1P6TA

Structure characterization of the water soluble region of p-type atpase copa from bacillus subtilis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGYHVVTEKAEFDIEGMTCAACANRIEKRLNKIEGVANAPVNFALETVTVEYNPKEASVSDLKEAVDKLGYKLKLKGEQDSIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potential copper-transporting ATPase
publication title Structural basis for the function of the N-terminal domain of the ATPase CopA from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 33
structure length 151
sequence length 151
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p6tA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p6tA01
4YEAA 1X0PA 1GXUA 1N5SA 4NPOA 1TR0A 1OPZA 1KVIA 1AFIA 3HHLA 1GXTA 2XMTA 3BF4A 2RU9A 1W2IA 2RSQA 1LQ9A 3FGVA 4A48A 2FTRA 1APSA 2QLWA 3TOQA 3WDOA 2LDIA 3FRYA 2FB0A 4ZA1A 3HHLB 2AJ0A 3TNVA 2BUNA 1VQSA 1X7VA 3BR8A 2OMOA 3MZIA 5T7LA 2OAUA 3GZ7A 1AW0A 1Y9OA 4NL5A 1OQ6A 1TZ0A 4A4JA 2GCFA 4Q2MA 1S6OA 2HIQA 2HLUA 1X8DA 5T7LB 2KKHA 1SB6A 3F44A 4HH1A 1FD8A 5K9FA 3UDCA 2KT3A 1AFJA 1MWZA 3HF5A 5B0BA 4OJ1A 1URRA 3I9ZA 2ROGA 3BN7A 4Q2LA 2N4CA 4OJGA 3MCSA 2W4PA 3FMBA 4U9RA 4ZOSA 1TL5A 5B0FA 1Q4RA 5F0UA 2XMMA 4HI1A 3BGUA 2ACYA 4HL9A 1FVQA 1TUVA 3KKFA 3HX9A 2OFGX 1FESA 1FEEA 1YRXA 1S6UA 5A6WA 4DL0C 2ROEA 1OSDA 1WD6A 3HDSA 3IWXA 1CC7A 2N4DA 1Y3JA 2LQBA 1KVJA 2GGPA 5B0AA 2QIFA 1N5QA 1SI9A 3HHLD 5KAKA 1N5VA 2ASYA 2W4CA 3DCAA 5B09A 1P6TA 4OJHA 2BJEA 2IFXA 5F0WA 4HI2A 2GGPB 2K7KA 2L3MA 4YDXA 1YJVA 1XBWA 1JK9B 1TL4A 2GO8A 2XMUA 2IYGA 3QMQA 2OD4A 1CC8A 1SQEA 2XMJA 4Y2KA 2QLXA 2QYCA 1MWYA 3TRGA 2RILA 2HFOA 2K2PA 2OP5A 2K1RA 2LXFA 4OIXA 1P8GA 2HQIA 2JDJA 4F67A 3KG0A 1IUJA 1YG0A 1YJUA 2K7JA 1QUPA 3KNGA 2ZDPA 1ULRA 3DXSX 2OFHX 3K7RA 3KG1A 1FVSA 1Q53A 2K1RB 1KQKA 5IXUA 4HH0A 3VTIA 1Q8LA 1YJTA 2HFNA 2XMKA 3LGMA 1RJJA 1YJRA 1K0VA 3T9NA 2FHMA 2GFFA 3BM7A 2CRLA 1V3ZA 2BYCA 4FNIA 1OQ3A 2IYIA 2PD1A 2Q3PA 1FE0A 2XMWA 1Q8BA 3BB5A 3E8OA 1Y0HA 1VQYA 2FIUA 4QOTA 3CJKA 5B08A 2BBEA 2EW9A 1Y3KA 2OD6A 2VH7A 4EFAC 1N5TA 4Y2IA 5B0GA 2KYZA 3HFKA 4OJ3A 2G9OA 5B0CA 2ZDOA 4DN9A 2AP6A 2N7YA 2HLTA 2GA7A 3CJKB 2W4DA 5B0DA 2VV5A 3IWLA 5B0EA 5A6PA 2PGCA 2ROPA 1R6YA 3QGPA 3BDEA 1FE4A 2BJDA 2AW0A 3LO3A 1CPZA 3LGNA 2RMLA 4Y2MA 1JWWA 2LQ9A 4FNHA 4DPOA 1U7LA 3HHLC 4A46A 2XMVA 4A47A 2GV1A 2OKQA 2AJ1A 2KT2A
chains in the Genus database with same CATH superfamily
1C0TB 2I0XA 2YWEA 3R5AA 1FXLA 2DYAA 2KZZA 2CG8A 1WDTA 5GAGU 3FQKA 2Z0GA 1RAEB 4ED2A 3FZBA 4OI6A 3W61A 2MZ1A 1DQ8A 1VDHA 2DJWA 4DR2J 4F0MA 4DV7J 3W60A 4FXDA 1U02A 2VG5B 2EKYA 4UY8T 2PI5A 2EFNA 2L9WA 2QSWA 1Y4ZB 1FESA 1UJ4A 2B3TB 2R9LA 2BANA 3KLFA 2G2OA 2AZ3A 2OH2A 2E5JA 4G3IA 5ETQA 5A8WB 2QA2A 1UEUA 1FK9A 3M8QB 1WELA 4KYZA 4FP9A 2YQ1A 3K89A 1RT2A 2V8PA 4QW8A 2YWFA 3CJ8A 2XSJA 4AL5A 1U6BA 3A13A 4F8RA 2JEFA 2GJIA 3E2EA 3AXKA 2B51A 3PEJA 3GIRA 3GV5B 1E6YB 4WIQA 4FDFA 2MTLA 5FD1A 5L9XA 1SKUB 2PA8D 5H9EK 1IKVB 1QAIA 3UN3A 2CUYA 4Y34A 1UPPA 1VBKA 1EQ0A 2H4YB 4DV3F 1HQUA 2KXNB 4LFBF 4C3LA 2PO4A 1WC4A 3CUNA 1SB6A 3OUYB 2VU5A 1B7FA 1XIQA 1WHWA 5AXLA 5I3QA 4L3NA 3TVKA 2X1GA 2VPYB 2FLPA 5LOQA 3KLHB 4LQ9A 2E5GA 2B6AB 4EI2A 2IRYA 3R7BB 3ULHA 2DTJA 2OPQB 3L4BC 4J37A 1SVDA 2FGCA 1ZM9A 3HP6A 4LF5F 5HROA 2GX8A 2IRXA 2YXLA 2NSBA 2V4RA 1BE4A 5EWEA 3QGPA 3HSDA 3G6XA 1S0VA 3PV8A 1N6QA 1X0PA 2UUAF 4PQUB 4K4ZA 3TAMA 5SUHA 3I0SB 4C97A 1HI1A 3MEDB 4CZCA 5T7LA 1RTJA 4B3RF 5EWFA 3PTWA 1YITS 2IVMA 4USWA 4OI0A 4UQGA 1X5OA 5BYRA 2HQGA 2KDOA 3N6NA 3NAIA 2B4PA 1JMTA 5HLFA 3QT7A 2ZHOA 3JSMB 1MW7A 2K2PA 3OXLA 4WP3A 1RTZA 4FS1A 2J7KA 2XY7A 5T14A 1Y11A 3QRRA 1SV5A 3FSYA 2I1RA 1FRJA 3D1OA 2CQ2A 4DR7F 5K14B 2UUBJ 5F9NA 1XNQJ 1QUVA 4YDDB 1FRXA 4FKXA 4DV5F 2KVQE 2CQIA 2YNFB 2UVVA 4GO5X 4L6V3 1B0PA 2Y1RI 3KJQB 2CPXA 3V6HA 3H42A 1NHVA 2DNQA 1N5YB 3B6BA 3N79A 2C3OA 4XAKA 2B43A 4YY3F 1U48A 4RWWA 1G3OA 2EC2A 5HQLA 3TAPA 4NCGB 3SQOP 4AT1B 4O0NA 3K5MA 4FYDA 4J9PA 2XO7A 2ZH6A 2VKRA 1ZM4A 2KO1A 3BKTA 4AL6A 3D68A 3GYNA 5BYSA 2XS5A 1YJUA 3QRQA 4DCJB 1Q8LA 5AXMA 5A76A 2WOMB 4ED1A 5D15A 3DOKB 1WACA 2WVBA 2EFOA 1V5VA 3A3OB 1IR0A 5E41A 2MZTA 3N5BA 3ZTPA 2Z8QA 4WFYA 4EUVA 2YKAA 1T9WA 3LPYA 3RB6A 2DVIA 3JSRA 1KC8T 2WVDA 3C15A 2ZBQA 1PIEA 3LP0A 1GQEA 1LQ9A 3IG1A 4LT6A 1N34J 2O67A 2XS2A 1J2VA 5E3RA 4ECSA 2GCFA 2Y1JA 1T02A 1UMJA 3HMJG 3JB9k 5J1PA 1VQMS 4FKYA 4QZVB 4OJGA 2B5JB 4NLUA 3I31A 2GVDA 4L73A 1EARA 2FZGB 5A6WA 2BZ2A 4I2PA 5E5NA 3BJYA 1KVJA 3TUIC 2OO4A 3I5CA 3M6XA 3FCHA 2EFPA 1AUDA 4F50A 2GIQA 3MM8B 4OMFG 1RAOA 4HVZA 4X4PA 2OFHX 2LEAA 4DX8H 4C8LA 4HH0A 1UFWA 2LQJA 3FBCA 2XMKA 2CQ0A 5KFGA 2GHWA 2HVEA 2A1BA 1V3ZA 3DHWC 2N3OA 4EO8A 2VHGA 2LXUA 4TU8A 2C42A 2RQCA 5F8MA 3G4SS 3SFGA 1EKSA 3NGDA 2XULA 1VQ6S 4CI0B 1J5OB 1FRKA 4WE1B 4OX9J 1XJWB 5LXRA 1UEVA 1UETA 1KQFB 1RGVA 4B9NA 2IBKA 3P96A 4IG0A 4DU8A 3OSNA 4RX6A 4YOEA 2YNGA 5CD4H 1G4CA 1LFPA 3CJQA 2KHCA 1EHWA 2KKHA 3PW5A 1XMQJ 2BA9A 2ASDA 2AYGA 4TKTA 3ZFVA 5JJBA 4IH7A 2BDPA 5KAKA 3DCAA 4JI0F 2CNNB 1EX8A 3O2IA 5KFRA 1VRTB 1HHSA 3I0RA 4NLPA 1XBWA 3GTYX 3PRBA 4ZPTR 5E3CA 2H4WB 3FMWA 2POKA 5KOWA 4DR5J 2QA1A 3C6UB 1CQMA 1NB2A 6FD1A 1S1WB 4FVMA 2HAFA 3W2WA 3K8WA 4CLYA 4IQXA 1K47A 2V63A 2OD6A 3L9ZA 1K9MT 1K1QA 1H2VZ 3W1YC 1JLEA 2LDYA 2AP6A 2HKEA 3JTOA 3TJ9A 1VQ7S 4B9UA 4PR6A 1SKRA 2R7SA 1VGYA 1CBKA 1WC1A 4JI4J 3KUGA 4OV1A 3NGUA 2ERRA 4X2BA 1EP4A 4OZ5A 1RA6A 1CG2A 1X7VA 4I68A 4ILLA 4WK3A 3RW6A 4DV4J 1YVFA 2B4UA 1LWXA 2N4CA 3ZZRA 4RW7B 3AOAA 3O6QA 4CYUB 1TUVA 3SYZA 4K4VA 3P8BB 1GX5A 4GRSA 5I42A 4DQSA 3ENQA 3VWSA 4TLQA 5K8MA 2H5IB 4RL1A 3EWGA 2DXEA 3A3PB 2EK6A 1G1XA 1Q79A 4USJC 3G9CA 2BR0A 4MIWA 5LSRA 2MKYA 1ZYQA 1CJVA 2GMJA 3DLGA 1AZSA 2DNMA 3T5LA 1ZZFA 3FDSA 4BC7A 5EHHA 3KDNA 2PE8A 3TA2A 1CJUB 4OI1A 2MQOA 3BBCA 1KKHA 1CJKA 3NMRA 4IFYA 3MR2A 1GAOA 1X31C 4K0KF 2BQUA 1L3KA 2LA6A 1UKUA 4K4UA 4JBCA 1SQGA 3G8QA 3DM2B 2BE7D 2LU2A 4DR4F 5KFZA 3EGZA 3W66A 1FKPB 5ADZA 2ZWPA 3NS7B 2E7WA 2MDAA 1F5CA 2ASYA 4R25A 3K8VA 2JEJA 1VBZA 1RTHB 2W24A 2WSEC 2RS8A 2HMIB 2KT5A 3AB2B 3JYTB 3OHBA 3G6VA 4OYOA 2W9AA 4JI1J 3TQ1A 3OXFA 1Q53A 1VS3A 2K1RB 4NLSA 1NDKA 2HVHA 2DIVA 2O1PA 1X5PA 4MTPA 1N33F 4JV2A 4C3KA 3J7ZT 4LF7F 3EVOA 2E1PA 3AD9C 3M9NB 3JQMA 1T05B 4KIAA 3J7AN 3HJFA 4F0HA 2LCWA 3QJJA 3HVTB 3KMSA 1RK8A 4HTJA 5SZTA 2ZH8A 2HS3A 3G8TA 5K8OA 3D66A 1KVKA 4UQTA 1U1RA 5L46A 3M2RB 3WZ0A 4C8NA 2C22A 2JLEA 4NMXA 3S7RA 1DRZA 3R7NB 2IVFB 4NLRA 4UZBA 2AT1B 2C2EA 3KDOA 1DY3A 2ZBRA 3BZQA 2J9EA 1AB8A 2D41A 2L3MA 3W8PA 2DCLA 4CT9A 1VCTA 3R5DA 4HYKA 3M8PB 2P2CB 3NCRA 2R8IA 3KNGA 2H5EA 3KG1A 1P1TA 1KQKA 3QT8A 4Y2AA 5U47A 1F2GA 1BGXT 1KDNA 1F9HA 3TWZA 2WVFA 1U8SA 3OTOF 4M95A 3CCQS 1WF1A 1RQ0A 2BKNA 3MPYA 1SCJB 3CJ0A 3HT3A 3AXMA 4LSZB 1FX2A 3OR1A 4GKJF 4DQPA 2KFZA 5KG1A 5F8GA 3R3TA 5A8KB 2DH7A 3DNCA 2M5YA 1FKOB 4LRFA 3HHDA 4GC6A 2AU0A 2ROGA 4DR3J 1HI0P 2VPZB 3MTJA 3FEYB 2E5IA 3L7PA 2XQCA 4ZS6A 3GQCA 4B9LA 2A10A 1BHNA 1TL4A 3AB4B 4ZVPB 1QAYA 3D6MB 2EWHA 3CC7S 4DQQA 4Q45A 1K0TA 3C6TB 4RBVA 3K58A 4UF4A 3VAGA 2B8QA 4FN5A 3QGIA 4FYYB 2W7OA 4WYLA 5F3ZA 3QFHA 2YPYA 1TL7A 1FRMA 4TY9A 2QX0A 2MGZB 4DL4A 3NS6A 2DGXA 4HT5A 3Q8RB 3CCSS 1TMJA 2RSQA 5DG7A 1S1TA 4PG7A 2AD9A 3QAUA 2ATCB 4U8YA 3VR1A 1LXJA 4F3MA 4X4QA 2NR0A 4RUCA 4IG3A 5CZXA 2YNHB 5KFXA 1R31A 4HL9A 1FVQA 3SEOA 3R27A 1VC0A 1LWCA 2WVEA 2FYXA 3VF0B 4CLZA 2VFVA 4A8WA 3K2YA 5DJBA 4QWBA 2V8VA 1UVKA 5EX3A 3DXBA 3MM9B 5E7OB 2VFRA 3I4HX 3ZNJ1 2RILA 1RWKB 4HLBA 3M9MB 4WU3A 3D6TB 5FDLA 1SIZA 2ZFHA 3QNWB 4F0KA 1TK8A 2GFFA 1D0EA 2HS4A 1FE0A 4QU6A 1RT5B 2NZCA 3Q8SB 2AGQA 1PJ6A 5B0GA 1G7CB 1FA0A 4B9MA 4XIUA 3GCWP 3M2UB 3IWLA 2HNZB 4Q44A 1FE4A 1RAIB 3B78A 4A46A 2DGSA 1VC6A 3OVSA 4USKA 4I56A 3P3DA 3H90A 3PDNA 4JI2F 5EN1A 5D4PA 3GU0A 4XPCA 4LF4J 3UO0A 3H98A 4HR2A 1X4CA 4PG5A 2MQLA 3WC0A 1B64A 2DHGA 4MKAA 3MOZA 4AQYF 4ZP7A 4ICLB 1NPRA 3KLGA 5CYQB 4ID8A 2FLOA 4MIAA 3GJTB 3OTBA 5M2PA 1RU1A 3PY8A 2DGOA 3L09A 1U0HB 4M94A 5HVFA 2RT3A 5KFUA 1O6XA 3UDVA 2IRUA 3T1AA 4ZPBA 1VQ8S 1HW8A 4OL8A 2V9KA 1KHVA 2XB2D 1JLFB 3HI9A 3DGPA 1OSCA 5A0YA 4P2SA 8RUCA 2JNJA 2OEMA 2ZUGA 1RU2A 1K73T 5HBMB 1DZ5A 5B0CA 4PXBA 3EGVA 4LVNP 1JLBA 5KFVA 4V1Ak 1NSQA 3Q8QB 3J7YU 2XGPA 3M4XA 4ZKAA 2YKNA 4ED8A 3ITHB 1S9FA 4DR2F 2J9CA 2DNLA 4EWTA 2B9YA 5CCMA 2FLLA 3U1LA 1S6PB 3EX7B 4FYVB 4K2XA 3K5PA 4G1QA 1VQKS 5DZ6A 4NA3A 2QLBB 1URNA 4YR2A 3DMJA 4USVA 3BPSP 4K50A 1VQ9S 2E7XA 3LUYA 4ES3A 4F36A 5IM0B 4RW9A 1T95A 1VRQC 2HNDB 2QL5B 2ZVIA 4ILRA 2LQ8A 1HBMA 1RT3B 5KFOA 1ULRA 1TVRB 1F0XA 4F3OA 2WW4A 3R6GB 1QLNA 4FXVA 3BN4A 4RZRA 4DL7A 4PUOA 1PAUB 1TKZB 2AGOA 3G82A 5C2GA 4ID5B 2VJVA 4NA2A 1PG5B 5DZ7A 5F3TA 5B0EA 2BJ3A 5HP1A 1WSRA 4Y65A 2PDAA 1NHUA 1TK0A 1RAJA 3BKFA 2R8HA 2RF2B 2FGOA 2JC0A 1M90T 3V4IB 2YBVA 2IPOB 7FD1A 2V4QA 3GIIA 4J90A 5FIIA 5GVQA 4U67Q 3VCDA 2X7IA 2MB0B 2E1RA 2HHUA 1ICEB 3V81B 4URGA 3VGSA 1UTAA 1HWUA 2IM2A 4IYQA 2CQCA 4JP8A 4USIA 1S1XA 2DGVA 3M8SA 2IA6A 2A2CA 2E29A 3UW1A 2WBRA 4ZCKA 3P5TL 3QGHA 4KKOA 2AJ2A 5ETLA 4RNNA 4R0EA 4X65F 3TJ8A 4Q0BA 1WI6A 4JI8J 3FRZA 3DLKB 4MMOA 4X4NA 3K7RA 2CPZA 4PKDB 2R8KA 1Q8KA 3TI0A 4I7FA 5FLXY 1X4HA 2RHSB 4KV8B 2GMHA 2VOPA 3TEHB 2XYGB 1N5TA 1MROA 3GE9A 2BM0A 1LK7A 2PMWA 1AA1B 2B8PA 4TY8A 4EYHB 5AE3A 1NJIT 5J2PA 2ADBA 3MD1A 2V4JA 4X84A 3ET6B 1GMWD 3BQ2A 2CZ4A 3QZ7A 2GHPA 4PWDB 1VQSA 5HQ8A 2D69A 4B08A 4A4JA 4LVOP 2RDJA 2HWHA 2K3KA 2HIQA 5C25A 3D54A 4GVBB 3RGIA 2LA4A 1N88A 2AEJA 4UTGA 3D0IE 3FC9A 3HX9A 4I0WA 3HFVA 4FF2A 8ATCB 1L3TA 4IR1A 4OJHA 1UA1A 4JYAJ 2VQEJ 4LF9F 1G2EA 4C8KA 3DLHA 1NO8A 5G0RB 3GJQB 4M5GA 3KUHA 2CPIA 2UUBF 5AJ3F 1XNQF 3VZHA 4ZN3A 4PG8A 5J2QA 4OI3A 2VFSA 4U96A 3M05A 1O5JA 1EKRA 1NSKL 3AT1B 2NXUA 1LW0B 2ZOGA 4OYBA 4ECWA 4N8NA 1CSJA 2EKNA 1H6KX 4TVAB 4DHVA 3LOUA 2GZOA 4I2QA 3CCWA 5DLFA 1T9UA 2JEGA 4NLXA 3OQ2A 3UR0A 4RBUA 5KFLA 1OO0B 2JLFA 2ZD1A 4P75A 2IJNA 4NMLA 4F4XA 3KK1B 4OHWA 4HKQA 3MPDA 2LMIA 3CCES 1WKLA 3Q2SC 3HVWA 4DL2A 4YR0A 1RHUB 1IQZA 1WOSA 4H4MB 2VD3A 1FCAA 3MMAB 4ED4A 4IFVB 1RA7A 4LJMA 2J7WA 1MMLA 2A18A 1KD1T 2KJWA 2Q6BA 5A8RB 5GAGI 1Y7PA 2C3PA 3IRXB 1Y3KA 2B9WA 1C0UA 3EE3A 1H2TZ 2PGCA 4CTAB 4J91A 4DWIA 1RT1B 1N34F 1JWWA 1RTIB 4JB8B 3QIPB 4DV3J 6FDRA 2DNRA 3SIPB 1QE1B 2ZH7A 4U7UK 1EQMA 3PRVA 3BREA 2RRAA 2V6AA 4WF9Q 2OSQA 1S1UB 2XSFA 3H7HB 2MY7A 4A8QA 3VGVA 4IQMA 3C8YA 4NLYA 3HLUA 4Q5VA 2WSFC 1S4FA 1Y3JA 3ILJA 4RO0A 1IKWA 4KHPJ 1UWBA 4DX6A 4LR9A 2DGTA 4Y2KA 1R89A 4O4RA 4F2RA 3UD3P 3O44A 1X4FA 1CLFA 2JDJA 3I4PA 2P9EA 3EZUA 3HKWA 2HFNA 1LKZA 5HMXA 4LFCJ 1MWQA 2BM1A 3KLFB 4OX9F 3EYZA 1VBXA 1JXVA 3UDLA 3MFIA 4ZIVA 4M8LA 1IWGA 2CQGA 2CJXB 4ZJQA 4QIEA 3U02A 2FHKA 2UUAJ 5LMNJ 4NCBA 1VIOA 3QRPA 2XY6A 3OVBA 2PT0A 4DFMA 4ZVRB 3BO2A 2HIYA 2M88A 1TKXB 4M5DB 1FEHA 2DXDA 1HIYA 3UN2A 2ZE2A 3PRDA 3OTEA 3POTB 2FY1A 2CQHA 3MEGA 2FJAB 2VICA 2W2OP 2G0IA 3BO3A 2LP4A 2C2OB 4O4GA 7FDRA 5J1EA 4DR5F 1S4EA 3W63A 1ZTTA 1NJWA 1JK9B 4RR5A 3LALA 4DCPB 3O3LA 1TV6B 5KFJA 1W7WA 2SXLA 2HQIA 2DD8S 1RT4A 1XTZA 1RCXB 3SMZA 4NWBA 3TZYA 4QR0A 2FHMA 2K06A 4CM0A 2ZM6J 4DR7J 4LRDA 3MDFA 5E33A 1CS4B 4X4OA 1YRUA 2EEYA 4JI4F 3H5UA 2F65A 1QY7A 5IT0A 2DHSA 3LANA 1HD0A 3DI6B 2HHTA 4ZVHA 1UFKA 1NPKA 3KK2B 1LEOA 4DV4F 1LNQA 5HROB 1JLAB 4CH7A 1I3OB 1UW4A 3CNQP 4YY3J 2Y1IA 4N8OA 1NKEA 2GIRA 5D0RA 3G6YA 2W2QP 2KT3A 4FF1A 1VJWA 2OEKA 4EBCA 1DAXA 2VFUA 3GB0A 2IMWP 4BLGA 4TU9A 4AL7A 5KFDA 2Y3YA 3NGKA 4X62J 1SI9A 2BW2A 3N6MA 3K5NA 2R7TA 5H1SV 4D3HA 3AODA 3GJRB 3QMQA 1ZA1B 4CLSA 1RT6A 2RH3A 2G2YA 3ZTSA 4DSIA 2R8JA 3SQGA 3JQJA 2AYMA 3H5YA 4PZVA 3Q86A 4NYPA 3R7SB 5C42A 3H4BA 3K5LA 2PI4A 3OR2B 1C4CA 2L08A 5KFBA 4ZK7M 1X60A 1VR6A 2ZUAA 4P74A 3AQPA 1J27A 5IQ6A 2BOAA 4PQAA 4RW4A 2XMVA 2GVZB 2E5HA 1C1CB 2E9RX 1HWIA 4RBTA 2HHWA 1GXTA 2Z57B 4J9UE 4ZMMA 1HL6A 2OMOA 4IOCQ 1OQ6A 2UU9F 2JRSA 3OL9A 3A8KA 1PKUA 2HQDA 2WCXA 2U2FA 3IAS9 3KHRA 1DQAA 1QM9A 1NM2A 2QMWA 4ALZA 5LT5A 4P7TA 5DG9A 2UVRA 1H98A 5E0OA 3UD5A 3J81Y 3HZEA 1EJ7L 1QAJA 1OY6A 2RD5C 3HHLD 5F8LA 1IQTA 2QLJB 4YDXA 3BH6B 3M32A 3DRRB 3EICA 4FF3A 1S0OA 1ZH5A 1F9FA 4IO1A 1JLCA 3EM1A 4OYWA 3EVWA 1QTNB 4AD6A 2V69A 2P9CA 3TZXA 2BBEA 4XDDA 2W01A 3OVAA 3CXCR 2OEJA 4CT8A 2N7YA 2W7PA 2YX1A 4OFZA 1RBAA 4M5JA 4DJBA 2IDEA 1RWVB 3T6JA 1FDAA 2CQ4A 2NLWA 4KGZB 2DNGA 2DBBA 2CIMA 2QO3A 4RWXA 1SJ3P 2UUWA 2K3IA 3H2UB 1IJFB 2AX1A 4N77A 3C16B 3RU0A 1X9WA 4WFNQ 4M5LA 1NRKA 1OWXA 4N56A 4DXLA 1IBKF 4IH6A 4DR6J 3Q8VA 4RW6B 1RAGB 5D3GA 5HI7A 3C15B 4ERDA 2KB2A 3HDSA 1R8BA 2IAJB 5J2MA 2BE2B 2GGPA 3FBFA 3F73A 1DLOB 3IG1B 2GS8A 3NOCA 3BR9A 4ZPVR 2ZBCA 4DQRA 3PR5B 2V5HG 4CO3A 2C2ZB 1NK4A 4USMA 3HD1A 5F8IA 4ECQA 1DTTB 2MZJA 4QR1A 5KG6A 4NLGA 1REVA 1HBUB 3TVYA 2QGFB 2MMYA 3CJ5A 1JLGB 5D77A 2EW9A 1YGYA 4D3GA 1B4SA 4LBPA 3NEKA 3C14B 2CNKB 2G13A 2W4DA 1NDCA 3CB4A 1WF0A 2NXJA 2QRRA 1C0TA 4CCHA 3P4UB 5D4LA 4X4VA 2V2VA 5D8HB 3THVA 2NQPA 1HNWF 3SBMA 3F41A 3DDKA 1H7XA 4DR3F 2FTRA 1APSA 3WX4A 4KHRA 4LFAF 5D4OA 1T9TA 1X9SA 5HMYA 2ASLA 1WTFA 3N5FA 2AV5A 4QWCA 2KFNA 5CYMB 3HK2A 1UL3A 2VG5A 3KHHA 3MF5A 3PIOQ 2G0JA 1HARA 3H4DA 2BQRA 3JSYA 3SV3A 4OYZA 5A8WA 3ENVA 3M8QA 4XPEA 3BEGB 3KK3B 2LYVA 1BWEA 4HHHA 3V6JA 2LEBA 3ZZOA 2CQ3A 4KRWA 3W65A 2M8DB 4FNIA 3CD7A 4FYWB 4CLFA 4CLPA 1XERA 3I0RB 2Z56B 5KFPA 5JXSA 5H9EJ 2DKOB 1IKVA 5T41A 1X4AA 4W92B 2WAQD 2QLFB 5D4NA 3ISZA 1V5IB 4QWEA 1WKJA 3MECA 5CYJA 5EX0A 1YLXA 3OUYA 2CDRB 4WWSA 2FJDB 3DN9A 4DR4J 4OZLA 5G4DA 1T3OA 2A3JA 2ILZA 2HK3A 3IR6B 3GFHA 4RUAA 1U09A 1UVMA 5A2QU 2WONB 3FCVA 3G2XA 4ZDNA 4DFKA 3NBPB 1TKDA 1TQLA 3I5BA 5L1LA 1S72S 4IDKB 2B6AA 3CDUA 4BBYA 4RUBA 1F3FA 4EZ6A 1HKAA 4WCEQ 3DYAB 1TU0B 2WZ1A 5LMUF 2DHXA 1D9FA 3DXSX 5KFYA 1TL1B 1Y5LB 1N33J 3LGHA 3T1YF 1PGZA 4NRUA 1MMNA 2KL8A 2W7AA 4LF7J 5KFMA 2CNLB 1H7WA 3CDWA 5JUMA 3BDEA 4FZVA 2OPSB 4B3MJ 4PQUA 2FY8A 2F63A 1N4LA 4NPOA 1GXUA 4XDCA 4DSJA 5HL7Q 1YBAA 4LF4F 3I0SA 2I5JB 3MEDA 4XTTA 4ZVUB 3MR6A 1S59A 2V8DA 2PIIA 2VASA 4N7TA 1TAUA 2ZH3A 1X8DA 3OLAA 4KT0C 4ZIWA 1OMSA 4M5KA 1CVJA 4J9RA 3R97A 2CDQA 1KS2A 4ZLJA 4L75A 2OLWA 3BSNA 1PC4A 3HO1A 2ZHAA 3UCZP 2B56A 2LQBA 3FBEA 4F4YA 3JSMA 4LF2A 1YWXA 5CABA 1S48A 5A2QY 1YJRA 3OTOJ 2A6MA 3G71S 1YIJS 1QTMA 4F4AA 1UFLA 2VODA 4EFAC 3MR3A 2D3O1 3GPAA 5MLCV 3MCMA 2YNFA 2X1FA 4GKJJ 5CCLA 5IZHA 4ECYA 3QWUA 3T5JA 1DJ0A 1XQIA 3WC2A 3KYLA 1N5YA 2LDIA 4MJKA 3TX8A 5LSLA 2C2RA 1YTYA 3VQTA 3C2PA 3IGNA 4B3OB 1RLDA 3O5TB 4NCGA 2JJ4D 3CT9A 5E3PA 1H74A 4PWUA 2DCUB 3H40A 2CXEA 2EK1A 2R7UA 1PYSB 1CJTB 1OYDA 4QYRA 5HVHA 1T9YA 3Q22A 1RACB 2WK4A 3OPKA 2XBPA 4F4KA 2IVYA 3OFGA 3DLLQ 1GNKA 1VOMA 3GFZA 4DPYA 2DY1A 2WOMA 3OW2R 4N76A 4LRBA 1RE1B 3DOKA 2QG9B 2DPJA 3T9NA 1PBUA 3DOMB 1YBUA 3M30A 1TMMA 3GILA 1F2HA 3BBFA 3VALA 2Q43A 2UXDJ 4NLWA 3BGFA 4DZDA 1L3UA 4O3PA 1YDLA 3JTNA 1RYRA 4ED3A 3BKUA 2C3MA 4TYBA 2CPFA 4J9LA 4UT4A 4K5SA 5MAOA 4ZHRB 1T9XA 2HPUA 4ZVTB 5B0BA 3NKYA 4AYBD 2XO6A 3ENAA 2RRBA 4K2JA 1UJ5A 2ACYA 2LQ5A 3KKFA 3KOAA 4DL6A 3E01B 1VQ4S 2HRUA 4OX7A 3EZ5A 5EUHA 4ZJLA 3IC1A 2WB4A 3MM8A 4WBFA 5J2NB 3KJVB 3FUYA 4ANEA 4OIXA 4WTOB 1M1KT 1NXIA 2AJQA 2YKOA 2JFDA 3D7SB 3RBXA 5LL6d 3BQ0A 3SCJE 3TZWA 2F1FA 2M0GB 2PD1A 2CYYA 2F9DA 1S5ZA 2DIUA 1P9QC 4A8XA 1QDUB 1QJHA 2W9BA 2HVZA 4WE1A 3GIJA 2JZ5A 3D3CJ 1MSWD 3HHLC 1S1VA 3FEZA 2JLGA 1LWFB 2FC9A 1AT1B 4JI2J 2JEIA 1MLAA 3FQLA 2NXNA 1DFDA 1ZS6A 1UAWA 3WHIA 4ZN1A 3ZO7A 1TL7B 2HAIA 4PABA 2YKPA 2A6OA 3I9ZA 5HJYA 4AQYJ 3IS9B 2L41A 1TUWA 2VQEF 4DS5A 2C3UA 1BLUA 1NK0A 2HWIA 1VQOS 4HHJA 1S1TB 2LKZA 1VRTA 4UZCA 5L1JA 2K7KA 3MEKA 1M1HA 3DC2A 1JJ4A 1BUXA 1L3SA 3C6UA 4IG3B 1S1WA 5KT5A 3LP2B 4C8MA 2J9DA 3ZZTA 2UP1A 2BYCA 5KT3A 2VH7A 4OX6A 3N01A 1RCOB 2HLTA 1R3NA 3RG6A 4C9DA 2IM1A 1EZZB 5BXIA 1NK9A 3QGGA 1YX2A 4PEOA 2QA4S 4ZA1A 3HHLB 1ZOTA 4E0DA 2GNKA 3VHQA 1IXKA 4ES1A 4HTIA 2HHQA 4J9VA 5K9FA 1AFJA 2IA0A 4RW7A 5HN0A 3W7BA 2YQ3A 2DNNA 1NU4A 2I38A 4U9RA 1Q81T 2UZAA 1NJZA 2ZH9A 4BDPA 1KWMA 1FTRA 2JL9A 4EK2A 3U1MA 2LU1A 4DUZJ 1RWPB 1WDDA 4OZJA 4ECXA 2VA3A 3MCNA 2EC0A 2KU7A 2QLXA 3PNIA 1MWYA 3VVUA 3J7YI 3EZOA 1MU2B 2HYIB 4Z2XA 2FJBB 3K17A 1QUPA 1YJTA 1XWLA 2ZBIA 3CDBA 1JQGA 2R2TA 3OFEA 1U6ZA 1N0VC 2EG1A 2FHOB 3LAMA 1VK3A 1R6YA 4CO2A 4MYUA 3BSCA 3P45B 1CJUA 3PFOA 3PYFA 3A8IA 4FPRA 3HJVA 4WJBA 2KH9A 2HGLA 2IIHA 3US5A 1JIHA 4B17A 4L3KA 2RUSA 1PC5A 2PSZA 4ZCMA 3J80U 5A0YB 2C28A 5GAHU 2MHEA 1YRTA 2QE5A 3BBBA 3OHAA 1IN0A 2ZH5A 2KRBA 5KFAA 2B7CB 3CMAS 5DDOC 3MMBB 1KEKA 4B3TJ 3PXGa 3UDCA 4HH1A 3RB3A 1JLBB 1BQMB 3HF5A 3QO9B 6AT1B 1VRUB 4PYAA 1FKPA 4KHPF 1KQGB 3RTVA 1OPIA 1AXQA 2JX2A 1PO6A 1RTHA 3ONQA 4K59A 4QIGA 2HMIA 3NAHA 3JYTA 2R2RA 4LFCF 2E1MC 2H1YA 4X65J 2MSSA 5C2CA 1SQEA 3U27A 4J9OA 3EGWB 2K1RA 3RAMA 3DMJB 3MMCB 3ISNC 2QFIA 3EDQB 4RW9B 4QR2A 1D3WA 5LMNF 2MLYA 2DNOA 1VLOA 2FIUA 4DV2F 4LF6J 1HBMB 1T05A 4CQ1A 4RJVA 1OJ4A 1N52B 2J6TA 3LGNA 3OL6A 2HQFA 1HWJA 1Z4UA 3EXCX 1EIYB 3OBIA 1SC1B 3WDOA 3G82B 3ENWA 3FK4A 4IH5A 1EETA 2EFGA 1S6OA 1RAHB 5HP1B 2MQPA 3IBWA 5IWAJ 1EB0A 4C0BA 4HACA 5CA5A 1TL5A 2CJ9A 2A0FB 3ELHA 2D7SA 3JAMU 2HSEB 3R8YA 2C2KB 3DLBA 4QQBA 3J80Y 3CO9A 2OGUA 4S0MA 4Z7CA 4LF9J 3P5BP 5LM7E 4K8RA 4N5SA 4UW2A 2RDDA 3M8PA 5KT4A 2ZM6F 1HYSB 3OXGA 3NGTA 1O0PA 5AJ3J 2HWTA 1RTDB 1WC5A 2DO4A 4DOZA 4RLEA 1ZM2A 1IR2A 2IM3A 3CC4S 2FVSA 1U1NA 1KLMB 1ELOA 4H4OB 4WXOA 4J5OA 3ZZ0A 1O51A 5KFFA 3KLIB 4H4KC 2B9XA 2F8EX 3RBZA 2V2ZA 3RJMB 2F8MA 4LRCA 4FNHA 3PJXA 5A8KA 1NK8A 3AJ2A 3AD8C 2ZJQQ 1FKOA 3UNGC 1Y5NB 1LWEB 3FGVA 1BC6A 4DPXA 1H3DA 1MROB 5I3PA 2GAHC 3HHKA 3OTDA 1KONA 4KH0B 4X62F 1KOHA 1H38A 4QWDA 4OZ2A 4NI2B 5L8RC 1FD2A 1H0HB 2UXBJ 2ZEJA 4YB1P 2DY9A 4DSKA 4DZ6A 5KG3A 4L76A 1I51B 5C5JA 4DF8A 1N32J 4OLOA 3CW2C 4NZ6A 5DM7Q 3C6TA 1RHMB 3KG0A 4C8OA 1YSJA 1K44A 4NYZA 3TJAA 4KTQA 2J6UA 4NLTA 3D28A 2MY8A 4F3QA 3JAMY 3CDEA 1HBOA 2UUTA 2F3JA 1HWLA 1YJWS 2KYZA 2MGZA 4TNOA 5H9FK 3NGRA 2PMHA 3G86A 1HA1A 1XMOJ 1X5SA 2Y8YA 4DG1A 5DDPC 2RJZA 4YEAA 2LXIA 1FRHA 2DXFA 4ED5A 2RU9A 3QPIA 4UUXA 5J2QB 1TP7A 1Q95G 3IO1A 3M1VB 4ELTA 1RWOB 1D8ZA 5HSPA 2CJYB 2H3EB 2YNHA 3W9JA 2V8GA 2WBMA 3BGLA 1FTCA 2PA3A 3N0VA 2E5LF 1T03A 4PWWA 1SH0A 3W5ZA 3I56S 3UFCX 5F0WA 1W25A 3MM9A 3ADAC 1IBLF 5C24B 3EDRB 3JQKA 3RAQA 4C11B 2QEXS 1S79A 2OP5A 3CD5A 5IV3A 3UNYA 3CE8A 4NZ7A 4OZNA 2CRLA 1RT5A 5ETOA 4AXIA 2HBZB 3TZZA 4QYZK 4WFZA 1M5KC 3NY0A 3M2UA 2HNZA 3CJ2A 4GKKF 3KJNB 4DN9A 1BD6A 1V6HA 3NOGA 1Y00A 2BJ8A 4DF4A 2CWKA 2MHNA 2R3VA 3HHEA 1AFIA 1FHTA 1NLKL 3ZZPA 4DR6F 4K7QA 3NNAA 3UCGA 2V50A 3R9LA 3PYDA 5RUBA 4I67A 2CJAA 2COLA 2N82B 3QQCD 4BC9A 1IBMF 2CQPA 2FVPA 1SKWA 3BGRB 1NHKL 2ALZA 4U8VA 4ICLA 2OFGX 4NRTA 4JI7F 1YRXA 5KT6A 4I1TA 3QLHB 4BWJA 1FJEB 4FBUA 1UZHA 1BQNB 4FPIA 3WIVA 2J8SA 1U0HA 3QZ8A 1VMBA 2WVCA 3T3FA 1S57A 4MK8A 2NUHA 3FCWA 1GMUA 1JLFA 1JJ2R 3IM8A 2MPUA 2MJUA 3OL8A 4KJIA 3PM9A 5HBMA 5JVGQ 1NKBA 3E3XA 1IKWB 4ZVQB 3W5YA 1UEKA 4GVLA 5DQGA 1WEYA 1JLQA 3MM5A 1WHXA 1I94F 2RAQA 5F8NA 3PFEA 2M7SA 2RQMA 2HFSA 2NSCA 3UD4P 4USTA 2XMTA 4KGKA 2XTJP 1S6PA 4P2XA 2HBRB 3BSOA 3TP2A 2D9PA 3A12A 4TYAA 1X4DA 2M2BA 4RW8B 4I69A 3I87A 3EJMA 4ZOSA 1VQNS 5BR8F 5IM0A 4PXEA 1DBDA 3CMQA 1S6UA 4TU7A 2HNDA 2YTCA 4ETZA 4ZP8A 2HEKA 4K4TA 4OYXA 1ZA2B 1WHVA 1RT3A 3HSZA 3PHTA 1FT8A 3KWMA 4GMKA 2AJFE 1NZAA 3HCXA 1TVRA 2XM3A 4EYIB 1RP5A 2Z58B 3G96A 1L3VA 2ATLA 3R2CJ 1HNIA 1TKZA 3ZXWA 2HS0A 2Q3PA 3M2VB 1OYEA 2BXJA 4ID5A 5J1EB 2CPEA 4QWAA 1HFEL 2ZVSA 3IN5A 2UV8A 2RF2A 4QU7A 4JI6J 1UWAA 3JSBA 3V4IA 4J7CA 5GAEU 3LWMA 3Q83A 2AYBA 3VAHA 2V94A 2UU9J 1U0SA 3QIDA 1Q16B 4F26A 3W62A 2B0GA 1E6VB 3TNVA 5I3UB 3NWRA 3FZ2A 1URRA 3V81A 1HNZJ 4W98A 2P6SA 4ZP9A 3GSDA 2Z2LA 2QC3A 1YHQS 1RKJA 2I2YA 2QTWA 1WD6A 2FHJD 3LP1B 1RLCL 1S7IA 1R0BG 2YKMB 1HMVB 4UOCA 2IJFA 1XR5A 2VONA 3DLKA 4P6QA 2FZCB 1HQEB 1WF2A 4WP9A 1FJGF 2ZWOA 1U26A 2HK2A 4KV8A 4YB5A 4WZQA 4B3MF 5KFIA 4JOUA 1QSYA 5DDRC 1XN9A 3O1LA 5IT4A 3DDIA 3GG1A 2HRTA 3IR7B 3CJKB 4USHA 2O01C 2AYEA 2RRNA 3SQGB 3CTRA 5GADI 1S9EB 5KFTA 4X66J 3ET6A 2HFUA 4PWDA 4X4UA 5C42B 4OV6A 1XC9A 2C2NA 5CAAA 1NDPA 2O5DA 2ZZNA 3HFZB 1S6QB 2BACA 4DPWA 4GVBA 1IBKJ 3OV7A 2KN4A 2I9SA 2P9GA 3AJDA 4RW4B 1Z2ZA 3FEXB 4ER8A 2HZVA 1N5QA 2U1AA 2MLZA 4ANCA 3KXDA 4LRAA 5L9NA 1ZM3A 1OS5A 5G0RA 2XY5A 3QT5A 1KRPA 4JI3F 4MT1A 3SDEB 4FVCA 1PYTA 4DSLA 3RB4A 1SXLA 2HNYA 1WJ9A 2OUGA 2E7VA 4KGMA 1K1SA 3B4MA 4EBEA 2OELA 3MR7A 4ENOA 1GFWB 1P27B 3M32B 3DRXA 3PHEA 1NEEA 3DOLB 2BJ7A 1U1MA 2QMXA 2ZKTA 2HQ3A 2OPRB 2EBGA 4DPOA 1HNWJ 3AD7C 3R1LA 2KT2A 1NK6A 2MYFA 1YK9A 2H54B 1FO1A 4JV5F 1WC0A 4LFAJ 2XI2A 4A8KA 3IM9A 5BYQA 4ECZA 2K8GA 3D5MA 3DLEA 1LK5A 4NZ0A 5HAOA 2KJVA 2R2UA 1SC6A 3KK1A 2RQKA 5L39A 3BS9A 3HVRA 1HPZB 1VIXA 4R5PB 3TAQA 2CPDA 2A2DA 4ZLLA 2VB6A 4X4SA 3MOJB 4H4MA 3RRHA 4WYWA 3UVJB 3ZC4A 4IFVA 2J6SA 4J9SA 2X3DA 3WIUA 2VBYA 2BOPA 5K5MA 2XNQA 2EFVA 4FS2A 5F41A 3QBCA 2FUG9 2JOQA 2HZCA 2UXDF 5IC6B 2Z4PA 3IRXA 4B02A 1LXNA 2R7XA 3PACA 4NA1A 5B08A 4CTAA 4DFPA 1RT1A 2JWNA 2RKIB 2MZRA 3TW0A 3TA0A 1RTIA 4RNFA 1Q5YA 3Q8UA 3QIPA 1NBEB 1MG7A 3T5KA 4DV0J 2OKQA 3ILIA 2F4VF 4DEZA 2GJ2A 1S7HA 1VI7A 5AXNA 4KO0B 2QT7A 1AW0A 3PKMA 4ANDA 1S1UA 2FC8A 1SL1A 3W9IA 1WG1A 2KI2A 5KG4A 1TELA 2XS7A 4CH1A 2J8AA 4LIRA 3M9OB 3FMBA 5EDWA 1HD1A 2MKSA 4NLQA 2E66A 4Y2CA 2Y8WA 1QVGR 4HHUA 1NH8A 1KHWA 2MLXA 5HJXA 1RT7B 2Q1LA 2V0NA 5LMUJ 1LW2B 3HZGA 2BRLA 1HR0F 3S01A 4YR3A 2K7JA 3T1YJ 2DH8A 1DTQB 1FKAF 2CWXA 1XR6A 1CULB 4OLPA 2YWGA 4M1KA 2YNIB 3CJTA 1GMVA 1ZPVA 2RS2A 2IJRA 2G9OA 3T19A 5B0DA 2DRAA 2GW8A 1OIAA 2VG7B 1I6JA 3PW0A 1YJNS 4LR8A 2LQ9A 4R0JA 2BEFA 3CCTA 1XK8A 2F9JA 1TKXA 4M5DA 1R0CB 2AEFA 1HNVB 7AT1B 1SJQA 3MEEB 2AJ0A 5ETTA 3ZZZA 3F44A 2R8GA 3FFIA 3I82A 1RDRA 3POTA 1JKHB 4QIVA 5JVHQ 3D3BJ 3MAAA 4LMZA 2AZ1A 1VHIA 4O3NA 2N7CA 3MECB 5DRKA 3PX6A 3IRWP 4DPTA 3CMES 1RBOB 1TV6A 2YQ0A 2HHHJ 2H48B 1U2CA 1VISA 2G0CA 4J9QA 3K0JA 2VG6B 1AUSL 1SJ1A 3MD3A 4IRDA 4H54A 5HK4A 1CS4A 3MAQA 3RBEA 3CF5Q 4DN0A 1QAXA 1VFJA 5GMDA 4B9TA 1HI8A 3Q8YA 3MGJA 5K20B 5A6PA 3DI6A 3KK2A 3V4MA 3VQSA 2CJQA 3D0GE 1JLAA 4P73A 1D9DA 1H2UX 3TOQA 4IOAQ 1RWWB 3FRYA 5FLXU 3AH6A 3BR8A 3BO4A 3RR8A 4DX7A 4K4XA 4DUZF 1S9GA 3C66A 5L38A 1C4AA 3V6DB 3R5CA 1LOUA 4AE5A 1KR4A 1S12A 5LJ5Y 1RHQB 3FNNA 5B0AA 4Z7YA 2BJEA 2XGQA 4DBQA 5D0HA 2W25A 3IAM9 2MZQA 4OYPA 4IUFA 9ATCB 1UA0A 3RAXA 4L72B 4QIFA 3MM6B 5DGBA 4FBTA 3R6LB 2D3OR 1X0FA 2APOA 1Q78A 3OR2A 3UN5A 4K4SA 4Y2IA 4GO7X 4LQ3A 3UCUP 2NZ4A 2GVZA 1C1CA 2Y0SD 2QN6B 3B54A 4B3TF 1HHTP 2ZNZA 1TR0A 3SI8A 4KFBB 2YWHA 4A8SA 4LREA 2VDHA 2FB0A 1T0TV 2OAUA 2QL9B 4CWBA 2J0XA 1U4BA 5ETKA 2ZOFA 2R7VA 2YWKA 1SH2A 1U47A 1Q86T 4A8FA 4NXMF 4DU7A 5EGYA 1OSDA 4O44B 2BJ9A 2CG4A 2E1AA 4MFBB 1CEZA 3IMQJ 3DRRA 1C2PA 4MH8A 1YJVA 1T3NA 4LSLB 2NS1B 4EGLA 3EMTA 2V2KA 3K59A 2PFDA 3KMQA 1M5HA 4DR1F 4LF6F 4YMEA 5E3AA 3UR3C 3BM7A 1R27B 2JVRA 4KGXB 3ZTRA 3V2UC 1GTHA 3WX8A 3LAKA 1FDBA 2UUCF 3B8HA 1IWAA 3N9UC 4B3SJ 1ZBTA 5DG8A 4ZJOA 2AW0A 2OPPB 3RYLA 2H65B 4NLDA 2EG2A 5IWAF 5D78A 1RHKB 2EI5A 2JH3A 3P49B 3R5GA 4EO6A 3VAMA 3M30B 3QWPA 4DV1F 3C16A 5IQQA 4DSFA 1RHRB 4Z37A 5L1IA 2J9DE 1GEHA 2BV3A 2GHVC 1Q1KA 4C48A 1NZ8A 2JVOA 4RW6A 4KAIA 2CQ1A 1YZ7A 3MURP 1XNRJ 2IAJA 3PO5A 2BE2A 1DLOA 4DL0C 1SUQB 5DO2A 3UDEA 4DL3A 5B09A 4LIWA 4ZLPA 5CQGA 4ATNA 2E44A 3PW4A 4PXDA 2RHQB 1IKYB 3W2VB 2PN6A 1DTTA 1TAQA 1NNDA 2HVIA 3M6UA 2D3ZA 4CO1A 4E98A 2PEHA 1HBUA 2FD2A 2CQBA 1JLGA 4ECVA 1JNZB 4M63A 4DCOB 2ZHBA 1N54B 3C14A 2M70A 1VQ5S 2ZOMA 2QL7B 2XG8A 3DRPB 1HNXJ 4XO0A 1NDLA 4OZ3A 5KTQA 3TEGA 3MM7A 3W64A 4JUZA 1FWLA 2KFYA 2QFJA 2MJNA 1QD1A 2UXCF 3PJWA 1SKSA 2UXBF 5DETA 5DDQC 4DUYF 1Y9OA 1DURA 3IP0A 5CYMA 3TVZA 2W9BB 1W2BR 2GJFA 3IBCB 5IC4B 1R0AA 2F4FA 2Y0BB 3RW7A 4OHVA 4Q2LA 1S1VB 3DRSB 4WXWA 4A8OA 1N32F 1R8CA 1WG5A 1RUSA 1N36F 2CVEA 1RI7A 2N4DA 1NSPA 4EEYA 3AA9A 4KBIA 3KK3A 1WG4A 1DARA 2GC8A 2V2QA 3VGTA 2W9CB 4OZ0A 2E1CA 4F67A 2BKPA 4A8YA 1U2FA 2ZBPA 1GMWA 1TTHB 4KSEB 2IC3A 1XMOF 3A4TA 3Q24A 2DHAA 1FX4A 4LSNB 3M7VA 2QSFA 3H2VE 2V67A 1TL3A 1C1BB 3G87A 1PJ5A 1U1KA 1U24A 3TR5A 2EFQA 1D9AA 4NXNF 2KRRA 4Q7AA 1IKXB 2RU3A 4ZPCA 2FJEB 4EMDA 4BHQA 5HMZA 3EUNA 1HBNA 3TUPA 3PX0A 2MQMA 3D2WA 4YUDA 4CRJA 2WONA 3CC2S 5CD4A 1TKTA 4DQIA 4DLEA 3NBPA 2HW3A 3ZZYA 1TFYA 5HMWA 4BS2A 4IDKA 1GH8A 2HURA 1SC3B 4R8UA 2BANB 3DYAA 4E8UA 3KUEA 1RABB 1GTEA 5HVGA 1TL1A 2W8KA 2ZDPA 1FK9B 4PYDA 1N48A 1JJHA 3LH2S 1RT2B 1VYAA 5GAHI 5K8NA 2DR5A 4DV2J 2XSJB 1Y0HA 3MMJA 5KG2A 3HHNB 2OPSA 3A1YG 4YHHF 2G2ZA 4HEA9 3KFWX 3GP9A 2I5JA 1B7YB 2FJVA 1T9VA 3C46A 2HHVA 3HD2A 3M8RA 4M5HA 1HQUB 4PRFA 4IO9Q 1M5PC 4DI6A 1HLWA 3P6YC 1QSSA 2ALYB 3PW2A 2OJ3A 1BMQB 1OY9A 2OIHA 5LJ3Y 5KFEA 3T5HA 3A8JA 5ETMA 1N5VA 4DS4A 3OL7A 1KSPA 5ETPA 2M52A 4G1PA 2GO8A 2AF6A 5AXKA 3NCPA 3GG0A 2HFOA 4UOHA 2WSCC 2BW7A 5GMKa 8AT1B 3J81U 4QOTA 2G4BA 2DT9A 4EZ9A 1X5TA 2NREA 1RADB 1U25A 2AQ4A 4F4WA 2QZ8A 2BJDA 3SSSA 3A8EA 1U7LA 3CD6S 2BKOA 3SV4A 2VIHA 1IBCB 1N6QB 4ES2A 3CO0P 3EGNA 2P6TA 3ZTQA 1M5SA 1Q82T 3TAMB 1M5VC 4B3OA 2CAJA 4G6VB 2HHXA 3D6HB 5T7LB 1NB7A 1RTJB 4KB7A 2VC0A 2JC1A 3BN7A 4OI4A 2B4VA 2XI3A 4F7VA 4I6YA 1CJTA 4LR7A 3IFEA 3QFWA 4G65A 4K4YA 2NYHA 3KLEA 2BRKA 2W4CA 2F40A 3CULA 1JXLA 1EETB 2HFZA 1YZ6A 1K8AT 4X64J 3TUZC 2YVSA 1Y10A 4C3MA 5HLFB 4U7CA 4HACB 4TN2A 5KFNA 4EU0A 4MYTA 3DOMA 1K0VA 3CCLS 1R8PA 2DEIA 4YN3B 4JI6F 1S49A 4TQSA 1SV5B 1U45A 2XC9A 1FF2A 3SCIE 2DR9A 4A8MP 2GA7A 2NCKL 1RZMA 2CZVC 3H2LA 2CZ9A 3CCVS 2CJBA 1A9NB 3H5XA 3X3UA 4P2FA 5GADU 1XMBA 2ZJPQ 3MTKA 1HNZF 1VQPS 3MUVP 4C8YA 9RUBA 4NCAA 4ZHRA 2DNKA 4P7VA 1UVLA 3BGOP 3Q2TC 1NK5A 1I5OB 1IM4A 1HHQA 3EXYA 2E5LJ 5ETRA 3E01A 2ZJRQ 1XEZA 3DHXA 1IBLJ 2C2MB 5J2NA 3KJVA 2NXCA 1P6TA 3LTOA 1RBLA 2CFXA 2R4FA 4ZVOB 2PMZD 1CC8A 3G6ES 2AKWB 2LXFA 4QW9A 1WEZA 2W2NP 2RVJA 1WTBA 4L74A 4CNZA 1KLNA 4LF8F 3SZ2A 4MK9A 3GIMA 4GKKJ 4M5MA 2DGUA 4AFFA 4X66F 1FWPA 2XYPB 1NAQA 1LWFA 2DNHA 1N56A 1MN7A 2Q6CA 2NPFA 2VBZA 2XLIA 3OTCA 5IV4A 4KC5A 2DITA 1HBOB 3J7A1 4DPUA 3LP0B 2X1AA 4KR0B 3MR5A 1FFWB 2X3GA 2H5JB 1IBMJ 3PO4A 1R43A 3IS9A 2AX0A 3MCSA 2W4PA 4HDGA 4JI7J 4DG1B 2W2PP 4Y6IA 4RNMA 1WI8A 1Q4RA 2M3DA 3GV7B 4I6WA 1CQNA 2OHDA 2GVDB 3FSXA 4I2PB 3NNCA 3BV8A 3ZTOA 4MAKA 2OD4A 3K5OA 2KTQA 3LP2A 3I5AA 2R42A 4DMZA 1RJJA 3CWJA 4WK1A 1T03B 3GONA 1RKIA 3LW5C 5IOLA 4DV6J 3TARA 2VA2A 1S97A 1I94J 4RNHA 1HWKA 2V8HA 3V6KA 3JS9A 1WC6A 3QJPA 3HHLA 4PCQA 3THPA 4IG0B 1T94A 1SJ4P 5IS2A 2YNGB 2OMLA 3L7OA 4I4BA 3KHLA 5BR8J 3D6FB 1U8WA 4RU2A 2N3LA 1ZAWA 2CNOB 4JI5F 4M5NA 2KHDA 2XMAA 3W9HA 2AGPA 1OY8A 1U2RA 3GCXP 3OSPA 4ZPWR 1KFSA 3H8YA 2VC1A 1MU2A 1E6YA 1HW9A 2VQFF 3B82A 1FRIA 3PX4A 2BQ3A 1B70B 4Q8EA 4CH0S 3QSYB 2AIRB 4IOBA 2DR8A 2J7UA 1OQ3A 2IBOA 3NWGA 2FDNA 3W2WB 2QV6A 4DV0F 1S0NA 1RAAB 1SL2A 3FSIA 2XZWA 3IR5B 3ISND 3QATA 2R7QA 1VC5A 1JLEB 4K5RA 4KPCA 2DGWA 2L48A 2IMOA 3VAJA 3AFGA 2VUGA 4C2MA 4RPFA 1JXEA 2ZKUA 3Q0AA 2QLWA 3MMBA 3VZIA 4Y00A 1BQMA 3KLHA 1EP4B 4ECTA 1FXDA 3QO9A 1VRUA 3HT0A 3T1HJ 2KYXA 1JLQB 3MM5B 1PSDA 2XNRA 4J9KA 3T41A 2OPQA 3UPFA 2XZDB 4ZPDA 5F0UA 3BGUA 4DV7F 2IHR1 2ADCA 1FEEA 1H73A 2MKHA 3BSAA 2AHOB 3THTA 5I42B 2FJXA 3I55S 2ZC3A 3MMCA 1QVFR 1FJGJ 4WU2A 1WKKA 4C7QA 5GAEI 4ECRA 4OYAA 2D1CA 4MKYA 3TYTA 1IVZA 3U1NA 2DR6A 1ZTWA 4BCAA 3GJSB 3HFKA 3FVYA 1CJVB 2W1BA 3DLGB 1R8AA 1AZSB 2RDIA 1DQ9A 2FPHX 4RU9A 3D67A 5C7PA 2HBQB 3A3NB 1WUUA 3D0HE 3TX0A 2IM0A 4W4MA 3SXLA 1HNIB 3UE2A 1XR7A 2HBYB 1Q7YT 3MZIA 1CJKB 1FDNA 4IFYB 4FF4A 2KXFA 2BABA 2YY3A 1TUGB 2GQQA 3RBDA 2QYGA 4PG4A 1FD8A 2WHOA 1UVNA 5ITHA 4EBDA 2J0WA 1U1PA 2HHHF 3U7JA 1UZDA 2MZSA 2P5VA 3ZZUA 1G6BA 1RSCA 2D3UA 1IR1A 2NXEA 3SFUA 3MWBA 1HYSA 3AOCA 2FVRA 5K14A 4JI3J 1RTDA 2PEBA 2JFKA 3NXZA 3H20A 4QPXA 5AE2A 4WFBQ 4DX5A 1T8EA 2G1HA 2ZC4A 1SPBP 1KLMA 2AMCB 4H4OA 2CA9A 4CLLA 3KLIA 1S76D 5DS7A 3CIMA 4Y28C 2XLJA 2C2DA 3PR4A 1J5EJ 5F8JA 2LEPA 2V34A 4JV5J 2M9KA 1LWEA 2RQ4A 1KVIA 2ZNYA 1U1LA 3I9V9 3HSGA 2QMUB 5AT1B 4ED7A 3AOBA 2UV8G 4NOHA 1FWKA 4NI2A 5KFCA 4O3QA 5KFQA 3Q89A 4C0OC 4KHMA 1X4BA 1X4EA 3R5BA 2ROEA 3EVMA 5KT7A 1BY9A 1WORA 2LFVA 2LLZA 5D0GA 1BQXA 2VKZG 3J81j 2XCAA 3DGVA 2HG4A 2ZH1A 3DDNA 5FJ4A 4LBIA 5H9FJ 3E8OA 4YB6A 3TUJC 1RISA 4OJ3A 5HATA 2E9ZA 5D6GA 2F4VJ 4GC7A 3BPDA 2J5AA 3AHPA 4H4KA 5D0EA 3L7UA 2B5JA 2HNYB 2VPWB 3OR1B 3K57A 2DNZA 1FJ7A 3M1VA 2KM8C 3R1HA 3TA1A 2V68A 3NGSA 1NMEB 1D1UA 4Y0FA 3T6BA 5DQHA 4O3OA 3Q8PB 2GQ2A 2GQCA 3F0NA 3F56A 2EPIA 3BQ1A 4HI1A 3MHYA 1VQLS 1PBAA 2CVIA 1NK7A 1RYSA 2NPIA 4C4WA 1M0SA 5C24A 4P72A 3DLEB 2IFXA 4C11A 1HR0J 3W5XA 2XMUA 1A0OB 2DGQA 4DLGA 4C98A 2I6WA 1P8GA 3JXOA 2VFTA 3IBFB 1J5OA 2CKWA 3IA0A 4OQJA 4B3SF 4QYZJ 3AA8A 1VBYA 4V19X 1ZAXA 3KTQA 4YP3A 3CCZA 1ZAVA 1VQYA 2FZKB 3R5JB 2VBXA 3GMGA 2V9WA 4WZMA 2YWWA 3N6LA 4AUKA 2ZITA 4CNYA 4CO5A 2L9NA 3I32A 2R7RA 4Y2MA 2RMLA 4WTYA 1MNEA 4BWMA 3ICLA 1U6FA 1N5SA 2B9EA 3B4DA 1FNMA 3KNAA 2YH0A 4OI2A 5BJRA 2IDLA 3E51A 4F25A 4N41A 4NEZA 3GZ7A 1XNRF 3CJ4A 3MPWA 3BGRA 2KM8B 2XYHB 4ITSA 3QLHA 2DEJA 4LFBJ 3RRGA 1BQNA 4C0HA 2FJWA 1Q7LB 3EPIA 3LF0A 1LWCB 2DRDA 3QJLA 4KPYA 1NKCA 2EVZA 4URSA 2D9OA 1YJ9S 2C3YA 5CH7B 3VGUA 4CO0A 3LGMA 1NJYA 1YI2S 5FDLB 1F9EB 3OJSA 1HNXF 4FXWA 2Q66A 4WKYA 2ZH4A 1KBRA 1M1GA 4OZ1A 3BB5A 4U7UD 2MKJA 2GAGC 2ZZTA 4UOGA 3RZAA 1F5AA 3G8SA 3S6EA 4TQRA 3GV8B 2HZAA 1VLYA 1B3TA 3PCOB 4LF5J 3IXQA 2UVUA 5KFKA 4A47A 5IXUA 1Z1ZA 2DNYA 4CYUA 5K8PA 4ZVSB 3HXMA 3UQSA 4LBHA 3SSRA 5KG7A 1D8YA 2BUNA 4USUA 4V19J 4ZP6A 2RB7A 4RW8A 3C3LA 4WP8A 1SC4B 3QAEA 4OJ1A 2CPYA 4CLTA 3DU5A 1FERA 2VPXB 4ED6A 3DRYA 1EAYC 1VJQA 4B3RJ 1XMQF 4WIIA 2RUGA 1RWXB 1PYOB 3N4WA 4K4WA 5DLGA 3H59A 3KLGB 3SCKE 1NJXA 1IM6A 1NPPA 3FFIB 1T11A 4KE5A 1X4GA 1YG0A 3CIZA 3MAAB 4Y3CA 3M2VA 3BYPA 5ETSA 3MCOA 5GMEA 1JNRB 1YKWA 1S77D 3DGPB 1B99A 5F8HA 2FQQB 4NLOA 3L3CA 1KN6A 3DM2A 5J1NA 4I64A 3LO3A 3BDPA 4JV0A 2Y9HA 3R2DJ 2YKNB 3MUTP 1W2IA 3NNHA 2MSTA 1E6VA 3GYGA 4PPDA 4DV5J 1KNZA 3L95X 2P8IA 5I3UA 4AXJA 3M6WA 3TO8A 2GMLA 3PYGA 3NLCA 1FFGB 4G1QB 2VL1A 3CCUS 1FJCA 4NXMJ 1BXNA 3GFXA 3HULA 3LP1A 3UI3A 4F2SA 2YKMA 3ILLA 1HMVA 4OHXA 2CJKA 3AY0A 1RWMB 2X51A 1HQEA 2OTLS 1F6TA 2DPIA 4DR1J 3ILOA 1S9GB 5DQIA 1FVSA 1MMDA 1UJ6A 1PCAA 4CM2A 2L9DA 2IYIA 3HVTA 5HQMA 2AEMA 2UUCJ 4P10A 1D09B 3CJKA 1F60B 4PUOB 5KG0A 1S9EA 2VV5A 1FFSB 3M2RA 1F1BB 5KFSA 2KG1A 1VK8A 4NYOA 2GV1A 2R7OA 4UOFA 4ZVGA 1GX6A 4UY85 3AJ1A 4DV1J 1PAEX 1S6QA 1LFWA 1T7PA 4TXSA 1RHJB 1TZ0A 5E3QA 2MQNA 1WWHA 2XHWA 3MFHA 2RE1A 1RWNB 2CQDA 2W2MP 2PFFB 2LECA 2XMMA 3H0PA 3CPWR 1SL0A 5E2QA 2YX7A 1S1XB 2KVIA 5DGAA 3SDEA 2D74B 5B7WA 3PKYA 4KKOB 1KQSR 2HVDA 3VTIA 4Q0BB 4JI1F 3GR1A 5HANA 3H25A 4F02A 4G1IA 3NG8A 3CCMS 3RR7A 1WOOA 4I7FB 2W8LA 3DOLA 3BH7B 2OPRA 2YPZA 2HQCA 3PZPA 2ROPA 3D1QA 3MUMP 2CPHA 3TQEA 1WC3A 1SJFA 2DO0A 1HQ2A 4QJVA 2BVZA 1REGX 1NH7A 4TY8B 2UXCJ 1OPZA 4ZLNA 5J2PB 2DRBA 2AJ4A 3NRBA 3WBZA 3HVAA 4DUYJ 3CJSA 1GXLA 2V4JB 1RWUA 2F7VA 3KLVA 2AWZA 1HPZA 2DB1A 4R5PA 1R7IA 5C25B 4O0IA 1N36J 4X64F 3IWXA 1CC7A 3MPUB 3UVJA 2X1BA 3DFEA 2IYGA 2I8EA 3GIKA 2BE9B 2GO9A 2WB1D 5I4MA 2FLNA 3I96A 1ACMB 2QA4G 4JI0J 3S1TA 4NASA 4B9VA 2M4MA 2GIFA 3MPVA 4U95A 1M5OC 2RKIA 1UVIA 1MN9A 3CSKA 3FJ2A 1ROFA 4Q8FA 2EBEA 2B7BB 2R7WA 1U49A 1S0MA 1SBRA 1WHYA 1CPZA 4NXNJ 2JHEA 1PJ7A 3NMAA 2WW8A 2J0QD 3GLJA 1A7GE 2UVWA 4KO0A 3PJ9A 2DHHA 3CJ3A 3V5RA 4P52A 4CP5A 4I2QB 5F9LA 3LWLA 4W90B 4C6AA 1KTVA 5LSOA 2BX6A 3MM7B 2YX4A 4LF1A 3DKDA 3TANA 4Q43A 2ZD1B 3PYEA 2Z2ZA 4XK8C 4YQWA 1H72C 4P71A 2CPJA 1RT7A 1LW2A 3MAHA 4WPAA 3T9ZA 3PVXA 2H51B 3GFYA 1JB0C 1R0AB 2KZMA 1DTQA 3PEHA 1CULA 3LQVA 2ZH2A 2YNIA 1YJ7A 1N0UA 4X4TA 2XHCA 1X9MA 2FVQA 4DSEA 2OSRA 2PC6A 2KG0A 2VG7A 2HHPA 3KG4A 4YHHJ 3FKBA 3W3SA 5KFHA 1ZETA 2YKQA 3NS5A 1ZPWX 1C0UB 3NCQA 4RKUC 3DU6A 4F4ZA 1HNVA 1P9YA 2IC3B 3MEEA 4RNOA 4E2FB 3HPOA 3CJRA 4A48A 2J0SD 5CYQA 1L5UA 4NL5A 3VAKA 2Y1LB 1Q8IA 1JKHA 1MWZA 1TL3B 3HKZD 3NL0A 1UCNA 1Q5VA 4K0KJ 4ZITA 5IFMA 1RXOB 3QT6A 4PG6A 1HBNB 1FNOA 1QSLA 2VG6A 2HHSA 2XMJA 3TRGA 1UWBB 4ETXA 3M6VA 1TKTB 4B9SA 4DV6F 3QSIA 1R8HA 4FYXB 2VZ9A 2ZZMA 3ITHA 3I6PA 3PG9A 4O3SA 3AQOA 2XMWA 5CZVA 1F3VA 4ELUA 4R8UB 1U1OA 5KFWA 3WQPA 4F04B 4NE9C 1GT8A 3LPEA 2MKIA 3JTPA 2XLKA 2F8HA 4OYIA 2NYIA 3DLJA 1AROP 3RB0A 4C8ZA 5IT9U 2J76E 5CHCB 1WEXA 3CVKA 5KOXA 4ZCLA 1KP6A 1UP1A 4OX8A 1VHFA 3EPGA 4WKRA 4OYMA 2DK2A 1B0TA 4Q2MA 4IKAA 4CLKA 3H5SA 1UPMB 3V6DA 5KG5A 2F5GA 2ZE2B 4N47A 4NLVA 2DR7A 4ELVA 4X4RA 3MEGB 2DISA 4NEYA 4HI2A 4O4GB 4MK7A 3NP5A 3CCRS 4CIOA 3D4JA 3MM6A 3Q23A 1RT4B 1SJRA 2IY5B 3CEDA 4DL5A 4IRCA 4KH1B 1AYEA 2MQQA 1A6LA 1NCLA 1FDDA 4MKVA 4O23A 1JX4A 3FBBA 5KT2A 4YFUA 3C19A 4QCLA 4PXCA 2AJ1A 2HRYA 4QBUA 4IR9A 1GK8A 4KFBA 3T1HF 3OD2A 4O3RA 4RUHA 3BF4A 3RUBL 2VOOA 2XWXA 1P1LA 1WOPA 1NSAA 1KTQA 3MI7X 3SSQA 3OT9A 4P2MA 4CO4A 1TFWA 2WTFA 1V3SA 2R2SA 1SIWB 4O44A 4KY3A 4MFBA 2NUUG 3W8GA 1B0VA 5IT9Y 3CDAA 2DNPA 4WFXA 2OTJS 4LSLA 4ZPAA 1N8RT 2WRMA 3D9BA 3BYRA 4ZCIA 1YBTA 2QYCA 1RB0A 1BWVA 1RT6B 1IUJA 4I6AA 2B4OA 3QYYA 3VAIA 3MXHP 1DHMA 4LF8J 1SH3A 5LXYA 3PIPQ 1JJCB 1FI4A 2LVWA 1IJEB 2XZTB 1Q8BA 4YS2A 3KLEB 1NUEA 2VBWA 4MKBA 2VDIA 3UWTA 3OFHA 1WNEA 2OPPA 1FNXH 4KQZA 1V3RA 3M8ZA 1Z2LA 5ETNA 2CADA 3HSJA 2RNEA 4CLUA 3KJFB 1FRLA 1I1GA 2VJUA 1ZZNA 2MKKA 2XCPA 3OFFA 3IGVA 4MIBA 5HO4A 2YH1A 1RAFB 1S10A 4QPTA 4OHZA 5EWGA 1U1QA 5JMNA 1SUQA 3VV2B 3SCLE 2MXYA 2O66A 1YQHA 2HFVA 2ABYA 1UVJA 5DM6Q 3AAWB 4J9NA 4URQU 1IKYA 2C1EB 3W2VA 3X1LB 2XWYA 2HGNA 1FXRA 4IRKA 2EXUA 1LW0A 1UW9A 1V9OA 2HGMA 3RRKA 2Z2YB 3D1HA 3GR0A 3PW7A 2MKCA 4JI8F 1JLCB 3ETOA 3CCJS 4HDHA 4DUTA 1J5EF 2G1DA 3DRPA 4P9SA 4U6PA 4DDFA 3M8YA 3OLBA 2DH9A 3GYXB 3KHGA 4ZVEA 1PILA 4ED0A 4J9MA 3S8SA 1W26A 4WFAQ 2RIJA 3OJUA 5AE1A 1Y5IB 3HM9A 1Q0NA 2FVCA 2E9TA 1KFDA 2M8HA 2FHJA 3IWNC 1F5BA 5M2RA 2H9ZA 4DFJA 4M5IA 3LA0A 5CXTA 4QIWD 2Z2MA 2HLUA 3DRSA 4ZVFA 2MEWA 2XEXA 3MMAA 3M8WA 4JI5J 3ETMA 5B0FA 4KGVB 2Q79A 4OHYA 2VF3A 2ILYA 3VVTA 5D3GB 2QIFA 4NX9A 5A8RA 2MQ8A 5THWA 2ASJA 2JSXA 2VQFJ 3N28A 5J2MB 2GGPB 2W9CA 1WSVA 1KOOA 1TK5A 2ACMA 4UUWA 4CDIA 1ITPA 4TLRA 4JYAF 2O3DA 2Z30B 1S99A 3J7Z5 4YB7A 1LV5A 5L1KA 2BJ1A 4ECUA 4JV1A 4ILMA 3CD0A 1QE1A 2OI2A 3CGIA 1R6VA 4LSNA 3O8WA 3GSIA 3VAFA 5ETVA 1O8BA 1REVB 2BMBA 4HT7A 3GWCA 4CLWA 2ZDOA 1C1BA 4PAAA 1SQFA 2KXHA 4PPZA 3ZNUA 4LUBA 5M2UA 1IKXA 2QJ3A
chains in the Genus database with same CATH topology
3QIPB 1C0TB 4DF4A 2MHNA 3HHEA 2I0XA 2YWEA 6FDRA 3QJPA 1AFIA 3HHLA 1FHTA 2DNRA 1QE1B 4PCQA 3R5AA 1FXLA 2ZH7A 3ZZPA 4U7UK 3THPA 4IG0B 2KZZA 5GAGU 4DR6F 3BREA 3FQKA 2RRAA 2Z0GA 4WF9Q 4ED2A 3NNAA 1T94A 3FZBA 2OSQA 4OI6A 3UCGA 1SJ4P 2MZ1A 5IS2A 2YNGB 1DQ8A 2OMLA 3L7OA 1S1UB 2XSFA 2MY7A 4I4BA 3KHLA 2CJAA 4A8QA 4I67A 2COLA 2DJWA 2N82B 4IQMA 4RU2A 4BC9A 1IBMF 2CQPA 1ZAWA 2N3LA 2FVPA 1SKWA 3BGRB 4FXDA 3C8YA 2ALZA 2VG5B 4NLYA 2EKYA 4UY8T 3HLUA 4Q5VA 2PI5A 2EFNA 2L9WA 4JI5F 2KHDA 4ICLA 2AGPA 2QSWA 2WSFC 1Y4ZB 2OFGX 1FESA 4NRTA 4JI7F 1YRXA 5KT6A 4I1TA 1UJ4A 3QLHB 4BWJA 2B3TB 2R9LA 2BANA 1FJEB 1S4FA 1Y3JA 4FBUA 3KLFA 1BQNB 1U2RA 3OSPA 2OH2A 2E5JA 4ZPWR 1IKWA 3QZ8A 1KFSA 1VMBA 3H8YA 2VC1A 1MU2A 1UWBA 4G3IA 5A8WB 2QA2A 3T3FA 2DGTA 1E6YA 1HW9A 4MK8A 3B82A 4Y2KA 1R89A 1UEUA 2NUHA 4O4RA 1FK9A 1FRIA 3M8QB 3O44A 3UD3P 4F2RA 1X4FA 3PX4A 1WELA 2JDJA 1CLFA 3I4PA 4FP9A 2BQ3A 4Q8EA 4CH0S 1JLFA 1RT2A 2P9EA 3EZUA 4QW8A 3HKWA 1JJ2R 2YWFA 2HFNA 1LKZA 5HMXA 2MPUA 4IOBA 2DR8A 2MJUA 2BM1A 3OL8A 2XSJA 2J7UA 1OQ3A 4AL5A 4WKRA 3KLFB 2IBOA 3NWGA 2FDNA 3PM9A 4KJIA 5HBMA 2QV6A 3W2WB 4OX9F 3EYZA 5JVGQ 1VBXA 4DV0F 3UDLA 1U6BA 3MFIA 1NKBA 1S0NA 3E3XA 1IKWB 1SL2A 4F8RA 4M8LA 2JEFA 3FSIA 2GJIA 3E2EA 2XZWA 2B51A 2CQGA 3IR5B 3PEJA 3GV5B 4QIEA 1E6YB 3ISND 5DQGA 1WEYA 3U02A 1JLQA 3MM5A 1WHXA 2R7QA 5FD1A 1VC5A 1JLEB 2FHKA 4K5RA 5L9XA 1I94F 2DGWA 4NCBA 5F8NA 2PA8D 3PFEA 2L48A 1IKVB 1QAIA 2M7SA 1VIOA 2IMOA 3VAJA 2RQMA 2XY6A 2VUGA 2NSCA 3UD4P 4C2MA 3OVBA 2PT0A 4DFMA 2XMTA 4KGKA 4Y34A 1JXEA 2ZKUA 3Q0AA 3BO2A 2QLWA 2M88A 1S6PA 1TKXB 4M5DB 1HQUA 4DV3F 3MMBA 3VZIA 3BSOA 2KXNB 3TP2A 2D9PA 4C3LA 4Y00A 4LFBF 1BQMA 3KLHA 2PO4A 1EP4B 4TYAA 4ECTA 1FEHA 1FXDA 3QO9A 1X4DA 1VRUA 3CUNA 2M2BA 1SB6A 2KYXA 1JLQB 3MM5B 1PSDA 2ZE2A 4RW8B 2XNRA 3PRDA 3OUYB 4J9KA 3OTEA 2OPQA 4I69A 3I87A 3UPFA 4ZOSA 1VQNS 5BR8F 4ZPDA 5IM0A 3POTB 4PXEA 5F0UA 2FY1A 2CQHA 3BGUA 1B7FA 4DV7F 2IHR1 3MEGA 1DBDA 2FJAB 2ADCA 1WHWA 1FEEA 1S6UA 5AXLA 5I3QA 4TU7A 2HNDA 2YTCA 4L3NA 4ETZA 3BO3A 4ZP8A 2MKHA 3BSAA 4K4TA 4O4GA 3THTA 3TVKA 7FDRA 5J1EA 2X1GA 1WHVA 2VPYB 4DR5F 2FLPA 5I42B 1ZTTA 1NJWA 2FJXA 3I55S 1RT3A 3KLHB 1JK9B 1FT8A 3KWMA 2ZC3A 4GMKA 2E5GA 2B6AB 3LALA 4LQ9A 2AJFE 3O3LA 2IRYA 1TV6B 1NZAA 3MMCA 5KFJA 1TVRA 2HQIA 2SXLA 4EYIB 2DD8S 1RT4A 2DTJA 2OPQB 3ULHA 1QVFR 1RP5A 1XTZA 3G96A 4WU2A 5GAEI 4C7QA 4J37A 3SMZA 4ECRA 2FGCA 4NWBA 1ZM9A 3HP6A 4QR0A 2FHMA 1L3VA 2ATLA 2D1CA 1HNIA 1TKZA 4MKYA 2HS0A 3MDFA 3TYTA 2Q3PA 3U1NA 3M2VB 4LF5F 5E33A 2BXJA 5HROA 2GX8A 4ID5A 1ZTWA 2IRXA 5J1EB 4BCAA 2CPEA 4X4OA 1YRUA 4QWAA 2NSBA 4JI4F 1HFEL 3H5UA 3HFKA 3FVYA 1QY7A 2ZVSA 5IT0A 2DHSA 2V4RA 5EWEA 3QGPA 3DLGB 3G6XA 1R8AA 2RDIA 1S0VA 3PV8A 1DQ9A 2FPHX 3LANA 4RU9A 3IN5A 2UV8A 2RF2A 4QU7A 1N6QA 3JSBA 1HD0A 3DI6B 3V4IA 2HHTA 1X0PA 4ZVHA 2UUAF 4PQUB 5GAEU 3KK2B 3LWMA 3D0HE 4DV4F 4K4ZA 2IM0A 3SXLA 1HNIB 3TAMA 2AYBA 3UE2A 1XR7A 3VAHA 2V94A 5SUHA 5HROB 1JLAB 3QIDA 4CH7A 1Q16B 1UW4A 3I0SB 4C97A 1HI1A 1Q7YT 3MEDB 3MZIA 4F26A 5T7LA 4CZCA 1RTJA 1FDNA 4B3RF 4IFYB 2Y1IA 4FF4A 2KXFA 2B0GA 2BABA 1E6VB 4N8OA 1NKEA 2YY3A 3TNVA 2GQQA 2GIRA 5EWFA 3RBDA 4PG4A 1FD8A 2WHOA 5I3UB 2KT3A 3G6YA 4FF1A 1UVNA 1VJWA 5ITHA 4EBDA 2J0WA 3FZ2A 4EBCA 1U1PA 1URRA 3V81A 2P6SA 4ZP9A 3GSDA 1YITS 2Z2LA 2IVMA 1DAXA 1YHQS 2VFUA 3GB0A 2HHHF 2IMWP 3U7JA 1RKJA 4OI0A 2I2YA 4UQGA 1X5OA 2MZSA 5BYRA 2P5VA 3ZZUA 4TU9A 1WD6A 1G6BA 4AL7A 2FHJD 3LP1B 5KFDA 2D3UA 3NGKA 1SI9A 2BW2A 2KDOA 3N6NA 3NAIA 3N6MA 3K5NA 2YKMB 3MWBA 2B4PA 3SFUA 1HYSA 2FVRA 1JMTA 5K14A 1HMVB 2R7TA 4UOCA 2IJFA 5H1SV 4D3HA 1RTDA 3QMQA 1XR5A 2VONA 1RT6A 2RH3A 3DLKA 5HLFA 4P6QA 2ZHOA 3JSMB 4DSIA 2R8JA 1MW7A 2K2PA 3OXLA 2JFKA 1HQEB 3SQGA 3H20A 4QPXA 2AYMA 3H5YA 5AE2A 4WFBQ 1WF2A 4FS1A 1T8EA 2J7KA 1FJGF 2XY7A 5T14A 1U26A 2ZC4A 4KV8A 4NYPA 1KLMA 4YB5A 4WZQA 4B3MF 5C42A 1SV5A 5KFIA 3FSYA 2I1RA 4JOUA 4H4OA 3H4BA 1QSYA 3K5LA 1FRJA 3D1OA 5DDRC 2PI4A 1XN9A 2CQ2A 3OR2B 4DR7F 3KLIA 1S76D 5DS7A 1C4CA 5K14B 3O1LA 2L08A 5IT4A 4ZK7M 5KFBA 3CIMA 3GG1A 4Y28C 5F9NA 3IR7B 3CJKB 4USHA 1QUVA 3AQPA 4YDDB 2XLJA 2C2DA 5IQ6A 2O01C 3PR4A 1FRXA 2AYEA 2RRNA 3SQGB 3CTRA 4PQAA 5GADI 4DV5F 1S9EB 2CQIA 2YNFB 2LEPA 4RW4A 5F8JA 2UVVA 4GO5X 5KFTA 2XMVA 4L6V3 2M9KA 2E5HA 1B0PA 1LWEA 2Y1RI 1C1CB 2RQ4A 2CPXA 3V6HA 1HWIA 2E9RX 1KVIA 4PWDA 4RBTA 2ZNYA 1NHVA 1U1LA 3I9V9 1GXTA 2HHWA 4X4UA 5C42B 1XC9A 4ZMMA 2O5DA 2ZZNA 1HL6A 1S6QB 2OMOA 2BACA 2DNQA 4ED7A 4IOCQ 1N5YB 1OQ6A 2UU9F 3N79A 2UV8G 2C3OA 2JRSA 4NOHA 3OL9A 4XAKA 2B43A 2WCXA 4YY3F 1U48A 4RWWA 2U2FA 3OV7A 3IAS9 5KFCA 4O3QA 2KN4A 3KHRA 5KFQA 1DQAA 1G3OA 1QM9A 2I9SA 2P9GA 2QMWA 3TAPA 4RW4B 4NCGB 4C0OC 4ALZA 1Z2ZA 5LT5A 3K5MA 4P7TA 5DG9A 4FYDA 4KHMA 2UVRA 1X4BA 4J9PA 1X4EA 3FEXB 1H98A 3R5BA 5E0OA 3J81Y 2XO7A 2ROEA 2VKRA 3HZEA 2ZH6A 1ZM4A 2KO1A 1QAJA 2RD5C 1N5QA 4AL6A 3HHLD 2U1AA 5F8LA 5KT7A 1IQTA 1BY9A 3GYNA 5BYSA 5L9NA 1ZM3A 4YDXA 1OS5A 3M32A 5G0RA 3DRRB 2XS5A 4FF3A 2LLZA 1S0OA 2XY5A 1KRPA 4JI3F 1ZH5A 1YJUA 1BQXA 2VKZG 1F9FA 4FVCA 3SDEB 4IO1A 2XCAA 1JLCA 4DSLA 2HG4A 2ZH1A 1Q8LA 3RB4A 1SXLA 5AXMA 2HNYA 4KGMA 1K1SA 2WOMB 3DDNA 3B4MA 5FJ4A 4ED1A 2P9CA 5H9FJ 3DOKB 1WACA 3E8OA 4YB6A 2EFOA 4EBEA 1IR0A 2BBEA 3TUJC 5E41A 1RISA 4XDDA 1P27B 3M32B 3OVAA 4OJ3A 3CXCR 3DRXA 2N7YA 3PHEA 4CT8A 2MZTA 1NEEA 2W7PA 3N5BA 3DOLB 2YX1A 2Z8QA 1U1MA 2QMXA 4WFYA 2E9ZA 4EUVA 4OFZA 5D6GA 2ZKTA 2HQ3A 4GC7A 2OPRB 2YKAA 4DJBA 2EBGA 2J5AA 3AHPA 3T6JA 4DPOA 1FDAA 3LPYA 3RB6A 4H4KA 3R1LA 2DVIA 2KT2A 2CQ4A 2NLWA 3JSRA 1NK6A 1KC8T 2B5JA 2DNGA 2HNYB 2MYFA 2VPWB 2DBBA 2CIMA 1FO1A 3OR1B 2QO3A 4RWXA 4JV5F 3K57A 3LP0A 1SJ3P 1GQEA 2DNZA 2XI2A 1FJ7A 3M1VA 1LQ9A 2UUWA 4A8KA 2K3IA 2KM8C 3R1HA 3TA1A 3H2UB 3IG1A 5BYQA 1IJFB 4LT6A 4ECZA 2K8GA 3D5MA 3DLEA 2AX1A 2O67A 2XS2A 1J2VA 4N77A 1LK5A 5E3RA 1D1UA 4Y0FA 4NZ0A 3T6BA 4ECSA 2GCFA 2KJVA 5DQHA 1T02A 2R2UA 2Y1JA 4O3OA 3RU0A 1UMJA 1X9WA 4WFNQ 3HMJG 1SC6A 3KK1A 3JB9k 2RQKA 1NRKA 1OWXA 5L39A 4N56A 3Q8PB 2GQ2A 2GQCA 5J1PA 1IBKF 3BS9A 3HVRA 1VQMS 1HPZB 1VIXA 4OJGA 4QZVB 4R5PB 3F56A 2EPIA 3BQ1A 3TAQA 2B5JB 4HI1A 4IH6A 4NLUA 3I31A 4RW6B 3MHYA 5D3GA 5HI7A 5A6WA 2CPDA 2BZ2A 2A2DA 2KB2A 4I2PA 3HDSA 5E5NA 2CVIA 1VQLS 4ERDA 1R8BA 1NK7A 3BJYA 1RYSA 1KVJA 2IAJB 2NPIA 2BE2B 2GGPA 3F73A 5J2MA 2VB6A 3TUIC 4C4WA 1DLOB 1M0SA 5C24A 3IG1B 4X4SA 3MOJB 3DLEB 3BR9A 4H4MA 2IFXA 4ZPVR 3RRHA 4C11A 2ZBCA 4WYWA 2OO4A 4DQRA 3I5CA 3M6XA 3ZC4A 2XMUA 4IFVA 2J6SA 3PR5B 3FCHA 2EFPA 2DGQA 1AUDA 4F50A 4DLGA 2GIQA 3MM8B 4OMFG 4J9SA 2BOPA 2VBYA 5K5MA 2V5HG 2XNQA 4C98A 4CO3A 2EFVA 4HVZA 1P8GA 1NK4A 2VFTA 1J5OA 4X4PA 2OFHX 4FS2A 2LEAA 4DX8H 5F8IA 2CKWA 4C8LA 3IA0A 4HH0A 4OQJA 4ECQA 1DTTB 1UFWA 2LQJA 3AA8A 2FUG9 2XMKA 2CQ0A 5F41A 1VBYA 2JOQA 5KFGA 2GHWA 2MZJA 2A1BA 4V19X 2HZCA 2UXDF 4QR1A 1ZAXA 1V3ZA 3DHWC 1REVA 1HBUB 2Z4PA 5KG6A 3TVYA 3KTQA 4NLGA 3IRXA 4B02A 1LXNA 4YP3A 3CCZA 2MMYA 3CJ5A 1JLGB 1ZAVA 2R7XA 5D77A 2N3OA 1VQYA 4EO8A 3PACA 4NA1A 5B08A 2EW9A 2LXUA 4TU8A 1YGYA 2C42A 2VBXA 4D3GA 4CTAA 2RQCA 4DFPA 3GMGA 2V9WA 4WZMA 5F8MA 1RT1A 2JWNA 2RKIB 2ZITA 2G13A<