1P6TA

Structure characterization of the water soluble region of p-type atpase copa from bacillus subtilis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGYHVVTEKAEFDIEGMTCAACANRIEKRLNKIEGVANAPVNFALETVTVEYNPKEASVSDLKEAVDKLGYKLKLKGEQDSIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potential copper-transporting ATPase
publication title Structural basis for the function of the N-terminal domain of the ATPase CopA from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 33
structure length 151
sequence length 151
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p6tA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p6tA01
2AJ0A 5T7LA 2ROGA 2CRLA 2XMWA 3BF4A 2IYIA 4OJ3A 5B0EA 2Q3PA 2N4DA 1V3ZA 3FMBA 1OQ6A 2OP5A 3DCAA 3K7RA 5A6WA 2K2PA 2FHMA 2KYZA 4FNIA 1TUVA 3HDSA 2BJEA 4YEAA 2N4CA 3IWXA 3T9NA 4F67A 1JWWA 2OD4A 1Q53A 2XMVA 1GXTA 2BBEA 3MZIA 4A4JA 2XMKA 4HH0A 4OJGA 5B0DA 1AFJA 3LGNA 1RJJA 4DN9A 1N5QA 2K7JA 1XBWA 2BUNA 1U7LA 1Y3KA 4A46A 1S6UA 2OD6A 1Y0HA 5KAKA 2HFOA 1FE4A 2PGCA 3HFKA 4ZA1A 5IXUA 2ZDOA 2BYCA 2RMLA 2EW9A 3HX9A 3LGMA 1X0PA 4HL9A 2GO8A 5F0WA 5B0AA 1X7VA 2GA7A 1LQ9A 2GCFA 4Y2IA 4DPOA 2XMMA 3HHLD 2FB0A 1OSDA 4NL5A 2HLUA 4U9RA 2BJDA 4ZOSA 4A48A 2QIFA 2GGPA 2AJ1A 3FGVA 3HHLC 1YJUA 2RU9A 3BGUA 1AW0A 1GXUA 3DXSX 3CJKA 1MWYA 2FIUA 4HI2A 3TOQA 1K0VA 2KT2A 3BDEA 2QLXA 2XMJA 2XMUA 2HLTA 2AP6A 2LXFA 3HF5A 2GV1A 2VV5A 2W4CA 1KQKA 1N5SA 3WDOA 1N5VA 3KNGA 1KVIA 3GZ7A 3QGPA 1CC7A 1OPZA 2K1RA 1FD8A 1S6OA 2LQBA 2ZDPA 3BM7A 4OJHA 4Y2MA 5T7LB 2OKQA 1SB6A 1TL4A 1P8GA 2FTRA 3TNVA 1CPZA 2N7YA 1YG0A 3KKFA 3IWLA 5B0GA 2L3MA 1Y9OA 1JK9B 2JDJA 3HHLB 2OAUA 2ACYA 5B0FA 2K7KA 1WD6A 4YDXA 3TRGA 1P6TA 5B08A 2RILA 4OIXA 2HQIA 2G9OA 4OJ1A 2RSQA 1VQYA 2OMOA 1W2IA 3UDCA 1Q8LA 1FE0A 1YRXA 2QYCA 1URRA 3KG0A 2KKHA 3QMQA 2HFNA 4FNHA 1OQ3A 1X8DA 2OFGX 4HH1A 1FVQA 4QOTA 4EFAC 5B09A 1ULRA 2GFFA 2VH7A 1TZ0A 3LO3A 1IUJA 3MCSA 1FVSA 2XMTA 1TL5A 2W4DA 3I9ZA 1KVJA 1YJTA 3BR8A 5F0UA 2HIQA 3KG1A 1APSA 2GGPB 3E8OA 3VTIA 1VQSA 3CJKB 1TR0A 1AFIA 2ROPA 1Q4RA 1QUPA 4Q2MA 2PD1A 2ASYA 3F44A 4A47A 1N5TA 1R6YA 5K9FA 3HHLA 1CC8A 1SI9A 2AW0A 2LQ9A 4Y2KA 2IYGA 2K1RB 3BN7A 5A6PA 5B0BA 2OFHX 1MWZA 5B0CA 2IFXA 1Q8BA 4DL0C 1FEEA 2ROEA 1FESA 4NPOA 1YJRA 1Y3JA 3FRYA 3BB5A 2QLWA 2KT3A 2LDIA 2W4PA 4Q2LA 1SQEA 4HI1A 1YJVA
chains in the Genus database with same CATH superfamily
4CLPA 4PUOB 2MSTA 3U02A 2ZBIA 2MDAA 4CO1A 2HRTA 3M2UA 3H8YA 3PW5A 1TKZA 1H2UX 3MCNA 4USMA 5HMYA 3R2CJ 1CJVA 1CSJA 2JLFA 3LGMA 2XM3A 4CT9A 2HGLA 1RABB 4HDGA 2XO6A 1NSAA 2HHQA 1Y7PA 4TU8A 1CJTA 4LSNB 4JYAJ 4L75A 4UF4A 4KGVB 4YN3B 3MUMP 1QTMA 4H54A 3CGIA 1S9EA 2RB7A 2QA2A 1Y5NB 4TNOA 4G65A 5J1EB 3CF5Q 3RR7A 4U7UD 3I9ZA 3FDSA 4DF4A 2M0GB 2CJKA 2JOQA 4H4OA 1SC6A 1TL3B 1U1NA 3Q8VA 3CO0P 3VAIA 2FHJA 3FRYA 1LW2B 4OV6A 4P7TA 1C0UB 2WCXA 3OLAA 5IWAJ 3K5NA 1YJ9S 4MTPA 3J81j 5DG7A 4ED4A 4CH0S 4F4AA 1KTVA 1XIQA 2AX0A 3QSYB 3A3NB 3CMQA 3IGVA 4I1TA 4HL9A 4WP9A 1WC0A 1TFYA 2E5JA 4XAKA 3TA1A 3HVAA 4Q43A 4U8YA 4JOUA 4KR0B 4ZVTB 5ETRA 3Q8UA 4S0MA 4EYHB 2XB2D 4PG4A 3HI9A 1XQIA 3T5KA 4ZPBA 1J5EF 2W01A 3VF0B 4X4QA 5E3AA 2DIUA 5DS7A 1D09B 2NXNA 3RAQA 1XTZA 1PAEX 4WE1B 2MZ1A 4OHYA 1RT3A 1MSWD 3FEZA 3BYPA 1FRHA 1MWZA 4BS2A 4WFZA 1CS4B 4I56A 3MR2A 3PG9A 5DDPC 2ROGA 3FBFA 2KN4A 5ETSA 5CA5A 4DX5A 3ILOA 2FHMA 3RB6A 3FC9A 2HMIB 2YWHA 4OYOA 2HHWA 5J1NA 3CDEA 2MQQA 2QLJB 4MKYA 2FLPA 2I5JB 4U95A 3R97A 1AZSA 3MM5B 4ZA1A 2MZJA 3CTRA 4WU2A 3MEEA 1IKWA 3I0RB 3CC4S 3OTOJ 2UXBJ 5K14B 1X0FA 4JV5J 2AYMA 1KVIA 4X4UA 3RTVA 1FKPA 3ZZZA 3OFHA 2AT1B 1HW8A 3C14B 1REGX 4XTTA 4LF8J 3HSJA 5EWGA 3HJFA 2XYPB 1BD6A 1VISA 4FVCA 3W2VB 2E44A 4OYWA 1IWAA 2H4WB 2X1AA 2F4VF 3TP2A 4WYWA 2ZHBA 1Q4RA 2EFPA 4Y2KA 1UA0A 4M5IA 1RAEB 3R5CA 4ED0A 2ZM6F 3MAAB 2MKSA 5L1KA 4LVNP 1IKXA 1VBYA 1HIYA 4PRFA 1N4LA 4NMXA 1U6FA 2MY8A 1JNRB 3N9UC 3PVXA 3K17A 1SPBP 2W9BB 1NH7A 2R3VA 3MMBA 2XMMA 4DLGA 5BXIA 2E29A 4ZMMA 3KHLA 3PJXA 1K0VA 5ETKA 4DOZA 3IA0A 3OTCA 1N5SA 2A3JA 4CLUA 3BO3A 2B4OA 3LAMA 1XMOJ 1G3OA 3LW5C 3T1HJ 1ZAVA 4PG7A 3GR1A 3HHLB 4DR1F 1O5JA 1WC4A 2IRUA 2JLGA 3HSZA 4MKBA 4NYOA 1O6XA 5A8RA 1FJ7A 2PFDA 3PW0A 1S0NA 2Q43A 1TU0B 3TJAA 1F3VA 4PWDA 4A47A 1QDUB 4Q0BB 1NH8A 1U48A 3W7BA 2JL9A 3MAQA 3M6WA 4OYMA 1Q8BA 4GRSA 2E5LF 1Y3JA 2DIVA 1SQEA 3NGSA 3RU0A 3A4TA 5IC4B 1Z2ZA 2XLJA 3DI6A 3CD6S 6AT1B 1LWFA 2CQ3A 4LSLA 3WZ0A 1P9QC 3DM2A 2CNNB 4DV2J 2WVEA 2ZEJA 4P73A 2LVWA 3A8JA 3G9CA 1RHKB 1U8WA 3FNNA 3DLEB 5J2QB 2HZAA 4CTAB 3OUYB 1EB0A 5CABA 4YMEA 1ZM2A 2C3YA 1FRKA 1JK9B 2BRLA 4DQIA 1NKCA 1ITPA 3W2WB 4I6YA 1F6TA 1NU4A 1KOOA 2J9DA 4NLYA 5G4DA 2ZNZA 2B5JA 3MM6A 4X2BA 2YKMA 4TU7A 2CG4A 3GE9A 1K8AT 2VIHA 2WSFC 2V50A 2PD1A 4ZLJA 2CQHA 2Y9HA 4V19X 3UR0A 4J9UE 5M2PA 1Y5IB 4OI0A 4BC9A 2QX0A 1UKUA 3IWXA 2CQCA 2MHEA 4LF4F 3QWPA 5A8WA 3ZNUA 4QBUA 2P5VA 4NASA 4BCAA 1SIWB 4TLQA 3O6QA 2LXIA 3BGUA 4ER8A 4AQYF 4EK2A 3HF5A 1N36F 4X65F 3WDOA 2W24A 2OEJA 4C0HA 3BSNA 4LFCJ 3LP0A 3PNIA 1WJ9A 4PXDA 1PYOB 1FI4A 2OUGA 3LPEA 4O44B 1SUQB 1QAIA 3HXMA 2FUG9 2Y8YA 4ES1A 3V6DB 5EN1A 1KRPA 5KTQA 2L9DA 4ZKAA 4I64A 4ZN1A 3GONA 2E66A 2A6OA 5CHCB 3RRHA 3Q24A 2E1RA 1T94A 4NPOA 4LMZA 4ZLLA 4PG6A 1FA0A 3TR5A 1K9MT 3I32A 4FNIA 4J9MA 2XZTB 4A8SA 4KYZA 3SCKE 2QV6A 3B54A 4I6AA 4KO0A 4I67A 3FFIA 2V69A 5IQ6A 3PYFA 5KFAA 2RDDA 1MW7A 2KZMA 1NZ8A 1DARA 1HNVA 2B51A 2OPSA 5BYSA 1FRMA 4QIFA 3G6ES 3DRRA 4KKOA 2K1RA 3KJFB 3VGUA 3IWNC 1CJUB 2HVDA 2IIHA 2K7KA 4NXNJ 3NNAA 4EO8A 1N32F 1H0HB 4OJ1A 1GMWA 3FJ2A 4FBTA 3HHEA 2MZRA 2VBZA 1YDLA 1U2CA 4K4XA 4FYXB 3MAHA 2IHR1 1X4GA 4LIWA 4U67Q 2RHSB 2HIYA 4FS1A 3CJ3A 2POKA 4CIOA 1TKTB 1B70B 2YPYA 3C3LA 1U45A 1Q86T 4M5DA 4NEZA 3MCOA 1F2HA 2Z4PA 3EVMA 2GAGC 3T9NA 1UTAA 3FQLA 2B9EA 4OJGA 3ZFVA 4Y0FA 4PG8A 3MTJA 2QRRA 1VQMS 2CKWA 2ZDOA 3V4MA 3G82A 4CRJA 4D3GA 1NB7A 2HHUA 1BQMA 2CPDA 1TQLA 2HS3A 2PIIA 4ZCIA 3C6UA 3BM7A 3BKUA 4DUZJ 3D5MA 5ETPA 4O3QA 1VRTA 4J90A 3GLJA 3JTOA 3UCZP 4RNNA 2HQIA 4TLRA 4ICLA 1X5TA 3GSDA 2VODA 1S48A 2OFGX 4Q45A 3QAUA 1VC0A 1YJTA 3GILA 5KG3A 4WFNQ 4ZVPB 5CYJA 3MMAA 4RLEA 3TVYA 3LQVA 2ZKTA 4LBPA 5CYMB 4XPCA 1YITS 1FDDA 4DZ6A 3GJRB 2VUGA 3ET6B 1Y5LB 3OJUA 2W2QP 1HNWF 3OJSA 4JI3J 3DRSB 2BJEA 4JI6J 4QW8A 1S10A 1FXRA 2RIJA 3T1YF 4ENOA 3B4DA 1S72S 2OPPA 4I4BA 2WK4A 1JLQA 1VJQA 3GJQB 4OZ3A 2BEFA 4ED5A 4DPUA 3HHLD 2HEKA 1TAUA 5ETLA 1HR0J 3CJKA 3AB2B 3BDEA 2YX1A 1WF2A 2LCWA 3DN9A 2KYXA 3D9BA 2XTJP 2LQJA 3CMES 1ZPWX 2YNFB 2B7BB 2IJFA 3MM7A 4F8RA 2VICA 1Q79A 4A8YA 4N41A 2OEKA 5D4NA 3AB4B 2DNHA 3MMCB 2YQ0A 3CDAA 5DDRC 4JI2J 1SKSA 2GAHC 4H4KC 1UZDA 2DISA 3BR8A 1ZAXA 4ZPDA 1S12A 2HQGA 2BV3A 5K9FA 2WVBA 2WHOA 3C46A 3H2VE 5B0CA 1TVRA 1BLUA 3KLGA 2HFUA 2FHOB 2IVYA 1CEZA 4QIWD 1U0SA 2OO4A 4Z2XA 4L76A 2PC6A 4CNZA 4LVOP 2R8HA 1UJ5A 3CJ2A 2KVQE 5F9NA 5F3ZA 3J81U 4PPDA 3LGNA 1RJJA 3PRDA 3RZAA 3CCTA 5M2RA 4RW9B 3OSNA 1KQGB 3CCUS 2CQGA 5EWEA 4PEOA 3EX7B 1D8YA 3BSAA 2P8IA 4IRKA 3BGLA 4OX6A 3OT9A 2HLUA 3QIPB 2F5GA 4P7VA 4E0DA 4C8LA 3ISNC 3P5BP 2VG5A 3W8PA 3VAMA 3KNGA 4AL6A 3PIOQ 3MPVA 2QFJA 3IWLA 2HQFA 2DH7A 3D67A 2H54B 4IH6A 1WEZA 5GAEI 4P71A 2VHGA 1TK5A 4Z37A 4AT1B 1JIHA 1LWEB 1JJ2R 2MQNA 2DGOA 1VQ4S 2Q6BA 3I0SB 1C1CB 4IR9A 5FIIA 4DV3F 1AUSL 1GX6A 3PHTA 4ZHRB 1OIAA 2OH2A 1U2FA 5MAOA 3C15A 1TELA 1GNKA 5AJ3J 4USTA 1U8SA 3BN4A 4Q2LA 5KFJA 3QPIA 3KLVA 3Q8YA 1VQKS 1I5OB 3C8YA 2ZVIA 3HT3A 3M8SA 2COLA 1RHRB 3C6TA 2OPQB 2F9DA 2MQMA 1S77D 1M90T 4X62J 4DG1B 1NPKA 1FRJA 4B02A 3HP6A 4DFKA 5GAEU 3Q2TC 3QIDA 3O5TB 4I7FB 2GCFA 3RRKA 3DRYA 3UCGA 2N3LA 3D3CJ 4ZJOA 4URGA 4B9LA 3DLKA 3FGVA 2D41A 1JMTA 3DXSX 1M1KT 1D8ZA 3TZXA 2BJ1A 1JLAB 3EMTA 1U0HA 2ZHAA 1PKUA 2XLIA 2NLWA 4IYQA 3G86A 3KKFA 1RA7A 2MQOA 3GV8B 3QLHB 4CYUA 1HNZF 2JEJA 2HG4A 1GQEA 3N28A 5KFYA 1N0VC 2V2QA 2YWEA 4HH1A 3ETOA 4FZVA 4DL3A 5E7OB 2D3OR 4CLTA 3PX0A 2PFFB 1JLCA 4NXMF 3ADAC 3VR1A 7FD1A 3A3OB 2AEFA 1DJ0A 4MFBB 2UUAJ 3T1AA 4PXBA 2MQ8A 4DR3F 5CQGA 2DO4A 2QTWA 4CLWA 3E01A 4K8RA 5HROB 3PX6A 2MJUA 3MEEB 3KK3B 3BPSP 3AFGA 5KFCA 5M2UA 2VA3A 1GMUA 2BJ3A 2HAIA 1RWNB 1KFDA 2B4VA 2I9SA 1VI7A 2QL5B 3KDNA 3CB4A 1HNXF 1KVKA 4NLSA 1UWAA 3RG6A 2I0XA 2WONA 4C0BA 1N33F 5ETVA 5C2CA 3I87A 1TL4A 4MT1A 3MI7X 5RUBA 2VQEJ 2Y0SD 5AXMA 3PYDA 1U02A 3DLGB 4C6AA 1J5OA 3GU0A 3KLIA 5T41A 5J2NB 4CM0A 1FE0A 2MYFA 2GFFA 2R8IA 4ECSA 1IKXB 2ATLA 1WG4A 2HNDA 2RQCA 4RBTA 2R9LA 3GWCA 4QPTA 3NGDA 4R0JA 2R7SA 3KLFA 1X5PA 5HMXA 5CYQA 4FYVB 1S1WA 1JX4A 4B3MF 2FJAB 1JXLA 3AXKA 3MMBB 4ZOSA 1QVFR 3TOQA 4CO4A 3D3BJ 1WC5A 3D7SB 1HBNA 3AT1B 3G6VA 1SJ3P 2YKQA 5I42A 1Q95G 2VASA 1HW9A 2PEBA 3IGNA 4KGZB 1YZ7A 2HHTA 2KJWA 4WP8A 4JI7F 1CQMA 3D0IE 3NOGA 3THVA 3EUNA 4F4XA 4C11B 4E98A 2Q6CA 4K2JA 4DXLA 4ECWA 4ANCA 5DLGA 9RUBA 1KR4A 3NS6A 1RAFB 2DHHA 1WORA 1HBMB 1WD6A 4R0EA 1LW0B 1YRUA 4ANEA 2JFKA 3EGVA 4W98A 1MROA 2AU0A 2PO4A 3CJRA 4O3RA 1Q5YA 2GJFA 2YNGA 4DV7F 4X4OA 4OYIA 3RAXA 1QSLA 4JBCA 5HP1A 4DF8A 3PW4A 3RB3A 3DM2B 1FERA 3M6UA 2BANA 4OI6A 5BYQA 1HHTP 1WUUA 2UXCJ 4OL8A 5JJBA 2J6UA 1GXTA 2A2DA 3DOLA 3OW2R 1UEUA 4DWIA 4OI2A 1ZA2B 3PZPA 2XY7A 1IBKJ 4B3SF 4NCGA 5L1JA 4ZPVR 4NI2A 1NZAA 4KT0C 2QT7A 1XR6A 1FHTA 3KJNB 2NZ4A 1GMVA 2B5JB 1MN7A 2GV1A 2UUCJ 4X64J 5IT9Y 4QYRA 1H7WA 3QFWA 1X9SA 1FX2A 3A8EA 4QR2A 2BRKA 2AZ1A 3R5DA 1CBKA 1WSVA 3KXDA 2RKIB 4O4GB 2RRNA 4F4WA 3PM9A 4N77A 5ETNA 2E1CA 2W4DA 2UU9J 3IBFB 5F41A 2CQPA 3K89A 1R31A 2CPFA 2AYBA 3X1LB 4ECZA 2DH9A 4LF6F 4H4MA 1YBAA 5FJ4A 3UO0A 2QG9B 3IM9A 5J1PA 4RNOA 2GIFA 2RS2A 1B0PA 1IR2A 2AF6A 2GO9A 2Z57B 1FXLA 2K2PA 1U1KA 2XHCA 5IFMA 3CCQS 2YH1A 2P6SA 4HVZA 3EDRB 4L72B 2H5EA 4ED7A 4TQRA 2LYVA 2X3GA 2MKCA 5K8PA 2LXFA 4A8MP 1E6YB 1N5VA 1SJFA 2NREA 2PN6A 2HSEB 4R8UA 1FNXH 3C16A 1Y11A 5K8MA 1S9FA 3TRGA 5C42A 5IT0A 1NPRA 2CQ1A 1XR5A 1FK9B 1DZ5A 2V67A 1RHQB 1KLMA 2V8GA 1SBRA 1WKKA 2VKRA 1F5AA 1QVGR 5FD1A 3D6HB 3ZZPA 1HMVA 5L39A 5L9NA 3MEDA 3UVJA 3ZZYA 2D9PA 1HWJA 4KE5A 4RJVA 2BJ8A 3FSYA 4KGXB 1QAYA 2OPSB 1TK0A 4WZQA 2V4QA 3U1MA 3PCOB 1YVFA 2KYZA 2OMLA 2RRAA 4AL7A 3NMRA 2YKNA 5GMEA 3ITHA 4DUYF 1DFDA 1JXVA 1S6UA 1SL2A 2WVFA 2E5LJ 4ZN3A 2IAJB 4J7CA 4DV5F 2KM8B 1RKJA 4F3QA 5CZXA 3Q89A 4TN2A 1RWOB 4QWCA 3OFEA 1TKXA 1PJ7A 2N7YA 3LP2B 5C2GA 4B3OB 4IH7A 1CLFA 1ZTWA 4NEYA 1S1VA 2QEXS 2GMJA 2CVEA 4GO5X 3TAPA 2DNGA 4LF2A 1RWPB 4NLDA 5DM7Q 3QO9A 2O67A 3EGWB 4OI3A 3X3UA 2ASYA 3M8ZA 3I56S 2ILYA 4JYAF 3L7OA 4KFBB 3P6YC 2ALYB 1KQSR 4DL0C 2KXNB 2Z0GA 3G82B 1R27B 3BGRB 2FQQB 1YRTA 2CQ4A 3SEOA 2DY9A 4F0MA 4UY8T 3PEJA 4J37A 1WELA 1X5SA 3BH6B 5KAKA 1VRTB 3OR2A 2J9EA 4AUKA 1X4DA 2MTLA 5FDLA 4C98A 4NCBA 2JH3A 2WB4A 3B6BA 1DLOA 5A8KA 4OJHA 1U09A 5HLFA 5HJYA 1KOHA 5IWAF 3V5RA 2DRAA 1RA6A 1XEZA 3PV8A 2WBMA 1UJ6A 3EM1A 1JXEA 1SQFA 4ECQA 4WPAA 3S8SA 2BE2B 2XG8A 5DM6Q 3G87A 3BSCA 1YRXA 5LSRA 4EI2A 3M1VA 5AT1B 2W8KA 3FZBA 2L41A 3MCSA 5F0UA 3KJVB 4RW6B 3W1YC 3B82A 3B78A 1MU2A 2A0FB 2H3EB 4ZVQB 1FTCA 5LMNF 3W66A 1QTNB 1TUWA 3NNCA 4XIUA 4C8YA 2XGQA 5KFDA 2DGTA 3AXMA 2KT3A 3VZIA 4LQ3A 4HI1A 3RW6A 3IRXA 2J0SD 4OZLA 3ENWA 2DR7A 1OQ6A 3TA2A 2M52A 2J76E 1RKIA 1EP4A 1QJHA 2WTFA 4CH1A 2QE5A 1YJWS 3CC7S 5L1LA 2UVVA 2BA9A 1FKAF 3U27A 1UFWA 2ZOMA 5GADI 3VWSA 1IKVA 1BHNA 4P75A 3KJQB 1MG7A 1T95A 1AXQA 5DETA 2W4CA 3BBFA 4KV8A 2PE8A 3V6HA 4UTGA 4OQJA 5LOQA 3KOAA 4WXWA 5KFZA 1TVRB 1XMQJ 1FJCA 2GX8A 1NJYA 1YBUA 3NGTA 2HGNA 3PYGA 3PR5B 3OTOF 2UXBF 1VJWA 3FKBA 1RK8A 2IVFB 4JV5F 5L1IA 3ISZA 3HM9A 1SCJB 2MPUA 2LECA 1Q7YT 1WEXA 2HW3A 4LF9J 1XJWB 3SQGA 1UMJA 2XSFA 2OTJS 2EPIA 4LF8F 3M9NB 2D3ZA 4AE5A 3THTA 2LDYA 3ZTOA 4DPTA 2Q79A 2JVRA 4DCJB 2XMKA 4X4TA 3JQKA 2HBZB 3IBCB 3PW2A 1U1MA 2KXHA 1IKYA 3SFGA 4DPOA 3MECA 3GIJA 1SJRA 3LGHA 2ZD1B 5C7PA 3PXGa 2B4UA 2FC9A 4PKDB 2KG1A 4ZJLA 2BKNA 2V34A 1OO0B 2X1GA 5D0HA 1TL1B 1YSJA 2Z56B 1S1TB 2G9OA 2J6TA 3C15B 4FNHA 3JTNA 4OZ5A 3TUJC 1RHUB 2P6TA 1WG5A 3W9JA 4DFMA 2IJRA 3MURP 3HSDA 4K50A 4OX7A 3ONQA 4USHA 2DNOA 2R7QA 4KQZA 2HVEA 1Y00A 1XMOF 3T1HF 1S99A 1I6JA 2AHOB 2R7WA 1Q7LB 1VBKA 4ZPWR 2M88A 4XPEA 3DLKB 3FBBA 3AJDA 2RF2B 2BJ9A 2JFDA 1RT7A 5D6GA 3KLEA 2SXLA 4RKUC 3M8PB 1NHKL 1HPZA 2M8HA 1CULB 3PKMA 4U96A 3SV3A 5BR8J 4JB8B 2DNLA 2IC3B 2HQ3A 3FQKA 1NDLA 2UV8A 1A7GE 2K8GA 1SC4B 3MEKA 2PI5A 1FKOB 2J8AA 3KK1B 1X60A 4YR2A 2YWFA 5F8HA 5LT5A 3NP5A 4PXEA 4YB5A 1S5ZA 1SB6A 4RW7A 4OLPA 2JDJA 5SZTA 5D4PA 3EGZA 1HNIB 5C25B 3P3DA 1W2IA 4ZVHA 2MMYA 3CJQA 3DYAB 3PFOA 1X8DA 2PMZD 1S7HA 5KG0A 4DV2F 3M30B 2YQ1A 2ZH9A 3H4DA 5D3GA 5KG7A 3FK4A 3H40A 2J0WA 1C0TA 2DD8S 2OEMA 1C4AA 4TVAB 1X9WA 2LU1A 2HURA 2ZBQA 1RI7A 1LK5A 4M5JA 1HQEA 3ZXWA 1QY7A 5ETTA 5L8RC 1R8CA 3WC2A 2FZCB 3SCJE 2GVDB 2YVSA 1HI1A 2ZFHA 3SDEA 2RVJA 2V2KA 1EETA 2IBOA 3GP9A 5KT7A 3KLIB 1NK5A 2GGPA 2DXFA 1AW0A 4JI4J 4G1IA 1FRIA 1RTDB 4W92B 2O3DA 2I2YA 2VPZB 1EQ0A 1U26A 4DHVA 5EGYA 4F3MA 2E5IA 4USIA 1NBEB 2H4YB 1YZ6A 1RQ0A 4ES3A 3GG0A 1S1WB 4BLGA 2WW8A 1IBLJ 3FBEA 1VR6A 4UZBA 4C8ZA 4K4VA 4CCHA 3O44A 2WSCC 4ED3A 3J7A1 2CQBA 1HBNB 4J9OA 3F44A 5L9XA 5EWFA 4IOAQ 2JLEA 4LFCF 4CLKA 1S6QA 1RTJA 4QIGA 2DKOB 4IDKB 4U6PA 2HQCA 4X4NA 4ZCLA 3D6TB 4O3PA 2CQDA 4LBHA 3KHRA 1A6LA 2K3IA 4EUVA 4TY8A 2N4CA 1S59A 2IM3A 4LJMA 5HMWA 3VAHA 4A4JA 1AFJA 5KG6A 1YX2A 1RT6A 2YQ3A 4X4VA 3AA9A 1TKDA 1RTIA 2JZ5A 3I96A 3IMQJ 5T14A 3MXHP 2GVZA 1YJNS 2ERRA 4DI6A 5KFBA 4CM2A 2DVIA 1YJ7A 2E5HA 2MZQA 3L7UA 1T9XA 2HVHA 1RISA 3JQJA 3QAEA 4DX7A 1WI8A 2EKYA 1WC6A 1CG2A 3SI8A 4NX9A 1KFSA 4QOTA 1KHWA 1RTHB 2BQUA 3MUTP 2M5YA 3H5YA 4A8QA 5KFUA 5HATA 2I6WA 5GMKa 1HNZJ 1T9TA 5LM7E 2UXDF 2HZVA 3M8YA 1IJFB 1RSCA 4FBUA 3NLCA 2N7CA 4NXNF 1T05B 2EC2A 1YJVA 3GTYX 3M7VA 4AXIA 1UVLA 3NCQA 5HBMA 3KUHA 1AA1B 4I2PA 2ZJQQ 1KNZA 4USUA 4JUZA 4URQU 1ZPVA 5H9FK 2VDIA 2L08A 3A8KA 5JMNA 2W2NP 2C2KB 3OTBA 1XWLA 2HLTA 5KFIA 2RU3A 2ZE2A 4XDDA 2HRUA 1AUDA 5KFKA 2KB2A 4H4MB 1YIJS 1FEHA 2R7VA 2ZZMA 3D68A 1HBOA 1SKWA 1TV6A 3QMQA 3DRPA 1LXJA 3DOMA 3DKDA 4N5SA 4ALZA 4LF5J 4RU2A 5B7WA 4P72A 4DQRA 2RAQA 4DS5A 2FHKA 3CPWR 4ZJQA 4FYDA 1LXNA 2CAJA 3ELHA 3M32B 1N34J 4HACB 3BO4A 4DUZF 1FESA 2HK3A 2V8VA 2C3OA 3TAMA 2CVIA 4K59A 1HQ2A 1ZYQA 4PABA 1UEKA 1ZZNA 2F65A 3R1HA 2W25A 2DNKA 4Q5VA 4ZK7M 5D0RA 4A8XA 2ZH7A 2JEFA 2IM0A 2GQQA 7AT1B 5KG2A 3H2UB 4FKYA 4R8UB 3IXQA 3L4BC 4PQUA 1WC1A 2H5JB 1U2RA 1VQLS 3G8TA 3EVWA 1IQZA 2JRSA 1L3TA 2NUHA 4L6V3 2R42A 2V8HA 3IS9A 1UFLA 5KFHA 4JI3F 3MEDB 3MM8A 3CCRS 3UVJB 4JI6F 5B0GA 2FLOA 3TJ8A 4FKXA 4QWEA 1SC1B 1O8BA 2D3O1 1T3NA 3HD2A 3Q83A 5L38A 1IUJA 4IUFA 2YKAA 1HR0F 5I3UA 2YKNB 3HKWA 5IOLA 3W64A 1X4BA 2B7CB 4L3KA 1X4EA 3H4BA 3OL7A 2L9NA 2D1CA 3L09A 2DGQA 1WHXA 2O66A 1NKBA 1NHUA 4OJ3A 2DJWA 2XS5A 1M5HA 1NNDA 4GVBB 1RYRA 2RJZA 3CCZA 3NGUA 5KG5A 1IJEB 1G2EA 4JI2F 1JJHA 1E6VA 4PPZA 1TKXB 2GHVC 4IG0B 3POTB 3MPWA 4EYIB 2E7XA 1RBOB 2ZKUA 2DGWA 1RT4A 3TA0A 3H5SA 4IFYA 4OI4A 3GJTB 1X0PA 3GV7B 4IQMA 3BREA 1S1VB 4IG3B 1D9FA 4OHWA 5KFLA 4DCPB 4L3NA 1RTZA 1CJKA 5AE3A 2GHPA 1VFJA 2Z30B 2ZH2A 4YDXA 1YLXA 1RCOB 3D4JA 3DGPA 3CJSA 3W3SA 3KMQA 1NRKA 5DGBA 3JYTA 5KFVA 3A8IA 1Q81T 1S6PA 2QSWA 3H2LA 4DSKA 3CJ8A 2P9EA 2VL1A 3I5BA 3R7SB 1QUPA 4DPYA 4CP5A 4FXVA 4A8WA 4ZPCA 3MM9B 2FDNA 3BN7A 2R8KA 1U1RA 2LMIA 3MPDA 4Q8FA 4K5RA 3Q22A 5GAHU 2VC0A 3RR8A 5LSLA 3BYRA 1G4CA 3W9IA 3UD5A 2W9CA 3E51A 2EEYA 5A8KB 3H20A 1PG5B 4HH0A 1N8RT 2XULA 2ZH6A 3GR0A 2HVIA 1WDDA 2O01C 2VBWA 3F56A 3ENVA 3NOCA 1RAAB 1K1QA 1X7VA 1HFEL 4OYZA 2VB6A 2WBRA 5AJ3F 1NB2A 2MGZA 1JLFA 5HJXA 2GJIA 3I9V9 3V81A 5DG8A 1RWVB 4YHHJ 5KT2A 3P5TL 2VG7B 5JVHQ 1MU2B 4I2QB 3C2PA 4X62F 1Q8LA 1RP5A 1DAXA 4OX8A 3T19A 3T6BA 3IRXB 2F3JA 4QU7A 1FVSA 2PI4A 5LL6d 5HQLA 2YNHB 1LEOA 4QW9A 2ZOFA 1ZS6A 2ZWOA 2DEIA 2X1FA 3CCMS 2JVOA 1M1GA 1BMQB 4DPWA 1KWMA 3MR7A 3FZ2A 2CNKB 3H5UA 2CRLA 1RWXB 5LJ3Y 4WKYA 5I3QA 1RT2A 1C1BA 2E9RX 4IO1A 2XY6A 1NLKL 4R5PA 2XSJA 5KFEA 3KK2A 3WBZA 1SV5B 4ZVGA 2UUAF 2GA7A 4W4MA 1H2VZ 2MKJA 3AD7C 4UOFA 1HWIA 2VV5A 3UNGC 2Z2MA 1NAQA 3GJSB 5J2PB 4USKA 3GQCA 5AXKA 5F9LA 4IFVA 3IR6B 3QATA 5KT5A 1XERA 4NYZA 2AKWB 1N48A 2KVIA 2AQ4A 4DCOB 3UR3C 4XO0A 1F0XA 4GKKJ 1VBZA 1ULRA 1BQNB 2ZZTA 3ILIA 2GQCA 4Q8EA 3PIPQ 3MMJA 2GZOA 3U1LA 3OXLA 3UDLA 4MK8A 2C2OB 4XK8C 1K1SA 5AXNA 1RAJA 1S79A 1IKYB 3WQPA 1VRUA 2VQEF 3GIKA 4HHJA 2F8HA 2HBQB 2FJWA 3GYGA 1ZAWA 4RW8A 5KOXA 3N5FA 1WTBA 3BJYA 2Y0BB 5B0DA 5LSOA 3R5JB 2LEPA 1B7FA 3DU5A 1S1UB 1QE1A 1N6QA 3LAKA 3ICLA 3J7Z5 1U24A 2XI3A 2CNLB 4DX8H 2P2CB 4ZVEA 3M8QA 2HNZA 1W7WA 5H9FJ 1SKRA 4WFBQ 4ED1A 3W8GA 1WC3A 2APOA 4CWBA 1K0TA 3QNWB 2E9ZA 2KI2A 3PR4A 2A10A 1VYAA 3EZ5A 2ASJA 2HWIA 2AGOA 4NLVA 3JS9A 2KG0A 1VBXA 3WC0A 2U2FA 3I5CA 4M8LA 2XGPA 3CIMA 4Q2MA 4F4YA 3BZQA 1BY9A 2FZKB 5A6PA 1PBAA 3D0HE 4YR3A 4F25A 5AXLA 4LRFA 1ELOA 1N0UA 1F9FA 5H9EK 3LF0A 2B9XA 1RAHB 1UFKA 3BKTA 5G0RB 2H65B 3FMBA 2C2DA 4ZS6A 1W25A 3AJ1A 4G6VB 1PGZA 4RX6A 3GIMA 3SIPB 1ZM9A 2BBEA 1BQXA 2W1BA 1N56A 5LMNJ 1Y0HA 4J9PA 4RW7B 4MJKA 1PYSB 3EICA 3N6LA 3PHEA 5EX0A 4OMFG 4HI2A 3M2VA 1D1UA 3BDPA 1GEHA 2ZJPQ 3EGNA 3UQSA 1S6OA 4KHRA 5T7LB 4U7CA 3UD3P 2UXCF 1Y9OA 4PUOA 3CD5A 5EX3A 1HWLA 2BJ7A 1IBKF 1ROFA 2V4RA 1NEEA 2BW2A 1U6BA 3KUEA 3AY0A 3CMAS 1XR7A 2D9OA 2QL7B 3DOKA 5D0EA 2DHGA 3SV4A 2UUCF 1IXKA 4X64F 2HZCA 2IRXA 1EETB 1RHMB 3CCJS 4LSNA 3V4IA 1DTTA 1DTQB 4B9TA 3HVWA 1Q53A 2DCLA 4MYUA 1WHVA 2RH3A 1J2VA 3BBCA 2UU9F 1NO8A 2DR9A 2DRBA 3VAKA 4ZITA 2OSRA 4Y00A 5J1EA 3ZZ0A 3DLJA 4KHPJ 1LQ9A 2LA6A 3T5HA 3LA0A 4LR9A 3GPAA 3R6LB 1QSSA 1TL3A 1T7PA 1T03B 5L46A 2F4FA 2F63A 2MSSA 3CCLS 4C3LA 1FD2A 2OELA 4RU9A 4YFUA 1WKLA 4QZVB 3K0JA 2MY7A 2VPYB 4RZRA 2J0QD 1FF2A 4CO0A 2WOMB 3RUBL 4RW4B 1TR0A 4M63A 3PKYA 1IR0A 3A13A 2XWXA 3ZTSA 4X4SA 3AOAA 3BV8A 4YDDB 4DR2J 4FF2A 2GNKA 4PCQA 2H5IB 1V3ZA 2I1RA 1PSDA 2QZ8A 1ZA1B 3HDSA 3OXGA 3GMGA 2HS4A 2QJ3A 5IZHA 2E1AA 1WACA 4YQWA 2MHNA 4DV4J 4JV2A 5HANA 1X9MA 2GS8A 3M8WA 4WE1A 5KFMA 4NMLA 4P6QA 1HYSA 3HHLC 3CVKA 1GXUA 3HFZB 2DR5A 2VONA 2V9KA 3GZ7A 1FJEB 3C66A 3AAWB 1CS4A 2IDEA 3D1HA 4F4KA 4DR4J 3EYZA 4PZVA 2DK2A 3MR5A 1X4AA 3N5BA 3OLBA 4EO6A 4TQSA 2RQ4A 2HMIA 2CQ2A 3LO3A 2R7UA 2OPRB 1RT1A 5HBMB 3E8OA 1VQSA 2I5JA 3MM5A 1AFIA 4UT4A 4I2PB 4P2XA 4DSIA 3I0RA 4HKQA 2M70A 4OI1A 4EBCA 1H2TZ 2K06A 5K14A 4B9UA 4N7TA 4O0NA 3VHQA 1U47A 2GJ2A 3BBBA 1HQUB 3DCAA 1S97A 5I3PA 5J2MB 1HARA 2IA6A 4FYYB 4F36A 4RO0A 4CO2A 2YKPA 3OFFA 1IWGA 3QZ8A 4N8OA 4OFZA 3W2VA 1TL7B 2FB0A 4QJVA 4NZ0A 2J5AA 1GFWB 4DL2A 2KXFA 4P2MA 3QGPA 4ZLNA 2XWYA 2QO3A 4NE9C 1UPPA 2VBXA 4C48A 2LQ8A 3PX4A 3MAAA 3S6EA 2G1HA 2QA4S 4B3RJ 2H9ZA 3IR5B 4F3OA 1VMBA 4KY3A 3IG1B 1R0CB 2RSQA 1JLBA 1FFWB 3MPYA 4AYBD 4P2FA 1REVB 3W5XA 3IP0A 2W9BA 2AMCB 4C8OA 3VGTA 1UW4A 3SSQA 4LIRA 4DV0J 4K4YA 3MF5A 4ZCMA 3CD7A 4HTJA 4RWWA 4Y2AA 4WFAQ 1KTQA 2MJNA 2Q3PA 4FXDA 1S1XB 2G2OA 5MLCV 1S4EA 2KL8A 1GK8A 4ZDNA 1EJ7L 3IS9B 4CQ1A 3K59A 3SCIE 3MM8B 1JLEB 2ZOGA 3TX8A 2PGCA 1WDTA 3M2RB 4LF7J 2EKNA 2IM1A 3P96A 5GAGI 4Q0BA 4N8NA 5CAAA 5I3UB 1ZZFA 1C4CA 4X66J 1FWPA 5F3TA 3UN2A 2B8PA 2B6AB 1F1BB 2ASLA 4IOCQ 5KFOA 2CPEA 1TAQA 2FGCA 2FY1A 3KG0A 4WXOA 3Q8RB 2E5GA 2HHXA 4KBIA 2YWWA 3D0GE 4DL5A 2XS2A 1A0OB 1YKWA 3FUYA 1BUXA 1VQ9S 2QC3A 4RR5A 4A8FA 4HR2A 4GC6A 1YJRA 3DLEA 3K2YA 5GAGU 5J2QA 3RRGA 4KSEB 3TVKA 4OZJA 4CTAA 1ZBTA 4EZ6A 4HT5A 1XMQF 1KSPA 3DNCA 3JSBA 1JLGA 5H9EJ 3EXCX 2G13A 3W2WA 3VGSA 1CJKB 2DPIA 1FFGB 2RMLA 2UXDJ 3HX9A 1T8EA 5DLFA 4KAIA 2C22A 5H1SV 1PAUB 4LF9F 4EEYA 1S6PB 3T5LA 2UVWA 3E2EA 3O3LA 3GSIA 5DDOC 4OZ1A 3WX4A 2HKEA 1MLAA 2YH0A 2QSFA 3ENQA 3EZUA 2B0GA 2PMHA 3TAQA 4KPCA 5KG4A 4MIBA 4PWWA 2VC1A 4YB6A 4JI1J 1AB8A 1Q0NA 5F8JA 1F9EB 5IC6B 2HHHJ 3CDBA 3BQ2A 3N4WA 4CLLA 3BS9A 4RPFA 2AJ0A 4DBQA 1V5IB 1QD1A 3K7RA 1L3VA 1OYDA 2MGZB 4WWSA 4O44A 1SUQA 3V81B 2VF3A 3W9HA 1Y3KA 2UV8G 3V6DA 2QMUB 2XNQA 1FXDA 2CJQA 3NMAA 2QA4G 3T41A 1LK7A 5D78A 1VGYA 2XMAA 8ATCB 2KRBA 2RD5C 5EDWA 3HULA 3VGVA 2VFSA 4DPXA 2LXUA 2CQIA 2IVMA 3OR1B 4PYDA 3FBCA 3NY0A 3NXZA 2KFZA 1N5YB 5B0FA 2RILA 2RT3A 2ZJRQ 2HYIB 3KHHA 5BR8F 1W26A 1HWKA 2HFNA 2PA3A 5I4MA 1WSRA 3J7YI 4AFFA 2KH9A 3TARA 1RT2B 1C1BB 3DMJA 2ADCA 3LOUA 1LWXA 1CC8A 4YY3J 4R5PB 4DU7A 5E0OA 3H42A 2EG2A 1NHVA 1FRXA 5DDQC 3FEXB 3S01A 4WTOB 4BWMA 2G2ZA 4X84A 5GVQA 3CDUA 3LWLA 1B0VA 5BJRA 5K8OA 2DR8A 4QR0A 4G1QB 3N6NA 2ALZA 2FJBB 4ZP8A 1SH3A 4B3TJ 3ZTQA 1VIXA 4DQPA 4ECVA 4A48A 4ILRA 3J7YU 4EMDA 1FD8A 4MMOA 4JI0J 4B9MA 2F9JA 4LRDA 4DR7J 1TKTA 1Z1ZA 2VD3A 3M2UB 2DTJA 5B08A 4DZDA 1OWXA 2GIQA 1TKZB 4FDFA 2C28A 4E2FB 1CJVB 4NLQA 2B4PA 4F02A 1FVQA 3JSMA 4OZ2A 2HIQA 4JI4F 1CJTB 4C8KA 2BE9B 1QUVA 2E7VA 1PYTA 1NDCA 4F2RA 3EVOA 3HVTA 3MEGA 4RUCA 1O0PA 2N3OA 1IBMJ 2RDIA 4ETZA 4UQTA 1S9EB 3L7PA 4CZCA 3OHBA 1IBLF 5DO2A 3R5GA 4X4PA 5ETMA 2VJUA 1LFWA 3JSRA 4A46A 4H4OB 2Y1IA 3MCMA 4DL6A 1WWHA 2HNYA 1UETA 3CIZA 4M5KA 2BX6A 2DT9A 5D4LA 2FPHX 1GT8A 2FGOA 4ID5A 4WJBA 5CYMA 2EFOA 4IRDA 4RNMA 3GG1A 3SMZA 2DB1A 3ET6A 1U25A 2GHWA 4AL5A 1S0MA 2C42A 2BOPA 2AEMA 3DRSA 3VQSA 2V68A 4MYTA 3K8WA 2FY8A 4F2SA 2ZBRA 2IPOB 3OQ2A 2GC8A 4WIIA 3H7HB 1B99A 1N5TA 3J81Y 2F8EX 2Z58B 1KEKA 1H38A 2ZBCA 3UCUP 2QLWA 5ITHA 3LP1A 4CNYA 2CZ9A 2XQCA 4OYXA 3RB0A 3SBMA 1JQGA 4ECXA 3M2VB 4LFBJ 1JWWA 4YR0A 5F8GA 4BHQA 2JC1A 5THWA 1SL1A 2YX4A 4H4KA 2EW9A 1RT3B 3MMCA 3TUPA 3KTQA 2IJNA 3NKYA 3DHXA 4NLRA 1HI0P 2Y1RI 3EJMA 3CUNA 3D6FB 2CJAA 3DOKB 2C3PA 3CDWA 3I4PA 1U1PA 2DHSA 1EAYC 4EWTA 1TP7A 3TYTA 3HD1A 2J9DE 1OY8A 2A2CA 3MUVP 1AZSB 1NUEA 3V4IB 1DTTB 4HHHA 3G96A 2VH7A 1S9GA 1IKWB 4USVA 3W65A 3H98A 1Y10A 4P10A 2KHCA 3KG1A 4RW9A 2J7UA 4EBDA 1R6YA 4PWUA 1F60B 2ZVSA 3QIPA 1NDPA 1FKPB 1LNQA 3RGIA 2VPWB 4I0WA 4FPIA 1Y4ZB 1VQ5S 2L48A 2IYIA 4CT8A 4USWA 1PJ5A 4LF5F 5F8IA 4OX9J 5CZVA 1OJ4A 1VQNS 3CD0A 2JEGA 1JKHA 1LWEA 2E9TA 2CPZA 1UVIA 3I0SA 3U7JA 1C1CA 1N34F 3V2UC 6FD1A 2NSBA 1YJUA 4WFYA 1PC4A 1XNQJ 4ZHRA 4GKJJ 3CXCR 3DRXA 5KG1A 1OS5A 4Z7YA 4OHZA 2XLKA 3BQ1A 2V4JA 2KFNA 2IMWP 5DZ6A 4A8OA 4MIWA 2OPQA 2R4FA 2DNYA 5FLXU 2YTCA 2AIRB 3IAM9 2HVZA 4UW2A 1D3WA 4DG1A 4V1Ak 2LA4A 2QMXA 1YBTA 2VDHA 2DNPA 4KTQA 4I7FA 2AJ2A 3MTKA 2R2SA 3OL6A 1KKHA 2FJDB 4NA1A 1S49A 1JLAA 3CJ4A 5CD4A 4FN5A 1HYSB 2VOPA 5DQGA 5A8RB 3QLHA 5HVHA 2CYYA 4F04B 1QAXA 4ZPAA 4NLOA 2MLYA 3KG4A 3C19A 4ZVSB 2W7PA 2EG1A 4PAAA 4PWDB 5B0AA 5HMZA 1MMDA 5KT4A 2CJ9A 3M9OB 1WOSA 2VQFJ 4NCAA 4K4WA 4MFBA 1OY6A 1RT1B 2JWNA 5C24A 2YNIA 5HROA 5AE1A 3OV7A 5E3RA 3KK3A 2YKOA 3DI6B 1VIOA 1MMLA 1LWFB 4ZCKA 3MOZA 4UZCA 4LSLB 3TO8A 5FLXY 3R8YA 4L73A 3GIRA 2BVZA 4DV1J 1PO6A 2CJYB 3PRBA 2XZDB 4QIVA 3AOCA 1SJ1A 4EU0A 3WX8A 3D66A 2G0CA 2DO0A 3CNQP 2MQLA 2D69A 3QRPA 1URNA 2OHDA 2LDIA 2CG8A 3G6XA 4JI8J 1NSPA 3CJ0A 2HAFA 4CI0B 1R0BG 3MM6B 3DLGA 2YKMB 4CO3A 4X4RA 1XBWA 5J2NA 2Y1LB 4MH8A 2V6AA 1XNRJ 4UOGA 5IXUA 2RS8A 1UVMA 3NBPA 3NCPA 4OYAA 1JLBB 1RYSA 2O1PA 4ZP7A 1L3SA 4BDPA 4HEA9 2ZHOA 3MWBA 3ENAA 3ZNJ1 2AD9A 5KFNA 3HK2A 4DR5J 1NK7A 3M6XA 1RDRA 5A8WB 3HHNB 3HT0A 2XO7A 3UDCA 1UCNA 3QGHA 1TL5A 1VCTA 1APSA 3G71S 2KZZA 3VTIA 3CJ5A 3ZTRA 2V8PA 2JEIA 2LKZA 2WVDA 3R9LA 1WG1A 4B9VA 3PJ9A 3LP0B 4YHHF 3QFHA 1MWQA 4C11A 2DGXA 2ASDA 3HLUA 2M2BA 4DDFA 4KB7A 1T02A 3PYEA 5LXRA 2FHJD 3NCRA 3ZTPA 2E1PA 4K4SA 1HBMA 5IT4A 2Q1LA 3R5BA 1LW0A 4C8NA 4ED2A 1FWKA 3DDNA 1R0AA 1F2GA 1MN9A 3HVRA 4ED8A 4DX6A 2ZDPA 4ELTA 3DGVA 5KFPA 1HA1A 1C2PA 3HO1A 3B8HA 2DNQA 4NOHA 2DGSA 3NRBA 4M94A 2QYCA 4KO0B 3FFIB 4UUXA 1BXNA 2R7RA 2DHAA 1PILA 1ACMB 1HNVB 3Q86A 4DR6J 1HLWA 3WIUA 4ZVRB 5CXTA 1NJXA 1I51B 1JLGB 3DRRB 4KKOB 2EFQA 4HDHA 1KHVA 3DXBA 1M0SA 3KWMA 3OL8A 3UWTA 4DV6J 2K1RB 3TEGA 5A0YA 3VV2B 5IV3A 3AH6A 2HWTA 5IV4A 5KFWA 3HMJG 2V63A 4I68A 3KFWX 1WKJA 3L95X 1EX8A 4GKKF 3A3PB 2KM8C 4DL4A 4YUDA 4IH5A 2YBVA 2LP4A 2MZTA 5EUHA 1NM2A 1OMSA 2RKIA 4O4GA 2FJXA 4ZPTR 5IS2A 3HHKA 2D74B 1M5VC 2MQPA 4QU6A 1P9YA 4Z7CA 1NJIT 1HD1A 3TW0A 5HQ8A 2H48B 4WK1A 4M5DB 1M5PC 1SXLA 3UPFA 3TEHB 5GMDA 4YP3A 5DQIA 5LMUJ 2E1MC 3H90A 4WBFA 2ZH4A 1U1OA 2DBBA 2BOAA 2XMTA 1BQMB 3QZ7A 3ULHA 3OBIA 2UUWA 1NXIA 1CQNA 3C6UB 2MLXA 3SXLA 3LTOA 2FJEB 1RADB 1T0TV 4ELVA 1NSKL 1E6YA 3ZZOA 3FEYB 1R43A 4CLSA 2JC0A 1P27B 4ICLB 2GQ2A 1PIEA 1NDKA 3GB0A 4WFXA 3QJLA 3HKZD 2RDJA 1FK9A 1FTRA 4WIQA 4TU9A 1JJCB 4Y65A 3B4MA 2O5DA 3NGKA 3KUGA 1DBDA 3FSIA 4Y2CA 3N0VA 1OY9A 3MMAB 3JB9k 3MPUB 7FDRA 4J91A 1DQAA 1KBRA 4DSJA 3IN5A 3TJ9A 2CZVC 2XMUA 1KQKA 4IKAA 2B56A 2OI2A 3VVUA 1T11A 3KMSA 2ZH3A 4LFAJ 1J27A 3DMJB 2WAQD 4B9NA 3UN3A 1IQTA 3N6MA 3O2IA 5HN0A 2A6MA 4A8KA 2B8QA 2OPPB 1JLQB 2FVCA 3IRWP 1SJQA 2QFIA 2WB1D 1AROP 1Q78A 2XC9A 3CJKB 2VOOA 2KT5A 1PJ6A 1FT8A 1R89A 3HZGA 2IAJA 4CLZA 1B0TA 2X3DA 3ZZRA 4BBYA 2NCKL 3MM7B 1MWYA 2CUYA 3Q8SB 2VFTA 2PMWA 1PBUA 2ILZA 3LP2A 1EARA 2ZH1A 4B3OA 2EFNA 2CA9A 4E8UA 4ZVOB 2NYIA 2W8LA 3EPGA 3E3XA 2M7SA 3IBWA 2EVZA 4QPXA 4K4UA 2C1EB 1FWLA 5F0WA 1HI8A 2QIFA 4MIAA 2AEJA 1UPMB 1VQ7S 2R7XA 3KLGB 2BXJA 1IM4A 3JSMB 1GX5A 1RAGB 2J0XA 4KFBA 3NL0A 3N79A 3FCHA 3ZO7A 4MKVA 2C2ZB 1W2BR 3BGRA 1VQYA 4QR1A 3HVTB 3R1LA 3MEGB 4PYAA 5GADU 2KKHA 3PTWA 4JI5J 3TI0A 4KHPF 5ETOA 3AA8A 4WU3A 2NZCA 3LALA 3TX0A 2R7TA 4M1KA 1IR1A 2VG5B 3OHAA 4J9QA 3QBCA 4CO5A 2C2RA 3CULA 1CVJA 1R8PA 2VBYA 3JTPA 4NLWA 2UP1A 4M5HA 1VC6A 1IBCB 1I1GA 1RLCL 4I69A 2HNYB 4P9SA 2U1AA 2R2TA 2QGFB 2UZAA 3L9ZA 1Q8KA 2BE2A 1Q82T 3QT5A 4ID5B 3SZ2A 2Z2ZA 2HFOA 1M5OC 4LREA 2PDAA 5IQQA 2VFUA 3CEDA 3KJVA 5U47A 2AWZA 4ITSA 4RW6A 2UUBJ 1KP6A 1YGYA 4DR2F 1UA1A 3TVZA 2R8GA 1CPZA 3GV5B 1WOOA 3C6TB 5DZ7A 1VQ8S 3MHYA 1OYEA 1ZM4A 4DV4F 2CDRB 1RXOB 2QLBB 3MGJA 2EK1A 1GH8A 3LP1B 1SH0A 3M4XA 4P2SA 4JV0A 3MD3A 5KFTA 3W62A 5D15A 2BW7A 5E3QA 2IYGA 1U0HB 1X4FA 4DR4F 1BWEA 4CYUB 1K73T 2VG6A 3I82A 3Q8QB 1M1HA 4NLTA 2M4MA 3OVAA 2R8JA 1SQGA 1JLCB 3F41A 2OD6A 2EXUA 1FE4A 1NK8A 3I31A 4FPRA 5KFFA 3CE8A 3CCSS 3W63A 1Q8IA 3ILJA 2ACMA 1TK8A 9ATCB 1AYEA 1XMBA 3E01B 2XMJA 3BGFA 3D54A 1S9GB 2MXYA 1RBAA 2F7VA 4ZIVA 2KJVA 2ZUGA 2QL9B 3M6VA 3UE2A 2X51A 1VRQC 2BDPA 1IVZA 3DDIA 1DQ9A 1MMNA 2CWXA 2V2VA 4UY85 2KRRA 3K5PA 8RUCA 4Q44A 4ZVFA 2Z8QA 5LJ5Y 3SSRA 1EZZB 3BKFA 2EFGA 5KT6A 3AOBA 5KT3A 3LPYA 3ZZUA 2DITA 2WONB 2NYHA 1GMWD 3HJVA 1I94F 2DR6A 4RBVA 1PC5A 1G7CB 5DJBA 2ZD1A 3K5OA 1U49A 1JKHB 4F0KA 1K44A 2RUSA 1V3RA 4B3RF 1B4SA 1R3NA 3DLLQ 1J5OB 4YS2A 1TL1A 1QSYA 4QWDA 1RT5A 4ILMA 5IM0A 1S1TA 2BM1A 4DN9A 4YB7A 2CNOB 2F8MA 2Y8WA 2BUNA 2HNDB 3PFEA 1R8AA 2V4JB 4F4ZA 1SIZA 2D7SA 3KLFB 4DV0F 2BJDA 4USJC 3RYLA 4F26A 3BQ0A 3VAGA 4KPYA 5CYQB 3D2WA 2HBYB 3MFIA 3FSXA 5D77A 1S0VA 4RUHA 2V8DA 3FVYA 1JJ4A 3K8VA 4KHMA 3PO4A 2L3MA 2HFVA 2RF2A 5I42B 1VOMA 2BACA 3T5JA 3Q8PB 3W5ZA 3UDEA 2FVSA 4ECYA 1T9UA 3M8PA 4RUAA 4LF7F 3MD1A 1CULA 3WHIA 2ROPA 2CPIA 2IC3A 1X5OA 4X66F 1FKOA 3KK1A 3S7RA 2DH8A 1O51A 2HHSA 4G3IA 2NR0A 2CJXB 2G0JA 4QYZK 3A12A 1WI6A 2F1FA 1MROB 3MZIA 1U6ZA 3G8SA 1HNIA 5C25A 5C24B 2QLFB 2YNIB 2QMWA 1BE4A 2Y1JA 1K47A 1HWUA 3DYAA 4DFJA 2YNGB 1TMMA 2UVRA 2VA2A 1FDBA 2M9KA 3M30A 3J7AN 5HP1B 5HO4A 4LBIA 4OZ0A 2CFXA 2AP6A 2BANB 2AV5A 5HK4A 5DG9A 4JP8A 3M9MB 1WHWA 2FD2A 4OV1A 2NXCA 3DOLB 1URRA 3KLHA 4GC7A 2V0NA 2GVDA 3BR9A 4GVLA 4NCGB 3PEHA 4NI2B 4K4ZA 1PCAA 3TZYA 3RW7A 4NLPA 2RNEA 2MKIA 1RAIB 1UEVA 3CWJA 4RL1A 1B3TA 4B9SA 3GYXB 4MAKA 3UNYA 4WCEQ 3NBPB 1RTDA 4HT7A 3OVBA 5HI7A 4Y6IA 4RUBA 2HFZA 2P9CA 5E33A 3KHGA 3UD4P 5HAOA 1XC9A 2H51B 2I8EA 2CPHA 3I6PA 4ZVUB 1GTEA 4JI1F 2CQ0A 4FVMA 4C8MA 1FCAA 2ZNYA 4K2XA 2IRYA 3PJWA 2VU5A 2HHHF 3HHDA 4ZP9A 2PSZA 3QRQA 2ZBPA 4EBEA 2UVUA 1KONA 4DFPA 4IDKA 2OAUA 2JNJA 4HHUA 2V9WA 4FYWB 2E7WA 2HWHA 5IT9U 3D6MB 1VQOS 1KVJA 5E2QA 3UDVA 3SYZA 2VJVA 2BKOA 2QN6B 3Q0AA 2IFXA 3RBEA 1EQMA 1R8HA 3C16B 3LANA 4DSFA 1R0AB 2H1YA 4WK3A 4O23A 1UP1A 2DY1A 3NS5A 5C42B 2HPUA 4P52A 2XY5A 4OZNA 3BF4A 1FJGF 2RUGA 1FNMA 2GMHA 2F40A 1KLMB 1J5EJ 4UOCA 1SL0A 3BPDA 1EIYB 1FNOA 4KRWA 1HMVB 2XNRA 3GFZA 2X7IA 2KU7A 4YY3F 1RTHA 1JNZB 1RACB 4FF4A 2WZ1A 2RU9A 2BZ2A 3I5AA 2PT0A 3EE3A 1DRZA 1KN6A 1DY3A 1V5VA 1SC3B 1NJZA 1NK4A 3RB4A 4HTIA 4O4RA 1T05A 5D8HB 4NYPA 3M05A 5A0YB 2Z2LA 3ITHB 3T6JA 2ZH5A 2XI2A 4B3TF 4EFAC 4LF1A 2G1DA 3K5MA 5KFGA 2AJQA 1HL6A 3PW7A 3LWMA 4BWJA 3QSIA 1TUGB 3G4SS 1V9OA 4OLOA 1GAOA 4JI0F 5DRKA 4DR7F 1VLOA 4K5SA 2NQPA 1B64A 4ERDA 4DJBA 2GMLA 4LSZB 1YK9A 2K3KA 4DL7A 1EKSA 3D1QA 1V3SA 3QO9B 3ILLA 1U1LA 5CD4H 3RBZA 3ISND 1UW9A 4QWAA 2F4VJ 1LV5A 4J9SA 1F5CA 2DNNA 1D0EA 1IBMF 1RWUA 4J9RA 3M32A 2FVQA 4HACA 1SJ4P 2XHWA 4XDCA 4LRBA 2ZM6J 2ACYA 3CT9A 3NG8A 2MKKA 2BABA 1LWCA 3JAMU 3OR2B 2GIRA 5FDLB 1NPPA 1D9AA 5BYRA 2MKHA 2B9WA 3RBDA 4KH1B 1DLOB 4ID8A 3CC2S 1SKUB 5HLFB 3UI3A 4KGMA 2NPIA 3R7NB 3AHPA 2W7OA 1A9NB 3VZHA 2IM2A 3M1VB 4YEAA 2XCAA 4PQAA 2NXEA 3W61A 4DR1J 4I6WA 1VHIA 1U7LA 3LUYA 2DNMA 3CCES 3J80U 3NS7B 4K0KF 3AQOA 4IR1A 1T3OA 4PXCA 4FP9A 1VK3A 1M5SA 2KT2A 1N88A 1VC5A 1WOPA 1DURA 1T9WA 3DDKA 1NK6A 4LFBF 1EP4B 1MNEA 2XYHB 3TANA 3JAMY 4GVBA 1FDAA 2V2ZA 2R2RA 1D9DA 1V6HA 1IKVB 3POTA 4IG0A 3NWRA 4DUTA 2A18A 1UVKA 4FS2A 4DLEA 4KV8B 3UFCX 2RRBA 4C3KA 4ATNA 3QT7A 4IG3A 4MK7A 4RWXA 1RLDA 2KDOA 2OP5A 2BQRA 1S4FA 4C0OC 1NK9A 4F67A 3PO5A 1OSCA 2NSCA 3BO2A 4P74A 3QGGA 1N5QA 4QYZJ 5F8LA 1H7XA 3SCLE 3IR7B 2R7OA 4Y34A 3J80Y 3QJJA 4DMZA 2XBPA 2BR0A 2WVCA 4V19J 3SQGB 1T9VA 3MM9A 4Y2MA 2LU2A 3GYNA 2EWHA 2ZC4A 1TFWA 2DEJA 4UOHA 4AXJA 1ZH5A 3MR3A 3OSPA 2AGPA 4OIXA 4OX9F 1NJWA 4ILLA 4ES2A 4CH7A 2OIHA 1OQ3A 3H25A 4F0HA 2JJ4D 3NGRA 2ZZNA 4LF4J 3MECB 3KDOA 1NCLA 2HK2A 1KQFB 3N01A 4F7VA 1XNQF 2N82B 3OTDA 4GKJF 4WF9Q 2MLZA 2OLWA 3PRVA 5F8NA 3DFEA 2DYAA 2G0IA 5ADZA 4AQYJ 3S1TA 1N36J 4X65J 3HFVA 4LRCA 1HBUA 3VALA 2VG7A 4IO9Q 4KH0B 1TUVA 2NXUA 4I2QA 3R27A 4ANDA 2HS0A 3TUZC 2K7JA 2CPYA 4PG5A 2PA8D 1VQ6S 4NLGA 1YTYA 1ZOTA 1B7YB 1N54B 2ATCB 2M3DA 2YNHA 3MDFA 1X31C 3T9ZA 3CW2C 4U7UK 2NS1B 3VQTA 1EHWA 1RT7B 4J9KA 4DU8A 1WF1A 5DGAA 3KLEB 1HPZB 1Q1KA 4DQSA 3P4UB 1RWWB 2JSXA 5D4OA 2FLLA 4M5GA 4KIAA 1NKEA 2VG6B 2MB0B 2KO1A 5E3CA 5ETQA 2VQFF 1SV5A 2AW0A 3VVTA 1RHJB 1YWXA 3VAJA 2WSEC 3QT6A 2PEHA 3OTEA 5J2PA 5DQHA 3R3TA 5A6WA 2HRYA 3CSKA 4LUBA 1NSQA 4DV1F 1H3DA 1RBLA 1N32J 5D3GB 1F9HA 2DNRA 4NZ6A 1UWBA 2AYEA 4G1PA 4DSLA 2BYCA 2EBEA 5KFQA 3TQ1A 1BQNA 5A2QU 1KC8T 1C0TB 4LR8A 3V6JA 2FVPA 3A1YG 4JI8F 3SSSA 4ZLPA 2OKQA 1HQEB 3U1NA 3VAFA 2BE7D 1R7IA 3QJPA 1FDNA 5AE2A 3K58A 3FMWA 3P45B 2OJ3A 3SDEB 4FXWA 2MZSA 1XNRF 3AD8C 2J6SA 4QCLA 4J9NA 1LOUA 5HVGA 2GGPB 4OHVA 1RT5B 1S1UA 2YY3A 5IM0B 2V94A 1BWVA 4J9VA 3DLHA 1ZM3A 5KFXA 2VKZG 1QAJA 5K5MA 4DR5F 2W9AA 2AZ3A 1Q16B 1NK0A 1WNEA 1HKAA 2J9CA 3PDNA 1Z2LA 2ZITA 3KNAA 2HHVA 2NPFA 3CCVS 2FC8A 2LEAA 3QQCD 5A2QY 1LW2A 4U8VA 1C0UA 3I4HX 4C3MA 1S6QB 2IDLA 1RTJB 2FIUA 3H59A 2C2NA 2BMBA 1RZMA 2RQMA 4LR7A 2VFVA 4ECTA 4TY8B 4M5MA 2CPJA 4NA2A 5G0RA 1RT6B 1HNWJ 5CCMA 1RU1A 2C2MB 4YOEA 1RTIB 2W7AA 4GO7X 5B09A 1VHFA 3DLBA 3OL9A 1RE1B 1VS3A 2W2MP 2GVZB 4PR6A 3T1YJ 3RAMA 4MK9A 4F50A 4CLFA 2MEWA 3GCWP 2Y3YA 5KFSA 1BC6A 2D3UA 1ICEB 3AD9C 1TTHB 5T7LA 4BC7A 3BSOA 5CCLA 4Q7AA 5JVGQ 2DRDA 3AJ2A 3NAIA 1NMEB 3DU6A 4EZ9A 1S57A 1JB0C 4DR6F 2EBGA 8AT1B 2FVRA 4LQ9A 3HFKA 3OXFA 2YXLA 4DV6F 1OSDA 2QYGA 3HCXA 3QYYA 4NRTA 3KLHB 2DGUA 1OPZA 2LQBA 3NWGA 1FX4A 1EKRA 3NAHA 3NNHA 1YG0A 2WRMA 3GFHA 4DN0A 1UL3A 4J5OA 1YHQS 2CJBA 2CDQA 1DTQA 4NWBA 2FYXA 3IFEA 2OTLS 3L3CA 1HHQA 4C4WA 5F8MA 3JSYA 4M5LA 1L3UA 1VQPS 2DXDA 4WP3A 3C14A 3OPKA 4ELUA 1SI9A 2XCPA 2ZE2B 5B0BA 4TKTA 2YPZA 3HZEA 5EHHA 1RU2A 2ZUAA 1T03A 5LMUF 3M8RA 4UQGA 4KC5A 3TUIC 2DHXA 1HBOB 2LFVA 1TV6B 3DRPB 3K57A 2X1BA 2IMOA 4DS4A 3DOMB 4HYKA 4KJIA 1T9YA 4KGKA 4NLXA 1XK8A 1I94J 4DEZA 5A76A 4NRUA 1SVDA 4O0IA 4W90B 4DQQA 2WOMA 2YWKA 4RW4A 4DV3J 1RWKB 3HSGA 5CH7B 2ZWPA 1IN0A 3KYLA 2ADBA 3TAMB 2Z2YB 1S76D 4L74A 3TNVA 3RJMB 5HSPA 2G4BA 4FF3A 2AJFE 2BKPA 2XEXA 4FF1A 1KLNA 3MFHA 4PQUB 2YWGA 4LRAA 1VDHA 3F73A 3MOJB 2I38A 3NEKA 2IY5B 4WKRA 2LLZA 2XYGB 2EK6A 2HFSA 3QWUA 3TZWA 1H73A 3G8QA 3HHLA 1WTFA 3R7BB 3GIIA 2LQ9A 1UJ4A 4C7QA 2CADA 4WYLA 1UVJA 4LFAF 2ROEA 3BEGB 4R25A 3SQOP 3BB5A 3BH7B 4O3SA 3R6GB 1QM9A 5HVFA 2A1BA 2KTQA 2L9WA 3AQPA 2CWKA 4K7QA 3T3FA 3P8BB 5E3PA 2GO8A 2DPJA 2OPRA 1R6VA 3R5AA 4URSA 2HHPA 4NXMJ 1F3FA 4K4TA 4IQXA 2NXJA 1DQ8A 1XN9A 1Z4UA 4MKAA 3Q23A 4DR3J 3FCVA 2B3TB 2BQ3A 1G6BA 3OFGA 3ZC4A 1RWMB 2RQKA 2CPXA 1P6TA 1E6VB 4O3NA 2LEBA 1HQUA 4O3OA 3WIVA 4IOBA 2BM0A 3H0PA 5J2MA 4N56A 1N52B 1RT4B 4N76A 3AODA 4IFYB 2XZWA 2FZGB 4D3HA 3OUYA 1U4BA 3R2DJ 4LT6A 1HHSA 5JUMA 2IBKA 3F0NA 3O8WA 4YB1P 1TL7A 1WEYA 5HL7Q 1HNXJ 2C3UA 1QLNA 4RBUA 1VK8A 3EDQB 3GFYA 4C97A 1N33J 4B17A 3DGPB 1BGXT 4GMKA 3EWGA 3JYTB 4JI5F 1M5KC 1S7IA 2RHQB 1OPIA 4TYAA 4DSEA 3IG1A 2AX1A 2ZC3A 4Y3CA 1H74A 2DGVA 1UAWA 2AJ4A 4U9RA 2FLNA 1FO1A 1REVA 2EFVA 1GTHA 1LWCB 2MKYA 3EZOA 3H5XA 3D1OA 2EI5A 3TZZA 4TY9A 1S0OA 4ZP6A 2W9CB 4WTYA 4B3MJ 3CO9A 1IM6A 1S1XA 3UN5A 2DNZA 4AD6A 1F5BA 6FDRA 2UUBF 3J7ZT 5KFRA 4JV1A 1JLEA 4OHXA 4QIEA 3FCWA 1Q5VA 5K8NA 3M2RA 1JLFB 3IO1A 4JI7J 3EXYA 1RCXB 2OFHX 2XS7A 1UZHA 1FEEA 2AYGA 1H98A 1WHYA 2CIMA 4M95A 5B0EA 1RAOA 4TXSA 4Y28C 2B6AA 1FFSB 2OD4A 4QWBA 3GFXA 4C9DA 2VZ9A 1ZETA 1DHMA 2YX7A 5SUHA 1KDNA 2DXEA 2AGQA 3FRZA 3QGIA 3ETMA 2ABYA 2P9GA 3I55S 1FJGJ 4DV7J 1P1LA 3GCXP 3DHWC 1AT1B 5C5JA 1TMJA 4RNFA 2C3MA 3JXOA 1I3OB 3K5LA 3PACA 4B08A 2C2EA 4EGLA 4C2MA 1X4HA 5GAHI 2XSJB 1ZTTA 4ED6A 3KK2B 2RE1A 3IC1A 3JQMA 3Q2SC 1VLYA 3US5A 3IAS9 1CJUA 4B3SJ 2G2YA 3ZZTA 5JXSA 3TQEA 1SH2A 3LH2S 4IFVB 1KD1T 3W5YA 1RB0A 3G2XA 1R8BA 3QRRA 2B43A 4NZ7A 1YQHA 4NA3A 1U1QA 2XMVA 4J9LA 1H6KX 3OD2A 1RGVA 1L5UA 2WW4A 5E5NA 5LXYA 3RBXA 2KFYA 4NL5A 2AJ1A 3O1LA 1VRUB 2OSQA 2QLXA 5K20B 1WF0A 4LF6J 2JX2A 3V6KA 1P8GA 4RW8B 3CCWA 3EPIA 2LQ5A 3IM8A 2OMOA 1QE1B 1N6QB 4ETXA 2JHEA 4CLYA 1HBUB 3HPOA 2R2UA 4OYBA 1G1XA 1X4CA 4ECUA 3BGOP 3M8QB 2HNZB 3MR6A 2B9YA 1LFPA 5E41A 4NLUA 3THPA 1P1TA 2HBRB 5HQMA 3W60A 2W4PA 2GW8A 4UUWA 3D28A 2IA0A 2XMWA 1GXLA 2N4DA 4HLBA 1H72C 3OR1A 1N5YA 3TWZA 3DC2A 3G6YA 1RUSA 1FRLA 3CJTA 5D0GA 4Y2IA 4IRCA 2Q66A 2VPXB 4M5NA 2J8SA 4TYBA 3P49B 2NUUG 2QA1A 3SFUA 1YI2S 2M8DB 1CC7A 2J7WA 2FTRA 1UVNA 3UW1A 1L3KA 2W2PP 4CDIA 3PY8A 2HGMA 2CXEA 4K0KJ 2W2OP 2EC0A 3QT8A 4N47A 2V5HG 1TZ0A 2HQDA 2VFRA 4DUYJ 2J7KA 4G1QA 4ZIWA 2FJVA 2UUTA 2ZH8A 4OYPA 5KOWA 1LKZA 2YNFA 4RNHA 2CZ4A 1HD0A 2OGUA 4DV5J 4ECRA 1UWBB 1KS2A 2DCUB 3OVSA 2KHDA 4QQBA 3VCDA 4WZMA
chains in the Genus database with same CATH topology
4PUOB 1KTQA 1O51A 1R27B 2MSTA 2MJNA 2HHSA 2Q3PA 3BGRB 4G3IA 2NR0A 3U02A 4FXDA 2ZBIA 1S1XB 1WI6A 2MDAA 4CO1A 1YRTA 2CQ4A 3SEOA 5MLCV 4UY8T 2F1FA 3PEJA 4ZDNA 1MROB 3MZIA 1U6ZA 3G8SA 3M2UA 1HNIA 3H8YA 3IS9B 5C25A 3PW5A 4CQ1A 4J37A 1WELA 5C24B 1TKZA 2YNIB 1H2UX 3K59A 1X5SA 3SCIE 2QMWA 3MM8B 5KAKA 1JLEB 1HWUA 2ZOGA 3TX8A 1VRTB 3DYAA 5HMYA 4DFJA 3OR2A 2PGCA 2YNGB 1CSJA 2UVRA 2J9EA 2FY1A 2JLFA 2VA2A 1FDBA 2M9KA 3LGMA 3M30A 4CT9A 2HGLA 4HDGA 3M2RB 4AUKA 2IM1A 1X4DA 5HP1B 5HO4A 3P96A 5GAGI 2HHQA 4OZ0A 5FDLA 1Y7PA 4C98A 4TU8A 2CFXA 4NCBA 2JH3A 2WB4A 4LSNB 4Q0BA 2AP6A 4N8NA 2BANB 2AV5A 1DLOA 5A8KA 5DG9A 4OJHA 5I3UB 1U09A 1ZZFA 3M9MB 5HLFA 1KOHA 1C4CA 1WHWA 2FD2A 3V5RA 5IWAF 4OV1A 2DRAA 1RA6A 5F3TA 1XEZA 3PV8A 2WBMA 1UJ6A 1JXEA 2B6AB 3MUMP 4ECQA 3S8SA 2ASLA 4IOCQ 2BE2B 1QTMA 2XG8A 4H54A 5DM6Q 3DOLB 3CGIA 5KFOA 2CPEA 1S9EA 3BSCA 1TAQA 2FGCA 2RB7A 1YRXA 5LSRA 1URRA 2QA2A 3KG0A 1Y5NB 4WXOA 2V0NA 3M1VA 3Q8RB 3KLHA 4GC7A 4TNOA 3BR9A 5J1EB 2W8KA 4NCGB 3CF5Q 2E5GA 2HHXA 3FZBA 2L41A 4KBIA 3MCSA 3RR7A 3PEHA 3I9ZA 4K4ZA 3FDSA 3D0GE 5F0UA 4DF4A 3KJVB 4DL5A 4RW6B 2M0GB 2CJKA 2XS2A 2JOQA 4H4OA 3RW7A 4NLPA 1SC6A 3B82A 3B78A 1TL3B 1MU2A 1U1NA 2RNEA 2MKIA 1UEVA 3CWJA 3VAIA 1FTCA 2FHJA 5LMNF 1VQ9S 4B9SA 3GYXB 4A8FA 4MAKA 3NNCA 4GC6A 4XIUA 1YJRA 3DLEA 3FRYA 3K2YA 4C8YA 5GAGU 2XGQA 5KFDA 4WCEQ 2DGTA 5J2QA 3RRGA 2KT3A 3NBPB 4KSEB 3TVKA 1RTDA 1LW2B 3VZIA 4LQ3A 4OZJA 4HT7A 3OVBA 4HI1A 4CTAA 1ZBTA 4P7TA 5HI7A 4Y6IA 1C0UB 4EZ6A 3IRXA 2WCXA 3RW6A 3OLAA 2J0SD 2HFZA 4OZLA 3ENWA 2DR7A 2P9CA 1OQ6A 4HT5A 1XMQF 1KSPA 3DNCA 5E33A 3TA2A 2M52A 3K5NA 1YJ9S 2J76E 3JSBA 1JLGA 3KHGA 3UD4P 5H9EJ 3EXCX 1RKIA 1EP4A 4MTPA 1QJHA 2G13A 2WTFA 4CH1A 1XC9A 3W2WA 5DG7A 2I8EA 2CPHA 2QE5A 3I6PA 1GTEA 4JI1F 1YJWS 2CQ0A 4CH0S 2DPIA 1KTVA 2AX0A 4FVMA 3CC7S 4C8MA 5L1LA 2UVVA 2RMLA 3HX9A 2BA9A 1FKAF 3IGVA 1FCAA 4I1TA 2ZNYA 4HL9A 4K2XA 3U27A 2IRYA 1UFWA 2ZOMA 1T8EA 5DLFA 3PJWA 5GADI 3VWSA 1IKVA 2E5JA 4KAIA 1TFYA 4XAKA 2C22A 2HHHF 5H1SV 3HHDA 1T95A 4LF9F 1AXQA 4EEYA 3TA1A 3HVAA 1S6PB 4ZP9A 4Q43A 2PSZA 2W4CA 5DETA 3T5LA 2UVWA 3E2EA 3O3LA 4JOUA 4KR0B 5DDOC 4KV8A 2PE8A 4EBEA 4OZ1A 3V6HA 2UVUA 3WX4A 4EYHB 4OQJA 2XB2D 1KONA 4PG4A 3HI9A 3T5KA 4WXWA 2YH0A 4DFPA 5KFZA 3KOAA 4IDKA 4ZPBA 2OAUA 1J5EF 2QSFA 2V9WA 3ENQA 3VF0B 4X4QA 5E3AA 2DIUA 3EZUA 1TVRB 5DS7A 2B0GA 2E7WA 2PMHA 3TAQA 1FJCA 2HWHA 5KG4A 3RAQA 4MIBA 1XTZA 2VC1A 2GX8A 1NJYA 4WE1B 2HGNA 3PR5B 3OTOF 1VQOS 2UXBF 1KVJA 2MZ1A 5E2QA 1VJWA 4YB6A 3SYZA 1RK8A 2IVFB 4OHYA 1RT3A 4JV5F 1MSWD 5L1IA 3ISZA 3FEZA 1FRHA 3HM9A 5F8JA 3Q0AA 2MPUA 1MWZA 2LECA 4BS2A 2IFXA 3RBEA 3CDBA 3BQ2A 1Q7YT 1R8HA 1WEXA 3N4WA 2HW3A 3LANA 4DSFA 4WFZA 3SQGA 1R0AB 3BS9A 1UMJA 2XSFA 2OTJS 4I56A 4WK3A 2EPIA 4O23A 3MR2A 1UP1A 3NS5A 2AJ0A 5DDPC 5C42B 2HPUA 4DBQA 2XY5A 4LF8F 2ROGA 4OZNA 3BF4A 2KN4A 3M9NB 2D3ZA 4AE5A 5CA5A 1FJGF 2RUGA 3K7RA 3THTA 2FHMA 1FNMA 3RB6A 2GMHA 2F40A 2LDYA 1L3VA 1KLMB 2Q79A 2JVRA 2HMIB 2YWHA 2MGZB 2XMKA 4O44A 1SUQA 4UOCA 5J1NA 2HHWA 3V81B 4X4TA 1SL0A 3CDEA 2MQQA 4MKYA 2FLPA 1FNOA 1Y3KA 2UV8G 3PW2A 2I5JB 1IKYA 2KXHA 4KRWA 1U1MA 1HMVB 3SFGA 3MM5B 3V6DA 4ZA1A 2XNQA 1FXDA 2CJQA 2MZJA 3CTRA 2QA4G 3NMAA 2XNRA 4WU2A 3GFZA 3MEEA 4DPOA 1LK7A 1IKWA 3MECA 3I0RB 2KU7A 4YY3F 3GIJA 3CC4S 5D78A 1RTHA 1SJRA 1VGYA 1JNZB 4FF4A 2RU9A 2BZ2A 3I5AA 2KRBA 2PT0A 2ZD1B 5K14B 3PXGa 1DRZA 1KN6A 2RD5C 2B4UA 2FC9A 1X0FA 4PKDB 2KG1A 5EDWA 2AYMA 1KVIA 4X4UA 3RTVA 2VFSA 1FKPA 1OO0B 1NJZA 1NK4A 3ZZZA 3OFHA 2LXUA 2CQIA 2IVMA 2X1GA 3OR1B 3RB4A 1TL1B 4HTIA 1HW8A 1YSJA 2KFZA 1N5YB 4O4RA 1T05A 5B0FA 5D8HB 4NYPA 1S1TB 3M05A 5A0YB 2Z2LA 3ITHB 2RILA 2RT3A 2ZJRQ 2G9OA 2J6TA 3T6JA 2ZH5A 2XI2A 2HYIB 3KHHA 5BR8F 4B3TF 2HFNA 1HWKA 3JTNA 4FNHA 4OZ5A 4EFAC 5EWGA 3TUJC 3HJFA 1BD6A 4FVCA 2G1DA 3W2VB 2PA3A 2E44A 3K5MA 5KFGA 2P6TA 1WG5A 5I4MA 2AJQA 2X1AA 2F4VF 4DFMA 3MURP 1HL6A 4K50A 3PW7A 4OX7A 3TP2A 3J7YI 4WYWA 4AFFA 1Q4RA 3LWMA 3ONQA 2KH9A 2ZHBA 3TARA 1RT2B 1C1BB 4USHA 4BWJA 2EFPA 3DMJA 2DNOA 3G4SS 2ADCA 3LOUA 2R7QA 1V9OA 4KQZA 1CC8A 4Y2KA 1UA0A 4R5PB 4OLOA 5E0OA 1GAOA 1Y00A 4JI0F 1XMOF 3R5CA 4ED0A 3T1HF 2EG2A 5DRKA 2ZM6F 4K5SA 1S99A 1NHVA 4DR7F 2NQPA 4ERDA 1B64A 1FRXA 4DJBA 5DDQC 2R7WA 1I6JA 1Q7LB 2MKSA 3FEXB 2M88A 4ZPWR 3S01A 5L1KA 4XPEA 2GMLA 3DLKB 4LVNP 2RF2B 1IKXA 1VBYA 2JFDA 4PRFA 4BWMA 1N4LA 4X84A 5GVQA 3CDUA 3LWLA 1U6FA 1RT7A 1B0VA 2K3KA 4DL7A 5D6GA 3KLEA 2MY8A 2SXLA 5BJRA 1JNRB 3M8PB 3N9UC 4RKUC 5K8OA 1HPZA 2M8HA 3D1QA 3PVXA 2DR8A 3PKMA 4QR0A 1V3SA 4G1QB 3QO9B 3N6NA 1U1LA 2ALZA 2FJBB 5CD4H 4ZP8A 3SV3A 1SH3A 2W9BB 1NH7A 1VIXA 2DNLA 2IC3B 3MMBA 2HQ3A 2XMMA 3FQKA 4DLGA 4DQPA 3ISND 4ECVA 4A48A 2UV8A 1A7GE 2K8GA 3MEKA 4QWAA 2PI5A 1FKOB 2J8AA 2E29A 4ZMMA 3KHLA 1LV5A 3PJXA 3KK1B 1K0VA 4J9SA 4YR2A 2YWFA 1F5CA 4DOZA 2DNNA 3IA0A 4ILRA 3OTCA 5F8HA 1D0EA 5LT5A 3J7YU 1N5SA 1IBMF 2A3JA 3NP5A 4PXEA 4YB5A 1RWUA 1FD8A 4J9RA 3M32A 3BO3A 1SB6A 2B4OA 2FVQA 4MMOA 3LAMA 1G3OA 2F9JA 1SJ4P 3LW5C 2XHWA 4B9MA 4XDCA 1TKTA 1ZAVA 4PG7A 4RW7A 1Z1ZA 3GR1A 4OLPA 2JDJA 3HHLB 4DR1F 2ACYA 1O5JA 5D4PA 5SZTA 3EGZA 2VD3A 3M2UB 1HNIB 3CT9A 2DTJA 5C25B 5B08A 3NG8A 1OWXA 2GIQA 1TKZB 3P3DA 1W2IA 4ZVHA 2BABA 2MKKA 2IRUA 1LWCA 2MMYA 2JLGA 2C28A 4MKBA 3DYAB 3PFOA 4NYOA 3OR2B 1X8DA 2B4PA 4NLQA 1FVQA 2PMZD 1S7HA 5KG0A 5A8RA 4DV2F 4F02A 1FJ7A 3M30B 3JSMA 2ZH9A 3H4DA 2GIRA 5D3GA 3PW0A 2HIQA 5KG7A 1S0NA 3H40A 4JI4F 5FDLB 2Q43A 1D9AA 5BYRA 2MKHA 4C8KA 4PWDA 4A47A 2B9WA 3RBDA 4Q0BB 1NH8A 2J0WA 1U48A 1DLOB 3W7BA 1C0TA 2JL9A 1QUVA 2DD8S 3MAQA 3M6WA 1C4AA 4ID8A 3CC2S 5HLFB 1Q8BA 3UI3A 1X9WA 4F2RA 2E5LF 1Y3JA 2LU1A 3HVTA 3MEGA 2DIVA 4RUCA 4KGMA 1SQEA 1O0PA 1RI7A 2N3OA 2NPIA 3AHPA 2W7OA 1A9NB 1LK5A 1HQEA 2RDIA 4ETZA 3RU0A 3VZHA 2IM2A 4UQTA 1QY7A 1S9EB 3L7PA 5L8RC 4CZCA 1R8CA 3WC2A 3OHBA 3M1VB 4YEAA 3SCJE 1Z2ZA 2XCAA 1IBLF 2XLJA 4PQAA 2YVSA 3DI6A 5DO2A 3CD6S 1HI1A 4X4PA 2ZFHA 1LFWA 1LWFA 4I6WA 2CQ3A 3SDEA 3JSRA 2RVJA 1U7LA 3LUYA 2V2KA 4LSLA 4A46A 3WZ0A 1EETA 4H4OB 2Y1IA 2DNMA 3CCES 1P9QC 2IBOA 3DM2A 4DL6A 4K0KF 3AQOA 4IR1A 1T3OA 5KT7A 3KLIB 1NK5A 4PXCA 2GGPA 1WWHA 2LVWA 4FP9A 2HNYA 1UETA 3G9CA 1AW0A 4G1IA 1VK3A 1FRIA 3CIZA 1M5SA 3FNNA 3DLEB 2KT2A 1N88A 5J2QB 1VC5A 1RTDB 2DT9A 5D4LA 2FPHX 4W92B 4CTAB 1GT8A 3OUYB 2FGOA 2O3DA 2I2YA 4ID5A 1DURA 2VPZB 4YMEA 1ZM2A 4WJBA 5CYMA 2C3YA 2EFOA 3DDKA 1U26A 1NK6A 4IRDA 1FRKA 4RNMA 4DHVA 3GG1A 1JK9B 3SMZA 5EGYA 4F3MA 4LFBF 2BRLA 2E5IA 4USIA 2DB1A 1EP4B 1U25A 1NKCA 2GHWA 4DQIA 1RQ0A 4ES3A 2C42A 1MNEA 3W2WB 1S0MA 4AL5A 3GG0A 1S1WB 4I6YA 1NU4A 3TANA 1KOOA 3JAMY 2J9DA 2BOPA 1FDAA 2WW8A 4NLYA 5G4DA 3DRSA 2ZNZA 3VQSA 2B5JA 4C8ZA 4MYTA 3MM6A 2R2RA 4K4VA 4X2BA 3K8WA 2YKMA 1D9DA 4F2SA 4TU7A 1V6HA 4CCHA 2CG4A 1IKVB 3GE9A 2WSCC 3O44A 3POTA 4IG0A 4ED3A 1K8AT 3J7A1 2WSFC 2CQBA 1HBNB 3OQ2A 2GC8A 4J9OA 2A18A 4WIIA 2PD1A 3F44A 1UVKA 5L9XA 5EWFA 1N5TA 3J81Y 4IOAQ 2JLEA 2F8EX 4FS2A 4LFCF 2CQHA 4DLEA 4KV8B 3UFCX 4V19X 3UR0A 1S6QA 1KEKA 5M2PA 1Y5IB 1RTJA 1H38A 2RRBA 4C3KA 4ATNA 4QIGA 2ZBCA 3UCUP 4IG3A 4BC9A 4OI0A 4MK7A 2QLWA 5ITHA 3LP1A 4IDKB<