4OZ0A

Crystal structure of human caperalpha u2af homology motif (apo-state)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cancer-relevant splicing factor CAPER alpha engages the essential splicing factor SF3b155 in a specific ternary complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-binding protein 39
total genus 28
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oz0A00
3MXHP 1K8AT 3U1LA 1VBZA 4RU2A 2DGVA 2MSSA 3VAMA 5LSOA 3CCLS 5IFMA 3CUNA 1VQNS 1H2VZ 1U1OA 2CQHA 3G6ES 2CQ2A 4Y00A 2JVRA 2BZ2A 2MZRA 2LCWA 3UCUP 5DDOC 2E5HA 2MGZA 2PEHA 2FPHX 2XS5A 4FXWA 2MQOA 2KHCA 1U1QA 3SDEB 2RRBA 1M5VC 1XN9A 3P3DA 2DGSA 3CCSS 2LECA 5D78A 3P49B 4V19X 2OTLS 2LMIA 2DIUA 2LEAA 3B4DA 5IM0A 2DIVA 2CQCA 1NO8A 2CPEA 3MI7X 1HD1A 3LPYA 2CPZA 3RW6A 2I38A 5LXRA 3B4MA 4F26A 5CXTA 1SJQA 2HGNA 4PR6A 2DNNA 2J8AA 2D9PA 4IUFA 5GADU 2MQMA 2ZJRQ 2AD9A 4OZ0A 1FJCA 2RT3A 2YTCA 1X4CA 4IOAQ 1U1MA 2DGOA 1U6FA 2MPUA 2G1DA 2LA6A 2XNQA 1OWXA 3TO8A 3CCVS 1P27B 1FXLA 4TLQA 2MKJA 4BS2A 1WG1A 3CPWR 1URNA 3HHNB 1FHTA 3TP2A 4WFBQ 4W90B 1JJ4A 2CPHA 3THPA 2KXNB 2KH9A 1UFWA 2MY7A 2DHGA 1KOHA 5DM6Q 1X5TA 3U1MA 3G8SA 1W2BR 1BY9A 1KOOA 5GMKa 2KRRA 2HGLA 3J7ZT 1U1LA 1KD1T 4UQTA 1VQMS 4WFAQ 5LXYA 1RKJA 2U1AA 4LJMA 2VOOA 4WIIA 2XSFA 3G71S 1WEZA 3ULHA 2BOPA 2DHXA 1WF0A 3EX7B 3NS5A 3CF5Q 1WHYA 3L3CA 2MKHA 1VQKS 1U6BA 3RW7A 3UCZP 5ITHA 1Q82T 2DITA 2E5JA 1OIAA 1H2UX 3PIOQ 3NNCA 3CTRA 4YOEA 2DISA 3CCES 4F02A 3P6YC 5FJ4A 3NS6A 2DO0A 2E5GA 2L9WA 2KG0A 3G4SS 1DBDA 4YB1P 2VOPA 5IM0B 2E5IA 2GHPA 3LQVA 2MY8A 2DH7A 2DNMA 2FHOB 2MKSA 5LSLA 2HGMA 1VQ7S 5CYJA 1KC8T 4OZ1A 2OJ3A 2JX2A 1UP1A 1WTBA 2CQ0A 2DNRA 1DZ5A 3CMAS 2RQ4A 4PKDB 3FEYB 1A7GE 2ERRA 2M52A 3BO2A 3ZZZA 2PE8A 2CQGA 3ZZYA 2CQ3A 2EVZA 3K0JA 1ZZFA 1FT8A 2DNLA 2K3KA 1U2FA 1RK8A 3NMRA 4CH0S 2MQLA 1YWXA 3J7YU 2XS7A 1UW4A 1YI2S 4WCEQ 3CD6S 2JRSA 1K73T 3VF0B 1OO0B 2MQQA 1N52B 4TU8A 4QPTA 4CH1A 1WI6A 4QU6A 3SMZA 2A3JA 3H2UB 2VONA 2ZJPQ 3CXCR 1YTYA 1M90T 2QA4S 1PGZA 3BO4A 3HI9A 3CCJS 1QM9A 2OSRA 1U1PA 2AYMA 2O3DA 3Q2TC 2LA4A 2CQPA 2KXFA 1NJIT 3D2WA 3TYTA 1S72S 4ERDA 3SXLA 2E44A 2N3OA 1Q7YT 3UCGA 3S8SA 1SJFA 2XS2A 1WG5A 2HYIB 2MQPA 3MUMP 3BS9A 4C0OC 4WKRA 2SXLA 2D9OA 1SXLA 2CQ1A 2F3JA 2MZTA 3S01A 1K9MT 2XNRA 4U67Q 2DHAA 2CQBA 2MGZB 2OTJS 3VAGA 5JVHQ 4A8XA 3VAIA 2Q79A 1M1KT 2K8GA 5D77A 3R1HA 2B0GA 2FY1A 2X1FA 2RQCA 3MOJB 4YUDA 2DGTA 5EN1A 2DH8A 1R8HA 5DDPC 1L3KA 2RVJA 2M4MA 2LXIA 4C7QA 3P5TL 2DGWA 4PRFA 2AYGA 1WG4A 2KI2A 5JVGQ 3G8TA 3CCUS 4ED5A 3VALA 4LIRA 3Q2SC 3CC2S 4Y0FA 2FC9A 2MZJA 3NNAA 2KM8C 2VODA 1JJHA 1X5OA 1VBXA 2DNKA 2N7CA 3BEGB 3MUVP 3VAHA 3H2VE 4F25A 1WEXA 1H2TZ 2HVZA 5GAGU 1M5PC 1M5OC 2CQIA 2DK2A 1FJ7A 2RUGA 1JJ2R 2MB0B 1Q86T 2MYFA 1R8PA 3VAKA 4CQ1A 2LKZA 5GAHU 2ADCA 4Z2XA 1WELA 4P6QA 3G96A 1IQTA 4J5OA 4IOCQ 1QVFR 2DGXA 1HL6A 2RNEA 1AUDA 4FXVA 2MKKA 1Q81T 4W92B 2JVOA 2F9JA 2M9KA 4QU7A 3BO3A 3I56S 1YIJS 3DLLQ 2CPFA 2KM8B 1VQ4S 2YWKA 1VQ5S 1VC5A 3CCMS 2OSQA 4C4WA 3VAJA 1VQPS 2DNZA 2MXYA 2CPDA 2MHNA 1U1NA 2MJNA 2M88A 4TU9A 3S6EA 3IRWP 3CCRS 2M2BA 2X1AA 1OPIA 1YHQS 2M70A 2AYEA 3MD1A 2KFYA 5DM7Q 3UD4P 4ZKAA 2RU3A 1U1RA 1NU4A 1X0FA 5LJ3Y 2CQDA 2MJUA 5MLCV 1SJ4P 3MD3A 2M8HA 3CMES 1N88A 2EK6A 4EGLA 2KRBA 3UWTA 3EGNA 1VC0A 3MDFA 2M8DB 2XB2D 1WWHA 1VC6A 2YKAA 4WFNQ 2L08A 4QQBA 2RS8A 5H1SV 1U1KA 2DHSA 2N82B 2EK1A 1WHVA 2NZ4A 2M7SA 2LYVA 3PIPQ 1B7FA 1VQ8S 2DH9A 1A9NB 2CJKA 1KQSR 2DNHA 3R27A 5CA5A 2MZ1A 4UY8T 3US5A 1SJ3P 2KU7A 2CPYA 1O0PA 5GAEU 3MURP 1ZH5A 4CIOA 5IQQA 2L41A 1ZZNA 1WF2A 2DNYA 5HO4A 1VQOS 1N8RT 3CC4S 2DB1A 1N54B 2QFJA 3CC7S 3EGZA 1HA1A 2X1BA 4WF9Q 3G9CA 3S7RA 2LXUA 1YJNS 3NNHA 2G0CA 5GVQA 3UD3P 3VAFA 2KN4A 1HD0A 1YJWS 2N3LA 1WI8A 1D8ZA 1WF1A 2DGQA 1CVJA 2J0QD 2LQ5A 3UE2A 2M0GB 1X4BA 2DNPA 1X4AA 1UAWA 3THTA 2G4BA 2YH0A 2X1GA 2RRAA 1WEYA 1X4EA 2DNOA 1H6KX 2DNQA 3OW2R 2DO4A 1FO1A 1WHXA 2HZCA 3MUTP 2LEBA 2NLWA 1S79A 1X5SA 2MZQA 2MMYA 2DNGA 3V4MA 1SJRA 3CULA 2CPJA 2WBRA 3SDEA 5LJ5Y 5DDRC 1FNXH 2UP1A 2DGUA 4LMZA 2MZSA 3FEXB 5DDQC 1WHWA 3JB9k 1QVGR 2AYBA 1DRZA 2MKIA 2OIHA 2KT5A 2MQNA 4TU7A 2J76E 2JWNA 2RS2A 1G2EA 3N9UC 1VQLS 1D9AA 2U2FA 1VBYA 2GO9A 1X4GA 1X5PA 1VQ9S 4M5DB 5DETA 1X4FA 4IO9Q 1JMTA 1FJEB 2ZJQQ 5BJRA 2FC8A 1PO6A 2V94A 2MKCA 2KG1A 1DHMA 3CCQS 2ADBA 1YITS 2F9DA 2YH1A 2QEXS 1X4HA 2CPIA 5HL7Q 1M5KC 3I55S 2MSTA 3DXBA 3R1LA 2D3OR 2KVIA 2I2YA 2CQ4A 1F9FA 1YJ9S 2KXHA 3IWNC 1X4DA 2J0SD 1VQ6S 1P1TA 2CPXA 2KYXA
chains in the Genus database with same CATH superfamily
1NH8A 2DR6A 1C1BB 3N0VA 4AXJA 2ZITA 2NSCA 1S12A 3U1LA 2IDEA 4QR2A 5KFPA 2CJQA 1GX5A 4ZPCA 2YNHA 5ETVA 3PKYA 3GIKA 2LEPA 3VAMA 4EZ9A 3GSDA 1M1HA 1NSKL 4C3MA 3HVRA 2ZUAA 3CCLS 3T5JA 1FNOA 4ILRA 3BGLA 2XZTB 3TRGA 3FK4A 3PV8A 1SL0A 4K4WA 1FESA 1TAQA 2BMBA 1RWPB 4HT7A 3PM9A 2DCUB 2V34A 1GX6A 1GT8A 1RHRB 1RU2A 2LCWA 2R3VA 2YKPA 5IZHA 2MGZA 1REVB 2ROPA 1IJEB 2PEHA 2QTWA 5HAOA 4XO0A 2H5IB 3OR2B 1Z2ZA 1SVDA 2B6AB 2GZOA 4FXWA 4AD6A 4NCGB 3OPKA 2HFUA 2OEJA 3K89A 1JLFB 1UVKA 1HR0F 3MMAB 4PZVA 1S1UB 3MM6A 3DDIA 2P2CB 4KGXB 1CS4B 5IM0A 2C2RA 3EVMA 1X9MA 1N5SA 2KT3A 4OI3A 4RU9A 1YJ7A 2PMZD 1GXLA 3HHLB 3LAMA 3MPDA 5KFFA 4RUBA 1CQNA 2IC3B 1NAQA 3OVAA 1UVIA 3V6JA 1QTMA 3FQKA 3OXLA 4NI2B 3DLEB 4YB5A 3TQEA 4AYBD 3JSMA 2EC2A 2D9PA 4IUFA 3D6HB 2UXDF 4EBCA 2CG4A 2RT3A 1HNVB 2YTCA 4PG4A 3DRSA 4IOAQ 3ET6A 2DHHA 3NEKA 1Q5YA 2YNIB 4O44A 4ANDA 4YY3J 5IWAF 2V6AA 3I0RB 4GKJF 4NYPA 1YQHA 2VFSA 3ISND 2F40A 3EVOA 3TVZA 2LA6A 2XNQA 3TO8A 3CCVS 1P27B 1YG0A 4TLQA 1DLOB 5KTQA 3AJ1A 4L73A 1KN6A 2BV3A 1Z4UA 1YK9A 3CIMA 4ZLNA 3HHNB 3BDEA 5ETQA 1UKUA 1R43A 2OPQA 4QWBA 3W8PA 4WFBQ 3IWXA 2ZH9A 1IVZA 1M0SA 2UVWA 4N56A 1BWVA 1KP6A 1UETA 2MY7A 1KQGB 2HFZA 2DHGA 1JLEA 2VFRA 4WK3A 3KJFB 1CJUB 3PRBA 3D68A 3G8SA 3Q23A 4IFVA 2BW2A 2XLIA 1BY9A 3J7Z5 1DQ8A 5EX0A 1I5OB 1FDDA 1MMDA 1OQ3A 4OHZA 1YDLA 1SQFA 3J7ZT 1U1LA 1Y3KA 1KR4A 1RKJA 4LR8A 2U1AA 4LJMA 4LF4J 2EFQA 3AD8C 1JLGA 1FVSA 3ELHA 4WIIA 4OZ5A 5DQIA 1WEZA 4ZPBA 1HPZA 1MWZA 2R8JA 2XMJA 3H20A 3V2UC 2BOPA 2EFNA 3K17A 1HNXJ 2IY5B 1DARA 1ELOA 1RUSA 2DHXA 2JOQA 2W4PA 3DCAA 1RI7A 4YB6A 3RRGA 2FHKA 3DC2A 4MYTA 2GFFA 2YNGB 1FWLA 3CF5Q 4DF4A 2FDNA 3F56A 4OJGA 5K9FA 4ED1A 1FE4A 2E1CA 4EO6A 1ITPA 1R8AA 5A8KB 2WCXA 3BYPA 2HNYB 4NRUA 4N8NA 3JAMU 4NYOA 5ITHA 2V8GA 2CA9A 4QIWD 2DITA 3AH6A 2VV5A 3KJVB 3M6UA 5LMUJ 4AQYJ 2HAFA 2ZE2B 3A8KA 2RILA 3CTRA 2E7WA 4GRSA 4DL4A 5B09A 4YOEA 2NUHA 1TUGB 1ZM3A 1S5ZA 2R7OA 2MQ8A 1NKBA 1D0EA 1FJGJ 2JEIA 3ICLA 3CCES 4PUOA 4F02A 3AY0A 5EGYA 2DO0A 4DV5F 3EDQB 3K5MA 4HTIA 1ICEB 1RHMB 3DLGA 3RAMA 3W63A 2J6TA 5D3GB 1QE1A 4YB1P 1X60A 3A4TA 2XMAA 4Y2KA 2QT7A 2BQRA 4YR2A 1TL1A 4BC7A 1UA1A 4YFUA 1BQMB 3FJ2A 3C6UA 3PHTA 4KKOA 1LK5A 4X4SA 2DNMA 5K14A 5HSPA 3K59A 3NY0A 1ZAXA 2IM1A 4FS2A 3RG6A 1N5QA 2B7BB 2HGMA 1KC8T 2OJ3A 5FLXU 3ZTSA 4WKYA 5DG7A 1UVNA 4UUXA 5HROA 4A4JA 3UO0A 2DNRA 3QAEA 4F67A 3Q8SB 4OV6A 2C2EA 3CMAS 1QVFR 4ZCLA 4GKJJ 1JNRB 4RW4B 1KFSA 4Q5VA 1T05B 4DR3F 1HWUA 3SCLE 1F3FA 5BYQA 3FSIA 2BANA 3FEYB 4Q0BB 4PQAA 2R4FA 1A7GE 2P6SA 1XMQJ 2GMLA 4KPYA 1T0TV 4ZCKA 2YKQA 5A2QU 4F4WA 3OBIA 4WXOA 1BXNA 2WVDA 1E6VA 4ICLB 2HSEB 4DUYJ 2CQ3A 3K7RA 4X65J 2AJQA 4ZP8A 4ZIWA 2BE2B 4DL6A 1UA0A 1DQAA 2QSWA 1S4FA 4KC5A 4MAKA 3K0JA 4V1Ak 2BBEA 3VV2B 3W9IA 3FFIB 1K1SA 2K3KA 1U2FA 2QV6A 1TFYA 4XDDA 3NMRA 1TKXB 1DFDA 2VASA 1NDKA 4NEZA 3KYLA 1OY8A 1YBUA 3MPYA 1UW4A 2PDAA 3M9MB 3UN3A 4DI6A 2OHDA 2JRSA 2XWXA 3KG0A 1VLYA 4HI1A 3TEHB 3UN2A 4MYUA 1ZPVA 2MQQA 1ZPWX 5L38A 1DTTA 1HBNB 1TP7A 4QPTA 4DL0C 4CH1A 1WI6A 3HFVA 4LF6J 3G2XA 1LWCA 1YX2A 2JNJA 2V5HG 2L9DA 3HKZD 3IMQJ 3PYDA 3SMZA 1HBOA 3OFHA 4USWA 3VGTA 1S1VB 3MMJA 3BSNA 3CJSA 1YTYA 2QA4S 3RZAA 1N34F 1SB6A 2GC8A 1RTDA 4FYXB 4I2PA 2R7RA 2LLZA 3HI9A 2VG7A 2W4CA 1LW2B 3CDAA 2KYZA 1JKHB 1P8GA 2OSRA 2E7VA 3CIZA 4B3MJ 2AYMA 2O3DA 3GMGA 2AJ2A 1FX2A 3W9HA 5BYSA 1U24A 3MTKA 2A18A 2KJWA 4K59A 2FZCB 3T1AA 2FUG9 4ES3A 3N5FA 5C5JA 4ELUA 3HVTB 4DU8A 3OV7A 5EHHA 2FJAB 4CO3A 4FKXA 5DS7A 3WDOA 4AQYF 3MMCA 4DFKA 3D1QA 4XIUA 4X4VA 4K8RA 2HYIB 4HVZA 7AT1B 3GSIA 4B3SJ 4EMDA 1Q4RA 1F5BA 1ACMB 2O66A 3HKWA 2VFUA 5KFAA 2D9OA 3CEDA 4Q44A 4JI7J 4CO1A 2R42A 3PEHA 2CQ1A 1RTIA 1Y9OA 2ZC4A 2MZTA 2EC0A 4HH0A 5EUHA 1RT4A 4DX8H 1U47A 3CCWA 5DO2A 1R0BG 3C14A 3EGWB 3M2UB 3VAGA 1RT3B 5JVHQ 2ASJA 1TVRA 2BJDA 3BGOP 2P9EA 2P6TA 3D0HE 3L95X 4CO4A 5J1EB 3PDNA 3KK2A 1GNKA 2AMCB 2ZEJA 4C98A 3MMAA 3DU6A 3UPFA 1PAEX 4DV3J 1HYSA 3H5YA 4OL8A 5K8OA 4ED3A 4WJBA 4U8YA 3KLEB 2HG4A 4WP3A 2X1FA 3J7A1 4YUDA 5CABA 3LP2A 2F63A 2ROGA 3HHLA 2E1RA 1RBAA 4DS4A 2MEWA 2PI4A 1R8HA 5DDPC 1L3KA 4Y65A 2LXIA 4C7QA 4QOTA 3W5ZA 2Y3YA 2AYGA 4ILLA 1XR5A 2KI2A 2HBRB 5KG6A 4FF3A 2HWHA 3UVJB 3KMSA 3Q2SC 3BKFA 3Q22A 2FC9A 2MZJA 2V68A 2KFNA 4U7UD 1DTQB 5IOLA 4OYPA 1HNVA 2Q1LA 2YY3A 3AODA 4M94A 1JJHA 5J2NB 1TAUA 4D3GA 3BEGB 1XWLA 4JI2F 4F25A 1HNWJ 2CKWA 2AWZA 4JUZA 2B8PA 4H4MA 2HVZA 2CVEA 3V81B 2VG5A 1NJYA 4J9KA 2JDJA 2VDIA 3QQCD 4P75A 1RWNB 1WC0A 1FJ7A 1H3DA 3BGFA 3R5GA 2VBZA 2F65A 2MB0B 2RDIA 2Y9HA 3C16B 3OL8A 1HMVB 2QSFA 1FKOA 4CQ1A 3QBCA 2ADCA 2CWXA 4BWJA 4C8KA 5HMYA 4P6QA 2IIHA 4UZBA 4IOCQ 1J5EJ 3K5OA 2ALZA 2ZD1A 4UTGA 3FRYA 4X64J 4TYAA 1BD6A 1HWLA 4DV0J 2ZM6F 4DR5J 3SI8A 2F9JA 4CO0A 5E5NA 3T5KA 1YIJS 3AAWB 5HQLA 1RADB 1LEOA 1PILA 2ZH6A 1VIOA 4DL3A 1HI0P 5E3PA 4MT1A 4KPCA 4ZN3A 1B99A 3BF4A 2MKYA 4NA1A 3CCMS 2OSQA 2K7JA 3MCSA 3OFEA 4BHQA 5C42A 2DNZA 2MHNA 2VB6A 4PXEA 2MJNA 2M88A 1HWKA 3WQPA 4J9SA 4QYZK 3LP0A 4Y34A 1DURA 2AZ1A 1JWWA 2M2BA 4LSNA 2ZM6J 3RR7A 4UY85 3H5SA 2PFFB 4JV0A 2M70A 4NWBA 3TOQA 5DM7Q 3BSCA 4ETZA 2HHVA 3B78A 2GIRA 3L4BC 1FDNA 1LXJA 2VPYB 4ZP6A 4ZKAA 1ROFA 3OL6A 1NM2A 2CQDA 2MJUA 4LSLA 5MLCV 3MD3A 1N32F 3I4PA 1ZM4A 2EK6A 3DYAB 4LFBJ 2AP6A 3UWTA 3ETOA 1HKAA 3MDFA 5GADI 2OD4A 1K47A 1VC6A 1UPPA 4E98A 3PR4A 1Q1KA 4IFYB 3BDPA 4P7VA 4QQBA 1C0TB 2RS8A 3SEOA 3SQOP 5H1SV 1TL1B 1U1KA 5HI7A 3S1TA 3PACA 3C6UB 4KKOB 2MLYA 4DR3J 3IS9A 3VHQA 4RKUC 4HKQA 3Q86A 3MM9A 3IG1A 4GO5X 4USKA 3B8HA 4JI0F 3H5UA 3PIPQ 2C3UA 3JSRA 4IG0B 4IRCA 4ZLPA 1YBTA 5KFLA 4HHHA 4LFBF 4DUYF 1KQSR 1IM4A 3MEKA 3CWJA 1CEZA 4ECVA 4JB8B 1VLOA 3DFEA 3MM7B 2MZ1A 3K5NA 4PYAA 3Q89A 1X31C 3KG1A 4ZPVR 3WX8A 1I94F 1LKZA 2RHQB 4DR2J 2KU7A 3TR5A 3ZZPA 4KV8A 2OMLA 3BZQA 3QJPA 3H4BA 1JXLA 1IKVA 2GNKA 3LPEA 2BQ3A 4DR4F 4C0BA 2GAGC 4PG8A 5FDLB 4F4XA 2DJWA 2F4FA 4JI2J 1WF2A 4ICLA 1HNZJ 2V4QA 3I5CA 3A8IA 1FKAF 4CO2A 2HLUA 3DRRB 1N54B 3GFHA 1OYDA 3CD5A 2Z2YB 3CJTA 3TUZC 3IRXB 5LMUF 4LF9F 1C0UA 2RF2A 2XMVA 1TKXA 3TA1A 2ZH3A 2R7QA 2XCAA 2KTQA 1F2HA 3GJQB 4RW6B 2BEFA 3RBZA 3KHLA 2RH3A 3BPSP 2ZH5A 4NCBA 3MAHA 5HN0A 1S9GA 2HIYA 3MOZA 3OUYA 2JLGA 3Q8YA 2B43A 4DBQA 4LFCJ 1CVJA 4C8YA 3N6LA 2J0QD 2CZVC 2GIFA 4L75A 1JLAA 4M5HA 5BR8F 4NYZA 1HI1A 2DNPA 4DEZA 5IQ6A 3EMTA 2V67A 2WONA 2HHHJ 4DFJA 2XTJP 3EICA 4DQSA 2RRAA 1WEYA 4UW2A 1E6YA 1H6KX 1N5YA 2JC1A 2PA8D 3OW2R 2ZWOA 5L8RC 1RBLA 1FO1A 3PR5B 2LEBA 2E9TA 2J7WA 1RTDB 1Q79A 4GVBA 5BR8J 1S79A 1X5SA 3CD0A 4G6VB 4CWBA 4PXBA 1RAIB 1FFSB 2BYCA 2W2PP 3NOGA 4I68A 2GVDB 3HZEA 4MMOA 3V4MA 1ZETA 2OPPA 1RP5A 4JI7F 2B6AA 3CULA 4DV1F 4PXCA 4NMXA 3SDEA 2QE5A 1B4SA 2MLZA 3A1YG 2GHVC 3K58A 2HRTA 3E8OA 4Z37A 1KEKA 4DCJB 1L3TA 1TR0A 1IBMJ 4FF2A 5ADZA 2A2CA 3JQKA 3LGHA 2DGUA 3RYLA 2VKRA 4NA3A 2DKOB 5L9XA 4GC7A 3U7JA 1CC8A 3FEXB 3UDLA 3QFWA 1QVGR 5F8GA 1IBKJ 1RABB 4ED7A 2CJXB 2V2KA 2HS3A 2F5GA 2IC3A 2G13A 3BR9A 1EP4A 1NUEA 3RJMB 2OIHA 4L6V3 1U0SA 3M9OB 3JS9A 4C3KA 2IJNA 1S0MA 4GKKF 2C42A 3JSMB 1VRUA 2QIFA 3W66A 3RRKA 1LWFA 3M2RA 2D1CA 1LV5A 4DLGA 2VBXA 3VVUA 4ECYA 4LVNP 1CPZA 1F3VA 1YLXA 1X4GA 2EBEA 3AOCA 1X4FA 3LOUA 4NLWA 4IO9Q 1D9DA 4CH7A 1U25A 3HT0A 2RE1A 2C2ZB 4OFZA 3SIPB 3O6QA 3LA0A 4R5PB 1NDLA 3UFCX 3KKFA 3KLEA 1U26A 1JJCB 4O3SA 4RNHA 1T94A 1IWGA 3LP2B 4LRBA 3JSYA 1WOPA 3T41A 2HHUA 5A6PA 2GGPA 4CM2A 1RACB 2YH1A 4EU0A 2CPIA 1KVIA 1H73A 5HL7Q 1YJVA 1T95A 4I1TA 4M5IA 2VKZG 4O3PA 3LH2S 1KQFB 2QA2A 1S6QB 3N28A 1HARA 4JI3F 1PKUA 2KXHA 2I5JA 2J0SD 4KTQA 2CDQA 1S49A 1RWXB 1LQ9A 3FNNA 2QX0A 1P1TA 1PYSB 2CPXA 4LQ9A 3GILA 5IT9Y 4QWEA 4H4MB 3N6NA 1XMBA 4YDXA 3MXHP 2FVPA 2C3OA 4B3OB 1VBZA 1TUWA 4PG6A 4ER8A 3RAQA 4C2MA 2DGVA 1K0TA 4I7FA 3H98A 1H2VZ 1MMNA 3D6TB 1U1OA 3KUGA 3C8YA 1KS2A 3QYYA 3VVTA 3OLAA 2GMHA 1UWBB 1NK9A 5EX3A 3EZUA 4BCAA 4Y00A 2HNYA 4FS1A 4JP8A 2JZ5A 3HULA 3AOAA 1SBRA 4B9UA 1YJTA 4G1QA 4KYZA 2BJ3A 5ETRA 4WYWA 3NGTA 2R2TA 4PUOB 1QY7A 2NSBA 3P3DA 2BKPA 3RGIA 4RZRA 2LECA 3BGUA 4LF5F 4MKYA 1X8DA 2Q6CA 3FQLA 3M7VA 2DRDA 3PRDA 4Z7CA 5EWEA 4RNOA 4J9MA 2DIVA 1FCAA 2CQCA 4IO1A 1N5YB 4NA2A 4F4YA 2CPEA 3MI7X 4OYZA 1HD1A 2WSCC 2KKHA 1HW8A 1IXKA 2CPZA 1BQMA 3J80Y 2I38A 2JH3A 4X65F 3PW7A 4D3HA 3B4MA 3HXMA 5KFIA 2CUYA 4F04B 4ED8A 3HHLC 2ZC3A 4PR6A 2BXJA 4LSNB 1EZZB 2DNNA 1NSPA 4I2QB 3HHKA 2DRAA 4B02A 2MQMA 5GADU 2ZJRQ 1M5HA 4NLSA 2CJAA 1RAHB 4EYIB 1S4EA 4CLZA 3NKYA 2LXFA 2ZOMA 3H5XA 3ONQA 4JI4J 1NK5A 2KZZA 1UEKA 2G1DA 3HLUA 5E3AA 3NMAA 1OWXA 1U8WA 1F9HA 1TFWA 1HBUA 4O3NA 4NLDA 3M05A 2GX8A 3CJRA 4Q0BA 2VD3A 4YR3A 3HHEA 3CPWR 1MN9A 1URNA 2BRKA 3CDEA 3GG0A 2C3MA 2CPHA 4DU7A 4RW9B 2IRXA 3PEJA 3VTIA 2KXNB 2KH9A 3V6DB 3TAQA 4C8OA 2ROEA 1XNRF 2PA3A 1NSQA 4HT5A 5F9NA 3BN4A 1R7IA 5E2QA 1G7CB 3QPIA 4ZVHA 5DM6Q 1MNEA 4N8OA 5LOQA 3HM9A 1AW0A 3HZGA 3UW1A 1HBMB 4B9NA 2L3MA 1VDHA 4DV0F 2IVFB 4LF8F 3ZTQA 3MCMA 5DLFA 2AX0A 2XEXA 4UQTA 4C11B 2PN6A 2W4DA 1I3OB 3D67A 5LXYA 4F4KA 2VOOA 2B9YA 2F8MA 4TY9A 4BC9A 4EI2A 5C24B 4E8UA 1RAJA 3W3SA 3D54A 1PJ6A 2VBWA 3DRPB 3PFOA 5HK4A 4LF6F 2Z58B 1BQNA 2OO4A 1Y00A 4ZHRA 4ZPAA 4OI1A 3UDVA 5L9NA 3RAXA 5ETLA 3NOCA 5F8HA 3PJXA 2XZWA 3ZZRA 4ENOA 4DZ6A 5KFDA 5KT5A 2XO6A 2RDJA 5HVGA 3C46A 2FJWA 4A8SA 3L3CA 3TX8A 2BA9A 1V6HA 1VQKS 1U6BA 2ZZTA 3JSBA 2AIRB 3RW7A 2JJ4D 3UCZP 3QGGA 1MWQA 2K7KA 3DOLA 2B4PA 3LP1A 5ETKA 5KG2A 2E5JA 1IKXB 1FRXA 2MTLA 1OIAA 2XYGB 3H8YA 5CYMB 1SIWB 4URQU 2YWGA 4DR7J 4C97A 1RT5A 2BJ9A 1R6VA 1S10A 2DISA 2XG8A 4JI8J 3MTJA 4UUWA 3P6YC 2C2DA 3NWGA 5L1JA 1VK3A 2QL9B 3OUYB 3HVTA 4ZA1A 2B56A 3R2CJ 2AJ1A 4GMKA 2APOA 5HJXA 1CS4A 5IM0B 3D1HA 3R7BB 3GR0A 1Q8BA 2JL9A 4PWWA 3UQSA 2UVVA 1EHWA 5F3TA 4OLOA 1RT2A 4DF8A 4DSJA 2F4VF 1FRIA 3L7UA 3LQVA 4PWDB 1SH3A 1FXRA 4A8MP 4X2BA 3ADAC 1R0CB 2UU9F 5ETPA 1N56A 1HIYA 3T6BA 3PHEA 3AJDA 2XMWA 1NB7A 5KFMA 2VICA 4ZPWR 4GVBB 2PGCA 1VQ7S 1WKJA 4OZ1A 1PCAA 2JX2A 1WTBA 1S1TA 2BR0A 5JJBA 1Q78A 4JOUA 5HVFA 4KH1B 3G6YA 3KHRA 2IMOA 3IAM9 4ZCMA 1MU2A 5GAHI 2UU9J 1ZA1B 1AFIA 1FK9B 1RDRA 2AJ4A 3I0RA 3CD7A 4NOHA 1VHIA 2CNOB 2RQ4A 3G87A 3HSZA 3M30B 3Q8VA 1KHVA 4PCQA 3AOBA 1RISA 4CLTA 3TZWA 5C7PA 3LWMA 3H4DA 1J5OB 1AZSA 3I4HX 3LGMA 3N4WA 2XM3A 2M52A 4OQJA 3N6MA 2ERRA 4IQXA 2OFGX 4FYYB 2E1MC 3ZZZA 3SFUA 2PMWA 2ZBCA 1JLEB 5E33A 1AUSL 1VI7A 1QUVA 8ATCB 3GE9A 3IR5B 4TLRA 1JXVA 1QSYA 5F8MA 1FTCA 4FF1A 5THWA 2XLKA 3DLKA 2XULA 4UZCA 4CH0S 1DTQA 2Q6BA 4JBCA 1UW9A 5J2NA 4ZPTR 3G82B 1KBRA 4KFBB 3R5AA 5ETOA 1K73T 4WP9A 2XI3A 2F4VJ 3SV4A 3MECA 3V81A 3M8ZA 1PJ7A 3JTPA 3MPUB 2VZ9A 4USIA 4WWSA 4USMA 4R5PA 4R25A 4ZOSA 3I32A 3IC1A 4ZLLA 5I4MA 5EDWA 4I56A 4ZITA 1NLKL 3M1VB 3PYFA 2VA2A 4QU6A 1B70B 4DSEA 2GA7A 3GONA 5A2QY 2XGQA 4IDKA 2J9DE 3H2UB 3K2YA 2P9CA 3HF5A 1IR2A 4URSA 4ZP7A 2OPRB 5LMNJ 2VONA 1J2VA 1OSCA 4CLYA 4Y3CA 4DJBA 3R6GB 3ISNC 2ILZA 4MFBA 3CCJS 2DEJA 1T7PA 4AUKA 2V9KA 2I8EA 3QSIA 3KJVA 2QN6B 4DFMA 4JV1A 3GR1A 2GW8A 3MWBA 1VRTB 2CNLB 2CQPA 4QBUA 5M2UA 1VQSA 2KXFA 2DPJA 1TKZA 5BYRA 3TI0A 3QRRA 1JB0C 1F0XA 1CG2A 4OJ1A 2QMXA 2R8HA 3HHLD 1A6LA 1HQUA 4NZ7A 2WW4A 3M6XA 4G1IA 4ZVFA 4RNFA 4ZN1A 1URRA 2O5DA 2X51A 2FZGB 1TELA 2E44A 3R5CA 2N3OA 3V6HA 4B3OA 3S8SA 2FLOA 2ACMA 4A8YA 1WG5A 2IAJA 3IP0A 1RLCL 4OHXA 1EX8A 1JLBB 3B82A 2BJEA 3PX4A 4WKRA 2SXLA 3LP0B 3D0GE 1QTNB 1VFJA 1N5TA 2EW9A 3OT9A 3P4UB 1WDDA 2H9ZA 3HSJA 2HBZB 2F3JA 4NE9C 3SBMA 4EFAC 1K9MT 4V19J 2YBVA 2GJFA 3LAKA 4U67Q 4A47A 1N6QB 4JI6F 5K8MA 1YZ6A 2OTJS 3QNWB 4I64A 4RBVA 3W1YC 4DQRA 3BJYA 2FQQB 1OYEA 2Q79A 4WFXA 2YKMB 1RWKB 4H4KC 4JYAJ 2NXJA 5D77A 4C0HA 1IM6A 4CI0B 1SKUB 3MR5A 1U8SA 2QZ8A 2B0GA 2WVBA 2H1YA 5B0FA 3SSQA 1VOMA 5L1KA 1WSVA 1PSDA 2HHXA 2CADA 1OY6A 3GJTB 4KHRA 2UVUA 1TUVA 3MOJB 4LVOP 1NHVA 2DXDA 4CYUA 2K2PA 5F9LA 3F73A 4WE1A 1NJXA 1NMEB 5IV3A 1NJWA 3CCSS 5EN1A 4OHVA 4C6AA 2R7SA 2EPIA 4HL9A 4WU2A 2RUSA 2RVJA 4KGVB 2DTJA 4F2SA 4PRFA 1NK7A 3ZZTA 4ED5A 2IA6A 3GCWP 4JI3J 1U0HB 2HFNA 2HFVA 1UJ6A 3CDUA 3JTNA 1SKRA 4NEYA 2RKIA 2KM8C 2VODA 3FUYA 2V63A 1EAYC 2WB4A 2B3TB 2DNKA 4L76A 3MM7A 4CLUA 1FD8A 1TKTA 3H2VE 4B08A 4FPRA 4ZP9A 3TZYA 4X62J 2YXLA 1WEXA 3FMBA 5F8LA 2BE9B 5GAGU 1M5PC 2GQQA 2WVCA 1C1BA 1VK8A 2QA1A 3C19A 2CQIA 4ANEA 2FJEB 5KFCA 2XI2A 1WKLA 2LDIA 2AJFE 3RB4A 1RYRA 2D74B 4YHHJ 3EWGA 3OD2A 3NCRA 5C25A 2MYFA 4QIVA 1B64A 3GIJA 3OFFA 4UF4A 4OX7A 4F7VA 2GQ2A 3CJKA 1F6TA 3ZZUA 1CBKA 2XMMA 2YNFA 2A1BA 3MM8B 1CQMA 2W7PA 4J5OA 1IQTA 4N77A 2DGXA 1RA6A 5CHCB 1HL6A 4E2FB 4OYBA 2JEGA 3FEZA 5A6WA 4DPWA 4UOGA 2CXEA 4F0MA 2JVOA 1BE4A 2M9KA 3M32B 3SSRA 2G9OA 2VG6B 2J0XA 5LMNF 3UDEA 3BO3A 3TZXA 2AGPA 1NPPA 1TU0B 3TAMB 1UEUA 3H42A 1MROB 2CPFA 1S9GB 2NPFA 5EWGA 2HNDA 1NBEB 2L9NA 3MM6B 5GAEI 1P9YA 4Q8EA 1VQ5S 1SC1B 3CDBA 4USTA 3MMCB 4ED0A 3A3NB 5KFYA 4DDFA 2GIQA 3EPIA 1FFWB 1Q8LA 1LW0A 4J9QA 3VAJA 3OLBA 5KG7A 1FRJA 1VQPS 4XDCA 2XMUA 4NI2A 4M5MA 4F4ZA 1TK5A 2O01C 3EUNA 5DQHA 1RA7A 5J2QA 4ZVQB 5K8PA 4FBTA 2YKOA 2X1AA 5HMZA 4WZMA 4KIAA 3ISZA 1IKXA 2HBQB 1IQZA 2AJ0A 3GJRB 4LRCA 1FEEA 2AYEA 2CFXA 4YB7A 2GVDA 1SJ1A 1ZM9A 4HACA 2HHWA 3CW2C 3FSXA 3DRSB 3M2UA 1TV6B 2QMUB 4OJ3A 2Q43A 2YNIA 3CO0P 3M8WA 5LJ3Y 3KUEA 1SJ4P 1L3VA 3CMES 3K57A 4JYAF 4MKVA 1VJQA 3TJAA 4K5RA 2X7IA 1KQKA 3MFIA 1HYSB 1N33J 2HURA 1IBKF 1VC0A 3M8QB 3EZ5A 2M8DB 2XB2D 4XPCA 1XIQA 3EYZA 2K1RB 3DI6B 4FBUA 4WFNQ 3PZPA 1KVKA 1Y10A 1PAUB 3KUHA 4IRKA 1JK9B 2G1HA 3JTOA 2JFDA 1R8BA 3W2WB 5B0AA 2AQ4A 1YRXA 4JI4F 3HX9A 2EK1A 3R3TA 4DV4J 1WHVA 3I0SB 2RB7A 1TK0A 2HFSA 4YR0A 5L46A 3IBFB 5JUMA 4CT8A 2M7SA 3GLJA 5B7WA 1RQ0A 2UUTA 4ZVOB 2YX4A 4HI2A 5KFTA 4BLGA 3UVJA 1T3NA 4F2RA 1MN7A 3MAAA 1T11A 1S1TB 2FB0A 2DH9A 1LWFB 1FWKA 1GFWB 1WJ9A 1O8BA 1Y3JA 3ENQA 3GYGA 5CZVA 4DQPA 4J91A 4PG5A 5CYQA 4YN3B 1MU2B 3TEGA 3J81U 2DNHA 2E66A 1IBCB 3KTQA 4TNOA 1C1CA 2RHSB 2YQ0A 4P2SA 2WVEA 4CM0A 5CCLA 1BWEA 2D69A 2VC0A 1HPZB 1WC1A 3US5A 1SJ3P 2GAHC 4LF8J 1QDUB 4KQZA 1AZSB 4P9SA 2XC9A 3MURP 1R89A 5H9EJ 1ZH5A 1V5VA 4USJC 4CIOA 1W2IA 2X3DA 3AA9A 5IQQA 4ETXA 1N34J 4IR9A 3C16A 4C3LA 3LANA 2BRLA 3CJ0A 2R2UA 2WSEC 2GGPB 3Q8UA 1N8RT 2WBMA 4IRDA 1R8CA 4GC6A 5KT7A 4YQWA 1BGXT 1Y0HA 2AF6A 3PRVA 3CC7S 2ZDOA 4NXMF 1LWEA 1P9QC 1RCXB 2X1BA 1F60B 2EG1A 2Z0GA 3PTWA 4X4PA 3G9CA 3NNHA 2LXUA 2IM2A 4K4VA 2G0CA 3O1LA 5GVQA 2E5LJ 3VAFA 4QYZJ 5KG5A 2UUWA 2V8HA 2KHDA 5G0RA 1HD0A 1DY3A 5HANA 3QIPA 3VGUA 4U95A 3PKMA 4NLUA 4M5NA 2WZ1A 1D8ZA 3MECB 4OYIA 5CAAA 3M8YA 1FKPA 1K0VA 2HQCA 2EBGA 2OPSA 2VF3A 2Z8QA 2M0GB 4TQSA 1RBOB 1X4AA 3MEEA 2VQEF 1B7YB 3M1VA 3R9LA 5C42B 5AXNA 2G4BA 1L5UA 1CJVA 2DNOA 2VHGA 4IDKB 1C4AA 5KAKA 5AE1A 1RAOA 2YWHA 4RL1A 3MUTP 1AUDA 1UWAA 3IBWA 4KSEB 4LF2A 3NBPB 3PVXA 9RUBA 1R6YA 2X3GA 4RBTA 2HWIA 2MMYA 5HP1B 2NXEA 2YX1A 3FZ2A 4TY8B 5I3UA 2UXDJ 1XNQJ 1YJUA 4DWIA 1TL4A 1CSJA 3H25A 4LSLB 4DR6J 5LJ5Y 4RW4A 3L7OA 3CDWA 3MEDA 5E41A 2D7SA 1IR1A 2A2DA 2B7CB 4CLLA 4UQGA 1JLCB 4NRTA 1ULRA 3OHBA 3WC2A 5CH7B 4LRDA 3BR8A 4LMZA 3IGNA 3CJQA 2MZSA 1LXNA 1HHQA 1C0TA 2XSJB 5DDQC 3JB9k 4ZCIA 4CRJA 4ZIVA 4DL5A 1E6VB 4RWWA 2MKIA 1T03A 3TVYA 4R0EA 3EVWA 2IYGA 2FHJA 4JI5J 5HMXA 2RIJA 4L72B 4I2QA 4DLEA 3KWMA 2RS2A 1G2EA 2IVMA 1W7WA 2J9EA 3M8RA 3NGSA 3QT5A 1D9AA 2U2FA 4AE5A 4RJVA 2CJYB 2UUAF 4B3RJ 4AFFA 4MTPA 4MK8A 5HMWA 3I5BA 3T5HA 2LQ8A 3NWRA 4K4YA 5CQGA 2E5LF 5GMEA 5H9FK 1H72C 2VUGA 3IR7B 3JQJA 3L9ZA 3GIIA 2ASLA 4USHA 5D0GA 3VGSA 4ANCA 2ZBRA 4KV8B 2QYGA 2YX7A 2HVDA 2HPUA 1RLDA 2KL8A 3T6JA 3KK3B 1RZMA 3V4IA 3PO4A 1HNIA 5E3QA 5FDLA 2HHPA 1GH8A 3N01A 2V94A 4S0MA 1NK4A 4X62F 3D3CJ 3A3OB 1DHMA 3CCQS 2ADBA 1X4HA 2ZDPA 1OPZA 1L3UA 2AT1B 3DRRA 4I2PB 1UFKA 4WTYA 1WC5A 1KTQA 5SZTA 3GV5B 1HBMA 4MH8A 1XR7A 3R1LA 2I2YA 2CQ4A 2J7UA 1APSA 1C0UB 2RF2B 2H4YB 3K5LA 1UJ4A 1VQ6S 4LBHA 2DY9A 2HRUA 1FRHA 2LU1A 3SCIE 5KFWA 2HW3A 1RWUA 2ZHBA 4RPFA 3OVSA 1TKTB 1T9VA 4QZVB 3O5TB 4LF4F 1RE1B 2HVIA 3JAMY 1H0HB 2PEBA 3MEGA 4P7TA 5F3ZA 3NAHA 5D0RA 3DOMA 3M4XA 2BVZA 3J7YI 4RUHA 2RRNA 2H54B 2MSSA 1HI8A 3QWUA 1RHUB 3QGHA 2KO1A 5IFMA 5C25B 3KLHB 2YVSA 5A8RA 4ECUA 4W4MA 1VQNS 1MW7A 2CQHA 4TVAB 3G6ES 4ECSA 2CQ2A 2FVQA 3MM8A 3GP9A 1T9YA 1GK8A 1N0VC 2BZ2A 3TJ8A 2RD5C 3DOLB 2QL5B 3LP1B 5J2PA 1NZAA 1XMOF 3SYZA 1RT4B 4TYBA 2HQIA 2ZKUA 2W2OP 2FVRA 4DMZA 1LNQA 2XS5A 2FPHX 3BYRA 3M32A 3OJSA 3DM2A 2MQOA 2VC1A 3DRYA 3PW2A 1U1QA 3SDEB 4DR6F 3KK2B 1M5VC 1XN9A 2DGSA 1ZBTA 1GMUA 1RAFB 2CG8A 3CSKA 3LUYA 4HHUA 4V19X 1SL2A 2LMIA 1Z2LA 2LEAA 1N0UA 3AFGA 4P73A 4ALZA 1S0VA 4IR1A 5IT9U 3MGJA 1SC3B 3GV8B 4Q2MA 2FLLA 1IKYA 2D41A 2J8SA 3LPYA 3M9NB 2DPIA 4Z7YA 5AT1B 1C4CA 4ZVRB 1ZM2A 2CNNB 3R97A 3NP5A 4DV6J 3RW6A 4PWDA 1EP4B 2ILYA 3CJ8A 5LXRA 4Q43A 1GAOA 1M5SA 4F26A 5CXTA 5J2QB 3KDOA 3D5MA 1SKWA 2HGNA 2RQKA 2HNZA 3LTOA 1ZTWA 8RUCA 1UEVA 1Q95G 2H4WB 4DV2J 2AD9A 2UUCJ 4DPTA 4OZ0A 1MMLA 4HACB 3KHHA 4ERDA 1X4CA 3NLCA 4RW8A 4DPXA 1NHKL 5I3QA 4TQRA 1U1MA 3HPOA 3BM7A 1TL3A 2M3DA 4USUA 6FD1A 3I82A 4ZJQA 4NLVA 4DV1J 1RAEB 1WUUA 1UPMB 2DGOA 3OL7A 1U6FA 2MPUA 5KFSA 4QJVA 1JQGA 3ITHB 2FJDB 2C3PA 3QWPA 1B0VA 1FXLA 4X4RA 4RR5A 2FGCA 4BS2A 3C66A 4NXNF 1WG1A 2ATLA 3I87A 2O1PA 5EWFA 3O3LA 4OZNA 2C22A 4W90B 3UNYA 3PYGA 2UV8A 2V2QA 3CCZA 2VPWB 4KGMA 1W25A 2WW8A 3G6XA 1QAJA 1ZTTA 1XERA 4CDIA 3THVA 5IV4A 1U2CA 4B3MF 1X5TA 4X4OA 2CYYA 1T9TA 1M1GA 1S6QA 4PYDA 3MAAB 4F3MA 1KOOA 4K4XA 2VA3A 2H48B 4DSIA 4OX6A 1T9UA 4TXSA 4WBFA 3M8PA 1J5EF 1EETA 2FHMA 2HGLA 1VQMS 4O23A 4ZLJA 4HDGA 3GCXP 1O51A 3PX0A 2W2NP 2Y0SD 1UZHA 4KFBA 1TL7A 3IO1A 2I6WA 5D0EA 5KFKA 3VR1A 3G71S 1U6ZA 3TVKA 1U48A 4NXNJ 1RTHA 2ZH8A 1UVLA 4B9MA 3BSOA 2LVWA 3N79A 1WF0A 3EX7B 2HMIB 3PFEA 4ID8A 2LU2A 4I7FB 3TNVA 4J9NA 4CNYA 3QT6A 1S6PA 1WHYA 4P71A 2BJ1A 3OR1B 2BDPA 1XBWA 2VH7A 2OI2A 3FDSA 4B3TJ 1HWIA 4K7QA 1Q82T 5T7LB 5LM7E 2K3IA 2H3EB 2LDYA 3DMJA 2E9ZA 3QIDA 3PIOQ 2VL1A 5KG1A 1Y5NB 3D1OA 3OXFA 4URGA 4F0KA 1Q16B 1TKZB 2AKWB 4J90A 1I51B 2E5GA 4MIWA 3F0NA 3VZHA 9ATCB 2OKQA 1FKPB 2KG0A 1KTVA 2EI5A 4M1KA 2OPSB 2OAUA 3BQ0A 1S77D 2AGQA 1YBAA 3E01A 1FD2A 1WC3A 3HHDA 4LF5J 4RWXA 1KHWA 1QUPA 4IYQA 2XLJA 3DLBA 4GKKJ 4WYLA 4B3SF 4DV5J 3IS9B 2G2OA 3Q83A 2DH7A 4UOFA 4RUCA 2FHOB 3MMBB 1JNZB 3A8EA 4NL5A 3ZNJ1 5LSLA 4J9OA 3KG4A 5FIIA 5CYJA 3AB2B 3TW0A 3RB0A 2R7TA 1G1XA 4DN0A 2BQUA 1IBMF 2RDDA 5I3UB 1S1WA 1IKWB 4GVLA 2JFKA 2CQ0A 4OIXA 1XMQF 1N6QA 4ELVA 2W9CA 3K5PA 2WK4A 4KGKA 1DZ5A 2XQCA 1FDBA 4DUTA 2QLJB 2YKMA 1S9FA 3U02A 2IFXA 2R2RA 3RU0A 1I6JA 1UVMA 2VFTA 4PKDB 3RTVA 3ILIA 1GXUA 1QSLA 5J1PA 1FRMA 4DL2A 2AV5A 2UUCF 4B9TA 2EEYA 5A8WA 3MPVA 3KLGB 1IKVB 4CP5A 4LR9A 4IQMA 5DLGA 5J2MA 3VCDA 1GMWA 2XSJA 3W64A 3BBCA 3MM5A 2B51A 4WFYA 2KFZA 3PW4A 3HCXA 4DG1B 2FVSA 5JMNA 2EFPA 1WOOA 1T03B 3W2VB 5DGAA 1JIHA 2FLNA 4N47A 4HLBA 2IBOA 3OQ2A 1FT8A 4X66J 3KJQB 2BUNA 4DOZA 5F0WA 1U0HA 2ZOFA 1RT6B 2MQLA 4I4BA 4OV1A 4ED2A 2FLPA 4RW6A 1R31A 2F8HA 3TUIC 3N5BA 1CJTA 2DR7A 1Y4ZB 2B9WA 1NK6A 3DRPA 4NLGA 3VF0B 3CJ5A 1S9EA 1OO0B 4AT1B 5AE3A 2XY7A 2NCKL 3I5AA 4M5JA 4M5LA 6FDRA 1JLAB 3IGVA 3QAUA 5B0BA 5CCMA 1D8YA 3PNIA 2R7VA 3MAQA 2NR0A 1NH7A 3W8GA 4LSZB 3LALA 5B0DA 2A3JA 2C1EB 4X4QA 1E6YB 2ZOGA 4CZCA 3CXCR 2ZJPQ 2QL7B 3PX6A 3CJKB 4WXWA 2DY1A 5AE2A 4M8LA 3MCNA 2GJIA 5L1IA 1PGZA 1M90T 3AB4B 3BO4A 4LF1A 2DXFA 4EZ6A 1FXDA 2HK3A 1O5JA 3HDSA 3T1HJ 1YVFA 3Q2TC 2LA4A 1OS5A 1NNDA 1RSCA 4MKBA 3OTEA 4DZDA 5HLFA 1WNEA 4BDPA 3BKTA 2AU0A 1NJIT 4HEA9 3TAMA 1F5AA 2PI5A 3R7NB 4MIAA 4YP3A 4B17A 2HNDB 3H7HB 2XWYA 1S72S 3SXLA 1Q7YT 3UCGA 4Y2AA 4DUZF 2ZBQA 2YKNA 2XS2A 1XEZA 2MQPA 4M5GA 4QCLA 8AT1B 3MUMP 1LWXA 1VHFA 3MR7A 2EFVA 3OTDA 4C0OC 4DV4F 1HR0J 5KFXA 3KLIB 4EBEA 1BMQB 2W25A 3PYEA 3FZBA 5I42B 4DUZJ 5GMDA 5J2PB 3MFHA 1GXTA 1TZ0A 2B9XA 1REVA 3QO9B 4CT9A 2QLWA 1LFPA 4DHVA 2MGZB 4F3OA 3WZ0A 3QRPA 2UXCJ 4ZVSB 2OD6A 4I6YA 1DAXA 5E3RA 4ECRA 4JI8F 1YZ7A 4NCGA 4C8LA 3A12A 1FK9A 2K8GA 1M1KT 1TMJA 2BOAA 5A0YA 5KFRA 3TA0A 2P8IA 2JHEA 1H7WA 4MK9A 3M8QA 1KVJA 2Z30B 2E29A 3D66A 3KNGA 4K50A 3GZ7A 4PABA 2NZCA 4PEOA 2FY1A 3MR6A 4JI1F 1UJ5A 3R5JB 2RQCA 4KHPJ 4DR1F 2IJRA 2UUBJ 2AEJA 3W2WA 2KT2A 5KFGA 4OYMA 4RX6A 2DH8A 2IDLA 3QFHA 2ZVIA 2GVZA 2MLXA 3C6TA 1PBUA 3P5TL 3OL9A 1AT1B 2IM0A 1Q8IA 1VR6A 1A0OB 3Q8QB 3POTB 4W98A 3CCUS 2ZH2A 3DLJA 4LIRA 3VALA 4Y0FA 1SPBP 2IA0A 3DLKB 5ETTA 2CAJA 3DOKA 4KO0B 4EBDA 2I5JB 2NXUA 4RW8B 3B54A 1KLMB 1ZAWA 1QAXA 1X5OA 1JXEA 4NPOA 5CYQB 1RU1A 3W60A 1VBKA 5DDOC 3VAHA 1IBLF 2RU9A 2HVHA 3UR0A 1NDCA 1H2TZ 4DR1J 4XAKA 3OTCA 1M5OC 1HNXF 3A3PB 1Y5IB 1NK8A 2DR8A 2OPQB 3M8SA 4K4TA 1JJ2R 4ZVUB 1NSAA 3D4JA 1R8PA 1SUQB 2HBYB 5RUBA 1H7XA 2KDOA 3I9ZA 3WX4A 4Z2XA 1CJUA 1WELA 2EWHA 2B4OA 3ETMA 5DRKA 3WC0A 2H51B 3OTBA 4YHHF 3G96A 5SUHA 5KFVA 4LRAA 4DPYA 1YKWA 2WAQD 4MIBA 3IN5A 2VJUA 3UI3A 1LWEB 2JC0A 4WIQA 2RNEA 3OJUA 3LO3A 4FXVA 3E51A 2MKKA 2QLBB 1HFEL 3T1HF 3ILLA 3M8PB 1Q81T 2NUUG 1HNWF 2R7XA 2F1FA 4QU7A 5G0RB 2QA4G 2AW0A 4K2JA 5IC4B 1G4CA 1TL7B 2XBPA 2HVEA 3FRZA 5LL6d 2C3YA 2QLXA 1VQ4S 2PC6A 3TUJC 2YWKA 3OFGA 5AJ3F 2DCLA 5KFBA 4FXDA 3U27A 4BBYA 3VWSA 3QJLA 4YEAA 3G86A 1HWJA 1T02A 4ED4A 2HMIA 4C4WA 3D6FB 2N4DA 2OH2A 4CLWA 1TMMA 5C2GA 4FYWB 3TANA 1WDTA 3V6KA 3JYTB 1S7HA 3S6EA 1Y7PA 4K2XA 3T3FA 2OMOA 4DL7A 5A8KA 1BHNA 1RAAB 1XR6A 3R5BA 5T7LA 4X4UA 4OHYA 1RHKB 4Y28C 1YHQS 5HP1A 2GQCA 3KFWX 2FZKB 3DMJB 3MD1A 4EUVA 3I96A 2B9EA 3OTOF 2KFYA 2OP5A 4Y2IA 3BREA 1X0FA 1HLWA 2D3UA 2M8HA 2V4RA 4DN9A 2BKOA 2W9AA 1AA1B 1N88A 3MEDB 4PPZA 3FCHA 3PO5A 2KRBA 1D09B 1GMWD 1HBUB 1QE1B 3EGNA 2IVYA 2ZKTA 3ZC4A 2HHHF 1WWHA 4A8WA 4P2XA 3DDNA 3NL0A 2YKAA 2L08A 2WOMA 3IFEA 4FDFA 5H9FJ 3KHGA 1U49A 4RW9A 2VPXB 2DHSA 2VBYA 3ZNUA 4CO5A 4ES1A 4A8FA 2EKNA 2AGOA 3ENVA 4LR7A 5KFJA 3MMBA 4NX9A 2GHWA 2LYVA 2DVIA 4UT4A 1B7FA 1RT1B 3R2DJ 1IJFB 4DR2F 2ASYA 2QGFB 2I1RA 3ILJA 5U47A 1A9NB 1S6OA 1VRQC 2B4UA 2FY8A 2G2ZA 4FN5A 3KDNA 4J37A 4WU3A 5KFUA 4IG3B 2HZAA 1HNZF 2QMWA 2UV8G 1WC6A 1NKCA 1HW9A 1BQNB 1PBAA 2K06A 3BGRB 1JLQA 2VDHA 4IH5A 4O4GA 5DJBA 3KLGA 1F5CA 1S1XA 3KK3A 1RYSA 2J6SA 4F0HA 5E3CA 3VQSA 4DQQA 3IA0A 2L41A 2AEMA 3CVKA 3G6VA 2DR9A 1VCTA 2G0IA 2WRMA 2DNYA 4UOHA 5HO4A 2MDAA 1VQOS 1XNRJ 4RBUA 2ABYA 3CC4S 2A10A 5A76A 2YNFB 2HHTA 5T14A 1NZ8A 2DB1A 4RNNA 3K8VA 2QFJA 1XC9A 1U2RA 4ZVPB 1XMOJ 1H98A 1FA0A 5CYMA 4OMFG 1OSDA 4R8UB 1YJNS 2BX6A 4PQUA 3AA8A 3ZXWA 4I69A 4ZVEA 3PCOB 3FC9A 5DZ6A 1U7LA 2DR5A 1GEHA 2D3ZA 1YJWS 3KK1A 4B9LA 1QLNA 1CJTB 4PG7A 4X4TA 3I31A 3GQCA 1WI8A 1XQIA 2W01A 2V0NA 3DOMB 2LQ5A 1MLAA 1KNZA 3G8QA 3Q0AA 5LSRA 3PY8A 2C2NA 1PC5A 1X4BA 1IUJA 4FKYA 1LW0B 1RT2B 1UAWA 2HRYA 3DKDA 5I3PA 3THTA 1D1UA 4I6AA 3KLHA 1REGX 2HK2A 5A8RB 3CB4A 6AT1B 2R8GA 4ITSA 1S1VA 2OGUA 2L48A 2P9GA 1N4LA 3K8WA 2NYHA 4ES2A 2WSFC 3CJ3A 1WHXA 3EM1A 3FKBA 4F4AA 2J9CA 2BM1A 2NLWA 2PO4A 4H54A 4L3NA 5IS2A 2VG7B 3Q8RB 3J7AN 3PJWA 1JKHA 3WBZA 2Q66A 2DNGA 1D3WA 4F8RA 2WB1D 1FE0A 1KWMA 1SJRA 3DM2B 3GWCA 5IWAJ 3L7PA 1KDNA 2CPJA 2DD8S 2WBRA 3AQOA 4LIWA 1RWWB 1HHSA 3W62A 4OI4A 4NMLA 3GYXB 2GV1A 4ZS6A 2ZH4A 1S1UA 3M30A 4KRWA 4EO8A 5DDRC 4DPUA 1J5OA 4P10A 2AHOB 1NCLA 1EB0A 3DI6A 2V8DA 3EJMA 3QGPA 4OZJA 2OEKA 4P72A 2Y0BB 4EEYA 1DJ0A 1WHWA 1NDPA 2VFVA 3TUPA 2HKEA 3TARA 1Z1ZA 4HYKA 1S6UA 2V2VA 1DRZA 1V5IB 3KLIA 4NLPA 2ACYA 2MQNA 3DLEA 3W65A 2J5AA 1BC6A 4X4NA 1SL1A 1CJKA 3OTOJ 1SI9A 1FJGF 1SV5B 4ECWA 2GMJA 1WACA 4ZDNA 2JWNA 4DX5A 1FNMA 1X7VA 3QO9A 4FNIA 1NRKA 4DXLA 3T5LA 4WP8A 1RT3A 3ET6B 2HLTA 3R5DA 2IHR1 3MHYA 2B8QA 3AXKA 4O44B 4XK8C 2V8PA 3J80U 4FP9A 3GIRA 1X5PA 1VQ9S 5DETA 4YS2A 1RT7B 3TJ9A 1JMTA 3DXSX 1WORA 4ECTA 1FJEB 5BJRA 1O6XA 1QAYA 2WTFA 1Q53A 3D9BA 2COLA 2XYPB 3T9NA 2BABA 2MKCA 2VU5A 2KG1A 2C28A 1PO6A 1RWVB 1ZS6A 1YITS 2F9DA 1XJWB 2OPRA 3C6TB 4K0KJ 2JEJA 1F2GA 3D7SB 3ENAA 2B5JA 3DGPA 3TWZA 3I55S 2R2SA 3NCQA 4IKAA 2W2MP 3DXBA 4MFBB 1TL5A 4DX7A 3QZ7A 1RWOB 2UVRA 1F9FA 5D4OA 2YPZA 2ZFHA 3M2VB 2BJ7A 3GFXA 1YJ9S 1B3TA 1UVJA 1X4DA 1FX4A 1VRTA 3LW5C 3P96A 3DHXA 4O3QA 2CZ9A 5H9EK 1HQEA 5AXMA 3RB3A 2W8KA 2ZWPA 5AXLA 3SZ2A 3C3LA 1HQUB 4ZJOA 2VQEJ 3EDRB 3SCJE 4A48A 1K8AT 5B0GA 4F50A 2QC3A 1F9EB 4RU2A 4J9RA 4ELTA 1UL3A 2KVQE 2IAJB 3MEEB 5F41A 1GTHA 5LSOA 4O0IA 2FVCA 3CUNA 5DZ7A 4K0KF 2GJ2A 2FGOA 2Y1RI 4N76A 3CO9A 4FPIA 2YNGA 1EKRA 3D3BJ 4QIGA 1I1GA 7FDRA 4NZ6A 3QLHB 2FJBB 2V4JA 3TAPA 2HHSA 4NLYA 5E0OA 2H65B 2JVRA 3SV3A 2JSXA 1VMBA 5ETNA 3NBPA 4C48A 3QRQA 2MZRA 4NXMJ 2ZBPA 2Z4PA 3RBEA 3UCUP 2JLFA 3UDCA 2E5HA 2LP4A 2I9SA 2NYIA 2OLWA 3DHWC 3AJ2A 1B0PA 2PSZA 4TY8A 2ATCB 3GFZA 3H90A 2F8EX 3RBDA 3QJJA 2KHCA 4KY3A 4A8OA 1N32J 1NPRA 1OY9A 2RRBA 4RNMA 2CNKB 4CTAB 2YQ3A 1OQ6A 2PIIA 1IWAA 5K8NA 3W5XA 3GV7B 2FYXA 3CT9A 3DLGB 2CZ4A 1QD1A 1KKHA 1RXOB 2O67A 3FMWA 5D78A 2DIUA 1D9FA 3B4DA 2OTLS 1KSPA 3CGIA 4JI1J 4KHPF 2Z2ZA 1CC7A 2HWTA 1NO8A 2EXUA 2YWEA 5IC6B 1PG5B 1S48A 2DXEA 4H4OA 5CZXA 3FCWA 4OZLA 4F3QA 3O44A 4OYOA 2AX1A 1EARA 2PFDA 4JV5J 5K14B 3ZO7A 1SJQA 3RB6A 4HTJA 2ZNZA 2GS8A 2J8AA 4QR1A 2UUBF 4HH1A 3WIVA 1FRLA 2F7VA 2FJVA 4IOBA 1S1WB 1IKWA 4DFPA 2CWKA 1FJCA 4C8ZA 4U6PA 4DSKA 2RKIB 4QR0A 1BQXA 2RAQA 4OYAA 2KZMA 1UFLA 1WKKA 3BV8A 2G0JA 2Z57B 4XPEA 1RHQB 1RAGB 4NZ0A 3DYAA 1FI4A 1T05A 1TQLA 4M5DA 1NJZA 3BBFA 3W5YA 4DSFA 2BJ8A 5B0CA 5L1LA 2MKJA 5A8WB 4XTTA 3OSNA 3V4IB 3AD7C 1FHTA 3VGVA 3TP2A 3OSPA 2Q3PA 1MSWD 5IT0A 1JJ4A 4JV5F 3MM5B 4AL5A 3NXZA 3THPA 3TQ1A 3FBFA 4LBIA 3HK2A 1UFWA 3QZ8A 4P2MA 1WTFA 1KOHA 4ID5B 3MM9B 3IG1B 5B08A 3NRBA 4FVMA 3U1MA 3BH7B 1W2BR 3FFIA 5HBMA 1BUXA 4X64F 1XTZA 5GMKa 4ZJLA 3GJSB 5DG8A 1X9SA 2KRRA 5D15A 3QT8A 4TKTA 1S97A 1KD1T 2VG6A 3DLHA 2OFHX 4WFAQ 3GFYA 3PG9A 1QJHA 2V8VA 3FBEA 3L09A 1MROA 2XMTA 2XSFA 3H2LA 4U7UK 1SQEA 3GU0A 3T9ZA 2LQBA 1N36J 2ASDA 3ULHA 4PXDA 3ZTOA 1HBNA 1U02A 3IBCB 1SKSA 4DR5F 4NLTA 3NS5A 4M63A 3QT7A 4OI2A 2EKYA 4QIFA 3H40A 2CVIA 2ZHAA 4DS5A 4HR2A 3VZIA 4B3TF 5K5MA 2A0FB 4LFCF 3DU5A 4CLKA 3FGVA 2JLEA 2MKHA 3LF0A 3SCKE 4OX9J 5CD4A 4K4UA 3KLFA 3FBCA 1XNQF 2UXBF 3B6BA 4ILMA 2FD2A 2V2ZA 1V3ZA 3LWLA 4KH0B 3F44A 1H2UX 5KG4A 1ZAVA 5D4PA 5D6GA 3NNCA 1NEEA 2RQMA 5B0EA 3OR2A 4NCAA 1TV6A 1LFWA 5HLFB 4C9DA 1PYOB 4RLEA 5IXUA 5FJ4A 1S76D 4M95A 3NS6A 1VISA 4OI6A 4DV7J 1RGVA 2Y8WA 2L9WA 3G4SS 4NLQA 1DBDA 2RMLA 1RTJB 2BE7D 4BWMA 1T9WA 3AQPA 2J9DA 4DCPB 2XO7A 3M6VA 4CLFA 2VOPA 4K4ZA 2K1RA 2PD1A 2Z56B 2DBBA 1S57A 2E5IA 1VYAA 2WONB 4M5KA 2Y1JA 2GHPA 4U8VA 3HVWA 4NLXA 3A13A 4KGZB 1T8EA 4OYXA 2MY8A 1FERA 1SH2A 3I0SA 4DCOB 1NK0A 3IR6B 3U1NA 2A6OA 2HZVA 2ZNYA 2MKSA 5C2CA 4Q45A 5I42A 1K44A 1UP1A 3OVBA 4LRFA 2Y1LB 3C14B 4LREA 2J0WA 4G1PA 4A46A 2FTRA 3TA2A 3J81j 3LGNA 1TL3B 1UCNA 2W9BA 1SC4B 3NGRA 1EJ7L 1C1CB 2R7UA 4OX8A 4CLPA 3ITHA 4UOCA 3BH6B 1EKSA 5KT6A 2UZAA 2H5JB 3EPGA 1N36F 3RUBL 3BN7A 3UR3C 1RCOB 3BO2A 1KRPA 2PE8A 2CQGA 3ZZYA 3EXYA 2QO3A 1TTHB 2HAIA 2EVZA 2GVZB 3GG1A 1P1LA 4QPXA 1ZYQA 4EK2A 1CJKB 4IFVB 1ZZFA 3EGVA 1SV5A 4RUAA 1U45A 2HS4A 2DNLA 4DR4J 3EXCX 2KJVA 2HEKA 3M2RB 2UXBJ 1S99A 1RK8A 3AHPA 3HFZB 4N5SA 1YWXA 3T1YF 1VIXA 2QJ3A 3J7YU 3EE3A 3NGKA 1N48A 2XS7A 1YI2S 4YY3F 3DN9A 3QIPB 4WCEQ 1R27B 4Q2LA 1JLGB 4LF7J 3X3UA 3CD6S 2I0XA 4J9LA 3R6LB 5D0HA 3KNAA 2D3OR 3NAIA 2N7YA 2PT0A 1RTHB 3JQMA 7FD1A 4LF9J 1UZDA 1N52B 4ECQA 1FF2A 3BSAA 4TU8A 3KLVA 2N4CA 2V69A 2VJVA 3HP6A 1CJVB 1C2PA 1SUQA 1HMVA 4J9PA 3OR1A 4OX9F 4WPAA 4CNZA 5T41A 1GTEA 1IR0A 4WTOB 5HVHA 3FVYA 2ZBIA 2W24A 4QWDA 3X1LB 5KFHA 1QM9A 4WFZA 1U1PA 4KB7A 3M2VA 2ZE2A 1H74A 5F0UA 1CULA 2IBKA 4N41A 2NPIA 4O3OA 1HQEB 3R8YA 5KFQA 1R0AA 5F8IA 2LQ9A 3MZIA 3TYTA 2E1PA 3D2WA 4RW7A 3RR8A 1JLCA 2LFVA 4DR7F 4QWCA 3M6WA 1X9WA 2YPYA 5IT4A 4O4RA 1SJFA 2C2MB 1TK8A 3ILOA 3MPWA 3KXDA 4I0WA 1S0OA 4OHWA 1U4BA 3BS9A 4FYDA 4MK7A 2GCFA 3JYTA 5KFNA 4GO7X 1AYEA 3SQGA 5L39A 1SXLA 1UWBA 1N5VA 2CIMA 1AB8A 1Q7LB 1SC6A 3S01A 3SSSA 3SFGA 3I6PA 2XNRA 2ZUGA 4J9VA 2CJ9A 2CQBA 2DHAA 4FVCA 4IH7A 1FFGB 4G65A 5HATA 4G1QB 3IXQA 2FHJD 2W9CB 1CLFA 4K5SA 4A8XA 2V50A 3HD1A 3VAIA 1V3SA 4CTAA 4DV6F 2W2QP 3R1HA 2UUAJ 2UXCF 3P49B 4B3RF 2XHCA 1PYTA 2ZZNA 1IN0A 4P2FA 1NB2A 2DYAA 3GPAA 1SCJB 4MKAA 4YDDB 1EIYB 2J6UA 3FSYA 3ZZ0A 4IFYA 3RRHA 1HNIB 4H4OB 3Q8PB 2QFIA 1NHUA 2G2YA 4HDHA 4LQ3A 3ENWA 2DGTA 1DQ9A 2VPZB 3C15A 5HQMA 3AT1B 1Y11A 4DG1A 4U96A 3HO1A 3W2VA 2M4MA 3MCOA 4QW8A 2BE2A 4AXIA 2DGWA 3O8WA 1WG4A 1FRKA 1RT1A 2HQ3A 3QATA 5M2PA 1EQMA 2HQGA 3G8TA 5JVGQ 1U1RA 2VQFJ 3CC2S 2PMHA 4I6WA 4ATNA 2JEFA 3NNAA 3KJNB 1MWYA 3IWLA 4JI0J 4L74A 3PW5A 1WC4A 1VBXA 1T3OA 2N7CA 1EQ0A 3MUVP 5F8NA 3PJ9A 2E9RX 1RHJB 2HIQA 1S9EB 2GO8A 3MEGB 1XK8A 2QG9B 4P52A 1Q0NA 1BLUA 3CNQP 1FVQA 4AL6A 1JLQB 3VQTA 4FF4A 1DTTB 2DK2A 1S1XB 2YNHB 2FIUA 1VJWA 2RUGA 1KONA 2W7AA 2XZDB 2BM0A 1PC4A 1Q86T 3V6DA 4KR0B 3VAKA 2LKZA 4R0JA 4P74A 5GAHU 3J81Y 5FLXY 1R3NA 4ID5A 2E1AA 4J7CA 1T9XA 2CRLA 4CCHA 3NGDA 4TN2A 5D8HB 3IRXA 1FDAA 4OLPA 4Q7AA 5D3GA 4R8UA 1AFJA 2NREA 4W92B 5KFZA 4PQUB 3HSDA 4C11A 4B9SA 3NS7B 4YMEA 5ETSA 5KT4A 4EYHB 1RTZA 4J9UE 3QSYB 2XY6A 3I56S 2R7WA 1JLFA 1UTAA 4H4KA 3DLLQ 2KM8B 3TZZA 2E7XA 2EG2A 3R7SB 4ZHRB 1SQGA 1HQ2A 2OUGA 1VC5A 1FTRA 2YKNB 2V9WA 1IKYB 4A8KA 1YRUA 5LT5A 2MXYA 2CPDA 3DRXA 3I9V9 1U1NA 4TU9A 1B0TA 5AXKA 3IRWP 5M2RA 2QRRA 5HQ8A 1V9OA 3CCRS 5G4DA 5MAOA 3KLFB 4DSLA 3AD9C 1RTIB 1X0PA 2HNZB 1QAIA 1OPIA 3MR2A 1RB0A 4JI5F 4MJKA 3UD4P 4FNHA 5KOXA 1RT5B 2OPPB 5KFEA 2RU3A 4DV3F 1NU4A 4OI0A 4DV7F 1TVRB 4U9RA 5J1EA 1G6BA 4QW9A 5A0YB 1Q5VA 2IRUA 3ZZOA 4EGLA 1RWMB 2OEMA 3BKUA 3QMQA 5CD4H 3CJ4A 1GQEA 3HD2A 1RTJA 2IMWP 1DLOA 4FYVB 4JI6J 4X84A 1W26A 4OZ2A 5FD1A 4NLOA 1Y5LB 2N82B 2R8IA 2EFGA 3RBXA 2ZZMA 2NZ4A 1VGYA 3QGIA 3D28A 3HFKA 3HJVA 3HJFA 1S7IA 3NGUA 3O2IA 5DG9A 1VRUB 3POTA 4O3RA 1LOUA 3DGVA 4ED6A 1VQ8S 4USVA 1YSJA 1U09A 2BACA 4K4SA 3DOKB 4KO0A 1EETB 2WHOA 4L3KA 3UNGC 2CDRB 2CJKA 1KLMA 3T19A 2XGPA 3W7BA 2AZ3A 2W9BB 2YWWA 2M5YA 1AXQA 3R27A 4N7TA 5CA5A 2OELA 2XCPA 4LFAF 2D3O1 4UY8T 2NS1B 1S0NA 3BQ2A 2RSQA 4OJHA 1RT7A 1SH0A 2VG5B 2IRYA 2CPYA 4LT6A 3T1YJ 2H5EA 3H0PA 1RJJA 3D6MB 5KG3A 3BPDA 4C8NA 1O0PA 5K20B 4HHJA 4KAIA 5HJYA 5GAEU 2Y1IA 1JX4A 1NKEA 1ZZNA 3DDKA 3W9JA 1S6PB 4LFAJ 2IM3A 3WIUA 1FKOB 1L3SA 3H59A 2Y8YA 1WSRA 1NPKA 3OHAA 2W1BA 3WHIA 2NXNA 2B5JB 3DGPB 3D0IE 2BW7A 4LUBA 3CE8A 3JXOA 1UMJA 3EGZA 1HA1A 2ALYB 2ZD1B 2KB2A 2C2KB 3EZOA 3MF5A 4AL7A 4WF9Q 3S7RA 5F8JA 1ZOTA 1TKDA 3UD3P 1PJ5A 1FEHA 2KN4A 3BQ1A 3NG8A 3G82A 1KFDA 4E0DA 1IBLJ 3CCTA 5ETMA 2N3LA 4OZ3A 1WF1A 2DGQA 4QIEA 2FJXA 3GTYX 1LK7A 2IJFA 2YWFA 4KHMA 2DT9A 1AROP 3UE2A 2AEFA 1FWPA 3E01B 5GAGI 5KOWA 3CJ2A 3GYNA 2YH0A 4O0NA 2R8KA 2X1GA 1X4EA 1VQYA 3V5RA 4DQIA 2HFOA 2RJZA 5E7OB 3MR3A 2DNQA 3QLHA 2V4JB 4IH6A 2DO4A 2HZCA 4B9VA 4I67A 4PPDA 1K1QA 3BBBA 4ZPDA 5KG0A 1F1BB 3IAS9 2VIHA 2MZQA 3DNCA 4ECXA 3AXMA 1KLNA 5HROB 3HT3A 5KFOA 4G3IA 4KJIA 2XYHB 1CULB 1MG7A 3GIMA 5JXSA 3GB0A 1Q8KA 3PW0A 4ECZA 3ZTPA 1NXIA 1R0AB 5D4NA 2HQFA 2ZH1A 4RW7B 1QSSA 2ZH7A 2BANB 3KOAA 1FNXH 2UP1A 3IM8A 3E3XA 3HVAA 1PIEA 4A8QA 5J2MB 2WOMB 1S59A 1HHTP 4Q8FA 3KMQA 1P6TA 1JLBA 1J27A 1SIZA 4WK1A 2AYBA 4ZMMA 2KT5A 1OMSA 2XHWA 4PWUA 3SQGB 2BKNA 2XY5A 1H38A 4ZVGA 4TU7A 3FCVA 2DRBA 2J76E 1GMVA 2HS0A 2WVFA 1WOSA 5D4LA 4IG0A 4RO0A 1VS3A 3N9UC 1VQLS 1OJ4A 2QLFB 1RT6A 2MHEA 1I94J 3OXGA 1G3OA 1VBYA 1N33F 4PAAA 4F36A 4IG3A 2IPOB 2XMKA 4Y2CA 2GO9A 2R9LA 2W7OA 4M5DB 2HQDA 4CLSA 2ZVSA 2VQFF 3CMQA 2Z2MA 3BGRA 4O4GB 2CJBA 3W61A 2EFOA 4U7CA 3E2EA 2B4VA 3P45B 1YRTA 4FZVA 2C2OB 3P5BP 4C8MA 2ZJQQ 4CYUB 4ZK7M 4DPOA 3A8JA 1LWCB 1ZA2B 2FC8A 3F41A 3FBBA 4WE1B 2ZHOA 4Y2MA 2Z2LA 3C15B 4KE5A 2J7KA 2A6MA 1HBOB 3HMJG 4QWAA 4LF7F 3P8BB 3PXGa 5BXIA 2P5VA 2QEXS 1M5KC 3HSGA 3NCPA 4EWTA 4DV2F 4WZQA 5DQGA 3IM9A 2HHQA 1LW2A 2MSTA 2QYCA 4Y6IA 3UD5A 5HBMB 2KVIA 2YQ1A 2LQJA 4KBIA 3TX0A 2DEIA 3UN5A 4X66F 1V3RA 4LBPA 2W8LA 2NXCA 3IWNC 4KT0C 4OYWA 3ZFVA 5AJ3J 4NLRA 5DGBA 2IYIA 3BB5A 5KT3A 1RKIA 2POKA 4ZVTB 3KK1B 3Q24A 4NASA 3ZTRA 4QYRA 1WD6A 5C24A 5J1NA 4JV2A 3C2PA 5KT2A 4DX6A 1YJRA 2KYXA 2NQPA 1YGYA
chains in the Genus database with same CATH topology
1NH8A 3N0VA 1C1BB 4AXJA 2ZITA 2NSCA 3U1LA 4QR2A 5KFPA 2CJQA 1GX5A 4ZPCA 2YNHA 3PKYA 3GIKA 4EZ9A 2LEPA 3VAMA 3GSDA 4C3MA 3HVRA 3CCLS 3T5JA 1FNOA 4ILRA 3BGLA 3TRGA 3PV8A 1SL0A 4K4WA 1FESA 1TAQA 4HT7A 3PM9A 2DCUB 1GX6A 1GT8A 2LCWA 2YKPA 5IZHA 2MGZA 1REVB 2ROPA 1IJEB 2PEHA 4XO0A 3OR2B 4FXWA 1Z2ZA 2B6AB 4NCGB 3OPKA 1JLFB 1UVKA 1HR0F 3MMAB 1S1UB 3MM6A 2C2RA 5IM0A 1X9MA 1N5SA 2KT3A 4OI3A 4RU9A 2PMZD 1GXLA 3HHLB 3LAMA 5KFFA 1CQNA 2IC3B 1NAQA 3OVAA 1UVIA 3V6JA 1QTMA 3FQKA 3OXLA 3DLEB 4YB5A 4AYBD 3JSMA 2D9PA 4IUFA 2UXDF 4EBCA 2CG4A 2RT3A 1HNVB 2YTCA 4PG4A 3DRSA 4IOAQ 4O44A 2YNIB 5IWAF 3I0RB 4GKJF 4NYPA 1YQHA 2VFSA 3ISND 2F40A 3TVZA 2LA6A 2XNQA 3TO8A 3CCVS 1P27B 1YG0A 4TLQA 1DLOB 5KTQA 3AJ1A 1KN6A 2BV3A 1Z4UA 3CIMA 3HHNB 3BDEA 1UKUA 1R43A 2OPQA 4QWBA 4WFBQ 3IWXA 2ZH9A 1M0SA 4N56A 2VFRA 1UETA 1KQGB 2HFZA 2DHGA 1JLEA 2MY7A 4WK3A 3PRBA 3G8SA 3Q23A 4IFVA 2BW2A 2XLIA 1BY9A 3J7Z5 1DQ8A 5EX0A 1FDDA 1MMDA 1OQ3A 4OHZA 3J7ZT 1U1LA 1Y3KA 1KR4A 1RKJA 2U1AA 4LJMA 2EFQA 1JLGA 1FVSA 4WIIA 4OZ5A 5DQIA 1WEZA 4ZPBA 1HPZA 1MWZA 2R8JA 2XMJA 3H20A 3V2UC 2BOPA 2EFNA 1DARA 1ELOA 2DHXA 2JOQA 2W4PA 3DCAA 1RI7A 4YB6A 3RRGA 2FHKA 3DC2A 4MYTA 2GFFA 2YNGB 3CF5Q 4DF4A 2FDNA 3F56A 4OJGA 5K9FA 4ED1A 1FE4A 2E1CA 4EO6A 1R8AA 5A8KB 2WCXA 4NRUA 2HNYB 4N8NA 4NYOA 5ITHA 2V8GA 4QIWD 2DITA 3AH6A 2VV5A 3KJVB 3M6UA 2ZE2B 2RILA 3CTRA 2E7WA 4DL4A 4YOEA 5B09A 2NUHA 1NKBA 1ZM3A 2R7OA 1D0EA 3ICLA 3CCES 4PUOA 4F02A 3AY0A 5EGYA 2DO0A 4DV5F 3K5MA 4HTIA 3DLGA 3RAMA 2J6TA 5D3GB 1QE1A 4YB1P 4Y2KA 2QT7A 2BQRA 4YR2A 1TL1A 4BC7A 1UA1A 4YFUA 1BQMB 3FJ2A 3C6UA 4KKOA 1LK5A 4X4SA 2DNMA 5K14A 3K59A 1ZAXA 2IM1A 4FS2A 1N5QA 2B7BB 2HGMA 1KC8T 2OJ3A 4WKYA 5DG7A 1UVNA 4UUXA 5HROA 4A4JA 2DNRA 3QAEA 4F67A 3Q8SB 2C2EA 3CMAS 4ZCLA 1JNRB 4RW4B 1KFSA 4Q5VA 1T05B 4DR3F 1HWUA 3SCLE 5BYQA 3FSIA 2BANA 3FEYB 4Q0BB 4PQAA 2R4FA 1A7GE 2P6SA 2GMLA 4KPYA 4ZCKA 2YKQA 4F4WA 3OBIA 4WXOA 4ICLB 1E6VA 2CQ3A 3K7RA 2AJQA 4ZP8A 2BE2B 4DL6A 1UA0A 1DQAA 2QSWA 1S4FA 4KC5A 4MAKA 3K0JA 2BBEA 3FFIB 1K1SA 2K3KA 1U2FA 2QV6A 1TFYA 4XDDA 3NMRA 1TKXB 1DFDA 2VASA 3KYLA 3MPYA 3M9MB 1UW4A 2PDAA 2JRSA 2XWXA 3KG0A 1VLYA 4HI1A 4MYUA 1ZPVA 2MQQA 1ZPWX 5L38A 1DTTA 1HBNB 1TP7A 4QPTA 4DL0C 4CH1A 1WI6A 1LWCA 3HKZD 2V5HG 2L9DA 3SMZA 1HBOA 3OFHA 1S1VB 3MMJA 3BSNA 1YTYA 2QA4S 3RZAA 1N34F 1SB6A 2GC8A 1RTDA 4I2PA 2R7RA 2R7TA 2LLZA 3HI9A 2VG7A 2W4CA 1LW2B 3CDAA 2KYZA 1P8GA 1JKHB 2OSRA 3CIZA 2AYMA 2O3DA 3GMGA 5BYSA 1U24A 3MTKA 2A18A 2KJWA 4K59A 3T1AA 4ES3A 2FUG9 4ELUA 3N5FA 5C5JA 3HVTB 3OV7A 5EHHA 2FJAB 4CO3A 4AQYF 5DS7A 3MMCA 4DFKA 3D1QA 4XIUA 4X4VA 2HYIB 4HVZA 1Q4RA 1F5BA 2O66A 3HKWA 5KFAA 2VFUA 4Q44A 2D9OA 3CEDA 4CO1A 3PEHA 2CQ1A 1RTIA 1Y9OA 2ZC4A 2MZTA 2EC0A 4HH0A 5EUHA 1RT4A 4DX8H 1U47A 3CCWA 5DO2A 3EGWB 3M2UB 3VAGA 1RT3B 5JVHQ 2ASJA 1TVRA 2BJDA 3L95X 2P9EA 2P6TA 3D0HE 4CO4A 5J1EB 3KK2A 3PDNA 1GNKA 4C98A 3MMAA 3DU6A 3UPFA 1HYSA 3H5YA 4OL8A 5K8OA 4ED3A 4WJBA 3KLEB 2HG4A 2X1FA 3J7A1 4YUDA 3LP2A 2ROGA 3HHLA 2E1RA 4DS4A 2PI4A 1R8HA 5DDPC 1L3KA 4Y65A 2LXIA 4C7QA 4QOTA 2AYGA 4ILLA 1XR5A 2KI2A 5KG6A 4FF3A 2HWHA 3KMSA 3Q2SC 3Q22A 2FC9A 2MZJA 2KFNA 1DTQB 2JEIA 1HNVA 2Q1LA 2YY3A 4M94A 1TAUA 1JJHA 5J2NB 4D3GA 3BEGB 1XWLA 4JI2F 4F25A 2CKWA 2AWZA 4JUZA 3V81B 4H4MA 2HVZA 2CVEA 1NJYA 2VG5A 4J9KA 2JDJA 1FJ7A 1H3DA 3BGFA 2VBZA 2MB0B 2RDIA 3OL8A 1HMVB 2QSFA 1FKOA 4CQ1A 2ADCA 4BWJA 4C8KA 5HMYA 4P6QA 4IOCQ 3K5OA 2ALZA 2ZD1A 3FRYA 4TYAA 1BD6A 1HWLA 2ZM6F 3SI8A 2F9JA 4CO0A 5E5NA 3T5KA 1YIJS 3AAWB 1PILA 2ZH6A 1VIOA 4DL3A 1HI0P 5E3PA 3BF4A 4NA1A 3CCMS 2OSQA 2K7JA 3MCSA 3OFEA 4BHQA 5C42A 2DNZA 2MHNA 2VB6A 4PXEA 2MJNA 2M88A 1HWKA 4J9SA 3LP0A 4Y34A 1DURA 1JWWA 2M2BA 4LSNA 2PFFB 3RR7A 4UY85 3H5SA 4JV0A 2M70A 4NWBA 3TOQA 5DM7Q 3BSCA 4ETZA 2HHVA 3B78A 2GIRA 4ZP6A 1FDNA 1LXJA 2VPYB 4ZKAA 1ROFA 3OL6A 2CQDA 2MJUA 4LSLA 5MLCV 3MD3A 1N32F 3I4PA 1ZM4A 2EK6A 3DYAB 2AP6A 3UWTA 3ETOA 3MDFA 5GADI 2OD4A 1VC6A 4E98A 3PR4A 1Q1KA 4IFYB 3BDPA 4P7VA 4QQBA 1C0TB 2RS8A 3SEOA 5H1SV 1U1KA 1TL1B 5HI7A 3S1TA 3PACA 3C6UB 4KKOB 3IS9A 4RKUC 4HKQA 3MM9A 3IG1A 4GO5X 3PIPQ 3B8HA 4JI0F 3H5UA 2C3UA 3JSRA 4IG0B 4IRCA 4ZLPA 5KFLA 4LFBF 4DUYF 1KQSR 1IM4A 3MEKA 3CWJA 1CEZA 4ECVA 3DFEA 3MM7B 2MZ1A 3K5NA 3KG1A 4ZPVR 1I94F 1LKZA 2KU7A 3TR5A 3ZZPA 4KV8A 2OMLA 3BZQA 3QJPA 3H4BA 1JXLA 1IKVA 2GNKA 2BQ3A 4DR4F 4C0BA 4PG8A 5FDLB 4F4XA 2DJWA 1WF2A 4ICLA 2V4QA 3I5CA 1FKAF 4CO2A 2HLUA 3DRRB 1N54B 3GFHA 3CD5A 3TUZC 3IRXB 5LMUF 4LF9F 2XMVA 1C0UA 2RF2A 1TKXA 3TA1A 2ZH3A 2R7QA 2XCAA 2KTQA 4RW6B 3KHLA 2RH3A 4NCBA 3MAHA 5HN0A 1S9GA 3MOZA 3OUYA 2JLGA 2B43A 4DBQA 1CVJA 4C8YA 3N6LA 2J0QD 2CZVC 1JLAA 5BR8F 4NYZA 1HI1A 2DNPA 4DEZA 5IQ6A 2WONA 4DQSA 2RRAA 1WEYA 4UW2A 1E6YA 1H6KX 1N5YA 2JC1A 2PA8D 3OW2R 2E9TA 5L8RC 3PR5B 1FO1A 2LEBA 2J7WA 1RTDB 1Q79A 1S79A 1X5SA 3CD0A 4G6VB