4OX7A

Structure of synechococcus elongatus pcc 7942 ccmk2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
PIAVGMIETLGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVSAGLDSAKRVAGGEVLSHHIIARPHENLEYVLPIRYTEAVEQFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Carbon dioxide-concentrating mechanism protein CcmK
publication title Engineering Bacterial Microcompartment Shells: Chimeric Shell Proteins and Chimeric Carboxysome Shells.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 25
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ox7A00
4OX8A 2A1BA 3H8YA 3N79A 4AXJA 4RBTA 3SSRA 4OX7A 4OX6A 3CIMA 2A10A 4OLOA 4RBUA 4QIFA 4P7TA 3SSSA 2A18A 3MPYA 4P7VA 3NWGA 3BN4A 3VCDA 2EWHA 3CGIA 2G13A 3DNCA 4AXIA 3NGKA 3PACA 3SSQA 3DN9A 4LIWA 4OLPA 4DDFA 3I6PA 3MPWA 3IA0A 4QIVA 4QIGA 5L38A 4P2SA 4QIEA 4RBVA 4PPDA 3I96A 5DJBA
chains in the Genus database with same CATH superfamily
4DR2J 3CD5A 2MQPA 2D1CA 1FJEB 3PEJA 4B9SA 1NO8A 1WC4A 4DMZA 4HLBA 1SV5B 1JKHB 2CZ9A 5DRKA 3FC9A 2FJWA 4FF3A 3VAFA 1L3SA 1B4SA 3MMAB 3T1YF 5E3PA 2DY9A 5F9NA 3GFZA 3CE8A 4F8RA 2H3EB 2BZ2A 4NA1A 2IRUA 5CYQB 2VFRA 3CMQA 1KQGB 2V8DA 4URQU 5KFXA 2IM3A 3FKBA 3OLAA 2ZBIA 3NAHA 3TQEA 1PO6A 3KK3B 1KP6A 4JI1F 1C1CB 2AF6A 4JYAF 1K8AT 4B3SF 2KFZA 3VAJA 1O6XA 3HF5A 4NLGA 2AJ4A 1JNRB 3HFKA 3UN5A 2E7WA 3VAMA 2VICA 1VGYA 4TY8A 4H4MA 1R0AA 5LSOA 4EZ9A 2DO0A 1JLBA 2YX7A 3NWGA 2GMHA 3K2YA 3Q8PB 1TR0A 1B0VA 1BXNA 3G96A 2KZZA 5FJ4A 2VFSA 5IQQA 2KKHA 1PCAA 3KJVB 3MD3A 4C0BA 1PBUA 5T14A 3N6NA 4BWJA 3D6MB 1RU2A 2RRNA 3GJQB 3ZTOA 3Q8RB 4DL0C 3DDKA 4PPDA 1FJGF 1FWKA 1BWEA 5CXTA 3ELHA 2ZH2A 1XNRJ 4ZCLA 4AXJA 5A8WB 1U2RA 2ZNYA 4IH6A 2G0JA 3Q8VA 4N47A 2FZCB 1ZOTA 1XMOF 4DSFA 1PJ5A 2OELA 1Q0NA 1RADB 4J90A 1R0BG 2CQ0A 4TU9A 3RRKA 2JC1A 2GQ2A 3UD4P 1QM9A 1H98A 1U2FA 4DL7A 5T7LB 2ZE2B 1U26A 3M8YA 3PYFA 4DU7A 1C0TA 3VWSA 3EUNA 3LPYA 2A18A 2DT9A 1U0HA 3M9OB 2YQ3A 3BF4A 1NKEA 1N34F 1W7WA 2EC0A 1CG2A 3PO5A 1FRLA 2WBRA 2J0SD 1X7VA 1DBDA 2C22A 2G9OA 2ZOMA 1U6BA 2DGOA 2LXUA 5DZ6A 1LW2A 2BE7D 1NZAA 3W5ZA 5IC6B 5GVQA 3TZWA 4P73A 1Q5YA 4A8OA 3U1LA 3J80Y 2XMJA 5C7PA 1M5KC 3IRXA 3K5NA 2CPIA 3B8HA 1FDDA 1HQUA 4LF6F 4IFYB 1HNWJ 3NGRA 1YIJS 1ITPA 2GHVC 3VVTA 2XMKA 3DLEB 3OL9A 4TNOA 2IMWP 1RT7A 4UT4A 4ECRA 3A8KA 1X9SA 3Q8YA 4CIOA 1IKVB 3DM2A 2XSJB 7AT1B 3OVBA 5D0HA 2JOQA 4A46A 1ZH5A 4IOCQ 2MLXA 2QSWA 4YHHJ 2R42A 2JVRA 3AJ2A 3CJRA 4TY9A 4C4WA 3MGJA 3C6TA 1R6YA 2MY7A 4UOFA 3TX0A 1WEZA 3T6JA 2JL9A 1S48A 1VQPS 3F41A 3JSMA 2YNHA 2HHTA 1XQIA 2MQQA 4DQPA 4HACA 3MM8A 4NLOA 3TZYA 3AHPA 5G4DA 1NLKL 2QC3A 3OVSA 2G2OA 1BWVA 2B3TB 1U49A 4FP9A 4QIVA 3JAMY 3CC7S 4LF8J 1N33J 1LKZA 3I96A 4JI8F 2XZTB 3IAM9 4BCAA 5A6PA 4N8NA 4LR8A 2GAGC 2AV5A 3UDLA 2F4VJ 4I6AA 4Q2LA 1E6VB 2FHMA 1MN9A 4TQRA 2HQDA 2UVUA 4FZVA 2MMYA 2B7BB 2N7YA 2DRBA 3AODA 4LF7F 1OY9A 1SV5A 2HHXA 4ZA1A 1YLXA 5CQGA 2KDOA 4FS1A 1U6FA 3B4MA 1HWIA 3QLHB 4M8LA 1WG4A 1MNEA 5KG1A 5HP1A 1S6PB 4QR2A 4IUFA 4UOCA 1FX2A 1EQ0A 3P6YC 5B0BA 1RLDA 4OZNA 2XMMA 2JLEA 3JYTB 2OHDA 4ZVRB 1NJYA 3R5AA 4USWA 1WELA 4JOUA 3M8QB 1N4LA 4R5PA 4GC6A 3MTKA 3VQTA 3FRZA 2AQ4A 3HSGA 1C1CA 4WK1A 4ED2A 3R7NB 1Y3JA 1SPBP 3GTYX 5GAHU 3EVWA 2R4FA 1Y5LB 5A6WA 2WHOA 3IAS9 4OX9F 1SKWA 4QU7A 4DV3F 2HHWA 1IBKF 1GXLA 1MW7A 3U1MA 4Y28C 1UVJA 1VQNS 3GYGA 4DUYF 2IRYA 2A0FB 3KJVA 3OFGA 1FEEA 1MWQA 2GQQA 1VISA 1N0UA 2J7UA 3MPYA 3PG9A 4CQ1A 5K5MA 2WOMB 2FJBB 1J5EJ 4X4UA 3UPFA 4CLYA 1SB6A 3R9LA 1YI2S 2C3OA 4RBUA 1YJTA 3A3OB 2LDYA 1PYOB 3PW2A 1JNZB 4U67Q 3MAAA 2VL1A 3Q2TC 1PAUB 4PXCA 5HQMA 3SEOA 4JI7J 1RACB 1H74A 2ZVIA 2C3PA 1HNVB 1VC0A 1YK9A 4JI5J 2HGNA 2Q66A 4K2JA 2YVSA 2IM1A 3BEGB 3GFXA 3R1HA 2Z57B 4UUXA 2ZH1A 3N5FA 1WHYA 3PYGA 4Z2XA 3QT6A 4IG3B 1JXEA 2X3GA 3NNHA 5GAEI 2AD9A 4RU9A 2C2KB 2PDAA 3U02A 4CH1A 3NOGA 2NLWA 1RT2B 5BR8J 3LP1B 4KR0B 1RWXB 2E5HA 5ETOA 4FKXA 2EK6A 1BMQB 3HT3A 1IM4A 1MMNA 4FBTA 2VBYA 4RKUC 3MPVA 1SUQB 3OSPA 1IBMF 3CO9A 1X4FA 3ADAC 2R7RA 3KNAA 2CJQA 5IT9Y 2XEXA 1Q16B 3GE9A 1FD8A 4DR5J 5ETVA 4OI4A 3EXYA 1TU0B 1AZSA 3I87A 1UFLA 1CJKB 3I5AA 3CMES 2DH7A 3BYRA 4KPYA 3DLEA 2DITA 4P6QA 1RB0A 2CQIA 3CJSA 2VH7A 3BGRA 1Q7YT 4P71A 1IKVA 3I9V9 4ICLB 4ECZA 1YVFA 4R8UA 2G2YA 5HATA 2XLJA 2CJKA 2KVIA 2XULA 2BJ1A 2HHHF 1CLFA 3HZEA 2DNHA 1ZM3A 4NEYA 1P6TA 1T0TV 4RWXA 2F3JA 2RDJA 1IJFB 1U7LA 3FZ2A 4OYMA 1X4AA 4USJC 1SC3B 2N4DA 4ZK7M 3HT0A 5CCMA 1PYSB 2GVDB 4GO5X 3LOUA 3AJ1A 3MFHA 4FF1A 2KI2A 4USUA 3ILIA 4U6PA 1AT1B 4ZP7A 3OXLA 1SCJB 2UUAJ 5EWEA 1E6VA 2GW8A 2HBYB 4KHPJ 2KJWA 1HNZF 4OI1A 3M8RA 3KLVA 4CYUB 1VK8A 4CLWA 4NLUA 1A9NB 4OHZA 3DLBA 2IA0A 3ZO7A 2P9EA 4PWWA 5IQ6A 3CDUA 3MECB 3O5TB 3H8YA 5E41A 1JLGB 3QLHA 2VJVA 2UXDF 2YQ0A 3LGNA 4EK2A 2HK3A 1U1MA 1S99A 4WWSA 3BQ1A 5IV3A 3IS9A 2FVSA 4P72A 2HHQA 2CVIA 2PT0A 3D68A 3JYTA 3BH6B 1DQAA 1XC9A 3EGWB 3HFVA 4JI3F 4O3SA 2FYXA 1W25A 1VQMS 1NRKA 1HMVB 4DUZJ 3GWCA 3QGGA 1VC5A 1LXJA 4EYIB 4K5RA 3CCJS 1HPZB 1VQYA 1T9UA 2VG5B 4H4OB 4LBIA 4AL7A 3G2XA 4QR0A 4KRWA 3WC0A 2OEJA 1VBKA 2ZZTA 3AA9A 2NXJA 1UKUA 1S9GB 5ETSA 2FPHX 4ZPWR 1NK0A 2DPJA 3H5SA 2VU5A 2FGOA 4ED8A 1LNQA 4DLGA 2KVQE 2YTCA 2CAJA 2W2NP 3HHKA 5AJ3J 1K0TA 4KGXB 3CT9A 1ZM4A 2W9BB 4DV7J 5KFYA 1RABB 4CWBA 5H9FJ 2MSSA 4LRFA 4AXIA 5EUHA 2D3UA 2WOMA 3Q22A 4UW2A 2B9XA 1NSQA 1YRXA 4KGKA 1NKCA 1FDNA 2BJ7A 3P45B 4JI4F 2FTRA 5KFIA 3KLIA 4J9OA 3PM9A 4M5DA 3A1YG 3L7UA 2B4VA 2ASLA 1D9AA 3N0VA 3LW5C 1JLFA 2FZKB 2ZZMA 1HNVA 1WKLA 4Y2MA 1SL2A 1UJ6A 2IAJB 1VRQC 8ATCB 4FBUA 1S12A 1XNQJ 1RXOB 2W01A 2B4UA 5KFWA 2RQKA 1APSA 4DR2F 3T1AA 4DUTA 2F63A 4G65A 2GA7A 4BS2A 3TUIC 1N8RT 2J9DA 4HVZA 2MKSA 4CRJA 3GP9A 3IBCB 2VONA 2E5IA 4CCHA 4FXDA 3QIDA 5IV4A 5IOLA 2ZH8A 3BSOA 2AYGA 1HL6A 5KFLA 3QYYA 2E1CA 1RT2A 1F6TA 3C14B 1HR0J 4I1TA 3N79A 2DO4A 2CPHA 3GYXB 1CULB 2DIUA 3BN4A 1IBLF 4Y2CA 2MEWA 1N5QA 1H73A 2X1BA 3WIUA 4UY8T 3VAHA 4HKQA 1IQTA 4WBFA 2OD4A 3FQKA 3DRRB 4Q2MA 2LMIA 3G6ES 5ETTA 2P6SA 1DAXA 1VC6A 2Z2ZA 1UEVA 3FSYA 4NLXA 4NLQA 4I67A 2Y1RI 1FD2A 2EFVA 1CJKA 4RW4B 2HNYB 2ZJQQ 1WWHA 3KUGA 1U0SA 2XWXA 2P8IA 1QSSA 3CDEA 3CD7A 2OI2A 2B4OA 3HK2A 1RI7A 1VIOA 4EGLA 4ICLA 2EG1A 5AXNA 4QWAA 4OYOA 4I0WA 4IR1A 1HNIB 4M5LA 4I2QB 3SV3A 5E3RA 1T05B 4OZLA 1U48A 1K73T 1LXNA 2OD6A 3ZZUA 2DGUA 2Z58B 2FLNA 3PRVA 2CQ2A 2GVDA 1XNRF 1YBAA 1HA1A 2C2ZB 2VBZA 1IR0A 2V6AA 4ZPBA 3GIMA 3UVJB 1SH0A 4HHUA 2UV8A 4CYUA 5GMKa 1YZ6A 4PG4A 3KK1B 4AL5A 5DM6Q 3HHNB 4F4WA 4P2MA 2UXCJ 4OYPA 5GAHI 3MECA 2E1RA 1RWWB 3EZUA 5KT4A 5BYSA 2F7VA 3TAPA 2U1AA 4OLOA 2PC6A 2QL7B 3CCWA 1P1TA 5IM0B 4IYQA 3OLBA 3E8OA 3MOJB 4X66J 1FKPB 3HD2A 1NPRA 1AUSL 2CRLA 3KTQA 5D3GA 4B02A 4NLTA 1HMVA 4QIFA 4KT0C 4A48A 4YS2A 2PE8A 2VFVA 4F04B 3UR3C 2VG5A 5IXUA 4H4OA 3EZ5A 1WC3A 3JTPA 4QOTA 1RA6A 3D28A 1R43A 4ATNA 2CJXB 1S9GA 1FF2A 1U1NA 3D1HA 4XPCA 3BDEA 5FIIA 3Q86A 2NZCA 2J0QD 4V19J 2AJ1A 3HVTB 2QLWA 4JP8A 4CO3A 2D9OA 1U6ZA 3MWBA 4OZ2A 1BQXA 1HNWF 2ILZA 3GG0A 2HS0A 4W98A 3IR5B 4E2FB 1C1BB 4OJ3A 4O4GB 2B56A 3B54A 3QJLA 2VIHA 1SIZA 1Z1ZA 4FF4A 2NSCA 2CDQA 2M52A 4YHHF 3PYDA 3GFYA 2HRUA 3QFHA 2RKIB 3CTRA 1V9OA 3QGIA 3VZIA 3T19A 5JUMA 1UZHA 2HIQA 1FXRA 4EUVA 3QZ7A 2IAJA 1SL1A 2WTFA 4OI6A 4LF8F 4FYYB 4P2XA 5DO2A 1Q8BA 1R7IA 4IRCA 1O5JA 3A13A 4QIGA 2BV3A 2CPYA 3MPUB 1UP1A 1JLEB 1JJ4A 3JTOA 5IFMA 2OMLA 2GC8A 3AXKA 5DDPC 2MYFA 2OMOA 2LEAA 2V5HG 2AGOA 4B9TA 4PG5A 4FN5A 3TUPA 4WP8A 2FQQB 1M0SA 3C14A 3I4HX 2HMIA 2V8VA 1TKXA 5F8JA 2HS4A 2RD5C 3A8EA 2KH9A 1GXTA 5I3QA 1CULA 1RTIB 3CSKA 4BC9A 3HHLD 4ZP9A 1UAWA 2PMZD 2VC1A 1FFSB 1YJNS 1W26A 3QQCD 3BM7A 2RRBA 2KRRA 1QSLA 1CS4B 4CP5A 2J7WA 3KG4A 2ZBPA 3D6FB 2CZ4A 2UUTA 3VGSA 2OFHX 5D15A 3CJ8A 3L95X 2CNKB 1Q8LA 3OL7A 3AOAA 1U1OA 2DKOB 2HNYA 4Y34A 4OYWA 4ZS6A 4MK8A 1WKJA 3ILLA 4O0NA 1TV6B 1RAGB 3K5PA 3WC2A 1CC8A 4WXOA 2XYGB 3WHIA 1WD6A 2V2QA 3P5BP 2Q6CA 2LQ8A 3BGFA 4B17A 1SKRA 2N82B 2W2QP 1SH3A 1VJQA 2PN6A 4GVLA 2DCUB 2QSFA 5HBMB 1T05A 3BGUA 3M1VB 3MAHA 2K2PA 1B99A 3CCRS 5L1JA 1OO0B 2ZH3A 1TKTB 4LVNP 2WSEC 1RT1B 2RS8A 3ZZ0A 3OD2A 3EWGA 3DNCA 3NGDA 3R7SB 4KB7A 1V5IB 3ZTPA 2O67A 5HK4A 4OYZA 1SBRA 3KG1A 3RG6A 2I8EA 1DHMA 3MTJA 1RISA 2IMOA 3IGVA 4JI7F 2CZVC 4B3RJ 5I3UB 3JAMU 1XJWB 2DYAA 2QEXS 2HWHA 4LUBA 3SQGB 2PA3A 4Y6IA 3LALA 3TOQA 5G0RB 3LH2S 5AE2A 1N52B 5IM0A 5DG8A 5F3TA 1D9FA 1FKPA 4NCAA 3HO1A 5LMUF 1U1LA 3IBWA 3D0GE 1ZM2A 3CJ3A 4K0KJ 2XNRA 1VBZA 2XZWA 2GMLA 2DY1A 4XDCA 4WZMA 2EWHA 2GX8A 3R5JB 1E6YB 4GKJJ 4FXWA 2WVDA 4ECVA 4Q8FA 2WSFC 4C2MA 3W2VB 4DR6J 1S6QB 3GU0A 3TR5A 2WVCA 4U95A 3RB0A 1HHQA 4IQXA 1K9MT 4DG1B 2V63A 4ZDNA 3HVTA 4OX8A 4OX7A 4YY3J 4DR5F 1SJ1A 2F9JA 5LMNJ 1V6HA 1XMQJ 1JJ2R 2B5JB 4ZN3A 2Q79A 2BKNA 1C1BA 3VGVA 5DG7A 3K5LA 2QT7A 1Z2LA 3NS7B 2JFKA 4Z7CA 1Y11A 4ECXA 2CXEA 1YG0A 3TA1A 3K57A 4RX6A 5HJYA 3MMBB 1NKBA 5BJRA 3JB9k 2AX0A 5HSPA 2FUG9 1JWWA 3RW7A 5JVGQ 4I2PB 2ASYA 2OPQB 4KV8B 4NLDA 4ELTA 4AD6A 5C24B 4NA3A 4C8MA 4ZVQB 4NE9C 4HL9A 2KL8A 1F2GA 4P74A 3AOBA 1RWPB 2CQ1A 1RP5A 5HJXA 2QN6B 1JK9B 4ILRA 1SJRA 4O3QA 1U8WA 3CCLS 1YZ7A 2UUAF 3IP0A 3FUYA 4KHPF 1PBAA 3CULA 4QW8A 1RHQB 5L1IA 3MEKA 1WEYA 2EC2A 3EGZA 1PIEA 5JXSA 1QTNB 3DOLB 2JZ5A 1ULRA 2E5GA 4YB1P 3VTIA 1S10A 1U45A 3TWZA 1IWGA 3MM9B 3OFHA 4U8YA 1RTIA 1OPZA 3N6LA 4B3TJ 1F9EB 4L73A 2F5GA 2RMLA 3AD8C 4DUZF 4UTGA 3LP0A 1EP4B 2BM0A 4W90B 2VFTA 4IFVB 3DLGB 2Y1JA 3CMAS 4P2FA 3KHHA 2XY6A 1LFWA 1DY3A 2ALYB 5B0AA 1HWJA 2HLTA 2AJ0A 4Y2KA 4C8OA 4OJHA 3ITHA 1FEHA 3I0RB 2Z2YB 2EK1A 3RR8A 5IT9U 3QWPA 1VQLS 3UD5A 3T5HA 4QYZK 3N5BA 1LQ9A 1SKSA 4DPOA 3GIKA 2L3MA 4U96A 2RHQB 2LEBA 1S1TB 5CZVA 2DH9A 4JUZA 1UFWA 5AJ3F 4A8MP 3CGIA 2D7SA 2CA9A 1U2CA 1OYEA 5F8IA 2XHWA 1RK8A 5HMWA 4DV7F 5D78A 1NDPA 3N28A 2C28A 3F44A 4QYZJ 2HNDA 4ZIVA 1KS2A 1TKTA 4RLEA 1RT1A 2DNMA 2ZUGA 3G82B 4LSLB 1T9VA 4ENOA 2OUGA 3SBMA 5AE3A 2ADBA 1N5TA 3OL6A 5F8MA 2XMAA 3AFGA 3J7YU 4F0HA 1SIWB 2HLUA 2B7CB 1R8HA 1CJTA 3KLGA 1PC5A 3TJAA 1IQZA 1ZPWX 2BEFA 1VHIA 1FT8A 1XNQF 2DR8A 3EJMA 1TUVA 1B0TA 1YWXA 2YKMB 4GC7A 2ZFHA 3HHEA 1BQNA 2KN4A 1NHUA 3BO2A 3HKZD 4LQ9A 1Q79A 3TAMB 3FQLA 4F67A 3RRHA 2Z30B 2JFDA 1T94A 2QO3A 3HKWA 5DGAA 1I51B 4MMOA 4TLRA 3LAKA 4ILLA 1LW0B 2FLPA 1KQFB 1GX6A 2VC0A 3EDQB 3H42A 1HR0F 4MT1A 3OJUA 2V4QA 3GIJA 3PX0A 2MKKA 1H6KX 5CD4H 2NXNA 2CNNB 1AROP 3QT8A 1S6QA 5CH7B 3FEZA 4TYAA 3RAMA 3GV5B 4DHVA 2RU9A 1ZS6A 3ICLA 2DEJA 2DGQA 3AAWB 2AJFE 4I69A 3W60A 3NBPA 2IBKA 2IYGA 4PEOA 3BR8A 1NNDA 4RNOA 2ZM6F 5I42B 4B3SJ 2DHHA 9RUBA 1EQMA 1V3ZA 2MHEA 4HHJA 3S8SA 1VQ5S 2IVMA 3NY0A 2R2SA 1GQEA 1PJ6A 3AOCA 4EZ6A 3L7PA 1WDTA 2FJVA 1ZTWA 2AZ3A 4X4SA 5E5NA 2IY5B 2LCWA 1GNKA 3JQMA 4O3PA 2VPWB 2XGQA 3MMJA 1RHUB 2DR7A 4PKDB 3AQOA 1J2VA 2YKOA 4RO0A 3AH6A 2QIFA 3UN3A 3W5YA 4I2PA 2OPQA 1TL5A 3VAKA 5C24A 4XK8C 3T41A 4ECYA 3HX9A 1OPIA 4HT7A 2H1YA 1M1KT 2JEFA 1FJGJ 2XCAA 1FNMA 4DV5J 3CNQP 4Q44A 2XMWA 4NYOA 1FK9B 2DHAA 5KOXA 5DDOC 1PILA 2MZSA 5H9EK 2ZHOA 1KKHA 1HWUA 2KT3A 1YX2A 5MAOA 2R8GA 1ZBTA 3M2VA 2UXCF 2CFXA 3R1LA 1YTYA 4NPOA 3KKFA 2CQPA 2JJ4D 1TL3B 2YNIB 2B4PA 3PX6A 1LWEB 5HLFB 3SDEB 4TVAB 1M1GA 3UE2A 5H9EJ 2HPUA 4KAIA 3MM7A 2D9PA 1EP4A 2YKNA 5A2QY 2RQMA 4YOEA 4IFVA 3DLGA 1RT4A 1NK6A 4OHYA 4K4XA 4P9SA 2O66A 4F36A 4K8RA 2HW3A 1FRJA 3DCAA 4ERDA 1S9EA 1UW9A 1S72S 3E2EA 3H0PA 4XDDA 2QYGA 1RBAA 1NUEA 2ROGA 1S1TA 1H0HB 5J2NA 1LWCB 2R8IA 2OPPB 1QTMA 2DK2A 1J5OA 2XB2D 3IM8A 4USVA 2HRYA 2D3O1 3CJ0A 1U1PA 1IR2A 3KDNA 4F2SA 4ZVHA 3CCES 3R7BB 3NCQA 4DV6J 2KXFA 4LSLA 4ER8A 3CCUS 5F8GA 4QQBA 4WE1A 2WVFA 3LTOA 4L3NA 3MXHP 1EZZB 3GONA 3D54A 2EVZA 4ECQA 4TLQA 4X4QA 1RAAB 4TU8A 3W63A 4WKYA 2BJ9A 2EXUA 2DEIA 4N5SA 2V4RA 4JV2A 1FWPA 1A0OB 2W9AA 3JQKA 2AHOB 1MU2B 1NK4A 2YKMA 2ERRA 4DR1J 4NCGB 3EICA 3TAMA 1IR1A 1N48A 1QJHA 4LF7J 1IVZA 1XN9A 1RTDA 4RW6A 2A2DA 4X2BA 1LW0A 3KLHB 3R8YA 4OQJA 2Z2LA 4MKVA 1HNXJ 4A8FA 1KFSA 4OL8A 4DX5A 2BACA 4RBVA 2HKEA 2Z4PA 3OUYA 2AZ1A 3V4IB 4NI2B 3RTVA 4OYIA 1GTEA 3BH7B 2CJAA 1VQSA 2XNQA 2ZJRQ 2ZWOA 1PC4A 5LSLA 4LQ3A 2MJUA 1RU1A 3C15B 2RJZA 1JLAB 1VIXA 1TKDA 3Q8QB 4IH5A 2MZRA 2DRDA 5F8NA 4YR2A 4LFBJ 1KDNA 2IVFB 5I4MA 4LMZA 4C98A 5E3QA 4URGA 1FJ7A 1P8GA 1PKUA 1RSCA 1GMWA 2CADA 4Q8EA 2ZBCA 3OTBA 4IOBA 1OSDA 5KFDA 3MMCB 3M7VA 2MKIA 4IR9A 4XAKA 3BQ2A 1RTHA 1IBKJ 5T41A 4MKBA 3NGUA 1S79A 1X0FA 4L3KA 1HBOA 2P5VA 3MEDB 2DB1A 1GFWB 4BWMA 5CYJA 4PPZA 2QFIA 4MFBA 3AB2B 3G6YA 4ZMMA 3VCDA 3VQSA 2ZBRA 4IDKA 3I6PA 5FDLB 4FDFA 4LFAJ 1HW8A 1VBYA 4DI6A 2ZC4A 5BYQA 1WUUA 5J2PA 1FK9A 4EO8A 2ASDA 5J1EB 1UVKA 3LANA 1OY6A 4EO6A 1FFGB 3VAIA 1X5TA 3FSIA 2AWZA 3ILJA 3HJFA 2VFUA 4B3RF 5A8KA 2IJRA 2AEJA 3NCPA 3FSXA 3M6UA 2ZVSA 1FRXA 1TL3A 2Y9HA 2YNIA 3H98A 3TAQA 2DR5A 5EN1A 3H2UB 1RAFB 3ISZA 1RAOA 3CJ2A 1S4EA 3VV2B 5J1PA 3TJ8A 1LWEA 5HLFA 1FVQA 5FLXY 1UVLA 3DYAA 3BYPA 1XR5A 4R0EA 3MR7A 2E44A 2IFXA 4LSNA 4K0KF 1D1UA 2OKQA 3SQOP 1X9WA 4GKJF 2HAIA 2VBWA 4I6WA 2ZNZA 3THTA 3DC2A 5HQ8A 3RB4A 2VOOA 1KR4A 1U24A 1X0PA 3B6BA 1FXLA 4DR6F 1S1WB 3N9UC 2IPOB 1JLCB 1ZAVA 4IG0B 2P9CA 1X8DA 1JLQA 1TVRB 1UWBB 1JJHA 4CTAB 3DGPA 4KC5A 3DGVA 4DPTA 2GGPA 4F4ZA 3J7YI 4YY3F 1MROB 4DR4J 2E9RX 2FDNA 3T1HF 5IS2A 4H54A 2VUGA 5LMNF 1LWCA 3V81A 2E7VA 1VMBA 2QTWA 2I5JB 2DXFA 3G4SS 1F60B 2JLGA 1HD1A 1F1BB 2HAFA 1S0NA 2Z0GA 4C8KA 2FLLA 4G1QB 4DSLA 2HHHJ 3RB3A 3LGHA 4KY3A 3Q0AA 3I31A 3BGOP 2AYEA 3HDSA 2NQPA 1KOOA 4GKKJ 4X64J 1SH2A 2NUHA 1NBEB 3A8IA 4ZCMA 3HMJG 2YY3A 1NDLA 3W3SA 4DV1F 1MU2A 3RBEA 5DDQC 1PJ7A 3L09A 1QVGR 2DXDA 4KH1B 2DGSA 3DOMA 1T7PA 2QZ8A 1U4BA 3EVMA 3H4DA 3NWRA 3TARA 3GV8B 3DRXA 2SXLA 1TK8A 4EMDA 1Y4ZB 2RVJA 3KLHA 3FK4A 3V6DA 1GMWD 1S1XB 1YSJA 2DNYA 2FIUA 5J1NA 3KLFA 4B3TF 3V4IA 3WBZA 2BX6A 1CBKA 3IN5A 2UP1A 4LF1A 4RNFA 3G6VA 3SCJE 2LXFA 2DIVA 4CT9A 1U47A 4GVBB 4NXMJ 4C0HA 1KOHA 3C15A 2FD2A 1RHMB 4DZDA 4KJIA 3WX4A 5ETQA 1KRPA 1SXLA 3ZTSA 4DL6A 4K7QA 1AW0A 3CDWA 4LIWA 4C3LA 3I0SB 4Z37A 2YKAA 2WRMA 2DNGA 1RWUA 1KQSR 1VI7A 2WB4A 3HLUA 2DD8S 3GB0A 3CIMA 1P27B 4MK9A 4H4KA 1KHWA 1RTJB 4DL5A 3M6WA 2B9WA 4ETZA 4F02A 2BANA 1RJJA 2AYMA 2ACMA 3H5UA 2ZHAA 2FB0A 1FI4A 1RHJB 2VDHA 4ZKAA 1K0VA 2B6AB 5FD1A 4ZPTR 3HJVA 3HVRA 5FDLA 4C8NA 2FC9A 1S7HA 2LDIA 3LGMA 3QGHA 3GG1A 3P3DA 3DRSA 5CD4A 4WZQA 1JMTA 1HI8A 3GILA 4DL2A 3DMJB 3QO9A 1TKZB 2JNJA 1HI0P 2W4CA 4NLRA 1GMVA 1EETA 1H2UX 2RS2A 3D1OA 4I68A 1P9QC 2LA6A 3PNIA 2QGFB 2QG9B 4DSKA 3FMWA 3J7ZT 2WVBA 4BBYA 2NCKL 4N7TA 3MUTP 4YDDB 1PYTA 4QWBA 3DXBA 2UV8G 3OL8A 4EFAC 3L9ZA 3S7RA 4PRFA 3KJNB 4X84A 3TANA 3NLCA 4KIAA 3CJQA 1T11A 4F3QA 2ADCA 3QZ8A 3LWMA 3DXSX 3C6UB 2X1AA 2V9WA 3QNWB 2G13A 2KTQA 4YDXA 1S1WA 3R5DA 1JLCA 3EXCX 5DLFA 2AMCB 4RPFA 5KG4A 1IBLJ 2R2RA 2V2VA 2B8PA 1LV5A 1EIYB 1UWBA 3W65A 3BPSP 4W92B 4J9NA 2BE9B 2W9CA 5KFBA 2B9EA 2Q1LA 2JDJA 1KD1T 1MROA 4HR2A 3D0IE 4IRDA 1DFDA 1YBTA 2HFSA 2MDAA 4ZJQA 2I9SA 1JXVA 4FVCA 3UCZP 4DEZA 4C3MA 2HVIA 2I5JA 4WK3A 1VJWA 4NX9A 3ETMA 4ED0A 4L74A 1DTQA 2DNPA 1N88A 1Y10A 3SFGA 4DSIA 3CCTA 3HHDA 4DL3A 4C6AA 3RB6A 3HPOA 2LA4A 4G1QA 2R7VA 4WP3A 5MLCV 2ZKTA 2XO6A 2VKRA 2H4YB 2GHWA 8AT1B 5EWFA 1RWOB 3GQCA 2ZDPA 1UW4A 3KJFB 1RAJA 3M30B 2EG2A 2ZKUA 3Q24A 3LWLA 4G3IA 3T3FA 3GYNA 4DV5F 3OPKA 1OQ6A 1RBLA 2HVEA 1VQ4S 4WFYA 1FKOB 1KLMA 3L4BC 4KHRA 3CCQS 2CPEA 3JSBA 1OIAA 2K1RB 1I94J 3TEGA 5KOWA 2W4DA 2IJFA 2XM3A 1TK5A 4PQAA 1VRTB 2J0XA 3PZPA 1S1XA 4OYXA 2YNFB 1DLOB 3PIOQ 3T5KA 1NJZA 3FCWA 4LRCA 5THWA 3QIPB 2HWTA 4I56A 3FCHA 3ENVA 3OFFA 1NK7A 1YJRA 3FFIB 1TL7B 4GVBA 2EPIA 3IM9A 2CNLB 2YPYA 3CD0A 4L76A 2DCLA 3ULHA 3GFHA 2G1DA 4IH7A 1BE4A 4RBTA 1D09B 3EMTA 2YWKA 3M05A 3GJTB 2C3YA 4J7CA 3AD9C 1N5SA 3MCOA 3UDCA 1KNZA 2J8AA 4OYAA 4K4YA 5DETA 4CLLA 1RTJA 2XY5A 4JI0J 1K1SA 3R97A 2CG8A 1HYSB 1RCXB 1Y5NB 2JC0A 2K06A 4WCEQ 4ETXA 2R7SA 3Q8SB 1S59A 3WQPA 4ZCKA 3SSRA 4KKOA 3BN7A 3CEDA 3B82A 1QLNA 5HMYA 3I9ZA 3TEHB 2XTJP 4DV6F 5DZ7A 4Y00A 1UETA 1VQ6S 1Q8IA 4WFZA 2A1BA 2VG7B 5HO4A 4LF5J 5L39A 2P9GA 2APOA 2HG4A 1GH8A 4ED4A 3QAEA 5KT3A 1IKXB 3VGUA 2EFOA 2D3ZA 4PYAA 1AUDA 4USKA 4K4UA 4UOGA 3HCXA 3T9ZA 1TFYA 3W2WB 1X4CA 3NXZA 3M2UA 1TKZA 1XK8A 1J27A 3FNNA 1AYEA 5K8NA 1HIYA 4DR1F 4L75A 1FWLA 2VPZB 4DSJA 4O3OA 1X5SA 2FLOA 1S6OA 3PHEA 4NYZA 4OIXA 2MQMA 3EGVA 1JKHA 1LK7A 1KTQA 4F2RA 3LP2B 2BOAA 2DHXA 4YFUA 2BYCA 3MMAA 2LEPA 1NCLA 1ZZFA 1OJ4A 1HNXF 2GIFA 3C6UA 5A76A 3JTNA 4DX8H 2BXJA 2M88A 2CQDA 5CYQA 2G4BA 1N56A 4D3HA 2V2ZA 1I1GA 1ICEB 5DJBA 5CZXA 4B9UA 2P6TA 4USIA 3KK3A 1H38A 1RAEB 1WC1A 3I82A 4FYWB 1KONA 2GAHC 4C97A 4LFBF 4LVOP 3RJMB 4CLFA 3DDNA 3PW5A 3LA0A 2RH3A 4ELUA 3SIPB 2FGCA 2N3LA 3MDFA 2YWEA 2YWHA 3F56A 4KGZB 1T02A 3KG0A 3HVAA 4R25A 1IKWB 1NB2A 2IC3B 1EKSA 4C8YA 5KTQA 4AUKA 4NOHA 4N56A 1WOSA 2NZ4A 3UCGA 3M30A 1M1HA 4LF4J 2HZCA 4LFAF 2OGUA 4FYVB 5A8WA 4KSEB 4X4PA 1FKOA 2L9WA 1T03B 1MMLA 5L9XA 1OY8A 2AIRB 2FJEB 1ZA2B 2FHOB 4B9MA 3GSIA 3KDOA 4ES1A 2V0NA 4QWDA 3LPEA 2HHUA 1JB0C 4YR0A 2MZQA 1VRTA 3NS5A 4OLPA 2YNFA 5T7LA 2ZE2A 3P49B 4DXLA 3W1YC 2HFUA 5LMUJ 2V2KA 3SV4A 1B3TA 2E5LF 2JH3A 4HDHA 5DDRC 1RWNB 2E5JA 3A3NB 3FFIA 4PXBA 1TL7A 1UEUA 2KG0A 1WF0A 2DNZA 4YB5A 1OSCA 3MR5A 3GV7B 3NS6A 4RL1A 2QMXA 3QSYB 3ZZPA 3BS9A 3CPWR 3DI6B 4DN9A 1TL1B 2L48A 4LFCJ 3KXDA 1S9FA 1P1LA 2VJUA 5IT4A 1D8YA 3D6TB 4O3RA 3T6BA 2E1AA 3QRQA 3IG1B 2NUUG 3CB4A 3NOCA 3D6HB 4DR4F 3IFEA 2YQ1A 4AL6A 2MKJA 4MH8A 4RW7B 2NYIA 4ZLJA 4FYXB 4LF2A 2BW7A 1HYSA 2ROPA 2C2RA 3CC2S 4IFYA 5DG9A 4QR1A 1UA0A 1WSRA 4Y0FA 2QA4G 1V3RA 1BUXA 1VQKS 2DHGA 2M0GB 4OJ1A 5RUBA 5K20B 3OT9A 1DQ8A 2BJ3A 4WJBA 2XSJA 2HQIA 3D3CJ 5EWGA 3CWJA 4A8WA 2ZHBA 2OSQA 2BE2B 2VG7A 4FS2A 3KHRA 2AEFA 4WYWA 1IKXA 5CA5A 4N76A 3GCWP 3O8WA 1FE0A 5D6GA 4GKKF 4X64F 4H4KC 4LSZB 1CJVB 3Q23A 2F65A 3F0NA 3EZOA 2GJIA 5F8HA 4ANDA 4C8LA 4PCQA 4ID8A 3TVKA 1SVDA 2C2MB 2NR0A 1HARA 3N4WA 1SL0A 2EFPA 3LP2A 3PFEA 2R2UA 1ZAWA 2HBQB 5FLXU 3O2IA 4CNYA 1S0VA 1IBCB 1S6PA 4LIRA 2BKPA 2DGVA 3ZTRA 1TK0A 1XEZA 2DXEA 2FJDB 3W5XA 3UNGC 5L9NA 1PGZA 4C11B 3M8QA 3K5MA 2EFQA 4NXMF 2ZC3A 1FO1A 1UTAA 3AT1B 4F0KA 3KYLA 1QSYA 5ETNA 1T9TA 3QPIA 5E2QA 1DTTB 1HHSA 1FA0A 4HDGA 4QPXA 3J7Z5 2MZTA 2RDIA 1O8BA 4C48A 4ILMA 4J9KA 4A8KA 2HFVA 4RNNA 2ZEJA 3ONQA 1D0EA 3TZZA 3IWNC 1R89A 4F3MA 1UVMA 1SQGA 5H9FK 2RNEA 1QUVA 2H4WB 2Z2MA 1YKWA 4DU8A 3TA0A 4QZVB 3MR6A 3UNYA 1KN6A 4M5MA 2F8EX 4ZVUB 5KT5A 1NH7A 2H65B 1L3KA 2CVEA 3M8PB 3MFIA 1VHFA 3QGPA 4WIQA 4GRSA 1FXDA 4JB8B 5D0GA 2VA2A 2BVZA 2HQ3A 5AXLA 2O01C 2L08A 3ILOA 2E66A 4Q43A 3M8ZA 3OVAA 5F9LA 1ZPVA 1QE1B 2WCXA 3GIRA 1EB0A 5C25B 2M3DA 5A8RB 3RU0A 4K2XA 1KSPA 3PKMA 5D8HB 3R6LB 4USMA 1T03A 1HW9A 1RLCL 1HWLA 1XTZA 1BGXT 4DR3J 4F7VA 2CJBA 2K7KA 1CQNA 2QLXA 1HFEL 2UUCJ 5KFCA 3V5RA 4U7UK 4YP3A 3MZIA 3NAIA 4OV1A 4ECSA 1HD0A 4CLTA 1L3TA 4DQSA 4UQGA 4CH0S 3H59A 4C7QA 1WOOA 3O1LA 3HP6A 1NM2A 4PABA 2W1BA 4ALZA 1WHXA 7FDRA 1RHKB 2UVWA 4WIIA 4IG3A 4DF4A 3MURP 2K8GA 3UW1A 3PXGa 2G1HA 2YH0A 3PW4A 1D8ZA 3DU5A 4U7UD 3CCSS 4F25A 2YWGA 4U8VA 5DQGA 5DS7A 2ACYA 1M90T 2YPZA 3LP1A 5KFQA 5AXKA 5E0OA 4LBPA 3DI6A 2CJYB 2V94A 2FHKA 1TL1A 2KFNA 4M63A 3NNCA 4OFZA 3TX8A 1S76D 2VDIA 4IO9Q 1F9FA 5KFNA 2HGMA 3TUJC 2D69A 5M2RA 4AE5A 3MUMP 1SUQA 2AX1A 4PG6A 2X51A 4DCOB 2UXBJ 4EI2A 5L46A 3IRXB 3MPDA 1RYSA 1JX4A 2ZBQA 2V8HA 4PYDA 4RW7A 1RKIA 2WB1D 2J7KA 3RRGA 1NH8A 2ZM6J 3J7A1 2B9YA 2VASA 2G0CA 2YNGB 2QA4S 1AFIA 4XTTA 2MTLA 2MSTA 3KMSA 2CYYA 2I6WA 1RT7B 2RF2B 2BQUA 4EBCA 4Y2AA 3LQVA 4UZBA 1YBUA 2ATCB 2QA1A 2BE2A 4O3NA 4G1IA 3DLJA 1VCTA 2CQBA 1WACA 3C6TB 5B7WA 2HBZB 3A3PB 5F3ZA 4YUDA 2CNOB 3JSMB 2YNHB 1NMEB 4KBIA 4HACB 4DX7A 1VRUB 3SFUA 3R5GA 1R8AA 2R8JA 2IM0A 3G6XA 3C2PA 2XMTA 5K8MA 1TUGB 4A4JA 2BJ8A 2XYPB 1C0UB 2LU2A 2FVCA 3P4UB 2W2MP 3OTCA 3QFWA 3PCOB 3TA2A 4CT8A 3B78A 1I94F 2BQRA 4FNIA 5KFEA 3NGKA 5K9FA 3TZXA 1JLGA 3KOAA 1N6QB 2DNNA 1A6LA 1D3WA 4OHXA 5HP1B 3K8VA 1DZ5A 2B8QA 2DGWA 3BGLA 1S7IA 3M8WA 1QAJA 2A6OA 4MIAA 4QW9A 4C11A 1QAIA 3DHXA 1IJEB 1T9YA 2LQJA 2N3OA 4R5PB 2RQ4A 1CJUB 1HPZA 1YITS 1QAYA 3MR2A 3H5YA 4FVMA 2ZH7A 3UO0A 3HFZB 5HAOA 3PR4A 3KLEB 1KFDA 1DTTA 2QLBB 4FPRA 2VF3A 1RYRA 4QJVA 1RTZA 3EGNA 2X1FA 2W25A 3QMQA 4QU6A 2HGLA 3G87A 4O0IA 5GMDA 1Y3KA 3ZZRA 4J9RA 4JI0F 2E1MC 4ZJLA 2W24A 3BBCA 1URNA 4PWUA 3K5OA 3M8PA 2M2BA 2JEJA 1V5VA 1DQ9A 1WF1A 2AJQA 1AB8A 4ED1A 3M6XA 3W66A 2W9BA 5AE1A 3FZBA 4F4AA 1YRUA 1SC1B 2ZH5A 2IM2A 5D4NA 5LSRA 4YEAA 4LF5F 3CW2C 1QE1A 5C25A 5A8RA 1M5PC 3CJKB 4Q0BB 1SKUB 4ELVA 2IBOA 3MAQA 1FDAA 1AA1B 2J9EA 2XLIA 1ZZNA 1JXLA 3MAAB 3THVA 3ZZZA 3X1LB 3QRPA 5HN0A 5B0DA 2H48B 4O44B 4JV1A 4HH0A 3HVWA 3QATA 2BDPA 4A47A 3C66A 3DLKB 4Q45A 2PMHA 1NDCA 1CQMA 4YR3A 2BKOA 4QWCA 2ZDOA 2WW4A 5J2MB 3NMAA 2LYVA 1YDLA 2E9ZA 1FRHA 3TUZC 1REVB 1MMDA 2QLFB 3KUEA 2GIRA 3GJRB 5LL6d 1CVJA 2KT2A 3MPWA 2KT5A 2KZMA 3H20A 3DRRA 4WFXA 4GMKA 4ZVEA 4ZLPA 2F4FA 3ENQA 1WF2A 4HHHA 3RR7A 2VHGA 2LU1A 3PJWA 5AXMA 3NG8A 3MUVP 5L8RC 3GCXP 4ZVGA 2XY7A 3J80U 2WW8A 1C4AA 1AZSB 4RW4A 3PTWA 2POKA 2YNGA 1S1UB 3SXLA 2RF2A 4OHVA 4RUHA 1VYAA 4PG8A 3BGRB 2QYCA 1NHVA 2L9DA 4RU2A 1EAYC 2RB7A 1UPMB 3NCRA 3AY0A 1HNIA 4R8UB 1M5HA 3HD1A 2OPRB 4I2QA 2EFGA 2F8HA 2DHSA 4ZVSB 3KK2B 4ID5B 2CPZA 2YXLA 2GHPA 4LF4F 2R7OA 1VRUA 1WC0A 5SZTA 1Z2ZA 4K4TA 2ZOFA 2JEGA 2RUGA 2DNRA 2VQFJ 2JX2A 3J81Y 3J7AN 2PMWA 1R0CB 5DLGA 4WFAQ 4MIWA 4UOHA 1C0UA 1Q53A 2NXUA 4J37A 5KFUA 1VDHA 2KRBA 4CDIA 3UVJA 3AXMA 3M9NB 5KFSA 4ZCIA 3KK1A 2DH8A 2HVDA 5DQIA 4DOZA 6FDRA 1X4HA 2HYIB 1HBUB 5CYMB 4IKAA 3A12A 1VLOA 2W2OP 2HSEB 4KGMA 4OZ0A 1N6QA 1QUPA 2W4PA 1Z4UA 5KFMA 2E29A 3PW0A 3IS9B 2R7WA 5L1KA 3NP5A 2UVRA 1KVKA 3PRDA 3M2RB 3IRWP 2Z8QA 3DFEA 1CJUA 5KFRA 2CQ4A 1WHWA 2PI5A 4JI2J 4MKYA 2GV1A 4OHWA 3RGIA 3VALA 2H9ZA 3NNAA 2RUSA 1U1RA 3KLEA 1VQOS 3S1TA 1YRTA 2Y1LB 4OJGA 3LUYA 4LFCF 4IO1A 4B3MF 4MYTA 3VGTA 3EYZA 2G0IA 2UUWA 3I32A 3RAQA 4F4YA 3UCUP 1K44A 2OJ3A 4WTOB 2WAQD 3CJ5A 3T1HJ 4MJKA 4NYPA 2J6UA 4M94A 2XQCA 2XGPA 1GT8A 2C2EA 2CPJA 4FNHA 4O4GA 3QT5A 3OHBA 2EFNA 2RE1A 4IRKA 1FFWB 3PV8A 4J9QA 2RKIA 4F26A 2RHSB 4K50A 3CUNA 2F9DA 3CJKA 3OBIA 4Q0BA 3KLIB 2M8HA 4ZHRB 1H7XA 1YJWS 2GQCA 4CNZA 4E8UA 6AT1B 4NMLA 2WSCC 3POTB 4M5DB 2RSQA 2B0GA 2COLA 1UZDA 2DGXA 1JLFB 2EI5A 5KFJA 1T9WA 1NSPA 4DQQA 5K14B 2OTJS 3IR6B 3D66A 3R3TA 1SQFA 3EE3A 5ITHA 3E51A 3QRRA 4O44A 4DV1J 2CJ9A 3EM1A 1G2EA 1UL3A 3GJSB 1JLEA 1SC4B 4B08A 2AU0A 2RAQA 3G9CA 2V67A 3W8PA 3TW0A 3DLKA 1QVFR 2MLZA 3FCVA 2CQHA 2XI2A 3UFCX 2X1GA 4CI0B 4WPAA 5HMXA 5J2MA 4WTYA 4DFJA 4Y2IA 2JRSA 2VB6A 5CABA 1VBXA 1IKYB 1REVA 5F41A 3GLJA 2O3DA 4ZVFA 4A8SA 4C0OC 4AQYJ 2JSXA 2XSFA 3DOKB 2LXIA 2ASJA 2DRAA 4I7FB 4URSA 4ES3A 1CS4A 2QRRA 5HVGA 3US5A 1WC6A 2W8LA 2GIQA 4EU0A 3PACA 4QWEA 2AP6A 4UUWA 4CO4A 2R3VA 2NXCA 3QBCA 2XG8A 1BY9A 4CLSA 2M5YA 4WXWA 1W2IA 1S1UA 2OPSB 1TV6A 4G1PA 2XO7A 1M5SA 1Q1KA 1YJ7A 2HQGA 3VHQA 4DDFA 1ROFA 4TXSA 5F0UA 2FJXA 3HHLB 1IM6A 3PDNA 3CDBA 2OPRA 5LXYA 2IDEA 2KB2A 4RNHA 5A0YB 3LF0A 1VQ9S 5HBMA 1L3VA 3KK2A 3M1VA 4ID5A 3D67A 3PFOA 2WVEA 1SC6A 4ITSA 5ETLA 2QA2A 1JJCB 2LQ9A 2XMUA 3G8QA 3OW2R 3QJJA 2BRKA 3MF5A 4ANEA 4DR3F 1Q78A 1UEKA 2Y8WA 1XIQA 3DU6A 5I3UA 2UUCF 1HBUA 2HFOA 4X65J 4KQZA 5CYMA 1WKKA 2IIHA 3S01A 1VR6A 3SQGA 2GS8A 1ACMB 5G0RA 2MKHA 3DKDA 4QBUA 1B64A 3MM6B 2D41A 5E33A 3WX8A 1WG1A 1TAUA 4JV5J 3DN9A 3AA8A 1VFJA 2LVWA 4RW8B 1PG5B 1NK9A 1QY7A 4OMFG 5EHHA 2VODA 1L3UA 4EEYA 4PR6A 1U1KA 3M2RA 1S57A 3JQJA 5D3GB 4OX6A 4DN0A 1TMMA 2A2CA 2LECA 3DLHA 1E6YA 2HHSA 1FKAF 1FESA 3BZQA 1K1QA 2L9NA 4ECTA 4DQIA 4DV0J 1I6JA 2X7IA 3W2VA 2DR6A 4K59A 1WDDA 3CXCR 2KU7A 1T3NA 2Z56B 4HTJA 4DG1A 3FGVA 4CLZA 2UXBF 5IC4B 3I4PA 3P96A 3V6HA 2A10A 5IT0A 3W61A 3HSJA 2B5JA 1REGX 3H7HB 1M5OC 1M5VC 2MGZB 3H2LA 1TELA 5JMNA 5D4OA 4QIWD 2XYHB 3SSSA 1WEXA 3DRYA 2MQOA 4ZLLA 3RBZA 8RUCA 1NPKA 2CDRB 2C2NA 4FKYA 3MMBA 1NZ8A 4LF9F 4J5OA 2GNKA 4ZHRA 2W7AA 3I55S 4LBHA 1GX5A 4KV8A 2AGQA 3QSIA 1X4GA 3POTA 4OZ5A 1FERA 1NB7A 2FJAB 1S49A 1UVIA 3FMBA 2ROEA 3AJDA 2Y1IA 5AT1B 1ELOA 2W2PP 2GJFA 5K14A 5KG6A 1T9XA 3KUHA 3S6EA 2KYXA 5HROB 2ALZA 1S0OA 4ZVTB 2EW9A 4QCLA 3UDVA 1TTHB 4DFPA 3DOLA 1H2VZ 3ZNJ1 1N32J 1T3OA 4BC7A 3GMGA 3MR3A 1RA7A 1UJ5A 1QDUB 3MM9A 1IKYA 2HMIB 2CQ3A 1XR7A 2H54B 1TKXB 4DV2J 5HI7A 3UD3P 1LWXA 2XWYA 3DOKA 5CHCB 1BHNA 2YX4A 1CPZA 4I7FA 3W8GA 3OJSA 4QPTA 3PYEA 3K58A 3UN2A 2EKYA 3H40A 4HH1A 4HI2A 4KYZA 5E3CA 2VD3A 1V3SA 5KG7A 4A8QA 1RAIB 2R8HA 3SMZA 3I0RA 4HI1A 3X3UA 1JIHA 3CD6S 4RW9B 1LWFB 2OPSA 1F0XA 2NXEA 4J9VA 4L72B 2KHCA 2XMVA 4L6V3 4TQSA 1G4CA 3BPDA 4JI6J 2RILA 3R2CJ 3HHLA 2J9CA 4ZITA 1FHTA 1TFWA 5A0YA 1Q8KA 4OZ1A 4CLUA 3EPGA 4PQUB 5ETPA 2J8SA 2BJDA 1FTCA 4ZN1A 3H5XA 1YJVA 3BDPA 3G82A 1NXIA 4WFNQ 1RWKB 5D0EA 5L38A 2XS5A 2GCFA 2PEBA 1IN0A 3CC4S 4P52A 2ZITA 4N77A 2UUBJ 3O44A 4IQMA 2UU9J 5C42B 4N8OA 4KGVB 1RDRA 2LQ5A 5KFAA 3IWLA 3G8SA 4PWDB 3OV7A 3IMQJ 4DL4A 2DPIA 3MM6A 1RE1B 2UVVA 3ZC4A 5F0WA 4X4OA 2YKQA 3BQ0A 4CO0A 4RW8A 2FY8A 3ET6B 1JQGA 4KO0B 3O3LA 4P10A 1FVSA 1GXUA 1NJXA 5KFTA 4P7VA 2D3OR 3FJ2A 2U2FA 4NLVA 3TI0A 4ED7A 4LR7A 2AYBA 4KTQA 5KT2A 2YBVA 2BW2A 1IUJA 2HNZB 2XHCA 2HK2A 4DSEA 1R3NA 2VPYB 2J76E 3P8BB 3Q2SC 1N36J 1DURA 5KG0A 2VV5A 1H7WA 1U1QA 4LJMA 5HVFA 2KXHA 3UWTA 3EX7B 4ZOSA 3ZTQA 4DS5A 5I42A 4AT1B 4KFBB 2XC9A 1OQ3A 1XR6A 1SJQA 5GMEA 5KFOA 4DFKA 1D9DA 3FDSA 2MGZA 4NZ0A 4CM0A 4CZCA 4HT5A 5HMZA 2OAUA 4O23A 5LXRA 3K0JA 3IXQA 4JBCA 2QE5A 3W7BA 2B43A 2OEKA 3ENWA 4M5IA 3Q83A 2OFGX 1YHQS 3VZHA 2PD1A 2MB0B 3C8YA 4K4VA 4UZCA 1KBRA 4NRUA 1MG7A 2I1RA 4YMEA 2DNQA 4R0JA 3BB5A 1EKRA 4A8XA 4LRAA 3BBFA 1MWZA 2VQFF 1Y00A 4DLEA 2V9KA 4EBEA 2XI3A 1N33F 1RUSA 1F5AA 2OIHA 1NK5A 3CF5Q 1AFJA 1WJ9A 5D4LA 1RT6B 5HROA 3W9JA 5EX0A 2F4VF 3DRPB 2HWIA 1WI6A 4TYBA 3PJXA 1UWAA 2DGTA 2VPXB 5HQLA 2OEMA 4Z7YA 2OH2A 3RUBL 4IOAQ 2F8MA 1FCAA 2CIMA 2MY8A 3FBCA 2LFVA 2ATLA 4OI2A 3SDEA 1B7FA 1VLYA 4NRTA 4F50A 2KYZA 2ZH9A 6FD1A 4DV4J 3HULA 4DPUA 1AXQA 3GPAA 3W62A 1IXKA 3BSCA 2YX1A 2E5LJ 3DLLQ 5D77A 3BO3A 1HBNB 2DNKA 4DR7J 3LP0B 2PFDA 2ZZNA 4JI2F 3IWXA 4M5GA 3T9NA 2J0WA 4OV6A 1F2HA 3I5CA 3OR1B 2DVIA 2BABA 1T95A 4P2SA 5SUHA 2ZJPQ 2JVOA 4RJVA 1X9MA 1UCNA 3ITHB 4RW9A 4NWBA 3K59A 1QAXA 1LWFA 4ZPVR 2WZ1A 3TVYA 1CSJA 2R7XA 4FF2A 4RNMA 3NRBA 3H90A 2IA6A 4FYDA 3UI3A 4AFFA 1HBMB 1FRKA 2DNOA 2L41A 3KMQA 3BBBA 2VQEJ 1KEKA 4PZVA 3IO1A 2OPPA 1P9YA 2UZAA 3VAGA 1VK3A 3SCIE 3J81j 4PQUA 3BKFA 2FVQA 2BQ3A 1HI1A 2VG6B 2ZH4A 3M8SA 2WONB 3D0HE 1FX4A 2HNDB 2IRXA 2XBPA 1O0PA 1Y0HA 3FRYA 1J5EF 2MLYA 2RU3A 1HQ2A 2AT1B 3NEKA 1IWAA 3WIVA 5B0FA 1CC7A 3BSNA 2KO1A 1MWYA 1HWKA 4NA2A 4K4ZA 2KM8B 3HI9A 2FVRA 3J81U 5C42A 2FHJA 1CJTB 3KLGB 3D5MA 3RAXA 3TVZA 4PWDA 4B9LA 1UPPA 2MPUA 5D4PA 5C5JA 2C3UA 4JI5F 2HVHA 4J91A 2B51A 1OS5A 1PAEX 1TQLA 3KJQB 1R31A 2AEMA 2C3MA 5E3AA 2QFJA 4GO7X 4NCGA 1BQNB 4LRDA 3L3CA 3ET6A 4KO0A 4MYUA 4C8ZA 4BHQA 2QL5B 5LT5A 4J9PA 4I4BA 3SYZA 2HRTA 4YB7A 5JJBA 4DCPB 2LKZA 1G1XA 5J2QB 3K89A 4G6VB 3KWMA 5BR8F 1SJ3P 3VVUA 1XMBA 1NSKL 3OSNA 3W64A 3CIZA 4ECUA 4NZ7A 4AQYF 2HNZA 4Y65A 4NI2A 3HM9A 3PRBA 1ZAXA 4YN3B 4X62J 3D9BA 5C2GA 1FRIA 2XS7A 1JLAA 3AD7C 2FY1A 3NBPB 2BUNA 2KG1A 3D2WA 3KNGA 2XLKA 4KFBA 2R8KA 3BREA 4S0MA 3M4XA 5M2UA 2QX0A 4KE5A 3GR1A 5K8PA 3CVKA 1T8EA 5KFVA 4P75A 3U7JA 3V6KA 2MQLA 1Q82T 3PIPQ 5KG5A 4NLPA 3MMCA 3ZZOA 4W4MA 2GO8A 3C16B 4MKAA 2HVZA 3MEDA 3BKUA 2NS1B 3V2UC 2IVYA 3CDAA 3E01B 2VZ9A 4XPEA 3D3BJ 2PGCA 1RT3B 3SI8A 4CLKA 1N5YB 4PXDA 3ISND 4LR9A 3OQ2A 1XERA 2CUYA 4USTA 3BO4A 4O4RA 4DZ6A 4PG7A 3G86A 1F5CA 1S0MA 2OSRA 5J1EA 4K4WA 1RT6A 3JS9A 2MZJA 4QYRA 5KT6A 2MQNA 4F3OA 3DRPA 2IYIA 4ED5A 2GVZB 4X65F 1NDKA 5DQHA 1NK8A 3TQ1A 3M2VB 2K7JA 3R5BA 4EYHB 1S6UA 5GADU 3TO8A 3G8TA 1R8PA 4E0DA 3P5TL 4JV5F 1R6VA 4HYKA 2CWXA 1OWXA 5D0RA 1F3VA 1YGYA 3MHYA 1HBNA 3QT7A 3MM7B 1NEEA 5CCLA 3U1NA 2MHNA 2YKNB 4DV0F 1RT4B 2WBMA 2Q43A 3OTOJ 2LLZA 5JVHQ 2W7OA 3H25A 3O6QA 3OR1A 1NAQA 1S4FA 3PR5B 2G2ZA 4IG0A 3K8WA 2H5IB 1KHVA 9ATCB 3UDEA 3EDRB 4WKRA 1LOUA 1TVRA 4CTAA 2BRLA 4B3OB 5GAGU 4CH7A 5IWAJ 1C4CA 3A4TA 1Y5IB 1S9EB 1MLAA 2GJ2A 4B9VA 2D74B 1HBMA 1RQ0A 4EBDA 2FHJD 2AGPA 1G7CB 1R8CA 3PW7A 1BD6A 2M4MA 5J2NB 2PO4A 4ZPCA 3I56S 2FZGB 2ZD1B 2OLWA 1J5OB 4UY85 1KTVA 1R27B 5B0CA 2VG6A 3OR2B 2WONA 4NXNJ 2VBXA 2CPDA 3NL0A 2HEKA 1EX8A 2BM1A 4WE1B 1FE4A 4XO0A 1PSDA 1FDBA 2EEYA 1QD1A 2V4JB 4WP9A 3NKYA 1RWVB 1U8SA 5KG3A 4LRBA 4WU2A 4WF9Q 3HHLC 4FPIA 3L7OA 3OTDA 4X4NA 4TU7A 1GEHA 4M5HA 4RUBA 2C2OB 3Q89A 1DJ0A 2FVPA 1DARA 4Q7AA 4V1Ak 3IGNA 1OYDA 4I64A 2CPXA 4CO5A 1ZM9A 4PUOB 2PFFB 1N32F 3HSDA 1RTDB 4RW6B 4CO2A 5J2QA 2C2DA 1FNOA 3NMRA 3T1YJ 4OI0A 4DV2F 3SZ2A 2ZWPA 2GFFA 2DISA 1YJUA 2MJNA 4UF4A 3QWUA 3BKTA 1N54B 1I3OB 3NGTA 4KPCA 3IR7B 3OUYB 1RWMB 2QMUB 2YWWA 3Q8UA 4Q5VA 5DGBA 1WG5A 4E98A 1HLWA 4X4TA 1YJ9S 2XZDB 2HFZA 3RYLA 2X3DA 1VOMA 4YQWA 2PEHA 1RT5B 3R5CA 1O51A 3MOZA 4JI1J 3R6GB 2E9TA 4JYAJ 2A6MA 1VS3A 3I0SA 1U09A 2NPIA 1G6BA 4M1KA 5DM7Q 4OI3A 1BC6A 2W8KA 5IZHA 1X31C 3MEGB 5I3PA 3MEEB 4JI6F 4M5KA 1KVJA 3C16A 3JSRA 5EX3A 2J6SA 1RTHB 2XS2A 3ZXWA 1RBOB 3BV8A 3GIIA 1HBOB 4RZRA 3E01A 4JV0A 1RT3A 4DPYA 4MFBB 1N5YA 3PEHA 3TJ9A 2N7CA 2PA8D 2B6AA 4IDKB 4X4VA 3JSYA 2BR0A 1SJ4P 4USHA 5B09A 3JXOA 3GSDA 4J9MA 1FRMA 2M8DB 2CKWA 5ETRA 3BJYA 5J2PB 5KFGA 2LQBA 3MM5B 3OXFA 4QIEA 3MCSA 2UUBF 1VQ8S 2ZUAA 1ZYQA 2UU9F 2E7XA 3G71S 2GVZA 3CCZA 3DMJA 2NYHA 1XMOJ 2R9LA 5B08A 5A8KB 3N01A 2DJWA 2V69A 1N5VA 3SSQA 1WHVA 2AKWB 4M5JA 1N0VC 3PO4A 4F0MA 1G3OA 2EBGA 1KQKA 4X66F 2J5AA 2F1FA 4DCJB 2ABYA 1ZA1B 1H72C 3DYAB 4ZPDA 3NGSA 1FNXH 2Q3PA 1HHTP 4LSNB 3ZFVA 1WNEA 4MAKA 2VOPA 1RKJA 1W2BR 1N34J 2RQCA 3RZAA 5HANA 3OHAA 1GMUA 1WI8A 1Y9OA 3M9MB 2MKYA 4M95A 4MTPA 3M32B 4TKTA 1NPPA 1HKAA 2QL9B 2CQGA 4KHMA 5A2QU 1KC8T 1N36F 2QMWA 1NJIT 2JWNA 1CEZA 4TN2A 2GZOA 2A3JA 4B3OA 4CLPA 1JLQB 3MCMA 2RRAA 3DGPB 2O5DA 3D4JA 3ISNC 1S1VB 3GZ7A 4AYBD 2GGPB 4BLGA 3E3XA 1Y7PA 4D3GA 2HQCA 3PJ9A 2RT3A 4DS4A 3D1QA 4LF6J 3M6VA 5C2CA 3V81B 2ZD1A 4HEA9 4WU3A 4NASA 4C9DA 2DTJA 3ETOA 4DFMA 1EARA 3IA0A 2FC8A 3D7SB 3OR2A 4DQRA 1MSWD 3V4MA 1Q81T 4ZIWA 3RBDA 4HTIA 1F5BA 2V8GA 4DJBA 1TP7A 4ES2A 4YB6A 1XBWA 3AB4B 2V4JA 3C46A 2ZH6A 1X4EA 2EKNA 1SJFA 1B70B 3K17A 1LK5A 3TRGA 2VA3A 2ZOGA 2YWFA 4X4RA 1RHRB 1S5ZA 4JI8J 2BMBA 2DBBA 1GK8A 3V6JA 2HS3A 2K1RA 5LJ5Y 2JEIA 4ZJOA 2EBEA 2M7SA 3WDOA 4DPWA 2DR9A 3DOMB 4PUOA 4NEZA 1EJ7L 1X4BA 2QLJB 1R8BA 3A8JA 2HQFA 3QAUA 4RR5A 1I5OB 5KFFA 1U25A 3CCMS 3RW6A 2CQCA 5LJ3Y 3V6DB 1DLOA 3BSAA 4DV4F 3U27A 1Q5VA 2HZVA 3QIPA 2K3IA 1BQMB 2PI4A 3KLFB 4PXEA 2XCPA 3OTEA 3HSZA 2YH1A 2LP4A 4UQTA 2PIIA 3PKYA 5ETMA 1ZTTA 2RDDA 4WYLA 3MCNA 5KAKA 4CO1A 4DR7F 4ZLNA 3FBFA 3KHGA 1MN7A 3T5LA 1F9HA 1WOPA 2E1PA 2MQ8A 4KH0B 1RT5A 1X5PA 4OZJA 5LM7E 5B0GA 1BLUA 2Y0SD 4B3MJ 3MD1A 3R27A 3N6MA 1FJCA 2GO9A 1YQHA 3MEGA 1UFKA 4DX6A 2JLFA 3MEEA 4OX9J 1WTFA 2VQEF 3CO0P 3CCVS 5KFPA 4NLWA 4ZP6A 2C1EB 4DV3J 1Q7LB 2BANB 1NU4A 2HZAA 2O1PA 3FVYA 3LAMA 2V8PA 4EWTA 1X4DA 1UA1A 4DUYJ 3CJ4A 4LREA 5GADI 1H2TZ 4MIBA 4C3KA 1SI9A 2JHEA 1Q86T 2KHDA 4DPXA 3LO3A 3FEXB 2H5JB 3T5JA 4J9LA 5E7OB 3DRSB 1Q95G 1HQEB 2MXYA 2V50A 3MM5A 3W2WA 1VQ7S 1NJWA 1OMSA 4OYBA 3FBEA 3IC1A 2BOPA 3QO9B 4LT6A 4NMXA 1GAOA 1EETB 4DBQA 3OFEA 1TUWA 5GAGI 4ECWA 2AW0A 5BXIA 4F4XA 2VKZG 2NREA 1K47A 4CM2A 2IDLA 4F4KA 2CWKA 3B4DA 3SCLE 4A8YA 1TMJA 1NHKL 3PX4A 4V19X 3UR0A 1WTBA 4NZ6A 3THPA 3K7RA 4RWWA 1TAQA 5U47A 1URRA 3M32A 1WC5A 5ADZA 4NCBA 2NSBA 4X62F 4B9NA 1RZMA 3OXGA 2Y8YA 1IBMJ 1S1VA 2W9CB 2HHVA 2CPFA 5LOQA 4FXVA 1XMQF 4P7TA 2KFYA 3VR1A 5L1LA 3DDIA 1RCOB 3ZZTA 1DTQB 4TY8B 4H4MB 4ANCA 2HIYA 1R0AB 5HVHA 2OP5A 3HXMA 2KXNB 1L5UA 1JLBB 2P2CB 4MK7A 2Y3YA 3SCKE 3UQSA 4WFBQ 4ZP8A 5ETKA 2F40A 4NLYA 1IKWA 2IC3A 3TYTA 2R2TA 4ZVOB 2N4CA 2QV6A 2HFNA 5KT7A 3KHLA 2RIJA 2R7UA 3HZGA 2C42A 3FEYB 5M2PA 4U9RA 3DHWC 5KG2A 5EGYA 1KLNA 3TNVA 4N41A 4NLSA 3TP2A 4M5NA 1C2PA 2Y0BB 4ZVPB 2DNLA 1FTRA 1S77D 5HL7Q 2R7TA 3KFWX 1GTHA 3W9IA 1U02A 1KLMB 2PSZA 1UVNA 3PHTA 2GMJA 2IJNA 1HNZJ 2NPFA 5BYRA 2M70A 2V68A 5KFHA 1ZETA 3EPIA 3VF0B 2UXDJ 3RBXA 2QJ3A 4K5SA 1A7GE 4PAAA 4RUCA 2KM8C 1BQMA 7FD1A 3C3LA 2KJVA 2BA9A 3PVXA 1C0TB 2W7PA 3I5BA 5KFZA 1B7YB 2OTLS 2R7QA 4JI3J 1U0HB 3AQPA 2BJEA 4RUAA 2ILYA 5KFKA 2M9KA 4ED3A 2OO4A 2CG4A 3OTOF 1NSAA 3W9HA 1UJ4A 4ZPAA 2H5EA 1S97A 2WK4A 1WORA 3MI7X 3CJTA 1WSVA 1LEOA 2AJ2A 1LW2B 4XIUA 3H2VE 2J9DE 1SQEA 5IWAF 1Q4RA 1KWMA 3IG1A 3F73A 2I2YA 2BBEA 2K3KA 2MKCA 2MZ1A 2IHR1 5CAAA 1HQUB 1X5OA 5H1SV 2I38A 1XWLA 5GAEU 4U7CA 3QJPA 4J9UE 1B0PA 3IBFB 2HURA 1LFPA 4KKOB 4OZ3A 1X60A 4J9SA 5F8LA 4ED6A 2H51B 4NXNF 1UMJA 1KVIA 3WZ0A 3DM2B 1RGVA 1DRZA 3FBBA 3GR0A 2Q6BA 5B0EA 4LF9J 1H3DA 2YKPA 4JI4J 2HHPA 3R2DJ 1HQEA 1F3FA 2V34A 4I6YA 1RAHB 1TZ0A 5K8OA 2HBRB 3C19A 3MM8B 3ZNUA 3ZZYA 3BR9A 1EHWA 4BDPA 1CJVA 4NL5A 2I0XA 3M2UB 4DWIA 4DF8A 5EDWA 2J6TA 3EVOA 4K4SA 3PY8A 3ENAA 4Y3CA 3H4BA 1TL4A
chains in the Genus database with same CATH topology
2HHUA 5L1IA 3MEKA 1WEYA 3MM6A 3CD5A 2MQPA 1JB0C 2D1CA 3EGZA 2UVVA 4YR0A 1FJEB 2MZQA 5JXSA 5F0WA 1VRTA 3PEJA 3ZC4A 2YKQA 3DOLB 2JZ5A 4X4OA 1ULRA 3BQ0A 4B9SA 1NO8A 2E5GA 3NS5A 4DMZA 4YB1P 4HLBA 4CO0A 4OLPA 1SV5B 4RW8A 1JKHB 2YNFA 5T7LA 3VTIA 2ZE2A 1U45A 4KO0B 5DRKA 1S10A 3P49B 3O3LA 2FJWA 4FF3A 3VAFA 1L3SA 3MM9B 2V2KA 3MMAB 3OFHA 3SV4A 1FVSA 3T1YF 1GXUA 2E5LF 5E3PA 2JH3A 1NJXA 1RTIA 4HDHA 1OPZA 5DDRC 5KFTA 4P7VA 2E5JA 2D3OR 3FJ2A 3FFIA 3N6LA 2U2FA 4NLVA 4PXBA 5F9NA 3TI0A 1UEUA 2KG0A 3GFZA 3CE8A 1WF0A 4F8RA 2DNZA 2BZ2A 4NA1A 4YB5A 2IRUA 4ED7A 1OSCA 3MR5A 5CYQB 3NS6A 3GV7B 2AYBA 2RMLA 2VFRA 4DUZF 4KTQA 5KT2A 3LP0A 2QMXA 2BW2A 3ZZPA 1EP4B 3BS9A 1KQGB 1IUJA 2BM0A 2HNZB 4W90B 2V8DA 3CPWR 2VFTA 4IFVB 3DI6B 4DSEA 3DLGB 4URQU 2Y1JA 1R3NA 5KFXA 2VPYB 2J76E 4DN9A 3CMAS 1TL1B 2IM3A 3Q2SC 3KHHA 3OLAA 2XY6A 1DURA 2L48A 1LFWA 2ZBIA 5KG0A 2VV5A 3NAHA 1PO6A 5B0AA 1HWJA 3KK3B 2HLTA 1H7WA 1U1QA 2AJ0A 4Y2KA 4LJMA 4C8OA 4JI1F 1C1CB 2AF6A 1P1LA 4OJHA 1S9FA 3ITHA 4JYAF 4YOEA 2KXHA 5IT4A 1K8AT 1D8YA 4B3SF 1FEHA 3UWTA 4O3RA 3EX7B 4ZOSA 2KFZA 3T6BA 3I0RB 4DS5A 2E1AA 3VAJA 3IG1B 2NUUG 2EK1A 3RR8A 5I42A 3HF5A 4NLGA 4KFBB 3CB4A 2AJ4A 3QWPA 1VQLS 3T5HA 1JNRB 3HFKA 4DR4F 3IFEA 4AL6A 3N5BA 2MKJA 4MH8A 2XC9A 4RW7B 2E7WA 1OQ3A 1LQ9A 1XR6A 2NYIA 3VAMA 1SKSA 4DPOA 3GIKA 2L3MA 1SJQA 1HYSA 2ROPA 2C2RA 5KFOA 4IFYA 5DG9A 3CC2S 4QR1A 1UA0A 1VGYA 4DFKA 2LEBA 3FDSA 1D9DA 2MGZA 4TY8A 4Y0FA 4NZ0A 2QA4G 4H4MA 1S1TB 5CZVA 2DH9A 1R0AA 4JUZA 1V3RA 5LSOA 1UFWA 5AJ3F 4EZ9A 2DO0A 1VQKS 1JLBA 4CZCA 2YX7A 2DHGA 2M0GB 4HT5A 3NWGA 4OJ1A 5HMZA 4A8MP 2GMHA 3CGIA 2OAUA 3K2YA 3Q8PB 1TR0A 2D7SA 4O23A 1B0VA 5LXRA 3K0JA 3IXQA 4JBCA 2QE5A 3W7BA 1DQ8A 5F8IA 2XHWA 3G96A 4WJBA 2XSJA 2HQIA 2B43A 2KZZA 5FJ4A 2VFSA 3ENWA 1RK8A 5HMWA 5IQQA 2KKHA 5EWGA 5D78A 3CWJA 4DV7F 4A8WA 2OFGX 3N28A 2C28A 3F44A 3VZHA 1YHQS 2PD1A 2ZHBA 2OSQA 2BE2B 2VG7A 2HNDA 3MD3A 3KJVB 3KHRA 4FS2A 4QYZJ 2MB0B 3C8YA 4C0BA 4K4VA 1KS2A 5T14A 1TKTA 4WYWA 3N6NA 4RLEA 1RT1A 2DNMA 4BWJA 4NRUA 2ZUGA 1IKXA 4LSLB 2RRNA 5CA5A 2I1RA 4N76A 4YMEA 2DNQA 3Q8RB 4R0JA 4DL0C 5AE3A 2ADBA 1N5TA 3OL6A 3O8WA 3BB5A 3DDKA 4PPDA 5F8MA 4A8XA 1FJGF 1FE0A 1BWEA 5CXTA 5D6GA 2ZH2A 4GKKF 4X64F 1MWZA 2VQFF 1Y00A 4DLEA 4H4KC 3J7YU 4ZCLA 4AXJA 1SIWB 5A8WB 2HLUA 2V9KA 1U2RA 4EBEA 2B7CB 2ZNYA 3Q23A 2XI3A 1N33F 1R8HA 3KLGA 1F5AA 4IH6A 1PC5A 2OIHA 4N47A 1NK5A 3CF5Q 1ZOTA 1AFJA 2GJIA 1IQZA 1ZPWX 5D4LA 5F8HA 1RT6B 5HROA 1XMOF 4C8LA 5EX0A 2F4VF 1FT8A 4DSFA 4PCQA 1XNQF 2DR8A 3DRPB 2HWIA 1WI6A 1TUVA 4TYBA 3PJXA 1B0TA 4ID8A 2DGTA 3TVKA 1YWXA 2YKMB 4GC7A 2VPXB 2CQ0A 2ZFHA 3HHEA 4TU9A 1BQNA 2KN4A 2OH2A 3RRKA 1NHUA 2NR0A 2JC1A 1HARA 3N4WA 3BO2A 2GQ2A 3HKZD 4LQ9A 2F8MA 1FCAA 1Q79A 3UD4P 1SL0A 1QM9A 1H98A 1U2FA 2CIMA 2EFPA 2MY8A 3FQLA 3LP2A 5T7LB 2ZE2B 3TAMB 3PFEA 4F67A 3RRHA 4DL7A 1U26A 2R2UA 1ZAWA 2ATLA 4OI2A 3SDEA 1B7FA 1VLYA 4NRTA 3O2IA 2JFDA 4F50A 4CNYA 2KYZA 2ZH9A 1T94A 2QO3A 3HKWA 6FD1A 5DGAA 1C0TA 4MMOA 4TLRA 3VWSA 1S0VA 3EUNA 3LAKA 3LPYA 4ILLA 2A18A 1S6PA 1LW0B 1AXQA 4LIRA 2DT9A 2FLPA 1KQFB 1IXKA 3M9OB 2YQ3A 3BF4A 1GX6A 3BSCA 2YX1A 2VC0A 2DGVA 1NKEA 1TK0A 1N34F 1HR0F 3OJUA 2V4QA 3DLLQ 1XEZA 2EC0A 2FJDB 3GIJA 1CG2A 5D77A 3PX0A 2MKKA 3BO3A 1HBNB 1H6KX 5CD4H 3PO5A 3UNGC 5L9NA 2DNKA 1PGZA 1AROP 4C11B 1FRLA 3M8QA 3K5MA 3LP0B 2WBRA 2EFQA 1S6QA 2J0SD 2ZZNA 5CH7B 1X7VA 1DBDA 3FEZA 4TYAA 2ZC3A 4JI2F 4NXMF 3IWXA 2C22A 2G9OA 3RAMA 3GV5B 2ZOMA 3T9NA 2J0WA 1U6BA 1FO1A 2DGOA 4DHVA 2LXUA 2RU9A 3I5CA 3OR1B 3KYLA 1LW2A 2DVIA 2BABA 1NZAA 1T95A 1QSYA 3ICLA 2DGQA 3AAWB 2AJFE 4I69A 4P2SA 5SUHA 2ZJPQ 5GVQA 3QPIA 2JVOA 3NBPA 4A8OA 5E2QA 3U1LA 1X9MA 3ITHB 1DTTB 3J80Y 2IBKA 2IYGA 4NWBA 1HHSA 4RW9A 3BR8A 3K59A 1NNDA 1FA0A 4HDGA 2XMJA 4QPXA 1QAXA 1LWFA 2MZTA 2RDIA 4ZPVR 3J7Z5 4RNOA 1O8BA 3IRXA 1M5KC 4ILMA 4J9KA 4A8KA 3TVYA 2ZM6F 5I42B 1CSJA 4RNNA 2R7XA 3K5NA 4FF2A 4RNMA 3ONQA 2CPIA 3B8HA 3NRBA 1D0EA 3IWNC 1R89A 2IA6A 4FYDA 4F3MA 1UVMA 2MHEA 1V3ZA 4HHJA 3UI3A 1FDDA 1HQUA 4AFFA 3S8SA 1VQ5S 1HBMB 1FRKA 2DNOA 2RNEA 2L41A 4LF6F 4IFYB 1QUVA 3KMQA 2Z2MA 2IVMA 2R2SA 1GQEA 1KEKA 4EZ6A 3TA0A 4QZVB 3L7PA 3MR6A 1YIJS 2GHVC 1KN6A 3IO1A 2OPPA 2XMKA 2F8EX 1ZTWA 2FJVA 3DLEB 4X4SA 3OL9A 5KT5A 2UZAA 5E5NA 4TNOA 1NH7A 2IMWP 2LCWA 1RT7A 1GNKA 4ECRA 1L3KA 1X9SA 3VAGA 4O3PA 1VK3A 2CVEA 2VPWB 3SCIE 3M8PB 4PQUA 2FVQA 4CIOA 1IKVB 3DM2A 2BQ3A 2XGQA 2XSJB 3MFIA 1VHFA 3QGPA 1HI1A 3MMJA 2VG6B 3OVBA 2JOQA 4A46A 1ZH5A 4IOCQ 2ZH4A 2QSWA 3M8SA 1FXDA 2JVRA 3AJ2A 2DR7A 2WONB 4PKDB 3D0HE 3AQOA 2VA2A 1J2VA 4TY9A 2YKOA 2HNDB 3AH6A 2BVZA 2HQ3A 2IRXA 2QIFA 2XBPA 3MGJA 3C6TA 5AXLA 4C4WA 4I2PA 1O0PA 2O01C 2L08A 1R6YA 1Y0HA 3FRYA 2OPQA 1J5EF 1TL5A 2RU3A 3VAKA 2E66A 2MY7A 4Q43A 1WEZA 5C24A 3T6JA 2JL9A 4XK8C 1S48A 3OVAA 3F41A 1VQPS 5F9LA 3JSMA 4ECYA 5B0FA 3HX9A 2YNHA 1CC7A 1ZPVA 2HHTA 1QE1B 2WCXA 1OPIA 5C25B 2MQQA 3BSNA 4DQPA 4HT7A 3MM8A 2M3DA 5A8RB 2KO1A 4NLOA 3RU0A 1MWYA 4K2XA 3AHPA 1KSPA 1M1KT 1HWKA 2JEFA 3PKMA 5G4DA 3OVSA 4NA2A 5D8HB 4K4ZA 2XCAA 1FNMA 2B3TB 2KM8B 3HI9A 2FVRA 1T03A 1HW9A 5C42A 1U49A 1XTZA 1HWLA 1BGXT 2FHJA 4Q44A 3KLGB 3D5MA 3RAXA 2XMWA 3TVZA 4NYOA 1FK9B 2DHAA 4FP9A 5KOXA 4PWDA 4B9LA 4QIVA 2MPUA 3JAMY 3CC7S 5D4PA 5DDOC 2CJBA 2K7KA 5C5JA 1CQNA 2C3UA 2QLXA 1LKZA 1HFEL 1PILA 2MZSA 3I96A 3IAM9 4JI8F 4JI5F 2HVHA 4BCAA 2ZHOA 5KFCA 5A6PA 2B51A 1OS5A 4N8NA 1HWUA 1TQLA 4U7UK 2KT3A 3V5RA 4YP3A 3MZIA 2AV5A 3UDLA 5MAOA 3NAIA 2R8GA 4OV1A 4I6AA 4Q2LA 1E6VB 1ZBTA 1HD0A 4ECSA 1R31A 2FHMA 1L3TA 2C3MA 3M2VA 5E3AA 4TQRA 2UXCF 4DQSA 2CFXA 2UVUA 4UQGA 4FZVA 2QFJA 3R1LA 2MMYA 4CH0S 2B7BB 4GO7X 1YTYA 3H59A 2N7YA 4NCGA 2DRBA 4C7QA 4LF7F 1BQNB 1SV5A 4NPOA 3L3CA 2HHXA 3O1LA 3KKFA 2CQPA 2JJ4D 4KO0A 4MYUA 1TL3B 2YNIB 4ZA1A 3HP6A 5CQGA 4C8ZA 4BHQA 2B4PA 2KDOA 4ALZA 4FS1A 5LT5A 4J9PA 1WHXA 3PX6A 4I4BA 1U6FA 7FDRA 1LWEB 3B4MA 3SYZA 3SDEB 5HLFB 1HWIA 2UVWA 4WIIA 4IG3A 3QLHB 4M8LA 4YB7A 3MURP 2K8GA 4DF4A 5JJBA 1WG4A 3UW1A 2LKZA 1G1XA 1MNEA 3PXGa 5J2QB 5KG1A 5HP1A 3UE2A 1S6PB 4QR2A 4IUFA 2YH0A 4G6VB 3PW4A 4UOCA 1D8ZA 5H9EJ 3P6YC 2HPUA 3DU5A 5B0BA 3KWMA 5BR8F 1SJ3P 4OZNA 2XMMA 3CCSS 1XMBA 2JLEA 4F25A 2YWGA 4KAIA 5DQGA 3JYTB 3OSNA 3MM7A 5DS7A 2ACYA 3CIZA 2D9PA 1NJYA 3LP1A 4ECUA 1M90T 4NZ7A 1EP4A 3R5AA 5KFQA 5AXKA 4AQYF 2HNZA 2YKNA 5E0OA 5A2QY 1WELA 4JOUA 4Y65A 3M8QB 2RQMA 4IFVA 3DI6A 1N4LA 3DLGA 1RT4A 3HM9A 3PRBA 4R5PA 1NK6A 4OHYA 1ZAXA 2V94A 4GC6A 3MTKA 2FHKA 1TL1A 4K4XA 3VQTA 2KFNA 4M63A 3NNCA 4OFZA 3FRZA 2AQ4A 3TX8A 2O66A 1S76D 4IO9Q 1F9FA 5KFNA 2HGMA 3TUJC 5M2RA 4AE5A 1C1CA 4WK1A 3MUMP 4ED2A 1FRIA 2XS7A 1Y3JA 1JLAA 2FY1A 1SUQA 3NBPB 2AX1A 2BUNA 2KG1A 4PG6A 5GAHU 3D2WA 2X51A 3KNGA 2HW3A 2XLKA 1FRJA 3DCAA 4KFBA 4ERDA 3IRXB 2R8KA 3BREA 1RYSA 1JX4A 1S9EA 2V8HA 4RW7A 2R4FA 1RKIA 3M4XA 1Y5LB 2WB1D 5A6WA 2J7KA 1S72S 3E2EA 5M2UA 4XDDA 4KE5A 3GR1A 5K8PA 3RRGA 2WHOA 1NH8A 3CVKA 1T8EA 5KFVA 3J7A1 2B9YA 3IAS9 3U7JA 2ROGA 4OX9F 3V6KA 1S1TA 2MQLA 1H0HB 2VASA 2G0CA 1SKWA 5J2NA 2YNGB 2QA4S 4QU7A 1LWCB 1AFIA 4DV3F 1Q82T 3PIPQ 5KG5A 2HHWA 2R8IA 1IBKF 4NLPA 3MMCA 1GXLA 2OPPB 1QTMA 2DK2A 2MSTA 3KMSA 1J5OA 3ZZOA 2CYYA 1MW7A 1RT7B 3U1MA 2GO8A 2RF2B 2XB2D 4MKAA 4Y28C 2HVZA 2BQUA 4EBCA 2HRYA 4Y2AA 3CJ0A 3LQVA 3MEDA 1U1PA 1UVJA 4F2SA 1VQNS 4DUYF 2NS1B 2IRYA 2QA1A 3V2UC 2IVYA 3CDAA 2BE2A 3KJVA 3E01B 2VZ9A 4O3NA 4XPEA 4G1IA 3OFGA 4ZVHA 1FEEA 3DLJA 3CCES 2PGCA 3NCQA 1RT3B 2GQQA 2CQBA 3SI8A 1WACA 1N5YB 2KXFA 1N0UA 2J7UA 3MPYA 4PXDA 3C6TB 4LSLA 4CQ1A 5B7WA 3ISND 5K5MA 3CCUS 5F3ZA 5F8GA 4QQBA 4WE1A 3OQ2A 1XERA 4YUDA 2WOMB 2FJBB 4L3NA 4X4UA 3UPFA 3MXHP 3D54A 2EVZA 3JSMB 4ECQA 2YNHB 3BO4A 4TLQA 4KBIA 4X4QA 1SB6A 4TU8A 1VRUB 4O4RA 1YI2S 3SFUA 2C3OA 4RBUA 4WKYA 1YJTA 4PG7A 1R8AA 2R8JA 2LDYA 3G86A 1F5CA 1S0MA 3PW2A 2OSRA 2IM0A 3G6XA 3C2PA 1JNZB 2XMTA 5J1EA 4U67Q 1RT6A 4N5SA 4K4WA 2MZJA 4QYRA 5K8MA 5KT6A 2VL1A 3Q2TC 2V4RA 2MQNA 4JV2A 4PXCA 4A4JA 3SEOA 4F3OA 3DRPA 1C0UB 2IYIA 2LU2A 2W9AA 2FVCA 4ED5A 2C3PA 1HNVB 1VC0A 4X65F 3OTCA 5DQHA 1NK8A 1MU2B 1NK4A 2YKMA 3TA2A 4CT8A 2ERRA 3B78A 1I94F 2BQRA 3TQ1A 2HGNA 3M2VB 4FNIA 2Q66A 2K7JA 2YVSA 5KFEA 2IM1A 3BEGB 3GFXA 3NGKA 3R1HA 4UUXA 3R5BA 5K9FA 2ZH1A 4NCGB 4EYHB 1S6UA 3N5FA 3TAMA 5GADU 3TO8A 1N48A 1QJHA 3G8TA 1WHYA 1XN9A 1JLGA 1RTDA 3KOAA 1R8PA 4RW6A 4Z2XA 1N6QB 4E0DA 2A2DA 3P5TL 4JV5F 4X2BA 2DNNA 4IG3B 1A6LA 1LW0A 1JXEA 2X3GA 3KLHB 4HYKA 1D3WA 3NNHA 4OHXA 5HP1B 3K8VA 1DZ5A 1OWXA 5GAEI 4OQJA 2Z2LA 2AD9A 2DGWA 3BGLA 1KFSA 4RU9A