4OX7A

Structure of synechococcus elongatus pcc 7942 ccmk2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
PIAVGMIETLGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVSAGLDSAKRVAGGEVLSHHIIARPHENLEYVLPIRYTEAVEQFRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Bacterial Microcompartment Shells: Chimeric Shell Proteins and Chimeric Carboxysome Shells.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Structural protein
molecule keywords Carbon dioxide-concentrating mechanism protein CcmK
total genus 25
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ox7A00
5DJBA 3NWGA 4DDFA 3SSSA 3VCDA 3IA0A 2A1BA 3BN4A 3H8YA 2A18A 3DNCA 4OLOA 2A10A 4QIGA 4QIFA 4OX7A 3SSQA 4AXIA 3I6PA 3I96A 4AXJA 4RBTA 3CGIA 3SSRA 4OX6A 3DN9A 4RBUA 4QIEA 4RBVA 2G13A 2EWHA 3N79A 3NGKA 4P2SA 4LIWA 4QIVA 4P7TA 3PACA 4OX8A 4OLPA 4P7VA 4PPDA 3MPWA 5L38A 3CIMA 3MPYA
chains in the Genus database with same CATH superfamily
2DB1A 4PR6A 4RW8B 1P9QC 2B3TB 4BC9A 4J90A 3HX9A 4M5GA 1XNQF 5H9EK 1ACMB 3NXZA 5AT1B 2ZE2A 3M05A 1HNVB 3ZNJ1 4DQQA 3SI8A 3BDEA 1Q86T 3M6WA 1FJCA 1FI4A 4IFVA 2VASA 2CFXA 3JQMA 5GADI 3PX6A 4I2PB 3BO3A 3QJLA 4PZVA 1BE4A 1FWKA 3W9IA 2FVSA 5DO2A 1SC1B 1GXLA 1NH8A 3B6BA 1PJ6A 4CTAB 3VVUA 1KKHA 2Z30B 1VRTB 1LKZA 4CDIA 2IPOB 1QAIA 2ZUAA 4PWUA 3JSMB 2VF3A 2GVZA 1JK9B 1Z2ZA 4A8QA 2LQ9A 4ED0A 5BYQA 4DFMA 4A8FA 1Q95G 5GMEA 1CS4B 1N88A 2AGPA 1VI7A 3HHLB 3KLIB 3P5TL 3HHEA 4HTJA 5B0GA 2RRAA 3VAKA 2OEKA 3P45B 3EYZA 3PNIA 5KFBA 1WI6A 2RILA 3GB0A 1FD2A 1VQSA 3MM7B 3MFHA 2XYPB 4QU6A 1S1WB 4WFNQ 4NRTA 5I3PA 4P9SA 3PJWA 4C11B 2XGQA 5GAEI 4DL4A 3A3PB 3OLAA 4F26A 2YQ3A 3OXGA 4IQMA 5J1PA 3M32B 3OL7A 3G8TA 1J27A 1F5AA 1ZM3A 2GC8A 1UWBA 2KJWA 1SQFA 3KYLA 2IBKA 3I96A 3MM9B 1HNZJ 4C8KA 4C48A 1NKCA 2I1RA 4DR2J 1FTCA 2VPWB 4IO9Q 1I94J 1S0VA 1R43A 4C8ZA 4OX9F 4RUCA 4ECYA 3BQ1A 3V6DA 2VOOA 4C6AA 5FD1A 3VQTA 4ZMMA 4ZITA 4DUYJ 2XYGB 4U7UK 2PEBA 4ZPBA 3KLVA 1R89A 2HNYA 4OI2A 4O3RA 4ZPWR 3ZZRA 3SCIE 2YNIA 4DG1A 4DSIA 4USUA 3KLGA 1M90T 2IVYA 2POKA 5JXSA 2R8KA 2ZITA 1P9YA 2UUWA 1RWUA 3EPGA 3E8OA 2QMUB 3NAIA 4DR2F 1IKXA 5DZ7A 1NB2A 2GJFA 3D0HE 3BQ0A 2FJVA 1RHUB 1RACB 2IM0A 4C8OA 1TKTB 3I4PA 3J7AN 1M5PC 3HMJG 2KFZA 2FD2A 1UMJA 1B0VA 2V34A 4RW7A 4RZRA 1MG7A 5B0DA 1Z1ZA 2FJWA 4HDGA 1UP1A 1KONA 5EUHA 5ETPA 3SQGB 2XI2A 2UUAF 2FGOA 2ASYA 5KFVA 3CB4A 1YHQS 3CMES 1QM9A 1HQUB 4ZPTR 2MLZA 2CNOB 3JYTA 2Y1JA 2ERRA 1YJWS 3KG0A 3M2RB 3AB2B 4RWWA 4PQAA 4TNOA 3D66A 1JJCB 4HH1A 5HL7Q 3FCHA 4MK8A 2WONA 1QAXA 3P5BP 1MLAA 3B54A 4DL0C 1JLCA 4J9UE 5DM7Q 1PGZA 3UVJA 2GIQA 4D3GA 5KFWA 1KVJA 2QX0A 4DPTA 1PYOB 2MXYA 1UVKA 2RDIA 1MN7A 1RTHA 1E6VA 2DH9A 1Q8BA 3D1QA 3GV5B 3RAQA 1FJ7A 4CO5A 1UFLA 2N82B 4IH5A 2MQMA 4BHQA 1JLQA 3GJRB 1AZSB 2HIYA 3IAM9 4GMKA 2HAIA 2RAQA 4F67A 5D6GA 3GYGA 4QZVB 1T8EA 2RDDA 4Z7YA 1WACA 1JNZB 1URRA 2GGPB 2FUG9 4UF4A 4KO0B 2EXUA 2F4FA 3A13A 3IR6B 1P1LA 3LQVA 4P75A 1JLCB 2F8HA 5ETQA 4CLKA 3OR1A 2CPYA 1T0TV 2YH0A 5HATA 1N34J 2FLLA 2NSCA 3NCPA 3DRPB 4XDCA 5KFIA 2VHGA 2VPXB 4C4WA 1VBKA 5DRKA 5K9FA 4RW8A 1FXRA 2ZWOA 2MZRA 3MD3A 2KXNB 2DRDA 4ZCLA 1KQGB 1TL1A 2KB2A 2C3UA 2ZM6J 2ZE2B 3JTPA 4LFBJ 1PJ5A 1LW0B 2V6AA 3BSCA 3DRRA 3QWUA 5ETOA 4IFVB 3W2WB 4TU9A 3KKFA 3VGSA 4OZJA 3IO1A 3HI9A 2ZH5A 2AGQA 3CJ5A 4ES3A 1BLUA 1ZPWX 4N8OA 2R8GA 2VFVA 2Y1LB 4IFYB 1YQHA 1RQ0A 2PMWA 4EMDA 5EWEA 1JLAA 3S6EA 3CCJS 3RRGA 5F0UA 3HO1A 3EMTA 1HIYA 2CQ3A 1BWEA 2EPIA 2GIRA 3PYEA 3HJFA 1FERA 4PUOA 4NCGB 2HK2A 4K5RA 1T03A 2MZ1A 4ZLLA 2Z57B 2E1PA 5DQIA 2M70A 1FF2A 1Q1KA 4NLXA 1TL1B 1DURA 1U02A 1YRXA 2HK3A 4BC7A 2C2NA 3IM8A 3MM7A 5DQHA 1CBKA 1S1UA 1U4BA 3OTEA 2OFHX 1IM6A 2RJZA 1FX4A 2XG8A 1NZ8A 1X5OA 2B4VA 2C3PA 1RTJB 3ADAC 4FVCA 4LF2A 4R0EA 4LUBA 1Q8IA 5CZVA 1FDNA 3BB5A 3V4MA 2G0JA 2GS8A 2D3ZA 2W7OA 1HA1A 1RU2A 2HIQA 3IMQJ 3FMWA 3D6FB 4QR2A 5IT9Y 4KH1B 3RB0A 4GVBB 2J0XA 5B0AA 1NSAA 4NLOA 4AXIA 3RR8A 1JLEB 3C46A 3L7PA 3GILA 1WI8A 4F4WA 2P9GA 3R6LB 5E7OB 3R7SB 4KGMA 4A4JA 3R3TA 2BR0A 2IM3A 2M0GB 2WAQD 2NLWA 2YNIB 5KFUA 3QWPA 4JYAF 2OKQA 4DL5A 2JLFA 1WG5A 2FLOA 5C5JA 2IVFB 1L3SA 2B8QA 2LA4A 2MTLA 5D0RA 1K1SA 4F0KA 1XIQA 3OW2R 1NJIT 1O0PA 1D9DA 4L3KA 1PAEX 2QYCA 3MECA 1EARA 3DKDA 1QTNB 5HQ8A 4YQWA 3GFZA 1Y3JA 3IBFB 4ZLJA 3WZ0A 1S99A 3AJ2A 3PG9A 4OHVA 3S7RA 3IRWP 4J9LA 2AZ3A 1ZM2A 2W24A 3PY8A 3NS5A 1YK9A 1LWEA 4ID5B 4JI2F 4AXJA 4DN9A 1K9MT 4GKKJ 1X5TA 5DG7A 2J8SA 4OYXA 3FDSA 4CRJA 2R2TA 1HWLA 1WG1A 4K0KJ 4ZPAA 3RAXA 1S48A 3UVJB 3HT3A 3KDOA 2MQ8A 4HDHA 3NNHA 2F4VJ 3K17A 5J1EB 4ETZA 3DM2A 5J2MB 4OJ3A 3G96A 5H9FJ 1RSCA 2J0WA 4M8LA 4ZS6A 5KT7A 3NMRA 4N77A 3QRPA 1VDHA 2JLEA 3I31A 7AT1B 2BUNA 1TKZA 2LCWA 3BPSP 3CJSA 4Y00A 4ERDA 2I2YA 3H20A 2ASJA 1SKRA 4K8RA 1J5OA 3MMJA 3I0SB 3T19A 1C0TB 1IWGA 2MY7A 4PXCA 2M4MA 3PYFA 2HNZA 5B0EA 3ZTQA 2XWYA 3CDBA 2VUGA 5KFHA 2U2FA 1ZS6A 3PHTA 5IT4A 4F4YA 1T3NA 1ZA1B 4CLTA 3CIZA 2VBWA 2ZJPQ 5HROA 3GE9A 2GQ2A 1FRXA 1F2HA 2P9EA 3I56S 1QAJA 2LKZA 2J8AA 1S6PB 5KFSA 3B82A 1NK6A 2QTWA 5T7LA 2GW8A 2XS5A 1X4AA 4YR3A 2FIUA 3MFIA 3DOMB 1VLOA 5LSOA 5LJ5Y 4P7TA 2KM8B 4CP5A 3NGRA 2B9WA 2XMJA 3IGNA 2R4FA 5L46A 1C0TA 5HO4A 4FPIA 2E5LF 2CPJA 2UVVA 2R7QA 2XSJB 3OV7A 4X4VA 1HHTP 2ZFHA 4WTYA 3S1TA 1U1OA 1U6ZA 2BVZA 3QGIA 3LWMA 4KV8B 1YJTA 2VOPA 3HVWA 1CJVA 2EKYA 2IFXA 2W2MP 3KJQB 2AP6A 2PE8A 4IOBA 1RE1B 1WC1A 2FJAB 1WF2A 4OX7A 1FTRA 4PKDB 4ES1A 2EBEA 4V19X 1LNQA 3BH7B 4Q8EA 3LAKA 4H4MB 5E33A 4RX6A 3GJTB 2RH3A 4I7FA 4PYAA 4RW6A 2QSWA 4BWJA 3RYLA 2HMIA 2F65A 3CCZA 3HVAA 4QIEA 3IBWA 1JWWA 3J81j 1S9EA 4NI2B 5D77A 3KMQA 1TMMA 1CJTA 2EFQA 3PIPQ 4DSFA 4PABA 1H7XA 4OX8A 1S79A 2HNDB 4ZVFA 4ZVQB 1WC3A 1JB0C 4K2XA 3SMZA 3J80U 2ZJRQ 5KT3A 2R7UA 2CWXA 1BQXA 2WB4A 3M2UB 3HZEA 1YWXA 4WE1B 1R8BA 5D8HB 1TUVA 1OY6A 2CDRB 2CJXB 3GFYA 3QT7A 4ZLNA 1TL7B 3MM5A 3WIUA 3PRDA 4G1QB 1FNMA 3R97A 1HQEA 3TRGA 1IBMF 2ZZMA 4ILLA 3SIPB 3H7HB 1NK5A 5BYSA 3ULHA 1SKSA 5LT5A 1WKKA 4DR6J 1U1MA 1UKUA 6FD1A 1HW9A 2V2ZA 4JBCA 4Y2MA 3MF5A 2CQ0A 2RKIA 4NLUA 4B9MA 1HWKA 1T95A 2VZ9A 3C16B 2KVQE 2J7UA 2VG6A 4MKBA 2PI4A 2HNDA 4EO8A 4Q0BA 1JXEA 1HYSA 4JI1J 4DR7J 1JLBA 4PWWA 4ZVRB 5C2CA 1GTHA 3KUEA 1YZ7A 1L3TA 1FE0A 1HWJA 3TYTA 2HHHF 3CJ4A 3GYXB 2YH1A 3OXFA 1TV6B 3IBCB 1UPMB 3RW7A 4Y34A 3V2UC 4H4KC 2ZDOA 3VZIA 5KFEA 2QIFA 1Z4UA 4ZLPA 1CJKB 1WHWA 4Y65A 4R8UB 5IQQA 4Q5VA 4C8YA 4QJVA 2OLWA 4ZJLA 2DHXA 2EG2A 3CCMS 2LVWA 4LBPA 2CYYA 1UVLA 1DZ5A 3UCGA 2AJFE 4WBFA 1IR2A 1KLMA 1K8AT 1S72S 2RVJA 3IGVA 3MCOA 4RKUC 3J7A1 4QCLA 5CCLA 4I4BA 2F9JA 1C0UA 1Q0NA 3O1LA 1T05B 2IRYA 3F56A 4WP8A 3UD3P 1M0SA 2F8MA 2GHVC 2NXNA 4FVMA 3DGVA 1FD8A 4OQJA 2F8EX 3KUGA 1X0FA 1OSDA 2W2OP 4UT4A 1Q16B 2A1BA 2YNHA 4B02A 4EO6A 1UJ6A 2DNLA 2RQ4A 1C2PA 3FBBA 2NSBA 4U9RA 3MR6A 2Z0GA 4A8OA 2VJVA 3SV4A 2QA4S 1Q4RA 2CQ2A 5IC6B 1NK7A 2PA3A 2HS0A 3GJQB 3KNAA 1FVSA 2YX4A 1RWNB 3QGPA 1CS4A 1XMQF 3D1HA 3ISND 4JV5F 1SXLA 3M30B 3T6BA 4AD6A 3PYDA 4C0HA 3HM9A 4NOHA 2AW0A 3CULA 1IVZA 1Q7LB 2YWGA 3BBCA 1RBAA 5J1NA 3T9ZA 2ZH4A 4X4QA 2LEAA 5D0EA 3ZC4A 4ZVEA 3FEXB 2LQ5A 3G82A 2YWEA 2RRNA 3DRXA 3BSNA 2XO6A 1RAHB 2DHHA 3VGVA 2OPRA 1OY8A 3MCMA 5LJ3Y 2BM1A 3DI6B 1KQFB 2UXDF 4M94A 3NBPB 1K47A 2CNLB 2ZKUA 1VQ6S 2CUYA 5EDWA 4USHA 3Q22A 4KBIA 3K8VA 2MY8A 1TUWA 2DTJA 3G8SA 2AJ4A 2YKMB 4F4KA 3A8IA 4Y2CA 4DF4A 5HK4A 4RW6B 3A12A 4J9RA 1H7WA 2N4DA 4P72A 1N5YB 2JFKA 4Y0FA 4G1IA 2YX1A 5DS7A 3PO5A 2WVEA 2DGWA 2F1FA 3AD7C 4IG0A 3AH6A 4QPXA 2V8PA 2COLA 4ZN3A 2YPYA 5ETRA 5A8KA 3UW1A 5F9NA 2PGCA 1NJYA 2XBPA 4LREA 3M2UA 4USKA 2FJEB 2VICA 3MUTP 3NWRA 3LP0A 3GONA 1MU2A 5HAOA 3BSOA 9RUBA 2UXCJ 2XZWA 2FTRA 4LFAF 3GZ7A 2E7XA 3OFEA 2O5DA 3PZPA 4F8RA 2YKMA 1GXUA 1R8PA 1WEXA 1WDTA 2DY1A 2HEKA 1GEHA 3VAGA 4B3OB 2IMOA 4KH0B 4JYAJ 2HFOA 4F25A 3GIKA 4EZ9A 3R5AA 1RHKB 1C1BB 2CWKA 3S8SA 2DGOA 3BV8A 3UDCA 2AJ2A 3M9MB 2B0GA 5GMKa 4F2RA 1QVGR 3WC0A 2Z4PA 4DLGA 1S7HA 2AZ1A 2IMWP 5BJRA 2P5VA 1YRUA 1D9AA 1RTHB 1WF0A 2A3JA 3AXKA 1H2VZ 3PCOB 3M1VA 3N79A 5KFQA 1PAUB 3GIIA 1A7GE 3TANA 4USJC 3IR5B 5GVQA 1NDKA 4XPCA 4GKJF 4RW4A 3AB4B 3H2UB 4FP9A 4XTTA 1XTZA 4UQTA 3W8PA 4LF7F 3F0NA 4ANCA 1YTYA 5D3GA 2GGPA 2VFSA 2HBRB 4N47A 4J9QA 1FRIA 4ZIVA 3FEYB 3CT9A 1FXDA 1SIWB 2R3VA 1XK8A 3DOLB 2NPFA 5EWFA 2OSRA 2LECA 1N8RT 2GVZB 1TP7A 2RMLA 3MEEB 5CH7B 2W9AA 2IHR1 3RBDA 1EP4B 4MTPA 5E3RA 3OL6A 1IBCB 1LQ9A 3LGNA 4EI2A 3I9ZA 4Q45A 2GVDB 1B7FA 4DR5J 2BJ3A 3TZWA 2GQQA 2WBRA 1MROB 1FT8A 1PKUA 1SBRA 1E6YA 4YHHF 4ZJOA 1JJ4A 4JV2A 1TL3A 3HSDA 4M1KA 2X3DA 5A76A 1TL4A 4B3MJ 5F8IA 2UVWA 1Y00A 3PFEA 2EW9A 3RTVA 4CH1A 1TL5A 1ZM4A 1VMBA 2I9SA 1MN9A 3M4XA 4NZ6A 1K73T 3JS9A 1IXKA 2WW8A 2DKOB 3L4BC 2YKNA 2P8IA 4WIIA 2LEPA 2E7WA 1WHVA 3FBCA 2OPQB 5I42A 2A10A 2KHCA 2K1RA 2JEGA 1N0UA 1S4FA 1VRUA 1PJ7A 2IVMA 1URNA 3Q2TC 3K59A 3EGZA 2XTJP 5L1KA 1F9HA 3W64A 2UXBJ 2PT0A 5AE3A 1HKAA 4W98A 2DNYA 2E5LJ 3GSDA 1YJNS 1HMVB 2B7CB 4LF4F 3PR5B 1KFDA 3L7OA 4RO0A 5KFXA 3UN3A 4J9MA 2C2DA 2Y1RI 4FDFA 3QT6A 3CD0A 2QL7B 2BDPA 1BMQB 2Y9HA 2R7SA 2OPRB 3R5DA 4GVBA 3DXSX 2HWHA 1YG0A 3J7YI 4U96A 1KNZA 3MPYA 1LXJA 3QRRA 1T94A 3CJ3A 1JLEA 1YJ7A 2J5AA 4DZ6A 1RT1B 3AFGA 3CJ8A 1VR6A 3BGOP 2RHQB 3LA0A 4Q43A 3MXHP 5KG3A 4IRCA 3O2IA 4QQBA 4PQUA 1LWCB 4ECWA 3CD7A 3IWXA 5K14A 5M2UA 2AIRB 3RB4A 4O3SA 4PXEA 1X4DA 5L39A 2RU3A 3NGSA 1S49A 1C4AA 2V5HG 3G87A 1JMTA 2JWNA 3QT8A 3OHBA 3DLEB 3OQ2A 2MQQA 3VWSA 3WBZA 4FBTA 1KHVA 3FRYA 5ETTA 4ZCMA 3GFHA 3L9ZA 4LRBA 2PA8D 1QY7A 3MECB 4CLWA 2HSEB 1KWMA 2KN4A 3M8QB 4P10A 2HW3A 1CSJA 3OR2B 3KJVA 2IA0A 4QYZK 1WWHA 3OL9A 1KHWA 3AD8C 2MHNA 1RWOB 2LDIA 3GQCA 2CG4A 2KRBA 4FYVB 4WFBQ 2CJAA 3PX0A 2C28A 4KHMA 5LXYA 3SXLA 4YP3A 2ZKTA 1SV5A 1H98A 4B3MF 4P2MA 5HMYA 2C2MB 2H4WB 2W4CA 4NE9C 2BKOA 3DRPA 4BBYA 2ZBRA 4DCPB 3KLHA 2XY6A 1D9FA 3MR3A 3IAS9 3N6NA 1NSPA 3ELHA 3MI7X 4L73A 4DPYA 4B9NA 1RA6A 4F0HA 2XB2D 4O0IA 2EBGA 3U1LA 3P3DA 4C98A 1IKVA 2HBQB 2JL9A 1WKLA 1IQZA 2ZHOA 3D68A 4DZDA 1VOMA 1HQ2A 3KTQA 1D8ZA 2W2NP 3KUHA 1XERA 2GMJA 4Y2AA 4YY3F 2HNZB 2AX1A 4DN0A 1NSQA 4K50A 5J2PA 2E66A 3DMJA 3A4TA 1KTQA 4FYYB 1VHFA 2FHKA 2IJFA 1Q5VA 3FBEA 4FKXA 2KDOA 4IFYA 2EK1A 4LVOP 3EVMA 4NYZA 1Y9OA 4CLUA 1YJ9S 3T9NA 4CT8A 5F0WA 2KFYA 1TFWA 2XS2A 2JX2A 1SV5B 2MKYA 2XHCA 2A2CA 3TX0A 4X84A 3UNGC 4A8XA 4UZBA 1H3DA 4MYUA 3HPOA 2D3OR 2LU2A 3FRZA 3RAMA 4YMEA 4CQ1A 3Q8QB 1F5BA 3GR0A 1F6TA 1EX8A 5HP1A 3LGMA 1G7CB 5KTQA 1RABB 3TAPA 2VQFF 4O3QA 1VJQA 4ANDA 5KFLA 1T7PA 2HHTA 1SH3A 3MEKA 2DGQA 1RT5A 1RCXB 1X4CA 3Q8RB 3N01A 5J2QB 4KGKA 2J6UA 2OUGA 1O51A 2NXUA 3MEGB 4FXWA 2HPUA 2O3DA 2DEJA 4CNZA 4LF8J 1VIXA 2K1RB 4J9KA 3DXBA 5SZTA 3UQSA 1TKXB 2F5GA 3I5AA 4X62F 1ZH5A 1FRKA 4N76A 2E44A 4TKTA 2HMIB 2E1CA 4DSLA 4NLVA 1IKWA 5AXKA 1Q79A 2DCLA 2WSEC 3DHWC 3HFVA 3HKZD 1GFWB 4JV0A 5KAKA 3I0RB 1V3ZA 3PTWA 4DSEA 3JB9k 1N33J 1QE1B 4DF8A 1LWFA 2IDLA 2J0QD 1HPZA 4RBUA 2LQBA 2FB0A 2DY9A 2XLKA 3MDFA 2CG8A 3DOKA 1DQ9A 1WELA 2C3MA 5CQGA 1YJUA 2KVIA 4DFJA 1UZHA 1FKPB 4I69A 4LRDA 3TR5A 1KC8T 3CD6S 2DO0A 2KHDA 3IWLA 2RQCA 2ALYB 3KG4A 4I6AA 2K06A 4CCHA 4X2BA 5HMZA 3TQ1A 2MKSA 1QSSA 4R25A 4K4ZA 1DY3A 3J81U 3SFGA 4ID5A 2V9WA 3FEZA 1YX2A 4CO0A 3POTA 2G0IA 5ETVA 1C4CA 3GV7B 2OTJS 3H90A 4EWTA 2CPZA 4QWEA 3M8YA 2KG1A 2V9KA 2HRYA 2E1MC 1T9WA 3DM2B 2PEHA 1T11A 3N6LA 5FDLB 2M88A 2HVDA 1KS2A 3GMGA 3EX7B 2YKAA 4Y2IA 2MKKA 1SJQA 1N32J 2XMKA 3JSYA 3OR2A 1HD1A 3UPFA 3HP6A 4ANEA 3R5CA 3FGVA 3SQGA 2NR0A 1NHKL 2HHVA 1TQLA 2DHGA 3F41A 4ICLB 1RHQB 2YKOA 3ITHB 2N3OA 4IH6A 4JI0J 3V6JA 5IFMA 2CADA 3C14A 2F9DA 2GCFA 5DDPC 1RAAB 2FJBB 2YNGA 1WG4A 1UEKA 1APSA 4DCJB 2BE9B 2HZAA 2CA9A 2QA2A 1HNWJ 4PXDA 3CE8A 3LALA 3AAWB 1E6VB 5FDLA 3TX8A 4GC7A 4RLEA 4ZVTB 5IT0A 2R2UA 4CNYA 1S6UA 1KR4A 3HSJA 3KNGA 4OV1A 4F4AA 2WTFA 1RAGB 6AT1B 1HLWA 1SH2A 2BE7D 3TAMA 3KMSA 4DR3J 2WOMB 1EQ0A 1IR1A 4DS4A 1FE4A 1IN0A 4UOHA 4YDDB 4HYKA 1JLGA 2Q6CA 1HHSA 3GLJA 1RLDA 4HI1A 2EKNA 2UXCF 3OVSA 4X66F 1TU0B 2JJ4D 3HVTB 3TAQA 3EZUA 4DQIA 3T3FA 2XM3A 2VA2A 2FLPA 4ZDNA 1NXIA 3FJ2A 4USMA 1RTZA 4F3OA 1S0MA 4X4PA 1WDDA 1S1XA 2KI2A 4I7FB 1JXVA 3CMQA 3WDOA 4ECRA 1NK8A 3DGPA 3K5OA 4CLSA 1U1LA 4Q7AA 5DG8A 1MWQA 5B0FA 2VODA 4Q44A 5A2QU 1S1TA 2AEMA 2VU5A 3CVKA 3V6KA 1WHYA 3LUYA 3AJ1A 3NS6A 1PG5B 3C15A 1KP6A 4NA1A 3EJMA 3CCRS 4ECXA 4DL6A 5ETMA 2UXDJ 2OTLS 3I5BA 4HTIA 2ZD1A 1HBNA 2JNJA 1SC3B 2YTCA 1BGXT 3H5UA 4WE1A 3T1HJ 3HVTA 3FMBA 3O3LA 3OPKA 1HBMB 1MWZA 2H65B 3D9BA 3HDSA 5IM0B 2RE1A 1UVIA 4ZK7M 4PUOB 3EZOA 4NCGA 3Q8PB 4EZ6A 4NLWA 2D9OA 5LMNF 4ED2A 2UU9F 4JI2J 5DJBA 4FF3A 1LV5A 3DRSA 3LAMA 3O8WA 4ZP7A 2AGOA 1XMOJ 4QIWD 5F9LA 3LPYA 3BR9A 4O0NA 1FFGB 2XLIA 1QTMA 2WBMA 2V4JB 1VBZA 2IC3B 2GMHA 1L3UA 1VFJA 3EICA 3EM1A 2DCUB 2U1AA 3EGWB 4OYZA 4K4XA 4F4XA 3EWGA 2B51A 4DPOA 4I68A 3OLBA 3PYGA 5C25A 4B3RJ 3QYYA 2MB0B 2DNMA 2FDNA 2CPHA 3EGVA 3VF0B 3BO4A 2XI3A 1F0XA 3HULA 3SCJE 4I56A 3W2VA 2QA1A 1MU2B 3QSIA 3C6TA 4RR5A 4U6PA 4OZ2A 1IM4A 2G0CA 2ZOFA 4KC5A 3Q24A 2W8LA 1B3TA 2HKEA 4LIWA 3GCXP 4GRSA 4UUWA 3Q23A 4Y28C 1JKHB 1TAQA 3TA2A 1QSYA 3M2RA 1CQNA 2X1BA 1GK8A 4DR3F 3OT9A 3V5RA 1NPKA 5D4OA 1SC4B 1M5SA 5F8GA 2XY7A 2HRTA 3QBCA 4IQXA 4AQYJ 3RW6A 1U09A 4ZVGA 4CO3A 4RNFA 1FDAA 3OXLA 1XC9A 2GJIA 5K8OA 3DLKA 1SIZA 2ZH3A 2LP4A 3ENAA 3PM9A 4Q2MA 1TUGB 5KG5A 2B9YA 4ZKAA 2Q1LA 5AE1A 2YKQA 1PILA 2YXLA 1N5SA 3LF0A 4X4TA 3HXMA 2E29A 1AW0A 4AQYF 2D74B 3PW4A 4S0MA 2HHUA 4MAKA 2B5JA 3G8QA 4NRUA 5A0YB 1S7IA 2BW2A 4B17A 4K4VA 1MSWD 1NPPA 2J7KA 3BREA 3CF5Q 2PI5A 1RHJB 3J7Z5 4DR6F 4CO1A 5K8NA 3OTBA 2IIHA 2W9CB 4DR4F 3C66A 1U25A 5D78A 3ZZOA 5GMDA 3H42A 4L75A 3OTOF 2HS4A 1NAQA 3TA0A 1VQ4S 4HT5A 2R2RA 3DRRB 3NRBA 3SBMA 1SL2A 1I6JA 2ZNYA 3RBXA 4RNOA 4RBTA 1X60A 2I5JA 4FKYA 3G82B 1HI1A 1ZAXA 1SB6A 3JQKA 3CXCR 2R8HA 2ZNZA 4OI6A 4WU3A 2OPPB 1YBAA 3KLFB 1WNEA 4C9DA 3FCWA 1SQGA 3MM8B 5IWAF 5J2NA 2W7PA 2DBBA 2RF2A 5D4NA 4DXLA 4ECVA 3GWCA 1AA1B 4UTGA 2OPQA 3LW5C 2ILYA 4DU7A 5I42B 4P52A 4F50A 3T5JA 2NREA 2V50A 1OS5A 1IUJA 1FKOB 2ACMA 3UR3C 3W65A 3R1HA 4TU8A 1D8YA 1WOOA 4KFBB 2NXEA 3Q8VA 4O44A 3BPDA 3I82A 5A6PA 5MAOA 1Y5IB 3M8PB 2UZAA 5HI7A 1WSVA 4E98A 5IWAJ 4ZPVR 1RJJA 1VISA 4UQGA 3MURP 3N28A 4ILRA 4IG0B 3T1AA 2I5JB 3TVKA 1AB8A 1RTJA 4AUKA 3KK1B 2MGZB 4O4GB 4DV1F 4DFPA 2HWIA 1MMNA 1CVJA 2AEJA 4BS2A 4NLSA 2VDHA 5A8WB 4DBQA 1LK5A 3NOCA 3PJ9A 1GMUA 4WFAQ 4DV5F 1T3OA 3CC4S 2HQCA 1RXOB 4CM2A 2XMMA 2HGNA 4DPWA 5KG0A 5DETA 2AQ4A 5KFDA 2MQLA 2HZCA 2UUAJ 1FO1A 1VHIA 3PEHA 5K14B 2ROGA 2W7AA 1S9EB 4NI2A 4DX8H 2FHJA 3A8EA 4DMZA 2XC9A 1CJTB 3AXMA 5AXLA 2KKHA 5DGAA 3UNYA 1VK3A 2BKPA 3DLBA 2DGSA 1QVFR 3QRQA 3NG8A 5E3CA 1WEYA 5C25B 4B9VA 1Y10A 2CPIA 2P9CA 4PG4A 4UOFA 1TAUA 1RTIB 2GX8A 3VTIA 3MMBB 3HHDA 3SV3A 1QUVA 4CWBA 2XNRA 4LF5J 4LFCF 3C6TB 5A6WA 4DHVA 4HEA9 3AJDA 2BOPA 2F63A 3GR1A 2V2QA 4X64J 1XJWB 3TUIC 5B0CA 4ZPCA 2N7CA 3M8ZA 2JEFA 4JI4F 4NPOA 2R42A 4F36A 3P4UB 3TJAA 4NX9A 4CLYA 2JH3A 2RD5C 4ECQA 1U48A 5F3ZA 2UUTA 4FN5A 3U02A 2HQDA 3RG6A 3M8SA 3R7NB 1ZAWA 1U26A 2JRSA 3I32A 2RKIB 1DRZA 3JXOA 5C2GA 1SUQA 5J1EA 2Z2YB 1EJ7L 3OUYA 2HZVA 2CPFA 3BBFA 2WRMA 3HHKA 3IRXA 4IDKB 5B0BA 2FZGB 4LRAA 1M5VC 1PIEA 2MMYA 4B9LA 1GNKA 2FVCA 5C24B 2ACYA 2MKCA 3KK3A 3MAHA 4HR2A 1T9XA 1L5UA 1G3OA 2JSXA 2OHDA 2VC1A 5KG7A 4DV6J 3D7SB 4NMXA 2J9EA 3CO0P 4ZVHA 1QJHA 1AFJA 3JTNA 5JVGQ 1VQYA 3AOCA 1MW7A 4PG8A 2HRUA 3BEGB 5HBMB 3FNNA 4M5JA 4RBVA 2B5JB 2MZJA 4PWDB 2B9XA 1IBKF 1Y7PA 1H72C 2PIIA 4JI5F 3MMAB 4DPXA 3W5XA 1KLMB 2IDEA 1U49A 1S76D 4J7CA 1S6PA 1VRUB 1WC0A 3KJNB 2BJ9A 3LP2A 4BLGA 1V9OA 4Q8FA 4MYTA 3M2VB 4ZCKA 2EC0A 3E2EA 2ZBCA 1UCNA 2AYMA 3PW7A 1C0UB 1T05A 3CNQP 4N8NA 3AQPA 2J0SD 4W4MA 4P6QA 1EIYB 1YLXA 2CQGA 3PJXA 3RU0A 2DGVA 3D2WA 3PKYA 5C42B 1PBUA 3N4WA 3ENVA 3H59A 5G4DA 2G2YA 8ATCB 1UW9A 4DX6A 3CCVS 2XCPA 3M32A 4GKJJ 2VG7A 2IY5B 2RQKA 2XSFA 3W1YC 5JJBA 1GX5A 3ILJA 2VC0A 1B4SA 1TELA 1NZAA 4MT1A 2J76E 4OJGA 4DR7F 4ZN1A 5KFZA 2DNQA 3SFUA 1UEUA 3UI3A 2UP1A 4H4MA 3LP2B 1F60B 4P2SA 4O3PA 4XIUA 4ED1A 2YQ0A 4WJBA 3D3CJ 5CYQB 4PG6A 2IM1A 3V81B 2FJDB 1LWCA 2R9LA 4TYBA 2ZOMA 2EK6A 1DJ0A 1H2UX 1GX6A 4LBHA 4OHZA 1V5VA 5L1JA 4A8YA 3DLEA 3ILIA 3D54A 4QBUA 3T1HF 1HPZB 3R7BB 1F1BB 4IO1A 4AL6A 4QU7A 2P2CB 2L9DA 3ET6B 3J81Y 2L41A 5KFJA 2R8JA 1OO0B 1VYAA 5T41A 1RAOA 4ELTA 1RADB 4LF7J 4LFBF 1Y4ZB 4USWA 5E0OA 4LR9A 1NM2A 3MM5B 1VBXA 3VR1A 2ROPA 4LSNB 2CZVC 2MJNA 2WHOA 5CYQA 3CWJA 1T02A 2FHMA 2HVEA 4P74A 4A8MP 4CH0S 1PC4A 2DR6A 4DV6F 1S6OA 1FWLA 2OP5A 3L09A 2L08A 3B8HA 1HNZF 1GMWA 3G6ES 4PXBA 3ZZ0A 5HVHA 1RISA 2LLZA 1X31C 2VKZG 4LR7A 4OFZA 2W2PP 2CJBA 4F04B 5KFGA 4DUYF 1OYEA 2LEBA 1X9SA 1N32F 4LT6A 3T41A 1HD0A 3CDWA 2E9RX 3MMBA 3KHHA 1NPRA 4KRWA 3Q0AA 4LF6J 3W63A 4Z37A 4NXMF 3N0VA 4A8KA 2BMBA 1OYDA 4RW9B 1M5KC 1KSPA 4I2PA 4HHUA 3JTOA 2BOAA 4IG3B 3WIVA 1D3WA 4R8UA 4NLRA 2Q79A 3LO3A 3P8BB 1RHRB 2QJ3A 3C14B 4F4ZA 3O44A 1CPZA 2CIMA 1FJGF 3FUYA 3MGJA 5DLGA 1UA0A 2OSQA 1G2EA 2DNZA 3MOZA 1XQIA 4YB1P 1JLFB 1FRLA 2J9CA 2BE2B 3LTOA 3SSSA 4DJBA 3U7JA 4WFZA 5KT5A 3BN4A 3TJ8A 2XZDB 4DU8A 2PC6A 2VQFJ 4J91A 3THTA 3VAJA 5HP1B 1BWVA 4OHYA 2BJDA 4X4NA 2QYGA 2N3LA 5BYRA 5IV3A 3SEOA 3EPIA 2W9BB 4TN2A 5I3QA 4M5DB 3VVTA 1HARA 3FQKA 4X66J 4DV0J 4AE5A 1XR7A 2KXFA 3IM9A 1OQ3A 3JSBA 1RT5B 1KD1T 2C2RA 1RT6B 2MZTA 3QSYB 1HW8A 4OZ3A 2NZ4A 1Q53A 2IYIA 3P6YC 3VV2B 3G6XA 4C3MA 1TVRA 4YUDA 5E41A 3GYNA 1TKXA 4KHRA 1TFYA 3GG0A 1N6QB 1B64A 1S1XB 4ZP6A 3MHYA 2CKWA 4DV3F 2M7SA 2MDAA 5KG1A 2FC9A 2GVDA 4QYRA 2FHOB 1FX2A 4QOTA 2VBXA 4LFCJ 1XMQJ 5KFMA 2HFNA 2BBEA 2DNRA 5I3UA 2J6TA 5KT4A 1E6YB 1X5PA 2M9KA 3F44A 4K0KF 2LXUA 4RWXA 2DIUA 4MKYA 1N34F 3QAEA 1QE1A 5KT2A 3QZ8A 1Q78A 4P2XA 5B09A 2QC3A 4I0WA 1N5TA 3QGGA 5KOXA 3GPAA 3G71S 1U6BA 5F8JA 1VRTA 3HLUA 3PDNA 3CCUS 4DV3J 1VCTA 3TOQA 4DL7A 1YIJS 4JI8J 2DRAA 3HHNB 3R5JB 2ZM6F 1U0HA 1XR5A 3HJVA 3THPA 4NLQA 2V8GA 2JOQA 3CO9A 2K3IA 1VQPS 2RS8A 2WZ1A 5LMUF 2HYIB 4B9UA 4RNMA 4FF2A 3X1LB 1N6QA 1NH7A 5FJ4A 2EWHA 2DH7A 2C1EB 1RCOB 2DXFA 2IC3A 3Q86A 2MPUA 2WONB 3A8KA 3BBBA 4WWSA 3T1YF 3QGHA 3GCWP 4CZCA 1KTVA 1BQMA 4L72B 2J7WA 4A48A 3J7YU 4DL3A 4W90B 5G0RB 3K57A 2I38A 3BZQA 4CO2A 5L1IA 1ITPA 3GIJA 2MSSA 4HVZA 2QO3A 4YB6A 1GXTA 3FBFA 1M1GA 2IRXA 3C6UB 5KOWA 5HLFA 4EBDA 3GIRA 3M7VA 4OMFG 3MAAA 1OMSA 1U0HB 1U2RA 4C0OC 1AFIA 2ZVSA 3MR5A 1F3FA 1RT1A 1YDLA 1G1XA 3K5NA 2KZZA 5AE2A 4TQSA 4X65J 3ITHA 2DIVA 3CPWR 4P2FA 5HVGA 2OPSB 3LWLA 2MKJA 3X3UA 4B3SJ 2XEXA 4I6YA 1MMDA 4PQUB 5IZHA 2A6OA 1AUSL 2QLFB 5DDRC 2IA6A 2UUCJ 4OYMA 4XAKA 4QR0A 3CCTA 2CQCA 3I55S 4JUZA 3ZTOA 4EBEA 1B99A 2PD1A 2ZEJA 2VA3A 1X0PA 5L9XA 2Q43A 3IG1B 3PRVA 4KB7A 1U6FA 2EFPA 2AX0A 3AODA 3M8QA 3MCNA 5F3TA 1M5HA 4DX7A 3TAMB 2J9DE 4DV5J 5BR8F 3HZGA 2Y8YA 3RRKA 2BEFA 4AT1B 2XMUA 5MLCV 2EFGA 4H4OA 3OFFA 2XYHB 4HI2A 3R9LA 3TJ9A 4NWBA 2CQIA 4PG7A 2KT2A 2NYHA 3ENWA 2YWHA 5KFYA 2HURA 1FJEB 4OZ5A 3H0PA 1V3SA 2C2OB 1ICEB 4UOGA 4YB5A 3PEJA 1LXNA 3DU5A 4V19J 2VFRA 3NP5A 2HVZA 1X4BA 4JB8B 2RRBA 3LANA 4C0BA 2BE2A 4RUAA 2R7VA 5AJ3J 5IC4B 4XK8C 2DPJA 1WORA 3WX8A 1JLQB 4TY8B 2RUSA 2MLYA 2V4QA 2C2EA 2AYEA 4XO0A 4PPZA 5H9FK 3MPUB 4ED3A 4EGLA 1VGYA 3ZZUA 4A46A 3C19A 4QWAA 2ZUGA 1RT6A 7FDRA 2ILZA 4N56A 1YRTA 2ZH1A 1VQNS 2DHAA 2HHSA 2W4PA 1QSLA 1JIHA 2MZSA 3JSMA 2C22A 1NDLA 3OR1B 1SL1A 2QGFB 1UW4A 5EX3A 3M6XA 1S1VB 1U0SA 3UDLA 1KQKA 2VDIA 4UZCA 3VGUA 1NHVA 3OTCA 1AYEA 3RUBL 1RTDB 4GVLA 4IUFA 3OJUA 5HMWA 2LXFA 3CEDA 2DHSA 4LVNP 3MUVP 2R8IA 1FRJA 4DR1J 4QIVA 4OV6A 5I3UB 1M5OC 3GIMA 1L3VA 4ZIWA 2BACA 2PFDA 3ILLA 1PBAA 4TXSA 2O67A 2NUHA 4OI3A 2ZC4A 3KK1A 4QWBA 2HHPA 1HBUB 3KFWX 4CLLA 3T5KA 2BQUA 4NEZA 4KE5A 1Y3KA 3CJRA 2VKRA 1U47A 3EXYA 4URQU 1ELOA 3BKTA 3QPIA 1RK8A 4LF9F 1FJGJ 1GH8A 4LF1A 1KFSA 3W5ZA 2RQMA 4RU9A 1RBLA 3ZTRA 2FLNA 3RRHA 1JJ2R 4J9VA 1X8DA 2BKNA 4RNNA 1RTDA 2IAJA 3FCVA 3LGHA 4KY3A 2M8DB 4IRDA 4NXNJ 3TUPA 1NUEA 3FC9A 1LW2A 1RWPB 3FVYA 4D3HA 2IJRA 2AV5A 3PXGa 1BQMB 4FXDA 1QD1A 3G86A 3UD5A 2XQCA 2NQPA 4FZVA 3NCRA 3EGNA 1VQ5S 5ITHA 1HBUA 4ZJQA 1TR0A 4HHJA 4LBIA 3VCDA 3FFIB 2QSFA 3DOKB 1ROFA 2BM0A 3MAAB 3NNCA 2NPIA 2XCAA 1RWKB 1VJWA 2XWXA 3I6PA 4WZMA 1PYTA 1T9YA 1I3OB 4Y2KA 4DUZJ 3CDUA 1NRKA 3POTB 4OHXA 4L74A 5LSRA 5IOLA 1LEOA 2DISA 1SJRA 4TLRA 2UV8G 3M6UA 5KFCA 5GAHI 1N54B 2CQDA 3NY0A 4ELVA 1ZTTA 2W9CA 2VONA 3HHLC 1Z2LA 1SKWA 4IDKA 5CYJA 1NJZA 2H9ZA 4BDPA 1IQTA 2CQPA 2E1RA 1WUUA 1N5VA 1H74A 3DOMA 3IS9B 1IKVB 3MM6A 2VIHA 2OEMA 3TQEA 3SDEA 3BGFA 1ZOTA 5LMUJ 3S01A 2RB7A 3DU6A 3DYAB 3LP1B 1RWXB 3ZZPA 4ZHRA 4C8NA 5EWGA 3NKYA 5A2QY 2Q6BA 5J2PB 3UN5A 3HVRA 4JI5J 3HT0A 3C3LA 2GJ2A 1RUSA 4KV8A 2OAUA 3AY0A 2V8VA 3DC2A 4WXOA 1T9VA 2EI5A 1V5IB 3H5YA 1N56A 3GFXA 3AA9A 1W7WA 3E01B 2X1GA 2AJ0A 4JI0F 3NGDA 2CJYB 2VBZA 1VQOS 1JJHA 1RT2B 4DQPA 2AD9A 1XNQJ 3BSAA 3QLHB 4X4RA 1Q8LA 4DOZA 3M2VA 3THVA 2E5GA 1D0EA 3R5BA 3ILOA 4O44B 4K4UA 1Q5YA 4RU2A 3A1YG 3CTRA 3NNAA 1N52B 3NLCA 1IJEB 1VS3A 1ZPVA 1EB0A 3D0GE 4TY8A 4M5LA 3UDEA 1KRPA 2EEYA 4F7VA 4B3RF 1J5OB 3Q8UA 3CUNA 2ZDPA 4ZHRB 2IRUA 4DV7J 2HFZA 2GO9A 1RYSA 2H5IB 4M5HA 2MGZA 4OYIA 4YEAA 3PO4A 1HI8A 3M6VA 2NZCA 4NZ0A 1FXLA 1M1KT 2FPHX 3UDVA 3DI6A 3MMCB 5HANA 3HF5A 4XDDA 5IT9U 2HLUA 3M9NB 5SUHA 4N5SA 5ETNA 3IFEA 3TARA 4CYUB 2DXDA 3FSXA 2H3EB 3DRYA 1TKDA 3ETMA 1N0VC 4DWIA 3K5PA 3WQPA 4KGVB 4QYZJ 2BXJA 2KH9A 3TO8A 1N5YA 1HFEL 4USIA 3QT5A 3AT1B 1CLFA 3DDKA 2G2ZA 4TYAA 2HHQA 2GO8A 1FFSB 2HFUA 5E3PA 3ZTSA 3KXDA 1PC5A 2DK2A 3CCES 1K0TA 1K0VA 2VG6B 3GU0A 4A8WA 1EETA 1R31A 1FVQA 2HGLA 3C15B 5L38A 5CYMB 2R2SA 3G2XA 4UOCA 3BGRA 2SXLA 3QO9B 4WYWA 1UA1A 2ROEA 4BWMA 1N33F 2D7SA 1WHXA 4J37A 2DR8A 1FDBA 1QDUB 4Q0BB 2JC0A 2L9NA 1IR0A 1YGYA 2V0NA 2YBVA 1CJUB 1FK9B 1GT8A 4V1Ak 1BUXA 1S9GA 2BA9A 2RT3A 2X51A 5KG4A 3H40A 3K5MA 4ECUA 4A8SA 4KSEB 5LL6d 2J9DA 2V2KA 3HD1A 2X1AA 2FYXA 1NNDA 4DEZA 5BXIA 2JZ5A 3QNWB 1S6QB 3CGIA 2QA4G 4ZA1A 4YFUA 3T6JA 2ZZNA 3R2DJ 8AT1B 1FEHA 2WVBA 4PAAA 4DR4J 2H54B 2V8DA 2BQ3A 2ADBA 3D1OA 2DNPA 1REGX 2G13A 4MIBA 2ZHAA 1S0OA 3OUYB 3MOJB 1FHTA 2DNGA 2Z56B 2M2BA 4M95A 3PACA 2N4CA 1WC5A 1WD6A 4ZP8A 2D69A 4M5IA 3FQLA 4X65F 3OHAA 3BJYA 3KHRA 1UTAA 4HACB 3CCSS 4G1QA 2DR7A 3AOAA 4ICLA 2B56A 2MZQA 5D3GB 3DDIA 3B78A 4DR1F 1FEEA 1NK9A 4PWDA 1RWVB 4RPFA 3TVZA 3DOLA 1DTQA 1SPBP 3FSIA 3Q83A 1WOSA 4UW2A 5HQMA 1DLOA 4DV7F 1EP4A 2K2PA 3OBIA 4OX6A 3CCLS 4DV4F 2W01A 1QLNA 1JLFA 3D6TB 2JVOA 2A0FB 3CJ0A 3NGTA 1IBLJ 1R7IA 4JI3F 1FWPA 4WIQA 1LFWA 3NS7B 1KVKA 2LA6A 3IS9A 3K7RA 4X4UA 2X3GA 5H9EJ 3MM6B 4LRFA 3MPWA 4OYPA 5F8HA 3N6MA 5DDOC 3PIOQ 4CIOA 2EVZA 4KGZB 1EKRA 5CD4H 3Q8YA 2LU1A 4I6WA 2V4RA 1KBRA 2LQJA 2F3JA 3TUJC 5KT6A 4KGXB 1U1PA 2PFFB 2WW4A 3ENQA 3QLHA 4EU0A 4OI4A 2C3YA 5L9NA 2QG9B 3PX4A 2MQOA 1J2VA 3GP9A 3G9CA 1T9TA 4X62J 4OI0A 3SQOP 1UFKA 1XBWA 2QLXA 2ZVIA 5BR8J 4X4OA 5ETKA 2G1HA 4FNHA 1RKJA 3NGKA 1RA7A 2PMZD 1Q7YT 1S1TB 2HQIA 1IBMJ 4OJ1A 2MSTA 3W9HA 3EUNA 1U45A 4LIRA 4OLOA 3W5YA 4DUZF 4LF5F 1UVNA 2X1FA 2MLXA 2Y8WA 3TNVA 4I1TA 2AYBA 1RAIB 3R8YA 1H0HB 4DUTA 2CPEA 5K5MA 4U67Q 4IOAQ 5IM0A 4JI6J 5AXNA 5KFAA 3NAHA 1WTBA 1LWXA 3V6DB 2LDYA 4JP8A 3SSQA 4E0DA 2QLJB 1BD6A 4K4WA 3RB3A 1A9NB 5HJYA 5F8MA 4UY85 1X7VA 2HNYB 2H51B 4ITSA 2OMOA 3LH2S 5M2PA 2JEIA 2AKWB 3DCAA 5E3QA 4CM0A 4MK9A 3A3OB 2E1AA 3H4DA 5D0HA 2PN6A 3PW2A 2RU9A 4QW8A 4I67A 3SCKE 4LRCA 4JI6F 2DRBA 1B7YB 2DGTA 3D4JA 4K4SA 1J5EJ 2Z2LA 4LR8A 1NMEB 2CQ1A 2DH8A 2JVRA 4Q2LA 4LF6F 3QO9A 3KOAA 2NXJA 1S9FA 1HR0F 2B8PA 3P96A 2UVRA 3DLHA 4KT0C 4CT9A 3JAMY 4DV1J 1TK0A 3NBPA 1Y0HA 3KJVB 2LMIA 1SL0A 2R7XA 2DJWA 4KKOA 3OFHA 2BZ2A 4N7TA 4FYDA 2W8KA 5K20B 1PSDA 1DARA 4DQRA 5B7WA 3VAIA 4MIAA 5RUBA 2K7KA 3JYTB 4U8VA 5DG9A 1JKHA 4K7QA 4YDXA 2BX6A 3PRBA 4WXWA 5HMXA 1GTEA 3EVOA 4CO4A 2OJ3A 3AQOA 3HHLD 4PYDA 3D28A 3KWMA 2H1YA 3CW2C 5EGYA 2O1PA 2XY5A 4U7CA 3BYPA 4LSLB 2ASLA 1S97A 1VIOA 5DDQC 1GMVA 3KK2B 2DD8S 2DVIA 4DFKA 2HS3A 5CZXA 1FNXH 4NCBA 5HJXA 1XNRJ 2LFVA 5KFOA 1ULRA 4NLPA 1GAOA 2NS1B 4FYWB 3E51A 3PW0A 1U1KA 3JAMU 5F41A 2RDJA 1DTTB 2I6WA 4WTOB 3LP0B 2KM8C 3V6HA 4ED5A 1RT4B 1MROA 2IJNA 1AZSA 1B0PA 2P6TA 4FPRA 4J9OA 1TL3B 2XMWA 2HG4A 4M5DA 3R1LA 2HFSA 4C2MA 5U47A 3OVAA 4FS1A 3P49B 2OMLA 4WFYA 2DR9A 1RHMB 1YI2S 1JQGA 4RL1A 2CZ9A 1P6TA 1X5SA 2QN6B 2Y0BB 4DSKA 4ED4A 2FZKB 2CAJA 2V8HA 2ZH2A 1XWLA 2GNKA 1NEEA 3N5BA 3VAHA 4OZLA 3AOBA 2DNKA 2IYGA 3IRXB 3QATA 3C8YA 4KPCA 4C8MA 1W2BR 5L1LA 3QJPA 3CJTA 1PYSB 1U2FA 3N5FA 3KK3B 1BQNA 3U27A 1R8HA 2YVSA 1RP5A 5EX0A 1N48A 4EYIB 4WKRA 5KFNA 2PO4A 3WX4A 4P7VA 4BCAA 3IN5A 1AROP 4YOEA 2HQFA 5E5NA 4RUBA 1JLAB 2QZ8A 5IS2A 2WVDA 5M2RA 3CCWA 1ZYQA 1UAWA 2DXEA 3VAMA 3BGUA 1UVMA 2R7TA 3L95X 1IJFB 1JNRB 2YNFA 1S1VA 4B3OA 4E8UA 3CD5A 1T03B 1Q81T 1AXQA 3SCLE 1MWYA 4YS2A 2OFGX 3TUZC 4NYPA 4YY3J 3G6YA 2V67A 4KFBA 4Z7CA 4R5PA 2CNKB 2AF6A 2KRRA 3IC1A 2KU7A 2UV8A 3M9OB 1G4CA 2CQBA 1V6HA 4B3TJ 3SYZA 1DBDA 1O8BA 2H5JB 3HSZA 3ZTPA 4GC6A 1VQ7S 2UVUA 3G4SS 2V94A 2ABYA 2DGUA 2DITA 1SC6A 3GJSB 3MR7A 3E3XA 3D67A 2VPZB 1HNWF 4RNHA 1SJFA 2OO4A 2K3KA 1ZZNA 3C6UA 5HLFB 2UXBF 2HFVA 1C1CA 3ZZZA 1NB7A 2YWKA 4DDFA 4OJHA 3U1NA 4AL7A 3CJKA 3G6VA 3IA0A 1UEVA 5KFPA 1SQEA 1REVA 1OWXA 2GMLA 4MK7A 4F3MA 1I1GA 4JI7F 3V81A 3KJFB 2EFVA 1RI7A 2YKPA 4ER8A 1VC6A 4ECZA 1MNEA 1SCJB 1GQEA 2CRLA 3BF4A 3K8WA 1ZETA 4ZVSB 2XHWA 1UWAA 3BS9A 2BRLA 5FLXU 2KZMA 3MTKA 5GAEU 3ZXWA 3CJ2A 3GG1A 3CC7S 2IBOA 4F0MA 3QIDA 1BHNA 4DPUA 1TK5A 1Y5NB 1U24A 5HN0A 2MHEA 4H4OB 2ATCB 4HT7A 3VZHA 3H5XA 4QPTA 1G6BA 1R8AA 4IR9A 1QUPA 4OX9J 3IWNC 2CQ4A 4DCOB 4TU7A 1L3KA 4KO0A 3ONQA 4WYLA 4J9SA 2DNOA 2DNNA 1VQ8S 4KHPF 2F4VF 4WK1A 2R7OA 1XMBA 3H2VE 5LOQA 2Y3YA 1NO8A 2ZHBA 1NJWA 3WC2A 5B08A 1VQMS 4F2SA 1RWWB 2I8EA 2G4BA 2GV1A 5KFRA 5K8PA 4WP9A 2D3O1 2GIFA 5KFTA 4URGA 1RT3A 1DTTA 2NXCA 4MH8A 5GADU 2G9OA 4B9TA 1TKZB 1RT4A 3T5HA 3KLEA 1RLCL 3W2WA 3J80Y 2VV5A 3OTOJ 4U95A 1KQSR 3W66A 2D1CA 1R0BG 1RYRA 1ZBTA 1B0TA 4QIFA 5HBMA 1CC7A 1OPZA 3QIPA 2AJQA 1RB0A 2E5JA 3DLLQ 1DQAA 1FESA 2KYXA 3MEGA 2CQHA 2MQPA 2XGPA 2KG0A 3HKWA 2W1BA 2EFOA 1IBLF 2JLGA 1D1UA 1NK4A 4ZPDA 2BV3A 2WB1D 3ISZA 2VFTA 4ZVUB 1O6XA 4G65A 4HL9A 4USTA 3DGPB 1I5OB 5A8RB 1FNOA 2KTQA 4TVAB 1HNVA 4MKVA 1S1UB 3Q8SB 2AHOB 3RBEA 3HD2A 4EEYA 3I0RA 2MKHA 5ADZA 2O66A 1S59A 2OD6A 1NHUA 1R27B 2CVIA 1NSKL 2XSJA 4DLEA 1EZZB 2KL8A 3DMJB 1CG2A 2Q3PA 3D6MB 3QIPB 3MAQA 2OI2A 2BQRA 1RU1A 2ZD1B 2ZZTA 3W61A 1OPIA 1RKIA 2CXEA 3MMCA 3K0JA 2HVIA 5FLXY 3ETOA 3SZ2A 1CULA 4C3LA 4TQRA 2ZH8A 5CABA 2CJKA 4PRFA 3D3BJ 4IR1A 4OYBA 2PDAA 1YSJA 4EBCA 2NCKL 2QL9B 3DRSB 3ZO7A 2UUCF 4QIGA 1SH0A 2CVEA 4R5PB 3Q2SC 1VQKS 4WPAA 1X9MA 2XMTA 4ELUA 3BO2A 1LW2B 2ZH6A 2W25A 1OIAA 1V3RA 1HMVA 2GFFA 2WVFA 3TP2A 4JOUA 3PW5A 1SJ1A 2RUGA 2QV6A 2BJ1A 3BN7A 3MPDA 4ZP9A 4WFXA 4C11A 1CQMA 1VQ9S 1RAFB 3BGRB 2NYIA 1DAXA 3H5SA 1UWBB 1O5JA 3FFIA 4URSA 2RSQA 1HHQA 2OELA 1C1CB 1UETA 4GO7X 3TZXA 1AT1B 1HNXF 1FK9A 2WSCC 3N9UC 4JI8F 2CJQA 3HCXA 2YX7A 2FY8A 3EE3A 4FNIA 3F73A 2FY1A 4LMZA 3I9V9 1FRHA 2ZOGA 2M3DA 3GTYX 4A47A 5LM7E 1RDRA 3D5MA 2UUBF 3D0IE 4B9SA 1HBOB 1UL3A 2KT3A 4WCEQ 3MWBA 1R0AB 2OH2A 4WKYA 4NLTA 3TVYA 1GMWD 2ATLA 2R7WA 4KTQA 4FF1A 5IQ6A 1YBTA 3PKMA 4O3NA 5CD4A 5DQGA 2W2QP 5KG2A 2E9ZA 1XN9A 2UU9J 1UJ5A 3NGUA 1VRQC 3B4DA 1TKTA 4YR0A 5C7PA 1D09B 4ILMA 4ZCIA 4DL2A 1YVFA 1Q8KA 4HHHA 4LFAJ 4ENOA 4M5KA 4I2QA 1EAYC 5CXTA 2BJ7A 1FKPA 2ZH9A 3A3NB 2DNHA 1LK7A 4FXVA 2FGCA 4KQZA 4C8LA 4RW9A 4LF9J 4W92B 4NXMJ 5JMNA 4P73A 1HQUA 1JLGB 4NEYA 1WC4A 3R2CJ 1ZZFA 3OVBA 3QFWA 4UUXA 3LPEA 1NU4A 1DTQB 2CPDA 5HROB 2KJVA 2L3MA 4DV2F 2ZWPA 4RUHA 3EZ5A 3KLHB 1P27B 1YKWA 1T9UA 1HNIA 5T7LB 1R3NA 3HFZB 3I5CA 4XPEA 3HSGA 1TK8A 5CCMA 3BYRA 1F9EB 1WOPA 3R27A 2XMAA 3PV8A 2B4PA 2HGMA 3OJSA 1X9WA 1FRMA 4HLBA 2W9BA 3IR7B 3UD4P 3UCUP 1S12A 4MJKA 4DQSA 2XMVA 4L6V3 3FZ2A 2QMXA 3R6GB 2YY3A 3IP0A 3UR0A 4JI7J 2JC1A 2OGUA 2B9EA 2OPPA 3KLFA 4HKQA 1U7LA 3UN2A 1DFDA 3NL0A 4QR1A 5ETLA 3J7ZT 3BQ2A 1WTFA 4G6VB 1ZA2B 4GKKF 1TVRB 2YNGB 3MEDA 1VLYA 2FC8A 3TW0A 3H25A 3T5LA 1HNIB 1P8GA 1U8WA 3RZAA 1XEZA 4M5MA 3HHLA 3KLIA 3M30A 3PFOA 3TA1A 4OHWA 5DM6Q 5A8RA 3DDNA 1WEZA 1NCLA 3O6QA 2YPZA 3HK2A 1S1WA 1LFPA 2AJ1A 2X7IA 2CPXA 1WKJA 1NKBA 1EETB 1UFWA 3KHLA 4CLZA 1JXLA 5CYMA 4FF4A 5J2QA 1N36J 2DPIA 2D9PA 4KHPJ 1P1TA 3MM9A 4C7QA 2DR5A 2V2VA 4H54A 4FYXB 4G1PA 5IV4A 4NLGA 3D6HB 1CULB 2JDJA 2KYZA 1TL7A 1YZ6A 3TI0A 5EN1A 5HQLA 2E9TA 2K7JA 3MCSA 1S5ZA 2Z58B 1EQMA 2F40A 4CH7A 3QJJA 1RAEB 2H5EA 5GAGI 1KLNA 4C3KA 1NBEB 3VGTA 1Y11A 4DG1B 4LJMA 4R0JA 4IOCQ 2BYCA 1RBOB 2HAFA 1RAJA 3QAUA 5KFFA 1VBYA 1IWAA 2DYAA 2ALZA 1DHMA 1IKXB 4I64A 1W25A 3CMAS 3MTJA 1LWFB 2BRKA 2HQGA 2WSFC 4WU2A 4ALZA 2VPYB 4WP3A 1HWUA 2OD4A 3CJQA 1IKYB 4CLFA 1HBNB 4WZQA 3I4HX 2E5IA 3K2YA 4RJVA 5E3AA 5ETSA 1R6YA 3DLGA 3CSKA 2ADCA 2M52A 1TV6A 4KKOB 3US5A 4HACA 4OZNA 2EG1A 2QL5B 5D4PA 5DZ6A 3RGIA 2HVHA 1HWIA 4PCQA 2XULA 3EVWA 4ETXA 2GHPA 2VD3A 7FD1A 2FZCB 3UO0A 3H2LA 2J6SA 2OPSA 3A8JA 4P71A 2V4JA 1N5QA 3MZIA 4PEOA 1R0AA 3C2PA 8RUCA 2AEFA 3QFHA 3TWZA 4QW9A 3GV8B 4G3IA 4C97A 4KPYA 2C2ZB 3BDPA 1KVIA 1UZDA 1VK8A 1IKYA 4H4KA 3KDNA 3IG1A 1BXNA 3FZBA 3RBZA 2QMWA 4OYOA 3DHXA 1WJ9A 5D15A 2VG5B 2BABA 3MD1A 3O5TB 4I2QB 1F2GA 4OZ1A 4LF8F 3TZZA 3PR4A 1K1QA 1S57A 4CLPA 2BJ8A 3OL8A 1NKEA 4LQ9A 9ATCB 1U1QA 2K8GA 2DO4A 1NDCA 2HBYB 2F7VA 2HQ3A 2AMCB 2QFIA 3MM8A 5J2NB 3AA8A 1DQ8A 1F5CA 1M1HA 2GAGC 2WK4A 3CIMA 5KG6A 3W60A 4YR2A 3MMAA 4PG5A 3MR2A 2Z2ZA 1I51B 2BJEA 3NMAA 1KEKA 5J2MA 1FKOA 3WHIA 4X64F 1B70B 4JI4J 1RT7A 3DNCA 2QLBB 1ZTWA 3ZZYA 3FSYA 3KHGA 2V63A 1X4FA 2H4YB 1RWMB 4OYWA 5KFKA 2XZTB 3OD2A 3R5GA 5FIIA 4KAIA 1LW0A 3QQCD 3T1YJ 4NCAA 2WOMA 3SDEB 5JVHQ 5THWA 2C3OA 2ZBIA 3BGLA 1EKSA 3I0SA 4TLQA 3DYAA 3LP1A 5T14A 2VBYA 3K5LA 1KDNA 5F8LA 3W3SA 3MUMP 2VG7B 2GZOA 4ZOSA 4CI0B 3OFGA 5A0YA 4QWCA 1MMLA 2QT7A 2D3UA 1SVDA 2I0XA 1FFWB 2YNFB 3MEDB 1RT2A 2RIJA 2B43A 1U1NA 4OIXA 1RT7B 4MFBB 4NLDA 4AYBD 4E2FB 2KFNA 2G1DA 4Y6IA 4L76A 3H4BA 2B6AB 3FKBA 4NL5A 2DEIA 1PO6A 1F9FA 1WF1A 1S10A 1NK0A 2JFDA 4B3SF 4JI3J 1UVJA 2BW7A 1AUDA 2RHSB 2MYFA 1BY9A 3W7BA 4KIAA 3TEGA 2GQCA 2XS7A 2VB6A 5HVFA 1S4EA 1TMJA 4NZ7A 4K4YA 1UJ4A 4UY8T 2ZJQQ 3ZFVA 2EC2A 3BKFA 3V4IB 2JEJA 3DN9A 2LXIA 4KJIA 2GA7A 1HBMA 4DV2J 4KR0B 3BR8A 1U1RA 3NCQA 3CJKB 2B7BB 3CCQS 2Q66A 1H73A 4DV0F 2HWTA 2AWZA 4EYHB 2WCXA 4LSNA 5GAGU 3KG1A 5E2QA 2C42A 4PPDA 4MKAA 3LOUA 2IAJB 2B6AA 4F3QA 1A0OB 5IXUA 3M8PA 4EK2A 3NWGA 4J9PA 5JUMA 1KOHA 2O01C 3OSPA 3ISNC 1SKUB 1VC0A 2MEWA 3H8YA 3NEKA 4LSLA 4N41A 1XNRF 3W9JA 2FVPA 5F8NA 1R0CB 2A2DA 4K59A 4OZ0A 4IRKA 1YJVA 4ES2A 1U2CA 3VQSA 1OSCA 2C2KB 5CA5A 2M5YA 3JQJA 1Y5LB 3M1VB 1HNXJ 3BM7A 3DLJA 3W2VB 3TZYA 1X4HA 3DLGB 5D4LA 4M63A 1QAYA 1CJUA 3SSRA 1H38A 4RW4B 2P6SA 4O3OA 4ZVPB 2MQNA 4ED6A 4IG3A 1HQEB 2M8HA 4U7UD 2YWWA 1UPPA 1LWEB 2XNQA 1OJ4A 2WVCA 4YB7A 3RJMB 4OLPA 4ED8A 1JX4A 3K89A 4ZVOB 1WSRA 4J5OA 3MEEA 4GO5X 2FQQB 4JV5J 2AU0A 2EFNA 2V68A 5LSLA 1HYSB 2OEJA 2A18A 1LOUA 4ECSA 1N36F 2JHEA 4ED7A 3RB6A 4OYAA 2PMHA 4YHHJ 3PVXA 2QEXS 3DLKB 1RT3B 3ZNUA 5DGBA 2VQEF 2VG5A 3VAFA 3UE2A 2KO1A 1NJXA 1BQNB 2HHWA 1FA0A 2GHWA 5AJ3F 3H98A 1S0NA 3JSRA 2XLJA 5C42A 2HHHJ 2YWFA 2ZH7A 2XO7A 2AYGA 4K4TA 1XMOF 1CJKA 2GAHC 4CTAA 2R7RA 2KT5A 1FKAF 4Y3CA 1YJRA 4Z2XA 2AT1B 5DLFA 5GAHU 2LQ8A 5L8RC 4FS2A 4DV4J 2OIHA 2YKNB 4IH7A 4K2JA 3ZZTA 3E01A 2VQEJ 2VFUA 2MKIA 4WF9Q 4KYZA 2HBZB 2H48B 1DLOB 2BANB 4DI6A 2W4DA 2APOA 2YQ1A 5I4MA 1FCAA 2G2OA 1K44A 2Z8QA 3EDQB 3ICLA 4HH0A 4IKAA 6FDRA 3VALA 4B3TF 3CDAA 3AD9C 4LF4J 4U8YA 4OI1A 4NA2A 1SJ4P 1R6VA 2ZBQA 1YITS 2VH7A 1J5EF 2IM2A 3BH6B 2QE5A 1A6LA 1IBKJ 2FVRA 2HHXA 1BC6A 1TTHB 4MMOA 3W8GA 2Y1IA 1HI0P 2KXHA 4NLYA 3L3CA 5CAAA 1F3VA 2YNHB 1X4GA 4AFFA 1PCAA 3OSNA 3ET6A 1H6KX 2FJXA 1TZ0A 1HL6A 2N7YA 2QRRA 4JV1A 2L9WA 1CJVB 4F02A 2L48A 2RF2B 2VL1A 1CEZA 4JI1F 4ATNA 4ID8A 2BANA 4L3NA 3FK4A 3OTDA 4LSZB 4J9NA 1REVB 2DGXA 4CYUA 4OL8A 1KN6A 4MFBA 4DSJA 1N4LA 3IXQA 2B4OA 5C24A 2RNEA 1W26A 4YN3B 1FDDA 3KLGB 1IKWB 4K5SA 4NXNF 4DR5F 1NLKL 1OQ6A 3RR7A 2QLWA 5G0RA 2QFJA 3NOGA 1ZM9A 1H2TZ 3QMQA 5K8MA 2DT9A 4DX5A 3DFEA 4O4GA 3M8RA 3V4IA 1SJ3P 1W2IA 4RW7B 3PHEA 3B4MA 5D0GA 5A8WA 5EHHA 4NA3A 3UFCX 4NYOA 3QZ7A 4LQ3A 1VC5A 1ZAVA 2E7VA 1S9GB 2Z2MA 3I87A 4O23A 3K58A 2PSZA 3UCZP 2UUBJ 1SI9A 2LYVA 3CDEA 4EFAC 1HBOA 1S6QA 4AL5A 3U1MA 5H1SV 1U8SA 5LXRA 1YBUA 4WK3A 2FHJD 3AHPA 3C16A 1I94F 2FVQA 4EUVA 5A8KB 4TY9A 1EHWA 1NDPA 4MIWA 3CC2S 1VQLS 1JLBB 2CZ4A 2V69A 1RTIA 4X4SA 5AXMA 3BKUA 1S77D 5CHCB 1RZMA 1KOOA 2ZC3A 1XR6A 4IYQA 4ECTA 3KLEB 4NASA 4DS5A 3Q89A 3UWTA 2NUUG 5HSPA 1HR0J 5LMNJ 2B4UA 3GSIA 4NMLA 2VJUA 2HLTA 2A6MA 3HFKA 2RS2A 1OY9A 2CJ9A 4FBUA 3MPVA 2D41A 3VHQA 2CNNB 2MJUA 2CDQA 3L7UA 4O4RA 1C1BA 4M5NA 2ZBPA 3EXCX 1CC8A 4USVA 3M8WA 3W62A 1R8CA 3EDRB 2ASDA 1WC6A 1Q82T 1SUQB 1RGVA 1X4EA 2Y0SD 3KK2A 2E5HA 4B08A 4QWDA 3TEHB
chains in the Genus database with same CATH topology
2DB1A 4PR6A 4RW8B 1P9QC 2B3TB 4BC9A 3HX9A 1XNQF 2ZE2A 3M05A 1HNVB 4DQQA 3SI8A 1Q86T 3BDEA 1FJCA 3M6WA 4IFVA 2VASA 2CFXA 5GADI 3PX6A 4I2PB 3BO3A 3QJLA 2FVSA 5DO2A 1GXLA 1NH8A 4CTAB 1VRTB 1LKZA 1QAIA 4PWUA 3JSMB 4A8QA 1JK9B 1Z2ZA 2LQ9A 4ED0A 5BYQA 4DFMA 4A8FA 2AGPA 1N88A 1VI7A 3HHLB 3KLIB 3P5TL 3HHEA 4HTJA 5B0GA 2RRAA 3VAKA 3EYZA 3PNIA 5KFBA 1WI6A 2RILA 3GB0A 1FD2A 1VQSA 3MM7B 3MFHA 4QU6A 1S1WB 4WFNQ 4NRTA 5I3PA 2XGQA 3PJWA 4C11B 5GAEI 4DL4A 3OLAA 4F26A 2YQ3A 3OXGA 4IQMA 5J1PA 3M32B 3OL7A 3G8TA 1F5AA 1ZM3A 2GC8A 5CXTA 1UWBA 2KJWA 3KYLA 2IBKA 3I96A 3MM9B 4C8KA 1NKCA 2I1RA 1FTCA 2VPWB 4IO9Q 1S0VA 1R43A 4C8ZA 4OX9F 4RUCA 4ECYA 3BQ1A 3V6DA 2VOOA 4ZMMA 5FD1A 3VQTA 4U7UK 4ZPBA 3KLVA 1R89A 2HNYA 4OI2A 4O3RA 4ZPWR 3ZZRA 3SCIE 2YNIA 4DG1A 4DSIA 3KLGA 1M90T 2IVYA 2POKA 5JXSA 2R8KA 2ZITA 2UUWA 1RWUA 3EPGA 3E8OA 3NAIA 4DR2F 1IKXA 2FJVA 3D0HE 3BQ0A 4C8OA 2IM0A 1TKTB 3I4PA 1M5PC 3HMJG 2KFZA 2FD2A 1UMJA 1B0VA 4RW7A 4JI1F 4RZRA 4DR7F 5B0DA 1Z1ZA 2FJWA 4HDGA 1UP1A 1KONA 5EUHA 3SQGB 2XI2A 2UUAF 2FGOA 2ASYA 5KFVA 3CB4A 3CMES 1QM9A 1HQUB 4ZPTR 2Y1JA 3JYTA 2ERRA 1YJWS 3KG0A 3M2RB 3AB2B 4RWWA 4PQAA 4TNOA 5HL7Q 4HH1A 4B3OA 4F2RA 3FCHA 4MK8A 2WONA 1QAXA 4DL0C 5DM7Q 1JLCA 1PGZA 2GIQA 4D3GA 5KFWA 1KVJA 2MXYA 1UVKA 2RDIA 2DH9A 1RTHA 1E6VA 3D1QA 1Q8BA 3GV5B 3RAQA 1FJ7A 4CO5A 1UFLA 2N82B 4IH5A 2MQMA 4BHQA 1JLQA 3IAM9 4GMKA 2HAIA 4F67A 1T8EA 5D6GA 4QZVB 1WACA 1JNZB 1URRA 2GGPB 2FUG9 4KO0B 3IR6B 1P1LA 3LQVA 1JLCB 2F8HA 3OR1A 2CPYA 2YH0A 2FLLA 2NSCA 3NCPA 3DRPB 4XDCA 5KFIA 2VPXB 4C4WA 5DRKA 5K9FA 4RW8A 1FXRA 2MZRA 3MD3A 2KXNB 4ZCLA 1KQGB 1TL1A 2KB2A 2C3UA 2ZE2B 3JTPA 3BSCA 1LW0B 3DRRA 3QWUA 3W2WB 4TU9A 4IFVB 3KKFA 4OZJA 3IO1A 3HI9A 2ZH5A 2AGQA 3CJ5A 4ES3A 1BLUA 1ZPWX 4N8OA 2R8GA 2VFVA 4IFYB 1YQHA 1RQ0A 5EWEA 3CCJS 3HO1A 1JLAA 3S6EA 3RRGA 5F0UA 2CQ3A 1BWEA 2EPIA 2GIRA 3HJFA 1FERA 4PUOA 4NCGB 4K5RA 1T03A 2MZ1A 5DQIA 2M70A 1FF2A 1Q1KA 4NLXA 1TL1B 1DURA 1YRXA 4BC7A 3MM7A 5DQHA 1U4BA 1S1UA 3OTEA 2OFHX 2RJZA 2XG8A 1X5OA 2B4VA 2C3PA 1RTJB 4FVCA 5CZVA 4R0EA 3V4MA 4LUBA 1Q8IA 5LT5A 1FDNA 3BB5A 1VQOS 2D3ZA 2W7OA 1HA1A 2HIQA 4QR2A 3FMWA 5IT9Y 3RB0A 2J0XA 5B0AA 4NLOA 4AXIA 3RR8A 1JLEB 3C46A 3L7PA 3GILA 1WI8A 4F4WA 2P9GA 5E7OB 4A4JA 4KGMA 3R3TA 2BR0A 2IM3A 2M0GB 2WAQD 2NLWA 2YNIB 5KFUA 3QWPA 4JYAF 2OKQA 4DL5A 2JLFA 1WG5A 2FLOA 5C5JA 2IVFB 1L3SA 2LA4A 1K1SA 3OW2R 1NJIT 1O0PA 1D9DA 2QYCA 3MECA 5HQ8A 4YQWA 3GFZA 1Y3JA 3WZ0A 1S99A 3AJ2A 3S7RA 4OHVA 4J9LA 3IRWP 1ZM2A 2W24A 3PY8A 3NS5A 4ID5B 1LWEA 4JI2F 4AXJA 4DN9A 1K9MT 1X5TA 5DG7A 3FDSA 2R2TA 1HWLA 1WG1A 4ZPAA 3RAXA 1S48A 3HT3A 4HDHA 3NNHA 5J1EB 4ETZA 3DM2A 5J2MB 4OJ3A 3G96A 5H9FJ 2J0WA 4M8LA 4ZS6A 5KT7A 3NMRA 4N77A 2JLEA 3I31A 2BUNA 1TKZA 2LCWA 4Y00A 4ERDA 2I2YA 3H20A 2ASJA 1SKRA 1J5OA 3MMJA 3I0SB 3T19A 1C0TB 4PXCA 2MY7A 2M4MA 2HNZA 5B0EA 2XWYA 3CDBA 2VUGA 5KFHA 2U2FA 5IT4A 4F4YA 1T3NA 3CIZA 2VBWA 2ZJPQ 5HROA 3GE9A 2GQ2A 1FRXA 2P9EA 3I56S 1QAJA 2LKZA 2J8AA 1S6PB 5KFSA 3B82A 1NK6A 5T7LA 2XS5A 2GW8A 1X4AA 4YR3A 2FIUA 3MFIA 5LSOA 5LJ5Y 4P7TA 2KM8B 2B9WA 2XMJA 3IGNA 2R4FA 1C0TA 5HO4A 2UVVA 2E5LF 2CPJA 2R7QA 2XSJB 3OV7A 4X4VA 1HHTP 2ZFHA 4WTYA 3S1TA 1U1OA 1U6ZA 2BVZA 3QGIA 3LWMA 4KV8B 1YJTA 2VOPA 3HVWA 2EKYA 2IFXA 4IOBA 4OX7A 2AP6A 2PE8A 4PKDB 2W8LA 4Q0BA 2FJAB 1WF2A 4X2BA 1FTRA 4ES1A 2EBEA 4V19X 4Q8EA 3LAKA 4H4MB 5E33A 4RX6A 2RH3A 4I7FA 4RW6A 2QSWA 4BWJA 3RYLA 2HMIA 3CCZA 3HVAA 4QIEA 3IBWA 1JWWA 1S9EA 5D77A 3KMQA 4DSFA 2EFQA 3PIPQ 1H7XA 4OX8A 1S79A 2HNDB 4ZVFA 3SMZA 2ZJRQ 1JB0C 4K2XA 4K4SA 5KT3A 2R7UA 3M2UB 1BQXA 2WB4A 3HZEA 1YWXA 4WE1B 1R8BA 5D8HB 1TUVA 3GFYA 3MM5A 3PRDA 4G1QB 1FNMA 1IBMF 1HQEA 3TRGA 2ZZMA 4ILLA 1NK5A 5BYSA 3ULHA 1SKSA 1U1MA 1UKUA 6FD1A 1HW9A 4Y2MA 4JBCA 3MF5A 2CQ0A 2RKIA 4NLUA 4B9MA 1HWKA 1T95A 2VZ9A 2VG6A 2J7UA 4MKBA 2PI4A 2HNDA 4EO8A 1HYSA 1JXEA 1JLBA 1GTHA 1L3TA 1FE0A 1HWJA 3TYTA 2HHHF 3CJ4A 3GYXB 2YH1A 3OXFA 1TV6B 3V2UC 3RW7A 4Y34A 3VZIA 4H4KC 2ZDOA 5KFEA 2QIFA 1Z4UA 4ZLPA 1WHWA 4Y65A 4R8UB 5IQQA 4Q5VA 4C8YA 4QJVA 2OLWA 2DHXA 2EG2A 3CCMS 2LVWA 2CYYA 1UVLA 1DZ5A 3UCGA 2AJFE 1KLMA 1K8AT 1S72S 2RVJA 3IGVA 4RKUC 4QCLA 5CCLA 4I4BA 2F9JA 1C0UA 3O1LA 1T05B 2IRYA 3F56A 3UD3P 1M0SA 2F8MA 2GHVC 4FVMA 1FD8A 4OQJA 2F8EX 1X0FA 1OSDA 1Q16B 2A1BA 2YNHA 4B02A 4EO6A 1UJ6A 2DNLA 2RQ4A 1C2PA 3MR6A 2NSBA 4U9RA 3SV4A 2Z0GA 4A8OA 2QA4S 1Q4RA 2CQ2A 1NK7A 2PA3A 2HS0A 3KNAA 1FVSA 2YX4A 3QGPA 1XMQF 3D1HA 3ISND 4JV5F 1SXLA 3M30B 3T6BA 4C0HA 3HM9A 3CULA 2OTJS 4NOHA 2AW0A 1Q7LB 2YWGA 5J1NA 3T9ZA 2ZH4A 4X4QA 2LEAA 3ZC4A 4ZVEA 3FEXB 2LQ5A 2YWEA 2RRNA 3DRXA 3BSNA 2OPRA 5LJ3Y 2BM1A 3DI6B 1KQFB 2UXDF 4M94A 3NBPB 2ZKUA 5EDWA 4USHA 3Q22A 4KBIA 3K8VA 2MY8A 2DTJA 3G8SA 2YKMB 2AJ4A 4F4KA 4Y2CA 4DF4A 4RW6B 4J9RA 1H7WA 2N4DA 1N5YB 2JFKA 4Y0FA 4G1IA 2YX1A 5DS7A 3PO5A 2DGWA 2F1FA 4IG0A 3AH6A 4QPXA 2COLA 5A8KA 3UW1A 5F9NA 2PGCA 1NJYA 2XBPA 3M2UA 2FJEB 3MUTP 3LP0A 1MU2A 3BSOA 2XZWA 2FTRA 4LFAF 3GZ7A 2E7XA 3OFEA 2O5DA 3PZPA 4F8RA 2YKMA 1GXUA 1R8PA 1WEXA 3VAGA 4B3OB 2IMOA 2HFOA 4F25A 3GIKA 4EZ9A 3R5AA 1C1BB 3S8SA 2DGOA 3UDCA 3M9MB 2B0GA 5GMKa 1QVGR 3WC0A 2Z4PA 4DLGA 1S7HA 2IMWP 5BJRA 2P5VA 1YRUA 1D9AA 1RTHB 1WF0A 2A3JA 1H2VZ 3M1VA 3N79A 5KFQA 3GIIA 3TANA 1A7GE 4USJC 3IR5B 5GVQA 4XPCA 4GKJF 4RW4A 3AB4B 3H2UB 4FP9A 1VQ6S 1XTZA 4UQTA 4LF7F 5D3GA 1YTYA 2GGPA 2VFSA 4N47A 4J9QA 1FRIA 3FEYB 3CT9A 1FXDA 1SIWB 2NPFA 1XK8A 3DOLB 5EWFA 2LECA 2OSRA 1N8RT 3CD6S 1TP7A 2RMLA 3MEEB 5CH7B 2W9AA 2IHR1 3RBDA 1EP4B 4MTPA 5E3RA 3OL6A 1LQ9A 3LGNA 3I9ZA 4Q45A 1B7FA 2GQQA 2WBRA 1MROB 1FT8A 1SBRA 1JJ4A 1E6YA 4YHHF 4JV2A 1TL3A 4M1KA 1TL4A 5F8IA 2UVWA 1Y00A 3PFEA 2EW9A 3RTVA 4CH1A 1TL5A 1ZM4A 1VMBA 2I9SA 3M4XA 4NZ6A 1K73T 1IXKA 2WW8A 2YKNA 4WIIA 2LEPA 2E7WA 1WHVA 2OPQB 5I42A 2A10A 2KHCA 2K1RA 2JEGA 1N0UA 1S4FA 1VRUA 2IVMA 1URNA 3Q2TC 3K59A 3EGZA 5L1KA 2PT0A 5AE3A 2DNYA 3GSDA 1YJNS 1HMVB 2B7CB 4LF4F 3PR5B 1KFDA 3L7OA 4J9MA 5KFXA 2C2DA 2Y1RI 3CD0A 2BDPA 2R7SA 2OPRB 3R5DA 1KNZA 3DXSX 2HWHA 1YG0A 3J7YI 3MPYA 1LXJA 1T94A 3CJ3A 1JLEA 2J5AA 1RT1B 4Q43A 3MXHP 5KG3A 4IRCA 3O2IA 4QQBA 4PQUA 1LWCB 4ECWA 3CD7A 3IWXA 5K14A 5M2UA 3RB4A 4O3SA 4PXEA 1X4DA 5L39A 2RU3A 1S49A 1C4AA 2V5HG 1JMTA 2JWNA 3OHBA 3DLEB 3OQ2A 2MQQA 3VWSA 3WBZA 4FBTA 1KHVA 3FRYA 4ZCMA 3GFHA 2PA8D 1QY7A 3MECB 2KN4A 3M8QB 2HW3A 1CSJA 3OR2B 3KJVA 2IA0A 1WWHA 3OL9A 1KHWA 2MHNA 2LDIA 3GQCA 2CG4A 2KRBA 4WFBQ 2CJAA 3PX0A 2C28A 4KHMA 5LXYA 3SXLA 4YP3A 2ZKTA 1SV5A 1H98A 4B3MF 5HMYA 2W4CA 3PV8A 3KLHA 4BBYA 3DRPA 2XY6A 2FJXA 1D9FA 3MR3A 3IAS9 3N6NA 3MI7X 4B9NA 1RA6A 2XB2D 4O0IA 2EBGA 3U1LA 3P3DA 4C98A 1IKVA 2JL9A 1IQZA 2ZHOA 1VOMA 3KTQA 1D8ZA 1XERA 2GMJA 4Y2AA 4YY3F 2HNZB 2AX1A 4DN0A 4K50A 5J2PA 2E66A 3DMJA 1KTQA 1VHFA 2FHKA 2IJFA 4IFYA 4LVOP 2KDOA 2EK1A 4NYZA 1Y9OA 1YJ9S 3T9NA 4CT8A 5F0WA 2KFYA 1TFWA 2XS2A 2JX2A 1SV5B 3UNGC 2A2CA 4A8XA 4X84A 3HPOA 2D3OR 1H3DA 4MYUA 2LU2A 3FRZA 3RAMA 4YMEA 4CQ1A 3Q8QB 1F5BA 3GR0A 5HP1A 3LGMA 1G7CB 5KTQA 3TAPA 2VQFF 4O3QA 2HHTA 5KFLA 1T7PA 1SH3A 3MEKA 2DGQA 1RT5A 1X4CA 3Q8RB 3N01A 5J2QB 4KGKA 2J6UA 1O51A 2NXUA 3MEGB 4FXWA 2HPUA 2O3DA 4CNZA 1VIXA 2K1RB 4J9KA 3DXBA 5SZTA 3UQSA 1TKXB 1ZH5A 3I5AA 4X62F 1FRKA 4N76A 2E44A 4TKTA 2HMIB 2E1CA 4DSLA 4NLVA 1IKWA 5AXKA 1Q79A 2DCLA 2WSEC 3DHWC 3HKZD 4JV0A 5KAKA 3I0RB 1V3ZA 4DSEA 3JB9k 1QE1B 4DF8A 1LWFA 2J0QD 1HPZA 4RBUA 2LQBA 2FB0A 2XLKA 3MDFA 3DOKA 1DQ9A 1WELA 2C3MA 5CQGA 1YJUA 2KVIA 4DFJA 4I69A 1FKPB 3TR5A 1KC8T 2DO0A 2KHDA 3IWLA 2RQCA 3KG4A 4I6AA 4CCHA 5HMZA 3TQ1A 2MKSA 1QSSA 4R25A 4K4ZA 2V9WA 3SFGA 4ID5A 3FEZA 4CO0A 3POTA 1C4CA 3GV7B 4EWTA 2CPZA 4QWEA 2KG1A 2V9KA 2HRYA 2E1MC 3DM2B 2PEHA 3N6LA 5FDLB 2M88A 3GMGA 1KS2A 3EX7B 2YKAA 4Y2IA 2MKKA 1SJQA 2XMKA 3JSYA 3OR2A 1HD1A 3UPFA 3HP6A 3R5CA 3FGVA 3SQGA 2NR0A 2HHVA 1TQLA 2DHGA 3F41A 4ICLB 2YKOA 3ITHB 2N3OA 4IH6A 3V6JA 5IFMA 2F9DA 2GCFA 5DDPC 2FJBB 2YNGA 1WG4A 1APSA 2QA2A 4PXDA 3CE8A 3LALA 3AAWB 1E6VB 5FDLA 3TX8A 4GC7A 4RLEA 5IT0A 2R2UA 4CNYA 1S6UA 1KR4A 3KNGA 4OV1A 2WTFA 3KMSA 1SH2A 3TAMA 2WOMB 4DS4A 1FE4A 1IN0A 4YDDB 4HYKA 1JLGA 2Q6CA 1HHSA 4HI1A 3OVSA 4X66F 2JJ4D 3HVTB 3TAQA 3EZUA 4DQIA 3T3FA 2VA2A 2FLPA 4ZDNA 3FJ2A 4F3OA 1S0MA 4X4PA 2KI2A 1S1XA 4I7FB 4ECRA 1NK8A 3WDOA 3DGPA 3K5OA 1U1LA 4Q7AA 5DG8A 5B0FA 2VODA 4Q44A 1S1TA 3CVKA 3V6KA 1WHYA 3LUYA 3AJ1A 3NS6A 4DL6A 4NA1A 3CCRS 4ECXA 2OTLS 3I5BA 4HTIA 2ZD1A 1HBNA 3H5UA 2YTCA 4WE1A 1BGXT 3HVTA 3FMBA 3O3LA 3OPKA 1HBMB 1MWZA 3HDSA 5IM0B 1UVIA 2RE1A 4ZK7M 4PUOB <