3NGUA

Structure of leishmania ndkb complexed with adp.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIASWTSHSVSQIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Molecular adaptability of nucleoside diphosphate kinase b from trypanosomatid parasites: stability, oligomerization and structural determinants of nucleotide binding.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 44
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2010-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3nguA00
1WKLA 2DYAA 3FBEA 3FC9A 3EVMA 5IOLA 4UOGA 3NGUA 1PKUA 2HVEA 3EVOA 1NDKA 2CWKA 1NDPA 3ZTSA 1WKKA 3NGTA 2HVDA 3FBFA 1BHNA 5C7PA 3VGVA 2DXDA 4CP5A 3VGSA 1UCNA 1NSQA 1S5ZA 4DI6A 1HHQA 3EVWA 4F36A 4ENOA 3FBBA 3BBFA 3MPDA 3ZTPA 3FCWA 1EHWA 3Q8UA 1B4SA 3JS9A 1NLKL 2DY9A 1HLWA 3VVTA 4F4AA 1NSPA 3BBBA 3PRVA 4S0MA 4DUTA 1NPKA 1XIQA 3NGSA 3ZTRA 3GP9A 3VGUA 3R9LA 3Q83A 1S57A 2DXFA 2HURA 3ELHA 1LEOA 3EJMA 3ENAA 4EK2A 1NUEA 1NSKL 3ETMA 3EE3A 1S59A 3L7UA 1VYAA 3DDIA 3Q8YA 3ZTQA 1BE4A 2B8QA 1LWXA 3BH7B 3BH6B 2AZ3A 3FKBA 4DZ6A 5CAAA 3EMTA 1NDLA 1ZS6A 4KPCA 4W98A 1U8WA 2NCKL 4C6AA 5BXIA 1K44A 3FCVA 1F6TA 3VVUA 1F3FA 3G2XA 1JXVA 4WBFA 4FKYA 3B6BA 3DKDA 1NB2A 2BX6A 2ZUAA 1NDCA 4ANCA 3VGTA 3Q8VA 1HIYA 4HR2A 4UOFA 3B54A 5CABA 1MN9A 1XQIA 3Q89A 2DXEA 1WKJA 3ZTOA 1KDNA 1NCLA 1B99A 4FKXA 3GPAA 3EICA 1NHKL 1MN7A 1PAEX 1BUXA 2AZ1A 3NGRA 3EM1A 1W7WA 4ANEA 3WX8A 3PJ9A 2VU5A 2BEFA 3BBCA 3FBCA 4O0NA 4ANDA 4UOHA 3Q86A 2B8PA
chains in the Genus database with same CATH superfamily
3M30B 5T14A 4V19J 3T5JA 4LQ3A 1G6BA 4OZ3A 3KLFB 1RT5A 2HQ3A 2I5JB 5I42B 5DGAA 4PKDB 4DR5F 1RB0A 1OYEA 2BA9A 4C8YA 1HFEL 4C4WA 4ZN3A 4LFCF 4LF9F 1B0PA 3CWJA 1LWCA 3UI3A 1HMVB 3RR8A 2K06A 1MWYA 4J9RA 5JJBA 4QPXA 2M70A 3GYXB 5F0UA 4OYIA 3R6LB 1PILA 1ZS6A 2E1MC 4F3OA 1RAHB 2GJFA 3WIVA 1R89A 2YKPA 3B4MA 1MLAA 4G6VB 2J9EA 1U1QA 3KLGB 1TL7A 1J5OA 3C46A 1X9WA 1T8EA 5CABA 2VOOA 4QBUA 4P2MA 1EQ0A 3TWZA 1FK9B 2KO1A 2W25A 2ZEJA 4JI1J 3LQVA 3QFWA 1VGYA 2VG5B 2HHQA 1EETA 4F4YA 1UA0A 1XN9A 2XEXA 1B7YB 9ATCB 1OQ6A 2N7YA 3M8RA 4FNIA 2PMHA 4ENOA 1S1WB 4ZVFA 2CPXA 2QG9B 1SKWA 1LV5A 1N0VC 3L3CA 3I9ZA 2A18A 3HVAA 1GMWA 3NGSA 4URQU 3ZTRA 2VPZB 2HZAA 2J0WA 3PJXA 3HHLB 2ROEA 1W26A 3TZWA 1RT1B 3RW7A 7FD1A 4PG8A 1RTJB 1OQ3A 1CJVA 3UCZP 2F1FA 3TZYA 4FF3A 2JEGA 1XQIA 3GQCA 2DJWA 3TVYA 4WFNQ 3DRSA 4C48A 1H7XA 5KFHA 3PKYA 1T03B 2ZOMA 1TKXB 2E5IA 4EU0A 3M8ZA 4Y65A 3BQ1A 4PWUA 4QWCA 2FVPA 2W2OP 3HO1A 4ZPAA 3B82A 4IO1A 3EVWA 3ZZRA 2CG4A 1YRUA 4PYDA 3POTB 1S9GA 1JLGB 3H5SA 1QAYA 5IT4A 4LVNP 4ECRA 2OPQA 2FVRA 4XPEA 1UAWA 2OEKA 1T3OA 2DNKA 3RRGA 4ZLPA 3HZGA 3P8BB 3BH7B 2W9CB 3EMTA 2OPRB 2DEJA 2LU1A 1XNQJ 2ZNYA 2Y1IA 3K5OA 4DR5J 1V3RA 3PFOA 5HMXA 1T94A 4NMLA 1AFIA 2GIQA 2PDAA 1RK8A 4AYBD 2NSCA 3DYAB 4LFCJ 4LF9J 1P27B 4I2PA 1YJ9S 1S6QA 1JLBA 3S8SA 3KK1A 2DGXA 2V6AA 3C66A 2Y0BB 2FJXA 4JI4F 1U0SA 3I4PA 3KLHA 3E2EA 3I32A 2IJFA 3T1YF 2CJQA 5BYQA 4U8YA 5D78A 3OR2A 2C2EA 1HBUA 3HJFA 5D4PA 2ZM6J 2QLWA 3EX7B 2V2QA 3NWGA 2YY3A 1SL0A 1SC6A 3I31A 3MI7X 4DQRA 2OFHX 2RILA 1IQTA 4ATNA 4RNHA 3TI0A 4JI3F 2PI5A 2CIMA 1F9FA 2JHEA 4M63A 3N6NA 1AZSB 2GJIA 1RTDA 2JH3A 2Z0GA 3E8OA 2XLJA 1CBKA 1J2VA 2OH2A 3NP5A 1HNVB 1WDDA 1NK4A 4DV0F 2IM0A 1CJKB 5E0OA 1WACA 3R5JB 1B0VA 4O44B 2V4JB 2UUBF 3BGUA 3D5MA 1CQMA 4UUXA 4LF1A 4OI4A 5AXNA 1RDRA 3NCPA 2J9DA 3MUTP 3M6UA 3CCRS 3Q86A 2Y3YA 4ID8A 4Y2CA 3EVMA 2B4UA 3R3TA 1HI0P 2C42A 2FHKA 1L3TA 2J5AA 3D3BJ 3PIPQ 2B7BB 3MEGB 1YGYA 1UMJA 4PRFA 3CD5A 2D3O1 4Y00A 1S99A 4CQ1A 1MMDA 2G9OA 2XCAA 1M0SA 2QEXS 4I1TA 2HFSA 2XHWA 3MPWA 2R8IA 2HQCA 2HFVA 1FD2A 1LWFA 4L72B 1Y4ZB 1NPPA 3ELHA 2M3DA 2IBKA 2JDJA 4G1PA 3F44A 2XB2D 2E9RX 4LIWA 4MKAA 4WXWA 2AYMA 1FNMA 5IT9U 2MZRA 3FFIB 3FCVA 2YKNB 2J0SD 2FHOB 4WFXA 2PN6A 3SFUA 1WKJA 2A10A 5B0EA 4B3MF 2QLFB 3SCKE 2FHMA 5L1JA 3U1NA 4NPOA 2C2DA 2GHPA 1N6QA 2GFFA 2QYCA 4OI1A 1HD1A 3OQ2A 1LW0A 1UFWA 1GH8A 4NCGB 4URGA 4Q5VA 1NO8A 1D9FA 2FHJA 3OT9A 5KG2A 2B9YA 2JL9A 2N7CA 4M5JA 4ZPCA 2YQ0A 2ZVIA 3BO4A 3D54A 4F4AA 1M5SA 1GMUA 5HLFA 3DDKA 4JI4J 4ZIVA 4YR3A 1YBUA 1VYAA 3T1YJ 1DAXA 2FY1A 1R8CA 1ZA2B 5CCLA 4DU8A 3GV7B 4BWMA 1F5CA 2E5GA 4USWA 5AE2A 5K8PA 1DQ9A 1S4EA 1F3FA 5B0DA 1FEEA 4NLQA 2OP5A 5KFUA 5E2QA 1R7IA 2X1AA 1KS2A 4JI3J 2MZQA 4Y2IA 4G1QA 3FQKA 3NCRA 4TU7A 4YQWA 2J9CA 3QZ8A 3OHAA 1IM6A 2CPHA 4L3NA 2NUHA 4DV0J 5CZXA 4WJBA 2BKNA 4I7FB 1BHNA 3RBEA 1XC9A 2R3VA 2YBVA 3CJSA 3BEGB 4PQUB 2UUBJ 1IKXB 4ZOSA 1BQMB 4L73A 3LO3A 1NKBA 2R7SA 4C3MA 1TVRA 1HNIB 3P6YC 4ID5B 4DUTA 1DRZA 2LCWA 2B9WA 4EGLA 4CLKA 1VCTA 1X4CA 4QPTA 3ZXWA 2RT3A 2DRBA 4C2MA 3R7NB 4DLGA 5CYMA 2EG2A 4FKYA 2Y1RI 4ZPVR 4C98A 1NK8A 5GAGI 4DSLA 1H73A 1Y5NB 2MSSA 3GE9A 4JV2A 2HHVA 1PBUA 4DV7F 2J9DE 1C1CB 3HKZD 4FZVA 4K4YA 1M5PC 4LRBA 1U1LA 1QVGR 3GFZA 3F56A 2CPDA 3W5ZA 2KM8B 4OX8A 4KO0A 4WF9Q 3D3CJ 3J80U 5IOLA 2PMWA 1Q81T 1SC1B 1T05A 3M6XA 1C1BB 1DLOB 1HNXF 3FBFA 2FUG9 2H51B 2WB4A 3IS9B 3MWBA 1Y9OA 3U1LA 4YOEA 3HFZB 2VF3A 1YJTA 5B0FA 3V6DB 2W1BA 5KFBA 1XBWA 1S0OA 3PFEA 1S0MA 3PEJA 1WF2A 3CNQP 4B3MJ 4CYUB 1VISA 3V4MA 2EG1A 1RHMB 2KJWA 5GADU 4LIRA 3AD7C 4ETXA 2JC0A 2WZ1A 2E5LF 2FB0A 5KG6A 4RL1A 1IKWA 1YJVA 1X60A 1FRXA 2EI5A 3PW2A 5LOQA 1RBAA 3B6BA 2ZZNA 2F5GA 2RKIB 2WSFC 1FXRA 2V2VA 2EW9A 2GMHA 3AHPA 3HXMA 3WC2A 4USMA 5CQGA 2U1AA 3W2WB 3ZNJ1 1LXJA 1HQ2A 4B17A 2H4WB 1T9UA 3HHEA 1VK3A 1GXUA 5ETPA 5AE1A 1FTRA 1S1XA 3LWMA 3CVKA 2ZHOA 2JEFA 1REVA 3GWCA 5T7LB 5K14A 1N4LA 3RG6A 4TN2A 1Z2LA 3BBFA 2ZKTA 4P2FA 1DTQB 1CS4A 3PX6A 1TL1A 1XJWB 2XWXA 4K8RA 1DHMA 3ZZPA 4RBVA 4DCJB 4NL5A 2D74B 4WE1A 4I68A 1TUGB 1RT4A 5A8KA 5J2QA 5A0YA 3VALA 3MM7A 3SIPB 3RB0A 2XBPA 4RBTA 4Z2XA 1FE4A 2OJ3A 4C8NA 3MR7A 2YQ1A 2YNGB 4ZKAA 1IR2A 1HIYA 2FVQA 2E7VA 2EFOA 2FVSA 4FBTA 1HYSB 1A9NB 3HHKA 2MKCA 1W2IA 3RRHA 1RCXB 3L4BC 3SCIE 2BJ1A 4JI6F 4X64F 2XO7A 5KG0A 3CPWR 4OZ0A 1WG5A 2ACYA 2NYIA 1X0PA 2ZOGA 5SUHA 4UQGA 4IKAA 5KFOA 5LSOA 1UW9A 4F0KA 4RKUC 1X4AA 1YJ7A 4IRCA 4PWDA 4IQXA 1FFGB 3OSPA 5J1EB 3KJVA 3K0JA 2ZH7A 3NBPA 4LQ9A 4DV7J 2Q43A 3M8QA 1KQGB 4NLPA 4IRDA 4U7UD 5DRKA 2HNYB 1M5HA 1LEOA 1ZM3A 2BACA 2J6TA 2J6UA 2N4CA 2DNYA 2W2QP 3BZQA 2JSXA 3ZZYA 4DF8A 4DSKA 3N01A 3TRGA 1G4CA 3SSQA 1AB8A 5ETKA 2XQCA 4UOFA 3HDSA 3EGZA 1RADB 2JX2A 4X4UA 3OFHA 4M5HA 4CCHA 2NUUG 2XLIA 4I67A 2LQ8A 1CJTB 1FD8A 4UQTA 4DEZA 3CCSS 1HBOB 5IT9Y 3QYYA 1CC7A 1Y5LB 1TV6A 4ZPTR 2E5LJ 2HYIB 2DH8A 2VB6A 2HVEA 3EVOA 3DOLB 3CJ3A 3HHNB 1ZBTA 4PXEA 1UCNA 4DQPA 5A8WA 4DPTA 4LFAF 2VC0A 4CM0A 2ZNZA 1GAOA 3KOAA 5KG1A 3W62A 2VIHA 2MKJA 4GVBB 3MCNA 4DSFA 1YBAA 2HGLA 3KK2A 4FXDA 4Y2AA 4CRJA 1RYRA 1B3TA 3UPFA 1QJHA 1PJ6A 1UEUA 4Q44A 1F1BB 3CDWA 2L3MA 3VAMA 4KGXB 2MQ8A 1K1SA 1DQAA 3QJLA 4DX7A 3BH6B 1WTFA 2WBMA 1RT7A 1SKRA 3M1VA 3U1MA 3DRXA 3W7BA 2KB2A 2DPIA 2ATLA 2VZ9A 1L5UA 3MMBA 1ZZFA 4J9SA 3OVBA 2A2CA 4NE9C 4KT0C 3MAAB 1KDNA 4G1IA 2AJ2A 2ZE2A 1X9SA 4F4ZA 3JSMB 3AXMA 4CTAB 5J1NA 2FIUA 3C3LA 1BWVA 2RU3A 3ILIA 1FRHA 4QR1A 1Z1ZA 1RWVB 2VG6B 1TL3A 5HAOA 3TOQA 4X4SA 2RQCA 3M8WA 5D0HA 3NS5A 2GMJA 2G1DA 3EDRB 2YWEA 3MR5A 5HMYA 4QU6A 3W3SA 4UTGA 1S6PA 4UT4A 3NWRA 2JWNA 2FZCB 2KT3A 3ULHA 4FP9A 3M32A 2C2OB 1GQEA 1SJRA 3Q8YA 4X64J 2BKPA 3RGIA 1X4DA 3IGVA 3MFIA 1E6YB 2HVIA 4IFVA 1E6VA 1MU2B 4LF5J 2NZ4A 4M5GA 3HFKA 3TEHB 4DG1A 5FIIA 3PRDA 4C0HA 3QWPA 2OO4A 4IRKA 3DGVA 1UA1A 3OXGA 3M05A 4CLYA 2ZDPA 1VQ9S 4A8FA 4HEA9 1EKRA 4FYDA 5HROA 2FJBB 2ZD1B 5IT0A 3C6UA 1FDNA 2B8PA 2C22A 3E01B 1RE1B 5B09A 4UOGA 3PR4A 3GFHA 3NOCA 2DT9A 5J2PB 4KPYA 2DK2A 3M8PA 1DARA 5HBMA 1N5TA 4B3OB 4MK8A 1F60B 2O67A 4WKRA 4AUKA 4L6V3 4DR6J 3J80Y 2DRDA 4F4WA 1RT5B 1U8SA 2M7SA 4NLWA 3TJAA 1S6UA 4GMKA 1X5SA 2ILZA 3LW5C 2P6TA 1LWCB 8RUCA 1YZ7A 3NAHA 4DWIA 4NLXA 4LFAJ 5ADZA 2QMUB 4CO3A 3Q89A 1AT1B 1IBMF 4ELVA 4DFPA 3BYRA 4ZVQB 3W63A 3FQLA 1NMEB 3IBWA 3NL0A 2JVRA 1TL7B 1J5OB 5KT5A 1KOHA 3M6WA 4JI0J 3AAWB 1WORA 4J5OA 2HVDA 3HFVA 1MROA 3WHIA 3J7A1 1D8YA 5T41A 4MKVA 2FC9A 2XLKA 4MK7A 3D6FB 3MEDA 2AHOB 2W7AA 1DURA 2FJEB 1Y3KA 2YNFA 3NG8A 2GV1A 1U1NA 1EETB 3N6LA 2MQLA 3NOGA 2ZHAA 4K4UA 5IC4B 1TKZA 4TQSA 1C0TA 4DZDA 1N48A 4C7QA 3WQPA 4UZCA 5CAAA 1S10A 1XEZA 5I3UA 4IH5A 4PG4A 4UF4A 2W9AA 3BDPA 2HAFA 5EX0A 4EBDA 4X4QA 1FKPA 3U02A 1S9EA 3TX8A 2QMXA 3V81A 4HACB 1F5BA 1UFLA 2VFSA 2CA9A 2FD2A 3OSNA 4ED3A 2WVBA 3L7PA 2HK3A 2HLTA 3TW0A 4K50A 3NRBA 4C8KA 1UW4A 3A4TA 1QVFR 3N79A 3VAIA 3PKMA 3EUNA 1I3OB 4IOBA 4R5PA 4A4JA 4ZVRB 4WPAA 1U6BA 3DRSB 4XO0A 4IR9A 2R8JA 2YTCA 3ITHA 2Y8YA 3G86A 2E66A 1B4SA 2WRMA 1HLWA 1KFDA 2FYXA 2YKMA 4J9OA 3PZPA 4QYZJ 1ZM4A 2LP4A 3BKTA 2HHPA 5L39A 5FLXU 2ALZA 4ED4A 1I6JA 2MKSA 2BW7A 1S59A 1S9GB 2YWGA 2AZ3A 3IP0A 5BYRA 1RWMB 4Z7YA 4OQJA 2AT1B 4NI2B 5E3AA 2OPQB 3EGVA 4TVAB 2PO4A 1VBYA 4DX5A 3CD0A 4YHHF 2ADBA 1N5YA 4RW7A 3BO2A 3CTRA 5DQGA 4NEZA 3PHEA 3VR1A 1RT6A 4ZJOA 1EAYC 3TA1A 1ZH5A 3N9UC 2W4DA 2BJ8A 2PMZD 3GB0A 3Q8RB 3QT5A 5K8NA 4I2PB 1JLBB 1RT2A 3PXGa 3KK1B 2AGQA 1A6LA 4KFBA 2HGMA 1RQ0A 2ZFHA 5H9FJ 3KLHB 2VFVA 4B9MA 2YXLA 1S0NA 1QE1A 5GMKa 3QRQA 5A6PA 4J9NA 2IM1A 1NPKA 6FDRA 3TUIC 3OR2B 1HBUB 1N0UA 3AOBA 2AX0A 2MHNA 4WFZA 1K1QA 1VQ7S 3W2VB 3QJJA 4LF7F 4CLFA 1Q8BA 2XG8A 4TY9A 1YHQS 1XNRF 2CDRB 4DJBA 2DHAA 1RTDB 2H1YA 1NRKA 2VDHA 4ZCMA 4NWBA 1KWMA 1PG5B 2V50A 1HI8A 2FLOA 1KVJA 5F41A 3NGRA 2B43A 4RW6A 4DV1F 1D0EA 4WCEQ 2IMOA 4Y6IA 1FTCA 2P9CA 1X4GA 4NLGA 4EZ6A 2H5JB 2W8LA 3W66A 3FVYA 1FO1A 4ECWA 1R6VA 2A3JA 4PXCA 3AD8C 1LWEA 3SQGA 3CB4A 5KFWA 1WC3A 4B3RF 4QW8A 2VUGA 1VS3A 1VRTA 4DR4F 1NEEA 3D6MB 4OHZA 1NUEA 3LALA 4X84A 4FYVB 1H72C 3I4HX 3G8TA 2K7KA 3OLBA 2XZTB 1GX6A 4XK8C 1LWFB 1EB0A 4OV1A 1WC0A 2CQCA 4HR2A 2BZ2A 3MM9A 4DR1F 4I6WA 2PI4A 3HULA 5FJ4A 2DCUB 2YX7A 3PW7A 3EPGA 2QL9B 1T9XA 3A3NB 4ZP7A 3K8VA 4ECQA 2ZC3A 4CNZA 5A76A 2XY6A 2BRLA 1WSRA 1IVZA 3VGVA 2UXBF 3KLEB 1WWHA 5M2RA 4YP3A 3FCWA 1S1UA 1RA6A 4B3TF 2VC1A 4YHHJ 1N6QB 3MTJA 4HH1A 1RWUA 4CM2A 2DNZA 2E29A 3L95X 5KFDA 1LW0B 3BGOP 3JYTA 2ZOFA 2R7UA 5LSLA 1PC5A 2Z56B 1J5EF 5HL7Q 3J81U 2VBXA 4JV0A 3QMQA 3G4SS 2LYVA 3Q23A 2ZUGA 4OZNA 2BDPA 2QX0A 5HLFB 4KH0B 4NZ7A 2EEYA 1WI8A 3GIKA 1O0PA 2DR6A 2ADCA 2HRTA 4ZVPB 3UFCX 1RWPB 1MWQA 3GG0A 5AJ3F 4BWJA 1SH2A 2XMJA 4DCOB 2R2SA 3UNYA 3MPUB 3IAM9 1EP4A 1IR1A 3C6TA 2B9EA 1S4FA 1JKHB 1XNRJ 3VGSA 3QSYB 1SJ4P 1HARA 4OLPA 3D7SB 1RLDA 1U02A 5ITHA 4JI5F 3CCUS 2W7OA 2HHSA 4I69A 4JI2J 5DDOC 2D3OR 4EWTA 2LQBA 1R8AA 2FZGB 2ACMA 4DV1J 3M9NB 2NYHA 1GTEA 1BMQB 2MGZB 2FGOA 1M1HA 2W24A 1ZA1B 5GMEA 1TVRB 2MQOA 1S1VA 3R7BB 3VVUA 4DV2F 2FJWA 2RE1A 4NXNF 3DXBA 1RAGB 3RAQA 2K3KA 1Q0NA 3N5BA 3GIJA 4A48A 1U4BA 3HHDA 2QIFA 1KHWA 4HVZA 1FT8A 4QIFA 4B3SJ 4DR4J 2VQEF 2GQCA 3N5FA 4JP8A 3MHYA 3UWTA 4NXMF 4R8UA 3SI8A 3LAKA 3TA0A 2DEIA 5ETVA 2GVDA 3GJQB 4X4VA 4P7VA 4KO0B 4DL0C 4U67Q 4DR1J 3J7ZT 4LSLA 2DHSA 3Q2TC 3WZ0A 4FVMA 2QTWA 4LR7A 2LQ5A 5C2CA 1BD6A 3H98A 5IWAJ 3MDFA 3ENAA 4V19X 1S49A 3VAJA 2HBZB 2XS7A 5IM0A 4DZ6A 3OTCA 4OZ2A 2UXBJ 4G65A 1DQ8A 3GJRB 2HHWA 4AFFA 3I96A 4DQSA 1SC3B 4NLUA 2ATCB 1ITPA 1P1TA 3KUEA 2E5HA 5FLXY 1QAJA 5BYSA 1IKWB 2ZHBA 1PAEX 4ES2A 3R2DJ 5EN1A 2CNNB 1TTHB 3KKFA 2V2ZA 2IYGA 1YJWS 1J5EJ 2OELA 3NGUA 1T0TV 2BANA 2EFPA 2MZJA 2HNZA 3DRPB 2AGOA 2DRAA 3MM8A 3IAS9 2ZJQQ 4A8QA 3CULA 1VQLS 5EGYA 2GAGC 1EHWA 1JQGA 2LA6A 5HJXA 2LFVA 3HD2A 2OD4A 4M5KA 4OZJA 3SDEA 5AJ3J 2ROPA 1NK6A 4NMXA 2QMWA 1REVB 1RSCA 2V94A 3JSRA 3NS6A 2UVVA 3LH2S 2UZAA 4RR5A 2W4CA 4ZIWA 5K14B 4GC7A 1EJ7L 2HFZA 4L3KA 3DLJA 4DV4F 2R7XA 1N33F 2UXDF 2I8EA 2HWIA 5HVFA 2DGWA 4WYLA 3BDEA 1WC1A 4FS2A 1GFWB 8AT1B 2EWHA 5EWGA 3UDEA 1ZM9A 2CPFA 4WE1B 4ELUA 5J1PA 1CLFA 1SH0A 4JI5J 4J9QA 2Z2YB 4WFYA 3FDSA 5A8KB 4WXOA 5J2QB 3MM7B 3IMQJ 3G6VA 1MG7A 5D8HB 5D0EA 3ILLA 3CC2S 2CQ0A 2CJ9A 2KVIA 2O1PA 1JLFA 2PA3A 2OIHA 2OTLS 1RHQB 3D1HA 2F63A 2DNOA 2BBEA 3H42A 1HPZA 3A8IA 4RU2A 4DV2J 3NNHA 4NXNJ 1HHQA 2LQ9A 2R4FA 1ZOTA 3MMJA 4USJC 2GMLA 2Y0SD 3I56S 1F9HA 1TKDA 2ZKUA 5KG7A 3W8PA 2Y1JA 4K5RA 2RUSA 3ENWA 4A8OA 4NX9A 1VQOS 4QYZK 2RHSB 2VHGA 2XULA 3FNNA 2VQEJ 4OYPA 2ZH4A 3KJVB 4NXMJ 2DIVA 4HDHA 3NBPB 3M8QB 3HHLD 2V8PA 2UUTA 2MZ1A 1WF0A 4F04B 4BHQA 2QL5B 1JLEA 2F3JA 2CQ3A 1FRKA 1DFDA 4A8SA 4MK9A 1S0VA 2QSFA 3EICA 5FD1A 1X9MA 4FPRA 3JQMA 3IRXA 1A0OB 4CO4A 4UOHA 2QSWA 3KLVA 4OX9F 3I0SB 3D1QA 3R2CJ 2ZJRQ 2WW8A 3PRBA 1G2EA 4NA3A 3U27A 1L3VA 4OJ1A 1FXLA 3BPDA 1YTYA 5GAGU 4C97A 3I0RA 2BABA 5H9FK 4QIWD 1TV6B 5F8GA 3D67A 5EWEA 2UXCF 3HT0A 2XMAA 5B0GA 3AOCA 5A8WB 5DQHA 4DDFA 3O6QA 4KV8B 2ZBRA 2FJDB 2PEHA 3KK2B 4OYOA 5DETA 9RUBA 1OSDA 2VH7A 4KH1B 1S1TA 5B0CA 3V4IB 5KFFA 1RT3A 2CQGA 4NA1A 4KGMA 2UUAF 3Q2SC 4TLQA 4JYAF 2WHOA 1B70B 4J9LA 3X3UA 4WP8A 2B7CB 1NXIA 2QGFB 1RWXB 1SL2A 3IO1A 5LM7E 2LEBA 2R2TA 3RW6A 1NBEB 2MQNA 1RYSA 1H3DA 1WSVA 1YG0A 3MMBB 5LT5A 4DV4J 4EMDA 2JLGA 2UXDJ 3NGTA 2COLA 5LL6d 2VBYA 2ZE2B 3K89A 4RPFA 2K2PA 2CNLB 3AD9C 1RTZA 3BKFA 2EBEA 1WHVA 2E9ZA 2V9KA 5KT6A 3EZOA 3MTKA 2DHHA 1TL3B 4AXIA 2C2RA 4YEAA 3JTOA 2ZWPA 4DOZA 1TUWA 2MJUA 4FF4A 2HIYA 2B0GA 4PG5A 3HT3A 4AL5A 2AGPA 3K58A 4CNYA 1VMBA 3KK3A 1S6PB 2A6OA 3BV8A 2HPUA 3IG1B 3LGHA 4NASA 2BOPA 3M32B 4HDGA 3OTDA 2OPSA 2LKZA 1RUSA 2AJ1A 3GPAA 4CZCA 4IFVB 1FX2A 1Q53A 4CWBA 1E6VB 2GC8A 4RW4A 3FJ2A 2QJ3A 2XZWA 1JX4A 1XMBA 5H9EK 2V69A 1ZPVA 3KNAA 3AQPA 4X66F 1XR6A 3AA9A 3N0VA 3F0NA 4ZP9A 2UV8G 3KMSA 2B5JA 2BXJA 1OS5A 4TY8B 2FPHX 2RS2A 4LSZB 5HROB 1D9DA 3C6UB 5KFTA 2JFKA 2QFJA 5E5NA 4KTQA 3AY0A 3DLEA 4O4GA 4CT8A 4HTJA 2X3GA 3OXFA 3VVTA 3IGNA 1WC6A 4OFZA 4B08A 3A8JA 4JV5J 2OMLA 5DQIA 1UVJA 2V8HA 3M8PB 3MECB 5HBMB 3G6XA 1PBAA 5KOXA 1R0BG 4AT1B 4RLEA 1XWLA 4B9VA 1IBCB 3OTEA 3CW2C 4UY8T 3GCXP 3PEHA 2ZUAA 4OMFG 3AXKA 4QIVA 4I4BA 3QPIA 1PYOB 4OI2A 1SXLA 2XYPB 3W60A 2NREA 1H2UX 2UXCJ 1MN7A 1X4FA 4U6PA 1DBDA 2YQ3A 2CYYA 1V6HA 3SQOP 1SC4B 1K8AT 2WONA 2QA1A 4CO2A 3MOZA 2LMIA 3M8SA 3JTNA 3GV8B 3TQ1A 5H1SV 5CZVA 2CQHA 2CPEA 4F3QA 2Q66A 2I5JA 2AIRB 4YUDA 4DF4A 2EK6A 5MAOA 1TELA 2GHWA 3AODA 2AWZA 3F73A 2YH1A 3D4JA 1HNZF 2MY7A 2OHDA 2D41A 1RGVA 1F5AA 4PABA 4O0IA 2NLWA 2UUAJ 5KFMA 4X4RA 5KFYA 4Y3CA 3V6HA 1X31C 1WG4A 2P2CB 4J90A 4MH8A 4F26A 3SBMA 1MROB 3UE2A 5K5MA 5IV3A 1P9YA 4H4MB 1SKSA 5EHHA 4RBUA 2XGPA 3MEDB 4ECYA 4CH1A 3CDAA 1Q95G 5G4DA 2YNFB 3T6JA 3GR1A 1NB7A 4LRDA 3NEKA 2H54B 4LRAA 3KLGA 2OD6A 2ZH8A 3BGRB 3CIMA 3HJVA 4KGKA 2HFUA 1TKZB 2W7PA 3PW4A 2LEPA 2EFGA 2CJKA 4J9PA 1C0TB 5KOWA 1RAFB 2CZVC 5I3UB 1YSJA 2KXNB 2Y1LB 2A1BA 2YNHA 2HZCA 2XGQA 2AJQA 2QLJB 2M4MA 2VV5A 2BQ3A 1S12A 1FKPB 1BC6A 4LSNA 3T1HJ 3V81B 2M9KA 2V68A 4NCBA 2DXDA 2MY8A 2IAJA 3THTA 1NSQA 4IH6A 2UVWA 2DKOB 1HWUA 3GZ7A 1FWKA 5ETLA 3THPA 3AJ1A 2NR0A 3AJDA 3HVTA 4TYAA 3VGUA 4I64A 4R5PB 1U2CA 2V0NA 3HSDA 1VQPS 3TZZA 3CCVS 2KHCA 3M4XA 5F3TA 4ZVHA 3ITHB 1RWNB 1NK5A 2RUGA 4P7TA 3PX0A 4X66J 2XI2A 3RTVA 3CSKA 1TU0B 4QCLA 2YKMB 1KNZA 1U2RA 5JMNA 4KHMA 5C42A 2HFOA 1TR0A 3IBFB 2HNDB 3SSSA 3LAMA 3G8SA 1RWKB 4N5SA 1PJ7A 4ZVSB 1XNQF 3PG9A 1HWIA 1NKEA 2DD8S 2N82B 3HSZA 1RTIA 2VICA 4NLSA 1Q16B 3DI6A 2Q1LA 2DVIA 1FXDA 1UJ5A 1N5YB 2I0XA 3UO0A 3MMAA 4P2XA 4ZVTB 1X4BA 2ERRA 2RDDA 3I9V9 3Q8QB 3CDEA 5J2NA 4WK3A 3NS7B 4IO9Q 4O23A 2XMUA 2CVEA 2RD5C 1LK7A 1RT2B 2ZM6F 1N34F 2DY1A 3TANA 4KFBB 4J37A 5THWA 3ETMA 5CD4A 3DDIA 1QE1B 2GIFA 4AL7A 4KC5A 4PYAA 1FDDA 4TXSA 1X8DA 2OKQA 3G2XA 1HNZJ 1FX4A 1FJEB 1U48A 3D0GE 2MB0B 3JAMU 3T6BA 5F8NA 2QFIA 4QW9A 2KXFA 4X4TA 4AE5A 4U7CA 3CJRA 1RXOB 3BBCA 5A6WA 1UETA 3CJ0A 3D9BA 1IJFB 2UP1A 4NLRA 4DL3A 5KFLA 4Q45A 4LF8J 2PE8A 1OMSA 1S5ZA 2ZZTA 1QSSA 4RW6B 3U7JA 4HH0A 5HQMA 4C8OA 2GZOA 3IM8A 1GX5A 1VC5A 3G82A 3K2YA 6FD1A 1RISA 2C3OA 2MQPA 2DR9A 3QBCA 3K8WA 3CC4S 2KXHA 1JMTA 4OJHA 2L48A 5HATA 1HNVA 1LWEB 2YWHA 5E33A 5JVGQ 2DR8A 4JI7F 2X1BA 4N8NA 3SQGB 1VHFA 1IKYA 1CJKA 2Z2LA 4DR7F 2CQDA 4O44A 3UVJA 4F0MA 1L3UA 2O66A 4OZLA 3H5XA 2KM8C 2E1RA 2V4RA 2KYXA 3CJ5A 4PXBA 1AYEA 4XPCA 1UEKA 4QQBA 1WOOA 3T1AA 4U9RA 3T9ZA 1IKVB 2D3ZA 2HGNA 3JSYA 5DGBA 1N88A 4QR2A 3OV7A 2H5IB 5K8MA 1TK8A 2VDIA 3DMJA 2XM3A 4D3GA 2JRSA 3I5AA 2OI2A 3HVWA 4K4VA 4TNOA 4KE5A 2CVIA 4C11A 4MIAA 3IN5A 3MM9B 2CADA 1ZAXA 1JNZB 2W2NP 1A7GE 2GO9A 4DCPB 3LP2A 1YJUA 1ZETA 1UL3A 2IFXA 2E1AA 5DM7Q 1VRUA 1WD6A 1CULB 4FVCA 4K7QA 2CQ4A 2YKQA 4OZ5A 2IRUA 4ED6A 1U49A 4RUCA 4B9UA 3TEGA 3EXYA 4OYAA 2WSEC 1PO6A 3OBIA 2BUNA 2WSCC 3JYTB 1RABB 1DJ0A 4GC6A 1RHUB 1EQMA 3B54A 4HI1A 1JLQA 3I5CA 1RWOB 2PC6A 4FF1A 3JXOA 2G4BA 5HANA 2ZZMA 1N34J 1U0HA 3I87A 3CMAS 5DS7A 3IM9A 3R5CA 2WB1D 2NSBA 4NCGA 1XMOF 3WDOA 4P74A 1OPIA 3ZZUA 3BSNA 4XTTA 3Q8UA 3KNGA 4K2XA 1NJXA 3M7VA 1FJ7A 5IZHA 5HQ8A 2OEJA 1EP4B 1KR4A 2BM1A 3BB5A 3CCLS 1JJ4A 3QRRA 2NXEA 4PEOA 1U25A 1G3OA 1FNXH 4DPUA 4X2BA 1K0VA 2R8KA 3BREA 2L41A 4DHVA 3DRRA 2MKIA 2HWTA 2EK1A 3PHTA 4DX8H 1VQ4S 3D0HE 4PG7A 2DGSA 2UV8A 3OFFA 3P45B 3QJPA 1SL1A 3IWXA 3W9JA 1P1LA 3KHHA 1CC8A 1U26A 3ONQA 4C3KA 3FSIA 2IDLA 1BY9A 4OI0A 4ED0A 3FEXB 4JB8B 1S1VB 2DNMA 5F8IA 5HK4A 2KFYA 3FZBA 5E3RA 2KDOA 4EUVA 1VHIA 4A46A 3MD1A 5HJYA 1NHUA 4JI7J 4ER8A 2V4QA 1O6XA 4DR7J 3PTWA 2BE9B 2UVUA 2IVFB 2HRUA 4FS1A 1VFJA 3R1HA 3C14A 1VR6A 1APSA 2VPXB 2NQPA 1ACMB 2AU0A 1JLAA 4R8UB 1Y00A 5BR8J 2GVDB 4F4XA 2F65A 5DG7A 1F9EB 3AB2B 4RUAA 4LSLB 5M2PA 1YRTA 4LRFA 5FDLA 1HI1A 1FHTA 4DQIA 1FVQA 3I6PA 3BSAA 1VIXA 4A8MP 1VQYA 1MN9A 3GJSB 4MIBA 1ZAWA 5IM0B 3TJ9A 2I6WA 2HHXA 2BR0A 1Q5YA 3S01A 5A2QU 4ECVA 3PJ9A 5KAKA 2L08A 4K4TA 3KJNB 3C15A 4KJIA 2F7VA 1GXLA 3ZTSA 4YY3F 4IYQA 1QDUB 2YVSA 3NNCA 3DFEA 1HKAA 4ETZA 3QZ7A 1N8RT 1HNWJ 3KMQA 1KOOA 2PFDA 3UQSA 1YX2A 3P3DA 1TK0A 3BBBA 4PWWA 2BANB 2AMCB 1HR0F 4ED7A 2KJVA 1ZTTA 2NZCA 4NZ0A 4DSJA 2HNZB 2J8SA 3O44A 1RCOB 3SV4A 4TU9A 4FN5A 1HQUA 3MM8B 4PPDA 2DPJA 4RJVA 3CC7S 5DZ6A 2ZWOA 2L9DA 2IJRA 3VAKA 4A8XA 3B8HA 5IFMA 2CG8A 4WFAQ 3SDEB 1XMOJ 2RMLA 3CF5Q 1HWKA 1JXLA 2CJAA 3ISNC 1ROFA 3HI9A 3FMBA 5DM6Q 4IR1A 4Z37A 2GAHC 2E1PA 2GVZA 2JVOA 3UDLA 2D69A 2QN6B 2POKA 5D4NA 3IBCB 2BKOA 1DTTB 4NLDA 4OX7A 5C7PA 2FLLA 2FDNA 3S7RA 3WC0A 3H59A 3JAMY 2Y9HA 3PV8A 3EGWB 1JLFB 2Q3PA 3A8EA 5E41A 1I5OB 2D9PA 4DUZF 4DL2A 2IRYA 1XMQJ 4DR3J 4S0MA 1R31A 2Z57B 3ZNUA 1HPZB 2BE2A 2DGVA 3X1LB 2J76E 1TL5A 2BVZA 5F3ZA 2XY7A 3OTOJ 4I6AA 5KFZA 3CIZA 5KFRA 2YNIA 2XS5A 1OPZA 3LPEA 3OW2R 5G0RA 3CT9A 2YX1A 2KG1A 2X3DA 4YFUA 5AE3A 1ZZNA 4HHHA 1W25A 5DJBA 1JLCA 4A47A 3J7Z5 2V9WA 2YNGA 2F4VJ 2DISA 2N3OA 3T5KA 4FPIA 3R5DA 2XNQA 4LF2A 3EWGA 1GMWD 1QTNB 1S76D 4OIXA 2HBRB 1FWPA 5GAHI 2DNLA 3N28A 1Q86T 2CRLA 1PAUB 1JLEB 2DHXA 2F8MA 1VRQC 3H5YA 1VBKA 3BN7A 3W5XA 4A8WA 4Y0FA 3A13A 5HN0A 2P5VA 2MEWA 4CP5A 4IFYA 4WZQA 4M5NA 1N36F 3NY0A 4ITSA 2D7SA 5LJ5Y 3MPDA 4ZCLA 4OX6A 2CQBA 4BCAA 2AV5A 4LUBA 1SIWB 4CH0S 1QSLA 3TAQA 4R0EA 1RAAB 1SPBP 2OFGX 3I0RB 4I2QA 3VQTA 1JK9B 5KFXA 3GLJA 4DL5A 4YY3J 2QRRA 5KFPA 4LREA 3D6HB 3G96A 1HQEA 3DKDA 1NDCA 3OD2A 4P71A 2QZ8A 3BGLA 4O3PA 1HR0J 1ZAVA 4YB5A 3OFEA 1XR7A 1S1TB 3IC1A 5CHCB 1RT3B 1NJIT 1PYSB 1S9FA 2NPIA 4GO5X 2OSQA 4XDCA 4LJMA 3DOLA 4CH7A 1VQ8S 3GCWP 3PW5A 5MLCV 2V2KA 5D0GA 3T19A 3CCZA 3QIPA 4RW9B 1SCJB 4JUZA 3V2UC 5HP1A 1RP5A 3KDNA 4NEYA 5LXYA 1UWAA 3CD7A 3BS9A 4I0WA 3DLKA 2WBRA 3A1YG 2F4FA 2FY8A 4M1KA 3H7HB 3NNAA 2RQKA 4IH7A 1UTAA 1Q78A 2J0QD 2IM3A 3C8YA 2NXNA 3A3PB 3LANA 1QTMA 3NGKA 5D77A 2IMWP 4YB6A 5IXUA 3CO0P 2GGPA 1S7HA 8ATCB 4ED2A 1V5IB 1FI4A 2D3UA 1WOPA 4FNHA 4DUZJ 3GIMA 5CYQB 5L46A 1U09A 4EO8A 4LF5F 2KTQA 3KK3B 4L76A 1HBMA 3V5RA 3MUMP 2P6SA 2RAQA 4HT7A 1WKLA 3ZO7A 2RRAA 2OPSB 4ZHRB 4YDXA 1C2PA 4QWBA 4AQYF 4FXWA 5K20B 4RW4B 2V8VA 1C4AA 1AUDA 2OPPA 3D6TB 4P10A 5B7WA 3PW0A 2ZBPA 4FYXB 4MJKA 4NLYA 1NSAA 2IYIA 2EFVA 4P9SA 4CLPA 2B5JB 2XMTA 1R8HA 2RDJA 2MLYA 3NKYA 5HMZA 4Q8EA 3BKUA 3NGDA 3DLEB 4O4GB 5IQQA 4Q2MA 1X4HA 2CKWA 4DR6F 3DGPA 3MF5A 3TX0A 3CEDA 5L8RC 1N36J 1XERA 2CQ1A 4MT1A 4NRUA 3TVZA 2ASJA 3DM2B 2DBBA 4USHA 4CO1A 1X7VA 3FSXA 5CH7B 4F3MA 3OTBA 3H40A 1PYTA 3QLHB 3E01A 2V63A 3FBEA 3FC9A 5RUBA 3PM9A 4CLZA 3ICLA 1U47A 1WDTA 4ZJLA 4J91A 1LW2A 1QAXA 2CWXA 2WONB 4JI0F 5A2QY 2VBZA 1HHSA 2VD3A 3GJTB 3RB3A 4HT5A 2VKRA 3J7YI 4IOAQ 2QT7A 3CJTA 2MZTA 2ZJPQ 4DN9A 2MTLA 1U1PA 1IWGA 1FRLA 1HBNA 2N3LA 4B02A 4K4SA 3VAHA 2CXEA 2J7KA 2HQGA 5D4OA 2FHJD 5L9NA 3C2PA 4DL6A 3CJQA 1JXVA 2HWHA 3HSJA 4ZPWR 3RZAA 2VOPA 2LU2A 5L38A 1U1MA 5EUHA 1RU2A 4DBQA 3BQ2A 3O8WA 3PO5A 1NHKL 2YX4A 3D66A 1K47A 2IHR1 3FCHA 2WVDA 2EFQA 4ICLA 3OHBA 4X65F 2P8IA 3DCAA 4IG0A 3JB9k 4DS5A 3DLGA 2YNHB 2BMBA 4KY3A 2K1RA 3DOMA 2HHHF 1RBOB 4LSNB 2HMIA 1VBZA 3PRVA 1RTHB 2G2OA 5GAEI 1WELA 4EFAC 3FUYA 3WBZA 2IAJB 2HZVA 2HQFA 2C2KB 4Z7CA 1FFWB 3KTQA 1VLYA 3J81j 1FCAA 4NCAA 3OL6A 2NCKL 1B7FA 2DTJA 4AQYJ 1IR0A 2G1HA 2RB7A 3HVTB 3D1OA 2R8GA 2ZBIA 2R7QA 3KLIB 2HAIA 5I4MA 4DU7A 4HACA 1ZYQA 2BYCA 3CJ2A 4KKOA 5C24A 5CCMA 4LRCA 1SKUB 2H9ZA 5C5JA 4RNNA 4O3QA 1FRIA 1T3NA 3P49B 1NZAA 5C42B 2CUYA 3ENQA 2CPJA 4PAAA 4Q0BA 5JVHQ 2FZKB 2DHGA 2VFUA 1TZ0A 5KFJA 4UY85 1WUUA 2YWWA 2LA4A 1FKAF 2DGTA 1FRJA 4F67A 4RNFA 2DO4A 4DN0A 1RTIB 3MR6A 4JOUA 1U6ZA 3PJWA 3UD3P 3DI6B 2M8DB 4LF4F 2I9SA 5CD4H 1KHVA 5DDRC 5HI7A 5KT4A 4LFBF 3MM6A 1H2TZ 2WOMA 1FJGJ 2CPYA 1MMNA 3MMAB 5KFIA 5F8MA 2HKEA 2R2UA 3CJ4A 1FA0A 5DO2A 1UZHA 5KG5A 3SXLA 2MQMA 4IG3A 1FEHA 3S1TA 5J2NB 2FJVA 4RU9A 1I94J 4NYZA 3PNIA 3CMES 4ZLLA 4Q2LA 4U8VA 4NI2A 5E3PA 3PVXA 4KRWA 4Q8FA 5LJ3Y 3DHXA 1QM9A 3OPKA 4EI2A 3OUYA 3TUJC 1EKSA 2XSJA 2R7OA 2EBGA 2X1GA 3C16A 4WKYA 2LQJA 2WAQD 3T3FA 1KBRA 4PUOA 4QIEA 3UN2A 2OSRA 2EPIA 2H65B 2EFNA 3ZTPA 1YWXA 4WZMA 2KI2A 4CT9A 3NMAA 3KYLA 4AXJA 3MOJB 4RNMA 4ILLA 3CCJS 1T95A 1H0HB 1CG2A 2W4PA 1UVKA 4MYUA 1AROP 2WVFA 1YBTA 1U1KA 1V3ZA 1TQLA 5B0AA 1NK7A 2KHDA 3W2VA 4X65J 1U45A 4AD6A 1GK8A 4OI6A 3CMQA 3G82B 2EC0A 5E7OB 1EARA 4ZVGA 1CJVB 4W4MA 2WVEA 3RB4A 4LBIA 2HHHJ 4K0KF 1ULRA 2OLWA 1S72S 2RIJA 2YWFA 3DC2A 3GFYA 3DU6A 5ETSA 4ZVEA 2PGCA 1RI7A 1BXNA 1IKYB 5HVGA 3HMJG 1BUXA 1WHWA 3SFGA 2CZ4A 2P9EA 3SMZA 3UVJB 1G7CB 3OJUA 3SV3A 2IA6A 1SQGA 1X5PA 2F40A 4P2SA 1WKKA 4OJGA 2HS0A 3V6KA 2MDAA 3MPYA 2ZH9A 3DMJB 3R27A 3DHWC 3QQCD 4MKBA 4RWXA 5KFNA 2B3TB 2HW3A 4B9TA 4C11B 3SYZA 3RRKA 3T5LA 3AB4B 3G87A 3LP2B 2BJ7A 2HURA 2BJ3A 2JFDA 3HX9A 4EZ9A 5D6GA 5D3GA 3UCGA 3RR7A 1VRUB 1VDHA 3R6GB 2BM0A 2G13A 4J9MA 4M5IA 3PYEA 3I5BA 4EO6A 3KG0A 5CYJA 2AJFE 1NJZA 1URNA 3FMWA 4DFJA 2XMMA 2HQDA 3BM7A 1S6QB 4LF4J 1H98A 4LFBJ 2LVWA 2RH3A 3BR9A 1Q5VA 3UW1A 2GW8A 3KG1A 3H2VE 3EZ5A 1J27A 1JLQB 2GNKA 2Q79A 3D0IE 3GSDA 3KLEA 2W9BA 2A6MA 1BQNA 1U0HB 1YLXA 1Q8KA 4WP9A 2LDYA 4FF2A 2M2BA 2OAUA 2VQFF 3M2UA 3QIDA 1KKHA 3EJMA 1U1OA 4BLGA 1KD1T 4Y28C 1TKTA 2MKKA 4I56A 4JI2F 4BC7A 1U8WA 1S48A 3HD1A 5DDQC 4E2FB 1LK5A 3UNGC 3M2VA 3VGTA 1FRMA 3MCOA 3CO9A 3DRRB 3SEOA 3CE8A 1SUQA 4IDKA 3BR8A 2AYBA 3CCQS 3MD3A 4DL7A 3CDBA 2AEJA 6AT1B 3UCUP 3UR0A 3H2UB 3H4BA 1Q8IA 1JKHA 4KQZA 4RWWA 3BSCA 2BE7D 2KG0A 3NLCA 4B3SF 3RYLA 3CCMS 3O2IA 1XTZA 3MR2A 3KWMA 4CIOA 1LFPA 3CCES 3US5A 4K0KJ 5J2MA 4KGZB 2ALYB 3K5PA 3ISZA 3WIUA 3NXZA 5D0RA 3I55S 2DR5A 5C2GA 1S57A 1PCAA 1UVLA 2XS2A 4QR0A 2ZH6A 2JZ5A 4EK2A 2MGZA 3C14B 2WW4A 3EE3A 1M1KT 4CLUA 3K5MA 1UPPA 2JC1A 1EZZB 1NPRA 1JLAB 5BXIA 2CQIA 1M5OC 2K8GA 5F9LA 5IWAF 4YR0A 4DPYA 3T5HA 1S79A 1YQHA 3DDNA 3IFEA 1TFWA 3MAQA 2D1CA 2ZBCA 1Q4RA 3H5UA 3GSIA 1UFKA 5F8JA 2DO0A 4P73A 5FDLB 5F8HA 1SJFA 3BF4A 4WP3A 3OR1A 2C3YA 4DV6F 4HYKA 3H20A 5GVQA 3FZ2A 4F50A 4FDFA 2J7WA 2X7IA 3TUZC 3KUGA 1TUVA 2FTRA 3J7AN 4ZITA 4RW8A 3C15B 4OHXA 2JEJA 1JXEA 4OV6A 1XIQA 3KHRA 3AOAA 1KC8T 2B4VA 1X5OA 4LF6F 4O3NA 3SCLE 4JBCA 1QSYA 3IWNC 1L3KA 4A8KA 3BGFA 3CCWA 3LTOA 2A0FB 4USKA 1TK5A 4ZS6A 5DLGA 4H54A 1HD0A 1HQUB 1RBLA 1T9TA 2YPZA 2XYGB 4ECUA 1VBXA 4NA2A 4N47A 3ZTOA 1VC6A 3FEZA 1R0AA 2G0JA 5L1KA 1S97A 2VQFJ 3AT1B 1OWXA 2BQRA 4G1QB 2KZMA 3HK2A 2BEFA 4O0NA 4ANDA 5B0BA 1T7PA 4DPOA 1NAQA 1AA1B 3CDUA 4F0HA 3SSRA 2E9TA 2YPYA 2CWKA 2HRYA 1MW7A 1VI7A 1O51A 3DRPA 4E8UA 4DI6A 2GVZB 2IC3A 2UVRA 2ZDOA 3N4WA 2MLZA 2XMWA 1NK9A 5I3QA 4ZP6A 3RAMA 2JEIA 1NSPA 2IM2A 1SV5A 3MEEA 1WNEA 2KFNA 2IBOA 3A12A 3UN5A 3B78A 3DRYA 1AW0A 5KFKA 1KSPA 3JQKA 1HL6A 2DGQA 1S7IA 4MFBA 1R6YA 3G6YA 4XDDA 1F2GA 2FGCA 1NDLA 4C6AA 2M88A 3AQOA 1HWLA 5CYMB 1RA7A 2BE2B 3RAXA 2ZBQA 2KL8A 4EBCA 2WK4A 3ZZTA 1NCLA 2YNIB 2RS8A 2AZ1A 1Z4UA 5G0RB 3VF0B 3EPIA 1RZMA 1CVJA 5C25A 5JXSA 2C3UA 1JLCB 3DOKA 1TP7A 3N6MA 1QD1A 1EIYB 1VQSA 3TAMA 3O1LA 1NDKA 1T05B 4KGVB 5LMNF 1SJ1A 2FJAB 2QYGA 2EVZA 3E51A 3IR7B 3VAGA 2EXUA 1M1GA 3HZEA 1JIHA 2GIRA 7FDRA 4IFYB 4O4RA 2B4PA 3UD5A 4FXVA 5IV4A 3PY8A 1P6TA 1RKIA 4RZRA 2F9JA 4DV6J 3RJMB 3ZTQA 2AD9A 1LWXA 3PR5B 3QATA 4DXLA 2KRRA 3GYNA 4HL9A 4MYTA 2ASDA 2Z58B 3TA2A 5K8OA 1UWBA 3M9MB 4NRTA 2XWYA 3IXQA 2CQ2A 4I2QB 2XSFA 1NHVA 1SJQA 3P96A 1Y0HA 1HNXJ 1UP1A 2FQQB 1IWAA 2KKHA 4LF6J 1IM4A 1HQEB 1NKCA 4ZLNA 3I0SA 5ETOA 1S1XB 4ZMMA 3Q8PB 1IQZA 1RAEB 1C0UA 1Y10A 3D68A 1U24A 2QLXA 1C4CA 1LKZA 2HQIA 2VPWB 2H5EA 3W5YA 1T9YA 5DDPC 4OYBA 4Q7AA 2B56A 4O3SA 1VC0A 3M2RA 2ILYA 1CS4B 3Q22A 1TL1B 1SIZA 1SI9A 4YR2A 1D9AA 2VBWA 1H74A 1XR5A 3PDNA 4DR2F 4WTYA 5IQ6A 1Y3JA 3QIPB 3FGVA 4U96A 3K17A 2KN4A 2OEMA 1RT4B 2KT5A 4KV8A 1FFSB 5K9FA 5HP1B 4EBEA 3ILJA 4TKTA 2KFZA 3K57A 5A0YB 3DLKB 2JLFA 3K59A 1WC5A 2VONA 3V4IA 3Q8VA 5KFVA 1KN6A 2GS8A 4DMZA 3MMCA 1VJQA 2G2ZA 2K7JA 2RHQB 4WIIA 4ANEA 2ZVSA 2GGPB 5HQLA 2QA2A 1Q1KA 2LECA 4QWAA 3TNVA 4CLLA 4QWDA 2PA8D 2K3IA 2CJXB 3OXLA 1SBRA 1K73T 5KFCA 2F8EX 4C3LA 2L9NA 4M94A 2O3DA 4HTIA 1UEVA 4ZK7M 5GMDA 1HBMB 1CSJA 2N4DA 2NS1B 1WOSA 4PWDB 2HFNA 3NAIA 2PIIA 4QIGA 1V3SA 1QAIA 2GQ2A 5DG9A 2M0GB 4B9SA 3GMGA 1EX8A 2QA4S 1MWZA 3HF5A 3QWUA 1L3SA 2YKAA 1JWWA 2OPPB 1Q8LA 1KEKA 1PGZA 4PR6A 2Q6BA 4CO0A 4XAKA 3Q24A 2HEKA 3KUHA 5LMNJ 1HHTP 2VA3A 4JV5F 3IG1A 3B4DA 4PCQA 3TAPA 1QUVA 2GA7A 4DV5F 2XHCA 3G8QA 3NCQA 1GMVA 1T11A 1NH7A 2J7UA 4JI6J 4M8LA 2O01C 3DU5A 2UU9F 3K7RA 4PQAA 4LVOP 3DGPB 1GEHA 2EKNA 3R8YA 4GO7X 4BC9A 2XC9A 1UJ6A 4MTPA 2QA4G 1OY9A 1YRXA 4F2SA 1NDPA 2OMOA 4M5LA 2XY5A 5L9XA 1NK0A 3L7OA 2OTJS 3LP1A 3P5TL 4TY8A 4F36A 1FESA 1O5JA 4I6YA 5A8RA 4QOTA 5GAHU 4OYXA 4USVA 2EC2A 4FYYB 3MM5A 3UDVA 1PJ5A 3MECA 2DNHA 2PFFB 1LW2B 1KVKA 3HLUA 3MCMA 1UVMA 2JJ4D 3AFGA 4F8RA 2VG7A 2HS4A 3H8YA 3ZZZA 4OL8A 1RT7B 3M1VB 2IVMA 3J81Y 3W61A 2AQ4A 2O5DA 4WIQA 1UVIA 1UZDA 1HBNB 4N56A 1FKOA 3R5GA 2HIQA 2H4YB 2KU7A 1SB6A 3GTYX 4DR2J 5E3CA 1N32F 4M5DA 5LSRA 3GYGA 2ASYA 2X1FA 5DLFA 2RF2A 2MZSA 3QO9A 1OYDA 1H7WA 1GTHA 1CJUA 3MUVP 2B6AA 2M5YA 5B08A 3CXCR 3KHLA 4USTA 4ES3A 4TQRA 4WTOB 1D1UA 2G0IA 3T1HF 3PIOQ 3L9ZA 4ILRA 4ICLB 4Q43A 2CNOB 4USIA 2DB1A 4KHPF 4IG0B 4C0BA 3GP9A 4F7VA 3BQ0A 2LXFA 4MMOA 5L1IA 4H4MA 4N76A 3T41A 3DLGB 3R1LA 2K1RB 3DOMB 3ET6A 3W1YC 4KIAA 4N8OA 1R3NA 3EYZA 3OL7A 5ETRA 3ZZ0A 1KQSR 2HMIB 2G2YA 4ZVUB 1TAQA 3THVA 3BGRA 3QT8A 3LP0A 3T9NA 2SXLA 2R7WA 3BYPA 4DG1B 2V34A 2E1CA 3FSYA 3GIIA 1S6OA 1VQNS 2UUWA 1AXQA 1JNRB 1T02A 2NXUA 2M8HA 4W90B 2BRKA 4C9DA 2CAJA 4XIUA 3FRYA 2DYAA 4QWEA 2IIHA 3QT7A 1R8PA 4KKOB 3PX4A 1KQFB 5C24B 4YN3B 1YKWA 3OL8A 3MGJA 3SZ2A 4DV5J 2E5JA 4H4OA 3CJKA 1U7LA 2AJ0A 3JS9A 2IVYA 3L09A 2C28A 4Q0BB 3QGPA 2UU9J 3GIRA 2W2MP 3TARA 1H38A 3A8KA 5IS2A 2F8HA 1GT8A 4B9NA 4ZN1A 4YB7A 1KLMA 3PYFA 4F2RA 3FKBA 1SJ3P 4W98A 1RAJA 1RLCL 4B9LA 1F6TA 4ES1A 1CQNA 3KJQB 2FC8A 3MM6B 2NXCA 4CLTA 1VJWA 1U2FA 2LDIA 2WOMB 3M30A 4ANCA 3V6JA 2HNDA 3PO4A 2XMKA 3RBZA 2HBQB 2AX1A 4URSA 4GVLA 5F0WA 3KLFA 1KQKA 1XK8A 4RX6A 4FKXA 1V9OA 4IG3B 4YDDB 4L74A 5I42A 1V5VA 4ED1A 5CXTA 4ZVOB 4PG6A 4DFKA 3TR5A 3FBCA 1D8ZA 2B4OA 3QT6A 4ERDA 3QSIA 2DIUA 2AYGA 3S6EA 1RHKB 4KBIA 1YIJS 1URRA 5KG4A 2MJNA 3GILA 4ZPBA 1HMVA 2PEBA 3OUYB 1N54B 1ICEB 2XSJB 3FK4A 2ZH3A 1H2VZ 3W65A 3TZXA 4DFMA 1R0CB 2IDEA 3C16B 2AP6A 4V1Ak 5AXLA 3KFWX 4LF8F 1OIAA 3O5TB 2MQQA 5I3PA 1H6KX 4PUOB 2DNGA 4BDPA 2IA0A 4QZVB 1N32J 3E3XA 1KTVA 4Y2MA 1HA1A 3G9CA 4ZCIA 4N7TA 1BE4A 2CJBA 1FK9A 1IBMJ 1RHJB 1R27B 3OLAA 1SQFA 2G0CA 4JI8F 2CZ9A 3ZFVA 1M5VC 3G71S 4HLBA 2VG5A 3PCOB 4UUWA 4E98A 3TP2A 1JB0C 3EDQB 1S9EB 3DLHA 5ETQA 2ZITA 3J7YU 4OLOA 1TL4A 5BJRA 4KHPJ 2MXYA 3BJYA 4RO0A 3WX8A 2RSQA 1IN0A 3W9HA 1I51B 1S1WA 4FYWB 1ELOA 4ED5A 1T9WA 1VQMS 1PKUA 4NOHA 4P72A 3VHQA 5AT1B 4ED8A 3R7SB 2RVJA 4LBPA 4NLVA 2W01A 5AXKA 1RAOA 3HHLA 2HHTA 2I38A 3FBBA 1RT1A 2IRXA 1NLKL 2DY9A 2H48B 5IC6B 2HG4A 1RTJA 1OY6A 2EKYA 3IR6B 2IY5B 2ZC4A 5F9NA 4Y34A 3G6ES 1ZPWX 4QYRA 1T03A 2AYEA 2P9GA 1TKXA 2KT2A 4E0DA 3Q0AA 1IKVA 4RUHA 5D3GB 5GAEU 4DLEA 1B99A 4PPZA 3GU0A 2R9LA 4RW7B 3K5NA 1U1RA 4FBUA 4NYPA 1RT6B 2B9XA 3POTA 2BOAA 1RAIB 1JLGA 5LXRA 2W2PP 4TU8A 3BN4A 4OHVA 2CFXA 2RU9A 5AXMA 4OJ3A 3D28A 4K5SA 5H9EJ 5KG3A 2CPZA 4PXDA 2AEFA 1LQ9A 2W9CA 4X62F 1WF1A 1CULA 2OPRA 3PYGA 2CPIA 3SCJE 4W92B 4DL4A 4LR9A 1K9MT 1P9QC 5LMUF 2W9BB 4NLOA 3DXSX 3VAFA 3DYAA 1BQNB 5HVHA 3C19A 4HI2A 2XNRA 5EX3A 2CNKB 3M2UB 2CJYB 2QL7B 2M52A 2V67A 2DH9A 1DY3A 4MAKA 1TKTB 4DUYF 1Y7PA 4OI3A 1WI6A 4X4NA 4EEYA 4WU2A 3JSBA 5ETMA 3M2VB 2GX8A 4CDIA 3HKWA 2DNQA 1Y5IB 2XTJP 4ZPDA 1SUQB 1AUSL 2PD1A 3QRPA 4IDKB 4JI8J 3MXHP 1AZSA 3LA0A 2YKOA 4O3OA 2KH9A 4PZVA 3GR0A 4OYZA 2VPYB 1N52B 1MMLA 1FJCA 4WU3A 1WEZA 4LF7J 3QAUA 2ZH2A 2V4JA 1NNDA 1VRTB 1AFJA 3KDOA 4H4KA 1G1XA 3L7UA 4K4WA 3QNWB 3VZIA 4P75A 3M6VA 5J2MB 3H0PA 4P6QA 3IA0A 5BR8F 3ILOA 2R2RA 1OO0B 1VOMA 3TO8A 2VODA 4K4ZA 2HVHA 1KONA 4ZA1A 5JUMA 1NU4A 1VQKS 2YH0A 2AW0A 1WHXA 5KFEA 2HVZA 3IR5B 3MEGA 3IWLA 2BJ9A 1R8BA 4JV1A 2VL1A 2VA2A 4J7CA 4R0JA 1VQ5S 1JJCB 5GADI 2Z8QA 3MR3A 3HPOA 4YB1P 4B3RJ 4HKQA 4C0OC 3MAHA 2GCFA 1X5TA 2E44A 4ECZA 4NYOA 3OR1B 1S1UB 4U95A 2PSZA 3JTPA 4IUFA 2RRNA 3FFIA 2QLBB 3TYTA 4EYIB 1SH3A 2BJDA 2BJEA 2YKNA 1RACB 4ELTA 1HNWF 2YWKA 3DLBA 2MKYA 4RW8B 4ALZA 1FERA 2WCXA 2ABYA 1IBLF 1CEZA 2GO8A 4WBFA 4C8ZA 3RB6A 4O3RA 4X62J 5F8LA 2MKHA 1N5VA 1VIOA 3DLLQ 4CLSA 1ZTWA 1DZ5A 1YDLA 1P8GA 5KT7A 5LMUJ 1LOUA 3ETOA 4LR8A 1R43A 4B3TJ 4BBYA 3BO3A 4DX6A 2JNJA 3EZUA 3C6TB 3D2WA 3OVAA 1R0AB 2ROGA 1FE0A 5DZ7A 3MURP 3ENVA 2Z2ZA 1REGX 4LMZA 5KTQA 4DUYJ 1O8BA 1LNQA 4K4XA 5ETNA 3CUNA 2R7TA 4U7UK 4ILMA 4DPWA 1PIEA 2MSTA 2BV3A 4ZP8A 3PYDA 4GRSA 4MKYA 2DGOA 2IC3B 4K59A 2C3PA 2VFRA 3GV5B 1X4EA 1XMQF 1FNOA 1KP6A 4DR3F 1SV5B 3MEEB 4DSEA 3EXCX 3AA8A 4CO5A 1I1GA 3OTOF 4DV3F 3TQEA 1D09B 4UW2A 5E3QA 4MFBB 2HS3A 2VJVA 1NJWA 2QE5A 3AH6A 2FLNA 2DXEA 1Q82T 4MIWA 4I7FA 2RRBA 4QJVA 4PQUA 1IKXA 3ISND 1BQMA 3HP6A 2AJ4A 2LXUA 2F4VF 1RHRB 2FLPA 1KFSA 1VK8A 1DTTA 1HNIA 4ID5A 2AEMA 5D4LA 2NXJA 4ZDNA 4RNOA 1WEXA 5U47A 3HCXA 5C25B 1SQEA 3OVSA 3DOKB 4G3IA 3FRZA 1FWLA 2RNEA 2VASA 1NM2A 3TAMB 1VQ6S 2DNNA 4DPXA 4OYMA 5KFSA 4OHYA 3Q83A 3QGHA 2U2FA 1KLNA 1PC4A 2RDIA 1M90T 2L9WA 1YZ6A 2QO3A 1C1CA 3TJ8A 2LLZA 2PT0A 3I82A 3MFHA 1RKJA 2GHVC 2HLUA 4C8MA 2CQPA 2WTFA 1BWEA 1RJJA 1HW8A 2XMVA 4KAIA 4UOCA 5HMWA 3BPSP 1ZM2A 1C1BA 1DLOA 2KZZA 3OFGA 3IS9A 4ECTA 1WEYA 1W7WA 4F25A 2KRBA 2APOA 1KTQA 3V6DA 4R25A 1UWBB 4ZCKA 4ECXA 4CYUA 5D15A 1IBLJ 2DNPA 5EWFA 4J9VA 4KSEB 2V5HG 2MYFA 1OJ4A 2VKZG 1B64A 2HBYB 4ECSA 1C0UB 2RQ4A 2XO6A 4C8LA 4OYWA 1UVNA 3W9IA 2RKIA 1IBKF 4WWSA 4KYZA 3RBXA 2A2DA 3M2RB 3QAEA 1IXKA 3W2WA 5SZTA 2X51A 2E7WA 4KPCA 5M2UA 1WHYA 5KFGA 3A3OB 3QGIA 2DGUA 2DH7A 3GONA 3DN9A 4AL6A 1NJYA 3LPYA 3VV2B 2DCLA 1MNEA 2H3EB 2LXIA 3LUYA 2C1EB 3FEYB 1FF2A 3KHGA 4WYWA 5T7LA 4QU7A 3UR3C 5KFAA 4CLWA 1BQXA 3Q8SB 1DTQA 4ZLJA 4GKKF 3MMCB 1OSCA 3LF0A 1Q7LB 1TMMA 1YJRA 2Z4PA 3ZC4A 4RW9A 4WFBQ 3TUPA 4DV3J 4KR0B 2UUCF 3MPVA 1N33J 1Y11A 5KT2A 1QLNA 3R9LA 4D3HA 1F0XA 1Q7YT 2HHUA 5CA5A 3OL9A 3HHLC 1HYSA 1S77D 2RQMA 2Z30B 2VFTA 2KYZA 2C2ZB 3PACA 1U6FA 1LXNA 3HM9A 4Y2KA 1SVDA 2AF6A 1HW9A 1TMJA 2XZDB 2R7VA 1KRPA 1VLOA 5CYQA 4USUA 3NMRA 2ASLA 2MMYA 4P52A 2FVCA 2AKWB 2KVQE 2HSEB 3IRXB 4TLRA 3LGMA 5J1EA 4DSIA 1WC4A 4ZHRA 3VCDA 4HHUA 2I2YA 2J8AA 3AJ2A 1K0TA 3WX4A 2HNYA 2C2NA 4N41A 2Y8WA 3GFXA 1MSWD 4KHRA 3QFHA 1JJ2R 4EYHB 4YMEA 2IPOB 3R5AA 1Q79A 1QY7A 2BW2A 4NLTA 2QV6A 3CD6S 4GKJF 1T9VA 3JQJA 1QUPA 3LP1B 4LT6A 1X0FA 3UD4P 3MEKA 3CGIA 2VJUA 1YITS 4IQMA 2LEAA 3OJSA 1F3VA 3LOUA 1CJTA 2OGUA 2D9OA 3TVKA 5A8RB 5ETTA 3VWSA 1IUJA 4DQQA 3MM5B 1HBOA 1FDBA 1NB2A 1UKUA 3RU0A 3H2LA 1UJ4A 4BS2A 1BLUA 2MPUA 4OX9J 3DM2A 7AT1B 3KG4A 4IOCQ 2ZH1A 3H25A 3UN3A 2CDQA 2VG7B 3H90A 1PSDA 4CI0B 2DNRA 2R42A 2VU5A 3QLHA 1W2BR 3R97A 1IBKJ 1GNKA 3HSGA 4GVBA 1FKOB 2R7RA 3K5LA 2Q6CA 3KXDA 4J9KA 4M95A 2ZH5A 4M5DB 5L1LA 4L75A 1WG1A 1JJHA 2RF2B 3VZHA 2GQQA 3QO9B 5HSPA 2Z2MA 3CCTA 1TAUA 2XCPA 3UDCA 5DG8A 1CJUB 4M5MA 2B6AB 4JI1F 1YI2S 1CPZA 3W64A 2DXFA 4TYBA 2XI3A 3RBDA 1RU1A 3IRWP 1GXTA 4GKKJ 2V8DA 4JYAJ 3MAAA 5KFQA 2B8QA 2J0XA 3MCSA 5HO4A 2B51A 4WK1A 3QGGA 2OUGA 3W8GA 3ZZOA 1WJ9A 3P4UB 5KT3A 3CJ8A 3JSMA 3O3LA 4A8YA 4CTAA 4X4OA 1YK9A 2XYHB 4N77A 4H4KC 2QC3A 1FVSA 3ET6B 3F41A 2UUCJ 2VG6A 3R5BA 2R8HA 3MZIA 1WTBA 1Z2ZA 2NPFA 3LWLA 3EM1A 3M8YA 3HVRA 2DR7A 3LP0B 3ADAC 2E7XA 2GJ2A 3VQSA 1OY8A 4RUBA 4OZ1A 3BSOA 1BGXT 1NZ8A 4K2JA 2DITA 1TFYA 1N56A 3H4DA 2HK2A 1D3WA 2WVCA 1HWJA 2JOQA 1RWWB 2V8GA 1N5SA 2IJNA 1E6YA 3P5BP 3M9OB 5EDWA 1MU2A 1RTHA 4HHJA 1F2HA 1FDAA 2W8KA 1LFWA 4YS2A 1IJEB 2JLEA 1NSKL 2J6SA 2F9DA 2I1RA 1UPMB 4H4OB 3CJKB 1NH8A 4KB7A 4UZBA 1YVFA 4OHWA 4ZJQA 1K44A 1KVIA 4DS4A 1B0TA 4J9UE 3RUBL 2ZD1A 1YJNS 1FJGF 3LGNA 1N5QA 2BX6A 3DNCA 3KLIA 2C3MA 4NZ6A 4F02A 4X4PA 2C2MB 2BQUA 3GG1A 1KLMB 4LBHA 4F4KA 3KJFB 1I94F 5J2PA 1M5KC 4GKJJ 2RJZA 2MLXA 3VTIA 3EGNA 4B3OA 2MHEA
chains in the Genus database with same CATH topology
1WKLA 2DYAA 3FBEA 3FC9A 3EVMA 5IOLA 4UOGA 3NGUA 1PKUA 2HVEA 3EVOA 1NDKA 2CWKA 1NDPA 3ZTSA 1WKKA 3NGTA 2HVDA 3FBFA 1BHNA 5C7PA 3VGVA 2DXDA 4CP5A 3VGSA 1UCNA 1NSQA 1S5ZA 4DI6A 1HHQA 3EVWA 4F36A 4ENOA 3FBBA 3BBFA 3MPDA 3ZTPA 3FCWA 1EHWA 3Q8UA 1B4SA 3JS9A 1NLKL 2DY9A 1HLWA 3VVTA 4F4AA 1NSPA 3BBBA 3PRVA 4S0MA 4DUTA 1NPKA 1XIQA 3NGSA 3ZTRA 3GP9A 3VGUA 3R9LA 3Q83A 1S57A 2DXFA 2HURA 3ELHA 1LEOA 3EJMA 3ENAA 4EK2A 1NUEA 1NSKL 3ETMA 3EE3A 1S59A 3L7UA 1VYAA 3DDIA 3Q8YA 3ZTQA 1BE4A 2B8QA 1LWXA 3BH7B 3BH6B 2AZ3A 3FKBA 4DZ6A 5CAAA 3EMTA 1NDLA 1ZS6A 4KPCA 4W98A 1U8WA 2NCKL 4C6AA 5BXIA 1K44A 3FCVA 1F6TA 3VVUA 1F3FA 3G2XA 1JXVA 4WBFA 4FKYA 3B6BA 3DKDA 1NB2A 2BX6A 2ZUAA 1NDCA 4ANCA 3VGTA 3Q8VA 1HIYA 4HR2A 4UOFA 3B54A 5CABA 1MN9A 1XQIA 3Q89A 2DXEA 1WKJA 3ZTOA 1KDNA 1NCLA 1B99A 4FKXA 3GPAA 3EICA 1NHKL 1MN7A 1PAEX 1BUXA 2AZ1A 3NGRA 3EM1A 1W7WA 4ANEA 3WX8A 3PJ9A 2VU5A 2BEFA 3BBCA 3FBCA 4O0NA 4ANDA 4UOHA 3Q86A 2B8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKL A;  2DYA A;  3FBE A;  3FC9 A;  3EVM A;  5IOL A;  4UOG A;  3NGU A;  1PKU A;  2HVE A;  3EVO A;  1NDK A;  2CWK A;  1NDP A;  3ZTS A;  1WKK A;  3NGT A;  2HVD A;  3FBF A;  1BHN A;  5C7P A;  3VGV A;  2DXD A;  4CP5 A;  3VGS A;  1UCN A;  1NSQ A;  1S5Z A;  4DI6 A;  1HHQ A;  3EVW A;  4F36 A;  4ENO A;  3FBB A;  3BBF A;  3MPD A;  3ZTP A;  3FCW A;  1EHW A;  3Q8U A;  1B4S A;  3JS9 A;  1NLK L;  2DY9 A;  1HLW A;  3VVT A;  4F4A A;  1NSP A;  3BBB A;  3PRV A;  4S0M A;  4DUT A;  1NPK A;  1XIQ A;  3NGS A;  3ZTR A;  3GP9 A;  3VGU A;  3R9L A;  3Q83 A;  1S57 A;  2DXF A;  2HUR A;  3ELH A;  1LEO A;  3EJM A;  3ENA A;  4EK2 A;  1NUE A;  1NSK L;  3ETM A;  3EE3 A;  1S59 A;  3L7U A;  1VYA A;  3DDI A;  3Q8Y A;  3ZTQ A;  1BE4 A;  2B8Q A;  1LWX A;  3BH7 B;  3BH6 B;  2AZ3 A;  3FKB A;  4DZ6 A;  5CAA A;  3EMT A;  1NDL A;  1ZS6 A;  4KPC A;  4W98 A;  1U8W A;  2NCK L;  4C6A A;  5BXI A;  1K44 A;  3FCV A;  1F6T A;  3VVU A;  1F3F A;  3G2X A;  1JXV A;  4WBF A;  4FKY A;  3B6B A;  3DKD A;  1NB2 A;  2BX6 A;  2ZUA A;  1NDC A;  4ANC A;  3VGT A;  3Q8V A;  1HIY A;  4HR2 A;  4UOF A;  3B54 A;  5CAB A;  1MN9 A;  1XQI A;  3Q89 A;  2DXE A;  1WKJ A;  3ZTO A;  1KDN A;  1NCL A;  1B99 A;  4FKX A;  3GPA A;  3EIC A;  1NHK L;  1MN7 A;  1PAE X;  1BUX A;  2AZ1 A;  3NGR A;  3EM1 A;  1W7W A;  4ANE A;  3WX8 A;  3PJ9 A;  2VU5 A;  2BEF A;  3BBC A;  3FBC A;  4O0N A;  4AND A;  4UOH A;  3Q86 A;  2B8P A; 
#chains in the Genus database with same CATH topology
 3M30 B;  5T14 A;  4V19 J;  3T5J A;  4LQ3 A;  1G6B A;  4OZ3 A;  3KLF B;  1RT5 A;  2HQ3 A;  2I5J B;  5I42 B;  5DGA A;  4PKD B;  4DR5 F;  1RB0 A;  1OYE A;  2BA9 A;  4C8Y A;  1HFE L;  4C4W A;  4ZN3 A;  4LFC F;  4LF9 F;  1B0P A;  3CWJ A;  1LWC A;  3UI3 A;  1HMV B;  3RR8 A;  2K06 A;  1MWY A;  4J9R A;  5JJB A;  4QPX A;  2M70 A;  3GYX B;  5F0U A;  4OYI A;  3R6L B;  1PIL A;  1ZS6 A;  2E1M C;  4F3O A;  1RAH B;  2GJF A;  3WIV A;  1R89 A;  2YKP A;  3B4M A;  1MLA A;  4G6V B;  2J9E A;  1U1Q A;  3KLG B;  1TL7 A;  1J5O A;  3C46 A;  1X9W A;  1T8E A;  5CAB A;  2VOO A;  4QBU A;  4P2M A;  1EQ0 A;  3TWZ A;  1FK9 B;  2KO1 A;  2W25 A;  2ZEJ A;  4JI1 J;  3LQV A;  3QFW A;  1VGY A;  2VG5 B;  2HHQ A;  1EET A;  4F4Y A;  1UA0 A;  1XN9 A;  2XEX A;  1B7Y B;  9ATC B;  1OQ6 A;  2N7Y A;  3M8R A;  4FNI A;  2PMH A;  4ENO A;  1S1W B;  4ZVF A;  2CPX A;  2QG9 B;  1SKW A;  1LV5 A;  1N0V C;  3L3C A;  3I9Z A;  2A18 A;  3HVA A;  1GMW A;  3NGS A;  4URQ U;  3ZTR A;  2VPZ B;  2HZA A;  2J0W A;  3PJX A;  3HHL B;  2ROE A;  1W26 A;  3TZW A;  1RT1 B;  3RW7 A;  7FD1 A;  4PG8 A;  1RTJ B;  1OQ3 A;  1CJV A;  3UCZ P;  2F1F A;  3TZY A;  4FF3 A;  2JEG A;  1XQI A;  3GQC A;  2DJW A;  3TVY A;  4WFN Q;  3DRS A;  4C48 A;  1H7X A;  5KFH A;  3PKY A;  1T03 B;  2ZOM A;  1TKX B;  2E5I A;  4EU0 A;  3M8Z A;  4Y65 A;  3BQ1 A;  4PWU A;  4QWC A;  2FVP A;  2W2O P;  3HO1 A;  4ZPA A;  3B82 A;  4IO1 A;  3EVW A;  3ZZR A;  2CG4 A;  1YRU A;  4PYD A;  3POT B;  1S9G A;  1JLG B;  3H5S A;  1QAY A;  5IT4 A;  4LVN P;  4ECR A;  2OPQ A;  2FVR A;  4XPE A;  1UAW A;  2OEK A;  1T3O A;  2DNK A;  3RRG A;  4ZLP A;  3HZG A;  3P8B B;  3BH7 B;  2W9C B;  3EMT A;  2OPR B;  2DEJ A;  2LU1 A;  1XNQ J;  2ZNY A;  2Y1I A;  3K5O A;  4DR5 J;  1V3R A;  3PFO A;  5HMX A;  1T94 A;  4NML A;  1AFI A;  2GIQ A;  2PDA A;  1RK8 A;  4AYB D;  2NSC A;  3DYA B;  4LFC J;  4LF9 J;  1P27 B;  4I2P A;  1YJ9 S;  1S6Q A;  1JLB A;  3S8S A;  3KK1 A;  2DGX A;  2V6A A;  3C66 A;  2Y0B B;  2FJX A;  4JI4 F;  1U0S A;  3I4P A;  3KLH A;  3E2E A;  3I32 A;  2IJF A;  3T1Y F;  2CJQ A;  5BYQ A;  4U8Y A;  5D78 A;  3OR2 A;  2C2E A;  1HBU A;  3HJF A;  5D4P A;  2ZM6 J;  2QLW A;  3EX7 B;  2V2Q A;  3NWG A;  2YY3 A;  1SL0 A;  1SC6 A;  3I31 A;  3MI7 X;  4DQR A;  2OFH X;  2RIL A;  1IQT A;  4ATN A;  4RNH A;  3TI0 A;  4JI3 F;  2PI5 A;  2CIM A;  1F9F A;  2JHE A;  4M63 A;  3N6N A;  1AZS B;  2GJI A;  1RTD A;  2JH3 A;  2Z0G A;  3E8O A;  2XLJ A;  1CBK A;  1J2V A;  2OH2 A;  3NP5 A;  1HNV B;  1WDD A;  1NK4 A;  4DV0 F;  2IM0 A;  1CJK B;  5E0O A;  1WAC A;  3R5J B;  1B0V A;  4O44 B;  2V4J B;  2UUB F;  3BGU A;  3D5M A;  1CQM A;  4UUX A;  4LF1 A;  4OI4 A;  5AXN A;  1RDR A;  3NCP A;  2J9D A;  3MUT P;  3M6U A;  3CCR S;  3Q86 A;  2Y3Y A;  4ID8 A;  4Y2C A;  3EVM A;  2B4U A;  3R3T A;  1HI0 P;  2C42 A;  2FHK A;  1L3T A;  2J5A A;  3D3B J;  3PIP Q;  2B7B B;  3MEG B;  1YGY A;  1UMJ A;  4PRF A;  3CD5 A;  2D3O 1;  4Y00 A;  1S99 A;  4CQ1 A;  1MMD A;  2G9O A;  2XCA A;  1M0S A;  2QEX S;  4I1T A;  2HFS A;  2XHW A;  3MPW A;  2R8I A;  2HQC A;  2HFV A;  1FD2 A;  1LWF A;  4L72 B;  1Y4Z B;  1NPP A;  3ELH A;  2M3D A;  2IBK A;  2JDJ A;  4G1P A;  3F44 A;  2XB2 D;  2E9R X;  4LIW A;  4MKA A;  4WXW A;  2AYM A;  1FNM A;  5IT9 U;  2MZR A;  3FFI B;  3FCV A;  2YKN B;  2J0S D;  2FHO B;  4WFX A;  2PN6 A;  3SFU A;  1WKJ A;  2A10 A;  5B0E A;  4B3M F;  2QLF B;  3SCK E;  2FHM A;  5L1J A;  3U1N A;  4NPO A;  2C2D A;  2GHP A;  1N6Q A;  2GFF A;  2QYC A;  4OI1 A;  1HD1 A;  3OQ2 A;  1LW0 A;  1UFW A;  1GH8 A;  4NCG B;  4URG A;  4Q5V A;  1NO8 A;  1D9F A;  2FHJ A;  3OT9 A;  5KG2 A;  2B9Y A;  2JL9 A;  2N7C A;  4M5J A;  4ZPC A;  2YQ0 A;  2ZVI A;  3BO4 A;  3D54 A;  4F4A A;  1M5S A;  1GMU A;  5HLF A;  3DDK A;  4JI4 J;  4ZIV A;  4YR3 A;  1YBU A;  1VYA A;  3T1Y J;  1DAX A;  2FY1 A;  1R8C A;  1ZA2 B;  5CCL A;  4DU8 A;  3GV7 B;  4BWM A;  1F5C A;  2E5G A;  4USW A;  5AE2 A;  5K8P A;  1DQ9 A;  1S4E A;  1F3F A;  5B0D A;  1FEE A;  4NLQ A;  2OP5 A;  5KFU A;  5E2Q A;  1R7I A;  2X1A A;  1KS2 A;  4JI3 J;  2MZQ A;  4Y2I A;  4G1Q A;  3FQK A;  3NCR A;  4TU7 A;  4YQW A;  2J9C A;  3QZ8 A;  3OHA A;  1IM6 A;  2CPH A;  4L3N A;  2NUH A;  4DV0 J;  5CZX A;  4WJB A;  2BKN A;  4I7F B;  1BHN A;  3RBE A;  1XC9 A;  2R3V A;  2YBV A;  3CJS A;  3BEG B;  4PQU B;  2UUB J;  1IKX B;  4ZOS A;  1BQM B;  4L73 A;  3LO3 A;  1NKB A;  2R7S A;  4C3M A;  1TVR A;  1HNI B;  3P6Y C;  4ID5 B;  4DUT A;  1DRZ A;  2LCW A;  2B9W A;  4EGL A;  4CLK A;  1VCT A;  1X4C A;  4QPT A;  3ZXW A;  2RT3 A;  2DRB A;  4C2M A;  3R7N B;  4DLG A;  5CYM A;  2EG2 A;  4FKY A;  2Y1R I;  4ZPV R;  4C98 A;  1NK8 A;  5GAG I;  4DSL A;  1H73 A;  1Y5N B;  2MSS A;  3GE9 A;  4JV2 A;  2HHV A;  1PBU A;  4DV7 F;  2J9D E;  1C1C B;  3HKZ D;  4FZV A;  4K4Y A;  1M5P C;  4LRB A;  1U1L A;  1QVG R;  3GFZ A;  3F56 A;  2CPD A;  3W5Z A;  2KM8 B;  4OX8 A;  4KO0 A;  4WF9 Q;  3D3C J;  3J80 U;  5IOL A;  2PMW A;  1Q81 T;  1SC1 B;  1T05 A;  3M6X A;  1C1B B;  1DLO B;  1HNX F;  3FBF A;  2FUG 9;  2H51 B;  2WB4 A;  3IS9 B;  3MWB A;  1Y9O A;  3U1L A;  4YOE A;  3HFZ B;  2VF3 A;  1YJT A;  5B0F A;  3V6D B;  2W1B A;  5KFB A;  1XBW A;  1S0O A;  3PFE A;  1S0M A;  3PEJ A;  1WF2 A;  3CNQ P;  4B3M J;  4CYU B;  1VIS A;  3V4M A;  2EG1 A;  1RHM B;  2KJW A;  5GAD U;  4LIR A;  3AD7 C;  4ETX A;  2JC0 A;  2WZ1 A;  2E5L F;  2FB0 A;  5KG6 A;  4RL1 A;  1IKW A;  1YJV A;  1X60 A;  1FRX A;  2EI5 A;  3PW2 A;  5LOQ A;  1RBA A;  3B6B A;  2ZZN A;  2F5G A;  2RKI B;  2WSF C;  1FXR A;  2V2V A;  2EW9 A;  2GMH A;  3AHP A;  3HXM A;  3WC2 A;  4USM A;  5CQG A;  2U1A A;  3W2W B;  3ZNJ 1;  1LXJ A;  1HQ2 A;  4B17 A;  2H4W B;  1T9U A;  3HHE A;  1VK3 A;  1GXU A;  5ETP A;  5AE1 A;  1FTR A;  1S1X A;  3LWM A;  3CVK A;  2ZHO A;  2JEF A;  1REV A;  3GWC A;  5T7L B;  5K14 A;  1N4L A;  3RG6 A;  4TN2 A;  1Z2L A;  3BBF A;  2ZKT A;  4P2F A;  1DTQ B;  1CS4 A;  3PX6 A;  1TL1 A;  1XJW B;  2XWX A;  4K8R A;  1DHM A;  3ZZP A;  4RBV A;  4DCJ B;  4NL5 A;  2D74 B;  4WE1 A;  4I68 A;  1TUG B;  1RT4 A;  5A8K A;  5J2Q A;  5A0Y A;  3VAL A;  3MM7 A;  3SIP B;  3RB0 A;  2XBP A;  4RBT A;  4Z2X A;  1FE4 A;  2OJ3 A;  4C8N A;  3MR7 A;  2YQ1 A;  2YNG B;  4ZKA A;  1IR2 A;  1HIY A;  2FVQ A;  2E7V A;  2EFO A;  2FVS A;  4FBT A;  1HYS B;  1A9N B;  3HHK A;  2MKC A;  1W2I A;  3RRH A;  1RCX B;  3L4B C;  3SCI E;  2BJ1 A;  4JI6 F;  4X64 F;  2XO7 A;  5KG0 A;  3CPW R;  4OZ0 A;  1WG5 A;  2ACY A;  2NYI A;  1X0P A;  2ZOG A;  5SUH A;  4UQG A;  4IKA A;  5KFO A;  5LSO A;  1UW9 A;  4F0K A;  4RKU C;  1X4A A;  1YJ7 A;  4IRC A;  4PWD A;  4IQX A;  1FFG B;  3OSP A;  5J1E B;  3KJV A;  3K0J A;  2ZH7 A;  3NBP A;  4LQ9 A;  4DV7 J;  2Q43 A;  3M8Q A;  1KQG B;  4NLP A;  4IRD A;  4U7U D;  5DRK A;  2HNY B;  1M5H A;  1LEO A;  1ZM3 A;  2BAC A;  2J6T A;  2J6U A;  2N4C A;  2DNY A;  2W2Q P;  3BZQ A;  2JSX A;  3ZZY A;  4DF8 A;  4DSK A;  3N01 A;  3TRG A;  1G4C A;  3SSQ A;  1AB8 A;  5ETK A;  2XQC A;  4UOF A;  3HDS A;  3EGZ A;  1RAD B;  2JX2 A;  4X4U A;  3OFH A;  4M5H A;  4CCH A;  2NUU G;  2XLI A;  4I67 A;  2LQ8 A;  1CJT B;  1FD8 A;  4UQT A;  4DEZ A;  3CCS S;  1HBO B;  5IT9 Y;  3QYY A;  1CC7 A;  1Y5L B;  1TV6 A;  4ZPT R;  2E5L J;  2HYI B;  2DH8 A;  2VB6 A;  2HVE A;  3EVO A;  3DOL B;  3CJ3 A;  3HHN B;  1ZBT A;  4PXE A;  1UCN A;  4DQP A;  5A8W A;  4DPT A;  4LFA F;  2VC0 A;  4CM0 A;  2ZNZ A;  1GAO A;  3KOA A;  5KG1 A;  3W62 A;  2VIH A;  2MKJ A;  4GVB B;  3MCN A;  4DSF A;  1YBA A;  2HGL A;  3KK2 A;  4FXD A;  4Y2A A;  4CRJ A;  1RYR A;  1B3T A;  3UPF A;  1QJH A;  1PJ6 A;  1UEU A;  4Q44 A;  1F1B B;  3CDW A;  2L3M A;  3VAM A;  4KGX B;  2MQ8 A;  1K1S A;  1DQA A;  3QJL A;  4DX7 A;  3BH6 B;  1WTF A;  2WBM A;  1RT7 A;  1SKR A;  3M1V A;  3U1M A;  3DRX A;  3W7B A;  2KB2 A;  2DPI A;  2ATL A;  2VZ9 A;  1L5U A;  3MMB A;  1ZZF A;  4J9S A;  3OVB A;  2A2C A;  4NE9 C;  4KT0 C;  3MAA B;  1KDN A;  4G1I A;  2AJ2 A;  2ZE2 A;  1X9S A;  4F4Z A;  3JSM B;  3AXM A;  4CTA B;  5J1N A;  2FIU A;  3C3L A;  1BWV A;  2RU3 A;  3ILI A;  1FRH A;  4QR1 A;  1Z1Z A;  1RWV B;  2VG6 B;  1TL3 A;  5HAO A;  3TOQ A;  4X4S A;  2RQC A;  3M8W A;  5D0H A;  3NS5 A;  2GMJ A;  2G1D A;  3EDR B;  2YWE A;  3MR5 A;  5HMY A;  4QU6 A;  3W3S A;  4UTG A;  1S6P A;  4UT4 A;  3NWR A;  2JWN A;  2FZC B;  2KT3 A;  3ULH A;  4FP9 A;  3M32 A;  2C2O B;  1GQE A;  1SJR A;  3Q8Y A;  4X64 J;  2BKP A;  3RGI A;  1X4D A;  3IGV A;  3MFI A;  1E6Y B;  2HVI A;  4IFV A;  1E6V A;  1MU2 B;  4LF5 J;  2NZ4 A;  4M5G A;  3HFK A;  3TEH B;  4DG1 A;  5FII A;  3PRD A;  4C0H A;  3QWP A;  2OO4 A;  4IRK A;  3DGV A;  1UA1 A;  3OXG A;  3M05 A;  4CLY A;  2ZDP A;  1VQ9 S;  4A8F A;  4HEA 9;  1EKR A;  4FYD A;  5HRO A;  2FJB B;  2ZD1 B;  5IT0 A;  3C6U A;  1FDN A;  2B8P A;  2C22 A;  3E01 B;  1RE1 B;  5B09 A;  4UOG A;  3PR4 A;  3GFH A;  3NOC A;  2DT9 A;  5J2P B;  4KPY A;  2DK2 A;  3M8P A;  1DAR A;  5HBM A;  1N5T A;  4B3O B;  4MK8 A;  1F60 B;  2O67 A;  4WKR A;  4AUK A;  4L6V 3;  4DR6 J;  3J80 Y;  2DRD A;  4F4W A;  1RT5 B;  1U8S A;  2M7S A;  4NLW A;  3TJA A;  1S6U A;  4GMK A;  1X5S A;  2ILZ A;  3LW5 C;  2P6T A;  1LWC B;  8RUC A;  1YZ7 A;  3NAH A;  4DWI A;  4NLX A;  4LFA J;  5ADZ A;  2QMU B;  4CO3 A;  3Q89 A;  1AT1 B;  1IBM F;  4ELV A;  4DFP A;  3BYR A;  4ZVQ B;  3W63 A;  3FQL A;  1NME B;  3IBW A;  3NL0 A;  2JVR A;  1TL7 B;  1J5O B;  5KT5 A;  1KOH A;  3M6W A;  4JI0 J;  3AAW B;  1WOR A;  4J5O A;  2HVD A;  3HFV A;  1MRO A;  3WHI A;  3J7A 1;  1D8Y A;  5T41 A;  4MKV A;  2FC9 A;  2XLK A;  4MK7 A;  3D6F B;  3MED A;  2AHO B;  2W7A A;  1DUR A;  2FJE B;  1Y3K A;  2YNF A;  3NG8 A;  2GV1 A;  1U1N A;  1EET B;  3N6L A;  2MQL A;  3NOG A;  2ZHA A;  4K4U A;  5IC4 B;  1TKZ A;  4TQS A;  1C0T A;  4DZD A;  1N48 A;  4C7Q A;  3WQP A;  4UZC A;  5CAA A;  1S10 A;  1XEZ A;  5I3U A;  4IH5 A;  4PG4 A;  4UF4 A;  2W9A A;  3BDP A;  2HAF A;  5EX0 A;  4EBD A;  4X4Q A;  1FKP A;  3U02 A;  1S9E A;  3TX8 A;  2QMX A;  3V81 A;  4HAC B;  1F5B A;  1UFL A;  2VFS A;  2CA9 A;  2FD2 A;  3OSN A;  4ED3 A;  2WVB A;  3L7P A;  2HK3 A;  2HLT A;  3TW0 A;  4K50 A;  3NRB A;  4C8K A;  1UW4 A;  3A4T A;  1QVF R;  3N79 A;  3VAI A;  3PKM A;  3EUN A;  1I3O B;  4IOB A;  4R5P A;  4A4J A;  4ZVR B;  4WPA A;  1U6B A;  3DRS B;  4XO0 A;  4IR9 A;  2R8J A;  2YTC A;  3ITH A;  2Y8Y A;  3G86 A;  2E66 A;  1B4S A;  2WRM A;  1HLW A;  1KFD A;  2FYX A;  2YKM A;  4J9O A;  3PZP A;  4QYZ J;  1ZM4 A;  2LP4 A;  3BKT A;  2HHP A;  5L39 A;  5FLX U;  2ALZ A;  4ED4 A;  1I6J A;  2MKS A;  2BW7 A;  1S59 A;  1S9G B;  2YWG A;  2AZ3 A;  3IP0 A;  5BYR A;  1RWM B;  4Z7Y A;  4OQJ A;  2AT1 B;  4NI2 B;  5E3A A;  2OPQ B;  3EGV A;  4TVA B;  2PO4 A;  1VBY A;  4DX5 A;  3CD0 A;  4YHH F;  2ADB A;  1N5Y A;  4RW7 A;  3BO2 A;  3CTR A;  5DQG A;  4NEZ A;  3PHE A;  3VR1 A;  1RT6 A;  4ZJO A;  1EAY C;  3TA1 A;  1ZH5 A;  3N9U C;  2W4D A;  2BJ8 A;  2PMZ D;  3GB0 A;  3Q8R B;  3QT5 A;  5K8N A;  4I2P B;  1JLB B;  1RT2 A;  3PXG a;  3KK1 B;  2AGQ A;  1A6L A;  4KFB A;  2HGM A;  1RQ0 A;  2ZFH A;  5H9F J;  3KLH B;  2VFV A;  4B9M A;  2YXL A;  1S0N A;  1QE1 A;  5GMK a;  3QRQ A;  5A6P A;  4J9N A;  2IM1 A;  1NPK A;  6FDR A;  3TUI C;  3OR2 B;  1HBU B;  1N0U A;  3AOB A;  2AX0 A;  2MHN A;  4WFZ A;  1K1Q A;  1VQ7 S;  3W2V B;  3QJJ A;  4LF7 F;  4CLF A;  1Q8B A;  2XG8 A;  4TY9 A;  1YHQ S;  1XNR F;  2CDR B;  4DJB A;  2DHA A;  1RTD B;  2H1Y A;  1NRK A;  2VDH A;  4ZCM A;  4NWB A;  1KWM A;  1PG5 B;  2V50 A;  1HI8 A;  2FLO A;  1KVJ A;  5F41 A;  3NGR A;  2B43 A;  4RW6 A;  4DV1 F;  1D0E A;  4WCE Q;  2IMO A;  4Y6I A;  1FTC A;  2P9C A;  1X4G A;  4NLG A;  4EZ6 A;  2H5J B;  2W8L A;  3W66 A;  3FVY A;  1FO1 A;  4ECW A;  1R6V A;  2A3J A;  4PXC A;  3AD8 C;  1LWE A;  3SQG A;  3CB4 A;  5KFW A;  1WC3 A;  4B3R F;  4QW8 A;  2VUG A;  1VS3 A;  1VRT A;  4DR4 F;  1NEE A;  3D6M B;  4OHZ A;  1NUE A;  3LAL A;  4X84 A;  4FYV B;  1H72 C;  3I4H X;  3G8T A;  2K7K A;  3OLB A;  2XZT B;  1GX6 A;  4XK8 C;  1LWF B;  1EB0 A;  4OV1 A;  1WC0 A;  2CQC A;  4HR2 A;  2BZ2 A;  3MM9 A;  4DR1 F;  4I6W A;  2PI4 A;  3HUL A;  5FJ4 A;  2DCU B;  2YX7 A;  3PW7 A;  3EPG A;  2QL9 B;  1T9X A;  3A3N B;  4ZP7 A;  3K8V A;  4ECQ A;  2ZC3 A;  4CNZ A;  5A76 A;  2XY6 A;  2BRL A;  1WSR A;  1IVZ A;  3VGV A;  2UXB F;  3KLE B;  1WWH A;  5M2R A;  4YP3 A;  3FCW A;  1S1U A;  1RA6 A;  4B3T F;  2VC1 A;  4YHH J;  1N6Q B;  3MTJ A;  4HH1 A;  1RWU A;  4CM2 A;  2DNZ A;  2E29 A;  3L95 X;  5KFD A;  1LW0 B;  3BGO P;  3JYT A;  2ZOF A;  2R7U A;  5LSL A;  1PC5 A;  2Z56 B;  1J5E F;  5HL7 Q;  3J81 U;  2VBX A;  4JV0 A;  3QMQ A;  3G4S S;  2LYV A;  3Q23 A;  2ZUG A;  4OZN A;  2BDP A;  2QX0 A;  5HLF B;  4KH0 B;  4NZ7 A;  2EEY A;  1WI8 A;  3GIK A;  1O0P A;  2DR6 A;  2ADC A;  2HRT A;  4ZVP B;  3UFC X;  1RWP B;  1MWQ A;  3GG0 A;  5AJ3 F;  4BWJ A;  1SH2 A;  2XMJ A;  4DCO B;  2R2S A;  3UNY A;  3MPU B;  3IAM 9;  1EP4 A;  1IR1 A;  3C6T A;  2B9E A;  1S4F A;  1JKH B;  1XNR J;  3VGS A;  3QSY B;  1SJ4 P;  1HAR A;  4OLP A;  3D7S B;  1RLD A;  1U02 A;  5ITH A;  4JI5 F;  3CCU S;  2W7O A;  2HHS A;  4I69 A;  4JI2 J;  5DDO C;  2D3O R;  4EWT A;  2LQB A;  1R8A A;  2FZG B;  2ACM A;  4DV1 J;  3M9N B;  2NYH A;  1GTE A;  1BMQ B;  2MGZ B;  2FGO A;  1M1H A;  2W24 A;  1ZA1 B;  5GME A;  1TVR B;  2MQO A;  1S1V A;  3R7B B;  3VVU A;  4DV2 F;  2FJW A;  2RE1 A;  4NXN F;  3DXB A;  1RAG B;  3RAQ A;  2K3K A;  1Q0N A;  3N5B A;  3GIJ A;  4A48 A;  1U4B A;  3HHD A;  2QIF A;  1KHW A;  4HVZ A;  1FT8 A;  4QIF A;  4B3S J;  4DR4 J;  2VQE F;  2GQC A;  3N5F A;  4JP8 A;  3MHY A;  3UWT A;  4NXM F;  4R8U A;  3SI8 A;  3LAK A;  3TA0 A;  2DEI A;  5ETV A;  2GVD A;  3GJQ B;  4X4V A;  4P7V A;  4KO0 B;  4DL0 C;  4U67 Q;  4DR1 J;  3J7Z T;  4LSL A;  2DHS A;  3Q2T C;  3WZ0 A;  4FVM A;  2QTW A;  4LR7 A;  2LQ5 A;  5C2C A;  1BD6 A;  3H98 A;  5IWA J;  3MDF A;  3ENA A;  4V19 X;  1S49 A;  3VAJ A;  2HBZ B;  2XS7 A;  5IM0 A;  4DZ6 A;  3OTC A;  4OZ2 A;  2UXB J;  4G65 A;  1DQ8 A;  3GJR B;  2HHW A;  4AFF A;  3I96 A;  4DQS A;  1SC3 B;  4NLU A;  2ATC B;  1ITP A;  1P1T A;  3KUE A;  2E5H A;  5FLX Y;  1QAJ A;  5BYS A;  1IKW B;  2ZHB A;  1PAE X;  4ES2 A;  3R2D J;  5EN1 A;  2CNN B;  1TTH B;  3KKF A;  2V2Z A;  2IYG A;  1YJW S;  1J5E J;  2OEL A;  3NGU A;  1T0T V;  2BAN A;  2EFP A;  2MZJ A;  2HNZ A;  3DRP B;  2AGO A;  2DRA A;  3MM8 A;  3IAS 9;  2ZJQ Q;  4A8Q A;  3CUL A;  1VQL S;  5EGY A;  2GAG C;  1EHW A;  1JQG A;  2LA6 A;  5HJX A;  2LFV A;  3HD2 A;  2OD4 A;  4M5K A;  4OZJ A;  3SDE A;  5AJ3 J;  2ROP A;  1NK6 A;  4NMX A;  2QMW A;  1REV B;  1RSC A;  2V94 A;  3JSR A;  3NS6 A;  2UVV A;  3LH2 S;  2UZA A;  4RR5 A;  2W4C A;  4ZIW A;  5K14 B;  4GC7 A;  1EJ7 L;  2HFZ A;  4L3K A;  3DLJ A;  4DV4 F;  2R7X A;  1N33 F;  2UXD F;  2I8E A;  2HWI A;  5HVF A;  2DGW A;  4WYL A;  3BDE A;  1WC1 A;  4FS2 A;  1GFW B;  8AT1 B;  2EWH A;  5EWG A;  3UDE A;  1ZM9 A;  2CPF A;  4WE1 B;  4ELU A;  5J1P A;  1CLF A;  1SH0 A;  4JI5 J;  4J9Q A;  2Z2Y B;  4WFY A;  3FDS A;  5A8K B;  4WXO A;  5J2Q B;  3MM7 B;  3IMQ J;  3G6V A;  1MG7 A;  5D8H B;  5D0E A;  3ILL A;  3CC2 S;  2CQ0 A;  2CJ9 A;  2KVI A;  2O1P A;  1JLF A;  2PA3 A;  2OIH A;  2OTL S;  1RHQ B;  3D1H A;  2F63 A;  2DNO A;  2BBE A;  3H42 A;  1HPZ A;  3A8I A;  4RU2 A;  4DV2 J;  3NNH A;  4NXN J;  1HHQ A;  2LQ9 A;  2R4F A;  1ZOT A;  3MMJ A;  4USJ C;  2GML A;  2Y0S D;  3I56 S;  1F9H A;  1TKD A;  2ZKU A;  5KG7 A;  3W8P A;  2Y1J A;  4K5R A;  2RUS A;  3ENW A;  4A8O A;  4NX9 A;  1VQO S;  4QYZ K;  2RHS B;  2VHG A;  2XUL A;  3FNN A;  2VQE J;  4OYP A;  2ZH4 A;  3KJV B;  4NXM J;  2DIV A;  4HDH A;  3NBP B;  3M8Q B;  3HHL D;  2V8P A;  2UUT A;  2MZ1 A;  1WF0 A;  4F04 B;  4BHQ A;  2QL5 B;  1JLE A;  2F3J A;  2CQ3 A;  1FRK A;  1DFD A;  4A8S A;  4MK9 A;  1S0V A;  2QSF A;  3EIC A;  5FD1 A;  1X9M A;  4FPR A;  3JQM A;  3IRX A;  1A0O B;  4CO4 A;  4UOH A;  2QSW A;  3KLV A;  4OX9 F;  3I0S B;  3D1Q A;  3R2C J;  2ZJR Q;  2WW8 A;  3PRB A;  1G2E A;  4NA3 A;  3U27 A;  1L3V A;  4OJ1 A;  1FXL A;  3BPD A;  1YTY A;  5GAG U;  4C97 A;  3I0R A;  2BAB A;  5H9F K;  4QIW D;  1TV6 B;  5F8G A;  3D67 A;  5EWE A;  2UXC F;  3HT0 A;  2XMA A;  5B0G A;  3AOC A;  5A8W B;  5DQH A;  4DDF A;  3O6Q A;  4KV8 B;  2ZBR A;  2FJD B;  2PEH A;  3KK2 B;  4OYO A;  5DET A;  9RUB A;  1OSD A;  2VH7 A;  4KH1 B;  1S1T A;  5B0C A;  3V4I B;  5KFF A;  1RT3 A;  2CQG A;  4NA1 A;  4KGM A;  2UUA F;  3Q2S C;  4TLQ A;  4JYA F;  2WHO A;  1B70 B;  4J9L A;  3X3U A;  4WP8 A;  2B7C B;  1NXI A;  2QGF B;  1RWX B;  1SL2 A;  3IO1 A;  5LM7 E;  2LEB A;  2R2T A;  3RW6 A;  1NBE B;  2MQN A;  1RYS A;  1H3D A;  1WSV A;  1YG0 A;  3MMB B;  5LT5 A;  4DV4 J;  4EMD A;  2JLG A;  2UXD J;  3NGT A;  2COL A;  5LL6 d;  2VBY A;  2ZE2 B;  3K89 A;  4RPF A;  2K2P A;  2CNL B;  3AD9 C;  1RTZ A;  3BKF A;  2EBE A;  1WHV A;  2E9Z A;  2V9K A;  5KT6 A;  3EZO A;  3MTK A;  2DHH A;  1TL3 B;  4AXI A;  2C2R A;  4YEA A;  3JTO A;  2ZWP A;  4DOZ A;  1TUW A;  2MJU A;  4FF4 A;  2HIY A;  2B0G A;  4PG5 A;  3HT3 A;  4AL5 A;  2AGP A;  3K58 A;  4CNY A;  1VMB A;  3KK3 A;  1S6P B;  2A6O A;  3BV8 A;  2HPU A;  3IG1 B;  3LGH A;  4NAS A;  2BOP A;  3M32 B;  4HDG A;  3OTD A;  2OPS A;  2LKZ A;  1RUS A;  2AJ1 A;  3GPA A;  4CZC A;  4IFV B;  1FX2 A;  1Q53 A;  4CWB A;  1E6V B;  2GC8 A;  4RW4 A;  3FJ2 A;  2QJ3 A;  2XZW A;  1JX4 A;  1XMB A;  5H9E K;  2V69 A;  1ZPV A;  3KNA A;  3AQP A;  4X66 F;  1XR6 A;  3AA9 A;  3N0V A;  3F0N A;  4ZP9 A;  2UV8 G;  3KMS A;  2B5J A;  2BXJ A;  1OS5 A;  4TY8 B;  2FPH X;  2RS2 A;  4LSZ B;  5HRO B;  1D9D A;  3C6U B;  5KFT A;  2JFK A;  2QFJ A;  5E5N A;  4KTQ A;  3AY0 A;  3DLE A;  4O4G A;  4CT8 A;  4HTJ A;  2X3G A;  3OXF A;  3VVT A;  3IGN A;  1WC6 A;  4OFZ A;  4B08 A;  3A8J A;  4JV5 J;  2OML A;  5DQI A;  1UVJ A;  2V8H A;  3M8P B;  3MEC B;  5HBM B;  3G6X A;  1PBA A;  5KOX A;  1R0B G;  4AT1 B;  4RLE A;  1XWL A;  4B9V A;  1IBC B;  3OTE A;  3CW2 C;  4UY8 T;  3GCX P;  3PEH A;  2ZUA A;  4OMF G;  3AXK A;  4QIV A;  4I4B A;  3QPI A;  1PYO B;  4OI2 A;  1SXL A;  2XYP B;  3W60 A;  2NRE A;  1H2U X;  2UXC J;  1MN7 A;  1X4F A;  4U6P A;  1DBD A;  2YQ3 A;  2CYY A;  1V6H A;  3SQO P;  1SC4 B;  1K8A T;  2WON A;  2QA1 A;  4CO2 A;  3MOZ A;  2LMI A;  3M8S A;  3JTN A;  3GV8 B;  3TQ1 A;  5H1S V;  5CZV A;  2CQH A;  2CPE A;  4F3Q A;  2Q66 A;  2I5J A;  2AIR B;  4YUD A;  4DF4 A;  2EK6 A;  5MAO A;  1TEL A;  2GHW A;  3AOD A;  2AWZ A;  3F73 A;  2YH1 A;  3D4J A;  1HNZ F;  2MY7 A;  2OHD A;  2D41 A;  1RGV A;  1F5A A;  4PAB A;  4O0I A;  2NLW A;  2UUA J;  5KFM A;  4X4R A;  5KFY A;  4Y3C A;  3V6H A;  1X31 C;  1WG4 A;  2P2C B;  4J90 A;  4MH8 A;  4F26 A;  3SBM A;  1MRO B;  3UE2 A;  5K5M A;  5IV3 A;  1P9Y A;  4H4M B;  1SKS A;  5EHH A;  4RBU A;  2XGP A;  3MED B;  4ECY A;  4CH1 A;  3CDA A;  1Q95 G;  5G4D A;  2YNF B;  3T6J A;  3GR1 A;  1NB7 A;  4LRD A;  3NEK A;  2H54 B;  4LRA A;  3KLG A;  2OD6 A;  2ZH8 A;  3BGR B;  3CIM A;  3HJV A;  4KGK A;  2HFU A;  1TKZ B;  2W7P A;  3PW4 A;  2LEP A;  2EFG A;  2CJK A;  4J9P A;  1C0T B;  5KOW A;  1RAF B;  2CZV C;  5I3U B;  1YSJ A;  2KXN B;  2Y1L B;  2A1B A;  2YNH A;  2HZC A;  2XGQ A;  2AJQ A;  2QLJ B;  2M4M A;  2VV5 A;  2BQ3 A;  1S12 A;  1FKP B;  1BC6 A;  4LSN A;  3T1H J;  3V81 B;  2M9K A;  2V68 A;  4NCB A;  2DXD A;  2MY8 A;  2IAJ A;  3THT A;  1NSQ A;  4IH6 A;  2UVW A;  2DKO B;  1HWU A;  3GZ7 A;  1FWK A;  5ETL A;  3THP A;  3AJ1 A;  2NR0 A;  3AJD A;  3HVT A;  4TYA A;  3VGU A;  4I64 A;  4R5P B;  1U2C A;  2V0N A;  3HSD A;  1VQP S;  3TZZ A;  3CCV S;  2KHC A;  3M4X A;  5F3T A;  4ZVH A;  3ITH B;  1RWN B;  1NK5 A;  2RUG A;  4P7T A;  3PX0 A;  4X66 J;  2XI2 A;  3RTV A;  3CSK A;  1TU0 B;  4QCL A;  2YKM B;  1KNZ A;  1U2R A;  5JMN A;  4KHM A;  5C42 A;  2HFO A;  1TR0 A;  3IBF B;  2HND B;  3SSS A;  3LAM A;  3G8S A;  1RWK B;  4N5S A;  1PJ7 A;  4ZVS B;  1XNQ F;  3PG9 A;  1HWI A;  1NKE A;  2DD8 S;  2N82 B;  3HSZ A;  1RTI A;  2VIC A;  4NLS A;  1Q16 B;  3DI6 A;  2Q1L A;  2DVI A;  1FXD A;  1UJ5 A;  1N5Y B;  2I0X A;  3UO0 A;  3MMA A;  4P2X A;  4ZVT B;  1X4B A;  2ERR A;  2RDD A;  3I9V 9;  3Q8Q B;  3CDE A;  5J2N A;  4WK3 A;  3NS7 B;  4IO9 Q;  4O23 A;  2XMU A;  2CVE A;  2RD5 C;  1LK7 A;  1RT2 B;  2ZM6 F;  1N34 F;  2DY1 A;  3TAN A;  4KFB B;  4J37 A;  5THW A;  3ETM A;  5CD4 A;  3DDI A;  1QE1 B;  2GIF A;  4AL7 A;  4KC5 A;  4PYA A;  1FDD A;  4TXS A;  1X8D A;  2OKQ A;  3G2X A;  1HNZ J;  1FX4 A;  1FJE B;  1U48 A;  3D0G E;  2MB0 B;  3JAM U;  3T6B A;  5F8N A;  2QFI A;  4QW9 A;  2KXF A;  4X4T A;  4AE5 A;  4U7C A;  3CJR A;  1RXO B;  3BBC A;  5A6W A;  1UET A;  3CJ0 A;  3D9B A;  1IJF B;  2UP1 A;  4NLR A;  4DL3 A;  5KFL A;  4Q45 A;  4LF8 J;  2PE8 A;  1OMS A;  1S5Z A;  2ZZT A;  1QSS A;  4RW6 B;  3U7J A;  4HH0 A;  5HQM A;  4C8O A;  2GZO A;  3IM8 A;  1GX5 A;  1VC5 A;  3G82 A;  3K2Y A;  6FD1 A;  1RIS A;  2C3O A;  2MQP A;  2DR9 A;  3QBC A;  3K8W A;  3CC4 S;  2KXH A;  1JMT A;  4OJH A;  2L48 A;  5HAT A;  1HNV A;  1LWE B;  2YWH A;  5E33 A;  5JVG Q;  2DR8 A;  4JI7 F;  2X1B A;  4N8N A;  3SQG B;  1VHF A;  1IKY A;  1CJK A;  2Z2L A;  4DR7 F;  2CQD A;  4O44 A;  3UVJ A;  4F0M A;  1L3U A;  2O66 A;  4OZL A;  3H5X A;  2KM8 C;  2E1R A;  2V4R A;  2KYX A;  3CJ5 A;  4PXB A;  1AYE A;  4XPC A;  1UEK A;  4QQB A;  1WOO A;  3T1A A;  4U9R A;  3T9Z A;  1IKV B;  2D3Z A;  2HGN A;  3JSY A;  5DGB A;  1N88 A;  4QR2 A;  3OV7 A;  2H5I B;  5K8M A;  1TK8 A;  2VDI A;  3DMJ A;  2XM3 A;  4D3G A;  2JRS A;  3I5A A;  2OI2 A;  3HVW A;  4K4V A;  4TNO A;  4KE5 A;  2CVI A;  4C11 A;  4MIA A;  3IN5 A;  3MM9 B;  2CAD A;  1ZAX A;  1JNZ B;  2W2N P;  1A7G E;  2GO9 A;  4DCP B;  3LP2 A;  1YJU A;  1ZET A;  1UL3 A;  2IFX A;  2E1A A;  5DM7 Q;  1VRU A;  1WD6 A;  1CUL B;  4FVC A;  4K7Q A;  2CQ4 A;  2YKQ A;  4OZ5 A;  2IRU A;  4ED6 A;  1U49 A;  4RUC A;  4B9U A;  3TEG A;  3EXY A;  4OYA A;  2WSE C;  1PO6 A;  3OBI A;  2BUN A;  2WSC C;  3JYT B;  1RAB B;  1DJ0 A;  4GC6 A;  1RHU B;  1EQM A;  3B54 A;  4HI1 A;  1JLQ A;  3I5C A;  1RWO B;  2PC6 A;  4FF1 A;  3JXO A;  2G4B A;  5HAN A;  2ZZM A;  1N34 J;  1U0H A;  3I87 A;  3CMA S;  5DS7 A;  3IM9 A;  3R5C A;  2WB1 D;  2NSB A;  4NCG A;  1XMO F;  3WDO A;  4P74 A;  1OPI A;  3ZZU A;  3BSN A;  4XTT A;  3Q8U A;  3KNG A;  4K2X A;  1NJX A;  3M7V A;  1FJ7 A;  5IZH A;  5HQ8 A;  2OEJ A;  1EP4 B;  1KR4 A;  2BM1 A;  3BB5 A;  3CCL S;  1JJ4 A;  3QRR A;  2NXE A;  4PEO A;  1U25 A;  1G3O A;  1FNX H;  4DPU A;  4X2B A;  1K0V A;  2R8K A;  3BRE A;  2L41 A;  4DHV A;  3DRR A;  2MKI A;  2HWT A;  2EK1 A;  3PHT A;  4DX8 H;  1VQ4 S;  3D0H E;  4PG7 A;  2DGS A;  2UV8 A;  3OFF A;  3P45 B;  3QJP A;  1SL1 A;  3IWX A;  3W9J A;  1P1L A;  3KHH A;  1CC8 A;  1U26 A;  3ONQ A;  4C3K A;  3FSI A;  2IDL A;  1BY9 A;  4OI0 A;  4ED0 A;  3FEX B;  4JB8 B;  1S1V B;  2DNM A;  5F8I A;  5HK4 A;  2KFY A;  3FZB A;  5E3R A;  2KDO A;  4EUV A;  1VHI A;  4A46 A;  3MD1 A;  5HJY A;  1NHU A;  4JI7 J;  4ER8 A;  2V4Q A;  1O6X A;  4DR7 J;  3PTW A;  2BE9 B;  2UVU A;  2IVF B;  2HRU A;  4FS1 A;  1VFJ A;  3R1H A;  3C14 A;  1VR6 A;  1APS A;  2VPX B;  2NQP A;  1ACM B;  2AU0 A;  1JLA A;  4R8U B;  1Y00 A;  5BR8 J;  2GVD B;  4F4X A;  2F65 A;  5DG7 A;  1F9E B;  3AB2 B;  4RUA A;  4LSL B;  5M2P A;  1YRT A;  4LRF A;  5FDL A;  1HI1 A;  1FHT A;  4DQI A;  1FVQ A;  3I6P A;  3BSA A;  1VIX A;  4A8M P;  1VQY A;  1MN9 A;  3GJS B;  4MIB A;  1ZAW A;  5IM0 B;  3TJ9 A;  2I6W A;  2HHX A;  2BR0 A;  1Q5Y A;  3S01 A;  5A2Q U;  4ECV A;  3PJ9 A;  5KAK A;  2L08 A;  4K4T A;  3KJN B;  3C15 A;  4KJI A;  2F7V A;  1GXL A;  3ZTS A;  4YY3 F;  4IYQ A;  1QDU B;  2YVS A;  3NNC A;  3DFE A;  1HKA A;  4ETZ A;  3QZ7 A;  1N8R T;  1HNW J;  3KMQ A;  1KOO A;  2PFD A;  3UQS A;  1YX2 A;  3P3D A;  1TK0 A;  3BBB A;  4PWW A;  2BAN B;  2AMC B;  1HR0 F;  4ED7 A;  2KJV A;  1ZTT A;  2NZC A;  4NZ0 A;  4DSJ A;  2HNZ B;  2J8S A;  3O44 A;  1RCO B;  3SV4 A;  4TU9 A;  4FN5 A;  1HQU A;  3MM8 B;  4PPD A;  2DPJ A;  4RJV A;  3CC7 S;  5DZ6 A;  2ZWO A;  2L9D A;  2IJR A;  3VAK A;  4A8X A;  3B8H A;  5IFM A;  2CG8 A;  4WFA Q;  3SDE B;  1XMO J;  2RML A;  3CF5 Q;  1HWK A;  1JXL A;  2CJA A;  3ISN C;  1ROF A;  3HI9 A;  3FMB A;  5DM6 Q;  4IR1 A;  4Z37 A;  2GAH C;  2E1P A;  2GVZ A;  2JVO A;  3UDL A;  2D69 A;  2QN6 B;  2POK A;  5D4N A;  3IBC B;  2BKO A;  1DTT B;  4NLD A;  4OX7 A;  5C7P A;  2FLL A;  2FDN A;  3S7R A;  3WC0 A;  3H59 A;  3JAM Y;  2Y9H A;  3PV8 A;  3EGW B;  1JLF B;  2Q3P A;  3A8E A;  5E41 A;  1I5O B;  2D9P A;  4DUZ F;  4DL2 A;  2IRY A;  1XMQ J;  4DR3 J;  4S0M A;  1R31 A;  2Z57 B;  3ZNU A;  1HPZ B;  2BE2 A;  2DGV A;  3X1L B;  2J76 E;  1TL5 A;  2BVZ A;  5F3Z A;  2XY7 A;  3OTO J;  4I6A A;  5KFZ A;  3CIZ A;  5KFR A;  2YNI A;  2XS5 A;  1OPZ A;  3LPE A;  3OW2 R;  5G0R A;  3CT9 A;  2YX1 A;  2KG1 A;  2X3D A;  4YFU A;  5AE3 A;  1ZZN A;  4HHH A;  1W25 A;  5DJB A;  1JLC A;  4A47 A;  3J7Z 5;  2V9W A;  2YNG A;  2F4V J;  2DIS A;  2N3O A;  3T5K A;  4FPI A;  3R5D A;  2XNQ A;  4LF2 A;  3EWG A;  1GMW D;  1QTN B;  1S76 D;  4OIX A;  2HBR B;  1FWP A;  5GAH I;  2DNL A;  3N28 A;  1Q86 T;  2CRL A;  1PAU B;  1JLE B;  2DHX A;  2F8M A;  1VRQ C;  3H5Y A;  1VBK A;  3BN7 A;  3W5X A;  4A8W A;  4Y0F A;  3A13 A;  5HN0 A;  2P5V A;  2MEW A;  4CP5 A;  4IFY A;  4WZQ A;  4M5N A;  1N36 F;  3NY0 A;  4ITS A;  2D7S A;  5LJ5 Y;  3MPD A;  4ZCL A;  4OX6 A;  2CQB A;  4BCA A;  2AV5 A;  4LUB A;  1SIW B;  4CH0 S;  1QSL A;  3TAQ A;  4R0E A;  1RAA B;  1SPB P;  2OFG X;  3I0R B;  4I2Q A;  3VQT A;  1JK9 B;  5KFX A;  3GLJ A;  4DL5 A;  4YY3 J;  2QRR A;  5KFP A;  4LRE A;  3D6H B;  3G96 A;  1HQE A;  3DKD A;  1NDC A;  3OD2 A;  4P71 A;  2QZ8 A;  3BGL A;  4O3P A;  1HR0 J;  1ZAV A;  4YB5 A;  3OFE A;  1XR7 A;  1S1T B;  3IC1 A;  5CHC B;  1RT3 B;  1NJI T;  1PYS B;  1S9F A;  2NPI A;  4GO5 X;  2OSQ A;  4XDC A;  4LJM A;  3DOL A;  4CH7 A;  1VQ8 S;  3GCW P;  3PW5 A;  5MLC V;  2V2K A;  5D0G A;  3T19 A;  3CCZ A;  3QIP A;  4RW9 B;  1SCJ B;  4JUZ A;  3V2U C;  5HP1 A;  1RP5 A;  3KDN A;  4NEY A;  5LXY A;  1UWA A;  3CD7 A;  3BS9 A;  4I0W A;  3DLK A;  2WBR A;  3A1Y G;  2F4F A;  2FY8 A;  4M1K A;  3H7H B;  3NNA A;  2RQK A;  4IH7 A;  1UTA A;  1Q78 A;  2J0Q D;  2IM3 A;  3C8Y A;  2NXN A;  3A3P B;  3LAN A;  1QTM A;  3NGK A;  5D77 A;  2IMW P;  4YB6 A;  5IXU A;  3CO0 P;  2GGP A;  1S7H A;  8ATC B;  4ED2 A;  1V5I B;  1FI4 A;  2D3U A;  1WOP A;  4FNH A;  4DUZ J;  3GIM A;  5CYQ B;  5L46 A;  1U09 A;  4EO8 A;  4LF5 F;  2KTQ A;  3KK3 B;  4L76 A;  1HBM A;  3V5R A;  3MUM P;  2P6S A;  2RAQ A;  4HT7 A;  1WKL A;  3ZO7 A;  2RRA A;  2OPS B;  4ZHR B;  4YDX A;  1C2P A;  4QWB A;  4AQY F;  4FXW A;  5K20 B;  4RW4 B;  2V8V A;  1C4A A;  1AUD A;  2OPP A;  3D6T B;  4P10 A;  5B7W A;  3PW0 A;  2ZBP A;  4FYX B;  4MJK A;  4NLY A;  1NSA A;  2IYI A;  2EFV A;  4P9S A;  4CLP A;  2B5J B;  2XMT A;  1R8H A;  2RDJ A;  2MLY A;  3NKY A;  5HMZ A;  4Q8E A;  3BKU A;  3NGD A;  3DLE B;  4O4G B;  5IQQ A;  4Q2M A;  1X4H A;  2CKW A;  4DR6 F;  3DGP A;  3MF5 A;  3TX0 A;  3CED A;  5L8R C;  1N36 J;  1XER A;  2CQ1 A;  4MT1 A;  4NRU A;  3TVZ A;  2ASJ A;  3DM2 B;  2DBB A;  4USH A;  4CO1 A;  1X7V A;  3FSX A;  5CH7 B;  4F3M A;  3OTB A;  3H40 A;  1PYT A;  3QLH B;  3E01 A;  2V63 A;  3FBE A;  3FC9 A;  5RUB A;  3PM9 A;  4CLZ A;  3ICL A;  1U47 A;  1WDT A;  4ZJL A;  4J91 A;  1LW2 A;  1QAX A;  2CWX A;  2WON B;  4JI0 F;  5A2Q Y;  2VBZ A;  1HHS A;  2VD3 A;  3GJT B;  3RB3 A;  4HT5 A;  2VKR A;  3J7Y I;  4IOA Q;  2QT7 A;  3CJT A;  2MZT A;  2ZJP Q;  4DN9 A;  2MTL A;  1U1P A;  1IWG A;  1FRL A;  1HBN A;  2N3L A;  4B02 A;  4K4S A;  3VAH A;  2CXE A;  2J7K A;  2HQG A;  5D4O A;  2FHJ D;  5L9N A;  3C2P A;  4DL6 A;  3CJQ A;  1JXV A;  2HWH A;  3HSJ A;  4ZPW R;  3RZA A;  2VOP A;  2LU2 A;  5L38 A;  1U1M A;  5EUH A;  1RU2 A;  4DBQ A;  3BQ2 A;  3O8W A;  3PO5 A;  1NHK L;  2YX4 A;  3D66 A;  1K47 A;  2IHR 1;  3FCH A;  2WVD A;  2EFQ A;  4ICL A;  3OHB A;  4X65 F;  2P8I A;  3DCA A;  4IG0 A;  3JB9 k;  4DS5 A;  3DLG A;  2YNH B;  2BMB A;  4KY3 A;  2K1R A;  3DOM A;  2HHH F;  1RBO B;  4LSN B;  2HMI A;  1VBZ A;  3PRV A;  1RTH B;  2G2O A;  5GAE I;  1WEL A;  4EFA C;  3FUY A;  3WBZ A;  2IAJ B;  2HZV A;  2HQF A;  2C2K B;  4Z7C A;  1FFW B;  3KTQ A;  1VLY A;  3J81 j;  1FCA A;  4NCA A;  3OL6 A;  2NCK L;  1B7F A;  2DTJ A;  4AQY J;  1IR0 A;  2G1H A;  2RB7 A;  3HVT B;  3D1O A;  2R8G A;  2ZBI A;  2R7Q A;  3KLI B;  2HAI A;  5I4M A;  4DU7 A;  4HAC A;  1ZYQ A;  2BYC A;  3CJ2 A;  4KKO A;  5C24 A;  5CCM A;  4LRC A;  1SKU B;  2H9Z A;  5C5J A;  4RNN A;  4O3Q A;  1FRI A;  1T3N A;  3P49 B;  1NZA A;  5C42 B;  2CUY A;  3ENQ A;  2CPJ A;  4PAA A;  4Q0B A;  5JVH Q;  2FZK B;  2DHG A;  2VFU A;  1TZ0 A;  5KFJ A;  4UY8 5;  1WUU A;  2YWW A;  2LA4 A;  1FKA F;  2DGT A;  1FRJ A;  4F67 A;  4RNF A;  2DO4 A;  4DN0 A;  1RTI B;  3MR6 A;  4JOU A;  1U6Z A;  3PJW A;  3UD3 P;  3DI6 B;  2M8D B;  4LF4 F;  2I9S A;  5CD4 H;  1KHV A;  5DDR C;  5HI7 A;  5KT4 A;  4LFB F;  3MM6 A;  1H2T Z;  2WOM A;  1FJG J;  2CPY A;  1MMN A;  3MMA B;  5KFI A;  5F8M A;  2HKE A;  2R2U A;  3CJ4 A;  1FA0 A;  5DO2 A;  1UZH A;  5KG5 A;  3SXL A;  2MQM A;  4IG3 A;  1FEH A;  3S1T A;  5J2N B;  2FJV A;  4RU9 A;  1I94 J;  4NYZ A;  3PNI A;  3CME S;  4ZLL A;  4Q2L A;  4U8V A;  4NI2 A;  5E3P A;  3PVX A;  4KRW A;  4Q8F A;  5LJ3 Y;  3DHX A;  1QM9 A;  3OPK A;  4EI2 A;  3OUY A;  3TUJ C;  1EKS A;  2XSJ A;  2R7O A;  2EBG A;  2X1G A;  3C16 A;  4WKY A;  2LQJ A;  2WAQ D;  3T3F A;  1KBR A;  4PUO A;  4QIE A;  3UN2 A;  2OSR A;  2EPI A;  2H65 B;  2EFN A;  3ZTP A;  1YWX A;  4WZM A;  2KI2 A;  4CT9 A;  3NMA A;  3KYL A;  4AXJ A;  3MOJ B;  4RNM A;  4ILL A;  3CCJ S;  1T95 A;  1H0H B;  1CG2 A;  2W4P A;  1UVK A;  4MYU A;  1ARO P;  2WVF A;  1YBT A;  1U1K A;  1V3Z A;  1TQL A;  5B0A A;  1NK7 A;  2KHD A;  3W2V A;  4X65 J;  1U45 A;  4AD6 A;  1GK8 A;  4OI6 A;  3CMQ A;  3G82 B;  2EC0 A;  5E7O B;  1EAR A;  4ZVG A;  1CJV B;  4W4M A;  2WVE A;  3RB4 A;  4LBI A;  2HHH J;  4K0K F;  1ULR A;  2OLW A;  1S72 S;  2RIJ A;  2YWF A;  3DC2 A;  3GFY A;  3DU6 A;  5ETS A;  4ZVE A;  2PGC A;  1RI7 A;  1BXN A;  1IKY B;  5HVG A;  3HMJ G;  1BUX A;  1WHW A;  3SFG A;  2CZ4 A;  2P9E A;  3SMZ A;  3UVJ B;  1G7C B;  3OJU A;  3SV3 A;  2IA6 A;  1SQG A;  1X5P A;  2F40 A;  4P2S A;  1WKK A;  4OJG A;  2HS0 A;  3V6K A;  2MDA A;  3MPY A;  2ZH9 A;  3DMJ B;  3R27 A;  3DHW C;  3QQC D;  4MKB A;  4RWX A;  5KFN A;  2B3T B;  2HW3 A;  4B9T A;  4C11 B;  3SYZ A;  3RRK A;  3T5L A;  3AB4 B;  3G87 A;  3LP2 B;  2BJ7 A;  2HUR A;  2BJ3 A;  2JFD A;  3HX9 A;  4EZ9 A;  5D6G A;  5D3G A;  3UCG A;  3RR7 A;  1VRU B;  1VDH A;  3R6G B;  2BM0 A;  2G13 A;  4J9M A;  4M5I A;  3PYE A;  3I5B A;  4EO6 A;  3KG0 A;  5CYJ A;  2AJF E;  1NJZ A;  1URN A;  3FMW A;  4DFJ A;  2XMM A;  2HQD A;  3BM7 A;  1S6Q B;  4LF4 J;  1H98 A;  4LFB J;  2LVW A;  2RH3 A;  3BR9 A;  1Q5V A;  3UW1 A;  2GW8 A;  3KG1 A;  3H2V E;  3EZ5 A;  1J27 A;  1JLQ B;  2GNK A;  2Q79 A;  3D0I E;  3GSD A;  3KLE A;  2W9B A;  2A6M A;  1BQN A;  1U0H B;  1YLX A;  1Q8K A;  4WP9 A;  2LDY A;  4FF2 A;  2M2B A;  2OAU A;  2VQF F;  3M2U A;  3QID A;  1KKH A;  3EJM A;  1U1O A;  4BLG A;  1KD1 T;  4Y28 C;  1TKT A;  2MKK A;  4I56 A;  4JI2 F;  4BC7 A;  1U8W A;  1S48 A;  3HD1 A;  5DDQ C;  4E2F B;  1LK5 A;  3UNG C;  3M2V A;  3VGT A;  1FRM A;  3MCO A;  3CO9 A;  3DRR B;  3SEO A;  3CE8 A;  1SUQ A;  4IDK A;  3BR8 A;  2AYB A;  3CCQ S;  3MD3 A;  4DL7 A;  3CDB A;  2AEJ A;  6AT1 B;  3UCU P;  3UR0 A;  3H2U B;  3H4B A;  1Q8I A;  1JKH A;  4KQZ A;  4RWW A;  3BSC A;  2BE7 D;  2KG0 A;  3NLC A;  4B3S F;  3RYL A;  3CCM S;  3O2I A;  1XTZ A;  3MR2 A;  3KWM A;  4CIO A;  1LFP A;  3CCE S;  3US5 A;  4K0K J;  5J2M A;  4KGZ B;  2ALY B;  3K5P A;  3ISZ A;  3WIU A;  3NXZ A;  5D0R A;  3I55 S;  2DR5 A;  5C2G A;  1S57 A;  1PCA A;  1UVL A;  2XS2 A;  4QR0 A;  2ZH6 A;  2JZ5 A;  4EK2 A;  2MGZ A;  3C14 B;  2WW4 A;  3EE3 A;  1M1K T;  4CLU A;  3K5M A;  1UPP A;  2JC1 A;  1EZZ B;  1NPR A;  1JLA B;  5BXI A;  2CQI A;  1M5O C;  2K8G A;  5F9L A;  5IWA F;  4YR0 A;  4DPY A;  3T5H A;  1S79 A;  1YQH A;  3DDN A;  3IFE A;  1TFW A;  3MAQ A;  2D1C A;  2ZBC A;  1Q4R A;  3H5U A;  3GSI A;  1UFK A;  5F8J A;  2DO0 A;  4P73 A;  5FDL B;  5F8H A;  1SJF A;  3BF4 A;  4WP3 A;  3OR1 A;  2C3Y A;  4DV6 F;  4HYK A;  3H20 A;  5GVQ A;  3FZ2 A;  4F50 A;  4FDF A;  2J7W A;  2X7I A;  3TUZ C;  3KUG A;  1TUV A;  2FTR A;  3J7A N;  4ZIT A;  4RW8 A;  3C15 B;  4OHX A;  2JEJ A;  1JXE A;  4OV6 A;  1XIQ A;  3KHR A;  3AOA A;  1KC8 T;  2B4V A;  1X5O A;  4LF6 F;  4O3N A;  3SCL E;  4JBC A;  1QSY A;  3IWN C;  1L3K A;  4A8K A;  3BGF A;  3CCW A;  3LTO A;  2A0F B;  4USK A;  1TK5 A;  4ZS6 A;  5DLG A;  4H54 A;  1HD0 A;  1HQU B;  1RBL A;  1T9T A;  2YPZ A;  2XYG B;  4ECU A;  1VBX A;  4NA2 A;  4N47 A;  3ZTO A;  1VC6 A;  3FEZ A;  1R0A A;  2G0J A;  5L1K A;  1S97 A;  2VQF J;  3AT1 B;  1OWX A;  2BQR A;  4G1Q B;  2KZM A;  3HK2 A;  2BEF A;  4O0N A;  4AND A;  5B0B A;  1T7P A;  4DPO A;  1NAQ A;  1AA1 B;  3CDU A;  4F0H A;  3SSR A;  2E9T A;  2YPY A;  2CWK A;  2HRY A;  1MW7 A;  1VI7 A;  1O51 A;  3DRP A;  4E8U A;  4DI6 A;  2GVZ B;  2IC3 A;  2UVR A;  2ZDO A;  3N4W A;  2MLZ A;  2XMW A;  1NK9 A;  5I3Q A;  4ZP6 A;  3RAM A;  2JEI A;  1NSP A;  2IM2 A;  1SV5 A;  3MEE A;  1WNE A;  2KFN A;  2IBO A;  3A12 A;  3UN5 A;  3B78 A;  3DRY A;  1AW0 A;  5KFK A;  1KSP A;  3JQK A;  1HL6 A;  2DGQ A;  1S7I A;  4MFB A;  1R6Y A;  3G6Y A;  4XDD A;  1F2G A;  2FGC A;  1NDL A;  4C6A A;  2M88 A;  3AQO A;  1HWL A;  5CYM B;  1RA7 A;  2BE2 B;  3RAX A;  2ZBQ A;  2KL8 A;  4EBC A;  2WK4 A;  3ZZT A;  1NCL A;  2YNI B;  2RS8 A;  2AZ1 A;  1Z4U A;  5G0R B;  3VF0 B;  3EPI A;  1RZM A;  1CVJ A;  5C25 A;  5JXS A;  2C3U A;  1JLC B;  3DOK A;  1TP7 A;  3N6M A;  1QD1 A;  1EIY B;  1VQS A;  3TAM A;  3O1L A;  1NDK A;  1T05 B;  4KGV B;  5LMN F;  1SJ1 A;  2FJA B;  2QYG A;  2EVZ A;  3E51 A;  3IR7 B;  3VAG A;  2EXU A;  1M1G A;  3HZE A;  1JIH A;  2GIR A;  7FDR A;  4IFY B;  4O4R A;  2B4P A;  3UD5 A;  4FXV A;  5IV4 A;  3PY8 A;  1P6T A;  1RKI A;  4RZR A;  2F9J A;  4DV6 J;  3RJM B;  3ZTQ A;  2AD9 A;  1LWX A;  3PR5 B;  3QAT A;  4DXL A;  2KRR A;  3GYN A;  4HL9 A;  4MYT A;  2ASD A;  2Z58 B;  3TA2 A;  5K8O A;  1UWB A;  3M9M B;  4NRT A;  2XWY A;  3IXQ A;  2CQ2 A;  4I2Q B;  2XSF A;  1NHV A;  1SJQ A;  3P96 A;  1Y0H A;  1HNX J;  1UP1 A;  2FQQ B;  1IWA A;  2KKH A;  4LF6 J;  1IM4 A;  1HQE B;  1NKC A;  4ZLN A;  3I0S A;  5ETO A;  1S1X B;  4ZMM A;  3Q8P B;  1IQZ A;  1RAE B;  1C0U A;  1Y10 A;  3D68 A;  1U24 A;  2QLX A;  1C4C A;  1LKZ A;  2HQI A;  2VPW B;  2H5E A;  3W5Y A;  1T9Y A;  5DDP C;  4OYB A;  4Q7A A;  2B56 A;  4O3S A;  1VC0 A;  3M2R A;  2ILY A;  1CS4 B;  3Q22 A;  1TL1 B;  1SIZ A;  1SI9 A;  4YR2 A;  1D9A A;  2VBW A;  1H74 A;  1XR5 A;  3PDN A;  4DR2 F;  4WTY A;  5IQ6 A;  1Y3J A;  3QIP B;  3FGV A;  4U96 A;  3K17 A;  2KN4 A;  2OEM A;  1RT4 B;  2KT5 A;  4KV8 A;  1FFS B;  5K9F A;  5HP1 B;  4EBE A;  3ILJ A;  4TKT A;  2KFZ A;  3K57 A;  5A0Y B;  3DLK B;  2JLF A;  3K59 A;  1WC5 A;  2VON A;  3V4I A;  3Q8V A;  5KFV A;  1KN6 A;  2GS8 A;  4DMZ A;  3MMC A;  1VJQ A;  2G2Z A;  2K7J A;  2RHQ B;  4WII A;  4ANE A;  2ZVS A;  2GGP B;  5HQL A;  2QA2 A;  1Q1K A;  2LEC A;  4QWA A;  3TNV A;  4CLL A;  4QWD A;  2PA8 D;  2K3I A;  2CJX B;  3OXL A;  1SBR A;  1K73 T;  5KFC A;  2F8E X;  4C3L A;  2L9N A;  4M94 A;  2O3D A;  4HTI A;  1UEV A;  4ZK7 M;  5GMD A;  1HBM B;  1CSJ A;  2N4D A;  2NS1 B;  1WOS A;  4PWD B;  2HFN A;  3NAI A;  2PII A;  4QIG A;  1V3S A;  1QAI A;  2GQ2 A;  5DG9 A;  2M0G B;  4B9S A;  3GMG A;  1EX8 A;  2QA4 S;  1MWZ A;  3HF5 A;  3QWU A;  1L3S A;  2YKA A;  1JWW A;  2OPP B;  1Q8L A;  1KEK A;  1PGZ A;  4PR6 A;  2Q6B A;  4CO0 A;  4XAK A;  3Q24 A;  2HEK A;  3KUH A;  5LMN J;  1HHT P;  2VA3 A;  4JV5 F;  3IG1 A;  3B4D A;  4PCQ A;  3TAP A;  1QUV A;  2GA7 A;  4DV5 F;  2XHC A;  3G8Q A;  3NCQ A;  1GMV A;  1T11 A;  1NH7 A;  2J7U A;  4JI6 J;  4M8L A;  2O01 C;  3DU5 A;  2UU9 F;  3K7R A;  4PQA A;  4LVO P;  3DGP B;  1GEH A;  2EKN A;  3R8Y A;  4GO7 X;  4BC9 A;  2XC9 A;  1UJ6 A;  4MTP A;  2QA4 G;  1OY9 A;  1YRX A;  4F2S A;  1NDP A;  2OMO A;  4M5L A;  2XY5 A;  5L9X A;  1NK0 A;  3L7O A;  2OTJ S;  3LP1 A;  3P5T L;  4TY8 A;  4F36 A;  1FES A;  1O5J A;  4I6Y A;  5A8R A;  4QOT A;  5GAH U;  4OYX A;  4USV A;  2EC2 A;  4FYY B;  3MM5 A;  3UDV A;  1PJ5 A;  3MEC A;  2DNH A;  2PFF B;  1LW2 B;  1KVK A;  3HLU A;  3MCM A;  1UVM A;  2JJ4 D;  3AFG A;  4F8R A;  2VG7 A;  2HS4 A;  3H8Y A;  3ZZZ A;  4OL8 A;  1RT7 B;  3M1V B;  2IVM A;  3J81 Y;  3W61 A;  2AQ4 A;  2O5D A;  4WIQ A;  1UVI A;  1UZD A;  1HBN B;  4N56 A;  1FKO A;  3R5G A;  2HIQ A;  2H4Y B;  2KU7 A;  1SB6 A;  3GTY X;  4DR2 J;  5E3C A;  1N32 F;  4M5D A;  5LSR A;  3GYG A;  2ASY A;  2X1F A;  5DLF A;  2RF2 A;  2MZS A;  3QO9 A;  1OYD A;  1H7W A;  1GTH A;  1CJU A;  3MUV P;  2B6A A;  2M5Y A;  5B08 A;  3CXC R;  3KHL A;  4UST A;  4ES3 A;  4TQR A;  4WTO B;  1D1U A;  2G0I A;  3T1H F;  3PIO Q;  3L9Z A;  4ILR A;  4ICL B;  4Q43 A;  2CNO B;  4USI A;  2DB1 A;  4KHP F;  4IG0 B;  4C0B A;  3GP9 A;  4F7V A;  3BQ0 A;  2LXF A;  4MMO A;  5L1I A;  4H4M A;  4N76 A;  3T41 A;  3DLG B;  3R1L A;  2K1R B;  3DOM B;  3ET6 A;  3W1Y C;  4KIA A;  4N8O A;  1R3N A;  3EYZ A;  3OL7 A;  5ETR A;  3ZZ0 A;  1KQS R;  2HMI B;  2G2Y A;  4ZVU B;  1TAQ A;  3THV A;  3BGR A;  3QT8 A;  3LP0 A;  3T9N A;  2SXL A;  2R7W A;  3BYP A;  4DG1 B;  2V34 A;  2E1C A;  3FSY A;  3GII A;  1S6O A;  1VQN S;  2UUW A;  1AXQ A;  1JNR B;  1T02 A;  2NXU A;  2M8H A;  4W90 B;  2BRK A;  4C9D A;  2CAJ A;  4XIU A;  3FRY A;  2DYA A;  4QWE A;  2IIH A;  3QT7 A;  1R8P A;  4KKO B;  3PX4 A;  1KQF B;  5C24 B;  4YN3 B;  1YKW A;  3OL8 A;  3MGJ A;  3SZ2 A;  4DV5 J;  2E5J A;  4H4O A;  3CJK A;  1U7L A;  2AJ0 A;  3JS9 A;  2IVY A;  3L09 A;  2C28 A;  4Q0B B;  3QGP A;  2UU9 J;  3GIR A;  2W2M P;  3TAR A;  1H38 A;  3A8K A;  5IS2 A;  2F8H A;  1GT8 A;  4B9N A;  4ZN1 A;  4YB7 A;  1KLM A;  3PYF A;  4F2R A;  3FKB A;  1SJ3 P;  4W98 A;  1RAJ A;  1RLC L;  4B9L A;  1F6T A;  4ES1 A;  1CQN A;  3KJQ B;  2FC8 A;  3MM6 B;  2NXC A;  4CLT A;  1VJW A;  1U2F A;  2LDI A;  2WOM B;  3M30 A;  4ANC A;  3V6J A;  2HND A;  3PO4 A;  2XMK A;  3RBZ A;  2HBQ B;  2AX1 A;  4URS A;  4GVL A;  5F0W A;  3KLF A;  1KQK A;  1XK8 A;  4RX6 A;  4FKX A;  1V9O A;  4IG3 B;  4YDD B;  4L74 A;  5I42 A;  1V5V A;  4ED1 A;  5CXT A;  4ZVO B;  4PG6 A;  4DFK A;  3TR5 A;  3FBC A;  1D8Z A;  2B4O A;  3QT6 A;  4ERD A;  3QSI A;  2DIU A;  2AYG A;  3S6E A;  1RHK B;  4KBI A;  1YIJ S;  1URR A;  5KG4 A;  2MJN A;  3GIL A;  4ZPB A;  1HMV A;  2PEB A;  3OUY B;  1N54 B;  1ICE B;  2XSJ B;  3FK4 A;  2ZH3 A;  1H2V Z;  3W65 A;  3TZX A;  4DFM A;  1R0C B;  2IDE A;  3C16 B;  2AP6 A;  4V1A k;  5AXL A;  3KFW X;  4LF8 F;  1OIA A;  3O5T B;  2MQQ A;  5I3P A;  1H6K X;  4PUO B;  2DNG A;  4BDP A;  2IA0 A;  4QZV B;  1N32 J;  3E3X A;  1KTV A;  4Y2M A;  1HA1 A;  3G9C A;  4ZCI A;  4N7T A;  1BE4 A;  2CJB A;  1FK9 A;  1IBM J;  1RHJ B;  1R27 B;  3OLA A;  1SQF A;  2G0C A;  4JI8 F;  2CZ9 A;  3ZFV A;  1M5V C;  3G71 S;  4HLB A;  2VG5 A;  3PCO B;  4UUW A;  4E98 A;  3TP2 A;  1JB0 C;  3EDQ B;  1S9E B;  3DLH A;  5ETQ A;  2ZIT A;  3J7Y U;  4OLO A;  1TL4 A;  5BJR A;  4KHP J;  2MXY A;  3BJY A;  4RO0 A;  3WX8 A;  2RSQ A;  1IN0 A;  3W9H A;  1I51 B;  1S1W A;  4FYW B;  1ELO A;  4ED5 A;  1T9W A;  1VQM S;  1PKU A;  4NOH A;  4P72 A;  3VHQ A;  5AT1 B;  4ED8 A;  3R7S B;  2RVJ A;  4LBP A;  4NLV A;  2W01 A;  5AXK A;  1RAO A;  3HHL A;  2HHT A;  2I38 A;  3FBB A;  1RT1 A;  2IRX A;  1NLK L;  2DY9 A;  2H48 B;  5IC6 B;  2HG4 A;  1RTJ A;  1OY6 A;  2EKY A;  3IR6 B;  2IY5 B;  2ZC4 A;  5F9N A;  4Y34 A;  3G6E S;  1ZPW X;  4QYR A;  1T03 A;  2AYE A;  2P9G A;  1TKX A;  2KT2 A;  4E0D A;  3Q0A A;  1IKV A;  4RUH A;  5D3G B;  5GAE U;  4DLE A;  1B99 A;  4PPZ A;  3GU0 A;  2R9L A;  4RW7 B;  3K5N A;  1U1R A;  4FBU A;  4NYP A;  1RT6 B;  2B9X A;  3POT A;  2BOA A;  1RAI B;  1JLG A;  5LXR A;  2W2P P;  4TU8 A;  3BN4 A;  4OHV A;  2CFX A;  2RU9 A;  5AXM A;  4OJ3 A;  3D28 A;  4K5S A;  5H9E J;  5KG3 A;  2CPZ A;  4PXD A;  2AEF A;  1LQ9 A;  2W9C A;  4X62 F;  1WF1 A;  1CUL A;  2OPR A;  3PYG A;  2CPI A;  3SCJ E;  4W92 B;  4DL4 A;  4LR9 A;  1K9M T;  1P9Q C;  5LMU F;  2W9B B;  4NLO A;  3DXS X;  3VAF A;  3DYA A;  1BQN B;  5HVH A;  3C19 A;  4HI2 A;  2XNR A;  5EX3 A;  2CNK B;  3M2U B;  2CJY B;  2QL7 B;  2M52 A;  2V67 A;  2DH9 A;  1DY3 A;  4MAK A;  1TKT B;  4DUY F;  1Y7P A;  4OI3 A;  1WI6 A;  4X4N A;  4EEY A;  4WU2 A;  3JSB A;  5ETM A;  3M2V B;  2GX8 A;  4CDI A;  3HKW A;  2DNQ A;  1Y5I B;  2XTJ P;  4ZPD A;  1SUQ B;  1AUS L;  2PD1 A;  3QRP A;  4IDK B;  4JI8 J;  3MXH P;  1AZS A;  3LA0 A;  2YKO A;  4O3O A;  2KH9 A;  4PZV A;  3GR0 A;  4OYZ A;  2VPY B;  1N52 B;  1MML A;  1FJC A;  4WU3 A;  1WEZ A;  4LF7 J;  3QAU A;  2ZH2 A;  2V4J A;  1NND A;  1VRT B;  1AFJ A;  3KDO A;  4H4K A;  1G1X A;  3L7U A;  4K4W A;  3QNW B;  3VZI A;  4P75 A;  3M6V A;  5J2M B;  3H0P A;  4P6Q A;  3IA0 A;  5BR8 F;  3ILO A;  2R2R A;  1OO0 B;  1VOM A;  3TO8 A;  2VOD A;  4K4Z A;  2HVH A;  1KON A;  4ZA1 A;  5JUM A;  1NU4 A;  1VQK S;  2YH0 A;  2AW0 A;  1WHX A;  5KFE A;  2HVZ A;  3IR5 B;  3MEG A;  3IWL A;  2BJ9 A;  1R8B A;  4JV1 A;  2VL1 A;  2VA2 A;  4J7C A;  4R0J A;  1VQ5 S;  1JJC B;  5GAD I;  2Z8Q A;  3MR3 A;  3HPO A;  4YB1 P;  4B3R J;  4HKQ A;  4C0O C;  3MAH A;  2GCF A;  1X5T A;  2E44 A;  4ECZ A;  4NYO A;  3OR1 B;  1S1U B;  4U95 A;  2PSZ A;  3JTP A;  4IUF A;  2RRN A;  3FFI A;  2QLB B;  3TYT A;  4EYI B;  1SH3 A;  2BJD A;  2BJE A;  2YKN A;  1RAC B;  4ELT A;  1HNW F;  2YWK A;  3DLB A;  2MKY A;  4RW8 B;  4ALZ A;  1FER A;  2WCX A;  2ABY A;  1IBL F;  1CEZ A;  2GO8 A;  4WBF A;  4C8Z A;  3RB6 A;  4O3R A;  4X62 J;  5F8L A;  2MKH A;  1N5V A;  1VIO A;  3DLL Q;  4CLS A;  1ZTW A;  1DZ5 A;  1YDL A;  1P8G A;  5KT7 A;  5LMU J;  1LOU A;  3ETO A;  4LR8 A;  1R43 A;  4B3T J;  4BBY A;  3BO3 A;  4DX6 A;  2JNJ A;  3EZU A;  3C6T B;  3D2W A;  3OVA A;  1R0A B;  2ROG A;  1FE0 A;  5DZ7 A;  3MUR P;  3ENV A;  2Z2Z A;  1REG X;  4LMZ A;  5KTQ A;  4DUY J;  1O8B A;  1LNQ A;  4K4X A;  5ETN A;  3CUN A;  2R7T A;  4U7U K;  4ILM A;  4DPW A;  1PIE A;  2MST A;  2BV3 A;  4ZP8 A;  3PYD A;  4GRS A;  4MKY A;  2DGO A;  2IC3 B;  4K59 A;  2C3P A;  2VFR A;  3GV5 B;  1X4E A;  1XMQ F;  1FNO A;  1KP6 A;  4DR3 F;  1SV5 B;  3MEE B;  4DSE A;  3EXC X;  3AA8 A;  4CO5 A;  1I1G A;  3OTO F;  4DV3 F;  3TQE A;  1D09 B;  4UW2 A;  5E3Q A;  4MFB B;  2HS3 A;  2VJV A;  1NJW A;  2QE5 A;  3AH6 A;  2FLN A;  2DXE A;  1Q82 T;  4MIW A;  4I7F A;  2RRB A;  4QJV A;  4PQU A;  1IKX A;  3ISN D;  1BQM A;  3HP6 A;  2AJ4 A;  2LXU A;  2F4V F;  1RHR B;  2FLP A;  1KFS A;  1VK8 A;  1DTT A;  1HNI A;  4ID5 A;  2AEM A;  5D4L A;  2NXJ A;  4ZDN A;  4RNO A;  1WEX A;  5U47 A;  3HCX A;  5C25 B;  1SQE A;  3OVS A;  3DOK B;  4G3I A;  3FRZ A;  1FWL A;  2RNE A;  2VAS A;  1NM2 A;  3TAM B;  1VQ6 S;  2DNN A;  4DPX A;  4OYM A;  5KFS A;  4OHY A;  3Q83 A;  3QGH A;  2U2F A;  1KLN A;  1PC4 A;  2RDI A;  1M90 T;  2L9W A;  1YZ6 A;  2QO3 A;  1C1C A;  3TJ8 A;  2LLZ A;  2PT0 A;  3I82 A;  3MFH A;  1RKJ A;  2GHV C;  2HLU A;  4C8M A;  2CQP A;  2WTF A;  1BWE A;  1RJJ A;  1HW8 A;  2XMV A;  4KAI A;  4UOC A;  5HMW A;  3BPS P;  1ZM2 A;  1C1B A;  1DLO A;  2KZZ A;  3OFG A;  3IS9 A;  4ECT A;  1WEY A;  1W7W A;  4F25 A;  2KRB A;  2APO A;  1KTQ A;  3V6D A;  4R25 A;  1UWB B;  4ZCK A;  4ECX A;  4CYU A;  5D15 A;  1IBL J;  2DNP A;  5EWF A;  4J9V A;  4KSE B;  2V5H G;  2MYF A;  1OJ4 A;  2VKZ G;  1B64 A;  2HBY B;  4ECS A;  1C0U B;  2RQ4 A;  2XO6 A;  4C8L A;  4OYW A;  1UVN A;  3W9I A;  2RKI A;  1IBK F;  4WWS A;  4KYZ A;  3RBX A;  2A2D A;  3M2R B;  3QAE A;  1IXK A;  3W2W A;  5SZT A;  2X51 A;  2E7W A;  4KPC A;  5M2U A;  1WHY A;  5KFG A;  3A3O B;  3QGI A;  2DGU A;  2DH7 A;  3GON A;  3DN9 A;  4AL6 A;  1NJY A;  3LPY A;  3VV2 B;  2DCL A;  1MNE A;  2H3E B;  2LXI A;  3LUY A;  2C1E B;  3FEY B;  1FF2 A;  3KHG A;  4WYW A;  5T7L A;  4QU7 A;  3UR3 C;  5KFA A;  4CLW A;  1BQX A;  3Q8S B;  1DTQ A;  4ZLJ A;  4GKK F;  3MMC B;  1OSC A;  3LF0 A;  1Q7L B;  1TMM A;  1YJR A;  2Z4P A;  3ZC4 A;  4RW9 A;  4WFB Q;  3TUP A;  4DV3 J;  4KR0 B;  2UUC F;  3MPV A;  1N33 J;  1Y11 A;  5KT2 A;  1QLN A;  3R9L A;  4D3H A;  1F0X A;  1Q7Y T;  2HHU A;  5CA5 A;  3OL9 A;  3HHL C;  1HYS A;  1S77 D;  2RQM A;  2Z30 B;  2VFT A;  2KYZ A;  2C2Z B;  3PAC A;  1U6F A;  1LXN A;  3HM9 A;  4Y2K A;  1SVD A;  2AF6 A;  1HW9 A;  1TMJ A;  2XZD B;  2R7V A;  1KRP A;  1VLO A;  5CYQ A;  4USU A;  3NMR A;  2ASL A;  2MMY A;  4P52 A;  2FVC A;  2AKW B;  2KVQ E;  2HSE B;  3IRX B;  4TLR A;  3LGM A;  5J1E A;  4DSI A;  1WC4 A;  4ZHR A;  3VCD A;  4HHU A;  2I2Y A;  2J8A A;  3AJ2 A;  1K0T A;  3WX4 A;  2HNY A;  2C2N A;  4N41 A;  2Y8W A;  3GFX A;  1MSW D;  4KHR A;  3QFH A;  1JJ2 R;  4EYH B;  4YME A;  2IPO B;  3R5A A;  1Q79 A;  1QY7 A;  2BW2 A;  4NLT A;  2QV6 A;  3CD6 S;  4GKJ F;  1T9V A;  3JQJ A;  1QUP A;  3LP1 B;  4LT6 A;  1X0F A;  3UD4 P;  3MEK A;  3CGI A;  2VJU A;  1YIT S;  4IQM A;  2LEA A;  3OJS A;  1F3V A;  3LOU A;  1CJT A;  2OGU A;  2D9O A;  3TVK A;  5A8R B;  5ETT A;  3VWS A;  1IUJ A;  4DQQ A;  3MM5 B;  1HBO A;  1FDB A;  1NB2 A;  1UKU A;  3RU0 A;  3H2L A;  1UJ4 A;  4BS2 A;  1BLU A;  2MPU A;  4OX9 J;  3DM2 A;  7AT1 B;  3KG4 A;  4IOC Q;  2ZH1 A;  3H25 A;  3UN3 A;  2CDQ A;  2VG7 B;  3H90 A;  1PSD A;  4CI0 B;  2DNR A;  2R42 A;  2VU5 A;  3QLH A;  1W2B R;  3R97 A;  1IBK J;  1GNK A;  3HSG A;  4GVB A;  1FKO B;  2R7R A;  3K5L A;  2Q6C A;  3KXD A;  4J9K A;  4M95 A;  2ZH5 A;  4M5D B;  5L1L A;  4L75 A;  1WG1 A;  1JJH A;  2RF2 B;  3VZH A;  2GQQ A;  3QO9 B;  5HSP A;  2Z2M A;  3CCT A;  1TAU A;  2XCP A;  3UDC A;  5DG8 A;  1CJU B;  4M5M A;  2B6A B;  4JI1 F;  1YI2 S;  1CPZ A;  3W64 A;  2DXF A;  4TYB A;  2XI3 A;  3RBD A;  1RU1 A;  3IRW P;  1GXT A;  4GKK J;  2V8D A;  4JYA J;  3MAA A;  5KFQ A;  2B8Q A;  2J0X A;  3MCS A;  5HO4 A;  2B51 A;  4WK1 A;  3QGG A;  2OUG A;  3W8G A;  3ZZO A;  1WJ9 A;  3P4U B;  5KT3 A;  3CJ8 A;  3JSM A;  3O3L A;  4A8Y A;  4CTA A;  4X4O A;  1YK9 A;  2XYH B;  4N77 A;  4H4K C;  2QC3 A;  1FVS A;  3ET6 B;  3F41 A;  2UUC J;  2VG6 A;  3R5B A;  2R8H A;  3MZI A;  1WTB A;  1Z2Z A;  2NPF A;  3LWL A;  3EM1 A;  3M8Y A;  3HVR A;  2DR7 A;  3LP0 B;  3ADA C;  2E7X A;  2GJ2 A;  3VQS A;  1OY8 A;  4RUB A;  4OZ1 A;  3BSO A;  1BGX T;  1NZ8 A;  4K2J A;  2DIT A;  1TFY A;  1N56 A;  3H4D A;  2HK2 A;  1D3W A;  2WVC A;  1HWJ A;  2JOQ A;  1RWW B;  2V8G A;  1N5S A;  2IJN A;  1E6Y A;  3P5B P;  3M9O B;  5EDW A;  1MU2 A;  1RTH A;  4HHJ A;  1F2H A;  1FDA A;  2W8K A;  1LFW A;  4YS2 A;  1IJE B;  2JLE A;  1NSK L;  2J6S A;  2F9D A;  2I1R A;  1UPM B;  4H4O B;  3CJK B;  1NH8 A;  4KB7 A;  4UZB A;  1YVF A;  4OHW A;  4ZJQ A;  1K44 A;  1KVI A;  4DS4 A;  1B0T A;  4J9U E;  3RUB L;  2ZD1 A;  1YJN S;  1FJG F;  3LGN A;  1N5Q A;  2BX6 A;  3DNC A;  3KLI A;  2C3M A;  4NZ6 A;  4F02 A;  4X4P A;  2C2M B;  2BQU A;  3GG1 A;  1KLM B;  4LBH A;  4F4K A;  3KJF B;  1I94 F;  5J2P A;  1M5K C;  4GKJ J;  2RJZ A;  2MLX A;  3VTI A;  3EGN A;  4B3O A;  2MHE A; 
#chains in the Genus database with same CATH homology
 1WKL A;  2DYA A;  3FBE A;  3FC9 A;  3EVM A;  5IOL A;  4UOG A;  3NGU A;  1PKU A;  2HVE A;  3EVO A;  1NDK A;  2CWK A;  1NDP A;  3ZTS A;  1WKK A;  3NGT A;  2HVD A;  3FBF A;  1BHN A;  5C7P A;  3VGV A;  2DXD A;  4CP5 A;  3VGS A;  1UCN A;  1NSQ A;  1S5Z A;  4DI6 A;  1HHQ A;  3EVW A;  4F36 A;  4ENO A;  3FBB A;  3BBF A;  3MPD A;  3ZTP A;  3FCW A;  1EHW A;  3Q8U A;  1B4S A;  3JS9 A;  1NLK L;  2DY9 A;  1HLW A;  3VVT A;  4F4A A;  1NSP A;  3BBB A;  3PRV A;  4S0M A;  4DUT A;  1NPK A;  1XIQ A;  3NGS A;  3ZTR A;  3GP9 A;  3VGU A;  3R9L A;  3Q83 A;  1S57 A;  2DXF A;  2HUR A;  3ELH A;  1LEO A;  3EJM A;  3ENA A;  4EK2 A;  1NUE A;  1NSK L;  3ETM A;  3EE3 A;  1S59 A;  3L7U A;  1VYA A;  3DDI A;  3Q8Y A;  3ZTQ A;  1BE4 A;  2B8Q A;  1LWX A;  3BH7 B;  3BH6 B;  2AZ3 A;  3FKB A;  4DZ6 A;  5CAA A;  3EMT A;  1NDL A;  1ZS6 A;  4KPC A;  4W98 A;  1U8W A;  2NCK L;  4C6A A;  5BXI A;  1K44 A;  3FCV A;  1F6T A;  3VVU A;  1F3F A;  3G2X A;  1JXV A;  4WBF A;  4FKY A;  3B6B A;  3DKD A;  1NB2 A;  2BX6 A;  2ZUA A;  1NDC A;  4ANC A;  3VGT A;  3Q8V A;  1HIY A;  4HR2 A;  4UOF A;  3B54 A;  5CAB A;  1MN9 A;  1XQI A;  3Q89 A;  2DXE A;  1WKJ A;  3ZTO A;  1KDN A;  1NCL A;  1B99 A;  4FKX A;  3GPA A;  3EIC A;  1NHK L;  1MN7 A;  1PAE X;  1BUX A;  2AZ1 A;  3NGR A;  3EM1 A;  1W7W A;  4ANE A;  3WX8 A;  3PJ9 A;  2VU5 A;  2BEF A;  3BBC A;  3FBC A;  4O0N A;  4AND A;  4UOH A;  3Q86 A;  2B8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...