4OX7A

Structure of synechococcus elongatus pcc 7942 ccmk2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
PIAVGMIETLGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVSAGLDSAKRVAGGEVLSHHIIARPHENLEYVLPIRYTEAVEQFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide-concentrating mechanism protein CcmK
publication title Engineering Bacterial Microcompartment Shells: Chimeric Shell Proteins and Chimeric Carboxysome Shells.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Structural protein
total genus 25
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ox7A00
4LIWA 4OLOA 4AXIA 3CIMA 2G13A 4RBVA 2EWHA 4QIVA 4QIGA 5DJBA 3SSSA 3H8YA 2A18A 4QIFA 3PACA 3VCDA 3MPYA 3IA0A 3SSQA 4OX8A 5L38A 3NGKA 3DNCA 4PPDA 4DDFA 3DN9A 4OX6A 4AXJA 3CGIA 3SSRA 3MPWA 4RBUA 4P7VA 4OX7A 2A1BA 4P2SA 4P7TA 3NWGA 4QIEA 3I6PA 4OLPA 3N79A 3I96A 2A10A 4RBTA 3BN4A
chains in the Genus database with same CATH superfamily
1B4SA 2RB7A 2FJBB 2QYGA 2HHHF 1NB2A 5HI7A 2KH9A 3PVXA 4I68A 3OR2A 1U48A 1TK0A 3NS5A 2MLYA 1UAWA 3M6VA 4F4ZA 2CQBA 2W8KA 4AE5A 3RRHA 3IA0A 1LKZA 4DV2F 4KE5A 5HMZA 2AZ1A 2V8VA 2DEJA 5ETTA 3BQ1A 3QYYA 5BJRA 1R89A 1H38A 3N5FA 2AMCB 2LP4A 2RE1A 5CABA 1FNXH 3SSQA 3NGDA 4KKOA 1NPRA 2H48B 1S12A 2OJ3A 3EGNA 3K17A 3NLCA 5D15A 2IAJB 3PR5B 4FF1A 3UCZP 4DFJA 1JXLA 3MECA 2AW0A 3K58A 4WJBA 3M9OB 2VFRA 2ZJPQ 5CYQA 2Z56B 3PHTA 4ZLJA 3DMJB 1NK5A 4L74A 5H9EK 3LWMA 5IXUA 2OKQA 4YB1P 4WCEQ 2QV6A 3P5BP 1LWEA 1RAHB 4LVNP 4ED5A 3LAKA 1YJNS 1SI9A 1NJXA 5I42A 4Y6IA 1WKJA 2UUTA 2B7BB 3NS6A 4EU0A 4J9VA 4PXBA 4P7TA 2LQBA 2FDNA 1DJ0A 5CYJA 1RT7B 2IJRA 4A8KA 3LPYA 5IQQA 3D1QA 3I0RB 3PV8A 1NBEB 2F9DA 4CP5A 4DJBA 3UFCX 5JVGQ 2DNKA 3SEOA 1S59A 2IA0A 4B3OB 3ADAC 4B9LA 4U96A 1C4CA 4NYOA 3C16A 2HZVA 1MN7A 1N8RT 2VIHA 4P52A 4C7QA 4ZP7A 4KB7A 1LW2A 5H9FJ 2GAGC 4ANEA 2WTFA 3LW5C 1SC3B 2LEAA 2B4PA 2FVPA 2UVRA 4F02A 4H4MB 2ROEA 1N5TA 4DR2J 2RU9A 3D0IE 2UUCJ 2XMJA 4C9DA 3HHDA 4IH6A 2DCUB 1JK9B 1HNVB 2RS2A 4UY8T 1N5SA 1QUPA 2F5GA 4RW8B 3T41A 4URSA 3F56A 1K1SA 5AXMA 2M8HA 2QN6B 3MM8B 4JI4J 4J7CA 4BS2A 4QWEA 4WZQA 4OI6A 2C1EB 3D0GE 2RKIA 2DGSA 1YJ7A 1P8GA 4UZBA 1R0AB 1NXIA 2GIFA 2JWNA 4UZCA 1I6JA 4NZ0A 2EFPA 3GZ7A 1PO6A 4ETZA 4XDCA 4OYMA 5I3QA 5KFDA 3M32A 3GMGA 1W26A 2W24A 1RTHB 4O4RA 1HBUA 2YQ0A 3J81j 2FVRA 3GU0A 3IR5B 3PHEA 3QSIA 3HSDA 3IM9A 1FWLA 2C42A 1RABB 3KJVA 3D54A 4NA3A 4DSIA 1JJHA 2R9LA 2W2MP 3JTNA 1KN6A 1IKXA 1HNIA 2CVIA 4Y2CA 3SQGA 1F5AA 4XTTA 3HJFA 1UFWA 1T9XA 2NPFA 3LUYA 1K47A 2CXEA 2XZWA 1LW0B 2HURA 4OHXA 3BYPA 4UW2A 1BC6A 4OZ1A 2B6AB 3TAMB 4NWBA 1B0PA 2OTLS 5I4MA 3PJXA 3UCUP 3QLHB 4XK8C 2ROGA 3T3FA 1D3WA 1XNQF 5L39A 2YH1A 3IS9A 3T6BA 1O51A 4Y65A 4DS4A 2R3VA 4ECWA 1R8CA 1RT5A 2ASYA 3LA0A 2RSQA 2CQ3A 3JSBA 4RLEA 3TANA 3B78A 3CB4A 2BE7D 2H54B 2DR9A 3GILA 2KYZA 4ECSA 1T03A 4CLTA 3TI0A 1HQ2A 3TX8A 3QWPA 1S4EA 1GXTA 4G65A 4H4OA 4F4KA 4NRTA 3H5SA 2P6TA 4LFCF 3DLKB 2HS4A 1HI0P 4X84A 2HGNA 4NLQA 4USTA 3M8PA 2BXJA 2DHSA 2NREA 4BC9A 5D4PA 4MT1A 4I67A 2E7VA 1RT6B 3UI3A 2RQCA 2HQ3A 1KC8T 4F2RA 3TA0A 2KT3A 4H54A 1NEEA 2MQQA 1GX6A 1U6ZA 1VLOA 1SJRA 2AGPA 3HULA 4ZN1A 5EX3A 3WX4A 2G2OA 1L3UA 1X5OA 3KK1A 2KRBA 4USJC 4LF5F 2CADA 8ATCB 5RUBA 2AYGA 3PEHA 5KFRA 2NQPA 4RUAA 3BDPA 2ASDA 3M30B 4RUCA 2VPWB 4H4KC 4UOFA 4RNNA 3GR1A 1XR7A 3PRDA 3M8SA 4P10A 4OYIA 4NXNJ 2ZD1A 4KC5A 3NBPA 2AEMA 4MYTA 3CCSS 3CCUS 1XMQJ 3MURP 2ZUGA 3GIIA 3BSNA 2Q1LA 2BKOA 3KXDA 2Y1LB 5HL7Q 2ILZA 2C2DA 3EE3A 4OX9F 2R7WA 1JLGB 4RW7B 5K14A 4X4RA 4L76A 4DBQA 3V4IB 2AV5A 4RKUC 4FZVA 2DISA 4B3SF 2WVDA 4PWDB 1FESA 4OMFG 1Q7LB 2UU9J 2HHPA 3ZZZA 4AQYF 1F9EB 3W5ZA 3HKZD 4I6YA 4YHHF 2MLZA 1ZM4A 4ZVTB 3BKTA 5FD1A 1NSKL 4ZVRB 2J6SA 3FFIA 1DLOA 2QMUB 1VC0A 1I3OB 4HI1A 3CCJS 2HS0A 2LQ9A 2GO9A 3Q23A 1S9GB 2ZH1A 5L8RC 4EO8A 3VGVA 2K1RB 3M9NB 1RT1A 2IBKA 1HARA 2G0IA 2NXCA 4ZVOB 1QLNA 4YP3A 3O1LA 2WAQD 1UL3A 3BDEA 1T05A 1RTZA 4ECVA 3PW2A 1YBAA 3BQ0A 3M8QB 1S9EA 4OLPA 3CJQA 1MWQA 2YY3A 2PMZD 3W60A 3UCGA 2HMIA 3EZ5A 1V3ZA 1FRMA 4CH7A 2E1CA 2HVIA 5GAHI 2VUGA 3FRZA 3A3NB 2YKMA 1FHTA 3L7UA 4AFFA 4ZHRA 2VG6B 5HROA 1N36F 1HD1A 3F41A 3KHRA 3CJKB 3RB4A 1E6YA 1JJCB 2QRRA 2UVVA 1OMSA 4GKKJ 2MZJA 1QAXA 4A48A 1WDDA 1RT4B 2EFVA 3KJQB 1VBYA 2ZM6F 3HSJA 2UVWA 1Q8LA 4USVA 1TL3B 2VV5A 4DQSA 1X4AA 1NHVA 2LECA 3A8EA 4N77A 1U1KA 2RMLA 4TU8A 3KHLA 4IOAQ 2MB0B 4ILMA 4TN2A 1FE4A 2EFQA 3HF5A 3D6HB 4DV5J 3HFVA 3KNGA 3ILOA 4JI0F 2QX0A 4F4XA 4ED8A 2A3JA 2ZEJA 3HO1A 2CQ0A 4C8MA 4EGLA 3L09A 2MZTA 3O3LA 5D77A 4YQWA 1HD0A 3D1HA 1NK8A 2HSEB 2QFJA 2P6SA 3N28A 5DDQC 4Y2MA 3QRPA 1X4DA 5KFEA 5DZ6A 3SCKE 2G13A 2HK2A 3S6EA 2HIQA 5HJXA 1IBCB 2Q3PA 1GMWD 4B9SA 3PW0A 1HYSA 1S5ZA 3CJ2A 2RDJA 4UOGA 3C6TB 5L1KA 4KKOB 5HSPA 2YTCA 2V2VA 2E9ZA 5KG5A 3AT1B 4URGA 2GC8A 2B8PA 5AT1B 3BO3A 2CPIA 1QM9A 4P72A 3T9ZA 4C8ZA 1ZA1B 3DLJA 1LWFA 3MECB 1T7PA 4U8YA 4M5IA 5CYQB 1K1QA 5B7WA 3CDUA 3K8WA 3D9BA 3CO0P 4IG3A 4WIIA 5FJ4A 2PMWA 3R7BB 1FTCA 2QG9B 2GQ2A 2W9AA 1F9HA 2C2OB 5MLCV 2YWEA 3A8IA 5I42B 3LGMA 4MKAA 3GR0A 4YS2A 5CYMA 4ZK7M 1X7VA 2U2FA 2YKOA 4LF8J 2AT1B 2CPDA 1TV6A 1BWEA 1FX2A 4DN9A 2R4FA 1S49A 4DS5A 3Q8YA 1WI6A 3M8RA 2QA4S 1ZZNA 3HM9A 3IAM9 3M2UA 5K8NA 1Y11A 1RAIB 1DTQA 4K4YA 4JBCA 3VALA 1HNZF 4PG5A 1D8YA 2DPJA 1FJ7A 1REVA 1RXOB 4FVCA 4Z37A 1TELA 3O8WA 2OPPA 4ZCIA 2DR6A 2W7AA 1UJ6A 4WPAA 3M1VA 5E7OB 1LW2B 1UJ5A 4QR2A 4V19J 1TL1A 4OZNA 1B64A 2IFXA 2VZ9A 2YPZA 2Q79A 2LKZA 4I6WA 3V6HA 1TQLA 4FXVA 2GV1A 4OHZA 5A8RA 1RDRA 1F3VA 2GX8A 1RWWB 4B9MA 2E1AA 1I51B 2OFHX 1HQUA 2W2OP 4WZMA 5DDOC 4KV8A 2ZUAA 4MFBA 1U09A 2O3DA 1BXNA 1PBUA 4M5DA 4DG1A 2RKIB 4ELUA 3X3UA 1WC4A 1EETA 4DR7J 1YRXA 1FO1A 2Y1IA 3FCHA 1GT8A 2HFVA 5CAAA 2GGPA 2M5YA 4P7VA 2O67A 2R8IA 1NKCA 4FF3A 3WQPA 4J9OA 2OTJS 1N48A 5C25A 1HBUB 2JLFA 2KM8B 2LXIA 1AT1B 1SL2A 3OFHA 3KJVB 2MQPA 1VQ9S 4C48A 3H59A 4H4KA 2V9WA 1IKXB 2AGQA 5M2UA 5AE1A 1FDAA 3LTOA 2HHTA 4FPRA 5GAGU 2DNLA 5KAKA 4EBCA 3SCIE 2XC9A 1WOSA 2L08A 2E9TA 1HBNA 4X2BA 1EX8A 2B4OA 4MH8A 4AYBD 2XI3A 1K0VA 4C98A 4DFPA 2R42A 3MPYA 4ELVA 1KWMA 2CIMA 5DDPC 3FGVA 2N3LA 2GS8A 3CULA 1MLAA 1YJUA 4OI2A 4U95A 2FHJD 5LOQA 3VAFA 3ENQA 3FMBA 2XQCA 5HMXA 3H40A 3R5BA 2CQ2A 1RT5B 2EXUA 4C2MA 4GVLA 3FCVA 1QD1A 5D0HA 1T03B 3K7RA 3W2VA 3BO2A 2Q43A 4WXOA 4EBDA 2KG1A 4H4OB 1FNMA 1OSDA 2ASLA 3MFIA 1VHIA 2DNOA 1XR6A 2OSRA 4DSJA 1C0UA 3NAIA 4EI2A 3M8PB 4ZCKA 5K8MA 2MKCA 4X4QA 2OEKA 2XY5A 1NRKA 4OV1A 3HKWA 3R97A 2BQUA 3UVJA 4WFAQ 5KFFA 3PO5A 1EIYB 3K2YA 2VG5A 1ZS6A 3CCTA 4X66J 4X64J 2HIYA 3S1TA 1GTEA 4KIAA 4B3RF 5E3PA 5DS7A 4B9TA 2BEFA 1X5PA 1EJ7L 4CLUA 1R8PA 2CWXA 3G82A 1UA1A 3MF5A 3AHPA 3BB5A 3D6TB 2JRSA 3G6VA 4FF2A 4Y0FA 2AF6A 5ETSA 1CJVA 1RWUA 2Z57B 3NBPB 1TAQA 3X1LB 4PWWA 3E2EA 1K44A 3I4PA 1N34F 1T8EA 5B0DA 2ZJQQ 2VBYA 5L9NA 1VQMS 1X0FA 1Y7PA 1LQ9A 1PIEA 2FTRA 2OPRB 2IC3A 5K14B 5D8HB 1OSCA 5J2PA 3EDQB 1F2HA 1IR2A 2OAUA 3L9ZA 7AT1B 2J9DA 4MKBA 1P1LA 2B4VA 1NM2A 1TL5A 4FXWA 3G2XA 2ZDOA 2RH3A 1RA7A 4N41A 3WX8A 3SV3A 3KLGA 4KHPJ 1N54B 5J2NB 3CCES 4DL2A 3PG9A 5DG9A 1DLOB 2BANA 2CYYA 4R8UA 2DK2A 3IR6B 4U7UK 4CM2A 3QNWB 3VV2B 2MKHA 4QIGA 2QSFA 4EK2A 4OYAA 2ADBA 5DLGA 3QPIA 4USIA 1UEUA 2C2MB 3CJ3A 1TMJA 3MR7A 2HQFA 4RO0A 1NDLA 4XAKA 5A76A 4KO0A 4QBUA 2N7CA 4ALZA 2O01C 1RWPB 1R7IA 1RISA 4NA2A 1H3DA 1AB8A 1Y10A 1T05B 2BJ1A 2CDQA 4HT7A 4M94A 2X51A 3DOKB 3DYAB 1B99A 1FNOA 1S9EB 4X4OA 2F8MA 3TZXA 2OPQB 4JI7F 2HRUA 2WVFA 5MAOA 2K3IA 2HMIB 3T5HA 1U2RA 3Q24A 4CQ1A 3I9V9 2VKRA 3KUEA 4YEAA 1SCJB 5CD4A 2YKMB 4EYIB 3AOBA 4NLVA 3VHQA 5HROB 2HPUA 3TZWA 1AZSA 5KFUA 2DGXA 1WG4A 1S4FA 2MQ8A 3OTOJ 3W9JA 4OFZA 4QJVA 4JYAF 1E6YB 4NASA 4F50A 1U1RA 2IBOA 3UWTA 1HNZJ 4WFZA 5HQMA 4PZVA 2NXEA 3MCNA 1R8AA 4R25A 3J80Y 4DV1F 1Q1KA 1TR0A 5FDLA 3TAPA 3BSCA 2CPYA 3HD2A 3CCRS 3V6JA 4RX6A 3GJQB 2FHMA 2FJAB 4JI5J 5CCLA 2BJ7A 3R7NB 4ER8A 2QMWA 4WYWA 2FJWA 3J81Y 1OIAA 4K59A 1MW7A 2JEIA 1I5OB 3GFHA 5KFHA 1WACA 1T9VA 4WFBQ 1W7WA 4TQRA 2VPXB 3I55S 5LMNJ 2XY7A 4AT1B 1TKDA 4OZ0A 1Y4ZB 2FD2A 4F26A 3UDCA 1FRHA 2VC1A 3RBDA 1IWAA 3LANA 4GC6A 1RI7A 2A6MA 3DCAA 2V4QA 4DV0F 1TFYA 2HBQB 3JSMA 4ZVSB 5EN1A 2C3MA 1TP7A 2UUAF 3MM6A 1H2TZ 1NJIT 2OO4A 1A6LA 5J1PA 2ZH5A 3GFYA 1WHYA 4KSEB 1BD6A 5IV3A 2EKNA 2DHAA 3DXBA 2N4CA 4EFAC 1GEHA 3B54A 4OZJA 4WYLA 3DOMA 2OSQA 4OHWA 3MWBA 1KBRA 2QE5A 1GAOA 3PRVA 4WFNQ 4M1KA 2XULA 3Q8VA 4IG3B 2VQEF 2M9KA 3OXFA 5A6WA 3VAKA 4IH5A 3W9IA 1WJ9A 1HLWA 4BLGA 2R2RA 1RU2A 5IQ6A 1IWGA 3EWGA 3LPEA 1XBWA 5CYMB 3GP9A 3PXGa 1GNKA 2QA2A 1M1KT 5D3GA 1TV6B 2RDDA 4V1Ak 3UNGC 4RJVA 2XMMA 3M8YA 3QGHA 3ZTPA 2RAQA 3FSYA 5KFOA 3M2UB 2E44A 4HKQA 2AP6A 4DR5F 4NLGA 4WU2A 1NLKL 3U1LA 3WIUA 3T19A 5E3RA 2OPPB 3A13A 4OYPA 2B0GA 1T0TV 2AYMA 1R0BG 5EUHA 3M1VB 3I9ZA 8AT1B 1IR1A 3MAHA 5F9NA 1XNRF 2UXDJ 2NUUG 3DM2A 1IBMF 3D3CJ 5A8RB 4HTIA 1F9FA 1CVJA 3ZXWA 1LWXA 1X9MA 1HHQA 1VQ4S 4YY3F 2Z4PA 1X4BA 5L1IA 4K0KJ 2AIRB 2ZHAA 3MR5A 4ERDA 4C3LA 3TARA 2JZ5A 3QIPB 2CQDA 4MFBB 2C2KB 2DGWA 2LA6A 1SKUB 3KOAA 3GIMA 4DUYJ 4M5DB 4DG1B 1X4FA 3TVKA 2Y8YA 4U67Q 2NCKL 1PJ7A 1EETB 3KLFA 4QYRA 1CBKA 4JV5J 1VRQC 3PW5A 3AOCA 2HAFA 4HACA 5HP1A 3DRXA 1YWXA 2GGPB 2QTWA 4J9LA 1JWWA 1N88A 3R5AA 5E5NA 3MM5B 3F0NA 5C25B 4ED7A 1AUDA 3CDAA 2FC9A 1F6TA 4FXDA 1UVJA 2D69A 3UD3P 3TUPA 3N6NA 2DXEA 3QGGA 3CSKA 1RYSA 2ZBPA 2O66A 2RRBA 2GAHC 4ZP8A 1QE1A 3JXOA 3LH2S 1RLDA 4I2PA 1VBZA 4IQMA 1MNEA 2Z58B 1URRA 3QRRA 4Q44A 1HBNB 3AQPA 3QIDA 4W98A 5HVGA 2OGUA 5T41A 4LFAJ 2W7PA 1Q8IA 5ETPA 3TO8A 3MTKA 3I31A 3AJ1A 4MKVA 1RHUB 4ECQA 4FKXA 2V69A 2RRAA 2JLGA 3JAMY 2VH7A 4IR9A 1OYEA 2HRTA 3BBCA 9RUBA 1RTJA 3SCJE 1WEZA 1R8HA 3LP1A 2J0SD 1TAUA 3KG0A 1RHMB 2ZFHA 4QWBA 4C4WA 5AE2A 3Q89A 1GH8A 2X7IA 2Y1JA 4L75A 1U1MA 4TU7A 2KI2A 1AW0A 3NOCA 4PPZA 4PG4A 1SL1A 1VJWA 1PAEX 3OTCA 1HR0F 2H4WB 4A8YA 3A3PB 2PO4A 4AXJA 2OELA 1S76D 1C0UB 1T94A 2MJNA 4N8OA 1OQ6A 2E5LJ 1UFLA 4K4ZA 2GHWA 1U2CA 3RUBL 1RTIB 2DNPA 4QW8A 2BKPA 2J9EA 3UVJB 4IQXA 1RQ0A 1H7XA 2VG5B 1WC0A 1S79A 4WP9A 3KG1A 3OW2R 2UUWA 2FGCA 1S1WA 2CPHA 3PYGA 4J37A 2VPZB 2UUBF 4AUKA 3GG1A 2UVUA 4WK1A 3G82B 3SIPB 2MZSA 2X1FA 1WOPA 2IMOA 3MR2A 4USKA 4B9NA 4JI6J 2E5GA 3F73A 3R3TA 4ZJLA 4HHJA 1HNWJ 5DLFA 2FJEB 1OPZA 2ASJA 2BV3A 2BJEA 4KQZA 3LAMA 5A8WA 4LF1A 3HX9A 2NXNA 3MZIA 4F3MA 2IRYA 3DLGA 1T9YA 4LMZA 3M8ZA 5J2PB 3H5YA 1RLCL 1PBAA 2H3EB 1SJFA 2QL5B 4DN0A 4GMKA 4LRAA 3HHNB 2JC1A 4CO0A 3G86A 3KMSA 2WOMA 3CJRA 4FBUA 3Q8SB 2DO4A 4NRUA 1HMVA 2VFTA 4NLOA 3KLGB 4BWMA 3PM9A 2GVZA 2BANB 2ZE2A 4R8UB 4L6V3 2GMLA 4M5MA 3S01A 2DGQA 1FXLA 4PG7A 3H20A 1KNZA 1RU1A 2KJVA 1NPPA 5IT4A 1UWBA 3N6MA 4NX9A 2MDAA 3CC7S 1RAOA 4MJKA 4KO0B 2PA3A 2H5IB 5M2RA 4CTAA 2WSCC 3HSZA 1ICEB 1RAJA 2B4UA 2ZBCA 4X4SA 2FVSA 1Q8KA 4OHYA 4M5LA 4LQ9A 4Q8FA 4C0OC 3KG4A 1EP4A 3BGRA 3DKDA 2HWIA 4DLEA 1YG0A 1YZ7A 4ZVHA 2G9OA 3RR7A 2HFUA 3G4SS 4B08A 4MIWA 2DCLA 1AXQA 3G87A 3VCDA 5A0YB 2M0GB 1RHRB 2H9ZA 1S6PA 2H4YB 1GFWB 4WP8A 2YNFA 1FE0A 5H9FK 1WTFA 2R7XA 5G0RA 5DGAA 5C42B 2PDAA 1SJ1A 2V4JA 1AZSB 3IRWP 3QATA 1LNQA 1B7FA 3QO9A 3BREA 5JXSA 1KLNA 2DT9A 4JI1F 4V19X 3I56S 4DQRA 1RZMA 1NK7A 1GMVA 4TVAB 4BC7A 5FDLB 4L72B 3HSGA 3HFZB 3QRQA 2XMKA 2DNRA 5IC6B 2KKHA 4U7CA 1N6QA 1UZDA 1KD1T 2BYCA 2BJ3A 1IBMJ 2RD5C 3OQ2A 4NMLA 4UQTA 2MLXA 1N0UA 4CLKA 4TKTA 5LSOA 1XN9A 1U1LA 2R7VA 1KVJA 2FVCA 2HQGA 5F8LA 2FQQB 3PIPQ 4PXCA 1WEXA 4LVOP 3M2VA 4Y2IA 5C2CA 3WHIA 1UMJA 1UPMB 2W01A 3AA9A 3MEGA 2HHUA 4I69A 4QQBA 2IMWP 1IKYA 4JV1A 1SH2A 1IBLF 1XJWB 1SJ3P 4Z2XA 3LGHA 2IM3A 4Q45A 3BR8A 2IVYA 3OT9A 1BLUA 3QGIA 4C3KA 4JB8B 3EVMA 3R5DA 2ZBQA 4N56A 3BZQA 3DOMB 3J80U 3NGTA 4IR1A 1IXKA 2J0QD 2Z2LA 1REGX 1DRZA 3QT8A 3O2IA 2MXYA 2HFZA 4Q7AA 2VHGA 3ZZPA 1UCNA 1R31A 2BJ8A 2CPJA 3POTA 3OJUA 1VQYA 5F8IA 2AKWB 3T1YJ 3J81U 4CO2A 1HWJA 1D1UA 1ZETA 2EC2A 4KAIA 3QJJA 1T3NA 3ILLA 5D3GB 2DR7A 4M5JA 5DJBA 2F63A 5L1JA 4ZPAA 2G4BA 3UR0A 3CC2S 1JNZB 3T6JA 4ZPTR 1G4CA 3ZZYA 4OZLA 3MEDA 2PA8D 4NYZA 1O0PA 2V8DA 4B02A 1G7CB 1IVZA 2HHQA 2CJ9A 1RA6A 2YX7A 3P4UB 1J2VA 3BS9A 4YUDA 3CGIA 3DGPA 3CVKA 3V2UC 2BVZA 3DM2B 4C0BA 1RHQB 1FKPA 3QSYB 2VFVA 1CS4A 4ZA1A 4CH1A 2KT2A 3D1OA 5LJ3Y 4JI3J 4F36A 5LSLA 2F65A 3W2WA 3VR1A 2VDHA 1KRPA 1O6XA 3M6XA 2J8AA 4ID5A 2QLFB 4E2FB 3RB6A 5GADI 4Y34A 3MI7X 3IWLA 5KG0A 3KLFB 1SQGA 5HP1B 1KVKA 4KT0C 4ZCLA 5AJ3J 3NKYA 2VG7A 3KLHA 3TA1A 4C97A 4FPIA 3RB3A 3M2RB 2K8GA 1TKTA 1RADB 3V6DA 1VQ7S 4K50A 2LYVA 5IS2A 3N4WA 1FXRA 4OZ3A 2DRDA 1BMQB 3I6PA 1N5YA 5ETQA 2M8DB 1MWYA 3NCPA 1F5BA 4MKYA 3B4MA 4EO6A 2VJVA 4ZLLA 2AQ4A 3C8YA 5IZHA 1A0OB 4CCHA 1PJ5A 1QE1B 1LFWA 2V8PA 3UD5A 5KT4A 1E6VA 4DR2F 4A8QA 2UUCF 2AJ1A 4NI2A 2MQOA 1JLQA 2KXHA 1KR4A 4P2MA 5T7LA 2MTLA 1RTDA 4EYHB 3J7ZT 4ZVQB 2OD6A 4WXWA 1MROA 2XMUA 2MKIA 4CO4A 5B0BA 4JI4F 2QLJB 1MWZA 3NCQA 3SXLA 5KFVA 5HAOA 3K5OA 1U0SA 2I38A 4LRDA 3QJPA 3LP1B 3TQ1A 3UD4P 1Y9OA 4OV6A 3J7YI 3KUHA 4WU3A 5KG4A 4ZDNA 1IN0A 4CNZA 4GC7A 3HZEA 1KVIA 1JKHA 3AXMA 1JNRB 4DZDA 4HR2A 3MCMA 1JLFA 2BMBA 2CQCA 1Q16B 1YJWS 4LBPA 1JLBB 3NNHA 2VC0A 4O3QA 3SBMA 4DR1J 2BZ2A 1OO0B 2J7WA 3Q22A 3K0JA 1YJTA 3EGWB 1M0SA 3RAQA 2GJ2A 1RWXB 2RQ4A 1FJEB 4AD6A 1G3OA 2CKWA 3MMAA 3GV8B 2WSEC 4OX6A 5LSRA 3Q2SC 2IY5B 1G2EA 3D28A 4J9RA 5A2QU 4WP3A 1RBLA 2OEMA 1S1WB 1Y5IB 1UZHA 1VQNS 1PC4A 1TUGB 2RVJA 1B70B 1FDNA 1HFEL 4ED1A 4DL0C 5ETRA 1RT2B 3JAMU 2RIJA 1BHNA 2ZNYA 5FIIA 4G1QA 1S57A 5AXNA 2B7CB 1KKHA 1RJJA 2IA6A 1YVFA 4IUFA 2PC6A 4QU6A 2LEPA 3TRGA 4OIXA 5K8OA 1PSDA 2LFVA 2PEHA 2JFDA 4RNOA 4QPXA 2VOOA 1D0EA 2D74B 3DLGB 4NCAA 4LF6J 5DG7A 2PFFB 4XIUA 2B9YA 3EVOA 2R8HA 4C6AA 1XERA 1WEYA 2IDEA 4PQUA 1UW9A 4NYPA 4USWA 2AGOA 4PR6A 1X4EA 5BYSA 2CZVC 3B82A 4J90A 2VICA 3M05A 1NKEA 4QWAA 4O3SA 2PT0A 4CH0S 1HMVB 2WW8A 4YR0A 3FEYB 2E66A 2IYIA 4ZJOA 1ZTTA 4Z7CA 2YXLA 1R8BA 4Q2LA 2XI2A 3GFXA 1IM4A 2GVZB 4KRWA 4LF7J 2UXBJ 3C2PA 2ZE2B 3O44A 5KFMA 3THVA 3RG6A 2HFOA 5F0UA 2G1DA 2EPIA 2I6WA 1SIZA 1YX2A 1UWBB 2GMHA 1Q7YT 3CCZA 4DSFA 4LF9J 4NXNF 1K9MT 1D09B 4TU9A 4CTAB 1NHUA 4G6VB 1XMQF 1UTAA 2ZH9A 2EG1A 3VTIA 2VOPA 3RU0A 1EP4B 3BGRB 2FZCB 2V6AA 3OLBA 1H74A 4LR7A 4ES3A 3CJ4A 1VFJA 4NLTA 5IFMA 4HEA9 3LGNA 2KFNA 3E01A 3V5RA 2UU9F 1RAGB 2N82B 1S6PB 3DLBA 2NYIA 2W8LA 2YNFB 4LF4J 2UXCJ 2MQLA 4OI4A 3C6UA 1XMOJ 2RHSB 3QJLA 5G0RB 5KT6A 2IJNA 2JEFA 5JMNA 2V4JB 2V4RA 2CJAA 2D1CA 2ZWPA 1KOOA 2GMJA 1KQKA 3DNCA 3QO9B 2E29A 2XEXA 2WVEA 2E1PA 2YWFA 4ZS6A 3G8SA 4BHQA 4DR6J 1KP6A 5HBMA 3GYXB 1S6QA 1HI1A 1IUJA 4FDFA 2WBMA 4K2XA 5G4DA 1PYTA 3B8HA 4X65J 2XYPB 3CCWA 3EXYA 1QDUB 1J5EJ 5JUMA 3CIMA 3IFEA 1N6QB 3CDWA 3I87A 5F9LA 3PACA 4J9UE 1U1NA 2M70A 1GMWA 1GQEA 2CQ4A 2JEJA 4DL6A 4CZCA 4JOUA 2JJ4D 3CW2C 4JI8F 3TX0A 4DF8A 3NNAA 4UY85 1SV5A 4LFBJ 4RL1A 1WC3A 3UPFA 3SI8A 1Z2LA 1CQMA 3HFKA 3OJSA 3DFEA 1KHWA 3P5TL 2Z0GA 3ET6A 3M2VB 3T5JA 4K4XA 2HNZB 2JEGA 4HH1A 3UN2A 3GIKA 2KHDA 3BV8A 2I1RA 5LXRA 2AWZA 2DJWA 1JB0C 4MIAA 1BQXA 5KFLA 1TKXB 3EM1A 3TQEA 3MEGB 4GKKF 3ZO7A 3KDOA 1U47A 1PG5B 1IKYB 3BN7A 4WBFA 2ZJRQ 2ZVIA 1UP1A 2J8SA 5DO2A 3FK4A 4KBIA 1UVKA 1T95A 2RUGA 1FEHA 4ECUA 7FD1A 1NK6A 3TWZA 2GFFA 1P9YA 4ED2A 2C2NA 4PQAA 1RWOB 2FZKB 4RR5A 1X4HA 2COLA 3SDEA 4DV5F 3POTB 3MD3A 2HNDA 1VYAA 2YNHA 3EYZA 4F3QA 2HS3A 2JLEA 2V50A 2OUGA 2GW8A 3EXCX 2A6OA 2AJQA 5D6GA 4WF9Q 3T1HJ 3HMJG 3IR7B 2I5JA 4NL5A 3PYFA 5AXKA 1MSWD 3OSNA 4DX6A 3JSYA 1QTNB 3NL0A 1VJQA 3O6QA 1HNXJ 3TJAA 1W2BR 1FFWB 2ZC3A 3SMZA 3OSPA 3R27A 2PE8A 2HBYB 3G6XA 1V3SA 3MUTP 4F67A 5ETLA 2ZOGA 3MEDB 5DG8A 2M3DA 2G0CA 5EX0A 5LXYA 2BE9B 2ZITA 4QWDA 1R43A 4RW6B 1EQ0A 2PD1A 2HHSA 1SQEA 2Q66A 3KLVA 1UWAA 1NZAA 2V63A 3PX0A 1Y3JA 1RAFB 2F9JA 4MK8A 2YWKA 4RNMA 2XCAA 3AB4B 3DGPB 1UEKA 1YBTA 3VAHA 2CFXA 1ZPVA 1WELA 3H90A 3BQ2A 4GO7X 2G1HA 1IJFB 2J9DE 5IWAJ 1CS4B 1NJYA 1Y0HA 3AA8A 5KFWA 5HQ8A 3P3DA 3CCQS 3W2WB 2IRXA 2CJYB 4FNHA 2AYEA 4ID5B 4IRCA 1JXVA 3DRPA 1F3FA 3VZHA 1XWLA 2IHR1 3CE8A 4LF8F 3CIZA 1VHFA 3ICLA 4R0JA 4IG0A 2VG7B 3KLHB 1U49A 3KTQA 4FNIA 1M5KC 1EB0A 1TKTB 1LK5A 4OYBA 3V6DB 4ES2A 3MDFA 3EUNA 1P6TA 5LL6d 3DGVA 1B0VA 3ZNUA 2ZNZA 4PCQA 1NDCA 2GZOA 1S9FA 5BYRA 4CLPA 2FHJA 2ALYB 1YLXA 5M2PA 3OFEA 4EUVA 3BJYA 1DURA 1E6VB 4NI2B 1JLQB 1YTYA 5T7LB 1RTDB 2GA7A 2A18A 4ES1A 1M5VC 4PUOB 2V2KA 4R0EA 1MROB 2XYGB 4K7QA 4DFMA 3GYNA 3NWRA 4QPTA 4DCOB 5IOLA 2KZMA 1YITS 2B5JA 4K5RA 2KL8A 3A8JA 3DRYA 3P8BB 2VQFJ 1FVQA 3RR8A 4GKJJ 4HT5A 4ZPCA 4DR7F 1YI2S 1Z1ZA 2H65B 4FYDA 3G9CA 3AXKA 4TYAA 2EBGA 3EZUA 1JKHB 4IOBA 2BR0A 2J0WA 2ZDPA 4X62J 1BGXT 3DMJA 3OFGA 1NSQA 3HXMA 2QT7A 1GK8A 3N9UC 4I1TA 2EC0A 2KG0A 2ZH8A 4LREA 3A3OB 2QEXS 1WC6A 2LDIA 3GYGA 2G2ZA 1MMDA 2QC3A 2DRBA 4IH7A 2DNHA 4K2JA 5KT3A 1XR5A 5KFKA 4QCLA 4RBTA 5KG6A 1PYOB 1KTVA 2AJ2A 3RB0A 4HDHA 5D0EA 5KFQA 2DRAA 5U47A 4X4TA 1LFPA 1Y00A 3PEJA 5D4NA 4ZN3A 2XZDB 4ZLNA 2LCWA 4G1QB 4DQQA 1EQMA 4NLSA 2LU2A 2L9NA 2NPIA 6FD1A 3VVUA 2P5VA 3UDEA 2RU3A 3HVAA 1OY8A 2ROPA 2EI5A 3BN4A 5LMUJ 1JIHA 4QR0A 1FWKA 2B9WA 4YB7A 4DV7J 3QMQA 1HKAA 2BA9A 1U26A 1TVRA 2C2RA 2CQIA 3QBCA 1VMBA 4RW8A 4ZPDA 2B56A 2X1BA 1X31C 4IO9Q 4PQUB 2E5HA 4C11A 3H98A 2ATCB 4USMA 3P45B 4ZP6A 4JI8J 2DNYA 3QT7A 3GE9A 2F3JA 1IQTA 2MKKA 2C3OA 1LV5A 2CNLB 2WVCA 3KYLA 4KGXB 3U1NA 3PX4A 1J27A 1U24A 4QZVB 4X66F 4X64F 3QZ8A 3BPDA 3DRRA 2IVFB 2CNNB 4CT9A 4A46A 4PEOA 1NPKA 3HD1A 3PW4A 1I94J 2HHVA 2EFGA 2GIQA 3A1YG 3ZZOA 3CD5A 1IM6A 3DI6A 3E51A 2V5HG 4NLDA 5KFPA 4P71A 3WC2A 4PXDA 2R7TA 1R6YA 2V67A 1TU0B 1HWLA 1ZAWA 4RWXA 3TP2A 4QWCA 2QMXA 2A2CA 3MGJA 2R8GA 1WKKA 3NNCA 4CO3A 3V81A 4DL4A 5C24A 1CJKA 2O1PA 5EWGA 3JYTA 3AQOA 3LP2A 1S48A 2Y8WA 2YBVA 3AFGA 3E01B 4KGZB 1VDHA 2F40A 4F0MA 2XM3A 1S99A 1CG2A 3W66A 2DIUA 2JOQA 2PFDA 4DFKA 2ZH4A 3C6UB 3OR2B 3ZTQA 3RW6A 4TXSA 1PILA 2RS8A 5EWEA 4KHPF 2CVEA 2HG4A 1RWMB 2DR8A 2FY8A 1TFWA 2QIFA 1EKRA 5DETA 4EWTA 5CXTA 5AXLA 4DV4J 1NDKA 5A8KA 3G71S 5HBMB 1NH7A 4C8NA 1S6QB 2RHQB 3K5NA 3DOLA 2MPUA 2KXFA 3ZZ0A 4X4UA 2L3MA 4FP9A 1SC6A 1H72C 1UVMA 4F4WA 2GCFA 2V94A 1NB7A 4MMOA 3SYZA 3IWXA 1H73A 4KHRA 3VQSA 5IV4A 3DDKA 4IFYA 2YPYA 4DDFA 2AEFA 2JHEA 5K8PA 1LWEB 1RACB 3NGUA 1KHVA 2XWYA 2HW3A 2GJIA 1MG7A 1WF0A 1IQZA 4YB5A 3CT9A 5F41A 3OVAA 1SV5B 3ZTSA 4MAKA 1K73T 3AH6A 3ET6B 4NLRA 1TZ0A 2YKPA 1TTHB 3CJ8A 3PFOA 4DPWA 2XLKA 4DL7A 3FSIA 3OTOF 1OY9A 3D68A 1WDTA 1Q53A 4RW7A 5D78A 1HPZA 4KPCA 3H7HB 4L73A 1H2VZ 3FCWA 5IT9U 1MMLA 4DUZJ 3C16B 2CQPA 4X4VA 1BE4A 5L9XA 5LJ5Y 1J5OA 4WFYA 4UOHA 5BR8J 2FYXA 2V68A 4CT8A 1GXLA 2B9EA 4JI5F 3BO4A 4LSNA 3SDEB 4EEYA 4F04B 2YNHB 4YDXA 3NG8A 3QT6A 1VC6A 4U7UD 1X9WA 1WNEA 2W2NP 2DNNA 4FYVB 3T5LA 2AHOB 1GTHA 1CJUA 3C15A 2WZ1A 5LMNF 4C0HA 2MMYA 2EW9A 3GJSB 1HBOA 3K89A 3V4MA 3AJ2A 1DQ9A 4CWBA 4C8YA 4NZ6A 4ZJQA 3BGOP 4NE9C 2DR5A 3BEGB 1UPPA 2ZVSA 2A1BA 3CMAS 2CUYA 4D3GA 3M32B 4OYXA 4P6QA 3CEDA 5HVHA 4DSKA 3L3CA 4XO0A 2K2PA 5SZTA 4I64A 1H0HB 3G96A 3P96A 4O44A 3FNNA 3SFUA 4KH0B 3FC9A 3O5TB 3NY0A 2VODA 1U6FA 1HNIB 1VQOS 4P2XA 2VF3A 2OPSA 3SQGB 1T9UA 3DU5A 4KGMA 4K4SA 3PJWA 3HT3A 2XGQA 1SKRA 1FD2A 3I96A 1KQSR 2KVQE 3T1AA 4DPXA 5KFGA 2G0JA 1VQLS 4JI2J 4OI0A 3S8SA 2W4DA 1C1BA 1VRUA 3LP0A 1VISA 2DNQA 4IG0B 3MCSA 2R2TA 2KJWA 3PDNA 3IS9B 1OWXA 2C22A 3G6ES 5KOWA 3OVBA 1CQNA 2B51A 1Y5NB 4A8WA 2DBBA 3GCXP 5GADU 3J7A1 4DR3J 3R6LB 3S7RA 1LXNA 4PYAA 2MY7A 5HK4A 2VASA 4UUXA 3Q86A 2YNIA 4F2SA 2DXFA 3AAWB 4P73A 3MAQA 4OJ1A 1Q81T 2UXDF 3FJ2A 1SPBP 3QAEA 2C2EA 1M90T 4TQSA 2BRLA 4CLYA 2BACA 2MYFA 2GJFA 3AD8C 5E3QA 2N3OA 4K0KF 2YQ3A 1S1VA 3MUVP 2ZHOA 3FEXB 1MU2A 3OL7A 2M88A 4ZPVR 5ETMA 2QL9B 3KK1B 4DUYF 3C6TA 4RUBA 1CLFA 2B5JB 2HRYA 4PRFA 2XG8A 1KFDA 2V9KA 2HHXA 1FJGJ 3R5CA 2BW7A 2FVQA 3VVTA 4JV5F 2AU0A 1S1UA 1RBAA 3ILJA 1L3SA 1WTBA 4PWUA 3GWCA 2DH9A 3IBWA 2JFKA 2ZD1B 3DU6A 2J76E 3UR3C 4DX7A 2XNRA 1JLEA 2VJUA 4OZ5A 1DQAA 2BJ9A 3ZZTA 3K8VA 1I1GA 1NJWA 1RCXB 2PN6A 1KTQA 5E3CA 2Z2ZA 5KG7A 3U7JA 3W7BA 1NK9A 3BKFA 1TK5A 4MYUA 3J7YU 1CEZA 1VOMA 2Z2MA 2BDPA 4P75A 5K5MA 2GNKA 4FS2A 5GMEA 1ZM9A 1ZOTA 3ZZRA 3OL8A 3HT0A 1ACMB 3EMTA 4A8FA 2B8QA 1NDPA 5FLXY 4LFAF 1V3RA 4DCPB 4W92B 5DM6Q 4ED0A 3FFIB 6FDRA 2B9XA 1O5JA 1PKUA 2HLTA 2POKA 3W62A 2AZ3A 3PCOB 4QYZJ 2O5DA 4B3MJ 3ZFVA 2BUNA 1XEZA 5B0AA 1GX5A 2NYHA 4Y2KA 2FC8A 1RT1B 2ZZNA 3PX6A 3W64A 2V8GA 1D9DA 2ZWOA 1W2IA 2P8IA 2MEWA 1TVRB 3FDSA 1DBDA 1HQEA 2OH2A 4J91A 1V9OA 2CJBA 1S10A 2FLLA 1NH8A 2DHXA 2HVHA 2F4VJ 4PG6A 1C2PA 4C11B 1KEKA 2E5LF 4NXMJ 3JB9k 2JNJA 2CJXB 1KQGB 3PY8A 2AEJA 2PIIA 4J9SA 5EGYA 1BQMA 1NO8A 1IR0A 4ZVFA 1EAYC 1FXDA 3GJRB 2FJDB 3R2DJ 3HVTA 1H98A 3KWMA 3LO3A 2EBEA 3DRRB 3BYRA 4ZHRB 1DARA 2RDIA 2ZKTA 3IM8A 1S6UA 1KDNA 4DR4J 1NCLA 4HYKA 1Q82T 2F1FA 2DNGA 3DI6B 4JI6F 4YR2A 4KPYA 1HNWF 1P9QC 4D3HA 2LXFA 4ED4A 3FZBA 4WK3A 1WD6A 4NLYA 1QAJA 2KFYA 3OTDA 4DV3J 5F3ZA 4C8OA 3V81B 2DNZA 2F4FA 2VONA 5C24B 2L9WA 1CJKB 3BSOA 5B09A 3JYTB 1U25A 4PXEA 3CJ0A 1RSCA 3LP2B 2G2YA 1JJ2R 2K7KA 3WBZA 2DTJA 2OI2A 4O3PA 3W5XA 4TYBA 5L38A 3NGKA 1X60A 5D0RA 3VAGA 1C1CA 2CQ1A 1C0TA 2CQGA 3FZ2A 2HQIA 1SJQA 3D66A 2DB1A 2OFGX 4HI2A 2Z30B 2FLNA 1U8WA 1LXJA 3FMWA 2KXNB 1QJHA 2W4CA 3EX7B 4F0HA 3CD0A 4OL8A 2BOAA 1R3NA 5HQLA 1N5VA 1YRUA 2AJ0A 2AJ4A 1RT3A 4ATNA 3OXGA 2ZHBA 1FJCA 4GVBA 1HYSB 5A8KB 1N33J 1KLMA 3DOLB 3NAHA 2Y9HA 1U1OA 6AT1B 4JV2A 1D9FA 1WKLA 3TVYA 5KFBA 3N0VA 3A8KA 1H7WA 1LWCA 1LWFB 2R7SA 3QWUA 5KFJA 1Q79A 2I9SA 2APOA 3BM7A 3A4TA 2MKSA 3UDVA 3VWSA 4E0DA 4IFYB 3K5PA 1VQ6S 1QAYA 2OIHA 2W9BA 2K06A 4M5GA 1N52B 4DV6J 4KGVB 3CJ5A 4X4PA 4BBYA 2NXJA 3AY0A 4Z7YA 3W5YA 1UKUA 1ZA2B 5ADZA 1QSSA 2XWXA 3D3BJ 3MHYA 2KZZA 2IPOB 3I5AA 1PYSB 3N5BA 1NHKL 3CCMS 1SKSA 4O23A 4LBHA 2OPRA 4F0KA 2LQ8A 4BDPA 2V0NA 3ETOA 3R9LA 1DTQB 1FTRA 5LM7E 3VZIA 5KFSA 1HPZB 4J5OA 4RW4A 1NUEA 1RWVB 1REVB 2B3TB 5CZVA 1SIWB 2IM1A 2Z2YB 1YDLA 1FERA 2YWGA 2HHHJ 1J5OB 3AD9C 2YVSA 3R5JB 1WOOA 4P2FA 1QSLA 4K4UA 2D9OA 2KYXA 3ZNJ1 2HFNA 3TVZA 1DZ5A 1TL1B 3PR4A 3TJ8A 4LSNB 1SKWA 5J2NA 1EZZB 4CYUA 2QFIA 3THTA 4DV2J 2HHWA 2V2ZA 4Y3CA 3PW7A 5JVHQ 3HJVA 4N5SA 1HL6A 1HQUB 2AJFE 1APSA 2K7JA 1CJUB 2JH3A 2C3YA 4KV8B 3MUMP 3OL6A 3C15B 2XNQA 1WORA 2XB2D 5KT7A 2X3DA 4LQ3A 5THWA 3GIJA 4IYQA 3TAQA 3ZZUA 1HBOB 4FBTA 4LBIA 3LALA 5DM7Q 2QLWA 3PJ9A 5KFZA 2RRNA 4F8RA 3L95X 4OI1A 1BQNA 3NRBA 4E98A 2JDJA 3LQVA 3NXZA 3B4DA 3M6WA 5HJYA 1KS2A 1IBKF 4OJ3A 2WK4A 3DOKA 3DYAA 3CCLS 4DHVA 2OPQA 4K4WA 4O44B 3BGLA 1KOHA 2H51B 3G6YA 3LF0A 2JL9A 3C14A 1NNDA 3TZZA 2DD8S 1S72S 2R7QA 2OPSB 1VI7A 3ILIA 1FEEA 4B3TF 1GXUA 1X5TA 2HEKA 3T1YF 1IKVA 4TY8A 1U1QA 1BY9A 2CJKA 3KLIA 5A2QY 3JTPA 1Q8BA 2E1RA 1NSPA 4CLFA 4U9RA 2ZZMA 1RWKB 1C1BB 3M4XA 1VRUB 1HBMA 3LP0B 1S0NA 4HH0A 3MMCA 1RHKB 1TUWA 3FSXA 5L1LA 3NCRA 4I56A 5ETNA 3CDBA 2DY1A 2C2ZB 4M95A 1Q5YA 3D67A 2E7WA 4B9UA 4OYWA 4TLQA 3CPWR 2MQNA 3TUJC 3I5BA 5HVFA 1YKWA 4DL5A 3HPOA 4OX7A 2AD9A 1ZM3A 4CI0B 3W2VB 4YDDB 3MAAA 1NK0A 2L9DA 4C8LA 3MM7A 2XMVA 1DY3A 3OV7A 1M1GA 4ZIVA 1CULA 2YNIB 1FKOA 3H42A 3KFWX 2DEIA 1VIXA 2HFSA 3K5LA 2C3PA 3EICA 4CNYA 3ZTRA 1S1XA 1B7YB 2W1BA 1ZM2A 4QIVA 3Q0AA 3PYEA 2W2PP 4KYZA 3KK2A 4NZ7A 1YGYA 4NOHA 1S1VB 4JI3F 1MU2B 2IDLA 3MD1A 5KFAA 3R1HA 3L7OA 3NOGA 2ZOMA 1AFJA 1N32F 4NLUA 5J2QA 2RF2A 1S1UB 1Q5VA 1ITPA 5AJ3F 1U4BA 3MEEA 4OHVA 3P49B 2XBPA 1FF2A 1CJVB 4DF4A 1RP5A 1YRTA 1JLEB 9ATCB 2SXLA 3HZGA 4J9KA 4O4GA 2QJ3A 3SCLE 2IC3B 5E33A 3SSSA 3HCXA 2ZOFA 1UVIA 3D6FB 4F7VA 1QY7A 1TKZA 2K3KA 3PKYA 2EKYA 4ETXA 3MOJB 1XNQJ 1H2UX 1JMTA 2PGCA 3HHLC 2CA9A 1S77D 3AOAA 3HHKA 3MM9A 2RUSA 2H5JB 4DQIA 1CJTA 4ANCA 3BGUA 2R7OA 1JQGA 4DWIA 5DQHA 1T02A 1FRJA 2DNMA 2GHVC 3DN9A 1MN9A 2XLJA 3U1MA 2HVEA 4RWWA 3PKMA 4LFCJ 1OS5A 2AX0A 1VGYA 3D4JA 2R8JA 4J9MA 1CPZA 4A8SA 2PMHA 3QGPA 3KHHA 1RK8A 1Q78A 5CA5A 1SH3A 2WHOA 2VFUA 1S97A 3VF0B 1HQEB 3N79A 1F60B 2J9CA 1EKSA 2RJZA 5B0EA 1RKIA 2BE2A 4GO5X 3QIPA 3ZTOA 1KFSA 1NSAA 2FHOB 3UDLA 2MHNA 4DR1F 3OHAA 4WWSA 1JLCA 4LF5J 3RTVA 5HMYA 4F4AA 2XTJP 1F2GA 1X5SA 3IG1A 5LT5A 3AJDA 1BQMB 4OYOA 5CCMA 2CG4A 1URNA 1HIYA 2DPIA 2ACYA 5C5JA 4IRKA 1DTTA 2IRUA 1FK9A 4NLXA 3HVTB 3CO9A 5FLXU 3HP6A 5H9EJ 1U7LA 3MM5A 4I2QA 3A12A 3GCWP 2HVDA 3FVYA 3I0SA 4OX9J 1WHWA 4OI3A 3GV7B 1GMUA 1KSPA 4U8VA 4I4BA 4DPOA 1HHTP 1FRLA 3I4HX 1ZBTA 1N4LA 5CH7B 4N76A 4NCGA 2YNGA 3CUNA 3GG0A 2ZH2A 4B3SJ 2LQ5A 4NLPA 3KHGA 5KFYA 4ZOSA 1A9NB 3KUGA 2WW4A 2BQRA 4AQYJ 3MCOA 2D9PA 3BBBA 4AXIA 4ED3A 5J2MA 4YHHJ 3TUZC 4LF6F 2EFNA 2W9CA 3MEKA 4ZVEA 4Q43A 2HWTA 1C1CB 1ROFA 1VLYA 1C0TB 3UW1A 3CCVS 5HATA 5HN0A 2JX2A 2XSFA 2JSXA 1RGVA 3EVWA 1WF2A 4KFBA 3RAMA 4LF7F 2UXBF 4B9VA 1IJEB 4USUA 1XTZA 2FIUA 3W1YC 3HDSA 3GONA 1RT3B 3GIRA 2KT5A 1CSJA 3CXCR 1MMNA 3MFHA 4GVBB 3RJMB 2MZQA 1LEOA 1KLMB 3IBFB 3JSMB 1IBKJ 1SUQA 5ETVA 4ZKAA 4LR9A 3MM6B 3DDNA 4LF9F 4QIWD 3C19A 5KFCA 1RTIA 3BKUA 3FBEA 2DH7A 3L4BC 1VC5A 1PC5A 1AA1B 1LWCB 1VBXA 3IP0A 3MR6A 2IIHA 1N56A 3N6LA 2NSBA 2F7VA 1VRTA 4DSLA 4FVMA 3GB0A 3ISNC 4I6AA 4J9PA 2ALZA 2QA4G 3AB2B 3GV5B 2M52A 1NAQA 1N36J 4B3TJ 5KTQA 2ZH6A 5HANA 2CQHA 2W9BB 2E1MC 5BYQA 3QZ7A 4UOCA 1QUVA 5DZ7A 2PSZA 2WONA 2GQCA 4ILLA 2R8KA 3QAUA 4LF4F 2OLWA 3MMBA 1QTMA 2UXCF 1WI8A 1XMOF 3IGVA 5B08A 2ZM6J 3R7SB 2KO1A 1WC5A 4Q0BA 5ETKA 3C46A 3DHXA 2LA4A 3D7SB 1Y5LB 4IO1A 4HHHA 4BCAA 1JX4A 4DR6F 3H5UA 3N01A 4RW4B 4XPCA 2QSWA 1YJVA 3U02A 1X4CA 4JI0J 4PPDA 2D3OR 3LWLA 2KRRA 4NLWA 4EZ9A 4DI6A 5JJBA 4J9NA 3TYTA 4X65F 2NZ4A 2MKYA 4N47A 1ZZFA 4EBEA 2N4DA 3PTWA 4CLLA 1S1TA 1J5EF 2LXUA 5IC4B 4I0WA 3HVWA 4MK9A 3MPVA 4CYUB 1AUSL 5I3UA 3IXQA 1RCOB 4CO5A 3IC1A 3SZ2A 2XS2A 1HWUA 3RYLA 4ITSA 2HNYA 3TEGA 1V5VA 1ELOA 4DPYA 5CZXA 3RBZA 3DLEA 2YQ1A 2CRLA 4LFBF 2BBEA 2GQQA 3J7Z5 2KDOA 7FDRA 4WFXA 1NK4A 1N32J 2RNEA 1PGZA 1Z4UA 1S0MA 3CJSA 4HACB 1QSYA 2XO6A 1BQNB 3G8QA 3KDNA 1TL7A 2CG8A 1U0HA 4OJHA 4QW9A 3IMQJ 2BX6A 4AL5A 3WZ0A 4YOEA 2XS5A 4O0IA 4R5PA 2Y3YA 3U27A 4ECXA 2H5EA 3UQSA 5A0YA 1XQIA 5HO4A 2MSSA 1Q4RA 2DHGA 3C14B 3OD2A 3Q8RB 3P6YC 3Q8UA 1T3OA 1L3VA 5GAEU 2UV8A 3EZOA 5C42A 4ECZA 2LVWA 4MK7A 4I2PB 1WWHA 2VB6A 5KG2A 1Y3KA 3UO0A 2FPHX 2CDRB 2VA3A 2GVDA 3W8PA 1IKVB 4TY8B 3KLIB 3E8OA 4DLGA 1X0PA 5B0CA 2D7SA 3T1HF 4M5HA 1VCTA 2ADCA 1FFSB 1HBMB 1JXEA 2D3UA 1VQSA 2HBZB 3MMCB 4YMEA 2MZ1A 1HNXF 5KOXA 5D4OA 1RTJB 3HHLA 2YKQA 4DPUA 4USHA 1M5SA 4ZPWR 2EFOA 2IM2A 2FLPA 2IYGA 2V34A 4ID8A 3GLJA 3WC0A 4DU8A 3H2UB 4L3NA 2MQMA 5KG1A 2QL7B 3MAAB 3RAXA 2MGZA 2F8EX 2DIVA 3MPWA 3MM7B 3H4BA 1CULB 3T9NA 1FKOB 2JVOA 2FLOA 3OFFA 4G1PA 4UT4A 4YN3B 3OR1A 1S1XB 2ILYA 3Q83A 1R27B 4C3MA 2CJQA 4OYZA 5IWAF 3KK2B 5GVQA 2IJFA 2P9GA 2HBRB 1QVFR 3VAIA 4CLSA 4HTJA 4UQGA 1LOUA 4UUWA 3R2CJ 5E41A 1ZPWX 2WSFC 3E3XA 3QFHA 1WG5A 3NS7B 2HVZA 3FRYA 4RNFA 5EHHA 5DQIA 5E3AA 5KG3A 1T9WA 3EDRB 4F4YA 4WE1A 5J2QB 4RPFA 2RF2B 2J7UA 2NZCA 3GQCA 3MEEB 3CWJA 2JC0A 2DHHA 2J6TA 2UZAA 4O4GB 4Y2AA 1PJ6A 5A8WB 1P27B 5L46A 3NMRA 4TNOA 2CPFA 3V6KA 2OD4A 3TNVA 2RILA 3HI9A 2FJVA 4W90B 1TKZB 2RQKA 4HVZA 2WRMA 1O8BA 1HW9A 1RB0A 2W25A 5CD4H 2P9EA 3GJTB 2WB1D 4ILRA 4DX5A 1VBKA 2WOMB 4CM0A 3QQCD 3MM9B 5F8MA 1U02A 3D2WA 1CJTB 2M4MA 4NEYA 2GIRA 1X9SA 3DDIA 4PKDB 3MOZA 2BM0A 3KJNB 3PZPA 3ENVA 1V5IB 3ONQA 1RUSA 1FDBA 1F0XA 2DGVA 1FFGB 2P9CA 4IFVA 3HVRA 3KNAA 4DEZA 1VS3A 4LRFA 4G3IA 3VGSA 2VQFF 3UNYA 2YH0A 3MPUB 4GKJF 2BW2A 4NEZA 5CQGA 2W7OA 4LUBA 2D41A 2MKJA 3ITHA 2CAJA 3IN5A 1OJ4A 4N7TA 3EGVA 3KLEA 1SXLA 3NGRA 4PABA 2ZBIA 4X62F 2DKOB 5F8JA 2BE2B 3H2LA 1L5UA 3IRXA 2OEJA 1F1BB 5A6PA 4LR8A 1DHMA 1JLCB 3LOUA 4WTOB 4B3RJ 3BPSP 3IG1B 2MZRA 1FKAF 1M5HA 3SSRA 1SVDA 2HZAA 1DTTB 3W63A 1FK9B 1SC4B 5D4LA 3VQTA 4UF4A 3M2RA 1Q86T 2GO8A 2VA2A 1N34J 4I2QB 2B43A 2CPZA 3OXLA 3CC4S 4ED6A 3KK3A 2ZBRA 3I0SB 1W25A 2XLIA 4WTYA 5KFTA 4HL9A 1JLAA 2CNKB 2XSJA 4ZP9A 4ANDA 2I8EA 2BOPA 4ICLA 3Q2TC 3NWGA 3THPA 4NCGB 2YNGB 2DO0A 4EMDA 2A10A 2VU5A 1ZAXA 1FRIA 1FD8A 5IT9Y 3QFWA 4LIRA 5LMUF 4W4MA 5IM0A 3JQKA 4Y00A 1G1XA 1KQFB 4DV7F 2BABA 3OBIA 3C66A 3CNQP 5E2QA 5J2MB 1VQKS 2HWHA 4DPTA 1RHJB 2LMIA 1UFKA 2W9CB 4CRJA 1S7IA 1C4AA 4ECYA 5K9FA 4DCJB 2U1AA 4ZLPA 3FQLA 1T11A 2P2CB 4G1IA 4FKYA 4IRDA 4KTQA 5HMWA 2XHWA 1OYDA 2NLWA 4IDKA 2KVIA 1WC1A 2YX1A 2L41A 3VAJA 3CJTA 1SJ4P 3VGUA 4KFBB 4WKRA 2JVRA 4UTGA 2VFSA 4OZ2A 1K8AT 1OY6A 3WIVA 2QO3A 5J1EA 2ATLA 2NR0A 3M9MB 2V2QA 1JLBA 1I94F 1VQ5S 2OHDA 3SQOP 1K0TA 1M1HA 1RE1B 3DRSA 3RBEA 2BRKA 3DXSX 2YX4A 1SUQB 2X1GA 3CDEA 1PCAA 3M7VA 3BH6B 4NA1A 2ZH3A 1FRKA 2R2SA 2LEBA 1ZTWA 1RAAB 4DOZA 1VQPS 2XO7A 4KR0B 5HLFA 4JI7J 2DITA 4K8RA 4LSZB 4RBUA 1S0OA 1IKWA 1UA0A 3CD7A 1UETA 2LQJA 1VRTB 1V6HA 3RRGA 5C2GA 3UE2A 3MTJA 2VKZG 4FYWB 1BUXA 2R7RA 2YKNA 4O3OA 5ETOA 4TY9A 4RNHA 1RT2A 3PRBA 2EVZA 4JYAJ 3R8YA 2WONB 2YWWA 1YHQS 3ULHA 4DZ6A 4KH1B 2Y1RI 3M8WA 4CLWA 3MMBB 3OUYA 3J7AN 4QR1A 3UN5A 2ZKUA 1S6OA 3EPGA 2HGMA 2MJUA 1EARA 2FGOA 2D3O1 2ABYA 1L3TA 4DV1J 2KHCA 4Q0BB 3FBBA 5K20B 4I7FA 5BXIA 4DV4F 4DX8H 1U6BA 3IGNA 1OQ3A 4NMXA 4FN5A 3TZYA 2IM0A 1YJRA 3CMQA 1UVNA 4M8LA 2HAIA 1M5PC 3FBFA 4M5KA 3Q8QB 1S1TB 4A8OA 3W61A 4ZVPB 2AYBA 2H1YA 4OLOA 3QT5A 3PIOQ 4LSLA 5I3UB 1FKPB 1WHVA 1YBUA 2HNYB 1D9AA 3NP5A 1TK8A 4DV0J 3H5XA 2WVBA 1R6VA 1SL0A 3BGFA 4MIBA 3DLEB 2XMTA 3C3LA 2UUAJ 2WBRA 2DGOA 4LJMA 3PO4A 4O3RA 2XMAA 1Q95G 1S0VA 3HK2A 3H25A 4YB6A 2EEYA 3OPKA 2BM1A 3JS9A 4RW9A 1UVLA 1XIQA 4HHUA 1TL7B 1AROP 1U0HB 1Z2ZA 4ZMMA 2VQEJ 3PFEA 1F5CA 4DU7A 5D0GA 2E5IA 4NPOA 4R5PB 4YFUA 1H6KX 2V8HA 4DSEA 1N5QA 2VPYB 1N5YB 3JTOA 4DUZF 3M6UA 4KHMA 2DYAA 3BF4A 2HLUA 4O3NA 5BR8F 4QYZK 3D0HE 3OL9A 2PI5A 4DQPA 3HHLD 5ITHA 3GPAA 4RZRA 1LK7A 2GVDB 4PG8A 5CHCB 3PYDA 2ZH7A 3RGIA 1AYEA 3JQMA 4LIWA 4DR5J 4K4VA 3K5MA 2FY1A 1UJ4A 4CDIA 3FEZA 5GAHU 3EJMA 3B6BA 3HHLB 4K5SA 1U45A 2IAJA 2QYCA 3IWNC 4S0MA 1L3KA 1XNRJ 3CTRA 4PAAA 2X3GA 2NS1B 3DLHA 3K59A 2XMWA 2I0XA 3GSIA 3NGSA 2BQ3A 2MGZB 1XK8A 2E7XA 5DGBA 5J1NA 5I3PA 4YY3J 4QU7A 2XYHB 2KFZA 4RU2A 1JLFB 1TMMA 2VL1A 1P1TA 2HQDA 2XY6A 1FI4A 3I82A 3H0PA 3Q8PB 2OP5A 2F8HA 2DGUA 3OR1B 1UEVA 1YQHA 1RT7A 2HNZA 2XZTB 3JQJA 1WF1A 3GTYX 3ENWA 1CC7A 3BBFA 3MMAB 3I0RA 2ERRA 4B17A 4ENOA 1WSVA 2ZZTA 3BR9A 2CNOB 1TKXA 1WG1A 1EHWA 5C7PA 3L7PA 4B3OA 4JI2F 2OMLA 4P74A 2XGPA 3IO1A 4FYXB 1UW4A 2LDYA 4QOTA 3FBCA 2FHKA 4WE1B 4ECTA 2KTQA 5SUHA 2WCXA 4Q8EA 2EWHA 1DQ8A 1HW8A 3H8YA 3R6GB 3GSDA 4HDGA 2NXUA 2DVIA 1WSRA 2J7KA 1YIJS 1NU4A 2YWHA 3HHEA 1KONA 4H4MA 4ZPBA 1FRXA 2XS7A 2E9RX 5F3TA 3RW7A 4OX8A 4DR3F 4O0NA 1HA1A 4C8KA 1HNVA 4A47A 3WDOA 2QA1A 4E8UA 2GHPA 2A2DA 3FQKA 5DRKA 3CMES 8RUCA 1VIOA 1FA0A 5KFXA 1ZYQA 3MM8A 4YR3A 2RT3A 4JV0A 3I5CA 1R0AA 2OMOA 1RYRA 1RKJA 4F3OA 3VAMA 4IKAA 4Q2MA 3MMJA 4Q5VA 5GAGI 1FCAA 3MPDA 4J9QA 2EK1A 3TW0A 3KJFB 4Y28C 1FT8A 3OHBA 4L3KA 3RBXA 4IFVB 2NUHA 4RW6A 2J0XA 2VDIA 3BH7B 3F44A 1G6BA 4QIEA 1RTHA 1XC9A 2RQMA 1FJGF 1HR0J 2CPXA 1M5OC 1ZH5A 3ITHB 4NCBA 2YKAA 2ACMA 2R2UA 2M2BA 4FF4A 3KLEB 1RBOB 3TUIC 3W65A 3MR3A 1XMBA 2LLZA 4PYDA 2CZ4A 1A7GE 4WIQA 2EG2A 3IRXB 2EK6A 3W9HA 1FX4A 1LW0A 3ZC4A 2VBWA 5H1SV 3TA2A 1ZAVA 4KJIA 2B6AA 3H4DA 3D6MB 3ISND 3TAMA 4M5NA 4ECRA 2UUBJ 4ZCMA 4IOCQ 4URQU 3AODA 2W2QP 3QLHA 2HK3A 2QLXA 3CD6S 3ISZA 1DAXA 1WHXA 1FVSA 2R7UA 4ELTA 3ENAA 5B0GA 2KU7A 1RAEB 2HZCA 4AL6A 3CF5Q 5KFNA 1PAUB 1CC8A 2MY8A 3KK3B 2E5JA 3IBCB 3DC2A 5KT5A 4XDDA 4K4TA 3FUYA 1SH0A 2XCPA 2L48A 1QAIA 1JLAB 2XSJB 1U1PA 1HI8A 1X8DA 3RZAA 4ICLB 1HWIA 4QIFA 3SV4A 4B3MF 3DLKA 2UV8G 1N0VC 1HHSA 2M7SA 3ETMA 2CPEA 4EZ6A 4CO1A 3EPIA 3D5MA 5IM0B 5EDWA 1RT6A 2MSTA 4KY3A 1WUUA 4ZVUB 1NJZA 3MXHP 1B0TA 1YZ6A 4DL3A 1D8ZA 3FKBA 3H2VE 3IAS9 4A8MP 4PUOA 1VK8A 4DMZA 2F4VF 1YJ9S 3TJ9A 5GMDA 2KM8C 4NXMF 4RUHA 3US5A 2Q6CA 4TLRA 3M30A 4IDKB 4U6PA 1AFIA 2FB0A 3AD7C 1HWKA 2MHEA 4X4NA 3KMQA 1Q0NA 1SB6A 4AL7A 1BWVA 3DLLQ 2KB2A 3BSAA 3UN3A 5EWFA 5J1EB 4A8XA 2FZGB 3G8TA 4WKYA 2XHCA 4LRCA 2C3UA 2HGLA 5KFIA 1NKBA 3EGZA 4DR4F 3DRSB 2PEBA 1SBRA 2CZ9A 2HYIB 5E0OA 1JLGA 3JSRA 2UP1A 3NMAA 4LT6A 2HKEA 2PI4A 3V4IA 4LRBA 2QLBB 1T9TA 2QZ8A 2BKNA 4ZIWA 5HLFB 4PWDA 2FUG9 1IKWB 3RRKA 1FWPA 1NZ8A 1SQFA 1SC1B 5F0WA 2D3ZA 3W8GA 4FS1A 4DV3F 3VGTA 2CWKA 4F25A 2VD3A 1R0CB 4RU9A 1S7HA 2YKNB 4N8NA 1YK9A 3W3SA 4M63A 2HNDB 3HLUA 3TOQA 2J6UA 3OTBA 1VQ8S 5DDRC 4A4JA 3OTEA 1DFDA 3OVSA 5T14A 1ULRA 5GMKa 1S9GA 2DXDA 3OUYB 3NEKA 4HLBA 4OQJA 2I5JB 2K1RA 2HQCA 4KGKA 4JI1J 4ZVGA 2IVMA 1OPIA 3TEHB 2X1AA 3K57A 4I7FB 2ZC4A 5GAEI 2DH8A 1B3TA 4LF2A 3I32A 5B0FA 1N33F 2LU1A 4CLZA 4XPEA 4CIOA 3SFGA 2VBXA 4MTPA 4BWJA 1JJ4A 2Q6BA 3M8QA 2AX1A 3GFZA 2DGTA 3R5GA 2BJDA 2NSCA 2N7YA 5F8HA 2QGFB 2KN4A 4LSLB 1U2FA 2J5AA 1NMEB 3OLAA 1FDDA 4GRSA 5AE3A 2VG6A 3DHWC 3ELHA 2I2YA 3KKFA 3CJKA 4DV6F 1VK3A 4JUZA 1TUVA 1QVGR 5DQGA 4FYYB 4OJGA 3DRPB 4P9SA 5F8NA 1IBLJ 5IT0A 1RT4A 1U8SA 2Y0BB 2Y0SD 4P2SA 3T5KA 4RW9B 5F8GA 2DY9A 2A0FB 1TL3A 1VR6A 2WB4A 1X4GA 4RBVA 3TR5A 2FJXA 1RWNB 3PNIA 2W4PA 4ZITA 1TL4A 4JP8A 1YSJA 4DUTA 2C28A 2Z8QA 4DXLA 3R1LA 5KT2A 2VBZA
chains in the Genus database with same CATH topology
2MZQA 2DRAA 5U47A 1KLMB 2LA6A 1LFPA 1Y00A 3PEJA 4X4TA 3GIMA 3KOAA 5D4NA 3JSMB 2RB7A 4M5DB 2FJBB 1SUQA 1X4FA 2LCWA 4DG1B 4G1QB 4DQQA 3TVKA 4ZKAA 2HHHF 4U67Q 3MM6B 4NLSA 2LU2A 3DDNA 2L9NA 5HI7A 4LF9F 2NPIA 2KH9A 3PVXA 4QIWD 6FD1A 4I68A 2P5VA 1EETB 5KFCA 1RTIA 3KLFA 3OR2A 2DH7A 4QYRA 3PW5A 1U48A 1VC5A 1PC5A 2RU3A 3HVAA 1LWCB 1TK0A 2ROPA 1VBXA 5HP1A 3DRXA 3MR6A 2EI5A 1YWXA 3NS5A 3BN4A 1UAWA 1N56A 3M6VA 1JIHA 4F4ZA 2CQBA 4QR0A 2W8KA 2GGPB 3N6LA 2NSBA 4AE5A 2B9WA 4YB7A 3RRHA 2F7VA 3IA0A 1LKZA 3QMQA 1VRTA 4DV2F 4FVMA 4DSLA 3GB0A 3ISNC 4I6AA 4J9PA 2BA9A 2ALZA 1U26A 1TVRA 2QA4G 4KE5A 2C2RA 5HMZA 2CQIA 4J9LA 1JWWA 1N88A 3AB2B 2V8VA 3R5AA 5E5NA 3GV5B 3MM5B 3BQ1A 5C25B 4ED7A 1AUDA 3CDAA 1VMBA 2FC9A 1NAQA 2M52A 4RW8A 5KTQA 4ZPDA 4FXDA 3QYYA 5BJRA 1UVJA 1R89A 2B56A 2ZH6A 1H38A 2CQHA 3N5FA 2RE1A 2W9BB 3UD3P 2E1MC 5BYQA 1FNXH 2X1BA 3QZ7A 3N6NA 4UOCA 4IO9Q 4PQUB 2E5HA 4C11A 1QUVA 3H98A 3SSQA 2PSZA 3NGDA 4KKOA 2WONA 3QGGA 2GQCA 4ILLA 4ZP6A 2R8KA 3QAUA 4LF4F 2OLWA 3MMBA 1QTMA 2UXCF 2OJ3A 3CSKA 3EGNA 1RYSA 2DNYA 1WI8A 3NLCA 1XMOF 3IGVA 2IAJB 5B08A 2O66A 2RRBA 3GE9A 3PR5B 4FF1A 4ZP8A 1QE1A 2F3JA 4DFJA 3UCZP 2KO1A 2MKKA 1JXLA 1IQTA 2C3OA 1LV5A 3LH2S 3MECA 2AW0A 4I2PA 3K58A 1VBZA 4IQMA 4WJBA 1MNEA 3KYLA 4Q0BA 3M9OB 1URRA 3U1NA 4Q44A 3C46A 2VFRA 1HBNB 2ZJPQ 5CYQA 3PX4A 3AQPA 3QIDA 3DHXA 1U24A 4QZVB 2LA4A 4X64F 4X66F 3QZ8A 5T41A 3DMJB 2W7PA 1Y5LB 1NK5A 4IO1A 1Q8IA 3DRRA 4BCAA 2IVFB 3LWMA 4CT9A 5IXUA 2OKQA 1JX4A 4YB1P 4A46A 4DR6F 4WCEQ 2QV6A 3TO8A 3H5UA 3MTKA 3I31A 3N01A 4RW4B 1LWEA 3AJ1A 4LVNP 2QSWA 4XPCA 3PW4A 4ED5A 1YJVA 3LAKA 1YJNS 4ECQA 2HHVA 1SI9A 3U02A 1NJXA 1X4CA 4PPDA 2RRAA 2D3OR 3LWLA 5I42A 2KRRA 4Y6IA 2JLGA 3JAMY 2UUTA 4NLWA 2EFGA 4EZ9A 2B7BB 2GIQA 3NS6A 2VH7A 3A1YG 3ZZOA 4EU0A 5JJBA 3TYTA 4PXBA 4J9NA 4IR9A 4P7TA 3CD5A 3DI6A 3E51A 2V5HG 4NLDA 1RTJA 5KFPA 4X65F 2LQBA 2NZ4A 3WC2A 2FDNA 4PXDA 1DJ0A 4N47A 5CYJA 1RT7B 2R7TA 1ZZFA 1R6YA 4EBEA 3SCJE 4A8KA 2N4DA 1WEZA 1R8HA 3LP1A 2J0SD 1TAUA 1S1TA 1J5EF 2LXUA 3KG0A 3LPYA 5IQQA 2ZFHA 3D1QA 4QWBA 4I0WA 1HWLA 1ZAWA 3HVWA 3I0RB 5AE2A 4C4WA 1GH8A 4MK9A 4RWXA 3MPVA 3PV8A 3TP2A 4QWCA 2F9DA 2Y1JA 5I3UA 2QMXA 2A2CA 3IXQA 3MGJA 4DJBA 4CO5A 3UFCX 1U1MA 5JVGQ 2R8GA 3IC1A 4TU7A 2KI2A 3SZ2A 2XS2A 1AW0A 1HWUA 2DNKA 3RYLA 4PPZA 4CO3A 3NNCA 3SEOA 3V81A 4ITSA 4DL4A 2IA0A 5C24A 4B3OB 4PG4A 2O1PA 5EWGA 2HNYA 4B9LA 3JYTA 1SL1A 1VJWA 1C4CA 3OTCA 3AQOA 1HR0F 3LP2A 4A8YA 1ELOA 1S48A 2PO4A 4NYOA 5CZXA 4AXJA 3E01B 1S76D 1C0UB 2F40A 1T94A 2MJNA 3DLEA 2CRLA 4N8OA 4LFBF 1OQ6A 1UFLA 1S99A 2BBEA 4K4ZA 1CG2A 1N8RT 2GHWA 2GQQA 3J7Z5 2KDOA 7FDRA 2DIUA 4C7QA 4WFXA 1NK4A 2JOQA 4ZP7A 4KB7A 4DFKA 1LW2A 5H9FJ 1RTIB 2ZH4A 2WTFA 3C6UB 3LW5C 3OR2B 2RNEA 2DNPA 1PGZA 1Z4UA 1S0MA 3RW6A 4QW8A 2LEAA 4TXSA 2B4PA 2FVPA 2UVRA 1PILA 2J9EA 2RS8A 4IQXA 4F02A 1RQ0A 1QSYA 1H7XA 4H4MB 5EWEA 4KHPF 2VG5B 2CVEA 1BQNB 2HG4A 3G8QA 2ROEA 2DR8A 1N5TA 2RU9A 1S79A 3D0IE 4OJHA 2XMJA 4QW9A 4C9DA 3HHDA 3KG1A 3OW2R 4IH6A 2DCUB 2UUWA 1TFWA 2QIFA 4AL5A 1JK9B 1HNVB 2FGCA 1S1WA 2CPHA 2RS2A 3WZ0A 4UY8T 5DETA 1N5SA 4J37A 2VPZB 1QUPA 4EWTA 5AXLA 5CXTA 2UUBF 4YOEA 2XS5A 4RW8B 4AUKA 4O0IA 3GG1A 4R5PA 2UVUA 4WK1A 3U27A 4ECXA 2H5EA 4URSA 3F56A 1K1SA 5AXMA 2M8HA 5A8KA 3G71S 3UQSA 5HBMB 5A0YA 1NH7A 3MM8B 4C8NA 1S6QB 3K5NA 5HO4A 3DOLA 2MSSA 2MZSA 4BS2A 4QWEA 2MPUA 4WZQA 1Q4RA 4OI6A 2X1FA 2IMOA 2DHGA 3D0GE 2RKIA 2DGSA 3MR2A 2KXFA 3ZZ0A 4X4UA 1P8GA 4B9NA 2L3MA 2E5GA 1R0AB 4FP9A 1SC6A 3F73A 3R3TA 1UVMA 3Q8RB 2JWNA 3P6YC 4HHJA 5DLFA 1T3OA 1L3VA 5GAEU 2FJEB 4F4WA 2GCFA 2UV8A 2V94A 1NB7A 4NZ0A 1I6JA 5C42A 4ECZA 1OPZA 2LVWA 4MK7A 2EFPA 2ASJA 2BV3A 3GZ7A 4I2PB 4MMOA 1PO6A 1WWHA 3SYZA 2VB6A 2BJEA 4KQZA 3LAMA 3IWXA 5A8WA 5KG2A 4ETZA 1Y3KA 4KHRA 4XDCA 2FPHX 3VQSA 3DDKA 2VA3A 5I3QA 3HX9A 3M32A 5KFDA 1IKVB 3GMGA 4TY8B 3KLIB 3MZIA 4IFYA 4F3MA 3E8OA 2IRYA 4DDFA 4DLGA 2W24A 1X0PA 3DLGA 4LMZA 1RTHB 5J2PB 5B0CA 4O4RA 2JHEA 2D7SA 5K8PA 1HBUA 3T1HF 3H5YA 2FVRA 1LWEB 1KHVA 3IR5B 3PHEA 2XWYA 1SJFA 2HW3A 2ADCA 1HBMB 1WF0A 1JXEA 1IQZA 2D3UA 2GJIA 1VQSA 4YB5A 3CT9A 4DN0A 2C42A 4GMKA 3HHNB 5F41A 3OVAA 1SV5B 3MMCB 4YMEA 2JC1A 4CO0A 4MAKA 3KJVA 3D54A 2MZ1A 4NA3A 5KOXA 5D4OA 1HNXF 4DSIA 1JJHA 3G86A 3JTNA 2R9LA 3KMSA 1K73T 1KN6A 1RTJB 1IKXA 3AH6A 1HNIA 3HHLA 2WOMA 4NLRA 1TZ0A 4FBUA 2YKQA 4USHA 2YKPA 3Q8SB 1M5SA 2CVIA 4Y2CA 2DO4A 4ZPWR 2EFOA 2IM2A 3PFOA 4NRUA 3SQGA 1HMVA 2VFTA 4NLOA 2XLKA 2FLPA 1F5AA 2IYGA 3HJFA 4DL7A 1UFWA 4ID8A 2NPFA 3KLGB 3LUYA 3WC0A 3H2UB 3PM9A 4BWMA 4L3NA 2XZWA 3FSIA 2MQMA 1LW0B 5KG1A 4OHXA 3OTOF 2BANB 2ZE2A 4UW2A 4L6V3 4R8UB 2GMLA 4OZ1A 2MGZA 3RAXA 1BC6A 2F8EX 3S01A 2B6AB 4RW7A 1Q53A 2DIVA 3MPWA 3TAMB 4NWBA 1B0PA 5D78A 2DGQA 3MM7B 3H4BA 1FXLA 4PG7A 5I4MA 2OTLS 3PJXA 1HPZA 3H20A 3UCUP 1KNZA 3QLHB 4XK8C 3T9NA 1FKOB 2ROGA 3T3FA 2KJVA 1H2VZ 1D3WA 1XNQF 5IT4A 2JVOA 1UWBA 2FLOA 5L39A 3N6MA 1MMLA 3OFFA 4NX9A 2CQPA 2MDAA 4G1PA 4X4VA 3CC7S 5L9XA 5LJ5Y 1J5OA 4WFYA 2YH1A 3OR1A 1S1XB 2ILYA 1R27B 3IS9A 4KO0B 4MJKA 2PA3A 3T6BA 1O51A 5M2RA 4C3MA 4Y65A 4DS4A 4CTAA 2CJQA 2WSCC 5IWAF 4ECWA 1R8CA 1RAJA 1RT5A 2B4UA 2ZBCA 4CT8A 2ASYA 3KK2B 4X4SA 5GVQA 2RSQA 2FVSA 2CQ3A 3JSBA 2IJFA 2P9GA 4RLEA 1GXLA 3TANA 4OHYA 3B78A 4JI5F 3BO4A 1QVFR 4LSNA 3CB4A 3SDEB 4LQ9A 3VAIA 4EEYA 4HTJA 2DR9A 4UQGA 2YNHB 4YDXA 1LOUA 3GILA 4UUWA 2KYZA 4Q8FA 4ECSA 3NG8A 1T03A 4C0OC 1VC6A 3KG4A 3TI0A 1EP4A 3BGRA 1X9WA 2HWIA 1WNEA 2DNNA 5E41A 1YG0A 3TX8A 4DLEA 3QWPA 3T5LA 4ZVHA 1GTHA 1ZPWX 1GXTA 2G9OA 3RR7A 2WSFC 4H4OA 3E3XA 4F4KA 3G4SS 1WG5A 4NRTA 2HVZA 4B08A 3H5SA 2P6TA 3FRYA 4MIWA 4RNFA 4LFCF 2DCLA 3DLKB 5EHHA 5DQIA 1AXQA 5E3AA 5KG3A 5LMNF 2HS4A 4F4YA 4WE1A 5J2QB 1HI0P 3VCDA 5A0YB 2RF2B 2J7UA 4X84A 2HGNA 4C0HA 4NLQA 2MMYA 2M0GB 3M8PA 3GQCA 2BXJA 2DHSA 2H9ZA 3MEEB 2EW9A 1S6PA 3CWJA 2NREA 4BC9A 5D4PA 4I67A 2YNFA 1HBOA 1FE0A 3V4MA 1RT6B 3AJ2A 3UI3A 1DQ9A 2JC0A 1WTFA 2RQCA 2HQ3A 2R7XA 1KC8T 4C8YA 5G0RA 5DGAA 2J6TA 5C42B 2PDAA 2UZAA 4NZ6A 4O4GB 4Y2AA 4F2RA 1SJ1A 3TA0A 2KT3A 4H54A 1NEEA 2MQQA 1GX6A 5A8WB 1U6ZA 2V4JA 1SJRA 1P27B 3BEGB 2DR5A 2ZVSA 2A1BA 3CMAS 2AGPA 3IRWP 5EX3A 3M32B 2CPFA 4TNOA 3WX4A 4D3GA 3NMRA 3V6KA 1X5OA 1L3UA 3KK1A 1B7FA 2KRBA 3QO9A 4P6QA 3CEDA 2OD4A 4USJC 3TNVA 4LF5F 3BREA 2RILA 3HI9A 5JXSA 2AYGA 2FJVA 4DSKA 3L3CA 3PEHA 4XO0A 2K2PA 5KFRA 1TKZB 2RQKA 4W90B 2NQPA 4RUAA 5SZTA 3BDPA 4HVZA 2ASDA 4I64A 2WRMA 1KLNA 3M30B 1H0HB 4RUCA 2VPWB 4H4KC 1O8BA 2DT9A 3GR1A 4RNNA 1HW9A 1XR7A 3P96A 3PRDA 4O44A 3G96A 3I56S 3FNNA 4JI1F 4V19X 3SFUA 2W25A 5CD4H 2P9EA 3O5TB 4DQRA 3M8SA 1NK7A 2VODA 2WB1D 4ILRA 1U6FA 2ZD1A 1HNIB 3NBPA 4KC5A 2WOMB 4BC7A 1VQOS 3MM9B 5FDLB 5F8MA 4MYTA 4L72B 3CCSS 2OPSA 3CCUS 3D2WA 3SQGB 2XMKA 2DNRA 3DU5A 2M4MA 4KGMA 3MURP 2KKHA 4U7CA 2ZUGA 3GIIA 1N6QA 4K4SA 3PJWA 1KD1T 2GIRA 1X9SA 3BSNA 2BYCA 2Q1LA 4PKDB 2RD5C 3MOZA 2BM0A 3HT3A 5HL7Q 3OQ2A 3PZPA 3ENVA 4NMLA 2ILZA 2C2DA 3ONQA 2XGQA 1SKRA 1FDBA 1F0XA 2DGVA 2P9CA 1FD2A 3I96A 4UQTA 4OX9F 1KQSR 1N0UA 4IFVA 4TKTA 3HVRA 2R7WA 3KNAA 4DEZA 1JLGB 4RW7B 3T1AA 5K14A 1VS3A 4X4RA 5KFGA 4G3IA 1VQLS 2VQFF 5LSOA 4OI0A 2YH0A 1XN9A 4DBQA 3S8SA 2W4DA 3V4IB 2AV5A 1U1LA 4GKJF 2BW2A 4RKUC 2R7VA 1C1BA 5CQGA 2W7OA 4LUBA 1KVJA 1VRUA 2FVCA 4FZVA 2DISA 4B3SF 3LP0A 4PWDB 2D41A 2DNQA 1FESA 5F8LA 4OMFG 2MKJA 1Q7LB 3ITHA 4IG0B 3PIPQ 3IN5A 2HHPA 3MCSA 3ZZZA 2R2TA 4PXCA 1WEXA 2KJWA 3KLEA 4AQYF 1SXLA 3PDNA 4LVOP 3IS9B 3M2VA 1OWXA 3HKZD 4Y2IA 4I6YA 2ZBIA 4X62F 4YHHF 2C22A 5F8JA 3G6ES 1ZM4A 5KOWA 1UMJA 2BE2B 3OVBA 3H2LA 1L5UA 1CQNA 4NCBA 5FD1A 3IRXA 2J6SA 2B51A 1Y5NB 1DLOA 3FFIA 4A8WA 2DBBA 5GADU 1VC0A 3J7A1 5A6PA 1DHMA 1JLCB 3AA9A 3LOUA 1LXNA 2HS0A 4HI1A 3S7RA 3CCJS 3MEGA 2LQ9A 2HHUA 2GO9A 3Q23A 2MY7A 1S9GB 2ZH1A 4I69A 4QQBA 2VASA 2IMWP 1IKYA 4UUXA 4JV1A 1SH2A 1IBLF 5L8RC 3IG1B 4EO8A 1SJ3P 4Z2XA 2YNIA 2IM3A 4Q45A 2MZRA 4F2SA 3BR8A 2IVYA 2K1RB 1BLUA 3M9NB 3AAWB 3QGIA 1FKAF 4C3KA 4OJ1A 3MAQA 3R5DA 1M5HA 3SSRA 1Q81T 4N56A 2UXDF 1RT1A 2IBKA 3FJ2A 3BZQA 3QAEA 2C2EA 1HARA 1M90T 1DTTB 4IR1A 1IXKA 1FK9B 4TQSA 2BRLA 5D4LA 2J0QD 3VQTA 2Z2LA 3M2RA 2BACA 2MYFA 1Q86T 1DRZA 2GO8A 2VA2A 3O2IA 1QLNA 2MXYA 5E3QA 4I2QB 2B43A 2HFZA 4Q7AA 2N3OA 2CPZA 4YP3A 3OXLA 3O1LA 4K0KF 3ZZPA 1R31A 2YQ3A 1S1VA 3MUVP 2ZHOA 3FEXB 1MU2A 3CC4S 2CPJA 3POTA 4ED6A 3OJUA 3OL7A 1VQYA 3KK3A 5F8IA 2M88A 4ZPVR 2WAQD 3I0SB 1W25A 1UL3A 2XLIA 3BDEA 4WTYA 5KFTA 4HL9A 1T05A 3KK1B 4DUYF 4ECVA 3C6TA 1CLFA 1JLAA 2B5JB 2HRYA 1HWJA 2XSJA 4ZP9A 4CO