY A;  4AT1 B;  2HW3 A;  2BVZ A;  4LBI A;  3DGP A;  3MAA A;  4LVN P;  2XSJ A;  3GE9 A;  3OW2 R;  1DUR A;  1A0O B;  2A2C A;  1U48 A;  5HJX A;  1FXD A;  1M5O C;  4N56 A;  1F60 B;  1J2V A;  3KWM A;  2ADB A;  3RBZ A;  2MQP A;  2VOP A;  2RIJ A;  1MU2 B;  5HMY A;  1TVR A;  2YNH A;  1FRK A;  4YFU A;  3ZNU A;  3PV8 A;  3AJD A;  3ENQ A;  2UXB J;  4USI A;  4ZOS A;  2Q79 A;  3K57 A;  3RW7 A;  4DUZ F;  2ZH2 A;  3QSY B;  3ZC4 A;  4URQ U;  4Z7C A;  4O3N A;  4RW4 B;  1X4G A;  2V69 A;  1IR1 A;  2FIU A;  2CZ4 A;  3DCA A;  1YJ9 S;  3L09 A;  1FJE B;  1HYS B;  5IT0 A;  4NE9 C;  2C28 A;  1PIL A;  1H2V Z;  2ZFH A;  2QLF B;  1AZS A;  4B3S F;  4QR2 A;  2ZH8 A;  3UD5 A;  5KFE A;  3TRG A;  1FDB A;  3H8Y A;  2FHM A;  3D54 A;  3CIZ A;  2HND A;  5C25 B;  1S6Q B;  3M9N B;  1N8R T;  2CKW A;  2F4F A;  3DOM A;  2M7S A;  1JKH B;  1LWX A;  3ILL A;  3M8Q B;  1U0S A;  1CUL B;  3X1L B;  3OFG A;  2VKR A;  1ZM2 A;  3HJV A;  5F8I A;  5KFB A;  3VGU A;  4E98 A;  1XNR J;  3AT1 B;  3B78 A;  3I96 A;  2H51 B;  2A10 A;  4JI6 F;  4MT1 A;  2B8Q A;  3D68 A;  2BE9 B;  1ACM B;  3FSY A;  2LEP A;  3MEC B;  3SQG B;  3LP0 A;  1GTH A;  1O6X A;  2BOP A;  4KHR A;  4EZ6 A;  3T9Z A;  1X5P A;  1LWC A;  3UPF A;  2UUA J;  2RKI B;  2HQI A;  3A8J A;  4MIB A;  3KNA A;  2I9S A;  3NLC A;  4OJH A;  2YKQ A;  1XWL A;  1WKK A;  1SV5 B;  1SJR A;  1LEO A;  2D69 A;  1VC0 A;  2AYB A;  4PKD B;  2KRB A;  2G9O A;  3SCK E;  2CJX B;  2ZDO A;  3H20 A;  1VRT A;  1X4C A;  1BD6 A;  3PHT A;  2DKO B;  3CCE S;  1S79 A;  3OL6 A;  3I32 A;  1RTJ B;  3VAI A;  2Q6C A;  1P9Y A;  2V4J B;  1LXN A;  1LFP A;  1XQI A;  4OYM A;  3TJA A;  2LQB A;  4MFB B;  3W8P A;  4ZVO B;  3NCP A;  1PJ7 A;  4WU3 A;  2OMO A;  1VBX A;  3I0S B;  2WVE A;  2VIC A;  4UUX A;  4I7F A;  2A18 A;  2KG0 A;  4YB5 A;  1D9D A;  3CJS A;  5KTQ A;  4YP3 A;  1JLE B;  2UUC F;  3NBP A;  1RT5 A;  1GAO A;  4CYU B;  1F2G A;  3M32 B;  3ZTO A;  1VRU A;  2ROE A;  4ZVG A;  2MQM A;  3DLB A;  2MKY A;  1XNQ J;  2DR8 A;  1J5E F;  3LWM A;  2QN6 B;  2GGP B;  2AGO A;  2HMI A;  1HD1 A;  2E1R A;  1H7X A;  2V63 A;  1VOM A;  2M3D A;  4F67 A;  2W4P A;  2J6U A;  3DRR A;  4RKU C;  3N01 A;  1VQ5 S;  3VGS A;  2IRU A;  5LMU F;  1Q82 T;  1GH8 A;  3TX0 A;  1B99 A;  3EM1 A;  1N5S A;  2LLZ A;  1TMJ A;  1X4D A;  3TA0 A;  1RZM A;  5KFF A;  3CCU S;  2GVZ B;  4ZP8 A;  3GR1 A;  4QIF A;  4RZR A;  4LBP A;  5KT4 A;  1ZPW X;  2RDD A;  2I0X A;  2FHO B;  1CJK B;  2Q66 A;  3UN5 A;  4DR3 F;  3T19 A;  1L3K A;  1TL3 B;  4V19 J;  4DV6 J;  3OUY B;  3DOK A;  1NLK L;  2MPU A;  2FZC B;  2J6T A;  2RS2 A;  2J9D A;  2DRA A;  4OX6 A;  3QRQ A;  1N5Q A;  2YXL A;  2LQ5 A;  3RRH A;  3G4S S;  2HKE A;  3G82 B;  3GSI A;  3R5A A;  3HF5 A;  1F0X A;  3ONQ A;  1ICE B;  4IRC A;  1TKT B;  1Q7L B;  1HNX J;  4Y6I A;  1YKW A;  4F2S A;  3OFH A;  2QYG A;  4TY9 A;  3KHG A;  3IBF B;  1ZZN A;  5ETN A;  1M5V C;  4FN5 A;  5CQG A;  2B9W A;  2K2P A;  2HVD A;  4O4R A;  4DV7 F;  1HNI B;  2CQ0 A;  2HRT A;  2X7I A;  3CW2 C;  1QAI A;  2I5J A;  2ZEJ A;  3MM5 B;  3P3D A;  4CLK A;  5KFH A;  1WF0 A;  2GIR A;  1WOP A;  1ZPV A;  2B4V A;  2IC3 B;  1NK4 A;  1OMS A;  2FGC A;  4ZVE A;  2LFV A;  4AXI A;  1IR0 A;  1RYR A;  4FDF A;  2LA6 A;  3IS9 A;  1RWW B;  3FZ2 A;  4NEZ A;  3IWL A;  2EK6 A;  2Y1R I;  4CZC A;  3KLG A;  2DR9 A;  1NSK L;  1X8D A;  3AJ1 A;  2KXH A;  2DIU A;  4TQS A;  4ES1 A;  1RYS A;  2IFX A;  2HUR A;  2WB4 A;  2LQ8 A;  2JFK A;  1HBO A;  1YJR A;  5D0R A;  5HO4 A;  1R89 A;  1HW8 A;  1LOU A;  2BW2 A;  3VR1 A;  3MM6 A;  5DQG A;  3IR7 B;  4EWT A;  1WEZ A;  4K4Z A;  3N6M A;  3OLA A;  2CYY A;  2E9R X;  4XPC A;  2EW9 A;  2PE8 A;  4WE1 B;  2WAQ D;  2CJ9 A;  4Y0F A;  3GU0 A;  1DZ5 A;  1S1V A;  2VQE J;  2N7C A;  1K0V A;  3R1H A;  3PG9 A;  3LA0 A;  3IRX A;  2P9E A;  4HH1 A;  1DTT A;  3FCW A;  3K59 A;  5IWA J;  2A6M A;  5KFZ A;  2J8A A;  5D0E A;  2CXE A;  3UN3 A;  3ZZR A;  3T5K A;  4X4R A;  4WWS A;  1MMD A;  3FQL A;  4CTA A;  1U47 A;  1RDR A;  4DV2 J;  3PHE A;  2BJE A;  3MEG B;  1NM2 A;  1U1Q A;  1JJ4 A;  2K3K A;  3GFZ A;  3P8B B;  4DF4 A;  2YNI B;  5ITH A;  3DKD A;  4FF2 A;  5DZ7 A;  3H5Y A;  4WXO A;  2CVE A;  2ZWO A;  2D74 B;  3O2I A;  2AYE A;  3DFE A;  3PDN A;  3OV7 A;  3TZW A;  1ZAW A;  4DV4 F;  2D3O 1;  2ACY A;  3WC2 A;  5K14 A;  2HWT A;  1PAU B;  3U1M A;  3NP5 A;  1IJE B;  3BGO P;  1S1W A;  3UR0 A;  4CT8 A;  3PYG A;  4UOF A;  2KL8 A;  4QQB A;  1KQG B;  4LFC J;  3DYA A;  1V9O A;  1SQF A;  2E7W A;  2J0S D;  4P7T A;  4U9R A;  2XSF A;  3KK1 B;  2NSB A;  4NLS A;  4K4T A;  3PO4 A;  4KGZ B;  1U1L A;  1IR2 A;  4RLE A;  1Q53 A;  3H2V E;  2F8E X;  1DY3 A;  4UUW A;  3DLK B;  3TO8 A;  3D2W A;  3DXB A;  2GZO A;  4P71 A;  1R8P A;  2OSR A;  2EKN A;  3S1T A;  3QIP B;  2NR0 A;  3TUI C;  2HGN A;  1FE0 A;  4KQZ A;  5F8M A;  1SC1 B;  5A8R A;  4OHZ A;  4FKX A;  3N6N A;  5DM7 Q;  3PNI A;  4DR1 F;  2G2O A;  3IA0 A;  4B3T F;  1HNV A;  5CAA A;  1JXV A;  4PCQ A;  4M95 A;  1Q0N A;  3NAI A;  3GB0 A;  1HR0 J;  4Y2I A;  3OVB A;  3V5R A;  2V2Q A;  3D28 A;  2DGW A;  4H4K A;  3I55 S;  5CD4 H;  3PKY A;  4YN3 B;  2F1F A;  3V6J A;  3CC2 S;  3AD8 C;  1WOR A;  4ES2 A;  3M8S A;  4K4S A;  5J2P B;  1SH0 A;  1ZYQ A;  4OI3 A;  1SKU B;  1WI6 A;  1VIX A;  3P4U B;  4BHQ A;  5KFU A;  4LSZ B;  1DAR A;  4RW8 B;  4HI2 A;  3W64 A;  3NKY A;  5A8K B;  4UOG A;  2O5D A;  2DNO A;  4CH7 A;  3PR5 B;  3KK3 B;  1IBM F;  1R8C A;  3C8Y A;  1H7W A;  2BOA A;  2ZJR Q;  3U1L A;  2HGM A;  3RB0 A;  3HFV A;  5JXS A;  5DDP C;  4UY8 5;  3FEZ A;  3GTY X;  3D6H B;  1U1K A;  5U47 A;  2OIH A;  3UD3 P;  2H5E A;  2RE1 A;  2XYG B;  2ILZ A;  1SQG A;  2WBM A;  3OFF A;  3EPG A;  2E5H A;  2C3Y A;  1Q95 G;  2HVZ A;  1HFE L;  4NI2 B;  2W7A A;  2JEF A;  2WW8 A;  1C2P A;  3UN2 A;  1S76 D;  3VAJ A;  2MHE A;  3S6E A;  3NG8 A;  4C11 A;  1DTQ B;  2XHW A;  2QLW A;  3EGZ A;  1WUU A;  2R2T A;  5HP1 A;  1Q5Y A;  3H42 A;  2IMW P;  2C2K B;  2ASL A;  4DPY A;  4FYD A;  4IDK B;  1F3F A;  3I4H X;  3D0I E;  4B3R J;  1U24 A;  1JLF A;  3TP2 A;  1JLA A;  1HI1 A;  4NAS A;  3BBB A;  1B70 B;  2J8S A;  2VHG A;  2EBE A;  1Y11 A;  2LYV A;  3QT7 A;  3QJP A;  4A4J A;  3E01 A;  3M2R A;  1QY7 A;  1RT3 B;  5KT3 A;  2Y0B B;  5F8L A;  4Q0B B;  1BHN A;  3IGN A;  1ULR A;  2DXE A;  3CT9 A;  5HMX A;  2QE5 A;  3RB4 A;  1S6U A;  2NCK L;  3DLG A;  4K2X A;  4LMZ A;  3TVK A;  4PPD A;  5DLG A;  1W2I A;  3FDS A;  4I64 A;  1NME B;  3OFE A;  5D4N A;  4IQM A;  1QAY A;  4ALZ A;  4HHJ A;  1TK8 A;  3JXO A;  5D3G A;  4OIX A;  3UDL A;  1FFG B;  3R8Y A;  4X65 F;  2B4P A;  4RO0 A;  1QDU B;  5I42 A;  3THT A;  1HLW A;  3MM7 B;  1S1U A;  1U09 A;  4ECQ A;  3FFI B;  4DV1 F;  1P1L A;  3FGV A;  1JLC A;  1U0H A;  5KG7 A;  2BUN A;  3DGP B;  3MAA B;  3LTO A;  3EDR B;  1REG X;  3DN9 A;  2DNR A;  2NRE A;  2IM1 A;  3C15 B;  2F7V A;  3MTJ A;  4OYI A;  3JYT A;  2OI2 A;  3BN4 A;  4OZJ A;  4DFM A;  3RRK A;  4DPU A;  4TY8 B;  1BQN A;  1I5O B;  3BN7 A;  5L38 A;  1Z1Z A;  4YEA A;  1IJF B;  3SSR A;  2PI5 A;  5KOW A;  2YNH B;  4ZLJ A;  5KOX A;  2J0Q D;  4GO5 X;  3TWZ A;  4WYW A;  4ZPA A;  1H2T Z;  3IC1 A;  2NXC A;  4KH1 B;  1MLA A;  1YVF A;  1N52 B;  4OJ1 A;  3I5B A;  2SXL A;  2RNE A;  2OEM A;  4K59 A;  2RML A;  4FYX B;  2Y1I A;  3R5C A;  4M8L A;  3I0R A;  3J81 U;  3H4D A;  1HWI A;  1Q79 A;  1TFW A;  3SIP B;  1AZS B;  1N0V C;  2AJ1 A;  3Q8Q B;  1SKR A;  4ZMM A;  3AOA A;  5E3P A;  3DU5 A;  1K73 T;  4NLQ A;  2HHT A;  1NO8 A;  3RBX A;  4C3M A;  5LXY A;  1YRU A;  3DOM B;  2DYA A;  4DN9 A;  2AGQ A;  2F65 A;  3G8T A;  3WC0 A;  3C2P A;  2B6A A;  1P9Q C;  4J9R A;  1HBU A;  3AXM A;  1OPZ A;  5KFX A;  5K8P A;  3KLE B;  5EGY A;  2ZKU A;  2U2F A;  1H98 A;  2VQF J;  4WP3 A;  2D1C A;  2YX7 A;  3LP0 B;  2PN6 A;  1KQS R;  3UE2 A;  1SQE A;  3BPD A;  2ROG A;  1FXL A;  1LWC B;  3CED A;  2A3J A;  4I6A A;  1RAD B;  1RHK B;  2COL A;  2P8I A;  1V3Z A;  3OTO F;  5HLF B;  2HFO A;  4OX7 A;  4Y65 A;  3BQ0 A;  1HNW F;  3UO0 A;  3MMC B;  3MD3 A;  2EXU A;  4PEO A;  2ZOF A;  4WU2 A;  2AJ2 A;  1SJ3 P;  4ENO A;  3G6X A;  1M1K T;  2YWH A;  1PKU A;  2KZZ A;  3HCX A;  4Q8F A;  1AFJ A;  4HVZ A;  1KOO A;  3JTO A;  5B0G A;  1HQU A;  1VRT B;  2VOD A;  2CQG A;  4J9M A;  2QA4 G;  4DEZ A;  2ZVI A;  3MR7 A;  3R3T A;  4C8O A;  1S49 A;  5DDQ C;  1T94 A;  3HKW A;  1NHV A;  1S97 A;  4DOZ A;  1RHM B;  1RI7 A;  3LGH A;  4P9S A;  1QUP A;  4X66 J;  4JYA F;  4PZV A;  4RNN A;  4F8R A;  2MDA A;  3IBC B;  1AT1 B;  1TKZ B;  1L3T A;  1I1G A;  4NYZ A;  4CLW A;  1OIA A;  4HAC A;  1GXT A;  2G2Y A;  4KB7 A;  5L46 A;  4CO3 A;  4MTP A;  4I7F B;  4I68 A;  3OXL A;  3W2V A;  5FDL A;  2LXI A;  3NBP B;  3L9Z A;  3NL0 A;  1FNX H;  3BH7 B;  4DL0 C;  2BRK A;  1YJN S;  4KFB A;  3MEE A;  2WW4 A;  3D5M A;  3U1N A;  1LK5 A;  2XUL A;  1ZAV A;  3DLE B;  4UT4 A;  3RU0 A;  2WVB A;  2HMI B;  3HPO A;  2I2Y A;  2MZT A;  3KDO A;  1GMW D;  1IQZ A;  2XS5 A;  2DD8 S;  1XN9 A;  4KKO A;  4ZVR B;  3HM9 A;  2D41 A;  3DRR B;  1R0C B;  2B43 A;  2RU3 A;  2V8P A;  2QMU B;  2IVF B;  3RBD A;  1SC3 B;  4P2M A;  3ZZU A;  4CLT A;  2ZKT A;  2NSC A;  2G1H A;  2UVR A;  3D7S B;  4XDD A;  3V81 A;  4WXW A;  2OEL A;  4MMO A;  2DIV A;  2IJR A;  2FHK A;  2KG1 A;  5KFK A;  4IO1 A;  1TEL A;  4ANC A;  3LF0 A;  3CB4 A;  1GFW B;  2AP6 A;  3DOK B;  1HNX F;  3SV3 A;  4EFA C;  2E5L J;  1WD6 A;  4NLV A;  3BSO A;  2Z58 B;  4ICL A;  4LBH A;  2CFX A;  1K1Q A;  3PW5 A;  3FMW A;  2QJ3 A;  1TTH B;  1KS2 A;  3D66 A;  3OJU A;  4P6Q A;  5DDR C;  4DR6 F;  4OYB A;  4XTT A;  2AJ4 A;  4WZQ A;  4GKK J;  4JV5 J;  2EVZ A;  1UWB A;  1KLN A;  4ZVH A;  4EMD A;  1OWX A;  4OV1 A;  1X9S A;  4WBF A;  2IHR 1;  2BE2 A;  2KHC A;  3FBB A;  1EET A;  3PRV A;  4LF8 J;  1NHU A;  1M1G A;  3KYL A;  3DRY A;  1IM6 A;  4RBT A;  5J2M A;  3KLV A;  3MHY A;  1UJ5 A;  3HHE A;  2XB2 D;  1Q1K A;  4IH7 A;  3P6Y C;  3VAK A;  1R0A A;  1KVI A;  3PJX A;  1V5V A;  1HBM B;  3C6T A;  2XY7 A;  2C2M B;  3IS9 B;  2AHO B;  4F4K A;  2OLW A;  4LF4 F;  1Q86 T;  1X31 C;  1Y7P A;  2DGT A;  1CEZ A;  3KG1 A;  2Z30 B;  3ZTQ A;  2WSC C;  4ZVF A;  3TYT A;  3IAS 9;  1S0M A;  4V1A k;  3HUL A;  2WON A;  1HBO B;  1FFW B;  1U1O A;  1VQ8 S;  3HFZ B;  4QR1 A;  3M4X A;  3SCI E;  4GVB A;  1X9M A;  3MM6 B;  1EZZ B;  1UA1 A;  5C2C A;  7AT1 B;  3P49 B;  3BF4 A;  2MEW A;  2V8G A;  2M8D B;  4FF1 A;  5CCL A;  3ZZ0 A;  1S1V B;  4JI7 F;  1BC6 A;  1QE1 B;  3IRX B;  1R6V A;  1UA0 A;  1DTT B;  1S9G B;  5DQH A;  4DR5 J;  3JTP A;  3PR4 A;  4Z7Y A;  3HSG A;  1KEK A;  3PW2 A;  1O0P A;  1RT4 A;  2XLK A;  2ZBQ A;  2VPW B;  4CTA B;  3IFE A;  4DXL A;  3HKZ D;  2UXC J;  7FDR A;  3OVS A;  3M6W A;  3I31 A;  3QZ7 A;  3S01 A;  2ZHO A;  2ZM6 F;  5F8H A;  1FE4 A;  4RUC A;  2KRR A;  2F63 A;  4C3K A;  2UUW A;  4UTG A;  4DL4 A;  2HHH F;  2DGX A;  3F41 A;  3CCW A;  4LSN A;  2MLX A;  3LO3 A;  3HZE A;  4LQ9 A;  5E0O A;  1RHJ B;  3BR8 A;  4IFV B;  3MPY A;  1VI7 A;  4OFZ A;  1HMV A;  3K2Y A;  4JBC A;  5ETM A;  2O1P A;  2HFU A;  1S1W B;  3IR5 B;  4DR2 F;  2FY8 A;  2HGL A;  3PYF A;  5ETS A;  1RWN B;  2LA4 A;  4HEA 9;  3JSB A;  5MAO A;  5F0W A;  1N54 B;  4IRD A;  1SIW B;  4QIV A;  3DYA B;  4I1T A;  4IO9 Q;  3HVT B;  1B0T A;  2YNF B;  5ETV A;  3EGN A;  3DU6 A;  2ALY B;  3QT5 A;  1N36 J;  2R2U A;  2EC0 A;  5E33 A;  3MCS A;  3Q2S C;  2Y9H A;  3MR5 A;  1T8E A;  2GX8 A;  3MMB A;  2ZJQ Q;  1RK8 A;  1RT6 A;  2DR7 A;  3V6K A;  1NDK A;  1OSD A;  1NHK L;  5EWE A;  2QL5 B;  5A8R B;  2ROP A;  2V2V A;  1BXN A;  4J9V A;  3MMA A;  4NLT A;  2EFV A;  4PWD A;  1ZA2 B;  4M5D A;  3KLH A;  3MR6 A;  1M5P C;  2BA9 A;  2G4B A;  2V67 A;  1KFS A;  4E2F B;  1HNV B;  4LFA F;  4ILR A;  3G6Y A;  2BMB A;  4FP9 A;  4TKT A;  2AEJ A;  2XM3 A;  2E44 A;  2LDY A;  3A3O B;  1NAQ A;  3OTE A;  5JJB A;  4DV3 J;  2D3O R;  2EFG A;  3FCH A;  5IV3 A;  1WC5 A;  2HAI A;  4RX6 A;  1RHU B;  1RLD A;  4UQT A;  5JMN A;  3DDK A;  4GC7 A;  1NZA A;  1UP1 A;  3BYP A;  3VQS A;  1WG5 A;  4ED4 A;  2E1A A;  2C2E A;  3HHL D;  5LSO A;  2LQJ A;  3JAM Y;  4U8V A;  2HS4 A;  2M4M A;  1EAY C;  2I8E A;  2XCA A;  2HIQ A;  1P1T A;  4Z37 A;  4Q8E A;  3AB4 B;  5KFA A;  3PIO Q;  2EI5 A;  3ZTR A;  1YJT A;  2RAQ A;  1HIY A;  3TAN A;  4EGL A;  5IOL A;  3QAU A;  4PXB A;  1RAH B;  1WKJ A;  4UW2 A;  4B17 A;  2ZBR A;  4WKY A;  3MCO A;  3M9M B;  1Q8B A;  4H4O B;  3N79 A;  1RAB B;  3GV5 B;  4TU9 A;  3KNG A;  2W25 A;  5KG0 A;  2KKH A;  5HI7 A;  1BY9 A;  5B0C A;  2PT0 A;  3Q86 A;  1BQM A;  1JLQ B;  3MCN A;  1MWZ A;  2ZNY A;  4IFY B;  4D3H A;  3FK4 A;  4C11 B;  4B3M F;  5HP1 B;  3DOL B;  5CYQ A;  1JLB B;  3GYG A;  4CO1 A;  3MFI A;  2DNQ A;  1C0U B;  2YKO A;  3BGU A;  5G0R A;  1F1B B;  3I87 A;  2IM0 A;  3JSY A;  5KFM A;  1F2H A;  1RWP B;  4K8R A;  2EFP A;  2ZDP A;  1JLF B;  1JLA B;  3HJF A;  3DC2 A;  2DHG A;  3M30 B;  1UEV A;  4MYT A;  2IM2 A;  4RU2 A;  2YNG A;  3QZ8 A;  2BAN A;  1IWG A;  2XO6 A;  3SCJ E;  4WII A;  1NK8 A;  3MM9 A;  4LF7 F;  3BO2 A;  2HK2 A;  3E01 B;  2DHS A;  3CC7 S;  2HVH A;  1WJ9 A;  4DQR A;  2HQF A;  2BAB A;  1AUS L;  4ZPT R;  3SSS A;  2YKM A;  3SSQ A;  4OYP A;  4Q5V A;  2N82 B;  2OKQ A;  3DLG B;  1YIT S;  5CZV A;  4DPT A;  2YQ3 A;  4U8Y A;  1VRQ C;  3IM9 A;  3TI0 A;  3B54 A;  2CNN B;  1HL6 A;  5CA5 A;  2IJF A;  4LF9 J;  5F9N A;  2JDJ A;  1I6J A;  1KR4 A;  1K9M T;  3HP6 A;  4A8Y A;  2XI3 A;  2MZ1 A;  5L9N A;  4JV1 A;  4DSJ A;  2LCW A;  3M7V A;  5E3R A;  2Z0G A;  2XMW A;  3VTI A;  2YVS A;  3MPU B;  5A2Q Y;  3LPY A;  1FTR A;  2GHW A;  2C2O B;  2CUY A;  1H72 C;  2OUG A;  3RG6 A;  4ZCL A;  5I42 B;  2VUG A;  3BGF A;  1RWX B;  1JLC B;  4B9L A;  1KLM A;  2M2B A;  4EYH B;  3OBI A;  3QNW B;  1R8H A;  2Q1L A;  4KJI A;  3ISN D;  5F8N A;  2H65 B;  3D6F B;  2KYX A;  4WJB A;  3PXG a;  2V6A A;  4QYR A;  1BQN B;  3ZTP A;  1T9T A;  1ZS6 A;  3CD0 A;  1MU2 A;  2VJU A;  4MKA A;  4WK3 A;  4EI2 A;  3PW0 A;  4J9O A;  4WFN Q;  1FK9 A;  1PIE A;  3WDO A;  1Q8I A;  1WEL A;  1VR6 A;  2BXJ A;  1RP5 A;  1Q8L A;  3TUZ C;  1N6Q A;  2QGF B;  1VQP S;  4GKJ J;  5BXI A;  4FYW B;  4FXD A;  3EVO A;  3W5X A;  1FRJ A;  4RW4 A;  2A0F B;  1EQM A;  2XTJ P;  3AD9 C;  2KM8 C;  2Z56 B;  3Q8U A;  1RGV A;  1IBC B;  2V4R A;  1U8W A;  1NUE A;  2AYG A;  4NYP A;  3Q8R B;  2C3M A;  4MK7 A;  3JTN A;  1KHV A;  3KXD A;  5EX0 A;  5C25 A;  4ZIV A;  4NLP A;  2HZC A;  1RCX B;  1YLX A;  3T9N A;  4RW6 A;  3MD1 A;  2FC9 A;  2ZOM A;  2CG4 A;  1V3R A;  3DLL Q;  1MW7 A;  3ENV A;  4EO6 A;  3ET6 A;  5ETT A;  3ZNJ 1;  5CYJ A;  3CME S;  3LOU A;  2XLI A;  3G6V A;  4FPI A;  2QFJ A;  5E2Q A;  4Q45 A;  2HBZ B;  3QQC D;  3DRS B;  1YJV A;  3EJM A;  3ISZ A;  3W65 A;  1CS4 B;  1OS5 A;  1HI8 A;  4OYZ A;  5HQM A;  4NLY A;  4RR5 A;  3CD6 S;  4BS2 A;  1PSD A;  4E0D A;  4U7U D;  1WF1 A;  2JX2 A;  5CYM A;  2ZJP Q;  2GA7 A;  3OTD A;  3MFH A;  1N32 J;  4URG A;  2X1B A;  3WQP A;  4JI5 J;  2LVW A;  1KP6 A;  2IIH A;  2PD1 A;  1ZBT A;  1JMT A;  1HAR A;  1RTZ A;  5AXN A;  4DJB A;  4X66 F;  3PRB A;  2AEM A;  2OFG X;  4MKB A;  3VAF A;  4EEY A;  2G13 A;  2CQ2 A;  2F40 A;  1RAC B;  1WSR A;  4J5O A;  3QSI A;  3M6X A;  2N3O A;  2Y0S D;  2X1G A;  1FJG J;  2NLW A;  2AX0 A;  2OPR B;  2K06 A;  4OMF G;  2DJW A;  2E1M C;  3R5G A;  2MZR A;  4HAC B;  4TXS A;  2ASJ A;  4LUB A;  4CT9 A;  4WTY A;  4NRT A;  2OD6 A;  3D67 A;  5M2U A;  2IVY A;  3EZ5 A;  1VHI A;  2GMH A;  3D1Q A;  1Y00 A;  2V5H G;  3IO1 A;  5EDW A;  4W4M A;  4O3P A;  4CO2 A;  3QJL A;  3GIM A;  4CYU A;  1T95 A;  2FY1 A;  1WC4 A;  1OQ3 A;  3MEE B;  4G65 A;  2DR6 A;  2OPS A;  2AWZ A;  3L7P A;  3M1V A;  3Q0A A;  4QR0 A;  4A47 A;  5D4O A;  3J7A 1;  4IH6 A;  2GGP A;  2L08 A;  3A13 A;  4DSF A;  1CJV A;  3CWJ A;  1T9X A;  1C1C A;  2R4F A;  4KKO B;  2Y1J A;  3PO5 A;  3B4D A;  2CAJ A;  4NZ6 A;  3P5T L;  5L9X A;  1JK9 B;  3QWU A;  3GSD A;  3VAM A;  4NA3 A;  3PYE A;  3AXK A;  2V8H A;  3RUB L;  3AHP A;  2XZT B;  1S77 D;  3VAG A;  3UD4 P;  1N33 J;  1WKL A;  4RNM A;  3RB3 A;  3V81 B;  5BYS A;  3MF5 A;  1IKY A;  2E5L F;  1NDP A;  4C0H A;  2Y8W A;  4O44 B;  4FYV B;  1IKW A;  4NXM J;  1JJH A;  1MML A;  2HVI A;  2DNK A;  1UTA A;  1CVJ A;  5KFL A;  4DSL A;  4NLX A;  1VJW A;  4KE5 A;  5IT4 A;  2ZH6 A;  4BDP A;  2GVD A;  2IRX A;  3X3U A;  3VZI A;  1FNO A;  2GQC A;  1TZ0 A;  4XPE A;  4DV5 J;  4QZV B;  1YG0 A;  4ICL B;  2VZ9 A;  2L3M A;  4LJM A;  3R27 A;  1FJ7 A;  2QIF A;  5C42 B;  2YWK A;  1TKT A;  4LFB J;  2JRS A;  4NXN J;  3JQJ A;  4JV0 A;  2HVE A;  3GIR A;  1UW4 A;  1UWB B;  3N5B A;  3SFG A;  4WFA Q;  1YK9 A;  4FF4 A;  1Q4R A;  1C4A A;  1GMV A;  1VJQ A;  2O3D A;  2HYI B;  1HNI A;  2BE2 B;  2XG8 A;  1T02 A;  2NPF A;  1EET B;  1O51 A;  3ITH A;  5IC4 B;  4ID8 A;  4X4N A;  5J2M B;  4RUA A;  2IC3 A;  5DGA A;  2MYF A;  3QT8 A;  2CWK A;  5IT9 Y;  1R0A B;  3C6T B;  4JI0 F;  1H3D A;  2YY3 A;  3TVY A;  1VS3 A;  4XDC A;  3UWT A;  4X64 J;  3SQO P;  3J81 j;  4MYU A;  5ETK A;  4B9V A;  2PFD A;  4PXC A;  3CO0 P;  1FRI A;  5L1J A;  5B0A A;  4LRD A;  3PFO A;  5HQ8 A;  2PC6 A;  2X3D A;  4FXV A;  1JJ2 R;  5J2N A;  1NBE B;  4GRS A;  2VOO A;  2HHS A;  3LW5 C;  3VZH A;  3NRB A;  3G71 S;  3CJT A;  2ZZN A;  3HD2 A;  4OX9 F;  3Q8S B;  3PKM A;  4X4V A;  5K20 B;  3J80 Y;  2UXD J;  1PBA A;  2Y1L B;  4OQJ A;  2IBK A;  3QAE A;  1RT4 B;  3VCD A;  3AOD A;  4OI1 A;  2A6O A;  3QGH A;  4A8X A;  2OP5 A;  1FWL A;  3W2W A;  1XC9 A;  4I2P A;  2DBB A;  3IXQ A;  3K5N A;  3RR8 A;  2QV6 A;  3TJ8 A;  3GG1 A;  5JUM A;  4FYY B;  3GV7 B;  3H98 A;  4LSN B;  2HBY B;  4OYX A;  1PO6 A;  2GNK A;  4QWE A;  4PQU B;  1YRT A;  1MNE A;  2DPI A;  1B4S A;  3BPS P;  1N88 A;  1K47 A;  2HIY A;  5D77 A;  2GIF A;  2DVI A;  2WOM A;  4DX5 A;  2FJX A;  1X0P A;  2XMT A;  4PG8 A;  3A8E A;  3FSI A;  2BJ1 A;  3QID A;  5M2P A;  2PI4 A;  2CPX A;  3TEG A;  4Y3C A;  1XMO J;  2HWH A;  1FKA F;  4QU6 A;  3KK1 A;  5ADZ A;  3DHX A;  2J9E A;  2MLY A;  1KN6 A;  2F3J A;  3I56 S;  3MMB B;  4HH0 A;  1L3V A;  1RT6 B;  3CCQ S;  1QUV A;  4JI2 F;  3DXS X;  1OQ6 A;  2UUB F;  4ECV A;  4HDG A;  4QCL A;  4X4U A;  2FD2 A;  4QPT A;  5DQI A;  1GEH A;  5DLF A;  4OYO A;  1EIY B;  4I6W A;  1BLU A;  4LR8 A;  1M5S A;  5EWF A;  3A12 A;  4CO4 A;  4PWD B;  4DU7 A;  2M5Y A;  4M5D B;  3KLH B;  1G7C B;  1Z2Z A;  1T9Y A;  2V34 A;  1NK0 A;  5J2Q B;  3DLH A;  2N3L A;  2XMJ A;  2C3U A;  3FEX B;  3K17 A;  1TUW A;  2BJ3 A;  1IBL F;  5KFN A;  4A8O A;  1RQ0 A;  4L73 A;  2R7V A;  4YR3 A;  1H73 A;  1JIH A;  4YHH J;  4ZVS B;  2POK A;  4FVM A;  3D0H E;  1J27 A;  1RT2 A;  4NLW A;  5BYQ A;  3EXC X;  3M2V A;  1PC4 A;  2KYZ A;  3KK3 A;  5A76 A;  1SPB P;  4YB7 A;  2GMJ A;  2HNY B;  5T7L B;  4AFF A;  1GX6 A;  4OZ0 A;  4OL8 A;  1YBA A;  4OZ3 A;  2HBQ B;  1NH8 A;  5CAB A;  2CPF A;  4LF5 J;  4MK8 A;  2J9D E;  3WBZ A;  3KTQ A;  3GZ7 A;  1KON A;  1XMQ J;  2UUT A;  1BQM B;  2VPY B;  1WC3 A;  3EGV A;  4RJV A;  3UFC X;  5D4P A;  5LL6 d;  3PX0 A;  2DNG A;  4X62 J;  4C48 A;  1VIS A;  4RBU A;  1FRH A;  4USU A;  2AEF A;  4CLS A;  1BGX T;  1DTQ A;  1HD0 A;  3MPD A;  1X7V A;  4I0W A;  4RW9 B;  4F4X A;  2M88 A;  2F9D A;  2VIH A;  1EQ0 A;  1X9W A;  2M0G B;  5G0R B;  3HHD A;  5LMN J;  3H25 A;  4JI4 F;  3MWB A;  4J9K A;  5H9F K;  3TAM B;  3W5Z A;  3DRX A;  3KUG A;  1F9F A;  1W26 A;  3T5J A;  2VG7 B;  4K50 A;  9RUB A;  2D9P A;  2BAN B;  3SZ2 A;  1ZAX A;  3Q2T C;  1EP4 B;  3MM9 B;  4ANE A;  4DDF A;  1R6Y A;  1HWJ A;  2V9K A;  2RU9 A;  2HHQ A;  3RTV A;  1U8S A;  2KO1 A;  4G1P A;  2HG4 A;  1RT3 A;  4QPX A;  3ZZO A;  2K1R B;  2YKM B;  4NLU A;  1RAO A;  4XO0 A;  4ZVQ B;  4TQR A;  5THW A;  3JQM A;  3ILJ A;  2KXF A;  4C0B A;  3NOC A;  3EVW A;  2IM3 A;  4ZA1 A;  1IBK F;  4KGX B;  3U27 A;  4HHH A;  2BJ8 A;  4HTI A;  2MMY A;  3T1H J;  4CI0 B;  3HDS A;  1NKB A;  5F41 A;  2RRB A;  4DV0 F;  2HHP A;  1N34 J;  3K8V A;  5KFC A;  2NUU G;  5L1I A;  1CQN A;  3NGK A;  1N4L A;  1JNZ B;  3MM7 A;  3H4B A;  2HBR B;  1FF2 A;  1KLM B;  4DL6 A;  3G2X A;  2VBX A;  1TL1 A;  1DJ0 A;  1ZA1 B;  3LWL A;  4RUH A;  4KSE B;  3TA2 A;  3C15 A;  2AJQ A;  2KFY A;  4GKJ F;  2VFT A;  4TY8 A;  4F0M A;  3Q8Y A;  5MLC V;  2X3G A;  5IM0 A;  2GQQ A;  2MGZ A;  2AV5 A;  2ALZ A;  1FK9 B;  4X84 A;  1SL2 A;  4ES3 A;  2RJZ A;  1N6Q B;  1Q8K A;  3QBC A;  4LF6 J;  5AJ3 F;  3BSN A;  2XWY A;  4N41 A;  5AT1 B;  5HAO A;  2AMC B;  1VBK A;  2RD5 C;  2CZV C;  1OYD A;  2J5A A;  3TZY A;  4ZCI A;  1Q5V A;  3I82 A;  3NWG A;  5A6P A;  2NYH A;  4WZM A;  3HZG A;  4F50 A;  3CMQ A;  5D0H A;  5K8O A;  1S4F A;  4U7U K;  4F0K A;  2DT9 A;  2BKO A;  2XBP A;  1WTB A;  5B7W A;  4WFX A;  2HQ3 A;  2YPZ A;  2UP1 A;  1T0T V;  1KNZ A;  1KBR A;  1R31 A;  2J7U A;  4C8K A;  2FJA B;  4ER8 A;  3OT9 A;  4RW6 B;  2FVC A;  5HVH A;  6AT1 B;  1VQ4 S;  4LQ3 A;  2F4V J;  3ET6 B;  4P7V A;  3TAR A;  5FD1 A;  3TA1 A;  4PWW A;  1D9F A;  2RVJ A;  1RE1 B;  4R5P B;  3HVW A;  4M5N A;  1J5O A;  3KLE A;  4I56 A;  2CNL B;  2DNY A;  2DO0 A;  3AB2 B;  4OX8 A;  2GFF A;  3TEH B;  3RB6 A;  4DPO A;  3K5O A;  3ZXW A;  3CIM A;  2EC2 A;  5CYM B;  5LJ5 Y;  1YIJ S;  4IR9 A;  1YJ7 A;  2HRU A;  2HLT A;  1NRK A;  5G4D A;  3PRD A;  4FPR A;  3NS7 B;  4XAK A;  2R42 A;  2E66 A;  2W2Q P;  2H48 B;  3ENA A;  5HLF A;  4KPC A;  1SIZ A;  4IG0 B;  4MJK A;  4TYA A;  2E9Z A;  2YWF A;  3MMC A;  4JI8 J;  4PG4 A;  2O01 C;  1NCL A;  4BC7 A;  2W2N P;  1FDN A;  2ZC4 A;  1SI9 A;  1ROF A;  2W7P A;  4X4P A;  2OPP B;  3RRG A;  3U7J A;  4B3O B;  3TZX A;  5AXL A;  2ZH1 A;  2AW0 A;  3DRP A;  2PA3 A;  1YDL A;  3POT B;  1N48 A;  4K4X A;  3R5B A;  4DR4 F;  1XTZ A;  2OJ3 A;  2FYX A;  2DNN A;  1TKZ A;  4PPZ A;  2VG6 A;  3BH6 B;  2WB1 D;  5L8R C;  1VQO S;  4YY3 F;  2YH0 A;  3CNQ P;  1NKE A;  4K4V A;  2HPU A;  4DUZ J;  3BBF A;  4ILM A;  1NZ8 A;  3NWR A;  4MIA A;  3KG4 A;  2W9B B;  1PYO B;  2OPS B;  2GAG C;  1X4H A;  4KGM A;  4B3S J;  2XYP B;  4F4W A;  4PXD A;  3UVJ A;  4QYZ K;  2QA1 A;  3M1V B;  3K5M A;  3DLE A;  2Y3Y A;  2XNR A;  1V5I B;  1CJV B;  5ETO A;  5KT7 A;  2FJV A;  1C1C B;  3PEH A;  2XHC A;  5I3P A;  4PG5 A;  1ZOT A;  4NML A;  2VPX B;  4B08 A;  2CIM A;  1MWQ A;  4TVA B;  2VF3 A;  4CLY A;  3GV8 B;  2VC1 A;  2JLF A;  2AKW B;  2GHV C;  4NA1 A;  4N8N A;  3EWG A;  4WFZ A;  4M5J A;  5EHH A;  3PEJ A;  1IKY B;  1VBY A;  5D8H B;  4JI6 J;  1XER A;  3M8Y A;  2G0C A;  4PUO A;  1I94 F;  3A3N B;  1IKW B;  4IQX A;  4TLR A;  2ZZM A;  4DL7 A;  2EKY A;  3G8Q A;  4A48 A;  1D8Z A;  3D3C J;  2UU9 F;  2NUH A;  2HFS A;  1UEK A;  2GVD B;  2MLZ A;  2ZVS A;  4CH0 S;  2XMV A;  1X4B A;  1CC8 A;  2DH8 A;  2DNL A;  3PFE A;  3R2C J;  4DL3 A;  3HO1 A;  3UCU P;  1E6V A;  2MKI A;  1YHQ S;  4AUK A;  4JOU A;  3B4M A;  3HI9 A;  4K7Q A;  2OGU A;  5ETQ A;  3HX9 A;  4F4Y A;  1GTE A;  2IMO A;  1U4B A;  1FER A;  3ITH B;  1PBU A;  1LXJ A;  1CJT A;  3O8W A;  1P27 B;  1S6P A;  1K0T A;  3QAT A;  4C6A A;  3W61 A;  4WFB Q;  2LXU A;  2X1A A;  4CO5 A;  2H1Y A;  1RKJ A;  1SL1 A;  4XK8 C;  4AND A;  5L39 A;  3SI8 A;  3S8S A;  1HBM A;  2K3I A;  1S5Z A;  1WHW A;  3Q23 A;  2FLP A;  2RDJ A;  3MAH A;  4F25 A;  2O67 A;  3MEK A;  2UVV A;  2YKP A;  1T9U A;  4DX8 H;  4F04 B;  5HRO B;  3MZI A;  4IG3 A;  3CXC R;  1R3N A;  3A1Y G;  2QLB B;  3KUE A;  2R8J A;  5KFY A;  4K0K F;  1GXU A;  3OTC A;  5ETL A;  1J5E J;  1QSS A;  4N47 A;  1UVM A;  3VAL A;  3DMJ B;  4G1I A;  2UXD F;  2DIS A;  5FLX Y;  3CPW R;  2B9Y A;  5AE2 A;  3SYZ A;  5ETP A;  5J2N B;  4R0E A;  4A8M P;  3DM2 B;  1WC1 A;  4G1Q A;  1WHY A;  3A8I A;  1N5V A;  2VKZ G;  3Q24 A;  4DHV A;  4ED0 A;  5LMU J;  3CJ3 A;  1RT1 A;  1QAJ A;  1AYE A;  2E5G A;  1QE1 A;  2PEB A;  1U25 A;  2OO4 A;  1S9G A;  5L1K A;  4B9U A;  4LSL A;  1MN7 A;  2PMW A;  1F9E B;  3WIV A;  3HMJ G;  4RW7 A;  1YGY A;  3TVZ A;  1UFK A;  4BBY A;  5D78 A;  4DR3 J;  2MZQ A;  4KYZ A;  2W4D A;  3AJ2 A;  4ZPW R;  3W2W B;  4P74 A;  4RNO A;  2QMW A;  4I2P B;  2YTC A;  1KDN A;  1U45 A;  2MQN A;  1VIO A;  1RAA B;  4EBE A;  1K44 A;  2BZ2 A;  3I4P A;  2L9W A;  3N28 A;  4U96 A;  4ILL A;  4DLE A;  4J9P A;  4IFV A;  4ZVU B;  2CQP A;  4URS A;  4LRE A;  1U2R A;  1EHW A;  1F3V A;  2WOM B;  3ZZZ A;  1UZH A;  1HWK A;  4DN0 A;  4QWB A;  2ASD A;  1M90 T;  2R8G A;  2MZS A;  2KT2 A;  1WNE A;  2UV8 G;  2HFN A;  3F73 A;  3QFH A;  4ZJO A;  4AQY F;  1C1B A;  4DV7 J;  3MDF A;  3HVT A;  4DUY F;  2YNF A;  1RWM B;  1G6B A;  4BWM A;  4Y2A A;  1R27 B;  1JX4 A;  1A6L A;  4P10 A;  3KLI A;  2LU1 A;  4ED6 A;  1SJQ A;  3GYN A;  3R7B B;  2FVR A;  3OL8 A;  4FS1 A;  4USW A;  1QSY A;  3GYX B;  1T03 A;  4OI4 A;  3M2U B;  4KY3 A;  1X5S A;  3VQT A;  1VQM S;  3AA9 A;  1UEU A;  3KMQ A;  3QO9 A;  1S1T B;  3OPK A;  3QGP A;  3D1H A;  1T9V A;  3F44 A;  4Q44 A;  2RQC A;  1WEY A;  4NWB A;  2GML A;  2WVC A;  3CSK A;  4R25 A;  3DDN A;  2QL9 B;  3LAL A;  3V2U C;  2IRY A;  2NXJ A;  4ZIW A;  2EEY A;  2LMI A;  3OLB A;  4USM A;  3TOQ A;  2DIT A;  4IYQ A;  1WTF A;  4RPF A;  4IRK A;  2DPJ A;  4CNY A;  1UJ6 A;  3MMJ A;  5DG9 A;  3D3B J;  1RT2 B;  1U1R A;  1FEE A;  1SBR A;  1V6H A;  3UW1 A;  3M2V B;  2MST A;  2GW8 A;  2R8H A;  3TUJ C;  3I5C A;  4NLO A;  2DGV A;  3TJ9 A;  2DXF A;  4WP9 A;  1X0F A;  2CJB A;  3MTK A;  3IG1 A;  1R8A A;  1XJW B;  2XZD B;  4H4O A;  4OYW A;  5HVG A;  3M6V A;  1E6Y A;  1UW9 A;  2HS0 A;  4TU7 A;  1B7F A;  2ZHA A;  2HHV A;  2JLE A;  3QGI A;  4DV4 J;  3ZTS A;  4OLP A;  4DQS A;  1JLQ A;  1NSA A;  2XMA A;  3QMQ A;  5LMN F;  3VF0 B;  2NPI A;  4IFY A;  4DF8 A;  2VA2 A;  1TP7 A;  2RDI A;  3T41 A;  4ZK7 M;  3UNG C;  1L3S A;  3DOL A;  3NGT A;  2RHS B;  1JLB A;  2JL9 A;  1C0U A;  1NK6 A;  5B0F A;  4OZ2 A;  3CTR A;  3NGS A;  1D1U A;  4FBT A;  1FWP A;  1LW0 A;  2XYH B;  4HI1 A;  3R5D A;  3Q8V A;  3M30 A;  3QRP A;  2FGO A;  3J7A N;  4DLG A;  3R5J B;  1KOH A;  1OYE A;  3L7O A;  4M5L A;  3TNV A;  1R7I A;  3ULH A;  2HFV A;  4C97 A;  4CNZ A;  2KXN B;  5H9F J;  3VAH A;  2BQU A;  1KFD A;  2ILY A;  2PSZ A;  1UVL A;  4C8N A;  2W8K A;  4X4T A;  4DL5 A;  2KB2 A;  4F3O A;  1XR5 A;  3LAM A;  1F9H A;  3CE8 A;  5KT6 A;  4CLZ A;  4DR1 J;  1TQL A;  5HMW A;  4B3T J;  5B0D A;  3A3P B;  1S7H A;  2M70 A;  3I9V 9;  1HNZ F;  4N76 A;  1N34 F;  3U02 A;  1YBT A;  4C8M A;  3OR1 A;  3CJQ A;  3AOC A;  3HXM A;  5HK4 A;  4OV6 A;  1WWH A;  4PAA A;  3CJR A;  4HT5 A;  5DET A;  2PII A;  4TNO A;  2B7C B;  3IGV A;  2VDI A;  1TV6 B;  3SBM A;  4ZPC A;  2OTL S;  2PDA A;  3SV4 A;  4ECY A;  4NA2 A;  2W01 A;  3C14 A;  3T5L A;  3CGI A;  2VFU A;  2HLU A;  1I51 B;  3EVM A;  1UAW A;  1IBM J;  1TL1 B;  2JEJ A;  5GME A;  2VL1 A;  2CZ9 A;  1TK5 A;  3NCR A;  2VFR A;  2UXB F;  1UKU A;  4K4Y A;  1RA6 A;  5IM0 B;  4PG7 A;  2MGZ B;  1SUQ A;  4F26 A;  1IN0 A;  3HSZ A;  4B02 A;  4ETZ A;  5J1N A;  2B9X A;  4B9T A;  4RNF A;  2EBG A;  3GMG A;  1ZZF A;  3M8Z A;  1SL0 A;  4H4M B;  1X4A A;  1LWF B;  5B08 A;  2I38 A;  2HWI A;  3TX8 A;  3A4T A;  2MJN A;  3CCV S;  5C7P A;  1GNK A;  1LK7 A;  1R0B G;  3L95 X;  3OQ2 A;  1R8B A;  1UVN A;  1F5B A;  1B7Y B;  2IY5 B;  2F4V F;  2ZHB A;  4OI6 A;  4ZLL A;  3JAM U;  1HKA A;  3C19 A;  1XNR F;  4ED3 A;  4Y2M A;  2R2S A;  4JI3 J;  1NB7 A;  3FBC A;  2DXD A;  2YX1 A;  1FD8 A;  4C8Z A;  2AIR B;  1VLO A;  5CZX A;  2GCF A;  3H5S A;  1VQK S;  2P9G A;  4DFP A;  4UZB A;  1X5T A;  2Z2Z A;  1WAC A;  3I5A A;  2L41 A;  1J5O B;  5HAT A;  4ZN1 A;  1GXL A;  1RLC L;  4DZ6 A;  2W24 A;  3TR5 A;  2XMK A;  2UUA F;  2J7W A;  3DRS A;  2Z8Q A;  1NB2 A;  1FCA A;  2WHO A;  2C22 A;  1UMJ A;  1CS4 A;  1DBD A;  3RJM B;  1O8B A;  3IN5 A;  2B7B B;  1SKS A;  3MUT P;  3CCT A;  5DG8 A;  4GVL A;  4YDX A;  4CM2 A;  3ELH A;  3UCZ P;  3J7Y I;  3BGL A;  2IBO A;  6FDR A;  3BR9 A;  4B9M A;  4OZ5 A;  4J7C A;  2CQC A;  1FKP B;  2WSE C;  4WIQ A;  1Y10 A;  4QWA A;  2ZD1 A;  4X65 J;  3CDE A;  2ZH9 A;  1WOS A;  2PFF B;  1DRZ A;  3KK2 A;  1FRM A;  4B9N A;  1NK7 A;  4DV1 J;  3Q83 A;  2UZA A;  4OZN A;  1FJC A;  3W66 A;  3UDC A;  2FVQ A;  4OHV A;  4KHP J;  4ECX A;  4NEY A;  1YJU A;  3DRP B;  3ZO7 A;  4QOT A;  2CPJ A;  2EK1 A;  2R7S A;  3VWS A;  2KFZ A;  5DGB A;  4EBC A;  2BKN A;  2IVM A;  4IOA Q;  2Q43 A;  3C16 A;  2OPR A;  4Y2K A;  3UQS A;  3SFU A;  2VG6 B;  4ZLN A;  3R6L B;  1UVJ A;  1JXE A;  2DNZ A;  4O3S A;  1RU1 A;  1VQN S;  3TQE A;  9ATC B;  4UZC A;  5A0Y A;  4HKQ A;  3W9I A;  2CJK A;  1XNQ F;  4O3R A;  3BO4 A;  2E29 A;  4ECZ A;  3CDB A;  3EDQ B;  3CCS S;  3JQK A;  2BBE A;  3H2U B;  5KT5 A;  1SJ4 P;  5A2Q U;  1RTD B;  1CQM A;  2MHN A;  2M9K A;  1W2B R;  3UVJ B;  5J1P A;  3QLH B;  1JQG A;  2AYM A;  2ZOG A;  2FB0 A;  1NDL A;  2KM8 B;  2EG2 A;  2RF2 B;  2J0X A;  5BJR A;  2Z2Y B;  4M5H A;  1U02 A;  2CNO B;  3HD1 A;  4QYZ J;  4DV6 F;  4OI0 A;  4ECU A;  1NPR A;  4X4O A;  4DQP A;  2Z2L A;  3N6L A;  5EWG A;  1FD2 A;  4PUO B;  2C3O A;  1G2E A;  4MH8 A;  3ETM A;  4O44 A;  5B0B A;  5CXT A;  4CLP A;  5KG6 A;  2FC8 A;  2FQQ B;  1EB0 A;  1VQ6 S;  3GCX P;  1FRX A;  3PIP Q;  2WVD A;  1U6B A;  3QGG A;  2JWN A;  4ECT A;  3R1L A;  4DUT A;  5K5M A;  4J37 A;  2KH9 A;  1HHT P;  2QG9 B;  2QO3 A;  4ZLP A;  4QBU A;  3OTO J;  2LKZ A;  4F4Z A;  3FEY B;  3M8R A;  2V8D A;  4OZ1 A;  1HNW J;  2D7S A;  2FJB B;  1NPP A;  3ILI A;  3MAQ A;  1U26 A;  5C42 A;  1E6V B;  1KKH A;  3WX4 A;  1TKD A;  3EZU A;  1IUJ A;  3BZQ A;  3DI6 B;  4N7T A;  4AYB D;  4ED8 A;  4ZS6 A;  3F56 A;  2I6W A;  4CLU A;  2J76 E;  2FJD B;  2W7O A;  2DY1 A;  3W62 A;  5GAE I;  3J7Y U;  2OHD A;  1CJT B;  3AY0 A;  1NDC A;  1B0P A;  4CDI A;  3GFH A;  4XIU A;  2DGQ A;  2V68 A;  4JYA J;  1S6P B;  2ZC3 A;  1SB6 A;  2H4W B;  3CJ0 A;  3PAC A;  1CPZ A;  3KFW X;  2XLJ A;  3PJW A;  1SKW A;  3F0N A;  2XGP A;  3EPI A;  3GWC A;  2V9W A;  3LP1 A;  4DR7 J;  2HHU A;  4N8O A;  2CAD A;  2ERR A;  4ZP9 A;  2WK4 A;  2B4U A;  4CIO A;  4IG3 B;  3RZA A;  2XMU A;  4C8Y A;  2L48 A;  3PM9 A;  2FUG 9;  2HFZ A;  3CCJ S;  1NSP A;  1QJH A;  5IXU A;  3EGW B;  2VQE F;  3CF5 Q;  2AJF E;  4P2X A;  5IWA F;  1YX2 A;  3Q8P B;  2ASY A;  4PAB A;  1IQT A;  2MKK A;  2VBZ A;  1MRO B;  5C24 B;  4G1Q B;  2XY5 A;  1FEH A;  1T11 A;  5DO2 A;  1RT1 B;  4DV2 F;  1T9W A;  3BGR A;  1TKX A;  3KUH A;  5CD4 A;  4LSL B;  2VV5 A;  3G9C A;  5KFQ A;  4RW7 B;  1S0N A;  1MG7 A;  2CJQ A;  5KG4 A;  1K8A T;  1YZ7 A;  3W8G A;  2C2D A;  2DGU A;  3SXL A;  2ZH7 A;  4EU0 A;  1ZM3 A;  3D1O A;  2ABY A;  3HHK A;  3MR2 A;  1VFJ A;  3KJV A;  2Z2M A;  1OSC A;  4KV8 B;  2XCP A;  4LFC F;  4PQU A;  3IR6 B;  2VFV A;  3BDE A;  4ZDN A;  1GQE A;  2XWX A;  3FVY A;  1V3S A;  1N5Y A;  4UOH A;  3RBE A;  1HHQ A;  2R7Q A;  2A1B A;  4KT0 C;  4DR6 J;  1IWA A;  1KVK A;  3WX8 A;  3BJY A;  3N9U C;  2KT5 A;  1EKS A;  5L1L A;  4QJV A;  2D3U A;  5RUB A;  2MY8 A;  4KIA A;  2WZ1 A;  1QTN B;  2EWH A;  5KFI A;  4NCB A;  2HNZ A;  2HAF A;  1C1B B;  2V94 A;  4F3M A;  1EAR A;  2B4O A;  4BCA A;  3PVX A;  3GIK A;  2G0I A;  3CCZ A;  1UET A;  4OLO A;  1KC8 T;  1BMQ B;  3KLI B;  2BQR A;  3CJK A;  2QFI A;  1GX5 A;  2FZG B;  2NQP A;  1S6O A;  3BBC A;  4DS4 A;  3UNY A;  2DR5 A;  1S1X B;  5JVH Q;  1T03 B;  1YJW S;  3BM7 A;  1UFW A;  1HR0 F;  3MM8 A;  4LF4 J;  2VON A;  3QO9 B;  3RGI A;  3W7B A;  2L9D A;  5GAE U;  1RTH A;  4TLQ A;  2AX1 A;  1BWV A;  3S7R A;  5J2Q A;  1OJ4 A;  2CQI A;  4Q2L A;  3CCR S;  2RRA A;  3FBF A;  2OD4 A;  2YWE A;  2XS2 A;  3CCM S;  2E5J A;  3KJN B;  2KN4 A;  1GMU A;  1RTI A;  4KRW A;  1YTY A;  2XO7 A;  4JI7 J;  4C98 A;  1RXO B;  5I3U A;  1XMB A;  4NLR A;  3CJ2 A;  2BJ7 A;  1XK8 A;  4M5M A;  4L3N A;  3WIU A;  5K8N A;  3OHA A;  1IM4 A;  5LSL A;  2HNY A;  4WKR A;  5IT9 U;  5T7L A;  2CDQ A;  1VC6 A;  2NXN A;  2G0J A;  3GP9 A;  3IMQ J;  3KJF B;  1HHS A;  3IG1 B;  4KO0 A;  2ZH4 A;  2CVI A;  1MSW D;  4J9S A;  2ZM6 J;  8ATC B;  3OSN A;  1E6Y B;  4ZJQ A;  2BW7 A;  2HHH J;  2P6T A;  2B8P A;  4FNI A;  1U6F A;  4R8U A;  3M8P A;  2FLO A;  2QA4 S;  4M5I A;  1FVQ A;  2E5I A;  4B3R F;  1UPP A;  2ZNZ A;  5KG3 A;  4DR2 J;  2RS8 A;  1RHQ B;  3BSC A;  3LQV A;  4RW9 A;  3EUN A;  1QVF R;  3CJ8 A;  1AB8 A;  3PW4 A;  4F2R A;  1RIS A;  3G6E S;  1Y3K A;  1G3O A;  2R7O A;  2BAC A;  1LW0 B;  4EZ9 A;  3TAM A;  2CDR B;  4FNH A;  1S12 A;  1MMN A;  2HK3 A;  3C66 A;  3J80 U;  4LF1 A;  2W1B A;  2VG7 A;  3EMT A;  2CQB A;  2UV8 A;  4K4U A;  1EP4 A;  3MOZ A;  5H9E K;  1UVI A;  1YBU A;  3HHN B;  3QWP A;  4USJ C;  1DQ9 A;  5HJY A;  3V6D B;  3K8W A;  2K1R A;  5T41 A;  4ZVP B;  4DX7 A;  3DHW C;  3CC4 S;  4AL6 A;  1KHW A;  3ZZP A;  4LFA J;  1CG2 A;  3H2L A;  4HTJ A;  3V4M A;  3OR1 B;  3E3X A;  1FA0 A;  5GMD A;  5SUH A;  3EE3 A;  2QLJ B;  3KKF A;  2DNM A;  2VA3 A;  2NXE A;  3ZZT A;  2DCL A;  3E51 A;  5SZT A;  3LUY A;  3PX4 A;  4JV2 A;  1Q81 T;  2RIL A;  3R7N B;  3C14 B;  4Z2X A;  5D4L A;  1W25 A;  3CD7 A;  2CQ4 A;  3ILO A;  4ZPV R;  1FT8 A;  2GV1 A;  4JP8 A;  5IFM A;  2KI2 A;  4NRU A;  1Q7Y T;  5IQ6 A;  4ID5 B;  2HRY A;  4P73 A;  2L9N A;  1FKO A;  2B5J B;  2FJE B;  2FHJ A;  4A8Q A;  2RSQ A;  2HSE B;  4FXW A;  1QLN A;  1S4E A;  3EYZ A;  5F9L A;  1I3O B;  4UOC A;  1SUQ B;  1Y9O A;  2QC3 A;  1SH3 A;  5HL7 Q;  3HHL B;  2GO8 A;  4LIR A;  3R6G B;  2XS7 A;  4P75 A;  3IWN C;  2E1P A;  1NJI T;  4NPO A;  3NEK A;  2ZZT A;  5E3C A;  4I6Y A;  2BV3 A;  2ZE2 B;  2WBR A;  2I1R A;  5K9F A;  3EX7 B;  4B3M J;  3GFY A;  4ECR A;  2DHA A;  1JNR B;  4JI3 F;  2CA9 A;  1PJ6 A;  2CQ1 A;  3LH2 S;  4U95 A;  1NEE A;  4WCE Q;  2N4D A;  5LT5 A;  1NJX A;  1PYS B;  2W9C B;  4OYA A;  1BQX A;  5DDO C;  1ZM4 A;  2LP4 A;  1HQE B;  3FNN A;  4FS2 A;  1SJF A;  3HLU A;  4PQA A;  3BQ1 A;  2VQF F;  2Y8Y A;  4LF7 J;  3ZZY A;  4USV A;  2OEJ A;  4YUD A;  3PJ9 A;  1EKR A;  4GC6 A;  4QU7 A;  2MTL A;  2XNQ A;  4DFK A;  4R5P A;  3T1A A;  2P6S A;  4TU8 A;  3T3F A;  3MGJ A;  1F6T A;  5KFW A;  2VJV A;  4KGV B;  1TL5 A;  1PG5 B;  2LQ9 A;  3JSM A;  2WTF A;  2CWX A;  3NCQ A;  4PRF A;  2N4C A;  2XSJ B;  4KHP F;  2DRB A;  4LRC A;  4IG0 A;  1U1M A;  2ZD1 B;  4M94 A;  1HPZ A;  4U7C A;  4USK A;  5T14 A;  2YWW A;  3V4I A;  1RKI A;  3KK2 B;  3RR7 A;  2IYG A;  4EO8 A;  4KBI A;  5C5J A;  1RCO B;  5KG2 A;  2J7K A;  1TVR B;  2GO9 A;  3K7R A;  3HVA A;  1XBW A;  1JWW A;  4B3O A;  2OPP A;  5IS2 A;  1B64 A;  4ED2 A;  5ETR A;  2VPZ B;  2HHW A;  4DU8 A;  3POT A;  4TYB A;  4DL2 A;  4EBD A;  3C16 B;  1RAF B;  5GAG I;  1S9E A;  1QTM A;  2C1E B;  3CJ4 A;  4LVO P;  4AL7 A;  1KQF B;  1XR7 A;  2YX4 A;  4ZN3 A;  1U1P A;  3NS5 A;  5A0Y B;  2QYC A;  2RH3 A;  3K0J A;  2ZWP A;  3ENW A;  4I2Q A;  5LSR A;  2QL7 B;  3N0V A;  1ELO A;  3HSD A;  3JB9 k;  5BYR A;  2K7J A;  2HND B;  2F8H A;  3FMB A;  3A8K A;  3DLJ A;  4IR1 A;  3HSJ A;  2MQL A;  4LRF A;  1FO1 A;  1TL7 A;  2W9B A;  4NLD A;  3DDI A;  2CPE A;  4YR2 A;  1TAQ A;  4YS2 A;  4J9L A;  4CCH A;  3UCG A;  1RAG B;  3L3C A;  5B0E A;  3GON A;  2EG1 A;  1SCJ B;  4UST A;  4EK2 A;  3PTW A;  4AXJ A;  2W4C A;  2H54 B;  1LW2 A;  3BEG B;  1AFI A;  2KTQ A;  4KGK A;  1JLG A;  1U6Z A;  4X4Q A;  2PGC A;  2JZ5 A;  2CQH A;  3R97 A;  4P2F A;  3BB5 A;  4PR6 A;  1WHX A;  3NGR A;  1O5J A;  2VAS A;  2PO4 A;  2MB0 B;  3KOA A;  1PCA A;  2DGO A;  3KLF A;  2VG5 A;  4ZHR A;  3FSX A;  1KVJ A;  2DGS A;  3LP2 A;  4U6P A;  2H5I B;  2V0N A;  3GIL A;  2CQ3 A;  4DSE A;  3H5U A;  3EIC A;  4GKK F;  2W2O P;  2QLX A;  4JV5 F;  3QPI A;  4DG1 A;  1TU0 B;  2CRL A;  2HZA A;  1DLO A;  2K8G A;  3EXY A;  4LRB A;  4A8K A;  2DH7 A;  1S7I A;  4BC9 A;  4LF8 F;  4F0H A;  3BO3 A;  4PYA A;  4IKA A;  4ECW A;  2VB6 A;  3ICL A;  4F36 A;  1M5H A;  3J7Z T;  1G1X A;  5HN0 A;  4JI1 J;  2PMH A;  2DO4 A;  4F02 A;  2GJI A;  4FF3 A;  3VGV A;  2BM1 A;  5HBM A;  4DR7 F;  5J1E A;  1KSP A;  2EFN A;  2R8I A;  2QMX A;  2DCU B;  1BE4 A;  1U2F A;  2PA8 D;  5AE3 A;  1UL3 A;  1RT5 B;  2XY6 A;  3NNA A;  1RWU A;  2R2R A;  4RU9 A;  2JSX A;  1VRU B;  1RUS A;  3LP1 B;  2YBV A;  1CC7 A;  3CUN A;  5CHC B;  1WDT A;  3FUY A;  4Y34 A;  4W98 A;  3CCL S;  4M1K A;  5HRO A;  1NK5 A;  2JVO A;  4KAI A;  1KTV A;  4L75 A;  4C0O C;  5GAG U;  4L76 A;  4KC5 A;  3M6U A;  4NX9 A;  4IUF A;  3W63 A;  3TZZ A;  4DR5 F;  3RYL A;  3DMJ A;  3T5H A;  2A2D A;  3DM2 A;  3ZFV A;  5E3Q A;  1PAE X;  2UVW A;  3C46 A;  2DHH A;  2UXC F;  4O3Q A;  3GIJ A;  1H2U X;  3BGR B;  1TKX B;  4RWX A;  3GJT B;  3HVR A;  1WEX A;  2NZC A;  2CPD A;  5HMZ A;  2H5J B;  4AE5 A;  3AAW B;  2BYC A;  2HEK A;  1WF2 A;  2O66 A;  4OHY A;  1TUG B;  4ZCK A;  3OR2 A;  1W7W A;  2XC9 A;  3IM8 A;  3AQO A;  1RHR B;  2W2P P;  2JNJ A;  3FJ2 A;  4HYK A;  3PZP A;  2JHE A;  2Z4P A;  1UFL A;  2VDH A;  3GJS B;  4O0N A;  5EUH A;  2QX0 A;  4F4A A;  5KAK A;  3KJV B;  1MN9 A;  1EJ7 L;  4F7V A;  2LDI A;  3N4W A;  2N7Y A;  1WC6 A;  1S59 A;  4K5S A;  1N5Y B;  2DNP A;  3OJS A;  1OY8 A;  2I5J B;  1VLY A;  3BKT A;  2ZH5 A;  3GII A;  1CSJ A;  1N36 F;  2V2K A;  1PJ5 A;  3W5Y A;  4J9Q A;  5KT2 A;  2HNZ B;  1QVG R;  1FVS A;  4PG6 A;  3LAN A;  5GMK a;  2Q6B A;  3SMZ A;  1T7P A;  2XQC A;  4RNH A;  5KFO A;  4LT6 A;  3AH6 A;  2RQM A;  3KLG B;  3VVT A;  4IOB A;  4FVC A;  1QAX A;  4ZPB A;  3CJK B;  4O23 A;  5D0G A;  5IC6 B;  2OTJ S;  4CQ1 A;  4CLF A;  2VFS A;  1GK8 A;  2X51 A;  4DS5 A;  1RT7 A;  3FZB A;  4ZP7 A;  1WOO A;  4JI0 J;  2YKA A;  4DSI A;  3MUV P;  3M2U A;  3MM8 B;  2G1D A;  3BYR A;  2CQD A;  4OHX A;  1S1T A;  4DV3 F;  2R8K A;  1Y5N B;  1RTH B;  2GQ2 A;  5E7O B;  1FTC A;  1NND A;  4M5G A;  4DX6 A;  4TN2 A;  2AJ0 A;  3T1Y J;  3O3L A;  5A8W A;  3H90 A;  3IRW P;  4EYI B;  1FDD A;  4J9U E;  1TFY A;  1AW0 A;  1XR6 A;  4QWC A;  5DS7 A;  1FWK A;  2KVQ E;  1REV A;  1DQ8 A;  2CPI A;  5CH7 B;  1NJY A;  4HT7 A;  1KQK A;  1RTI B;  4IOC Q;  2ZBI A;  1X4E A;  3BQ2 A;  3L7U A;  4DPX A;  5I3U B;  4OX9 J;  4YB1 P;  1Y5I B;  2JOQ A;  4Y00 A;  4N77 A;  4I67 A;  1D09 B;  2KJV A;  1RAJ A;  3BDP A;  1TMM A;  2LXF A;  1JB0 C;  3TQ1 A;  1RWV B;  1C4C A;  1CJU A;  3HHL C;  3H40 A;  4NZ7 A;  1VQS A;  1WG1 A;  5BR8 J;  2B9E A;  3RAM A;  3PCO B;  1ARO P;  4KO0 B;  5K14 B;  4NCG A;  4NZ0 A;  2DH9 A;  2WSF C;  1IKV A;  2PEH A;  3QT6 A;  1RBA A;  5KG5 A;  4KH0 B;  1IXK A;  1NU4 A;  3CUL A;  2ZBP A;  2MKJ A;  4R8U B;  2JEI A;  3M8P B;  4NCA A;  3D0G E;  2IA6 A;  3IBW A;  3GCW P;  4OI2 A;  4DCP B;  3CJ5 A;  1DHM A;  4DWI A;  5F8J A;  5AXK A;  4OHW A;  2F9J A;  4FKY A;  3THV A;  3TAP A;  2HQD A;  5FLX U;  3CDA A;  4YR0 A;  4ERD A;  3DGV A;  2ZUG A;  2KVI A;  1U7L A;  1IKX A;  2AU0 A;  3RW6 A;  2OPQ A;  1WHV A;  3CO9 A;  3H7H B;  2CJY B;  1D8Y A;  1S99 A;  2FPH X;  2IAJ A;  1H38 A;  2XI2 A;  4JI2 J;  1AUD A;  3M05 A;  4ZPD A;  1T3O A;  2UUB J;  2ATC B;  5DM6 Q;  5F0U A;  3OHB A;  4WF9 Q;  3P5B P;  1RA7 A;  3KHR A;  5HAN A;  3CDW A;  4L72 B;  1LKZ A;  3CVK A;  3JSR A;  4LF9 F;  1HBN A;  2IJN A;  2LEA A;  4I4B A;  4YDD B;  3J81 Y;  5B09 A;  2W8L A;  3SDE A;  2F5G A;  3B82 A;  3MOJ B;  2OEK A;  5H9E J;  1OO0 B;  4MK9 A;  1IBL J;  2HS3 A;  2RRN A;  4RWW A;  4C9D A;  1TV6 A;  3C3L A;  2J6S A;  3NAH A;  1QM9 A;  5DRK A;  1ZM9 A;  3V6H A;  1LWE A;  3US5 A;  4KTQ A;  1L3U A;  1WI8 A;  2R7R A;  3W1Y C;  2B51 A;  2ZIT A;  4MIW A;  2GS8 A;  2MKC A;  1N5T A;  3MED A;  3IWX A;  4G3I A;  3OTB A;  1FKO B;  1C0T A;  5JVG Q;  1HA1 A;  3OSP A;  4M63 A;  2R9L A;  4J9N A;  4DQQ A;  3GQC A; 
#chains in the Genus database with same CATH homology
 2C2O B;  1BMQ B;  3SIP B;  2C2K B;  2HBR B;  1ICE B;  2CNO B;  1RWK B;  1RWP B;  3R5J B;  4DCJ B;  1RWX B;  2QLF B;  1RHR B;  3GJR B;  2H4W B;  2C1E B;  3IBF B;  3R7B B;  3KJF B;  1QDU B;  3P4U B;  4ZVR B;  1I3O B;  5K20 B;  1F9E B;  4LSZ B;  5IC4 B;  2XZT B;  2Y1L B;  3QNW B;  3R6G B;  2CJX B;  2H65 B;  3EDR B;  3GJS B;  3KJQ B;  1RE1 B;  3D6F B;  3P45 B;  3R6L B;  4ZVP B;  4JB8 B;  2XZD B;  2FQQ B;  3GJQ B;  2H5I B;  2QL7 B;  2CNL B;  1SC3 B;  2DKO B;  2HBQ B;  1RHM B;  4DCP B;  3D6M B;  3RJM B;  2HBZ B;  4ZVQ B;  3IBC B;  2QL5 B;  2QLJ B;  2C2M B;  3D6H B;  3EDQ B;  2Y0B B;  2HBY B;  1RHQ B;  2QL9 B;  4ZVU B;  1GFW B;  4ZVT B;  2H51 B;  1RWW B;  4ZVO B;  1SC1 B;  2XYG B;  4DCO B;  3R7S B;  2QLB B;  3R7N B;  3NS7 B;  2H48 B;  3KJN B;  1RHJ B;  1PYO B;  2CNN B;  1QTN B;  2CNK B;  2XYP B;  2CJY B;  1SC4 B;  2P2C B;  2H54 B;  2CDR B;  2H4Y B;  3GJT B;  1RHK B;  1NME B;  1RWV B;  2XYH B;  1I51 B;  1RHU B;  4ZVS B;  1PAU B;  1RWO B;  1RWN B;  2C2Z B;  5IC6 B;  1RWM B;  2H5J B;  1IBC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...