2MJNA

Structure, dynamics and rna binding of the multi-domain splicing factor tia-1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
b'GAMANHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleolysin TIA-1 isoform p40
publication title Structure, dynamics and RNA binding of the multi-domain splicing factor TIA-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 55
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mjnA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mjnA02
5HL7Q 1A7GE 1DZ5A 3J7ZT 1WEXA 3LQVA 2U1AA 2XS7A 2DGWA 1VC0A 1U1QA 3R27A 2KVIA 2SXLA 2ZJQQ 3VALA 1FJCA 1X4AA 5IM0B 3UCZP 2MGZA 4QU7A 2K3KA 2VODA 2CQ3A 2CQ4A 1SJRA 4QQBA 3P6YC 2MKIA 2LEBA 2LXIA 4LMZA 1VBZA 4FXVA 2AYMA 4QU6A 2M52A 2F9JA 2DGOA 1X4CA 2G0CA 3VF0B 2BOPA 1VQ4S 2MZ1A 2MKHA 2LA4A 2I2YA 1KOHA 2DNGA 5D78A 1PGZA 4F25A 3EGZA 2MKKA 1H2VZ 1VQMS 4C0OC 3CC7S 2CQCA 2DGQA 2HVZA 2L41A 2N3LA 2MQLA 1PO6A 4P6QA 3CD6S 2JVRA 2DITA 2V94A 1YI2S 3NNCA 3CMES 1XN9A 2HYIB 2CQBA 3BEGB 3H2UB 4Z2XA 2DGXA 1X4BA 1D9AA 1YITS 3CTRA 2KXFA 1YTYA 2XNRA 1VQ7S 2CPIA 5GADU 1YJ9S 2DNHA 1DHMA 4A8XA 4ERDA 1ZH5A 1X0FA 2MSTA 2U2FA 1VC6A 3Q2TC 1FHTA 3DLLQ 1VQOS 3CCRS 2LKZA 1YJNS 5DM6Q 1WF0A 3JB9k 2BZ2A 2MQOA 1FT8A 2LXUA 1K9MT 4IUFA 1N88A 3CC2S 2ADCA 1DBDA 2LQ5A 2KHCA 2M88A 4U67Q 4TU7A 2NLWA 1D8ZA 3TYTA 2MKCA 2N7CA 2CQPA 5DETA 1FJ7A 4CH0S 3SDEA 4C7QA 3BS9A 1VQLS 1U6BA 2M8HA 2AYGA 2I38A 2MPUA 3S01A 3VAHA 3G9CA 2MKSA 2KXHA 3BO4A 2PEHA 2LYVA 2DNRA 3S7RA 4WFAQ 5DDRC 2DGSA 2D3OR 1VQ9S 1M5OC 2LEAA 2CPFA 2VOOA 5DDOC 1X4EA 2PE8A 3IRWP 2XS2A 2KXNB 3G96A 2ZJPQ 2X1GA 3CC4S 5GAGU 2AYEA 2FPHX 2J76E 3RW7A 2OTLS 5DDPC 2RS2A 4M5DB 1IQTA 2A3JA 2DGUA 1X5PA 1U1MA 1B7FA 1UW4A 4F26A 5GMKa 3RW6A 2KFYA 4ZKAA 2G1DA 1H2UX 3NS5A 2MQMA 1Q86T 4EGLA 4FXWA 3CMAS 5EN1A 4OZ0A 2F9DA 2X1AA 2D9PA 1JJ4A 1W2BR 2MJUA 2DH8A 3BO3A 2LA6A 4YB1P 2M4MA 5IM0A 1X5OA 1R8PA 3N9UC 1WF2A 1U6FA 2CPJA 1N8RT 1VQKS 3I55S 1WEYA 2DNQA 3CULA 2M9KA 1FJEB 3EGNA 1U1RA 4PRFA 3K0JA 2KYXA 2DH7A 3THPA 1QVGR 2MZRA 2G4BA 4W90B 2RT3A 3MD1A 3ZZYA 3G8SA 1SJFA 2KRRA 1HD0A 4V19X 3VAFA 3S8SA 1KQSR 2KG1A 5BJRA 3TP2A 2XNQA 2DB1A 3CCMS 3NS6A 1S72S 1QVFR 1FO1A 2KT5A 2OSQA 2DNPA 4PKDB 4BS2A 5GVQA 2CPZA 2OSRA 3Q2SC 4QPTA 3P49B 1QM9A 2MY7A 3G6ES 2LCWA 3R1LA 2KM8C 4CQ1A 2CQDA 3L3CA 2MZTA 2DK2A 3MDFA 2DO4A 2DNZA 5JVHQ 2MSSA 3BO2A 2J0QD 1Q7YT 3EX7B 1WEZA 2FHOB 2YWKA 2MQPA 1RKJA 1P27B 2CJKA 5CA5A 3MUVP 2MXYA 3UCUP 4PR6A 5MLCV 3PIPQ 2X1FA 1U1PA 2AD9A 3CCQS 1M5KC 2CQ1A 1U1LA 3CCJS 1U1OA 1ZZNA 2XB2D 2FY1A 2VONA 4CH1A 2EK1A 1NJIT 1HA1A 3ZZZA 1WG5A 2XSFA 2YTCA 4F02A 1X4FA 1NU4A 3VAJA 3VAGA 2ERRA 2MHNA 2RRBA 1JMTA 5LJ3Y 2E5HA 2M8DB 2CQIA 2MY8A 3FEXB 1VQ8S 5ITHA 2E44A 2OIHA 4Y00A 2B0GA 5DM7Q 1P1TA 2DO0A 3CCSS 4LJMA 2KM8B 1A9NB 3MUMP 3HI9A 3CF5Q 5GAHU 4WKRA 3UD3P 1UP1A 3IWNC 3FEYB 3R1HA 4Y0FA 1RK8A 1SXLA 2HGLA 2MZQA 2DNMA 1WF1A 1O0PA 1FXLA 1M5PC 1CVJA 3NMRA 1Q82T 5LJ5Y 2MZJA 2MQQA 3CCUS 2M7SA 2MZSA 2X1BA 2EVZA 2M2BA 3UCGA 2CQ0A 3NNAA 3H2VE 1H6KX 1X4DA 4CIOA 4WFBQ 2QA4S 4IO9Q 1VQ6S 2E5JA 1WELA 2RS8A 3OW2R 1SJ4P 1M90T 3SMZA 2XS5A 3MI7X 3MD3A 5H1SV 4IOAQ 2KRBA 5LSLA 5FJ4A 2AYBA 1HL6A 1WG4A 3UE2A 3G71S 2DGTA 1H2TZ 2DNNA 2CPHA 2E5IA 1WHYA 2DIVA 3ULHA 1OWXA 2CPXA 1YJWS 2JVOA 2MGZB 3I56S 2L08A 1R8HA 3P3DA 4OZ1A 2DH9A 1UFWA 1Q81T 1U2FA 1ZZFA 2E5GA 1OPIA 2KG0A 3CPWR 3NNHA 1S79A 2DGVA 2MB0B 4YUDA 5LSOA 3CCES 1KD1T 1M1KT 1U1NA 3THTA 2NZ4A 1BY9A 5DDQC 2DNKA 5JVGQ 4UQTA 4YOEA 5LXYA 2GHPA 2UP1A 1WG1A 2RQ4A 4IOCQ 1G2EA 3CXCR 2MMYA 2DIUA 1WI8A 2MYFA 5GAEU 1VQNS 2M70A 1L3KA 2MQNA 3VAKA 4WFNQ 3US5A 3J7YU 2O3DA 2N82B 2CPYA 1VQ5S 1UAWA 5IFMA 2LMIA 1FNXH 3CCVS 2DHSA 2EK6A 2GO9A 1KOOA 3VAIA 4W92B 2LECA 1NO8A 2YH1A 1K73T 2F3JA 2M0GB 2RRAA 4WF9Q 4RU2A 1OIAA 3MOJB 4TU8A 2HGMA 2CQ2A 1WI6A 3V4MA 1OO0B 1VBYA 1N54B 3S6EA 1YWXA 2VOPA 2DHGA 2ZJRQ 3MXHP 5CYJA 3TO8A 1K8AT 2ADBA 4ED5A 2MJNA 1WTBA 5HO4A 1YHQS 2RU3A 2K8GA 1WHWA 4WIIA 2HGNA 2DHXA 1SJ3P 4C4WA 3P5TL 2JX2A 1X4GA 1X4HA 2KU7A 3SDEB 3U1LA 4WCEQ 1VQPS 2D9OA 1JJHA 1N52B 3LPYA 5LXRA 4TLQA 1VC5A 1HD1A 3D2WA 2DISA 5IQQA 1WHXA 1WHVA 3SXLA 2YH0A 3HHNB 3U1MA 1SJQA 2RUGA 2QFJA 4LIRA 5CXTA 1DRZA 2DNLA 1F9FA 2RVJA 5D77A 2FC8A 2OTJS 2DNYA 2L9WA 2CPEA 2Q79A 3VAMA 1X5SA 3G4SS 1YIJS 2JWNA 1URNA 4UY8T 3MURP 2KI2A 2CQHA 2CQGA 3UWTA 3PIOQ 3MUTP 1JJ2R 1AUDA 3DXBA 2J8AA 2DHAA 4TU9A 3G8TA 1M5VC 2KH9A 1KC8T 2CPDA 1X5TA 4J5OA 2WBRA 3CUNA 2FC9A 3B4DA 2N3OA 2J0SD 2JRSA 1U1KA 2QEXS 3CCLS 3B4MA 1VBXA 2OJ3A 2DNOA 3UD4P 2RQCA 2RNEA 2HZCA 2KN4A 1WWHA 2YKAA 2MKJA
chains in the Genus database with same CATH superfamily
4ED7A 3LP1B 2ZE2A 1TL4A 3KJFB 2FHJD 4DV0J 1HW8A 2Y1LB 1HWJA 3KWMA 3QLHB 1VBZA 4MYTA 1VQ4S 5L46A 3D0IE 3TZZA 3C6TA 3KLIA 3QSIA 1HI0P 1TQLA 3QT6A 3T5KA 3K5LA 4NYOA 1JKHA 4YHHJ 5ETKA 3FEZA 5L9XA 2HNDB 1I1GA 1YVFA 2RD5C 3GB0A 4RLEA 3GYXB 1FJGF 2V4JA 3BEGB 3HVRA 5KG2A 3DYAB 2HHUA 3O2IA 4D3GA 2CJQA 2NXNA 3ZXWA 4DOZA 4ERDA 2XLIA 1UL3A 1SCJB 1GMWD 2K7JA 3DLLQ 4ZPVR 4KRWA 4WP3A 1PBAA 2V4QA 2WVFA 1QSLA 3A13A 4UUXA 4MKYA 4DV1F 4G6VB 2XBPA 1FEHA 2NLWA 3RRGA 2LXFA 3TYTA 4NASA 5ETNA 3C2PA 4WFZA 4G1PA 5EUHA 1U8WA 4RWWA 2FHKA 4NZ7A 4JYAJ 1TL5A 3QO9A 1ZTTA 2POKA 3O44A 2F5GA 5F8NA 1KLMA 3VWSA 1L3SA 1RADB 2ZJPQ 3BKFA 3QIDA 4UUWA 2ZBCA 1NPKA 3EZUA 3BZQA 1H3DA 1REVB 4FNHA 1MN7A 1RISA 3N9UC 1U6ZA 3ZO7A 2MDAA 4M5IA 5G0RB 1NJZA 2HW3A 5ETLA 1SL1A 2RT3A 1X0PA 4JI5J 3VTIA 3NLCA 4GMKA 4FYWB 4PWDB 2J6SA 1IBLF 2DR6A 1D0EA 2O66A 2DNPA 5H9FK 2DRAA 2HMIB 4ZVGA 4DX8H 1IKXB 3CDWA 2DR8A 1T0TV 4ILMA 1TL7A 3W63A 2NSBA 3CJTA 4J9UE 3D3BJ 2BJ9A 5HSPA 5DQGA 1HMVA 5HROB 2FY1A 3CCTA 3H2LA 2O67A 2XSFA 2EPIA 1G3OA 2BYCA 2P6TA 4ZHRA 2ACMA 5L1JA 5A0YA 3TUJC 2E44A 3KG0A 4C98A 3J7Z5 2KM8B 4B9VA 1D8YA 5AXMA 3CD5A 2F4VF 3O3LA 4DPYA 2G2YA 2W24A 5DZ7A 3DLBA 4OZLA 4KYZA 2HG4A 3K5NA 2M2BA 2HQFA 1MNEA 5BYQA 5J2MA 4WYWA 3PX6A 3MAHA 1RT4B 3OW2R 4H4MA 4HT7A 2QV6A 3CDEA 5LMUF 4RKUC 3MFIA 4IRKA 1CJUA 3QWPA 2B5JB 4MK8A 1NM2A 2ILZA 3DKDA 4WE1A 2R7SA 4KQZA 4BWMA 2J6TA 3NBPB 1T95A 5E0OA 2WVCA 2Z2MA 4YN3B 4FXDA 3ZZTA 2HS3A 1M1KT 1JLBA 1P9YA 4EBDA 4U6PA 1DJ0A 5JJBA 2W9BB 2AEFA 1XK8A 2BUNA 1HQEA 2MMYA 2YQ0A 2J9DE 3VAKA 3WHIA 3L7UA 3HO1A 1RABB 3AJDA 5DRKA 4HACB 3T1YJ 1AFIA 2J6UA 3RZAA 4P74A 4Y3CA 2Z8QA 3BR8A 3QWUA 3KLEA 3TR5A 5KFQA 3OR2B 3M8YA 4F4ZA 3BREA 3MOJB 4ZLPA 3V4MA 3MR5A 4TY9A 3FBEA 4PXCA 2W7OA 4PG5A 2ADBA 4Y6IA 5ETQA 2WSEC 3P5TL 3PNIA 5EGYA 4EU0A 3D3CJ 3BYPA 1VQPS 1Z2ZA 1JJHA 2DISA 2H3EB 1JLEA 3Q22A 1RT2B 2V2ZA 4MFBA 3OV7A 1RTZA 1SQFA 1GT8A 4X4QA 3DGVA 2XY5A 1NB7A 1R8AA 2CQGA 1YKWA 3HHDA 3TUZC 5J2PB 4K8RA 3HHKA 3IP0A 2QEXS 2Y8WA 5HP1B 4OL8A 5RUBA 5J1PA 5C7PA 4OI2A 4QIEA 1YJTA 2F8EX 4KGZB 5F3TA 4QWDA 3K57A 2QLBB 3PG9A 1U45A 4QQBA 4KHRA 2CJXB 2CJBA 2X7IA 3A3PB 4QU6A 2FVRA 9RUBA 2M52A 2QO3A 2W9AA 5KTQA 5KOXA 4LF5F 2I2YA 1IKVB 1U8SA 5A76A 2JDJA 1LFWA 1OSDA 3BN7A 4DZ6A 2IJNA 2EWHA 2MQLA 1WC1A 3CD6S 3U7JA 3RBZA 2V94A 1S1VB 4WBFA 2HRTA 4B17A 1RTDA 3HULA 5FDLA 3I5AA 3NRBA 3HD2A 3M8QA 2LVWA 2HHHJ 4PXEA 5IT9Y 2V8DA 4HKQA 2UVVA 2DNHA 5ETPA 3H20A 3NCRA 1HBUB 3DRYA 6FDRA 1TUGB 1EP4A 5CD4A 2DHHA 3CE8A 2ROGA 1TFWA 2BRLA 2N7CA 1EARA 4M63A 2XSJA 1ICEB 3I6PA 1T9WA 4N5SA 5D0RA 2YXLA 1RT7A 2FZGB 3IFEA 1S6QB 3F56A 4F3QA 1G6BA 1HWKA 4ITSA 4L72B 3MFHA 4DSEA 4RW9A 4N7TA 2GZOA 1KDNA 2YY3A 4CO1A 2QC3A 2XMVA 3UNYA 3OR1B 4LVNP 1UKUA 2YWEA 4KGXB 4A8QA 1U1MA 4ZKAA 4K0KJ 4EGLA 3CMAS 4N8NA 4IR1A 2B3TB 2N7YA 2B9WA 3E3XA 2C2NA 2M4MA 2EFVA 1U6FA 3BGFA 2XLJA 2RILA 4RW6A 3SV4A 4F3OA 1D9FA 3B54A 4PYAA 1XMBA 3AOBA 3FKBA 3MD1A 4RNHA 3G8SA 1HD0A 3DLKA 3R2CJ 1B0PA 4ZS6A 1RJJA 2OSQA 2YKNA 4DSIA 3QGIA 1K44A 4HYKA 2ZHBA 2OSRA 4NMXA 2LDYA 3QJLA 4AE5A 3NCPA 4XPCA 2GAHC 4IFYA 2F4FA 1AW0A 2VFRA 1GAOA 4DF8A 5E2QA 1M5KC 4JI2J 2WOMB 1V6HA 1JLFA 2R7VA 4NMLA 2FQQB 4JI1J 1JMTA 3C6UA 3FEXB 1NJWA 1CQMA 5DM7Q 2HIQA 5KFBA 1N6QB 2FZCB 2HQCA 4UTGA 4N76A 4O0IA 3IN5A 1VRTB 2W9CA 3SFGA 2HKEA 3TI0A 1RAAB 4AUKA 1FXLA 2AKWB 1UPPA 1EQ0A 2E1AA 2ZD1B 4YDXA 4Y2AA 3IA0A 1W25A 4IYQA 1V9OA 5KFDA 1M0SA 1QE1A 2XWXA 1T9YA 3TJ8A 1Y00A 3EICA 3PACA 2OHDA 4FP9A 1NB2A 1V5IB 5F9LA 2CPHA 4OQJA 4UT4A 1XQIA 4RBVA 3UVJA 3GV7B 3QBCA 2FGCA 1Q81T 2V9KA 1S1XA 1ZZFA 1S79A 4WPAA 2DGVA 1SIZA 2YX7A 4ED0A 1RTIA 5FD1A 4YOEA 3N6LA 5LXYA 3N5BA 4CLFA 5I4MA 1NAQA 4Q7AA 2HRYA 3RJMB 5CYMA 1PYSB 5L1LA 4KT0C 3RUBL 4CYUB 1EETB 2N82B 3BPSP 3DRSA 5A6WA 4XTTA 4GVLA 5A2QU 4JI8F 2DHSA 3PKYA 4ZOSA 1FFWB 3NGSA 2VG5A 2BA9A 4ED5A 5I42A 2C2DA 5L38A 4O3SA 3M6XA 4X4UA 5J2NA 3D2WA 5IQQA 5CABA 1T7PA 1XWLA 2QMXA 2C2OB 4L74A 3W2VB 2Q79A 1O51A 3CJ8A 3MUTP 3JXOA 2QZ8A 4J5OA 3SI8A 3CUNA 2IC3B 2I5JA 1GTEA 1X60A 1UFKA 5HAOA 2KYZA 1GNKA 4FF3A 2CA9A 2IJRA 2QG9B 5FIIA 2U1AA 3FNNA 3ISND 3I82A 1VC0A 5AXNA 4EO6A 4QR2A 4ED8A 1E6YB 1Y3KA 5J1EB 3P6YC 2LEBA 1BQMA 1SKSA 1UWAA 1EZZB 2F9JA 3DLEB 4QCLA 2MZ1A 3D7SB 2BBEA 2DNGA 3I0RB 1PGZA 3KYLA 1HBNB 2B7CB 4YS2A 1NPRA 1S76D 1KQKA 1XNRJ 2OO4A 4IDKB 2NXCA 3KK3B 1F1BB 2Z2YB 3GP9A 2VHGA 1KVJA 2XNRA 2C3YA 4F50A 4W98A 2VASA 2ZDPA 5FLXU 3TAQA 2IY5B 1HR0J 4OI1A 1RU1A 4UOHA 1UWBA 1K9MT 5E3PA 3PO5A 4JV5J 3BBFA 1Y5LB 4FPIA 3OXFA 1RT1A 3AD8C 3HM9A 4DL4A 4AXIA 1U6BA 4UOFA 2GGPA 2XZWA 4DFJA 4O44B 3J80Y 5DDRC 1GK8A 3TA2A 1DTTA 4ID5A 3T19A 3BGRA 5IOLA 4FS1A 4WXWA 4LF6F 3OVBA 5DDOC 2COLA 7FDRA 2JC1A 2KXNB 3LP2B 1N33J 2CZ4A 4I6WA 5A8KB 2Q3PA 4NCGA 1X5PA 2B6AB 3RRKA 1Q4RA 3D6TB 4ECSA 3DNCA 4RNOA 3OJSA 1MWQA 1EJ7L 3TVZA 3MEGA 1T02A 4I6AA 1N5TA 1VQKS 3KLGA 4M5LA 1DQ9A 3UD5A 2QSFA 3IR5B 3V81B 1F2HA 2VB6A 2JH3A 3ET6A 4URGA 4OHZA 3W2WA 3FBBA 2GMLA 4V19X 3MEEB 4LF7J 4OZ2A 4ECVA 4KSEB 3R9LA 2DKOB 2WAQD 5LT5A 4X4OA 1LW2A 2OD4A 4O4GB 2A18A 1SVDA 2XZTB 1OJ4A 4ETZA 2WVBA 2DNZA 1TL3B 3MECB 2HHSA 1FFSB 4QPXA 3UCUP 2BACA 2G13A 5C25A 5BXIA 2AD9A 5CZVA 2P5VA 1U1LA 3GIJA 2VONA 1KSPA 2QYGA 3M9OB 1UCNA 2CVIA 3D6FB 1C2PA 1RKIA 4ZPAA 3C14B 2RRBA 4X4TA 1FRHA 3OTBA 5ETMA 3HVAA 4M8LA 2OPSB 3O8WA 1R8BA 4DV1J 5KT7A 3MUMP 3IGVA 4I64A 2HQGA 4Y0FA 1SKRA 3NXZA 3QAEA 1YJVA 4R25A 4K59A 3AQPA 2DTJA 3UN3A 5L1KA 2VF3A 2ZHOA 1CS4B 1VQ6S 2E5JA 4HI1A 1WOSA 3RB0A 1NHUA 2FYXA 2VQFJ 1XC9A 4XDCA 2XMTA 4C8MA 8RUCA 2BW7A 1SBRA 3T9ZA 3IRXB 2RDIA 3B78A 2B8QA 1FWPA 4OI4A 1QD1A 1N4LA 1R0AB 2DRDA 3CPWR 4S0MA 4YUDA 3DM2B 1RDRA 5CHCB 7AT1B 3UR0A 1DQAA 2R42A 4U7CA 2DIUA 5GAEU 4G65A 5F41A 1BQNA 4RW8A 4ZCLA 4ES2A 1IBLJ 1UAWA 3N0VA 3NWRA 1RE1B 1HPZA 4UY85 3QIPA 4KFBB 1GTHA 7FD1A 4LQ3A 4DQSA 4HVZA 5KT6A 1F5AA 2I6WA 1S48A 3M6UA 2GIFA 2YPYA 3CO9A 3DRPA 4ER8A 2DHXA 1UA0A 4ZP8A 3MPUB 5A8WA 4E98A 1W26A 3W9JA 4QOTA 1VHFA 4PABA 4ZP9A 3U1MA 3T5HA 4NEZA 4LIRA 4K4ZA 1XNQF 2L9WA 2NUUG 4NLXA 5HANA 2OFGX 1OQ3A 4F7VA 1FK9B 1S6PB 1NKCA 3GE9A 2JRSA 3OTCA 2DEIA 2RQCA 2HZCA 3OPKA 2JEGA 2W4CA 3I5BA 1DURA 3M32B 3MPWA 3MM5B 1HQUA 2VBWA 2K3KA 2VDHA 1T05A 3IR6B 1EKRA 3UQSA 2B9EA 5F8LA 2VC0A 3V6DB 4L3KA 1E6VA 2G0CA 4ZVPB 1FKOB 2O01C 3CC7S 2N3LA 2DITA 2R7WA 4ECQA 4DQPA 1N32F 4ECYA 1T03B 1J2VA 3GZ7A 1RA6A 1UVLA 5GADU 4ZVUB 2QA4G 4WKYA 4DZDA 2FVQA 4C0BA 1J5EF 1WF0A 4LFCJ 2W7AA 3ZTQA 2LXUA 4DSJA 2FJEB 1FKPA 1S1TB 2WW4A 2G0JA 2KHCA 1UA1A 1Z4UA 3FMWA 3M2VA 4OX9J 4FF2A 2LFVA 4USWA 3P45B 1P8GA 3BO4A 4A8WA 2LYVA 1HHSA 1Q8KA 2D3OR 1VRQC 1KEKA 5AJ3F 3KG4A 2R8HA 4ANDA 2ZBIA 4EMDA 2VKRA 1R27B 3HSZA 3IAM9 4IH7A 1WC4A 2JFKA 4F3MA 4F67A 1UW4A 3PCOB 4X4NA 1R8CA 3PHTA 4P2FA 1FWLA 4M5MA 5B0DA 2J7WA 5C5JA 5KFRA 1F2GA 1X5OA 4DF4A 1FE4A 4TVAB 5DQIA 4ZK7M 4I1TA 2DNQA 2GMJA 1UPMB 4JI4F 3EGNA 1XTZA 2YNGA 2YWGA 4W90B 4O3QA 2GC8A 1JLGA 1RLDA 2XQCA 3S8SA 4OJGA 5D4LA 2DB1A 4H54A 2H65B 2HK2A 3DRRA 1FO1A 4PG7A 2R7TA 4LF5J 3JQJA 4U7UD 3SCIE 2QA1A 2X51A 2A10A 4P10A 2BRKA 5DG9A 3EM1A 4F0HA 3VGTA 2W4PA 1ZZNA 2WSCC 2WSFC 3OSPA 4ZVOB 3CIMA 1C1BB 1U4BA 4FYYB 2K06A 1NK4A 3JYTA 2BKOA 1AB8A 1RBOB 3QPIA 4NOHA 2BQRA 2EFQA 1HARA 3MEDB 3JQMA 3WBZA 4EUVA 2CWKA 3JTOA 1WF1A 4ES1A 3C16B 3AD9C 4NA3A 2UUBF 1VIOA 3QT5A 3V6JA 4EFAC 3QSYB 4CIOA 4WFBQ 4KHPF 1LW0B 2ZBPA 3CWJA 6FD1A 3SMZA 3R5BA 2KRBA 4DL0C 2V0NA 3QAUA 1OY9A 5CYQB 2QLJB 1LK7A 3QGGA 4I2PA 1R8HA 2DH9A 1FVQA 4U96A 4CLLA 3WQPA 5D3GA 1OS5A 2YQ1A 4NRTA 3THTA 3V4IB 1HNVB 4PQUA 3LP0A 3NAHA 1CEZA 3GWCA 1VQNS 2N4CA 4OLPA 5A2QY 1MLAA 2B8PA 4RBUA 3LAKA 3KMQA 1CC7A 2HWTA 2WB1D 4PZVA 3V2UC 4B3OB 3KG1A 1TV6A 3KUEA 2ZH2A 5G4DA 1LOUA 4ECXA 2M0GB 1NZAA 2JLEA 1U0HB 3W61A 1S97A 3MXHP 4QIGA 1OYEA 1M1GA 4OHXA 3PHEA 2HEKA 1IKYA 1N5SA 1TUVA 1N36J 4NRUA 4GVBA 3DDNA 2AEMA 4KO0A 2Z30B 1URNA 1YIJS 2JWNA 4I2QB 3MM9B 3FRZA 4NLYA 2IMOA 2J9DA 2GNKA 4RNMA 3NG8A 2WBRA 4ZCKA 3UPFA 4YFUA 1RAEB 2YNIA 2GS8A 1RCXB 2GJFA 2MKJA 3R3TA 1DZ5A 3J7ZT 3UO0A 3VHQA 2SXLA 1I6JA 1ZETA 4LBIA 4P72A 3R97A 1IKWB 2HWHA 2MKIA 2QLWA 1KRPA 3MM6A 4KAIA 1FESA 4DLEA 2CUYA 4OFZA 5DQHA 1AZSA 1RHKB 1DTQA 2FVCA 2V4JB 4MIBA 2CNKB 1YI2S 3KK1A 3SEOA 1S1UA 3DHXA 3MMCA 4FNIA 3QYYA 2DGXA 1EQMA 1FNOA 1GXUA 3Q8PB 1NJYA 1VQ7S 4CO3A 2ZZNA 3I31A 3QJJA 2QL7B 3AQOA 3O6QA 4A48A 4OZ5A 4E8UA 1DFDA 2LKZA 1CJKB 3M9MB 2GVDB 5IWAJ 1S0MA 4LSNB 1ITPA 3CNQP 3DFEA 4X62J 1LWFB 3SZ2A 4BHQA 1QLNA 2CKWA 1NSPA 3DC2A 3FCWA 3OT9A 5ADZA 4WFAQ 3L95X 4QW9A 2LEAA 2EKNA 4DV4J 1VBKA 1JLAB 1FDAA 2BANA 1G1XA 3A8JA 1CJTA 4G3IA 1ZAVA 1NJXA 4NCAA 2RDDA 5DDPC 4DPTA 2JEIA 4LVOP 3HT3A 1N0UA 4MT1A 1SKUB 1TK5A 5DLGA 1JJ4A 4DWIA 1NNDA 4AXJA 2KFZA 3TUIC 3I55S 1GX5A 1I3OB 2GQQA 1NSKL 3UNGC 1U2RA 2DH7A 1S9EA 2XYHB 4A8OA 4Q44A 2ATCB 2WTFA 2DBBA 4MJKA 3TAMB 1QVFR 1RAHB 3GIIA 5B0BA 3TZWA 3TNVA 1HBMB 2IIHA 5B0FA 3SBMA 3RBEA 4RWXA 3MUVP 3R7SB 2YNFA 2PI5A 4RNFA 2X1FA 2J9EA 1U1PA 3DI6B 1N48A 2FTRA 2PO4A 4NZ6A 3OVSA 2HFZA 1SKWA 3EZ5A 4DR7F 2EK1A 2RE1A 3F44A 3BH7B 5GADI 1J27A 3CJ4A 4OYAA 3KLFB 2M8DB 4B3TF 4OZJA 3I96A 5I3UA 4O3RA 3CCSS 4DQIA 2V63A 5GAHU 3KLVA 2KJVA 4JB8B 3CO0P 2ACYA 3GSDA 1CVJA 1RWKB 2OEMA 1NK0A 2X1BA 3JS9A 3TX8A 2ASJA 4DG1A 3CDAA 4RR5A 1NH8A 4Q0BB 4J9QA 1TKZB 5LSLA 4PUOB 4WYLA 2XMUA 2OELA 1K1QA 3H5SA 1CJVB 5IC6B 3R5GA 2ZWOA 4OV6A 4FS2A 4GRSA 4CO2A 2LU1A 1U2FA 2V34A 3G82B 3RU0A 1HNIB 3M6VA 2NXJA 2EFOA 1KQGB 3KHHA 1QAIA 4KPYA 1TP7A 3CB4A 1X7VA 1WI8A 1OMSA 1FFGB 2ABYA 3E51A 2O3DA 1N34J 2E29A 3PJXA 1HI1A 1T9TA 5IT0A 1FNXH 1KOOA 4W92B 3E8OA 3LA0A 3GMGA 1W2IA 1FRJA 4KKOB 2P6SA 4LBHA 3AJ1A 3K89A 4LF2A 4HR2A 5E41A 1UFLA 4FKXA 1PKUA 3BBBA 3LGMA 1HNZJ 4K2XA 1U24A 2ZWPA 2V50A 3DOKA 1YBTA 2QFJA 3GG0A 3ZTOA 4GKJF 4LSLA 3A8EA 4CI0B 3MURP 5GMEA 1PYTA 3DU5A 1AUDA 5CCMA 3ZTPA 2CPDA 4I7FB 1X5TA 5DS7A 5K14A 2GMHA 2D3UA 3PFOA 1QDUB 5ETVA 3B4MA 3ILOA 1BD6A 5HK4A 4CLTA 4Q43A 4CT9A 1A7GE 3V5RA 2V4RA 3CJKB 4C3MA 1U26A 3IR7B 3R27A 3DXSX 4F0KA 1CG2A 1X4AA 2MGZA 3VR1A 4X65J 1WOOA 4WTOB 3MCNA 1SJRA 2IAJA 1C0TA 3RAQA 2G2OA 1S0OA 2LXIA 2P9CA 2HZVA 1N5YA 4FZVA 1TVRB 2MKHA 2HPUA 5D78A 3A3NB 2IDLA 2MKKA 2OKQA 3DLHA 1T3NA 2VPZB 3UI3A 2VPWB 3IBWA 1LWEA 2GHWA 3KKFA 2AGOA 2VICA 1X31C 1OQ6A 4F36A 4EYHB 3GYGA 2HWIA 5F8HA 1DHMA 1IBMJ 2BE7D 5U47A 1VQOS 1DY3A 3H5XA 3MR2A 3CDBA 1GXTA 1U48A 4JBCA 4ZJOA 2WONB 1D8ZA 2XSJB 3EVOA 1HKAA 1C4CA 1M1HA 4C7QA 1QUPA 5HVGA 5MAOA 3HP6A 4ED6A 2ZM6F 1NK8A 1WORA 2GVZB 4LBPA 1LEOA 2WVDA 3KK2B 5L1IA 3ISNC 2AZ1A 4RW9B 1VRUB 3MAAB 1RWPB 1TK8A 2R2SA 3VCDA 1GH8A 5KFIA 4DR4F 2Y1RI 4F4WA 1KN6A 3EZOA 3ZC4A 4JI0J 3R6LB 4LFAF 1IQTA 4TYBA 4F26A 3JSYA 5D6GA 3ETMA 3NS5A 2MQMA 3LP1A 4EZ6A 4CM2A 2CPJA 5LMNJ 2IFXA 3QLHA 2MLYA 3THPA 2FLNA 2ZH7A 1F0XA 2KRRA 1SC6A 1HNXF 2Q1LA 2WCXA 5BJRA 3GCWP 2BM1A 4NLRA 5BYRA 2KT5A 1HWLA 1TR0A 4BS2A 2FLOA 2HNDA 2FVPA 1XMQF 1EIYB 3MDFA 4DR3F 3DYAA 3HT0A 4DXLA 3PX4A 4LF4J 1AUSL 5A8RB 4DCJB 2NREA 3OTDA 3ZNJ1 4MYUA 4WWSA 2KHDA 2HK3A 4F02A 1KVKA 2JLFA 5M2RA 4DPUA 4LT6A 1D3WA 5DLFA 2OFHX 1RI7A 4OX7A 3K8VA 1K0VA 1QSSA 4LJMA 3UFCX 1XIQA 3MR6A 3UD3P 2UXBJ 3IWNC 3EDQB 4XO0A 4TN2A 3IMQJ 4ATNA 4EEYA 1O0PA 1M5PC 1VLYA 3HHLB 1F3VA 4J9SA 2DYAA 4LRDA 5AJ3J 2QA4S 2AV5A 3MI7X 2IVYA 1DAXA 1LQ9A 1RTHB 2F7VA 4AD6A 3GQCA 4MMOA 3HVTB 3G71S 5F8GA 1H2TZ 2E7VA 4NPOA 3BV8A 2JVOA 4OYWA 1REVA 1RWOB 2J8SA 5D0GA 4K5SA 1RTIB 5G0RA 5HATA 4YY3F 4NXNJ 2K7KA 2HBZB 2YPZA 4PWDA 3KJVB 2ZDOA 3OVAA 2B4OA 2MQNA 3DRSB 3W1YC 3J7YU 3AXMA 2BJ3A 1Z1ZA 2HMIA 3FFIB 1IKXA 2QL5B 3X1LB 4FKYA 2EK6A 2NZCA 4EZ9A 4PEOA 1NO8A 4RUHA 5HROA 5IT9U 2YX4A 1BGXT 1NZ8A 3K5MA 1WTBA 1WDDA 4WIIA 4DUTA 2HGNA 3SDEB 5HVFA 1MW7A 4TLQA 2KO1A 1MROB 3SXLA 2YH0A 4N77A 2IA0A 2VC1A 1F9FA 1I94F 2EBGA 4NLVA 4I67A 1QUVA 4FF4A 4LFBJ 4B3RJ 1RGVA 2YKOA 2FC9A 3GILA 4Z37A 3CCLS 3HFVA 5B0CA 1RT4A 2UUBJ 3FZ2A 2CJYB 2IPOB 5HL7Q 3N5FA 3AB4B 2AF6A 3I9V9 5HMYA 4IQMA 3AODA 2B5JA 3C8YA 4CLKA 1RU2A 1TU0B 1CSJA 3ISZA 1BQMB 2CQ4A 2HSEB 3NBPA 2ZH9A 4GO7X 1SL0A 2CNOB 4DUYJ 2LA4A 3PR5B 2W9BA 1PO6A 2ZKTA 5EWEA 3F0NA 4DV2J 3SCJE 1LXNA 3PRDA 4CLYA 3ONQA 3Q0AA 3PXGa 4HT5A 2XMWA 2NSCA 2ATLA 4P7TA 1FRIA 4DPWA 1NDPA 2DCLA 3VQTA 2C28A 4KV8A 3LGNA 4X66J 2UXCF 3OR2A 1UWBB 1FKAF 3M8ZA 2GGPB 2VA3A 4EI2A 2Q66A 3MEKA 4BWJA 2AYGA 4USJC 1ZM9A 1I51B 4DL7A 3L09A 4C9DA 1FD8A 5JUMA 5DGAA 1URRA 1RT2A 1FWKA 2D74B 5HJXA 3M9NB 4X4VA 2E9ZA 2BQUA 3GJRB 4DSFA 2PE8A 3K59A 4B3MF 1YG0A 4N41A 1QY7A 5J2PA 1NUEA 4NCGB 2X1GA 4MKBA 1NK5A 4K2JA 2RS2A 4M5DB 3CD0A 5HP1A 3M8PB 4A8YA 2QLXA 3K5OA 2V2KA 5L9NA 3D6MB 2Z2ZA 2D9PA 2MJUA 3AH6A 3KLGB 4X4SA 1SPBP 3CJ0A 4GC6A 1WEYA 4CLSA 4J9NA 3K0JA 3KJQB 4C11B 4NLUA 2UVWA 1IKVA 2AU0A 2KB2A 4ZPBA 3QRRA 2ZC3A 5HLFB 2I0XA 3Q2SC 1S1VA 3P49B 2MY7A 2P8IA 4CNYA 2CZVC 1Y11A 3IAS9 3TARA 2HFNA 1S0NA 4JV0A 1S9GA 4OYMA 2OD6A 1YK9A 1HBUA 2DY1A 4NLOA 2IJFA 2R7QA 2C2RA 4DV7J 3MM7A 2Z58B 2MHNA 1R0BG 1SB6A 2CQIA 2KT2A 3KDNA 2B0GA 2GV1A 3PEJA 3U02A 3C66A 2R7UA 4PYDA 4J9PA 3HI9A 1S6QA 3A3OB 4JV1A 1PIEA 2ZOMA 1BC6A 1S59A 2UXDJ 3AHPA 5HQLA 1REGX 5D4NA 4ZJLA 4OHYA 3TRGA 4CNZA 3H2VE 3OR1A 4IO9Q 3PY8A 1JK9B 2ZH3A 4EBEA 2XS5A 5FJ4A 2E9TA 1HL6A 1RT6B 3WDOA 1U47A 3PV8A 1RHQB 2J7KA 2ZUGA 2AJQA 2MB0B 1BQXA 5LL6d 2KZMA 3D1OA 4X64J 4L3NA 5EHHA 3PYEA 1R7IA 4OZNA 1H7WA 3MMBB 4EYIB 1TZ0A 1S6UA 2A1BA 1MWZA 4DL3A 4I6YA 4DS5A 2FJBB 2VG6B 1KBRA 2ALYB 3M30B 3MCOA 4DDFA 2LECA 2PFFB 5BYSA 2B43A 2WOMA 3PW5A 2XZDB 4FVMA 4DR6F 5KFUA 1YWXA 2HVIA 5HO4A 1YHQS 4LF9J 4H4OB 3POTB 2QIFA 2OH2A 2D69A 1S4FA 5HMXA 1N52B 2DR7A 2FJVA 4ZPCA 4RUBA 4CP5A 3TX0A 4F4YA 4B3SF 2IM2A 1N6QA 3NKYA 2CYYA 2PC6A 1RQ0A 2HHVA 5BR8F 1VRTA 2IMWP 3T6BA 2ZH6A 3ENWA 1DQ8A 2MHEA 3J80U 1RAJA 3TVKA 1SC3B 2ZD1A 3CD7A 1YJ7A 3BF4A 2OJ3A 2AWZA 5D8HB 1KONA 1ULRA 3VALA 3N79A 1FJCA 2DVIA 5EWGA 5IM0B 1VDHA 1E6VB 4R5PB 4DL6A 1TMMA 4YHHF 3L7PA 1YZ6A 2YWHA 2HVHA 2VKZG 1XMOJ 3PW7A 3GIRA 2HVZA 2QX0A 1RAGB 3NNCA 4G1QB 5K8PA 4CYUA 1EETA 5B09A 1RWUA 4DU7A 3LOUA 1YTYA 1KLNA 1KWMA 3TWZA 2OI2A 3JSBA 4HTIA 2NR0A 2BXJA 1FCAA 1ZH5A 5KT3A 2LDIA 2C2EA 2I9SA 1Y9OA 2EC0A 1L3UA 1S57A 5F8IA 4JYAF 2BZ2A 2UUCJ 1B7YB 4IUFA 3OTOJ 1NHKL 3BSOA 2BE2B 2Y0BB 3TEHB 2UZAA 3ZZRA 4F2SA 3PW2A 2R8IA 3CW2C 4CH0S 2LP4A 4DX5A 2ZH5A 4QJVA 1NK9A 2AEJA 1RHMB 2PSZA 3A8IA 1CC8A 3LALA 4QIWD 3W2VA 3DLGB 2Y0SD 3BKUA 4WP9A 2CFXA 1H73A 4LR9A 3J81Y 1RT5B 5K5MA 3RW7A 3K8WA 2FJDB 1MU2B 4FXWA 4JI5F 1W2BR 2IRXA 1XEZA 3RB4A 5GAGI 1WF2A 1N8RT 1Y10A 3SCLE 3HPOA 3H25A 3BBCA 4LF1A 1JLGB 3BJYA 3AA9A 1RWMB 3DLEA 5KFYA 2V9WA 3VAFA 2CIMA 2OPQA 3I0RA 1L3TA 3JQKA 1HBNA 3NS6A 2ZBQA 3SFUA 1SC1B 2KL8A 4ICLB 4IDKA 2P2CB 3JTNA 3R1LA 3KK3A 3L3CA 2MZTA 4WZMA 2PGCA 1RKJA 4A46A 1SQGA 4PR6A 1KKHA 2VQEJ 1QAXA 3EGVA 3WIUA 3MPVA 1JQGA 2BABA 2E66A 3ZZZA 1IUJA 1WG5A 4RU9A 4F4XA 3GR0A 4ZPTR 4PWWA 2JSXA 1NSAA 3MGJA 1RP5A 3B8HA 2AQ4A 3W9IA 4ECZA 4Z7YA 4Y00A 1P1TA 4BLGA 1F5BA 4O44A 4DFPA 1A9NB 3HHLD 1RTJB 4USIA 1RLCL 4KPCA 4Y34A 3FEYB 4Q8FA 2V2QA 3IS9B 4NLDA 1EB0A 5DZ6A 2LLZA 5LJ5Y 3W3SA 3LP2A 5T7LB 3NNAA 1HYSB 5A8KA 3QRQA 3DHWC 3HLUA 3X3UA 1SH3A 2B6AA 1KTQA 2DGTA 2DRBA 1WHYA 3ULHA 4ZLJA 3GFHA 3I56S 1S99A 2F63A 4LF8J 4DPXA 3P3DA 1SI9A 3V81A 1HI8A 4CLZA 3KMSA 5DJBA 3OL7A 4NLQA 3MEEA 2D3ZA 1HNXJ 2OMLA 3VQSA 2OPPB 3OFHA 4O4GA 2CPYA 1Q79A 2JLGA 1F3FA 1TL3A 1Y0HA 2ASLA 4Q45A 2XY7A 2BE9B 1BWVA 1XMQJ 3M2UB 1NBEB 4WF9Q 2VFVA 3VZIA 2KZZA 3D1QA 1OIAA 1TMJA 1IBKJ 4TNOA 3QJPA 3BQ1A 5DGBA 2XMAA 4JP8A 2MJNA 4F4AA 3C14A 2K8GA 1WHWA 1RHJB 3FGVA 4FYDA 1VC5A 2OPSA 1F9EB 1ZA2B 2R4FA 2DNYA 2C3OA 1X5SA 3QGPA 2DPJA 3KJNB 1S10A 2DD8S 3H7HB 1KTVA 1LXJA 5KT4A 1V3ZA 2PDAA 2UUAF 1M5VC 1RWNB 2KH9A 3RB3A 2KTQA 4KBIA 5IV3A 1VBXA 1CS4A 3PJ9A 4IH5A 2KN4A 2XGPA 5D0EA 4UF4A 1JLQB 2XS7A 4OYZA 4M5KA 2GAGC 1F9HA 4C3LA 3E2EA 1VOMA 1Q8LA 1YQHA 1VMBA 1C0UB 1R0AA 4LMZA 4PG6A 2HFUA 1TUWA 1FEEA 1SH2A 2R8GA 3DM2A 3HMJG 5F9NA 5E33A 2AMCB 2IRYA 3DOLB 3DMJA 3EGZA 2HHHF 1H2VZ 4U95A 1VQMS 2V8PA 5F8MA 1VQYA 3TZXA 3FJ2A 3FVYA 3NGUA 3CMES 4CM0A 4MK7A 2IBOA 4OHWA 3W64A 3RBDA 3Q8QB 3CJ2A 1TL1B 4C3KA 4OX8A 4M5GA 3J7AN 5EX3A 4KFBA 4RW7A 1UVMA 2HZAA 1V3RA 4KGMA 5KFGA 4USUA 3CJ3A 4FYXB 4ENOA 4WXOA 3CC2S 2M88A 3H4BA 1HBOB 4DHVA 2WW8A 3RGIA 1S9FA 1HIYA 3GU0A 3ILIA 3EUNA 3ZZPA 1U2CA 1AXQA 2A6OA 4YR3A 3D5MA 1T9XA 3KOAA 4K0KF 1FK9A 1I94J 1S6PA 2C3MA 3ADAC 3SQGB 3MCSA 1PC5A 1Q8BA 5EDWA 4K4VA 2A3JA 2DGUA 2R7RA 3PEHA 4NE9C 3HD1A 4M1KA 3M32A 2GFFA 1LWCB 2H4YB 1N5QA 2C2KB 3MM5A 4N47A 2BX6A 1Q16B 1ROFA 2ZITA 1GXLA 1R8PA 3M8RA 2RQMA 3NEKA 2NYIA 3TQEA 2E7WA 3V6DA 2G4BA 3I4PA 4B9SA 3OHAA 4OI6A 1FKOA 2DR5A 1KQSR 3H8YA 3TJAA 4J9VA 2XNQA 2NQPA 1Q1KA 3EXCX 5GVQA 4JI2F 4QPTA 4FVCA 2MTLA 4JUZA 1T03A 5KFFA 1PJ5A 2YNFB 2J0QD 2RDJA 2CJ9A 3M8WA 4Y65A 3BN4A 3M7VA 1BHNA 4JI1F 3MWBA 2ZZTA 4WFXA 2XB2D 1L3VA 4HLBA 3R5JB 4RJVA 1S1TA 2UXCJ 5KG3A 1UEVA 2E5HA 5ETOA 2EC2A 2DXDA 2OIHA 1YRUA 2QMWA 1HQ2A 4DR2J 5H9FJ 4CDIA 2JEJA 2OPRB 4GKKJ 4IRCA 3N6NA 2V8VA 2F65A 2RF2B 4ANEA 2MZJA 2M7SA 1JB0C 3Q8YA 4ZVQB 4OYBA 3FK4A 2XHWA 5HI7A 4TQSA 3RYLA 4A8SA 4OX6A 3ZTRA 1QJHA 3OUYB 4LUBA 3I0SB 4DQQA 2DNNA 2HRUA 1TKTA 4ZA1A 4F2RA 4RBTA 4DV6J 1Y7PA 5DG8A 3GPAA 3CJSA 1C1CB 1UFWA 2E5GA 2HNYB 2J7UA 4JOUA 2Q6CA 2JFDA 1JXVA 4JI7J 4KGVB 3CXCR 3PR4A 4MAKA 1RBLA 4LR8A 1NSQA 4DCPB 2BJ8A 3T1AA 5I3QA 3TUPA 1NKBA 3TOQA 1R31A 2JC0A 3T5LA 3Q8RB 1WC5A 2RRAA 1UJ4A 3R5AA 2HBRB 4KE5A 4Y28C 1WACA 4QWAA 3MHYA 6AT1B 1OSCA 1C1BA 4J9MA 2RU3A 2JX2A 2KU7A 1FD2A 2HNZB 3VGUA 3LPYA 5LXRA 4IQXA 1T9VA 2DJWA 4YR2A 1TKXB 3ILLA 4LSLB 3D9BA 2RVJA 3MEDA 2CPEA 3VAMA 3HK2A 1S4EA 1ZM3A 4USHA 4DR1F 5K14B 3C16A 4RW4B 1P9QC 1VISA 5DO2A 2N3OA 4M5NA 2J0XA 2IM3A 3ZZ0A 4CH7A 1LW0A 2V8HA 1KQFB 1GMVA 5HQMA 2CJAA 1RT3B 1UMJA 2H1YA 4WK1A 4AQYJ 2R2RA 3KXDA 2AHOB 4DUZF 5CYQA 1SV5B 3ITHB 4QU7A 3MMAB 3Q8UA 2CQ3A 4DFKA 2RJZA 1S1WB 3DGPB 5AXLA 3GCXP 3VF0B 3V4IA 1BWEA 4IR9A 3BYRA 1HNVA 4F25A 3H5YA 1GFWB 4BDPA 3L9ZA 2ZNZA 2ZH1A 1NHVA 3W8PA 1GEHA 1NLKL 2ZKUA 4Z7CA 1S7IA 1HR0F 4QW8A 4ZVTB 4DPOA 2XULA 4R8UB 4B3OA 4JV5F 2CPIA 3R8YA 5C42B 5KFCA 1X0FA 2W8LA 2E5LF 1G4CA 1D1UA 3AFGA 1FX2A 1FJGJ 1O8BA 3DOMB 1U0HA 4CTAB 5DM6Q 3PO4A 1APSA 4DV3F 1DBDA 1WSVA 4ZP7A 4TU7A 5KFNA 2AJ4A 1NDLA 1FJ7A 3G8QA 1FRLA 4NZ0A 2RU9A 1WKJA 3GONA 3DN9A 3EVWA 2IYIA 4K4SA 3PW0A 1RWXB 4DFMA 1N33F 4URSA 2DXEA 3W60A 4CO0A 3ETOA 3W5XA 3QNWB 3FC9A 4I2QA 3LPEA 4DJBA 3MM9A 3C15B 1X4EA 3SSSA 3OXGA 4J9RA 2XO6A 1F6TA 3V6HA 1BLUA 3W5YA 3D28A 2FPHX 3IWXA 4KHMA 4P2SA 4IFVB 4HHHA 2VG7B 4Y2CA 2BEFA 2BM0A 1IXKA 2DPIA 4NWBA 4PXBA 2X1AA 2Y1IA 1MN9A 2FGOA 1IKWA 1RA7A 4LF7F 3PFEA 1EX8A 5THWA 2H4WB 2M9KA 3KUGA 2D41A 3CGIA 4MKVA 2QJ3A 1PAEX 3UR3C 4AFFA 1FF2A 2K2PA 9ATCB 2KG1A 1N0VC 2R7OA 2G2ZA 4WTYA 5KFWA 3HZGA 4ECWA 1LNQA 2W25A 4ED4A 3QQCD 1AT1B 2MQPA 1P27B 2Y9HA 4L6V3 1IWGA 1H74A 3EVMA 4C8ZA 3CMQA 3EGWB 1VI7A 2Y3YA 1EKSA 1CJKA 3EDRB 2GVDA 4LSNA 5K8MA 1TTHB 3BSNA 1LWFA 2YKMB 1UEUA 1XR5A 2EBEA 3CF5Q 1UP1A 3WIVA 3PRVA 2VQFF 1RK8A 1VIXA 1NRKA 1Z2LA 2RRNA 1JLAA 2BJEA 2MZSA 1IM6A 1GQEA 2YNHB 1KFSA 2BJ7A 3FZBA 1F60B 2F4VJ 3OSNA 5H1SV 3JSMB 5H9EK 4X2BA 1OYDA 2F40A 5B7WA 2WB4A 2DIVA 2CPXA 3EWGA 4QWCA 3K5PA 3HSGA 1Q95G 4AYBD 2PMWA 4OZ1A 4ZPWR 4V19J 5LMUJ 4JI6F 4NXMF 4PPDA 4DBQA 4ELTA 3U27A 1HNWF 3TAMA 2OEJA 4ID8A 1PILA 3NS7B 4OI3A 1HBMA 5HJYA 3GJTB 1VQ5S 4A47A 2PIIA 3IG1B 2HS4A 2YH1A 2F3JA 2B4PA 3DI6A 3LUYA 3FDSA 1XR6A 2IM1A 4HI2A 2VOPA 1YBAA 3ICLA 3AY0A 4NI2B 2WZ1A 3O1LA 5IC4B 4C4WA 4USTA 1X4GA 2M3DA 1X4HA 3KLFA 2FIUA 2D9OA 4I68A 1WHVA 3OJUA 2K3IA 1SJQA 5D77A 3QFWA 3SYZA 5CD4H 4AL6A 1RSCA 5E3AA 4TU9A 5KFAA 4EWTA 3KDOA 5KFZA 1NDCA 1L5UA 3TA1A 2PMHA 2FJWA 3LO3A 4ETXA 4Q0BA 3CVKA 2ASYA 3MCMA 2YKAA 1TKZA 4QBUA 4PUOA 4M5JA 3KLHB 4QWBA 1UZHA 2CNLB 1KHWA 1CJVA 3OFFA 1S6OA 4CCHA 4KH0B 4UZCA 1NKEA 1I5OB 3E01B 2AYMA 3IBCB 3M1VB 4B9LA 2DGOA 4RL1A 1FXRA 3G82A 5D0HA 3WC0A 3QT8A 1HNIA 4UQGA 5J2QB 5C24B 3BPDA 4C0OC 2FLLA 4I56A 3GV8B 1Q0NA 2D7SA 2JVRA 2ZBRA 3WZ0A 1B0TA 4DV5F 5KG0A 3O5TB 3P96A 2VPXB 4LFCF 4KV8B 5HBMA 3KHGA 1NCLA 2W2PP 4OX9F 2EFGA 4DL2A 1CLFA 3HX9A 1B0VA 2H48B 1J5OB 2R9LA 2OAUA 5EWFA 1KFDA 1H72C 4LR7A 1PSDA 4KKOA 1N88A 3TW0A 2LQ5A 2W2NP 2D1CA 3PYDA 1RYSA 5KG1A 2MKCA 2CQPA 1K47A 2RKIB 2I38A 3VAHA 2H5EA 4Q2MA 4E2FB 4IG3B 1DLOB 3S7RA 2PEBA 2FJAB 3L4BC 3TEGA 2CPFA 3D1HA 2NPFA 4EBCA 4I7FA 1S0VA 3R5CA 2PFDA 4TQRA 1JJCB 3OD2A 2UUAJ 2QMUB 4OZ0A 3CJKA 3JAMY 2C42A 4MKAA 4X4RA 2HURA 1JLCB 4QYZK 4ZLNA 5C2CA 4TY8B 3UW1A 2XI2A 4G1IA 1TVRA 1ZA1B 1QVGR 5K8NA 4DI6A 4NCBA 3PYFA 1S72S 3Q83A 2B9XA 2L9NA 4I0WA 3G6ES 1Y4ZB 2MSSA 3MM8A 1RHUB 1S9GB 4BBYA 2YWKA 4U7UK 2CJKA 1VK8A 3M2RB 1P6TA 2CQ1A 2XTJP 2MKYA 5HMWA 3MM7B 2RHQB 1ZAXA 4V1Ak 4ZVFA 2HQIA 1X4FA 1NU4A 2WONA 1FTRA 1FX4A 4IG0B 1S5ZA 2MY8A 3KFWX 2EW9A 4A8MP 1CULB 2H51B 2MEWA 2GVZA 5AE3A 2OP5A 1KR4A 3KK2A 2FVSA 1VRUA 3HSJA 3MAAA 3QZ7A 4CZCA 1SUQB 3AB2B 4M5HA 3D67A 2ZEJA 2NYHA 2PA3A 1X4DA 1JXLA 3R6GB 2RS8A 2QRRA 3MD3A 1K1SA 2AYBA 2V67A 4K50A 2ZE2B 1TAQA 4LREA 1WC0A 4RO0A 2E1RA 2L08A 1W7WA 4DLGA 4Y2KA 3RG6A 2LQBA 2R7XA 3GV5B 3NNHA 2RUSA 2E1PA 4ZP6A 4OJ1A 2HAFA 3DRXA 4WU3A 3C6TB 2P9EA 3SSRA 2GHPA 3KLIB 2H54B 1YBUA 4L76A 1JKHB 3CSKA 4WFNQ 5SUHA 1WC3A 2RAQA 1LFPA 3KHLA 3EE3A 1A6LA 3HHLC 1U25A 5F0UA 5A8RA 5GAEI 4HHJA 1RHRB 1N36F 3BQ0A 1OO0B 3QATA 2DHGA 3H0PA 4JI8J 3VGVA 3I9ZA 2JZ5A 4P52A 4K7QA 3PTWA 2Y1JA 1HD1A 3QO9B 4K5RA 4U9RA 4I4BA 1RUSA 5CXTA 1KLMB 1LWXA 1FDDA 3I5CA 1T94A 3AD7C 3EXYA 2RIJA 3KNGA 3DXBA 3HHLA 4L75A 1NK6A 1U09A 3C3LA 2W2MP 1YDLA 4R0JA 4PAAA 3LGHA 1RTHA 4CLUA 3HVTA 5IS2A 4OYOA 1B99A 3P8BB 1BMQB 4F0MA 4ELUA 2OLWA 2CADA 4K4UA 4YP3A 2FJXA 1H7XA 1RBAA 2QLFB 3NGKA 3Q23A 3G86A 2DXFA 2W01A 2L41A 2LQ8A 3KJVA 2KT3A 4P6QA 2GIQA 2A2CA 2WK4A 4UZBA 5H9EJ 4J9KA 2QL9B 3CJRA 3FFIA 1X4BA 1YITS 5IWAF 2BVZA 1TL7B 2QYCA 4J7CA 1YJ9S 1HMVB 4X62F 4MIWA 3SIPB 4O3OA 1YJNS 4ED1A 5KG7A 2C3UA 3I4HX 4ZMMA 2XHCA 1T11A 4U67Q 3Q89A 4TYAA 4YB6A 2KVQE 3NY0A 4ZHRB 1UVNA 4DV4F 5A0YB 3SDEA 3BS9A 2M8HA 4RX6A 4C48A 1YRTA 3T41A 3F41A 3BDPA 1HLWA 5B0GA 1MROA 1FRKA 4BC9A 4CWBA 3M4XA 2DGSA 1FRXA 1NEEA 2VOOA 1KP6A 1NMEB 1R3NA 3VVTA 3IRWP 3GFXA 1JNRB 2XMJA 4JI3F 4CLWA 4P75A 2FB0A 3LF0A 5J2MB 2AYEA 1MMLA 2J0WA 2GQ2A 3GJSB 4DR1J 2HLTA 2OTLS 4H4MB 3DU6A 4LF6J 5T41A 2KFYA 2G1DA 1Q86T 1CJUB 5EN1A 3AA8A 4U8YA 4EO8A 1B70B 3EPIA 1HWIA 2LA6A 2QE5A 3HJFA 4YB1P 4WE1B 3G6VA 2UVRA 1FJEB 1X9MA 3G2XA 4NLSA 4DUZJ 2OPQB 1KHVA 1JLBB 4PQAA 1UTAA 3MAQA 3ENVA 4XDDA 3TQ1A 3W7BA 2WBMA 4DMZA 4YB7A 1HQEB 3D68A 1MMNA 5J1NA 2EFPA 4Y2MA 1RCOB 2V5HG 3TA0A 2LCWA 4CQ1A 1WDTA 2GW8A 3BO2A 1Q7YT 2Z2LA 1PBUA 3N28A 4P7VA 3KLEB 2RSQA 3EPGA 2AZ3A 2E5LJ 3QFHA 2JNJA 2W7PA 4DV3J 4CLPA 2DO0A 4LRAA 4NLGA 4IO1A 1JLEB 2VDIA 4ZVRB 4MFBB 3H4DA 1IWAA 1QTNB 1PAUB 2LU2A 3PM9A 4Q8EA 2BKPA 3NMRA 3SCKE 2X3GA 5KT2A 2EVZA 3BSAA 3D0HE 3PDNA 2VV5A 2CWXA 3R7NB 3I87A 3FCHA 4M5DA 4P9SA 4IOAQ 3M8PA 1WG4A 3H5UA 4B9UA 2HHTA 2C3PA 3U1NA 4TKTA 2Z56B 2IRUA 1OWXA 1YJWS 5F0WA 5AE2A 2QSWA 1RYRA 3OL9A 4IRDA 3CCES 3NP5A 1AA1B 2D3O1 4C11A 4BC7A 1N34F 3R7BB 3IM9A 1FRMA 2BV3A 4EK2A 3W9HA 2XO7A 4HHUA 4RPFA 3UDEA 5HLFA 3LWMA 2FZKB 4C8KA 4YEAA 2CAJA 1RTDB 5FDLB 1QAJA 1T9UA 3M8QB 3TJ9A 1VS3A 3D54A 3BGOP 3EJMA 1N5VA 4PG8A 3GTYX 1EAYC 2XC9A 3VAIA 4QYZJ 1B4SA 1WKKA 1UVJA 4TU8A 2F1FA 1HNZF 1EP4B 3HFZB 1VBYA 5IXUA 1NDKA 2WVEA 1OPZA 2KKHA 3Q8SB 3B82A 4GO5X 1FE0A 3JSRA 4I69A 1RT7B 1UZDA 2H9ZA 3ZFVA 2K1RA 1GX6A 4B9NA 2VZ9A 2CQHA 3PIOQ 1S12A 5L8RC 2DHAA 2YVSA 1KC8T 4FBTA 4C97A 4XAKA 4X65F 2XEXA 1U49A 1KVIA 1XNQJ 1U02A 2RNEA 3VV2B 1WWHA 1N56A 1VR6A 5D4OA 4K4WA 1RT6A 1TFYA 3DDIA 2E1MC 3M6WA 4FPRA 1U1QA 4OYPA 2ZJQQ 3J81U 3UCZP 1UVKA 2E7XA 4F04B 1IR2A 2AIRB 4K4YA 4RW6B 3WX4A 1IR1A 2HQ3A 3DMJB 2F8MA 3DLKB 2ZOGA 4ZJQA 2J9CA 2CQCA 4JI6J 3C19A 4NXMJ 3MMBA 2YKNB 3PX0A 2PMZD 1IBMF 3IBFB 3S1TA 2HBQB 4IFYB 4Q2LA 1FNMA 1YSJA 3GSIA 4Z2XA 1HNWJ 1D09B 4KJIA 4J37A 5EX0A 3T1HF 2VG6A 4RW7B 4ED2A 1VFJA 3CTRA 1KNZA 4WZQA 1SC4B 3M30A 1BXNA 2U2FA 5K20B 3T5JA 1JLFB 1N32J 2L48A 1LV5A 2O1PA 1UW9A 2GJ2A 4CO5A 1WOPA 2ILYA 2ROPA 4H4OA 3POTA 3C6UB 1RB0A 2KXHA 3IO1A 1J5EJ 4K4TA 4DX6A 1G7CB 1Q53A 1IVZA 4JI0F 2W9CB 2VIHA 2BDPA 1ZPVA 3UN5A 4N56A 3SQOP 3CC4S 1R6YA 1QE1B 5LMNF 2DY9A 4HEA9 3L7OA 3UN2A 5JMNA 4IOBA 4F4KA 3D6HB 5IM0A 3UVJB 3N4WA 1SIWB 4NYPA 1S1XB 2O5DA 1SL2A 2YKQA 2IBKA 4R5PA 5KFLA 1U1RA 2UU9F 1SJFA 4W4MA 2I1RA 4OJ3A 2MLXA 2ZUAA 3PZPA 4LF4F 4PPZA 1JIHA 4JI4J 5CYMB 4NA2A 4G1QA 2JEFA 4ECTA 3RR8A 2EFNA 1ZS6A 4NLPA 2KM8C 4DN9A 2DO4A 3C46A 4C8LA 2VA2A 1WEZA 3HJVA 5MLCV 4DV5J 5F3ZA 3K17A 1FI4A 2VG5B 3HDSA 4CH1A 1SH0A 4XIUA 5HVHA 2YTCA 2UXBF 1UEKA 5I42B 3DCAA 2BE2A 2Q6BA 4KTQA 5J2NB 2ZHAA 3MOZA 2BJDA 2LQJA 3W5ZA 4MIAA 4DU8A 4GC7A 3K7RA 1SXLA 2MZQA 3DLGA 4O4RA 8AT1B 3LW5C 3CCUS 1RAIB 2CQ0A 2I5JB 5GAHI 2XWYA 3K58A 1RT5A 3UDLA 3A1YG 1TKTB 2QN6B 3TVYA 4O3PA 1YJUA 3CCZA 2F8HA 3FSYA 3QMQA 5ETTA 1MU2A 2E5IA 3LWLA 4NXNF 5F8JA 2VL1A 4FBUA 1VYAA 1R0CB 2G0IA 3GLJA 4KHPJ 3VZHA 2QA2A 3FSXA 2FHJA 4RUAA 2RB7A 5IV4A 5M2PA 1U1NA 2NZ4A 5CAAA 4NL5A 1VJQA 2GCFA 2UP1A 2W1BA 3MPYA 1NH7A 4IOCQ 4WFYA 3HFKA 2GIRA 4ICLA 4UOCA 1UETA 4C8YA 2HFVA 2FD2A 2XMKA 4ZVHA 3FRYA 2AJ1A 3VVUA 4YB5A 1YGYA 2ROEA 3AAWB 4HACA 3MR7A 4JV2A 4DR5F 3GYNA 2CQ2A 1WI6A 1N54B 1GMWA 5CYJA 1K8AT 1ZM2A 5LM7E 1RT1B 1RAOA 2B7BB 2NCKL 4O0NA 3F73A 4WCEQ 2UUWA 1RWWB 1TK0A 1WHXA 3MMJA 2AX0A 4LFBF 1GMUA 4B3RF 2W2QP 1RTJA 1F5CA 3HHEA 4KH1B 2FC8A 4C2MA 2XI3A 1DTTB 4XK8C 2IDEA 3IS9A 4ID5B 3BGRB 3G4SS 4UY8T 2ZVSA 2ZH4A 4K4XA 1S7HA 1CQNA 2AJ0A 3FCVA 3FBFA 1A0OB 3BDEA 2H5IB 5T7LA 2DNOA 2VBXA 1HYSA 4TXSA 2HBYB 2GX8A 1WKLA 2JHEA 3OL8A 4KGKA 4DX7A 1UJ6A 1FDNA 4DUYF 2XCAA 3PKMA 2V68A 3MEGB 2VODA 2VBYA 4RZRA 3CJQA 4DV2F 2AGPA 4USMA 3ET6B 3W2WB 3P4UB 1X4CA 2KDOA 2QFIA 1O6XA 1T3OA 4ZDNA 3NL0A 5IZHA 1S49A 2JL9A 2CXEA 2B51A 3DLJA 3H40A 4X66F 2VFTA 1LW2B 4M95A 2R8JA 2OPPA 2HYIB 3NCQA 1Q5YA 1RACB 1D9AA 2KXFA 4DN0A 5C25B 4A8XA 2MSTA 4ED3A 4USVA 3M2UA 3BR9A 3Q2TC 4QZVB 4J90A 1OY6A 3FMBA 2C22A 2C1EB 2MQOA 2AJ2A 4OV1A 4URQU 2HVEA 2ZNYA 3DDKA 2B4UA 2ZVIA 3LH2S 1VQLS 3OLAA 3S01A 3G9CA 2N4DA 3KTQA 4B08A 2XLKA 2GA7A 5E5NA 2R3VA 3MTJA 3NAIA 3RAMA 1M5OC 3ZTSA 4ZN3A 3V6KA 4ILRA 4UW2A 1JWWA 3GFZA 3G96A 4KB7A 1HHTP 2ZOFA 4CO4A 2J76E 1BE4A 1XBWA 3RW6A 2V6AA 5K9FA 1ZYQA 2CZ9A 3FQKA 4ZVSB 3NMAA 1JLQA 2GHVC 2DH8A 1TELA 2AX1A 3TAPA 4LRCA 1P1LA 3CULA 1C0UA 4B9MA 4Y2IA 4PRFA 4ILLA 2L3MA 2CNNB 4OYIA 5CH7B 4D3HA 2VPYB 3DOLA 1FERA 5AE1A 5D4PA 3CCMS 2Z0GA 1H38A 5KFHA 4PKDB 1VK3A 1BQNB 2CPZA 1VJWA 4YR0A 4RW8B 2NUHA 5KFJA 2QGFB 5FLXY 4WP8A 1HPZB 3EX7B 4DV7F 1TL1A 2Z4PA 3QIPB 4A8FA 1VHIA 1MSWD 3CCQS 2IHR1 4MK9A 3ILJA 1WUUA 4OMFG 4KC5A 4PG4A 4FDFA 4KY3A 3FUYA 1HHQA 3MTKA 2XYGB 3VAGA 2NPIA 1HBOA 4NLTA 3DRPB 2PI4A 2EG1A 1WNEA 5A8WB 2UXDF 4DR7J 3W66A 2VBZA 1WTFA 3QT7A 4YDDB 3HKWA 4ECUA 2HQDA 5ETSA 3GR1A 4P71A 2HGLA 2DNMA 4B3TJ 2FY8A 2MQQA 1DARA 2V2VA 3UCGA 2RHSB 3AJ2A 3SQGA 1K0TA 1WELA 4DV0F 2HLUA 2HHQA 2GJIA 5DG7A 4JI3J 1QSYA 3UE2A 3P5BP 2DT9A 1LWCA 4X64F 2BOAA 1HQUB 1ZPWX 4ZCMA 1T05B 2APOA 2HHWA 4F8RA 1OPIA 1ZOTA 1YRXA 3NOCA 5E3CA 4IKAA 1TAUA 1BY9A 4OLOA 5KG6A 4R0EA 3HKZD 2CDRB 3A4TA 3PW4A 4FF1A 5KFPA 4C6AA 2MYFA 3CEDA 1ZBTA 2ZH8A 3GIMA 3W8GA 3US5A 3FSIA 3A12A 1R6VA 4C8OA 5IFMA 2YKPA 4J9OA 3RB6A 4LF9F 3LTOA 3PYGA 3CIZA 2HVDA 1ZAWA 2AP6A 4RU2A 2BMBA 3J7YI 1FKPB 1FA0A 3OFGA 3M2VB 5KFOA 1PJ7A 4X84A 1SJ1A 3BKTA 3AXKA 2NXEA 4E0DA 1YLXA 2IVMA 4IH6A 3N6MA 3HHNB 3CCWA 3OXLA 2OPRA 1DRZA 2DNLA 2EXUA 3WX8A 1RXOB 2OTJS 4DSKA 1JNZB 4DEZA 1X9WA 2RF2A 1FXDA 4LRFA 4HDGA 2B4VA 2KI2A 1HFEL 3G8TA 3OTEA 2GO8A 2E9RX 3B4DA 2OEKA 1U1KA 4DL5A 3RR7A 1IBCB 3UD4P 4GKJJ 3R5DA 2EEYA 2IC3A 1BUXA 3OUYA 2IVFB 3I0SA 2DGWA 1XR7A 3CT9A 3LANA 2ASDA 2HIYA 1AYEA 1XMOF 3GFYA 1E6YA 1C1CA 4PCQA 4QIVA 2CDQA 2YNGB 5J1EA 1QTMA 2ALZA 2HHXA 4RUCA 2HNYA 1KOHA 3QGHA 3DRRB 3Q8VA 2Z57B 2JOQA 4BCAA 1IJFB 3MZIA 1X9SA 5HBMB 1XN9A 5KFMA 2CQBA 3H2UB 2UUCF 3OTOF 4OI0A 2DR9A 5KOWA 1ZM4A 5E3QA 1VC6A 2VD3A 2IYGA 4HH1A 1MG7A 4P2XA 3JB9k 1FT8A 2CG4A 3M05A 1PCAA 2BQ3A 2X3DA 3KNAA 4O3NA 1AFJA 2IA6A 4ZITA 1C4AA 1RAFB 3JYTB 2HNZA 2MPUA 2IM0A 4C0HA 4ZCIA 1TKXA 3G87A 2LEPA 3FQLA 2AW0A 1V3SA 5C2GA 1VQ9S 3Q24A 3Q86A 2HS0A 2XY6A 4QYRA 2ZM6J 5IQ6A 1R43A 2YX1A 2HHPA 4RW4A 2YWWA 1VGYA 1VCTA 2HAIA 3NGDA 1O5JA 3KUHA 1Y5NB 4ZLLA 4H4KC 4DR4J 2FUG9 1RT3A 4HTJA 2XMMA 5ETRA 3ZNUA 1WJ9A 1SV5A 3ITHA 3MMAA 4I2PB 4ALZA 5KAKA 2G9OA 5KFTA 4LFAJ 4FYVB 5D3GB 2KYXA 1S1WA 3DGPA 1M5HA 2LQ9A 2MZRA 2A0FB 3ZZYA 3OL6A 4PQUB 1OY8A 2PT0A 5HN0A 3LP0B 1Y3JA 3VGSA 4WU2A 3M8SA 2VQEF 4OZ3A 3T1YF 1YX2A 2B56A 4P73A 3NOGA 3MM8B 1IM4A 1WC6A 3GJQB 2H5JB 1PJ6A 2JJ4D 2CQDA 2V69A 2DK2A 5JVHQ 2VH7A 1B64A 4H4KA 4R8UA 1XJWB 1NXIA 3QZ8A 2FHOB 1TV6B 3AT1B 1Q7LB 2MXYA 3PIPQ 4WK3A 3MECA 5C42A 3HF5A 3H98A 3CCJS 4QR1A 1U1OA 3T1HJ 3DOMA 2W2OP 1HA1A 4CTAA 4DR3J 4HDHA 3MPDA 2YBVA 5AT1B 3VAJA 1ZTWA 5LJ3Y 2VJVA 1IKYB 2FHMA 3IM8A 2XM3A 3H90A 5ITHA 1SQEA 2CRLA 4GVBB 1YJRA 4KO0B 2CG8A 4WKRA 3W62A 3RAXA 3R1HA 4Q5VA 1VLOA 4KR0B 3H42A 3C15A 3W65A 4ZPDA 2A2DA 1JXEA 1Q78A 3IGNA 3MF5A 5LOQA 2YNIB 4LF8F 3G6YA 3OBIA 5B0EA 1SJ4P 1Q5VA 2YQ3A 4IFVA 3BQ2A 3HSDA 2VG7A 4ZIWA 1U7LA 4OIXA 2CVEA 1HW9A 3IRXA 4NEYA 1R89A 2XYPB 5LSOA 3B6BA 3MM6B 1WD6A 1KD1T 2VJUA 5DDQC 4QIFA 2DNKA 2UUTA 3ZZOA 4MTPA 1RZMA 4WIQA 5KG5A 1AZSB 4B9TA 1WG1A 2RQ4A 3BB5A 5SZTA 2YWFA 3J81j 1DTQB 1UVIA 2UU9J 3LAMA 2M70A 3KK1B 1S1UB 4YY3J 2R2UA 2Y8YA 2OUGA 3MMCB 1IBKF 2LMIA 2RQKA 2UVUA 2GO9A 2AGQA 2AT1B 1K73T 2BR0A 1Q8IA 4ANCA 3N01A 5K8OA 5GMDA 4OJHA 2HGMA 2G1HA 5D15A 2VUGA 3TO8A 4FN5A 2QT7A 3A8KA 3H59A 3OQ2A 4RNNA 4TLRA 1SJ3P 3U1LA 5KFSA 3T6JA 2YKMA 4OHVA 3TANA 3CJ5A 1LKZA 1Y5IB 2PD1A 2RUGA 3AOCA 3BM7A 5T14A 4HH0A 4UOGA 2BANB 2DEJA 4OYXA 2OMOA 2J8AA 1CJTB 5JXSA 3GG1A 2YNHA 2ZC4A 4L73A 2UV8A 3BSCA 4AT1B 1FDBA 3BGLA 4NA1A 3ZZUA 4WJBA 3JSMA 4N8OA 2PA8D 3MR3A 1WEXA 3LQVA 4CRJA 1XERA 2KVIA 1S77D 5KFXA 5IT4A 5E7OB 2E1CA 4FXVA 2M5YA 5HQ8A 3JAMU 1H98A 1S9EB 5KFKA 3D66A 2BOPA 4J9LA 3THVA 2B9YA 8ATCB 2I8EA 4ZN1A 2DGQA 5A6PA 3ENQA 2EKYA 4USKA 3BH6B 2HFSA 4HL9A 1WSRA 3UDCA 2ZZMA 2KJWA 4DSLA 3IG1A 1FHTA 2BKNA 3CCRS 2XG8A 2ZFHA 2ADCA 3CDUA 4DR5J 4LIWA 4NYZA 1PYOB 4NI2A 5DETA 5I3UB 1H0HB 2PN6A 2MKSA 2PEHA 2EG2A 2DNRA 5KT5A 4J91A 1MWYA 3SSQA 2VFUA 5KG4A 1NPPA 2V8GA 4U8VA 4ECRA 1IR0A 1QAYA 2XS2A 3R2DJ 5M2UA 1B3TA 3NWGA 3G6XA 1V5VA 5GAGU 3UDVA 4DG1B 1VQSA 4ZVEA 1B7FA 5E3RA 5GMKa 4PXDA 3TZYA 1H2UX 3ELHA 3KLHA 4B3MJ 2RMLA 2F9DA 5CCLA 5KFVA 3FBCA 1AROP 2NS1B 3BO3A 2EI5A 3IWLA 4LRBA 3RBXA 4AL7A 2KFNA 3E01A 2BJ1A 2NXUA 1D9DA 2DCUB 3NGRA 3M1VA 4LQ9A 3HVWA 2FLPA 4M94A 2QTWA 3TP2A 5J2QA 2WHOA 5C24A 2OGUA 4CT8A 2L9DA 2R8KA 1FVSA 2W8KA 1QM9A 3QRPA 3GIKA 2W4DA 3RRHA 5HMZA 1LK5A 1ACMB 3OFEA 5CA5A 1JX4A 4QR0A 4AL5A 2FDNA 4DCOB 3J7A1 1J5OA 2VU5A 1NJIT 4NX9A 4DR2F 1IN0A 1X8DA 4GKKF 2ERRA 2MLZA 1T8EA 2RH3A 2RKIA 1VQ8S 3PJWA 2J5AA 3K2YA 1PC4A 3DOKB 4IG3A 1DLOA 1ELOA 2MQ8A 4X4PA 5AXKA 3PRBA 1Q82T 2R2TA 3ENAA 1IQZA 3BGUA 2VFSA 1PG5B 1KS2A 4DV6F 1H6KX 4NLWA 4MH8A 1MMDA 5B0AA 3KHRA 2UV8G 4KIAA 1M90T 5KFEA 1CPZA 1UJ5A 5LSRA 3T3FA 2MGZB 2C2MB 2AJFE 5CQGA 2IAJB 5L39A 1C0TB 4JI7F 1JLCA 4ZIVA 4TY8A 4A8KA 2KG0A 1N5YB 2WRMA 3IXQA 4B02A 2C2ZB 2XCPA 5JVGQ 3HXMA 1XNRF 4UQTA 3EMTA 4QWEA 4DQRA 1G2EA 4A4JA 4O23A 1CBKA 1L3KA 1LWEB 3HZEA 5B08A 2A6MA 3D0GE 3CCVS 3T9NA 1RWVB 3AOAA 3M2RA 2GQCA 2XGQA 1FTCA 2BW2A 1IJEB 4YQWA 3RTVA 3SV3A 1U0SA 3S6EA 3WC2A 2ZJRQ 2P9GA 3NGTA 4DS4A 1EHWA 3JTPA 4IG0A 4YMEA 1CULA 1M5SA 4ELVA 2K1RB 3I32A 4DR6J 2HFOA 1YZ7A 4LSZB 1HWUA 3D4JA 3OLBA 3HCXA 2Q43A 5CZXA 5I3PA 3PVXA 1JJ2R 3UWTA 1SUQA 4C8NA 4AQYF 4XPEA 4B3SJ 2J0SD 3OHBA 1NK7A 1TKDA 4PWUA 4P2MA 4ES3A 3IC1A 5BR8J 3EYZA
chains in the Genus database with same CATH topology
5D4OA 4ED7A 3R3TA 2XGPA 1DZ5A 4K4WA 1RT6A 3LP1B 1JLQB 3J7ZT 2ZE2A 1TFYA 2E1MC 1TL4A 2XS7A 3M6WA 4FPRA 1U1QA 2SXLA 1I6JA 2ZJQQ 1ZETA 2FHJD 3UCZP 1UVKA 1IKWB 1HW8A 4C3LA 2E7XA 2HWHA 3E2EA 1VOMA 1HWJA 3KWMA 1Q8LA 4K4YA 1YQHA 2MKIA 1VMBA 2QLWA 1C0UB 3QLHB 4RW6B 3WX4A 1R0AA 1VBZA 4LMZA 4MYTA 1KRPA 2HQ3A 4PG6A 3MM6A 1FEEA 1SH2A 3DMJB 4KAIA 2R8GA 3DM2A 1VQ4S 2F8MA 3HMJG 5F9NA 1FESA 5E33A 3DLKB 4DLEA 2IRYA 3D0IE 4OFZA 3DOLB 3C6TA 5DQHA 2ZOGA 3DMJA 3EGZA 2HHHF 3KLIA 2J9CA 1HI0P 1H2VZ 1TQLA 1VQMS 2CQCA 3K5LA 3T5KA 4NYOA 3MMBA 2YKNB 3PX0A 2PMZD 1DTQA 1JKHA 1VQYA 2FVCA 5F8MA 3FJ2A 2V4JB 3FVYA 4MIBA 3FEZA 1IBMF 1YI2S 5L9XA 2HNDB 3KK1A 3SEOA 3CMES 1I1GA 1S1UA 1YVFA 3S1TA 3DHXA 2RD5C 3GB0A 4RLEA 3GYXB 4IFYB 1FJGF 4Q2LA 2V4JA 3BEGB 1FNMA 1YSJA 4MK7A 3HVRA 5KG2A 2IBOA 3DYAB 3MMCA 4FNIA 4Z2XA 3QYYA 4J37A 2DGXA 4OHWA 5EX0A 3RBDA 4KJIA 1FNOA 2HHUA 3Q8QB 3T1HF 1GXUA 2VG6A 3O2IA 4RW7B 1VFJA 3CJ2A 3CTRA 1TL1B 4C3KA 4D3GA 4ED2A 1NJYA 1KNZA 4WZQA 1VQ7S 2CJQA 4OX8A 4CO3A 4DOZA 3M30A 5EX3A 4ERDA 2XLIA 1UL3A 4KFBA 4RW7A 2U2FA 2ZZNA 1UVMA 3I31A 3QJJA 1V3RA 3AQOA 3O6QA 4KGMA 4A48A 1JLFB 2K7JA 4OZ5A 3T5JA 4ZPVR 4KRWA 3DLLQ 5KFGA 4E8UA 2L48A 1DFDA 1LV5A 3CJ3A 2LKZA 2O1PA 2V4QA 1QSLA 2GJ2A 3M9MB 4CO5A 1S0MA 4WXOA 4UUXA 3CC2S 4MKYA 2ILYA 2M88A 3H4BA 4DV1F 4G6VB 1HBOB 2XBPA 1FEHA 4LSNB 2NLWA 2ROPA 3RRGA 4DHVA 2WW8A 2LXFA 3TYTA 4H4OA 3POTA 3C6UB 3DFEA 1S9FA 3C2PA 4WFZA 4G1PA 1LWFB 3SZ2A 5EUHA 4BHQA 1QLNA 2KXHA 4RWWA 3IO1A 2CKWA 3DC2A 2FHKA 4NZ7A 4K4TA 1TL5A 5ADZA 3QO9A 1G7CB 1Q53A 1ZTTA 3EUNA 4WFAQ 3ZZPA 2POKA 4JI0F 3L95X 3O44A 2W9CB 4QW9A 5F8NA 1KLMA 2BDPA 2LEAA 1AXQA 4YR3A 1JLAB 3D5MA 1FDAA 2BANA 3KOAA 1ZPVA 4K0KF 3VWSA 4N56A 1G1XA 1FK9A 1L3SA 1S6PA 2ZJPQ 2C3MA 4G3IA 3CC4S 3QIDA 1ZAVA 3SQGB 1NJXA 3MCSA 4NCAA 1R6YA 1PC5A 1QE1B 1Q8BA 5DDPC 5EDWA 4K4VA 2A3JA 2DGUA 2R7RA 3PEHA 4UUWA 5LMNF 2JEIA 2ZBCA 4HEA9 4LVOP 4M1KA 3L7OA 3HT3A 1N0UA 3M32A 1TK5A 3EZUA 5DLGA 3BZQA 2GFFA 1LWCB 4IOBA 1JJ4A 1N5QA 1H3DA 3MM5A 4F4KA 1REVB 4N47A 4DWIA 1Q16B 1NNDA 1ROFA 4FNHA 2ZITA 1GXLA 4AXJA 5IM0A 1R8PA 2KFZA 1RISA 3N4WA 3N9UC 3TUIC 1SIWB 1U6ZA 3M8RA 4NYPA 2MDAA 3I55S 1GX5A 1S1XB 2O5DA 2RQMA 1SL2A 2YKQA 5G0RB 2GQQA 4R5PA 2IBKA 5KFLA 1NJZA 2NYIA 2HW3A 1U1RA 3UNGC 1U2RA 2E7WA 3V6DA 2DH7A 1SL1A 1S9EA 2G4BA 3I4PA 4A8OA 2RT3A 2UU9F 1X0PA 4B9SA 3VTIA 3OHAA 1SJFA 2I1RA 4OI6A 3NLCA 4OJ3A 4Q44A 1FKOA 4GMKA 2DR5A 3PZPA 1KQSR 3H8YA 2WTFA 4PWDB 2DBBA 2XNQA 2NQPA 2J6SA 4LF4F 4PPZA 4MJKA 3TAMB 1QVFR 3GIIA 1IBLF 1Q1KA 1D0EA 2O66A 1JIHA 2DNPA 5CYMB 3EXCX 4NA2A 5B0BA 5GVQA 4JI2F 4G1QA 4QPTA 2JEFA 4ECTA 2DRAA 3RR8A 4FVCA 2EFNA 3TNVA 2HMIB 4NLPA 4ZVGA 2KM8C 4DN9A 4DX8H 4JUZA 1T03A 5KFFA 1HBMB 2DO4A 3C46A 2YNFB 1IKXB 2J0QD 5B0FA 2CJ9A 3CDWA 2RDJA 4Y65A 3RBEA 2DR8A 4C8LA 4ILMA 2VA2A 1WEZA 3BN4A 4RWXA 3MUVP 4JI1F 3MWBA 2NSBA 2YNFA 2PI5A 5MLCV 4WFXA 4RNFA 2X1FA 2J9EA 5F3ZA 1U1PA 3DI6B 1N48A 2VG5B 5DQGA 1HMVA 2FTRA 5HROB 2PO4A 4NZ6A 3OVSA 2XB2D 2HFZA 2FY1A 1SKWA 3CCTA 3HDSA 4CH1A 3EZ5A 1L3VA 4DR7F 3H2LA 2EK1A 2O67A 2RE1A 1SH0A 4XIUA 3F44A 2XSFA 4HLBA 5GADI 1S1TA 2YTCA 2UXBF 2EPIA 5I42B 3DCAA 2BE2A 1G3OA 5KG3A 2BYCA 3CJ4A 2P6TA 1UEVA 2E5HA 2Q6BA 4ZHRA 3KLFB 2M8DB 4B3TF 4OZJA 5L1JA 3I96A 5I3UA 5A0YA 3TUJC 4KTQA 5J2NB 2E44A 2OIHA 4O3RA 3KG0A 1YRUA 4C98A 2QMWA 2ZHAA 3CCSS 4DQIA 3J7Z5 3MOZA 2KM8B 2BJDA 2LQJA 4B9VA 5H9FJ 1D8YA 5AXMA 5GAHU 2JEJA 2OPRB 3KLVA 4MIAA 4IRCA 3N6NA 3CD5A 4GC7A 2V8VA 3K7RA 1SXLA 2F4VF 2KJVA 2RF2B 2MZQA 3DLGA 3O3LA 4O4RA 2ACYA 2W24A 3DLBA 3GSDA 1CVJA 3LW5C 4OZLA 2HG4A 2MZJA 3CCUS 2M7SA 1JB0C 1NK0A 2X1BA 3K5NA 2M2BA 2CQ0A 1MNEA 3TX8A 5BYQA 2ASJA 2I5JB 2XHWA 5HI7A 4TQSA 5J2MA 4WYWA 4DG1A 3CDAA 5GAHI 1NH8A 2XWYA 3RYLA 3K58A 3PX6A 3MAHA 1RT5A 3UDLA 1RT4B 3A1YG 4Q0BB 3OW2R 4A8SA 4J9QA 1TKZB 4H4MA 4HT7A 2QV6A 3CDEA 4OX6A 1QJHA 1TKTB 3TVYA 5LSLA 4PUOB 4O3PA 3OUYB 1YJUA 4LUBA 3CCZA 3I0SB 2F8HA 4WYLA 5LMUF 2XMUA 4RKUC 3MFIA 3FSYA 3QMQA 4DQQA 2DNNA 1MU2A 2E5IA 1K1QA 3LWLA 4IRKA 3QWPA 2HRUA 4NXNF 1TKTA 5F8JA 2B5JB 2VL1A 3H5SA 4FBUA 4MK8A 4ZA1A 2ILZA 4RBTA 4F2RA 1Y7PA 4WE1A 2R7SA 4KQZA 5DG8A 4FS2A 4BWMA 3VZHA 1C1CB 1UFWA 4CO2A 2LU1A 1U2FA 2J6TA 2E5GA 2QA2A 3NBPB 1T95A 5E0OA 3FSXA 2FHJA 2Z2MA 4RUAA 2RB7A 4FXDA 3ZZTA 2HS3A 5M2PA 1M1KT 1U1NA 2NZ4A 1JLBA 3RU0A 2HNYB 2J7UA 1HNIB 4NL5A 4JOUA 3M6VA 4EBDA 2EFOA 1KQGB 3KHHA 1QAIA 4U6PA 1DJ0A 2GCFA 2Q6CA 5JJBA 2W9BB 2UP1A 2JFDA 4KPYA 3MPYA 1NH7A 1TP7A 4IOCQ 1XK8A 3CB4A 2BUNA 3CXCR 1HQEA 2MMYA 1X7VA 4WFYA 1WI8A 3HFKA 2J9DE 3PR4A 3VAKA 2GIRA 4MAKA 2ABYA 3E51A 4ICLA 4UOCA 3HO1A 2O3DA 1UETA 2E29A 3PJXA 5DRKA 3T1AA 4C8YA 5I3QA 1HI1A 5IT0A 1NKBA 2FD2A 1FNXH 2XMKA 4ZVHA 1AFIA 3FRYA 3TOQA