4OZ0A

Crystal structure of human caperalpha u2af homology motif (apo-state)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
b'VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 39
publication title Cancer-relevant splicing factor CAPER alpha engages the essential splicing factor SF3b155 in a specific ternary complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oz0A00
2V94A 3MD1A 4Y00A 3CCVS 3UCUP 3UD3P 2LXUA 2U2FA 5JVGQ 2PE8A 3MD3A 3CCJS 1VQ7S 2RQ4A 1X4EA 2CPDA 2LCWA 2YH1A 4A8XA 2RQCA 1ZZFA 2M9KA 4Y0FA 2DGVA 2CQIA 1A7GE 4QPTA 5IQQA 2MZQA 2MKSA 1Q82T 2MZRA 1N8RT 1B7FA 1VQNS 2VOPA 3G9CA 1S79A 1X5SA 2FY1A 1X4FA 2DHGA 1U2FA 2N3OA 1KOHA 1QVFR 2L9WA 4C4WA 3VAHA 2CPJA 4Z2XA 4ZKAA 1H2TZ 2M88A 2MGZB 2KVIA 2NLWA 1N54B 2M2BA 3G71S 1X5PA 2LMIA 2KRBA 3H2VE 1U1QA 2KG0A 2VODA 1U6FA 2ADBA 3UCGA 1OO0B 4C0OC 3H2UB 3CPWR 5GMKa 3J7ZT 1OIAA 2DITA 1WG5A 1WHVA 3IWNC 2KYXA 3CCRS 1FJEB 2M0GB 2MXYA 2KHCA 5LXRA 2N7CA 2MHNA 2U1AA 1K8AT 3SDEB 3VAJA 5DDRC 1YJWS 1WEZA 2E5IA 4U67Q 2DHSA 2FHOB 3CCUS 1D9AA 1KQSR 2CQBA 2MKJA 2SXLA 1U1KA 2AYEA 3VAKA 3VF0B 3V4MA 2RT3A 2J0QD 2NZ4A 1NO8A 1FHTA 4LIRA 2O3DA 1YJ9S 2FPHX 2EK1A 2MJNA 2CPZA 4ERDA 4F25A 2CQHA 3LQVA 3BO4A 1UP1A 4WIIA 3VAGA 2MPUA 1Q86T 2E5JA 4V19X 2KG1A 1FXLA 4F26A 5LXYA 5HL7Q 2MQQA 3B4DA 2CPEA 1M90T 2MQOA 3CCMS 2DH9A 3N9UC 2HGMA 1UFWA 2JVRA 2CQ1A 3S01A 2KI2A 1DZ5A 2YH0A 1R8HA 4M5DB 2GHPA 1WHWA 3BEGB 3LPYA 5DM6Q 2LA4A 2G4BA 4IO9Q 1L3KA 2XNQA 3S8SA 2E44A 1K73T 2RUGA 1OWXA 5FJ4A 1A9NB 2MY8A 1WHXA 5GAHU 1HL6A 2MYFA 2N3LA 1NJIT 5IM0B 1F9FA 3R27A 3TP2A 1X4HA 2DGWA 3IRWP 3PIPQ 1YIJS 1VQKS 2XS2A 2VOOA 2GO9A 2L08A 5LSOA 3VAFA 2CPHA 2DH7A 1DBDA 5BJRA 4ED5A 2I2YA 3BO2A 2HVZA 2DIVA 2DHXA 2X1GA 1R8PA 2F9DA 1XN9A 2OSQA 4YUDA 5IFMA 3NNCA 4WFNQ 5LSLA 4QU7A 1M1KT 2M52A 2ERRA 3EGNA 2JRSA 4CIOA 2FC8A 1U1NA 2K8GA 2ADCA 2X1AA 2D9PA 1URNA 1SJQA 2DNZA 2DHAA 3MDFA 2M4MA 2CQGA 2MZ1A 2DB1A 2DGXA 3US5A 3PIOQ 4QQBA 1X4BA 2DGOA 3K0JA 1D8ZA 1VBZA 2OIHA 3U1LA 2MQPA 2HGNA 4IOCQ 1HD0A 3MI7X 3MURP 4LMZA 4EGLA 1U1MA 1FO1A 5HO4A 2L41A 3UWTA 2KM8C 2G0CA 4CH1A 2MB0B 2XS7A 2JWNA 2A3JA 2RU3A 1YITS 3THTA 1DRZA 2MGZA 5JVHQ 1FJCA 2CQ2A 3MUMP 2DGSA 2KFYA 1N88A 3MUTP 5DDOC 2DIUA 3G8SA 2KM8B 4F02A 1W2BR 2FC9A 1VQ8S 2CPXA 3NS5A 4P6QA 1H2UX 3CTRA 3CF5Q 2EK6A 5H1SV 4UY8T 1FJ7A 3I55S 4RU2A 3BS9A 3MXHP 1VC6A 3CCLS 2AYBA 2DISA 1FT8A 1VQ4S 2J0SD 3R1HA 1X0FA 1WF0A 1BY9A 2AYMA 3SDEA 1SJ3P 2N82B 3DLLQ 1JJ4A 1U1RA 2MY7A 5D78A 2X1BA 3CCES 3HHNB 2JX2A 2J8AA 3Q2TC 4QU6A 3CCQS 3CCSS 4UQTA 1YJNS 1WEXA 3MUVP 3I56S 1M5PC 2MKCA 4WF9Q 2Q79A 5GAEU 3NNAA 1WG4A 4OZ0A 1FNXH 4YOEA 4PKDB 1K9MT 2XNRA 4BS2A 1Q7YT 5GADU 2CQ3A 3THPA 4WKRA 4OZ1A 2DGQA 1VBYA 2DGTA 2KRRA 2QA4S 2MZTA 2LQ5A 2EVZA 3RW6A 1KC8T 2AD9A 1SJRA 5CA5A 1X4CA 3G8TA 2DNMA 1H6KX 3HI9A 2MJUA 3S6EA 4W90B 5EN1A 3UE2A 3VAMA 1CVJA 3ULHA 2KU7A 2WBRA 1VQMS 2JVOA 2XB2D 1ZZNA 2F9JA 2MQNA 2M8DB 3CXCR 3CD6S 2CQDA 2PEHA 3P5TL 4TU9A 2M70A 2AYGA 1M5OC 2RS2A 3B4MA 1DHMA 2DNYA 2ZJQQ 2OSRA 3SXLA 1HA1A 1S72S 2LKZA 2MZJA 5GAGU 2RVJA 1O0PA 1X4GA 5CYJA 2MKIA 3G4SS 2KH9A 1RK8A 3L3CA 3ZZZA 1WELA 2RNEA 1QM9A 2ZJRQ 5IM0A 2QFJA 3UD4P 2CPIA 1VBXA 1WHYA 2CQPA 1WG1A 2XSFA 2DNQA 1X5OA 2RRBA 3NMRA 5LJ5Y 2DNOA 2DNPA 2MMYA 3R1LA 3JB9k 2B0GA 1VQ9S 4WCEQ 4TU7A 4IUFA 2YKAA 4WFBQ 2DNLA 4TLQA 2DNNA 5DETA 2MKKA 3J7YU 1P1TA 4FXVA 1AUDA 1WF2A 2CQCA 1X4AA 3ZZYA 5LJ3Y 1SJFA 1VQLS 1HD1A 1ZH5A 2CQ4A 2MSTA 5DDQC 4TU8A 2DO4A 2VONA 1M5VC 2KXFA 2MQMA 2DNGA 3U1MA 5DDPC 1VQPS 1VQOS 3P6YC 2MKHA 1P27B 1YWXA 3S7RA 2E5GA 1X4DA 3FEXB 1NU4A 3EX7B 3CC2S 1SXLA 2DNKA 5MLCV 1U1LA 1WTBA 3DXBA 1WI8A 3SMZA 1KD1T 2E5HA 1JJ2R 2KXNB 2D9OA 3EGZA 4YB1P 1N52B 1VQ6S 1M5KC 3CC4S 2OTJS 1RKJA 2G1DA 1PO6A 1Q81T 3P3DA 2BOPA 1WEYA 5D77A 3OW2R 1IQTA 2DO0A 2LXIA 2MSSA 2MZSA 3NS6A 2LA6A 2DH8A 1YHQS 1UAWA 1VC0A 1WF1A 4CQ1A 4C7QA 2DGUA 2QEXS 4W92B 3G96A 2D3OR 5GVQA 2OTLS 2KXHA 3CMES 3Q2SC 2OJ3A 2DNRA 1UW4A 2MQLA 1YI2S 5DM7Q 2CPFA 2M8HA 1JMTA 3CUNA 1WWHA 2M7SA 3BO3A 2CJKA 2HYIB 4LJMA 2I38A 1U6BA 1WI6A 3CMAS 4CH0S 1VQ5S 2ZJPQ 1SJ4P 3D2WA 2CQ0A 2YTCA 3MOJB 1OPIA 3TO8A 2DK2A 3FEYB 4PR6A 3UCZP 1U1OA 3P49B 1YTYA 3RW7A 1JJHA 3G6ES 1U1PA 1H2VZ 2F3JA 2KT5A 2HZCA 3VALA 3CC7S 1X5TA 2RS8A 4WFAQ 2LEBA 2LECA 2RRAA 1QVGR 4IOAQ 3CULA 5CXTA 3NNHA 4FXWA 2LYVA 5ITHA 2HGLA 1KOOA 2BZ2A 2UP1A 2X1FA 1G2EA 1PGZA 2J76E 2YWKA 2KN4A 2CPYA 2DNHA 2K3KA 4J5OA 2LEAA 1VC5A 4PRFA 3TYTA 2XS5A 3VAIA
chains in the Genus database with same CATH superfamily
1S0OA 3UCUP 3UD3P 5JVGQ 2C3MA 2BW2A 4BWMA 5H9FJ 1A7GE 2WOMA 1U8SA 4IDKA 3SYZA 1Q82T 1C0TA 4K4TA 3KHRA 4J91A 2BQ3A 5D3GB 4B3RF 5K5MA 3LPEA 2JSXA 2CPJA 1TFYA 4X2BA 5JMNA 3DDNA 1JIHA 4XAKA 3UCGA 1OO0B 4DZ6A 4DI6A 3CSKA 2WRMA 2KYXA 1OS5A 2VQEJ 1Y10A 5KFVA 4L76A 1R8CA 2BBEA 2QA2A 4CLLA 5CD4A 3M6XA 3W65A 2L9DA 1W26A 1NJWA 1IBCB 4F2RA 3V4MA 1F9HA 1T0TV 2EK1A 4ZP7A 5C5JA 2Z2YB 4IKAA 4F25A 1K1QA 1K47A 1RWUA 4HH0A 4J9PA 1FXLA 1T8EA 1T9YA 2XBPA 1J2VA 4M8LA 3LPYA 3GILA 4LFCF 4K4XA 3NLCA 3ILJA 2F1FA 3RAMA 4TNOA 1SV5B 1RWMB 2O01C 1SUQB 1IR0A 3C2PA 3OXFA 2CZVC 4DL4A 1S7IA 4YP3A 3PO4A 2UUCJ 3I5BA 5IM0B 3OTOJ 4IG3A 5EHHA 3MCMA 4EWTA 4CT8A 2AKWB 2PFDA 1M1KT 1OY9A 3EGNA 3U7JA 1JLQB 2BJDA 2ADCA 2A18A 2MZ1A 2WONA 4NLOA 3THVA 4B9MA 1MU2B 3LO3A 3TX8A 3GCXP 2DEJA 3HCXA 4QR2A 5D3GA 1NDCA 3CW2C 3KHGA 4C9DA 2GIQA 1KRPA 2DGSA 3TOQA 3EICA 4OHVA 5HVHA 2Z8QA 2O66A 2UUAF 1T3NA 2HHTA 4J9NA 2UXDF 4LF1A 2JL9A 2F5GA 3BBFA 3V2UC 4FF2A 1F60B 1BQMB 2FZCB 4L75A 2AYMA 3RBEA 5D78A 2IMOA 4UOCA 3PX4A 1AXQA 4WJBA 1M5PC 3I56S 1NK5A 3LW5C 3N79A 3SCLE 1FNXH 4FS2A 2IYIA 2ZH9A 1FK9B 3W9HA 4OYZA 2LQ5A 4DX8H 3EVOA 2DNMA 2ILZA 1HI8A 3UE2A 3OFHA 3GR0A 4K4YA 2KU7A 4GC7A 1CC8A 1SV5A 2M8DB 3N0VA 4LF4J 1CJVB 5KT5A 1FERA 3FMWA 3MMBA 5GAGU 1FA0A 3DLGB 1UVNA 2RNEA 3T1HF 2BUNA 5IM0A 4DV1F 3I9ZA 3UD4P 3IXQA 3HMJG 4I1TA 3MEEB 3O3LA 3HFVA 1FJGJ 3A12A 1HR0F 2E5LF 1F3VA 2YNFB 3V81B 4DR3F 4I2PB 2VONA 3BGLA 1MU2A 1X4DA 4LF5F 3KMSA 4EI2A 2H9ZA 1PO6A 3LGNA 3QIDA 3AXKA 4PUOB 1NHUA 4IFVB 2OJ3A 3UDEA 1LWFA 4C3KA 6AT1B 3CCWA 3EM1A 4R0EA 1FF2A 4M5GA 2FIUA 4XTTA 4ZPBA 4DQSA 5J1EB 1BQMA 1ZA1B 2QZ8A 1N56A 3ZTRA 4B3RJ 3AH6A 4X4RA 2CYYA 2E7XA 2KT5A 3MMCB 2RS8A 4JB8B 2VV5A 4Q8EA 3KG1A 4PRFA 5J1PA 4EBCA 3R5BA 1TKDA 3GSIA 3KLVA 1FK9A 1RCOB 2POKA 3MD1A 2LXUA 3PDNA 3I5CA 3ILIA 2KZZA 2ALYB 1YJUA 2CNNB 5DG8A 1UZHA 4FVCA 1NXIA 2CNKB 3H2LA 2MTLA 2OLWA 1UPMB 2Y0BB 2N3OA 2QO3A 2KZMA 2M88A 2KVIA 3JS9A 3NGKA 3G71S 3MFHA 3L95X 3DLGA 2F4VF 2B6AB 3TRGA 2HQ3A 3MEEA 1R0BG 4DN0A 4J9SA 4DUTA 2W2PP 1KLNA 4LFCJ 5ETPA 5IT9Y 1NHVA 5LMNF 5C25A 4FF3A 2JZ5A 3V81A 3N5BA 1QAYA 4I2PA 4I56A 2NZ4A 4KY3A 2HK2A 5IT9U 1X31C 1ZM3A 3WBZA 4MK8A 2HHHF 3SV4A 2NR0A 4H4KA 2YH0A 2JC0A 4EU0A 1WHWA 2LU2A 3BJYA 1F2GA 2C42A 2WW4A 2AZ3A 2ZWPA 3ZZUA 4ZITA 1GXUA 5J1EA 2AP6A 3IFEA 2MYFA 1J5EF 4EZ6A 1RWNB 5B0EA 1HARA 1MWQA 2FJAB 3MMCA 2NPIA 2KL8A 1DQ9A 5LSOA 3HVRA 1LWCB 3ADAC 3KHLA 3M8ZA 2R42A 2K7JA 5HN0A 3NCPA 2CA9A 1S1VB 3BH7B 1XN9A 4YUDA 4QW9A 2DT9A 2DVIA 4DSJA 1R8BA 2UUAJ 3RTVA 3MAAA 4HHHA 1EZZB 1RSCA 4ZS6A 1URNA 2GGPB 2UXDJ 4U7CA 2B9YA 1KSPA 1X4BA 3TR5A 1IXKA 4FF1A 2HGNA 5KAKA 4M5KA 1FO1A 3QRRA 2RU3A 1BQNB 2WVDA 3ZTSA 1ZAVA 5GADI 4CLZA 2UU9F 2VBXA 1FXRA 2DR6A 4K4VA 4X66F 1NDPA 2QN6B 3EPGA 1BLUA 5C42B 1LWEB 2HIQA 2CPXA 4RR5A 2XY6A 2NUHA 1OYDA 2B9EA 4WPAA 3K5PA 1SC6A 2I5JB 3NAIA 2DRDA 1B0TA 1LK5A 4QW8A 4NLDA 1IKWB 5HVGA 1WF0A 3P8BB 3DLLQ 2QFIA 1NEEA 3D0HE 5E2QA 1NK0A 3F44A 3MUVP 2AJ1A 2JJ4D 1HWLA 5GAEU 4RZRA 2NXCA 1JLBB 3IA0A 3T1HJ 4ANDA 4WKRA 5H9EK 4DV1J 1RLDA 1HHTP 3W66A 3GJTB 3CDUA 2AD9A 4U9RA 2DR5A 1ZAXA 4DJBA 4W90B 2E5LJ 2OHDA 2AX0A 1FVSA 2QYCA 4DR3J 2CWXA 3BREA 1VIOA 1SC3B 2ZDPA 4DV3F 3MM9B 2X3DA 3K57A 3MM8B 3N5FA 2VDIA 4DL3A 3PKYA 2OMLA 2W24A 3KLFB 1BWEA 2KH9A 3DMJA 4LF5J 1WTFA 4ZIVA 2DY9A 4FKXA 4ES2A 1LWCA 4FVMA 2PC6A 4OYMA 4PG4A 1S1VA 3R1LA 2IBKA 1RBLA 2OO4A 4C8NA 4DOZA 2GGPA 2P9CA 5E3QA 1ZH5A 1TKZA 3UDVA 3V6KA 2IC3A 1M5VC 5KG7A 2HVDA 4OV6A 3R5DA 1WKLA 1L3TA 1YWXA 3G6XA 4ES1A 2E5GA 3CC2S 1VHFA 3M8WA 2C2DA 3HDSA 1BQNA 3IGNA 4ED6A 1FNOA 3ZTPA 2HVIA 3JXOA 1V5IB 2BOPA 2MZSA 3DRSB 3IWLA 2CXEA 1LWEA 1WF1A 2VA3A 4W92B 5E3PA 4V1Ak 5AXMA 1WOOA 2GJFA 2V50A 3Q8PB 3FNNA 3NGTA 3CD5A 2HYIB 3Q24A 4ID5A 1IKWA 1VBKA 1QD1A 1UL3A 1PSDA 3NXZA 3UCZP 4CO0A 1TL1B 3HO1A 4FYWB 8ATCB 2HGLA 4TN2A 1JLCB 3JQMA 1JLBA 1CJKB 2F4VJ 1Y00A 4ZPTR 3DLKB 4FKYA 4B9VA 3UVJB 3LP0B 4I6AA 1LEOA 4U95A 2PMWA 2P5VA 4FNHA 2AEFA 2GV1A 3HP6A 4CLUA 2VOPA 3G9CA 4IRCA 2IM3A 4NLGA 1U2FA 3IP0A 3S1TA 3GJSB 1QVFR 3MM9A 4QIVA 2XO7A 3JTNA 4CTAB 2M2BA 3BR9A 2BRLA 5K14B 4ZP8A 1NJYA 2G13A 2H4YB 2BJEA 2HHHJ 2RDDA 2P8IA 2D3O1 3W1YC 3OL9A 3M9NB 3KLGB 1N5SA 1T02A 3BYRA 1L3UA 2VFSA 2E5IA 3A3NB 2ASLA 1D9AA 1TK5A 1QAXA 3GIRA 2JHEA 3NS7B 4CM0A 1YJ9S 3OR2B 2FPHX 1J5EJ 1TAQA 3LQVA 4ZVOB 4WP8A 4DSFA 5L8RC 2HWIA 3IBCB 2ZH4A 3Q23A 4ECWA 4NYPA 5ETQA 2NXNA 4BC7A 2VG7B 3R5JB 2CQ1A 2FDNA 4Q45A 1PKUA 3DRSA 4RUHA 5B7WA 1JJCB 3SSSA 1OY8A 1K73T 3BBBA 4WU3A 1A9NB 1F3FA 4ILLA 4ZVFA 1GXLA 4EZ9A 2VFTA 1OSCA 3C46A 3X1LB 3GG1A 4O3PA 4M5HA 5EWGA 2GQCA 1NJIT 1TL1A 2UU9J 3QNWB 2L08A 1NKBA 3BF4A 4X66J 4N47A 4F4ZA 3DN9A 2ZH2A 2V34A 4L6V3 1CJKA 3NNCA 1SBRA 2LU1A 2JRSA 4DF4A 3OXGA 2X1AA 2M4MA 3UVJA 3GJQB 4USTA 2CJ9A 4ANCA 4A46A 4CM2A 4DR4F 4NCGB 4G1IA 4RL1A 2ZNZA 1JLFB 2YX4A 3MI7X 4IOCQ 2ZDOA 1H7WA 2EWHA 3I6PA 1HBNB 4LSNA 4OZJA 3OVBA 1TL7B 5KFNA 4CTAA 1SC1B 2W2OP 2OFHX 3WDOA 4Q7AA 5K14A 3CIZA 3IC1A 1JX4A 2Z56B 3R97A 1SH0A 4KRWA 1WORA 2A0FB 4ENOA 1VQ4S 3NBPA 3R1HA 3BPDA 5D0RA 2Q6CA 3CD0A 4DV3J 4C2MA 5HROB 1TKXA 1BUXA 1HBMB 1RT3A 3K59A 3LOUA 3ILOA 4UOFA 2WK4A 1XR5A 4HI1A 3IR5B 5IT0A 2HFNA 3BN7A 3M8SA 2KRRA 2QA4S 3PEHA 2XHWA 1H6KX 2RJZA 3DLHA 1RT2B 4OZNA 3HHLB 1YQHA 4MTPA 1AW0A 1D8YA 5DZ6A 5L9NA 4RKUC 3AJ1A 3SBMA 2AYGA 4BC9A 4ECUA 3SXLA 3SSQA 4CT9A 4EK2A 3PHEA 5KOWA 5B0FA 4A8FA 2CJXB 3ZZZA 4DFKA 1YGYA 3VVTA 5F8MA 2G2YA 2JC1A 1WG1A 2XSFA 2DNQA 2RRBA 4G1PA 2C3PA 3FMBA 4I67A 4LRBA 4TU7A 1S1TA 1CLFA 3EZ5A 4HT5A 1SJFA 2MSTA 4TU8A 4Q8FA 2OMOA 1VQOS 1UFKA 1XNQF 5AE2A 1B0PA 4P2FA 1JLFA 3DU6A 3W8GA 5J2QA 1T7PA 2D9OA 1TL7A 2DCUB 4C3LA 3QJJA 4K0KF 4NMXA 4CCHA 1T95A 3P3DA 1UVIA 2HNYB 1HWUA 1EP4A 4CQ1A 2AJ2A 1EAYC 2HMIB 2V2QA 2LDYA 3M7VA 2HLUA 4IRDA 1N36F 5DLGA 4GO7X 1TELA 2V9KA 5C24A 3FEYB 3GPAA 5HROA 2W7OA 3GR1A 2HZCA 2RRAA 1HBMA 1IKXB 2NREA 4JI8F 2BZ2A 5DZ7A 2X1FA 1PGZA 3I5AA 3DHXA 3GFHA 4KV8B 4RUBA 2XCAA 1YJNS 2FVPA 4ZP9A 1M0SA 3IS9B 1WDDA 4DL7A 5B0CA 2W9BA 1IUJA 4MKYA 2C2KB 2DGVA 2MKSA 3HHLA 2MZRA 3PW7A 1UEVA 5HQLA 1S79A 1X5SA 1U0HA 1FRIA 2LVWA 2KFZA 1UVMA 2O67A 1IWAA 1H2TZ 4O4GB 3CJRA 3MM6B 3MECA 2LMIA 1YG0A 1R6YA 1AROP 4NPOA 4L3NA 4C0OC 3LP2B 4ZVHA 5KFDA 2BANA 1D0EA 1RTDA 4IOBA 4ECXA 3PO5A 2V2VA 4RWXA 3VGUA 4C0BA 2U1AA 3MGJA 1I5OB 2H1YA 2DHSA 1AZSB 5KFRA 4NX9A 2CIMA 2SXLA 3MWBA 2J0QD 1RHUB 2YWHA 1TL3B 2CPZA 3DFEA 4A47A 1UP1A 5I42A 1HNIA 4V19X 2A6MA 1HFEL 2MQQA 4JYAF 2ROPA 4UF4A 2PSZA 2XYHB 5A0YB 3BKUA 1UFWA 5KG4A 3S01A 5HI7A 2V9WA 2OEJA 1JLGA 2YNGB 1VRUA 2HMIA 3A3PB 3WZ0A 1OWXA 4YEAA 1Y3JA 4DR4J 2RKIB 4K4SA 4FYXB 3IR6B 1RTIB 5A6PA 2KT2A 1H74A 3RB4A 1WOPA 2DGWA 1KQGB 1GTHA 3W9IA 4KV8A 1P9YA 2DHXA 2F63A 1DTQB 1KVIA 4WFNQ 2J0XA 3N6LA 3IS9A 1SPBP 4Q43A 1TV6B 2GVDB 3JSRA 4ECZA 4YR0A 4HR2A 2VKZG 1SC4B 4USIA 1VS3A 1D8ZA 1X0PA 3PRVA 3OJSA 4LMZA 1U1MA 3UWTA 1HNXF 4QWAA 3MM6A 4KR0B 2N4CA 3KG0A 3G8SA 1N4LA 4DV0J 3DLEB 3B54A 2ZOFA 2ZH1A 2HS0A 2R7TA 1JNZB 1AB8A 2ZKTA 4O4RA 1KONA 4DQIA 2AYBA 4KGXB 3PVXA 1FT8A 3M4XA 4F36A 3KLHB 4ZN3A 1PAEX 2YPYA 3GIKA 2NYIA 2ZWOA 3R2DJ 4X65F 2BM1A 1TL3A 2I1RA 3NWGA 2XYGB 2IMWP 1GTEA 3UD5A 4NXMF 3HHLD 5A0YA 3F41A 3RBXA 3OSPA 4B3SF 4DV7F 3N6NA 4CWBA 3IGVA 4OYOA 2JVOA 4NLSA 3CJ8A 4W98A 2F9JA 2RH3A 2BRKA 3P5TL 1XNQJ 2RKIA 1RTIA 1O0PA 5CYJA 4P2SA 2IA0A 1RK8A 3EZUA 1G7CB 2JH3A 1WHYA 4K0KJ 1RYSA 4I6YA 4YB7A 1NK7A 3F0NA 1DLOB 5LJ5Y 1U25A 1N0VC 1DTQA 2E29A 5KT3A 2YKAA 3Q8SB 6FDRA 1LFPA 1N48A 2MKKA 1FRHA 1TV6A 1HNZF 1AUDA 4PPZA 3OQ2A 2YWGA 1N36J 2QT7A 5DDPC 2EG1A 5BXIA 4ECTA 4ZLLA 2DTJA 3EX7B 1SXLA 1U26A 2KXNB 4JI8J 1S1XB 2EFVA 4OLPA 4A8YA 2VFRA 5D77A 2B3TB 2IVYA 3AJ2A 4X84A 3NS6A 3TVKA 4M5LA 4LF7F 1T9UA 4NA3A 3PKMA 2XZTB 5EWFA 1VQ5S 1LKZA 3GB0A 1SJ4P 3KLHA 1I1GA 2W01A 3NGUA 3DLBA 3CDWA 4NLPA 1U1PA 1H2VZ 1HWKA 5ITHA 3BYPA 4ETXA 3UN3A 3ITHB 1VC5A 3IG1B 1Q4RA 2HURA 2XMMA 2GFFA 1RHMB 2R7OA 4X4PA 4ALZA 3G87A 2PEBA 5E41A 1RP5A 2RQCA 1S0NA 4LRCA 3OL6A 4WZQA 2ROGA 1J27A 2AJQA 3BSNA 1N6QB 1ZAWA 1PJ5A 2HRYA 4ZVGA 3VAHA 1TFWA 2VPZB 3T6BA 4N77A 1Y0HA 4GC6A 1BXNA 2GMJA 2MQ8A 4PG6A 1NKEA 2Z58B 3JTPA 2DITA 1AYEA 1DLOA 3CCRS 4URQU 5DGAA 3F56A 2DJWA 1KQSR 2K3IA 4WE1A 4X4VA 1SL2A 1S1UB 5JXSA 1EX8A 3I0SA 1Q86T 4X62F 2E9TA 4P2MA 3BPSP 2MQOA 3H42A 4EBDA 1S1XA 3BB5A 3N9UC 4DCJB 5J2MB 2YVSA 1TQLA 3KDOA 1MN9A 2XG8A 4I4BA 3B6BA 1P8GA 1ROFA 3M8YA 2KJWA 4CRJA 3UN5A 4CO5A 2JEJA 3I31A 1HNXJ 1CSJA 1RT7A 4UT4A 1YIJS 2KKHA 3TVYA 4M5IA 3IG1A 2OSQA 1OY6A 2M52A 4EO6A 3TX0A 3CE8A 2CDRB 1X60A 1SJQA 2HFZA 1Z2LA 1Y3KA 2CG4A 4J9RA 4DPYA 3US5A 2AZ1A 2BEFA 4QOTA 1BGXT 4NLUA 3B8HA 4YR2A 4X65J 4OI2A 1R3NA 1SVDA 3MR7A 1B0VA 2DIUA 4ZK7M 4YMEA 4NXMJ 1XC9A 5H1SV 3O2IA 5EWEA 1QUPA 2LXFA 4RW8A 4B3SJ 4OIXA 1FX2A 4DV7J 3RZAA 4X4OA 1YRTA 4S0MA 1FFGB 3EZOA 4N5SA 3HLUA 4EFAC 1SKRA 2BJ7A 2IA6A 2J8AA 4QU6A 3QT5A 3CCSS 4UQTA 5CCMA 4LR7A 3WC2A 1YVFA 4NZ6A 2FZKB 1S7HA 4FPIA 1RBAA 1FVQA 3DRRA 2G0JA 4ED1A 5J2MA 2YQ1A 3FKBA 2OPPA 1HNZJ 1CJTB 3RBZA 1MNEA 4C8LA 4TU9A 1YSJA 3IWXA 3G4SS 1O8BA 3C15B 2EBGA 2NZCA 4EMDA 4NI2B 4RWWA 3QZ8A 1MN7A 4USJC 1RU2A 4LF7J 1HBUB 4CO4A 1LW0B 2XGQA 3RG6A 1NPRA 3HVTB 2YNHB 2CZ4A 4NCBA 4MIAA 4A8WA 5KFOA 2AHOB 2RAQA 4H4KC 2XZDB 5A8WB 4PXBA 4Y65A 4ELUA 4HEA9 2YBVA 4RLEA 4PEOA 1N52B 3CJTA 4L72B 2N7YA 2EFPA 4P72A 4J9KA 1OQ3A 2LXIA 4L3KA 1VC0A 2CJYB 3JQJA 3G96A 1REVB 1PC5A 2AGOA 1YI2S 2B4UA 4CYUA 1WWHA 4QJVA 3CD7A 3G6YA 3BO3A 1JLEB 3GJRB 2V4QA 1RTZA 3M2VA 3Q86A 2CADA 5KFGA 3NEKA 3CIMA 1IM6A 4DPXA 3QATA 2F3JA 1R0AB 2GQQA 4I7FB 1M5SA 1W7WA 5GMKa 2XS5A 5F0WA 4F3OA 4KFBB 2XI2A 1NB2A 4UY85 3AHPA 2VICA 2WZ1A 1U0SA 3H98A 5HMXA 5HLFB 3DI6A 4TKTA 4F0HA 1AFJA 1CJTA 2DXEA 2N4DA 3FDSA 1VQNS 2V2ZA 4FXDA 5THWA 2J6TA 5A2QY 4C4WA 1T9TA 4TY8A 2O5DA 1U47A 4Z2XA 1K1SA 4LR9A 2I0XA 4JP8A 4KGMA 4LF9F 4DU8A 2B5JB 2NSCA 2XM3A 4NI2A 2DEIA 3PYEA 2VFVA 5GMEA 1OIAA 5A2QU 4XDDA 2OEKA 2QSWA 2XC9A 3CJ4A 3TZZA 1R0CB 1LW0A 2EFNA 2RU9A 2YY3A 4P7TA 3OTCA 1J5OB 3HVTA 3VAJA 2YNHA 3PY8A 1OYEA 2R9LA 2HBRB 3W5XA 4RO0A 5IV4A 3DM2B 2V8PA 2QRRA 3VF0B 1NO8A 1VI7A 4DPTA 1O6XA 4B3MF 2MJNA 1DTTB 5K20B 5A8WA 3BO4A 4N7TA 1Q8KA 3D6HB 2E5JA 3CGIA 4OJ1A 4LFAF 2GVZB 1IM4A 2M5YA 1XTZA 3ET6B 2DH9A 1FTCA 3WX8A 3L4BC 4A8MP 2JVRA 2Z2ZA 2E9RX 1K44A 1DZ5A 3VVUA 1REVA 3CB4A 4Z7CA 2F8HA 4U7UD 2W2QP 2RDIA 2EPIA 3MHYA 2XS2A 2A1BA 3MM5A 2WBMA 2MLXA 3PFEA 5AE3A 4I7FA 4DPWA 4HHJA 4KYZA 3MEGA 3BO2A 4N41A 3GYNA 3PJWA 2KTQA 2VU5A 1QSSA 4PYAA 2UVVA 3FJ2A 5HLFA 3CT9A 4HLBA 3AD8C 1T03B 4K5SA 4D3HA 2DGOA 3KK1B 4NMLA 4JI1F 4OLOA 2XWYA 4EGLA 1QY7A 2W4DA 3NOGA 4OHZA 4RNNA 2UXCF 1F2HA 2NPFA 4P52A 5E5NA 1N88A 1GEHA 4ZJQA 2WVCA 2XEXA 1TUVA 4USHA 1S10A 4QIWD 2B5JA 2B8PA 3M30B 3NCQA 2HZVA 1ACMB 1JWWA 1X0FA 2BE2B 3PRDA 1BY9A 2UUBF 4JI2F 3BZQA 1MMLA 3FFIA 2BJ8A 4JI5F 2V4RA 3DM2A 1EETB 1BHNA 2RQMA 3RYLA 4YS2A 1DTTA 2PDAA 4OQJA 4USVA 4DQRA 4P71A 4ZP6A 7FDRA 2VG6B 1I3OB 4J9VA 2DGTA 1BMQB 3J7Z5 1SJRA 3EMTA 3JSYA 5CCLA 1X4CA 2VFUA 3HI9A 1S77D 4KT0C 3NG8A 5KFAA 1SQGA 2LP4A 3BR8A 3LALA 3QFWA 3K7RA 1QSYA 2CFXA 4OYIA 3OTDA 3ZTQA 2C3YA 2DNYA 3PG9A 2HQIA 3G86A 4DFMA 4ECRA 1W25A 4OZ5A 4C0HA 4CH7A 4QZVB 2CQPA 5F8JA 4K5RA 1X5OA 3R6GB 2ATLA 1D3WA 1RADB 1TZ0A 5DETA 1P1TA 2XMUA 4FXVA 1S9EB 3KLEB 4LR8A 1T03A 4TYAA 4FBUA 3IO1A 3KK1A 2XZWA 1QJHA 5IT4A 3TUIC 1A6LA 1FE4A 3L09A 5HSPA 3LAKA 2KVQE 3RB0A 4X4UA 2C2EA 4B3OB 3MPYA 1U4BA 3W61A 4OYXA 1GNKA 1U24A 3M30A 2M7SA 2VASA 3SZ2A 2EW9A 5M2UA 2PMHA 4M5MA 4QWBA 3OLAA 2BE2A 1C4CA 4R25A 5HK4A 2VQEF 3GQCA 3RW7A 3G6ES 4UTGA 1EETA 1FX4A 4FXWA 1IJEB 4AD6A 2FQQB 3R5CA 2V8GA 2VG6A 4LF9J 2V94A 5C2CA 2HHXA 3MD3A 1S6PA 3RB3A 1X4EA 4K8RA 3KHHA 3T1AA 1XQIA 3T5KA 3V6DA 2ZH8A 2MZQA 4ZCLA 4F3MA 4Q44A 3ENQA 4UQGA 3UR3C 1RHRB 1N54B 5BYSA 1HW8A 1PAUB 2ACMA 3J7AN 4P2XA 1Q7LB 4F0MA 1N5QA 2J7WA 4ED4A 1CULB 4LFAJ 2R8GA 1WSRA 1YJRA 3H2UB 4LUBA 2C1EB 1QAJA 2UVWA 3KUGA 1F9EB 2BJ9A 1TVRB 4PQUA 3H8YA 1KLMA 1IKVA 4QBUA 1AFIA 1S9EA 3KLEA 4U67Q 4OYBA 1R31A 5KFFA 4RW9A 2WSCC 1U09A 1NZ8A 1UVLA 1MWYA 1V3SA 1WKKA 2AEMA 3NRBA 3B4DA 2QTWA 2CPEA 5KFZA 1F0XA 5ADZA 3V4IA 2Y1JA 3SCIE 2AWZA 1AUSL 3KJQB 1TL4A 3K2YA 4M5DB 3ISZA 4B9LA 5LOQA 4DX7A 3W62A 2BV3A 1U48A 3OFFA 4XO0A 5I3QA 4JI1J 2K7KA 3T19A 2UXCJ 1HI1A 2DRBA 1AA1B 1F9FA 1ZM2A 3TP2A 1X4HA 5LMUF 2HVHA 1KEKA 2W2MP 1DBDA 2D1CA 2QLWA 2DIVA 3K5NA 1WOSA 4A8SA 2QA4G 2FZGB 2OGUA 5FDLB 4NWBA 1JXVA 2IVMA 5IWAF 4C8ZA 2YQ0A 3MR3A 2K8GA 2IJNA 1HD0A 2AMCB 4JI2J 3K8VA 2XS7A 1HWJA 4JI5J 4EYIB 4LBHA 4C3MA 3MUMP 1ZTWA 4YHHF 4NLXA 1DAXA 1XR7A 1CULA 2AV5A 4J90A 1EB0A 1H2UX 2NXEA 1RT5B 2DR8A 1RWOB 3UDLA 3BS9A 1VC6A 3H5YA 2LQ9A 3LP1B 1OJ4A 3BV8A 3HJVA 1TVRA 1XBWA 2OD4A 1SJ3P 1FKPB 1UA0A 2VD3A 3ZNUA 4NLYA 1GXTA 1HQEB 5EDWA 1BQXA 3MTJA 4KO0A 3GV5B 4HVZA 3BN4A 1NK4A 5EGYA 4YOEA 3PCOB 2GJ2A 5GADU 3EGVA 4WBFA 5DJBA 3H90A 4FN5A 2DGQA 5EX3A 4XDCA 4KJIA 5L46A 1IBLF 1FWLA 3D3CJ 3CEDA 3Q8VA 3DDIA 2MJUA 4G6VB 4QYZK 3ULHA 2JOQA 5K8NA 2OEMA 3BSCA 4JI4F 4JI0F 1R89A 3KWMA 4LFBF 4B9SA 3R5AA 4NLWA 2QLFB 2R8IA 1IKYA 2OSRA 5IC4B 3SEOA 2OAUA 2J5AA 3W2VB 2CZ9A 3L3CA 3ENWA 2OPRB 4N8NA 1JXLA 3PR5B 1Y11A 4OI0A 3J80Y 2GX8A 3LANA 1TP7A 5FDLA 4IUFA 1T9VA 3QT8A 2IPOB 2R4FA 2M3DA 2DHHA 2L9NA 2EKYA 3VR1A 3MZIA 2CQCA 4TVAB 3VGVA 3W5ZA 3TQEA 4NRUA 1VDHA 4X4QA 3W63A 2KXFA 1VQPS 5E0OA 3FEXB 4I0WA 2BA9A 3HFKA 1WTBA 4LSZB 4N8OA 4ILMA 1B70B 1CJUB 1VQ6S 3CC4S 2W8LA 4OMFG 1B99A 2QC3A 1IQTA 4H54A 4YB5A 1UAWA 2VH7A 1RT5A 1YJVA 4LQ3A 3MR2A 1XNRF 2CAJA 3T9ZA 4MK7A 1RAAB 4WWSA 2HFOA 3KK2B 1GFWB 1DURA 1RT4B 4JI3J 3CMAS 4PXEA 1ZBTA 2CQ0A 3LWMA 2YTCA 3BGOP 2R7SA 1OPIA 3UDCA 1FKPA 1VCTA 2PT0A 4ZHRB 1QAIA 5KFSA 2B4OA 1HQEA 1QVGR 4WFXA 2FJXA 3M8QA 2LYVA 4HI2A 4LRFA 1LW2B 3T5JA 2ZBCA 2GO8A 3NGRA 1EIYB 3PW0A 1IQZA 5KT4A 5D4NA 1RTHB 1N33F 2R2TA 3JAMY 2YH1A 5CD4H 2O1PA 3DOLA 4F04B 2HNZA 2V6AA 4ECQA 4CO2A 4JV1A 3TUZC 4CO1A 4GVBB 2X3GA 1UCNA 2XMWA 3DHWC 2RHSB 4YFUA 4ZVTB 4X64F 8RUCA 3W2VA 3IMQJ 2GS8A 3C19A 2OPRA 3C66A 2ASDA 5F8GA 2VKRA 5G0RB 4XPCA 4WP9A 2M0GB 4WXOA 4DR7F 4FNIA 4HT7A 1LFWA 2PGCA 4P10A 4J9UE 4I64A 5JUMA 5GAHI 2Z4PA 4O3RA 2CQBA 3D0GE 2OUGA 1U1KA 3HF5A 2HHWA 1Q53A 3TQ1A 5IV3A 1FCAA 4WP3A 3DGPB 1E6VB 5LMUJ 5KT2A 1CJUA 2XMVA 3C3LA 4F7VA 2WSFC 2LA4A 5IWAJ 2HQGA 3ZFVA 3POTB 3KJVB 2DYAA 2RUGA 1WC5A 3L7UA 3KK2A 4EBEA 1EKRA 3FRZA 4URGA 2XHCA 3OD2A 5D0HA 4KC5A 2VBZA 3TJ8A 7AT1B 3LUYA 2K1RB 4CZCA 3GFXA 5KOXA 2XMJA 2GMHA 3QBCA 2AF6A 5E3AA 4YHHJ 4TXSA 3CCTA 3HSJA 5CHCB 1SUQA 1LW2A 1M1HA 2GHWA 3EXYA 5B0BA 3E2EA 2YQ3A 5ETLA 3M6VA 2ERRA 4KGZB 4CIOA 1RTHA 4PWWA 2DHAA 3H59A 2VC1A 4DSLA 3K0JA 3QRQA 2D69A 5DLFA 4GVBA 1QLNA 5ETSA 2HLTA 3FCHA 3D1QA 1RAOA 1RU1A 1YITS 4HACB 1JLQA 1Z2ZA 2JFDA 3H5UA 4WFZA 1GQEA 4EO8A 2V67A 3MEDB 1X9SA 4ED3A 2GJIA 3MM7B 1UJ5A 1IBLJ 4FYDA 2ASJA 2VBWA 3PW4A 3JYTB 4WZMA 4JI4J 4ECVA 4JI0J 3DXSX 1NRKA 2YX7A 4LFBJ 2I8EA 3W64A 2DR7A 1CBKA 4PPDA 1PIEA 1S97A 3SFUA 2B56A 3UNYA 3QAUA 1YJTA 4OYAA 2ZBPA 1K9MT 1B7YB 2VA2A 1DY3A 3DGPA 1EARA 1H72C 1E6VA 2RSQA 3TZYA 3ZZPA 3EDRB 4DR6F 2NXUA 2E9ZA 3PW2A 1HNWF 3IRXB 1C0UB 2W9AA 1FTRA 1S1WB 1DFDA 3MPDA 3POTA 3KJVA 5HVFA 1GMUA 2HFSA 8AT1B 3IM9A 3QFHA 4AQYF 1DARA 3J81Y 5IOLA 1Y4ZB 3AXMA 1X4GA 3AAWB 2MKIA 2PO4A 2K1RA 4D3GA 2CG8A 4O3NA 3FQKA 5B08A 3O1LA 5BYQA 1KTQA 4OI3A 4IQMA 2FHJA 4ZVPB 2C2NA 3NOCA 3J81U 1WNEA 1CJVA 4WFBQ 2ZBIA 1XNRJ 1VQLS 2UVRA 5FLXY 3AD7C 2MQMA 3BKFA 1KVJA 3BGRB 4ZJOA 4BHQA 4DV2F 1IBKF 4DR1F 2B7BB 1JJ2R 1PYOB 3CDEA 1UJ6A 2CDQA 2YNFA 4KTQA 2WAQD 3EYZA 3OW2R 3VZIA 3I4HX 1KNZA 3PYDA 3ZC4A 4RBTA 2JDJA 2QEXS 5HMZA 3EPIA 2BDPA 1N33J 5F8IA 4IR9A 2ZVIA 1SI9A 2FJEB 3HJFA 2R2UA 3H7HB 1TK8A 1JQGA 1RHJB 3D2WA 3CJ5A 4F2SA 2DK2A 1RLCL 4PUOA 3GIJA 3VALA 2ZBQA 4NLQA 4IFVA 1H98A 1O5JA 1KOOA 1G2EA 4X64J 2MDAA 4Q2MA 4LBPA 4Y00A 4ER8A 4DR7J 2OELA 1UETA 4YY3F 5I3UB 3IRXA 1C0UA 1S1WA 2E1RA 4ZPCA 2ZZMA 2OH2A 2COLA 3U02A 3BSAA 1KOHA 3UI3A 2WVFA 1IR1A 2IAJB 4K4UA 3OHAA 4ITSA 2XTJP 1R27B 3BQ1A 3CJQA 5F0UA 2C2RA 2Y9HA 2YPZA 1UVKA 1S48A 3HPOA 2ZUAA 3H20A 3HVWA 3IN5A 1N34F 5K8PA 3X3UA 4H4OB 1VR6A 5KFYA 4A48A 2PFFB 1GAOA 1K8AT 3SDEB 1RDRA 4UW2A 2B6AA 1YRXA 1FESA 2XWXA 3D9BA 4L73A 2V8VA 4IH7A 2E1AA 2F7VA 3BGRA 3BSOA 4PZVA 3AJDA 3BQ2A 1G4CA 3MPUB 2HFUA 4ANEA 3D1HA 3M8RA 2KI2A 4O23A 1TMJA 1VRTB 3N6MA 2G1HA 2MY8A 2HHSA 2GZOA 1SJ1A 5CH7B 4AFFA 4NCAA 1NAQA 3WX4A 2RHQB 2FHJD 1V6HA 4HYKA 1VQKS 3QWUA 3R8YA 5IS2A 3LTOA 4A8OA 2DH7A 4Y28C 1URRA 4WK3A 2X1GA 2B4VA 2R2RA 5CABA 5IXUA 1SKUB 1H7XA 1VK8A 5L38A 5HMWA 1U1NA 3VCDA 3OL7A 2DB1A 4F8RA 2FLNA 5I3UA 2VJVA 2OIHA 1S57A 3SSRA 4AL6A 2G0CA 5H9EJ 1B3TA 3M8PB 4J9OA 3NGDA 4GO5X 1LWXA 1U49A 3OT9A 5A8RB 5KFBA 2MLYA 1C2PA 2ZHOA 3M2RB 3R7BB 4LF2A 2RF2B 2H5EA 5J2NB 4JOUA 5ETTA 4DR6J 1RACB 3NWRA 4UY8T 2RDJA 1ZM4A 5L1JA 3SI8A 1HNWJ 3GYGA 4DU7A 2LQ8A 3MCOA 3I9V9 3SDEA 4R8UB 2BKPA 3KTQA 5C42A 1KVKA 4AQYJ 2BR0A 3PRBA 1WEXA 2YKNB 1GMWA 2Q79A 2DXFA 1KKHA 2YKPA 5CYMB 2I5JA 3MAHA 3Q8UA 3FGVA 2CJBA 1RKIA 2PIIA 2R7UA 2A2DA 1N32J 1SL1A 1HKAA 1VRTA 5B0AA 2QX0A 1MROB 1X8DA 1RA7A 2CNLB 4MKAA 4IFYB 2V8HA 3B4MA 2WCXA 2FY8A 2MLZA 3M6WA 4NLRA 2H51B 4DV2J 1IBKJ 4DR1J 1NZAA 3W60A 1RYRA 3KNAA 3JSBA 1H73A 1TMMA 4NLVA 1KQKA 4NRTA 1PCAA 1VQ9S 2B0GA 4DG1B 3K58A 2E7WA 3MM8A 2PD1A 3TA2A 3KLFA 1C1CB 3H5XA 4DL2A 1X4AA 3OFEA 2FB0A 2IM0A 3RU0A 5KFLA 3J81j 3IAS9 2DNKA 2VPXB 1EJ7L 3DXBA 1WI8A 2OPSB 2HNDB 2HQFA 5AJ3F 2CRLA 2LQJA 5A8RA 5KT7A 2MKYA 2NSBA 3M2RA 4DCOB 3TWZA 2RF2A 2KXHA 2IIHA 2MQLA 9ATCB 4DLGA 2ZOGA 2FLLA 1JKHB 3CUNA 1U2CA 1R8AA 4P9SA 4YY3J 3TEHB 3K89A 3EUNA 1P6TA 1IJFB 4QIEA 1YTYA 3UQSA 4MIWA 4A8KA 1X5TA 2ZZNA 2YKNA 4WFAQ 2WOMB 4AUKA 5HQ8A 5CYMA 4Z37A 2KN4A 2D74B 1S49A 1H0HB 1QUVA 4RJVA 1O51A 3CCVS 2U2FA 3CCJS 3CDAA 1NK9A 4RNHA 1N34J 1T94A 5EX0A 2MEWA 4QPTA 4Q2LA 3SCJE 1JLCA 5KG0A 1MROA 1G6BA 1MSWD 3OTBA 2Y8YA 5L1IA 2FVCA 2V2KA 3LGMA 3PFOA 4IFYA 3DLKA 2FD2A 4ZKAA 2WB4A 2MGZB 2VQFF 2AT1B 3T1YF 3QSYB 3LP0A 2KRBA 4I2QB 1UFLA 1NPKA 1CG2A 3A1YG 1REGX 2ZC3A 5ETKA 4AT1B 3J7ZT 2D7SA 1F5BA 3ZZRA 4DG1A 4DX6A 1WACA 5LXRA 2HRTA 1C1CA 3P96A 1NJZA 5FD1A 1GMWD 3D4JA 1WEZA 2VPWB 4R0JA 5SUHA 1S6QB 1D09B 2NQPA 3VAKA 2NUUG 5H9FK 4DR5J 4PXDA 2RMLA 4Y34A 2YKMB 2MPUA 2ZH6A 1VQYA 5HL7Q 2VUGA 1N5TA 2HNDA 1F5CA 3KLGA 2HBQB 2HGMA 4GKJF 3I0RB 2GHPA 5DM6Q 2VBYA 5KFKA 3OR2A 2G4BA 1T9XA 2DY1A 4KAIA 2XNQA 3S8SA 4IG3B 3H4BA 3SFGA 4UOGA 2BQUA 2RD5C 3HD1A 3K5LA 4DV0F 5KFMA 2VG7A 2G9OA 3TZWA 2HHUA 4E2FB 2N3LA 2IYGA 2XMTA 1XMBA 2ACYA 4TY9A 1OQ6A 4DZDA 3ILLA 1PJ7A 2WONB 2AU0A 1VHIA 2VL1A 4ED5A 5CYQB 4C48A 1FRJA 7FD1A 5ETOA 5LSLA 1PC4A 1VQSA 2YWFA 1I6JA 1RAGB 3G2XA 2DGXA 3OSNA 4JV0A 5DQGA 4PAAA 3MURP 3Q8YA 1TL5A 3Q8RB 5HO4A 2L41A 5J1NA 4DEZA 2MB0B 2JWNA 5T7LB 1V9OA 2VF3A 1PJ6A 4ZA1A 2B51A 4OZLA 3HHKA 1DRZA 2MGZA 4DL6A 1UW9A 4BLGA 2C3UA 3M1VB 3OTEA 1UA1A 4NA2A 4I2QA 2BACA 4NCGA 3FBBA 2KM8B 1EKSA 2V63A 2XY7A 4HTIA 1Y9OA 3FC9A 2WB1D 4RU2A 1HBNA 1T3OA 3D6MB 3TUPA 3CCLS 5EUHA 3VV2B 2GA7A 3LAMA 4C11B 3DRPB 2IDEA 1RAHB 2UUTA 1S6QA 4NXNF 4V19J 2QA1A 1SB6A 4R5PB 4FDFA 4MAKA 6FD1A 1UEUA 3PX6A 4WTYA 4DWIA 2YKMA 4DQQA 2YKOA 3LWLA 5F8LA 1HWIA 4PWDB 3CWJA 1M1GA 4CLWA 3MMBB 3UN2A 1VYAA 1S6OA 3I0RA 3PYGA 1S76D 4DXLA 1PBUA 1KDNA 1S0VA 4DPUA 2EFOA 4RPFA 4QPXA 3RR7A 1SKWA 3HHDA 2FUG9 2DCLA 4PG5A 1NSKL 2BMBA 1TK0A 2HHVA 1RT2A 2ZJRQ 1U6ZA 5AJ3J 2NS1B 4ZCIA 4DF8A 4KGKA 1YRUA 2H65B 5CYQA 2DNPA 4Y2AA 3A8IA 1S4EA 3A8EA 3CJ2A 2YNIB 3NKYA 3KYLA 5HBMB 2CUYA 2LLZA 1FNMA 2IM1A 4FYVB 2UV8G 3MPVA 1RJJA 2BKOA 2J9DE 3GONA 1LWFB 5T7LA 2ZC4A 3E3XA 4DL5A 2Q1LA 1KS2A 1CQMA 4YB1P 4QIGA 3EE3A 1OSDA 3M1VA 3H4DA 4W4MA 4KBIA 1NHKL 2M8HA 1IR2A 1XK8A 2CJKA 4X4TA 1YBAA 3QT7A 4BBYA 1G3OA 2HNYA 4C11A 3DRPA 4U8YA 2BJ3A 1Y5IB 3P49B 4RW4B 4ZOSA 5BYRA 2VQFJ 4R5PA 3VGTA 1FRMA 3T1YJ 1FRLA 2EKNA 1YDLA 2AIRB 1T9WA 1ZA2B 4PWDA 3DOKB 3I96A 2LCWA 3C8YA 1GX5A 4CLKA 2XULA 1IKXA 4F4AA 4IYQA 2ROEA 1B7FA 1Q79A 1Q8IA 2DHGA 2VIHA 3CCZA 5GMDA 1JXEA 3Q0AA 2KFNA 4QR1A 1I94J 2ILYA 5C25B 4YDXA 3I4PA 5HANA 1XIQA 4QIFA 3VWSA 4C97A 4LSLB 2Y0SD 3QGGA 3O44A 4PWUA 5D8HB 3ELHA 2HIYA 2HAIA 5KFQA 4GKJJ 5ETVA 1WG5A 1UMJA 3IWNC 1RCXB 3NP5A 2MXYA 4O4GA 2C22A 2R8HA 2N7CA 3V5RA 1UWAA 1NK8A 2H3EB 2YNIA 3LP2A 4U7UK 5HBMA 1Q5YA 4CO3A 4AYBD 2HPUA 4WIIA 2GW8A 4M94A 4KHRA 1NSAA 3D6TB 1AZSA 2R7XA 1RXOB 4OX9F 2WSEC 3DC2A 3DGVA 4YR3A 1KBRA 1NNDA 1Y5NB 3ZXWA 4KHMA 4QR0A 3L7OA 2E1CA 1Y5LB 3LGHA 4E0DA 3N28A 3MAAB 2YNGA 1Q95G 3FCVA 2J9DA 4O3QA 5F41A 4MT1A 4FYYB 4RW4A 2C28A 3UFCX 2HHPA 4JUZA 2E7VA 4Y2IA 5LT5A 2VZ9A 2YKQA 3L9ZA 1KN6A 1N0UA 4DLEA 1MLAA 2DD8S 2F9DA 5LM7E 3D1OA 2W7PA 3DOKA 1U45A 1LXJA 2FC8A 4CLYA 4A4JA 3MDFA 1ZPVA 5IZHA 3BQ0A 2BW7A 1Z4UA 5HATA 2JFKA 1TU0B 3TAMB 2A3JA 4NXNJ 1UTAA 3W9JA 3PR4A 2GVDA 3NAHA 3LH2S 4ZPAA 3MMAB 4K50A 2H5IB 2AJFE 4ZVUB 4LSLA 2GMLA 1JLAB 4U8VA 4F02A 2BOAA 4OJGA 3TANA 4DQPA 3NGSA 4ECYA 3T5HA 3MXHP 2F8MA 1SCJB 4KH1B 4U6PA 1X9MA 2N82B 2MY7A 3SCKE 3PHTA 3DLEA 3OJUA 2B43A 2VHGA 1ZM9A 2H54B 2QMXA 1MMNA 2XNRA 1Q7YT 4OZ1A 4OI1A 4I68A 5D4LA 3MCSA 1KC8T 5CA5A 3ENVA 3J7YI 4U96A 3DMJB 2IVFB 2XB2D 2HG4A 3CXCR 3CD6S 2B4PA 4FBTA 1YZ6A 4C98A 1HA1A 1S72S 5A6WA 1HHSA 1JK9B 2HEKA 1ITPA 2LDIA 4TQSA 1TKZB 1QM9A 2QFJA 4PCQA 2CJAA 2IC3B 2HKEA 4RW6B 3PEJA 4KSEB 3C6UB 4DS5A 2WW8A 4MKBA 4DCPB 3PW5A 2C2MB 4F3QA 2GNKA 1RHKB 3U27A 2KDOA 5K9FA 3OHBA 1TTHB 5F3TA 1P27B 1WDTA 2ZITA 3TAMA 5MLCV 2VDHA 3G6VA 3PJXA 1NCLA 4USUA 4PQAA 4KIAA 2ZHAA 4ID5B 2HHQA 2G1DA 2RQKA 4MIBA 3MMAA 4OX7A 4DFPA 1ULRA 2LA6A 2EXUA 1CC7A 5AXLA 2X51A 1JLAA 3KG4A 2D3OR 3QWPA 4ZLJA 1UW4A 5DM7Q 1JMTA 4EUVA 3DNCA 2AQ4A 4LJMA 1U6BA 4DBQA 2Q66A 2EFGA 4G3IA 1HR0J 3U1NA 2LEBA 3HVAA 3AY0A 3Q8QB 4Y2MA 3H5SA 2ZE2B 2KHDA 3OBIA 3H25A 2FHKA 2RQ4A 4B9NA 1S0MA 4RNMA 2FVRA 3BGUA 3D68A 3ITHA 3ZZTA 4NOHA 1U2RA 3RUBL 5BR8F 1HI0P 1FXDA 3CNQP 1WC1A 2DBBA 2JLEA 4L74A 3Q22A 4WXWA 3UW1A 3KK3B 1RZMA 1VJWA 2KG0A 2V5HG 3DU5A 3KJNB 2VODA 2ZBRA 3R5GA 1VIXA 3HKZD 3ETMA 1GX6A 1N6QA 4RW6A 1HIYA 4OX9J 1V5VA 3C6UA 5KFIA 5K8MA 4CLTA 1SQFA 2FJWA 2KT3A 2AYEA 2RT3A 3T9NA 1FE0A 3QGHA 3IR7B 3QSIA 1PYTA 2CQHA 1QSLA 4B3TF 5LXYA 4AL7A 3QJLA 4H4MB 2YX1A 5KT6A 2J8SA 5K8OA 1YBUA 1VRQC 4M95A 4UZBA 1S1UA 2E44A 3GIMA 4Q0BB 2IM2A 1FDBA 1L3SA 3EDQB 1NKCA 3RAXA 5CQGA 4RBVA 4DN9A 1FFWB 1HL6A 3ZTOA 2OP5A 5KFPA 2Q43A 2FLPA 1VMBA 4M1KA 2HBZB 1Q0NA 2W9CB 4ZPVR 3IRWP 2AGPA 3NCRA 1E6YB 2GIFA 4IH5A 5LMNJ 2ZE2A 5BJRA 1W2IA 4ZVRB 4MKVA 2D41A 1R8PA 1NJXA 2W7AA 1RAJA 4LSNB 5CAAA 2H48B 4WYWA 4MH8A 3LA0A 1ELOA 4DHVA 4QQBA 1FWKA 1WKJA 3WIVA 2XLIA 3AD9C 4KGVB 3QMQA 5SZTA 4UUXA 2JEIA 2DPJA 4DMZA 3KK3A 3NBPB 2JEFA 3CMQA 4LREA 1W2BR 4QWCA 4WU2A 4LF8F 1TKXB 2QJ3A 1U7LA 1ZYQA 2QG9B 1RT3B 1NUEA 3DLJA 4EYHB 3TEGA 2FLOA 3A13A 2J0SD 2DXDA 5KFCA 2B7CB 1BD6A 1H3DA 5GAGI 1SIWB 2BX6A 1LOUA 3P45B 3PYFA 2XCPA 2D3UA 4CP5A 4PKDB 4KHPF 3QPIA 2CQ3A 3THPA 4LT6A 4H4MA 3OR1B 3T3FA 5T41A 3VGSA 3S6EA 3KXDA 2NXJA 3VAMA 1NDKA 3AB2B 3DCAA 5D6GA 5F8NA 2BABA 2HW3A 3CJKB 1XWLA 2L3MA 3A3OB 4Q0BA 5JJBA 2CQDA 2K06A 3AFGA 2ZJQQ 4RBUA 2LKZA 1S1TB 1RWVB 3FEZA 2JNJA 2W9CA 3ONQA 2W2NP 1E6YA 2OPQB 2P6SA 3NMRA 4YDDB 1U8WA 2DNOA 4RNFA 4WCEQ 2JLGA 1NLKL 1XEZA 4TLQA 4OYPA 5J2QB 4GKKF 2AJ0A 4HTJA 3EWGA 4IG0B 4B02A 3C15A 2W4PA 4RW7B 1EP4B 5HMYA 3S7RA 1RT1B 2J9CA 1U1LA 1HBUA 2IDLA 5E7OB 1PG5B 1KD1T 1KTVA 3G82B 4DV6F 3OV7A 2OTJS 5KFUA 2XO6A 1RKJA 4DSKA 4DR2F 1ZETA 5C24B 1Q5VA 1BC6A 4C7QA 5KTQA 2ZH5A 3WIUA 3A8JA 4ED7A 3TA0A 2XMKA 3K5MA 1R6VA 3UNGC 3RBDA 2XYPB 4LF6F 5DO2A 2W9BB 5BR8J 1U1OA 4KE5A 3CC7S 2K2PA 3GLJA 3JTOA 3NNHA 3HX9A 2CPYA 3O8WA 2Z0GA 2EG2A 3HZGA 3TAQA 1U0HB 1JLEA 3KFWX 3M6UA 3OR1A 1S9GB 3O6QA 1YBTA 4F4KA 3MECB 1ZZFA 4OHXA 2J7KA 5B09A 1R0AA 4F50A 1GMVA 1NMEB 1N8RT 4OYWA 3MFIA 3GE9A 3CJKA 2BANB 2F8EX 1RUSA 4C8MA 1RTDB 4C8KA 3D66A 4KFBA 1RT6B 2FVSA 1S4FA 5LL6d 2J0WA 4NZ0A 4B3TJ 3W3SA 5MAOA 2F40A 4UZCA 5F9LA 4TYBA 4C6AA 4OHWA 2OPQA 3F73A 2BXJA 3M9MB 2GAHC 1YKWA 4USMA 2Y3YA 5I3PA 4USKA 1WHVA 2IRXA 5I42B 1HNIB 2KHCA 2VJUA 1SIZA 4PYDA 4DV4F 4IG0A 2AGQA 4ETZA 4WYLA 1YJWS 3HSGA 2BE9B 3CCUS 3TI0A 4RW7A 2OKQA 2MKJA 2KYZA 1RAFB 2CVEA 1JLGB 1SKSA 4ED2A 4LIRA 4ZLNA 1VRUB 1RT1A 3NY0A 2Z57B 3C14B 3R6LB 4CI0B 2HQDA 2KG1A 2QLBB 2BE7D 2ZEJA 3G82A 1J5OA 3CCMS 2UZAA 1RAEB 3QZ7A 1WD6A 3QRPA 4C8OA 4ES3A 3K17A 4ID8A 1K0VA 3KUEA 1VJQA 2Z2LA 3HFZB 1DQAA 3TNVA 5FJ4A 4OV1A 1D1UA 1RB0A 5D4OA 3OVAA 4F0KA 4CNZA 2GVZA 4ZVSB 3ET6A 4RUCA 4J7CA 5GAHU 1N5YB 1HBOB 4BWJA 2AJ4A 3KLIB 5KFHA 2C3OA 2FJVA 3PIPQ 4WIQA 3SQGB 4NL5A 4MYTA 3VAFA 2VB6A 1LK7A 4Y6IA 5IFMA 1XMQF 2KJVA 4LF8J 1NH7A 4QU7A 1PBAA 4DFJA 1KQFB 1S9GA 4YB6A 3HSZA 1RQ0A 3PIOQ 1A0OB 2MQPA 2PA8D 1C4AA 5GAEI 2W25A 3R9LA 1GT8A 5C2GA 1RT6A 5HJXA 1ZPWX 2KFYA 3JSMB 3MPWA 4KHPJ 3IAM9 3WHIA 1FDNA 3AQOA 3BDEA 1HQ2A 4ELVA 4MFBB 4O0NA 3W2WB 3R7NB 1OPZA 1Q8BA 2KB2A 1L5UA 5AE1A 4XK8C 2Q6BA 2DISA 1U1RA 1WC4A 2X1BA 3LF0A 3HHNB 4JI7F 3MCNA 2Y1IA 1B4SA 3AA8A 4J37A 1UPPA 4WF9Q 2YXLA 3GCWP 2LFVA 3C14A 2PMZD 3HM9A 3P5BP 5A8KB 3CO0P 1VGYA 1S99A 1DJ0A 2V69A 2QE5A 5KG6A 3FSXA 4ZCKA 4PXCA 5HAOA 2HFVA 1CVJA 4FP9A 4M5JA 2OFGX 1VQMS 4GKKJ 3TA1A 4XPEA 1ZZNA 2OI2A 2ZUGA 3PTWA 3L7PA 4FS1A 2RS2A 2MZJA 4NEZA 1N5YA 2RVJA 1HBOA 1TUWA 3TZXA 3KLIA 3D0IE 2EC0A 3ISND 3CVKA 2WVBA 4BDPA 4JI3F 4DV6J 4P75A 3SQGA 4KQZA 4IR1A 4DR2J 4DV5F 2GHVC 1IN0A 2DNLA 2DNNA 4TQRA 4KH0B 1FEEA 2CQ4A 2NYHA 1YK9A 4LF6J 2V0NA 5D15A 2R7RA 1NU4A 2ZNYA 3FBFA 3AOBA 3FUYA 3ICLA 1RISA 2XLKA 3HT0A 3EGZA 4O3SA 3M2UB 4ZJLA 1Q81T 3JSMA 3I82A 5D0EA 4KPYA 2G0IA 1YHQS 5IC6B 2V68A 4WFYA 4MFBA 4KB7A 2PI4A 3W2WA 3HZEA 4HDGA 3Q89A 1R7IA 5KFTA 2I38A 1WI6A 2DPIA 4CH0S 3EVMA 3AT1B 4F4XA 4PABA 4N76A 1U02A 4B3OA 2IRYA 3NL0A 1UEKA 1EQ0A 4IOAQ 5CXTA 1VLOA 4LVOP 3W8PA 4WTOB 3QT6A 4OI6A 2FVQA 4RUAA 2XMAA 3GV7B 2EI5A 5A8KA 2RIJA 1S12A 2FJDB 3GTYX 1F5AA 4A8XA 2BJ1A 1VLYA 1RWPB 2FTRA 5DG7A 4AE5A 4DV4J 4Q5VA 1TKTB 5J2PB 2BYCA 2VG5B 3WQPA 4F4YA 2L9WA 1MWZA 3E01B 4JBCA 5DRKA 2FYXA 2PI5A 4K4WA 2HS3A 1U1QA 1HPZB 1VOMA 1U6FA 1CS4B 2C2ZB 3CJSA 4WE1B 1WSVA 4OX6A 3I0SB 1YZ7A 2HQCA 2MHNA 1RHQB 5KFWA 2R3VA 2FHOB 3OUYB 2AX1A 4J9QA 3RB6A 4ERDA 1NK6A 3FCWA 5L1LA 3FRYA 3FSIA 1F6TA 1LNQA 4X4SA 3M2UA 2FGCA 5A76A 3R3TA 2ZM6F 2IJRA 1KR4A 1XMQJ 3BEGB 2JEGA 1RT7B 2HZAA 1S6UA 1YX2A 3IBFB 3N01A 3HHLC 2UUWA 4CDIA 1TAUA 1P9QC 1SQEA 4O0IA 2RRNA 4HL9A 3T6JA 2ZFHA 2Q3PA 2P9GA 4HHUA 4ILRA 4P7VA 4M5DA 3HT3A 2QL5B 1SL0A 3R27A 5KFJA 3D6FB 2GO9A 3FZ2A 4ED8A 2ZH3A 4K7QA 2HSEB 5KG2A 3HHEA 1RBOB 4OFZA 2ZKUA 2DNZA 4NEYA 4YN3B 2WVEA 2CQGA 4G1QB 1FI4A 2UV8A 4UOHA 4JYAJ 2PA3A 4ICLB 3VHQA 1TKTA 1RABB 5J2PA 4RX6A 2KM8C 4JI7J 2VG5A 4RW8B 3H40A 3FVYA 2YWWA 3GSDA 4HH1A 4XIUA 4DPOA 3E01A 5AXKA 3C6TB 3R2CJ 5RUBA 4QYZJ 1HPZA 3J80U 1VQ8S 5E3CA 1CS4A 3NS5A 3OL8A 1ZS6A 3SQOP 2GC8A 2G2ZA 3BBCA 4A8QA 4FPRA 2R2SA 2IY5B 2QIFA 2GAGC 4M5NA 2Z30B 3O5TB 3RR8A 3RRGA 1UWBB 3QGIA 1HMVB 1JB0C 3DRRB 3PX0A 2A6OA 4K2XA 3OUYA 2OPPB 1GK8A 1Q78A 4OL8A 3LP1A 4FZVA 2QMWA 2Z2MA 1VBYA 2Y1LB 1ZTTA 4DV5J 3PACA 2JLFA 3QAEA 2H5JB 2RB7A 2NCKL 2WBRA 2FJBB 1KFDA 3R7SB 1VK3A 3P4UB 2MQNA 4GRSA 4WK1A 2M70A 3QQCD 2QMUB 1WC3A 1QE1B 1HHQA 3CJ3A 1PILA 4IQXA 2J7UA 4K59A 3GG0A 2I6WA 4ECSA 4ZIWA 4LVNP 2MMYA 3KUHA 1R43A 1ZOTA 3JAMU 1FWPA 2UVUA 2J9EA 2G2OA 5KG1A 2R8KA 1YJ7A 2BVZA 5DDQC 2DO4A 4G1QA 5T14A 3U1MA 2DNGA 3P6YC 4NE9C 3GMGA 2R7WA 4ICLA 2RILA 1M5HA 4CNYA 2C2OB 4CYUB 2AW0A 2RUSA 2CVIA 3HULA 2ZHBA 1RA6A 3C6TA 2CKWA 3M2VB 4DS4A 2DGUA 3M32B 3CMES 3NMAA 3EVWA 2CNOB 2DNRA 2QLJB 4LQ9A 4UUWA 1APSA 4WKYA 2ZH7A 2QGFB 4EEYA 1TUGB 4P73A 2ZJPQ 1UWBA 3M9OB 9RUBA 1HMVA 2Y1RI 3TO8A 2HVEA 1FD8A 2FHMA 3DI6B 4CLSA 3BGFA 1C1BB 2HK3A 3FK4A 2GCFA 2BM0A 1FDAA 1IBMF 2YWKA 1T05B 3D28A 1RT4A 3VAIA 4JI6F 1NSPA 5HP1B 4TY8B 4GVLA 2PE8A 4ZLPA 1Q16B 5U47A 4NASA 4ZHRA 4BCAA 2M9KA 4Y0FA 2HRUA 2CQIA 2YWEA 4OX8A 4LRAA 4DSIA 1K0TA 2FY1A 4IO1A 1X4FA 5DQHA 5I4MA 5DGBA 1VFJA 1MW7A 4I6WA 1X9WA 2NLWA 1QE1A 1V3ZA 2UXBF 4Y2KA 3AB4B 4QYRA 1XR6A 2WHOA 4PG7A 2ZM6J 3CPWR 1UZDA 1FJEB 1RWXB 5D0GA 2XY5A 4B9UA 1RE1B 5FIIA 1VISA 3D7SB 3MMJA 3QGPA 4URSA 1I51B 2R7VA 4O44B 5KFXA 4NYOA 4O3OA 1UJ4A 3CO9A 1FHTA 2O3DA 5G0RA 3T5LA 1UKUA 4ZPDA 1FDDA 2QV6A 2APOA 5ETRA 1CPZA 1KHVA 4OHYA 3AODA 1D9DA 1V3RA 4ZVEA 1QTNB 1X7VA 2X7IA 3OXLA 3QYYA 4IO9Q 3M32A 1JNRB 3MM5B 5KG3A 2DRAA 4DL0C 4OZ3A 1RWKB 3MEGB 4ATNA 1HNVB 1QDUB 1BE4A 1WC6A 1IWGA 2E66A 3W5YA 2WTFA 3V6HA 3DOMB 3MTKA 5M2PA 3RAQA 5E33A 4YQWA 1C1BA 2VOOA 4NA1A 3AA9A 3FBCA 4C8YA 1NDLA 4HKQA 1T05A 1KWMA 1NM2A 1IVZA 3KNGA 1XMOF 5HP1A 1UVJA 5DQIA 5AXNA 4K2JA 4X62J 2ABYA 2LQBA 3HSDA 3UO0A 4RNOA 4IRKA 4DUYF 2VC0A 1HYSB 1P1LA 4JV2A 4CH1A 4QWEA 3VQSA 2V8DA 4IH6A 1N32F 3EXCX 3RJMB 3GFYA 4MK9A 1FRKA 1FJCA 3TVZA 5M2RA 3QLHB 3MUTP 5DDOC 4E8UA 3FFIB 1WUUA 3CTRA 3KKFA 2ZOMA 3B78A 1NSQA 1DQ8A 3K5OA 2A2CA 5CZXA 2ASYA 3G8QA 2PN6A 3PNIA 4HACA 3ENAA 5FLXU 2J6SA 3DRXA 3FBEA 1RI7A 3MEDA 2JX2A 2QLXA 3A8KA 3MM7A 4O44A 3ZNJ1 3SV3A 4OZ2A 2MKCA 3JYTA 1WG4A 2HWTA 4QCLA 4BS2A 2R7QA 1KFSA 4TLRA 2MZTA 2EVZA 3DYAB 3UR0A 2IRUA 3CJ0A 3D67A 3G8TA 4LRDA 1MMDA 2EBEA 2QSFA 2L48A 1TR0A 4AXJA 2CWKA 3CDBA 4DSEA 1HNVA 1M5OC 3V6JA 1DHMA 4JV5F 4K4ZA 2F65A 5ETMA 3DOMA 4B17A 4I69A 2DR9A 1RTJB 3E8OA 3KJFB 2P9EA 3ETOA 2RE1A 5E3RA 4MJKA 2DKOB 2IHR1 5IQ6A 5DS7A 4ZVQB 3Q83A 5LJ3Y 1CEZA 5F9NA 3GWCA 4Y3CA 2LEPA 2OD6A 1CQNA 2KO1A 2XI3A 1HYSA 1LXNA 1Y7PA 2B9XA 2ATCB 2EC2A 1WC0A 2W1BA 2FGOA 3SMZA 1T11A 2E5HA 3B82A 3TARA 1M5KC 1IBMJ 3QLHA 4KKOB 2DH8A 4JI6J 4DUZF 3MF5A 5F3ZA 2ALZA 5GVQA 2OTLS 5F8HA 3KOAA 2BKNA 3C16B 2CPFA 4AL5A 1ICEB 1S6PB 1NB7A 4PR6A 1G1XA 1JJHA 3BDPA 4NYZA 3EJMA 3MEKA 3CULA 3V6DB 2UXBJ 2UP1A 3AQPA 3T41A 2J76E 4J9MA 2LEAA 3TYTA 3VQTA 4DR5F 3DYAA 3TAPA 5C7PA 1VQ7S 3PM9A 2CPDA 3MR5A 3BH6B 3ZO7A 3K8WA 2CJQA 4FF4A 2HS4A 5IQQA 3I87A 3MOZA 2H4WB 2QL7B 1FRXA 3QO9B 2HAFA 3HD2A 3D54A 2IJFA 1KHWA 2QL9B 1AT1B 1X5PA 2IFXA 4PQUB 1KLMB 3H2VE 1IKVB 1FD2A 4ZDNA 4B9TA 2ADBA 3HKWA 4RW9B 1RTJA 2MHEA 4RU9A 2IAJA 4ZCMA 3V4IB 5DDRC 1F1BB 3PXGa 3D5MA 4P74A 3H0PA 1FKAF 3ZZ0A 5KFEA 5B0GA 3GP9A 5D4PA 1OMSA 1Q8LA 3VAGA 4H4OA 1RWWB 4F26A 1RGVA 1Q1KA 4B08A 1M90T 1NPPA 5HQMA 2ZZTA 2XSJB 2B8QA 1R8HA 4KKOA 3TW0A 1XMOJ 5DG9A 1L3KA 4J9LA 3N4WA 5L9XA 3C16A 3PV8A 1EQMA 1D9FA 2Y8WA 1WHXA 3MR6A 1S59A 1H38A 4DUYJ 1L3VA 4X4NA 4ZN1A 3PZPA 3RGIA 5KG5A 5ETNA 2EEYA 1SH3A 2CPHA 3D3BJ 3BKTA 2I2YA 2HVZA 3OPKA 1YLXA 4MYUA 3KDNA 3DKDA 4B3MJ 2ZD1B 1HQUB 2D9PA 4E98A 3AOAA 2F4FA 1VBZA 4ELTA 2HBYB 3U1LA 3GFZA 4ED0A 1WJ9A 4M63A 3QO9A 2UUCF 1NH8A 3FZBA 4ZPWR 2J6UA 2B9WA 3THTA 5JVHQ 2CQ2A 3DDKA 1GH8A 3OTOF 1S9FA 1XERA 3ZZOA 3OFGA 3VTIA 5L1KA 2FC9A 2W4CA 1HW9A 3WC0A 3SIPB 4P6QA 2IBOA 3CF5Q 2EK6A 3VZHA 4KO0B 3M8PA 1FJ7A 3I55S 1S5ZA 3JQKA 2BQRA 2EFQA 2V4JB 2QYGA 2VPYB 4HDHA 3PJ9A 2XLJA 3GV8B 1JJ4A 4NLTA 3CCES 3GIIA 4OJHA 4F67A 1FKOB 1BWVA 3QIPB 4PG8A 3Q2TC 3CCQS 5L39A 2E1PA 5J2NA 4JV5J 3NNAA 3TJ9A 4OZ0A 3QJPA 5CZVA 3E51A 3RRHA 3IBWA 2R8JA 1HLWA 4DDFA 3FQLA 4R8UA 3RW6A 1IKYB 2XSJA 1N5VA 5EN1A 4F4WA 3KMQA 3GU0A 4IDKB 4MMOA 2HWHA 5LSRA 1C0TB 3OLBA 3HK2A 4GMKA 3OVSA 2PEHA 1LV5A 3HXMA 4OI4A 1LQ9A 3ISNC 1PYSB 2W8KA 3AOCA 1WELA 1Z1ZA 4NZ7A 2CPIA 1VBXA 3TJAA 4AXIA 2D3ZA 4QWDA 3MAQA 3W7BA 3DRYA 1EHWA 2UUBJ 1B64A 5HJYA 3JB9k 4DUZJ 2XQCA 4DX5A 4USWA 3J7YU 1WF2A 3ZZYA 2ZD1A 1HQUA 1HD1A 4CLPA 1NBEB 1RAIB 1QTMA 3IM8A 4LBIA 3J7A1 4LF4F 2MKHA 4Y2CA 3RRKA 3GYXB 4OJ3A 5AT1B 3UPFA 3I32A 4N56A 2ZVSA 3TUJC 2GQ2A 1FEHA 5G4DA 1WEYA 2DO0A 2I9SA 2MSSA 4Z7YA 3EGWB 1FJGF 3BM7A 3M05A 5B0DA 1MG7A 2AEJA 4ZMMA 1I94F 3Q2SC 3A4TA 3M8QB 2P6TA 1SH2A 3FSYA 2OPSA 2XGPA 4G65A 2V4JA 4KPCA 4LIWA 4CLFA 1FFSB 2GIRA 2P2CB 3MOJB 1XJWB 1FKOA 3QIPA 2A10A 3DOLB 3GZ7A 2HNZB 2LECA 2E1MC 1JKHA 2DNHA 2K3KA 1KP6A 4J5OA
chains in the Genus database with same CATH topology
3KFWX 2XMMA 1S0OA 2GFFA 3M6UA 4Y00A 3UCUP 3UD3P 3OR1A 2R7OA 5JVGQ 4X4PA 2C3MA 1S9GB 3O6QA 4ALZA 4F4KA 2BW2A 4BWMA 3MECB 5E41A 1RP5A 2RQCA 1ZZFA 5H9FJ 4OHXA 1S0NA 1A7GE 2J7KA 1U8SA 1UETA 2WOMA 4IDKA 5B09A 4YY3F 4F50A 3SYZA 5I3UB 1R0AA 3IRXA 1Q82T 1C0UA 1N8RT 1S1WA 3MFIA 3GE9A 1C0TA 2E1RA 3OL6A 4ZPCA 3CJKA 4WZQA 4K4TA 2ROGA 3KHRA 2BANB 2AJQA 3BSNA 2BQ3A 2F8EX 1ZAWA 4C8MA 1N6QB 2COLA 2OH2A 1RTDB 2ZZMA 3U02A 5D3GB 4C8KA 3BSAA 1KOHA 5K5MA 4B3RF 4KFBA 2HRYA 3UI3A 4ZVGA 3VAHA 1TFWA 2JSXA 2CPJA 2IAJB 1TFYA 1RT6B 4K4UA 4X2BA 2VPZB 2FVSA 1S4FA 3OHAA 4ITSA 5LL6d 2J0WA 1R27B 3BQ1A 5F0UA 4NZ0A 3T6BA 4N77A 1Y0HA 3DDNA 3W3SA 5MAOA 2F40A 4GC6A 5F9LA 2C2RA 4TYBA 2GMJA 1JIHA 4XAKA 3UCGA 4OHWA 1OO0B 1UVKA 2OPQA 1S48A 4PG6A 3F73A 2BXJA 3M9MB 1NKEA 3HPOA 3H20A 3HVWA 5I3PA 3JTPA 2DITA 3IN5A 3CSKA 1WHVA 2WRMA 1DLOA 1N34F 2KYXA 3CCRS 1OS5A 2IRXA 5K8PA 5I42B 5KFVA 1HNIB 3X3UA 4H4OB 2KHCA 5KFYA 4URQU 5DGAA 4A48A 2PFFB 1GAOA 1SIZA 1K8AT 1R8CA 3SDEB 1RDRA 4IG0A 4ETZA 4UW2A 2BBEA 2QA2A 3F56A 4WYLA 4DV4F 2AGQA 1YJWS 3M6XA 2L9DA 3CCUS 4RW7A 2B6AA 2DJWA 2OKQA 3TI0A 1YRXA 1FESA 1KQSR 2MKJA 2XWXA 2KYZA 2V8VA 1NJWA 2CVEA 4IH7A 4F2RA 1JLGB 3V4MA 2K3IA 1SKSA 4ED2A 4LIRA 2E1AA 1VRUB 2F7VA 1RT1A 2EK1A 4WE1A 3BGRA 4X4VA 4ZP7A 5C5JA 3BSOA 4IKAA 1SL2A 1S1UB 5JXSA 1K1QA 4F25A 4CI0B 1RWUA 3I0SA 3BQ2A 1Q86T 2KG1A 4X62F 2E9TA 4HH0A 4J9PA 1FXLA 2MQOA 1J5OA 3CCMS 4EBDA 1S1XA 2UZAA 3BB5A 3N9UC 3QZ7A 1WD6A 3D1HA 3M8RA 5J2MB 1T8EA 4C8OA 4ES3A 2YVSA 2KI2A 4O23A 2XBPA 1J2VA 4ID8A 4M8LA 1TQLA 3LPYA 3GILA 4LFCF 4K4XA 1K0VA 3NLCA 1VRTB 2XG8A 2Z2LA 4I4BA 3N6MA 2F1FA 3RAMA 1DQAA 3TNVA 4TNOA 1SV5B 5FJ4A 4OV1A 1D1UA 5D4OA 3OVAA 1P8GA 1SUQB 2O01C 4CNZA 1IR0A 1ROFA 3C2PA 2MY8A 2HHSA 1SJ1A 3OXFA 2CZVC 2KJWA 5CH7B 4AFFA 4DL4A 4RUCA 5GAHU 1N5YB 1HBOB 4CO5A 4BWJA 2AJ4A 4NCAA 2JEJA 1NAQA 3WX4A 4YP3A 3I31A 3PO4A 3KLIB 5KFHA 2FHJD 2C3OA 1CSJA 1RT7A 2FJVA 1V6HA 3I5BA 5IM0B 4HYKA 1YIJS 3PIPQ 1VQKS 2KKHA 3QWUA 5IS2A 3SQGB 4NL5A 4IG3A 4MYTA 3VAFA 2VB6A 5EHHA 1LK7A 4A8OA 2DH7A 3TVYA 4Y28C 4EWTA 4Y6IA 1URRA 4WK3A 2X1GA 4CT8A 3IG1A 2OSQA 2B4VA 5IFMA 1XMQF 2KJVA 2R2RA 1NH7A 4QU7A 5IXUA 4DFJA 1M1KT 2M52A 4EO6A 1H7XA 1VK8A 3CE8A 3EGNA 1KQFB 3U7JA 5L38A 5HMWA 1U1NA 1JLQB 1S9GA 2BJDA 2ADCA 1SJQA 3VCDA 2A18A 2HFZA 1Z2LA 1Y3KA 4YB6A 2MZ1A 3OL7A 2CG4A 2DB1A 4J9RA 1RQ0A 2WONA 4NLOA 4F8RA 3US5A 3PIOQ 2FLNA 5I3UA 3THVA 4B9MA 1MU2B 3LO3A 4QOTA 2OIHA 1BGXT 3TX8A 2MQPA 2PA8D 1C4AA 3SSRA 4AL6A 2G0CA 5GAEI 5H9EJ 4QR2A 2W25A 3M8PB 4J9OA 5D3GA 1GT8A 4NLUA 3KHGA 4C9DA 3B8HA 2GIQA 4YR2A 3NGDA 1KRPA 1RT6A 4GO5X 1U49A 4OI2A 5A8RB 1R3NA 1ZPWX 2DGSA 2KFYA 3TOQA 3JSMB 4OHVA 3MPWA 5KFBA 1B0VA 2Z8QA 2O66A 3IAM9 2DIUA 4ZK7M 1C2PA 1FDNA 2ZHOA 3AQOA 3M2RB 4YMEA 2UUAF 2RF2B 3BDEA 1T3NA 2H5EA 2HHTA 5J2NB 1XC9A 4JOUA 5H1SV 3O2IA 4ELVA 4MFBB 5EWEA 4UY8T 1QUPA 2LXFA 4RW8A 3W2WB 2RDJA 1ZM4A 4J9NA 5L1JA 2UXDF 1OPZA 3SI8A 1Q8BA 2KB2A 4OIXA 2JL9A 5AE1A 1L5UA 4XK8C 2Q6BA 2DISA 3V2UC 4FF2A 3RZAA 1F60B 1BQMB 1YRTA 3I9V9 4X4OA 2AYMA 3SDEA 4R8UB 3RBEA 4N5SA 1U1RA 5D78A 2IMOA 2X1BA 3LF0A 3HLUA 4EFAC 1SKRA 3KTQA 5C42A 3HHNB 2IA6A 2J8AA 4JI7F 4QU6A 4UOCA 3PX4A 2Y1IA 3CCSS 2BR0A 3PRBA 1AXQA 4UQTA 4WJBA 1WEXA 1M5PC 3I56S 2YKNB 3AA8A 4J37A 5CCMA 1NK5A 4WF9Q 2Q79A 3LW5C 3WC2A 3N79A 3SCLE 1YVFA 4NZ6A 2YKPA 5CYMB 2PMZD 1FNXH 2I5JA 1S7HA 3MAHA 3HM9A 4FS2A 3FGVA 5A8KB 2CJBA 1N4LA 1VGYA 2IYIA 2ZH9A 1FK9B 1S99A 1DJ0A 1FVQA 2LQ5A 4DX8H 2QE5A 5KG6A 3DRRA 1RKIA 2PIIA 3FSXA 4ED1A 2DNMA 4ZCKA 2R7UA 5J2MA 4PXCA 2ILZA 1HI8A 2A2DA 2OPPA 3UE2A 1CVJA 4FP9A 3OFHA 3GR0A 2OFGX 4K4YA 2KU7A 4GC7A 1SL1A 1VQMS 1VRTA 1CC8A 5B0AA 3TA1A 4XPEA 1MNEA 1ZZNA 1MROB 1X8DA 1RA7A 4C8LA 1SV5A 2ZUGA 4MKAA 2M8DB 4TU9A 4IFYB 3L7PA 2V8HA 3N0VA 1VBXA 4FS1A 2RS2A 3B4MA 5KT5A 1FERA 3FMWA 2WCXA 1YSJA 3M6WA 3MMBA 2MZJA 4NLRA 1N5YA 5GAGU 2RVJA 1HBOA 3IWXA 1FA0A 3G4SS 3DLGB 3KLIA 3D0IE 2EC0A 1UVNA 3ISND 3CVKA 1O8BA 2EBGA 2RNEA 3T1HF 1NZAA 4BDPA 2BUNA 5IM0A 1RYRA 4JI3F 3KNAA 3JSBA 4DV1F 3I9ZA 3UD4P 3IXQA 3SQGA 4RWWA 3QZ8A 4NLVA 4KQZA 1KQKA 3HMJG 4I1TA 3MEEB 4IR1A 4NRTA 3O3LA 4USJC 4DV5F 2GHVC 1IN0A 1HR0F 2B0GA 1VQ9S 1HBUB 4DG1B 4CO4A 2E5LF 3K58A 1LW0B 2E7WA 3MM8A 2DNLA 2DNNA 2PD1A 2XGQA 3TA2A 3KLFA 1C1CB 4TQRA 3H5XA 4DL2A 1FEEA 3HVTB 1X4AA 2YNFB 3OFEA 4DR3F 2YNHB 3V81B 2CZ4A 2FB0A 4NCBA 2IM0A 3RU0A 4MIAA 4I2PB 2CQ4A 2VONA 4A8WA 5KFLA 3BGLA 1MU2A 5KFOA 2V0NA 4H4KC 1X4DA 2R7RA 1NU4A 2ZNYA 3IAS9 2DNKA 2VPXB 5A8WB 4PXBA 4Y65A 4LF5F 3KMSA 3ICLA 3DXBA 1WI8A 1RISA 4ELUA 2XLKA 2OPSB 4HEA9 2HNDB 5AJ3F 4RLEA 3EGZA 2CRLA 4O3SA 1N52B 3M2UB 2LQJA 5A8RA 4L72B 2N7YA 2EFPA 2H9ZA 1PO6A 1Q81T 3JSMA 3LGNA 5KT7A 3QIDA 4J9KA 1OQ3A 2LXIA 3I82A 4KPYA 1YHQS 1VC0A 2NSBA 3M2RA 4PUOB 2RF2A 3G96A 2KXHA 1NHUA 1PC5A 1REVB 4IFVB 2OJ3A 4WFYA 4MFBA 2AGOA 2MQLA 4DLGA