2MJNA

Structure, dynamics and rna binding of the multi-domain splicing factor tia-1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
GAMANHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Nucleolysin TIA-1 isoform p40
publication title Structure, dynamics and RNA binding of the multi-domain splicing factor TIA-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mjnA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mjnA02
1WHYA 2DNMA 2M88A 4WF9Q 2DNHA 2UP1A 2DO0A 3G9CA 1CVJA 2DO4A 2L9WA 3R27A 1FJ7A 3US5A 2DITA 4EGLA 3EGZA 4W90B 5CA5A 1FNXH 2CQHA 3JB9k 3J7ZT 2FC9A 2MGZB 2ADCA 4UY8T 3VAIA 4QQBA 1X5PA 5IM0A 4W92B 2CQIA 1B7FA 1A9NB 2KYXA 3UWTA 2KVIA 2JRSA 2DHAA 5DDPC 1X0FA 3P49B 2JVOA 1NJIT 2YH0A 5HO4A 4IOCQ 2CQ0A 2VOOA 2RNEA 1VQ9S 2BOPA 4YUDA 5DDOC 2CQ2A 2YTCA 5GADU 3CCMS 1KOOA 5MLCV 2AYMA 1AUDA 2DHXA 1N54B 2G1DA 2DNRA 5GMKa 1N88A 1OWXA 3TP2A 1WHVA 2AYGA 4QU7A 1NU4A 3CF5Q 1X4FA 1VQKS 3CXCR 4ZKAA 4TU9A 5JVGQ 2LA4A 2Q79A 2ADBA 4C7QA 1M5VC 2LXIA 2CQPA 1X4EA 3SDEB 3RW7A 2MZSA 2VONA 2EK1A 4CH0S 1YI2S 1WELA 1H2UX 2MZRA 3VF0B 5DM6Q 2PE8A 1VQ7S 2DNYA 2RRAA 3PIPQ 2OSRA 1DZ5A 3UD4P 4YB1P 5H1SV 4F26A 3CPWR 4M5DB 1P27B 3IRWP 3H2UB 1YHQS 1HA1A 2DB1A 2MQNA 3BO4A 2DNGA 1M1KT 1PO6A 2MJUA 2GO9A 5D78A 1PGZA 1F9FA 1SJQA 1YIJS 3FEYB 3NNCA 3CCSS 2QFJA 1X5OA 3EGNA 3UE2A 3THTA 3BO3A 1Q7YT 1FHTA 2PEHA 5LXYA 5IFMA 3G4SS 3CULA 1WEZA 3G6ES 4C4WA 3FEXB 1KD1T 4CH1A 1WF1A 3H2VE 2ZJQQ 1D8ZA 2V94A 5DM7Q 4YOEA 2DH8A 2DH9A 2CJKA 1YTYA 1U1PA 1WWHA 3G96A 1M90T 1WHWA 2A3JA 2FHOB 5EN1A 5ITHA 2MKCA 3UCUP 1WTBA 2E5JA 3LPYA 1UFWA 2DHGA 2KFYA 1X5SA 2N7CA 4WCEQ 2MY8A 1X4GA 3TYTA 4Y00A 2I38A 2MQOA 4BS2A 2MQMA 3SMZA 2DGVA 3I56S 2N3OA 1X4HA 3NMRA 2CQ4A 1QM9A 3Q2SC 2G4BA 2LCWA 1SJ4P 1G2EA 1Q81T 4WFAQ 5LJ5Y 4CIOA 4UQTA 5HL7Q 3G8TA 2KG0A 3K0JA 4PRFA 3CC4S 2MB0B 3R1HA 1X4BA 5LXRA 2I2YA 4QU6A 3B4DA 2B0GA 3DLLQ 2LA6A 2CPDA 2CPFA 1U1QA 1VC5A 2CPJA 3ULHA 1IQTA 1VBYA 3UCGA 5DDQC 2CPEA 2MQQA 2DGOA 1Q86T 2M7SA 1WF2A 2XNQA 2EVZA 4U67Q 1WI6A 1U6FA 5CYJA 2OTLS 2O3DA 2LYVA 1BY9A 2KRBA 3R1LA 2X1AA 3ZZYA 1P1TA 2HYIB 2CQ3A 4J5OA 2HVZA 2HGLA 2RRBA 2CQDA 3MUMP 2MZJA 3CCVS 2MKSA 3I55S 3HI9A 2N3LA 3VAGA 3MURP 3S8SA 2CQ1A 1WF0A 2MSSA 2RQ4A 5DDRC 1YJ9S 3MD3A 3NNAA 3SXLA 4CQ1A 2E5IA 1M5PC 2DNNA 3B4MA 1U1KA 5JVHQ 1R8HA 2DGTA 2MJNA 3HHNB 2QA4S 4A8XA 3THPA 1UP1A 4P6QA 3CC2S 3CCES 3MUVP 2F9DA 2RQCA 3CTRA 2JWNA 3VAMA 2MKJA 1VQ8S 2AYBA 2DGXA 1UW4A 1N8RT 4IUFA 1YJWS 2KXNB 1M5OC 2G0CA 2L41A 2XS2A 3ZZZA 2XS5A 5BJRA 4ED5A 2KG1A 2U2FA 4WIIA 3CMAS 1RKJA 2AD9A 3S7RA 1SJRA 2XB2D 2BZ2A 2AYEA 2DISA 1K8AT 2MSTA 2SXLA 1OPIA 1VQNS 1VQ5S 3IWNC 2D9OA 3MUTP 2MPUA 1YWXA 2M70A 1YJNS 1WEYA 1QVFR 1ZZNA 1JJHA 3EX7B 3LQVA 2ZJPQ 2ZJRQ 5LSOA 5CXTA 2KXHA 4TU7A 2LEBA 2KI2A 2MQPA 2LKZA 1W2BR 5FJ4A 2E5GA 2DIVA 3PIOQ 1UAWA 2YWKA 2KHCA 2NLWA 5DETA 1FJCA 2DNKA 1X4CA 2DGQA 3NNHA 2KXFA 2EK6A 1SXLA 2N82B 2OTJS 2ERRA 3V4MA 3MOJB 2DNQA 3TO8A 5GAGU 2GHPA 5LJ3Y 2L08A 1URNA 2CPXA 2M8DB 3U1LA 2KT5A 2JVRA 1VBZA 3NS5A 4FXVA 3VAHA 2LQ5A 2KU7A 1HD1A 1WG1A 1DBDA 3P5TL 1OO0B 3P6YC 3UCZP 1JJ4A 2RVJA 1H2TZ 2LEAA 3MDFA 2DNOA 1VC6A 4Z2XA 1Q82T 2M8HA 4OZ0A 4QPTA 2MY7A 3OW2R 2VODA 1H6KX 2MKKA 1ZH5A 2J0SD 2E5HA 1FXLA 4WFBQ 2DGWA 2RT3A 3CCUS 3BO2A 2D3OR 1S72S 1VQLS 4OZ1A 3G8SA 3CCLS 2DGUA 1VQ6S 2YKAA 2D9PA 3CCQS 2DHSA 1RK8A 4FXWA 1KOHA 2MKHA 3MXHP 4PR6A 1WG4A 2DK2A 2CQCA 3VAFA 3CD6S 1D9AA 2FPHX 2KRRA 4PKDB 1S79A 3G71S 1FT8A 2WBRA 1ZZFA 3CMES 3D2WA 2HGNA 2KM8B 1VQOS 4LIRA 3MI7X 2FC8A 3CC7S 1VQPS 2DNLA 2LXUA 2CQGA 1O0PA 1KQSR 1VQMS 1U1OA 1KC8T 1HD0A 2LMIA 3BS9A 2HZCA 2CPIA 4V19X 3VAKA 2QEXS 1VC0A 3DXBA 2RS2A 1VBXA 4RU2A 2XNRA 4ERDA 2X1GA 2DH7A 2MZTA 2MMYA 1FO1A 2CPHA 2MZ1A 1M5KC 1X4DA 3J7YU 2KH9A 3MD1A 3CCRS 3Q2TC 1U1MA 3S6EA 5GAEU 2MGZA 2J0QD 1A7GE 1R8PA 2HGMA 1FJEB 1K9MT 1SJFA 1U1NA 1U6BA 2MKIA 2M4MA 2M2BA 4Y0FA 2CPYA 5GVQA 1N52B 2CQBA 3U1MA 3CCJS 3UD3P 1WHXA 2RU3A 2KN4A 1WEXA 1XN9A 2J76E 1U2FA 1OIAA 3NS6A 4TU8A 1QVGR 2MXYA 2E44A 3RW6A 2DNPA 2MYFA 4C0OC 1L3KA 5D77A 3BEGB 1NO8A 1U1LA 2XSFA 1X5TA 2KM8C 4LJMA 1JJ2R 4IOAQ 4F25A 2JX2A 2MHNA 3P3DA 4LMZA 4IO9Q 4F02A 3VALA 5IM0B 3S01A 2OIHA 1DHMA 2YH1A 2K3KA 2M9KA 1WI8A 2DGSA 5IQQA 2DNZA 2U1AA 3N9UC 5GAHU 1HL6A 2MZQA 2K8GA 2X1FA 3SDEA 2M0GB 1SJ3P 2OJ3A 2LECA 5LSLA 1WG5A 2MQLA 2F9JA 1U1RA 1K73T 1H2VZ 2X1BA 1DRZA 2CPZA 2F3JA 1YITS 1JMTA 2OSQA 2RS8A 2RUGA 3CUNA 1X4AA 2FY1A 4WFNQ 2M52A 2XS7A 3VAJA 3L3CA 2NZ4A 1VQ4S 2DIUA 2J8AA 4TLQA 2VOPA 4WKRA
chains in the Genus database with same CATH superfamily
1WC0A 3H20A 3PX0A 3J7Z5 1MN9A 2DO0A 3OTBA 3G9CA 2KFNA 1JKHA 2PA8D 4JI4J 3QZ7A 2X7IA 1S9FA 3LOUA 1FEHA 3L7UA 4X4OA 4ZVEA 3QIPB 5HO4A 5F8JA 1EETA 1VBKA 1NK0A 1IKVA 1CC8A 2WK4A 3SI8A 1F5AA 4TVAB 3DLEB 2MHEA 1VOMA 4OHZA 4U8YA 1YI2S 2N4DA 2MZRA 3BH6B 1HYSA 5GAHI 2CNNB 4LRBA 4NX9A 3HKWA 3TQEA 1CC7A 4M5DB 4CNZA 4LF6J 2HS3A 4LFCF 2UXBF 3M30B 4ZHRB 2JEJA 3OR1A 4DLGA 1N5VA 3EGNA 4DR3F 5LXYA 3PZPA 2CXEA 4N47A 3K5OA 2ZC3A 1XNQF 3H2VE 2IJNA 3W2WA 4H4MA 2ASJA 4RO0A 4DQIA 3MFHA 1LWCA 1MWZA 5ETLA 3JQJA 3TUJC 3HLUA 1BMQB 2N7CA 3TJ9A 2VG6A 1JLGA 3ZZPA 4X4RA 3NMRA 2Z4PA 1REGX 4OLPA 4OFZA 4DDFA 3BV8A 3NAIA 2GVDA 4DWIA 3W62A 2RILA 1VLYA 4LSNB 3HXMA 4GMKA 2HYIB 4IYQA 3I55S 1CULA 3TVZA 1X60A 2ZKTA 1F2HA 3BZQA 4F4YA 3BGLA 3TAMA 1I1GA 3NKYA 5JMNA 4MIBA 3IP0A 2HHTA 3OTOF 2F63A 2XCAA 5KT7A 1RISA 3ZZTA 3MUVP 1Z4UA 2BV3A 1LOUA 1S5ZA 4CTAA 4V19J 2C2ZB 2ZD1A 5A8KB 3LTOA 2I0XA 5CYQA 1YDLA 1IBLF 4PXDA 3UVJB 2ZBCA 3AA8A 2ZJPQ 1IKXB 3QJPA 2MQPA 4DSLA 2HKEA 1QE1A 2E5GA 2JLFA 2KHCA 4CYUB 1XK8A 1YX2A 3DU6A 1IBMJ 3TW0A 2OTJS 4RWWA 3CWJA 3TO8A 1VISA 4ES3A 1ROFA 3QGGA 2YVSA 4G6VB 1ZBTA 3RRKA 4IH5A 1PYSB 4KGVB 2E9ZA 4P73A 4USVA 1S12A 4WU3A 3G6VA 2JEIA 2FVPA 1S77D 4Q7AA 3G8SA 3GIJA 4KHRA 3CCQS 2QZ8A 3R97A 4QIVA 4CRJA 3CD6S 3AQOA 4U7CA 4RUCA 3I4PA 3H4BA 1L5UA 3KLIA 4LFAF 2QLXA 4KC5A 4P9SA 4DR7F 1RUSA 4HVZA 1VQOS 1XERA 2FC8A 3DMJB 2V8HA 3CJ4A 4I67A 1U1OA 2QA4G 3SEOA 5F8IA 2FIUA 2QEXS 4ZVGA 3GV7B 4DR4J 3V81A 2JHEA 5CCLA 2DH7A 1G7CB 2AHOB 5J2MA 4N41A 4A8MP 1ULRA 4NEYA 2GAHC 5L38A 4KPYA 5HMXA 2MKIA 5GVQA 3TR5A 2HNYB 5GAGI 2A6MA 2A6OA 1CS4A 1MMDA 4RW6A 1QVGR 3FK4A 3EPIA 1C1BA 2XMUA 4DV2J 2HIYA 2KM8C 2B51A 4DJBA 2GVZB 4FNHA 3CJKA 3F0NA 2BJEA 3MMCB 2ZNYA 4DV6J 1D8YA 3BBCA 1FJGJ 3EXCX 2MQLA 3QGHA 2X1BA 4ED7A 3SFUA 3PFEA 2BM0A 3Q24A 4C8KA 3ILJA 4YEAA 2XS7A 5M2PA 3MEKA 2DNMA 2UP1A 2VV5A 3ICLA 3I0SB 2J9DE 2W9CA 3FSYA 3W63A 1EB0A 5J1NA 4QQBA 2CQIA 4RW8B 3CIZA 5K8PA 1G3OA 2UUCF 2GHWA 1UWAA 3IRXB 5LT5A 1AB8A 3I5BA 1U24A 1PJ7A 3T1HJ 1RAAB 2W1BA 3TP2A 1VCTA 2R8KA 4ZVHA 2BM1A 5L1IA 2ZZNA 3LP1A 1NJZA 3TWZA 4NLGA 4W4MA 4N56A 2CQPA 3QJLA 1VJWA 5B0EA 2UXCF 1NK7A 1NRKA 2AIRB 1YBAA 3Q8VA 2PA3A 1KONA 2BVZA 4FVMA 4O44B 1E6YB 3JQKA 1N4LA 1MMLA 4NXNF 4DFPA 4P2MA 3FEYB 3W5ZA 2QFJA 3FRYA 3AJ1A 3C6TA 2IAJA 2RDJA 1TKDA 4C4WA 4CH1A 2R4FA 1WC5A 3O1LA 2QGFB 1Y9OA 1U1PA 1C1CB 4JI6J 5SUHA 3NXZA 3KYLA 2R7SA 2IY5B 3HD1A 3TNVA 4WXWA 4USKA 4J9NA 2DGVA 4U7UK 4M95A 4CCHA 4B3MF 4YY3J 4X62J 3EM1A 3NGDA 3HJFA 3M8PA 3DLLQ 1RU2A 1U1QA 1VC5A 4DFMA 3EICA 5KFTA 1V9OA 1F1BB 1DARA 3AOBA 1BC6A 2MQQA 4I68A 4RW7A 1Q86T 3OFHA 4X66J 2H48B 3LANA 1Y00A 2ASLA 3O2IA 2VKZG 1TL1A 4A8FA 2GZOA 3R1LA 4DL0C 1YGYA 2HVZA 1NKBA 3HI9A 2Z0GA 4RNMA 2N3LA 4DV3J 4ED6A 1XMQF 3RR7A 3AFGA 4OZ2A 1EQMA 5BR8J 1HBUA 4D3GA 2PIIA 1R8HA 1P1LA 2IRUA 4ED2A 3ZZ0A 4WK1A 4R5PB 2CZ4A 5LMNF 5ETTA 1JB0C 1Y3KA 3HKZD 1UA0A 3O6QA 2G2OA 3MTKA 1YJWS 5C42A 3OXFA 2XS5A 2WRMA 3W3SA 1I94F 2ZM6F 2OPSA 1SL2A 2DRBA 2W24A 1SB6A 1QAIA 3LQVA 4L74A 2KXHA 4TU7A 4MH8A 4ZCIA 3MCNA 4PG8A 2DIVA 3VQTA 2HK3A 3W64A 4DV5J 4J9OA 2HQCA 3W5XA 4J7CA 5T7LA 1EKRA 4URSA 3NS5A 4A8OA 4C3KA 3FBEA 1JIHA 2OHDA 3R5BA 3P5TL 3PKYA 3LAKA 4YFUA 5CYMA 4RBUA 2M8HA 3F44A 5FLXU 4X4PA 4Y34A 4DSEA 2RU9A 4TY8B 4CO3A 1B0PA 2ACMA 1N5YB 3C15A 2JSXA 4ELVA 2H3EB 4H54A 2BW2A 2HGNA 3G6XA 5AJ3F 4I7FB 2DNLA 3KLVA 1FRKA 1JLFA 2LMIA 4F2RA 4RW9B 5DLFA 3DN9A 2OPPB 1NK6A 4NLXA 3K58A 4PPZA 4PZVA 1FA0A 4CLLA 2H9ZA 1S1VB 1U4BA 4DQPA 3S6EA 3JYTA 4KB7A 3GP9A 2M2BA 2CPYA 1U47A 2IDLA 2R3VA 2C3UA 4L76A 1SIZA 2RDDA 4JI4F 2HFSA 1RTZA 1VLOA 2E44A 4RW4A 3MEGB 4DF8A 2MHNA 4IO9Q 4F02A 2M9KA 3AJDA 3JXOA 2DNZA 3MHYA 5GAHU 3CDBA 2X1FA 1V3RA 1S0VA 5HP1B 3A8KA 2K1RA 2RS8A 4K4XA 3OV7A 4ES1A 3M8SA 3QPIA 2QIFA 2HRUA 4UY85 2M88A 3DGVA 3L4BC 3U27A 1LXJA 3ENAA 4OHXA 3HPOA 3IN5A 4DSJA 2UXDJ 3B78A 3ILOA 5I4MA 4EBCA 3G86A 4HI1A 1DAXA 2QLFB 3WX4A 4LF6F 1B7FA 1A9NB 2BMBA 2ZH7A 1IJEB 1NJIT 3GG1A 2CNKB 3ZFVA 1ZTWA 2BOPA 4YUDA 3GR1A 4KAIA 1AUDA 2J6UA 2GNKA 2YX1A 2ZE2A 2AYGA 4MJKA 3PEHA 4WPAA 5L1LA 1VQKS 3A4TA 1YLXA 2QL9B 1NDCA 3SDEB 1U0HB 3E3XA 3FNNA 3TVKA 2HURA 4DPOA 3QLHA 5KFAA 1S6QB 2VD3A 3GFHA 3QIPA 1WC4A 3HO1A 2DRDA 3W65A 2VIHA 1RTJB 2IRXA 3TA1A 4MKVA 3PY8A 1HQUB 5U47A 1JNZB 1DLOB 2ZWOA 2BRKA 5KG1A 3DLEA 1MNEA 1HMVB 3DOKB 3T6BA 2GO8A 5DG8A 5E3RA 5DQHA 3A3NB 2E66A 2HWIA 3SBMA 4Q0BB 5CQGA 2W4PA 1FDBA 3TJAA 3LWMA 2W7AA 1UJ5A 3V6KA 2VDIA 4GC7A 2LQ9A 3W2VB 2Q6BA 1T8EA 2FY8A 4YQWA 2HMIB 4RX6A 1RSCA 1HW8A 2XWXA 5IC4B 3M30A 2P6TA 4ZHRA 2OPQB 4LF2A 2QTWA 3BQ2A 4UQTA 1HKAA 3G87A 2G9OA 2YNIA 4ECXA 2FJXA 4LQ9A 4QU6A 1QAYA 3UDLA 1Y7PA 3MECB 2QYCA 1VBYA 4IQMA 5IC6B 4DQRA 1VK8A 3BJYA 3OVAA 1WORA 4IFVB 1TL7B 4J9VA 3QT5A 3GPAA 1NHKL 1IKWB 3CCVS 3VAGA 3R6LB 3K8WA 1JK9B 4NCBA 3D67A 4B3OA 3QT8A 1Q95G 1FKPB 3CD7A 2E5IA 3DI6B 1IBMF 4OYBA 4R25A 3MAHA 1CJVA 2ZH4A 1S6OA 1S99A 1UVLA 1TK0A 3IAM9 4NLDA 2DGXA 4U8VA 2ILYA 4LSNA 3D66A 2ZEJA 1BD6A 3UQSA 4HHHA 3M9OB 2AD9A 4P7VA 4ECTA 3SFGA 1FRIA 3I9ZA 5HLFB 3CJ0A 3CDAA 2L9DA 2KKHA 3PR5B 2I5JB 4CLZA 5CHCB 1MROB 4URQU 3EX7B 2D41A 4K4YA 5FJ4A 5D4NA 2C2OB 5F8GA 5DS7A 3UD5A 3JTPA 1HHQA 6AT1B 2HQGA 5KFFA 4DZ6A 2XHCA 1CSJA 1D0EA 4RLEA 5GAGU 3W1YC 2LFVA 5KFEA 2AGPA 2VQEJ 4PWDB 2Y1RI 2AMCB 1N33F 3HCXA 4DR4F 4CDIA 3Q83A 2E1RA 3RJMB 3R5JB 3GR0A 3UI3A 1NPPA 4KGKA 1SL1A 2HHPA 1ZH5A 1DQ9A 1PYOB 1H38A 2D3OR 1IKXA 2V8VA 4N76A 1WOSA 2GQ2A 1EP4A 1VHIA 4CLUA 3R5CA 2OO4A 4KFBB 5K14A 4W98A 4DV2F 1AROP 4AUKA 1NK5A 4UF4A 4DV6F 1H0HB 1FDAA 2YNGB 1FRJA 2EC0A 3CO9A 3IBCB 2MZTA 3T1YJ 1SL0A 2UUTA 2GCFA 4LRDA 3WC2A 2AKWB 2HQFA 4ZPVR 2IYGA 3HHKA 2PO4A 1M1GA 1UL3A 3OT9A 1WHXA 3ZTQA 4ER8A 2R7XA 4DPWA 1SJ1A 1TTHB 3DMJA 2OLWA 4TNOA 4I6WA 3SSRA 4F4ZA 1TKZA 2Y9HA 1CJUA 2K06A 3T1HF 2PEBA 1S76D 1CLFA 4DS4A 4FPIA 1UVNA 2ZH8A 1G1XA 1HI1A 1DY3A 3ELHA 3KTQA 4E98A 2OAUA 1RWKB 2DIUA 1TKXB 2HNYA 2KT3A 1WHYA 9ATCB 4OI6A 5D8HB 3M32A 2DPJA 4DLEA 3GFXA 3CIMA 3JSBA 1HWIA 3WZ0A 1FE0A 5H9EK 3OPKA 4FXDA 4B9NA 2KYXA 2NXCA 2P6SA 2KVIA 1TUGB 3MMCA 1XMBA 1NK9A 2ZC4A 5ETMA 2RNEA 2YPZA 4EO8A 4E0DA 1SH2A 5DO2A 1XR6A 2QMXA 5E3AA 5KFCA 4KHPJ 3W8PA 3FMWA 4LRFA 4USHA 2XZDB 1G4CA 2EFQA 1RAFB 1RBAA 3I0SA 4RBVA 1F3FA 2XLKA 1SI9A 2OPRB 4KGZB 2OSRA 2FJDB 2HS4A 4YB1P 4F26A 3GIMA 2OGUA 4LR9A 4OI0A 4YY3F 3SQOP 2XO7A 4OV1A 1YG0A 3IGNA 2XMAA 4RL1A 1YIJS 1MLAA 1T02A 3G6ES 1BHNA 1HWLA 2OP5A 3DDKA 4X66F 2ZJQQ 5KT6A 1GTEA 2FGCA 2WVFA 3W5YA 3M7VA 3MCMA 1NDKA 4GC6A 3G96A 4OJGA 1WHWA 3T19A 1KTVA 1UEVA 5EGYA 1TZ0A 1KQGB 4DV3F 2MY8A 3HHEA 1E6YA 4YN3B 4K59A 5BR8F 3MCOA 2B6AB 3UFCX 5KFHA 2HIQA 4YDDB 1KWMA 3NOCA 3MEDB 4HLBA 1C1CA 2VICA 2EKYA 5AE1A 5CYJA 1T9YA 2WOMB 1F0XA 4L3NA 4ZVUB 5EUHA 3K59A 3GFZA 1NH7A 4FF1A 1RT1A 1IR2A 3M2VA 1WF0A 1NJYA 3B4MA 4DV5F 2CVIA 4DPYA 2JNJA 2VFRA 3GWCA 2FJEB 2XG8A 2YKOA 4F67A 2A1BA 2GGPA 2XMVA 3KLFB 3E01B 1DURA 1RKJA 3S7RA 4AXJA 3MAQA 4KE5A 2IA6A 2PMHA 4QBUA 2MPUA 1YWXA 2PFDA 2ZJRQ 5CXTA 3VGUA 4MK8A 2KI2A 1AFJA 3NRBA 2QL5B 2YWKA 4RWXA 2GIFA 1Q8IA 2B4OA 2DNQA 4L72B 3CJQA 5J2QB 2CPXA 2M8DB 1IQZA 3OD2A 3V6DA 1SV5A 4NYZA 5D15A 1JJ4A 3ENWA 2A10A 1W2IA 2P9CA 4Y2KA 4KHMA 3OW2R 1Q7LB 3FQLA 3ENVA 3FCWA 4IG0B 3CCUS 2VZ9A 2C3MA 2HVEA 3PRBA 4FZVA 1VQ6S 1WD6A 4C8MA 3ZTOA 3SQGA 4Q8EA 2J7WA 4OYMA 1T9WA 3O44A 4A8QA 4EBDA 2VDHA 3CC7S 2WVCA 1VQMS 1UEUA 4IKAA 1HD0A 3BS9A 1VJQA 3DFEA 5E33A 4ZJLA 3R9LA 2J7KA 4RU2A 1C0TB 2ZBIA 3HX9A 2YWGA 3V5RA 2FYXA 3PX6A 4C8OA 2FZGB 5HN0A 1HQEA 1RAEB 2HW3A 2W2NP 3HT0A 3GIRA 4TY8A 4RNOA 4Y0FA 2COLA 4ZVQB 1VRQC 2W2MP 3R5DA 2UXDF 2VQFJ 1TK8A 2KTQA 3PRVA 4I7FA 2OEJA 1FFWB 3OTEA 3ETMA 4RJVA 3Q8QB 4B9TA 3R2DJ 3RB0A 2HFUA 3BM7A 1D1UA 4PCQA 1SJ3P 2FVRA 1ZOTA 4CLKA 1S1VA 5D3GA 3VR1A 5F8MA 4OZJA 3L09A 2O66A 3DRRB 2OSQA 4C6AA 3N5FA 4TLQA 4HACA 4ITSA 3ZTRA 4A8YA 4U96A 5HAOA 4WF9Q 2KHDA 1VRUA 2EKNA 2BOAA 2Y8WA 3J7A1 1S0MA 4RU9A 1X31C 4C9DA 1FXRA 4ZMMA 1RT2A 2CYYA 5IS2A 2NPFA 4O3NA 2FUG9 4AD6A 3I5AA 4JI3J 5HP1A 5DDOC 3L95X 1TMMA 1WNEA 3T9NA 4G1PA 1AZSB 4PYAA 3HHLB 3OFGA 2FJBB 5EX0A 1X4FA 2FD2A 3EUNA 1VRTB 4RZRA 2KFZA 4YHHJ 3NY0A 3M9NB 2VPWB 2LXIA 5ADZA 3D7SB 1RT3B 4QWAA 4RNHA 1P9QC 4ECVA 5E3QA 2CIMA 2DB1A 5AXMA 1FWPA 4H4KC 5C5JA 1CJTB 4QR2A 1Q1KA 5KT4A 1VR6A 4CT9A 5KG5A 4Q8FA 1J2VA 7FDRA 4O0IA 3M2UA 4YOEA 4DXLA 2HFOA 4ZK7M 3KG0A 5T41A 4QIGA 2YQ1A 2J8SA 3UCUP 3VWSA 2E5JA 2KFYA 3DOMA 3ADAC 4DHVA 1KFSA 3KJNB 4ZPBA 1HQUA 3AA9A 3MCSA 2E1PA 1LV5A 1R0AA 1G2EA 3T9ZA 2POKA 4WFAQ 4CIOA 3G8TA 3NG8A 5B0AA 2KDOA 1UVJA 2BR0A 2I2YA 3DOKA 4WYLA 2KJVA 2B0GA 4ECYA 3BN4A 1UCNA 3KK2A 4Q0BA 5E2QA 3H4DA 2H5IB 4U67Q 5G0RB 1WI6A 3W2VA 4QWBA 5EX3A 1QSSA 3B54A 2ATCB 2OPQA 4B08A 2H5JB 4PXCA 1FWLA 2UUWA 2CWXA 2BJ3A 3MTJA 2CG4A 2O5DA 3MECA 5HMZA 3BPDA 4K0KJ 1R6VA 2VQEF 1XTZA 4TLRA 2RQCA 1C0UA 3D5MA 3POTB 4IFVA 5EDWA 4WIIA 1VS3A 2HS0A 4NCGA 2J9DA 2DEIA 1TV6B 3HFVA 1VQ5S 3Q8YA 1RWUA 4CM0A 4Y2IA 1BWVA 4OZ3A 2XZTB 1LWEB 1OJ4A 3LGNA 4IDKA 3NGUA 3GG0A 2ZUAA 2F65A 2ERRA 1NDPA 2V4JA 2D3ZA 2CA9A 3OLAA 1S0NA 2KL8A 1UVIA 5HVFA 4X4QA 2DR7A 4TYBA 3T1YF 1T05B 2Y0SD 4PABA 5LL6d 2RKIB 1VYAA 2OFHX 4ETXA 2I5JA 4MFBA 2F7VA 1UPPA 1MROA 1R0CB 3T6JA 2V69A 1R89A 2Z2LA 2WTFA 4PG5A 4YDXA 4ID5A 4GVBA 1FT8A 1V5VA 4F2SA 2WW8A 1DQ8A 4OYOA 2FVSA 4CO2A 2AU0A 4M8LA 4V19X 4JBCA 3NCPA 2WVDA 3RYLA 3UO0A 3ZC4A 1I6JA 4I64A 2BE9B 2IM3A 1U49A 1FKOB 1YJ7A 5FIIA 3VHQA 4NI2B 5L46A 2VHGA 1QDUB 2Y8YA 4RPFA 2V0NA 4TU8A 4DZDA 4ALZA 2MYFA 1NO8A 1X5TA 3I6PA 2CKWA 2R42A 2DHHA 4Y2MA 4LQ3A 4YR2A 4NLYA 1UFLA 3VCDA 5LSLA 5F0UA 3W61A 4KHPF 1S7IA 5A8WB 1NUEA 4J9QA 4CP5A 4DR2J 3MPDA 2AGOA 4DX5A 3M2RB 2D1CA 4B9VA 1NH8A 1FXDA 4HDGA 5L1JA 3NWRA 4ZVRB 3PG9A 4W90B 2UXBJ 4MAKA 1YRTA 4KR0B 3VAIA 1YJUA 4O0NA 4I2PB 1H98A 1DQAA 4DR3J 2GMJA 5M2RA 4BWJA 3GSIA 2AT1B 2BRLA 4A8SA 5KOXA 1B99A 3MR5A 1KVIA 3MAAA 1FE4A 4IOBA 1N54B 2BKNA 4ZVFA 1T0TV 1JLCB 4CLPA 1XEZA 4LF4J 2HBYB 5F0WA 3W7BA 4CH0S 4HHUA 3H0PA 3VF0B 2P9GA 3BKUA 3JSYA 4A46A 2H1YA 2C42A 4FKYA 2V6AA 4DF4A 5H1SV 4L73A 1PBAA 4ELUA 3SCLE 4C97A 3BO4A 5AE3A 4KSEB 2W9BB 2O01C 5D4PA 1SPBP 2RB7A 1FHTA 1JQGA 4NLRA 3KK3A 3DU5A 3SYZA 2B3TB 4WP3A 3RGIA 1URRA 4Q5VA 4P2SA 2OPRA 3RBEA 1D09B 4BHQA 3NGSA 2R8HA 3KNGA 3FZ2A 4UOFA 3GJQB 1XWLA 3HZEA 5HL7Q 2ZH9A 1QJHA 1X4BA 1YZ7A 5LXRA 3MMAA 3FDSA 1UWBB 2HG4A 3QGPA 5H9EJ 2LA6A 3OL9A 5J2PA 3UN3A 3ULHA 3PVXA 1IBLJ 1JLEB 4IG3B 3EJMA 1K47A 2OTLS 5GMDA 2VJUA 2AEFA 2BJ1A 3IWLA 4J5OA 1U26A 2MLZA 7AT1B 2AX1A 4NCAA 2B6AA 4DV4F 3N01A 3MD3A 4DX6A 4TN2A 4GRSA 4X4VA 1A6LA 4A8XA 2FVQA 2JZ5A 1ZTTA 1L3TA 3CTRA 3KJVB 3M6VA 4WFXA 5ETNA 3MFIA 2JFKA 2WBMA 2D7SA 2NSCA 3GE9A 1O5JA 4BDPA 1WC1A 4Q44A 3OBIA 2ZZTA 1PSDA 4EWTA 4G3IA 4DUYF 4DU7A 4RR5A 2F5GA 2FHKA 3QT6A 1R8CA 4MIWA 2W7PA 5I42B 1IKYB 3V4MA 3CD5A 2IMWP 3H5XA 4I56A 4KO0A 4ATNA 1BXNA 2HEKA 2LLZA 2VG5A 4EUVA 3BF4A 1H2TZ 2JOQA 3BBFA 2VODA 1H6KX 4MKAA 4B9UA 2CWKA 2R8JA 1A0OB 1RT4B 5F8LA 4WFZA 1WG4A 4J91A 4QR0A 4X65J 2JL9A 3NMAA 3A3OB 2BUNA 5J2QA 2GIQA 2ABYA 3D0GE 3MI7X 2LXUA 1KN6A 1KQSR 1ZM9A 4GO7X 1KC8T 1CPZA 4OJ3A 3UR0A 1X8DA 3B82A 3VAKA 3R2CJ 1GMWA 3I87A 3DM2B 2CPHA 2Z58B 4U95A 2V5HG 1X4DA 2EG1A 4IG0A 4ZN1A 5GAEU 5CH7B 1MU2B 1SJFA 4ECWA 2RF2B 3HP6A 2XMJA 2E9RX 1RAIB 4KTQA 2XSJB 1QAXA 2J76E 2UUCJ 2VC0A 2XMTA 5C7PA 3KUGA 1S9EB 2AQ4A 1ZPVA 5KFNA 1RP5A 2XEXA 3MM7A 1RHRB 4LMZA 2OIHA 4F50A 2K3KA 4EYHB 1C0TA 4I4BA 1KHVA 2DGSA 4FDFA 2M0GB 1FD2A 1FK9B 1OYEA 2K7KA 4DG1B 3CUNA 3OSNA 4MYTA 3MM8B 3VAJA 4YHHF 3OXLA 5HI7A 3L3CA 1VQ4S 3CGIA 2V63A 4WKRA 1Y4ZB 2K2PA 4NASA 3K5MA 3MM5B 1CVJA 2PGCA 3DLJA 4TQSA 2R7VA 5CCMA 4AL5A 3UN2A 1LFWA 4R0EA 3RAMA 1NPRA 3LGHA 2IBKA 3C19A 1M5SA 5F3ZA 2NXJA 4IOCQ 5B09A 2IRYA 1OS5A 3Q22A 3QATA 3DXSX 2XYPB 1FNOA 1H73A 1S1TB 3VZHA 1FTRA 3FFIB 4WIQA 1MMNA 4CZCA 3NBPB 1RWVB 2HBZB 3EVWA 3EVOA 4DSKA 1RT7A 1TL3B 3D6TB 4JI5J 3C8YA 1Z1ZA 1S6PB 4OYIA 1IWGA 2CNLB 3IRWP 2RD5C 1YHQS 1HNXF 3KG4A 3N6NA 1PBUA 4B3RJ 2DKOB 3BO3A 1EJ7L 2V9WA 3W8GA 4KV8B 3RRHA 3M05A 2Q1LA 5E41A 3C16B 3JS9A 4DFJA 2ZWPA 4FS2A 3DRSA 3GMGA 3BREA 3CSKA 4DPXA 3BGRB 4WCEQ 1NSAA 3TYTA 2BJ8A 3TRGA 1WUUA 3SV3A 1HNWF 4OMFG 3K0JA 3T1AA 2H65B 3PHTA 4DBQA 3AQPA 4K0KF 1QTNB 1HHSA 4N8OA 2KB2A 2CPFA 1UPMB 1I94J 4K4TA 1S1UB 2ZM6J 5B08A 3FVYA 2XNQA 4K4ZA 2ZBPA 1R3NA 3CDUA 3SIPB 4R8UB 2KRBA 4NLPA 1RTHA 2B5JA 4CLWA 1EX8A 2VPZB 2FJWA 4UZBA 1XNRF 2RRBA 2IM0A 2ROEA 4EMDA 4O3RA 2BQRA 3EZOA 4NZ6A 3ETOA 3RRGA 2WAQD 5E7OB 1N0VC 2HZVA 3THPA 2UZAA 4JI8J 2Y1JA 5G0RA 2E7XA 1T94A 4Z37A 1M5OC 5SZTA 3TEGA 2QMWA 4ED5A 1RA6A 1YSJA 3BGUA 4NZ7A 4LBIA 1NSPA 3GFYA 3LPEA 3HFZB 2Z8QA 2D3UA 4ECQA 2NREA 4HT7A 2J5AA 2LEBA 3IFEA 1NSQA 3LP2B 1FJCA 1X4CA 4HKQA 3D1OA 1FX2A 1BQMB 4B3SF 5LJ3Y 2KJWA 4QIEA 4A48A 2UUAF 4EZ9A 3DLKB 2HWTA 1RWXB 2BXJA 1SKSA 3VAHA 1HD1A 2OMLA 4YB7A 4OZ0A 4QPTA 2J0SD 4YB6A 4NZ0A 3ZNUA 4X2BA 4DX8H 2MTLA 1S72S 4FN5A 5KFKA 3CCLS 4OI3A 3HK2A 4G1QB 4ZS6A 1KOHA 3OFEA 2FJAB 4QYZK 1D9AA 2FPHX 2KRRA 1Y3JA 3ZXWA 4TKTA 3CMES 4IRKA 4ED3A 2RSQA 2DD8S 4C3MA 2BW7A 3EWGA 1UEKA 5H9FK 2VG7B 4URGA 1JJCB 4NPOA 1T05A 5J2NA 1Q4RA 3DXBA 4LFBF 3I9V9 1VBXA 1R6YA 3N4WA 1BWEA 3TOQA 1FO1A 2MDAA 4DR2F 3WHIA 1IN0A 3DLHA 2HGMA 1K9MT 1EIYB 2Z56B 3G6YA 4Y3CA 3BQ0A 5ETRA 1RA7A 4X84A 2NUUG 1WOPA 1N52B 2W8KA 3J80U 1TELA 3TI0A 1UJ6A 2DXDA 1I3OB 1HR0J 3S1TA 2A2CA 4NYOA 5EWEA 2R7RA 4I2QA 4K4VA 1LW0B 1XR5A 3UDEA 5IM0B 3FZBA 2FB0A 1DHMA 2HNZB 1VIOA 4PUOA 5HROB 2ZH6A 3IG1B 2CJAA 3GQCA 1H2VZ 1FRHA 4P72A 2CJYB 5I3UA 2RUGA 2HLTA 3PM9A 3RBXA 2BE2B 2YNHA 5A6PA 3GV8B 3QFWA 1T03B 4NI2A 2K7JA 2J8AA 3CE8A 4LF4F 1JLAB 2B4VA 5KT5A 2HK2A 2ZH1A 2DO4A 3Q8UA 5CA5A 2MGZB 2ADCA 3DLGB 2CAJA 5M2UA 4AT1B 3UWTA 3ILIA 5L8RC 2YH0A 4H4OA 2VPXB 4N8NA 1VQ9S 1TKTA 3CW2C 3VV2B 1M1HA 3V2UC 2XLIA 2CJXB 2F40A 3OR2B 2QFIA 4OYXA 5IT4A 4P2XA 2BBEA 4IH6A 3DRYA 3QJJA 3Q89A 3FBBA 4I2PA 1TQLA 3BR9A 5A8RA 1O6XA 4FVCA 3DC2A 3ZZUA 2UV8G 1UA1A 2VFVA 3GLJA 4C98A 5DZ6A 4MKBA 3NS7B 2NZCA 2AJQA 4DR6F 1S59A 2B56A 2C3PA 1NPKA 3BR8A 4HEA9 4LSLA 5DGBA 1EETB 2W2OP 2R2SA 4QYRA 4GO5X 4ZCLA 1Y0HA 4EBEA 3DDIA 5HK4A 2N4CA 4DCJB 2RJZA 4M5LA 1RT5B 2DHGA 2XBPA 3L7PA 4WWSA 1W26A 3PW0A 3UNYA 4I6YA 4ZPAA 4AYBD 5FDLA 2G4BA 4YR3A 2W9BA 4M5HA 1YZ6A 4ZP6A 5LJ5Y 5KFXA 1HQ2A 4OYAA 2H4WB 1HYSB 4NL5A 1TVRB 3DHWC 1HNZF 2M7SA 5IV4A 3OR1B 4O4GB 3JTNA 3TUZC 4CNYA 4C2MA 1TP7A 1DTTA 4U9RA 3J81U 3TA2A 3TANA 2XY7A 2M5YA 2XZWA 4OHWA 3Q0AA 1RWWB 4CQ1A 1M5PC 2DNNA 1K44A 2DGTA 3D4JA 3AB2B 3CNQP 1N33J 1DJ0A 3MM6B 1UP1A 3AHPA 1SC3B 2VG6B 1SH0A 1HBMA 4IG3A 3FMBA 2B9EA 3H90A 1GNKA 3W66A 1GXTA 5THWA 2V2QA 2AX0A 2KG1A 2G2ZA 2B9XA 2HFZA 2XB2D 3A3PB 1S0OA 3OUYA 4EO6A 3CMQA 2ZBQA 1OPIA 3T3FA 2UVUA 4C8LA 3OTDA 3IMQJ 4X65F 1QTMA 3FCHA 3O5TB 4NOHA 4OX7A 1IR0A 4ZJQA 2DGQA 1J5OA 2HWHA 5IT9U 4BC7A 1CULB 1LK5A 2C2MB 4DX7A 4K2XA 4OL8A 5CABA 4LF7J 3CJ3A 1KHWA 4EI2A 2OELA 3OTCA 2KU7A 3TAMB 1WG1A 4Z7YA 4P10A 2YKMB 1R43A 3N0VA 1N5TA 3H5UA 4A47A 1I5OB 4PWUA 4FYXB 1FXLA 3BO2A 3IS9B 3O8WA 2Z2MA 2Q43A 3HFKA 2DK2A 4PKDB 2ZD1B 3CD0A 2VBYA 1WKLA 3H25A 4QWCA 4ZPDA 1XBWA 1P9YA 2B7BB 3CJ8A 2AEJA 1JXEA 2EBEA 1QE1B 2MEWA 2MMYA 1JX4A 1F2GA 4L75A 1CQNA 1OSCA 3OJSA 3K17A 4LF8F 3LALA 1NHVA 1GMWD 2NYIA 3U1MA 2XTJP 1IVZA 4KT0C 1XMOF 1N34J 4KIAA 5F9NA 3NS6A 1J27A 3QAUA 5KFGA 3GJSB 2XY5A 2DNPA 2DEJA 1U1LA 2XSFA 1OY9A 2DYAA 1EKSA 3DM2A 4HYKA 2IJRA 2XYGB 1HBOA 3H2LA 5K8MA 3QNWB 4ZLJA 1NSKL 4ZIVA 3VGTA 4DI6A 3TARA 2L3MA 2GS8A 3TX0A 4LUBA 2XSJA 3K8VA 1LEOA 4MK9A 3V81B 3R27A 3HSJA 5J2MB 1FKAF 2H5EA 5KFIA 4JI5F 3PJWA 3MR2A 3FC9A 2C22A 4ZLNA 3KHRA 4BLGA 2NPIA 2IYIA 5DDPC 1SKRA 2ZH2A 3EDRB 4B3RF 1U8WA 1FK9A 2LDYA 1RCXB 4RW6B 2YTCA 3NGKA 2IJFA 4FF4A 1UFKA 2EFPA 5MLCV 1C1BB 3MM8A 4DQQA 4UQGA 2C3OA 1ZAWA 3DNCA 1F9EB 3CJKB 4ZKAA 5C2CA 3LA0A 3MM5A 2ADBA 4OX6A 1LWFA 1M5HA 5DGAA 2VASA 3P4UB 1VQYA 1KRPA 2C2KB 2YWFA 4DSIA 1N36F 4DL7A 1H7XA 3R3TA 1W25A 3BN7A 5GMEA 4KGMA 2VF3A 4KGXB 2LP4A 2QSWA 4IFYA 1N6QB 3G4SS 1PKUA 1UMJA 1S97A 3I0RB 5L9NA 3NBPA 4BC9A 1HFEL 1YTYA 2CJQA 2ZHAA 4Q45A 1HBNA 2AGQA 2RQKA 2LQ8A 4HT5A 4X4UA 3JAMY 4C8YA 4OX9J 1S6PA 4OJ1A 2HVDA 4P7TA 2RHSB 3PFOA 4NA3A 3SMZA 3LP1B 4CWBA 1F9HA 3A13A 4WJBA 1PYTA 3VVTA 3B4DA 4JI8F 2QL7B 3RB6A 4OJHA 2CPJA 2NSBA 2CPEA 4B02A 2DGOA 4E2FB 2EVZA 5BYRA 1RACB 1RHUB 3AOAA 3K57A 4ZJOA 3C6TB 2IAJB 2GMHA 2EI5A 4IH7A 3F73A 1RWOB 3BDEA 3SXLA 4M63A 3IAS9 3GTYX 4LR7A 4F3MA 4RNFA 4GKKJ 3R5AA 5ETPA 1RADB 4ZIWA 3NAHA 2JWNA 2AYBA 2HAIA 2BANA 1J5EF 2IC3B 4ED0A 5C24B 2HSEB 4K4SA 5LOQA 3M8PB 1QSYA 3KG1A 2R7OA 1K8AT 3HMJG 1FRMA 1SKWA 3J81j 2XHWA 1QVFR 1KQKA 4JI1J 2DR8A 1ZZNA 1JJHA 3HD2A 5LSOA 5IZHA 4KKOA 1S10A 1TL1B 2GAGC 2DNKA 3T5JA 2EK6A 5C25B 3OJUA 4DR5J 2PT0A 3MOJB 2QLWA 1IWAA 2L08A 3AAWB 4K4UA 3BBBA 3KLHB 4FXVA 4DU8A 2LQ5A 2YXLA 2BQ3A 2ACYA 2RHQB 3P6YC 1S48A 3ZTPA 2C2NA 3IR5B 4NLSA 3I5CA 4RKUC 3LGMA 4K2JA 2HHXA 2BE7D 4ENOA 1UZDA 9RUBA 3CJ5A 3LP2A 1HR0F 2AV5A 2BJDA 5IV3A 5L9XA 2R8IA 4QR1A 2IA0A 2KM8B 4IRCA 4O23A 4LIRA 4F4AA 1NZAA 3NLCA 3DLKA 4DUTA 4PAAA 3U1NA 3BSNA 3RAXA 2CPIA 1VC0A 2W01A 2RS2A 2X1GA 2QSFA 3SCIE 2QA1A 5T7LB 2J0QD 1FJEB 4GKJJ 5F8NA 1U1NA 1LW2B 3PJXA 2QA2A 4RBTA 2QJ3A 2DRAA 3K89A 2R8GA 4X64F 1GXUA 1O8BA 5ETSA 1WEXA 1XN9A 3C14B 3TX8A 2AEMA 2ZUGA 3MR7A 4YMEA 1JJ2R 4IOAQ 3P3DA 1ZA1B 3RB4A 4I0WA 1FD8A 3C46A 1HL6A 3SV4A 2LECA 5HVGA 3BDPA 5DLGA 3PR4A 1WDTA 2EW9A 2E1CA 2VKRA 4WFNQ 2M52A 2VOPA 4DL3A 4M5DA 3D6HB 1SH3A 4CO0A 1VQSA 1WSRA 4F4WA 2QLBB 3UR3C 3JYTB 5IM0A 2I9SA 1RAGB 1VDHA 2LQBA 5HROA 3IG1A 2IM1A 1PG5B 3ONQA 4QYZJ 4NXMF 1V3SA 4DR1J 3BYRA 4WXOA 3M8ZA 2H51B 3KMSA 1N88A 1VI7A 1OWXA 4RW4B 5H9FJ 5KFMA 4QU7A 2QC3A 4KH0B 3AXMA 5CD4H 3CDEA 1P8GA 1JLAA 3T5HA 2PDAA 4OX8A 5JVGQ 2HAFA 2YBVA 2LA4A 2BACA 4OV6A 4LRCA 5HJXA 1QD1A 1HHTP 2HZAA 3RW7A 3GV5B 2RRAA 1DZ5A 1RXOB 5HMWA 4NLVA 4MMOA 2J6SA 1PO6A 1JLBB 2LDIA 1AUSL 3D6FB 1SJQA 1FTCA 4KQZA 3T5LA 1X5OA 3UE2A 2PEHA 1HIYA 1EARA 1TL5A 4PG4A 2FLOA 1KD1T 1FF2A 4M5NA 5ETKA 1FCAA 4KPCA 3N79A 1PCAA 1WWHA 1RGVA 2Z2ZA 1I51B 3W9IA 4M5JA 3TJ8A 2V4QA 2ZE2B 4J9RA 3VTIA 2MQOA 4DCOB 4DSFA 2MQMA 1RWPB 2N3OA 1QM9A 3SSQA 3M8RA 1NAQA 3GYGA 5A8KA 3QLHB 4PQUB 5CAAA 5KG2A 3UVJA 1FEEA 4DV7J 1WF2A 4F3QA 3M8YA 5D0EA 3TUIC 4DL6A 4J90A 1RT5A 4NLOA 2YY3A 5E3CA 3FJ2A 3KUEA 4CYUA 3GIIA 3ZZYA 1TUVA 2EFVA 5JJBA 4ZP9A 4LF5F 4AQYF 3FCVA 4ZVPB 1MSWD 1NB7A 3QWPA 3DKDA 3IXQA 2XGPA 1YJ9S 3HT3A 1U1KA 1S49A 2MJNA 1RTIB 3D0HE 1TVRA 1SC4B 4P6QA 1RTDB 3KK1B 1RWMB 4G65A 1N5QA 4LF7F 1VQ8S 2MKJA 1RU1A 3X1LB 4O4GA 2F4FA 2Z30B 1HWKA 2LVWA 3ZZZA 4LRAA 2E9TA 2AJ2A 2YNIB 4DV0J 2IIHA 2QLJB 3P96A 3WC0A 2YWWA 2FGOA 2VBZA 4ANCA 1WEYA 2XI2A 5KFYA 3RBDA 3MM6A 3FUYA 2B9WA 2ROGA 2VU5A 4OZLA 2R9LA 1U09A 4NRTA 2R2UA 4FNIA 2ASDA 4B3OB 4LREA 3DYAB 2V34A 2HBRB 1U6ZA 2WCXA 3AT1B 3CJ2A 2FDNA 2RVJA 4B3TJ 1CJVB 1FRXA 4Z2XA 2YWEA 3UNGC 2B7CB 4LIWA 5B0DA 1KLMB 3H5YA 4J9UE 3OL8A 2E5LJ 2DGUA 2GVZA 2YKAA 4ZOSA 2UVVA 3CO0P 1N34F 2GHVC 4PR6A 3J7AN 3D2WA 5G4DA 4ZN3A 1VQPS 2XGQA 3P45B 3HM9A 3ET6B 1H7WA 1Q78A 2YKMA 2VPYB 3CCZA 3H98A 3M8WA 1EAYC 4ERDA 4LBPA 1FWKA 4WYWA 3MD1A 2ZDOA 3IS9A 1U1MA 3QMQA 3JSMB 1Z2ZA 5IWAJ 4RUAA 4RW8A 2C1EB 2B4UA 4DMZA 1BQXA 3IRXA 2HQDA 2RU3A 4G1IA 4X4NA 2I1RA 2BJ9A 3HVWA 5D6GA 2B4PA 4NRUA 3QT7A 1CEZA 2HHUA 4DL5A 2JX2A 3BSOA 2VL1A 1T3NA 5BXIA 3AD9C 5IQQA 2FZKB 1EP4B 5AXKA 4AL7A 2EFGA 1FVQA 5K14B 2YX4A 2CPZA 5B0FA 3IR6B 1FX4A 5HATA 4E8UA 4O44A 3LF0A 2Y1LB 4Y2AA 1C4CA 1TMJA 1JLQB 4AXIA 1IBCB 2PSZA 1JNRB 4IR1A 3ZTSA 1HNVB 4LF9F 2DR6A 4ICLB 4W92B 1NDLA 2DHAA 3CJSA 2JVOA 3QWUA 3OL7A 1VGYA 2HNDB 2CRLA 1Q5YA 1U0SA 1X0PA 5GADU 3QRQA 3B6BA 2OFGX 2LXFA 1TKZB 4C7QA 2XLJA 1Q5VA 1CJUB 1X4EA 4FF3A 1GAOA 2MZSA 4BCAA 4OX9F 1WELA 2NUHA 2A0FB 2ZOFA 4J9LA 2EFNA 3KHHA 3LWLA 2UUBF 3NEKA 2L9NA 3KJQB 1G6BA 2MJUA 2VC1A 3M32B 4QCLA 4A4JA 3CVKA 2WONB 4ZCKA 2D74B 3KLEB 3D1QA 2LU1A 2YX7A 1RJJA 4HH0A 1WF1A 5ETQA 4HTIA 1D8ZA 5DM7Q 3J80Y 2DH9A 1FNMA 2R2TA 3EVMA 2DBBA 2A3JA 4DV4J 3ILLA 1WTBA 1NNDA 3LPYA 4R5PA 3AD7C 2DY9A 1S4FA 1Y10A 1RHMB 2I38A 5KFWA 3LP0B 3NGRA 2XMWA 5KFPA 3Q2SC 3P8BB 4FYDA 3RG6A 1SJ4P 2C2EA 3GILA 3EDQB 1KLNA 1AFIA 2W2PP 1Y5IB 2V9KA 1CBKA 4GKKF 1N6QA 1Q8KA 3I0RA 4UT4A 2ALYB 1U8SA 4A8KA 2HQIA 1NLKL 4K8RA 4WP8A 1WKJA 2XYHB 4C0HA 2V8GA 1U48A 3OFFA 2O3DA 4DUYJ 4F36A 4NEZA 2X1AA 3QSYB 4F04B 4MK7A 3IM8A 3VVUA 4DQSA 2CQDA 2MZJA 3S8SA 4JI1F 4FBUA 4NWBA 4PPDA 4XAKA 2YKNB 2PD1A 4DR5F 1KFDA 1RABB 2MLYA 3DGPB 4C0BA 1ZAXA 2F8HA 2G0CA 2L41A 2XS2A 1LXNA 1RB0A 1RQ0A 4WP9A 1N5YA 3UDCA 2Q6CA 1Z2LA 2IPOB 4ZVSB 1VQNS 3Q8SB 2D9OA 2KZMA 2JEFA 4JV5F 6FDRA 2J6TA 4J9SA 4RW9A 4QPXA 4FP9A 2LKZA 3TEHB 2OPPA 1REVB 3A1YG 1RT1B 3M2VB 3LAMA 3MOZA 4LBHA 2IC3A 3U1LA 3KJFB 5C24A 2KT2A 3EXYA 2K3IA 2W25A 2DNOA 1VC6A 2VH7A 3A8JA 5IQ6A 3PX4A 4HI2A 4GKJF 4PWWA 4EFAC 4CT8A 1ZYQA 4Y28C 3MEGA 2GGPB 3R7NB 2E1AA 4DUZF 2XMMA 3VAFA 4ZPTR 5C25A 2F8EX 2WBRA 2UVWA 1Q53A 2J9CA 4EYIB 4JV2A 2HHWA 5GAEI 1F6TA 3KLGB 4F3OA 5KG0A 1O0PA 3KLHA 1XQIA 2V8DA 2CNOB 2GW8A 4F4XA 2DY1A 3GCWP 3MPYA 1GT8A 3I32A 2MKYA 3EZUA 4CH7A 1S1XB 4FF2A 2XNRA 2RRNA 5L1KA 1WC3A 4WE1B 2MLXA 1M5KC 4FS1A 3J81Y 3NCQA 4XDDA 1T9TA 2QYGA 3V6DB 3OSPA 5B0CA 3H59A 1BLUA 5BYQA 1SV5B 3BB5A 1SC1B 3AXKA 1OSDA 1N48A 4K5RA 1U2FA 1EZZB 3R6GB 4QW8A 1RHJB 3D54A 1VFJA 3VALA 2YH1A 4DR1F 3SQGB 1BE4A 2K8GA 2FLLA 3SDEA 5A2QU 1U0HA 3H42A 1YBTA 1S6QA 4EK2A 1LW2A 4JYAF 3K5LA 2EXUA 1U7LA 4I6AA 2UV8A 5EWGA 1SBRA 3JQMA 1RTJA 1U45A 4JI0J 3O3LA 3C14A 1DLOA 2DITA 1FVSA 3US5A 4ZVOB 4EGLA 4OI1A 1HNXJ 5K8OA 1FNXH 5IT9Y 4MT1A 4DN9A 1HQEB 3J7ZT 4NLTA 1P6TA 4WU2A 2Y0BB 1VIXA 1HMVA 2CJBA 2JRSA 3J7YI 1X0FA 2OH2A 2DR5A 3KDOA 4USJC 2F4VJ 4UTGA 5F9LA 1UVKA 4USIA 5KFJA 1LK7A 3CCMS 2AYMA 1U2RA 1FI4A 1ITPA 1RWNB 2QG9B 2GC8A 3H7HB 2HMIA 1RYRA 2Q79A 5J1PA 1PC5A 1M5VC 4ETZA 5JUMA 4F0KA 2ZH5A 2VUGA 2OKQA 5D3GB 2C28A 1H2UX 1Q16B 2XMKA 1HNWJ 3D28A 4ED4A 1AYEA 3PIPQ 3UD4P 4OQJA 5KOWA 3HSGA 1T9XA 4HACB 1P27B 1PJ5A 1HA1A 2MQNA 1VRUB 3PYEA 4PG7A 3IWXA 4LT6A 3TZYA 3NNCA 3THTA 2HHSA 1AW0A 4P74A 1TL7A 1WEZA 1RT2B 3H40A 3SCKE 4DV1J 4D3HA 1IKWA 4Q43A 4DV7F 4J9MA 4ECRA 2NR0A 2DH8A 4Q2MA 3RUBL 1XNRJ 3TZZA 1FKPA 4LVNP 2VJVA 3DI6A 2EC2A 2HRTA 2MKCA 5RUBA 2DTJA 3WIUA 4CI0B 3PJ9A 4WTOB 2EEYA 1JLBA 3QYYA 2KYZA 1YJTA 2OD4A 1PIEA 2EPIA 2LQJA 4WKYA 4B9LA 1Q81T 2ZVIA 5HANA 3IA0A 3R1HA 2HHHJ 1NBEB 5HLFA 4A8WA 1IQTA 1NJXA 3UCGA 1RAJA 5JXSA 2IDEA 3V4IB 1RLCL 4DV0F 2GV1A 3PTWA 3JSRA 4USMA 2Z57B 3QBCA 4KJIA 3HZGA 2BEFA 3PRDA 4I1TA 3MURP 3M2UB 1RHQB 5HBMB 2BJ7A 5HVHA 5DDRC 4B3SJ 4PWDA 1KQFB 4EEYA 4CLTA 4PQUA 2UUAJ 4IQXA 1QUPA 1GX6A 3BSAA 2WVBA 1F5BA 3DOMB 4FYYB 3CC2S 2ALZA 3VGSA 2XY6A 4B9MA 3MPUB 3MMBB 1F5CA 1R0AB 2KXNB 4O3SA 2P2CB 4USTA 2EFOA 4QWDA 5BJRA 4B3TF 1SJRA 2OUGA 4KFBA 2EBGA 2AYEA 3EGWB 4DEZA 2E5LF 3KK2B 3JAMU 1HI8A 3GIKA 2M70A 1L3UA 2W8LA 1RTIA 1LFPA 4DOZA 1MW7A 2YNGA 1RTDA 1FFSB 1SQGA 3T5KA 3KK1A 4LFBJ 2GIRA 1BUXA 4RNNA 2JVRA 2VBWA 2ZOGA 1VBZA 4QZVB 3M6WA 2HQ3A 3KNAA 1OO0B 4FBTA 4NLWA 4M5MA 3P5BP 1V5IB 2B8QA 2AJ0A 1SKUB 5D4OA 1C0UB 5IWAF 1SVDA 4MTPA 3HDSA 3D6MB 4JP8A 2DHSA 4FXWA 3EPGA 2MKHA 2CUYA 4KBIA 1NXIA 3DHXA 4NCGB 3MPWA 3FEZA 3GONA 4K50A 4KY3A 1GMVA 3DYAA 4DS5A 1TKXA 4CM2A 3D0IE 5HQ8A 1UTAA 4IDKB 2MZ1A 4J9KA 1AA1B 1KLMA 1R0BG 3CCRS 1OY8A 1NEEA 2V4JB 3KWMA 1X9MA 2A18A 2GJFA 3QO9B 3M8QB 1K1QA 2G0IA 1CG2A 3PHEA 2CQBA 2EG2A 3GSDA 2KN4A 4XIUA 3QGIA 2IVFB 4UOHA 1NM2A 3RW6A 4C0OC 1X9SA 5DQIA 4MFBB 3M6UA 1S7HA 3ET6A 2WB1D 4C11B 2L48A 2APOA 2G1HA 4ID5B 4JV1A 2MZQA 4GVBB 5E5NA 5A0YB 2F8MA 3B8HA 3GU0A 5IXUA 3JSMA 3OXGA 1DRZA 2QE5A 2I6WA 2NYHA 3QZ8A 1S9GB 2FY1A 2ZBRA 1L3SA 4EZ6A 1YRUA 2HVIA 3MM9B 1BQNB 3EGZA 1PAUB 2CQHA 3PYGA 4WTYA 4OHYA 1OQ6A 2MQ8A 3GB0A 4DR6J 4OYWA 2CQ0A 1N56A 2B43A 2CQ2A 3TZWA 3K7RA 1DTQB 4IRDA 1WHVA 1RAHB 1NU4A 2WSEC 3OHBA 1BGXT 4DPUA 3CXCR 1FJGF 2J7UA 2RQMA 1JLQA 2QRRA 5LMUJ 3PO5A 2J0WA 3ISZA 3DCAA 1TK5A 2ILZA 1IBKJ 3HVTB 2VONA 4WZQA 1HNVA 4Y6IA 2PE8A 4ICLA 1TAUA 1VQ7S 1DFDA 3TUPA 5KTQA 1LKZA 4PXEA 4AE5A 5KAKA 2KZZA 3MEDA 1ZA2B 3HSDA 1JXVA 5ETVA 1M1KT 1KSPA 2HNDA 2JDJA 2GO9A 1HNZJ 3EGVA 5D78A 1C2PA 2WOMA 2IHR1 5IFMA 5F41A 3FBFA 4XK8C 3KOAA 3HHLC 3VZIA 3N5BA 1RLDA 4ZLLA 4HHJA 3QIDA 4IR9A 4M5IA 2G0JA 3MAAB 2BQUA 2X3DA 4WZMA 4UOCA 5I3QA 3CT9A 1T9VA 3TAQA 5DQGA 3CCWA 5KFVA 2V67A 3HJVA 3I56S 2IVYA 3MGJA 5EHHA 4P75A 2WONA 3KLFA 1RT6B 3PYFA 4C8NA 4PRFA 3KLEA 3E01A 2XWYA 4LF1A 2CPDA 1B70B 3BGOP 1ZM4A 1B0VA 4USUA 4ZITA 4K5SA 3A8IA 3KK3B 1YJRA 1V6HA 2WHOA 3LP0A 3MUMP 4JI6F 4F4KA 4UOGA 1UW9A 2GQQA 3NP5A 4FYWB 1R27B 4ZP7A 4Z7CA 2OEKA 2BKPA 2RAQA 2C3YA 4DCPB 2RE1A 3VAMA 1OYDA 4X62F 1GEHA 2VBXA 3NL0A 4R0JA 3PKMA 3VGVA 3Q86A 2U2FA 2O1PA 4IO1A 3MMAB 2JC0A 1HW9A 2MSTA 5J2PB 1MWYA 3MWBA 4ILRA 4PG6A 3BYPA 1H72C 3RZAA 3ISNC 3UDVA 3TA0A 2YKNA 5K8NA 2Q66A 3UW1A 5KFQA 3KHGA 4OI2A 5DETA 2NLWA 4FKXA 4ECSA 4N7TA 1HPZB 1TFYA 3DGPA 3HULA 3GYNA 2G2YA 2D69A 1DBDA 3KUHA 5A76A 5HMYA 3UCZP 4LF8J 5J1EB 1WOOA 2MY7A 3PW4A 1XMOJ 1QLNA 5K9FA 2E5HA 4WFBQ 2I8EA 4OZ1A 2JH3A 1IJFB 4JUZA 2NS1B 1Q8LA 2DPIA 1FDNA 1HWJA 1REVA 7FD1A 3AD8C 8ATCB 5BYSA 2HPUA 1FFGB 4TXSA 2HVHA 2AZ1A 4M1KA 3DRRA 2CQGA 3TAPA 4ID8A 5DJBA 1GTHA 1YBUA 3BPSP 3IBFB 1QY7A 2P9EA 4BWMA 3K5NA 2F1FA 4ECUA 1GFWB 4B9SA 2CJ9A 1KS2A 3J7YU 4WBFA 3SCJE 4KO0B 3DOLB 1U6BA 2M4MA 1NKEA 4ZVTB 3MEEB 4K4WA 4JI0F 2RIJA 2VG5B 3AB4B 2FLPA 5T14A 4WK3A 3KLGA 2XQCA 3A12A 5F8HA 1S1WB 1AZSA 1L3KA 3HHLA 3M6XA 5KG4A 3RBZA 1XR7A 4TQRA 4LJMA 1R8BA 4F25A 1VRTA 2CADA 2F4VF 1S1XA 1WI8A 2U1AA 2VB6A 4OLOA 1YJVA 5IOLA 4WE1A 2OI2A 2RUSA 3KMQA 1RT3A 1NZ8A 1YITS 3CJRA 4XPCA 2C2DA 1RI7A 2IMOA 3ZZRA 3G2XA 4QIWD 4YR0A 1RZMA 1SQFA 2L9WA 4ILLA 3MR3A 1N36J 4U7UD 5CZVA 1CJTA 4NYPA 3JB9k 2FC9A 3DRPB 4UY8T 4NLQA 4J37A 1HNIB 2HLUA 4HL9A 5IT0A 2PMZD 1B7YB 4PXBA 1GMUA 2DHXA 2DNRA 5GMKa 1LQ9A 4DV1F 3TQ1A 3MM7B 4V1Ak 1L3VA 3QAEA 2ZVSA 2A2DA 4NMXA 4C3LA 4F0MA 2NXEA 2EK1A 3FRZA 4PEOA 1ZPWX 4P2FA 4L6V3 3BH7B 1JXLA 2P8IA 2VA3A 2UVRA 2CDQA 2R2RA 2HHHF 1ICEB 1Q7YT 2JEGA 1TFWA 1PILA 3CULA 2V94A 3OLBA 2G13A 1YQHA 1M90T 2OMOA 1WTFA 2FHJA 2ZNZA 5EN1A 5ITHA 1C4AA 2JLEA 1FESA 2CZVC 2W2QP 1X4GA 2VFSA 4BS2A 3WIVA 4LVOP 4ANDA 5E3PA 3POTA 4ZPWR 2MB0B 1RE1B 3M9MB 1RT7B 1YK9A 1J5EJ 3MMJA 3G82B 1IR1A 3TVYA 2RH3A 1TV6A 3F41A 4F8RA 5DG9A 1LWEA 1F60B 1BY9A 4PQAA 2R7TA 3BKFA 3C6UB 2DT9A 1AXQA 2JLGA 4CLFA 4M94A 3KDNA 3MF5A 2RQ4A 3AOCA 2CDRB 4JOUA 1GH8A 2YKQA 3DRSB 4XTTA 2NXUA 4ECZA 2HFNA 2RKIA 2BX6A 2FJVA 2BYCA 4F7VA 3CCES 2F9DA 3QRPA 1CJKB 4ZCMA 1N8RT 1T95A 3V4IA 5AXNA 3DLBA 2HHVA 3VQSA 4C8ZA 1Y5LB 4I69A 2HHQA 3FSIA 1K1SA 1KKHA 4NMLA 2WSCC 5HBMA 3WX8A 3IWNC 3MUTP 2Y3YA 3D1HA 4CO1A 4OYZA 2C2RA 2ROPA 3PIOQ 5KFDA 1RTHB 2B5JB 4OIXA 5KFLA 1OY6A 5KT2A 2WZ1A 1URNA 3MMBA 2RMLA 4L3KA 4O3OA 1FKOA 1N32J 4DL2A 1O51A 2DR9A 1SUQB 3D68A 2E29A 1Q82T 4X64J 2MKKA 2JC1A 4USWA 2FZCB 2DGWA 1TU0B 3ITHB 1VQLS 4JV0A 1U25A 2HBQB 4B17A 3GZ7A 1RK8A 3FBCA 2AWZA 4ZP8A 3WDOA 4OYPA 2YNFB 4AL6A 1S79A 3G71S 5HQLA 1LNQA 1ZZFA 2X3GA 1E6VB 4EU0A 1EQ0A 5A8WA 2W4CA 2ZHBA 1ZETA 3BSCA 3M1VB 3M2RA 1VK3A 1V3ZA 4P71A 2V2ZA 5B0GA 3C2PA 1NK4A 3MR6A 1MN7A 1R8PA 3C3LA 2UU9J 1N0UA 4S0MA 3K2YA 3Q8RB 5DZ7A 3I4HX 2FLNA 2PN6A 1WDDA 4JI2J 1JKHB 1MG7A 1RCOB 4JI7J 4NXMJ 1RDRA 2BDPA 5L39A 4X4TA 4LSZB 1PAEX 2H4YB 3S01A 1JLCA 4TYAA 2LU2A 4N5SA 3PO4A 1VMBA 3KXDA 3DRXA 2AJ1A 5E0OA 1D9FA 1S4EA 3RR8A 3M4XA 1IKVB 2F3JA 3QO9A 5KFOA 3M8QA 3KKFA 2GA7A 2NZ4A 4ELTA 3OL6A 4Y65A 1D3WA 5LMUF 5J2NB 4F0HA 1IBKF 2DNHA 2QN6B 4ZLPA 5HSPA 3GJTB 2WSFC 2IVMA 4NLUA 4O3QA 4C11A 2V8PA 3N6LA 3AH6A 1LWXA 1S6UA 1YKWA 3FKBA 5A0YA 3IC1A 4P52A 4ILMA 5D4LA 2V50A 1KOOA 4ZPCA 1S9GA 2G1DA 4QIFA 4I2QB 4ZA1A 3LW5C 2KO1A 4TU9A 1APSA 3E2EA 3MM9A 3L9ZA 4PUOB 2E7VA 1BQNA 3W2WB 3I82A 4H4MB 1OMSA 1Y11A 3FQKA 1NHUA 5I3UB 1LWCB 2YPYA 1NK8A 1UWBA 2YNHB 5DRKA 2P5VA 3DDNA 4XDCA 1WACA 4H4KA 4O3PA 3H2UB 1JLGB 1JLEA 3PXGa 2IBOA 4QJVA 1DTQA 3CEDA 1F9FA 3PDNA 1GK8A 2NXNA 4JB8B 3BKTA 4NA1A 8AT1B 2GVDB 4H4OB 1IUJA 4LF5J 3HVTA 4AQYJ 2LEPA 4TY9A 3CCTA 3W9HA 3NWGA 1TKTB 2W4DA 5A6WA 1RAOA 1X5SA 1T7PA 1TL4A 3GCXP 4Y00A 1NKCA 1K0TA 1OQ3A 3KJVA 1X4HA 3F56A 2LCWA 1ZS6A 1CQMA 1UVMA 2V68A 4LFCJ 5A2QY 3THVA 2KG0A 3CC4S 4KRWA 1M0SA 1Y5NB 5EWFA 5HJYA 1KEKA 2ATLA 2VA2A 5A8RB 1N5SA 4FYVB 4Q2LA 5DDQC 5AT1B 1XNQJ 1KVJA 1MWQA 3KHLA 4CTAB 5FLXY 3HF5A 3U02A 5ETOA 5I42A 1IKYA 1P1TA 2CQ3A 2HGLA 5CYQB 2BKOA 4M5GA 2MKSA 3H5SA 4LSLB 2AF6A 2MSSA 3UPFA 2CG8A 1RT6A 3HHDA 5JVHQ 3RAQA 1B0TA 5K5MA 3HHNB 2QA4S 3PACA 4CO5A 5KG3A 2VFUA 2YKPA 1R8AA 3IO1A 4ES2A 5KG6A 1UW4A 2DCUB 5FDLB 4IUFA 2V2VA 1IM6A 1RT4A 1SCJB 5I3PA 1UKUA 3PW5A 2AJ4A 2IFXA 2ZDPA 1B64A 2DISA 5KT3A 1IM4A 1WC6A 4DN0A 4ED1A 3CJTA 3QFHA 1HARA 1W7WA 2DVIA 4XO0A 3N6MA 1UAWA 4MIAA 2YQ3A 3R7BB 3NNHA 1DTTB 3KLIB 3OTOJ 4CLYA 4HTJA 3OVSA 3W9JA 1MU2A 3WQPA 2RF2A 3NOGA 1SC6A 2YWHA 2AW0A 1TR0A 3SZ2A 3GYXB 1ZAVA 4J9PA 1R31A 1S9EA 2VFTA 1HBMB 2QV6A 4ED8A 4N77A 3CB4A 2R7UA 1K0VA 2D9PA 2E7WA 1GX5A 4NA2A 4DPTA 3MXHP 3SSSA 2CQCA 5MAOA 1HPZA 3EE3A 3V6HA 3OUYB 2GJIA 2R7QA 4UUWA 1CS4B 4PYDA 3PW2A 4DG1A 3U7JA 1RYSA 2GFFA 4OZ5A 2OD6A 1PC4A 5J1EA 1HWUA 5B7WA 2JJ4D 5LM7E 2OEMA 1KVKA 2J9EA 1J5OB 3OVBA 3I96A 2WB4A 3L7OA 1UZHA 4XPEA 2YQ0A 1SIWB 4O4RA 3HVRA 1X7VA 4ANEA 5AE2A 1WJ9A 3FSXA 4CLSA 3PYDA 4LF9J 3EMTA 3V6JA 3QSIA 2X51A 1YVFA 2BA9A 1XJWB 1OIAA 2ZH3A 2MXYA 2W9CB 4LFAJ 4YP3A 4DR7J 5B0BA 2FHMA 3BEGB 1S1TA 2AZ3A 1S57A 3ZNJ1 3E51A 3FFIA 3AY0A 3MZIA 1KBRA 2PI4A 3NCRA 3T41A 2NCKL 3RB3A 2OJ3A 1K73T 4LR8A 4MKYA 3HHLD 3BQ1A 2PI5A 1JMTA 3DOLA 1TL3A 2B8PA 1QAJA 3MEEA 1JWWA 1QSLA 4BBYA 3MPVA 2IM2A 4RUBA 3N28A 5GADI 1H3DA 1RBOB 1R7IA 3QQCD 1FJ7A 3Q8PB 4GVLA 1S1WA 2UUBJ 5F3TA 2V4RA 4QW9A 1X5PA 4DFKA 4KV8A 2VQFF 2XI3A 2WVEA 3P49B 5D0RA 1PJ6A 1KNZA 1FRLA 3C16A 2ZFHA 1OPZA 2ZOMA 2VOOA 2O67A 3AJ2A 3IBWA 4HDHA 3I31A 2WW4A 3HVAA 8RUCA 4RUHA 2DCLA 3BGRA 2XM3A 3CF5Q 1ZM3A 2FTRA 2J0XA 3PEJA 1HBOB 3Q23A 1AT1B 3LO3A 2AP6A 2E1MC 2N7YA 4KYZA 3DRPA 2W9AA 5DM6Q 3RTVA 4K7QA 3A8EA 3D3BJ 3EZ5A 2DNYA 1HNIA 1KTQA 4HH1A 1U2CA 1F3VA 3CPWR 1S1UA 1YRXA 2DNGA 3GJRB 1PGZA 2CZ9A 3IM9A 4R8UA 4QWEA 3CCSS 2H54B 1TUWA 4ZDNA 2AJFE 3FEXB 3X3UA 4JI3F 3TZXA 1H74A 2V2KA 2CJKA 3LUYA 5DG7A 2PFFB 4RW7B 1HI0P 2DXEA 1WKKA 2FHOB 4WFYA 4YB5A 2ZZMA 1RKIA 1UFWA 3EYZA 4C48A 2UXCJ 3ISND 1GXLA 2D3O1 3C66A 2CQ4A 3D9BA 3R8YA 2XC9A 2FHJD 1LWFB 4NXNJ 1HBUB 1ZM2A 3E8OA 4CO4A 1NJWA 2XO6A 2QX0A 2QO3A 4AFFA 1B3TA 4OI4A 3KFWX 5AXLA 1ELOA 4OZNA 4U6PA 1U6FA 5C42B 1NCLA 2LYVA 3PW7A 2GQCA 2CFXA 2XCPA 4JV5J 2Z2YB 4IFYB 3ZZOA 1IXKA 4HR2A 1BQMA 3PV8A 3CDWA 2B9YA 2HFVA 3LH2S 1EHWA 1SQEA 1UETA 2OPSB 3FGVA 2CQ1A 2Y1IA 2EWHA 3IGVA 3NNAA 5C2GA 3W60A 1HBNB 3G82A 4B3MJ 3QRRA 3D3CJ 4QOTA 1XIQA 5KFZA 1QUVA 5KFUA 1NMEB 3R7SB 3JTOA 1N32F 1U02A 4G1QA 2ASYA 3OQ2A 1FERA 1D9DA 3C6UA 2GMLA 1XC9A 1ACMB 3CMAS 1VHFA 1KP6A 4DUZJ 2BZ2A 2PMWA 4UZCA 1RHKB 1B4SA 2SXLA 2CVEA 5CYMB 4DL4A 2VG7A 4UW2A 3G8QA 5KFSA 1YJNS 3H8YA 3AODA 4MYUA 4YS2A 2ZITA 2NQPA 1XMQJ 3WBZA 1W2BR 2FQQB 2Q3PA 3HSZA 1GQEA 2DXFA 1FDDA 1T9UA 2KXFA 1SXLA 2N82B 1KDNA 3C15B 1CJKA 2GHPA 4X4SA 5LMNJ 5CZXA 5FD1A 3PNIA 1Q79A 3IR7B 4UUXA 5KFBA 2KT5A 1JLFB 1NB2A 3NGTA 5D0HA 2QMUB 3ZO7A 2LEAA 3MDFA 1X9WA 2UU9F 2RDIA 2RT3A 1LW0A 1WSVA 3OHAA 2BANB 1Q0NA 2HNZA 2M3DA 2GX8A 4JI2F 1HLWA 4JI7F 3ENQA 3UN5A 2FVCA 2BE2A 1T11A 5LSRA 1T03A 1Q8BA 2KVQE 2HZCA 4KKOB 1SUQA 6FD1A 4JYAJ 3PCOB 2W7OA 4KH1B 4NE9C 4Y2CA 2KH9A 3ITHA 3Q2TC 2MGZA 1A7GE 4M5KA 3DLGA 2K1RB 4FPRA 2JFDA 3K5PA 2DJWA 3RU0A 2YNFA 1RBLA 1T3OA 3CCJS 3UD3P 2ZHOA 2XULA 1E6VA 1KR4A 5KFRA 1TAQA 3R5GA 2ZKUA 5D77A 2R7WA 3M1VA 4OHVA 2QT7A 5AJ3J 3OR2A 2GJ2A 5K20B 3BGFA 3N9UC 2PC6A 5HQMA 1WG5A 2HRYA 2F9JA 1U1RA 5CD4A 5KG7A 2BABA 1X4AA 5D0GA 1UJ4A
chains in the Genus database with same CATH topology
4ITSA 4LUBA 3H20A 3PX0A 4A8YA 1YRUA 2XSJA 3J7Z5 2HVIA 4WF9Q 3K8VA 2KHDA 1VRUA 2DO0A 3OTBA 3MM9B 4MK9A 3G9CA 3V81B 2KFNA 1JKHA 3R27A 1BQNB 3J7A1 3EGZA 1S0MA 5J2MB 4RU9A 2PA8D 3QZ7A 2CQHA 1FKAF 1S9FA 2H5EA 5KFIA 4JI5F 4WTYA 4C9DA 1FXRA 4OHYA 3PJWA 3MR2A 1OQ6A 3LOUA 2C22A 4ZMMA 1FEHA 1RT2A 3KHRA 2NPIA 4X4OA 2CYYA 5IS2A 2IYIA 4ZVEA 3QIPB 2NPFA 5DDPC 4O3NA 3GB0A 1SKRA 2ZH2A 2FUG9 5HO4A 5F8JA 2CQ0A 1EETA 4B3RF 1N56A 1NK0A 2B43A 3I5AA 1FK9A 1IKVA 5HP1A 2LDYA 2CQ2A 4RW6B 2YTCA 5DDOC 3K7RA 1DTQB 3L95X 1CC8A 2IJFA 2WK4A 3NGKA 4FF4A 3SI8A 1F5AA 2EFPA 5MLCV 1WNEA 3T9NA 4G1PA 1C1BB 4IRDA 3MM8A 4DQQA 3HHLB 3OFGA 4UQGA 2FJBB 1WHVA 2C3OA 2WSEC 1NU4A 5EX0A 3OHBA 3DLEB 1X4FA 1ZAWA 2FD2A 2MHEA 3EUNA 3DNCA 1BGXT 1VRTB 4RZRA 3CXCR 3CJKB 4ZKAA 1FJGF 2KFZA 3MM5A 2J7UA 2RQMA 1JLQA 2QRRA 1VOMA 4OHZA 2ADBA 3M9NB 3PO5A 4OX6A 2J0WA 2LXIA 2VPWB 3ISZA 3DCAA 1TK5A 2ILZA 1LWFA 5ADZA 3HVTB 2VONA 4WZQA 1YI2S 2N4DA 1HNVA 1RT3B 2MZRA 4Y6IA 1M5HA 4QWAA 5DGAA 1HYSA 2VASA 2PE8A 4ICLA 4RNHA 1VQ7S 1TAUA 1DFDA 5GAHI 1P9QC 5KTQA 1LKZA 4PXEA 4AE5A 4NX9A 1VQYA 1KRPA 5KAKA 3HKWA 4ECVA 2KZZA 3MEDA 1CC7A 2YWFA 4M5DB 4CNZA 5E3QA 4DSIA 2CIMA 2HS3A 1N36F 2DB1A 4DL7A 1M1KT 1KSPA 4LFCF 2HNDA 2JDJA 1H7XA 3M30B 3R3TA 4ZHRB 2GO9A 2UXBF 1W25A 3OR1A 2JEJA 4DLGA 5D78A 1N5VA 5AXMA 3BN7A 1C2PA 2WOMA 4H4KC 2IHR1 4KGMA 3EGNA 5C5JA 4DR3F 4QR2A 2QSWA 4IFYA 5LXYA 1Q1KA 5KT4A 1N6QB 5IFMA 5F41A 3G4SS 3PZPA 4XK8C 3KOAA 1UMJA 1S97A 4N47A 4CT9A 3K5OA 5KG5A 2ZC3A 3HHLC 3I0RB 3VZIA 4Q8FA 3N5BA 5L9NA 1XNQF 1J2VA 3NBPA 3H2VE 2IJNA 4BC9A 7FDRA 3M2UA 3W2WA 4O0IA 1HFEL 4YOEA 4HHJA 3QIDA 1YTYA 2HFOA 4ZK7M 4H4MA 4IR9A 3KG0A 5T41A 2ASJA 4QIGA 2CJQA 2ZHAA 4DQIA 4Q45A 3MFHA 1HBNA 2AGQA 2BQUA 1LWCA 2RQKA 4UOCA 4WZMA 5I3QA 3UCUP 4HT5A 1MWZA 4X4UA 3VWSA 2E5JA 3JAMY 3TUJC 4C8YA 3HLUA 3CT9A 1S6PA 2KFYA 4OJ1A 3DOMA 2N7CA 3TAQA 5DQGA 3CCWA 5KFVA 4P7TA 4DHVA 1KFSA 2VG6A 3PFOA 4NA3A 1JLGA 4ZPBA 3ZZPA 3SMZA 3I56S 4X4RA 3NMRA 3LP1B 2Z4PA 1HQUA 3AA9A 2IVYA 3MCSA 3MGJA 5EHHA 1LV5A 1R0AA 4WJBA 1G2EA 2WONA 3T9ZA 4OLPA 4OFZA 2POKA 4WFAQ 4CIOA 3KLFA 3G8TA 1RT6B 4C8NA 4PRFA 3NG8A 3KLEA 5B0AA 2KDOA 3E01A 1UVJA 2BR0A 4DDFA 2XWYA 2I2YA 3DOKA 4WYLA 2KJVA 3B4DA 4JI8F 2B0GA 2CPDA 3NAIA 4ECYA 4DWIA 3BN4A 1ZM4A 4OJHA 3RB6A 2CPJA 1B0VA 2NSBA 3KK2A 4Q0BA 5E2QA 2RILA 2CPEA 4B02A 2DGOA 3H4DA 2EVZA 5BYRA 4U67Q 4K5SA 5G0RB 1WI6A 1VLYA 3W2VA 3K57A 4LSNB 3HXMA 4QWBA 3C6TB 2IAJB 3KK3B 2GMHA 5EX3A 1YJRA 1QSSA 1V6HA 4GMKA 2EI5A 2HYIB 2WHOA 4IYQA 4IH7A 3LP0A 3MUMP 3I55S 2OPQA 4JI6F 3F73A 4F4KA 4B08A 3TVZA 2ZKTA 3BDEA 3BZQA 4F4YA 3SXLA 4PXCA 2GQQA 3BGLA 3NP5A 3TAMA 2UUWA 1I1GA 3NKYA 4M63A 3IAS9 4MIBA 3MTJA 1R27B 4ZP7A 4F3MA 2CG4A 2O5DA 4RNFA 3MECA 3R5AA 2HHTA 3OTOF 5HMZA 2XCAA 5KT7A 2C3YA 1RISA 3ZZTA 3MUVP 2VQEF 1Z4UA 1XTZA 4TLRA 2RQCA 3NAHA 1C0UA 2JWNA 2RE1A 3VAMA 2AYBA 2HAIA 4X62F 3D5MA 2BV3A 2VBXA 3NL0A 4R0JA 2BANA 1LOUA 3PKMA 1J5EF 2IC3B 4ED0A 4CTAA 5C24B 3POTB 4V19J 4IFVA 2U2FA 2O1PA 2ZD1A 4WIIA 5A8KB 5EDWA 4IO1A 1VS3A 4K4SA 2I0XA 2HS0A 3M8PB 4NCGA 3MMAB 5CYQA 1QSYA 3KG1A 2J9DA 2R7OA 2JC0A 1TV6B 1IBLF 1HW9A 2MSTA 1K8AT 4PXDA 5J2PB 1MWYA 3MWBA 2ZBCA 4ILRA 1VQ5S 4PG6A 1FRMA 3HMJG 1RWUA 4Y2IA 3RZAA 1SKWA 3ISNC 2XHWA 3TA0A 1QVFR 3AA8A 1KQKA 2DR8A 1ZZNA 1JJHA 2YKNA 2ZJPQ 1IKXB 5LSOA 5IZHA 4KKOA 5K8NA 1S10A 1LWEB 2Q66A 3QJPA 2MQPA 4DSLA 1QE1A 1TL1B 2E5GA 3UW1A 5KFQA 3KHGA 4OI2A 2JLFA 2KHCA 2NLWA 5DETA 2DNKA 3LGNA 4IDKA 3GG0A 1XK8A 4ECSA 3T5JA 1HPZB 2EK6A 3DU6A 5C25B 3TW0A 3OJUA 2OTJS 2PT0A 2ERRA 4RWWA 1TFYA 3CWJA 3MOJB 3TO8A 3DGPA 2QLWA 2L08A 2V4JA 4ES3A 2D3ZA 3AAWB 1ROFA 3QGGA 2YVSA 3OLAA 4K4UA 3GYNA 4G6VB 1S0NA 3KLHB 4FXVA 2LQ5A 1UVIA 1ZBTA 4X4QA 2BQ3A 3RRKA 4IH5A 1DBDA 2ACYA 2DR7A 4TYBA 3T1YF 1T05B 2E9ZA 5HMYA 2Y0SD 3P6YC 3UCZP 1S48A 5LL6d 5J1EB 2RKIB 4WU3A 2OFHX 4ETXA 3G6VA 2JEIA 2FVPA 3IR5B 2MY7A 3PW4A 2I5JA 1QLNA 5K9FA 4NLSA 4MFBA 2E5HA 1S77D 4WFBQ 3I5CA 4RKUC 2I8EA 2F7VA 1MROA 3LGMA 2HHXA 4Q7AA 4OZ1A 3T6JA 3G8SA 2JH3A 3GIJA 1IJFB 1R89A 4KHRA 2Z2LA 3CCQS 4JUZA 2QZ8A 3CJ5A 2WTFA 2NS1B 3LP2A 1Q8LA 1HR0F 2DPIA 2AV5A 4PG5A 4YDXA 4QIVA 1FDNA 3CD6S 1HWJA 3AQOA 4ID5A 1REVA 4U7CA 2BJDA 1FT8A 7FD1A 4RUCA 3I4PA 3H4BA 1L5UA 3KLIA 4LFAF 5BYSA 4F2SA 2WW8A 2QLXA 4KC5A 5L9XA 4DR7F 2R8IA 1DQ8A 4QR1A 2IA0A 2HPUA 4HVZA 2KM8B 4O23A 4TXSA 1VQOS 4LIRA 4IRCA 2HVHA 4M1KA 3DRRA 1XERA 2FC8A 1NZAA 2FVSA 3DMJB 2CQGA 2V8HA 3NLCA 3CJ4A 3DLKA 4CO2A 3TAPA 2AU0A 3U1NA 4ID8A 4I67A 5DJBA 1GTHA 1U1OA 3BSNA 2QA4G 3SEOA 5F8IA 1QY7A 2P9EA 2FIUA 4BWMA 3RAXA 2CPIA 4M8LA 4V19X 2QEXS 4JBCA 1VC0A 4ZVGA 2RS2A 3K5NA 2F1FA 3GV7B 3NCPA 4ECUA 3RYLA 3V81A 2JHEA 2X1GA 5CCLA 2DH7A 2QSFA 1G7CB 3SCIE 4B9SA 2QA1A