2UXCF

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uxcF00
4DR2F 3ZZPA 1N36F 1I94F 4DR5F 1QJHA 1IBLF 4LFBF 4DUZF 1HNWF 2J5AA 2UXBF 4DR6F 4JV5F 1LOUA 1RISA 1XNQF 4LF4F 2VQEF 4DV2F 4JI6F 4DV7F 4B3RF 1G7CB 1F60B 2UUCF 4GKJF 2RJZA 4JI7F 2B7BB 1IBMF 3R3TA 4X65F 1G1XA 4JI3F 1HNXF 1GH8A 2HHHF 2YY3A 4K0KF 4OX9F 4LFCF 1CQNA 2BXJA 4NXNF 2B7CB 4DR4F 4KHPF 1B64A 4X64F 1CQMA 1N33F 4DR1F 5AJ3F 4JI0F 4DV1F 3T1YF 2VQFF 4X62F 4JI4F 4LF5F 4DV0F 1XMQF 4YHHF 4B3MF 4DV5F 2ZM6F 4LF7F 2UUBF 4JI2F 5LMNF 4B3TF 4LFAF 3OTOF 1N34F 3T1HF 4JI1F 1N32F 4LF9F 5LMUF 1XMOF 4GKKF 5IWAF 2KJWA 1IBKF 4DR7F 1FJGF 2UUAF 4DUYF 1VMBA 2UXCF 4NXMF 1HNZF 2E5LF 4DV4F 1J5EF 4B3SF 2UXDF 4YY3F 1HR0F 4LF6F 4JI8F 2KJVA 4X66F 1FKAF 4DV3F 1IJFB 4AQYF 1XNRF 2UU9F 1IJEB 4JYAF 4LF8F 4JI5F 2F4VF 4DR3F 5BR8F 4DV6F 2BVZA
chains in the Genus database with same CATH superfamily
1U1QA 2KKHA 4FYYB 3BPDA 1Y0HA 1S1WA 3PDNA 2FJXA 4ZVTB 2ZJRQ 3SSSA 1UPPA 2E5JA 1FJCA 4F26A 2J9DA 4CM2A 4A8SA 2ZE2B 5EWFA 1CPZA 2CQ4A 4USHA 3FSIA 4K0KF 1EETA 4KO0B 4QIFA 4A8XA 1KQFB 1DTTB 2DT9A 4JV2A 3WX8A 5HN0A 4AUKA 4CRJA 1S57A 2PN6A 1IQTA 2KDOA 3MDFA 4LF7F 1W2IA 2RQ4A 2HAFA 3FCVA 3ILOA 2HFVA 3CCVS 1TL1A 4F3QA 5DLGA 2R2TA 3JSYA 1U7LA 3VVTA 3C16A 4N7TA 5LMUF 2HS3A 1VDHA 4FS2A 4A47A 2DR6A 1WHWA 3PHEA 4FDFA 5D4PA 2C28A 3M8SA 4ECUA 2DKOB 4CH7A 1U6FA 3CJ8A 3ENVA 1QD1A 1KQKA 4MAKA 3EE3A 4PQUA 1VQ7S 3NNAA 2H54B 4ATNA 3BREA 4JV0A 2B4VA 2R8JA 4U67Q 4DDFA 3J7YU 1RISA 4ZVHA 3VQTA 2J0XA 3T19A 2A0FB 3TUPA 1CBKA 2DNKA 1UFKA 3W5XA 5KFOA 4YS2A 3D9BA 1NJIT 2BZ2A 2MLXA 2MQQA 2HK3A 1EARA 2UVRA 1LWCA 2CJQA 3UDVA 1CJUB 2HQGA 4J9OA 1MWZA 1HBNA 1IN0A 3M1VB 4RUBA 2QA1A 1U1RA 3KHHA 5CXTA 3RR7A 2OPPB 4F0MA 3A3OB 3QIPB 4J90A 3OTDA 3DU6A 1XIQA 4MT1A 4J9MA 1EKRA 5KG7A 1J5OB 5C42A 3CDBA 5IZHA 3S6EA 1RT1B 2VHGA 1L3UA 2KB2A 2MQMA 1PBUA 3CMAS 1H2VZ 2FVRA 3QIDA 4ED6A 1WACA 2W9CA 4WTYA 3HFKA 2C3UA 5BXIA 3THVA 3OQ2A 4JI5J 2RRBA 5CABA 1X5OA 3N6MA 3K89A 4OX9F 2HFUA 2JL9A 3SCLE 3CDUA 2ZDOA 3OR1B 4ZPWR 1T9UA 1S0NA 4JI0F 1F0XA 3GYXB 4CLTA 2N7CA 5E3QA 5DG7A 3CWJA 6FDRA 4IFVA 3R5CA 1HNXJ 1ZPWX 2EW9A 3IAS9 2X51A 2A1BA 1NSQA 2EFNA 4RU2A 2C3OA 4EBCA 2Q1LA 4ECRA 1W2BR 1WTFA 3G6XA 3RB0A 1RWNB 8RUCA 2G2YA 5HVFA 2AEFA 4DV4F 1S6QA 1RT2B 2M88A 2PD1A 3M2VA 1I6JA 1PILA 2WVEA 3SI8A 1KC8T 1VBZA 2CJ9A 3M6XA 3OR2A 3I32A 2I0XA 2PT0A 2R7XA 3HHLC 2FJBB 1FRHA 2DK2A 5DG8A 4FS1A 3QJPA 3NRBA 5KFQA 1H72C 2R4FA 2GC8A 3Q0AA 1MWYA 4M5NA 3EZOA 2C3MA 1VQOS 4P9SA 4UF4A 2B43A 5K14A 1U0SA 4WTOB 1HBUA 4FZVA 3PKYA 5HQ8A 4DQPA 4GVLA 5KFSA 1BQXA 2B5JA 1C0TB 3CULA 4QJVA 4LREA 3ETOA 2OGUA 5J2PA 1R3NA 4DV0F 4PG6A 3NCQA 5F8MA 1UVMA 1BXNA 4RBVA 4DUZJ 4S0MA 3GFZA 3QSIA 3MOJB 1OS5A 3OTOF 5G0RA 2JEIA 3KNGA 4LSNB 2HURA 4X62J 1RUSA 2XGQA 2RQMA 2HQDA 5KFBA 1F9HA 2ZUGA 3TYTA 4PWDA 1SH3A 5ETLA 2HVZA 2DB1A 1FKAF 4KKOA 1U2FA 3TRGA 3RB6A 2XULA 4PQAA 1U25A 1UJ5A 1JJHA 5CCMA 2MQOA 1GTHA 4QR1A 1FJGJ 1TUWA 3DRXA 3M8QA 4KGKA 2LYVA 1FRLA 1SQEA 2W1BA 4ETXA 1NM2A 2CZ9A 4QYZJ 3NKYA 2MZQA 2XY6A 1G7CB 2XCAA 4F50A 2A2DA 3AA8A 2HVDA 2R7VA 4V19X 3QYYA 2AIRB 1SI9A 2GZOA 2W2QP 3DDKA 3L4BC 1F9EB 2F9DA 1SJ4P 3RGIA 3MMJA 2Z4PA 5A8KB 2CPDA 5D4NA 1AZSA 2ZH4A 2CRLA 2UVWA 3DYAB 4LRAA 2OTJS 5JVHQ 3W65A 2B0GA 4OI4A 1QLNA 4DQSA 3I31A 3RBEA 2LLZA 5LJ5Y 4FYDA 2ROEA 4ELVA 2G9OA 4EGLA 1FVQA 2EFVA 3HZGA 5HQLA 1S9FA 3CVKA 4U8VA 1GXLA 3ZZYA 4G1IA 1LKZA 2AGOA 2A18A 2K06A 3NBPB 2ZZNA 1UFWA 4UOFA 4F4XA 1ROFA 3MPUB 1VRTA 4DV3J 1BGXT 2CQDA 3JS9A 1Q5YA 4B3RF 4J9PA 1AXQA 2ZKUA 2YWFA 1IBMF 4RUHA 4J9VA 2PIIA 5D3GB 1XNQJ 3M05A 4NZ6A 3K17A 2YQ1A 4DV1F 4G1PA 1JLFB 2V2VA 2IVYA 1JKHA 1TKXB 2CG4A 3H0PA 2VH7A 4MFBB 1GMUA 3BYPA 4NE9C 3BQ0A 3NGTA 2BQ3A 2DD8S 3DDNA 3A12A 3PRBA 1S1VA 1KVJA 2JLFA 3CNQP 1TFWA 1YDLA 2E7VA 4KB7A 1X60A 3MAAA 4N56A 2UU9F 3D68A 4K2XA 4DR3F 5HP1A 4F3MA 2DNOA 1YK9A 2ZKTA 3TANA 2PE8A 2KT3A 4OHXA 3V5RA 4M95A 1XNRJ 3W8PA 5D77A 4ECZA 1NNDA 1XBWA 1YHQS 1U48A 1S1UB 2Z2YB 1GQEA 3MFHA 3ZC4A 1MROA 2BE7D 4NASA 2OO4A 4L6V3 2OPSA 4EU0A 5THWA 3GILA 3AB4B 1VQLS 4EBDA 1XR5A 4OI0A 1BQNB 2HIQA 1X4FA 1U0HB 5HJXA 4DJBA 2YNIB 4B9SA 1V3ZA 2N4CA 2IA6A 3QWPA 3WBZA 4B02A 3PYDA 2E7XA 1PJ5A 3BGRA 1ZM4A 2YNGA 2I6WA 3BH6B 2QMXA 5B0FA 3AY0A 2G0CA 4R25A 4PCQA 1FTCA 1YJUA 3OW2R 4ED2A 2C2KB 4ECWA 1NK5A 4HH1A 1ZM3A 2DH7A 4CLUA 1A9NB 4W90B 4B9VA 3K5MA 4C0BA 1RE1B 2HRYA 4CWBA 3NGRA 3ELHA 1EB0A 1S9EB 2N4DA 4LBPA 2YPYA 4MKBA 1N6QA 1YBAA 3DRRB 1OO0B 1FCAA 2DEJA 2VC0A 2B7CB 2FB0A 3ULHA 4H4OB 2R8IA 2YNHB 3FMBA 5KG0A 1TK8A 4EFAC 1LW2B 2QYGA 3AD7C 3G71S 4OV6A 3CD0A 2QEXS 3HO1A 4YB6A 1T3NA 2IPOB 3KLHA 1OQ6A 4ZVEA 5EHHA 3MTJA 3TX0A 3QT7A 4GKKF 2VOPA 4CNYA 1UETA 3ILLA 3FFIA 2HZAA 1CC7A 4IRDA 4EWTA 1HR0F 2JWNA 4K4VA 2CPZA 3IRWP 1WC0A 2VICA 3MEDA 4I64A 2W4DA 1N33J 1N34J 3C15A 5JUMA 4NCAA 4BWJA 2LP4A 1NSPA 1VGYA 2QA4G 1XMQJ 3PKMA 1CS4A 2YKMB 3QRPA 4UY8T 4KIAA 3VCDA 3KLGB 2JFDA 2AF6A 2EFQA 5BR8J 1YJVA 3C46A 1B7YB 1I94J 3LTOA 1AT1B 4DR5J 3FEYB 2BUNA 1MNEA 4X64F 1RTHB 1NUEA 2IC3A 4G3IA 5F3TA 1S1XB 1VK8A 3H2VE 1X0PA 4IFYA 2OH2A 1HWJA 1IWAA 1PYOB 2VBYA 4DQRA 4DS5A 5LSRA 5DJBA 2I5JB 3OFGA 3CCLS 2C2ZB 2DO4A 3KTQA 3RAXA 2G13A 2IMOA 4JI8F 1LW0A 1X31C 1UVNA 1K73T 1NZAA 1TV6B 4K4YA 5HANA 4F4KA 2DNHA 4DSIA 1U26A 3I4HX 3ZZPA 4KPYA 4GC7A 1DRZA 1S0VA 2J8SA 4B3SJ 2FIUA 1HPZA 3DOLB 1E6VB 5ETMA 1Q95G 1RAAB 1X5PA 2NSBA 5CYQB 5T14A 2DH9A 4OV1A 4QQBA 1SL1A 3W63A 1QY7A 2OLWA 5D78A 2JRSA 3DHXA 4ZCMA 4KE5A 3IFEA 4NXNF 4U7CA 3OSNA 1X4GA 2X1AA 4ZP6A 1SC4B 1U2RA 2C3YA 4KY3A 2DH8A 4ITSA 1YRTA 3I9V9 3MUVP 4ED5A 1ZTTA 4MK9A 1QVFR 4BDPA 4M5JA 3BM7A 2J0SD 5MLCV 3KNAA 2WOMB 2YKOA 1RJJA 3J7ZT 4YQWA 5IM0B 3PX4A 5H9EK 1IJFB 3PNIA 5J2QA 3DLHA 5GVQA 5KT3A 1VS3A 3M8PA 4TN2A 3MR2A 3CCES 2GAGC 3NCRA 4IG0A 3CCJS 3PVXA 3T6JA 2WSFC 4F25A 3G2XA 1M90T 1L3TA 3LWLA 4DFMA 2DXDA 2F5GA 2OSRA 2OP5A 4JI7F 1UZDA 4YN3B 2DY9A 3ENAA 2YTCA 4GVBA 1UAWA 4ZLLA 2GVZB 1FO1A 3CJKA 4EO6A 4OYAA 3E8OA 3DGPA 4U7UK 4FP9A 1X7VA 1X4AA 3G87A 3EGWB 3TI0A 2X1FA 5IS2A 4ZITA 3GCWP 3GE9A 5AE2A 3I0SA 3JSRA 3J81Y 4LFAF 2PEHA 2CPHA 1NK6A 3J80U 1F5CA 4YP3A 2P9EA 4G65A 1RWUA 3DLGB 2GQ2A 2HHTA 2DPIA 5B08A 3AJ1A 3NGSA 1FDAA 1HNIB 1UKUA 2UUBJ 4IQXA 4JI2J 1OIAA 1VR6A 1R0BG 3Q89A 4TLQA 4YR3A 4P72A 3OUYA 3WDOA 3DGVA 5KFPA 4G6VB 1QVGR 2XEXA 5K8NA 2AU0A 5ETNA 3MEGA 5ETQA 1YJ7A 4M5DB 2IYIA 2AJ0A 1RTIA 3GR0A 1JMTA 1RTJA 3D67A 2ZJQQ 3JSMA 2WVDA 3V81A 5IT9Y 3VF0B 5B0AA 2RKIA 1RT4A 2UV8A 3MM5B 4BCAA 3OLAA 4ER8A 3NXZA 2KG1A 5CYMA 3PO5A 3NNHA 2EKNA 4IG3A 3ZZUA 1NSAA 2X1BA 3OTCA 2GFFA 2FHJA 1B3TA 2CQ0A 4HL9A 4NLDA 4ZN1A 5T41A 3R9LA 1XR6A 1NK4A 4EYHB 4DSJA 1RHUB 3I55S 2L08A 3CDWA 2HHHJ 2ZH2A 4ZVUB 1IM6A 4BBYA 4WJBA 1M5OC 2LEBA 4EZ6A 1S99A 4MK8A 1JLCB 4FXVA 2CPFA 2W24A 4DFPA 2FQQB 4JV5F 3AQPA 2B6AB 1FI4A 2GV1A 2I9SA 1EETB 2RAQA 4F4YA 4OJ3A 2XM3A 3MMAA 1H7WA 2DGQA 5HSPA 3KJNB 3O8WA 3RW7A 1TMJA 3FEZA 2DR9A 3HVRA 3MM6A 3OFHA 2E66A 4DV5F 2MQ8A 1RTDA 3IAM9 1RBAA 3U27A 2J0QD 4ID8A 3UR3C 4OL8A 2V8HA 2XLJA 2YWWA 3HVWA 1UEKA 3EDRB 1NJYA 1FFWB 3A1YG 2QLBB 3DOMA 3UN3A 3MMCB 1IKYB 4OX7A 4LQ9A 1XJWB 3NS7B 5C2GA 2F4VF 2MKYA 3W2VA 3HSZA 5J1EA 1S76D 4ZPBA 3MM7A 5KFEA 1TP7A 4ECYA 4RR5A 1VFJA 1ZAXA 5GMEA 1X9MA 2XMTA 3MR7A 3O1LA 4CLLA 3UQSA 1UA0A 4HTIA 4TY8B 1CEZA 4NRUA 1C1BA 1SC3B 1S97A 2QYCA 1BD6A 1A6LA 1NHUA 3FZ2A 1T03B 2IVMA 3SQGB 1FRKA 3N6LA 2VQFF 1NKEA 5T7LA 2G1DA 4JI4F 4IYQA 4IH6A 4ZCLA 5F41A 1JXLA 4A8KA 5LSLA 3DLEB 1LWXA 4ZJLA 3NOCA 4ZPTR 4JOUA 3HFZB 5HLFB 2EPIA 2HRUA 4Y34A 4X65J 1WC4A 3BDEA 2EG1A 4LT6A 2U2FA 3Q8UA 3H42A 2XNRA 2J0WA 1WDTA 3UD3P 2XSFA 1XMOJ 4FNHA 2JEFA 2E1MC 3UD5A 2E1AA 3QGPA 1O51A 1W7WA 1TAQA 2AEJA 1HQ2A 2IRUA 2AMCB 2NS1B 2YWKA 2C2NA 1RWMB 2GVDA 4DEZA 3UCUP 1Z2ZA 2JVRA 3R27A 3HSJA 1Y5IB 2H51B 2DISA 1SUQB 1NAQA 2LXUA 4DF8A 4CDIA 1S7IA 3C3LA 3HKZD 1GK8A 4URSA 1UP1A 1NRKA 2AJ1A 3MD3A 3Q8PB 1S12A 4Y3CA 3IRXA 1SV5A 3NS5A 1RWKB 2OEKA 1LQ9A 2XSJA 2FC9A 1TFYA 4AYBD 4H4MA 3VQSA 3FC9A 2CJYB 3VVUA 4J91A 1TK5A 2VDHA 1RHMB 2LU2A 1EZZB 4ZP8A 3GIJA 3A4TA 4ZLNA 4C4WA 5GADI 1NJXA 3CCUS 3OL9A 1S59A 1Q8BA 3OFEA 2HNDB 1VQNS 4NXMJ 1FNMA 5K14B 4O0IA 4U95A 1YWXA 2HNYB 2KI2A 3HVAA 2ZE2A 1NJWA 4WXWA 2AZ3A 1UTAA 4TYAA 1HHSA 2ADCA 3KK1A 2N3LA 4U6PA 2XWYA 3F56A 1DTTA 1RAGB 4Q8FA 3GCXP 3HHLA 3I5BA 1UW4A 5D15A 3MMBB 2R9LA 2B3TB 1ZM9A 2QLWA 5JXSA 5IC4B 2D41A 1NHKL 4EYIB 3TAMB 1LV5A 3MAHA 3UW1A 4C3MA 4DN9A 2FLPA 1VQ8S 1Q86T 5DGAA 4NMLA 2XMJA 2LQJA 4XK8C 1SQGA 5HL7Q 2BVZA 3QO9A 4I56A 4ZCKA 3LALA 2ZM6J 9RUBA 3HCXA 1TL5A 3HF5A 3P96A 1DARA 1JJ4A 2Y8YA 1S77D 4LVOP 2J76E 2QSFA 5C25B 2VBWA 2MLYA 3PEHA 4DLGA 1TKDA 1S79A 5BJRA 1B64A 4X66J 3JSBA 2ZBIA 1RWWB 1AZSB 2HWHA 2LECA 1K1SA 1IKXA 2B56A 4GKJJ 1UWBB 2KM8C 2IBKA 1U8SA 2OPPA 5C2CA 2O01C 2ZITA 1ZA2B 5IQQA 2A3JA 1R0AB 3EWGA 2ZH5A 1YRUA 2RRNA 1D0EA 2HWTA 1RT5B 1WC1A 4LF1A 4OI1A 4DCPB 3Q8RB 4LF6F 2ZNZA 5CZXA 2EBEA 4JI5F 2HIYA 2PA3A 1U1NA 4BC9A 4LF5J 2FVQA 2HBYB 4QWEA 3FBFA 2XZTB 5GADU 4YB5A 4D3GA 3IC1A 2HHXA 1WEZA 5M2UA 5HAOA 2MZSA 2FZCB 2Y3YA 3OR1A 4OZ1A 1HNXF 4CM0A 2GJIA 1GT8A 4UY85 3G86A 3R1HA 2KXHA 1JKHB 3U1LA 2HBZB 4MH8A 4M5IA 3DRPB 2X3DA 1TKTB 3QPIA 1S1VB 4DFJA 2ZVSA 3SZ2A 2Z30B 3QFWA 2XO6A 2IM3A 1IM4A 2AEMA 1YKWA 2VA3A 1VQPS 1LK5A 3BF4A 3GG0A 1C1CA 3C2PA 2ZZMA 3K5NA 1MSWD 1FRXA 2FY1A 3WZ0A 1RT2A 3BQ1A 2CQHA 3VALA 1HWUA 5HP1B 1GMVA 3VAHA 3QFHA 4LRFA 1CULB 2IJFA 3LP1A 1OY9A 2AJQA 2YWHA 1VBYA 2Q66A 1S6PB 3PW0A 1BQMA 1QSYA 3PCOB 2IJNA 4OZ3A 2Y1RI 3OT9A 1SIZA 4UOCA 3BBBA 2V94A 3W2WB 5KFYA 3QJJA 4LF8J 2WVFA 2VODA 5EWEA 1NKCA 2EWHA 3M32B 1C0TA 3HZEA 3UE2A 1VC6A 3FMWA 1UJ4A 2Q43A 5C5JA 3ISZA 1NDPA 1WHYA 4X62F 4KHMA 2PEBA 1AW0A 4KR0B 2E1PA 2YNGB 3ITHB 2Y0SD 1YTYA 2QFJA 2ZBCA 4LSNA 1T94A 3OL6A 1WOOA 4XO0A 3JTNA 1Y3JA 4Y6IA 4ZIVA 2L9NA 3C19A 1FJGF 2ZD1B 4EI2A 2QLJB 1C4AA 1UCNA 3PYGA 2FGOA 2NYIA 4IH5A 2LCWA 5I3QA 1WTBA 1HD1A 2IYGA 4TY9A 4UTGA 2V8DA 5IT4A 1NB7A 2DXFA 4N41A 4ES2A 4IDKB 4HACB 2I2YA 2ZH1A 2AWZA 3WHIA 2J9DE 4Q44A 2JJ4D 1SQFA 2B7BB 3MPYA 1RLCL 1UEVA 1DJ0A 1F5BA 4HYKA 2LEPA 4DR6J 1RHJB 3JAMU 1DZ5A 1Q79A 5B0DA 4NLSA 3B8HA 4DL5A 4WCEQ 2V68A 2QFIA 2X1GA 4NA3A 3TZWA 2HW3A 1ELOA 2F8HA 3H5YA 3R6GB 4O44A 4IH7A 4RWWA 3FSYA 1S9GB 1XEZA 4YEAA 2RMLA 1FJEB 2KVIA 1RKIA 4MJKA 2ZH6A 3C15B 4NZ7A 1DLOB 1BY9A 3IM9A 4CO2A 3T5LA 1U02A 2DGOA 2L9WA 5I3PA 5IFMA 4C7QA 4DV3F 3FDSA 1JLEA 5DDQC 4Y2AA 4N47A 2RDJA 3PX0A 2Q79A 2VB6A 3O5TB 1B4SA 4KRWA 1HNVA 3G96A 2BABA 1QDUB 4K5SA 4Q2MA 3GV5B 4OLPA 4QWAA 4UOHA 3BKUA 4K4XA 1B7FA 1XNQF 1T9TA 3BO3A 4USUA 3GFYA 1F60B 4JYAJ 3TEHB 4CO1A 2IC3B 1ZETA 5D0RA 3VAJA 5B0CA 1YRXA 5A0YB 4PG8A 3ISNC 4OZ2A 1RA7A 1JLFA 2M7SA 5F9NA 4A8OA 2HQ3A 3KK2B 2CQ1A 4WZMA 1B99A 3T5JA 2RS2A 5A76A 1TKXA 1E6YB 4TU7A 1H0HB 2LDIA 4MFBA 2JC0A 4YFUA 2VKZG 4QIVA 4C6AA 3R5AA 4AL7A 2IM1A 2P6SA 3BSCA 1RAHB 2A6OA 1QAJA 3HVTB 4OQJA 2E5IA 4HI1A 2VONA 1R43A 2LQ9A 3THTA 4E2FB 2DNRA 3N79A 1YJWS 2JH3A 1XNRF 2YKNB 4JV1A 2C1EB 1NPRA 2HBRB 4MYTA 4MKAA 3MPWA 1NPPA 2YH1A 3FEXB 2FJDB 4C97A 3TQ1A 1WD6A 1R8AA 2XYGB 4ZVPB 4AQYJ 2XHCA 2DGUA 2R7TA 1XERA 3I87A 1S1UA 3BBFA 1HIYA 4DV6J 1KFSA 4RW6B 1Q8LA 2VKRA 1WKKA 3F41A 2W7OA 4RNFA 5DM7Q 1O0PA 5CD4H 2DO0A 3CJ5A 2YWEA 5U47A 1U0HA 1X4HA 1OY8A 2B4UA 2DHHA 3G6YA 3CDEA 2BEFA 2HK2A 4K8RA 4USWA 2QX0A 4F4AA 4F67A 1AA1B 4DV2J 3T1AA 2RILA 3CTRA 1KNZA 3M8ZA 1GAOA 1SJQA 3LP2B 2HZCA 2AJFE 5KFHA 2DY1A 2CPJA 4IG0B 1KOOA 1KQSR 3GWCA 1TKZB 5E3CA 4WXOA 3H8YA 1D9DA 4ZVRB 2FLOA 2V4QA 1NK9A 2FYXA 5HK4A 3SBMA 3CJQA 2GX8A 2J6UA 1RCXB 3AQOA 1NJZA 3VHQA 1VRUB 1JNRB 4I7FA 2OTLS 3DRRA 2FPHX 1X4EA 4FF3A 4RW4A 5A8RA 3TVZA 1NEEA 3RUBL 3CT9A 3IG1A 5K8PA 1UL3A 2ZZTA 4PR6A 1HWLA 2HNZB 4H4OA 1NSKL 2DCUB 1M1HA 2YNHA 2EK6A 2XYHB 4RW8B 1NO8A 3OHAA 1Y11A 3PG9A 1VIOA 3TARA 4QYZK 2D3UA 4IUFA 4A8MP 3OXGA 3D5MA 1WSRA 3J80Y 2WRMA 2FJEB 4MYUA 4CT9A 2XQCA 1N34F 2YX7A 3OVSA 2Z2ZA 1RACB 5DS7A 3CF5Q 3BR9A 5IT0A 1TVRB 2QA4S 1WC3A 1RAIB 4L72B 4Z2XA 5EX3A 5BR8F 3GG1A 1QTNB 2NLWA 1I94F 2UUAJ 3CJ2A 4DR5F 4HT5A 1RHQB 4LF7J 2P8IA 1JLQA 2MZ1A 2BW7A 1RTIB 3RB4A 2IBOA 5CYJA 3LGHA 2NUUG 4C48A 3V81B 1F5AA 5K9FA 2AGQA 1JNZB 2RKIB 1RT4B 1RTHA 5KFXA 4DSKA 5RUBA 2JNJA 4ZPDA 2HFOA 2G0JA 5CYMB 2RUSA 2YKPA 3M8RA 1Q4RA 3QNWB 1F9FA 4FXDA 2VG6B 2XTJP 3QT8A 2D3OR 4TQRA 5I3UB 2RB7A 4TU8A 1NLKL 4K59A 2FGCA 2YX1A 4RNOA 2FUG9 3PJWA 2RE1A 4N5SA 2EEYA 3T1YJ 2VASA 1S7HA 3ZNUA 3CD5A 4FYWB 5KFDA 5HATA 2P2CB 2HSEB 5ITHA 1VQ4S 3B54A 2ADBA 1TTHB 4ZVQB 4B3SF 1B0TA 2CQGA 1TV6A 1VQYA 2CA9A 2W25A 3L7UA 3N28A 3BEGB 1D1UA 2QTWA 1E6VA 3M4XA 1S4FA 2A6MA 1JLBB 4JP8A 1GXTA 2W2PP 4IOCQ 4ECTA 2HHVA 3JQMA 2KT5A 1D3WA 1VQKS 2H5JB 1HMVB 3BV8A 3HX9A 4OX6A 1U1OA 2X3GA 2HGLA 3R97A 2QT7A 3D2WA 3R8YA 3ZTQA 2WZ1A 1RTDB 2AYGA 4B9NA 4RL1A 2F8EX 4QIWD 1FESA 2SXLA 2ATCB 1HARA 3NS6A 3DKDA 2GJ2A 4WU3A 2HS4A 2CZVC 2WOMA 3VGVA 3M30B 5L46A 5IM0A 2NUHA 3BYRA 3N01A 1YG0A 3GFXA 4B3MJ 3W2VB 1D9FA 4OHWA 1IXKA 4L75A 3HKWA 5F8HA 4OX9J 1RT7B 1HD0A 1FKOB 3M2RA 3W62A 2OUGA 5IWAJ 3DLKB 1OMSA 2F7VA 2E5LJ 2UXDJ 3KLIA 2A10A 1H3DA 3CCZA 2VPZB 5EX0A 3MEKA 1U1KA 3T3FA 4OHVA 3B4DA 2B51A 2HHWA 2MSSA 3D0IE 1RZMA 1K0TA 3CGIA 4YUDA 2ALZA 4DV4J 4BHQA 2CPEA 4DN0A 4O3PA 4LJMA 3PXGa 2VQEJ 1Q0NA 1M1KT 4I68A 4XDDA 1R6VA 3J7AN 3QZ8A 5DGBA 1TR0A 1N5TA 3J81U 5ETPA 2LXFA 1DURA 2BANB 1ZTWA 3AOAA 3OTEA 5HI7A 4EEYA 1PAUB 3NAHA 2UUBF 4JI2F 2FZKB 2W2NP 2HFNA 2R7UA 2MMYA 4KBIA 4USJC 4CNZA 5AE3A 2R8HA 5GAHI 1HNIA 4DCJB 2F8MA 2W2OP 2D69A 5KG1A 4QWDA 2V50A 3POTB 1TZ0A 4IOAQ 2CFXA 1NHVA 3KJVB 3VAMA 4QU6A 1H73A 3T1HJ 2F9JA 2ZNYA 1N32J 2MSTA 3GJTB 1PCAA 4PPZA 4O4GB 2NXCA 5DQHA 1P8GA 4TKTA 4FVCA 2J5AA 1CJVB 4O3SA 3P8BB 1WKJA 1ACMB 4M5DA 3DFEA 2HRTA 2BKNA 2W2MP 2RHQB 2G1HA 5A2QY 1HYSA 5IC6B 1V5IB 3EGVA 3FJ2A 1H2TZ 3GLJA 3PFOA 4LFBJ 1UWAA 5B09A 2DR5A 1SV5B 1ZS6A 1FXDA 2XSJB 1H6KX 5KT7A 4QIGA 1M5KC 1RAOA 2PMZD 2B9XA 5KTQA 1G6BA 4IRKA 3QSYB 2KFYA 3KUEA 4QYRA 3PYFA 2KRBA 2HYIB 3HP6A 1KLMA 3AJ2A 1S48A 3MPVA 1T7PA 2XZDB 4IR9A 1JLCA 2WW4A 3TA2A 1N56A 1RQ0A 3IGNA 1WC6A 4M5MA 1SBRA 2R2UA 1HBOA 4NI2B 2B6AA 1DTQB 1HLWA 3W7BA 4C0HA 3KK1B 3IM8A 1PYTA 4C11B 3BDPA 3GIRA 5EN1A 4RBTA 4ES3A 4WU2A 3I5CA 4ZA1A 3HHLB 2O67A 3CUNA 1WWHA 4CLWA 2ACYA 2LQBA 5EWGA 4HHHA 2NZ4A 2JX2A 3KG4A 1TL3B 1CG2A 5B0BA 3CIMA 3BO2A 1WORA 5L1IA 1YJTA 3QWUA 1MLAA 3UWTA 4DL4A 5KOXA 5HQMA 2KFZA 4DOZA 4OYZA 4WFBQ 4R5PB 5F0UA 1YITS 2GO9A 2EFOA 3DHWC 3LW5C 1RHKB 1R27B 3MMCA 4ENOA 1IKYA 5ETOA 3AXKA 3BKTA 1HBMB 1X0FA 3QO9B 4F7VA 2MQNA 2HAIA 4FPRA 4KTQA 5KFAA 1RU2A 4YOEA 5GAHU 2H5EA 4TVAB 5DETA 2HLTA 2P6TA 3PO4A 1Y7PA 3KLEB 1X4DA 4WK1A 2VU5A 2BRKA 2KYXA 4NYZA 5JVGQ 5L8RC 5KG3A 3X3UA 3HK2A 4TY8A 2H3EB 1EQ0A 3EMTA 1HHTP 4NMXA 3ZZTA 1IKXB 1T03A 3MZIA 1Y4ZB 2MQLA 5AXKA 3SQGA 2J7KA 2G0IA 4HH0A 4LF4J 3AOBA 4OZNA 2IDLA 1FDDA 3DLEA 1SPBP 3PX6A 4DR3J 4FN5A 1KOHA 2AKWB 4PEOA 4ED1A 3K58A 2OMOA 4B3TF 1VC5A 2Q3PA 3I6PA 3S01A 1SJ3P 2CNOB 5HLFA 1Q7LB 2KL8A 2YKQA 5J2NB 3HJFA 1XMOF 5HROB 3MCMA 3D1OA 1N4LA 1VC0A 4FYXB 5KFWA 5CCLA 1RU1A 3H98A 1VBKA 3D6HB 3W1YC 1FTRA 3KUHA 1OPZA 3S7RA 3UN5A 4F2RA 1YBUA 1ITPA 4LIWA 2RIJA 4DPOA 1GXUA 4X4UA 1Q8IA 2MB0B 4XTTA 1FA0A 1Y9OA 5E3PA 1FX4A 3DC2A 1LOUA 4FNIA 2HQFA 2GQCA 2VFSA 1YJNS 1SUQA 4OI2A 2H48B 2V8VA 1WNEA 4CQ1A 3ILIA 1RABB 2YBVA 2ROPA 1B0PA 2G4BA 5F8JA 2V4JB 4ZJOA 3HT0A 1WOSA 4F36A 3SV3A 4WFNQ 4RPFA 3M8WA 5FIIA 3LWMA 3TJ9A 1C1CB 1RADB 3JQJA 2ZHBA 1FK9B 5DDOC 2BQUA 3TUIC 3BR8A 3DLBA 2GA7A 5HMWA 1C0UB 1URNA 5AJ3J 4CP5A 1M5PC 3DLJA 3LP1B 2KZZA 4NXMF 3ZO7A 4FKXA 4A8YA 2MY8A 4YY3F 3ILJA 2HHSA 3OHBA 4QPTA 3C6TB 5LMNJ 1BQMB 3I0RA 2HNDA 3VAGA 2PDAA 2LQ5A 3K5LA 1SKRA 4DR7J 3CSKA 5J2MB 2BRLA 2VJVA 3RRGA 3PW7A 2KXFA 5GAEI 2HNYA 2XMKA 2ASLA 1Z2LA 3RBDA 2JLGA 2OIHA 3ICLA 3NG8A 2BE9B 1U24A 4K4ZA 4RUAA 5JJBA 3M6UA 3D54A 1IKWA 1ZM2A 3LO3A 5LOQA 3MMBA 3J81j 1NXIA 4LF2A 4XPEA 3FBBA 1C2PA 2OJ3A 1NB2A 1RP5A 2CZ4A 2CXEA 4CIOA 2DHAA 4AXIA 2D74B 5D8HB 2XWXA 1M5VC 4UQTA 4C8YA 5F8NA 2OPRA 3TAMA 2LXIA 3W61A 1FVSA 4X84A 1N5VA 3NWGA 1FNXH 5EGYA 4PWUA 5M2PA 1ZH5A 3MHYA 4ID5A 3P6YC 3F44A 1IBKF 3C14A 5G4DA 4GMKA 3WIVA 2D9PA 4ELTA 3KK3A 4O3QA 3BGFA 3GSDA 2D9OA 5D6GA 2RD5C 4QBUA 3ETMA 4NZ0A 3TW0A 1NH7A 4JI1J 3HSDA 5JMNA 3K8WA 5KFKA 1SC1B 3CXCR 4DUYJ 2XGPA 1M5HA 3AHPA 4E98A 4ZN3A 2ZC4A 4U8YA 1DFDA 2EKYA 3EX7B 4DU8A 5C25A 4ZP9A 3CD6S 4GKJF 4L74A 1EP4A 2RU9A 3JAMY 1Q7YT 2VL1A 3R3TA 4DL6A 3G6VA 3IXQA 2NXEA 2N7YA 4PZVA 3KLFB 1HW9A 3QLHA 2CQIA 5K8MA 1UWBA 4MK7A 4M8LA 2IA0A 2DRBA 4O44B 1HHQA 3U7JA 5D0GA 4YR0A 4KHRA 3Q86A 1RWOB 2PSZA 1R0AA 3TAQA 4Q5VA 1RT5A 4F2SA 5KFTA 1PAEX 2E5GA 3BSOA 4CO4A 1Q8KA 4WIQA 1JLEB 2WSEC 2FVCA 1P1LA 1T95A 5KT6A 4B3OB 3Q2SC 3DI6B 4N77A 4X2BA 1H98A 1HNVB 2Y1JA 2Z58B 4PG5A 4USIA 4Y2KA 1JK9B 5C24A 2GNKA 1YJ9S 5L39A 1I51B 2VD3A 1FE4A 3G82B 4IOBA 3ZTPA 3EVOA 1X4BA 2D3O1 4ZIWA 4NLTA 4NPOA 4F0HA 5GAEU 2DR8A 1PO6A 5J1PA 4HDHA 3HT3A 3ADAC 2H1YA 1HNWJ 5B0GA 2DHXA 4Q2LA 2UVUA 4WFAQ 2R7WA 4JI6J 3DRPA 2MKIA 2V67A 2BJ3A 1TKTA 3PZPA 4DI6A 3NNCA 1YJRA 2JSXA 4F0KA 4I2QA 4RZRA 1ZZNA 4GO7X 2WSCC 1S4EA 4KHPJ 4Q8EA 3H25A 1RWXB 2W01A 5IOLA 1WG1A 3D3BJ 4P52A 3EXCX 3KFWX 5SZTA 2FJVA 1H38A 2UXCF 4WBFA 3V6HA 1CULA 1JWWA 4OHZA 5D0EA 2HVEA 4HT7A 3B6BA 1DQ8A 1SJ1A 2HLUA 2JEJA 3A13A 3FSXA 2FHOB 1NK0A 1WOPA 3E01B 1S6PA 4LF8F 4P10A 5KT4A 2KHCA 1LEOA 1VLOA 1UMJA 1J5EJ 4QZVB 5L9XA 4GRSA 3Q23A 3W2WA 4F4WA 3AAWB 3D7SB 4CLKA 4PUOB 2ZBRA 3M32A 5KT2A 4HHUA 3PEJA 2ZH3A 4I4BA 1U2CA 2FHJD 2CVEA 1IBLJ 1VOMA 2AD9A 1RBLA 2VPYB 4FPIA 4M63A 4FVMA 4DL0C 2AW0A 3JTOA 3NGKA 3GONA 4URGA 3JTPA 3BJYA 3ITHA 3KG1A 1HFEL 2HBQB 5HBMB 2NSCA 3HULA 4WKYA 2EVZA 4QU7A 3S8SA 2ZD1A 1X4CA 4USMA 2NPFA 3FZBA 4ECSA 1MW7A 1XK8A 3MUTP 2DCLA 3GZ7A 4DZDA 3D6TB 2CQCA 1T9YA 4KH1B 2BKOA 2V0NA 2FHKA 1U8WA 3RJMB 4I7FB 4FBUA 4OYWA 2YPZA 4LF9J 2DRAA 2EFPA 1JLAB 4IDKA 4HACA 4RW4B 5A8RB 5FLXY 3C8YA 1RB0A 3IG1B 3GJQB 2K1RA 5KFUA 4DR6F 4C8ZA 3GB0A 5F0WA 5B7WA 2DHSA 4RO0A 1U4BA 4K2JA 4OYPA 2KT2A 5LSOA 1LFWA 1R7IA 4DG1A 3GFHA 3AA9A 4P6QA 3G8TA 2ZOGA 4OYIA 4RX6A 4Q0BA 2DBBA 3BSAA 3I56S 3MCNA 2VF3A 4LSZB 4ALZA 4ANEA 3A3PB 1RWVB 2EK1A 1NZ8A 1S9GA 3HDSA 4RW9B 5LT5A 3GJRB 4JV5J 1UA1A 1DLOA 3SSQA 3RB3A 3W9JA 5DO2A 3V6DB 1GFWB 1VHFA 4QR2A 2FHMA 3WQPA 3K57A 5F8LA 3NY0A 2ZFHA 4DSLA 5K20B 2G2OA 4V19J 4PXDA 2OAUA 3HMJG 1L3VA 4JYAF 1JLQB 2IMWP 4OI6A 5KG5A 1TELA 2HG4A 4C8OA 2JDJA 4NLRA 3I4PA 4NCBA 5HO4A 3G4SS 5BYRA 3HD2A 2ZH9A 2KYZA 4MIWA 2MTLA 4JB8B 5A0YA 1N36J 4K4UA 3OL8A 4ERDA 2DGTA 1KONA 1T9WA 4BLGA 3N4WA 3KK2A 4DFKA 2DGXA 3N5BA 4U9RA 1VQ5S 1E6YA 2VBXA 3ET6A 2F4VJ 4WWSA 1NK8A 1SXLA 1FRMA 3PACA 2W8LA 4WFXA 3LA0A 3PTWA 5IQ6A 2RHSB 3WC2A 9ATCB 4P2MA 3HVTA 2ZWPA 1WUUA 4ZHRA 3QJLA 3FBEA 3KLVA 4HKQA 4AL5A 1Z1ZA 1EAYC 3CCWA 2DGWA 3O3LA 3QAEA 4IKAA 7FD1A 2RQKA 4QPXA 2YKNA 2ZHOA 2XS7A 3PY8A 1YQHA 4AQYF 2VZ9A 2JZ5A 5KFGA 2OMLA 4MTPA 1N5SA 1VJQA 4DV6F 2PI4A 2E5HA 4MKVA 4ELUA 1UPMB 2QL9B 3VGSA 3PM9A 2BOPA 3UVJA 1DAXA 3OTBA 4RW6A 4KH0B 3LUYA 3T9ZA 2HQCA 3CE8A 3CO0P 3TJAA 3AB2B 1PIEA 2AV5A 1KHVA 2AZ1A 4C3KA 1FFGB 3D28A 3W60A 3IO1A 2FLLA 3HJVA 5E41A 1T8EA 3X1LB 3EVWA 2QLFB 3LP2A 3BKFA 3BGLA 2XNQA 1IQZA 4X4QA 3M2RB 1TKZA 3C66A 2QMUB 5ETSA 1Q78A 2K3IA 2OPQB 5LXRA 3KLIB 4EMDA 1NMEB 2MHNA 1H2UX 3FRZA 3I82A 2XMMA 1VRUA 2M3DA 1N0VC 3IMQJ 2C42A 3C6UA 3UNYA 4C8MA 3OPKA 1R8HA 2HNZA 2GIQA 4CI0B 3GYNA 3EZ5A 1WC5A 1VLYA 4RW8A 2UXBJ 2E7WA 4A48A 4ZCIA 1SIWB 3SYZA 4P2SA 1R89A 2XB2D 2I38A 2DEIA 2CKWA 4XDCA 5DG9A 4P73A 2NPIA 5F8IA 4FF1A 3V6KA 1F6TA 2VBZA 4USKA 4X4VA 1NDCA 2BQRA 3QMQA 3EICA 4FXWA 3P5BP 1CJTA 5E3AA 3MF5A 1FX2A 2KRRA 3LP0B 4PRFA 2FLNA 3SQOP 2UUAF 2BJ7A 4BWMA 1TVRA 3L09A 1KWMA 5DLFA 3N5FA 4B9TA 3CJ0A 3VAFA 3TUJC 1T05B 3LAKA 2MGZB 5DRKA 2LVWA 1N88A 1HYSB 4NEZA 5FD1A 4CH1A 3Q24A 1APSA 2E9RX 1IUJA 2HWIA 2UUCF 3SIPB 3G6ES 2KG0A 1IR0A 2MZJA 2B9YA 3DU5A 1CSJA 1CJKA 1YI2S 4ZK7M 1U1MA 3P49B 2ROGA 3W9IA 1WI8A 1ICEB 2QC3A 2F4FA 3T1YF 2VG6A 2XMAA 2AYBA 2NQPA 5KFLA 5I3UA 1GMWD 4KYZA 5KOWA 2FDNA 2C2MB 1N0UA 1KLMB 4M5HA 3TZYA 1MU2A 3CC2S 3R6LB 2PC6A 1U6ZA 4ZVFA 3ZTRA 5L1LA 3KG0A 2RDDA 4KJIA 5E7OB 1FEHA 1UFLA 1HBOB 1BUXA 1SKWA 2QL7B 1VYAA 1N52B 3AOCA 1REVA 3KDOA 3LAMA 4HDGA 4NWBA 3LPEA 4DXLA 1JLBA 2YH0A 3P45B 4G1QB 2WCXA 1R8BA 4Y0FA 3W5YA 2RSQA 1UJ6A 1HMVA 5IXUA 4WF9Q 3AXMA 1FWKA 3IR7B 4IR1A 3CCRS 4LF6J 1H7XA 2IVFB 3OJSA 4ZVOB 4WE1A 4ED3A 2DGVA 4DX6A 4YDXA 2J7UA 5L1KA 1ZAWA 1HI1A 4O3OA 4B3MF 4J9RA 3TP2A 2VUGA 4YDDB 3ONQA 3KHRA 2V63A 4RWXA 4ETZA 3M30A 4DR1J 2HHPA 3VGUA 1ZAVA 5IWAF 4A8QA 2CAJA 1RT7A 2EBGA 4O3RA 2YVSA 2E5LF 2M70A 2NXNA 2UXDF 1FKOA 3CCSS 3J7A1 2RVJA 3CCQS 3PIPQ 4I67A 3R7BB 3DLKA 3IR5B 1SJFA 2Y8WA 1KTQA 2BM0A 4DPYA 4RKUC 1IJEB 3CJTA 2ILZA 4X4SA 5J1NA 1NDKA 2V9KA 3SXLA 1RA6A 1SC6A 1VRQC 1Y10A 3RRKA 2RF2A 1YZ6A 1M5SA 3DCAA 3W64A 2VQEF 1V9OA 4ZJQA 2IY5B 4UW2A 5AT1B 3OLBA 1SKUB 2XHWA 1X8DA 2XMUA 4RJVA 2OD6A 1UVLA 2D3ZA 3WC0A 3BGUA 2MEWA 2BANA 4DV7J 4OX8A 2Z56B 2CPIA 3H2UB 3GPAA 1WEXA 1S49A 2JEGA 1JLGB 2JOQA 2M4MA 3IWNC 3R1LA 1NH8A 3MM8A 2OI2A 1RLDA 2PI5A 2HGNA 4LFCJ 4R8UB 5KFJA 2UVVA 1RT3B 2KM8B 1TMMA 3DOKB 3T1HF 1KLNA 2ZHAA 1N32F 1RTZA 2WBMA 1FKPB 2R7RA 3L9ZA 1VQ6S 2ZBQA 3POTA 3KJVA 1X9WA 1GX6A 3QRQA 4CLYA 3R5BA 2GMLA 4O4GA 2M9KA 3MCSA 3M2UB 4DPTA 3FKBA 1CJVA 2DGSA 4LFBF 4FBTA 5A2QU 3MECB 4NLUA 5KFRA 2VFTA 4RW7A 2C2EA 2KHDA 2P9GA 2ZBPA 3HD1A 2UP1A 5LXYA 4NLYA 2V8PA 5H9FJ 1WDDA 4X4RA 1LXNA 2DIVA 1Y00A 3ZZZA 1WG5A 2Z8QA 3L3CA 1YX2A 2ZUAA 3MTKA 4E0DA 4JI3J 1NCLA 1S0OA 3QT6A 2AT1B 2FJAB 2HS0A 2AX1A 1KQGB 2GHWA 3TA1A 3BS9A 3I0RB 3LH2S 1V3RA 2HMIA 2F65A 3EVMA 2HHQA 2LA6A 4QIEA 4DS4A 3W5ZA 2GW8A 4P71A 3DLLQ 4X4TA 2C2DA 4EBEA 1T11A 4NI2A 1K0VA 4NLPA 1DTQA 3EXYA 1XR7A 4Z7YA 2QV6A 3T5KA 4CYUB 3DM2B 4C11A 4RU9A 4UUXA 1IKWB 2QIFA 1N5YB 2CJKA 2J9EA 4DL3A 5LJ3Y 1PBAA 1N5QA 3K5OA 3NEKA 2VIHA 4OJGA 3R2CJ 1TL3A 1SL2A 3TNVA 3R5DA 1EKSA 2OPRB 1V5VA 2OKQA 3QBCA 1RXOB 5IV3A 4R5PA 4ID5B 1AYEA 4NLQA 3C14B 2K8GA 1RI7A 1FFSB 3KK3B 1HI8A 1QE1B 3GMGA 1RHRB 3TAPA 5C7PA 1QUVA 2IM2A 1CLFA 1TL7A 2BE2B 2W9BB 2CPXA 4H54A 1HBMA 5ETTA 2YNFB 1XWLA 2J7WA 4Z7CA 3AT1B 1KN6A 1PC5A 3KLEA 4LBIA 4M94A 2BACA 5CQGA 3AD9C 2I1RA 4DU7A 2IJRA 2AP6A 1OWXA 2LU1A 1EP4B 4Y2IA 3V4MA 2VA2A 4LRDA 5L9NA 1R6YA 2GHPA 1MN7A 4LF4F 2CADA 3EPIA 5CHCB 3QLHB 3UCGA 3IR6B 2CG8A 4ZDNA 3DRSB 4ZVSB 3T9NA 2F3JA 3PR4A 1QSSA 3RBZA 2JVOA 1IKVB 3NCPA 2H5IB 3PHTA 1S72S 1QAYA 2GO8A 2BW2A 3K7RA 3E51A 4DPWA 4OYXA 2W4PA 2WB1D 1NU4A 3KJQB 7AT1B 4BS2A 4DR4J 5J2NA 5HROA 2KZMA 4O23A 1JXEA 4YR2A 3L7PA 3PW5A 3CEDA 3HI9A 3D3CJ 4OI3A 3DRYA 5C24B 1R8CA 1H74A 2DYAA 4YHHJ 3OFFA 3LF0A 3A8KA 3PYEA 1WHVA 1UZHA 3GP9A 5KFCA 1D9AA 1QM9A 2VG7B 1KBRA 2XLIA 2E9ZA 2NXJA 2CPYA 1HNZJ 3PRDA 2NYHA 2L48A 2O5DA 3W8GA 3GIIA 4U96A 1Z4UA 2VOOA 1SB6A 4RNMA 1G2EA 2LDYA 4XIUA 5KFMA 2V4JA 2W4CA 2M52A 5I4MA 2B4PA 4ZLPA 3V4IB 2IAJB 1KTVA 4I2QB 4KFBB 5AJ3F 4NLWA 4FF2A 4NCGA 3B82A 1P9QC 1S5ZA 3MFIA 2FJWA 1AB8A 1FK9A 4J5OA 1HQEB 2RQCA 1C0UA 3T6BA 2P9CA 1U09A 5LMNF 5E33A 2C3PA 3MCOA 1SH2A 3JYTB 3OBIA 5E0OA 1K47A 1VHIA 4DR7F 3TVYA 4XAKA 4PXBA 2KN4A 4KGVB 1VMBA 3MURP 3RG6A 4N8NA 4UUWA 3C6TA 3PW4A 2H4WB 5D0HA 3CO9A 1L5UA 1NKBA 1AUDA 5J2MA 4DHVA 4Y2MA 1U1PA 1L3KA 2Y1IA 5DZ7A 1JIHA 2X7IA 2R7SA 4PG4A 4DUZF 3CJRA 1G4CA 3OXFA 1A0OB 3IN5A 4DSEA 4DBQA 2QL5B 1B0VA 2DR7A 4IO9Q 3R5GA 2W9AA 3GSIA 4L76A 2QO3A 1Y3KA 1FHTA 3WIUA 2F1FA 3CCTA 1W26A 5FDLB 5A8WB 3MI7X 3V6JA 1O8BA 1GTEA 1I1GA 4NA1A 3K8VA 4DCOB 3JXOA 3VTIA 3QAUA 2R7QA 3MEEB 4P7VA 2V34A 1Q81T 3OVAA 4JI1F 1WSVA 1AUSL 2KJWA 3UN2A 3OL7A 3KHLA 4DUYF 1WF0A 4H4KC 2XZWA 1D09B 2K1RB 2M5YA 1S1TB 1LWFA 2MKJA 3EZUA 2DNZA 2YX4A 3R7NB 4KGZB 4A8WA 2XCPA 2DNMA 2V9WA 1URRA 4HVZA 4OIXA 3JB9k 2VG5B 4DG1B 2W8KA 2RJZA 1FRIA 4Q0BB 3KLFA 4QW8A 3V2UC 3BBCA 4DUTA 3ENQA 1KP6A 4UQGA 1RCOB 4Y28C 2LKZA 1WELA 3KXDA 3ZTSA 3MPDA 1LWEB 2MQPA 4OYOA 3TJ8A 5ADZA 4I69A 3ZTOA 2IDEA 3AFGA 1D8YA 4DWIA 2V5HG 3HLUA 4B9LA 3D6MB 3RZAA 3ENWA 3KOAA 1R31A 3M6WA 4B3OA 3DI6A 2V8GA 3SFGA 3GR1A 2E1CA 2MKKA 2MPUA 5EUHA 1XQIA 3G82A 1X9SA 2BBEA 3MR3A 3DDIA 4ECVA 1HNWF 8AT1B 1MMDA 3NMAA 4CT8A 5AE1A 3PFEA 5DM6Q 4JI6F 1F3VA 2GMHA 4QR0A 3VZHA 3HHNB 3MAQA 3ET6B 4WIIA 2LEAA 3THPA 3W9HA 4PYAA 1IVZA 4KHPF 4DZ6A 2QG9B 2U1AA 1P27B 1PJ6A 3UNGC 3IS9B 3MM9A 4ZHRB 2DPJA 1JXVA 4ZP7A 2M8DB 2BOAA 2NCKL 2N82B 3TEGA 4O3NA 4X4NA 3CDAA 3UDCA 3E3XA 4J9UE 4DL7A 3IBWA 2CUYA 1WHXA 2J8AA 1EHWA 6AT1B 1YSJA 3GV7B 1J5EF 1JB0C 3E01A 4Z37A 1J2VA 1FE0A 2CDRB 1FNOA 1FDBA 3AH6A 1VBXA 2GMJA 1N48A 3UVJB 1QAXA 4CTAB 1RGVA 1DBDA 2EFGA 2OELA 1UVKA 3IBCB 5CAAA 1YBTA 2GS8A 3SDEA 2NR0A 1IBLF 3I96A 3MXHP 3OXLA 4YB7A 1WJ9A 1FD8A 2HPUA 4PUOA 1ZZFA 3ZFVA 3VR1A 1MWQA 1XMBA 4C3LA 4DR2J 5I42B 1HQUA 1TUGB 3BN4A 3T41A 1CVJA 1J27A 3G9CA 4K50A 2R42A 4Q7AA 4O0NA 4PXCA 1FWLA 3SMZA 4DF4A 4C8LA 5HBMA 3PIOQ 2YXLA 3LGMA 4I2PA 1BWVA 2XC9A 2V69A 1PC4A 3R5JB 1Q1KA 2DNQA 4I6WA 5KFNA 3R7SB 1BC6A 3KMQA 3H5SA 1RAEB 4LF9F 2V2ZA 4KGMA 4FYVB 4A8FA 2Y0BB 1V6HA 2R2RA 3AJDA 3FK4A 4ICLB 2IIHA 4W92B 4OHYA 5FLXU 1U1LA 2H65B 3GIKA 1JLAA 3VWSA 1VQ9S 2COLA 2E44A 3MWBA 1RT6B 3C6UB 1ZPVA 5KG2A 3LPYA 3TOQA 5HVHA 1AROP 3RAMA 1U6BA 4JBCA 4KV8A 2PMWA 3MOZA 1KHWA 1S1WB 2Y9HA 4DSFA 5A6WA 3VAIA 4J9SA 2C2OB 2CNLB 2IRXA 3W66A 8ATCB 1OY6A 2O3DA 3FQKA 1N33F 4BC7A 3K5PA 2O1PA 3SCJE 1CJTB 2DHGA 4RW9A 1XMQF 1KRPA 1Y5NB 4K0KJ 4AL6A 3V6DA 3KYLA 3H7HB 2QN6B 4I6YA 1TL1B 2XBPA 4B17A 2QSWA 4DX7A 3C16B 3M7VA 2AJ2A 1P9YA 4LRBA 4C0OC 2KJVA 2XO7A 4M5GA 2JFKA 3P5TL 1UVIA 4UZBA 2E1RA 3U1MA 2CJXB 3DXSX 5LMUJ 3KHGA 3D66A 1N36F 1RYRA 3OVBA 2I8EA 1DY3A 3O44A 1CJKB 4PQUB 3IP0A 2LMIA 4DL2A 2QA2A 2XY7A 3FRYA 1EQMA 5HVGA 4ZS6A 4LMZA 2WONA 5KFVA 2E9TA 3FCHA 3EM1A 3NL0A 2XMVA 2RRAA 4UOGA 3OD2A 1WI6A 1EJ7L 3QGIA 1MU2B 5AXMA 2MJUA 1FDNA 3HSGA 1BLUA 2XI2A 1LWCB 2HQIA 3TX8A 3CB4A 1RWPB 1YGYA 1HBNB 5HMZA 1REVB 4OLOA 2Q6CA 2DRDA 2WVBA 1N8RT 5EDWA 1RKJA 1U45A 2MKCA 3SEOA 4J37A 4Y2CA 3I9ZA 5C42B 4RNHA 3IBFB 2AX0A 4KGXB 1WF1A 2YWGA 3QGHA 4USTA 1MG7A 1HI0P 2W9CB 4B3TJ 2VFUA 2QLXA 4AE5A 4X4PA 4WE1B 2HVIA 1REGX 7FDRA 4OZJA 5DDRC 3IGVA 1GH8A 5CH7B 1PG5B 4LSLA 2AJ4A 4C98A 5M2RA 2DTJA 2BM1A 1T02A 1ZBTA 4M5KA 3A8EA 2DXEA 5HJYA 2J6TA 1HWIA 2GGPA 1QTMA 4TLRA 5GMKa 1NPKA 3G8QA 4RNNA 2YQ3A 4IFVB 4ZMMA 1VQSA 4JI0J 3DMJA 3HXMA 2QMWA 4RLEA 2EC0A 1ZA1B 2QGFB 3HHDA 3LQVA 2CDQA 2XI3A 4U7UD 2OPQA 2BJEA 2BX6A 3TA0A 4DPUA 1AFIA 2RF2B 3ZZRA 1S6QB 3IA0A 3M2VB 2VJUA 1P1TA 4YMEA 2GIRA 1K8AT 1RSCA 4UZCA 4QCLA 4WP9A 2BYCA 4DQQA 2Z57B 3US5A 4ZPCA 3OR2B 2DNGA 2UXBF 2VDIA 3PV8A 3Q83A 4PG7A 4DQIA 2KFNA 3B78A 2YKAA 4PWWA 2RUGA 4ZOSA 4OJHA 4DPXA 3I5AA 3CJSA 1G1XA 2E29A 2B9EA 4ANDA 2HVHA 4YY3J 2CQPA 3KWMA 5F3ZA 1HBUB 4EO8A 3MM8B 4PYDA 4IO1A 1TU0B 3UFCX 5HMYA 3P4UB 3CJ4A 3D1HA 2B5JB 2GHVC 4LBHA 4KO0A 2F63A 2EXUA 5J2PB 3LP0A 1FWPA 3FGVA 2WAQD 4ZPAA 3GV8B 4PAAA 3ZXWA 2NREA 5G0RB 2VPWB 4JUZA 4DV0J 4LVNP 3EGNA 4ECXA 2V2QA 2UV8G 2MDAA 2MJNA 4PPDA 1OYEA 1T05A 2ILYA 3OTOJ 3CC7S 2MGZA 4PWDB 4CO5A 2NZCA 2W7AA 4KKOB 4O4RA 1UW9A 3O6QA 2ZH8A 4RW7B 4NLVA 1WEYA 2DIUA 2K2PA 2MKSA 4OYBA 3M8QB 3DN9A 1Q16B 3H90A 3CPWR 1IBKJ 1X5SA 1KSPA 2HHHF 4DMZA 3K2YA 1VCTA 1FD2A 3D0GE 1GX5A 1I5OB 1O5JA 3RW6A 1ZOTA 2HMIB 2R2SA 2WW8A 1AFJA 4LR8A 3T5HA 3PR5B 1CJUA 2CQ2A 3TR5A 1Q53A 3M1VA 2GQQA 2BA9A 4WP3A 4WK3A 3GIMA 2ASJA 4ILMA 2J9CA 2ACMA 2UUTA 1KDNA 3QIPA 3PJXA 2JC1A 2M2BA 2BR0A 5DZ6A 4CH0S 2EC2A 4R0EA 3AD8C 4G1QA 1VK3A 1J5OA 4F02A 1RT1A 4ECQA 4NA2A 1OSDA 5KG6A 5KFIA 1GMWA 3RTVA 1OYDA 2M8HA 2R3VA 1VRTB 5A6PA 2JLEA 3TWZA 1EIYB 2O66A 3BQ2A 1VQMS 3ISND 2DNYA 1HL6A 5B0EA 3U02A 4DR1F 2VFVA 2Z2LA 2VFRA 1C4CA 4B3RJ 3VGTA 3RYLA 5FJ4A 1TL7B 2NXUA 4OYMA 1IBMJ 4TYBA 4NEYA 2DJWA 4CLZA 1RBOB 2BJDA 4I0WA 4C8KA 1ZYQA 2LA4A 3BGOP 2BJ9A 3D4JA 3KMSA 1U47A 2DNLA 1RAJA 4DV1J 1B70B 5ETVA 2WTFA 4J9NA 3CMQA 1QSLA 2IM0A 2F40A 4ES1A 1NK7A 4ZVGA 4ZLJA 5MAOA 4F4ZA 3MAAB 4WYLA 3MD1A 5DQIA 2CWXA 3N9UC 4EUVA 4DV7F 2UU9J 2K7KA 4NX9A 3QRRA 4X65F 5BYSA 2UXCJ 3FNNA 2XY5A 1BMQB 3KJFB 2MZTA 2VV5A 3UDLA 4LFCF 3GYGA 3RRHA 4L3KA 4NYOA 4K5RA 2KH9A 1FEEA 1JLGA 1K1QA 2B4OA 3CC4S 1MROB 2PA8D 4FKYA 3MUMP 3HHKA 2OPSB 4R8UA 4ED7A 2UUWA 5H9EJ 1RT3A 3DOKA 2VC1A 1FKPA 1FT8A 4A46A 2PO4A 2Z0GA 2WB4A 2BV3A 3FQLA 3Q2TC 4USVA 3BGRB 5H1SV 2QJ3A 2DNNA 1YZ7A 3UI3A 3H4BA 3M2UA 2APOA 3GTYX 3JQKA 4Y00A 4MIAA 3FVYA 1VISA 4N8OA 3PRVA 3MECA 1QJHA 2J6SA 5F8GA 1KKHA 1TQLA 4LRCA 1OSCA 1KR4A 5LL6d 2MY7A 3EUNA 3BN7A 2IFXA 2XYPB 4ED4A 3CW2C 1G3OA 3S1TA 4P7TA 4B9UA 5IV4A 4NCGB 2ASDA 4NYPA 4JI3F 1N6QB 3J7Z5 2L9DA 2MHEA 4E8UA 3WX4A 4YB1P 1D8ZA 3HPOA 2EG2A 3NGDA 3HM9A 3OV7A 4KSEB 5GAGI 3RU0A 3OSPA 2XLKA 4MMOA 3PW2A 3SSRA 2XS5A 4NRTA 1JX4A 4HLBA 1PYSB 1I3OB 1HKAA 3KLHB 2BJ8A 2WBRA 3H20A 5A8KA 3D0HE 4A4JA 2BDPA 3DYAA 2Y1LB 4I1TA 3FFIB 4WFZA 2WK4A 4Y65A 5CD4A 2FC8A 3SCKE 3P3DA 1WF2A 4CYUA 2CWKA 3DM2A 3MEDB 4GKKJ 5KFFA 3H59A 5K8OA 2GIFA 1F2GA 1MMLA 5D4OA 3U1NA 3GU0A 1N5YA 1HR0J 3DXBA 4PXEA 4ILRA 1S10A 4AFFA 2N3OA 3L95X 1CS4B 3NBPA 4OZ0A 5SUHA 2LFVA 4F04B 3GQCA 4CCHA 1YVFA 4QOTA 4M5LA 1Q82T 1MN9A 3K59A 2YY3A 2MKHA 3HHEA 4EK2A 1CQNA 1PGZA 1LXJA 1CQMA 1T9VA 2PFDA 1IBCB 4WZQA 3L7OA 1RDRA 4AD6A 2RH3A 2KVQE 2AGPA 4CLPA 1QE1A 5D3GA 3Q8YA 2ZM6F 4Q45A 4FF4A 3O2IA 2BE2A 2W9BA 4IFYB 1WG4A 1FJ7A 4X64J 3M8YA 3UO0A 1UEUA 2YNFA 2D7SA 2AQ4A 4CO0A 4L73A 4URQU 1LWFB 2ZWOA 4PKDB 1A7GE 3B4MA 4X66F 3H5XA 3UCZP 1F3FA 5L1JA 1LW0B 3VZIA 2GJFA 4Q43A 1FXRA 1PKUA 2KXNB 1NDLA 1BE4A 2IRYA 4TU9A 2OEMA 4OZ5A 4JI8J 2CJBA 5E2QA 1XTZA 2WVCA 5CA5A 3W3SA 2RS8A 4I6AA 1HPZB 3TUZC 4H4KA 2W7PA 3FBCA 4P2XA 4R0JA 1JJCB 1QUPA 3DRSA 3SFUA 2A2CA 1TAUA 5LM7E 1HW8A 4N76A 4NOHA 4K4TA 4HI2A 3M9NB 5GMDA 2PGCA 3CJ3A 2KU7A 4KPCA 3BO4A 2BXJA 4DR4F 1IKVA 1FRJA 2CIMA 2DITA 5KFZA 4QWBA 4LF5F 4KC5A 4YHHF 1WKLA 1IWGA 2H9ZA 4NXNJ 4LUBA 2RNEA 5GAGU 2CQBA 1BQNA 1Q5VA 3AODA 1SH0A 2YNIA 3M9MB 3D6FB 3CD7A 1HNZF 2C2RA 5DDPC 1S0MA 4J9KA 4CLSA 3RAQA 2VG7A 2RU3A 1VJWA 2CNNB 2OSQA 1RAFB 1VI7A 2PMHA 1OQ3A 2ALYB 2RDIA 5AXNA 4ZPVR 5J2QB 3M8PB 2DNPA 3CMES 4P75A 5ETRA 3PJ9A 3H40A 4X4OA 1T0TV 4TXSA 4WP8A 2ZJPQ 3LANA 5HMXA 2EI5A 1S6OA 1F2HA 3V4IA 3MM9B 2IAJA 1LK7A 1S9EA 4KFBA 4GVBB 2V4RA 1HQEA 3CJKB 1HA1A 4HEA9 3DGPB 2FVPA 4JI7J 5K5MA 1X5TA 4OMFG 3JYTA 3SV4A 2G2ZA 1M1GA 3NLCA 2JHEA 1P6TA 1LW2A 4EZ9A 3I0SB 5H9FK 2LQ8A 2MZRA 2CJAA 1Y5LB 4HHJA 4ILLA 3MR6A 1U49A 3CIZA 3LGNA 3SDEB 3A8JA 4LFAJ 1SCJB 1SL0A 2KTQA 6FD1A 4ZKAA 2R8GA 2HFZA 1OJ4A 1L3SA 2MLZA 4M1KA 1T9XA 2OEJA 3D1QA 1HQUB 1JQGA 4P2FA 2HGMA 5CZVA 4KAIA 3OUYB 1CC8A 4L3NA 3NOGA 3UPFA 1M0SA 2ZDPA 1DHMA 3BB5A 4V1Ak 2K3KA 3MEGB 2YKMA 3H2LA 4I2PB 4C8NA 3ZZ0A 1OPIA 2ZEJA 2HEKA 5FDLA 5A8WA 3KLGA 1FF2A 2FZGB 3M6VA 4LR9A 1PSDA 1GEHA 1RTJB 1R0CB 2BMBA 4J9LA 2GCFA 3JSMB 2CYYA 1TUVA 3BPSP 4KT0C 1UVJA 2CVIA 1SVDA 3MEEA 2FVSA 2AHOB 2UZAA 2Z2MA 1HWKA 1NBEB 1S1XA 2CNKB 4IQMA 4IG3B 3NMRA 2UUCJ 1K9MT 3TQEA 4DX5A 3QGGA 2IHR1 2AYEA 4F8RA 4W98A 3TZZA 1S1TA 2ERRA 2I5JA 2HZVA 1SKSA 2OFGX 4KV8B 1GNKA 4CLFA 4D3HA 4MKYA 3VAKA 4ED0A 2PFFB 2HKEA 4GC6A 4OFZA 1TL4A 1YLXA 2VG5A 1S6UA 5F9LA 1VIXA 3KKFA 1KVKA 3NAIA 2KO1A 4AXJA 4K4SA 2OFHX 3GJSB 3RBXA 2ABYA 4C9DA 5ETKA 3QATA 3OJUA 3DOLA 3QQCD 4DLEA 1DQAA 4CZCA 1LWEA 3MMAB 5CYQA 3TVKA 5KT5A 4P74A 2VPXB 2XMWA 3H5UA 4MIBA 3KUGA 4DX8H 4ED8A 5D4LA 3H4DA 1KEKA 4HTJA 2V6AA 3MM6B 3FCWA 2ASYA 3NWRA 1IR2A 2B8PA 1KVIA 3Q8QB 3N0VA 3MR5A 3ZNJ1 1RK8A 4DV5J 4NLGA 5DQGA 2RT3A 2ZOFA 2BJ1A 4OJ1A 3DOMB 1JJ2R 3RR8A 4ANCA 5KG4A 4WFYA 3UDEA 2OD4A 4TNOA 1F1BB 2WONB 4J9QA 3E2EA 3DNCA 4LQ3A 1RYSA 4PABA 1W25A 2HFSA 5J1EB 3F0NA 4OZLA 3MM7B 4UT4A 3ZZOA 5L38A 1O6XA 3VV2B 1T3OA 4CO3A 3FUYA 2MYFA 2XG8A 4NLXA 3CCMS 1C1BB 4RUCA 2WHOA 4LR7A 2K7JA 2D1CA 3IS9A 1XN9A 2FD2A 3G8SA 1QAIA 1K44A 4KQZA 4RBUA 3R2DJ 4NLOA 2GVZA 1FERA 2FY8A 5T7LB 1ULRA 3EJMA 4AT1B 4LIRA 2QE5A 3HFVA 4C2MA 4WYWA 3UD4P 2CQ3A 3QT5A 2VQFJ 2GAHC 2B8QA 4JI4J 2V2KA 1V3SA 2XS2A 2ZH7A 2Q6BA 3NGUA 4CTAA 1TK0A 2M0GB 2H4YB 3BH7B 1LFPA 3DLGA 4K4WA 1KFDA 3J7YI 3TZXA 1FXLA 3EYZA 2FTRA 4DR2F 3KDNA 1MMNA 5BYQA 3A3NB 3F73A 2ATLA 1YIJS 1BWEA 2L3MA 2L41A 2C22A 2OHDA 2QRRA 1LNQA 3BSNA 1PJ7A 3Q22A 4DV2F 5I42A 4WPAA 2BKPA 4LSLB 5E5NA 3QZ7A 1EX8A 3A8IA 3UR0A 2GVDB 2MXYA 4QWCA 3NP5A 1SJRA 3IWLA 4QW9A 3Q8SB 2ZOMA 3BZQA 4W4MA 3IWXA 2GGPB 2ZVIA 2YQ0A 3SCIE 1BHNA 2AYMA 2P5VA 5KAKA 3DMJB 3EGZA 5IT9U 4IRCA 3N6NA 3M9OB 4TQSA 1KD1T 3K0JA 4GO5X 4NL5A 3EPGA 3IRXB 2QZ8A 4J7CA 3TO8A 3MM5A 1XC9A 1N54B 3Q8VA 4F3OA 5AXLA 2R7OA 4B9MA 4ICLA 2B9WA 4HR2A 1KS2A 2HHUA 3LOUA 3HHLD 4H4MB 4K7QA 3MGJA 4B08A 4WKRA 3EDQB 1RT6A 2R8KA 1R8PA 2POKA 5E3RA 2DVIA 1DQ9A 2ZC3A 1IR1A 4XPCA
chains in the Genus database with same CATH topology
1UVKA 1U1QA 1YJ9S 2KKHA 3QO9A 4I56A 5L39A 2VD3A 1FE4A 1Y0HA 3SDEA 2NR0A 4IOBA 1S1WA 3I96A 4ZCKA 1IBLF 3PDNA 3MXHP 3OXLA 3LALA 4YB7A 1FD8A 2HPUA 2FJXA 1TL5A 4PUOA 2ZJRQ 1X4BA 3HF5A 3P96A 3SSSA 1ZZFA 3ZFVA 2E5JA 3VR1A 1FJCA 4F26A 4NLTA 4NPOA 1DARA 1XMBA 1JJ4A 2J9DA 5GAEU 2DR8A 1PO6A 5J1PA 4A8SA 4C3LA 5I42B 4HDHA 3HT3A 1HQUA 1S77D 2ZE2B 3BN4A 4LVOP 5EWFA 1CPZA 2J76E 2QSFA 5C25B 1CVJA 2VBWA 2CQ4A 3PEHA 3G9CA 4K50A 4USHA 5B0GA 3FSIA 4DLGA 1TKDA 4K0KF 1S79A 5BJRA 2DHXA 1B64A 1EETA 4Q2LA 2UVUA 4KO0B 4QIFA 3JSBA 2ZBIA 4WFAQ 4A8XA 4Q7AA 2R7WA 4PXCA 3DRPA 1KQFB 2MKIA 2HWHA 3SMZA 2LECA 4DF4A 1K1SA 5HBMA 4C8LA 1IKXA 2B56A 3PIOQ 1TKTA 1DTTB 1UWBB 2DT9A 2KM8C 3PZPA 3LGMA 4I2PA 4JV2A 2IBKA 2XC9A 1U8SA 5HN0A 1PC4A 4AUKA 3NNCA 1Q1KA 1YJRA 2PN6A 1IQTA 2JSXA 2KDOA 2OPPA 3MDFA 2DNQA 2O01C 4LF7F 4I2QA 4I6WA 4RZRA 2ZITA 1ZZNA 1W2IA 5KFNA 2RQ4A 4GO7X 3CCVS 2WSCC 1TL1A 4F3QA 5IQQA 5DLGA 1BC6A 2R2TA 2A3JA 4Q8EA 3H25A 3KMQA 3H5SA 1R0AB 2ZH5A 3JSYA 1U7LA 1YRUA 2RRNA 1D0EA 4LF9F 1WG1A 2HWTA 1RT5B 2HS3A 5LMUF 3EXCX 3KFWX 5SZTA 4FS2A 2FJVA 4A47A 1H38A 4OI1A 4KGMA 3V6HA 2UXCF 1JWWA 4OHZA 4A8FA 4HT7A 1WHWA 3Q8RB 1V6HA 3PHEA 1DQ8A 2R2RA 4LF6F 4ICLB 1SJ1A 2ZNZA 2HLUA 2JEJA 4W92B 5D4PA 5CZXA 2C28A 4OHYA 1U1LA 3GIKA 3FSXA 2FHOB 1NK0A 2EBEA 1JLAA 3VWSA 3E01B 3M8SA 4ECUA 1S6PA 1VQ9S 4CH7A 1U6FA 2COLA 2E44A 3MWBA 4LF8F 1RT6B 3C6UB 4JI5F 1ZPVA 3ENVA 5KT4A 2PA3A 5KG2A 3LPYA 3TOQA 1KQKA 1U1NA 4MAKA 4BC9A 4PQUA 1VQ7S 2KHCA 2FVQA 3NNAA 1AROP 1UMJA 4QWEA 4ATNA 3BREA 4JV0A 3RAMA 4QZVB 5L9XA 2B4VA 5GADU 3Q23A 2R8JA 1U6BA 4JBCA 4U67Q 4KV8A 3W2WA 4YB5A 4DDFA 3J7YU 1RISA 3MOZA 4F4WA 1KHWA 1S1WB 4D3GA 3AAWB 3IC1A 2HHXA 4DSFA 4ZVHA 3VQTA 1WEZA 5A6WA 5M2UA 4PUOB 2J0XA 2MZSA 3VAIA 3T19A 2DNKA 3M32A 5KT2A 4J9SA 5KFOA 3PEJA 2ZH3A 4I4BA 2FHJD 1NJIT 3OR1A 2CVEA 4OZ1A 1HNXF 2IRXA 2GJIA 1VOMA 2AD9A 2BZ2A 2O3DA 2VPYB 3FQKA 1GT8A 2MQQA 4UY85 4M63A 4BC7A 3G86A 3R1HA 3K5PA 1N33F 4FVMA 2O1PA 4DL0C 2AW0A 2KXHA 2UVRA 1JKHB 1LWCA 2CJQA 3JTOA 3U1LA 4MH8A 3NGKA 2DHGA 3SCJE 4URGA 3JTPA 3BJYA 3ITHA 3DRPB 4RW9A 4J9OA 3KG1A 1HFEL 1MWZA 1HBNA 1XMQF 5HBMB 1KRPA 1IN0A 2NSCA 3M1VB 1TKTB 3QPIA 2QA1A 1Y5NB 1U1RA 1S1VB 4DFJA 2ZVSA 3KHHA 3SZ2A 5CXTA 4AL6A 4WKYA 3RR7A 2IM3A 3KYLA 2OPPB 3V6DA 1IM4A 2EVZA 2VA3A 1VQPS 4QU7A 3S8SA 2ZD1A 1X4CA 3QIPB 4I6YA 1LK5A 3BF4A 2NPFA 1TL1B 3FZBA 3GG0A 1C1CA 3C2PA 4ECSA 1MW7A 2XBPA 3OTDA 4B17A 1XK8A 2ZZMA 3DU6A 3MUTP 3K5NA 1MSWD 1FRXA 2QSWA 2DCLA 3WZ0A 2FY1A 1RT2A 3GZ7A 3BQ1A 2CQHA 3VALA 2CQCA 1HWUA 5HP1B 3VAHA 2V0NA 4J9MA 4C0OC 5KG7A 2KJVA 2FHKA 2XO7A 1J5OB 2JFKA 5C42A 2IJFA 3P5TL 3CDBA 5IZHA 3LP1A 3S6EA 4I7FB 2E1RA 3U1MA 1UVIA 1RT1B 4FBUA 1L3UA 2KB2A 2MQMA 3CMAS 2AJQA 3DXSX 2YWHA 3KHGA 2DRAA 1VBYA 1H2VZ 2EFPA 2Q66A 1JLAB 2FVRA 1N36F 4IDKA 3QIDA 4ED6A 1RYRA 3OVBA 4RW4B 1S6PB 2I8EA 5A8RB 5FLXY 3PW0A 3C8YA 1WACA 2W9CA 4WTYA 3IG1B 1BQMA 3O44A 2K1RA 5KFUA 1QSYA 4DR6F 3HFKA 4C8ZA 2IJNA 3GB0A 2XY7A 2LMIA 4DL2A 2QA2A 4PQUB 3FRYA 2Y1RI 5F0WA 5B7WA 4ZS6A 2C3UA 1SIZA 2DHSA 4LMZA 3THVA 2WONA 4UOCA 3OQ2A 5KFVA 2V94A 3W2WB 5KFYA 3QJJA 2E9TA 1U4BA 3FCHA 2VODA 2KT2A 5LSOA 2RRBA 3NL0A 5EWEA 1X5OA 2XMVA 1NKCA 1LFWA 2EWHA 3M32B 1R7IA 3N6MA 3GFHA 4DG1A 2RRAA 1C0TA 3HZEA 4OX9F 3AA9A 3UE2A 1VC6A 3FMWA 2JL9A 4P6QA 3G8TA 3SCLE 3CDUA 2ZOGA 2ZDOA 1UJ4A 4RX6A 3OR1B 1WI6A 2Q43A 4ZPWR 4Q0BA 2DBBA 1S0NA 5C5JA 3BSAA 3ISZA 4JI0F 3I56S 1F0XA 3QGIA 3GYXB 1MU2B 5AXMA 2MJUA 1FDNA 1WHYA 2N7CA 4X62F 1BLUA 4KHMA 5E3QA 2XI2A 4ALZA 5DG7A 1LWCB 2HQIA 3TX8A 3CWJA 1AW0A 2EK1A 6FDRA 4KR0B 1S9GA 4IFVA 3CB4A 2YNGB 3R5CA 3ITHB 2Y0SD 3HDSA 4RW9B 1YTYA 2QFJA 1YGYA 1ZPWX 1HBNB 2ZBCA 4LSNA 5LT5A 2EW9A 1T94A 3IAS9 3OL6A 5HMZA 4XO0A 2X51A 3JTNA 1UA1A 2A1BA 1Y3JA 4Y6IA 1DLOA 2L9NA 2EFNA 3SSQA 4RU2A 2C3OA 3RB3A 4EBCA 2Q1LA 5DO2A 1REVB 4OLOA 3V6DB 1FJGF 1VHFA 4QR2A 4ECRA 2FHMA 1WTFA 1W2BR 2ZD1B 3G6XA 3RB0A 3K57A 1C4AA 4DV4F 2Q6CA 5F8LA 1N8RT 2FGOA 5EDWA 1RKJA 1S6QA 1U45A 1RT2B 2ZFHA 2M88A 2MKCA 2PD1A 3M2VA 1I6JA 4DSLA 2NYIA 4IH5A 2LCWA 1PILA 5I3QA 1WTBA 1HD1A 3SEOA 2IYGA 4V19J 4J37A 3SI8A 4PXDA 2OAUA 1KC8T 4Y2CA 3HMJG 4TY9A 1VBZA 3I9ZA 1L3VA 4JYAF 1JLQB 5C42B 4RNHA 2IMWP 2CJ9A 2V8DA 3M6XA 4OI6A 5KG5A 3OR2A 2AX0A 3I32A 2HG4A 2I0XA 5IT4A 2PT0A 4C8OA 2JDJA 1NB7A 2R7XA 3HHLC 1WF1A 2FJBB 2YWGA 4N41A 1FRHA 2DK2A 5DG8A 3QGHA 4FS1A 4ES2A 4IDKB 3QJPA 3NRBA 2I2YA 4NLRA 5KFQA 3I4PA 2ZH1A 4NCBA 1HI0P 2R4FA 2W9CB 5HO4A 2VFUA 2GC8A 2AWZA 3G4SS 5BYRA 3Q0AA 1MWYA 2J9DE 2QLXA 2ZH9A 2KYZA 4Q44A 4AE5A 4MIWA 2JJ4D 4X4PA 2C3MA 1VQOS 5A0YA 2B7BB 4WE1B 2HVIA 3MPYA 7FDRA 2B43A 4K4UA 3OL8A 1UEVA 5K14A 2DGTA 4ERDA 4OZJA 5DDRC 1DJ0A 1F5BA 1HBUA 3IGVA 4FZVA 1KONA 1GH8A 4HYKA 3PKYA 5CH7B 2LEPA 5HQ8A 4DQPA 1DZ5A 5KFSA 3N4WA 4LSLA 3KK2A 4DFKA 1Q79A 2AJ4A 2DGXA 3N5BA 1BQXA 5B0DA 4C98A 2B5JA 1C0TB 3CULA 4NLSA 4QJVA 5M2RA 4U9RA 1VQ5S 3B8HA 1E6YA 2DTJA 2BM1A 3ETOA 4DL5A 4WCEQ 2VBXA 1T02A 5J2PA 1ZBTA 1R3NA 1NK8A 1SXLA 3A8EA 1FRMA 4PG6A 2X1GA 4NA3A 4DV0F 2J6TA 3NCQA 1ELOA 3PACA 5F8MA 2HW3A 1HWIA 2F8HA 4WFXA 2W8LA 1UVMA 4RBVA 3H5YA 2GGPA 5IQ6A 4TLRA 5GMKa 3GFZA 1QTMA 3G8QA 4RNNA 3MOJB 4O44A 4IH7A 4RWWA 3FSYA 2YQ3A 1S9GB 3WC2A 4IFVB 1OS5A 1XEZA 5G0RA 4ZMMA 4YEAA 3OTOF 2RMLA 3HVTA 2JEIA 1VQSA 4ZHRA 1FJEB 3DMJA 2KVIA 3KNGA 4LSNB 3HXMA 1RKIA 2QMWA 4RLEA 3QJLA 3KLVA 2EC0A 4MJKA 2ZH6A 4HKQA 4AL5A 3HHDA 1Z1ZA 4NZ7A 2XGQA 3LQVA 1DLOB 2CDQA 1BY9A 2XI3A 2OPQA 2RQMA 4CO2A 3CCWA 3T5LA 2DGWA 3O3LA 2BJEA 5KFBA 3QAEA 4IKAA 2ZUGA 2DGOA 2L9WA 3TYTA 7FD1A 5I3PA 2RQKA 4PWDA 5IFMA 4QPXA 4C7QA 1SH3A 2HVZA 2DB1A 2YKNA 2ZHOA 4KKOA 4DV3F 1FKAF 3PY8A 2XS7A 1U2FA 3TA0A 1YQHA 1AFIA 3FDSA 2RF2B 2VZ9A 4AQYF 3TRGA 2JZ5A 3RB6A 2XULA 3ZZRA 5KFGA 1S6QB 1JLEA 3IA0A 2OMLA 5DDQC 4PQAA 1U25A 1UJ5A 4Y2AA 4MTPA 1JJHA 3M2VB 5CCMA 1N5SA 1P1TA 4N47A 2RDJA 2MQOA 1GTHA 4QR1A 4YMEA 4DV6F 2GIRA 2Q79A 3PX0A 3DRXA 2VB6A 3O5TB 3M8QA 2PI4A 4KRWA 1HNVA 4KGKA 1K8AT 3G96A 2LYVA 2E5HA 4QCLA 2BABA 2BYCA 4K5SA 4ELUA 4Q2MA 4DQQA 3GV5B 4OLPA 3US5A 1FRLA 1SQEA 3OR2B 4ZPCA 2DNGA 2UXBF 4QWAA 3PM9A 2BOPA 4ETXA 3PV8A 4PG7A 4K4XA 1B7FA 1XNQF 1DAXA 4DQIA 3BO3A 2KFNA 3B78A 4QYZJ 3NKYA 3GFYA 3OTBA 2MZQA 2XY6A 1G7CB 1F60B 2YKAA 4RW6A 3LUYA 2RUGA 3T9ZA 2IC3B 3CE8A 4ZOSA 4CO1A 4OJHA 2XCAA 4F50A 1ZETA 2A2DA 3AA8A 3I5AA 3VAJA 2R7VA 5B0CA 1G1XA 3AB2B 4V19X 2E29A 1YRXA 5A0YB 3QYYA 1SI9A 2AV5A 2HVHA 1KHVA 4PG8A 3ISNC 2CQPA 3KWMA 5F3ZA 1RA7A 1JLFA 1HBUB 4EO8A 3MM8B 2M7SA 4C3KA 3D28A 3DDKA 5F9NA 4IO1A 4A8OA 3IO1A 2HQ3A 3UFCX 5HMYA 3KK2B 2F9DA 2FLLA 2CQ1A 3CJ4A 4WZMA 1SJ4P 3D1HA 3T5JA 2B5JB 2RS2A 2GHVC 1TKXA 1E6YB 3MMJA 4KO0A 2Z4PA 4TU7A 5J2PB 5E41A 1H0HB 1T8EA 5A8KB 2LDIA 2CPDA 3LP0A 3X1LB 4MFBA 5D4NA 2ZH4A 2CRLA 2JC0A 4YFUA 3FGVA 2WAQD 2VKZG 4QIVA 2UVWA 3DYAB 3R5AA 4AL7A 2IM1A 4ZPAA 2P6SA 2OTJS 3BSCA 3LP2A 3GV8B 3BGLA 5JVHQ 2XNQA 2NREA 2B0GA 1IQZA 4OI4A 4X4QA 1QAJA 3M2RB 5G0RB 3HVTB 1QLNA 1TKZA 4OQJA 2VPWB 4JUZA 4DQSA 2E5IA 3I31A 3C66A 4HI1A 4LVNP 3RBEA 1Q78A 3EGNA 4ECXA 2VONA 1R43A 2LLZA 2LQ9A 5LJ5Y 4FYDA 2UV8G 2K3IA 3THTA 2MDAA 2DNRA 2OPQB 2MJNA 4PPDA 5LXRA 3N79A 2ROEA 1T05A 4ELVA 2G9OA 4EGLA 1YJWS 2JH3A 1FVQA 3KLIB 2EFVA 2ILYA 3HZGA 1S9FA 1XNRF 2MHNA 3CC7S 1H2UX 2MGZA 3CVKA 4CO5A 4PWDB 1GXLA 2W7AA 2YKNB 3FRZA 3I82A 4KKOB 3ZZYA 4O4RA 4JV1A 2XMMA 1VRUA 2M3DA 4MYTA 4G1IA 1LKZA 1N0VC 3O6QA 4MKAA 4RW7B 2A18A 3MPWA 2ZH8A 2AGOA 4NLVA 3NBPB 2YH1A 3FEXB 1WEYA 2ZZNA 2FJDB 4C97A 2DIUA 1UFWA 4F4XA 2K2PA 1ROFA 2MKSA 3M8QB 3TQ1A 1WD6A 1VRTA 1R8AA 2C42A 3C6UA 1BGXT 2CQDA 3DN9A 4C8MA 3OPKA 4J9PA 4B3RF 1R8HA 2DGUA 2R7TA 1AXQA 1Q16B 1XERA 2ZKUA 3I87A 2YWFA 1S1UA 2HNZA 2GIQA 1IBMF 3CPWR 4CI0B 1KFSA 4RUHA 3GYNA 3EZ5A 2PIIA 4RW6B 1VLYA 4RW8A 1X5SA 1Q8LA 1KSPA 2HHHF 4DMZA 2VKRA 2E7WA 4A48A 4ZCIA 5D3GB 3F41A 2W7OA 3K2YA 4RNFA 5DM7Q 1FD2A 1SIWB 3M05A 1O0PA 4NZ6A 5CD4H 4DV1F 2DO0A 3CJ5A 2YWEA 4G1PA 5U47A 1X4HA 3SYZA 1JLFB 4P2SA 1R89A 2XB2D 3D0GE 1GX5A 2I38A 2CKWA 2B4UA 4XDCA 5DG9A 3G6YA 2NPIA 5F8IA 3CDEA 4FF1A 1O5JA 2IVYA 1ZOTA 3RW6A 3V6KA 4X4VA 2VBZA<