4OX7A

Structure of synechococcus elongatus pcc 7942 ccmk2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
PIAVGMIETLGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVSAGLDSAKRVAGGEVLSHHIIARPHENLEYVLPIRYTEAVEQFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide-concentrating mechanism protein CcmK
publication title Engineering Bacterial Microcompartment Shells: Chimeric Shell Proteins and Chimeric Carboxysome Shells.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Structural protein
total genus 25
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ox7A00
4LIWA 3MPYA 2A18A 3CIMA 3N79A 4AXJA 3NGKA 4OX6A 5L38A 3SSQA 4QIFA 4OLOA 4P2SA 3I6PA 3CGIA 4QIGA 3NWGA 2A10A 3MPWA 4QIEA 3H8YA 3SSRA 4OLPA 3BN4A 4RBUA 2G13A 3DN9A 4OX8A 2A1BA 3SSSA 3I96A 4P7TA 3DNCA 4PPDA 4P7VA 4DDFA 3PACA 4QIVA 4OX7A 3VCDA 4AXIA 3IA0A 4RBVA 5DJBA 2EWHA 4RBTA
chains in the Genus database with same CATH superfamily
3N6MA 4X64F 4JI1J 3I0RA 1JLAA 4USTA 4NMLA 4H4MA 4HLBA 2CDQA 2DIVA 2HGNA 3P45B 3D6TB 4DV5F 1AROP 4HKQA 3N0VA 5HMWA 1AB8A 1DRZA 1UPPA 4DBQA 3FVYA 4ECWA 1MMLA 5F8JA 2BE9B 4CP5A 2RU3A 2C2RA 2GQQA 4OHVA 2AYEA 4XO0A 1H72C 2MB0B 1S4FA 4PQUA 1G1XA 1IBLJ 1WOOA 3PW0A 2YNFB 4Z37A 1YVFA 4PWWA 1NDLA 1SL0A 4YB5A 4K4XA 2E66A 2FPHX 2HVHA 1WC3A 4WZQA 3R97A 4GRSA 4IYQA 1N56A 3T6BA 2W7AA 2FZGB 4OJGA 4RUAA 5CZVA 4CDIA 3MOJB 1SXLA 4WF9Q 1SJ3P 2APOA 4F02A 2M52A 4OX9F 1YBAA 2A10A 4LRFA 1WELA 2BEFA 4TQRA 2LU2A 1NHKL 4TNOA 3EUNA 1S97A 5AXLA 3I9ZA 3VWSA 1ZBTA 1X7VA 4M5DA 3NS5A 4BC9A 3I4PA 1RADB 2ADBA 1RB0A 1HBOA 5F8HA 2DNMA 2WVFA 4HDHA 1LWCB 1YQHA 3M6VA 4LF6J 4N8NA 1NSPA 3IA0A 3M2VA 1W25A 1RT6B 3RR8A 2FLNA 5HANA 2JNJA 3S6EA 1RK8A 2DEIA 2ZBRA 3SQGA 4QPXA 2AQ4A 4RU2A 1C0TA 3QWUA 2F9JA 4K8RA 2GHPA 3RBZA 3DRRA 2GJFA 4O3OA 1TKXA 3SCJE 2JC1A 1UW9A 3SFGA 4JI5F 3MEDB 3HT3A 3CIMA 4IQMA 4DN0A 1W2IA 3OW2R 3FRYA 2OH2A 3ETMA 2DXEA 2R4FA 1R8PA 4ZVPB 1YJ7A 2HSEB 1WKKA 4PUOB 2ZH3A 1TKZA 3MR3A 5KG7A 1KQSR 1K47A 1U47A 1GQEA 3C15A 4LR9A 1AZSA 4IFVB 1RTJA 4YR3A 3MUTP 2YKAA 3PDNA 4PABA 5L38A 4L73A 1TL3B 5AE1A 1FK9A 4F0KA 1FJGJ 2GQCA 2QE5A 3BGUA 2ZBCA 3LWLA 5ETQA 1D0EA 1MN9A 1JLEA 4XDCA 2L08A 4X62F 1JLCA 2BE2A 2LXFA 4NE9C 3THPA 2BYCA 3AOCA 2IAJA 4NA3A 5CCLA 3HDSA 5GMDA 2KVIA 4OMFG 4LFBF 3QZ7A 4M5KA 2UUTA 4C8KA 1S76D 1F9EB 1Q8KA 3DOLA 2OTLS 2KXNB 1VRQC 4JYAJ 4ZITA 1HNWF 3IM8A 3AJDA 3AT1B 3CO0P 4KV8A 5L39A 1U1MA 2WBRA 2KT3A 2C2KB 1OY6A 2XMUA 5CYMB 1WTFA 5LSLA 4I1TA 2J9CA 1XR7A 3CD0A 3TANA 1V9OA 3D1HA 3KK1B 2COLA 1W26A 3DLGB 1V3RA 4G1IA 1GNKA 4FVMA 5T7LA 4HH1A 1YK9A 3DGPB 4KH1B 3UNGC 1WD6A 1AYEA 3OR1B 3GWCA 1RTZA 2AT1B 1SIZA 3NWRA 1X4FA 4DLEA 3LUYA 2ZBPA 2K8GA 4BBYA 3W5XA 4HT5A 5A2QY 3LOUA 4CI0B 2IVFB 4HI1A 1CJTB 2IM0A 1VQ8S 4K4VA 1SV5B 4O4GB 4ZP8A 1KRPA 4RX6A 3A4TA 4CCHA 4QWBA 2UXDF 4ICLB 3NRBA 5DRKA 3P8BB 1RTDB 4KIAA 3BREA 4IR9A 1NM2A 3G82A 4I6AA 1HWJA 2MQOA 4J9NA 1NPPA 1CULB 4K50A 3UDCA 1X4CA 4CO3A 1KR4A 2HLUA 4LSLB 5KFGA 3G8QA 1FRXA 2ASLA 3M05A 4KHMA 2VL1A 2ZUGA 3CD5A 4B3MF 4Y28C 3IWNC 5KFNA 1BQNA 2YWWA 3CEDA 3DOKA 2RU9A 3NCQA 2H48B 4F0HA 2GAHC 4RU9A 4QR1A 3GV7B 4YR2A 1XK8A 1JLGA 1N52B 2MSSA 3FUYA 2R2TA 4PWDA 3D2WA 1NNDA 4FYXB 4A8XA 3Q8PB 3T1HF 3A8IA 4LIRA 4ZN1A 4UOHA 1ZPVA 1NZAA 4YB6A 2WVEA 2ZC3A 2VFVA 4C3MA 4LSNA 2DCLA 1AT1B 4X66F 1EP4B 3PZPA 3W2WB 4TU8A 2DRAA 1R0CB 3VGSA 3V81B 2EEYA 2V8DA 5FDLA 2C2MB 3DRSB 4DR3F 1C4AA 1SH2A 1B7YB 4IOCQ 3NAHA 4BLGA 2V8PA 2LA6A 3HVAA 2V4RA 2FGCA 2MKCA 2I8EA 5DQHA 2KKHA 1S79A 3QQCD 4G1PA 4RW8A 2MGZA 4ES1A 3W9JA 2IRXA 3D0GE 4EEYA 2CPHA 3CPWR 1NB7A 3R7NB 2FJVA 1HARA 2VKZG 1RXOB 3K58A 1RJJA 3E51A 3BO4A 5J2MA 4G65A 2BUNA 5EUHA 2GHWA 1SJQA 1FJEB 4C9DA 5B0EA 5IC6B 3TZWA 1Q95G 2G9OA 1TK0A 1VQOS 1O51A 3WZ0A 3L09A 5E3QA 4DCPB 1JKHB 3ULHA 1U0HB 3SYZA 1JNRB 5K14A 1J5OB 3O1LA 4WTOB 4Y2KA 4PKDB 3H4BA 2JC0A 3UR0A 1N48A 5DLGA 4NYZA 4OI4A 2ZFHA 1MWZA 3QSIA 1LK7A 4ZHRB 3RR7A 4USJC 3KHRA 2C28A 4DPUA 2DHAA 4DUYJ 4KFBB 1HBNA 3IS9A 4LF8J 3I6PA 1T0TV 1XNQJ 3PRDA 4L6V3 2UZAA 3T5JA 2KHDA 5HJXA 1VRTA 5C24B 1O8BA 3R9LA 1UP1A 4MFBB 5EWEA 4QCLA 4ID5A 1MW7A 2OUGA 4KKOB 3OBIA 1XBWA 3KLVA 5DS7A 3IR6B 1RWKB 1EETA 1URRA 3RBDA 4UOGA 4F26A 3CJTA 3FBCA 3KWMA 3CJ2A 3HHKA 3W3SA 2YPYA 3K5LA 2OPPB 3UDVA 4ED1A 4WFAQ 3EPIA 2F4VJ 3H5SA 3HD1A 2FY8A 4B3RJ 4ES3A 2H4WB 1R43A 2JHEA 2QYGA 3C3LA 3SDEA 1KONA 3SCLE 2FVPA 3CC4S 4NLXA 3DOMB 4USIA 4DR1F 4LFAJ 5HSPA 4R25A 2DNZA 2LQ5A 1UJ4A 2OPRA 2D7SA 1JX4A 3J81j 1WC1A 4NLYA 2UUAF 3MPUB 2KYZA 3KJQB 1CLFA 2KB2A 1EKRA 3MTKA 3AY0A 4B3OB 2DNGA 1KDNA 3MURP 2IVYA 3GMGA 1VI7A 4U8VA 2Y1RI 4I2PA 3CDAA 4ZOSA 2DT9A 3ZC4A 4DS4A 3EX7B 3HI9A 1RT7A 4FYVB 4NASA 2I9SA 2YX1A 1HPZB 2FD2A 3KHGA 3N5BA 4J9QA 2VV5A 3N79A 3CCRS 1GMVA 4AQYJ 1HQEA 2LP4A 2BBEA 3JSRA 2HVDA 2D9OA 3G96A 5A8KB 2Z2MA 3LP2B 2BR0A 1S12A 3DRPA 1HMVA 1N5QA 3ZZPA 3KJFB 2CQ4A 4OJ1A 1FDBA 4IH6A 2JEGA 2CNKB 2RT3A 4J9SA 3D54A 3HJVA 2MLYA 2NYIA 1FKPB 3QGIA 1JLBA 1RHQB 1BE4A 4OYPA 2CWKA 5A6WA 4DOZA 4WKYA 4JBCA 1NHUA 1XQIA 4IFYB 3HHEA 1DJ0A 3VF0B 4RW9A 5GADI 3R7SB 2QEXS 2WTFA 3DNCA 2CQDA 3SXLA 1T03B 3EVOA 2O1PA 4P52A 1XMOJ 2CPEA 3KLGA 3VZIA 4DFPA 2CDRB 2KFNA 5IV3A 4NI2B 4K5SA 4IDKB 3PG9A 5CYJA 3RJMB 5KFSA 1PJ7A 2VU5A 3MFHA 4XTTA 4C11B 2Y3YA 2F9DA 3QYYA 5K20B 4JP8A 5HP1B 2DGWA 1J5EJ 4Y0FA 2E5GA 4JOUA 3O3LA 4BS2A 1DARA 3LP0A 2MJNA 5GVQA 1HNVB 5IOLA 2YNIB 4I2QB 2CWXA 4WBFA 5EDWA 3TARA 5J2PA 4ZDNA 1UFKA 5DO2A 2PA3A 5HLFB 4DQPA 2ZWOA 1K0VA 4M94A 3A8EA 3VALA 4CNYA 1Z2ZA 4KHPJ 2IA0A 1N0VC 4ZVOB 2NLWA 4LBHA 4OX7A 1N34F 4ZCKA 3I0RB 1UA0A 3DLLQ 1PAEX 1JXEA 2EBGA 4LF5F 2OELA 2ERRA 2QT7A 2ZJRQ 3AAWB 3HD2A 4FXWA 1X4HA 1Y10A 5JVGQ 3Q8UA 2NXEA 2PSZA 1ZTWA 4DV3F 1S1UB 4LF7F 2VA2A 2ZITA 2EFVA 1NXIA 1QD1A 4I68A 3TA1A 4NXMJ 5D3GA 4JI7J 2GJIA 2QFIA 2UXBJ 1FT8A 4C8MA 2BMBA 1EQMA 4CLPA 3I5CA 4C3KA 4WFYA 2V69A 2GAGC 4DV2F 2P9EA 2ATLA 4PQUB 2GO8A 1X8DA 2HWTA 2KJVA 2PT0A 3GIJA 2LYVA 4P2FA 1U25A 2X1GA 1C0UB 1X9WA 4UW2A 3U1LA 4A8WA 1REVB 2N4CA 1G6BA 2M5YA 3PHEA 2W9BA 2MJUA 4RUBA 4ANCA 2CQ1A 3J7ZT 4ZPVR 5LJ3Y 3OV7A 1VDHA 4N7TA 2DNHA 3OFGA 3AB4B 3VAJA 4IOAQ 4PPZA 4HR2A 3P3DA 4WP9A 3O8WA 1S1WA 1DQ9A 4J7CA 4N5SA 3TEGA 4FNIA 1D8ZA 3GIRA 1N36F 2GVZA 4M5DB 1UFWA 2KI2A 2R42A 2ASDA 2EKNA 4AL7A 1IXKA 5F8NA 3HVWA 4X65J 4FBTA 2DTJA 4ECZA 1QE1A 3M1VB 4IG0A 1S77D 3NCPA 1S48A 2E5LJ 3CCVS 1U1LA 2V2VA 3O44A 3T19A 3G87A 4MIAA 4JV0A 2YY3A 5KAKA 3A8KA 3SQGB 3CMQA 3DM2A 3D5MA 5IS2A 1RWXB 3DYAA 1NSKL 4OQJA 3D6HB 2ZUAA 3RRHA 4O3QA 2ROEA 3NNHA 3TEHB 3BSCA 3DLJA 2VBXA 3M9MB 2E29A 3Q8VA 2JLFA 2VJUA 1SBRA 1PJ5A 3PCOB 3RAXA 2LDIA 3QIPB 3QWPA 2DH8A 4I7FA 4QYZJ 5HAOA 2X3DA 3W8GA 2R9LA 3UR3C 2ZHBA 4OI0A 1FTRA 3K0JA 1TKZB 3BDPA 1M90T 3P96A 2O01C 4NA1A 2RILA 5KT7A 2QL7B 1MMNA 2XYPB 5K9FA 2DNYA 2HK2A 2MKJA 1F9FA 1O6XA 2XNRA 2ZVIA 4PZVA 1AZSB 5KFVA 5KFJA 3T5LA 2V2KA 2Y8YA 3CJKB 4JI0F 1RAAB 1REGX 1VIOA 3U7JA 1DTQA 3W8PA 5GAHI 2J9EA 2KN4A 3R27A 1PIEA 2ZH2A 3LPYA 4C8YA 1APSA 2AGOA 4ZVTB 2BQUA 3LGMA 1UVJA 3OR2B 5CQGA 2HIQA 3MM9B 3AODA 2MHEA 2H4YB 2QV6A 4W4MA 1S6QB 2OPSA 2FGOA 4RUHA 3PW4A 2NXJA 2HYIB 1JB0C 2A3JA 1RBAA 5JJBA 5ETKA 4PG6A 4ID8A 3BQ1A 1RU2A 2KVQE 2IYIA 2QRRA 3UCGA 4DX7A 2HRYA 2XI2A 3A1YG 3SEOA 3RB0A 1NBEB 2QFJA 3FKBA 4KV8B 3NOGA 4HHUA 4FYYB 4B9SA 4USKA 1CEZA 3VCDA 4RR5A 1CPZA 3W62A 2CNLB 4RW7A 3NEKA 5HQ8A 3OFHA 1OWXA 3BN4A 2AJQA 4QIVA 4WE1B 2M8DB 3G6YA 3C6TA 2ZZMA 4NLQA 3L9ZA 1S59A 3L7UA 1VQLS 3SSRA 4Y34A 4F67A 3GCXP 4Z2XA 3FNNA 1DQAA 3D3CJ 4FF2A 2E5HA 2XSFA 3TI0A 1QTMA 4AXJA 2AYBA 3VGTA 2CQHA 1FKOA 4AD6A 3P5TL 1WACA 3W1YC 1AW0A 1GFWB 4QU6A 5JVHQ 2OMLA 2BVZA 1I94F 1VJWA 3TX8A 5AE3A 2FIUA 3LPEA 3MEGB 2D3O1 3Q8SB 4DR4F 4V19J 4OL8A 1WKLA 3G82B 3ISZA 4JI4F 2YXLA 5LSRA 4JI1F 3NGTA 1S49A 3PACA 4OYWA 4DR7F 1KOHA 1NSAA 4MYTA 2R8HA 4J9MA 4OLOA 2LKZA 4DU8A 2AZ1A 1TFYA 5KG1A 1EAYC 1RWPB 5HQLA 3DGVA 3JSMA 3I96A 1QAJA 4CLKA 5KFXA 4RBVA 3BSAA 2JRSA 3PYEA 4OIXA 1VQYA 3BYPA 3J7AN 4Z7CA 1NJIT 1FE0A 2HRTA 1RACB 2KL8A 3BBFA 2P9CA 2MSTA 1IBLF 3KNAA 3PKYA 2GIQA 4ILRA 4PWDB 1KLMA 2R7WA 4Y3CA 2D74B 3SI8A 1S9FA 3I56S 1C1CA 2EC0A 2J9DE 4YOEA 5E3PA 4D3HA 1T9XA 1HD0A 4NYOA 3PW7A 1HBUA 3ZZRA 3HF5A 2UUBF 2L48A 3DDKA 2R7QA 5DGAA 4DPOA 3OVSA 1FRJA 5KFRA 4QYRA 4JI2J 4LRAA 2RH3A 1WC6A 2HQDA 5B0AA 5EX0A 1WHWA 2AYGA 3J7Z5 4CO1A 3KK3B 2AV5A 4Y2AA 2I0XA 4C4WA 3MHYA 4RNHA 4DL2A 3ET6B 3UVJA 3BGRA 4NPOA 2MDAA 4GKKJ 4OYOA 2N3OA 4RW8B 2MPUA 3ZO7A 1U26A 4F04B 4LF6F 2VG7B 2WVDA 4CLWA 1ZH5A 4CLUA 2BOAA 5F9NA 3CIZA 4PG7A 2OIHA 2DJWA 4LJMA 1IQZA 1Y7PA 3CNQP 3UWTA 2MXYA 3O6QA 4IH7A 5D4OA 5I3UA 2MQPA 3KLFB 3V6HA 4LBPA 1V5IB 5K14B 3HO1A 2RVJA 4USWA 3FZ2A 3GCWP 1T9WA 2X1BA 2A18A 4NLTA 5F8MA 5EX3A 1SKRA 3HSZA 2D69A 3IXQA 1WEZA 1IBMF 5D8HB 5A8WA 4DUTA 1XR6A 1K73T 5HBMA 1EX8A 4O3PA 2B6AA 1WHVA 3EGWB 1S1XB 1SQGA 3QJLA 4USMA 2M70A 3R6LB 1KOOA 4OZ5A 4MKBA 2ZBIA 1HBNB 4F4XA 3IS9B 3V6KA 4DCOB 2RDIA 4A8OA 3TJAA 2QJ3A 3QGHA 1I6JA 1UWAA 2RF2B 1TL5A 2VODA 1TZ0A 3BQ0A 2QLBB 2CJYB 2AF6A 2B8QA 4LRDA 1QUVA 4ID5B 4PXDA 1UZDA 1EETB 1TAUA 2C22A 4TY8A 4Q2MA 2RDJA 3BBCA 3OJSA 4CWBA 4A8MP 2DCUB 4X84A 3VGUA 3GFHA 1LW0A 1RE1B 1U8SA 3Q8QB 1YZ7A 1FJGF 1IKXB 3QAUA 4LVNP 3HULA 4IOBA 3R5AA 3FCVA 3H5UA 1D1UA 2DITA 4OZ0A 1TL1A 4P2XA 4Y65A 3OHBA 1HNZJ 3SDEB 1S72S 1N6QB 3SSQA 5KFYA 2HFUA 4X2BA 2FZKB 3WDOA 1VQNS 2NZCA 1B4SA 4KPCA 2C3YA 3LW5C 4DPTA 2WW4A 1S7HA 1NH8A 1UJ6A 3TA2A 4PXCA 2YKNB 2GMJA 4DX8H 1QAYA 2WONB 1P6TA 3NGKA 3Q23A 4JYAF 3ZZTA 1XIQA 2C2DA 3LWMA 4RBUA 2OMOA 4EK2A 4B9VA 4TLQA 3TVKA 2Y1LB 2JWNA 1RLDA 2IBKA 5KFEA 5E3AA 3W5ZA 3UW1A 4HEA9 2JFKA 2BJ7A 4J91A 4O3SA 3M2UB 2EC2A 1RT7B 1AXQA 2V94A 5C5JA 2GCFA 1X4EA 3EM1A 4ZVGA 4PAAA 1PC4A 1FNOA 4JV1A 4RLEA 4O0NA 3CD7A 2RB7A 4MKYA 2CXEA 2OPQB 3IC1A 3NAIA 4OI6A 4ZJLA 2UXCJ 4PQAA 3MCOA 3DRPB 4LFCJ 4IUFA 2FHJD 2DR9A 4A8FA 1Q8BA 3EDQB 2NR0A 1OY9A 1PG5B 2WB4A 2A0FB 2Z57B 1UL3A 5L9XA 5GADU 3AJ2A 1JLBB 1MNEA 3TZYA 3TVZA 2VD3A 4M5IA 5HVGA 4DR6J 3PY8A 3FK4A 3M7VA 3CT9A 1LWCA 2HNDB 1A6LA 5I3PA 1FRLA 1QVFR 1CC7A 4DWIA 4F4AA 2IM3A 3KLGB 5CABA 3CO9A 3QPIA 2EFGA 2PDAA 2DHSA 4ECYA 3POTB 3ITHB 3QT6A 1KNZA 1D09B 3AOBA 3K7RA 2WSCC 5KG3A 4E8UA 4ZCIA 4JI6J 2NSCA 2AKWB 2PI5A 3Q89A 2DKOB 3MEDA 1NU4A 3AFGA 4ZJQA 4P7VA 4R0JA 7FD1A 4NCAA 2W1BA 2GW8A 4Y2IA 1NK5A 2GFFA 2RQCA 2XO6A 4RW6A 3GJRB 1WORA 4OI2A 1GXTA 3LANA 3M6WA 4PUOA 1XEZA 5M2PA 1TMMA 2UUWA 4YDDB 2BDPA 5JXSA 4F2RA 2F8EX 4O44A 1WNEA 4LF9J 1JJCB 2EWHA 1X4DA 4RBTA 2MTLA 2HPUA 1TL3A 3MM5A 2HLTA 2BV3A 3K57A 2LEPA 1YLXA 2VBYA 4F7VA 4WK1A 1U24A 4MIWA 3T9NA 2O66A 2KDOA 1M5OC 4NRTA 4ED0A 3CJ5A 1T11A 1X4GA 4UY8T 1RWMB 2CRLA 1Y3KA 3NCRA 5K8OA 2HNYB 2W2PP 3TQ1A 4CLYA 1AA1B 1LFWA 1UMJA 3H5YA 2HBQB 4NXNJ 2V50A 2DHHA 3RRKA 3MEKA 3QT8A 4PEOA 3GIKA 3PX4A 5L46A 1SIWB 3RW6A 2VICA 2IMOA 2FJEB 5DZ6A 2M88A 3M8PB 4Q44A 3H4DA 3LP1A 2AP6A 5B0GA 1NH7A 4NX9A 1X4BA 2JDJA 2ACYA 2KRBA 2GA7A 4OFZA 4RO0A 5T41A 3KK1A 5HROB 4UQGA 1FWPA 3OXLA 4OX6A 3C6UB 1TTHB 3BGOP 4DUYF 2FC8A 1RISA 4WCEQ 3DGPA 3MM6A 4LF8F 1XNQF 4J9OA 2QMXA 2GVZB 2VOPA 1TAQA 2J6TA 3CCLS 3MTJA 1KTVA 3KFWX 2AGPA 1I51B 3KK2B 3TJ9A 2NCKL 4DFKA 1JWWA 1ULRA 2MQQA 1EIYB 2G2YA 3PNIA 3CDBA 2CPYA 4IG0B 3ILIA 3PTWA 1UPMB 2EK6A 3UCZP 5MAOA 4NYPA 4ZS6A 5H9FJ 4O4GA 2R8JA 2BKPA 5D0GA 1JLFB 1HW9A 3DM2B 1IKYB 1H74A 4ICLA 3KJNB 2F4VF 2J5AA 3DYAB 1JQGA 4OHXA 1TP7A 2Q3PA 2GC8A 1RWVB 4X4NA 4F25A 4G1QA 1FO1A 3W63A 3HHLD 1R27B 1XNRJ 5GAGU 1CJKB 4LFAF 2Y0BB 1TL4A 5KG6A 2HHXA 2G0IA 1I1GA 3CC2S 5E3RA 2XSJA 3GG1A 2OSRA 3IBCB 5D4NA 3LF0A 1HFEL 1KC8T 4NLRA 2EFOA 3FC9A 4DSEA 3CWJA 2Z0GA 3IBWA 4R5PB 1RQ0A 4KB7A 4IRKA 1E6VB 4FS1A 2HS0A 3U02A 3EPGA 1OYDA 2IJNA 2ZD1A 4MJKA 2QG9B 3PJ9A 3L7OA 2MY7A 5DLFA 1HWKA 4LF2A 1H2TZ 2QA2A 3OLBA 1ZAXA 4OYBA 2K3KA 2DH9A 4A8YA 4AQYF 3W2WA 2D3OR 2V6AA 3V81A 4ZP6A 4C3LA 5IQ6A 4WP8A 4LF4J 4L3NA 1RT5A 2XLJA 2LEBA 3QNWB 1CQNA 3DRSA 3BQ2A 3OFEA 1KVJA 2OPSB 3GE9A 1P8GA 2FC9A 4DSLA 4TXSA 2M4MA 2GHVC 1XMBA 2B56A 3ENQA 3KUGA 1K8AT 2W2MP 1PYTA 1NK7A 2ZWPA 4Q2LA 1X9MA 2CQGA 4OZJA 3D67A 3PX6A 4MIBA 2FHKA 1S6PA 2W2QP 1KHVA 2HNZB 4ENOA 2XMAA 2C2NA 4ED2A 4J9UE 3BH6B 1RCXB 1HLWA 1WDTA 5LT5A 1PAUB 4DR5F 1JKHA 2ALYB 2F8MA 5IXUA 1J5OA 2OAUA 2R7UA 2DNOA 4ZPWR 1XMQJ 4TU7A 3ELHA 2MZTA 4NEYA 4ECTA 1KSPA 3JS9A 4MH8A 2FVSA 3C6TB 2BJDA 1FJCA 1GX5A 1RT3A 4DV5J 1FFGB 3A3OB 1NB2A 4GVLA 1UKUA 2KM8C 3AQOA 3H2VE 3S01A 4ZHRA 1Q1KA 4KFBA 1NUEA 5D78A 1P1LA 4N41A 1VQ6S 3EICA 1UCNA 5C24A 5KFTA 2W8LA 4HDGA 3KG0A 2IJRA 3IM9A 4MFBA 1JNZB 1LFPA 4KKOA 3OT9A 3MCSA 4WYWA 5F8IA 4KHPF 5H9EJ 3KOAA 3R5GA 1V6HA 1LKZA 5KFCA 5EHHA 4OZ1A 1J27A 1Y5NB 2RQKA 3HZGA 3US5A 2OPPA 1FNMA 5KFIA 3GU0A 2VBWA 4MTPA 4WK3A 2ROGA 1VQ4S 5G0RA 2B9YA 2Z56B 1YITS 3KDOA 1R6YA 4NA2A 1GXUA 2LXIA 1C4CA 3JSMB 4NXMF 4WWSA 3BJYA 3ZTRA 3DOMA 3MD3A 1NJWA 3T9ZA 1NK0A 2H5IB 3CCZA 4ELTA 4DL7A 3M9OB 2DGQA 5E2QA 3ICLA 3NGSA 2W7PA 3W64A 4DEZA 1U1PA 4UY85 2NXCA 5KT4A 3JQKA 2C2ZB 1KLMB 2MLXA 3IFEA 4A47A 2XZDB 5DM6Q 5L1JA 1ZS6A 4B3OA 1KVKA 3MI7X 4DV4J 4BWMA 4ED7A 1NJZA 4H4KC 3UN5A 3BKTA 7FDRA 1HW8A 3R5JB 1WKJA 1HBUB 4C97A 1WEYA 4C98A 3IWXA 4N56A 3KTQA 5J2QB 4X4OA 5H1SV 3VAIA 1U7LA 1U1OA 3BO3A 2UVVA 1S9EB 1VBYA 2EVZA 4QPTA 1KQFB 1HPZA 2ZBQA 4RL1A 3G6VA 4QU7A 3BBBA 3ZZOA 3WIVA 1I3OB 1SPBP 1YBUA 4JI5J 1FI4A 5A8KA 1YTYA 1Y5IB 3LP2A 4HH0A 2B9EA 3UVJB 2B51A 2HFNA 2ILYA 1YJTA 1S6UA 3CMAS 1RTIB 3BGRB 4DMZA 3AXMA 2Z2YB 2J0WA 4X65F 4ZVHA 2RHQB 4C0BA 1ZM2A 3W61A 3GIMA 4NLDA 4DV1J 2E5LF 4HTIA 3PO5A 3EGZA 3MMBA 3ILJA 4J5OA 2JFDA 4B9TA 2XCPA 1G3OA 4WFXA 5F41A 2MMYA 3TUPA 5ETOA 2UVRA 1DFDA 1KQKA 1OSDA 2DR5A 3RRGA 4ELVA 2LQ8A 1T03A 1K9MT 2MKHA 5LXYA 2KU7A 4NZ7A 2ZH9A 2UU9F 3W66A 2CNNB 6FD1A 3IAS9 5B0DA 3GSDA 4Y6IA 3H2UB 1VBXA 3MFIA 4IDKA 4C7QA 4DU7A 3TZXA 1URNA 4UZBA 4L75A 2YKMA 3FBBA 2JX2A 1LQ9A 3H25A 3M30A 2VQEJ 2XI3A 2BANA 2AYMA 3IWLA 5BYQA 1X31C 4B02A 1U2RA 2F3JA 5HP1A 1WSVA 1VRUB 4OHYA 1RT4B 2K06A 1P1TA 2XULA 1SH3A 4TN2A 2V8VA 1N54B 1BWEA 4NLOA 5I42A 4CLZA 3FSXA 4LR8A 1HQUA 3CJ3A 1HNWJ 2KRRA 4I2QA 4MKVA 2ZM6J 4TY8B 3AB2B 1NDKA 5HLFA 3C46A 1JXLA 1LW0B 3C19A 3KG1A 1FESA 1V5VA 3Q24A 1UVIA 2JEFA 3HSGA 4LBIA 3WX8A 4FPIA 4USUA 3HVRA 2QA4G 1YZ6A 2G1HA 1RAGB 3TJ8A 1Z2LA 3RW7A 1NHVA 1Q8LA 2KXFA 5A8RA 3MAAB 4FF4A 3BM7A 2IJFA 1H3DA 3E01A 4OYAA 4BCAA 3NP5A 1BLUA 2K3IA 1S1UA 1RLCL 1H6KX 1PILA 2CG8A 3L95X 2XG8A 5J2NA 2ZH8A 2OD4A 2R2UA 3DXBA 4QR0A 2B3TB 2CZ4A 3IP0A 1CSJA 1Y9OA 2VPWB 4GKJJ 2ASJA 3ZFVA 2XBPA 3QLHB 2ZE2B 2VFUA 2UXDJ 2RRBA 1EQ0A 3U1NA 4PG4A 1C0UA 2K1RB 2HG4A 3RYLA 2DR7A 2RDDA 1N5VA 3T6JA 2FDNA 2GGPB 1REVA 2OEMA 3ENAA 4AL5A 1MSWD 2AZ3A 3ISND 4F2SA 4TYBA 3QAEA 5DDPC 2BRKA 3PYFA 2MHNA 1YHQS 3BKUA 1SKSA 5IWAJ 1RAHB 3MR6A 2DHGA 2M2BA 1RGVA 3N01A 2HGMA 3FGVA 2JSXA 4O3NA 3CULA 4HI2A 2JZ5A 4KC5A 2WOMB 1TKTA 3EE3A 4CYUB 2FY1A 3WC0A 1LOUA 1RKJA 1U48A 3R5DA 3FDSA 4EMDA 2QLXA 4DFJA 4URSA 1F6TA 4F3MA 1C1BA 3M1VA 7AT1B 2RKIA 1FFSB 4WIIA 2HBYB 4ANEA 1RBOB 4BWJA 3C14A 1R0BG 5E7OB 2DNQA 4CO4A 5ETTA 4GO7X 1KWMA 1Y4ZB 2G2OA 2EKYA 5IM0A 3R8YA 4XDDA 3NGRA 2E1CA 1DTTA 1LK5A 5IC4B 1G7CB 4XAKA 3L4BC 4M1KA 5BYSA 4DR3J 4KHRA 4KRWA 1S1VA 4YHHF 4EBCA 2A1BA 2B4VA 2NQPA 5IT0A 3W65A 4UUXA 4AXIA 4G3IA 1U1QA 2KFYA 4K2XA 1KHWA 2CQBA 3PJXA 3FCWA 3QIPA 3R3TA 4PYAA 4RW6B 1T8EA 3TAMA 4ES2A 3MF5A 2UVWA 4JV2A 1T94A 3KUEA 1HYSA 2J0QD 2FLOA 3PEJA 2XNQA 4NLSA 4M5MA 2YNGB 2AX1A 4DV7F 4O44B 3GJQB 5CD4A 4XPEA 1F5BA 3E8OA 4X4UA 2IRYA 2FYXA 2B7CB 1YWXA 5KFUA 4JI2F 4B17A 3CJKA 2OLWA 4EBDA 2JVRA 1HD1A 3MM5B 4KR0B 1F5CA 4Z7YA 2X1AA 3DLBA 1KVIA 1IM6A 1JIHA 3VHQA 3G2XA 1A0OB 1QAIA 3FEXB 3PR5B 2J7WA 3OR2A 5ETLA 3QFHA 1MWYA 3MM9A 5J1NA 2VZ9A 1S6QA 2DVIA 4X4VA 2DNNA 4DHVA 1RYRA 4X4SA 4EFAC 5ETMA 3PR4A 5GAEI 2C3MA 3KMSA 3KDNA 2I2YA 2IM2A 1NK4A 1QTNB 2PO4A 1HWIA 3FQKA 4TY9A 2C42A 3NXZA 2HK3A 4CZCA 1MWQA 5DQGA 5CAAA 1PC5A 4I67A 4QW9A 3LP1B 2G0CA 5KG4A 3T5HA 3A3NB 2W8KA 4OX8A 4PPDA 3TVYA 5DG8A 2XLIA 3BSOA 2UV8A 2AX0A 3V4IA 2MKIA 3QATA 1WG4A 1K0TA 4OHZA 3AXKA 3NGUA 2L9NA 3ZTSA 3AD8C 2ZH1A 4C0HA 2DGXA 3SQOP 5H9FK 3V6JA 4YFUA 4FS2A 4WE1A 3MM6B 2SXLA 2PIIA 4DR1J 1OQ3A 2KXHA 2GMLA 4EI2A 5CHCB 4ZIWA 2FHOB 2QMWA 1PSDA 2QA1A 1R8CA 1W2BR 4KGMA 3LTOA 2LVWA 1T9TA 3IMQJ 2J7UA 5HATA 4IG3B 4N47A 4DPWA 3KJVB 2QLJB 4PRFA 5C42B 4RNNA 1NKBA 4DL4A 3S8SA 2BX6A 3JTNA 2P9GA 4CTAB 1ZM3A 1SL2A 3Q8RB 4NWBA 3MEGA 1DHMA 1GTEA 2BW7A 5HVFA 2CG4A 2HFZA 4CH1A 4G1QB 2ASYA 1HNZF 3NL0A 2QTWA 2J6UA 4Q7AA 4OYXA 1RWWB 1U49A 5F8LA 1M5VC 3SFUA 4AFFA 3IRXA 2WVBA 1HHTP 2XSJB 3BS9A 3MDFA 2I6WA 3B6BA 1B70B 2WCXA 1YGYA 4FXDA 3TA0A 3TRGA 2DO0A 3KLEB 4WYLA 2G1DA 2XGQA 2RD5C 1LNQA 3SCKE 4B08A 1BWVA 2IDLA 2BJ3A 1AFIA 1FD8A 2FVCA 5D6GA 3CCSS 3QRPA 3F0NA 5SUHA 2ZD1B 2DNKA 4ZN3A 3HHLC 2CIMA 3AJ1A 2YBVA 2ROPA 1ZA1B 1X0PA 1IJEB 3B4DA 4L76A 1U6BA 4JI8F 4ETXA 3TUJC 3MM7B 3W60A 1ROFA 2FHJA 2VDHA 1HNXJ 4IO1A 2ZKUA 2UXCF 5ETVA 1RT5B 3ZZUA 3KUHA 3T5KA 3QRRA 2BKOA 1HR0J 2LU1A 4MKAA 3KK3A 4ED8A 2J0XA 3QIDA 2W4PA 5J1EB 3QJJA 1SJ4P 3TO8A 5DQIA 3DRYA 4L74A 3ET6A 1FERA 1NPRA 5FJ4A 3D6FB 3V2UC 4U7UD 4DR6F 3F44A 2DGVA 2LMIA 3F41A 1M5KC 3CCES 1Q7YT 2VG7A 1CJVA 1JJ4A 3LAMA 1MU2A 3FSIA 5DZ7A 4FZVA 1MROB 1HNIA 4ECUA 1S6PB 2ZH4A 2HIYA 4YUDA 1BQXA 4M5HA 4OHWA 3KLFA 1N34J 2XHWA 3I31A 1R0AB 8ATCB 4JI6F 3IAM9 3MPYA 3I5AA 2BQ3A 2MZQA 4CO5A 1KTQA 1R8AA 1RT3B 5H9EK 2EFNA 5LMUF 4KGZB 2NSBA 3KXDA 1GT8A 1S1XA 1JLQB 2PC6A 4LF7J 4OZ3A 3MEEB 4DXLA 2E9RX 4CH0S 3I9V9 1VQSA 1UEVA 2HS3A 4QIEA 3R2CJ 1T02A 5KFPA 1PBAA 2R8KA 1H7WA 5DDRC 3NKYA 2RF2A 3JQJA 3MOZA 3HSJA 1Z1ZA 3HT0A 4MAKA 1N5SA 3OL7A 2I38A 4FF3A 3UNYA 3BEGB 1YRTA 2HZVA 1OSCA 1RTHB 4DDFA 4W90B 1WJ9A 2H5EA 4KGVB 2HW3A 1IKXA 5GMEA 4QJVA 3X1LB 4ED3A 2RQMA 4FBUA 2JOQA 3D66A 1YJNS 2OJ3A 3GSIA 5G0RB 5LM7E 4WU3A 2BRLA 1UVMA 1S10A 1N6QA 4LIWA 3FBEA 1L3VA 2H65B 5K5MA 4IO9Q 3OL8A 5L1LA 5DDOC 1ZM4A 2YWHA 2XY7A 2YKNA 4NXNF 2WONA 3I32A 4PWUA 4DV0J 3T1YJ 3OJUA 2QC3A 3GV5B 3ZXWA 2KHCA 1HKAA 3O2IA 3K5NA 1SC1B 2FJAB 5KFFA 4WIQA 4JV5J 4QWAA 3CDUA 2R7SA 4NEZA 4ZPTR 2Z2ZA 3G6ES 2E1RA 4AL6A 3TX0A 1YJWS 3MAQA 4WU2A 1S99A 3M2UA 2RNEA 1XWLA 2UP1A 4HL9A 1WG1A 2WSEC 4ZVQB 1BMQB 2OGUA 1RABB 2GJ2A 1TUVA 3MM8B 4Y2CA 2VIHA 2CPJA 2HMIB 3VTIA 2CZ9A 2OPQA 1U02A 3M8QA 2H9ZA 1VR6A 1MLAA 5AJ3F 5L8RC 3T1AA 5LMNF 3JAMU 1M1KT 2HEKA 4UZCA 1IQTA 3QO9B 3BF4A 2AJ0A 3BPSP 2LDYA 3EYZA 4F4ZA 3MMBB 3MMCA 3HK2A 2JJ4D 3OXFA 1PGZA 2FZCB 4ZVSB 2ZHAA 5L1IA 3EXCX 1VHFA 2HNDA 2IC3B 1X60A 3TYTA 5IFMA 2AWZA 1M1HA 2DGSA 2NZ4A 1F9HA 2HAIA 2HHWA 5HJYA 4I6WA 3JYTA 4JI0J 4M95A 3C2PA 1XNRF 5AE2A 3HKZD 2VOOA 2VC0A 3MCNA 1RHKB 1VC0A 2IFXA 2OEKA 3DHWC 4DSJA 1JMTA 2Z2LA 3MPVA 4YP3A 1NK9A 3CDEA 3POTA 4ZLJA 4PG5A 3ITHA 3HFZB 1EARA 2YKMB 3LGHA 1RA7A 3M30B 2BANB 2ZNZA 3J7YU 4Q0BB 3DLEB 3DU5A 2GMHA 3VQTA 4FF1A 2P2CB 3ZNJ1 1M0SA 2E7WA 5CCMA 2B4UA 5KFAA 1G2EA 2DXDA 1YJUA 4RZRA 2ILZA 2VH7A 4S0MA 1KFDA 3D0IE 1KP6A 2AEMA 5I42B 4ZKAA 4A48A 1HQUB 3DKDA 3HPOA 2NXNA 3R5CA 4GC6A 1PCAA 1FX2A 3W7BA 4QBUA 2I5JA 3N6NA 4QZVB 4WJBA 1ZETA 3CF5Q 5BXIA 3VAHA 1T05B 3MPWA 1FF2A 1TFWA 2W2NP 3J7A1 4LF4F 3KYLA 1VLYA 1NDCA 3VGVA 4B9NA 5A8RB 3G6XA 2YX7A 4UF4A 1BXNA 1H7XA 2HQFA 2KM8B 3THVA 3E01B 1KKHA 4DUZJ 2BZ2A 4EZ9A 1E6YA 2Q1LA 1WEXA 2Q79A 3M8RA 1IWGA 1XERA 2CPIA 1RKIA 2B9WA 2A6OA 2HNYA 4RW4A 1VQPS 5J2NB 1F1BB 2OO4A 2DD8S 2DB1A 2ZEJA 4WFZA 1M5SA 2R7XA 1WC4A 2AJFE 4KGKA 2CJKA 4ZIVA 3FRZA 4P75A 2R8GA 1U1KA 2XEXA 4DR4J 1U4BA 1VYAA 3M8PA 4B3TF 4JI4J 1FTCA 3H5XA 1XMQF 1RT2B 4DR7J 2DYAA 1GAOA 3CCWA 3PW2A 2KT2A 2AJ1A 1FRHA 2UV8G 5KOWA 5HROA 3EGNA 3DLKA 3BH7B 1N8RT 3GV8B 3NOCA 2DEJA 4C8ZA 3D1QA 1RT1A 3C6UA 4LREA 4QIGA 2V4JB 5M2RA 4O4RA 2W24A 1CJUB 4H4OB 2QYCA 3KLHB 2GX8A 1TKTB 5D0HA 2AEJA 1FVQA 4E2FB 3LO3A 5DG7A 3KK2A 5D77A 4UTGA 3AOAA 3VV2B 2L41A 1B64A 1X5SA 2IY5B 2ZH6A 4GMKA 1C1BB 4DR2F 3ISNC 2RKIB 3C14B 3NGDA 2V8GA 4DPXA 2R3VA 4YDXA 5B7WA 1BUXA 2Y0SD 2WVCA 4D3GA 1JLFA 2C2OB 5IM0B 1IKYA 3K59A 2LFVA 2YKQA 2UUBJ 5HVHA 3H90A 2E1PA 3QT5A 1DTTB 1SC3B 4XK8C 2HQCA 1RP5A 3OSPA 3CCJS 3QT7A 4DS5A 1S1VB 1CJKA 2CQ3A 2YWEA 3JB9k 4EBEA 4GVBB 3QFWA 3Q86A 2GIFA 5THWA 1S7IA 4CO0A 3Q2TC 3QSYB 2GNKA 4E98A 5GAGI 2ADCA 5FIIA 3H40A 3K5OA 2R2RA 3TAMB 5HMYA 3OL6A 1I5OB 2X51A 3NS6A 1NZ8A 3PFEA 2DIUA 1HYSB 2CA9A 2AU0A 5KFZA 4DV4F 3FJ2A 3ZTOA 1LWEA 3FMWA 4JI3J 4C8NA 2V4QA 4R5PA 2J0SD 3DU6A 1E6VA 4AYBD 2KZZA 3T3FA 1Q5VA 2B8PA 2AJ4A 4B3SJ 2P6SA 5D0EA 3HSDA 4DG1B 4NCBA 3D0HE 4WXOA 1IBMJ 4ZLPA 5CZXA 5KG0A 2WAQD 4K5RA 4AE5A 2HVIA 5GAEU 3EVWA 1VQ5S 2KTQA 5HQMA 5ITHA 1Q86T 1F5AA 1FVSA 3WQPA 2R7RA 1SKWA 2HHSA 3Q2SC 4K0KJ 2ZH5A 3AD7C 2QSFA 2BOPA 4DV1F 3G8TA 3I5BA 3GP9A 1FNXH 4W92B 2KJWA 3HVTB 1QSLA 4RUCA 2G13A 3BYRA 2HVZA 4DL0C 1WI8A 1NLKL 3TOQA 3KMQA 3FFIA 2CQIA 2V9WA 2YWKA 4MK9A 2DISA 2XYGB 3HXMA 2HNZA 4EZ6A 3OTCA 6FDRA 3V4IB 2H54B 5GMKa 4FKYA 1WHXA 2LEAA 1VQ7S 4ITSA 1FXDA 2D9PA 4A46A 4OJHA 1YX2A 3KLIB 1R89A 3C16B 2VQEF 2UUCJ 4CM2A 2Y1IA 3IBFB 3GR1A 2MZJA 2HHPA 2ATCB 3HZEA 2R7OA 1DZ5A 3GLJA 1RHRB 2LLZA 4YY3J 4OZNA 3N5FA 4LQ9A 3NS7B 3W2VB 2FJWA 1VJQA 1NEEA 2PFDA 4I4BA 3F73A 4LR7A 4YQWA 2ZM6F 5B0FA 3P49B 3IGVA 5IT9U 3BPDA 4KYZA 1ZZFA 5JUMA 2B5JB 3N9UC 1DLOA 2HZCA 5C25B 1Q5YA 1IN0A 1FHTA 1P9QC 4I6YA 4J37A 3BSNA 2RIJA 1FKAF 3D9BA 2XQCA 1R31A 2IYGA 1F3FA 4LT6A 4U7UK 4FNHA 5KFWA 3J80U 2P6TA 2E1AA 1RA6A 1BC6A 3WX4A 3OFFA 2IRUA 3DI6B 3IRXB 3H0PA 3PEHA 3D6MB 2CADA 3AA8A 3R1LA 1H38A 1YDLA 1M5PC 1LWXA 1TMJA 2V0NA 5KT5A 4ZVFA 5ETSA 3QBCA 1VFJA 2RHSB 4EWTA 3UQSA 1UEUA 1YRXA 1GX6A 3GFYA 1NAQA 4GKJF 4I69A 1Z4UA 1FRIA 2XY6A 3GFXA 2XYHB 2A6MA 1ELOA 2OD6A 1O5JA 3A3PB 4P2SA 2J6SA 4LRBA 3CSKA 1CQMA 1VIXA 4ZCLA 4RNFA 2WSFC 4DN9A 9ATCB 3RU0A 4OYIA 3ZTPA 3KNGA 2BXJA 3QGPA 4DQQA 4MK8A 5J2QA 3CUNA 1S9EA 4PXEA 5IWAF 2FUG9 4J9PA 1DBDA 2WZ1A 2RS8A 1L3SA 2RRAA 3MD1A 2NPFA 4C8OA 5KFHA 1L3TA 5HMZA 3J81Y 2U2FA 2ZH7A 2F5GA 1PYOB 1FEEA 5ETRA 5AXNA 1SL1A 1FWLA 1RTIA 4ZPAA 4QWDA 4OV1A 4E0DA 1EB0A 4USVA 3ENVA 2ZOFA 1CJVB 2AJ2A 2PGCA 4IKAA 2BM1A 1MU2B 3OLAA 1U2CA 3HHDA 2BA9A 1HNIB 4KGXB 3WHIA 5D4PA 4P72A 2KFZA 2ABYA 3V6DB 1X9SA 2JEJA 3CCUS 1U09A 1KLNA 2VONA 1RCOB 2PFFB 2VG5A 1S0OA 4NCGB 1RAJA 2DR6A 2LQJA 2MLZA 5KFKA 1TV6A 4F4WA 3HJFA 3HFKA 4XPCA 1IBCB 3CTRA 4DX6A 3H7HB 1ZAVA 1IBKJ 4ZLNA 1M1GA 1M5HA 2RMLA 5FLXU 1VK8A 1VRUA 3R5BA 2B43A 3NBPB 1IUJA 1RT4A 2F40A 1ZA2B 2WRMA 2RRNA 4CLSA 1UAWA 4U67Q 1VBZA 3BV8A 5BR8J 2N82B 4R8UA 3KHLA 4ECXA 4PCQA 4EU0A 2R2SA 4F0MA 1UVLA 4HACA 5DM7Q 1SUQB 3UI3A 5AXKA 4U95A 1TL7B 3KG4A 2HGLA 2XMMA 2XC9A 4A8SA 4Y00A 4U6PA 1ICEB 4IQXA 2IA6A 2I1RA 4RNMA 3MAAA 1CBKA 3OTOJ 2W9CA 1RHUB 4YB7A 4WFBQ 1KFSA 4A4JA 3HX9A 5AT1B 4K4UA 2DRDA 1Q78A 2CYYA 2D1CA 1OIAA 1QUPA 3G86A 4UOFA 3TAQA 2PN6A 3BN7A 4ZPCA 1FX4A 1OO0B 1DURA 4JUZA 2J8SA 4OJ3A 4RWWA 2W25A 3ADAC 2PE8A 2Q6BA 2AD9A 3QLHA 2ZE2A 2K1RA 2ZZNA 5A0YB 2BJ1A 2GGPA 1VOMA 5E41A 3FBFA 3OHAA 3NLCA 5HI7A 3IGNA 3M8QB 3V5RA 1G4CA 1P27B 4ERDA 3T41A 2HWIA 2FLLA 1OQ6A 1HQ2A 3W9HA 3GIIA 2VB6A 4DL6A 2WOMA 4ED4A 4HTJA 4CYUA 1LW2A 3SV4A 2BJEA 3MMCB 3GR0A 2Z8QA 2M9KA 2QSWA 3MWBA 1WC5A 4DQSA 1SCJB 3HHLB 3K2YA 2UVUA 1SH0A 3AH6A 2HKEA 4NLWA 1S9GB 2G2ZA 4GO5X 2R7VA 1WF0A 3JYTB 4DV6J 3ONQA 3L7PA 1FXRA 3PX0A 4ETZA 5HN0A 2XS2A 1PKUA 2GVDB 3VVTA 2H5JB 4IRCA 2LXUA 2DK2A 3U1MA 3CVKA 2YNHB 4UT4A 2HQIA 2MQ8A 1T7PA 4KAIA 1YIJS 2VPXB 2KZMA 1ITPA 2J8AA 1Q82T 5F9LA 3BR9A 4P10A 3RZAA 2PMWA 2LECA 3D7SB 3QMQA 2RS2A 3RG6A 1NKCA 4X4RA 3I55S 1Y5LB 2BE7D 3UN2A 2XMKA 5A76A 4AUKA 2I5JB 3MR2A 1TUGB 4FYWB 2D3ZA 3ILLA 3CJ0A 5A6PA 1RBLA 1OMSA 3UD3P 3M32A 2YNGA 2HHUA 2MEWA 1HNXF 3NNAA 5BYRA 1WHYA 2B7BB 3EVMA 3X3UA 2HHTA 1YKWA 4WZMA 4KO0B 3NY0A 5KFOA 4DR5J 4CT8A 1TVRA 3EJMA 3BKFA 4KE5A 2OFGX 1HR0F 3KHHA 2CJBA 1IKWA 1KD1T 3OVBA 2QLWA 2YH1A 1YI2S 1YG0A 4FYDA 2KYXA 3RAQA 3ENWA 4LVOP 2ZJPQ 2MQMA 1E6YB 1N5YB 4EYHB 2J7KA 2NREA 2CQ2A 2HQ3A 1S4EA 4P2MA 4J9LA 1VISA 2W7OA 3ZNUA 4CLLA 4RW4B 4I0WA 3MPDA 2OP5A 3A13A 1FE4A 4ZJOA 2Z30B 3GB0A 2FJBB 2R7TA 1U6ZA 3W5YA 1RDRA 3IG1A 1UA1A 3LA0A 4ED6A 1WSRA 2LQ9A 4PYDA 2YQ1A 1YRUA 4A8QA 2F1FA 3RTVA 3DFEA 1JLAB 3CJRA 2CJQA 1S1TA 3CC7S 4A8KA 1VMBA 3DN9A 2CPDA 4ZVUB 4H4MB 3C66A 4NOHA 4LMZA 2V8HA 3DLKB 4RWXA 4CT9A 2QMUB 2CQCA 1RT1B 2K7JA 4ER8A 1HHSA 2JVOA 1XTZA 1NJYA 5C7PA 3AQPA 1X5PA 4MYUA 2GIRA 3MR7A 4BHQA 1QAXA 2H3EB 4QIFA 1CC8A 2CVIA 2XS7A 2AW0A 2EW9A 1UWBA 3PO4A 2QL5B 3R6GB 3TNVA 3SCIE 4CO2A 4J90A 4IG3A 1X4AA 3KJVA 5KFLA 4P6QA 3UDEA 5C42A 2G4BA 4C0OC 2HHHJ 1N88A 4CTAA 3I87A 1YBTA 2BJ9A 1CS4A 3GJTB 1N33J 1HBMA 3CCQS 1NK6A 1RWOB 3PXGa 4PG8A 1A9NB 4B3RF 2CPXA 4ZA1A 4F4KA 3PVXA 1TK5A 4HHHA 5CXTA 2XCAA 6AT1B 5CYQA 1JJHA 3PRBA 1X5TA 4O23A 3HM9A 4P73A 2HFSA 1HBOB 1WUUA 4DV0F 3T1YF 2C3OA 2F63A 1TUWA 1N32J 3M2VB 4JV5F 2VQFJ 1GMWD 2CUYA 2LQBA 3KLEA 1LWEB 1EHWA 1L5UA 2L9WA 4OV6A 2XMJA 2IHR1 1C0TB 1RWUA 1LXJA 3OTBA 1BQMA 3GONA 3GJSB 4EO8A 3DRRB 3JAMY 3NMAA 1HHQA 1TKXB 2UU9J 3MM7A 4WTYA 3RBEA 2B0GA 2HWHA 3Q8YA 2ZC4A 1B3TA 1QLNA 2GQ2A 3DHXA 4ZP9A 2CNOB 2E9ZA 3PJWA 2MKYA 3GQCA 4NLGA 2YVSA 3GYGA 1NMEB 1ZOTA 4ECQA 5J1EA 4B9UA 1T9VA 5KFMA 2DGUA 1Y3JA 4F4YA 2DGTA 4DFMA 1F2HA 1UFLA 4F3OA 4J9RA 3MMAA 4P9SA 1NO8A 3IO1A 2VFTA 5ADZA 3C15B 3MECA 2CJ9A 1RTJB 3S7RA 3OUYA 1RZMA 1IJFB 2V63A 4LUBA 3FFIB 4TLRA 1XMOF 1MROA 1IWAA 1X5OA 1FK9B 2PEHA 2ACMA 4QOTA 5CD4H 3DMJA 1OS5A 4R0EA 5D4LA 1JLEB 1T9YA 1JLCB 2BE2B 3M2RA 4DF8A 3PHTA 3OVAA 2ZOGA 2YX4A 1R0AA 4EO6A 3NMRA 4WXWA 2GS8A 2AIRB 4X64J 1QSYA 3PYGA 1K44A 2IAJB 2FVRA 3R2DJ 4K59A 4UUWA 3BGFA 1N5TA 3B4MA 1J5EF 2V5HG 1GMUA 5SZTA 1FDDA 3B78A 4ZVRB 2KT5A 4OZ2A 3PV8A 4MMOA 3DOLB 1JLQA 1QY7A 1QVGR 3HLUA 3MEEA 4URQU 2CPZA 1YJRA 1Y0HA 3PRVA 2P8IA 2JEIA 3K5MA 5G4DA 4NLPA 2YH0A 3BO2A 2EK1A 1DLOB 5IZHA 1WC0A 1BD6A 4K4TA 4V1Ak 2CFXA 1WOPA 3PKMA 3BZQA 3P5BP 4U96A 1JXVA 4F36A 2DHXA 5T7LB 1RTHA 4ATNA 4NL5A 3UPFA 2M3DA 1V3ZA 1HA1A 4G6VB 1H98A 5KT2A 2DPIA 4L72B 4U9RA 2G0JA 1TU0B 5KT6A 3K5PA 1HIYA 2DY9A 2K7KA 4DUZF 2JLGA 2WBMA 4B9MA 5DGBA 1SJFA 2O67A 3G4SS 4Q8EA 1S0MA 4OX9J 2IMWP 4DX5A 4JI7F 4KJIA 2UXBF 3P4UB 2HBZB 2VUGA 4QIWD 2IBOA 5F0WA 1FDAA 1B0TA 4K4YA 1FDNA 2POKA 3IRWP 2N7YA 3UO0A 4ZLLA 3DRXA 4N76A 3O5TB 4KY3A 3I0SA 1WDDA 5M2UA 4M8LA 5HMXA 1ZPWX 4DLGA 3DDNA 3NG8A 3D28A 1ACMB 3DC2A 2QL9B 2YWFA 2VHGA 4TQSA 1O0PA 1DQ8A 2K2PA 3RB4A 3MM8A 3MR5A 1OJ4A 1BQNB 2O3DA 4YHHJ 2OI2A 3DOKB 2HMIA 2F4FA 2ZNYA 1S5ZA 5IT4A 4Q5VA 2B9XA 1AUSL 5LOQA 1JLGB 3TZZA 4KBIA 4DPYA 1YJ9S 4IH5A 3CW2C 3QO9A 5KT3A 3Q83A 5K8NA 3LALA 3CD6S 3M4XA 2F8HA 1TK8A 1D9AA 2DNPA 1VQ9S 2PMZD 1KQGB 4ECVA 1UTAA 4AT1B 3IR7B 4LSNB 2C3PA 2X3GA 4K4WA 4DV7J 1RU1A 3HP6A 4ZVEA 3SZ2A 2HZAA 1K1QA 2IC3A 1LWFA 1OYEA 1FRMA 2Q6CA 5F0UA 1SQEA 5FDLB 5EWGA 1T3OA 2ZDPA 4DQIA 1SKUB 3RGIA 3WBZA 2DRBA 1VBKA 3EDRB 2AGQA 4L3KA 4OZLA 3TP2A 2DXFA 2V2QA 2YKPA 2VG5B 1VK3A 3NWGA 1NPKA 4X62J 2WK4A 1WF2A 3MZIA 5EGYA 5B0BA 3RUBL 2PEBA 2DY1A 1TV6B 3K8WA 4IR1A 3JXOA 2MGZB 1B7FA 5K8PA 1W7WA 3EWGA 4Q0BA 3DLEA 1RAEB 4WFNQ 2C2EA 4LFBJ 3M6UA 1NJXA 3VVUA 2QA4S 5MLCV 3MUMP 5J2MB 3CB4A 4JI3F 4PR6A 2N4DA 1LEOA 1NRKA 2D3UA 3J7YI 1UEKA 2ZKTA 2HFOA 1IKVA 4OLPA 2MQLA 4R8UB 4H54A 1TKDA 2RQ4A 5E33A 4B3SF 2QIFA 2IIHA 3QGGA 3UD5A 2IDEA 4HACB 1RSCA 1T05A 3TUZC 1UJ5A 2DNLA 1XC9A 3LGNA 5LXRA 4ED5A 3HKWA 2WHOA 3PYDA 4QW8A 1WG5A 3ILOA 2FLPA 4LF1A 4FP9A 4K0KF 3MAHA 4J9VA 5EWFA 5LSOA 4QWEA 2NXUA 1WF1A 5KFDA 2W9CB 3SBMA 1VRTB 2BM0A 2XY5A 4NMXA 2HRUA 2ZDOA 2M0GB 2QN6B 4ZPDA 1SJRA 2DO4A 2XMWA 4M5NA 1NDPA 1R8BA 4V19X 1PYSB 2ALZA 2CAJA 2EG2A 2ZHOA 2VPZB 2VFSA 1NSQA 2VA3A 3CJQA 1VS3A 3ETOA 4C6AA 3B82A 1J2VA 2VG6A 1L3UA 4X4PA 4CRJA 5A2QU 2XMVA 4C8LA 1U6FA 1GK8A 4K7QA 2UUCF 2LA4A 1RT2A 5KG5A 1RI7A 1SJ1A 1GH8A 1TELA 2GZOA 5IT9Y 1CVJA 2RUSA 4YY3F 4Q8FA 4TKTA 2OPRB 4YS2A 4RJVA 1SVDA 1HI1A 2MKKA 1OPIA 4YEAA 1QSSA 2PD1A 5L1KA 2V4JA 4B3MJ 3EZOA 1CJUA 3Q22A 5K8MA 4H4OA 4M5LA 2RSQA 4I64A 3KLHA 1WTBA 1LW2B 2H51B 2XGPA 4FPRA 1V3SA 1HI0P 4DSKA 2XM3A 5T14A 4I2PB 1IR2A 2X7IA 2FTRA 4F3QA 3J80Y 2YNFA 2FJDB 2VBZA 2E5JA 2CPFA 3T1HJ 4B9LA 1HWUA 1IR1A 1FXLA 4H4KA 3J81U 3MGJA 4JI8J 4J9KA 1BHNA 3KKFA 2HBRB 3Q0AA 4X66J 1R6VA 2XWYA 2J76E 1HQEB 1U8WA 3MCMA 3GILA 2MZRA 5ETNA 2N3LA 3JQMA 1HMVB 5L9NA 2XS5A 3GTYX 4O3RA 2ZJQQ 1BY9A 1SC6A 3U27A 1EJ7L 2RE1A 1YJVA 3PM9A 5I3QA 1U0SA 3C8YA 1Q4RA 4GVBA 2YKOA 2HHVA 4DL5A 2HQGA 1SI9A 1B0PA 4MT1A 4RW9B 2E1MC 1QDUB 2M8HA 1RT6A 1S6OA 1WWHA 2KG0A 2RJZA 3M32B 3D1OA 2W01A 2FHMA 2GO9A 5E3CA 4EUVA 2KG1A 1S57A 3M8WA 4FVCA 1TVRB 2HS4A 1U1NA 1D9FA 4M63A 3RB6A 4DG1A 3UCUP 1KBRA 1IKWB 2AHOB 2C3UA 2NS1B 2AEFA 4OI3A 2E9TA 2NPIA 1C2PA 4CM0A 4K4ZA 4WPAA 2NUUG 5LMUJ 2XB2D 4ZP7A 1OPZA 2VC1A 3BDEA 1UW4A 2DNRA 4GKKF 1L3KA 5CH7B 2U1AA 3LP0B 2V67A 3GG0A 5F3ZA 2PA8D 1WI6A 3M6XA 5I4MA 5KOXA 4MK7A 5J2PB 2LCWA 2W4DA 3FQLA 5FD1A 3H2LA 1VGYA 2CJXB 4QQBA 2QZ8A 4WP3A 3HVTA 2F7VA 3VR1A 1UZHA 1P9YA 3IG1B 4KT0C 2DH7A 1GTHA 3D3BJ 3EXYA 4IFVA 4DJBA 2C1EB 3R1HA 3H59A 2RAQA 2VF3A 1RHMB 4ZPBA 1S0NA 1FCAA 3I82A 2HVEA 3AHPA 3CJSA 1S1TB 1JJ2R 3HMJG 2IM1A 3FEYB 5E5NA 3OL9A 5FLXY 3VQSA 4LQ3A 3THTA 1U2FA 2CVEA 1HWLA 1GXLA 3M8SA 3KLIA 3C16A 2XHCA 4HVZA 3D68A 4ECSA 3ZZZA 3UD4P 2P5VA 5D3GB 4CIOA 2VKRA 5U47A 2L9DA 1OY8A 1IBKF 2CJAA 2AMCB 3OQ2A 1NCLA 4Q45A 2B4OA 2A2DA 4YMEA 2DPJA 5HO4A 2NYHA 5C2GA 2CZVC 2OSQA 3TW0A 3W2VA 1N4LA 1UWBB 1MMDA 1Q81T 2UUAJ 3DCAA 5BJRA 5BR8F 1VQMS 5LJ5Y 2CQPA 4OI1A 5DG9A 1HL6A 1R8HA 2OTJS 4F8RA 3GFZA 2B5JA 2W9BB 1VQKS 5CYMA 3RBXA 2GV1A 2VJVA 1CS4B 5C25A 4KSEB 5D0RA 1HBMB 1RAIB 2OFHX 2V68A 1NKEA 5ETPA 2YQ0A 1FFWB 3DLGA 3CXCR 5F8GA 4HT7A 3VAGA 3EGVA 3EMTA 3N28A 4PXBA 2E7VA 4QWCA 1S1WB 5CYQB 1RHJB 1ZAWA 5KFQA 1ZYQA 1ZM9A 3OR1A 3OTOF 2HFVA 4LRCA 3IR5B 1K1SA 2OKQA 1FRKA 4CQ1A 3CJ4A 3DI6A 5AJ3J 2IVMA 2MKSA 1LXNA 1QJHA 2MZ1A 2O5DA 5LMNJ 3CJ8A 2YQ3A 3GYNA 2HAFA 4UOCA 4FXVA 1QE1B 4P74A 3G8SA 3H98A 1B99A 1CJTA 2PMHA 4URGA 4KH0B 1SV5A 4BC7A 2Y8WA 4ZK7M 3PFOA 4QYZK 3DDIA 1RTDA 3JSBA 2EFPA 3HCXA 1HI8A 2MQNA 1R3NA 2BJ8A 4M5JA 3WIUA 2ZVSA 1BQMB 1MG7A 1SQFA 3OD2A 4N77A 1CULA 2JLEA 3E3XA 1EZZB 3F56A 1X0FA 2Z4PA 4C2MA 4TVAB 3N4WA 2WW8A 4LSLA 1MN7A 3M8YA 1H0HB 4C48A 4U7CA 4NLVA 2BQRA 4LFCF 1VC5A 4JB8B 3MXHP 4I7FB 2NUHA 1FEHA 3TAPA 1LV5A 4RNOA 3G71S 3P6YC 1KS2A 3OTDA 4CLTA 4LSZB 4U8YA 4DCJB 1N0UA 2MY8A 5HL7Q 2EFQA 3SSSA 3MMAB 1UETA 3OXGA 5GAHU 8AT1B 1FJ7A 5KFBA 1VC6A 3MECB 5AXMA 4I56A 1Y11A 3K89A 1D9DA 1D3WA 4RPFA 4NZ6A 3OUYB 3JSYA 4DV6F 4DZDA 1DTQB 5HK4A 2QX0A 3K17A 2BACA 1EP4A 1AFJA 3DMJB 5DJBA 4NRUA 4TYAA 3V6DA 2R8IA 5E0OA 2MZSA 2KH9A 2XMTA 1SB6A 4CNZA 2QGFB 1CG2A 3M2RB 3UE2A 2QO3A 2VDIA 3VAMA 3QZ8A 2Q66A 3ZTQA 4UQTA 1AUDA 4LF5J 1FA0A 2YWGA 2N7CA 3A12A 1RYSA 4W98A 5D15A 4NCGA 2H1YA 1T9UA 3JTOA 2EI5A 4DI6A 4ALZA 3DXSX 1WOSA 2RUGA 4DV3J 3L3CA 1Q53A 2VPYB 3BR8A 4EYIB 1YSJA 4ILLA 2D41A 2FB0A 3NBPA 2DBBA 4ILMA 4YR0A 5KTQA 4DV2J 3FSYA 4LF9F 1T3NA 3SIPB 1UVNA 1U0HA 3TR5A 4RW7B 2WB1D 1IR0A 1RUSA 4B3TJ 3VZHA 2XWXA 1QM9A 1IVZA 1SUQA 1RAOA 3B8HA 2FVQA 2CQ0A 4ZMMA 1TL7A 2Y9HA 1VCTA 2XTJP 3S1TA 1F60B 1ZZNA 1H2VZ 3K8VA 1VHIA 2EG1A 2EXUA 1PJ6A 4KPYA 3H20A 4OYZA 3MMJA 3H42A 2OEJA 5DDQC 4USHA 2MYFA 4GC7A 3ZZYA 2PI4A 2FQQB 5C2CA 1FKOB 1S0VA 1R7IA 1N36J 2VFRA 2J9DA 3FZBA 4QR2A 2Y1JA 4P71A 5LL6d 3OTEA 3PIPQ 3UDLA 2L3MA 3OPKA 2IPOB 2W4CA 3GPAA 1TQLA 3LQVA 2DGOA 1U45A 3QJPA 3W9IA 1DAXA 3I0SB 4DR2J 3SMZA 4RKUC 3G9CA 1Y00A 5KG2A 4Q43A 5IV4A 2ZZTA 1PBUA 3A8JA 3LH2S 3BGLA 5B0CA 1XN9A 5A0YA 2ZOMA 4ANDA 2HURA 2JH3A 2V2ZA 3VAFA 2EPIA 4FKXA 2YPZA 5F3TA 4KTQA 4ELUA 4YN3B 1VLOA 3M8ZA 1RWNB 3RB3A 4YB1P 3EZ5A 3MUVP 1BGXT 1B0VA 2BKNA 1Q0NA 3SV3A 1ZTTA 3CDWA 4XIUA 1C1CB 1H73A 3WC2A 3TWZA 1EKSA 2HHHF 2DR8A 3TQEA 3IN5A 4N8OA 4HYKA 4NZ0A 3GYXB 4FDFA 1N33F 3HHLA 3TUIC 2W9AA 4WKRA 1LWFB 3ZZ0A 1S9GA 2CKWA 1D8YA 2Z58B 2BW2A 3OSNA 4CH7A 2JL9A 1TR0A 3LAKA 3UFCX 3N6LA 4ZCMA 3QRQA 3HHNB 3FEZA 1Q8IA 2GVDA 1IM4A 3EZUA 8RUCA 5EN1A 2YTCA 3DLHA 4X4TA 4O0IA 1FD2A 1F2GA 1H2UX 3R7BB 2OHDA 2YNHA 5RUBA 5B09A 5B08A 4DF4A 1GMWA 4NLUA 1F0XA 2BABA 2W2OP 2XLKA 1DY3A 4K2JA 2FJXA 1XJWB 4DL3A 2EBEA 1N32F 1FKPA 1JK9B 4EGLA 2VQFF 2M7SA 3NNCA 2A2CA 3V4MA 3UN3A 3E2EA 2XO7A 1SC4B 4KQZA 3FCHA 3HFVA 3B54A 5CA5A 4IFYA 3CCMS 4DZ6A 1GEHA 3H8YA 5I3UB 1IKVB 4TU9A 1FWKA 2E44A 1XR5A 1PO6A 2Q43A 4BDPA 2E5IA 3FMBA 2VASA 1Q16B 2HHQA 2XZTB 2XZWA 4NI2A 4FN5A 1T95A 5A8WB 5HBMB 4P7TA 2B4PA 1Q79A 4KO0A 4Y2MA 1U1RA 4HHJA 2B6AB 3AD9C 2X1FA 1A7GE 5J1PA 3BB5A 4X4QA 4C11A 5JMNA 4IRDA 1F3VA 3PIOQ 3GZ7A 4K4SA 3D4JA 2F65A 3RAMA 1UVKA 2KO1A 9RUBA 1RAFB 2QLFB 3CMES 4F50A 1NK8A 1KN6A 1KEKA 1N5YA 4M5GA 3PW5A 3CCTA 3M9NB 3CGIA 1Q7LB 4DSIA 4DSFA 3I4HX 1HNVA 4CLFA 4OYMA 2YNIA 4ECRA 3CE8A 2E7XA 3AA9A 2V34A 5IQQA 3VAKA 2VG6B 5DETA 3JTPA 1I94J 4DQRA 1TL1B 2V9KA
chains in the Genus database with same CATH topology
4PG8A 1A9NB 2A18A 2CPXA 3N6MA 4NLTA 4ZA1A 5EX3A 5F8MA 4X64F 3I0RA 4IO1A 1SKRA 3IXQA 4F4KA 3PVXA 1JLAA 1WEZA 2ZKUA 1TK5A 1IBMF 5CXTA 2UXCF 2XCAA 5D8HB 5A8WA 1XR6A 1K73T 1RT5B 5CYQA 5HBMA 4NMLA 4H4MA 3ZZUA 1JJHA 4HLBA 3PRBA 4O3PA 1X5TA 3T5KA 2B6AA 2CDQA 1WHVA 4O23A 2DIVA 2HGNA 3EGWB 2LU1A 4DV5F 4MKAA 1S1XB 3KK3A 1AROP 3QJLA 4ED8A 4HKQA 2J0XA 3HM9A 2M70A 3QIDA 2W4PA 1KOOA 4OZ5A 5J1EB 4MKBA 3QJJA 1SJ4P 2ZBIA 3N0VA 1HBNB 5HMWA 3TO8A 5DQIA 4F4XA 1DRZA 1HBOB 3DRYA 3IS9B 3V6KA 1FERA 2RDIA 5FJ4A 4DV0F 4A8OA 3T1YF 3V2UC 3QGHA 1I6JA 2C3OA 4DBQA 4DR6F 3FVYA 4ECWA 1MMLA 2DGVA 2LMIA 3F44A 5F8JA 2RU3A 3F41A 2RF2B 2C2RA 2GQQA 1M5KC 1TL5A 3CCES 1TZ0A 4OHVA 3BQ0A 1Q7YT 2VODA 2AF6A 2VG7A 2AYEA 3M2VB 4XO0A 1JJ4A 4JV5F 1QUVA 2LQBA 4ID5B 3KLEA 3LAMA 4PXDA 1S4FA 2MB0B 4PQUA 1G1XA 1MU2A 1LWEB 3PW0A 1EETB 1TAUA 2C22A 1L5UA 2YNFB 4Z37A 3FSIA 4TY8A 1YVFA 4Q2MA 2L9WA 1SL0A 4FZVA 1MROB 2RDJA 1HNIA 4YB5A 3OJSA 4ECUA 4A8MP 2DCUB 1S6PB 4K4XA 2XMJA 4X84A 2IHR1 3GFHA 1C0TB 1LW0A 1U8SA 1RWUA 1LXJA 2E66A 2ZH4A 3OTBA 3Q8QB 4YUDA 1BQMA 1FJGF 2FPHX 2HVHA 4EO8A 1IKXB 1BQXA 3DRRB 3JAMY 3QAUA 3NMAA 4OHWA 4WZQA 3KLFA 4IYQA 4LVNP 1TKXB 1N56A 2XHWA 3R5AA 4IOBA 3T6BA 2W7AA 3H5UA 3I31A 1R0AB 4OJGA 3MM7A 4RUAA 5CZVA 1D1UA 2DITA 4WTYA 3RBEA 2B0GA 3MOJB 2HWHA 4OZ0A 1SXLA 1TL1A 4WF9Q 4JI6F 2ZC4A 1QLNA 2GQ2A 4Y65A 3OHBA 1SJ3P 2APOA 3DHXA 3IAM9 3MPYA 3SDEB 1S72S 3I5AA 2BQ3A 2MZQA 4ZP9A 4F02A 2M52A 4CO5A 3SSQA 1N6QB 2E9ZA 3PJWA 1KTQA 5KFYA 4OX9F 1YBAA 4X2BA 2A10A 1R8AA 1WELA 1RT3B 2EFNA 3WDOA 3GQCA 4NLGA 1VQNS 4TQRA 2LU2A 5LMUF 2YVSA 2NSBA 1GT8A 4TNOA 3EUNA 1S97A 1ZOTA 2C3YA 5AXLA 4ECQA 3LW5C 1S1XA 3I9ZA 3VWSA 1S7HA 1NH8A 1UJ6A 3TA2A 4PXCA 1JLQB 2GMJA 2YKNB 1ZBTA 1QAYA 1X7VA 2PC6A 4M5DA 4DX8H 5J1EA 3NS5A 4BC9A 4B9UA 3I4PA 3MEEB 5KFMA 2DGUA 2WONB 2ADBA 1Y3JA 4F4YA 1P6TA 2DGTA 1HBOA 2E9RX 3NGKA 3Q23A 5F8HA 4DFMA 4JYAF 3ZZTA 4CH0S 3I9V9 1UFLA 2DNMA 4F3OA 2C2DA 1VQSA 1UEVA 2HS3A 4J9RA 4QIEA 3LWMA 4HDHA 4RBUA 1LWCB 1T02A 3MMAA 1YQHA 2OMOA 5KFPA 1NO8A 3M6VA 2R8KA 3IO1A 1H7WA 2VFTA 4B9VA 4TLQA 3NKYA 4N8NA 2RF2A 5DDRC 3TVKA 5ADZA 2JWNA 3MOZA 3MECA 3IA0A 2CJ9A 2IBKA 5KFEA 3M2VA 1Z1ZA 1W25A 5E3AA 1RT6B 3RR8A 2FLNA 1RTJB 3UW1A 4B3RF 4HEA9 4MAKA 3S7RA 1N5SA 3OL7A 3S6EA 3OUYA 1RK8A 1IJFB 2JFKA 2I38A 3SQGA 4QPXA 4O3SA 4FF3A 3M2UB 4LUBA 3BEGB 3FFIB 4TLRA 1YRTA 1XMOF 1MROA 2AQ4A 1X5OA 4RU2A 1FK9B 1OSCA 1RT7B 2PEHA 1AXQA 2V94A 4QOTA 1RTHB 4DDFA 5C5JA 1C0TA 2GCFA 5CD4H 4W90B 3DMJA 1OS5A 2F9JA 3QWUA 1X4EA 2H5EA 2GHPA 4R0EA 5D4LA 1IKXA 4ZVGA 1JLEB 2HW3A 3DRRA 1PC4A 4QJVA 3X1LB 1FNOA 4ED3A 4JV1A 2RQMA 4FBUA 1JLCB 4O3OA 2JOQA 1TKXA 4RLEA 1YJNS 2BE2B 3M2RA 4DF8A 3CD7A 2ZOGA 3OVAA 2YX4A 3SCJE 2RB7A 4EO6A 1R0AA 2OJ3A 3NMRA 4MKYA 4WXWA 2JC1A 2OPQB 5G0RB 3IC1A 1QSYA 3NAIA 4OI6A 3SFGA 4JI5F 4WU3A 3MEDB 4PQAA 2IAJB 2FVRA 2BRLA 1UVMA 4K59A 3HT3A 4UUWA 1S10A 1N6QA 3BGFA 1N5TA 3B4MA 3CIMA 3DRPB 4IQMA 4LIWA 4DN0A 2FHJD 1L3VA 1W2IA 2DR9A 4IUFA 4A8FA 1Q8BA 5K5MA 1J5EF 2V5HG 3OW2R 4IO9Q 3FRYA 5SZTA 1FDDA 2OH2A 2NR0A 3B78A 3OL8A 5L1LA 5DDOC 1ZM4A 2R4FA 2KT5A 3PV8A 2WB4A 4MMOA 2YWHA 2XY7A 3DOLB 1UL3A 5L9XA 5GADU 1JLQA 1QY7A 2YKNA 3AJ2A 1QVGR 4NXNF 1R8PA 3HLUA 1JLBB 3MEEA 4URQU 1MNEA 2CPZA 4PUOB 2WONA 3I32A 4PWUA 2ZH3A 3TVZA 1YJRA 1TKZA 2VD3A 3OJUA 1Y0HA 3MR3A 3GV5B 5KG7A 3PY8A 2KHCA 3CT9A 2JEIA 1LWCA 2HNDB 1KQSR 3K5MA 3O2IA 5G4DA 3K5NA 1A6LA 2FJAB 5KFFA 1U47A 1GQEA 4QWAA 5I3PA 3CDUA 2R7SA 4NLPA 2YH0A 1FRLA 3BO2A 2EK1A 1DLOB 4IFVB 4ZPTR 5IZHA 1RTJA 1BD6A 3G6ES 4K4TA 2E1RA 2CFXA 4AL6A 1YJWS 4YR3A 1QVFR 1CC7A 3MUTP 4DWIA 2YKAA 3PDNA 3PKMA 2IM3A 3KLGB 5L38A 3MAQA 3BZQA 4WU2A 1S99A 3M2UA 2RNEA 3CO9A 1TL3B 3QPIA 2EFGA 5AE1A 1XWLA 2PDAA 2UP1A 2ZH8A 1FK9A 4HL9A 1WG1A 2DHXA 2DHSA 2WSEC 5T7LB 1RTHA 2GQCA 4ATNA 4NL5A 3UPFA 2M3DA 2QE5A 3BGUA 4ECYA 2ZBCA 3LWLA 2GJ2A 1V3ZA 3POTB 1HA1A 1D0EA 1JLEA 4G6VB 4XDCA 1H98A 1TUVA 3MM8B 4Y2CA 3ITHB 2L08A 5KT2A 4X62F 1KNZA 1JLCA 2DPIA 4L72B 2BE2A 4U9RA 2CPJA 2LXFA 3K7RA 5KT6A 3K5PA 2WSCC 2K7KA 5KG3A 4E8UA 2HMIB 3THPA 4ZCIA 3VTIA 2OPQA 2BYCA 3M8QA 2H9ZA 4DUZF 2NSCA 2JLGA 2WBMA 4B9MA 5DGBA 2PI5A 1SJFA 3MEDA 2IAJA 2O67A 1NU4A 3HDSA 4NA3A 4P7VA 5CCLA 5AJ3F 3G4SS 4R0JA 5L8RC 4Q8EA 1S0MA 7FD1A 2IMWP 2KVIA 4NCAA 4OMFG 4JI7F 3T1AA 5LMNF 4KJIA 4LFBF 3QZ7A 2GW8A 4Y2IA 2UXBF 1M1KT 1NK5A 2UUTA 2VUGA 4C8KA 2GFFA 1IQTA 3QO9B 1S76D 3BF4A 2RQCA 4QIWD 4RW6A 2AJ0A 4OI2A 2IBOA 1GXTA 3DOLA 5F0WA 1FDAA 2LDYA 1B0TA 2OTLS 3EYZA 4K4YA 3LANA 2KXNB 4F4ZA 3MMBB 3MMCA 1FDNA 3M6WA 2POKA 4PUOA 3HK2A 1XEZA 2JJ4D 3OXFA 3IRWP 5M2PA 1PGZA 1HNWF 2ZHAA 5L1IA 2N7YA 2UUWA 4YDDB 3DRXA 4N76A 3EXCX 3O5TB 1VHFA 2BDPA 5JXSA 2HNDA 4F2RA 2F8EX 3I0SA 4KV8A 5L39A 4O44A 1U1MA 1WNEA 2WBRA 2IC3B 2KT3A 3TYTA 5CYMB 2XMUA 5M2UA 5IFMA 2AWZA 1WTFA 5LSLA 4I1TA 2J9CA 2DGSA 4M8LA 2NZ4A 5HMXA 1XR7A 3CD0A 3TANA 1V9OA 2HAIA 1ZPWX 2HHWA 4I6WA 3JYTA 4DLGA 3D1HA 2EWHA 1X4DA 3KK1B 4M95A 3DDNA 4RBTA 3NG8A 2COLA 3D28A 3C2PA 2HPUA 3DLGB 1V3RA 1XNRF 3DC2A 5AE2A 1TL3A 2YWFA 3HKZD 2VOOA 4G1IA 3MM5A 4TQSA 2VC0A 1O0PA 1DQ8A 2HLTA 1VC0A 1GNKA 2IFXA 3DHWC 4FVMA 4HH1A 5T7LA 4DSJA 1JMTA 2Z2LA 3MPVA 2BV3A 3K57A 2K2PA 4YP3A 2LEPA 1NK9A 3RB4A 2VBYA 3CDEA 3POTA 4WK1A 3UNGC 3MM8A 4PG5A 1WD6A 1U24A 3ITHA 3OR1B 2YKMB 3MR5A 4MIWA 1BQNB 3T9NA 2O66A 2O3DA 3GWCA 1RA7A 3DOKB 3M30B 2HMIA 2KDOA 1M5OC 4NRTA 2BANB 2ZNZA 1SIZA 2ZNYA 4ED0A 3CJ5A 3J7YU 1X4FA 4DLEA 1X4GA 3LUYA 4UY8T 4Q0BB 2K8GA 3DLEB 2GMHA 3DU5A 4BBYA 5IT4A 3VQTA 2CRLA 1Y3KA 4Q5VA 4FF1A 4HT5A 3NCRA 5K8OA 2HNYB 2B9XA 1M0SA 2E7WA 3TQ1A 5CCMA 1JLGB 4KBIA 2B4UA 5A2QY 5KFAA 3LOUA 1G2EA 4CI0B 1YJUA 4RZRA 2IVFB 4HI1A 2ILZA 2VH7A 1YJ9S 4IH5A 3QO9A 2IM0A 1VQ8S 1LFWA 1UMJA 5KT3A 1KFDA 3H5YA 3D0IE 5K8NA 5I42B 3LALA 3CD6S 3M4XA 3RRKA 3MEKA 2F8HA 4K4VA 4ZKAA 4A48A 3GIKA 1HQUB 3HPOA 1TK8A 3PX4A 1SV5B 1D9AA 3R5CA 4O4GB 4GC6A 4ZP8A 1KRPA 2DNPA 4RX6A 1VQ9S 1SIWB 2PMZD 3RW6A 3W7BA 1KQGB 4QBUA 4ECVA 4CCHA 2I5JA 2IMOA 4QWBA 3IR7B 3N6NA 2FJEB 4LSNB 2UXDF 2C3PA 3NRBA 4ICLB 4QZVB 2X3GA 4WJBA 4KIAA 5DRKA 4K4WA 1ZETA 3BREA 1RTDB 3CF5Q 4IR9A 3HP6A 4ZVEA 3SZ2A 2M88A 3M8PB 4Q44A 3H4DA 3LP1A 2AP6A 1K1QA 2IC3A 5B0GA 3VAHA 4I6AA 1T05B 1HWJA 1NH7A 1LWFA 3MPWA 2MQOA 1FRMA 4J9NA 2Q6CA 5F0UA 1FF2A 1TFWA 1SQEA 4NX9A 1X4BA 5FDLB 2JDJA 5EWGA 2ACYA 2KRBA 1T3OA 2GA7A 4OFZA 3J7A1 5T41A 4K50A 4LF4F 2ZDPA 3UDCA 3KYLA 1X4CA 4DQIA 3KK1A 5HROB 4CO3A 1VLYA 3WBZA 2DRBA 4UQGA 3OXLA 1KR4A 2HLUA 2AGQA 4LSLB 4OZLA 3TP2A 4OX6A 3C6UB 5KFGA 2YKPA 3G8QA 1FRXA 2VG5B 1VK3A 3NWGA 2ASLA 3M05A 4B9NA 4KHMA 4DUYF 2FC8A 5A8RB 1RISA 2VL1A 4WCEQ 3DGPA 2WK4A 1WF2A 2ZUGA 3G6XA 2YX7A 3CD5A 4B3MF 3MM6A 3MZIA 1H7XA 4Y28C 5EGYA 4LF8F 3IWNC 5KFNA 2KM8B 5B0BA 1BQNA 3THVA 3E01B 1XNQF 4J9OA 3CEDA 2QMXA 3DOKA 1TV6B 2RU9A 3K8WA 2BZ2A 3NCQA 4IR1A 2VOPA 4EZ9A 1TAQA 1E6YA 2MGZB 2J6TA 1B7FA 3CCLS 3MTJA 2Q1LA 1WEXA 1KTVA 3KFWX 2AGPA 2Q79A 5K8PA 3KK2B 3M8RA 4Q0BA 1XERA 2CPIA 3DLEA 1RKIA 4RU9A 4WFNQ 2C2EA 3M6UA 2B9WA 1NJXA 4QR1A 3GV7B 2HNYA 4RW4A 1VQPS 5J2NB 4YR2A 5MLCV 1XK8A 2QA4S 1JLGA 4DFKA 1JWWA 1N52B 2OO4A 5J2MB 3MUMP 1ULRA 2MQQA 2DD8S 2MSSA 3PNIA 3CB4A 2DB1A 4PR6A 4JI3F 3CDBA 2N4DA 2CPYA 4WFZA 4IG0B 1M5SA 2R2TA 4PWDA 1NRKA 2R7XA 3D2WA 1NNDA 2D3UA 3J7YI 4A8XA 3Q8PB 2EK6A 3UCZP 3T1HF 5MAOA 4LIRA 2AJFE 4NYPA 4ZS6A 1ZPVA 1NZAA 5H9FJ 2ZKTA 2HFOA 4YB6A 4O4GA 2R8JA 4KGKA 1IKVA 4OLPA 2MQLA 2CJKA 2ZC3A 4R8UB 1JLFB 1HW9A 2VFVA 4H54A 1TKDA 3DM2B 1IKYB 3FRZA 4C3MA 4LSNA 2R8GA 4ICLA 2RQ4A 5E33A 2DCLA 2XEXA 1U1KA 4B3SF 4X66F 2QIFA 2F4VF 1EP4B 2J5AA 1U4BA 3DYAB 3PZPA 3QGGA 3M8PA 3W2WB 4OHXA 4TU8A 4B3TF 2DRAA 1TP7A 1FTCA 3H5XA 1XMQF 3V81B 2Q3PA 1T05A 3TUZC 1RT2B 2GC8A 1UJ5A 2DNLA 4F25A 4X4NA 4G1QA 3LGNA 1XC9A 1GAOA 3CCWA 5LXRA 2V8DA 5FDLA 3PW2A 4ED5A 2KT2A 2AJ1A 1FO1A 3HKWA 1FRHA 3HHLD 2UV8G 5KOWA 2WHOA 1R27B 3DRSB 4DR3F 5HROA 5GAGU 1C4AA 3EGNA 4QW8A 3DLKA 1WG5A 1SH2A 1N8RT 3GV8B 2FLPA 4LFAF 4C8ZA 4IOCQ 3D1QA 3NAHA 1RT1A 4FP9A 1TL4A 3C6UA 2LA6A 5KG6A 4K0KF 3MAHA 2HHXA 5EWFA 1I1GA 3CC2S 4QIGA 5E3RA 2V4JB 2XSJA 3HVAA 5LSOA 5M2RA 4O4RA 2W24A 4QWEA 2V4RA 2NXUA 4H4OB 3GG1A 1WF1A 2FGCA 2OSRA 5KFDA 2W9CB 2MKCA 5D4NA 2I8EA 3LF0A 1HFEL 5DQHA 2QYCA 2KKHA 3KLHB 1S79A 2GX8A 4NLRA 1VRTB 2EFOA 1KC8T 1TKTB 2BM0A 4G1PA 2XY5A 4DSEA 3CWJA 4RW8A 2MGZA 2HRUA 2ZDOA 2M0GB 4ES1A 1FVQA 2IRXA 3D0GE 2Z0GA 4EEYA 4ZPDA 1SJRA 2CPHA 2DO4A 2XMWA 3IBWA 3CPWR 1NB7A 3LO3A 5DG7A 3KK2A 2FJVA 5D77A 1HARA 1R8BA 4V19X 2VKZG 2ALZA 3K58A 2L4