2UXCF

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uxcF00
4GKJF 2KJWA 4DV4F 4JYAF 3ZZPA 2UUCF 4DUYF 4JI1F 4DR1F 4LFAF 1N36F 2HHHF 3OTOF 1IBMF 4YY3F 1G1XA 4AQYF 4LF7F 4JI6F 5AJ3F 4DR5F 1CQMA 4LF8F 4JI5F 1IJEB 1FKAF 1B64A 4DV5F 4DV6F 2ZM6F 1CQNA 4DR6F 5BR8F 1IBLF 5LMNF 1RISA 1LOUA 2VQFF 2KJVA 4B3TF 1N34F 2UXBF 4JI0F 2F4VF 2RJZA 2J5AA 4DV3F 1HNWF 2UUBF 2UU9F 1HR0F 4NXNF 1N32F 4X64F 2YY3A 4JI3F 4DV0F 1I94F 2UUAF 1HNXF 4X65F 2UXCF 1FJGF 1GH8A 4X66F 2BXJA 4LFBF 2UXDF 4DUZF 4JV5F 4LFCF 3T1YF 4JI2F 2BVZA 4LF5F 1HNZF 1N33F 4LF4F 1XMQF 4DR4F 4B3RF 4YHHF 1VMBA 1XNQF 4KHPF 4K0KF 4LF9F 4B3SF 2B7BB 4JI7F 1F60B 1XNRF 4DV2F 1J5EF 1QJHA 1XMOF 4X62F 4DR7F 1IBKF 4NXMF 4DV7F 5LMUF 4LF6F 3T1HF 2E5LF 4OX9F 4GKKF 2B7CB 4JI8F 5IWAF 1G7CB 4JI4F 1IJFB 2VQEF 4DV1F 4B3MF 4DR3F 3R3TA 4DR2F
chains in the Genus database with same CATH superfamily
1YI2S 1IBMJ 3TZWA 1DTTB 2RQMA 2JH3A 1KOHA 3W2WA 1RT4A 4QW9A 3V4IB 3Q0AA 3J80Y 2AT1B 1NHKL 5CCLA 4J5OA 4L3KA 4A8YA 4ICLB 1WG4A 4DN0A 1VGYA 1UZHA 1FXLA 2RU3A 1KVKA 2RD5C 2WZ1A 1TMJA 4XK8C 2L41A 1YJTA 5J2PB 4OJGA 4NEYA 3OFEA 1IKYA 5HQLA 3HT3A 3UVJB 2E5JA 4TYBA 1UW9A 3R7NB 1U1MA 3EZOA 2B7BB 1KQFB 2HSEB 3BGLA 4X62F 3I82A 3KXDA 2RB7A 4EWTA 4OHYA 5KFPA 2EC0A 3FQLA 1XEZA 4Y2IA 3E01A 4B3MF 5J1NA 4FPIA 2OP5A 2DH7A 3NMAA 1U6BA 2CPJA 3SIPB 1RT7B 5HLFB 4I2PB 2KFYA 2FIUA 2DH8A 4U9RA 2CG8A 4WFNQ 4C8YA 3FEZA 2BANB 4ANDA 4RUBA 2E5HA 2MLYA 1FVSA 5BR8F 1SJFA 5KT2A 2N3OA 1TK0A 2MHEA 4LSNB 2RQ4A 4PCQA 5HAOA 2D3UA 2X51A 1Q7YT 3DMJB 2C28A 2N4DA 2NR0A 4IO9Q 4X64F 4A8XA 1RWNB 5KG5A 4ZPTR 5GAHU 4USHA 4JB8B 5DDOC 2CNNB 1NK6A 5K14B 3DFEA 1SUQA 3T9ZA 5LOQA 4I6YA 2DNHA 1FFGB 2IJNA 3PW5A 3DLHA 1V6HA 2WB4A 1LWEA 4WE1A 3QMQA 2F4FA 1F5BA 5F8IA 2BRKA 3DOMA 1TVRA 2IDEA 2RDDA 3LA0A 1R0CB 2KJWA 5EWGA 3ZZPA 3EGVA 2QG9B 1NMEB 3E2EA 5H9FK 2V2KA 1X5TA 1JLQA 7AT1B 2KT2A 4BWJA 4RNHA 4ZOSA 4CO4A 4DQIA 3T19A 2C42A 4OI6A 1UMJA 3IWLA 2R7UA 1NK4A 5E41A 1QVFR 6FD1A 1AXQA 2VQFF 3QSIA 1NLKL 2UXBF 4JI3J 1X7VA 2UXCJ 3QIPA 4NEZA 5G0RB 5KT3A 4F26A 1LWCA 4DU8A 1RYSA 1VQ5S 2QYCA 3MMBB 4CM2A 1PC5A 4PPZA 1W2BR 4X4PA 1UPMB 4ZVTB 1WNEA 2UXDF 1NPRA 1ZM4A 3S8SA 1GEHA 3LTOA 1NK8A 1EB0A 5F0WA 2Q6CA 3OL8A 4ZP9A 4RW7A 2G2ZA 5F3ZA 5DG7A 3KLGA 1YK9A 1SJRA 3TWZA 2A6OA 1RKIA 1XR5A 3PO5A 4DR3J 2KM8C 4KGZB 4NL5A 2G4BA 2HKEA 2D41A 4JI4F 2YWWA 3TAPA 1QDUB 2XMWA 2AMCB 4DG1A 2LEAA 3A4TA 1S6OA 2QLBB 1FRXA 3AHPA 3RU0A 1RADB 1XC9A 1N6QB 3CCWA 4FN5A 4LR8A 4R8UA 2E9RX 2HNYB 3FMWA 3TEHB 2OEJA 2K2PA 3P45B 5KOXA 1RAAB 2R3VA 4E2FB 2P9CA 2R2UA 1X0FA 1UWBB 4M5DA 3D1HA 3K57A 3FFIA 1OY6A 3TNVA 2MQ8A 1S9GA 2HFOA 5KAKA 5EGYA 2FC9A 2GO8A 2XHWA 4DN9A 3DM2A 5IFMA 1M5HA 3I87A 4CLPA 3DGPB 1C1BB 1KVJA 3EXCX 3DRPB 2XGQA 1U26A 4A8OA 3ENVA 2CJYB 3DRXA 1MWZA 1JLEA 3BPSP 4ED0A 3QFHA 2GVZB 3CW2C 1IBKJ 2ABYA 3T1HJ 3NGKA 1F3VA 3TR5A 2DO0A 1WI8A 4AE5A 4B3RJ 4GKKF 5KT5A 4PWUA 5H9EJ 2RUSA 3SV4A 4DUYJ 4R5PA 2Q79A 1HLWA 5E3AA 3PACA 3KLHA 3BM7A 1WACA 2ROGA 4PYDA 2WTFA 2VL1A 1TZ0A 4CZCA 3N9UC 4YR3A 3E3XA 4ZCMA 2RILA 4EYIB 1S77D 3DYAA 3GILA 4DV3J 1PYSB 1S0VA 1JLBB 4OJ3A 1Q5VA 1TU0B 1VQ7S 1HBNA 4N77A 5DDQC 2FYXA 5HP1A 3OQ2A 1BQMB 2OSQA 4EK2A 1JB0C 1MMDA 1RJJA 4DV0F 3Q8RB 4Q43A 3BGUA 2OEMA 4JV5F 1C0UB 1FKOA 3CUNA 2YKNA 4MYTA 4PWDA 4USUA 2CQDA 4I7FB 2GGPA 4YB1P 4L74A 3QO9B 2WK4A 2CWXA 2ZITA 2XTJP 4NLRA 2LQJA 2JJ4D 3G71S 4KFBA 4DR1J 3CDEA 3KG0A 4FKXA 1RE1B 1NB7A 3JB9k 2C2NA 4Q7AA 1EKSA 2RH3A 4KBIA 2DIUA 4A8KA 2QC3A 3M1VB 2MXYA 1IWAA 4CTAA 3DOKB 1BGXT 4KPCA 3W2VB 2DGVA 3ENQA 4DBQA 5D3GA 5KFYA 1RTHA 2YH1A 3PV8A 2BEFA 4ZVQB 4I2QB 4KPYA 1HQUB 2GZOA 4ECRA 4KKOB 3O1LA 4MKVA 2Z0GA 2CZ9A 5ADZA 2OPRA 3T5KA 1HNZJ 4FYYB 3HX9A 1KNZA 3BQ2A 3L4BC 2N82B 1JX4A 2IIHA 2B4PA 1PBAA 4ETZA 5J2QA 2XLKA 2DCUB 4K4XA 1AYEA 3HD2A 1U6FA 1HBOA 4RR5A 4DR7F 3DHXA 4NA1A 1ACMB 1MNEA 1WC5A 2JOQA 4RW6B 3M2RB 4CLWA 1NK7A 3BKFA 1RHUB 1VRTB 3TUIC 1RWMB 3UR0A 1CJUB 4URGA 2HPUA 1XR7A 3UFCX 2QN6B 4Q0BA 1TL5A 2MQNA 4NLUA 4OZ3A 1CULA 2VFRA 4KO0A 3M32A 4ZIWA 3BGOP 5AXNA 4IO1A 2G0JA 4O3QA 3TUPA 4LRAA 3EM1A 4QIWD 2MZTA 1HNWJ 2BKNA 4DV5J 2V2QA 2MMYA 2UU9F 2DRAA 4C7QA 1JXEA 3UCGA 5HSPA 4W98A 5KOWA 2DNOA 2C2OB 3BN4A 3GFZA 1B0VA 4XTTA 4DHVA 3MECA 3HHDA 5KFGA 1JLAB 4LF5F 2C2EA 4OV6A 3PX4A 3HCXA 2HFZA 1GMVA 3PZPA 1IR0A 3SEOA 1S1XA 4DUZJ 4C8OA 3PCOB 4F4WA 3BDEA 1RT2A 3RB6A 1OPZA 3R27A 3TA1A 5ETQA 2DY1A 2QO3A 5BXIA 5HANA 2NPFA 1F2HA 2VKZG 4ECYA 4O4GB 4JI1J 4LFAJ 2E1PA 3QWUA 1H2UX 4YR2A 4QYZK 2UVWA 4Y65A 1N5YB 2F3JA 3D6MB 2AYGA 3VWSA 1HNIB 3GCXP 4ZK7M 4W90B 1S4FA 2KXNB 1UCNA 3CC7S 3OXGA 2Z57B 4DFPA 2PA8D 2YX1A 2UVUA 3LP1B 3QLHB 3F41A 5C42B 2PI5A 1FJGF 2DD8S 1YZ7A 4CM0A 2RHSB 4QWDA 1NXIA 2EFNA 4KV8B 4KHRA 5F0UA 4ECXA 4K0KJ 3H0PA 3HPOA 3AOAA 3N5BA 4NLQA 4OI1A 2QSFA 1I5OB 3OSNA 1EQ0A 2F9DA 4ITSA 4B3OA 3J81j 2EFPA 3FSYA 3NS7B 1TFWA 5F8LA 4GRSA 4WU2A 3BSOA 2C3YA 1XNQJ 3MEGB 4Q8FA 2P8IA 4Y6IA 2ADBA 3TAMB 1ZYQA 3N6LA 3KJVA 4F04B 1VIOA 3D28A 2IRYA 4MK9A 5D0HA 2FJXA 3MUMP 5JVGQ 5L8RC 3MZIA 4JI6F 2FUG9 3D0IE 4W4MA 2H3EB 1RAFB 1YG0A 3V6DB 4F0MA 3JQJA 2GJIA 3PJWA 2OKQA 2BDPA 1M5PC 2H4YB 3W9JA 1IXKA 2CADA 2SXLA 4ALZA 1NJIT 2LKZA 4DZ6A 2VC0A 2DGSA 1I94F 3ZZYA 3V81A 3MR3A 1SIWB 2K1RB 1M90T 1RTJA 4NLTA 3KJQB 3A8KA 3BB5A 4NA2A 3X3UA 1ZM3A 4NXNJ 4WJBA 3TANA 1PIEA 1KEKA 3I5CA 4TQSA 3TA0A 1KLMA 1Y4ZB 1PC4A 3D3CJ 4ZA1A 4P2XA 3I0RA 4ZPVR 5A8KB 4ZPBA 1EX8A 4BBYA 2Z4PA 5IWAF 2F8EX 2I9SA 4BS2A 2W9BB 3VAGA 1TKTB 2VBXA 1NJWA 4O3SA 2KFNA 2ZH3A 2BOPA 4DLEA 2V63A 4JI8J 4IG0A 1CJTB 1YLXA 4ZDNA 3A8IA 4MAKA 2EBGA 1OYEA 1G1XA 2NPIA 4U96A 4K4YA 1RTDB 4ZVOB 1QSYA 4LR7A 2F4VF 4OL8A 2Z2ZA 1HBMA 4NWBA 1TKDA 1OSCA 1DQ8A 2RQCA 1A9NB 1R7IA 5K8PA 4MTPA 4A8FA 3KFWX 4P2MA 1RT3A 4O0NA 5CZXA 3FUYA 3K59A 1JIHA 4USIA 1D9DA 4KHPF 2RF2B 3VAJA 5KFWA 1N52B 3LH2S 2ATLA 2KDOA 3IM8A 2PE8A 4P2SA 2HW3A 2AEFA 2FDNA 2W8KA 2DY9A 3K8WA 2UUCF 4OV1A 3A13A 3NKYA 2B51A 4KSEB 4OYBA 2MY8A 1FNXH 1GQEA 2QX0A 3HVWA 4CP5A 4AL5A 1X60A 4LF2A 2AZ3A 2YKOA 2CQBA 3HZGA 2AJ0A 4UUWA 4NI2A 3PRVA 3RBZA 2VASA 5J1EA 2X3DA 1HHTP 4O3PA 4DPOA 3M9OB 2IDLA 4CO0A 1R8PA 3UN2A 1FEHA 3CT9A 4XIUA 3IR5B 4UZBA 3QIDA 1E6YB 4LR9A 2IVFB 2JHEA 2A6MA 3H98A 4M5HA 4OX7A 1X4BA 1S9EB 2CQ0A 3UI3A 2XO7A 1IN0A 4TLRA 4PQUB 3S7RA 3LP2B 1B4SA 2N3LA 4Y28C 5A6WA 4P2FA 1UA1A 5H9EK 1S0MA 3HULA 2R7SA 3MAHA 3KUGA 3CJTA 1FTRA 1AZSA 2M2BA 2J6TA 5I4MA 4B9UA 1SV5A 3QZ8A 2RAQA 4F02A 2AQ4A 2FHOB 3A3PB 1S1UB 1N36F 1N56A 3DLGB 3AJ2A 4MFBA 4MIBA 3DKDA 5KG6A 5RUBA 3SFGA 2DNPA 2IJFA 4FF1A 2Y1JA 2H48B 4J9UE 2YNFA 4V19X 3MAAA 3ELHA 2HG4A 5LXYA 5KFCA 4R0EA 4F2RA 2HURA 3W8GA 3TX0A 2AU0A 4NYPA 4DS5A 4MT1A 2WBMA 5MAOA 2VQFJ 3HHLB 5LSRA 1JLGA 2W7PA 5KG1A 4P74A 4TY8A 3HVAA 1FK9A 1JLCB 3SCIE 2VA3A 2QSWA 1TUGB 1F6TA 3GV7B 3ILJA 4IOBA 3OFFA 1F0XA 3BDPA 1R6YA 1WSRA 2PMHA 1HARA 2DGWA 3W7BA 3IBWA 1WC3A 3H42A 1WORA 1HQEB 2AEMA 2L9WA 3AD9C 1GFWB 4JI4J 2UZAA 4LSLB 2A0FB 4LUBA 2O66A 3IO1A 3LP0A 3M6XA 3MPVA 3N6NA 2DHGA 2VG7A 3QWPA 2YX7A 2ATCB 1LW2A 3KMSA 3DRSB 3OTCA 3WIVA 1RHMB 1S1WA 4O44A 1X4HA 2W7AA 3DHWC 1TKXA 1YRUA 3OD2A 1Q78A 2ZH9A 1PSDA 1S79A 3RGIA 2NXCA 5FLXU 1XMQJ 7FDRA 2AGQA 1A7GE 1ELOA 2AV5A 3DXSX 3PXGa 5IV3A 3JSMA 3JYTA 1FVQA 4B08A 1RBOB 2XYPB 5DO2A 3RB3A 5GAEI 5C25B 1SI9A 4HACA 2OFGX 3FK4A 1WDDA 1HHSA 1AFIA 3I4HX 2J0XA 1HKAA 1Q5YA 4RW8A 2ZBCA 1UAWA 3PX0A 1N48A 4GKKJ 3CD0A 1BXNA 2IYGA 2WVFA 2R7OA 2C2RA 2V9WA 2DYAA 5A8WA 3H4BA 4WTYA 3BJYA 2CJBA 4OYWA 4DR5F 4MK8A 4M5GA 3A8JA 4F0KA 4CLUA 1FKAF 1RHKB 3DRRB 4FVCA 3KJFB 3M2UA 4CQ1A 3UNGC 1RYRA 1UKUA 3QFWA 3KWMA 1NPPA 4C2MA 5H1SV 3UDLA 1J27A 2BKPA 3KHGA 2DGQA 1TFYA 4QQBA 4JV5J 1RDRA 1FA0A 2G0CA 2EK6A 4JI7F 1K8AT 1PJ5A 1U49A 4ZCKA 2QZ8A 3W3SA 2XBPA 4C8MA 1UJ4A 2HHPA 1N5QA 3BZQA 1WKLA 2P9GA 5KFFA 2VOOA 3FRYA 2WVBA 3HHLD 4YY3F 4ILRA 2DPIA 3KK2A 3NS6A 2CA9A 2NSBA 4ZLPA 1AT1B 2QFJA 2YWFA 1CQMA 2GW8A 4WFBQ 2OD6A 2VF3A 3C6TB 2HGNA 2Z8QA 1DQ9A 3MEEA 3TJ9A 2WW8A 4RKUC 4PEOA 4K4ZA 4XAKA 4GO5X 2LP4A 1RI7A 5L39A 4X84A 3KKFA 3BV8A 3QGGA 2KFZA 3QNWB 3ILLA 3VCDA 3L7UA 1Z2ZA 2DJWA 3ZTOA 2MKIA 2OPPA 2C1EB 1JXLA 5B0AA 3GYNA 1RT5B 4IH7A 1G3OA 8AT1B 1EETA 1NHUA 1S6PB 1FD2A 4GO7X 2ZHAA 3LAKA 4F4AA 2HRTA 3ONQA 1VQKS 2AYMA 3WIUA 2OUGA 3AT1B 1IJFB 1T9YA 3CCJS 2K3KA 3QATA 1VBXA 1SH3A 4CO3A 1H7WA 4PG5A 4H4KA 3PYGA 3TUZC 2HNDA 3FSXA 1YITS 3JTPA 1IBLJ 1ITPA 1TL7B 1XERA 4A8WA 1GMUA 4CNYA 1B3TA 2KRRA 4DX5A 2XMMA 2W01A 3UDCA 3UR3C 1DHMA 1S12A 1VCTA 2AEJA 1O51A 1UL3A 1SL1A 2RHQB 1WG5A 1DZ5A 1GMWD 4U8VA 2XSFA 2DHAA 4HL9A 4DL7A 4PABA 2J6UA 1K47A 3H25A 1NK5A 1J5OA 2HK3A 1PGZA 2HHTA 2OJ3A 2EG1A 1KHWA 2I0XA 4LRBA 2HVEA 1RTIA 2B5JA 5THWA 5J2MA 3AOCA 3MTJA 4QPTA 3ZZOA 5E3CA 3RR7A 3N6MA 2G1HA 2ERRA 3LWMA 3B4MA 4WIQA 5IC4B 1SQEA 3AODA 4USJC 4LF8J 3TQ1A 4MMOA 1AUDA 3W9IA 3V2UC 1FX4A 3ISNC 2FHJA 3RW6A 2QEXS 3LWLA 4LREA 1QVGR 3TZXA 1NDLA 3WHIA 2GJFA 1E6VA 1FF2A 4FBTA 2VG6A 4IG3B 2ADCA 2B8QA 1FJGJ 1DARA 4DR4F 4HVZA 1EAYC 2MZSA 5HROA 4LF9F 2HQCA 2B4UA 1T7PA 1M1GA 4IKAA 3GIJA 2GMJA 2B6AA 1G7CB 3JQKA 2PMZD 3WC2A 2KI2A 4GKJF 3B4DA 1W25A 3IRXA 2J9DE 2XCAA 5LXRA 4JI5J 1T3OA 3M4XA 3Q8YA 3Q8QB 3NMRA 2KT5A 2RT3A 1OY8A 4NLYA 2CJKA 4L76A 4TQRA 1Y5IB 2EKYA 4M5KA 2AHOB 1U0SA 4CH1A 3POTB 1WEXA 2J0SD 2B9YA 4RU2A 1MW7A 1CSJA 1H7XA 1GH8A 3P96A 5B08A 4F7VA 4Y0FA 3U7JA 1Z4UA 2EG2A 4JP8A 1DTTA 5D6GA 1PAUB 4TXSA 1FESA 2DNYA 2MJNA 3HJVA 2M4MA 4J9QA 4QZVB 1V3RA 3AA9A 1EJ7L 1JNRB 3MM7B 4WIIA 1AFJA 2BACA 1TUWA 3MMAA 4RL1A 1UVIA 1VJQA 5KG0A 2MEWA 2RRBA 3DLKA 4JYAJ 3HD1A 1HMVB 3UE2A 2OTLS 3H2VE 1FRHA 3O44A 1VLOA 3OW2R 3OV7A 4XPCA 3ET6A 1YTYA 1DRZA 4FYDA 2ROEA 3M8PA 4ATNA 2EFVA 4F50A 2A2DA 1U48A 1VBKA 4ZPCA 5CD4H 2DXDA 4PG4A 3D66A 4OHWA 2DH9A 5KFOA 3SCJE 1VQ4S 4YS2A 2IMOA 3M8QA 2NREA 2QA1A 2F4VJ 5BYSA 1S49A 1GX6A 4ILMA 2MZRA 2HK2A 3KK1B 1R3NA 2HWIA 2X3GA 4K4WA 3OTDA 2CQ4A 1X9MA 1RABB 3T1AA 2R8HA 2LMIA 3QRPA 2BQUA 2QMWA 4ZHRA 2BR0A 2EI5A 3VGUA 4OZNA 2XZDB 1VC6A 2YX4A 2YWHA 2ZH5A 1Q7LB 1FNOA 4EBCA 4KHPJ 5HBMA 1HYSB 3W62A 4L3NA 3D5MA 2RKIB 3GB0A 3MR7A 4QR0A 4ED5A 1Q8IA 3KJNB 2ZJRQ 3D67A 2KVQE 3ETMA 5LSOA 3H8YA 4DX6A 4B9TA 4ZLLA 3IGNA 2CJXB 3MM8A 4ZVFA 4DR6F 2BJ7A 5FDLB 4YQWA 1TMMA 1KONA 4C48A 1KQSR 2Y8WA 3HK2A 3L9ZA 2VFVA 5IXUA 4P7TA 3C46A 2COLA 4J9PA 1RT1A 1HD1A 3FCVA 1RUSA 3RAXA 2DR6A 5JMNA 3IAM9 2DO4A 2DR8A 3W2WB 1B99A 1RAIB 1R8BA 1RT4B 2X1AA 5LMUJ 3EJMA 2D9OA 2DIVA 2H5IB 4LMZA 4DEZA 2ZH2A 2HQDA 4PKDB 1RU1A 4N7TA 4NZ7A 1UJ5A 3NEKA 4NCAA 2J8SA 2NQPA 2MKHA 2MQLA 5G0RA 4ZVEA 1TK8A 1TKZA 3CJSA 4N5SA 3MMBA 4ZIVA 2G13A 4ZCLA 3UW1A 2VJUA 1IKYB 5L1IA 1VQOS 4O4RA 2PIIA 1PCAA 2O1PA 5AXKA 2EVZA 1VRUB 2OPQA 3AQOA 3I9V9 3O6QA 3OUYA 3QJLA 4ILLA 2PFFB 2CPZA 3DU5A 4N76A 2XYHB 4ZP8A 1HNXF 3BBFA 2APOA 1LWFA 2FY8A 1RHJB 3E01B 4ER8A 1M5VC 1MN9A 2EC2A 2YQ1A 5KFEA 4DV2J 3I0SA 5C2CA 4F4KA 3CJ0A 1AROP 3G9CA 3OVAA 5DGBA 1B70B 2ZH4A 4Q8EA 4ECTA 1LFWA 2B7CB 3AB4B 3CJ5A 3BGRB 2ZE2B 3IWNC 2VQEF 2KKHA 3MM6A 2DK2A 1U0HB 3SCLE 3DGPA 3ENAA 3D3BJ 3D9BA 1UVJA 1OMSA 4OMFG 2YWEA 4B9VA 1T05A 2V2VA 2CJ9A 3VAMA 3QPIA 4RNNA 5EN1A 4A8QA 3R2DJ 1SUQB 3U27A 1HNVB 1ZZFA 2YKMB 3KDOA 4I4BA 2A10A 2GVZA 2C2KB 3L09A 5KG2A 4EBEA 4CNZA 5DZ7A 5IS2A 3QJJA 4IH5A 4DL0C 2F8HA 4WE1B 2B9WA 2E7XA 3HO1A 2GAGC 2IJRA 2IRUA 2IVYA 3DOMB 1TVRB 3AD7C 3R97A 3DU6A 5E33A 4FDFA 4MH8A 1MMNA 1O5JA 1KQGB 1U47A 1XK8A 2FQQB 1X4GA 3LOUA 4ZJLA 2ZVIA 4YHHF 3LPYA 3KK3B 5HL7Q 1F60B 2OLWA 2AYBA 1J2VA 3GG0A 1ROFA 2LEBA 2V8HA 4DV7F 5KFSA 4C11A 3T3FA 3HKZD 4DV1F 1YSJA 3OSPA 1KS2A 2Y0BB 2E1MC 4J37A 3QIPB 1YQHA 1JKHB 1LWCB 1WDTA 2VV5A 1ZTTA 5BYRA 4ZPWR 2M5YA 4OZ2A 1N4LA 2E44A 3AQPA 2ZM6F 2HFVA 4WK3A 4RW7B 4J9NA 2ZHBA 4I7FA 1NH8A 2XMJA 3Q22A 3DOLB 1NNDA 4ZVGA 1PILA 1YWXA 2OAUA 5GADU 3MM9A 1XR6A 4DOZA 3ENWA 2KN4A 3J81Y 2EKNA 3NG8A 1YBUA 4ZN1A 3GV8B 1SH0A 4AT1B 3R5BA 3CCES 3DI6B 1EKRA 2HQFA 2GMHA 3OJUA 4H54A 1J5EF 1ZA2B 1VHFA 2Y9HA 4ZJOA 3DOKA 1DLOB 1RWXB 2MY7A 3W60A 4M5DB 4DV4J 3FFIB 1SKWA 1S9GB 2J7WA 5AE2A 4DR2F 1Q81T 1WHXA 3UPFA 3DM2B 4DPWA 5C24B 5DQGA 4N47A 3K8VA 3SQOP 4KKOA 3FBFA 3CD6S 2V5HG 5L9NA 4C6AA 1RZMA 5ETPA 3CNQP 2ALYB 2R8KA 4F4XA 2XWXA 3FZBA 4YY3J 4DLGA 5I3PA 2XGPA 2G0IA 3BBBA 2PA3A 2LFVA 3OR1A 1TR0A 3MM5A 3E51A 1FERA 1GT8A 1UWAA 4RW6A 4ANCA 1Q95G 3BSAA 3GU0A 4OI2A 1WOSA 4R5PB 2L9DA 1IVZA 1CJUA 4Y2KA 1DTQA 5FIIA 4RW4A 2HIQA 1RCXB 4QWBA 2HVHA 4DL5A 2NXNA 3CMQA 4GVLA 2VJVA 1YJVA 1SKRA 3PO4A 2VIHA 4HR2A 2I1RA 5I3QA 3SSSA 2VG5B 2CVEA 2WW4A 1UJ6A 1HBNB 3VALA 5HP1B 2RDJA 3J7YU 2D7SA 1RHQB 4CLTA 2MTLA 1CJVB 2QA4S 2AP6A 4IQXA 2QRRA 2ZZMA 1MMLA 1U6ZA 1JLAA 3B54A 1I51B 1BD6A 2JDJA 2CAJA 2HQGA 2GHPA 4X4UA 2GGPB 2IVMA 4WFYA 2ZVSA 3NCRA 3BGFA 3VR1A 3Q8UA 2JFKA 4YDXA 3NAHA 4WZQA 2YKPA 1DFDA 4UQGA 5DGAA 2U1AA 1YJ9S 2ZH7A 4KFBB 2HHQA 2DR9A 4ES1A 1YZ6A 2G9OA 3FBBA 3TJAA 3EGNA 4KT0C 3V5RA 1V5IB 1FCAA 5T7LB 1N5YA 4M5LA 3CDWA 3TOQA 3BO4A 3ZZRA 9RUBA 2W7OA 1YJUA 5D3GB 2B56A 4IRKA 2R8IA 1X4FA 3RB4A 1RTHB 2NS1B 1U1RA 5IT9U 3DNCA 3LO3A 2CPIA 2B0GA 2GCFA 3C16A 1NHVA 3LP1A 1KVIA 4HI2A 4LT6A 4NPOA 4QJVA 1ZA1B 3CMAS 2H9ZA 1NKCA 1F3FA 3BH7B 4KR0B 5J2QB 1ZS6A 1IR2A 1VQPS 3SSQA 3GTYX 3T6BA 2IAJA 2RJZA 3MFHA 1N5VA 4OI0A 2IBOA 3UO0A 1EQMA 4ES2A 1OO0B 3CCLS 1HPZA 1IR1A 5EUHA 2AJFE 4OYAA 4LFCF 1W2IA 4OZ1A 4KGXB 3R6GB 3TAMA 3C15B 5KG4A 2Z56B 2J8AA 5I42B 4Q0BB 5KFTA 2IC3A 1CULB 4HHJA 4KO0B 4NLDA 1ZAVA 2V4JA 5HK4A 3OR2B 4H4MA 4DR4J 4PR6A 4DSFA 3V6DA 1U2RA 4ZVRB 4OX9F 2DEJA 3CC4S 5DM6Q 3I96A 3OXLA 3EVOA 2LXUA 5CZVA 1MU2A 4CLYA 2GQ2A 4M5NA 2E9ZA 1Y5NB 1RWVB 2JSXA 4QPXA 3I9ZA 3NLCA 3IFEA 1ZTWA 4CLZA 2FVQA 5KG3A 1S1XB 5AT1B 4I64A 3KTQA 3KDNA 4LBHA 3HSZA 1Y11A 2V94A 1RWKB 3BO3A 5A8KA 5DDPC 4ZMMA 2D9PA 1FJ7A 3S1TA 4EI2A 4WXOA 1KN6A 3EVWA 4ZPAA 3MOJB 1KDNA 3PW4A 1N5TA 4PQAA 1MWQA 2EPIA 2RIJA 3HSJA 1JLFB 3T6JA 5F9LA 3PEHA 4BC7A 2WSFC 1Q4RA 1NKBA 4QYZJ 4JV1A 3THPA 4MYUA 5DDRC 2WOMA 1VLYA 3PEJA 1Y00A 2GIQA 2OO4A 1HD0A 1UTAA 2BJ8A 3BSCA 4KTQA 4USVA 3CJRA 3TJ8A 3OTOF 2GJ2A 3GYXB 1UEKA 2JL9A 3M8YA 3RAMA 3OHAA 3MDFA 4DF4A 2ZEJA 3I5BA 1KSPA 3IM9A 1M1HA 1SJ3P 3MHYA 5CQGA 1HHQA 4B9NA 4J9VA 4WP3A 2MDAA 3NWRA 4J91A 3UWTA 2C3UA 1FDDA 2AX1A 4HLBA 2MSSA 3T1YF 1WKJA 1S1TA 1DQAA 3TUJC 1T9XA 3KJVB 4WPAA 4FP9A 4ZLNA 3DDKA 1I1GA 3W63A 3M8RA 5KFLA 3MF5A 4OQJA 3UD4P 3PIOQ 4J9LA 5J2NA 3QJPA 1XTZA 2QMXA 3AXMA 1K9MT 2CPFA 1D09B 5CHCB 5L1JA 3UN5A 4QWAA 2XMKA 1IBMF 3V81B 1S0OA 1RAOA 1RTJB 3NGRA 5IM0A 3J80U 1HWLA 2C3PA 2BQ3A 5LMNJ 4UOCA 4ID5B 1H98A 2ZH6A 5HMZA 3JAMY 1U24A 3M8ZA 2OHDA 1VK8A 3TX8A 4PQUA 2A3JA 3LP2A 3I0RB 3SDEA 4DR6J 1WEZA 4EUVA 4ECUA 3Q2SC 2J6SA 1QLNA 3IBCB 2V8GA 1P8GA 5DLGA 2QLFB 4OZJA 1MROA 2GQQA 2HNZA 1X9WA 3G8SA 1VOMA 4GC7A 2BJDA 3O8WA 3V6KA 1RKJA 5ETRA 4LF6J 1RK8A 1K0VA 4FKYA 3CJ8A 3NNHA 3KHHA 2K7JA 2UV8G 4CLFA 2HAFA 2VBWA 2FJDB 5ETSA 1IBCB 3OL9A 4OYOA 4U7UK 3MR2A 2EK1A 1Y7PA 1U4BA 1Q8BA 3D1OA 5IZHA 1C4CA 1HBMB 3V4MA 2AX0A 3NRBA 1QM9A 2WVCA 4UOFA 3C14A 2XLIA 3LGHA 2H5JB 2A2CA 2HMIB 3S01A 1JLCA 1RT3B 2EBEA 4DX8H 3DLEA 5F41A 1X4DA 2B4OA 2YNGB 1HR0J 2C3MA 1H72C 3M30B 3OXFA 3W61A 1KKHA 2BMBA 2YQ0A 3GV5B 4O3NA 1NU4A 4K8RA 2YBVA 4RNMA 2OH2A 2Y1RI 2KYZA 3FCHA 3L3CA 4IRCA 1XMOJ 4LSLA 2W2OP 3QGHA 2YPYA 3ZC4A 4PRFA 4PPDA 2LXIA 2FZGB 4C98A 3B78A 1SC6A 1JNZB 4F3MA 4F8RA 3WDOA 1ZAWA 3DRSA 2MKJA 2BE2A 1UVNA 3O2IA 5AJ3J 1YJNS 4CYUA 1X5OA 3F56A 4YUDA 4FS1A 1QAIA 3FGVA 2VICA 1JXVA 3DLLQ 1N34J 2ACYA 2GMLA 1IKWB 2DCLA 2BYCA 3G82A 3P8BB 1TELA 2BQRA 3X1LB 5BYQA 5HMXA 1B7FA 5C25A 4JI3F 5E2QA 1LK5A 2UUAF 2JNJA 3IG1A 1P1TA 2UXCF 5E3PA 1RBAA 4J9OA 1AZSB 3FC9A 2IM1A 2F40A 3IC1A 3PYEA 2Z2YB 1CVJA 5HN0A 1HFEL 3J7AN 3HLUA 1CC7A 2N7YA 3TZYA 1TL3B 1FWPA 3N28A 2J9CA 3FMBA 3DCAA 3OT9A 4ZCIA 2VDHA 4YHHJ 3DRRA 3TVZA 1KTQA 4DR3F 2LU2A 2WVDA 1URNA 1ZETA 4IOCQ 4CH0S 3AH6A 2DBBA 4JV0A 3PJXA 5B09A 5LSLA 1LKZA 2ASJA 2FJBB 1JLGB 2ZD1B 2W24A 3LW5C 2FLPA 2JFDA 1FK9B 1YHQS 3PTWA 2GO9A 2DXEA 4J9MA 1WC4A 3EGWB 2FJAB 3M2VA 1WF1A 3TW0A 3KNGA 4A48A 3CO9A 1YKWA 3GMGA 2ZM6J 3HHLC 3UQSA 1NSQA 1B0TA 3H2UB 4DSJA 2J76E 1WG1A 4OI3A 2NUHA 4IFVA 4TYAA 2AJ2A 3AAWB 2NZ4A 9ATCB 4CWBA 2QL7B 2QJ3A 1RQ0A 3TARA 5LJ3Y 2OMLA 3GE9A 1K1SA 3FRZA 2DB1A 1Y3JA 1TTHB 3U1NA 4DCPB 1IBKF 2CVIA 3T1HF 3WC0A 2CQ3A 1LW2B 1TAQA 1J5EJ 5ETTA 3IGVA 2JLFA 1S1WB 4O44B 3EZ5A 3C19A 3T5JA 1TKXB 2XM3A 4DUYF 1DJ0A 1URRA 3GSDA 5KFRA 4USWA 3Q2TC 4KJIA 5DG9A 1NRKA 2H1YA 2IM2A 4DFKA 1RT5A 3PR5B 2MSTA 1S6PA 4DV3F 3BYPA 5EX0A 3NBPB 4HACB 3MUTP 3VZHA 4DFMA 4FF4A 2PD1A 3RJMB 4DS4A 2L9NA 2OSRA 1MWYA 1NSPA 1EARA 1Y10A 2BOAA 1XJWB 3NNAA 1XNRJ 4IDKA 2QL9B 4GC6A 1U1LA 5HJXA 2PI4A 3N0VA 1NDPA 3J7A1 1N0VC 3ADAC 2V68A 2F9JA 3HFVA 2H51B 1WC0A 4I56A 1BQXA 1WF0A 4TU8A 3M2UB 3K17A 1S0NA 3IR7B 1S48A 2NXJA 1RLDA 2RQKA 2ZKUA 4DR1F 3PIPQ 3AJ1A 4HEA9 2LLZA 2VPWB 3CJKA 1F1BB 2KHCA 2PGCA 2AYEA 6AT1B 2DHHA 4HDGA 3HDSA 2LYVA 4B3TF 1CJKB 3CDBA 1D9FA 3CF5Q 3C6UA 2CQ2A 3M6VA 4K2JA 4JI2J 2OGUA 1N33J 2JWNA 4ZVUB 3C8YA 4C8LA 4RUCA 2P6TA 1RWOB 2RMLA 2Y3YA 5D4LA 1HNZF 2FVSA 3W5YA 3HVTA 3JSRA 2HGMA 3DLBA 2WHOA 3HZEA 2JLGA 4K7QA 2HLTA 1AA1B 5KTQA 1BE4A 3M9MB 2I2YA 3CD5A 4DPUA 1FFWB 5KFUA 2V67A 1HA1A 3MEEB 4PXBA 3VTIA 3EICA 3MD3A 3BQ1A 1R8CA 4EEYA 1EIYB 3M6UA 2RVJA 3D6FB 3AB2B 3TQEA 5G4DA 2ZZNA 4M8LA 2LQBA 3VVTA 4AD6A 3MCOA 1FI4A 2OPPB 2HFNA 3JS9A 3LUYA 4F3OA 3A12A 3EDQB 4HH1A 4HT7A 1WELA 1VQLS 1CC8A 4A47A 1VIXA 3U1LA 2UUBJ 2J0WA 1N32J 2XS5A 2XY7A 2LQ8A 1NKEA 2U2FA 2CQGA 3CDUA 1HNWF 2PT0A 5E0OA 3CJ4A 4EBDA 3MXHP 2HS3A 5IQQA 2VH7A 2A18A 2WONA 2WBRA 2DGXA 3GJQB 2F7VA 4Q5VA 2CRLA 3OPKA 1NK0A 2IY5B 3MEDA 1RGVA 2M9KA 4LFCJ 2LA6A 4EGLA 2HNDB 5HI7A 1T9WA 3I6PA 4KHMA 4BDPA 1QJHA 3HSGA 4KAIA 3W65A 3Q8SB 2FVRA 2DEIA 3TRGA 4F0HA 2NSCA 3KLEA 3CB4A 1RHRB 1D3WA 1UVKA 2NCKL 2Z2LA 4JI1F 4OYZA 2B8PA 1FO1A 4LFAF 4ZN3A 1PJ6A 3GJSB 2OPSA 5EX3A 5LM7E 1QTMA 1WSVA 1S4EA 4C0BA 3KLFB 5IV4A 1H2TZ 3BS9A 2DGUA 3OVBA 4H4OA 3KHRA 2HAIA 2VDIA 3AXKA 5A2QY 4NYZA 5D4PA 3QRQA 1IQTA 4RUAA 2DNGA 5KFIA 2MZ1A 3GONA 2DNQA 3BREA 2FGOA 2ZDOA 3UD3P 3RW7A 2KL8A 2UUWA 3FDSA 3MFIA 1OIAA 5EWFA 3Q8PB 2QMUB 4RX6A 3EWGA 3BKUA 4DPXA 1YJ7A 5CH7B 2FGCA 5CXTA 4K0KF 3IS9B 2GA7A 2HIYA 4NXMF 3D0GE 3B82A 4IH6A 1Q8KA 4V1Ak 4G1QB 4NLXA 4QU7A 4WYLA 2M7SA 1QUPA 2MKSA 3WX8A 3PKMA 2XNRA 4LF7F 4ZJQA 3Q86A 3BEGB 4F2SA 3QBCA 4FBUA 2VG6B 2NXEA 3SBMA 3KK1A 2YNHB 3W8PA 1PO6A 4TY9A 3I32A 1HWKA 2V8DA 1KHVA 3VAFA 4W92B 3G2XA 1M5SA 1VBYA 3MMCB 3CULA 4C8ZA 2RKIA 1GNKA 2OELA 2V9KA 2ALZA 1HIYA 1KWMA 4USKA 2FJVA 4X62J 3ITHA 3T1YJ 5SUHA 1RWUA 4B3MJ 2F8MA 2M0GB 2W8LA 4DSKA 4PUOA 3NGDA 3PW7A 1H74A 1IUJA 5FDLA 4BLGA 1VJWA 3DRYA 3VQTA 3RBEA 4QYRA 3PYDA 3H40A 4GMKA 6FDRA 2DPJA 4GVBA 2CPEA 5HATA 3C2PA 1LXJA 1Y5LB 5BR8J 4NCGB 5IOLA 2POKA 5GMEA 5D15A 1YJRA 2MJUA 4ED6A 4CLKA 4RUHA 1U25A 1IM4A 2BJ3A 4DQQA 3LQVA 1BHNA 4F36A 1VQSA 2HQIA 4RBTA 3VGVA 4Z2XA 4X64J 5KFNA 3H20A 2UV8A 1L3UA 3ILOA 4XDDA 1CG2A 2DHSA 3MMAB 2ZWPA 1LW0B 1NSAA 4USMA 4ZVSB 3DLKB 2O67A 1S72S 3VGSA 1QE1A 2C2DA 3UCUP 5C2GA 2YNIB 2NUUG 1U1PA 1VQ8S 4NRUA 4WP8A 1EZZB 2IM3A 4Y00A 1FDAA 2CQPA 3ET6B 3EZUA 2EFQA 3W1YC 3M8PB 3P4UB 2BM0A 4P6QA 3CC2S 1PG5B 3OJSA 4ECZA 4M94A 4KRWA 1B0PA 5A0YB 1VRUA 1NM2A 1A6LA 1FTCA 4NMXA 1SJQA 4RBUA 2C3OA 2C2ZB 3CIMA 3HM9A 2QTWA 5I3UA 4FNIA 3M8QB 1P6TA 1GX5A 3FKBA 3N79A 2ZC3A 3GLJA 1FE4A 1UVMA 5A8RA 2E29A 2GC8A 3GCWP 1QUVA 2HZVA 2UXBJ 1OWXA 3SXLA 4O3OA 1VYAA 3CMES 4FYWB 1KOOA 1S7HA 1R0AB 4ZHRB 3H5SA 2UXDJ 4DF8A 2RNEA 2IA6A 3GJTB 4Y2MA 3HI9A 5HBMB 1BUXA 3BGRA 2G1DA 2ZE2A 5HQ8A 3BN7A 4K5RA 1H6KX 2FHJD 4J90A 4P73A 1R43A 1NO8A 1U0HA 4UW2A 4NLGA 4DL2A 3NGTA 5IC6B 2OIHA 3BR9A 1QD1A 1VK3A 3MM8B 1HNVA 2BX6A 2YKMA 3F0NA 2FJWA 1OQ3A 4IQMA 1U45A 4J9SA 3Q23A 1U02A 1T3NA 1RT1B 2GQCA 3CPWR 5ITHA 3SI8A 1NJYA 4Y34A 2C22A 5KFZA 4HH0A 2AIRB 4OX6A 3UNYA 2BE7D 1VQ9S 2CFXA 4I68A 4FYVB 1OPIA 3KLVA 1S6QB 2QIFA 1U09A 4ZKAA 3H7HB 1RT6B 3KK3A 1S57A 2V34A 1FEEA 1YX2A 2Y1LB 2VOPA 3K5PA 3CVKA 5HVHA 4U7UD 4U6PA 4C3MA 5KFDA 3OLAA 2CNOB 4ECWA 4MIWA 3SFUA 4LIRA 5K9FA 3MOZA 2CPYA 1FWKA 3SCKE 2DNMA 4CCHA 4K59A 2UUAJ 1F5AA 1QY7A 2R7TA 3A1YG 1JKHA 4USTA 1TKZB 2BRLA 4O23A 1RAEB 2MHNA 1UFKA 2V8VA 3FSIA 1IKVB 3GIIA 3PFOA 4Z37A 2OPQB 1T9VA 1S97A 3C66A 3KUHA 5D4OA 4X4QA 3DOLA 3OUYB 4WP9A 2KXHA 2R2SA 5L9XA 1K73T 2ZUAA 2R2TA 2D3O1 2XULA 1L3VA 1KBRA 1LWFB 5F8JA 3Q89A 1RCOB 4C3KA 4Q2LA 3IWXA 3HHKA 3ZTQA 2WVEA 5ETOA 1SJ4P 5D4NA 4DV6F 3GYGA 3NGUA 3DI6A 3I0SB 3R5DA 4FXDA 3CCVS 4HHHA 3PM9A 4DV0J 3T9NA 3FCWA 2I8EA 1KFSA 3R7BB 2CPXA 4Y2CA 4N56A 1FXDA 2JRSA 2YY3A 1DLOA 4OJHA 1D8YA 1WC6A 2GFFA 4IFYB 2VA2A 1CS4B 2UVRA 3G4SS 3LAMA 1T03A 3MM6B 4DUTA 3M6WA 1T9UA 3ILIA 1FE0A 4YDDB 8ATCB 1XMQF 5C24A 2NYHA 4CDIA 5MLCV 4E8UA 1T05B 1REVB 2RRNA 1YDLA 5DG8A 5DS7A 2CZVC 2WSCC 4X4SA 2KO1A 1RAJA 3QT7A 3BH6B 1TAUA 2F65A 3I56S 3IAS9 2FTRA 3AD8C 4OZLA 1UVLA 2HBYB 3R7SB 3R2CJ 1BC6A 3LGMA 1ZAXA 1OY9A 4ED4A 5JXSA 2D69A 4CH7A 3DLJA 3KLIA 2CYYA 2CNKB 2O3DA 2AZ1A 1XMBA 3UCZP 2MGZB 3F44A 1YIJS 4TU7A 2NXUA 4C11B 3CCUS 3LGNA 2FVPA 1M5KC 4HDHA 4J9KA 1VR6A 4WYWA 2VG5A 4L73A 2E7VA 2FHMA 3R5GA 5LJ5Y 4M63A 4DR7J 4TVAB 4B17A 2I5JB 1NZAA 4KYZA 1CJVA 4M5IA 1RSCA 2Y0SD 1FX2A 3K2YA 2IYIA 1B7YB 4RLEA 3ZO7A 3QGPA 3GFXA 4KB7A 3MM9B 3TO8A 3WQPA 3K0JA 2MQQA 2W9AA 2HHHF 3ETOA 4EFAC 1P27B 1I6JA 3PR4A 3SQGB 2ZH1A 3CJQA 1T11A 1HI0P 3THVA 5AE1A 2PMWA 3NY0A 2VD3A 3BR8A 2QV6A 4BC9A 2UU9J 2WAQD 1X8DA 3FVYA 1NSKL 5T7LA 5B0EA 1JMTA 4B3TJ 3PX6A 4X65F 1VQYA 2XI2A 4ECVA 2XQCA 3WX4A 4LF5J 3MTKA 4K5SA 4RNFA 3G96A 3DGVA 1ZH5A 2YPZA 1BQNB 1IQZA 2HZCA 2FC8A 2PDAA 4ELVA 3NCQA 5A6PA 4YMEA 1U8SA 2V69A 2BJEA 1VMBA 1PJ7A 1RWPB 4UY85 3D4JA 2CZ4A 4UOGA 4K2XA 3E8OA 4ZS6A 1TV6B 1S1VA 2DRBA 3CJ2A 1SQGA 4DL6A 3O5TB 5KFKA 1RU2A 4DQSA 4XDCA 2AWZA 2DITA 5D0EA 1TL4A 2HRYA 5CYQB 3VGTA 4U8YA 1IKXA 3TEGA 3OR1B 5F8GA 1HBUA 4LRCA 3MM5B 3AA8A 3NGSA 4M5MA 1YGYA 1TL1B 3V6JA 2D1CA 3C15A 1IBLF 2XMVA 1DTQB 5I42A 4RW4B 4IRDA 2VB6A 2PN6A 4QWEA 5M2PA 1Q53A 3GIRA 1VC0A 4RBVA 2MPUA 4I6WA 4OYXA 2BW2A 3OR2A 1G2EA 3T41A 2QLXA 2W2MP 1JJ2R 1CEZA 4ETXA 2XY6A 4OI4A 3PRBA 2GVDB 2ZUGA 2LCWA 1N5SA 5HVFA 1DBDA 2AD9A 4DZDA 4OLOA 4LBIA 3RRHA 4IOAQ 4P9SA 5IT0A 5CD4A 1C1CB 4A8MP 1CLFA 2R7WA 2ILYA 5B0FA 2E5LF 2FD2A 2Y1IA 4HKQA 3OVSA 2HVIA 3K58A 1ZM9A 1NCLA 3GR1A 2P6SA 2W9CB 1V3SA 4JI6J 3HP6A 4LQ3A 2CXEA 2FPHX 2VFUA 1SVDA 2XLJA 3RRGA 5KT7A 2HHWA 4UF4A 2J0QD 2UVVA 5EHHA 4LF8F 1U2CA 4QOTA 4C8NA 3BQ0A 3BYRA 5D0GA 1LOUA 2QL5B 1I94J 5HQMA 2CG4A 3SV3A 2YWGA 1C0TB 3R5AA 1JLFA 3V4IA 2ZOFA 4B9SA 1FJEB 2HFUA 1JQGA 4RJVA 5B0DA 4A46A 2XWYA 4NCBA 1WI6A 3R5JB 4ICLA 3M7VA 4LF4F 2HYIB 2CKWA 3C16B 1LQ9A 4QW8A 2LXFA 1XN9A 3OFHA 5KFVA 1FT8A 5IWAJ 3NXZA 4QBUA 1RA6A 2L48A 3OBIA 2FY1A 5J2PA 5B0BA 1OYDA 3P3DA 4EYHB 4AL7A 2D3ZA 5F8NA 5ETNA 2G2OA 4DPYA 3CCZA 4NXMJ 3T5HA 2IAJB 3UVJA 2E1CA 4RWXA 3A3OB 2ASYA 2R7RA 1N54B 7FD1A 5CYMB 1EP4B 1SL0A 3M8SA 1FHTA 2AKWB 1HPZB 4RW9B 2QA2A 1U2FA 4R0JA 4JI5F 1IJEB 5T14A 1B64A 4FPRA 5ETMA 2PEBA 4UY8T 2ROPA 3L95X 3Q8VA 4LF7J 4PG8A 2IM0A 1QSSA 2DT9A 2IC3B 1S9FA 2WCXA 1Q1KA 3AOBA 1RT7A 2MKKA 1K1QA 2LEPA 2V4JB 5HMWA 4YR0A 4H4MB 2MQMA 5HLFA 4I2PA 2XSJB 1SH2A 5KFBA 1SIZA 4TKTA 4X66F 1O8BA 3OL6A 2BANA 3KHLA 5IQ6A 1Y0HA 1Z1ZA 3VZIA 5GVQA 3GFYA 1JJ4A 3GR0A 1A0OB 2CDRB 1MU2B 4HTIA 4G65A 2R8JA 5KFHA 4WTOB 2HFSA 1KQKA 4LSNA 3CXCR 5E5NA 4ZVHA 5K8MA 3DMJA 1NBEB 4B3SF 2M8HA 4OJ1A 5D77A 2W2QP 5FD1A 1U7LA 4QR1A 2ZBIA 2HHUA 3CWJA 4ID5A 3G6YA 1NJXA 4URQU 4LJMA 2W4CA 2XMAA 2UUCJ 3Q24A 5K14A 1C4AA 4NA3A 1REGX 4JYAF 1VQNS 2LU1A 4DSIA 4OLPA 1RWWB 3I4PA 4WFAQ 1T9TA 4IR1A 1FKPB 4ZP6A 2HLUA 3W64A 4CO5A 3GG1A 2HWHA 4ES3A 2FZKB 4WZMA 2XC9A 1Z2LA 2KJVA 1VFJA 3TYTA 4KQZA 5D0RA 2LDYA 3AY0A 3BSNA 4PYAA 2CQCA 3ZTPA 1T8EA 3ZZUA 5K20B 2MQOA 2R7VA 3NWGA 2XY5A 2YXLA 2UP1A 3VQSA 4C9DA 1H3DA 2WOMB 4MIAA 3G8QA 2YKAA 4Y3CA 1F9EB 1BWVA 4OYMA 1WJ9A 2HMIA 4NOHA 4X2BA 2KM8B 1I3OB 1GXTA 2B43A 2JVOA 3S6EA 2AJQA 2YNGA 5SZTA 1F5CA 1N36J 4I69A 5EWEA 4PXEA 3JTNA 3CCSS 1WC1A 2E66A 3M30A 4F25A 3FZ2A 2RRAA 4NASA 2ZWOA 2X1FA 3NOGA 2DISA 1NDCA 3H90A 4NE9C 5K5MA 3NS5A 1S1TB 3CCMS 1FRIA 2JVRA 4KGVB 1SC3B 1SKUB 4S0MA 4TU9A 3NOCA 1UETA 4CIOA 4YOEA 2ZOMA 3HVRA 1N6QA 2DNLA 3DXBA 2HNYA 5J2NB 2PEHA 1QAYA 1FFSB 3D1QA 3HFZB 3K89A 1SBRA 2XCPA 1UWBA 3SZ2A 2K3IA 4HTJA 3CE8A 3PDNA 1S7IA 2ILZA 1NK9A 2JEFA 3GWCA 2DXFA 4OHXA 4M1KA 4ED8A 1L3TA 2K06A 5IM0B 1C1BA 5ETKA 5LMUF 4EO8A 1X4EA 3DDIA 1KP6A 2ZH8A 2CUYA 1IKWA 3EXYA 3DRPA 4ED7A 5F8MA 3ZTSA 4PWWA 4C4WA 3HMJG 1IWGA 2ZHOA 4A8SA 4LVOP 4ZP7A 3SDEB 1VQ6S 2KZMA 5GADI 5F8HA 2XYGB 4PXCA 1LWEB 1AB8A 2Z2MA 1MROB 2KYXA 2HNZB 4NZ6A 2DHXA 2UUTA 4R25A 4Z7CA 1M1KT 3NL0A 1TL3A 2DGOA 4CLLA 2X1GA 1GAOA 1LEOA 1ULRA 1MG7A 2I38A 1JLQB 4MKAA 5FLXY 2B9XA 4ZPDA 1WOOA 3EVMA 1GK8A 4QU6A 2FLOA 2HVZA 1ZOTA 1JLBA 3R9LA 2AJ4A 4NX9A 3DN9A 2ZD1A 3IXQA 1UPPA 5GAGI 1D9AA 3C14B 4DV2F 1BQMA 2RUGA 3SMZA 3CCTA 2BW7A 3H59A 3EYZA 2JZ5A 4QIFA 3M9NB 5KG7A 5A76A 2F1FA 3DLEB 3PVXA 1C0UA 3M05A 4TLQA 1H0HB 5JUMA 4EO6A 2W1BA 2VBYA 3KLGB 4DR5J 2V6AA 1SPBP 2QYGA 5HO4A 3A8EA 3OLBA 4WFZA 3BBCA 3QO9A 3MPWA 4ECQA 3FQKA 4CT9A 3GJRB 3HFKA 4PAAA 4G3IA 4O0IA 4DI6A 5AE3A 4DG1B 1UEVA 3HJFA 1M5OC 1O0PA 4DV6J 1F9FA 2KG1A 4R8UB 4HI1A 4MKBA 2M70A 3M1VA 2Q3PA 1Y9OA 1JJCB 3VAIA 3D68A 2WSEC 1GTHA 1Q16B 3W2VA 4OHZA 3J7Z5 2EW9A 2W2PP 5LL6d 1P1LA 2R7XA 2BE2B 4N41A 1FRJA 4JI7J 4X4NA 4L72B 1HI1A 4CYUB 2HS4A 2B3TB 4FVMA 4OHVA 4KIAA 3J7YI 2C2MB 1OJ4A 3G6ES 2XS2A 4I2QA 2OMOA 1HQUA 4WK1A 3KOAA 2E7WA 2V8PA 3EPIA 3EE3A 3QT6A 1SJ1A 2XNQA 2FB0A 3G82B 4OZ5A 2BV3A 4FS2A 1JLEB 4FF2A 2GHVC 3VF0B 3RRKA 3NBPA 4U95A 4TN2A 1X4AA 1U1OA 3IG1B 5T41A 3R8YA 2AF6A 2E1RA 2XS7A 4FYXB 2ZOGA 1OSDA 2XMUA 4QIEA 1H73A 3IN5A 2R2RA 1K44A 1FWLA 3M2RA 3MD1A 4DQRA 1VRTA 2HBRB 3KLHB 1HI8A 3HT0A 4BWMA 3TA2A 1BY9A 2RE1A 3CSKA 4JV2A 4UTGA 5KT6A 2VUGA 4LFBF 3J81U 4M5JA 3DYAB 4WBFA 2CPHA 4WF9Q 2VPYB 3TVYA 2IPOB 1NPKA 2PO4A 4LBPA 3CTRA 1UEUA 4DMZA 3M2VB 2QE5A 3N5FA 1FJCA 3H5XA 3IR6B 1FKOB 2YKNB 4BHQA 4PWDB 4J9RA 1CJKA 4DV4F 4PZVA 1RLCL 2MZJA 3D54A 4YP3A 3PG9A 3TZZA 1X4CA 1LV5A 4X4VA 2IBKA 2CJAA 4E98A 4G1PA 4A4JA 5GAEU 4IFVB 4OFZA 1SC4B 1AUSL 1FDBA 1ZM2A 2HHHJ 2OFHX 3MAQA 4M95A 1RAHB 4O4GA 2KRBA 4CLSA 2KT3A 1FXRA 4JI0F 1YRXA 1R89A 3R5CA 3HKWA 5DZ6A 2BA9A 3MI7X 4RO0A 4YB7A 4CTAB 2D74B 1HNIA 3K5OA 2I6WA 2Q66A 4ED2A 4X65J 3UDVA 4UQTA 1BMQB 4I1TA 4L6V3 2ASDA 2R4FA 3OTEA 4OYPA 3R1LA 2GAHC 2VFSA 3QLHA 5C42A 2OPRB 2RS2A 1NUEA 4KV8A 3T5LA 2CQHA 1WHVA 4CO1A 4RWWA 2B9EA 4NLOA 1XBWA 3J7ZT 1F9HA 3GFHA 1HBOB 4QIGA 4N8NA 2EWHA 4O3RA 3CO0P 4UUXA 2ZNYA 1S76D 4DXLA 3MEGA 3MPUB 1PYOB 2MKCA 1NJZA 3PHEA 1GXLA 4IDKB 3H4DA 4K4UA 4PG6A 4KC5A 3VV2B 1W26A 2XG8A 2R42A 2DNZA 1HWJA 1SQFA 3JXOA 3M32B 4FXWA 2VPXB 4FF3A 4G6VB 4DL4A 2FHKA 4LF9J 2YQ3A 3OFGA 2BZ2A 4ENOA 3LPEA 4PXDA 1SXLA 2NYIA 5U47A 4C0HA 3CJKB 3KG4A 3KLFA 1EHWA 4GKJJ 2K1RA 3G86A 1ZPVA 4ERDA 2M3DA 3MECB 4P7VA 4YFUA 3UD5A 1D8ZA 3JSYA 3EMTA 3ISZA 2E5LJ 1K0TA 3OHBA 2IHR1 2M88A 2DTJA 2YKQA 1R31A 2ZC4A 3C6UB 1RT2B 4ELTA 2VPZB 5D78A 1SCJB 2EEYA 3CGIA 4P52A 2V2ZA 3PW0A 2L08A 1UA0A 1G6BA 2CQIA 2HVDA 3HVTB 5FJ4A 3F73A 2W9BA 1WTBA 3QAUA 1TKTA 1X5SA 2VU5A 4IYQA 3IS9A 4NZ0A 2Z58B 5KFAA 1SKSA 1ZZNA 2CDQA 3LANA 3KMQA 1R27B 1CJTA 2FJEB 1OQ6A 4L75A 3PJ9A 2BXJA 4DCOB 1N8RT 4G1QA 2BVZA 2KVIA 1RTDA 4RPFA 3D0HE 4EZ6A 1V9OA 3L7PA 1APSA 4LF4J 2DNKA 2GIRA 1KLNA 1SB6A 2GX8A 3FBEA 4KH1B 3IA0A 2YNHA 2JEGA 5GAHI 4LIWA 3CIZA 4DSLA 4DU7A 4XPEA 1R0BG 1Q79A 3P49B 1OS5A 3PFEA 2YH0A 2QA4G 1LWXA 4DQPA 4NMLA 4WKRA 2RF2A 3HHEA 4AQYF 3HXMA 3MMCA 3Q83A 4B3OB 1VI7A 5KFMA 4V19J 5E3QA 5L46A 2WONB 5HJYA 1XIQA 2N4CA 3CD7A 4I6AA 1FNMA 3AFGA 2DVIA 2BJ9A 2HGLA 3D7SB 3MEDB 4X4OA 3IRWP 4AXJA 1WTFA 1RA7A 3U02A 3MMJA 4ID8A 4EMDA 1MN7A 2ZKTA 1NB2A 4OZ0A 4DFJA 4C3LA 2R8GA 3K5NA 1VDHA 2PSZA 2BABA 3KLEB 4H4KC 4X66J 3BKTA 1N0UA 2JLEA 1XWLA 4F4YA 1R8AA 3R1HA 2BBEA 2OPSB 3PRDA 2M52A 4DSEA 3EX7B 3CDAA 5LT5A 5KT4A 4HT5A 4NCGA 2KZZA 4WWSA 2ZBRA 2OI2A 3P5TL 1IM6A 1VC5A 1RP5A 4B3SJ 4H4OB 2XZTB 4WXWA 1E6YA 2WRMA 1HL6A 2R7QA 1S9EA 3RBDA 3US5A 3N4WA 5GMDA 2ASLA 1AW0A 2KU7A 3L7OA 1KLMB 1LW0A 5L1KA 2BM1A 2WB1D 4Y2AA 4TNOA 2YNIA 1D0EA 4MKYA 4K50A 2H4WB 2Z30B 5JVHQ 2KTQA 4NRTA 1QSLA 1S99A 1YBAA 4IG0B 2E5IA 2V0NA 3PYFA 1T94A 1S1UA 4P71A 1NAQA 1G4CA 3DLGA 1YVFA 3WBZA 1SC1B 4K4SA 1H2VZ 5A0YA 5CYJA 2IFXA 2CQ1A 2XB2D 2HHXA 1PAEX 4BCAA 3MEKA 4J7CA 2CJQA 3MPDA 4DJBA 5E3RA 4U67Q 3PKYA 2DR5A 3EUNA 1FRMA 3RR8A 3HHLA 4KY3A 3QT8A 1KFDA 3G6XA 4XO0A 2J7UA 1RAGB 5IT4A 2H65B 1R0AA 4ZVPB 4ECSA 1L5UA 2MKYA 2OEKA 3MUVP 2QLWA 2VBZA 4P72A 4P75A 2LECA 5D8HB 2LDIA 2JC1A 1DURA 4RU9A 2MYFA 5LMNF 3JAMU 3RTVA 3ITHB 1HQEA 1X9SA 1HNXJ 5F9NA 2KH9A 3UDEA 1N88A 4K4TA 5M2RA 2DNNA 1FD8A 2BUNA 2D3OR 4PUOB 1KR4A 1WEYA 4DCJB 3QSYB 2VODA 1WOPA 4X4RA 2JEIA 2N7CA 2E5GA 1ZBTA 1UFWA 1V3ZA 5JJBA 2ZBPA 3KG1A 4NI2B 2A1BA 2BKOA 3ZTRA 1T0TV 2VKRA 2M8DB 5J1EB 3G6VA 4GVBB 1VQMS 1L3SA 3I55S 1PKUA 2XO6A 1U1QA 3OL7A 5HVGA 4U7CA 2VQEJ 2GIFA 4LF6F 1DAXA 1S6QA 3QRRA 3R3TA 4OIXA 2E9TA 4HYKA 3MCNA 4YB5A 2QLJB 2CPDA 1RT6A 4QWCA 3O3LA 4YB6A 1NZ8A 2AJ1A 4KGMA 3FBCA 1GMWA 5DLFA 1QE1B 5L38A 2IA0A 2W2NP 2ZDPA 4MJKA 5CCMA 2OD4A 1CQNA 3D6HB 4ZLJA 2HWTA 2K7KA 1SV5B 3NAIA 2X1BA 4NLWA 3PW2A 4LF1A 1HR0F 3PNIA 2FVCA 4MFBB 2LQ5A 3KNAA 1IKVA 2DNRA 2EXUA 1FRKA 4PG7A 2HBZB 4LRFA 4KH0B 1VBZA 1WUUA 3RUBL 2YNFB 3MAAB 1TQLA 2ACMA 5I3UB 2FLLA 4DV7J 1Q86T 5A8RB 2L3MA 2PC6A 4JUZA 1XMOF 4DV1J 4TY8B 1VHIA 3ZZZA 1TK5A 2XEXA 5KFJA 3QZ7A 1D1UA 3IMQJ 3NCPA 4WFXA 3C3LA 2F5GA 4ZITA 2VZ9A 3RG6A 3EGZA 5KFXA 2W25A 3DDNA 1ICEB 3ZNUA 5AJ3F 1S59A 4IFYA 4LQ9A 2QT7A 2NLWA 1CS4A 3D2WA 3RBXA 4AL6A 2VC1A 2Q1LA 1P9YA 1RISA 2RDIA 5ETLA 2XMTA 1QTNB 2IRXA 1N34F 2KB2A 1GXUA 4OX8A 1UP1A 4F67A 1JJHA 2HRUA 2J7KA 2P9EA 1REVA 4UT4A 2HS0A 1NEEA 3LP0B 4Q44A 1KRPA 5EDWA 4JBCA 3GPAA 3LALA 3QAEA 2ZFHA 3C6TA 2VG7B 5DETA 2YTCA 2W4PA 2JX2A 3LF0A 5DJBA 2DKOB 1F2GA 2RSQA 4LSZB 5J1PA 4B3RF 4NLSA 1NH7A 3W9HA 1LNQA 1BLUA 3K7RA 1Q82T 4DR2J 1JWWA 3VHQA 4P10A 4JOUA 1DY3A 1GTEA 1R6VA 5GMKa 3GQCA 4KGKA 3D6TB 4X4TA 1NDKA 1V5VA 3MR5A 2NZCA 3RAQA 8RUCA 2YVSA 2MGZA 3JSMB 3JYTB 2VFTA 1UZDA 2DR7A 4IR9A 1VRQC 3SSRA 2RU9A 4B9LA 1O6XA 2GS8A 5H9FJ 2AW0A 1YBTA 3FEXB 5K8NA 3V6HA 5CA5A 4N8OA 4RW8B 1CPZA 3QQCD 2E1AA 3ZXWA 2I5JA 2J5AA 1S10A 1RTZA 5A8WB 2O01C 4DWIA 2R9LA 1TL7A 4F3QA 3DC2A 3P5BP 1H38A 2KG0A 2QGFB 4EU0A 3HHNB 4LFBJ 2VONA 2KHDA 3RZAA 2B4VA 4ELUA 3SQGA 3CJ3A 3MGJA 2ZZTA 3MPYA 5B7WA 2HHSA 5C5JA 4E0DA 5DM7Q 4Z7YA 4FZVA 2Q43A 4CT8A 2JEJA 4WKYA 5F3TA 4I67A 4K4VA 3QGIA 3PY8A 3NNCA 4WU3A 5E7OB 4Q2MA 3RB0A 4AYBD 5L1LA 4F4ZA 2O5DA 2DGTA 1BQNA 2BE9B 1VS3A 1T03B 2H5EA 3R6LB 2G2YA 1X0PA 1ZPWX 2XI3A 5GAGU 4AXIA 1P9QC 1RBLA 3VAKA 3FJ2A 2ZNZA 3U1MA 4NLVA 4OYIA 1KTVA 3W5XA 3MURP 1TV6A 3KK2B 3ICLA 4FNHA 4JI0J 1RXOB 2J9EA 3I5AA 3KUEA 2Q6BA 3SYZA 4NYOA 5DQHA 1T02A 4LVNP 1KC8T 2W4DA 5CAAA 3P6YC 1LK7A 3I31A 1TUVA 2MB0B 5CYQA 1UFLA 3MWBA 1WF2A 2PFDA 3PHTA 5ETVA 2LA4A 4I0WA 3VAHA 1XNRF 3VVUA 4IUFA 2MLZA 4KE5A 1WHYA 3B8HA 1PYTA 2F63A 3IBFB 1TL1A 3KLIB 3TVKA 2AGPA 2P2CB 4YEAA 1WHWA 5IT9Y 3H5YA 4IG3A 3ULHA 2BJ1A 1UW4A 1WKKA 2EFOA 2LQ9A 1U8WA 1EETB 2XZWA 2ZJPQ 2ZJQQ 2HEKA 1LXNA 2Y8YA 5B0CA 3WZ0A 2OTJS 5DRKA 3K5MA 4DV5F 2GVDA 3W5ZA 5DQIA 2MQPA 1YRTA 1HQ2A 2CIMA 4RZRA 4DDFA 1HWIA 3OTBA 3CCQS 1C1CA 4D3HA 3TP2A 3ZZTA 4DPTA 3FNNA 4DUZF 3N01A 4JI2F 5HMYA 1WD6A 4YN3B 3GP9A 5AXLA 1N33F 4G1IA 1U1KA 2W9CA 3HF5A 1S5ZA 1RACB 2IMWP 2V4QA 3RYLA 3CCRS 5K8OA 2HBQB 4OX9J 3POTA 4ED1A 1HW8A 3K5LA 1M0SA 4AUKA 2ZBQA 1RB0A 1TP7A 2V50A 3JSBA 3TAQA 1X5PA 4QR2A 1FDNA 4CI0B 3JQMA 3W66A 1J5OB 5M2UA 3G8TA 5KFQA 1C0TA 4Q45A 1RTIB 4EZ9A 2B5JB 1LFPA 3JTOA 1WWHA 3MM7A 5J2MB 1W7WA 2JC0A 4URSA 3NP5A 4DL3A 3MCSA 1YJWS 2HZAA 1HMVA 5C7PA 2HHVA 2FLNA 3M8WA 1FRLA 5BJRA 4FXVA 1HWUA 2UUBF 3B6BA 1N32F 1S1VB 3BPDA 3MR6A 3GSIA 2MLXA 4UZCA 4ANEA 1Q0NA 4DX7A 4RNOA 1Y3KA 3BO2A 2YWKA 3QYYA 1IKXB 5CYMA 4HHUA 1KD1T 1EP4A 1XNQF 1HBUB 3AJDA 2HQ3A 3GZ7A 4NLPA 4RW9A 1C2PA 1QAXA 3FEYB 4CO2A 3BF4A 1T95A 3GIKA 2XHCA 1Q8LA 2RS8A 2J9DA 4C8KA 2EFGA 4QCLA 3EDRB 3IP0A 1E6VB 1QAJA 4AFFA 1HW9A 3EPGA 3OTOJ 2MZQA 2X7IA 3ISND 5CABA 1XQIA 4ED3A 2FZCB 5HROB 4B9MA 1MSWD 1CBKA 2XSJA 4MK7A 1BWEA 2AGOA 1L3KA 4QIVA 5AXMA 1R8HA 2GV1A 2LVWA 2KXFA 2B6AB 3G87A 3KYLA 3H2LA 1HYSA 3GIMA 4AQYJ 4D3GA 1SL2A 2P5VA 1JK9B 1U1NA 4CRJA 3IRXB 5A2QU 3CEDA 3A3NB 4LRDA 2CWKA 4NXNF 3THTA 1VISA 3QT5A 4C97A 4WCEQ 5B0GA 2VHGA 1X31C 2V4RA 3MCMA 1MLAA 1S6UA 3ZZ0A 4C0OC 2H54B 2K8GA 4UOHA 3ZFVA 1FKPA 4B02A 2GNKA 3ZNJ1 3HSDA 2GHWA 2QFIA 3TI0A 3H5UA 2DRDA 4JI8F 1PBUA 3UN3A 2CNLB
chains in the Genus database with same CATH topology
3DRPA 4ED7A 5F8MA 3IGVA 4C4WA 2JLFA 3HMJG 2ZHOA 1YI2S 4A8SA 4LVOP 4ZP7A 1S1WB 4O44B 1DTTB 2RQMA 3EZ5A 2JH3A 3T5JA 1KOHA 3SDEB 1VQ6S 1TKXB 3W2WA 2KZMA 1SQEA 5GADI 4DUYF 5F8HA 1RT4A 4QW9A 4USJC 1DJ0A 3V4IB 4PXCA 1URRA 3TQ1A 3Q0AA 4MMOA 1LWEB 3GSDA 5KFRA 3J80Y 3Q2TC 4KJIA 5DG9A 2Z2MA 1AUDA 1MROB 5CCLA 1NRKA 2KYXA 2HNZB 2IM2A 4J5OA 4NZ6A 2DHXA 4A8YA 4ICLB 3V2UC 1WG4A 4DN0A 1VGYA 2UUTA 4R25A 4DFKA 1FXLA 1M1KT 3ISNC 2RU3A 1RT5A 3PR5B 2FHJA 3NL0A 2RD5C 3RW6A 1TL3A 2DGOA 2MSTA 1S6PA 4DV3F 2QEXS 5EX0A 2X1GA 1GAOA 3NBPB 1ULRA 3LWLA 3MUTP 3VZHA 2I38A 4XK8C 2L41A 1YJTA 1JLQB 4MKAA 4DFMA 5J2PB 1QVGR 4FF4A 2PD1A 4OJGA 5FLXY 3OFEA 2B9XA 4DS4A 1IKYA 2L9NA 1E6VA 2OSRA 4ZPDA 1FF2A 1MWYA 4FBTA 4QU6A 2FLOA 2VG6A 3HT3A 4IG3B 2ADCA 2E5JA 3NNAA 4TYBA 2HVZA 1DARA 1ZOTA 4DR4F 1JLBA 4HVZA 4IDKA 1U1MA 2AJ4A 2MZSA 5HROA 4NX9A 4GC6A 3DN9A 2ZD1A 1U1LA 2PI4A 4LF9F 2B7BB 3IXQA 2B4UA 1T7PA 3N0VA 5GAGI 1KQFB 1D9AA 4DV2F 1BQMA 2RUGA 3BGLA 4IKAA 3I82A 4X62F 3SMZA 3CCTA 3H59A 3EYZA 2RB7A 4EWTA 4OHYA 3J7A1 5KFPA 2EC0A 1N0VC 3GIJA 2JZ5A 3FQLA 1XEZA 2GMJA 2B6AA 4QIFA 3M9NB 2F9JA 4Y2IA 1G7CB 5KG7A 2F1FA 3DLEB 3PVXA 4I56A 3E01A 4B3MF 2PMZD 1BQXA 1C0UA 1WF0A 3M05A 5J1NA 4TU8A 3WC2A 2OP5A 2DH7A 2KI2A 3M2UB 3NMAA 1S0NA 4GKJF 3B4DA 1U6BA 2CPJA 1W25A 3IRXA 2J9DE 4TLQA 1H0HB 3IR7B 1S48A 2XCAA 5LXRA 1RT7B 5JUMA 2RQKA 4EO6A 2ZKUA 2VBYA 3KLGB 5HLFB 4I2PB 4DR1F 3PIPQ 5HO4A 2FIUA 3AJ1A 3A8EA 2KFYA 3OLBA 1T3OA 4HEA9 3M4XA 2DH8A 4WFZA 4U9RA 2LLZA 3Q8QB 2VPWB 3CJKA 4WFNQ 3NMRA 4C8YA 3QO9A 2KT5A 3FEZA 2BANB 3MPWA 4ECQA 2RT3A 2KHCA 4NLYA 3FQKA 4CT9A 3HFKA 2PGCA 2CJKA 2AYEA 2E5HA 4TQRA 4G3IA 1FVSA 1Y5IB 4HDGA 4O0IA 5BR8F 3HDSA 2LYVA 1SJFA 5KT2A 2N3OA 1TK0A 2MHEA 4LSNB 4B3TF 5AE3A 2RQ4A 4PCQA 4DG1B 1UEVA 3HJFA 2EKYA 1M5OC 2D3UA 2X51A 1Q7YT 3DMJB 1O0PA 3POTB 1WEXA 4CH1A 2C28A 2J0SD 3CDBA 1F9FA 2N4DA 2KG1A 1D9FA 2NR0A 4IO9Q 4R8UB 4HI1A 2B9YA 3CF5Q 4MKBA 4RU2A 4X64F 3C6UA 2CQ2A 1MW7A 3M6VA 1CSJA 4A8XA 5KG5A 1H7XA 2M70A 3M1VA 4ZPTR 2Q3PA 5GAHU 1Y9OA 1GH8A 4USHA 3VAIA 3P96A 5B08A 5DDOC 2WSEC 1NK6A 2JWNA 4Y0FA 3U7JA 3C8YA 5K14B 1GTHA 1Q16B 1Z4UA 2EG2A 3DFEA 4OHZA 1SUQA 3W2VA 2P6TA 4RUCA 3T9ZA 3J7Z5 4C8LA 2RMLA 2EW9A 5LL6d 1P1LA 2R7XA 5D4LA 1HNZF 1DTTA 2BE2B 2DNHA 4I6YA 5D6GA 2FVSA 1FRJA 2IJNA 3PW5A 3HVTA 4TXSA 3JSRA 2HGMA 3DLBA 3DLHA 1FESA 2DNYA 4X4NA 4L72B 1HI1A 2WHOA 3HZEA 2JLGA 2HS4A 2MJNA 2B3TB 2HLTA 4FVMA 2M4MA 4OHVA 4KIAA 3J7YI 1V6HA 4QZVB 4J9QA 3G6ES 2WB4A 1V3RA 3AA9A 5KTQA 1LWEA 2XS2A 4WE1A 3QMQA 4I2QA 1JNRB 3MM7B 3M9MB 2I2YA 3CD5A 4WIIA 1AFJA 2OMOA 1HQUA 2BACA 4WK1A 1F5BA 3MMAA 1UVIA 5KFUA 3KOAA 2E7WA 5KG0A 2RRBA 1HA1A 3EPIA 5F8IA 3MEEB 2BRKA 3DLKA 3DOMA 1SJ1A 1TVRA 2XNQA 3VTIA 1HMVB 2FB0A 3MD3A 3BQ1A 4OZ5A 3UE2A 2BV3A 1R8CA 4EEYA 2KJWA 2OTLS 3H2VE 1FRHA 4FS2A 1JLEB 3O44A 4FF2A 5EWGA 3M6UA 3OW2R 3OV7A 2GHVC 2RVJA 3ZZPA 3VF0B 4XPCA 3E2EA 3RRKA 3NBPA 3AB2B 2V2KA 4TN2A 1YTYA 1X4AA 1U1OA 1X5TA 1DRZA 1JLQA 2ROEA 3IG1B 3M8PA 2KT2A 4M8LA 4RNHA 2LQBA 4ZOSA 5G4DA 4BWJA 5T41A 4CO4A 2EFVA 2AF6A 4DQIA 3T19A 2E1RA 2C42A 4OI6A 2XS7A 2OPPB 1UMJA 2HFNA 2ZOGA 1OSDA 2XMUA 3IWLA 3LUYA 4QIEA 4F3OA 4F50A 2R7UA 2A2DA 3IN5A 4HH1A 4HT7A 1NK4A 5E41A 1WELA 1U48A 2R2RA 1VQLS 1CC8A 4A47A 1QVFR 1VIXA 6FD1A 3M2RA 1AXQA 3MD1A 3U1LA 2VQFF 4ZPCA 2J0WA 1VRTA 5CD4H 4DQRA 2XS5A 2UXBF 2XY7A 4PG4A 1X7VA 3KLHB 1HI8A 4OHWA 2DH9A 5KFOA 2U2FA 1NKEA 3QIPA 2CQGA 3SCJE 5G0RB 3CDUA 5KT3A 1VQ4S 1HNWF 4BWMA 3TA2A 4F26A 1LWCA 2IMOA 1BY9A 2RE1A 1RYSA 1VQ5S 3M8QA 2QYCA 3MMBB 2PT0A 5E0OA 2NREA 1PC5A 3CJ4A 3CSKA 4JV2A 4PPZA 5KT6A 4EBDA 3MXHP 2HS3A 2VUGA 4X4PA 1W2BR 2QA1A 1WNEA 5IQQA 2VH7A 4LFBF 2UXDF 5BYSA 1ZM4A 1S49A 3S8SA 1NK8A 1GX6A 2A18A 4ILMA 2WONA 2WBRA 2MZRA 2DGXA 3DYAB 3KK1B 2F7VA 5F0WA 1R3NA 2Q6CA 4Q5VA 2CRLA 3OL8A 3OPKA 4ZP9A 4RW7A 1NK0A 2HWIA 2X3GA 4K4WA 2CPHA 5F3ZA 5DG7A 3OTDA 2CQ4A 4WF9Q 3MEDA 2VPYB 1RGVA 3KLGA 2M9KA 1X9MA 3T1AA 2LA6A 2R8HA 1SJRA 2LMIA 4EGLA 3TVYA 2HNDB 5HI7A 2BQUA 2QMWA 4ZHRA 3I6PA 4KHMA 2BR0A 2EI5A 4BDPA 1QJHA 2PO4A 4OZNA 1RKIA 1XR5A 3PO5A 1VC6A 4KAIA 2KM8C 2YX4A 2YWHA 3Q8SB 3CTRA 2ZH5A 4NL5A 1UEUA 2FVRA 4DMZA 1Q7LB 1FNOA 2G4BA 4EBCA 3M2VB 2QE5A 5HBMA 3N5FA 2D41A 1HYSB 4JI4F 3TAPA 4L3NA 3D5MA 2RKIB 3IR6B 3H5XA 1FJCA 1FKOB 2XMWA 3GB0A 2YKNB 4BHQA 3TRGA 4PWDB 4QR0A 4DG1A 2LEAA 2NSCA 3KLEA 4J9RA 1Q8IA 4ED5A 1S6OA 4DV4F 3CB4A 2ZJRQ 1D3WA 1FRXA 3AHPA 3RU0A 1UVKA 2Z2LA 2MZJA 3D54A 4YP3A 1XC9A 1N6QB 3CCWA 4FN5A 1X4CA 1LV5A 4X4VA 4R8UA 4JI1F 2IBKA 2CJAA 2E9RX 1FO1A 2HNYB 4E98A 4G1PA 4LFAF 3FMWA 4A4JA 5LSOA 5GAEU 2K2PA 2OPSA 5EX3A 5KOXA 3H8YA 4IFVB 4OFZA 1QTMA 4C0BA 3KLFB 1FDBA 1ZM2A 2P9CA 4B9TA 2R2UA 1X0FA 3IGNA 1H2TZ 1UWBB 2OFHX 4M5DA 3BS9A 3MAQA 3D1HA 3MM8A 4M95A 3K57A 3FFIA 4ZVFA 2DGUA 4DR6F 3TNVA 5FDLB 1S9GA 2HFOA 4YQWA 3OVBA 4H4OA 3KHRA 5KAKA 2HAIA 4O4GA 4FYDA 1KONA 2KRBA 2FC9A 5EGYA 2GO8A 2XHWA 2KT3A 4DN9A 1KQSR 1FXRA 3DM2A 4JI0F 5IFMA 1M5HA 5A2QY 3HK2A 2VFVA 3I87A 4NYZA 1YRXA 5IXUA 1C1BB 1R89A 5D4PA 4P7TA 3C46A 2COLA 3R5CA 1KVJA 3HKWA 4J9PA 1RT1A 1IQTA 4RUAA 1HD1A 2BA9A 2DNGA 5KFIA 2MZ1A 3EXCX 3MI7X 4YB7A 4CTAB 3RAXA 2D74B 2DNQA 3BREA 2FGOA 3DRPB 2XGQA 1HNIA 2ZDOA 1U26A 4A8OA 3K5OA 3ENVA 3UD3P 3RW7A 2UUWA 2Q66A 3FDSA 3DRXA 3MFIA 1MWZA 1JLEA 4ED2A 1OIAA 3IAM9 4UQTA 2DO4A 5EWFA 3Q8PB 4ED0A 4I1TA 4RX6A 3W2WB 2DR8A 4L6V3 1R8BA 1RT4B 5CH7B 2ABYA 2X1AA 2ASDA 2FGCA 5CXTA 2R4FA 3OTEA 4K0KF 3NGKA 3IS9B 3R1LA 2GA7A 2VFSA 2D9OA 3TR5A 2DIVA 2DO0A 1WI8A 4AE5A 4LMZA 3QLHA 4DEZA 4NXMF 3D0GE 5C42A 2ZZNA 2ZH2A 4GKKF 2OPRB 5KT5A 2RS2A 3B82A 4IH6A 4PWUA 4PKDB 4NZ7A 5H9EJ 1UJ5A 3SV4A 4G1QB 4N41A 4KV8A 4NLXA 3T5LA 4R5PA 2CQHA 2Q79A 1WHVA 4NCAA 4QU7A 5E3AA 2NQPA 2MKHA 3PACA 4WYLA 4CO1A 4RWWA 3KLHA 2M7SA 1QUPA 2MQLA 2MKSA 4ZVEA 5G0RA 1TK8A 1TKZA 4NLOA 1XBWA 3J7ZT 4N5SA 3BM7A 3MMBA 1WACA 2G13A 3PKMA 3GFHA 2XNRA 4LF7F 1HBOB 2ROGA 2WTFA 2VL1A 4ZCLA 3UW1A 1TZ0A 4CZCA 3N9UC 4QIGA 4N8NA 3E3XA 4YR3A 2EWHA 3BEGB 1IKYB 5L1IA 1VQOS 4F2SA 4O3RA 4O4RA 4ZCMA 2RILA 4FBUA 2PIIA 4EYIB 4UUXA 2O1PA 2VG6B 2ZNYA 1S76D 5AXKA 2EVZA 1S77D 3DYAA 1VRUB 3MEGA 3GILA 3KK1A 2YNHB 2OPQA 1NJZA 2MKCA 1S0VA 3AQOA 1JLBB 4OJ3A 3PHEA 1PO6A 1GXLA 4IDKB 3I9V9 3H4DA 4TY9A 3I32A 1VQ7S 3O6QA 4K4UA 1HBNA 1HWKA 4PG6A 4N77A 3OUYA 5DDQC 3QJLA 4ILLA 4KC5A 2V8DA 2PFFB 5HP1A 3OQ2A 1BQMB 2CPZA 2OSQA 3DU5A 4N76A 1KHVA 2XG8A 3VAFA 4ZP8A 1JB0C 1MMDA 4W92B 2DNZA 1HWJA 1RJJA 4DV0F 1HNXF 1M5SA 1VBYA 2APOA 3M32B 1LWFA 3MMCB 3Q8RB 3CULA 4C8ZA 4FXWA 4Q43A 3E01B 3BGUA 4JV5F 2VPXB 1C0UB 4FF3A 2RKIA 1FKOA 3CUNA 4G6VB 2YKNA 4MYTA 4DL4A 1GNKA 4PWDA 2V9KA 2FHKA 1M5VC 2ALZA 2YQ3A 2CQDA 4I7FB 3OFGA 5KFEA 2GGPA 3I0SA 2FJVA 2BZ2A 3ITHA 4F4KA 5SUHA 3CJ0A 1AROP 4PXDA 1SXLA 2NYIA 3G9CA 5U47A 4YB1P 4C0HA 3OVAA 5DGBA 1RWUA 3CJKB 3QO9B 2WK4A 2ZH4A 2F8MA 3KG4A 4Q8EA 4ECTA 2ZITA 2M0GB 3KLFA 2W8LA 1LFWA 4NLRA 4DSKA 2LQJA 2K1RA 3G86A 1ZPVA 2JJ4D 4PUOA 2B7CB 4ERDA 3AB4B 3CJ5A 3NGDA 3BGRB 3G71S 2ZE2B 3PW7A 2M3DA 1IUJA 3IWNC 2VQEF 3MECB 2KKHA 5FDLA 1VJWA 4KFBA 4P7VA 4YFUA 3DRYA 3VQTA 3RBEA 1D8ZA 3CDEA 4QYRA 3MM6A 3JSYA 3KG0A 3ISZA 2DK2A 1K0TA 3H40A 3OHBA 1NB7A 3SCLE 2IHR1 3DGPA 2M88A 3JB9k 2DTJA 2YKQA 1R31A 2ZC4A 3C6UB 4GMKA 4Q7AA 6FDRA 1RT2B 1UVJA 2DPJA 4ELTA 2RH3A 4KBIA 2DIUA 2VPZB 2CPEA 4A8KA 4OMFG 2YWEA 5D78A 3M1VB 4B9VA 2MXYA 1T05A 3C2PA 1LXJA 4CTAA 1Y5LB 3CGIA 2CJ9A 3VAMA 4NCGB 3DOKB 2POKA 3QPIA 4RNNA 1YJRA 1BGXT 5EN1A 2MJUA 4A8QA 3W2VB 1SUQB 2DGVA 4ED6A 3PW0A 3ENQA 2L08A 4RUHA 3U27A 1U25A 1IM4A 1HNVB 4DBQA 1ZZFA 4DQQA 1UA0A 2YKMB 1G6BA 2CQIA 3LQVA 4I4BA 3HVTB 5FJ4A 3F73A 2W9BA 2A10A 1VQSA 2HQIA 3L09A 5KG2A 1WTBA 5D3GA 3QAUA 4EBEA 1TKTA 4RBTA 5KFYA 4CNZA 4Z2XA 5IS2A 1RTHA 3QJJA 2YH1A 4IH5A 1X5SA 4DL0C 5KFNA 3PV8A 2F8HA 2UV8A 3H20A 3IS9A 4IYQA 4WE1B 1L3UA 4I2QB 4NZ0A 1SKSA 5KFAA 2B9WA 2E7XA 1ZZNA 4KPYA 2CDQA 3LANA 1HQUB 4XDDA 1CG2A 3HO1A 4ECRA 3KMQA 1R27B 4KKOB 2DHSA 2FJEB 3MMAB 3O1LA 1OQ6A 1LW0B 2Z0GA 2IRUA 2IVYA 3DLKB 5ADZA 2OPRA 2O67A 3T5KA 2BXJA 1TVRB 3HX9A 1S72S 1KNZA 3BQ2A 1QE1A 2N82B