3NGUA

Structure of leishmania ndkb complexed with adp.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIASWTSHSVSQIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular adaptability of nucleoside diphosphate kinase b from trypanosomatid parasites: stability, oligomerization and structural determinants of nucleotide binding.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 44
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2010-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3nguA00
3BH6B 1HIYA 2DXEA 1KDNA 1U8WA 3ZTRA 3EJMA 4S0MA 3EVWA 3ELHA 3DDIA 5BXIA 1B4SA 4O0NA 1NB2A 3EE3A 3VGTA 1MN7A 3ZTOA 3FCWA 2HVEA 1NSPA 4DI6A 4FKYA 3BBBA 3Q83A 4ANEA 3PRVA 5CAAA 3L7UA 1NDCA 2BEFA 4ANDA 3VVTA 4ENOA 2DY9A 1K44A 1S59A 4EK2A 3EMTA 1WKJA 3BBFA 1W7WA 3EVOA 3Q86A 4CP5A 3ENAA 3ZTPA 3FBEA 3B6BA 5C7PA 5CABA 1VYAA 3EVMA 1NSKL 2NCKL 4DUTA 3MPDA 3R9LA 1NCLA 1NDLA 3DKDA 2VU5A 1BUXA 1JXVA 3VGVA 1BHNA 3FBCA 3GPAA 3NGUA 1B99A 1NPKA 3FBBA 1NUEA 4W98A 1LEOA 1S57A 4F36A 2CWKA 3NGSA 4DZ6A 4WBFA 1LWXA 3FBFA 3EM1A 2DXDA 1PAEX 2AZ3A 1HLWA 2B8PA 3VGUA 4UOGA 3FCVA 3Q8YA 1HHQA 3WX8A 1ZS6A 2DYAA 3BBCA 3BH7B 2AZ1A 1NLKL 3GP9A 3ZTQA 1UCNA 2HVDA 3VVUA 2ZUAA 3ZTSA 3PJ9A 1PKUA 3Q8VA 4ANCA 1NDKA 4C6AA 2HURA 1F6TA 1EHWA 3JS9A 4KPCA 2DXFA 4UOHA 3B54A 1NSQA 1WKLA 4FKXA 4UOFA 3NGRA 3Q8UA 3ETMA 1MN9A 3FC9A 4HR2A 1BE4A 1XIQA 1F3FA 3NGTA 5IOLA 4F4AA 3VGSA 2B8QA 3Q89A 1XQIA 1NDPA 3G2XA 1WKKA 2BX6A 3EICA 3FKBA 1NHKL 1S5ZA
chains in the Genus database with same CATH superfamily
4QIWD 2B0GA 4J9MA 3OBIA 4DL2A 2NQPA 1HI1A 3I5CA 2DNLA 4NI2B 4HTJA 1NK6A 1UJ4A 1U0HA 2QG9B 1S9EA 2E7XA 2YWGA 4URSA 1MU2B 2CPHA 4ZK7M 4A8KA 2HVIA 2OSQA 4ZVUB 1KKHA 1TUWA 2HZCA 4TKTA 4ZVRB 3D4JA 3M4XA 3PYGA 7FD1A 1T03A 3A1YG 3PKYA 1FKPA 1GAOA 5DO2A 1KQFB 3G4SS 3PHEA 4HHUA 3TUPA 1N8RT 2ZM6J 1YWXA 4TN2A 4JV1A 5E0OA 1XC9A 1MN7A 2VDHA 4X65F 3AD9C 3HHDA 4C0HA 1NSPA 3AQPA 2QLXA 3R7NB 3SCIE 3D7SB 1RABB 4WFZA 3SSSA 2FHJD 2IJRA 3UNYA 5CAAA 2BJ1A 3PEJA 3V81B 3L7OA 2GO9A 4Y6IA 3UVJA 2J7KA 2M88A 4CM2A 4AQYF 1M5VC 3FMWA 4GVBB 3OR1B 4B9LA 1RTDA 1B7FA 3V6KA 3CDWA 5D4OA 4F4XA 1RWPB 2LLZA 3NEKA 1WACA 1IKWB 2I1RA 2E1CA 1S1TA 4ALZA 5D0RA 1S49A 2KT3A 2LQ8A 4M95A 2QLFB 2LQ5A 1WC0A 1Z4UA 3H2LA 1RT7A 4PEOA 4XAKA 4ZVOB 3MAAA 3VV2B 3EPIA 3GYNA 3G71S 3U1NA 2F4VF 5C42A 4ZHRA 4HVZA 1HD1A 1HBNB 2WOMA 2RF2B 4Q2LA 4F25A 4EZ6A 1SCJB 1UZHA 1DARA 3FRYA 4J9UE 4OHXA 4JV0A 3VALA 4X2BA 4NLDA 1SQFA 3L4BC 1R8PA 1W2BR 2D69A 2XB2D 1DBDA 5KG5A 1NDLA 2C2OB 5T41A 3QT7A 1IM4A 2HAIA 2LVWA 1KVKA 2BABA 2J0WA 1CULA 3VGVA 1NEEA 3I31A 5L9XA 3AOCA 5K9FA 5L9NA 1J5OA 4DWIA 3KLGB 1WOSA 1T05B 1TAUA 3RB6A 4R8UA 3F0NA 1WG1A 2QO3A 4N47A 2CWKA 1JJ2R 3K5PA 3GIKA 4NRTA 2BUNA 1RT1A 3EWGA 3SV4A 2UXCJ 2BBEA 3J7AN 3MZIA 1PAEX 3FZ2A 3LP2A 4TQSA 3CO0P 2HIYA 3M8RA 2YKPA 4FF4A 1VOMA 3AH6A 3KDOA 3FCVA 5HBMB 4WKYA 5DRKA 3BBCA 1VK8A 4M5DA 5CYMA 5C24B 1V3ZA 4OI0A 2R8JA 2VA2A 5KFTA 3KJVA 2JEIA 3I0SB 3MOJB 2DRBA 2IRYA 3PJ9A 4X84A 1CVJA 2VG7A 3OTOJ 3K58A 1C1CB 5L46A 2V63A 1FE0A 3H5YA 5LMNF 2UVRA 5MAOA 4DFJA 3C6UA 1QE1B 1RZMA 1JKHB 4OZ1A 2AF6A 3OVBA 4FKXA 4TQRA 4MIWA 3MEDB 1EB0A 1NRKA 5GAEI 1RE1B 1T02A 2EBEA 3H20A 2QV6A 4X66J 1UWBB 5DLGA 4HT5A 1FHTA 5GVQA 4H4MB 5KT2A 3KK2A 5DG7A 2FJWA 4Q44A 2POKA 5DZ7A 4F3MA 2C22A 3V6HA 2BKNA 4ECSA 4WZQA 5B08A 1WNEA 3MECA 3CJ2A 1UWAA 4XO0A 2QLJB 4CO5A 3KKFA 1FVSA 4MYTA 1JJ4A 3KK3A 2F3JA 2YWWA 3BQ2A 3QQCD 4C3KA 1R6YA 2W7PA 5JVGQ 5GAGU 2DKOB 2BYCA 4U9RA 4QIGA 3ZTRA 4NLVA 1RBOB 2OD6A 2XHWA 1KQGB 4KPYA 1EQMA 5JVHQ 1D8YA 2MYFA 2IPOB 2D7SA 1WORA 4DX6A 1XTZA 1FA0A 4NLTA 4NLWA 1RWXB 1ZPWX 4JI3F 3IS9B 4JYAF 3L7PA 2F9JA 5LL6d 2ROPA 1F9HA 2RNEA 4J90A 1XEZA 1WC5A 3ISNC 5A0YA 1YX2A 2RMLA 2R4FA 5CCMA 1VQ8S 2V2VA 3HPOA 4FF2A 2NXCA 3ISND 1GTHA 3HVRA 3DXBA 4J9SA 4DR7F 1GXTA 3HD1A 2MKJA 3BPSP 1RHUB 3HSDA 3KUHA 3FNNA 4OX8A 2W9AA 4CYUA 5F3TA 2CQBA 3J7Z5 3KLFA 1T3NA 5I4MA 4KTQA 4FF3A 3JTOA 4HEA9 1DAXA 4OZ3A 2MKKA 3ISZA 3TUIC 2D3OR 5K8NA 2CG8A 4CO4A 2HK2A 3EVOA 5K8MA 3N5FA 3DMJA 1N32F 2CVEA 3BPDA 3M8PB 1IBLF 2PI5A 1FXRA 1RWNB 2LQJA 3IWXA 1IM6A 1SH3A 3EZ5A 1WG5A 4MK9A 4HH1A 5HANA 2W24A 3FBEA 2L3MA 2WRMA 3GB0A 5CYMB 5F0UA 4K59A 4X62F 3H8YA 3Q0AA 1TKDA 2BE7D 4AE5A 5CABA 3RB0A 1DLOB 1RT4A 5CZVA 3K89A 1HA1A 1L3KA 3EVMA 3MCOA 4YR2A 2RQMA 4NMXA 5IV4A 1IBLJ 2DNMA 1TKZA 3GG1A 3S7RA 1T95A 2NUUG 1NHVA 3GIMA 3RBEA 2G13A 2XY5A 2IM1A 1TK8A 1U4BA 4LF2A 3JTNA 1IUJA 2J76E 2AX1A 1RTJB 3QSIA 2GHPA 3GU0A 3JQJA 4W98A 1JB0C 3I56S 1YRXA 4JI5J 3KK1A 1WTFA 1QLNA 1ITPA 2YH0A 4R0JA 3OSPA 1QY7A 1XJWB 2COLA 2MKHA 4QWBA 1E6VA 1MWQA 4OQJA 5CD4A 2IA0A 4O3OA 2HRYA 3EM1A 2DXDA 2FQQB 5GAGI 1ZH5A 2NS1B 4HKQA 4JB8B 4MKAA 4F0KA 4OHVA 2DB1A 2RF2A 2QGFB 1HHQA 4DL3A 1Q7YT 1BC6A 1SJQA 3BSOA 1REVB 1SKRA 2CXEA 4HDHA 2YQ1A 3UDVA 4CZCA 2R8HA 4ECWA 1IKXB 1S79A 2C2EA 4LQ3A 4IDKA 4QU6A 1NK5A 1SUQA 1NHUA 1A9NB 3GR0A 1IQTA 4PQAA 1U1RA 5GAEU 2KKHA 1LQ9A 4HACA 4M5GA 5E3RA 1F3VA 3IGVA 2YQ3A 1CQNA 3KLEA 3GWCA 2GQ2A 1RKIA 1JJHA 2YXLA 1J27A 2H54B 3OD2A 4IH5A 4KV8B 3ETMA 4QU7A 1P6TA 4V1Ak 2AKWB 4CNYA 2FZCB 3L3CA 3GFXA 3SI8A 3VAHA 4RL1A 1FK9B 4IO1A 4CO0A 2NXJA 2UV8A 4J7CA 4CO1A 4X66F 3D66A 1HNZJ 4ZIWA 3SEOA 3CULA 1IVZA 1Q5YA 3L9ZA 3W9IA 1CJKB 2FYXA 1M5OC 1C4AA 2F8HA 1I94F 2UUAF 2CQGA 2QIFA 3ZZUA 5KAKA 2YWKA 4G6VB 1VC5A 3MCMA 1Q5VA 4PUOB 2XGQA 4JI6F 5LJ5Y 1BQNA 4DV2F 2ZH5A 3T1YJ 4HT7A 1SL1A 2KZMA 1U09A 3Q2SC 4C8YA 1P1TA 4EO8A 1CJVB 4FZVA 1F5AA 1VRUB 2JC1A 2HEKA 4NL5A 2VQFJ 4BDPA 5GADI 2XMAA 4IH7A 2IVFB 1FJEB 4C8KA 2QL7B 4MH8A 3X3UA 3OFGA 2ACMA 2QE5A 4DQIA 4Q0BB 3H5UA 1NNDA 2BA9A 2MZQA 2YNIA 5EWEA 1VI7A 3R3TA 4WYWA 3FCWA 4B3OA 4BWJA 2R7UA 2OEMA 4DQSA 5KFZA 3GQCA 2LFVA 2MY8A 3AA8A 4DSKA 1APSA 2NSCA 1HW9A 3A8EA 2O1PA 1UA1A 2K3KA 3BO3A 4ED5A 3CCTA 1LW0B 2HS3A 3H98A 1FESA 2EC2A 2V8GA 3CMQA 3EZUA 3PEHA 4C97A 5EHHA 3V6DA 4Y65A 1QVFR 4L72B 4P71A 1U1LA 2DHHA 5E3CA 3M8ZA 4J9VA 2LQBA 3Q24A 1TR0A 2IVMA 1C4CA 3O8WA 4QOTA 2ZE2A 4X4TA 1UVNA 2NR0A 3PG9A 2RT3A 1C0TA 4LSLB 4E2FB 3NLCA 1ICEB 2XMKA 3W8GA 2DO4A 3MR6A 4EGLA 3N01A 3JYTA 1TMMA 2HW3A 2CPXA 4OJGA 3IG1B 2ZM6F 7FDRA 2YY3A 4KGKA 3KJNB 1FDBA 5FDLB 2R7OA 3FQKA 4DL6A 4USIA 1PO6A 1NSKL 1T9XA 5LSOA 2WVBA 1ZTTA 2CQCA 2VOOA 2FVCA 2QMUB 1GXLA 4KH0B 1UPMB 5EWGA 2ZJRQ 3ENVA 4AXJA 4Y2KA 2R7VA 4CLLA 4Q43A 2BKOA 2XYGB 3MD1A 2UU9J 2C2KB 4NCGA 1FEHA 1G1XA 1VCTA 1X4HA 2RUSA 5E2QA 5KFLA 1VDHA 3U1MA 1YGYA 4ZIVA 4FYXB 3P5TL 4K2JA 4LBHA 1SJ3P 3N28A 3H42A 4F7VA 4K50A 3NGSA 2Q6CA 3LA0A 2B4UA 3CJTA 4ZJOA 4YB1P 1LWXA 4KR0B 2VL1A 4CTAB 2C2RA 2UU9F 1VC6A 3LP1A 5LJ3Y 5KFUA 1U25A 1J5EJ 3H2UB 1LKZA 2XMTA 3KLGA 1T05A 1YRTA 3A3NB 3QRRA 3WX8A 5B0FA 1K9MT 1UPPA 2C1EB 2N3OA 2Z57B 3KG0A 4IKAA 4PUOA 4DOZA 3R5GA 2KN4A 3FJ2A 3VVUA 4A8FA 3ITHB 3K5LA 1GEHA 1Q81T 1F5BA 3B8HA 1PYTA 2FVSA 3CD5A 3GFHA 3HVTB 4JI7J 3UDEA 4IRDA 5KFOA 3Q2TC 4KO0A 4RKUC 5IM0B 2F1FA 2JJ4D 4RR5A 4WJBA 1CG2A 4F67A 2R7RA 3CVKA 4USTA 1X9WA 1OY9A 1RHQB 3CWJA 3D6HB 1S9FA 2B9XA 3NGTA 4ZVPB 2DVIA 1RBAA 1HPZB 5FD1A 2N4CA 4H4OB 2W9BA 2E44A 1WF2A 1X5PA 2A18A 2MHEA 1MROB 1TL7B 3ZZYA 4ZVSB 3GILA 3ENQA 5BYSA 3G2XA 2IM0A 3PFEA 2IHR1 2KT2A 4OX9F 1YJTA 3H7HB 2LXUA 5I3PA 2FHJA 3J80Y 1L3SA 4Z7YA 2B5JA 1KDNA 4DV4F 1NKEA 2ZDPA 1EP4A 2L48A 3TUJC 1NJWA 3EX7B 4LF7F 1BMQB 1XNRJ 1KN6A 2KVIA 5GADU 1VBKA 2J7WA 3IO1A 2W9CA 2P9GA 4GMKA 4DZDA 4U7UD 3GMGA 1TELA 3CCMS 2WVEA 1HWLA 4AL7A 1VQLS 1NU4A 2RDIA 3JXOA 2LDYA 3HD2A 4RBUA 4B9UA 4QCLA 3Q22A 2V8VA 3MM5A 1E6VB 3BEGB 3MDFA 1IWGA 2UZAA 3T1YF 1RAEB 2AJ2A 2CA9A 4B08A 5BYRA 2H9ZA 1H6KX 2BRKA 5KFWA 4DUYF 3IBCB 2DR8A 3A3PB 1SJ1A 3D6FB 2IMOA 3UDLA 2XWXA 4A8OA 2XGPA 2KG1A 4PWDA 4N56A 4RBTA 3IRXA 5C2CA 3QPIA 2HQCA 1YZ6A 3M2VA 4GO5X 1ROFA 2K3IA 2HWTA 4OLOA 1KOOA 3OV7A 1WI6A 3I5AA 1HBMB 5GAHU 1ULRA 3OUYA 1KQKA 2NZCA 3B82A 1HQEB 2MZRA 1WKJA 2QYCA 3MEGB 3MMCB 4TLQA 4IQXA 1EETB 1B70B 3F56A 1Q8BA 3Q86A 1VRTA 4CM0A 4LRAA 1HNVB 1JLBB 2OO4A 2U2FA 3SQGB 3PX6A 2WVFA 4XK8C 2H5IB 3C66A 3ENWA 3JSRA 4HDGA 3FMBA 3ZTPA 4BC9A 1LWEB 2HQIA 2I38A 1SQEA 3GIIA 2FB0A 2JC0A 4JI8F 4DR4F 2G2YA 2EG1A 3HVAA 2GX8A 4KHMA 1TUGB 2JHEA 2J5AA 2AGPA 4ELVA 1GK8A 3HFZB 4QPTA 5DZ6A 4RUCA 2RSQA 1U6FA 2H4WB 4RW9A 1FKOA 1AROP 4KYZA 3HJFA 2DGWA 4H4KA 1S72S 2HQGA 2ZBCA 4RNMA 3D0GE 1M1KT 4YDDB 1UL3A 4PR6A 3OTCA 3IWLA 4YR0A 1S1VB 1HNXF 1QTMA 3MMAB 3TEHB 4OIXA 3W61A 3WBZA 1HHSA 1Q16B 1U6BA 1YSJA 1TTHB 4F3OA 2CPIA 1NUEA 1GMVA 2HKEA 2YWEA 4YB7A 1OYDA 4LF9F 3HZGA 4Y34A 4QW8A 2EVZA 2PMWA 3AJ1A 3GZ7A 3IS9A 4DJBA 4P6QA 5KFRA 2IDLA 4NA1A 4K0KF 1WUUA 3AOBA 4DCOB 2AZ3A 1RADB 2WONB 4LR9A 6FD1A 1JNRB 3QGGA 1FTRA 1T3OA 2HS0A 1RT5B 4ED4A 3TZZA 3QZ7A 1NKCA 1NLKL 3GP9A 4MKYA 1E6YB 1ZM2A 1VQ4S 5C2GA 1DRZA 3HSZA 1RTHA 1V9OA 3U1LA 3PIPQ 4K0KJ 3BYRA 1MMDA 3PO4A 2D1CA 2XS5A 4IOAQ 1R3NA 2ASYA 2MZJA 3TA1A 3KHLA 1KVJA 2VICA 3PZPA 2PGCA 5A8KA 5E33A 2AGQA 4KHPF 1R7IA 4HH0A 2HNZB 3T6JA 4JV5J 2ALZA 2E29A 2EI5A 1YKWA 2KG0A 2DGXA 3W60A 3MAQA 1MMLA 1DFDA 1EAYC 1JLEA 1T7PA 3OXFA 3G6VA 2UUCJ 1GX6A 4HACB 5A2QY 2E9ZA 4YS2A 4K5SA 3MURP 2ZWPA 2MB0B 3KJQB 3T3FA 2VV5A 2R7WA 3CB4A 4I2PA 4Y2AA 4PWDB 1REVA 5HJXA 2P9CA 2EFOA 2XMVA 4RW6A 4J9LA 3RRGA 1Q82T 4C2MA 2DNHA 4OHWA 2UUCF 2G1DA 2HBQB 1X5SA 1EX8A 1IR1A 2PDAA 3ZO7A 2MLXA 2YWFA 2O01C 1VC0A 1GXUA 5EDWA 3N4WA 3R5BA 3ET6A 4S0MA 5KFAA 2ZH7A 3RB3A 3NL0A 3BYPA 2MZTA 3HO1A 3O6QA 5IQQA 4B3OB 2YKMA 2ZUGA 1B4SA 5THWA 3EYZA 2VQEJ 1XMBA 2W9CB 2FGCA 2GA7A 3M2RA 4NXNF 2XY6A 4LFBJ 1FJ7A 1HHTP 2GVZB 2XY7A 1U49A 2E1MC 2WHOA 3CJKA 3I9V9 3WIUA 2KJWA 1N5VA 5J1EB 3QYYA 5A8WA 4ECZA 1H38A 4N41A 2Q66A 3GR1A 2KB2A 2EKYA 3DRSB 3OR2B 5D4NA 4DQPA 1RSCA 2DNKA 1PC5A 2VBZA 3TO8A 3UI3A 2N7YA 1CULB 4KKOB 5K14A 3J7YU 4MYUA 3US5A 1X9MA 1NPRA 2AP6A 2EPIA 3AFGA 1U1OA 4MIAA 3HXMA 2LEBA 1HWKA 5DM7Q 1MWZA 1RAJA 2CZVC 3UD5A 1FWLA 3LWLA 2JVOA 4H54A 4PWWA 4A8QA 4DQQA 1BXNA 4F2SA 5KFMA 4N76A 1HBNA 2IM3A 4LBIA 2M4MA 4OI1A 3LQVA 3KMQA 2RQ4A 4AXIA 3DFEA 3AJ2A 3DLLQ 4KO0B 3A8IA 3AXKA 2C3PA 4ZVGA 2O66A 3R8YA 4C3MA 3H90A 3QIPB 5I3UB 3M6VA 5J2QB 3B6BA 2A6OA 3MD3A 3OFFA 2OI2A 4NPOA 1YJUA 5JUMA 2HWHA 4FPRA 1KONA 4K8RA 4DS5A 1YJNS 1NK9A 1GH8A 2CZ9A 1HQUB 4UOCA 1IKVA 1N6QA 2GMLA 1S6PA 3AA9A 3MMJA 4QR0A 4ZPCA 2B3TB 4I4BA 3PKMA 3P49B 3KNAA 2W4PA 5U47A 3HM9A 5ETTA 4B3SJ 4OI6A 1SL0A 3D6MB 3DGPA 1FFGB 3RW7A 1UEUA 3C16A 3EGVA 3I0RA 5A6PA 2RS2A 4IR1A 4F4KA 1D0EA 2ZZTA 1V5VA 3V2UC 1RKJA 2J6TA 4DL0C 4CTAA 3QGPA 4P75A 1S48A 1SV5B 3O1LA 3CPWR 3DLGA 2E9RX 4KIAA 3FBBA 2R7SA 3QZ8A 4A8MP 3CJQA 4ZCKA 1OQ3A 5F9NA 1B3TA 2J6UA 1IBKF 1UVJA 1NAQA 2CRLA 1UZDA 4OLPA 4DZ6A 1VQMS 4J9QA 3CJ8A 1EZZB 4A8SA 1T03B 4B3TF 3NNHA 4DR5J 2BM0A 3CJ0A 5D0EA 3QJJA 3T41A 3HLUA 5I3QA 1RACB 2CPDA 2DR5A 1SJ4P 3C19A 5DM6Q 4WF9Q 2CVIA 4NI2A 5B0EA 3CJRA 2Y3YA 2HHQA 4K7QA 4H4KC 2R42A 4ZVQB 1R0BG 4USWA 2OPSA 1RI7A 1DQ8A 1FFWB 3H5XA 2F4FA 2G0JA 5HQ8A 4EWTA 4QIEA 2R9LA 4A8YA 4EU0A 3M9NB 3CDUA 5IC4B 1RHJB 1FRIA 2HURA 4NEYA 1EHWA 3OTBA 4KPCA 4DQRA 1YRUA 2M5YA 3MMCA 1MLAA 4LSLA 1A0OB 4HTIA 3TEGA 4YQWA 3SV3A 1OQ6A 4X4QA 3EPGA 1ZBTA 1VQPS 1QE1A 1HMVB 2NXNA 1R8AA 2RKIB 2AGOA 4FBTA 2JOQA 5RUBA 3VGSA 3QLHA 3FEXB 3ZNJ1 2FJDB 4DPOA 2OTJS 4CH1A 1ZAXA 2FGOA 3VHQA 1YI2S 4CCHA 2M9KA 3GLJA 1VHFA 4KGMA 5HAOA 3V6DB 4OX9J 1YBTA 1LW0A 3EICA 2R7TA 1CJUB 1RYSA 4F0HA 2MMYA 1N34J 2ACYA 2KVQE 2ZH6A 4DX8H 2CG4A 2ZKTA 2NUHA 2BW7A 5KOXA 3BH6B 4CLTA 3G6XA 1PBUA 3A12A 3UN5A 8RUCA 1FJCA 5AXNA 1TV6A 2K1RB 4LRFA 1RXOB 1H0HB 2YNIB 2OD4A 4KFBA 5FLXY 4QBUA 1WI8A 1S77D 1C1BB 4FN5A 3M32A 3QO9B 3TP2A 1KEKA 1CS4A 2WB4A 4O4GB 3DLGB 5HROB 3KOAA 3FUYA 2VOPA 3IXQA 5G0RB 1Y5IB 2BE9B 4I2QA 4LMZA 2IJNA 1X0FA 2QSWA 1QD1A 4O0NA 1GFWB 1VQNS 5KFGA 1SXLA 2RDJA 1NB2A 3ET6B 3DGPB 3KUEA 2XMMA 4CLPA 8ATCB 4IRCA 1QJHA 2ERRA 1T9WA 3FSIA 3IAS9 2HVEA 3PTWA 3BSNA 4ILLA 2YNGA 3Q83A 1IKVB 4OX7A 4UZBA 2YWHA 1RAOA 4JI0F 1ZZFA 2FLOA 1T9TA 2JLEA 2B9WA 2ZOFA 2RB7A 1X7VA 4ATNA 4A8WA 4DSEA 2FVRA 4ZPWR 5GMKa 3D6TB 3K8VA 5I3UA 1IBMF 2JEGA 1SVDA 1K44A 1S59A 3AQOA 3HFVA 4RO0A 1RWWB 2DNNA 2OFGX 3DM2A 4E8UA 4EK2A 4ZHRB 4AYBD 5C42B 2EBGA 2GJFA 2YBVA 5CHCB 4DU7A 5IM0A 2WSCC 2MKIA 4QWAA 2E5GA 3OQ2A 2EFVA 2MQQA 2GFFA 1UMJA 3TRGA 4JI2J 1FX4A 4FDFA 3ENAA 5CXTA 5KFFA 5AT1B 3CCJS 1AUSL 5H9FK 3N79A 2JDJA 3NKYA 1N4LA 2KTQA 4W90B 3VCDA 3G82A 2BOAA 1G4CA 3ZZ0A 5EN1A 4DR7J 2P8IA 4OYOA 3T5KA 2EK6A 1R0AA 2IA6A 5JJBA 3RZAA 4O3SA 1KLMB 2GCFA 4B02A 1WHVA 4TXSA 1F5CA 1FX2A 3M6WA 4IFYB 3BKUA 1T8EA 1HWJA 1RCXB 3JSMB 4K4TA 1FFSB 4RJVA 2IYGA 2AJ1A 2HRUA 3DNCA 4UUXA 3W5ZA 4A4JA 3IN5A 2YTCA 1QSSA 2ASLA 3DLEA 4F36A 1YJWS 1S7HA 4WP9A 5I42B 5KFPA 1TAQA 3NMRA 2Z2LA 1TVRB 2A3JA 2JLFA 3NY0A 4DN0A 4ID5A 3LAKA 4N8NA 3W2WA 1R8BA 4RW6B 4B3TJ 2OLWA 1RK8A 4M5MA 1XN9A 4EUVA 1N5YB 3G8QA 5DDPC 4J9PA 3UCGA 1WG4A 3BR9A 3MM8B 4OV1A 5ETQA 1BY9A 3SZ2A 2NREA 3IWNC 2K1RA 2AZ1A 4YDXA 2CUYA 1OJ4A 1TL3B 4F2RA 3ZTQA 4C11B 2HVDA 3JSBA 3QFWA 1BGXT 4P2FA 2XS2A 4NA2A 2XMJA 2IFXA 4P73A 3M8YA 3H59A 3Q8SB 2DH9A 3CC4S 2ALYB 2Y8YA 4ITSA 3PW4A 1N33F 2ZE2B 5HMYA 5H9EJ 1NK4A 4X4UA 2XSFA 2FLNA 4DSIA 4Y0FA 3KTQA 1CQMA 1EKSA 3CCSS 1WEXA 1H2TZ 2OPSB 2LEPA 1LWEA 3DMJB 2EFNA 2NPFA 3FC9A 4A48A 3PR5B 1YHQS 2CNLB 3NMAA 3NBPB 2FVQA 2QFJA 2LCWA 3G6ES 2C2MB 4D3HA 2ZOGA 2ZC3A 2V2QA 3I4HX 3BQ1A 4CYUB 1R0CB 2VA3A 1NH7A 1HNIB 2G2OA 1RWKB 1RT5A 3UPFA 3EUNA 3HF5A 2KM8C 2LP4A 3NS6A 1TFYA 1Q78A 1SKUB 2KHCA 3OL9A 3ZZOA 4OFZA 1JNZB 4YHHJ 3CDBA 2XO7A 4OYBA 4WXOA 2IMWP 4UZCA 4FP9A 3RUBL 2V5HG 1Y4ZB 4RNHA 2OSRA 3OXLA 2QZ8A 1JIHA 3I5BA 1NBEB 3NWGA 3DOLB 3HCXA 4RW8B 3W63A 3EJMA 1XMQF 3MEEB 1U47A 5F8JA 3PIOQ 4JI4J 4ES3A 1KNZA 3DLEB 1Y7PA 2N3LA 2HFNA 5HQLA 3IGNA 3P4UB 2O3DA 3RBXA 5J2PA 1TKTA 3G8SA 3RAQA 1N36F 1WDDA 2HRTA 4NXNJ 3ZTOA 4TY9A 1PIEA 1RCOB 4RW9B 2ZH3A 2AJ4A 1VLOA 1RAGB 3DLKA 1FXDA 1MW7A 4MTPA 1RB0A 2ZHBA 1Q8LA 1HNWJ 2DNYA 4LSZB 1VBXA 3V4MA 4HI1A 4ECXA 4KAIA 2ZOMA 4JP8A 3WQPA 2HFSA 4M5NA 1M1HA 1TMJA 1IJFB 2LA6A 4P9SA 4C8LA 2HHUA 2WTFA 4LJMA 1YJ7A 4EYIB 2VC0A 2QTWA 2BJDA 1VQ7S 2UUBF 1SL2A 1VQ5S 3OJUA 3BBFA 4ZPDA 2CJXB 3MF5A 1WELA 1H72C 2CNNB 3MEDA 1BWEA 1RAFB 1RHMB 3BV8A 2B56A 4IR9A 1VMBA 1HBMA 3OUYB 4WK1A 1TL3A 1NJZA 3MCSA 1OSCA 1WDTA 4OJHA 3PO5A 2KXFA 1UW4A 1VYAA 4BHQA 3D67A 2AV5A 5KFJA 4LF6F 1HBOA 2AQ4A 4RLEA 1RWOB 1R8CA 2Q1LA 2Y0BB 4I1TA 5DS7A 1W2IA 5T14A 4YHHF 2GW8A 4KHPJ 2CQ4A 1XERA 3HKWA 3Q23A 1CJTB 2BANB 2HHSA 4WWSA 2DHXA 3QT8A 2VBYA 3TA0A 2MGZB 4J9OA 2DTJA 3CD7A 3DRSA 3OR2A 4KB7A 2VKRA 4OI3A 1Y3KA 4PAAA 3CJ5A 3W5YA 5KFQA 1JMTA 1Y00A 5AJ3J 1W25A 3KDNA 4JI1F 2WAQD 3AT1B 1S57A 3R7BB 3BN7A 2DK2A 3QWPA 4O4GA 4Q8EA 1JQGA 2Y1LB 2XNRA 1KLMA 2YKMB 2ZH4A 2FTRA 1R43A 3DC2A 4L3KA 2JL9A 5CH7B 1HFEL 2DEJA 5KFHA 4JI8J 2HGMA 2RQCA 4OJ1A 2HLTA 3CJSA 4CT9A 5KTQA 3HHEA 2K06A 4O3PA 4NCGB 3DU6A 4DL7A 1KHVA 1L5UA 1SH0A 1XR6A 2J9CA 3DRXA 4NZ7A 2GIRA 1PBAA 5HK4A 3WIVA 1K8AT 3AHPA 1CJUA 5K20B 1HBOB 4RWXA 5D77A 2LXFA 3RW6A 1FNXH 3G87A 1NM2A 4GKJF 1Q53A 1Y11A 2HG4A 3PNIA 3I82A 2V4QA 4K4YA 4JYAJ 1IKYA 2YPYA 2A0FB 4EMDA 4NX9A 4ZN3A 2EW9A 1SJRA 3BSAA 4ZVEA 2HLUA 4BWMA 1RT7B 1LK7A 2MPUA 3AXMA 5AXMA 4ZLLA 3PX0A 2OIHA 3R5DA 2FLLA 4TLRA 1XR7A 4DV5J 2QT7A 2MQOA 1QAYA 5JXSA 1H3DA 4KGXB 4GC7A 1VS3A 3DYAB 4B3RF 1M0SA 1SC3B 4OMFG 4ED0A 2WW8A 3O5TB 2CJBA 2PE8A 2X7IA 1UTAA 3K17A 2WZ1A 3R1LA 4DCJB 1JXEA 3K8WA 3ZZZA 3GJRB 2O67A 2ASJA 2R8GA 2YNHB 3D5MA 4Y00A 4URGA 1VHIA 3TJ9A 3MMBA 3HSJA 3FQLA 5G0RA 2Y1RI 1OSDA 3UN3A 1FJGJ 2H5EA 4GKKJ 4IO9Q 2OJ3A 3RRKA 3DHWC 5F8LA 4NLSA 2ZBPA 3P8BB 3NWRA 2PA8D 3POTA 4DV5F 5D0HA 2ZH1A 5DGBA 1Z2ZA 2KI2A 4WU3A 1TK5A 1AW0A 2RAQA 5AXKA 3KLHA 5E41A 2C3YA 1I1GA 4BCAA 5IS2A 3MFHA 3VR1A 5K8OA 1WSVA 3FFIA 3VGTA 4X4RA 2CJQA 4WPAA 1U02A 1JXLA 2BKPA 4Y3CA 1SKWA 3BBBA 1N5QA 5KFKA 1HNWF 1I3OB 2BJ7A 4ED1A 2GV1A 4H4MA 1T11A 3CC2S 2XC9A 1HNVA 2JLGA 2YX4A 1NK7A 1IXKA 2OP5A 4TU8A 4L73A 2Z8QA 4ZVTB 1Q7LB 5LT5A 1M5HA 3MM6A 2AYMA 5J2QA 3GCXP 2BJEA 1JKHA 2IVYA 3PYFA 4WFNQ 5A2QU 5IV3A 3K5MA 3RBDA 4WYLA 4KH1B 2GGPA 3F73A 4RUAA 2GO8A 5C7PA 1TU0B 1JLBA 2BXJA 2PMZD 4YEAA 5ETRA 5IC6B 3SCLE 1X8DA 5HO4A 3THTA 1GNKA 2KM8B 4F4ZA 3R1HA 3T9ZA 2H3EB 2VQEF 4M5DB 1IWAA 1D09B 1FO1A 2WVCA 5C24A 3SMZA 5L38A 4YB6A 1Q86T 4KKOA 5K14B 5CA5A 2NZ4A 5B0CA 3OJSA 1U1QA 1RBLA 1SB6A 3LP2B 4C9DA 4IDKB 4B17A 3TAPA 3LTOA 5A8WB 4B9SA 3I32A 4U96A 3GSDA 1RT1B 1BHNA 1U48A 3ZXWA 3W2WB 4DV7F 4XPEA 3KJFB 3NGUA 3OLBA 2KRBA 2YX7A 2IRUA 2Q6BA 4DPUA 3W5XA 5G4DA 3UFCX 1CJVA 5EGYA 2R2UA 4I6YA 2KO1A 5IT4A 3FSYA 3I0RB 3CXCR 4LVNP 3D2WA 2E5LF 5B09A 2XMUA 4A8XA 4K4XA 2HMIA 1H2VZ 2JFKA 3CIZA 2GIFA 1BD6A 2W2PP 3LGNA 4MFBB 2BZ2A 3LWMA 1HQUA 2RU3A 2B8PA 3VGUA 4ED8A 1HL6A 1CJKA 2D9OA 3Q8YA 3SCKE 2XCAA 1S0VA 4LF9J 2BACA 3QRPA 2CPYA 1WWHA 2C3MA 3QIPA 2B5JB 4UTGA 2DH7A 2OPPB 1R0AB 2WOMB 4DR3J 2CIMA 2ZUAA 2BJ8A 1FKAF 2VDIA 3QIDA 3A4TA 1Q0NA 3G82B 3ZNUA 4V19X 4DBQA 2AEMA 5SZTA 2OMOA 3ETOA 2Z58B 1JLEB 3E3XA 4OYXA 2WK4A 2DXFA 1KD1T 2W9BB 3LP0A 2M8HA 4NMLA 4O4RA 1IKWA 3TAQA 1X5TA 3D28A 3N0VA 3ITHA 1UVKA 3IA0A 3CDEA 5A8KB 1CEZA 1JLCB 4HR2A 4DR4J 1F3FA 5H9FJ 5KFDA 2I9SA 1X4DA 2CDQA 3IR6B 4HLBA 4F3QA 4RW4B 3V81A 1S0MA 2W2MP 5D4LA 1XMOJ 2GAHC 2OPRB 3Q8PB 2ILZA 1TKXB 3OL8A 2MSSA 2WSFC 3DLKB 3DRRB 2KFYA 4I6WA 3MFIA 2AU0A 2JSXA 3R5AA 4XDDA 1JLQA 3SXLA 3CF5Q 3MWBA 2GMHA 4OYAA 5BYQA 2CQIA 4CH7A 5J2PB 4IOBA 1YZ7A 3K7RA 3IMQJ 2EC0A 3OTDA 2VONA 4CO3A 1S1WA 2M8DB 1AT1B 1G6BA 3S6EA 1TZ0A 2AWZA 2RILA 3JAMU 4K4VA 3MPVA 4XTTA 3EVWA 2XI2A 1YBAA 1IR2A 3EGWB 1S9EB 3ULHA 3ELHA 2XLIA 1OPZA 3LPEA 3BN4A 1XMOF 4ZP8A 1VQKS 3VZHA 3KHGA 3JTPA 2EFQA 2JVRA 1FEEA 4B3MF 1H98A 3DDNA 5FDLA 2UXCF 3F44A 2D3ZA 3MTKA 1DURA 1OY6A 3CO9A 2NXEA 1HNIA 2KXNB 3TX0A 3DRPB 3JB9k 1EJ7L 2PEHA 3KK3B 1C0TB 3J7A1 5LM7E 2CNOB 2LKZA 2AIRB 1HQ2A 1HI0P 4JI6J 1ZPVA 3HP6A 4P10A 4DV7J 4KGVB 3EMTA 2B4PA 2QL5B 1W7WA 2HFVA 4ZLPA 1HW8A 5IQ6A 3RU0A 3V4IA 3P45B 2XLKA 3MPUB 4J9KA 4LVOP 3BKFA 5CQGA 3M8WA 4C7QA 5HJYA 1EETA 1M5PC 2BE2A 3MEGA 3FK4A 4ZPTR 2DHSA 4HHJA 1FNOA 4LRCA 1M5KC 2A1BA 3GIJA 5F8NA 4PXBA 4NASA 4WFBQ 2V2KA 1N34F 1PC4A 1WHYA 1U6ZA 3R9LA 1UKUA 4B9NA 3C6TB 3PACA 4JI5F 2KL8A 1K0TA 3UQSA 4CLZA 2Z2MA 2YPZA 5AE1A 2H48B 4L74A 3G86A 3QAUA 3SFUA 3L09A 3PFOA 4WE1A 4LF8F 2AHOB 3NOGA 5HBMA 2CQ2A 2XS7A 5KT4A 5CCLA 3BGRA 1F9EB 1NPKA 2OPQA 1KLNA 4JI2F 4P7TA 3TI0A 2B7BB 2DGUA 2QEXS 4Q0BA 3HHKA 1CC8A 2DGVA 4PG7A 3JSMA 1LW2A 2AD9A 4M1KA 1SV5A 5KT5A 2PMHA 3DOKB 1TKXA 2YH1A 4JI3J 3R2CJ 1ZOTA 2JWNA 2ROGA 3ZZRA 1Y10A 4MJKA 4ZCLA 4KJIA 3MUMP 3HMJG 1JLGB 1ZETA 5KFYA 1YTYA 1S97A 3TNVA 1N6QB 3PW2A 4CLKA 2AYGA 1O51A 3LOUA 4DR5F 3UCZP 2HNDA 3OXGA 5F8GA 1HPZA 2H4YB 1U0SA 5AE3A 5B7WA 3KLVA 4EBEA 4DF4A 3M30A 2J9EA 2YKOA 3B54A 2FJEB 1YVFA 3PRBA 2PA3A 3IBWA 4DV0F 3NGRA 2GNKA 3VQTA 2E5HA 2ZBIA 5ETOA 2ZC4A 1DTTA 1LK5A 2MSTA 2RE1A 5B0DA 2IDEA 4F4AA 1H7XA 4U8YA 1C2PA 1YJ9S 4X62J 2KYXA 3KLEB 4PQUB 2XG8A 1XQIA 3N6NA 4IH6A 2QA2A 3NRBA 4NYZA 4F4WA 4MFBA 1UVMA 1RGVA 3GV8B 4I0WA 2I0XA 3D1OA 2AYEA 3OR1A 2F40A 3VZIA 2HIQA 4EFAC 5A76A 2WSEC 1I5OB 4PPDA 5E5NA 2HBRB 4CNZA 3KXDA 4IG3B 5C25B 9ATCB 4DHVA 4DL4A 4OZNA 4IUFA 2XNQA 4LF7J 3KFWX 1VBYA 1FJGF 1X4BA 3M2RB 3PJXA 4NYPA 1N56A 4ECVA 1BLUA 3PDNA 3UD3P 3GSIA 4YR3A 4JI4F 1J5OB 4N8OA 3V5RA 4IG3A 4QWDA 2J0XA 3K0JA 4DX5A 5BXIA 3DI6B 3FCHA 1TV6B 1H2UX 5KFNA 1KFSA 1SH2A 1TKZB 3SQOP 2XCPA 1UA0A 2FJVA 2W7AA 4YMEA 3MCNA 4C0OC 2CPZA 2V67A 3WZ0A 3RR7A 4H4OA 1PJ5A 3GE9A 1OS5A 1UJ5A 5L8RC 3LAMA 1B0PA 4ZJQA 4W92B 1FE4A 1FCAA 4KBIA 4WK3A 3MPYA 2CPEA 2GGPB 2QA1A 2V94A 1DJ0A 3QLHB 5L1LA 2PI4A 2Z56B 3TZXA 3M8PA 3MPWA 1LFWA 2VKZG 1JJCB 3K5NA 3H5SA 1SC6A 3MAAB 2DH8A 4M5JA 2PN6A 3R5JB 5CZXA 2PEBA 2GMJA 1RAHB 4MT1A 2PT0A 1FRKA 2CADA 1DZ5A 4Y2MA 1S6OA 1DLOA 1RT4B 5EUHA 2M0GB 3IAM9 3TYTA 2XQCA 1JX4A 4CP5A 1EQ0A 2BV3A 2HNZA 5F41A 3CUNA 2ZDOA 3C15B 1JLGA 1D9DA 1S9GA 2GJIA 2YQ0A 3OVAA 4EZ9A 2UVVA 1XNQF 1VFJA 3WHIA 1RA7A 2PFDA 5DJBA 4LF1A 4ZLNA 4ZP9A 2VJUA 4JI0J 3FFIB 1RUSA 3OFEA 1RWMB 2VG5A 1M5SA 3MPDA 5KFBA 3VAKA 4DR2F 3FZBA 4CH0S 3SIPB 3G96A 5A6WA 4GO7X 1NJXA 3ZC4A 4JI1J 2XHCA 2QMWA 4DL5A 2E9TA 2FZKB 4NLOA 2QX0A 4ZVHA 1D8ZA 4C48A 2E1AA 1FERA 2HHVA 2L08A 1AB8A 2P2CB 2LU1A 2XMWA 3BREA 2XZTB 3M2UA 4AT1B 4WFAQ 2JZ5A 1QAIA 1LNQA 2DHAA 2HQ3A 5HP1B 3R27A 1S76D 1XK8A 1FRLA 2BQ3A 2DGSA 3ONQA 1NO8A 4C98A 5HSPA 1MG7A 1V3RA 1VRUA 3GJQB 4C0BA 1WC3A 2ADBA 2QMXA 3CEDA 3QGIA 2RHQB 3BB5A 2M3DA 1U26A 5HP1A 3JQKA 2HBYB 4O3QA 2HVHA 1HLWA 1RT6B 2BRLA 4LSNB 1D3WA 3BJYA 1MWYA 4K5RA 4USMA 4NZ0A 1BQXA 2DYAA 1UFLA 3GV7B 1Z1ZA 2A6MA 4USKA 1VIOA 2IC3A 4USUA 3CCES 3TARA 4IOCQ 5KG2A 1F0XA 1UAWA 2VPWB 3I9ZA 4R0EA 5HQMA 1YIJS 3QT5A 2HHXA 3FEYB 2MKCA 4Y2IA 2DR9A 3TWZA 3M05A 4UY8T 4ANCA 4B3RJ 1KVIA 4DFKA 3BSCA 1F6TA 3GTYX 2G9OA 5J2NA 4DPXA 3MR3A 2VH7A 3DGVA 3FVYA 3M8QA 4IG0A 2ZH8A 3PV8A 5HVGA 3VAMA 2DEIA 3W65A 1U1NA 2L41A 3Q8UA 4TVAB 3M6XA 4WTYA 2VASA 3MUTP 1IR0A 4USVA 3KJVB 3DRPA 2E5IA 3V6JA 5KG7A 1FTCA 2CYYA 4NLYA 1LWCA 4W4MA 4PKDB 5F8HA 1CSJA 3Q89A 4MKBA 4Z2XA 2J7UA 1UW9A 2Y0SD 5LMUJ 4ECYA 3GJTB 5D78A 1NDPA 1WF0A 1FRXA 5KG3A 1HWIA 4E98A 4OYMA 3CD6S 2XEXA 2CQ1A 5IFMA 1N5YA 3D3BJ 3SDEA 5IT9Y 2FJAB 1RHRB 2EWHA 2KU7A 4OZ5A 3I0SA 3SCJE 3TVKA 2ASDA 2Y8WA 3W1YC 2YVSA 2AYBA 5HL7Q 2DBBA 3QWUA 4UUWA 3CTRA 2DCUB 1KSPA 3K2YA 4FVCA 4ICLA 3AJDA 2MGZA 4ID8A 1O0PA 2LMIA 1YK9A 4I56A 5T7LB 2RD5C 1B64A 3CJ3A 2IAJB 3MM9A 2R8IA 1FNMA 3OL7A 4LF4J 8AT1B 1RWUA 1RTJA 2VB6A 1JLQB 4J91A 5AJ3F 2DNGA 2VPYB 4FXDA 2XSJA 2G1HA 4ELUA 2ZZNA 2V9KA 1IN0A 1QM9A 5B0AA 5KT7A 4EEYA 2J0QD 4I67A 1VJQA 3HHLD 2N4DA 1UJ6A 2M52A 1U8SA 1UETA 3LGMA 2VFTA 1FK9A 2MHNA 3HHLC 3TZWA 3G8TA 3RGIA 1JLCA 3C14A 3B4MA 2DD8S 1RLCL 3HHLB 5D3GA 1N33J 2UUWA 3OL6A 1NDCA 1PSDA 4R5PA 2Z30B 3NS7B 4KSEB 4QIVA 4USJC 5M2RA 1MROA 4DF8A 1U1MA 2KFNA 5LXRA 4O0IA 3RYLA 3D0HE 2JRSA 1VBZA 2NXUA 4TU9A 2FHKA 2W2NP 4PCQA 3ZZPA 4FXWA 1UFWA 4RUHA 3C8YA 3MI7X 4ED2A 3DM2B 4LFAF 1VQYA 4YY3J 1VQOS 3QATA 4JI7F 2W4DA 1S6QA 2BJ3A 2C2NA 2W1BA 4RW7A 4K4WA 2E7WA 1FD2A 4RU9A 2EXUA 3KLFB 4FXVA 1Q8IA 1S1TB 2UUAJ 3P96A 4QZVB 4ZDNA 2DJWA 2VHGA 2EFPA 1DQ9A 2RQKA 3H25A 3BGOP 3FDSA 2HVZA 3BKTA 4NLQA 2HMIB 1RLDA 1GQEA 1RT2B 3DKDA 3UVJB 2M7SA 1PGZA 4K4SA 1TQLA 4FYYB 1PJ6A 3WDOA 4M8LA 4DV2J 1OWXA 1T94A 2XBPA 3U7JA 2K2PA 3DOLA 1OPIA 4RW8A 2CJ9A 3R7SB 1RT3A 1MU2A 1HD0A 3FBCA 4UF4A 2HS4A 3UCUP 3ICLA 1U0HB 3M9OB 1LXNA 2DY1A 2NYIA 1CS4B 3PM9A 3VAFA 1FVQA 3M32B 3QO9A 3PW5A 4XDCA 1P9YA 5EX0A 2FC8A 1AFJA 2HGNA 1KWMA 2KJVA 2W2OP 3O3LA 2D41A 3PHTA 2BJ9A 5D0GA 1S1VA 4X4SA 2ZH2A 3J7ZT 1U2RA 1V5IB 2BM1A 1XBWA 1OYEA 5HVHA 3HK2A 3HFKA 1T0TV 3HJVA 3TJAA 3CMES 2MQPA 4C8ZA 4ZOSA 5HLFA 2ZNZA 3BGRB 4M5LA 2FD2A 2OGUA 4EI2A 4UOGA 2HFZA 2DNPA 4LR8A 2J6SA 3DLBA 3J81U 2EG2A 3AY0A 1YBUA 1H73A 2BOPA 1S99A 4ZN1A 4CLUA 4NEZA 1S0NA 2UUBJ 1VQ6S 4QJVA 3TX8A 1ZM4A 2E7VA 2RKIA 1KHWA 2B4OA 1N5TA 5LMNJ 2MTLA 2PIIA 5HVFA 2CQPA 3T9NA 2BW2A 3K57A 4DV3F 4I69A 3SQGA 1X4GA 1VRTB 1VK3A 4IQMA 4TU7A 3IC1A 2XM3A 2V8PA 3N6MA 2FUG9 4WFYA 5GMEA 3W64A 4DUZF 3J81j 1HQEA 2ATLA 2ATCB 2ZWOA 3KLIA 4UOFA 2G4BA 1DHMA 2BE2B 3D0IE 4DV1J 3EDRB 2X1AA 2DPJA 1N36J 2J9DE 1OY8A 4NRUA 4EO6A 3MEKA 2UUTA 2B8QA 4O3NA 2XYHB 3CCLS 3IRXB 1VISA 2FC9A 5J2NB 1RHKB 3VAGA 4MK8A 4DV6J 2B43A 2CAJA 2GQQA 5J2MA 4X4PA 3CCQS 2KZZA 4CQ1A 4G1PA 1ZM3A 2B7CB 2C2ZB 2EKNA 2K7KA 4C3LA 4U6PA 3MR5A 3LH2S 1Q4RA 2IC3B 1P8GA 2F8EX 2V9WA 1U8WA 2R7QA 3DN9A 3MM5B 2CQHA 4LFBF 1YG0A 2QA4G 4B9VA 4WIIA 5HMZA 3CCRS 2X51A 2PFFB 5DLFA 4CI0B 3G6YA 5IT9U 2FDNA 1PJ7A 3QNWB 2W7OA 1N32J 1PG5B 1B0VA 2VPZB 1EP4B 2EK1A 3QGHA 2WB1D 1AYEA 1V3SA 4FNIA 2YNHA 4MKVA 4I7FB 4P74A 3UE2A 4NXMJ 3GV5B 2V4JB 3PX4A 2WBMA 1YLXA 1SC1B 2BQRA 4KT0C 3H4DA 2RRNA 2JEFA 3M2UB 1X4EA 2E1RA 3CT9A 2IBOA 3H40A 1TL7A 3LF0A 3RJMB 1AUDA 3W8PA 4O44B 2LECA 3CNQP 1WTBA 4P72A 1LWFA 4TYBA 3DRRA 3HSGA 3C6UB 2ZNYA 3NNAA 2J9DA 4A46A 4YUDA 1PAUB 3PJWA 4OZ2A 5DG8A 3DCAA 1XWLA 3GJSB 3ILIA 3HVTA 1PYSB 2I5JA 3TQ1A 3GG0A 2DPIA 3A8JA 4QWCA 4RUBA 1SIWB 1WHXA 2M2BA 3O44A 1WOOA 4WP3A 4WCEQ 4AL6A 1QTNB 1TK0A 4QYZJ 2EFGA 4DG1A 2ZJQQ 1RP5A 2MLYA 4NOHA 1RAAB 5LSRA 2P5VA 5GAHI 1WEZA 1I94J 2IBKA 2QC3A 4P52A 1ZA2B 2NCKL 1HWUA 5JMNA 1UFKA 4CT8A 2QL9B 1GTEA 2W01A 5ITHA 3CJKB 2VU5A 2GVZA 2OHDA 1N88A 4ZP6A 2IM2A 1VR6A 2O5DA 2GHWA 3OHBA 5F3ZA 1C1BA 2X3GA 2EEYA 3HI9A 3VAIA 4OZJA 4NXMF 1F2HA 1Q95G 4USHA 2VFVA 1P27B 1TL5A 1HBUA 2H65B 1VIXA 3A13A 3T1AA 2M70A 5D6GA 2VJVA 1RYRA 2J0SD 5T7LA 2HQFA 2WBRA 4DPWA 4ELTA 3K5OA 2MKYA 1W26A 3DI6A 4L76A 4UQTA 2DT9A 2XO6A 4NLGA 2OFHX 1A7GE 1PYOB 2OEKA 1QAXA 5ETVA 2YKNA 2FHMA 4I2PB 3TAMB 4C4WA 5CD4H 4B3SF 2FIUA 2P6TA 1X60A 2MJUA 5FIIA 3JAMY 1QUPA 4BLGA 3I96A 3IM8A 4X64F 4MK7A 2AX0A 4HYKA 2DIVA 4DV6F 5E7OB 4MMOA 1ACMB 1X4FA 3NGDA 1OO0B 1FF2A 2OMLA 2YKAA 5DQIA 1ZTWA 5IZHA 1N0UA 4GKKF 4I6AA 1NDKA 1LWCB 3BGLA 4KGZB 1K73T 1L3VA 6AT1B 3D1QA 1URRA 4Q7AA 3KHHA 5AE2A 1BQMB 4DV0J 3GFZA 4RPFA 2UXDF 2F7VA 2VQFF 4DUZJ 4YFUA 3WC2A 1FWPA 1JLFA 2VIHA 5CYQB 2NLWA 2W4CA 4PG8A 1RTHB 3PW0A 4PG5A 1NK0A 2HHPA 4ED7A 2G0IA 2RHSB 3LANA 4CLFA 4WP8A 3UNGC 4OZLA 1TL1A 5KFSA 1TP7A 1L3UA 3PW7A 3R6LB 2KRRA 2PC6A 2WONA 3CW2C 2BR0A 4LBPA 1ELOA 3E01B 1S5ZA 4ZP7A 1F2GA 3BR8A 1HIYA 1J5EF 1EKRA 1NXIA 1RT6A 4LSNA 3SFGA 2DNZA 1Y3JA 4U95A 2H51B 3M7VA 4M63A 1M90T 3D9BA 2HPUA 3GIRA 1GMWA 1RA6A 2HZAA 2V4JA 3U02A 3KYLA 4QIFA 4PWUA 1IBKJ 2FZGB 5D4PA 4M5KA 1NH8A 2GIQA 4FNHA 3FGVA 5KT3A 4NLXA 4WTOB 4NYOA 3UR3C 4PXDA 4R25A 2V4RA 2V50A 4Q8FA 2VFSA 2VBWA 4DR1F 4C8NA 3EE3A 4RNFA 5DG9A 1G3OA 2ZFHA 1PCAA 7AT1B 2F4VJ 1FKOB 3POTB 1GT8A 1NSAA 3NAIA 2V0NA 4ES1A 4N5SA 3S01A 2D74B 4G1QB 3DHXA 1FRHA 2VODA 4CWBA 3RAMA 4DLGA 3PYEA 1KRPA 2JNJA 2VF3A 2ADCA 4Z7CA 3L7UA 5ETPA 1R27B 4TY8A 5DQGA 5J2MB 1NJYA 2DGQA 3VAJA 2BEFA 2DRDA 2W2QP 5DDOC 4OI2A 1SPBP 5AXLA 2ZHAA 1LV5A 3R6GB 4RBVA 3N6LA 3T1HJ 2LXIA 1S9GB 1H74A 3AODA 1VQ9S 2CDRB 1SKSA 4LFAJ 2L9WA 2HYIB 4IYQA 3OHAA 1KP6A 2IJFA 3P6YC 3DOMB 5BR8F 3DDKA 1AZSB 2B4VA 3IP0A 1S1XB 4X65J 3RG6A 5A8RB 5KOWA 1NPPA 3MM8A 1SI9A 4WU2A 2FVPA 1QDUB 3PVXA 2VG7B 1RWVB 2ZKUA 1SC4B 2V8DA 4CLSA 2CPJA 1TVRA 3HDSA 2Q3PA 3OTEA 1XR5A 5F0WA 3AOAA 5H1SV 5LMUF 5I42A 2DRAA 3M6UA 2A10A 1BUXA 1JXVA 2SXLA 3GONA 1AFIA 3ILLA 5GMDA 4D3GA 1VRQC 3PY8A 3NCPA 4OYPA 3QJPA 3KWMA 3KK1B 4PABA 3THVA 4DV1F 1Y9OA 1B99A 4K4UA 1LOUA 4LUBA 1Q79A 4IFYA 1AXQA 2F8MA 2VUGA 2Y1JA 2QLBB 2I8EA 4FVMA 3CCUS 3DLJA 3BGUA 4DLEA 1HNXJ 4LF8J 4ZPAA 2Z4PA 5IXUA 1RT3B 3OTOF 4U7CA 1IBCB 3HZEA 3M1VA 4ERDA 1R89A 3RR8A 2RUGA 5DDRC 3W66A 1F60B 1RDRA 1KR4A 1Y0HA 2B6AB 2RJZA 4DMZA 5C25A 2R2SA 2R2TA 4DR2J 3BH7B 3CC7S 3Q8QB 3OW2R 2DNQA 2HHTA 3MXHP 5J1NA 4ZJLA 1CJTA 2BANA 1NJIT 1J2VA 3IR5B 1UEKA 3ZTSA 1HARA 4WIQA 2FJBB 4JOUA 2XLJA 3CDAA 2C28A 3C2PA 4FYVB 2CQDA 1RTIB 4GRSA 4O23A 3TQEA 3HHNB 4PQUA 5E3PA 3QT6A 2V69A 3EXYA 1DTQB 4I64A 5ETSA 5L1JA 2J8AA 2K7JA 1DTTB 1RISA 1Q1KA 2CPFA 2ZHOA 3JSYA 4YN3B 1WKLA 1T9VA 3UO0A 4DEZA 4RNNA 4EYHB 1CPZA 4LT6A 1E6YA 3CCZA 4L75A 5MLCV 1BE4A 3M30B 1XIQA 3DOMA 3DRYA 2AT1B 4ILRA 3QAEA 2YNGB 4PXCA 4JUZA 5DQHA 4ZPVR 3EZOA 4ER8A 3AD8C 4LIRA 2HNDB 1YJRA 2HFOA 2U1AA 2V8HA 4GVBA 4DXLA 1FWKA 3CCVS 2HHHJ 3HHLA 2DHGA 1WJ9A 4YP3A 4B9MA 1O5JA 4OL8A 3SBMA 2W25A 4QR2A 3FKBA 3HX9A 2E5JA 3B4DA 3LP1B 3M1VB 4X4NA 4OHZA 4PG6A 2MJNA 4TY8B 2HHWA 4NLUA 2ZD1B 4I7FA 3VWSA 2Q43A 4RWWA 4Q5VA 4U8VA 4AFFA 3Q8RB 3T5HA 3HKZD 4NCBA 2FLPA 1ZAWA 2XSJB 3MMAA 5KT6A 1YDLA 2QYGA 5HI7A 2PO4A 5IWAF 2DNOA 3P3DA 1TKTB 2XULA 2OPQB 3F41A 1S1UB 4JBCA 2ZH9A 5DGAA 5L39A 3D3CJ 3O2IA 4YB5A 3KUGA 1WHWA 2Z0GA 2DGTA 2V6AA 3QJLA 3VF0B 4ZLJA 1VLYA 3N5BA 3PRVA 1HMVA 3W2VA 4Z37A 1JWWA 2XYPB 1P9QC 2YNFA 4WFXA 3C6TA 5SUHA 3TANA 3KK2B 2KYZA 4L6V3 1NMEB 3W9HA 4X4OA 3IG1A 3EGZA 1GMWD 3VVTA 3ZZTA 3SYZA 4ED3A 2ROEA 1S1XA 1HYSB 2AJQA 1AZSA 4Y28C 2N7CA 1FDNA 4UQGA 2QJ3A 3NCQA 4PPZA 3HT0A 2RRBA 2V68A 1N0VC 1HYSA 2L9DA 4CDIA 2ZITA 1WOPA 2HBZB 4KY3A 4FBUA 1JLAB 1VGYA 2H1YA 3UR0A 2C2DA 2MZSA 3M2VB 2CFXA 2MY7A 2HNYA 3NBPA 4URQU 3M8QB 4IG0B 3BO4A 4PRFA 2YNFB 1JLFB 4QWEA 1LXJA 4NLRA 1Z2LA 1KFDA 4A47A 4BC7A 3QSYB 3D68A 3MM6B 1WSRA 4L3NA 2CJAA 4F02A 1TUVA 3CMAS 4M5HA 4DR3F 4ECQA 1SIZA 2W8KA 2FY1A 4HI2A 1C0UB 5F9LA 3AAWB 3WC0A 1RTZA 2GZOA 3T5JA 2I6WA 5D8HB 4M5IA 3KG4A 4DSFA 2WVDA 2YKQA 3TW0A 4ZKAA 3I55S 2IIHA 3TZYA 1GMUA 4DN9A 3GYXB 4J9NA 2JFDA 5F8MA 2MLZA 3GPAA 4N7TA 4O3RA 2YKNB 3DXSX 3TAMA 1A6LA 4RZRA 1LEOA 4DSLA 4ID5B 4ECUA 3MTJA 2QRRA 3C16B 3R5CA 4Q2MA 3R97A 1UP1A 1U24A 2DGOA 3FBFA 4FYWB 1WD6A 2XTJP 2VFRA 3E01A 4FYDA 3E2EA 3P5BP 3UD4P 1UEVA 2HZVA 1CLFA 4QYZK 1RJJA 4AL5A 4BS2A 5BR8J 4P2MA 3UDCA 1HI8A 1KS2A 1WC6A 1ZS6A 4U67Q 3PR4A 3AB2B 3AD7C 2VG6B 2GHVC 3CCWA 4DSJA 1UCNA 1SJFA 4OV6A 3OPKA 5KG1A 2VG5B 2ABYA 4AD6A 4K4ZA 2DO0A 1PKUA 2GVDB 2HGLA 9RUBA 2L9NA 4RW4A 2OTLS 3EXCX 3T6BA 3MM7B 2Y9HA 4ILMA 3U27A 1RU1A 5D15A 4KV8A 4DX7A 2VBXA 4DCPB 4ZMMA 1KC8T 3JS9A 3E8OA 4P2SA 5HMWA 4KC5A 5L1IA 1RTIA 2OELA 1KBRA 2Z2YB 3DYAA 4RX6A 1YITS 2MQNA 4NZ6A 4LFCJ 4G3IA 2OUGA 3TR5A 1QSLA 4DU8A 4KQZA 1U2FA 2LDIA 1N5SA 1V6HA 1SUQB 3W62A 3M8SA 3MUVP 1JK9B 4M94A 1SBRA 2B9YA 2XZWA 4CIOA 2GVDA 1QUVA 3C14B 2KH9A 2X1BA 3PYDA 4C8OA 4WKRA 1DTQA 2UXBF 1WC4A 1H7WA 2BX6A 2OPPA 1ZAVA 2RS8A 2BQUA 3NGKA 1M1GA 3GYGA 2GS8A 4FPIA 3KMSA 3NNCA 4F0MA 5ETMA 3T1HF 5KFXA 3OLAA 4HHHA 4ETXA 2DXEA 1FXLA 1FKPB 2LYVA 1TL4A 2D3UA 2QFIA 2A2DA 2CNKB 3EDQB 1AA1B 4G65A 4PZVA 1UVLA 2IAJA 3TVYA 5KG6A 1P1LA 2E66A 2MKSA 1HBUB 3S1TA 4X64J 3NOCA 3E51A 1L3TA 1U45A 2MXYA 3MGJA 3DDIA 3B78A 2JEJA 2OKQA 4NE9C 1FRMA 3TOQA 1D9AA 5ADZA 1HNZF 2CQ3A 2AJFE 2LU2A 5HROA 2E1PA 3ILJA 2UV8G 5LXYA 2CWXA 4ZA1A 5EWFA 2ZBQA 4FKYA 4KFBB 4QW9A 4XPCA 1S0OA 3JYTB 3BZQA 4PYDA 3CSKA 2MQLA 1G7CB 3OT9A 1K1QA 4IFVB 4OI4A 4OYZA 3S8SA 1ZZNA 1QAJA 2IYIA 3AB4B 2RIJA 2HSEB 5B0BA 4FS2A 2I5JB 5HATA 2H5JB 1ZM9A 3MM7A 5LOQA 2C42A 2ZVIA 2AW0A 3HULA 4LIWA 4ETZA 3C46A 1RQ0A 1X4AA 1FD8A 1KOHA 4F26A 3UW1A 4QYRA 4DUYJ 2VG6A 4OJ3A 1FT8A 1D9FA 4X4VA 2MQMA 2ZBRA 4Y2CA 4LF5J 2RDDA 5E3AA 3J80U 3UN2A 3SSRA 1T9UA 5FJ4A 4LR7A 4B9TA 1ZYQA 2IRXA 2KHDA 2FY8A 3THPA 5IT0A 1NCLA 1I51B 1R31A 1MMNA 1U2CA 5A0YB 2BVZA 3G9CA 2UXBJ 3W2VB 5IWAJ 2UVWA 4B3MJ 2J8SA 3I87A 2W8LA 5KG0A 4HL9A 2MZ1A 1XNQJ 2KFZA 1S7IA 4OZ0A 1N52B 5F8IA 3KHRA 3IBFB 1RU2A 3WX4A 4NWBA 1S4EA 4YY3F 4LFCF 2Q79A 1BQNB 3CJ4A 3LPYA 3DU5A 1FDAA 3QBCA 3KLHB 2FHOB 2P6SA 3W7BA 2GJ2A 1XMQJ 2GQCA 2UP1A 2P9EA 2R7XA 2HHHF 3CE8A 2LA4A 2G2ZA 2OAUA 4DPTA 4OYWA 3RBZA 4F04B 1TL1B 3NP5A 3C3LA 2ZD1A 5CYJA 3BM7A 2DITA 3I4PA 1U7LA 3MECB 4ZS6A 3MMBB 4ZCMA 5DETA 4CRJA 4J5OA 5J1PA 1X9SA 4JV5F 3NG8A 2R2RA 2LEAA 2GC8A 2QSFA 4G1IA 1QSYA 2D9PA 2NSBA 2CJYB 4EBCA 3K59A 3RAXA 1UWBA 4PYAA 2F63A 1X5OA 2JX2A 1HR0F 2K8GA 3GCWP 5BJRA 2OH2A 1S6PB 3I6PA 5KFVA 4LF4F 1DY3A 4ZPBA 2QN6B 2MDAA 2MQ8A 4UOHA 3TUZC 5KFEA 2ZEJA 1S10A 1KQSR 1D1UA 1NSQA 1B0TA 3JQMA 4BBYA 2E5LJ 4RW7B 1MN9A 2X1GA 2RU9A 4RNOA 3KG1A 4RU2A 4LF6J 1IKXA 4TYAA 1T9YA 1EARA 1C1CA 2XWYA 2AEJA 4LQ9A 2Y1IA 1IKYB 3NCRA 6FDRA 2WCXA 2X3DA 3FRZA 1BQMA 4J37A 3A8KA 4IFVA 4LRBA 1OIAA 1X4CA 5EX3A 5M2UA 5KFCA 3HT3A 3ILOA 1WKKA 5FLXU 1MNEA 4F8RA 1B7YB 4GC6A 4F4YA 4ZCIA 1S1UA 4U7UK 2Z2ZA 3GFYA 5HLFB 5HN0A 1TFWA 2XZDB 5D3GB 3T5LA 2QA4S 2KT5A 3LW5C 4OX6A 4NCAA 2RVJA 4DPYA 1IBMJ 1WF1A 3BS9A 4J9RA 2DIUA 4N77A 1F9FA 4R8UB 5J1EA 3A3OB 1FRJA 2DISA 3H4BA 3N9UC 2X1FA 4IRKA 3BGFA 4MAKA 2F65A 2G0CA 4DDFA 1U1KA 4AUKA 2V2ZA 1K0VA 4YOEA 3CIMA 4I68A 3MM9B 1S1WB 2LQ9A 5E3QA 1S4FA 1RT2A 3MR7A 2KXHA 1GX5A 5B0GA 4F50A 1X31C 3PRDA 5ETLA 1IJEB 2XI3A 5KFIA 1BWVA 4DI6A 2R3VA 2VD3A 2OEJA 3UWTA 4ANEA 4ECRA 1VJWA 2D3O1 1YJVA 1ZA1B 3NAHA 1REGX 1O6XA 1FDDA 1NZAA 2DNRA 2VPXB 3OFHA 4CLYA 3IRWP 4FS1A 4ECTA 4OHYA 2CQ0A 4K2XA 2BMBA 2OPRA 3T19A 1CBKA 3SDEB 4ANDA 4ENOA 1S6QB 3LO3A 4TNOA 1FI4A 2DY9A 4CO2A 3MR2A 2YX1A 1Q8KA 3TA2A 4UT4A 3LALA 1N54B 4MIBA 1NK8A 1R6VA 2BDPA 4DS4A 2GAGC 5K5MA 5KG4A 4DR6F 3NS5A 3TVZA 1LWFB 1PILA 4DG1B 2HAFA 3BQ0A 1HKAA 3LP0B 2HK3A 3RB4A 2VC1A 4GVLA 1RTDB 1OMSA 2F9DA 2ILYA 4OYIA 1N48A 4PXEA 3FEZA 2DR6A 4R5PB 3BDEA 4DR1J 1QVGR 1URNA 2B6AA 3VQSA 2I2YA 4FF1A 1MSWD 3J7YI 1CC7A 1VQSA 4PG4A 1KTQA 4DUTA 3FSXA 3L95X 3IFEA 4NLPA 3LGHA 5H9EK 4WZMA 1WEYA 5LSLA 3DOKA 4DV3J 1YQHA 3PCOB 3SSQA 5DDQC 1XNRF 3RRHA 1F1BB 4O44A 1K47A 1LW2B 4LF5F 2V34A 4KE5A 2APOA 3H0PA 2F5GA 3KNGA 2DCLA 2B51A 4Q45A 1LFPA 4ZITA 3J81Y 3CGIA 3MAHA 4QQBA 1Y5LB 5L1KA 3IM9A 4ZVFA 2PD1A 2HWIA 2B9EA 2CKWA 4ICLB 5HMXA 4P2XA 2ZJPQ 5ETNA 1NKBA 1WC1A 2NYHA 3QRQA 3EGNA 2HQDA 3MEEA 4WE1B 4WBFA 4C8MA 4I2QB 3MHYA 1X0PA 4KRWA 2RRAA 4JV2A 2ZVSA 4CLWA 2NPIA 2CJKA 2JH3A 2HFUA 1RAIB 3H2VE 1KTVA 4UW2A 3W9JA 2C3UA 1R8HA 3RTVA 4UY85 4KHRA 3PXGa 4ED6A 2DR7A 3DLHA 2IY5B 3QMQA 5M2PA 3OSNA 5A8RA 3R2DJ 2UXDJ 1DQAA 2VZ9A 1NZ8A 1C0UA 2UVUA 2FPHX 1I6JA 1UVIA 3KLIB 4DFPA 2FJXA 1NB7A 4P7VA 4E0DA 1K1SA 3ADAC 3Q8VA 4DV4J 2ZZMA 4DFMA 2KDOA 3W3SA 5C5JA 4AQYJ 3BDPA 4V19J 4C6AA 4NA3A 3BF4A 1G2EA 4XIUA 3ZFVA 5CYQA 3BO2A 3V4IB 1S12A 2AEFA 2HNYB 3LUYA 2WW4A 1JLAA 1SQGA 4EBDA 1EIYB 4DR6J 3C15A 3QFHA 2N82B 2C3OA 1Y5NB 2AMCB 3OVSA 1HR0J 5IOLA 4GKJJ 2QLWA 2AJ0A 4G1QA 3M9MB 1S6UA 3TJ8A 2MEWA 3MOZA 2CZ4A 2PSZA 2RH3A 3D1HA 3NXZA 4QPXA 2R8KA 3IR7B 4ES2A 4WXWA 3X1LB 3D54A 3HVWA 1U1PA 4C11A 1IQZA 3CD0A 2A2CA 1O8BA 2VFUA 4LRDA 3VTIA 5K8PA 5ETKA 1NHKL 4LREA 4QR1A
chains in the Genus database with same CATH topology
3BH6B 1HIYA 2DXEA 1KDNA 1U8WA 3ZTRA 3EJMA 4S0MA 3EVWA 3ELHA 3DDIA 5BXIA 1B4SA 4O0NA 1NB2A 3EE3A 3VGTA 1MN7A 3ZTOA 3FCWA 2HVEA 1NSPA 4DI6A 4FKYA 3BBBA 3Q83A 4ANEA 3PRVA 5CAAA 3L7UA 1NDCA 2BEFA 4ANDA 3VVTA 4ENOA 2DY9A 1K44A 1S59A 4EK2A 3EMTA 1WKJA 3BBFA 1W7WA 3EVOA 3Q86A 4CP5A 3ENAA 3ZTPA 3FBEA 3B6BA 5C7PA 5CABA 1VYAA 3EVMA 1NSKL 2NCKL 4DUTA 3MPDA 3R9LA 1NCLA 1NDLA 3DKDA 2VU5A 1BUXA 1JXVA 3VGVA 1BHNA 3FBCA 3GPAA 3NGUA 1B99A 1NPKA 3FBBA 1NUEA 4W98A 1LEOA 1S57A 4F36A 2CWKA 3NGSA 4DZ6A 4WBFA 1LWXA 3FBFA 3EM1A 2DXDA 1PAEX 2AZ3A 1HLWA 2B8PA 3VGUA 4UOGA 3FCVA 3Q8YA 1HHQA 3WX8A 1ZS6A 2DYAA 3BBCA 3BH7B 2AZ1A 1NLKL 3GP9A 3ZTQA 1UCNA 2HVDA 3VVUA 2ZUAA 3ZTSA 3PJ9A 1PKUA 3Q8VA 4ANCA 1NDKA 4C6AA 2HURA 1F6TA 1EHWA 3JS9A 4KPCA 2DXFA 4UOHA 3B54A 1NSQA 1WKLA 4FKXA 4UOFA 3NGRA 3Q8UA 3ETMA 1MN9A 3FC9A 4HR2A 1BE4A 1XIQA 1F3FA 3NGTA 5IOLA 4F4AA 3VGSA 2B8QA 3Q89A 1XQIA 1NDPA 3G2XA 1WKKA 2BX6A 3EICA 3FKBA 1NHKL 1S5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH6 B;  1HIY A;  2DXE A;  1KDN A;  1U8W A;  3ZTR A;  3EJM A;  4S0M A;  3EVW A;  3ELH A;  3DDI A;  5BXI A;  1B4S A;  4O0N A;  1NB2 A;  3EE3 A;  3VGT A;  1MN7 A;  3ZTO A;  3FCW A;  2HVE A;  1NSP A;  4DI6 A;  4FKY A;  3BBB A;  3Q83 A;  4ANE A;  3PRV A;  5CAA A;  3L7U A;  1NDC A;  2BEF A;  4AND A;  3VVT A;  4ENO A;  2DY9 A;  1K44 A;  1S59 A;  4EK2 A;  3EMT A;  1WKJ A;  3BBF A;  1W7W A;  3EVO A;  3Q86 A;  4CP5 A;  3ENA A;  3ZTP A;  3FBE A;  3B6B A;  5C7P A;  5CAB A;  1VYA A;  3EVM A;  1NSK L;  2NCK L;  4DUT A;  3MPD A;  3R9L A;  1NCL A;  1NDL A;  3DKD A;  2VU5 A;  1BUX A;  1JXV A;  3VGV A;  1BHN A;  3FBC A;  3GPA A;  3NGU A;  1B99 A;  1NPK A;  3FBB A;  1NUE A;  4W98 A;  1LEO A;  1S57 A;  4F36 A;  2CWK A;  3NGS A;  4DZ6 A;  4WBF A;  1LWX A;  3FBF A;  3EM1 A;  2DXD A;  1PAE X;  2AZ3 A;  1HLW A;  2B8P A;  3VGU A;  4UOG A;  3FCV A;  3Q8Y A;  1HHQ A;  3WX8 A;  1ZS6 A;  2DYA A;  3BBC A;  3BH7 B;  2AZ1 A;  1NLK L;  3GP9 A;  3ZTQ A;  1UCN A;  2HVD A;  3VVU A;  2ZUA A;  3ZTS A;  3PJ9 A;  1PKU A;  3Q8V A;  4ANC A;  1NDK A;  4C6A A;  2HUR A;  1F6T A;  1EHW A;  3JS9 A;  4KPC A;  2DXF A;  4UOH A;  3B54 A;  1NSQ A;  1WKL A;  4FKX A;  4UOF A;  3NGR A;  3Q8U A;  3ETM A;  1MN9 A;  3FC9 A;  4HR2 A;  1BE4 A;  1XIQ A;  1F3F A;  3NGT A;  5IOL A;  4F4A A;  3VGS A;  2B8Q A;  3Q89 A;  1XQI A;  1NDP A;  3G2X A;  1WKK A;  2BX6 A;  3EIC A;  3FKB A;  1NHK L;  1S5Z A; 
#chains in the Genus database with same CATH topology
 4QIW D;  2B0G A;  4J9M A;  3OBI A;  4DL2 A;  2NQP A;  1HI1 A;  3I5C A;  2DNL A;  4NI2 B;  4HTJ A;  1NK6 A;  1UJ4 A;  1U0H A;  2QG9 B;  1S9E A;  2E7X A;  2YWG A;  4URS A;  1MU2 B;  2CPH A;  4ZK7 M;  4A8K A;  2HVI A;  2OSQ A;  4ZVU B;  1KKH A;  1TUW A;  2HZC A;  4TKT A;  4ZVR B;  3D4J A;  3M4X A;  3PYG A;  7FD1 A;  1T03 A;  3A1Y G;  3PKY A;  1FKP A;  1GAO A;  5DO2 A;  1KQF B;  3G4S S;  3PHE A;  4HHU A;  3TUP A;  1N8R T;  2ZM6 J;  1YWX A;  4TN2 A;  4JV1 A;  5E0O A;  1XC9 A;  1MN7 A;  2VDH A;  4X65 F;  3AD9 C;  3HHD A;  4C0H A;  1NSP A;  3AQP A;  2QLX A;  3R7N B;  3SCI E;  3D7S B;  1RAB B;  4WFZ A;  3SSS A;  2FHJ D;  2IJR A;  3UNY A;  5CAA A;  2BJ1 A;  3PEJ A;  3V81 B;  3L7O A;  2GO9 A;  4Y6I A;  3UVJ A;  2J7K A;  2M88 A;  4CM2 A;  4AQY F;  1M5V C;  3FMW A;  4GVB B;  3OR1 B;  4B9L A;  1RTD A;  1B7F A;  3V6K A;  3CDW A;  5D4O A;  4F4X A;  1RWP B;  2LLZ A;  3NEK A;  1WAC A;  1IKW B;  2I1R A;  2E1C A;  1S1T A;  4ALZ A;  5D0R A;  1S49 A;  2KT3 A;  2LQ8 A;  4M95 A;  2QLF B;  2LQ5 A;  1WC0 A;  1Z4U A;  3H2L A;  1RT7 A;  4PEO A;  4XAK A;  4ZVO B;  3MAA A;  3VV2 B;  3EPI A;  3GYN A;  3G71 S;  3U1N A;  2F4V F;  5C42 A;  4ZHR A;  4HVZ A;  1HD1 A;  1HBN B;  2WOM A;  2RF2 B;  4Q2L A;  4F25 A;  4EZ6 A;  1SCJ B;  1UZH A;  1DAR A;  3FRY A;  4J9U E;  4OHX A;  4JV0 A;  3VAL A;  4X2B A;  4NLD A;  1SQF A;  3L4B C;  1R8P A;  1W2B R;  2D69 A;  2XB2 D;  1DBD A;  5KG5 A;  1NDL A;  2C2O B;  5T41 A;  3QT7 A;  1IM4 A;  2HAI A;  2LVW A;  1KVK A;  2BAB A;  2J0W A;  1CUL A;  3VGV A;  1NEE A;  3I31 A;  5L9X A;  3AOC A;  5K9F A;  5L9N A;  1J5O A;  4DWI A;  3KLG B;  1WOS A;  1T05 B;  1TAU A;  3RB6 A;  4R8U A;  3F0N A;  1WG1 A;  2QO3 A;  4N47 A;  2CWK A;  1JJ2 R;  3K5P A;  3GIK A;  4NRT A;  2BUN A;  1RT1 A;  3EWG A;  3SV4 A;  2UXC J;  2BBE A;  3J7A N;  3MZI A;  1PAE X;  3FZ2 A;  3LP2 A;  4TQS A;  3CO0 P;  2HIY A;  3M8R A;  2YKP A;  4FF4 A;  1VOM A;  3AH6 A;  3KDO A;  3FCV A;  5HBM B;  4WKY A;  5DRK A;  3BBC A;  1VK8 A;  4M5D A;  5CYM A;  5C24 B;  1V3Z A;  4OI0 A;  2R8J A;  2VA2 A;  5KFT A;  3KJV A;  2JEI A;  3I0S B;  3MOJ B;  2DRB A;  2IRY A;  3PJ9 A;  4X84 A;  1CVJ A;  2VG7 A;  3OTO J;  3K58 A;  1C1C B;  5L46 A;  2V63 A;  1FE0 A;  3H5Y A;  5LMN F;  2UVR A;  5MAO A;  4DFJ A;  3C6U A;  1QE1 B;  1RZM A;  1JKH B;  4OZ1 A;  2AF6 A;  3OVB A;  4FKX A;  4TQR A;  4MIW A;  3MED B;  1EB0 A;  1NRK A;  5GAE I;  1RE1 B;  1T02 A;  2EBE A;  3H20 A;  2QV6 A;  4X66 J;  1UWB B;  5DLG A;  4HT5 A;  1FHT A;  5GVQ A;  4H4M B;  5KT2 A;  3KK2 A;  5DG7 A;  2FJW A;  4Q44 A;  2POK A;  5DZ7 A;  4F3M A;  2C22 A;  3V6H A;  2BKN A;  4ECS A;  4WZQ A;  5B08 A;  1WNE A;  3MEC A;  3CJ2 A;  1UWA A;  4XO0 A;  2QLJ B;  4CO5 A;  3KKF A;  1FVS A;  4MYT A;  1JJ4 A;  3KK3 A;  2F3J A;  2YWW A;  3BQ2 A;  3QQC D;  4C3K A;  1R6Y A;  2W7P A;  5JVG Q;  5GAG U;  2DKO B;  2BYC A;  4U9R A;  4QIG A;  3ZTR A;  4NLV A;  1RBO B;  2OD6 A;  2XHW A;  1KQG B;  4KPY A;  1EQM A;  5JVH Q;  1D8Y A;  2MYF A;  2IPO B;  2D7S A;  1WOR A;  4DX6 A;  1XTZ A;  1FA0 A;  4NLT A;  4NLW A;  1RWX B;  1ZPW X;  4JI3 F;  3IS9 B;  4JYA F;  3L7P A;  2F9J A;  5LL6 d;  2ROP A;  1F9H A;  2RNE A;  4J90 A;  1XEZ A;  1WC5 A;  3ISN C;  5A0Y A;  1YX2 A;  2RML A;  2R4F A;  5CCM A;  1VQ8 S;  2V2V A;  3HPO A;  4FF2 A;  2NXC A;  3ISN D;  1GTH A;  3HVR A;  3DXB A;  4J9S A;  4DR7 F;  1GXT A;  3HD1 A;  2MKJ A;  3BPS P;  1RHU B;  3HSD A;  3KUH A;  3FNN A;  4OX8 A;  2W9A A;  4CYU A;  5F3T A;  2CQB A;  3J7Z 5;  3KLF A;  1T3N A;  5I4M A;  4KTQ A;  4FF3 A;  3JTO A;  4HEA 9;  1DAX A;  4OZ3 A;  2MKK A;  3ISZ A;  3TUI C;  2D3O R;  5K8N A;  2CG8 A;  4CO4 A;  2HK2 A;  3EVO A;  5K8M A;  3N5F A;  3DMJ A;  1N32 F;  2CVE A;  3BPD A;  3M8P B;  1IBL F;  2PI5 A;  1FXR A;  1RWN B;  2LQJ A;  3IWX A;  1IM6 A;  1SH3 A;  3EZ5 A;  1WG5 A;  4MK9 A;  4HH1 A;  5HAN A;  2W24 A;  3FBE A;  2L3M A;  2WRM A;  3GB0 A;  5CYM B;  5F0U A;  4K59 A;  4X62 F;  3H8Y A;  3Q0A A;  1TKD A;  2BE7 D;  4AE5 A;  5CAB A;  3RB0 A;  1DLO B;  1RT4 A;  5CZV A;  3K89 A;  1HA1 A;  1L3K A;  3EVM A;  3MCO A;  4YR2 A;  2RQM A;  4NMX A;  5IV4 A;  1IBL J;  2DNM A;  1TKZ A;  3GG1 A;  3S7R A;  1T95 A;  2NUU G;  1NHV A;  3GIM A;  3RBE A;  2G13 A;  2XY5 A;  2IM1 A;  1TK8 A;  1U4B A;  4LF2 A;  3JTN A;  1IUJ A;  2J76 E;  2AX1 A;  1RTJ B;  3QSI A;  2GHP A;  3GU0 A;  3JQJ A;  4W98 A;  1JB0 C;  3I56 S;  1YRX A;  4JI5 J;  3KK1 A;  1WTF A;  1QLN A;  1ITP A;  2YH0 A;  4R0J A;  3OSP A;  1QY7 A;  1XJW B;  2COL A;  2MKH A;  4QWB A;  1E6V A;  1MWQ A;  4OQJ A;  5CD4 A;  2IA0 A;  4O3O A;  2HRY A;  3EM1 A;  2DXD A;  2FQQ B;  5GAG I;  1ZH5 A;  2NS1 B;  4HKQ A;  4JB8 B;  4MKA A;  4F0K A;  4OHV A;  2DB1 A;  2RF2 A;  2QGF B;  1HHQ A;  4DL3 A;  1Q7Y T;  1BC6 A;  1SJQ A;  3BSO A;  1REV B;  1SKR A;  2CXE A;  4HDH A;  2YQ1 A;  3UDV A;  4CZC A;  2R8H A;  4ECW A;  1IKX B;  1S79 A;  2C2E A;  4LQ3 A;  4IDK A;  4QU6 A;  1NK5 A;  1SUQ A;  1NHU A;  1A9N B;  3GR0 A;  1IQT A;  4PQA A;  1U1R A;  5GAE U;  2KKH A;  1LQ9 A;  4HAC A;  4M5G A;  5E3R A;  1F3V A;  3IGV A;  2YQ3 A;  1CQN A;  3KLE A;  3GWC A;  2GQ2 A;  1RKI A;  1JJH A;  2YXL A;  1J27 A;  2H54 B;  3OD2 A;  4IH5 A;  4KV8 B;  3ETM A;  4QU7 A;  1P6T A;  4V1A k;  2AKW B;  4CNY A;  2FZC B;  3L3C A;  3GFX A;  3SI8 A;  3VAH A;  4RL1 A;  1FK9 B;  4IO1 A;  4CO0 A;  2NXJ A;  2UV8 A;  4J7C A;  4CO1 A;  4X66 F;  3D66 A;  1HNZ J;  4ZIW A;  3SEO A;  3CUL A;  1IVZ A;  1Q5Y A;  3L9Z A;  3W9I A;  1CJK B;  2FYX A;  1M5O C;  1C4A A;  2F8H A;  1I94 F;  2UUA F;  2CQG A;  2QIF A;  3ZZU A;  5KAK A;  2YWK A;  4G6V B;  1VC5 A;  3MCM A;  1Q5V A;  4PUO B;  2XGQ A;  4JI6 F;  5LJ5 Y;  1BQN A;  4DV2 F;  2ZH5 A;  3T1Y J;  4HT7 A;  1SL1 A;  2KZM A;  1U09 A;  3Q2S C;  4C8Y A;  1P1T A;  4EO8 A;  1CJV B;  4FZV A;  1F5A A;  1VRU B;  2JC1 A;  2HEK A;  4NL5 A;  2VQF J;  4BDP A;  5GAD I;  2XMA A;  4IH7 A;  2IVF B;  1FJE B;  4C8K A;  2QL7 B;  4MH8 A;  3X3U A;  3OFG A;  2ACM A;  2QE5 A;  4DQI A;  4Q0B B;  3H5U A;  1NND A;  2BA9 A;  2MZQ A;  2YNI A;  5EWE A;  1VI7 A;  3R3T A;  4WYW A;  3FCW A;  4B3O A;  4BWJ A;  2R7U A;  2OEM A;  4DQS A;  5KFZ A;  3GQC A;  2LFV A;  2MY8 A;  3AA8 A;  4DSK A;  1APS A;  2NSC A;  1HW9 A;  3A8E A;  2O1P A;  1UA1 A;  2K3K A;  3BO3 A;  4ED5 A;  3CCT A;  1LW0 B;  2HS3 A;  3H98 A;  1FES A;  2EC2 A;  2V8G A;  3CMQ A;  3EZU A;  3PEH A;  4C97 A;  5EHH A;  3V6D A;  4Y65 A;  1QVF R;  4L72 B;  4P71 A;  1U1L A;  2DHH A;  5E3C A;  3M8Z A;  4J9V A;  2LQB A;  3Q24 A;  1TR0 A;  2IVM A;  1C4C A;  3O8W A;  4QOT A;  2ZE2 A;  4X4T A;  1UVN A;  2NR0 A;  3PG9 A;  2RT3 A;  1C0T A;  4LSL B;  4E2F B;  3NLC A;  1ICE B;  2XMK A;  3W8G A;  2DO4 A;  3MR6 A;  4EGL A;  3N01 A;  3JYT A;  1TMM A;  2HW3 A;  2CPX A;  4OJG A;  3IG1 B;  2ZM6 F;  7FDR A;  2YY3 A;  4KGK A;  3KJN B;  1FDB A;  5FDL B;  2R7O A;  3FQK A;  4DL6 A;  4USI A;  1PO6 A;  1NSK L;  1T9X A;  5LSO A;  2WVB A;  1ZTT A;  2CQC A;  2VOO A;  2FVC A;  2QMU B;  1GXL A;  4KH0 B;  1UPM B;  5EWG A;  2ZJR Q;  3ENV A;  4AXJ A;  4Y2K A;  2R7V A;  4CLL A;  4Q43 A;  2BKO A;  2XYG B;  3MD1 A;  2UU9 J;  2C2K B;  4NCG A;  1FEH A;  1G1X A;  1VCT A;  1X4H A;  2RUS A;  5E2Q A;  5KFL A;  1VDH A;  3U1M A;  1YGY A;  4ZIV A;  4FYX B;  3P5T L;  4K2J A;  4LBH A;  1SJ3 P;  3N28 A;  3H42 A;  4F7V A;  4K50 A;  3NGS A;  2Q6C A;  3LA0 A;  2B4U A;  3CJT A;  4ZJO A;  4YB1 P;  1LWX A;  4KR0 B;  2VL1 A;  4CTA B;  2C2R A;  2UU9 F;  1VC6 A;  3LP1 A;  5LJ3 Y;  5KFU A;  1U25 A;  1J5E J;  3H2U B;  1LKZ A;  2XMT A;  3KLG A;  1T05 A;  1YRT A;  3A3N B;  3QRR A;  3WX8 A;  5B0F A;  1K9M T;  1UPP A;  2C1E B;  2N3O A;  2Z57 B;  3KG0 A;  4IKA A;  4PUO A;  4DOZ A;  3R5G A;  2KN4 A;  3FJ2 A;  3VVU A;  4A8F A;  3ITH B;  3K5L A;  1GEH A;  1Q81 T;  1F5B A;  3B8H A;  1PYT A;  2FVS A;  3CD5 A;  3GFH A;  3HVT B;  4JI7 J;  3UDE A;  4IRD A;  5KFO A;  3Q2T C;  4KO0 A;  4RKU C;  5IM0 B;  2F1F A;  2JJ4 D;  4RR5 A;  4WJB A;  1CG2 A;  4F67 A;  2R7R A;  3CVK A;  4UST A;  1X9W A;  1OY9 A;  1RHQ B;  3CWJ A;  3D6H B;  1S9F A;  2B9X A;  3NGT A;  4ZVP B;  2DVI A;  1RBA A;  1HPZ B;  5FD1 A;  2N4C A;  4H4O B;  2W9B A;  2E44 A;  1WF2 A;  1X5P A;  2A18 A;  2MHE A;  1MRO B;  1TL7 B;  3ZZY A;  4ZVS B;  3GIL A;  3ENQ A;  5BYS A;  3G2X A;  2IM0 A;  3PFE A;  2IHR 1;  2KT2 A;  4OX9 F;  1YJT A;  3H7H B;  2LXU A;  5I3P A;  2FHJ A;  3J80 Y;  1L3S A;  4Z7Y A;  2B5J A;  1KDN A;  4DV4 F;  1NKE A;  2ZDP A;  1EP4 A;  2L48 A;  3TUJ C;  1NJW A;  3EX7 B;  4LF7 F;  1BMQ B;  1XNR J;  1KN6 A;  2KVI A;  5GAD U;  1VBK A;  2J7W A;  3IO1 A;  2W9C A;  2P9G A;  4GMK A;  4DZD A;  4U7U D;  3GMG A;  1TEL A;  3CCM S;  2WVE A;  1HWL A;  4AL7 A;  1VQL S;  1NU4 A;  2RDI A;  3JXO A;  2LDY A;  3HD2 A;  4RBU A;  4B9U A;  4QCL A;  3Q22 A;  2V8V A;  3MM5 A;  1E6V B;  3BEG B;  3MDF A;  1IWG A;  2UZA A;  3T1Y F;  1RAE B;  2AJ2 A;  2CA9 A;  4B08 A;  5BYR A;  2H9Z A;  1H6K X;  2BRK A;  5KFW A;  4DUY F;  3IBC B;  2DR8 A;  3A3P B;  1SJ1 A;  3D6F B;  2IMO A;  3UDL A;  2XWX A;  4A8O A;  2XGP A;  2KG1 A;  4PWD A;  4N56 A;  4RBT A;  3IRX A;  5C2C A;  3QPI A;  2HQC A;  1YZ6 A;  3M2V A;  4GO5 X;  1ROF A;  2K3I A;  2HWT A;  4OLO A;  1KOO A;  3OV7 A;  1WI6 A;  3I5A A;  1HBM B;  5GAH U;  1ULR A;  3OUY A;  1KQK A;  2NZC A;  3B82 A;  1HQE B;  2MZR A;  1WKJ A;  2QYC A;  3MEG B;  3MMC B;  4TLQ A;  4IQX A;  1EET B;  1B70 B;  3F56 A;  1Q8B A;  3Q86 A;  1VRT A;  4CM0 A;  4LRA A;  1HNV B;  1JLB B;  2OO4 A;  2U2F A;  3SQG B;  3PX6 A;  2WVF A;  4XK8 C;  2H5I B;  3C66 A;  3ENW A;  3JSR A;  4HDG A;  3FMB A;  3ZTP A;  4BC9 A;  1LWE B;  2HQI A;  2I38 A;  1SQE A;  3GII A;  2FB0 A;  2JC0 A;  4JI8 F;  4DR4 F;  2G2Y A;  2EG1 A;  3HVA A;  2GX8 A;  4KHM A;  1TUG B;  2JHE A;  2J5A A;  2AGP A;  4ELV A;  1GK8 A;  3HFZ B;  4QPT A;  5DZ6 A;  4RUC A;  2RSQ A;  1U6F A;  2H4W B;  4RW9 A;  1FKO A;  1ARO P;  4KYZ A;  3HJF A;  2DGW A;  4H4K A;  1S72 S;  2HQG A;  2ZBC A;  4RNM A;  3D0G E;  1M1K T;  4YDD B;  1UL3 A;  4PR6 A;  3OTC A;  3IWL A;  4YR0 A;  1S1V B;  1HNX F;  1QTM A;  3MMA B;  3TEH B;  4OIX A;  3W61 A;  3WBZ A;  1HHS A;  1Q16 B;  1U6B A;  1YSJ A;  1TTH B;  4F3O A;  2CPI A;  1NUE A;  1GMV A;  2HKE A;  2YWE A;  4YB7 A;  1OYD A;  4LF9 F;  3HZG A;  4Y34 A;  4QW8 A;  2EVZ A;  2PMW A;  3AJ1 A;  3GZ7 A;  3IS9 A;  4DJB A;  4P6Q A;  5KFR A;  2IDL A;  4NA1 A;  4K0K F;  1WUU A;  3AOB A;  4DCO B;  2AZ3 A;  1RAD B;  2WON B;  4LR9 A;  6FD1 A;  1JNR B;  3QGG A;  1FTR A;  1T3O A;  2HS0 A;  1RT5 B;  4ED4 A;  3TZZ A;  3QZ7 A;  1NKC A;  1NLK L;  3GP9 A;  4MKY A;  1E6Y B;  1ZM2 A;  1VQ4 S;  5C2G A;  1DRZ A;  3HSZ A;  1RTH A;  1V9O A;  3U1L A;  3PIP Q;  4K0K J;  3BYR A;  1MMD A;  3PO4 A;  2D1C A;  2XS5 A;  4IOA Q;  1R3N A;  2ASY A;  2MZJ A;  3TA1 A;  3KHL A;  1KVJ A;  2VIC A;  3PZP A;  2PGC A;  5A8K A;  5E33 A;  2AGQ A;  4KHP F;  1R7I A;  4HH0 A;  2HNZ B;  3T6J A;  4JV5 J;  2ALZ A;  2E29 A;  2EI5 A;  1YKW A;  2KG0 A;  2DGX A;  3W60 A;  3MAQ A;  1MML A;  1DFD A;  1EAY C;  1JLE A;  1T7P A;  3OXF A;  3G6V A;  2UUC J;  1GX6 A;  4HAC B;  5A2Q Y;  2E9Z A;  4YS2 A;  4K5S A;  3MUR P;  2ZWP A;  2MB0 B;  3KJQ B;  3T3F A;  2VV5 A;  2R7W A;  3CB4 A;  4I2P A;  4Y2A A;  4PWD B;  1REV A;  5HJX A;  2P9C A;  2EFO A;  2XMV A;  4RW6 A;  4J9L A;  3RRG A;  1Q82 T;  4C2M A;  2DNH A;  4OHW A;  2UUC F;  2G1D A;  2HBQ B;  1X5S A;  1EX8 A;  1IR1 A;  2PDA A;  3ZO7 A;  2MLX A;  2YWF A;  2O01 C;  1VC0 A;  1GXU A;  5EDW A;  3N4W A;  3R5B A;  3ET6 A;  4S0M A;  5KFA A;  2ZH7 A;  3RB3 A;  3NL0 A;  3BYP A;  2MZT A;  3HO1 A;  3O6Q A;  5IQQ A;  4B3O B;  2YKM A;  2ZUG A;  1B4S A;  5THW A;  3EYZ A;  2VQE J;  1XMB A;  2W9C B;  2FGC A;  2GA7 A;  3M2R A;  4NXN F;  2XY6 A;  4LFB J;  1FJ7 A;  1HHT P;  2GVZ B;  2XY7 A;  1U49 A;  2E1M C;  2WHO A;  3CJK A;  3I9V 9;  3WIU A;  2KJW A;  1N5V A;  5J1E B;  3QYY A;  5A8W A;  4ECZ A;  1H38 A;  4N41 A;  2Q66 A;  3GR1 A;  2KB2 A;  2EKY A;  3DRS B;  3OR2 B;  5D4N A;  4DQP A;  1RSC A;  2DNK A;  1PC5 A;  2VBZ A;  3TO8 A;  3UI3 A;  2N7Y A;  1CUL B;  4KKO B;  5K14 A;  3J7Y U;  4MYU A;  3US5 A;  1X9M A;  1NPR A;  2AP6 A;  2EPI A;  3AFG A;  1U1O A;  4MIA A;  3HXM A;  2LEB A;  1HWK A;  5DM7 Q;  1MWZ A;  1RAJ A;  2CZV C;  3UD5 A;  1FWL A;  3LWL A;  2JVO A;  4H54 A;  4PWW A;  4A8Q A;  4DQQ A;  1BXN A;  4F2S A;  5KFM A;  4N76 A;  1HBN A;  2IM3 A;  4LBI A;  2M4M A;  4OI1 A;  3LQV A;  3KMQ A;  2RQ4 A;  4AXI A;  3DFE A;  3AJ2 A;  3DLL Q;  4KO0 B;  3A8I A;  3AXK A;  2C3P A;  4ZVG A;  2O66 A;  3R8Y A;  4C3M A;  3H90 A;  3QIP B;  5I3U B;  3M6V A;  5J2Q B;  3B6B A;  2A6O A;  3MD3 A;  3OFF A;  2OI2 A;  4NPO A;  1YJU A;  5JUM A;  2HWH A;  4FPR A;  1KON A;  4K8R A;  4DS5 A;  1YJN S;  1NK9 A;  1GH8 A;  2CZ9 A;  1HQU B;  4UOC A;  1IKV A;  1N6Q A;  2GML A;  1S6P A;  3AA9 A;  3MMJ A;  4QR0 A;  4ZPC A;  2B3T B;  4I4B A;  3PKM A;  3P49 B;  3KNA A;  2W4P A;  5U47 A;  3HM9 A;  5ETT A;  4B3S J;  4OI6 A;  1SL0 A;  3D6M B;  3DGP A;  1FFG B;  3RW7 A;  1UEU A;  3C16 A;  3EGV A;  3I0R A;  5A6P A;  2RS2 A;  4IR1 A;  4F4K A;  1D0E A;  2ZZT A;  1V5V A;  3V2U C;  1RKJ A;  2J6T A;  4DL0 C;  4CTA A;  3QGP A;  4P75 A;  1S48 A;  1SV5 B;  3O1L A;  3CPW R;  3DLG A;  2E9R X;  4KIA A;  3FBB A;  2R7S A;  3QZ8 A;  4A8M P;  3CJQ A;  4ZCK A;  1OQ3 A;  5F9N A;  1B3T A;  2J6U A;  1IBK F;  1UVJ A;  1NAQ A;  2CRL A;  1UZD A;  4OLP A;  4DZ6 A;  1VQM S;  4J9Q A;  3CJ8 A;  1EZZ B;  4A8S A;  1T03 B;  4B3T F;  3NNH A;  4DR5 J;  2BM0 A;  3CJ0 A;  5D0E A;  3QJJ A;  3T41 A;  3HLU A;  5I3Q A;  1RAC B;  2CPD A;  2DR5 A;  1SJ4 P;  3C19 A;  5DM6 Q;  4WF9 Q;  2CVI A;  4NI2 A;  5B0E A;  3CJR A;  2Y3Y A;  2HHQ A;  4K7Q A;  4H4K C;  2R42 A;  4ZVQ B;  1R0B G;  4USW A;  2OPS A;  1RI7 A;  1DQ8 A;  1FFW B;  3H5X A;  2F4F A;  2G0J A;  5HQ8 A;  4EWT A;  4QIE A;  2R9L A;  4A8Y A;  4EU0 A;  3M9N B;  3CDU A;  5IC4 B;  1RHJ B;  1FRI A;  2HUR A;  4NEY A;  1EHW A;  3OTB A;  4KPC A;  4DQR A;  1YRU A;  2M5Y A;  3MMC A;  1MLA A;  4LSL A;  1A0O B;  4HTI A;  3TEG A;  4YQW A;  3SV3 A;  1OQ6 A;  4X4Q A;  3EPG A;  1ZBT A;  1VQP S;  1QE1 A;  1HMV B;  2NXN A;  1R8A A;  2RKI B;  2AGO A;  4FBT A;  2JOQ A;  5RUB A;  3VGS A;  3QLH A;  3FEX B;  3ZNJ 1;  2FJD B;  4DPO A;  2OTJ S;  4CH1 A;  1ZAX A;  2FGO A;  3VHQ A;  1YI2 S;  4CCH A;  2M9K A;  3GLJ A;  1VHF A;  4KGM A;  5HAO A;  3V6D B;  4OX9 J;  1YBT A;  1LW0 A;  3EIC A;  2R7T A;  1CJU B;  1RYS A;  4F0H A;  2MMY A;  1N34 J;  2ACY A;  2KVQ E;  2ZH6 A;  4DX8 H;  2CG4 A;  2ZKT A;  2NUH A;  2BW7 A;  5KOX A;  3BH6 B;  4CLT A;  3G6X A;  1PBU A;  3A12 A;  3UN5 A;  8RUC A;  1FJC A;  5AXN A;  1TV6 A;  2K1R B;  4LRF A;  1RXO B;  1H0H B;  2YNI B;  2OD4 A;  4KFB A;  5FLX Y;  4QBU A;  1WI8 A;  1S77 D;  1C1B B;  4FN5 A;  3M32 A;  3QO9 B;  3TP2 A;  1KEK A;  1CS4 A;  2WB4 A;  4O4G B;  3DLG B;  5HRO B;  3KOA A;  3FUY A;  2VOP A;  3IXQ A;  5G0R B;  1Y5I B;  2BE9 B;  4I2Q A;  4LMZ A;  2IJN A;  1X0F A;  2QSW A;  1QD1 A;  4O0N A;  1GFW B;  1VQN S;  5KFG A;  1SXL A;  2RDJ A;  1NB2 A;  3ET6 B;  3DGP B;  3KUE A;  2XMM A;  4CLP A;  8ATC B;  4IRC A;  1QJH A;  2ERR A;  1T9W A;  3FSI A;  3IAS 9;  2HVE A;  3PTW A;  3BSN A;  4ILL A;  2YNG A;  3Q83 A;  1IKV B;  4OX7 A;  4UZB A;  2YWH A;  1RAO A;  4JI0 F;  1ZZF A;  2FLO A;  1T9T A;  2JLE A;  2B9W A;  2ZOF A;  2RB7 A;  1X7V A;  4ATN A;  4A8W A;  4DSE A;  2FVR A;  4ZPW R;  5GMK a;  3D6T B;  3K8V A;  5I3U A;  1IBM F;  2JEG A;  1SVD A;  1K44 A;  1S59 A;  3AQO A;  3HFV A;  4RO0 A;  1RWW B;  2DNN A;  2OFG X;  3DM2 A;  4E8U A;  4EK2 A;  4ZHR B;  4AYB D;  5C42 B;  2EBG A;  2GJF A;  2YBV A;  5CHC B;  4DU7 A;  5IM0 A;  2WSC C;  2MKI A;  4QWA A;  2E5G A;  3OQ2 A;  2EFV A;  2MQQ A;  2GFF A;  1UMJ A;  3TRG A;  4JI2 J;  1FX4 A;  4FDF A;  3ENA A;  5CXT A;  5KFF A;  5AT1 B;  3CCJ S;  1AUS L;  5H9F K;  3N79 A;  2JDJ A;  3NKY A;  1N4L A;  2KTQ A;  4W90 B;  3VCD A;  3G82 A;  2BOA A;  1G4C A;  3ZZ0 A;  5EN1 A;  4DR7 J;  2P8I A;  4OYO A;  3T5K A;  2EK6 A;  1R0A A;  2IA6 A;  5JJB A;  3RZA A;  4O3S A;  1KLM B;  2GCF A;  4B02 A;  1WHV A;  4TXS A;  1F5C A;  1FX2 A;  3M6W A;  4IFY B;  3BKU A;  1T8E A;  1HWJ A;  1RCX B;  3JSM B;  4K4T A;  1FFS B;  4RJV A;  2IYG A;  2AJ1 A;  2HRU A;  3DNC A;  4UUX A;  3W5Z A;  4A4J A;  3IN5 A;  2YTC A;  1QSS A;  2ASL A;  3DLE A;  4F36 A;  1YJW S;  1S7H A;  4WP9 A;  5I42 B;  5KFP A;  1TAQ A;  3NMR A;  2Z2L A;  1TVR B;  2A3J A;  2JLF A;  3NY0 A;  4DN0 A;  4ID5 A;  3LAK A;  4N8N A;  3W2W A;  1R8B A;  4RW6 B;  4B3T J;  2OLW A;  1RK8 A;  4M5M A;  1XN9 A;  4EUV A;  1N5Y B;  3G8Q A;  5DDP C;  4J9P A;  3UCG A;  1WG4 A;  3BR9 A;  3MM8 B;  4OV1 A;  5ETQ A;  1BY9 A;  3SZ2 A;  2NRE A;  3IWN C;  2K1R A;  2AZ1 A;  4YDX A;  2CUY A;  1OJ4 A;  1TL3 B;  4F2R A;  3ZTQ A;  4C11 B;  2HVD A;  3JSB A;  3QFW A;  1BGX T;  4P2F A;  2XS2 A;  4NA2 A;  2XMJ A;  2IFX A;  4P73 A;  3M8Y A;  3H59 A;  3Q8S B;  2DH9 A;  3CC4 S;  2ALY B;  2Y8Y A;  4ITS A;  3PW4 A;  1N33 F;  2ZE2 B;  5HMY A;  5H9E J;  1NK4 A;  4X4U A;  2XSF A;  2FLN A;  4DSI A;  4Y0F A;  3KTQ A;  1CQM A;  1EKS A;  3CCS S;  1WEX A;  1H2T Z;  2OPS B;  2LEP A;  1LWE A;  3DMJ B;  2EFN A;  2NPF A;  3FC9 A;  4A48 A;  3PR5 B;  1YHQ S;  2CNL B;  3NMA A;  3NBP B;  2FVQ A;  2QFJ A;  2LCW A;  3G6E S;  2C2M B;  4D3H A;  2ZOG A;  2ZC3 A;  2V2Q A;  3I4H X;  3BQ1 A;  4CYU B;  1R0C B;  2VA3 A;  1NH7 A;  1HNI B;  2G2O A;  1RWK B;  1RT5 A;  3UPF A;  3EUN A;  3HF5 A;  2KM8 C;  2LP4 A;  3NS6 A;  1TFY A;  1Q78 A;  1SKU B;  2KHC A;  3OL9 A;  3ZZO A;  4OFZ A;  1JNZ B;  4YHH J;  3CDB A;  2XO7 A;  4OYB A;  4WXO A;  2IMW P;  4UZC A;  4FP9 A;  3RUB L;  2V5H G;  1Y4Z B;  4RNH A;  2OSR A;  3OXL A;  2QZ8 A;  1JIH A;  3I5B A;  1NBE B;  3NWG A;  3DOL B;  3HCX A;  4RW8 B;  3W63 A;  3EJM A;  1XMQ F;  3MEE B;  1U47 A;  5F8J A;  3PIO Q;  4JI4 J;  4ES3 A;  1KNZ A;  3DLE B;  1Y7P A;  2N3L A;  2HFN A;  5HQL A;  3IGN A;  3P4U B;  2O3D A;  3RBX A;  5J2P A;  1TKT A;  3G8S A;  3RAQ A;  1N36 F;  1WDD A;  2HRT A;  4NXN J;  3ZTO A;  4TY9 A;  1PIE A;  1RCO B;  4RW9 B;  2ZH3 A;  2AJ4 A;  1VLO A;  1RAG B;  3DLK A;  1FXD A;  1MW7 A;  4MTP A;  1RB0 A;  2ZHB A;  1Q8L A;  1HNW J;  2DNY A;  4LSZ B;  1VBX A;  3V4M A;  4HI1 A;  4ECX A;  4KAI A;  2ZOM A;  4JP8 A;  3WQP A;  2HFS A;  4M5N A;  1M1H A;  1TMJ A;  1IJF B;  2LA6 A;  4P9S A;  4C8L A;  2HHU A;  2WTF A;  4LJM A;  1YJ7 A;  4EYI B;  2VC0 A;  2QTW A;  2BJD A;  1VQ7 S;  2UUB F;  1SL2 A;  1VQ5 S;  3OJU A;  3BBF A;  4ZPD A;  2CJX B;  3MF5 A;  1WEL A;  1H72 C;  2CNN B;  3MED A;  1BWE A;  1RAF B;  1RHM B;  3BV8 A;  2B56 A;  4IR9 A;  1VMB A;  1HBM A;  3OUY B;  4WK1 A;  1TL3 A;  1NJZ A;  3MCS A;  1OSC A;  1WDT A;  4OJH A;  3PO5 A;  2KXF A;  1UW4 A;  1VYA A;  4BHQ A;  3D67 A;  2AV5 A;  5KFJ A;  4LF6 F;  1HBO A;  2AQ4 A;  4RLE A;  1RWO B;  1R8C A;  2Q1L A;  2Y0B B;  4I1T A;  5DS7 A;  1W2I A;  5T14 A;  4YHH F;  2GW8 A;  4KHP J;  2CQ4 A;  1XER A;  3HKW A;  3Q23 A;  1CJT B;  2BAN B;  2HHS A;  4WWS A;  2DHX A;  3QT8 A;  2VBY A;  3TA0 A;  2MGZ B;  4J9O A;  2DTJ A;  3CD7 A;  3DRS A;  3OR2 A;  4KB7 A;  2VKR A;  4OI3 A;  1Y3K A;  4PAA A;  3CJ5 A;  3W5Y A;  5KFQ A;  1JMT A;  1Y00 A;  5AJ3 J;  1W25 A;  3KDN A;  4JI1 F;  2WAQ D;  3AT1 B;  1S57 A;  3R7B B;  3BN7 A;  2DK2 A;  3QWP A;  4O4G A;  4Q8E A;  1JQG A;  2Y1L B;  2XNR A;  1KLM A;  2YKM B;  2ZH4 A;  2FTR A;  1R43 A;  3DC2 A;  4L3K A;  2JL9 A;  5CH7 B;  1HFE L;  2DEJ A;  5KFH A;  4JI8 J;  2HGM A;  2RQC A;  4OJ1 A;  2HLT A;  3CJS A;  4CT9 A;  5KTQ A;  3HHE A;  2K06 A;  4O3P A;  4NCG B;  3DU6 A;  4DL7 A;  1KHV A;  1L5U A;  1SH0 A;  1XR6 A;  2J9C A;  3DRX A;  4NZ7 A;  2GIR A;  1PBA A;  5HK4 A;  3WIV A;  1K8A T;  3AHP A;  1CJU A;  5K20 B;  1HBO B;  4RWX A;  5D77 A;  2LXF A;  3RW6 A;  1FNX H;  3G87 A;  1NM2 A;  4GKJ F;  1Q53 A;  1Y11 A;  2HG4 A;  3PNI A;  3I82 A;  2V4Q A;  4K4Y A;  4JYA J;  1IKY A;  2YPY A;  2A0F B;  4EMD A;  4NX9 A;  4ZN3 A;  2EW9 A;  1SJR A;  3BSA A;  4ZVE A;  2HLU A;  4BWM A;  1RT7 B;  1LK7 A;  2MPU A;  3AXM A;  5AXM A;  4ZLL A;  3PX0 A;  2OIH A;  3R5D A;  2FLL A;  4TLR A;  1XR7 A;  4DV5 J;  2QT7 A;  2MQO A;  1QAY A;  5JXS A;  1H3D A;  4KGX B;  4GC7 A;  1VS3 A;  3DYA B;  4B3R F;  1M0S A;  1SC3 B;  4OMF G;  4ED0 A;  2WW8 A;  3O5T B;  2CJB A;  2PE8 A;  2X7I A;  1UTA A;  3K17 A;  2WZ1 A;  3R1L A;  4DCJ B;  1JXE A;  3K8W A;  3ZZZ A;  3GJR B;  2O67 A;  2ASJ A;  2R8G A;  2YNH B;  3D5M A;  4Y00 A;  4URG A;  1VHI A;  3TJ9 A;  3MMB A;  3HSJ A;  3FQL A;  5G0R A;  2Y1R I;  1OSD A;  3UN3 A;  1FJG J;  2H5E A;  4GKK J;  4IO9 Q;  2OJ3 A;  3RRK A;  3DHW C;  5F8L A;  4NLS A;  2ZBP A;  3P8B B;  3NWR A;  2PA8 D;  3POT A;  4DV5 F;  5D0H A;  2ZH1 A;  5DGB A;  1Z2Z A;  2KI2 A;  4WU3 A;  1TK5 A;  1AW0 A;  2RAQ A;  5AXK A;  3KLH A;  5E41 A;  2C3Y A;  1I1G A;  4BCA A;  5IS2 A;  3MFH A;  3VR1 A;  5K8O A;  1WSV A;  3FFI A;  3VGT A;  4X4R A;  2CJQ A;  4WPA A;  1U02 A;  1JXL A;  2BKP A;  4Y3C A;  1SKW A;  3BBB A;  1N5Q A;  5KFK A;  1HNW F;  1I3O B;  2BJ7 A;  4ED1 A;  2GV1 A;  4H4M A;  1T11 A;  3CC2 S;  2XC9 A;  1HNV A;  2JLG A;  2YX4 A;  1NK7 A;  1IXK A;  2OP5 A;  4TU8 A;  4L73 A;  2Z8Q A;  4ZVT B;  1Q7L B;  5LT5 A;  1M5H A;  3MM6 A;  2AYM A;  5J2Q A;  3GCX P;  2BJE A;  1JKH A;  2IVY A;  3PYF A;  4WFN Q;  5A2Q U;  5IV3 A;  3K5M A;  3RBD A;  4WYL A;  4KH1 B;  2GGP A;  3F73 A;  4RUA A;  2GO8 A;  5C7P A;  1TU0 B;  1JLB A;  2BXJ A;  2PMZ D;  4YEA A;  5ETR A;  5IC6 B;  3SCL E;  1X8D A;  5HO4 A;  3THT A;  1GNK A;  2KM8 B;  4F4Z A;  3R1H A;  3T9Z A;  2H3E B;  2VQE F;  4M5D B;  1IWA A;  1D09 B;  1FO1 A;  2WVC A;  5C24 A;  3SMZ A;  5L38 A;  4YB6 A;  1Q86 T;  4KKO A;  5K14 B;  5CA5 A;  2NZ4 A;  5B0C A;  3OJS A;  1U1Q A;  1RBL A;  1SB6 A;  3LP2 B;  4C9D A;  4IDK B;  4B17 A;  3TAP A;  3LTO A;  5A8W B;  4B9S A;  3I32 A;  4U96 A;  3GSD A;  1RT1 B;  1BHN A;  1U48 A;  3ZXW A;  3W2W B;  4DV7 F;  4XPE A;  3KJF B;  3NGU A;  3OLB A;  2KRB A;  2YX7 A;  2IRU A;  2Q6B A;  4DPU A;  3W5X A;  5G4D A;  3UFC X;  1CJV A;  5EGY A;  2R2U A;  4I6Y A;  2KO1 A;  5IT4 A;  3FSY A;  3I0R B;  3CXC R;  4LVN P;  3D2W A;  2E5L F;  5B09 A;  2XMU A;  4A8X A;  4K4X A;  2HMI A;  1H2V Z;  2JFK A;  3CIZ A;  2GIF A;  1BD6 A;  2W2P P;  3LGN A;  4MFB B;  2BZ2 A;  3LWM A;  1HQU A;  2RU3 A;  2B8P A;  3VGU A;  4ED8 A;  1HL6 A;  1CJK A;  2D9O A;  3Q8Y A;  3SCK E;  2XCA A;  1S0V A;  4LF9 J;  2BAC A;  3QRP A;  2CPY A;  1WWH A;  2C3M A;  3QIP A;  2B5J B;  4UTG A;  2DH7 A;  2OPP B;  1R0A B;  2WOM B;  4DR3 J;  2CIM A;  2ZUA A;  2BJ8 A;  1FKA F;  2VDI A;  3QID A;  3A4T A;  1Q0N A;  3G82 B;  3ZNU A;  4V19 X;  4DBQ A;  2AEM A;  5SZT A;  2OMO A;  3ETO A;  2Z58 B;  1JLE B;  3E3X A;  4OYX A;  2WK4 A;  2DXF A;  1KD1 T;  2W9B B;  3LP0 A;  2M8H A;  4NML A;  4O4R A;  1IKW A;  3TAQ A;  1X5T A;  3D28 A;  3N0V A;  3ITH A;  1UVK A;  3IA0 A;  3CDE A;  5A8K B;  1CEZ A;  1JLC B;  4HR2 A;  4DR4 J;  1F3F A;  5H9F J;  5KFD A;  2I9S A;  1X4D A;  2CDQ A;  3IR6 B;  4HLB A;  4F3Q A;  4RW4 B;  3V81 A;  1S0M A;  2W2M P;  5D4L A;  1XMO J;  2GAH C;  2OPR B;  3Q8P B;  2ILZ A;  1TKX B;  3OL8 A;  2MSS A;  2WSF C;  3DLK B;  3DRR B;  2KFY A;  4I6W A;  3MFI A;  2AU0 A;  2JSX A;  3R5A A;  4XDD A;  1JLQ A;  3SXL A;  3CF5 Q;  3MWB A;  2GMH A;  4OYA A;  5BYQ A;  2CQI A;  4CH7 A;  5J2P B;  4IOB A;  1YZ7 A;  3K7R A;  3IMQ J;  2EC0 A;  3OTD A;  2VON A;  4CO3 A;  1S1W A;  2M8D B;  1AT1 B;  1G6B A;  3S6E A;  1TZ0 A;  2AWZ A;  2RIL A;  3JAM U;  4K4V A;  3MPV A;  4XTT A;  3EVW A;  2XI2 A;  1YBA A;  1IR2 A;  3EGW B;  1S9E B;  3ULH A;  3ELH A;  2XLI A;  1OPZ A;  3LPE A;  3BN4 A;  1XMO F;  4ZP8 A;  1VQK S;  3VZH A;  3KHG A;  3JTP A;  2EFQ A;  2JVR A;  1FEE A;  4B3M F;  1H98 A;  3DDN A;  5FDL A;  2UXC F;  3F44 A;  2D3Z A;  3MTK A;  1DUR A;  1OY6 A;  3CO9 A;  2NXE A;  1HNI A;  2KXN B;  3TX0 A;  3DRP B;  3JB9 k;  1EJ7 L;  2PEH A;  3KK3 B;  1C0T B;  3J7A 1;  5LM7 E;  2CNO B;  2LKZ A;  2AIR B;  1HQ2 A;  1HI0 P;  4JI6 J;  1ZPV A;  3HP6 A;  4P10 A;  4DV7 J;  4KGV B;  3EMT A;  2B4P A;  2QL5 B;  1W7W A;  2HFV A;  4ZLP A;  1HW8 A;  5IQ6 A;  3RU0 A;  3V4I A;  3P45 B;  2XLK A;  3MPU B;  4J9K A;  4LVO P;  3BKF A;  5CQG A;  3M8W A;  4C7Q A;  5HJY A;  1EET A;  1M5P C;  2BE2 A;  3MEG A;  3FK4 A;  4ZPT R;  2DHS A;  4HHJ A;  1FNO A;  4LRC A;  1M5K C;  2A1B A;  3GIJ A;  5F8N A;  4PXB A;  4NAS A;  4WFB Q;  2V2K A;  1N34 F;  1PC4 A;  1WHY A;  1U6Z A;  3R9L A;  1UKU A;  4B9N A;  3C6T B;  3PAC A;  4JI5 F;  2KL8 A;  1K0T A;  3UQS A;  4CLZ A;  2Z2M A;  2YPZ A;  5AE1 A;  2H48 B;  4L74 A;  3G86 A;  3QAU A;  3SFU A;  3L09 A;  3PFO A;  4WE1 A;  4LF8 F;  2AHO B;  3NOG A;  5HBM A;  2CQ2 A;  2XS7 A;  5KT4 A;  5CCL A;  3BGR A;  1F9E B;  1NPK A;  2OPQ A;  1KLN A;  4JI2 F;  4P7T A;  3TI0 A;  2B7B B;  2DGU A;  2QEX S;  4Q0B A;  3HHK A;  1CC8 A;  2DGV A;  4PG7 A;  3JSM A;  1LW2 A;  2AD9 A;  4M1K A;  1SV5 A;  5KT5 A;  2PMH A;  3DOK B;  1TKX A;  2YH1 A;  4JI3 J;  3R2C J;  1ZOT A;  2JWN A;  2ROG A;  3ZZR A;  1Y10 A;  4MJK A;  4ZCL A;  4KJI A;  3MUM P;  3HMJ G;  1JLG B;  1ZET A;  5KFY A;  1YTY A;  1S97 A;  3TNV A;  1N6Q B;  3PW2 A;  4CLK A;  2AYG A;  1O51 A;  3LOU A;  4DR5 F;  3UCZ P;  2HND A;  3OXG A;  5F8G A;  1HPZ A;  2H4Y B;  1U0S A;  5AE3 A;  5B7W A;  3KLV A;  4EBE A;  4DF4 A;  3M30 A;  2J9E A;  2YKO A;  3B54 A;  2FJE B;  1YVF A;  3PRB A;  2PA3 A;  3IBW A;  4DV0 F;  3NGR A;  2GNK A;  3VQT A;  2E5H A;  2ZBI A;  5ETO A;  2ZC4 A;  1DTT A;  1LK5 A;  2MST A;  2RE1 A;  5B0D A;  2IDE A;  4F4A A;  1H7X A;  4U8Y A;  1C2P A;  1YJ9 S;  4X62 J;  2KYX A;  3KLE B;  4PQU B;  2XG8 A;  1XQI A;  3N6N A;  4IH6 A;  2QA2 A;  3NRB A;  4NYZ A;  4F4W A;  4MFB A;  1UVM A;  1RGV A;  3GV8 B;  4I0W A;  2I0X A;  3D1O A;  2AYE A;  3OR1 A;  2F40 A;  3VZI A;  2HIQ A;  4EFA C;  5A76 A;  2WSE C;  1I5O B;  4PPD A;  5E5N A;  2HBR B;  4CNZ A;  3KXD A;  4IG3 B;  5C25 B;  9ATC B;  4DHV A;  4DL4 A;  4OZN A;  4IUF A;  2XNQ A;  4LF7 J;  3KFW X;  1VBY A;  1FJG F;  1X4B A;  3M2R B;  3PJX A;  4NYP A;  1N56 A;  4ECV A;  1BLU A;  3PDN A;  3UD3 P;  3GSI A;  4YR3 A;  4JI4 F;  1J5O B;  4N8O A;  3V5R A;  4IG3 A;  4QWD A;  2J0X A;  3K0J A;  4DX5 A;  5BXI A;  3DI6 B;  3FCH A;  1TV6 B;  1H2U X;  5KFN A;  1KFS A;  1SH2 A;  1TKZ B;  3SQO P;  2XCP A;  1UA0 A;  2FJV A;  2W7A A;  4YME A;  3MCN A;  4C0O C;  2CPZ A;  2V67 A;  3WZ0 A;  3RR7 A;  4H4O A;  1PJ5 A;  3GE9 A;  1OS5 A;  1UJ5 A;  5L8R C;  3LAM A;  1B0P A;  4ZJQ A;  4W92 B;  1FE4 A;  1FCA A;  4KBI A;  4WK3 A;  3MPY A;  2CPE A;  2GGP B;  2QA1 A;  2V94 A;  1DJ0 A;  3QLH B;  5L1L A;  2PI4 A;  2Z56 B;  3TZX A;  3M8P A;  3MPW A;  1LFW A;  2VKZ G;  1JJC B;  3K5N A;  3H5S A;  1SC6 A;  3MAA B;  2DH8 A;  4M5J A;  2PN6 A;  3R5J B;  5CZX A;  2PEB A;  2GMJ A;  1RAH B;  4MT1 A;  2PT0 A;  1FRK A;  2CAD A;  1DZ5 A;  4Y2M A;  1S6O A;  1DLO A;  1RT4 B;  5EUH A;  2M0G B;  3IAM 9;  3TYT A;  2XQC A;  1JX4 A;  4CP5 A;  1EQ0 A;  2BV3 A;  2HNZ A;  5F41 A;  3CUN A;  2ZDO A;  3C15 B;  1JLG A;  1D9D A;  1S9G A;  2GJI A;  2YQ0 A;  3OVA A;  4EZ9 A;  2UVV A;  1XNQ F;  1VFJ A;  3WHI A;  1RA7 A;  2PFD A;  5DJB A;  4LF1 A;  4ZLN A;  4ZP9 A;  2VJU A;  4JI0 J;  3FFI B;  1RUS A;  3OFE A;  1RWM B;  2VG5 A;  1M5S A;  3MPD A;  5KFB A;  3VAK A;  4DR2 F;  3FZB A;  4CH0 S;  3SIP B;  3G96 A;  5A6W A;  4GO7 X;  1NJX A;  3ZC4 A;  4JI1 J;  2XHC A;  2QMW A;  4DL5 A;  2E9T A;  2FZK B;  4NLO A;  2QX0 A;  4ZVH A;  1D8Z A;  4C48 A;  2E1A A;  1FER A;  2HHV A;  2L08 A;  1AB8 A;  2P2C B;  2LU1 A;  2XMW A;  3BRE A;  2XZT B;  3M2U A;  4AT1 B;  4WFA Q;  2JZ5 A;  1QAI A;  1LNQ A;  2DHA A;  2HQ3 A;  5HP1 B;  3R27 A;  1S76 D;  1XK8 A;  1FRL A;  2BQ3 A;  2DGS A;  3ONQ A;  1NO8 A;  4C98 A;  5HSP A;  1MG7 A;  1V3R A;  1VRU A;  3GJQ B;  4C0B A;  1WC3 A;  2ADB A;  2QMX A;  3CED A;  3QGI A;  2RHQ B;  3BB5 A;  2M3D A;  1U26 A;  5HP1 A;  3JQK A;  2HBY B;  4O3Q A;  2HVH A;  1HLW A;  1RT6 B;  2BRL A;  4LSN B;  1D3W A;  3BJY A;  1MWY A;  4K5R A;  4USM A;  4NZ0 A;  1BQX A;  2DYA A;  1UFL A;  3GV7 B;  1Z1Z A;  2A6M A;  4USK A;  1VIO A;  2IC3 A;  4USU A;  3CCE S;  3TAR A;  4IOC Q;  5KG2 A;  1F0X A;  1UAW A;  2VPW B;  3I9Z A;  4R0E A;  5HQM A;  1YIJ S;  3QT5 A;  2HHX A;  3FEY B;  2MKC A;  4Y2I A;  2DR9 A;  3TWZ A;  3M05 A;  4UY8 T;  4ANC A;  4B3R J;  1KVI A;  4DFK A;  3BSC A;  1F6T A;  3GTY X;  2G9O A;  5J2N A;  4DPX A;  3MR3 A;  2VH7 A;  3DGV A;  3FVY A;  3M8Q A;  4IG0 A;  2ZH8 A;  3PV8 A;  5HVG A;  3VAM A;  2DEI A;  3W65 A;  1U1N A;  2L41 A;  3Q8U A;  4TVA B;  3M6X A;  4WTY A;  2VAS A;  3MUT P;  1IR0 A;  4USV A;  3KJV B;  3DRP A;  2E5I A;  3V6J A;  5KG7 A;  1FTC A;  2CYY A;  4NLY A;  1LWC A;  4W4M A;  4PKD B;  5F8H A;  1CSJ A;  3Q89 A;  4MKB A;  4Z2X A;  2J7U A;  1UW9 A;  2Y0S D;  5LMU J;  4ECY A;  3GJT B;  5D78 A;  1NDP A;  1WF0 A;  1FRX A;  5KG3 A;  1HWI A;  4E98 A;  4OYM A;  3CD6 S;  2XEX A;  2CQ1 A;  5IFM A;  1N5Y A;  3D3B J;  3SDE A;  5IT9 Y;  2FJA B;  1RHR B;  2EWH A;  2KU7 A;  4OZ5 A;  3I0S A;  3SCJ E;  3TVK A;  2ASD A;  2Y8W A;  3W1Y C;  2YVS A;  2AYB A;  5HL7 Q;  2DBB A;  3QWU A;  4UUW A;  3CTR A;  2DCU B;  1KSP A;  3K2Y A;  4FVC A;  4ICL A;  3AJD A;  2MGZ A;  4ID8 A;  1O0P A;  2LMI A;  1YK9 A;  4I56 A;  5T7L B;  2RD5 C;  1B64 A;  3CJ3 A;  2IAJ B;  3MM9 A;  2R8I A;  1FNM A;  3OL7 A;  4LF4 J;  8AT1 B;  1RWU A;  1RTJ A;  2VB6 A;  1JLQ B;  4J91 A;  5AJ3 F;  2DNG A;  2VPY B;  4FXD A;  2XSJ A;  2G1H A;  4ELU A;  2ZZN A;  2V9K A;  1IN0 A;  1QM9 A;  5B0A A;  5KT7 A;  4EEY A;  2J0Q D;  4I67 A;  1VJQ A;  3HHL D;  2N4D A;  1UJ6 A;  2M52 A;  1U8S A;  1UET A;  3LGM A;  2VFT A;  1FK9 A;  2MHN A;  3HHL C;  3TZW A;  3G8T A;  3RGI A;  1JLC A;  3C14 A;  3B4M A;  2DD8 S;  1RLC L;  3HHL B;  5D3G A;  1N33 J;  2UUW A;  3OL6 A;  1NDC A;  1PSD A;  4R5P A;  2Z30 B;  3NS7 B;  4KSE B;  4QIV A;  4USJ C;  5M2R A;  1MRO A;  4DF8 A;  1U1M A;  2KFN A;  5LXR A;  4O0I A;  3RYL A;  3D0H E;  2JRS A;  1VBZ A;  2NXU A;  4TU9 A;  2FHK A;  2W2N P;  4PCQ A;  3ZZP A;  4FXW A;  1UFW A;  4RUH A;  3C8Y A;  3MI7 X;  4ED2 A;  3DM2 B;  4LFA F;  1VQY A;  4YY3 J;  1VQO S;  3QAT A;  4JI7 F;  2W4D A;  1S6Q A;  2BJ3 A;  2C2N A;  2W1B A;  4RW7 A;  4K4W A;  2E7W A;  1FD2 A;  4RU9 A;  2EXU A;  3KLF B;  4FXV A;  1Q8I A;  1S1T B;  2UUA J;  3P96 A;  4QZV B;  4ZDN A;  2DJW A;  2VHG A;  2EFP A;  1DQ9 A;  2RQK A;  3H25 A;  3BGO P;  3FDS A;  2HVZ A;  3BKT A;  4NLQ A;  2HMI B;  1RLD A;  1GQE A;  1RT2 B;  3DKD A;  3UVJ B;  2M7S A;  1PGZ A;  4K4S A;  1TQL A;  4FYY B;  1PJ6 A;  3WDO A;  4M8L A;  4DV2 J;  1OWX A;  1T94 A;  2XBP A;  3U7J A;  2K2P A;  3DOL A;  1OPI A;  4RW8 A;  2CJ9 A;  3R7S B;  1RT3 A;  1MU2 A;  1HD0 A;  3FBC A;  4UF4 A;  2HS4 A;  3UCU P;  3ICL A;  1U0H B;  3M9O B;  1LXN A;  2DY1 A;  2NYI A;  1CS4 B;  3PM9 A;  3VAF A;  1FVQ A;  3M32 B;  3QO9 A;  3PW5 A;  4XDC A;  1P9Y A;  5EX0 A;  2FC8 A;  1AFJ A;  2HGN A;  1KWM A;  2KJV A;  2W2O P;  3O3L A;  2D41 A;  3PHT A;  2BJ9 A;  5D0G A;  1S1V A;  4X4S A;  2ZH2 A;  3J7Z T;  1U2R A;  1V5I B;  2BM1 A;  1XBW A;  1OYE A;  5HVH A;  3HK2 A;  3HFK A;  1T0T V;  3HJV A;  3TJA A;  3CME S;  2MQP A;  4C8Z A;  4ZOS A;  5HLF A;  2ZNZ A;  3BGR B;  4M5L A;  2FD2 A;  2OGU A;  4EI2 A;  4UOG A;  2HFZ A;  2DNP A;  4LR8 A;  2J6S A;  3DLB A;  3J81 U;  2EG2 A;  3AY0 A;  1YBU A;  1H73 A;  2BOP A;  1S99 A;  4ZN1 A;  4CLU A;  4NEZ A;  1S0N A;  2UUB J;  1VQ6 S;  4QJV A;  3TX8 A;  1ZM4 A;  2E7V A;  2RKI A;  1KHW A;  2B4O A;  1N5T A;  5LMN J;  2MTL A;  2PII A;  5HVF A;  2CQP A;  3T9N A;  2BW2 A;  3K57 A;  4DV3 F;  4I69 A;  3SQG A;  1X4G A;  1VRT B;  1VK3 A;  4IQM A;  4TU7 A;  3IC1 A;  2XM3 A;  2V8P A;  3N6M A;  2FUG 9;  4WFY A;  5GME A;  3W64 A;  4DUZ F;  3J81 j;  1HQE A;  2ATL A;  2ATC B;  2ZWO A;  3KLI A;  4UOF A;  2G4B A;  1DHM A;  2BE2 B;  3D0I E;  4DV1 J;  3EDR B;  2X1A A;  2DPJ A;  1N36 J;  2J9D E;  1OY8 A;  4NRU A;  4EO6 A;  3MEK A;  2UUT A;  2B8Q A;  4O3N A;  2XYH B;  3CCL S;  3IRX B;  1VIS A;  2FC9 A;  5J2N B;  1RHK B;  3VAG A;  4MK8 A;  4DV6 J;  2B43 A;  2CAJ A;  2GQQ A;  5J2M A;  4X4P A;  3CCQ S;  2KZZ A;  4CQ1 A;  4G1P A;  1ZM3 A;  2B7C B;  2C2Z B;  2EKN A;  2K7K A;  4C3L A;  4U6P A;  3MR5 A;  3LH2 S;  1Q4R A;  2IC3 B;  1P8G A;  2F8E X;  2V9W A;  1U8W A;  2R7Q A;  3DN9 A;  3MM5 B;  2CQH A;  4LFB F;  1YG0 A;  2QA4 G;  4B9V A;  4WII A;  5HMZ A;  3CCR S;  2X51 A;  2PFF B;  5DLF A;  4CI0 B;  3G6Y A;  5IT9 U;  2FDN A;  1PJ7 A;  3QNW B;  2W7O A;  1N32 J;  1PG5 B;  1B0V A;  2VPZ B;  1EP4 B;  2EK1 A;  3QGH A;  2WB1 D;  1AYE A;  1V3S A;  4FNI A;  2YNH A;  4MKV A;  4I7F B;  4P74 A;  3UE2 A;  4NXM J;  3GV5 B;  2V4J B;  3PX4 A;  2WBM A;  1YLX A;  1SC1 B;  2BQR A;  4KT0 C;  3H4D A;  2RRN A;  2JEF A;  3M2U B;  1X4E A;  2E1R A;  3CT9 A;  2IBO A;  3H40 A;  1TL7 A;  3LF0 A;  3RJM B;  1AUD A;  3W8P A;  4O44 B;  2LEC A;  3CNQ P;  1WTB A;  4P72 A;  1LWF A;  4TYB A;  3DRR A;  3HSG A;  3C6U B;  2ZNY A;  3NNA A;  2J9D A;  4A46 A;  4YUD A;  1PAU B;  3PJW A;  4OZ2 A;  5DG8 A;  3DCA A;  1XWL A;  3GJS B;  3ILI A;  3HVT A;  1PYS B;  2I5J A;  3TQ1 A;  3GG0 A;  2DPI A;  3A8J A;  4QWC A;  4RUB A;  1SIW B;  1WHX A;  2M2B A;  3O44 A;  1WOO A;  4WP3 A;  4WCE Q;  4AL6 A;  1QTN B;  1TK0 A;  4QYZ J;  2EFG A;  4DG1 A;  2ZJQ Q;  1RP5 A;  2MLY A;  4NOH A;  1RAA B;  5LSR A;  2P5V A;  5GAH I;  1WEZ A;  1I94 J;  2IBK A;  2QC3 A;  4P52 A;  1ZA2 B;  2NCK L;  1HWU A;  5JMN A;  1UFK A;  4CT8 A;  2QL9 B;  1GTE A;  2W01 A;  5ITH A;  3CJK B;  2VU5 A;  2GVZ A;  2OHD A;  1N88 A;  4ZP6 A;  2IM2 A;  1VR6 A;  2O5D A;  2GHW A;  3OHB A;  5F3Z A;  1C1B A;  2X3G A;  2EEY A;  3HI9 A;  3VAI A;  4OZJ A;  4NXM F;  1F2H A;  1Q95 G;  4USH A;  2VFV A;  1P27 B;  1TL5 A;  1HBU A;  2H65 B;  1VIX A;  3A13 A;  3T1A A;  2M70 A;  5D6G A;  2VJV A;  1RYR A;  2J0S D;  5T7L A;  2HQF A;  2WBR A;  4DPW A;  4ELT A;  3K5O A;  2MKY A;  1W26 A;  3DI6 A;  4L76 A;  4UQT A;  2DT9 A;  2XO6 A;  4NLG A;  2OFH X;  1A7G E;  1PYO B;  2OEK A;  1QAX A;  5ETV A;  2YKN A;  2FHM A;  4I2P B;  3TAM B;  4C4W A;  5CD4 H;  4B3S F;  2FIU A;  2P6T A;  1X60 A;  2MJU A;  5FII A;  3JAM Y;  1QUP A;  4BLG A;  3I96 A;  3IM8 A;  4X64 F;  4MK7 A;  2AX0 A;  4HYK A;  2DIV A;  4DV6 F;  5E7O B;  4MMO A;  1ACM B;  1X4F A;  3NGD A;  1OO0 B;  1FF2 A;  2OML A;  2YKA A;  5DQI A;  1ZTW A;  5IZH A;  1N0U A;  4GKK F;  4I6A A;  1NDK A;  1LWC B;  3BGL A;  4KGZ B;  1K73 T;  1L3V A;  6AT1 B;  3D1Q A;  1URR A;  4Q7A A;  3KHH A;  5AE2 A;  1BQM B;  4DV0 J;  3GFZ A;  4RPF A;  2UXD F;  2F7V A;  2VQF F;  4DUZ J;  4YFU A;  3WC2 A;  1FWP A;  1JLF A;  2VIH A;  5CYQ B;  2NLW A;  2W4C A;  4PG8 A;  1RTH B;  3PW0 A;  4PG5 A;  1NK0 A;  2HHP A;  4ED7 A;  2G0I A;  2RHS B;  3LAN A;  4CLF A;  4WP8 A;  3UNG C;  4OZL A;  1TL1 A;  5KFS A;  1TP7 A;  1L3U A;  3PW7 A;  3R6L B;  2KRR A;  2PC6 A;  2WON A;  3CW2 C;  2BR0 A;  4LBP A;  1ELO A;  3E01 B;  1S5Z A;  4ZP7 A;  1F2G A;  3BR8 A;  1HIY A;  1J5E F;  1EKR A;  1NXI A;  1RT6 A;  4LSN A;  3SFG A;  2DNZ A;  1Y3J A;  4U95 A;  2H51 B;  3M7V A;  4M63 A;  1M90 T;  3D9B A;  2HPU A;  3GIR A;  1GMW A;  1RA6 A;  2HZA A;  2V4J A;  3U02 A;  3KYL A;  4QIF A;  4PWU A;  1IBK J;  2FZG B;  5D4P A;  4M5K A;  1NH8 A;  2GIQ A;  4FNH A;  3FGV A;  5KT3 A;  4NLX A;  4WTO B;  4NYO A;  3UR3 C;  4PXD A;  4R25 A;  2V4R A;  2V50 A;  4Q8F A;  2VFS A;  2VBW A;  4DR1 F;  4C8N A;  3EE3 A;  4RNF A;  5DG9 A;  1G3O A;  2ZFH A;  1PCA A;  7AT1 B;  2F4V J;  1FKO B;  3POT B;  1GT8 A;  1NSA A;  3NAI A;  2V0N A;  4ES1 A;  4N5S A;  3S01 A;  2D74 B;  4G1Q B;  3DHX A;  1FRH A;  2VOD A;  4CWB A;  3RAM A;  4DLG A;  3PYE A;  1KRP A;  2JNJ A;  2VF3 A;  2ADC A;  4Z7C A;  3L7U A;  5ETP A;  1R27 B;  4TY8 A;  5DQG A;  5J2M B;  1NJY A;  2DGQ A;  3VAJ A;  2BEF A;  2DRD A;  2W2Q P;  5DDO C;  4OI2 A;  1SPB P;  5AXL A;  2ZHA A;  1LV5 A;  3R6G B;  4RBV A;  3N6L A;  3T1H J;  2LXI A;  1S9G B;  1H74 A;  3AOD A;  1VQ9 S;  2CDR B;  1SKS A;  4LFA J;  2L9W A;  2HYI B;  4IYQ A;  3OHA A;  1KP6 A;  2IJF A;  3P6Y C;  3DOM B;  5BR8 F;  3DDK A;  1AZS B;  2B4V A;  3IP0 A;  1S1X B;  4X65 J;  3RG6 A;  5A8R B;  5KOW A;  1NPP A;  3MM8 A;  1SI9 A;  4WU2 A;  2FVP A;  1QDU B;  3PVX A;  2VG7 B;  1RWV B;  2ZKU A;  1SC4 B;  2V8D A;  4CLS A;  2CPJ A;  1TVR A;  3HDS A;  2Q3P A;  3OTE A;  1XR5 A;  5F0W A;  3AOA A;  5H1S V;  5LMU F;  5I42 A;  2DRA A;  3M6U A;  2A10 A;  1BUX A;  1JXV A;  2SXL A;  3GON A;  1AFI A;  3ILL A;  5GMD A;  4D3G A;  1VRQ C;  3PY8 A;  3NCP A;  4OYP A;  3QJP A;  3KWM A;  3KK1 B;  4PAB A;  3THV A;  4DV1 F;  1Y9O A;  1B99 A;  4K4U A;  1LOU A;  4LUB A;  1Q79 A;  4IFY A;  1AXQ A;  2F8M A;  2VUG A;  2Y1J A;  2QLB B;  2I8E A;  4FVM A;  3CCU S;  3DLJ A;  3BGU A;  4DLE A;  1HNX J;  4LF8 J;  4ZPA A;  2Z4P A;  5IXU A;  1RT3 B;  3OTO F;  4U7C A;  1IBC B;  3HZE A;  3M1V A;  4ERD A;  1R89 A;  3RR8 A;  2RUG A;  5DDR C;  3W66 A;  1F60 B;  1RDR A;  1KR4 A;  1Y0H A;  2B6A B;  2RJZ A;  4DMZ A;  5C25 A;  2R2S A;  2R2T A;  4DR2 J;  3BH7 B;  3CC7 S;  3Q8Q B;  3OW2 R;  2DNQ A;  2HHT A;  3MXH P;  5J1N A;  4ZJL A;  1CJT A;  2BAN A;  1NJI T;  1J2V A;  3IR5 B;  1UEK A;  3ZTS A;  1HAR A;  4WIQ A;  2FJB B;  4JOU A;  2XLJ A;  3CDA A;  2C28 A;  3C2P A;  4FYV B;  2CQD A;  1RTI B;  4GRS A;  4O23 A;  3TQE A;  3HHN B;  4PQU A;  5E3P A;  3QT6 A;  2V69 A;  3EXY A;  1DTQ B;  4I64 A;  5ETS A;  5L1J A;  2J8A A;  2K7J A;  1DTT B;  1RIS A;  1Q1K A;  2CPF A;  2ZHO A;  3JSY A;  4YN3 B;  1WKL A;  1T9V A;  3UO0 A;  4DEZ A;  4RNN A;  4EYH B;  1CPZ A;  4LT6 A;  1E6Y A;  3CCZ A;  4L75 A;  5MLC V;  1BE4 A;  3M30 B;  1XIQ A;  3DOM A;  3DRY A;  2AT1 B;  4ILR A;  3QAE A;  2YNG B;  4PXC A;  4JUZ A;  5DQH A;  4ZPV R;  3EZO A;  4ER8 A;  3AD8 C;  4LIR A;  2HND B;  1YJR A;  2HFO A;  2U1A A;  2V8H A;  4GVB A;  4DXL A;  1FWK A;  3CCV S;  2HHH J;  3HHL A;  2DHG A;  1WJ9 A;  4YP3 A;  4B9M A;  1O5J A;  4OL8 A;  3SBM A;  2W25 A;  4QR2 A;  3FKB A;  3HX9 A;  2E5J A;  3B4D A;  3LP1 B;  3M1V B;  4X4N A;  4OHZ A;  4PG6 A;  2MJN A;  4TY8 B;  2HHW A;  4NLU A;  2ZD1 B;  4I7F A;  3VWS A;  2Q43 A;  4RWW A;  4Q5V A;  4U8V A;  4AFF A;  3Q8R B;  3T5H A;  3HKZ D;  4NCB A;  2FLP A;  1ZAW A;  2XSJ B;  3MMA A;  5KT6 A;  1YDL A;  2QYG A;  5HI7 A;  2PO4 A;  5IWA F;  2DNO A;  3P3D A;  1TKT B;  2XUL A;  2OPQ B;  3F41 A;  1S1U B;  4JBC A;  2ZH9 A;  5DGA A;  5L39 A;  3D3C J;  3O2I A;  4YB5 A;  3KUG A;  1WHW A;  2Z0G A;  2DGT A;  2V6A A;  3QJL A;  3VF0 B;  4ZLJ A;  1VLY A;  3N5B A;  3PRV A;  1HMV A;  3W2V A;  4Z37 A;  1JWW A;  2XYP B;  1P9Q C;  2YNF A;  4WFX A;  3C6T A;  5SUH A;  3TAN A;  3KK2 B;  2KYZ A;  4L6V 3;  1NME B;  3W9H A;  4X4O A;  3IG1 A;  3EGZ A;  1GMW D;  3VVT A;  3ZZT A;  3SYZ A;  4ED3 A;  2ROE A;  1S1X A;  1HYS B;  2AJQ A;  1AZS A;  4Y28 C;  2N7C A;  1FDN A;  4UQG A;  2QJ3 A;  3NCQ A;  4PPZ A;  3HT0 A;  2RRB A;  2V68 A;  1N0V C;  1HYS A;  2L9D A;  4CDI A;  2ZIT A;  1WOP A;  2HBZ B;  4KY3 A;  4FBU A;  1JLA B;  1VGY A;  2H1Y A;  3UR0 A;  2C2D A;  2MZS A;  3M2V B;  2CFX A;  2MY7 A;  2HNY A;  3NBP A;  4URQ U;  3M8Q B;  4IG0 B;  3BO4 A;  4PRF A;  2YNF B;  1JLF B;  4QWE A;  1LXJ A;  4NLR A;  1Z2L A;  1KFD A;  4A47 A;  4BC7 A;  3QSY B;  3D68 A;  3MM6 B;  1WSR A;  4L3N A;  2CJA A;  4F02 A;  1TUV A;  3CMA S;  4M5H A;  4DR3 F;  4ECQ A;  1SIZ A;  2W8K A;  2FY1 A;  4HI2 A;  1C0U B;  5F9L A;  3AAW B;  3WC0 A;  1RTZ A;  2GZO A;  3T5J A;  2I6W A;  5D8H B;  4M5I A;  3KG4 A;  4DSF A;  2WVD A;  2YKQ A;  3TW0 A;  4ZKA A;  3I55 S;  2IIH A;  3TZY A;  1GMU A;  4DN9 A;  3GYX B;  4J9N A;  2JFD A;  5F8M A;  2MLZ A;  3GPA A;  4N7T A;  4O3R A;  2YKN B;  3DXS X;  3TAM A;  1A6L A;  4RZR A;  1LEO A;  4DSL A;  4ID5 B;  4ECU A;  3MTJ A;  2QRR A;  3C16 B;  3R5C A;  4Q2M A;  3R97 A;  1UP1 A;  1U24 A;  2DGO A;  3FBF A;  4FYW B;  1WD6 A;  2XTJ P;  2VFR A;  3E01 A;  4FYD A;  3E2E A;  3P5B P;  3UD4 P;  1UEV A;  2HZV A;  1CLF A;  4QYZ K;  1RJJ A;  4AL5 A;  4BS2 A;  5BR8 J;  4P2M A;  3UDC A;  1HI8 A;  1KS2 A;  1WC6 A;  1ZS6 A;  4U67 Q;  3PR4 A;  3AB2 B;  3AD7 C;  2VG6 B;  2GHV C;  3CCW A;  4DSJ A;  1UCN A;  1SJF A;  4OV6 A;  3OPK A;  5KG1 A;  2VG5 B;  2ABY A;  4AD6 A;  4K4Z A;  2DO0 A;  1PKU A;  2GVD B;  2HGL A;  9RUB A;  2L9N A;  4RW4 A;  2OTL S;  3EXC X;  3T6B A;  3MM7 B;  2Y9H A;  4ILM A;  3U27 A;  1RU1 A;  5D15 A;  4KV8 A;  4DX7 A;  2VBX A;  4DCP B;  4ZMM A;  1KC8 T;  3JS9 A;  3E8O A;  4P2S A;  5HMW A;  4KC5 A;  5L1I A;  1RTI A;  2OEL A;  1KBR A;  2Z2Y B;  3DYA A;  4RX6 A;  1YIT S;  2MQN A;  4NZ6 A;  4LFC J;  4G3I A;  2OUG A;  3TR5 A;  1QSL A;  4DU8 A;  4KQZ A;  1U2F A;  2LDI A;  1N5S A;  1V6H A;  1SUQ B;  3W62 A;  3M8S A;  3MUV P;  1JK9 B;  4M94 A;  1SBR A;  2B9Y A;  2XZW A;  4CIO A;  2GVD A;  1QUV A;  3C14 B;  2KH9 A;  2X1B A;  3PYD A;  4C8O A;  4WKR A;  1DTQ A;  2UXB F;  1WC4 A;  1H7W A;  2BX6 A;  2OPP A;  1ZAV A;  2RS8 A;  2BQU A;  3NGK A;  1M1G A;  3GYG A;  2GS8 A;  4FPI A;  3KMS A;  3NNC A;  4F0M A;  5ETM A;  3T1H F;  5KFX A;  3OLA A;  4HHH A;  4ETX A;  2DXE A;  1FXL A;  1FKP B;  2LYV A;  1TL4 A;  2D3U A;  2QFI A;  2A2D A;  2CNK B;  3EDQ B;  1AA1 B;  4G65 A;  4PZV A;  1UVL A;  2IAJ A;  3TVY A;  5KG6 A;  1P1L A;  2E66 A;  2MKS A;  1HBU B;  3S1T A;  4X64 J;  3NOC A;  3E51 A;  1L3T A;  1U45 A;  2MXY A;  3MGJ A;  3DDI A;  3B78 A;  2JEJ A;  2OKQ A;  4NE9 C;  1FRM A;  3TOQ A;  1D9A A;  5ADZ A;  1HNZ F;  2CQ3 A;  2AJF E;  2LU2 A;  5HRO A;  2E1P A;  3ILJ A;  2UV8 G;  5LXY A;  2CWX A;  4ZA1 A;  5EWF A;  2ZBQ A;  4FKY A;  4KFB B;  4QW9 A;  4XPC A;  1S0O A;  3JYT B;  3BZQ A;  4PYD A;  3CSK A;  2MQL A;  1G7C B;  3OT9 A;  1K1Q A;  4IFV B;  4OI4 A;  4OYZ A;  3S8S A;  1ZZN A;  1QAJ A;  2IYI A;  3AB4 B;  2RIJ A;  2HSE B;  5B0B A;  4FS2 A;  2I5J B;  5HAT A;  2H5J B;  1ZM9 A;  3MM7 A;  5LOQ A;  2C42 A;  2ZVI A;  2AW0 A;  3HUL A;  4LIW A;  4ETZ A;  3C46 A;  1RQ0 A;  1X4A A;  1FD8 A;  1KOH A;  4F26 A;  3UW1 A;  4QYR A;  4DUY J;  2VG6 A;  4OJ3 A;  1FT8 A;  1D9F A;  4X4V A;  2MQM A;  2ZBR A;  4Y2C A;  4LF5 J;  2RDD A;  5E3A A;  3J80 U;  3UN2 A;  3SSR A;  1T9U A;  5FJ4 A;  4LR7 A;  4B9T A;  1ZYQ A;  2IRX A;  2KHD A;  2FY8 A;  3THP A;  5IT0 A;  1NCL A;  1I51 B;  1R31 A;  1MMN A;  1U2C A;  5A0Y B;  2BVZ A;  3G9C A;  2UXB J;  3W2V B;  5IWA J;  2UVW A;  4B3M J;  2J8S A;  3I87 A;  2W8L A;  5KG0 A;  4HL9 A;  2MZ1 A;  1XNQ J;  2KFZ A;  1S7I A;  4OZ0 A;  1N52 B;  5F8I A;  3KHR A;  3IBF B;  1RU2 A;  3WX4 A;  4NWB A;  1S4E A;  4YY3 F;  4LFC F;  2Q79 A;  1BQN B;  3CJ4 A;  3LPY A;  3DU5 A;  1FDA A;  3QBC A;  3KLH B;  2FHO B;  2P6S A;  3W7B A;  2GJ2 A;  1XMQ J;  2GQC A;  2UP1 A;  2P9E A;  2R7X A;  2HHH F;  3CE8 A;  2LA4 A;  2G2Z A;  2OAU A;  4DPT A;  4OYW A;  3RBZ A;  4F04 B;  1TL1 B;  3NP5 A;  3C3L A;  2ZD1 A;  5CYJ A;  3BM7 A;  2DIT A;  3I4P A;  1U7L A;  3MEC B;  4ZS6 A;  3MMB B;  4ZCM A;  5DET A;  4CRJ A;  4J5O A;  5J1P A;  1X9S A;  4JV5 F;  3NG8 A;  2R2R A;  2LEA A;  2GC8 A;  2QSF A;  4G1I A;  1QSY A;  2D9P A;  2NSB A;  2CJY B;  4EBC A;  3K59 A;  3RAX A;  1UWB A;  4PYA A;  2F63 A;  1X5O A;  2JX2 A;  1HR0 F;  2K8G A;  3GCW P;  5BJR A;  2OH2 A;  1S6P B;  3I6P A;  5KFV A;  4LF4 F;  1DY3 A;  4ZPB A;  2QN6 B;  2MDA A;  2MQ8 A;  4UOH A;  3TUZ C;  5KFE A;  2ZEJ A;  1S10 A;  1KQS R;  1D1U A;  1NSQ A;  1B0T A;  3JQM A;  4BBY A;  2E5L J;  4RW7 B;  1MN9 A;  2X1G A;  2RU9 A;  4RNO A;  3KG1 A;  4RU2 A;  4LF6 J;  1IKX A;  4TYA A;  1T9Y A;  1EAR A;  1C1C A;  2XWY A;  2AEJ A;  4LQ9 A;  2Y1I A;  1IKY B;  3NCR A;  6FDR A;  2WCX A;  2X3D A;  3FRZ A;  1BQM A;  4J37 A;  3A8K A;  4IFV A;  4LRB A;  1OIA A;  1X4C A;  5EX3 A;  5M2U A;  5KFC A;  3HT3 A;  3ILO A;  1WKK A;  5FLX U;  1MNE A;  4F8R A;  1B7Y B;  4GC6 A;  4F4Y A;  4ZCI A;  1S1U A;  4U7U K;  2Z2Z A;  3GFY A;  5HLF B;  5HN0 A;  1TFW A;  2XZD B;  5D3G B;  3T5L A;  2QA4 S;  2KT5 A;  3LW5 C;  4OX6 A;  4NCA A;  2RVJ A;  4DPY A;  1IBM J;  1WF1 A;  3BS9 A;  4J9R A;  2DIU A;  4N77 A;  1F9F A;  4R8U B;  5J1E A;  3A3O B;  1FRJ A;  2DIS A;  3H4B A;  3N9U C;  2X1F A;  4IRK A;  3BGF A;  4MAK A;  2F65 A;  2G0C A;  4DDF A;  1U1K A;  4AUK A;  2V2Z A;  1K0V A;  4YOE A;  3CIM A;  4I68 A;  3MM9 B;  1S1W B;  2LQ9 A;  5E3Q A;  1S4F A;  1RT2 A;  3MR7 A;  2KXH A;  1GX5 A;  5B0G A;  4F50 A;  1X31 C;  3PRD A;  5ETL A;  1IJE B;  2XI3 A;  5KFI A;  1BWV A;  4DI6 A;  2R3V A;  2VD3 A;  2OEJ A;  3UWT A;  4ANE A;  4ECR A;  1VJW A;  2D3O 1;  1YJV A;  1ZA1 B;  3NAH A;  1REG X;  1O6X A;  1FDD A;  1NZA A;  2DNR A;  2VPX B;  3OFH A;  4CLY A;  3IRW P;  4FS1 A;  4ECT A;  4OHY A;  2CQ0 A;  4K2X A;  2BMB A;  2OPR A;  3T19 A;  1CBK A;  3SDE B;  4AND A;  4ENO A;  1S6Q B;  3LO3 A;  4TNO A;  1FI4 A;  2DY9 A;  4CO2 A;  3MR2 A;  2YX1 A;  1Q8K A;  3TA2 A;  4UT4 A;  3LAL A;  1N54 B;  4MIB A;  1NK8 A;  1R6V A;  2BDP A;  4DS4 A;  2GAG C;  5K5M A;  5KG4 A;  4DR6 F;  3NS5 A;  3TVZ A;  1LWF B;  1PIL A;  4DG1 B;  2HAF A;  3BQ0 A;  1HKA A;  3LP0 B;  2HK3 A;  3RB4 A;  2VC1 A;  4GVL A;  1RTD B;  1OMS A;  2F9D A;  2ILY A;  4OYI A;  1N48 A;  4PXE A;  3FEZ A;  2DR6 A;  4R5P B;  3BDE A;  4DR1 J;  1QVG R;  1URN A;  2B6A A;  3VQS A;  2I2Y A;  4FF1 A;  1MSW D;  3J7Y I;  1CC7 A;  1VQS A;  4PG4 A;  1KTQ A;  4DUT A;  3FSX A;  3L95 X;  3IFE A;  4NLP A;  3LGH A;  5H9E K;  4WZM A;  1WEY A;  5LSL A;  3DOK A;  4DV3 J;  1YQH A;  3PCO B;  3SSQ A;  5DDQ C;  1XNR F;  3RRH A;  1F1B B;  4O44 A;  1K47 A;  1LW2 B;  4LF5 F;  2V34 A;  4KE5 A;  2APO A;  3H0P A;  2F5G A;  3KNG A;  2DCL A;  2B51 A;  4Q45 A;  1LFP A;  4ZIT A;  3J81 Y;  3CGI A;  3MAH A;  4QQB A;  1Y5L B;  5L1K A;  3IM9 A;  4ZVF A;  2PD1 A;  2HWI A;  2B9E A;  2CKW A;  4ICL B;  5HMX A;  4P2X A;  2ZJP Q;  5ETN A;  1NKB A;  1WC1 A;  2NYH A;  3QRQ A;  3EGN A;  2HQD A;  3MEE A;  4WE1 B;  4WBF A;  4C8M A;  4I2Q B;  3MHY A;  1X0P A;  4KRW A;  2RRA A;  4JV2 A;  2ZVS A;  4CLW A;  2NPI A;  2CJK A;  2JH3 A;  2HFU A;  1RAI B;  3H2V E;  1KTV A;  4UW2 A;  3W9J A;  2C3U A;  1R8H A;  3RTV A;  4UY8 5;  4KHR A;  3PXG a;  4ED6 A;  2DR7 A;  3DLH A;  2IY5 B;  3QMQ A;  5M2P A;  3OSN A;  5A8R A;  3R2D J;  2UXD J;  1DQA A;  2VZ9 A;  1NZ8 A;  1C0U A;  2UVU A;  2FPH X;  1I6J A;  1UVI A;  3KLI B;  4DFP A;  2FJX A;  1NB7 A;  4P7V A;  4E0D A;  1K1S A;  3ADA C;  3Q8V A;  4DV4 J;  2ZZM A;  4DFM A;  2KDO A;  3W3S A;  5C5J A;  4AQY J;  3BDP A;  4V19 J;  4C6A A;  4NA3 A;  3BF4 A;  1G2E A;  4XIU A;  3ZFV A;  5CYQ A;  3BO2 A;  3V4I B;  1S12 A;  2AEF A;  2HNY B;  3LUY A;  2WW4 A;  1JLA A;  1SQG A;  4EBD A;  1EIY B;  4DR6 J;  3C15 A;  3QFH A;  2N82 B;  2C3O A;  1Y5N B;  2AMC B;  3OVS A;  1HR0 J;  5IOL A;  4GKJ J;  2QLW A;  2AJ0 A;  4G1Q A;  3M9M B;  1S6U A;  3TJ8 A;  2MEW A;  3MOZ A;  2CZ4 A;  2PSZ A;  2RH3 A;  3D1H A;  3NXZ A;  4QPX A;  2R8K A;  3IR7 B;  4ES2 A;  4WXW A;  3X1L B;  3D54 A;  3HVW A;  1U1P A;  4C11 A;  1IQZ A;  3CD0 A;  2A2C A;  1O8B A;  2VFU A;  4LRD A;  3VTI A;  5K8P A;  5ETK A;  1NHK L;  4LRE A;  4QR1 A; 
#chains in the Genus database with same CATH homology
 3BH6 B;  1HIY A;  2DXE A;  1KDN A;  1U8W A;  3ZTR A;  3EJM A;  4S0M A;  3EVW A;  3ELH A;  3DDI A;  5BXI A;  1B4S A;  4O0N A;  1NB2 A;  3EE3 A;  3VGT A;  1MN7 A;  3ZTO A;  3FCW A;  2HVE A;  1NSP A;  4DI6 A;  4FKY A;  3BBB A;  3Q83 A;  4ANE A;  3PRV A;  5CAA A;  3L7U A;  1NDC A;  2BEF A;  4AND A;  3VVT A;  4ENO A;  2DY9 A;  1K44 A;  1S59 A;  4EK2 A;  3EMT A;  1WKJ A;  3BBF A;  1W7W A;  3EVO A;  3Q86 A;  4CP5 A;  3ENA A;  3ZTP A;  3FBE A;  3B6B A;  5C7P A;  5CAB A;  1VYA A;  3EVM A;  1NSK L;  2NCK L;  4DUT A;  3MPD A;  3R9L A;  1NCL A;  1NDL A;  3DKD A;  2VU5 A;  1BUX A;  1JXV A;  3VGV A;  1BHN A;  3FBC A;  3GPA A;  3NGU A;  1B99 A;  1NPK A;  3FBB A;  1NUE A;  4W98 A;  1LEO A;  1S57 A;  4F36 A;  2CWK A;  3NGS A;  4DZ6 A;  4WBF A;  1LWX A;  3FBF A;  3EM1 A;  2DXD A;  1PAE X;  2AZ3 A;  1HLW A;  2B8P A;  3VGU A;  4UOG A;  3FCV A;  3Q8Y A;  1HHQ A;  3WX8 A;  1ZS6 A;  2DYA A;  3BBC A;  3BH7 B;  2AZ1 A;  1NLK L;  3GP9 A;  3ZTQ A;  1UCN A;  2HVD A;  3VVU A;  2ZUA A;  3ZTS A;  3PJ9 A;  1PKU A;  3Q8V A;  4ANC A;  1NDK A;  4C6A A;  2HUR A;  1F6T A;  1EHW A;  3JS9 A;  4KPC A;  2DXF A;  4UOH A;  3B54 A;  1NSQ A;  1WKL A;  4FKX A;  4UOF A;  3NGR A;  3Q8U A;  3ETM A;  1MN9 A;  3FC9 A;  4HR2 A;  1BE4 A;  1XIQ A;  1F3F A;  3NGT A;  5IOL A;  4F4A A;  3VGS A;  2B8Q A;  3Q89 A;  1XQI A;  1NDP A;  3G2X A;  1WKK A;  2BX6 A;  3EIC A;  3FKB A;  1NHK L;  1S5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...