1CS4B

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
190
Chain Sequence
b'YHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYPE V ADENYLATE CYCLASE
publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 62
structure length 190
sequence length 200
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cs4B00
4CLKA 4CLTA 1WC5A 1FX2A 1WC1A 1WC4A 4CLUA 1CJVA 1CJVB 3C16B 4OYIA 4WPAA 4OYPA 2W01A 1CJTA 1CJTB 1CJKA 1WC3A 3R5GA 3UVJA 1CJUB 1WC0A 3UVJB 4USVA 1YK9A 4OYAA 4CLZA 4WP9A 4P2MA 3G82B 1U0HB 1TL7A 1TL7B 3ET6B 1FX4A 4CLPA 4USUA 4OYZA 1AB8A 3C16A 1AZSB 4OYMA 4NI2B 4OZ3A 2WZ1A 5D0RA 4OYXA 4CM0A 4CLWA 1CJUA 4P2FA 4USTA 4WP3A 5IV4A 3G82A 4CLSA 1U0HA 2GVZA 2GVZB 4P2XA 3C14B 3ET6A 4CM2A 2BW7A 5D0HA 3MAAA 3C15A 3C15B 2QV6A 3MAAB 1Y10A 1AZSA 4OYOA 4CLFA 1CS4B 1YBUA 4NI2A 4OZ2A 5D0EA 1YBTA 5IV3A 4WP8A 5D0GA 2GVDA 2GVDB 3C14A 4USWA 3MR7A 4OYWA 4CLYA 5D15A 1Y11A 1WC6A 1CS4A 1CJKB 1CULA 1CULB 4OYBA 4CLLA
chains in the Genus database with same CATH superfamily
2MZSA 3K8WA 3TJAA 1N48A 4ELTA 3TOQA 1HKAA 1AFIA 3RGIA 2BYCA 1VBYA 1YLXA 1RYSA 5HQ8A 3HF5A 2RU3A 4ID8A 3R5GA 3OR1B 2LEBA 5B08A 2LYVA 2W9AA 1IWAA 4NEYA 2DISA 4QOTA 2IMOA 1PILA 3EWGA 2E9RX 2R7XA 2DVIA 4JYAJ 4NLVA 4ZIWA 3M9OB 3CVKA 4XK8C 1U1LA 1R43A 4EO8A 1X0FA 2AX0A 2H51B 2Y0SD 2Q66A 1MWQA 3IGVA 3D68A 2LQ9A 2KN4A 4IFVA 2RH3A 2LP4A 2EW9A 3C3LA 5E3CA 2IM1A 2B8PA 2CPFA 4BC9A 3CDWA 5AXNA 2MPUA 5K14A 2ZDOA 2WSCC 1L3UA 1S72S 1IUJA 4O3OA 1S1WB 4WFZA 4F67A 5B7WA 1EZZB 4F3QA 5E41A 2ZE2B 3N6MA 4K4TA 2BEFA 3MOZA 3VAGA 1FF2A 1VBKA 4WJBA 5C2GA 5IT0A 5F9NA 1LEOA 4F4YA 1S4EA 2W9BA 1WC4A 4ZN3A 3V4MA 2W24A 2CJQA 3L9ZA 3X1LB 3GV8B 3HSZA 2FJDB 4TXSA 3GFZA 2CAJA 3J7YI 1BMQB 3KUHA 1JJHA 4HYKA 4N8NA 3T41A 3AD9C 3D6MB 2F8MA 4F0HA 3M8PA 2DGOA 3UDLA 1NDPA 4OYXA 2FZKB 4X66F 2MKKA 2CADA 2DKOB 2BW2A 4MT1A 1CVJA 2AGOA 4B3MJ 3K8VA 2OTJS 1D09B 2MSSA 2OD6A 4ANCA 1ZAXA 2J9DE 3KWMA 1LQ9A 4DN0A 2X51A 4M5JA 1NK0A 3TAMB 5GMKa 1QE1A 2H5IB 2OLWA 2XSFA 3KKFA 1U6BA 4UUWA 4A8QA 3T5JA 4ZJLA 4J9MA 1V6HA 2Q6BA 3TQEA 3M2UA 3LP0A 1N5QA 2IJRA 5J1EB 3CJSA 5H9FK 1UETA 5J2NB 4DS5A 2CPHA 1SH0A 3CF5Q 1UVIA 3ET6B 4DG1A 2JOQA 3QJJA 1RT2A 1BXNA 4NI2B 4ECWA 3JQKA 1NXIA 3DOLA 1HBNB 1M0SA 2KT5A 2NSBA 2NS1B 3SI8A 5DRKA 3D0HE 4ILLA 2JH3A 4ZVQB 1AFJA 5HATA 3PG9A 1H6KX 4PABA 1Y9OA 4BBYA 4M5IA 1ZOTA 3CSKA 2N7YA 1SQGA 2GIQA 2YNGA 3K5LA 4DUTA 1IBLF 3DMJB 4NLTA 3HHNB 2MJNA 1F9FA 1DLOB 4ZLNA 1XNQJ 1TVRB 2OEMA 3E01B 4KO0A 2FVRA 5CYJA 4ICLA 1M5PC 1N56A 1VQSA 1EP4B 5A2QY 2LEAA 3N01A 3MM8B 3GIMA 4KHRA 2PGCA 2ZH5A 3PY8A 3BKFA 1UEUA 3ENWA 3MDFA 3Q8VA 1WC0A 2WK4A 4URQU 3TJ9A 2B6AB 2D3OR 2XI3A 2VF3A 1TTHB 3J80Y 5E2QA 4WWSA 2JEIA 4WIQA 3C16A 4L6V3 5IQQA 1JJ2R 2XY5A 5CA5A 4I2QA 1WD6A 2MZ1A 1FO1A 3I31A 4D3GA 4X4RA 1LFPA 1IM6A 2XMUA 4ERDA 2ZBCA 1VQ5S 2OPSA 1N36F 3I9V9 5DS7A 5K20B 4FYXB 4L73A 4USWA 1VK3A 2R2UA 3I96A 5D15A 1LW0B 2GV1A 2JFDA 1K8AT 1T8EA 1FK9A 1V3ZA 4GKKJ 3UN2A 1XERA 1JX4A 5HVGA 2D3O1 5HBMB 1WC1A 3MM7B 1S0VA 2NZ4A 2HS3A 3MEGB 1IR0A 2HVIA 4QIGA 1NHVA 2M0GB 2W2NP 3MR2A 4DCPB 1YJTA 4ZP6A 1FE0A 3V6KA 3K5PA 4GC7A 1RHQB 2F40A 3N9UC 1RDRA 5CXTA 5HLFB 2L9DA 2HIQA 3IG1A 3BKUA 4LMZA 4GO5X 3MFHA 1RBLA 4G3IA 1QDUB 4GRSA 1K0TA 1N54B 3QFWA 1K1QA 4RU9A 2FHOB 2ZZMA 1O6XA 5J2MA 2C3OA 3OJUA 3IAM9 1M5KC 3MUMP 1XK8A 1DQ8A 3OL8A 3GV7B 3CPWR 3QJLA 2R8JA 2V94A 4HR2A 1DTQB 2DPIA 4Q2MA 1U8SA 3W65A 1S1UB 2CQ1A 2MB0B 3PYDA 4C6AA 2RDIA 3DRPB 5MAOA 1HBOB 2AEJA 3GU0A 2Z2LA 2MJUA 1TL3A 1YJNS 2DGWA 4C48A 5EWEA 1NK5A 1T03B 3I32A 4ID5B 4JV0A 3J81Y 2D69A 3DOMB 5ETRA 4YB7A 4LF4F 1VQPS 1NUEA 1SH3A 3T1YF 2DR8A 4NA1A 3C6TA 3LP1B 3MEEB 2ZC4A 4S0MA 2GHWA 1VLOA 3C14B 2R2TA 1NJIT 4CO3A 4H4OA 3KTQA 4B9LA 2K3KA 2IM3A 1KHVA 2H54B 4N76A 3LH2S 3H0PA 3WIUA 4LFAF 4YMEA 4Q8FA 3R5JB 3SCKE 3KHLA 4KGXB 5T7LA 1Z1ZA 2XSJB 1PJ7A 3B4DA 5EWFA 2HLUA 4Z37A 9ATCB 1FJGJ 3HO1A 4LRFA 2IYGA 4X2BA 4V19J 2RILA 1CQNA 3VQSA 3E8OA 3EJMA 3OTOF 1K0VA 4PXBA 4JI4F 4DWIA 1RBAA 2I5JA 4J91A 1HA1A 1X9MA 1HQ2A 3SFGA 4CRJA 1QUVA 2YNIA 4QYZK 2JWNA 3WDOA 2J8AA 1WI6A 4O3QA 4Y00A 2W1BA 3OUYB 2MKYA 1FFWB 2G0IA 3VWSA 1Q81T 2R2RA 1RT3A 4IFVB 1Q8LA 1YJ9S 1OSCA 3EVOA 4OYMA 4ZMMA 4NYZA 3GG1A 3GWCA 4CM0A 2OSQA 1CJUA 5K14B 4L72B 1YJVA 1VISA 1X9WA 1VRTB 1HNWJ 3BBBA 4M5MA 1GX5A 5KG0A 2KTQA 4WK3A 1VQ6S 3BGUA 2X7IA 1NAQA 4Y2MA 2L3MA 2C3MA 1J5EF 4WKYA 4JUZA 4C3LA 2KZMA 3NNCA 5C5JA 1MLAA 2AW0A 2LXFA 1TKDA 3E3XA 4EMDA 3IFEA 3QT8A 3OL7A 3CCSS 4JI3J 2CPIA 1U25A 4OYIA 2EVZA 4I69A 3MCOA 4KSEB 3PKYA 2ZH3A 1NB2A 4OI6A 1D9DA 4DQPA 2ROGA 3MR5A 4NX9A 1M1HA 1R8CA 1TKXA 3W2WA 1F3FA 3MPDA 5BR8J 4ZDNA 3A8IA 3IR7B 3NLCA 5H1SV 2A6MA 2IJFA 3Q8QB 4PXDA 4KFBB 3H8YA 3NY0A 2RSQA 3MAHA 2GVZB 1TFWA 3MI7X 2RU9A 1FRIA 4QIEA 1QE1B 1NK9A 2RHQB 1BY9A 1RWUA 5KOWA 4N8OA 5A6WA 1N4LA 4RW4A 3BZQA 2E1RA 4DV1J 4DU8A 3DM2B 3FK4A 1PC4A 3M2UB 4Y34A 3LP0B 2EFQA 2DNHA 4HI2A 4ECSA 3Q22A 1REGX 1Y11A 4F0KA 4F4ZA 3QBCA 4F4AA 1WWHA 4JI8J 2AJ1A 2BE7D 4DG1B 3GONA 1H72C 1RT2B 4HACA 4FYDA 1TKZA 5HMZA 3HZEA 1RT5A 3QT5A 1NO8A 4RUBA 1C1CB 4OZ1A 4NXNJ 1TL7A 3NOCA 2R7UA 3U1MA 3P6YC 4DQQA 1A9NB 4J9QA 4WCEQ 2VA3A 2WVEA 1XNRF 1TUGB 1H98A 2HHVA 3KK3B 2LQ8A 1BD6A 5J2PA 2JZ5A 4DR1J 5D4OA 1X5TA 1B70B 3PZPA 3QFHA 3WHIA 2CFXA 4ICLB 4PPZA 2BQ3A 3ETOA 1NJYA 1SL2A 3BO3A 1K73T 3V6HA 4C7QA 4Q44A 3LANA 3QIPA 1SIWB 5IM0A 2CPZA 4OIXA 3KMSA 4LIWA 2NREA 4PXEA 3BN7A 4NCAA 4B17A 1BHNA 1XN9A 2B9WA 3C16B 3OFHA 2JVOA 1HIYA 1U6ZA 1PIEA 2CJKA 2LQBA 3D3CJ 2ABYA 2HRUA 3I4PA 2XZTB 4X84A 2AEFA 1KVIA 3R5CA 2IRYA 1ZS6A 4FXDA 2HHUA 1FT8A 1S49A 2OPSB 1MMLA 5ETKA 4DR7J 3W62A 1B0TA 2D41A 1RHUB 1S4FA 1X4CA 1A0OB 4ELUA 2CWXA 1KQSR 1AZSA 1HI0P 1P1LA 1TZ0A 3MMAA 1MG7A 1YBAA 1FK9B 4DSJA 1SL0A 1S9EB 1P27B 1MN9A 2E7XA 2CQDA 2GVDA 3J81U 3GIIA 2BM0A 2OP5A 4WFBQ 4TYAA 4FBTA 2R9LA 2NXJA 2GJIA 2Y9HA 3NP5A 3SSSA 1GTHA 1DBDA 5KFWA 5B0EA 5HMXA 1RQ0A 2VJVA 2B9EA 1NJZA 3CGIA 1RT7A 1J27A 1RYRA 1CQMA 1S6QB 3ICLA 2MQMA 3LWLA 2MGZB 2ZBQA 4FNHA 2IRUA 1FI4A 3SZ2A 1KD1T 4YY3J 4I6YA 3NG8A 1NKBA 2MDAA 2MQOA 2RS8A 3K5NA 2IVYA 2QJ3A 2ZWPA 2CDRB 3CIZA 3HSDA 5KFTA 1FJCA 1S9FA 4MFBA 5J2MB 3HVTA 2FIUA 2V63A 2HNZB 1NPRA 2KRBA 4HH0A 1F9EB 2F7VA 2A3JA 5HROA 4QZVB 3KLIA 3H90A 3NS7B 4N7TA 4ECXA 2YNFA 3CCLS 5BJRA 4IH5A 3F41A 3ZZPA 1Q0NA 1XMOF 3HMJG 5L9NA 3GR0A 1TMMA 2OFGX 4WZQA 2PEHA 1V5IB 4ZHRA 3NGTA 1FKOB 4WE1A 1TKTB 2H9ZA 1YTYA 5HP1B 2Z2ZA 3W1YC 1I1GA 3ZO7A 2M4MA 4DV2F 4FZVA 2BE2A 2XYPB 4G1QA 4K4VA 3UQSA 3DRRA 4F8RA 2GHPA 3CJKA 4J37A 5H9FJ 1X4GA 1ACMB 3C6TB 4F4KA 1VQKS 3NAHA 1HMVA 5LMNJ 2ILZA 4WTYA 4DL4A 3NGUA 4H4OB 2FGCA 2O67A 3UCGA 1T94A 3FVYA 4B3OA 3AOAA 1U4BA 1MNEA 4XTTA 2X1FA 4OZ0A 2A10A 1SQEA 4MKAA 1DY3A 4XAKA 5T7LB 1G7CB 2R4FA 3H42A 1B4SA 4M1KA 3OQ2A 1Q1KA 1PYOB 4ZVTB 1BWEA 2IYIA 4U9RA 3CCMS 2YX1A 4Q7AA 5ETQA 4KQZA 5HK4A 4YB1P 2FLLA 3QRRA 2IA6A 1GAOA 1G3OA 2I0XA 2HZCA 2I5JB 1N34J 1C0UA 3MEDA 3OV7A 2P9CA 5IZHA 2RDJA 2ASJA 2BQUA 4OYBA 1ZYQA 2X1AA 2VC1A 2VOPA 5B0BA 1EQMA 4V1Ak 3TEGA 1RT3B 4OX7A 2C2EA 3BV8A 3PYFA 3HI9A 1S77D 2EEYA 3KJVA 3OSPA 3HPOA 4QU7A 1CJUB 2ZH2A 3HDSA 2OMOA 2EBEA 3RAMA 2JC0A 3X3UA 4B9VA 4ZVGA 1RU1A 1S79A 1J5OA 3OT9A 2K2PA 1VR6A 1XR5A 4V19X 2EG2A 4IFYB 3O5TB 4LVNP 2FD2A 3OTDA 1TK8A 1WI8A 2DR5A 1N5SA 3IWXA 5AXKA 1KWMA 3RB4A 4LQ3A 3T9NA 4KY3A 2BW7A 1I94J 1YBUA 3TANA 2I1RA 4DFPA 2IIHA 2P2CB 2F9JA 4RL1A 1NDKA 2QE5A 3PFOA 1HYSB 1JXLA 4DPWA 2OEKA 1U26A 3I5AA 2VUGA 4A46A 4DX5A 8ATCB 1W7WA 4DV6F 3D4JA 2V2QA 3F56A 4TNOA 4X4TA 2E5JA 2HURA 5D3GA 3KLGB 3DDIA 1IR2A 4J90A 1H2TZ 2ZVSA 3NL0A 2RF2A 4ETXA 4UZCA 2J9EA 3EZ5A 1GXUA 2DO0A 2CPXA 3RRGA 4CLUA 4AE5A 1MMNA 4PAAA 3N5FA 3W66A 3IMQJ 3NKYA 4PKDB 3UPFA 3RAQA 2C28A 2BABA 5JXSA 1HQEA 1RA7A 4Y28C 2AYMA 4I0WA 4DSLA 4P52A 3HK2A 2ROEA 3D1HA 3ETMA 4QYRA 2AJQA 2FY1A 4RW4B 4I67A 1JKHB 4WP3A 2CDQA 2YNHA 3GJTB 3ILLA 2UUWA 2QV6A 2RRNA 1G2EA 2WAQD 1RTHA 2IPOB 2DRDA 2WHOA 2KU7A 2WVFA 4YS2A 4DLGA 4DFJA 3BN4A 5DM6Q 1VFJA 4ALZA 1TKZB 1U2CA 1RT5B 3DRSB 3PCOB 3R1HA 1M5SA 2DNKA 1D9AA 2Y0BB 1NPKA 1N88A 1WC3A 1ZM4A 2BR0A 3PX4A 1HNWF 1FDAA 3JTNA 2V4JA 2GQQA 5K8MA 2WVCA 4H54A 1FTRA 1EETA 3C8YA 3K2YA 2Q79A 4B9TA 5LJ3Y 1R7IA 4OX9J 3B82A 1O0PA 3FSYA 3HM9A 3LO3A 1RJJA 3AJ2A 5D0HA 4DF8A 1JB0C 1VRQC 3MF5A 2LQJA 3I0SA 1S9GA 3PJ9A 3ISZA 5E3QA 3MCNA 1JNRB 5D8HB 1FKPA 2PFFB 3IRWP 1X5PA 3MPYA 1CS4A 1DURA 2R3VA 4ATNA 1VQMS 3S01A 1RAAB 1G1XA 4CLTA 4EZ6A 3MPUB 1PG5B 2D1CA 1CJVA 5KFMA 5BR8F 2X1GA 2HNDA 3M9MB 4PPDA 2BRKA 3DU6A 5LXRA 2RRBA 4PRFA 1QY7A 3ISNC 1X4AA 4K8RA 4DX8H 1KFDA 1S6PA 4YR0A 1AB8A 4Q43A 2GGPA 1AZSB 2NPIA 4QCLA 2BKPA 4WFAQ 2F5GA 3MMAB 3KHRA 2CVEA 4DV1F 1YDLA 3GJQB 2IBKA 4H4KA 3GV5B 2M8HA 2W25A 3AY0A 3U7JA 4KGVB 2VICA 2IY5B 1IBMJ 3KHHA 5LL6d 2UU9J 2GIFA 4G65A 2EXUA 3BQ2A 1VMBA 3ENQA 2HPUA 1JK9B 3NNAA 2UUAJ 3UW1A 4ZLJA 2QIFA 2DHAA 1TP7A 3MM5A 1H74A 4NRTA 1RWMB 5HSPA 1T3OA 2G1DA 3DLGA 3K5OA 4NXNF 4KPYA 4IDKB 4JI0F 3R7NB 2KT2A 2CQ0A 1IN0A 1YKWA 3CDUA 3G8SA 4ZITA 3UN3A 1N33F 1N8RT 4DL0C 1FRKA 4MFBB 2RD5C 3M1VB 3HVTB 4EO6A 4ES2A 2LVWA 2GNKA 1KSPA 4DR1F 2XMKA 4Y2KA 2W7PA 3UO0A 1AUSL 2XWYA 2B4OA 2YNFB 1MROB 5D0RA 2EWHA 1VCTA 1R89A 2P6TA 4YDXA 2JSXA 3CIMA 3K59A 1N0UA 2XGQA 4WE1B 3TQ1A 4DR6J 1HWUA 2PI4A 1CC7A 3N5BA 4LUBA 4KR0B 2VH7A 2QFIA 3R7SB 4OHXA 3VHQA 1VHFA 4G1QB 3J7ZT 2DEIA 3DRRB 5ITHA 1SKSA 2POKA 2LFVA 1T9WA 5KFEA 1KOOA 1Y5LB 4FPIA 4JP8A 1RXOB 3US5A 3THVA 1R8BA 2GMJA 1U1NA 1RKJA 1HNZJ 2ATCB 1RHJB 4LJMA 5LSLA 3OLAA 3VALA 4UOGA 2OI2A 3UDVA 4B3OB 3TNVA 2J6SA 5H9EK 2DNLA 4CH1A 1NHKL 4DR7F 3UVJA 1F60B 3VTIA 3T6BA 1VQLS 4OHWA 5M2RA 4RLEA 1RT4A 3AODA 1PYTA 4RJVA 5SZTA 5DGBA 2DXDA 3ZZZA 3IBCB 2X3GA 1U6FA 1S1XA 1JJ4A 3CE8A 1RHKB 4CO0A 1QTMA 1C0UB 4RW7A 5J1NA 2DH9A 4OZ2A 1PCAA 5FIIA 1N32F 2DD8S 2VASA 1E6VA 3GYXB 3KMQA 1WDDA 4M5NA 1RABB 2XHWA 1FNXH 3KJVB 2OTLS 1WC6A 3L4BC 1KTQA 4DEZA 2QLXA 4HT7A 4YY3F 2UUTA 3S6EA 1KRPA 4ZLLA 4C3MA 5L8RC 2DCLA 3MECA 5KFFA 4MJKA 3RG6A 2DR7A 1Q82T 1M1GA 4HHJA 2Z30B 1V3SA 2JEFA 2DJWA 5DGAA 2WBMA 3WBZA 1KTVA 5I3UA 1SVDA 1NK6A 3JSMB 2HGMA 5EX0A 3CCRS 4CLPA 4U6PA 3DGVA 3KK2A 4RNMA 3UD3P 2FJVA 1S48A 1IVZA 2FLNA 2VBXA 3ZTOA 1O5JA 1JLQA 3VAHA 1BE4A 2HSEB 4ZCLA 2R7WA 2BZ2A 3JS9A 3C15B 1KOHA 4CLFA 5K9FA 3G96A 3GJRB 5D77A 1X8DA 2HW3A 4OV1A 2RF2B 4JBCA 4C3KA 2MSTA 5KFVA 4LF2A 4L3KA 3G8TA 1L3TA 2OPPA 4LBHA 2UUBJ 1BWVA 1XR6A 3ONQA 4DR5J 3HULA 3VAIA 4ES3A 2V2VA 3L7OA 4AYBD 3C2PA 1HBMB 1RAEB 2GMLA 5LMNF 3I4HX 3KDNA 1GMVA 1HQEB 2QL9B 3UI3A 1RGVA 2X3DA 1X4DA 1JIHA 5DG9A 5IT9Y 5B0GA 2UXCF 2QEXS 3BJYA 1UWBA 2R8HA 3R7BB 4QU6A 1JLEB 2PC6A 1EHWA 2KVIA 3BGLA 2MQQA 1WEYA 3G86A 3R6GB 5KG5A 2YNHB 3W9IA 4O0NA 1LW2A 3NS6A 4RKUC 4F50A 2AMCB 3C19A 2JX2A 2HHPA 2CPJA 1RTHB 3OTCA 3CD7A 4KKOA 3W64A 1HL6A 3TAQA 3MM9A 3O44A 4PYAA 2P9EA 4DV5J 2HGLA 4DUYJ 1VQNS 3W7BA 1BQNA 5DDPC 4GKJF 3PEHA 3SCJE 1N34F 5KAKA 3PKMA 4TKTA 3CMAS 1DTTA 1W26A 1NH8A 3IM8A 3G8QA 2PIIA 3PRBA 3V6JA 2FZGB 1IKXA 3CO9A 2ALYB 2VG5B 3GE9A 1OQ3A 1KQFB 5B0DA 4DV4F 2C22A 1O8BA 1OWXA 2BE9B 3PW2A 2RT3A 2ZBRA 1NK4A 1BUXA 5A8KA 3R27A 3GCWP 2P9GA 2V5HG 2ASYA 3PO4A 1HR0F 5DZ6A 2D3ZA 1EETB 4L74A 4NOHA 5HI7A 2BJ8A 3EICA 3DI6B 2XB2D 3HHEA 3ZTSA 1JLBA 2XI2A 2QZ8A 1NHUA 5B09A 1S9GB 2XMMA 2G2YA 3IRXA 4E98A 2QA4S 3AJ1A 4DV7F 3VV2B 1F5BA 5KFNA 5AXMA 1FKPB 5HJYA 1HI8A 2H48B 4USIA 3MAAA 2MQ8A 4KC5A 4FS1A 1CS4B 2HBYB 1AUDA 3IR6B 1KN6A 1GFWB 1WKJA 4RWWA 4IYQA 3M30A 6FD1A 3R8YA 9RUBA 1BC6A 3TI0A 1Y0HA 2HQ3A 2EFGA 3ZFVA 1HD1A 1WKLA 2OH2A 3MM6A 1RLDA 2VQFJ 1Q4RA 4F25A 2DHSA 5FLXY 1IM4A 3R6LB 1NSQA 3OXFA 4TLQA 1GNKA 2V68A 3CJTA 3PYGA 4OX8A 1VLYA 2BJ9A 3W63A 4TQSA 4U95A 1SJQA 2UXDF 2NR0A 4X62J 4LRBA 2LDIA 1UPPA 3DYAB 5B0AA 1A7GE 2ILYA 2CIMA 3G82A 4OLPA 5I3QA 3KLVA 2M3DA 3MM5B 4OYOA 1B64A 2CZ4A 2B4PA 1SJFA 3DLGB 3HSGA 1SB6A 2RHSB 5LJ5Y 4J9RA 4C8LA 3D66A 2CRLA 4HHHA 5ADZA 4KHPJ 1S7HA 4EUVA 1UVKA 2GO8A 2AZ1A 2IM2A 4PG5A 1JQGA 1APSA 3BPSP 2A0FB 5EDWA 4C4WA 4N77A 3HP6A 2VFSA 1B99A 3GFXA 3FZBA 3G9CA 3Q8RB 1S10A 1X9SA 1MMDA 2BMBA 1YK9A 1YJRA 3KJNB 4KH0B 2CNKB 3ZC4A 4K0KF 4DJBA 4K4WA 1FFSB 2YX7A 4C11A 4K2XA 5A8RB 4X4NA 3G2XA 2XO7A 1IQZA 1VJQA 4OI3A 1VC6A 1LWEB 3CTRA 4OI1A 1HARA 2B9YA 2A1BA 4F04B 5EX3A 3KJFB 2VZ9A 1XJWB 1WF2A 3PW4A 2ZJQQ 3UCZP 4F2RA 4AL6A 4NLDA 4B3TJ 3D28A 4DMZA 1F0XA 3JQMA 3L09A 1VC0A 4G6VB 2IM0A 3OVSA 3I87A 3KK1A 3L7UA 1CULB 2OO4A 1HW8A 4X4VA 1R31A 2HRYA 1FVQA 2CVIA 1AYEA 2WCXA 4I68A 3POTA 1RTIB 1TQLA 5J2NA 2ZFHA 1O51A 4DFMA 3PW7A 1T9UA 4A8XA 1IBMF 3KLEB 3JB9k 4IOAQ 2UU9F 4HHUA 2MQNA 1RADB 2VG6B 1E6VB 1HD0A 3PHTA 4NA3A 5IT9U 4ECQA 2HMIA 2I38A 2QX0A 2CQ4A 3D6TB 2OHDA 2VFTA 3T5HA 1RKIA 4DI6A 1HI1A 4FN5A 2VOOA 4NLSA 4WU3A 1EX8A 1RT6B 2VFUA 3H2VE 2I2YA 1H2UX 2HGNA 2CG4A 1LKZA 1WG4A 3M8QA 1TVRA 2MLZA 3E01A 2BJDA 3I6PA 1LK5A 2YKQA 2HFZA 2BANA 1NJXA 2B3TB 3QNWB 3TUZC 1UFWA 5KG7A 3JTPA 3SV4A 3MM8A 2DYAA 4PQUB 4GVLA 4ZN1A 3NGRA 4QPTA 2B6AA 2FLPA 4A47A 1HNXF 1Q95G 1GK8A 4DR6F 2EKYA 3QMQA 3MURP 3SBMA 1FDBA 4FXVA 5KFKA 4CH0S 2V4QA 1U2RA 4Q45A 5KFUA 1YZ6A 1NRKA 5DG8A 2LEPA 2FC9A 1R8PA 4O3SA 4KPCA 3BH6B 4NYOA 2VBYA 4RBVA 3M6UA 4XDCA 5ETOA 4ECVA 1HNZF 5F8JA 5KT7A 3MUVP 3KG1A 2HFVA 4NLOA 3Q8SB 4ZLPA 5DO2A 1HHSA 2EG1A 3MFIA 1S59A 1LW0A 2VPXB 4ZPDA 4AQYJ 2RQ4A 1LW2B 5HBMA 3MM7A 5GAEU 4XO0A 3MEGA 4NLXA 4RNHA 1CJTB 2C3UA 4CT9A 3EX7B 3MM9B 4OJHA 2ZHOA 3LGNA 4FNIA 2PD1A 2F65A 1IKVA 1WEXA 2DEJA 3M6WA 2DNPA 3T1AA 4LQ9A 1UW9A 4OJ1A 3FBEA 1RAFB 2B4UA 4FBUA 4HLBA 5HLFA 2M9KA 2B51A 4PR6A 3OD2A 3KLHA 5HMWA 3GIJA 2QLWA 4LF8F 3JSRA 4I7FB 3D7SB 3NNHA 1TV6B 2AWZA 4CO2A 4U7UK 2UVUA 4O23A 3NMRA 1FXRA 3IGNA 2PDAA 5A8KB 1F3VA 5GADI 2UVVA 4IKAA 1SC6A 5GMEA 1DTQA 4PG8A 4M94A 2GS8A 3S1TA 1S1UA 4LR7A 4C9DA 3DRPA 2E5GA 3V81B 1HBOA 2VL1A 4QJVA 3N6NA 3Q89A 3MTKA 1GMUA 1DHMA 3IRXB 2MZTA 3LA0A 3GSIA 3NRBA 1S99A 4CLZA 4Y3CA 1JLAA 2GIRA 2VPYB 1T03A 4DDFA 4ID5A 3ILOA 3CT9A 2KDOA 4DLEA 3MWBA 4OZNA 2VPZB 3DOMA 1P1TA 3FKBA 5HQLA 5I42A 4DPYA 5CD4A 1M1KT 1OS5A 4UQTA 3WX8A 3MEEA 4LSLB 1ULRA 1U0HA 3AD8C 2XY6A 4CTAA 3GIKA 1WACA 2B0GA 1ZPVA 4DR5F 3PR4A 3MM6B 2XS5A 2QN6B 3ITHB 4BWMA 5F3ZA 4L75A 4IRCA 3HVAA 3CW2C 3LGHA 4DL7A 2ZM6J 1X4BA 2M7SA 1FWLA 4DF4A 5KFPA 2XSJA 4CLYA 3M8ZA 4LBPA 5IOLA 3RYLA 2OPRA 4C97A 1VYAA 4QIFA 2XS7A 4DQRA 3O1LA 2NQPA 4F02A 5C2CA 2QMUB 2W2PP 1IQTA 3K58A 2QLFB 4J7CA 2W01A 1I3OB 4OLOA 2DGTA 2HG4A 3IO1A 3GTYX 3EVWA 1U02A 3BKTA 4F3MA 2KXHA 3G82B 4C2MA 3OUYA 5KT2A 1YI2S 2DY1A 3BSCA 1TUVA 1KLMB 4RUCA 4CI0B 3QYYA 3ZZRA 1Q5VA 3P3DA 3PW5A 4P10A 3HD1A 3GFHA 2ZH6A 1GMWA 4E0DA 4ED2A 4FPRA 3KUGA 1VRTA 2G4BA 4PWDA 4CNYA 5EGYA 4FYYB 1UA1A 2M52A 3TW0A 2MTLA 4AUKA 3FFIA 4C0HA 5D0GA 4M5HA 5DDOC 2B8QA 3IXQA 2VFVA 3MTJA 1GXTA 2LLZA 2DITA 2V9WA 4O4GA 1HQUB 2H5JB 2V6AA 4QQBA 2WRMA 3BBCA 3V4IB 1RB0A 2LECA 1ZM9A 4KIAA 5C42B 1PC5A 4C11B 4J9OA 2MQPA 1U45A 1UKUA 2OKQA 4USJC 2OEJA 1MU2A 2YH0A 2RQCA 1IXKA 3TR5A 3PTWA 3W5ZA 1R0BG 3QJPA 3PRVA 4AD6A 3BEGB 2GA7A 3RRHA 4TQRA 5IC6B 1S0MA 3FZ2A 3MUTP 4URSA 6AT1B 3HFZB 4YR3A 1NU4A 1D1UA 2EFVA 3UCUP 4ZJQA 2KM8B 3OSNA 4U8YA 2Z57B 4KGZB 1VS3A 4KFBA 2HQIA 1EAYC 2FLOA 2GVZA 3HVRA 2FGOA 5KFOA 3UWTA 4YDDB 2SXLA 3NEKA 2VB6A 2BKNA 5DZ7A 3KK1B 2LKZA 1HHQA 4MKBA 2QL5B 2VQFF 2JNJA 2VG7A 1ZA2B 3TP2A 2D7SA 3JQJA 3DM2A 1LWXA 1G6BA 1NK8A 1WF0A 2OIHA 1WHVA 1WSRA 2W2QP 5IWAJ 4EYHB 3POTB 3VGTA 2DGUA 2Y8WA 2JEJA 5A0YB 2HS0A 5AJ3J 4CIOA 2PFDA 4YHHJ 1NPPA 2V9KA 1OPZA 2V50A 2M2BA 3AQPA 3OFFA 3A12A 3QAUA 4X62F 1BQMB 3HD2A 5HJXA 1C1CA 5F0UA 2QLJB 4WYLA 1RZMA 1VQ9S 1UP1A 2DNGA 1WELA 5F8IA 2HMIB 4USUA 3CWJA 4ZKAA 2QLBB 1UFKA 3F0NA 3BDPA 1VGYA 2HHXA 3GSDA 2E5IA 2NPFA 2EI5A 2DPJA 3KK3A 5IV4A 1OY9A 2E7WA 2QA2A 5HO4A 3M8QB 4KHPF 1FRHA 1Y4ZB 2BM1A 4DX6A 2C2RA 3AD7C 1YBTA 3DLEA 3W3SA 1D3WA 4LF1A 2BANB 3D0IE 2WONA 1HWJA 1WEZA 3LALA 4LIRA 2F4VF 2IA0A 2MXYA 2H4YB 2MLXA 1Y3KA 5ETNA 1YQHA 5F0WA 4B9NA 2F1FA 2KT3A 3RRKA 3T5KA 3NCRA 3I55S 4DX7A 3OR2A 2HIYA 2A18A 1QVFR 4C8NA 3BBFA 2LU2A 4WFNQ 4NXMJ 3FUYA 4ED8A 1YJ7A 3M9NB 1KHWA 3BGRB 4NLUA 3M2VA 1FD8A 2LA6A 2XZWA 2B9XA 4B3TF 2N3OA 1Y7PA 4KV8B 4PYDA 2ZNZA 4N47A 1VI7A 1U1RA 2V8DA 3BM7A 3TEHB 1S9EA 2GQCA 2Z56B 4N41A 3JAMY 2MEWA 3UR3C 3ZXWA 5KT6A 2J7KA 4OZJA 3OHBA 4LF6F 3R2CJ 1DQAA 4EZ9A 3MCSA 3H2UB 2ERRA 1YHQS 4K50A 2J6TA 3VVTA 2MKCA 4FF1A 2BA9A 1T9TA 4ECUA 3IBWA 5SUHA 4X66J 3AHPA 4KH1B 1IKVB 4DSKA 4ECZA 2H1YA 3CO0P 4X4OA 1S6QA 3H40A 3AXMA 2MGZA 3V5RA 1NSPA 2H65B 2C2OB 1DAXA 1T9XA 4JOUA 4USMA 2CJBA 4FF3A 3KLHB 3LOUA 3PX6A 2E1MC 3OL6A 1LWFB 1HW9A 3B78A 2UP1A 3BO2A 1HWLA 3D3BJ 2YWEA 1SQFA 4ZVFA 5F41A 1T05A 2BACA 2FQQB 2HVDA 2HNZA 3W2VB 1KS2A 4CT8A 1YRUA 4I2PA 3TUIC 1SC4B 1V5VA 1UTAA 1RAIB 3LUYA 2BKOA 4ETZA 2QYGA 1HNVA 2EKNA 4NCGB 1FKOA 1VBZA 4ED4A 3GZ7A 2YWGA 1TKTA 3PX0A 2MYFA 1F1BB 5HP1A 4M5LA 1REVB 3CJ4A 3HKWA 1FA0A 4B3RF 3PHEA 1WF1A 3B4MA 3W61A 1SV5B 3PYEA 1JLAB 3K0JA 2DNOA 1AT1B 3TZWA 1UJ6A 2XYGB 4M63A 1EJ7L 2CQIA 5I42B 2XTJP 1TK5A 1ZAWA 4HL9A 5HAOA 5L1JA 2ZHAA 2E5LF 2AZ3A 1U0HB 5L38A 2DR6A 1WOPA 3HHLA 4NZ7A 5I3PA 3ZZOA 4UY85 3GFYA 1IBLJ 1SKUB 4LSNB 4CTAB 1H73A 2FUG9 4K4XA 2HHHF 4H4MA 3EM1A 4G1IA 2IDLA 3IC1A 5EHHA 4I56A 2DK2A 1EQ0A 4EGLA 3DLKA 3DXSX 2VA2A 2BBEA 1JLFA 2E5HA 4QPXA 4X65F 2ZOMA 3PVXA 2OPRB 3PIOQ 1Q7LB 3BB5A 1ZM2A 1QAIA 1TUWA 5LM7E 1KLNA 2G1HA 2PN6A 3CD5A 2U1AA 3UNYA 3T6JA 1KBRA 2VC0A 3KNAA 3PFEA 1TELA 5KT4A 1URNA 3DDKA 4K7QA 1F2GA 1U48A 2PMWA 1T02A 2C2DA 5KFIA 5DLGA 3FMWA 3PRDA 3OTBA 2OUGA 4HTJA 2C2NA 4I6WA 2NUUG 3SIPB 3LAMA 3D2WA 3ZNJ1 5F8NA 1SJ4P 2JLGA 3CDBA 1N36J 3CDAA 3QSYB 1V3RA 4ZVHA 4PWDB 4J9NA 1WJ9A 4L3NA 2HQCA 5IC4B 2XMWA 2XCPA 1R0AA 3NAIA 5E0OA 4AFFA 4ECRA 1XWLA 2KJWA 3FFIB 4IFYA 1RTJA 3EXYA 2WSFC 1CLFA 3K17A 5DDRC 2CWKA 5EUHA 1V9OA 5E33A 5L39A 6FDRA 3CUNA 3ZZYA 1S7IA 4O4GB 2M5YA 4NASA 4PEOA 3CCQS 4WK1A 4P7VA 1HYSA 1U24A 1UW4A 4F36A 3NWRA 4ZP8A 4P73A 4EBEA 4CNZA 4A48A 1MWZA 1MU2B 1N52B 1CC8A 7FDRA 4IRDA 1T0TV 3FJ2A 3KLGA 1KR4A 3THTA 4O3NA 1K9MT 4X4PA 2XMTA 1C2PA 1VQ4S 1SJ1A 5K5MA 2YXLA 1IKYB 5CZXA 5LXYA 3TA1A 1NH7A 1NMEB 1NSKL 3THPA 2OGUA 4C8MA 1VQYA 4DSFA 1UJ4A 3FEXB 1H7XA 4R8UA 2X1BA 4EEYA 1HNIB 3IM9A 2GJFA 1S1VB 5KFBA 1KQGB 4M5GA 1SJRA 2ADBA 2VHGA 3GP9A 2CNNB 1TL1A 1JKHA 2VG7B 3H4BA 3HJVA 4RO0A 3MGJA 2V4RA 2F63A 2ZZTA 3TX0A 1WHWA 4J9SA 4NYPA 1JXVA 3A8KA 2IAJA 1FHTA 4Y0FA 3R5DA 4JYAF 2DTJA 2E1CA 1OY8A 1X60A 2FVCA 2XG8A 2H5EA 2A6OA 5HVFA 1SCJB 1NLKL 1NJWA 3DRSA 1L3VA 2YKMA 4MAKA 3RW7A 2Q3PA 3HVWA 4XPCA 4LR8A 1MWYA 3H5YA 3QT6A 3K7RA 2ZD1A 1M5HA 3BR8A 1PSDA 3QO9B 1S1TA 2GZOA 2XS2A 1OO0B 2DBBA 2J0WA 3JAMU 5B0FA 3SV3A 4ZPAA 2RDDA 2KYXA 1LXNA 2KJVA 1LWCA 5K8OA 1QD1A 4U8VA 2CA9A 1I5OB 2AGPA 3T1HJ 3DLEB 1S6UA 1GTEA 2C3YA 2C1EB 2CQ3A 2GHVC 1FERA 1GT8A 2WONB 3D0GE 3RB3A 4ZVEA 1WHXA 2LU1A 4RNNA 4U7CA 3MMJA 4WTOB 5A8WA 3QWUA 3OTOJ 5F8HA 4WYWA 2CJAA 4QWBA 4W90B 2D9OA 3UR0A 2ZOFA 4UQGA 2AQ4A 2GJ2A 5J2QA 1F2HA 2E44A 4MK8A 2W2OP 3DLBA 7AT1B 4A8WA 4ZP9A 4GMKA 1DFDA 3H5XA 2W8KA 3HT0A 1HPZA 4ECYA 4OYWA 4WXWA 4PZVA 3OR2B 4O3PA 5F8GA 1R8AA 3DCAA 2HVHA 1SJ3P 4NPOA 3D1QA 3QWPA 2ACMA 1IR1A 3E51A 1R8HA 1WSVA 4B3MF 1K44A 4ZCMA 2DXFA 3M2VB 3MXHP 4B3SJ 2Y1LB 5AT1B 3J7Z5 4LSZB 2N7CA 3KLFB 1BQXA 2G2ZA 4WP9A 3OL9A 3RB6A 5GAEI 1J5EJ 1IKWA 3BGFA 4UZBA 3QT7A 4K5RA 1UVLA 3PJXA 4YFUA 1T95A 5BYRA 2FC8A 3ISND 1QJHA 1UZDA 4O44B 1QSLA 4NEZA 4P2XA 1XMQJ 2AJFE 2KVQE 3O8WA 4YP3A 5IWAF 3BYRA 3Q23A 1RK8A 3AB4B 1W2IA 1AXQA 1WKKA 5AJ3F 1TMJA 1VQ8S 3I0RB 4O4RA 2PT0A 3N6LA 2FVSA 4YHHF 3T5LA 3K89A 5K8PA 3MPVA 1QVGR 1OYEA 2Q43A 4P7TA 1KEKA 4ZPCA 4WF9Q 3GYNA 2AKWB 3G6VA 1XEZA 4OMFG 2UV8G 4IDKA 1S0NA 3I5CA 1ZH5A 4IOCQ 2FY8A 3BS9A 4DSEA 2H4WB 3V2UC 2V34A 2PE8A 3EPGA 4RW6B 3M1VA 2DGQA 4F0MA 1T05B 2AD9A 2XY7A 3PACA 4W98A 3NXZA 1XNQF 1VJWA 3C46A 1RAGB 4I2PB 5G0RA 5J1PA 1MROA 3MPWA 2AYEA 2W9CA 1FRJA 1SXLA 1C0TB 4FDFA 3MR3A 4ED1A 1HNVB 4RUHA 1DJ0A 3OW2R 3TAPA 3WC2A 1OSDA 2KXFA 3DLHA 3BGOP 1W25A 4Q8EA 4ED5A 2APOA 2DRAA 4NMLA 3W9JA 1WHYA 8RUCA 2QC3A 2DH7A 1CPZA 4EBCA 1ZPWX 3CMQA 1TL4A 2AV5A 2Q1LA 3EYZA 4HI1A 1SC1B 1IWGA 1XNRJ 4GVBA 1U0SA 1R27B 4NXMF 3UN5A 4PUOB 3NBPB 3HHLB 1M5VC 2O01C 1S57A 4DR2J 3UFCX 3AFGA 1HFEL 4MK9A 4H4MB 3LAKA 4IH6A 3AB2B 3B6BA 5KT3A 2G2OA 5AXLA 1RI7A 2OMLA 3DLKB 3PM9A 3UD5A 1JLFB 1X0PA 5LSRA 2RQMA 3CCES 1U8WA 3H7HB 4CLWA 4HH1A 4GKKF 4IG3B 2HHWA 2ZC3A 1Q8BA 1H2VZ 5C25A 3AOBA 4QWEA 3D54A 4RBTA 1QAJA 2ZJPQ 1OIAA 2RIJA 2AHOB 1YSJA 2W7OA 4TLRA 3A3PB 5LOQA 1SH2A 1KONA 4DN9A 2F8EX 3QLHA 1UEVA 4EU0A 4DV3J 1F9HA 1OY6A 1R0AB 2E1AA 2N4DA 2HBRB 3OHAA 2DCUB 1RTJB 2DNZA 2CYYA 3DFEA 5IFMA 7FD1A 2IVFB 3JSMA 3VGSA 1L3SA 3A3NB 4C8OA 3HZGA 4IO9Q 4TU8A 3DGPB 3TVZA 4M95A 1SL1A 1CSJA 4FKXA 2YKAA 4IOBA 2HK2A 4QW8A 1FKAF 1C4AA 3HHDA 3EGNA 1YGYA 4UF4A 3UE2A 1LK7A 3QGIA 3C15A 3BSNA 2Y3YA 5KFYA 4AT1B 4J9KA 1LXJA 4RBUA 3CB4A 3M8SA 2CG8A 4J9PA 2ZDPA 3I9ZA 3Q2SC 4OQJA 5T41A 3ELHA 1U1QA 1FD2A 1J2VA 1QSSA 3FC9A 4QWAA 1I6JA 3TWZA 1HBMA 3P96A 4HDGA 4R8UB 2IVMA 5KTQA 2DHGA 2FHJD 3C6UB 3CCUS 4PXCA 2ZKUA 3SQOP 3F73A 3FQLA 3LPEA 1TL1B 1DRZA 1JLEA 2V67A 3FBCA 1XMOJ 3IWNC 3AOCA 2QRRA 1XIQA 5M2UA 1EKRA 3HKZD 2EPIA 5B0CA 4BC7A 5L9XA 2HWTA 1FJGF 2K3IA 2PA3A 2IAJB 3IN5A 2PI5A 1VBXA 4DV2J 3S7RA 4ZVSB 2L41A 1PYSB 4OI0A 5HANA 3SQGB 2C3PA 4F4WA 4CM2A 1UVMA 2HFSA 4HKQA 4KTQA 2YKMB 3UNGC 2HNYB 2YY3A 4BS2A 3EMTA 5L1KA 1X31C 2R42A 2BV3A 2ZD1B 4ZCIA 3W8PA 3IS9B 2XMVA 2ZZNA 3DOKB 4JV5J 1S1TB 2GMHA 1NSAA 1D8YA 2XULA 2N82B 2WTFA 4DR3J 2VG5A 1BLUA 1N6QB 4CLLA 1N0VC 2DHXA 3DHXA 4UOCA 5IXUA 4UOHA 2KB2A 2HWHA 1TL5A 2YQ3A 4RZRA 1LWCB 3U1NA 3FQKA 3TA2A 5KOXA 4NL5A 3LP2A 3AT1B 2B4VA 3A3OB 3NS5A 2E9TA 3DI6A 2K7KA 3WZ0A 4JI7J 4EFAC 5A8WB 4ZVUB 2FDNA 4OI2A 3RBEA 1KVJA 4RW8A 1HWKA 5GADU 2E66A 5J2QB 2EBGA 2XLKA 5DDQC 1P9YA 4H4KC 1YIJS 2HAFA 2KL8A 5CZVA 1KDNA 4NLGA 2WB4A 4JI3F 2DY9A 1HPZB 2K7JA 3LF0A 2WVDA 3MCMA 1DZ5A 4ZPBA 4Y2CA 2W4DA 2YWHA 4ZOSA 1SUQA 1FRMA 1U1KA 3VAFA 5HL7Q 3EGZA 3JYTB 2BOAA 2AT1B 4MYTA 3Q2TC 5GAHU 2B7BB 2CJYB 3LGMA 2ZEJA 1Q16B 5CQGA 1SI9A 4LVOP 2PSZA 2BVZA 2BJ7A 2R7RA 2KFNA 1UEKA 2YKNB 4TY8A 4KB7A 2YKPA 2KFYA 1T9VA 2ZVIA 1BGXT 3T3FA 1IKWB 4Q0BA 2AEMA 4KT0C 3K5MA 2OPQB 5HVHA 2Z0GA 4DFKA 4KAIA 2IMWP 4K5SA 1JWWA 2B56A 2XO6A 1LV5A 2VU5A 4P2MA 1HBUA 5ETPA 1ZTTA 4A8MP 2UVRA 1I51B 3D67A 1H7WA 3VVUA 4DV6J 3EZOA 2MKHA 1VQ7S 4JI8F 1TFYA 3MMBB 4W92B 1NCLA 3DYAA 4MIWA 1B7FA 2B5JB 1NZAA 5CAAA 3JSYA 2WVBA 4CP5A 4EBDA 1NB7A 5I4MA 3QGPA 1VK8A 2K8GA 2MQLA 5A76A 2MKSA 4KGKA 1RWVB 1WNEA 4MTPA 4LRCA 3V6DB 3KYLA 3L95X 5FJ4A 1VDHA 2CJXB 4ZPWR 3M2RA 3DRYA 3BSOA 4TY9A 3MR6A 1Q53A 1JLGA 3PO5A 3CJ2A 3O3LA 3BF4A 5DQHA 2KKHA 3RUBL 4R0EA 4ILRA 5G0RB 4YEAA 4DL6A 3T1HF 2W9CB 4JI6J 1D0EA 5F9LA 1FXLA 4YB6A 3EXCX 1YRTA 2IHR1 4Z7CA 8AT1B 2R8KA 2XGPA 4C98A 4DL3A 1B7YB 1WTBA 1RCOB 4UTGA 5A8RA 4OZ3A 2P6SA 4FYVB 4LF7J 2K06A 2CUYA 1LWEA 1KC8T 3W60A 3H20A 5CHCB 2DRBA 1Y5IB 2BUNA 3U1LA 5ETLA 4U7UD 5KG4A 4GVBB 4URGA 2RB7A 2EC0A 2KG1A 4A8OA 4P75A 3I56S 5KFHA 1RHRB 5L1IA 2MY7A 4ZA1A 4HEA9 2RQKA 1Y3JA 2DIVA 2Z2MA 2DIUA 1IBKJ 4ZP7A 1N5YA 4O3RA 1GQEA 4UUXA 3H4DA 2QFJA 4B3SF 3B8HA 4WU2A 5L46A 3RJMB 3P45B 1ZM3A 2NLWA 1CULA 4P6QA 3QIDA 3M7VA 3CJRA 2E1PA 3VZIA 2W9BB 1YX2A 4JI2J 2HFUA 2COLA 3CC2S 4WPAA 3W5XA 2ZUGA 1OJ4A 4DOZA 4DQIA 1RTIA 4TU7A 3TZZA 2ZBPA 3OVAA 4EWTA 1RTDA 4JI1J 1ZTWA 3J81j 1SC3B 1XMQF 5C25B 4MKVA 2C2ZB 3M8PB 1D9FA 1W2BR 3H2LA 3KLEA 2WZ1A 4WBFA 2VG6A 2O3DA 2B43A 5EN1A 4BCAA 4F3OA 4NMXA 2J76E 1U49A 3JSBA 4J9LA 4LF5J 5A2QU 3QLHB 1RA6A 1RT6A 2Z2YB 2R7VA 1K47A 2K1RA 1RU2A 2MKJA 1U1PA 1VHIA 2WBRA 3DHWC 4OZ5A 3J80U 1VC5A 2RUGA 2UUCJ 2ZH9A 4PQUA 1KKHA 1E6YA 4YN3B 4U67Q 4P71A 2IFXA 4N5SA 2HQGA 4DV0J 2VKZG 1RWXB 3MEKA 2RMLA 3GYGA 3TO8A 3CCWA 3A8EA 2FJBB 1UMJA 1OPIA 3DU5A 2QT7A 3FRYA 3CNQP 1FE4A 3AXKA 3DOLB 4P2FA 4QWDA 4RW9A 2ALZA 3EDQB 4JI0J 2YWFA 2D74B 3TZYA 4ZJOA 5M2PA 1R6YA 3P49B 2R7OA 3UD4P 1N33J 3DNCA 3PIPQ 3OBIA 4CWBA 2HK3A 4I4BA 2W4PA 2YNGB 3CXCR 3UDCA 1FJ7A 4DR2F 5BXIA 1PJ6A 4LF9J 1Q86T 3HFKA 4KO0B 2FHMA 3M32A 3AA9A 4C8ZA 4ANEA 4JB8B 2DH8A 1NM2A 2DB1A 2E9ZA 2DNRA 3VAJA 1WUUA 3WQPA 3EVMA 1CJTA 5RUBA 2IDEA 1RTZA 4IG0A 1RT1A 1RHMB 5KT5A 4RUAA 2J0QD 1KQKA 3KG4A 3TUJC 4B08A 2VBZA 4CO1A 1EKSA 3CC4S 4I2QB 4PWUA 4M5DA 2EFNA 1UFLA 3OFEA 1GH8A 4PG4A 2CQGA 4FYWB 4I7FA 4WKRA 2FJWA 1TV6A 1VIOA 4OJ3A 3EPIA 2JVRA 1UAWA 5C24A 4QWCA 3IA0A 2VV5A 3WC0A 4IQXA 2YKOA 3NCPA 2FJEB 1YZ7A 4DV3F 3KG0A 2Z4PA 4ANDA 1OMSA 1U09A 3LP2B 2GC8A 4I6AA 1MN7A 4U96A 2FYXA 3TUPA 2ZH8A 3M05A 2QYCA 2DNNA 3V81A 4RW8B 1WORA 3PV8A 1I94F 2RAQA 2PO4A 3R9LA 5JMNA 1N32J 3U02A 3GJSB 3M4XA 1S12A 2ZH1A 4EI2A 2H3EB 2R8IA 1SUQB 3SSQA 2YTCA 4XDDA 2XEXA 4CH7A 2JC1A 4LSLA 2GX8A 1M90T 2NXNA 1RE1B 1YJUA 3A1YG 3IAS9 3IG1B 5IQ6A 1R0CB 1RLCL 3QZ7A 2MZQA 2O1PA 1FNOA 4Q2LA 3LQVA 2HHTA 3ITHA 4K4YA 2V8VA 4FKYA 2J9DA 4TY8B 2EC2A 2HZVA 3G6ES 2W8LA 1RBOB 4Q0BB 2XBPA 3FSXA 1GMWD 4ITSA 5U47A 2J8SA 3QPIA 5DQGA 2J0XA 1PBUA 1HBUB 3Q24A 3HCXA 5GAGU 1L3KA 3TA0A 2XMAA 3DXBA 3VAKA 5AE2A 1P8GA 3W5YA 2V2ZA 1TL3B 4B9SA 1KLMA 4GO7X 3G87A 1Q78A 5FD1A 3ILIA 2OFHX 3GPAA 2GO9A 5DETA 3G71S 3FRZA 4OI4A 2Z58B 3MD3A 1PAEX 2KM8C 4R5PA 1QLNA 2AX1A 4ZVRB 4JV5F 3RBZA 2NYIA 1QSYA 2UXCJ 2DGVA 2L08A 2FVQA 4P72A 4DR3F 3QRQA 4Q5VA 3M2RB 3JXOA 2HZAA 3DLJA 3A13A 1JLGB 3SEOA 4LR9A 3RU0A 5HMYA 4DCJB 1WG1A 1HQUA 2YPYA 3DC2A 4A8SA 4ZVOB 4OX9F 4FP9A 3V4IA 4DBQA 4JI7F 1T7PA 1Q7YT 5C42A 1FVSA 3S8SA 2MHNA 4GKJJ 2AJ4A 3LTOA 3GCXP 1CJKA 2YNIB 4B02A 2R7QA 5CCLA 3AQOA 2ZHBA 2W7AA 1S76D 3TVYA 5E7OB 4E8UA 3NWGA 3IR5B 1LOUA 4A8FA 4UT4A 2HFOA 1FJEB 4YR2A 4DV4J 1MSWD 4NLPA 2RKIA 2CQCA 1F5AA 4M8LA 4CO4A 5BYSA 3KHGA 1N5YB 2GQ2A 2UV8A 2VJUA 1FEEA 4I1TA 2HLTA 3KFWX 4QIVA 4PCQA 4KGMA 2BJ1A 1HR0J 1RISA 2AP6A 3L3CA 1YVFA 4ER8A 4ENOA 4Y65A 4IUFA 3PDNA 1B0VA 2R2SA 1ZZNA 2NYHA 3M6XA 2G0JA 4CCHA 5CH7B 3MZIA 3AH6A 4XPEA 3T19A 2HHQA 3R5AA 1U1OA 5A0YA 1RTDB 4DV7J 4DR4J 3PR5B 2CNOB 2J9CA 2LCWA 1Z2LA 2R7TA 1FNMA 2QTWA 4IO1A 2BJEA 4J5OA 4CDIA 5IS2A 2QG9B 2G13A 4UY8T 4CO5A 1BQMA 3LPYA 4OYAA 1HLWA 5KFDA 1CEZA 4P9SA 2UUAF 2FJAB 4NLQA 1FX4A 2HAIA 1TKXB 2WSEC 3W2WB 4MH8A 4IR1A 5KFRA 4DS4A 2RUSA 3HJFA 5AE3A 4QR0A 1ROFA 2YH1A 3SYZA 3NGSA 5L1LA 2K1RB 4MKYA 1CG2A 4ZK7M 3D1OA 2OELA 3M6VA 4Y2IA 4C8KA 2DT9A 2Y1RI 1VOMA 2KG0A 2W4CA 1PKUA 3HLUA 1Y00A 3VQTA 3ENVA 4C0BA 2XLIA 2I9SA 3BDEA 2Z8QA 1WOSA 4Y6IA 4Y2AA 1E6YB 2UXDJ 5FDLA 4RX6A 4JI6F 3PW0A 1RSCA 2RJZA 1JJCB 4RU2A 1NDCA 2CJ9A 4HACB 3SMZA 5CCMA 4D3HA 4LF7F 4RW9B 2HS4A 3N0VA 5JVGQ 2O66A 3EUNA 2KXNB 1TL7B 3M8WA 2GAGC 4LFBJ 2L48A 3NGDA 1NKCA 3BGRA 4M5KA 1G4CA 4OYZA 3O2IA 2VDHA 1S6OA 2NXUA 1H3DA 3CCVS 3GMGA 3CCTA 4KV8A 5HN0A 2FTRA 1IBKF 3R1LA 5J2PB 2NXCA 4LREA 3TJ8A 3K57A 2C2MB 3M32B 4NRUA 2C2KB 4K0KJ 3VGVA 3G6XA 2BJ3A 4JI2F 3VCDA 1N5VA 2J0SD 4X4QA 4USHA 1Z4UA 3MD1A 1WTFA 3HFVA 3QIPB 1JLCA 4OZLA 5D4PA 1TU0B 5IM0B 3OXLA 2P8IA 4IG0B 3LWMA 1RT1B 4JI1F 1KFSA 4ZPTR 1B3TA 3NMAA 1S0OA 3E2EA 5A6PA 5G4DA 4USKA 2Q6CA 2U2FA 4M5DB 2CNLB 3BQ0A 3OFGA 1LWFA 4A4JA 4K4ZA 2MY8A 2JLEA 2IRXA 3ZTQA 1FDDA 4QYZJ 1OQ6A 2XCAA 2DO4A 5CYQA 3I82A 4LF5F 5KFLA 3QQCD 5C24B 4CLSA 4EYIB 3RBDA 2R8GA 3W2VA 2LXIA 2E29A 3RTVA 3EDRB 3BSAA 3GQCA 3L7PA 4J9UE 3HHLD 2UUCF 3HSJA 2XZDB 4NCGA 2GVDB 3N4WA 5D4NA 3AAWB 2JEGA 2ZUAA 3CJ0A 3HX9A 3D6FB 4DPOA 1B0PA 2L9WA 1REVA 2ASDA 2J7WA 3CCJS 4NE9C 5DG7A 5EWGA 2VD3A 4YQWA 3NOGA 1SV5A 2F8HA 4DV0F 1RT7B 2CZVC 1RAOA 5GAHI 3ZZTA 4DPUA 4USVA 1XQIA 2M70A 1JNZB 1WG5A 2RVJA 3QGGA 4GC6A 4WFXA 2HHSA 5GVQA 2I6WA 4LSNA 2UUBF 3W8GA 1H38A 2YQ1A 3UDEA 3DRXA 4C8YA 3CCZA 2HBZB 5E3PA 3BQ1A 4MIAA 3BPDA 4LF9F 4OJGA 2ZBIA 5HROB 3Q8YA 3KLIB 1X4FA 2IC3A 4HTIA 3QAEA 3AA8A 5F8MA 3ZTRA 1AROP 3MMCA 1HNXJ 1ZZFA 3MAQA 5KG2A 4ZHRB 1X5OA 1U2FA 2EFOA 2Y1JA 2VQEJ 2IJNA 4RPFA 4A8KA 2JLFA 5LMUJ 4DV5F 4YOEA 3I5BA 4AL5A 4DUYF 1FTCA 3J7YU 2BE2B 4DPXA 1PBAA 3H98A 3CJKB 1P9QC 2JL9A 3IWLA 1QM9A 4OFZA 3Q8PB 1UVNA 4AL7A 1UVJA 1VRUA 4ED0A 3FGVA 2MKIA 1PAUB 1HMVB 2CKWA 2HBQB 4R5PB 2B7CB 2V2KA 2XNQA 4DUZJ 2R7SA 2WOMA 3CJ5A 3GR1A 3CEDA 3KJQB 3KXDA 3H5SA 2VKRA 1ZETA 2JJ4D 2ACYA 1SIZA 1EARA 2KRRA 3VZHA 4ED7A 2CQ2A 2OJ3A 2AGQA 5KG3A 3RB0A 5IT4A 2NCKL 3QATA 1N5TA 3OJSA 2YPZA 4BDPA 1QAYA 2CQHA 3P8BB 4JI5J 3MEDB 2LA4A 3Q8UA 1CJKB 3H59A 5JUMA 4TYBA 1URRA 1FWKA 3RR8A 5DLFA 3VGUA 4CLKA 1EIYB 1GX6A 2UXBJ 4ES1A 4LF8J 2XC9A 1IKYA 2ATLA 3OPKA 3N79A 4DHVA 4KRWA 4P2SA 2RKIB 2GFFA 3HT3A 3NCQA 4X64J 2VONA 4K2JA 3VAMA 1SPBP 5D6GA 4WFYA 2KHCA 1HNIA 3CC7S 2AU0A 1S1VA 3A8JA 1J5OB 4KE5A 2LMIA 3NGKA 1DARA 3ILJA 3FNNA 3TVKA 3IBFB 4QIWD 2LQ5A 3RW6A 1FWPA 5KFJA 4DPTA 2WW8A 2OD4A 3ENAA 1JMTA 3DN9A 2L9NA 1AA1B 2AIRB 2XMJA 1C1BA 1FESA 2F3JA 2XWXA 4LT6A 2V8PA 1IJEB 3AJDA 4KHMA 4W4MA 3B54A 1T3NA 4LFCJ 2XQCA 4DU7A 4RWXA 1T9YA 4X4UA 2CPDA 4DL2A 3F44A 2UVWA 5D3GB 1RWWB 2M8DB 3H5UA 2BDPA 4DQSA 3QO9A 4OX6A 2HVEA 5KFZA 2NXEA 3GIRA 1KP6A 2D9PA 5D4LA 2ZKTA 5T14A 1Q8IA 2DNMA 3BREA 5LSOA 3IP0A 4OL8A 1F5CA 4PG7A 3M8YA 5CD4H 2P5VA 4Z2XA 2VIHA 4HT5A 3CMES 2ZITA 3QGHA 1QUPA 4IRKA 3DKDA 1UZHA 2KYZA 5JJBA 4ZVPB 4ED6A 4ECTA 3TZXA 4DL5A 3FDSA 1IJFB 4TU9A 4AXIA 5FDLB 1ELOA 1VIXA 4X4SA 1JXEA 4TN2A 1XBWA 3LW5C 1M5OC 5CYMA 5ETVA 2EK6A 2QMWA 1TR0A 3TARA 4K4UA 4A8YA 3GG0A 3KUEA 3Q0AA 2HQDA 1Q79A 2YQ0A 2FHJA 1Q5YA 2QGFB 2QMXA 1FXDA 4LRDA 2HFNA 2KZZA 2CZ9A 2N3LA 1RAJA 3R3TA 1PJ5A 5HQMA 4G1PA 3KLFA 2AF6A 2QSWA 2KHDA 2V4JB 1UA0A 2QA4G 5KFGA 1YG0A 2AJ0A 3BYPA 1EB0A 4O44A 1X5SA 3SFUA 1RCXB 2MHEA 4FF4A 2FPHX 1Y10A 2BOPA 1JLCB 3RZAA 3I0SB 1HWIA 2ZOGA 2AJ2A 4DR4F 4WIIA 3I0RA 3SDEA 3FEYB 1NDLA 3FEZA 4QW9A 1FCAA 3DLLQ 4DZDA 3TX8A 1NBEB 3N28A 4ZPVR 1P6TA 3QSIA 3QRPA 4DZ6A 5JVHQ 4FF2A 2AYGA 3P4UB 2BX6A 1FX2A 4CYUA 2VPWB 3KDOA 1CJVB 3C66A 2CQPA 2HNDB 2N4CA 2V8HA 3CD6S 1FRXA 3HHLC 5CYQB 4RW6A 4PG6A 2YWWA 3ZZUA 4NLRA 2YVSA 1Q8KA 2HYIB 3SCLE 1S6PB 2LDYA 2RE1A 3U27A 4K4SA 4OV6A 2GGPB 2M88A 1NNDA 2DHHA 3O6QA 4ELVA 2CPEA 3RR7A 2V8GA 3OR1A 2OSRA 1C0TA 1Z2ZA 5KFAA 3OTEA 2EK1A 2V0NA 2VBWA 4FVMA 5KFSA 4MYUA 1RWKB 3SSRA 1X4HA 5D0EA 1YJWS 2J6UA 2DR9A 4RNFA 2DXEA 1F6TA 3SCIE 4PUOA 2RNEA 2FVPA 3NBPA 1WC5A 4LFBF 4ZCKA 4RR5A 3PJWA 1S1WA 4OYPA 4YB5A 2XYHB 2GAHC 2BQRA 1CBKA 2ZE2A 4DCOB 1QAXA 3VF0B 4O0IA 4N56A 3RBXA 2EFPA 5GAGI 2YBVA 5LT5A 2F4VJ 1UL3A 2UZAA 3Q86A 2KFZA 2O5DA 3A4TA 2IC3B 2VODA 1RUSA 4MIBA 2Y8YA 2JRSA 2A2DA 3MMCB 2PMZD 4IH7A 4IG3A 1RWOB 4BLGA 4AQYF 3FSIA 4KJIA 5KFXA 4FXWA 3PNIA 2JFKA 3KNGA 4QR1A 4FVCA 1GEHA 2BXJA 3J7A1 2QL7B 3P5BP 4KBIA 4BWJA 4WP8A 4WXOA 5ETMA 2QSFA 3MOJB 3R97A 3RAXA 2ZNYA 3CJ3A 1VRUB 5F8LA 1XMBA 4NLWA 1X4EA 2DGSA 2CPYA 3GB0A 3R2DJ 2AYBA 3TAMA 1TAUA 2WW4A 4NWBA 2FB0A 2GCFA 3ULHA 2WOMB 4DXLA 2ZH7A 1FDNA 3WIVA 3G6YA 3UVJB 3MHYA 5BYQA 2HQFA 4B9MA 3ADAC 1UPMB 2OAUA 1ZBTA 3BO4A 2MZJA 3DGPA 2V69A 1X7VA 1LFWA 2QO3A 4K59A 1RT4B 4LF6J 2LXUA 5J1EA 4R0JA 4JV1A 1LNQA 1SBRA 3R5BA 2RRAA 1DQ9A 4R25A 1S1XB 1OYDA 1UWAA 3ET6A 1WDTA 2CQBA 1U47A 2HWIA 5K8NA 2DGXA 1R6VA 4RW7B 4NI2A 2ZH4A 1Y5NB 3D6HB 4J9VA 5F3TA 2IBOA 2XM3A 1HBNA 1RAHB 4CZCA 3TRGA 3CJ8A 5MLCV 3HXMA 2RS2A 1QTNB 3P5TL 3FBBA 4PQAA 2MMYA 2W2MP 4NA2A 4AXJA 1PO6A 2DNYA 5E5NA 2HEKA 4PWWA 3C6UA 3DMJA 2XLJA 2MZRA 3OVBA 5C7PA 1DLOA 3MECB 4DSIA 1K1SA 1S97A 1R3NA 4XIUA 1TAQA 4LRAA 5I3UB 2MLYA 1EP4A 2ZM6F 1YWXA 3D9BA 5KFCA 1T11A 2C42A 3GILA 2YX4A 3KK2B 3SXLA 2PEBA 2GW8A 2HKEA 4HVZA 4IR9A 2F9DA 1C1BB 2FJXA 2JHEA 3VR1A 1JLQB 4B3RJ 2ASLA 4ED3A 2XHCA 2VFRA 1ZAVA 2HVZA 5CABA 3Q83A 3ZNUA 3SQGA 2ROPA 1UCNA 2VQEF 2DNQA 4LF4J 4E2FB 5GMDA 5LMUF 4RNOA 4OHYA 3T1YJ 2HNYA 1YRXA 1AW0A 2E5LJ 1RWNB 4UW2A 3CDEA 1U7LA 3PXGa 3IS9A 3DOKA 5DM7Q 3MR7A 2OPPB 4IQMA 4OHZA 3FCVA 2HHHJ 2YWKA 2PA8D 2KO1A 2NSCA 1S5ZA 4LFAJ 3ZTPA 1N6QA 1WOOA 2G9OA 2ZWOA 1TK0A 1NKEA 4L76A 5ETSA 4DUZF 2XNRA 3GLJA 4NZ6A 1FFGB 3CJQA 4X65J 3CD0A 1U1MA 1UWBB 1RACB 3W9HA 3J7AN 5KG1A 3T9ZA 2JDJA 2BRLA 3G4SS 4NCBA 4ILMA 1ICEB 4Z7YA 2PMHA 4F2SA 2KH9A 4JI4J 1IBCB 3EGWB 1KVKA 2NUHA 5E3RA 3FMBA 2E7VA 2G0CA 4FS2A 1XTZA 1C4CA 3KOAA 4KKOB 3WX4A 3BR9A 5CYMB 2J5AA 2FHKA 3HHKA 3FCWA 1BQNB 4ZS6A 2J7UA 3D5MA 4JI5F 1FRLA 2HRTA 1DTTB 1XR7A 5IV3A 1NK7A 3TYTA 3H25A 3BH7B 3JYTA 2Y1IA 1YITS 5FLXU 1XC9A 1IKXB 3EE3A 5AE1A 2UXBF 3FBFA 3DDNA 1VQOS 1PGZA 4MK7A 2ADCA 4QBUA 1H0HB 4TVAB 5D78A 2I8EA 5DJBA 1UJ5A 4ZIVA 1MW7A 1HHTP 4BHQA 4X64F 4UOFA 2CXEA 2YKNA 1SKWA 4JV2A 5ETTA 4P74A 1L5UA 3EGVA 4CQ1A 3OXGA 4F7VA 1ITPA 4MMOA 3ZZ0A 4F4XA 1GXLA 3QZ8A 2OPQA 4QR2A 1KNZA 5THWA 5KFQA 4I64A 1JLBB 1ZA1B 4HDHA 4NZ0A 4OHVA 2WB1D 1FEHA 5H9EJ 1RP5A 2FZCB 3EZUA 5E3AA 3MMBA 2A2CA 4USTA 1SKRA 3SDEB 2B5JA 4WZMA 5DQIA 2VDIA 1RWPB 3PEJA 1A6LA 4LBIA 4EK2A 4LFCF 2D3UA 3MAAB 3M8RA 1D8ZA 3OLBA 4B9UA 4F26A 3LP1A 3M30B 2ZJRQ 3FCHA 2F4FA 3V6DA 4CYUB 3C14A 4YUDA 1NZ8A 4C0OC 4NLYA 2NZCA 3CULA 5KG6A 2QA1A 3JTOA 4KYZA 2KI2A 1NEEA
chains in the Genus database with same CATH topology
4CLKA 4CLTA 1WC5A 1FX2A 1WC1A 1WC4A 4CLUA 1CJVA 1CJVB 3C16B 4OYIA 4WPAA 4OYPA 2W01A 1CJTA 1CJTB 1CJKA 1WC3A 3R5GA 3UVJA 1CJUB 1WC0A 3UVJB 4USVA 1YK9A 4OYAA 4CLZA 4WP9A 4P2MA 3G82B 1U0HB 1TL7A 1TL7B 3ET6B 1FX4A 4CLPA 4USUA 4OYZA 1AB8A 3C16A 1AZSB 4OYMA 4NI2B 4OZ3A 2WZ1A 5D0RA 4OYXA 4CM0A 4CLWA 1CJUA 4P2FA 4USTA 4WP3A 5IV4A 3G82A 4CLSA 1U0HA 2GVZA 2GVZB 4P2XA 3C14B 3ET6A 4CM2A 2BW7A 5D0HA 3MAAA 3C15A 3C15B 2QV6A 3MAAB 1Y10A 1AZSA 4OYOA 4CLFA 1CS4B 1YBUA 4NI2A 4OZ2A 5D0EA 1YBTA 5IV3A 4WP8A 5D0GA 2GVDA 2GVDB 3C14A 4USWA 3MR7A 4OYWA 4CLYA 5D15A 1Y11A 1WC6A 1CS4A 1CJKB 1CULA 1CULB 4OYBA 4CLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLK A;  4CLT A;  1WC5 A;  1FX2 A;  1WC1 A;  1WC4 A;  4CLU A;  1CJV A;  1CJV B;  3C16 B;  4OYI A;  4WPA A;  4OYP A;  2W01 A;  1CJT A;  1CJT B;  1CJK A;  1WC3 A;  3R5G A;  3UVJ A;  1CJU B;  1WC0 A;  3UVJ B;  4USV A;  1YK9 A;  4OYA A;  4CLZ A;  4WP9 A;  4P2M A;  3G82 B;  1U0H B;  1TL7 A;  1TL7 B;  3ET6 B;  1FX4 A;  4CLP A;  4USU A;  4OYZ A;  1AB8 A;  3C16 A;  1AZS B;  4OYM A;  4NI2 B;  4OZ3 A;  2WZ1 A;  5D0R A;  4OYX A;  4CM0 A;  4CLW A;  1CJU A;  4P2F A;  4UST A;  4WP3 A;  5IV4 A;  3G82 A;  4CLS A;  1U0H A;  2GVZ A;  2GVZ B;  4P2X A;  3C14 B;  3ET6 A;  4CM2 A;  2BW7 A;  5D0H A;  3MAA A;  3C15 A;  3C15 B;  2QV6 A;  3MAA B;  1Y10 A;  1AZS A;  4OYO A;  4CLF A;  1CS4 B;  1YBU A;  4NI2 A;  4OZ2 A;  5D0E A;  1YBT A;  5IV3 A;  4WP8 A;  5D0G A;  2GVD A;  2GVD B;  3C14 A;  4USW A;  3MR7 A;  4OYW A;  4CLY A;  5D15 A;  1Y11 A;  1WC6 A;  1CS4 A;  1CJK B;  1CUL A;  1CUL B;  4OYB A;  4CLL A; 
#chains in the Genus database with same CATH topology
 2MZS A;  3K8W A;  3TJA A;  1N48 A;  4ELT A;  3TOQ A;  1HKA A;  1AFI A;  3RGI A;  2BYC A;  1VBY A;  1YLX A;  1RYS A;  5HQ8 A;  3HF5 A;  2RU3 A;  4ID8 A;  3R5G A;  3OR1 B;  2LEB A;  5B08 A;  2LYV A;  2W9A A;  1IWA A;  4NEY A;  2DIS A;  4QOT A;  2IMO A;  1PIL A;  3EWG A;  2E9R X;  2R7X A;  2DVI A;  4JYA J;  4NLV A;  4ZIW A;  3M9O B;  3CVK A;  4XK8 C;  1U1L A;  1R43 A;  4EO8 A;  1X0F A;  2AX0 A;  2H51 B;  2Y0S D;  2Q66 A;  1MWQ A;  3IGV A;  3D68 A;  2LQ9 A;  2KN4 A;  4IFV A;  2RH3 A;  2LP4 A;  2EW9 A;  3C3L A;  5E3C A;  2IM1 A;  2B8P A;  2CPF A;  4BC9 A;  3CDW A;  5AXN A;  2MPU A;  5K14 A;  2ZDO A;  2WSC C;  1L3U A;  1S72 S;  1IUJ A;  4O3O A;  1S1W B;  4WFZ A;  4F67 A;  5B7W A;  1EZZ B;  4F3Q A;  5E41 A;  2ZE2 B;  3N6M A;  4K4T A;  2BEF A;  3MOZ A;  3VAG A;  1FF2 A;  1VBK A;  4WJB A;  5C2G A;  5IT0 A;  5F9N A;  1LEO A;  4F4Y A;  1S4E A;  2W9B A;  1WC4 A;  4ZN3 A;  3V4M A;  2W24 A;  2CJQ A;  3L9Z A;  3X1L B;  3GV8 B;  3HSZ A;  2FJD B;  4TXS A;  3GFZ A;  2CAJ A;  3J7Y I;  1BMQ B;  3KUH A;  1JJH A;  4HYK A;  4N8N A;  3T41 A;  3AD9 C;  3D6M B;  2F8M A;  4F0H A;  3M8P A;  2DGO A;  3UDL A;  1NDP A;  4OYX A;  2FZK B;  4X66 F;  2MKK A;  2CAD A;  2DKO B;  2BW2 A;  4MT1 A;  1CVJ A;  2AGO A;  4B3M J;  3K8V A;  2OTJ S;  1D09 B;  2MSS A;  2OD6 A;  4ANC A;  1ZAX A;  2J9D E;  3KWM A;  1LQ9 A;  4DN0 A;  2X51 A;  4M5J A;  1NK0 A;  3TAM B;  5GMK a;  1QE1 A;  2H5I B;  2OLW A;  2XSF A;  3KKF A;  1U6B A;  4UUW A;  4A8Q A;  3T5J A;  4ZJL A;  4J9M A;  1V6H A;  2Q6B A;  3TQE A;  3M2U A;  3LP0 A;  1N5Q A;  2IJR A;  5J1E B;  3CJS A;  5H9F K;  1UET A;  5J2N B;  4DS5 A;  2CPH A;  1SH0 A;  3CF5 Q;  1UVI A;  3ET6 B;  4DG1 A;  2JOQ A;  3QJJ A;  1RT2 A;  1BXN A;  4NI2 B;  4ECW A;  3JQK A;  1NXI A;  3DOL A;  1HBN B;  1M0S A;  2KT5 A;  2NSB A;  2NS1 B;  3SI8 A;  5DRK A;  3D0H E;  4ILL A;  2JH3 A;  4ZVQ B;  1AFJ A;  5HAT A;  3PG9 A;  1H6K X;  4PAB A;  1Y9O A;  4BBY A;  4M5I A;  1ZOT A;  3CSK A;  2N7Y A;  1SQG A;  2GIQ A;  2YNG A;  3K5L A;  4DUT A;  1IBL F;  3DMJ B;  4NLT A;  3HHN B;  2MJN A;  1F9F A;  1DLO B;  4ZLN A;  1XNQ J;  1TVR B;  2OEM A;  3E01 B;  4KO0 A;  2FVR A;  5CYJ A;  4ICL A;  1M5P C;  1N56 A;  1VQS A;  1EP4 B;  5A2Q Y;  2LEA A;  3N01 A;  3MM8 B;  3GIM A;  4KHR A;  2PGC A;  2ZH5 A;  3PY8 A;  3BKF A;  1UEU A;  3ENW A;  3MDF A;  3Q8V A;  1WC0 A;  2WK4 A;  4URQ U;  3TJ9 A;  2B6A B;  2D3O R;  2XI3 A;  2VF3 A;  1TTH B;  3J80 Y;  5E2Q A;  4WWS A;  2JEI A;  4WIQ A;  3C16 A;  4L6V 3;  5IQQ A;  1JJ2 R;  2XY5 A;  5CA5 A;  4I2Q A;  1WD6 A;  2MZ1 A;  1FO1 A;  3I31 A;  4D3G A;  4X4R A;  1LFP A;  1IM6 A;  2XMU A;  4ERD A;  2ZBC A;  1VQ5 S;  2OPS A;  1N36 F;  3I9V 9;  5DS7 A;  5K20 B;  4FYX B;  4L73 A;  4USW A;  1VK3 A;  2R2U A;  3I96 A;  5D15 A;  1LW0 B;  2GV1 A;  2JFD A;  1K8A T;  1T8E A;  1FK9 A;  1V3Z A;  4GKK J;  3UN2 A;  1XER A;  1JX4 A;  5HVG A;  2D3O 1;  5HBM B;  1WC1 A;  3MM7 B;  1S0V A;  2NZ4 A;  2HS3 A;  3MEG B;  1IR0 A;  2HVI A;  4QIG A;  1NHV A;  2M0G B;  2W2N P;  3MR2 A;  4DCP B;  1YJT A;  4ZP6 A;  1FE0 A;  3V6K A;  3K5P A;  4GC7 A;  1RHQ B;  2F40 A;  3N9U C;  1RDR A;  5CXT A;  5HLF B;  2L9D A;  2HIQ A;  3IG1 A;  3BKU A;  4LMZ A;  4GO5 X;  3MFH A;  1RBL A;  4G3I A;  1QDU B;  4GRS A;  1K0T A;  1N54 B;  3QFW A;  1K1Q A;  4RU9 A;  2FHO B;  2ZZM A;  1O6X A;  5J2M A;  2C3O A;  3OJU A;  3IAM 9;  1M5K C;  3MUM P;  1XK8 A;  1DQ8 A;  3OL8 A;  3GV7 B;  3CPW R;  3QJL A;  2R8J A;  2V94 A;  4HR2 A;  1DTQ B;  2DPI A;  4Q2M A;  1U8S A;  3W65 A;  1S1U B;  2CQ1 A;  2MB0 B;  3PYD A;  4C6A A;  2RDI A;  3DRP B;  5MAO A;  1HBO B;  2AEJ A;  3GU0 A;  2Z2L A;  2MJU A;  1TL3 A;  1YJN S;  2DGW A;  4C48 A;  5EWE A;  1NK5 A;  1T03 B;  3I32 A;  4ID5 B;  4JV0 A;  3J81 Y;  2D69 A;  3DOM B;  5ETR A;  4YB7 A;  4LF4 F;  1VQP S;  1NUE A;  1SH3 A;  3T1Y F;  2DR8 A;  4NA1 A;  3C6T A;  3LP1 B;  3MEE B;  2ZC4 A;  4S0M A;  2GHW A;  1VLO A;  3C14 B;  2R2T A;  1NJI T;  4CO3 A;  4H4O A;  3KTQ A;  4B9L A;  2K3K A;  2IM3 A;  1KHV A;  2H54 B;  4N76 A;  3LH2 S;  3H0P A;  3WIU A;  4LFA F;  4YME A;  4Q8F A;  3R5J B;  3SCK E;  3KHL A;  4KGX B;  5T7L A;  1Z1Z A;  2XSJ B;  1PJ7 A;  3B4D A;  5EWF A;  2HLU A;  4Z37 A;  9ATC B;  1FJG J;  3HO1 A;  4LRF A;  2IYG A;  4X2B A;  4V19 J;  2RIL A;  1CQN A;  3VQS A;  3E8O A;  3EJM A;  3OTO F;  1K0V A;  4PXB A;  4JI4 F;  4DWI A;  1RBA A;  2I5J A;  4J91 A;  1HA1 A;  1X9M A;  1HQ2 A;  3SFG A;  4CRJ A;  1QUV A;  2YNI A;  4QYZ K;  2JWN A;  3WDO A;  2J8A A;  1WI6 A;  4O3Q A;  4Y00 A;  2W1B A;  3OUY B;  2MKY A;  1FFW B;  2G0I A;  3VWS A;  1Q81 T;  2R2R A;  1RT3 A;  4IFV B;  1Q8L A;  1YJ9 S;  1OSC A;  3EVO A;  4OYM A;  4ZMM A;  4NYZ A;  3GG1 A;  3GWC A;  4CM0 A;  2OSQ A;  1CJU A;  5K14 B;  4L72 B;  1YJV A;  1VIS A;  1X9W A;  1VRT B;  1HNW J;  3BBB A;  4M5M A;  1GX5 A;  5KG0 A;  2KTQ A;  4WK3 A;  1VQ6 S;  3BGU A;  2X7I A;  1NAQ A;  4Y2M A;  2L3M A;  2C3M A;  1J5E F;  4WKY A;  4JUZ A;  4C3L A;  2KZM A;  3NNC A;  5C5J A;  1MLA A;  2AW0 A;  2LXF A;  1TKD A;  3E3X A;  4EMD A;  3IFE A;  3QT8 A;  3OL7 A;  3CCS S;  4JI3 J;  2CPI A;  1U25 A;  4OYI A;  2EVZ A;  4I69 A;  3MCO A;  4KSE B;  3PKY A;  2ZH3 A;  1NB2 A;  4OI6 A;  1D9D A;  4DQP A;  2ROG A;  3MR5 A;  4NX9 A;  1M1H A;  1R8C A;  1TKX A;  3W2W A;  1F3F A;  3MPD A;  5BR8 J;  4ZDN A;  3A8I A;  3IR7 B;  3NLC A;  5H1S V;  2A6M A;  2IJF A;  3Q8Q B;  4PXD A;  4KFB B;  3H8Y A;  3NY0 A;  2RSQ A;  3MAH A;  2GVZ B;  1TFW A;  3MI7 X;  2RU9 A;  1FRI A;  4QIE A;  1QE1 B;  1NK9 A;  2RHQ B;  1BY9 A;  1RWU A;  5KOW A;  4N8O A;  5A6W A;  1N4L A;  4RW4 A;  3BZQ A;  2E1R A;  4DV1 J;  4DU8 A;  3DM2 B;  3FK4 A;  1PC4 A;  3M2U B;  4Y34 A;  3LP0 B;  2EFQ A;  2DNH A;  4HI2 A;  4ECS A;  3Q22 A;  1REG X;  1Y11 A;  4F0K A;  4F4Z A;  3QBC A;  4F4A A;  1WWH A;  4JI8 J;  2AJ1 A;  2BE7 D;  4DG1 B;  3GON A;  1H72 C;  1RT2 B;  4HAC A;  4FYD A;  1TKZ A;  5HMZ A;  3HZE A;  1RT5 A;  3QT5 A;  1NO8 A;  4RUB A;  1C1C B;  4OZ1 A;  4NXN J;  1TL7 A;  3NOC A;  2R7U A;  3U1M A;  3P6Y C;  4DQQ A;  1A9N B;  4J9Q A;  4WCE Q;  2VA3 A;  2WVE A;  1XNR F;  1TUG B;  1H98 A;  2HHV A;  3KK3 B;  2LQ8 A;  1BD6 A;  5J2P A;  2JZ5 A;  4DR1 J;  5D4O A;  1X5T A;  1B70 B;  3PZP A;  3QFH A;  3WHI A;  2CFX A;  4ICL B;  4PPZ A;  2BQ3 A;  3ETO A;  1NJY A;  1SL2 A;  3BO3 A;  1K73 T;  3V6H A;  4C7Q A;  4Q44 A;  3LAN A;  3QIP A;  1SIW B;  5IM0 A;  2CPZ A;  4OIX A;  3KMS A;  4LIW A;  2NRE A;  4PXE A;  3BN7 A;  4NCA A;  4B17 A;  1BHN A;  1XN9 A;  2B9W A;  3C16 B;  3OFH A;  2JVO A;  1HIY A;  1U6Z A;  1PIE A;  2CJK A;  2LQB A;  3D3C J;  2ABY A;  2HRU A;  3I4P A;  2XZT B;  4X84 A;  2AEF A;  1KVI A;  3R5C A;  2IRY A;  1ZS6 A;  4FXD A;  2HHU A;  1FT8 A;  1S49 A;  2OPS B;  1MML A;  5ETK A;  4DR7 J;  3W62 A;  1B0T A;  2D41 A;  1RHU B;  1S4F A;  1X4C A;  1A0O B;  4ELU A;  2CWX A;  1KQS R;  1AZS A;  1HI0 P;  1P1L A;  1TZ0 A;  3MMA A;  1MG7 A;  1YBA A;  1FK9 B;  4DSJ A;  1SL0 A;  1S9E B;  1P27 B;  1MN9 A;  2E7X A;  2CQD A;  2GVD A;  3J81 U;  3GII A;  2BM0 A;  2OP5 A;  4WFB Q;  4TYA A;  4FBT A;  2R9L A;  2NXJ A;  2GJI A;  2Y9H A;  3NP5 A;  3SSS A;  1GTH A;  1DBD A;  5KFW A;  5B0E A;  5HMX A;  1RQ0 A;  2VJV A;  2B9E A;  1NJZ A;  3CGI A;  1RT7 A;  1J27 A;  1RYR A;  1CQM A;  1S6Q B;  3ICL A;  2MQM A;  3LWL A;  2MGZ B;  2ZBQ A;  4FNH A;  2IRU A;  1FI4 A;  3SZ2 A;  1KD1 T;  4YY3 J;  4I6Y A;  3NG8 A;  1NKB A;  2MDA A;  2MQO A;  2RS8 A;  3K5N A;  2IVY A;  2QJ3 A;  2ZWP A;  2CDR B;  3CIZ A;  3HSD A;  5KFT A;  1FJC A;  1S9F A;  4MFB A;  5J2M B;  3HVT A;  2FIU A;  2V63 A;  2HNZ B;  1NPR A;  2KRB A;  4HH0 A;  1F9E B;  2F7V A;  2A3J A;  5HRO A;  4QZV B;  3KLI A;  3H90 A;  3NS7 B;  4N7T A;  4ECX A;  2YNF A;  3CCL S;  5BJR A;  4IH5 A;  3F41 A;  3ZZP A;  1Q0N A;  1XMO F;  3HMJ G;  5L9N A;  3GR0 A;  1TMM A;  2OFG X;  4WZQ A;  2PEH A;  1V5I B;  4ZHR A;  3NGT A;  1FKO B;  4WE1 A;  1TKT B;  2H9Z A;  1YTY A;  5HP1 B;  2Z2Z A;  3W1Y C;  1I1G A;  3ZO7 A;  2M4M A;  4DV2 F;  4FZV A;  2BE2 A;  2XYP B;  4G1Q A;  4K4V A;  3UQS A;  3DRR A;  4F8R A;  2GHP A;  3CJK A;  4J37 A;  5H9F J;  1X4G A;  1ACM B;  3C6T B;  4F4K A;  1VQK S;  3NAH A;  1HMV A;  5LMN J;  2ILZ A;  4WTY A;  4DL4 A;  3NGU A;  4H4O B;  2FGC A;  2O67 A;  3UCG A;  1T94 A;  3FVY A;  4B3O A;  3AOA A;  1U4B A;  1MNE A;  4XTT A;  2X1F A;  4OZ0 A;  2A10 A;  1SQE A;  4MKA A;  1DY3 A;  4XAK A;  5T7L B;  1G7C B;  2R4F A;  3H42 A;  1B4S A;  4M1K A;  3OQ2 A;  1Q1K A;  1PYO B;  4ZVT B;  1BWE A;  2IYI A;  4U9R A;  3CCM S;  2YX1 A;  4Q7A A;  5ETQ A;  4KQZ A;  5HK4 A;  4YB1 P;  2FLL A;  3QRR A;  2IA6 A;  1GAO A;  1G3O A;  2I0X A;  2HZC A;  2I5J B;  1N34 J;  1C0U A;  3MED A;  3OV7 A;  2P9C A;  5IZH A;  2RDJ A;  2ASJ A;  2BQU A;  4OYB A;  1ZYQ A;  2X1A A;  2VC1 A;  2VOP A;  5B0B A;  1EQM A;  4V1A k;  3TEG A;  1RT3 B;  4OX7 A;  2C2E A;  3BV8 A;  3PYF A;  3HI9 A;  1S77 D;  2EEY A;  3KJV A;  3OSP A;  3HPO A;  4QU7 A;  1CJU B;  2ZH2 A;  3HDS A;  2OMO A;  2EBE A;  3RAM A;  2JC0 A;  3X3U A;  4B9V A;  4ZVG A;  1RU1 A;  1S79 A;  1J5O A;  3OT9 A;  2K2P A;  1VR6 A;  1XR5 A;  4V19 X;  2EG2 A;  4IFY B;  3O5T B;  4LVN P;  2FD2 A;  3OTD A;  1TK8 A;  1WI8 A;  2DR5 A;  1N5S A;  3IWX A;  5AXK A;  1KWM A;  3RB4 A;  4LQ3 A;  3T9N A;  4KY3 A;  2BW7 A;  1I94 J;  1YBU A;  3TAN A;  2I1R A;  4DFP A;  2IIH A;  2P2C B;  2F9J A;  4RL1 A;  1NDK A;  2QE5 A;  3PFO A;  1HYS B;  1JXL A;  4DPW A;  2OEK A;  1U26 A;  3I5A A;  2VUG A;  4A46 A;  4DX5 A;  8ATC B;  1W7W A;  4DV6 F;  3D4J A;  2V2Q A;  3F56 A;  4TNO A;  4X4T A;  2E5J A;  2HUR A;  5D3G A;  3KLG B;  3DDI A;  1IR2 A;  4J90 A;  1H2T Z;  2ZVS A;  3NL0 A;  2RF2 A;  4ETX A;  4UZC A;  2J9E A;  3EZ5 A;  1GXU A;  2DO0 A;  2CPX A;  3RRG A;  4CLU A;  4AE5 A;  1MMN A;  4PAA A;  3N5F A;  3W66 A;  3IMQ J;  3NKY A;  4PKD B;  3UPF A;  3RAQ A;  2C28 A;  2BAB A;  5JXS A;  1HQE A;  1RA7 A;  4Y28 C;  2AYM A;  4I0W A;  4DSL A;  4P52 A;  3HK2 A;  2ROE A;  3D1H A;  3ETM A;  4QYR A;  2AJQ A;  2FY1 A;  4RW4 B;  4I67 A;  1JKH B;  4WP3 A;  2CDQ A;  2YNH A;  3GJT B;  3ILL A;  2UUW A;  2QV6 A;  2RRN A;  1G2E A;  2WAQ D;  1RTH A;  2IPO B;  2DRD A;  2WHO A;  2KU7 A;  2WVF A;  4YS2 A;  4DLG A;  4DFJ A;  3BN4 A;  5DM6 Q;  1VFJ A;  4ALZ A;  1TKZ B;  1U2C A;  1RT5 B;  3DRS B;  3PCO B;  3R1H A;  1M5S A;  2DNK A;  1D9A A;  2Y0B B;  1NPK A;  1N88 A;  1WC3 A;  1ZM4 A;  2BR0 A;  3PX4 A;  1HNW F;  1FDA A;  3JTN A;  2V4J A;  2GQQ A;  5K8M A;  2WVC A;  4H54 A;  1FTR A;  1EET A;  3C8Y A;  3K2Y A;  2Q79 A;  4B9T A;  5LJ3 Y;  1R7I A;  4OX9 J;  3B82 A;  1O0P A;  3FSY A;  3HM9 A;  3LO3 A;  1RJJ A;  3AJ2 A;  5D0H A;  4DF8 A;  1JB0 C;  1VRQ C;  3MF5 A;  2LQJ A;  3I0S A;  1S9G A;  3PJ9 A;  3ISZ A;  5E3Q A;  3MCN A;  1JNR B;  5D8H B;  1FKP A;  2PFF B;  3IRW P;  1X5P A;  3MPY A;  1CS4 A;  1DUR A;  2R3V A;  4ATN A;  1VQM S;  3S01 A;  1RAA B;  1G1X A;  4CLT A;  4EZ6 A;  3MPU B;  1PG5 B;  2D1C A;  1CJV A;  5KFM A;  5BR8 F;  2X1G A;  2HND A;  3M9M B;  4PPD A;  2BRK A;  3DU6 A;  5LXR A;  2RRB A;  4PRF A;  1QY7 A;  3ISN C;  1X4A A;  4K8R A;  4DX8 H;  1KFD A;  1S6P A;  4YR0 A;  1AB8 A;  4Q43 A;  2GGP A;  1AZS B;  2NPI A;  4QCL A;  2BKP A;  4WFA Q;  2F5G A;  3MMA B;  3KHR A;  2CVE A;  4DV1 F;  1YDL A;  3GJQ B;  2IBK A;  4H4K A;  3GV5 B;  2M8H A;  2W25 A;  3AY0 A;  3U7J A;  4KGV B;  2VIC A;  2IY5 B;  1IBM J;  3KHH A;  5LL6 d;  2UU9 J;  2GIF A;  4G65 A;  2EXU A;  3BQ2 A;  1VMB A;  3ENQ A;  2HPU A;  1JK9 B;  3NNA A;  2UUA J;  3UW1 A;  4ZLJ A;  2QIF A;  2DHA A;  1TP7 A;  3MM5 A;  1H74 A;  4NRT A;  1RWM B;  5HSP A;  1T3O A;  2G1D A;  3DLG A;  3K5O A;  4NXN F;  4KPY A;  4IDK B;  4JI0 F;  3R7N B;  2KT2 A;  2CQ0 A;  1IN0 A;  1YKW A;  3CDU A;  3G8S A;  4ZIT A;  3UN3 A;  1N33 F;  1N8R T;  4DL0 C;  1FRK A;  4MFB B;  2RD5 C;  3M1V B;  3HVT B;  4EO6 A;  4ES2 A;  2LVW A;  2GNK A;  1KSP A;  4DR1 F;  2XMK A;  4Y2K A;  2W7P A;  3UO0 A;  1AUS L;  2XWY A;  2B4O A;  2YNF B;  1MRO B;  5D0R A;  2EWH A;  1VCT A;  1R89 A;  2P6T A;  4YDX A;  2JSX A;  3CIM A;  3K59 A;  1N0U A;  2XGQ A;  4WE1 B;  3TQ1 A;  4DR6 J;  1HWU A;  2PI4 A;  1CC7 A;  3N5B A;  4LUB A;  4KR0 B;  2VH7 A;  2QFI A;  3R7S B;  4OHX A;  3VHQ A;  1VHF A;  4G1Q B;  3J7Z T;  2DEI A;  3DRR B;  5ITH A;  1SKS A;  2POK A;  2LFV A;  1T9W A;  5KFE A;  1KOO A;  1Y5L B;  4FPI A;  4JP8 A;  1RXO B;  3US5 A;  3THV A;  1R8B A;  2GMJ A;  1U1N A;  1RKJ A;  1HNZ J;  2ATC B;  1RHJ B;  4LJM A;  5LSL A;  3OLA A;  3VAL A;  4UOG A;  2OI2 A;  3UDV A;  4B3O B;  3TNV A;  2J6S A;  5H9E K;  2DNL A;  4CH1 A;  1NHK L;  4DR7 F;  3UVJ A;  1F60 B;  3VTI A;  3T6B A;  1VQL S;  4OHW A;  5M2R A;  4RLE A;  1RT4 A;  3AOD A;  1PYT A;  4RJV A;  5SZT A;  5DGB A;  2DXD A;  3ZZZ A;  3IBC B;  2X3G A;  1U6F A;  1S1X A;  1JJ4 A;  3CE8 A;  1RHK B;  4CO0 A;  1QTM A;  1C0U B;  4RW7 A;  5J1N A;  2DH9 A;  4OZ2 A;  1PCA A;  5FII A;  1N32 F;  2DD8 S;  2VAS A;  1E6V A;  3GYX B;  3KMQ A;  1WDD A;  4M5N A;  1RAB B;  2XHW A;  1FNX H;  3KJV B;  2OTL S;  1WC6 A;  3L4B C;  1KTQ A;  4DEZ A;  2QLX A;  4HT7 A;  4YY3 F;  2UUT A;  3S6E A;  1KRP A;  4ZLL A;  4C3M A;  5L8R C;  2DCL A;  3MEC A;  5KFF A;  4MJK A;  3RG6 A;  2DR7 A;  1Q82 T;  1M1G A;  4HHJ A;  2Z30 B;  1V3S A;  2JEF A;  2DJW A;  5DGA A;  2WBM A;  3WBZ A;  1KTV A;  5I3U A;  1SVD A;  1NK6 A;  3JSM B;  2HGM A;  5EX0 A;  3CCR S;  4CLP A;  4U6P A;  3DGV A;  3KK2 A;  4RNM A;  3UD3 P;  2FJV A;  1S48 A;  1IVZ A;  2FLN A;  2VBX A;  3ZTO A;  1O5J A;  1JLQ A;  3VAH A;  1BE4 A;  2HSE B;  4ZCL A;  2R7W A;  2BZ2 A;  3JS9 A;  3C15 B;  1KOH A;  4CLF A;  5K9F A;  3G96 A;  3GJR B;  5D77 A;  1X8D A;  2HW3 A;  4OV1 A;  2RF2 B;  4JBC A;  4C3K A;  2MST A;  5KFV A;  4LF2 A;  4L3K A;  3G8T A;  1L3T A;  2OPP A;  4LBH A;  2UUB J;  1BWV A;  1XR6 A;  3ONQ A;  4DR5 J;  3HUL A;  3VAI A;  4ES3 A;  2V2V A;  3L7O A;  4AYB D;  3C2P A;  1HBM B;  1RAE B;  2GML A;  5LMN F;  3I4H X;  3KDN A;  1GMV A;  1HQE B;  2QL9 B;  3UI3 A;  1RGV A;  2X3D A;  1X4D A;  1JIH A;  5DG9 A;  5IT9 Y;  5B0G A;  2UXC F;  2QEX S;  3BJY A;  1UWB A;  2R8H A;  3R7B B;  4QU6 A;  1JLE B;  2PC6 A;  1EHW A;  2KVI A;  3BGL A;  2MQQ A;  1WEY A;  3G86 A;  3R6G B;  5KG5 A;  2YNH B;  3W9I A;  4O0N A;  1LW2 A;  3NS6 A;  4RKU C;  4F50 A;  2AMC B;  3C19 A;  2JX2 A;  2HHP A;  2CPJ A;  1RTH B;  3OTC A;  3CD7 A;  4KKO A;  3W64 A;  1HL6 A;  3TAQ A;  3MM9 A;  3O44 A;  4PYA A;  2P9E A;  4DV5 J;  2HGL A;  4DUY J;  1VQN S;  3W7B A;  1BQN A;  5DDP C;  4GKJ F;  3PEH A;  3SCJ E;  1N34 F;  5KAK A;  3PKM A;  4TKT A;  3CMA S;  1DTT A;  1W26 A;  1NH8 A;  3IM8 A;  3G8Q A;  2PII A;  3PRB A;  3V6J A;  2FZG B;  1IKX A;  3CO9 A;  2ALY B;  2VG5 B;  3GE9 A;  1OQ3 A;  1KQF B;  5B0D A;  4DV4 F;  2C22 A;  1O8B A;  1OWX A;  2BE9 B;  3PW2 A;  2RT3 A;  2ZBR A;  1NK4 A;  1BUX A;  5A8K A;  3R27 A;  3GCW P;  2P9G A;  2V5H G;  2ASY A;  3PO4 A;  1HR0 F;  5DZ6 A;  2D3Z A;  1EET B;  4L74 A;  4NOH A;  5HI7 A;  2BJ8 A;  3EIC A;  3DI6 B;  2XB2 D;  3HHE A;  3ZTS A;  1JLB A;  2XI2 A;  2QZ8 A;  1NHU A;  5B09 A;  1S9G B;  2XMM A;  2G2Y A;  3IRX A;  4E98 A;  2QA4 S;  3AJ1 A;  4DV7 F;  3VV2 B;  1F5B A;  5KFN A;  5AXM A;  1FKP B;  5HJY A;  1HI8 A;  2H48 B;  4USI A;  3MAA A;  2MQ8 A;  4KC5 A;  4FS1 A;  1CS4 B;  2HBY B;  1AUD A;  3IR6 B;  1KN6 A;  1GFW B;  1WKJ A;  4RWW A;  4IYQ A;  3M30 A;  6FD1 A;  3R8Y A;  9RUB A;  1BC6 A;  3TI0 A;  1Y0H A;  2HQ3 A;  2EFG A;  3ZFV A;  1HD1 A;  1WKL A;  2OH2 A;  3MM6 A;  1RLD A;  2VQF J;  1Q4R A;  4F25 A;  2DHS A;  5FLX Y;  1IM4 A;  3R6L B;  1NSQ A;  3OXF A;  4TLQ A;  1GNK A;  2V68 A;  3CJT A;  3PYG A;  4OX8 A;  1VLY A;  2BJ9 A;  3W63 A;  4TQS A;  4U95 A;  1SJQ A;  2UXD F;  2NR0 A;  4X62 J;  4LRB A;  2LDI A;  1UPP A;  3DYA B;  5B0A A;  1A7G E;  2ILY A;  2CIM A;  3G82 A;  4OLP A;  5I3Q A;  3KLV A;  2M3D A;  3MM5 B;  4OYO A;  1B64 A;  2CZ4 A;  2B4P A;  1SJF A;  3DLG B;  3HSG A;  1SB6 A;  2RHS B;  5LJ5 Y;  4J9R A;  4C8L A;  3D66 A;  2CRL A;  4HHH A;  5ADZ A;  4KHP J;  1S7H A;  4EUV A;  1UVK A;  2GO8 A;  2AZ1 A;  2IM2 A;  4PG5 A;  1JQG A;  1APS A;  3BPS P;  2A0F B;  5EDW A;  4C4W A;  4N77 A;  3HP6 A;  2VFS A;  1B99 A;  3GFX A;  3FZB A;  3G9C A;  3Q8R B;  1S10 A;  1X9S A;  1MMD A;  2BMB A;  1YK9 A;  1YJR A;  3KJN B;  4KH0 B;  2CNK B;  3ZC4 A;  4K0K F;  4DJB A;  4K4W A;  1FFS B;  2YX7 A;  4C11 A;  4K2X A;  5A8R B;  4X4N A;  3G2X A;  2XO7 A;  1IQZ A;  1VJQ A;  4OI3 A;  1VC6 A;  1LWE B;  3CTR A;  4OI1 A;  1HAR A;  2B9Y A;  2A1B A;  4F04 B;  5EX3 A;  3KJF B;  2VZ9 A;  1XJW B;  1WF2 A;  3PW4 A;  2ZJQ Q;  3UCZ P;  4F2R A;  4AL6 A;  4NLD A;  4B3T J;  3D28 A;  4DMZ A;  1F0X A;  3JQM A;  3L09 A;  1VC0 A;  4G6V B;  2IM0 A;  3OVS A;  3I87 A;  3KK1 A;  3L7U A;  1CUL B;  2OO4 A;  1HW8 A;  4X4V A;  1R31 A;  2HRY A;  1FVQ A;  2CVI A;  1AYE A;  2WCX A;  4I68 A;  3POT A;  1RTI B;  1TQL A;  5J2N A;  2ZFH A;  1O51 A;  4DFM A;  3PW7 A;  1T9U A;  4A8X A;  1IBM F;  3KLE B;  3JB9 k;  4IOA Q;  2UU9 F;  4HHU A;  2MQN A;  1RAD B;  2VG6 B;  1E6V B;  1HD0 A;  3PHT A;  4NA3 A;  5IT9 U;  4ECQ A;  2HMI A;  2I38 A;  2QX0 A;  2CQ4 A;  3D6T B;  2OHD A;  2VFT A;  3T5H A;  1RKI A;  4DI6 A;  1HI1 A;  4FN5 A;  2VOO A;  4NLS A;  4WU3 A;  1EX8 A;  1RT6 B;  2VFU A;  3H2V E;  2I2Y A;  1H2U X;  2HGN A;  2CG4 A;  1LKZ A;  1WG4 A;  3M8Q A;  1TVR A;  2MLZ A;  3E01 A;  2BJD A;  3I6P A;  1LK5 A;  2YKQ A;  2HFZ A;  2BAN A;  1NJX A;  2B3T B;  3QNW B;  3TUZ C;  1UFW A;  5KG7 A;  3JTP A;  3SV4 A;  3MM8 A;  2DYA A;  4PQU B;  4GVL A;  4ZN1 A;  3NGR A;  4QPT A;  2B6A A;  2FLP A;  4A47 A;  1HNX F;  1Q95 G;  1GK8 A;  4DR6 F;  2EKY A;  3QMQ A;  3MUR P;  3SBM A;  1FDB A;  4FXV A;  5KFK A;  4CH0 S;  2V4Q A;  1U2R A;  4Q45 A;  5KFU A;  1YZ6 A;  1NRK A;  5DG8 A;  2LEP A;  2FC9 A;  1R8P A;  4O3S A;  4KPC A;  3BH6 B;  4NYO A;  2VBY A;  4RBV A;  3M6U A;  4XDC A;  5ETO A;  4ECV A;  1HNZ F;  5F8J A;  5KT7 A;  3MUV P;  3KG1 A;  2HFV A;  4NLO A;  3Q8S B;  4ZLP A;  5DO2 A;  1HHS A;  2EG1 A;  3MFI A;  1S59 A;  1LW0 A;  2VPX B;  4ZPD A;  4AQY J;  2RQ4 A;  1LW2 B;  5HBM A;  3MM7 A;  5GAE U;  4XO0 A;  3MEG A;  4NLX A;  4RNH A;  1CJT B;  2C3U A;  4CT9 A;  3EX7 B;  3MM9 B;  4OJH A;  2ZHO A;  3LGN A;  4FNI A;  2PD1 A;  2F65 A;  1IKV A;  1WEX A;  2DEJ A;  3M6W A;  2DNP A;  3T1A A;  4LQ9 A;  1UW9 A;  4OJ1 A;  3FBE A;  1RAF B;  2B4U A;  4FBU A;  4HLB A;  5HLF A;  2M9K A;  2B51 A;  4PR6 A;  3OD2 A;  3KLH A;  5HMW A;  3GIJ A;  2QLW A;  4LF8 F;  3JSR A;  4I7F B;  3D7S B;  3NNH A;  1TV6 B;  2AWZ A;  4CO2 A;  4U7U K;  2UVU A;  4O23 A;  3NMR A;  1FXR A;  3IGN A;  2PDA A;  5A8K B;  1F3V A;  5GAD I;  2UVV A;  4IKA A;  1SC6 A;  5GME A;  1DTQ A;  4PG8 A;  4M94 A;  2GS8 A;  3S1T A;  1S1U A;  4LR7 A;  4C9D A;  3DRP A;  2E5G A;  3V81 B;  1HBO A;  2VL1 A;  4QJV A;  3N6N A;  3Q89 A;  3MTK A;  1GMU A;  1DHM A;  3IRX B;  2MZT A;  3LA0 A;  3GSI A;  3NRB A;  1S99 A;  4CLZ A;  4Y3C A;  1JLA A;  2GIR A;  2VPY B;  1T03 A;  4DDF A;  4ID5 A;  3ILO A;  3CT9 A;  2KDO A;  4DLE A;  3MWB A;  4OZN A;  2VPZ B;  3DOM A;  1P1T A;  3FKB A;  5HQL A;  5I42 A;  4DPY A;  5CD4 A;  1M1K T;  1OS5 A;  4UQT A;  3WX8 A;  3MEE A;  4LSL B;  1ULR A;  1U0H A;  3AD8 C;  2XY6 A;  4CTA A;  3GIK A;  1WAC A;  2B0G A;  1ZPV A;  4DR5 F;  3PR4 A;  3MM6 B;  2XS5 A;  2QN6 B;  3ITH B;  4BWM A;  5F3Z A;  4L75 A;  4IRC A;  3HVA A;  3CW2 C;  3LGH A;  4DL7 A;  2ZM6 J;  1X4B A;  2M7S A;  1FWL A;  4DF4 A;  5KFP A;  2XSJ A;  4CLY A;  3M8Z A;  4LBP A;  5IOL A;  3RYL A;  2OPR A;  4C97 A;  1VYA A;  4QIF A;  2XS7 A;  4DQR A;  3O1L A;  2NQP A;  4F02 A;  5C2C A;  2QMU B;  2W2P P;  1IQT A;  3K58 A;  2QLF B;  4J7C A;  2W01 A;  1I3O B;  4OLO A;  2DGT A;  2HG4 A;  3IO1 A;  3GTY X;  3EVW A;  1U02 A;  3BKT A;  4F3M A;  2KXH A;  3G82 B;  4C2M A;  3OUY A;  5KT2 A;  1YI2 S;  2DY1 A;  3BSC A;  1TUV A;  1KLM B;  4RUC A;  4CI0 B;  3QYY A;  3ZZR A;  1Q5V A;  3P3D A;  3PW5 A;  4P10 A;  3HD1 A;  3GFH A;  2ZH6 A;  1GMW A;  4E0D A;  4ED2 A;  4FPR A;  3KUG A;  1VRT A;  2G4B A;  4PWD A;  4CNY A;  5EGY A;  4FYY B;  1UA1 A;  2M52 A;  3TW0 A;  2MTL A;  4AUK A;  3FFI A;  4C0H A;  5D0G A;  4M5H A;  5DDO C;  2B8Q A;  3IXQ A;  2VFV A;  3MTJ A;  1GXT A;  2LLZ A;  2DIT A;  2V9W A;  4O4G A;  1HQU B;  2H5J B;  2V6A A;  4QQB A;  2WRM A;  3BBC A;  3V4I B;  1RB0 A;  2LEC A;  1ZM9 A;  4KIA A;  5C42 B;  1PC5 A;  4C11 B;  4J9O A;  2MQP A;  1U45 A;  1UKU A;  2OKQ A;  4USJ C;  2OEJ A;  1MU2 A;  2YH0 A;  2RQC A;  1IXK A;  3TR5 A;  3PTW A;  3W5Z A;  1R0B G;  3QJP A;  3PRV A;  4AD6 A;  3BEG B;  2GA7 A;  3RRH A;  4TQR A;  5IC6 B;  1S0M A;  3FZ2 A;  3MUT P;  4URS A;  6AT1 B;  3HFZ B;  4YR3 A;  1NU4 A;  1D1U A;  2EFV A;  3UCU P;  4ZJQ A;  2KM8 B;  3OSN A;  4U8Y A;  2Z57 B;  4KGZ B;  1VS3 A;  4KFB A;  2HQI A;  1EAY C;  2FLO A;  2GVZ A;  3HVR A;  2FGO A;  5KFO A;  3UWT A;  4YDD B;  2SXL A;  3NEK A;  2VB6 A;  2BKN A;  5DZ7 A;  3KK1 B;  2LKZ A;  1HHQ A;  4MKB A;  2QL5 B;  2VQF F;  2JNJ A;  2VG7 A;  1ZA2 B;  3TP2 A;  2D7S A;  3JQJ A;  3DM2 A;  1LWX A;  1G6B A;  1NK8 A;  1WF0 A;  2OIH A;  1WHV A;  1WSR A;  2W2Q P;  5IWA J;  4EYH B;  3POT B;  3VGT A;  2DGU A;  2Y8W A;  2JEJ A;  5A0Y B;  2HS0 A;  5AJ3 J;  4CIO A;  2PFD A;  4YHH J;  1NPP A;  2V9K A;  1OPZ A;  2V50 A;  2M2B A;  3AQP A;  3OFF A;  3A12 A;  3QAU A;  4X62 F;  1BQM B;  3HD2 A;  5HJX A;  1C1C A;  5F0U A;  2QLJ B;  4WYL A;  1RZM A;  1VQ9 S;  1UP1 A;  2DNG A;  1WEL A;  5F8I A;  2HMI B;  4USU A;  3CWJ A;  4ZKA A;  2QLB B;  1UFK A;  3F0N A;  3BDP A;  1VGY A;  2HHX A;  3GSD A;  2E5I A;  2NPF A;  2EI5 A;  2DPJ A;  3KK3 A;  5IV4 A;  1OY9 A;  2E7W A;  2QA2 A;  5HO4 A;  3M8Q B;  4KHP F;  1FRH A;  1Y4Z B;  2BM1 A;  4DX6 A;  2C2R A;  3AD7 C;  1YBT A;  3DLE A;  3W3S A;  1D3W A;  4LF1 A;  2BAN B;  3D0I E;  2WON A;  1HWJ A;  1WEZ A;  3LAL A;  4LIR A;  2F4V F;  2IA0 A;  2MXY A;  2H4Y B;  2MLX A;  1Y3K A;  5ETN A;  1YQH A;  5F0W A;  4B9N A;  2F1F A;  2KT3 A;  3RRK A;  3T5K A;  3NCR A;  3I55 S;  4DX7 A;  3OR2 A;  2HIY A;  2A18 A;  1QVF R;  4C8N A;  3BBF A;  2LU2 A;  4WFN Q;  4NXM J;  3FUY A;  4ED8 A;  1YJ7 A;  3M9N B;  1KHW A;  3BGR B;  4NLU A;  3M2V A;  1FD8 A;  2LA6 A;  2XZW A;  2B9X A;  4B3T F;  2N3O A;  1Y7P A;  4KV8 B;  4PYD A;  2ZNZ A;  4N47 A;  1VI7 A;  1U1R A;  2V8D A;  3BM7 A;  3TEH B;  1S9E A;  2GQC A;  2Z56 B;  4N41 A;  3JAM Y;  2MEW A;  3UR3 C;  3ZXW A;  5KT6 A;  2J7K A;  4OZJ A;  3OHB A;  4LF6 F;  3R2C J;  1DQA A;  4EZ9 A;  3MCS A;  3H2U B;  2ERR A;  1YHQ S;  4K50 A;  2J6T A;  3VVT A;  2MKC A;  4FF1 A;  2BA9 A;  1T9T A;  4ECU A;  3IBW A;  5SUH A;  4X66 J;  3AHP A;  4KH1 B;  1IKV B;  4DSK A;  4ECZ A;  2H1Y A;  3CO0 P;  4X4O A;  1S6Q A;  3H40 A;  3AXM A;  2MGZ A;  3V5R A;  1NSP A;  2H65 B;  2C2O B;  1DAX A;  1T9X A;  4JOU A;  4USM A;  2CJB A;  4FF3 A;  3KLH B;  3LOU A;  3PX6 A;  2E1M C;  3OL6 A;  1LWF B;  1HW9 A;  3B78 A;  2UP1 A;  3BO2 A;  1HWL A;  3D3B J;  2YWE A;  1SQF A;  4ZVF A;  5F41 A;  1T05 A;  2BAC A;  2FQQ B;  2HVD A;  2HNZ A;  3W2V B;  1KS2 A;  4CT8 A;  1YRU A;  4I2P A;  3TUI C;  1SC4 B;  1V5V A;  1UTA A;  1RAI B;  3LUY A;  2BKO A;  4ETZ A;  2QYG A;  1HNV A;  2EKN A;  4NCG B;  1FKO A;  1VBZ A;  4ED4 A;  3GZ7 A;  2YWG A;  1TKT A;  3PX0 A;  2MYF A;  1F1B B;  5HP1 A;  4M5L A;  1REV B;  3CJ4 A;  3HKW A;  1FA0 A;  4B3R F;  3PHE A;  1WF1 A;  3B4M A;  3W61 A;  1SV5 B;  3PYE A;  1JLA B;  3K0J A;  2DNO A;  1AT1 B;  3TZW A;  1UJ6 A;  2XYG B;  4M63 A;  1EJ7 L;  2CQI A;  5I42 B;  2XTJ P;  1TK5 A;  1ZAW A;  4HL9 A;  5HAO A;  5L1J A;  2ZHA A;  2E5L F;  2AZ3 A;  1U0H B;  5L38 A;  2DR6 A;  1WOP A;  3HHL A;  4NZ7 A;  5I3P A;  3ZZO A;  4UY8 5;  3GFY A;  1IBL J;  1SKU B;  4LSN B;  4CTA B;  1H73 A;  2FUG 9;  4K4X A;  2HHH F;  4H4M A;  3EM1 A;  4G1I A;  2IDL A;  3IC1 A;  5EHH A;  4I56 A;  2DK2 A;  1EQ0 A;  4EGL A;  3DLK A;  3DXS X;  2VA2 A;  2BBE A;  1JLF A;  2E5H A;  4QPX A;  4X65 F;  2ZOM A;  3PVX A;  2OPR B;  3PIO Q;  1Q7L B;  3BB5 A;  1ZM2 A;  1QAI A;  1TUW A;  5LM7 E;  1KLN A;  2G1H A;  2PN6 A;  3CD5 A;  2U1A A;  3UNY A;  3T6J A;  1KBR A;  2VC0 A;  3KNA A;  3PFE A;  1TEL A;  5KT4 A;  1URN A;  3DDK A;  4K7Q A;  1F2G A;  1U48 A;  2PMW A;  1T02 A;  2C2D A;  5KFI A;  5DLG A;  3FMW A;  3PRD A;  3OTB A;  2OUG A;  4HTJ A;  2C2N A;  4I6W A;  2NUU G;  3SIP B;  3LAM A;  3D2W A;  3ZNJ 1;  5F8N A;  1SJ4 P;  2JLG A;  3CDB A;  1N36 J;  3CDA A;  3QSY B;  1V3R A;  4ZVH A;  4PWD B;  4J9N A;  1WJ9 A;  4L3N A;  2HQC A;  5IC4 B;  2XMW A;  2XCP A;  1R0A A;  3NAI A;  5E0O A;  4AFF A;  4ECR A;  1XWL A;  2KJW A;  3FFI B;  4IFY A;  1RTJ A;  3EXY A;  2WSF C;  1CLF A;  3K17 A;  5DDR C;  2CWK A;  5EUH A;  1V9O A;  5E33 A;  5L39 A;  6FDR A;  3CUN A;  3ZZY A;  1S7I A;  4O4G B;  2M5Y A;  4NAS A;  4PEO A;  3CCQ S;  4WK1 A;  4P7V A;  1HYS A;  1U24 A;  1UW4 A;  4F36 A;  3NWR A;  4ZP8 A;  4P73 A;  4EBE A;  4CNZ A;  4A48 A;  1MWZ A;  1MU2 B;  1N52 B;  1CC8 A;  7FDR A;  4IRD A;  1T0T V;  3FJ2 A;  3KLG A;  1KR4 A;  3THT A;  4O3N A;  1K9M T;  4X4P A;  2XMT A;  1C2P A;  1VQ4 S;  1SJ1 A;  5K5M A;  2YXL A;  1IKY B;  5CZX A;  5LXY A;  3TA1 A;  1NH7 A;  1NME B;  1NSK L;  3THP A;  2OGU A;  4C8M A;  1VQY A;  4DSF A;  1UJ4 A;  3FEX B;  1H7X A;  4R8U A;  2X1B A;  4EEY A;  1HNI B;  3IM9 A;  2GJF A;  1S1V B;  5KFB A;  1KQG B;  4M5G A;  1SJR A;  2ADB A;  2VHG A;  3GP9 A;  2CNN B;  1TL1 A;  1JKH A;  2VG7 B;  3H4B A;  3HJV A;  4RO0 A;  3MGJ A;  2V4R A;  2F63 A;  2ZZT A;  3TX0 A;  1WHW A;  4J9S A;  4NYP A;  1JXV A;  3A8K A;  2IAJ A;  1FHT A;  4Y0F A;  3R5D A;  4JYA F;  2DTJ A;  2E1C A;  1OY8 A;  1X60 A;  2FVC A;  2XG8 A;  2H5E A;  2A6O A;  5HVF A;  1SCJ B;  1NLK L;  1NJW A;  3DRS A;  1L3V A;  2YKM A;  4MAK A;  3RW7 A;  2Q3P A;  3HVW A;  4XPC A;  4LR8 A;  1MWY A;  3H5Y A;  3QT6 A;  3K7R A;  2ZD1 A;  1M5H A;  3BR8 A;  1PSD A;  3QO9 B;  1S1T A;  2GZO A;  2XS2 A;  1OO0 B;  2DBB A;  2J0W A;  3JAM U;  5B0F A;  3SV3 A;  4ZPA A;  2RDD A;  2KYX A;  1LXN A;  2KJV A;  1LWC A;  5K8O A;  1QD1 A;  4U8V A;  2CA9 A;  1I5O B;  2AGP A;  3T1H J;  3DLE B;  1S6U A;  1GTE A;  2C3Y A;  2C1E B;  2CQ3 A;  2GHV C;  1FER A;  1GT8 A;  2WON B;  3D0G E;  3RB3 A;  4ZVE A;  1WHX A;  2LU1 A;  4RNN A;  4U7C A;  3MMJ A;  4WTO B;  5A8W A;  3QWU A;  3OTO J;  5F8H A;  4WYW A;  2CJA A;  4QWB A;  4W90 B;  2D9O A;  3UR0 A;  2ZOF A;  4UQG A;  2AQ4 A;  2GJ2 A;  5J2Q A;  1F2H A;  2E44 A;  4MK8 A;  2W2O P;  3DLB A;  7AT1 B;  4A8W A;  4ZP9 A;  4GMK A;  1DFD A;  3H5X A;  2W8K A;  3HT0 A;  1HPZ A;  4ECY A;  4OYW A;  4WXW A;  4PZV A;  3OR2 B;  4O3P A;  5F8G A;  1R8A A;  3DCA A;  2HVH A;  1SJ3 P;  4NPO A;  3D1Q A;  3QWP A;  2ACM A;  1IR1 A;  3E51 A;  1R8H A;  1WSV A;  4B3M F;  1K44 A;  4ZCM A;  2DXF A;  3M2V B;  3MXH P;  4B3S J;  2Y1L B;  5AT1 B;  3J7Z 5;  4LSZ B;  2N7C A;  3KLF B;  1BQX A;  2G2Z A;  4WP9 A;  3OL9 A;  3RB6 A;  5GAE I;  1J5E J;  1IKW A;  3BGF A;  4UZB A;  3QT7 A;  4K5R A;  1UVL A;  3PJX A;  4YFU A;  1T95 A;  5BYR A;  2FC8 A;  3ISN D;  1QJH A;  1UZD A;  4O44 B;  1QSL A;  4NEZ A;  4P2X A;  1XMQ J;  2AJF E;  2KVQ E;  3O8W A;  4YP3 A;  5IWA F;  3BYR A;  3Q23 A;  1RK8 A;  3AB4 B;  1W2I A;  1AXQ A;  1WKK A;  5AJ3 F;  1TMJ A;  1VQ8 S;  3I0R B;  4O4R A;  2PT0 A;  3N6L A;  2FVS A;  4YHH F;  3T5L A;  3K89 A;  5K8P A;  3MPV A;  1QVG R;  1OYE A;  2Q43 A;  4P7T A;  1KEK A;  4ZPC A;  4WF9 Q;  3GYN A;  2AKW B;  3G6V A;  1XEZ A;  4OMF G;  2UV8 G;  4IDK A;  1S0N A;  3I5C A;  1ZH5 A;  4IOC Q;  2FY8 A;  3BS9 A;  4DSE A;  2H4W B;  3V2U C;  2V34 A;  2PE8 A;  3EPG A;  4RW6 B;  3M1V A;  2DGQ A;  4F0M A;  1T05 B;  2AD9 A;  2XY7 A;  3PAC A;  4W98 A;  3NXZ A;  1XNQ F;  1VJW A;  3C46 A;  1RAG B;  4I2P B;  5G0R A;  5J1P A;  1MRO A;  3MPW A;  2AYE A;  2W9C A;  1FRJ A;  1SXL A;  1C0T B;  4FDF A;  3MR3 A;  4ED1 A;  1HNV B;  4RUH A;  1DJ0 A;  3OW2 R;  3TAP A;  3WC2 A;  1OSD A;  2KXF A;  3DLH A;  3BGO P;  1W25 A;  4Q8E A;  4ED5 A;  2APO A;  2DRA A;  4NML A;  3W9J A;  1WHY A;  8RUC A;  2QC3 A;  2DH7 A;  1CPZ A;  4EBC A;  1ZPW X;  3CMQ A;  1TL4 A;  2AV5 A;  2Q1L A;  3EYZ A;  4HI1 A;  1SC1 B;  1IWG A;  1XNR J;  4GVB A;  1U0S A;  1R27 B;  4NXM F;  3UN5 A;  4PUO B;  3NBP B;  3HHL B;  1M5V C;  2O01 C;  1S57 A;  4DR2 J;  3UFC X;  3AFG A;  1HFE L;  4MK9 A;  4H4M B;  3LAK A;  4IH6 A;  3AB2 B;  3B6B A;  5KT3 A;  2G2O A;  5AXL A;  1RI7 A;  2OML A;  3DLK B;  3PM9 A;  3UD5 A;  1JLF B;  1X0P A;  5LSR A;  2RQM A;  3CCE S;  1U8W A;  3H7H B;  4CLW A;  4HH1 A;  4GKK F;  4IG3 B;  2HHW A;  2ZC3 A;  1Q8B A;  1H2V Z;  5C25 A;  3AOB A;  4QWE A;  3D54 A;  4RBT A;  1QAJ A;  2ZJP Q;  1OIA A;  2RIJ A;  2AHO B;  1YSJ A;  2W7O A;  4TLR A;  3A3P B;  5LOQ A;  1SH2 A;  1KON A;  4DN9 A;  2F8E X;  3QLH A;  1UEV A;  4EU0 A;  4DV3 J;  1F9H A;  1OY6 A;  1R0A B;  2E1A A;  2N4D A;  2HBR B;  3OHA A;  2DCU B;  1RTJ B;  2DNZ A;  2CYY A;  3DFE A;  5IFM A;  7FD1 A;  2IVF B;  3JSM A;  3VGS A;  1L3S A;  3A3N B;  4C8O A;  3HZG A;  4IO9 Q;  4TU8 A;  3DGP B;  3TVZ A;  4M95 A;  1SL1 A;  1CSJ A;  4FKX A;  2YKA A;  4IOB A;  2HK2 A;  4QW8 A;  1FKA F;  1C4A A;  3HHD A;  3EGN A;  1YGY A;  4UF4 A;  3UE2 A;  1LK7 A;  3QGI A;  3C15 A;  3BSN A;  2Y3Y A;  5KFY A;  4AT1 B;  4J9K A;  1LXJ A;  4RBU A;  3CB4 A;  3M8S A;  2CG8 A;  4J9P A;  2ZDP A;  3I9Z A;  3Q2S C;  4OQJ A;  5T41 A;  3ELH A;  1U1Q A;  1FD2 A;  1J2V A;  1QSS A;  3FC9 A;  4QWA A;  1I6J A;  3TWZ A;  1HBM A;  3P96 A;  4HDG A;  4R8U B;  2IVM A;  5KTQ A;  2DHG A;  2FHJ D;  3C6U B;  3CCU S;  4PXC A;  2ZKU A;  3SQO P;  3F73 A;  3FQL A;  3LPE A;  1TL1 B;  1DRZ A;  1JLE A;  2V67 A;  3FBC A;  1XMO J;  3IWN C;  3AOC A;  2QRR A;  1XIQ A;  5M2U A;  1EKR A;  3HKZ D;  2EPI A;  5B0C A;  4BC7 A;  5L9X A;  2HWT A;  1FJG F;  2K3I A;  2PA3 A;  2IAJ B;  3IN5 A;  2PI5 A;  1VBX A;  4DV2 J;  3S7R A;  4ZVS B;  2L41 A;  1PYS B;  4OI0 A;  5HAN A;  3SQG B;  2C3P A;  4F4W A;  4CM2 A;  1UVM A;  2HFS A;  4HKQ A;  4KTQ A;  2YKM B;  3UNG C;  2HNY B;  2YY3 A;  4BS2 A;  3EMT A;  5L1K A;  1X31 C;  2R42 A;  2BV3 A;  2ZD1 B;  4ZCI A;  3W8P A;  3IS9 B;  2XMV A;  2ZZN A;  3DOK B;  4JV5 J;  1S1T B;  2GMH A;  1NSA A;  1D8Y A;  2XUL A;  2N82 B;  2WTF A;  4DR3 J;  2VG5 A;  1BLU A;  1N6Q B;  4CLL A;  1N0V C;  2DHX A;  3DHX A;  4UOC A;  5IXU A;  4UOH A;  2KB2 A;  2HWH A;  1TL5 A;  2YQ3 A;  4RZR A;  1LWC B;  3U1N A;  3FQK A;  3TA2 A;  5KOX A;  4NL5 A;  3LP2 A;  3AT1 B;  2B4V A;  3A3O B;  3NS5 A;  2E9T A;  3DI6 A;  2K7K A;  3WZ0 A;  4JI7 J;  4EFA C;  5A8W B;  4ZVU B;  2FDN A;  4OI2 A;  3RBE A;  1KVJ A;  4RW8 A;  1HWK A;  5GAD U;  2E66 A;  5J2Q B;  2EBG A;  2XLK A;  5DDQ C;  1P9Y A;  4H4K C;  1YIJ S;  2HAF A;  2KL8 A;  5CZV A;  1KDN A;  4NLG A;  2WB4 A;  4JI3 F;  2DY9 A;  1HPZ B;  2K7J A;  3LF0 A;  2WVD A;  3MCM A;  1DZ5 A;  4ZPB A;  4Y2C A;  2W4D A;  2YWH A;  4ZOS A;  1SUQ A;  1FRM A;  1U1K A;  3VAF A;  5HL7 Q;  3EGZ A;  3JYT B;  2BOA A;  2AT1 B;  4MYT A;  3Q2T C;  5GAH U;  2B7B B;  2CJY B;  3LGM A;  2ZEJ A;  1Q16 B;  5CQG A;  1SI9 A;  4LVO P;  2PSZ A;  2BVZ A;  2BJ7 A;  2R7R A;  2KFN A;  1UEK A;  2YKN B;  4TY8 A;  4KB7 A;  2YKP A;  2KFY A;  1T9V A;  2ZVI A;  1BGX T;  3T3F A;  1IKW B;  4Q0B A;  2AEM A;  4KT0 C;  3K5M A;  2OPQ B;  5HVH A;  2Z0G A;  4DFK A;  4KAI A;  2IMW P;  4K5S A;  1JWW A;  2B56 A;  2XO6 A;  1LV5 A;  2VU5 A;  4P2M A;  1HBU A;  5ETP A;  1ZTT A;  4A8M P;  2UVR A;  1I51 B;  3D67 A;  1H7W A;  3VVU A;  4DV6 J;  3EZO A;  2MKH A;  1VQ7 S;  4JI8 F;  1TFY A;  3MMB B;  4W92 B;  1NCL A;  3DYA A;  4MIW A;  1B7F A;  2B5J B;  1NZA A;  5CAA A;  3JSY A;  2WVB A;  4CP5 A;  4EBD A;  1NB7 A;  5I4M A;  3QGP A;  1VK8 A;  2K8G A;  2MQL A;  5A76 A;  2MKS A;  4KGK A;  1RWV B;  1WNE A;  4MTP A;  4LRC A;  3V6D B;  3KYL A;  3L95 X;  5FJ4 A;  1VDH A;  2CJX B;  4ZPW R;  3M2R A;  3DRY A;  3BSO A;  4TY9 A;  3MR6 A;  1Q53 A;  1JLG A;  3PO5 A;  3CJ2 A;  3O3L A;  3BF4 A;  5DQH A;  2KKH A;  3RUB L;  4R0E A;  4ILR A;  5G0R B;  4YEA A;  4DL6 A;  3T1H F;  2W9C B;  4JI6 J;  1D0E A;  5F9L A;  1FXL A;  4YB6 A;  3EXC X;  1YRT A;  2IHR 1;  4Z7C A;  8AT1 B;  2R8K A;  2XGP A;  4C98 A;  4DL3 A;  1B7Y B;  1WTB A;  1RCO B;  4UTG A;  5A8R A;  4OZ3 A;  2P6S A;  4FYV B;  4LF7 J;  2K06 A;  2CUY A;  1LWE A;  1KC8 T;  3W60 A;  3H20 A;  5CHC B;  2DRB A;  1Y5I B;  2BUN A;  3U1L A;  5ETL A;  4U7U D;  5KG4 A;  4GVB B;  4URG A;  2RB7 A;  2EC0 A;  2KG1 A;  4A8O A;  4P75 A;  3I56 S;  5KFH A;  1RHR B;  5L1I A;  2MY7 A;  4ZA1 A;  4HEA 9;  2RQK A;  1Y3J A;  2DIV A;  2Z2M A;  2DIU A;  1IBK J;  4ZP7 A;  1N5Y A;  4O3R A;  1GQE A;  4UUX A;  3H4D A;  2QFJ A;  4B3S F;  3B8H A;  4WU2 A;  5L46 A;  3RJM B;  3P45 B;  1ZM3 A;  2NLW A;  1CUL A;  4P6Q A;  3QID A;  3M7V A;  3CJR A;  2E1P A;  3VZI A;  2W9B B;  1YX2 A;  4JI2 J;  2HFU A;  2COL A;  3CC2 S;  4WPA A;  3W5X A;  2ZUG A;  1OJ4 A;  4DOZ A;  4DQI A;  1RTI A;  4TU7 A;  3TZZ A;  2ZBP A;  3OVA A;  4EWT A;  1RTD A;  4JI1 J;  1ZTW A;  3J81 j;  1SC3 B;  1XMQ F;  5C25 B;  4MKV A;  2C2Z B;  3M8P B;  1D9F A;  1W2B R;  3H2L A;  3KLE A;  2WZ1 A;  4WBF A;  2VG6 A;  2O3D A;  2B43 A;  5EN1 A;  4BCA A;  4F3O A;  4NMX A;  2J76 E;  1U49 A;  3JSB A;  4J9L A;  4LF5 J;  5A2Q U;  3QLH B;  1RA6 A;  1RT6 A;  2Z2Y B;  2R7V A;  1K47 A;  2K1R A;  1RU2 A;  2MKJ A;  1U1P A;  1VHI A;  2WBR A;  3DHW C;  4OZ5 A;  3J80 U;  1VC5 A;  2RUG A;  2UUC J;  2ZH9 A;  4PQU A;  1KKH A;  1E6Y A;  4YN3 B;  4U67 Q;  4P71 A;  2IFX A;  4N5S A;  2HQG A;  4DV0 J;  2VKZ G;  1RWX B;  3MEK A;  2RML A;  3GYG A;  3TO8 A;  3CCW A;  3A8E A;  2FJB B;  1UMJ A;  1OPI A;  3DU5 A;  2QT7 A;  3FRY A;  3CNQ P;  1FE4 A;  3AXK A;  3DOL B;  4P2F A;  4QWD A;  4RW9 A;  2ALZ A;  3EDQ B;  4JI0 J;  2YWF A;  2D74 B;  3TZY A;  4ZJO A;  5M2P A;  1R6Y A;  3P49 B;  2R7O A;  3UD4 P;  1N33 J;  3DNC A;  3PIP Q;  3OBI A;  4CWB A;  2HK3 A;  4I4B A;  2W4P A;  2YNG B;  3CXC R;  3UDC A;  1FJ7 A;  4DR2 F;  5BXI A;  1PJ6 A;  4LF9 J;  1Q86 T;  3HFK A;  4KO0 B;  2FHM A;  3M32 A;  3AA9 A;  4C8Z A;  4ANE A;  4JB8 B;  2DH8 A;  1NM2 A;  2DB1 A;  2E9Z A;  2DNR A;  3VAJ A;  1WUU A;  3WQP A;  3EVM A;  1CJT A;  5RUB A;  2IDE A;  1RTZ A;  4IG0 A;  1RT1 A;  1RHM B;  5KT5 A;  4RUA A;  2J0Q D;  1KQK A;  3KG4 A;  3TUJ C;  4B08 A;  2VBZ A;  4CO1 A;  1EKS A;  3CC4 S;  4I2Q B;  4PWU A;  4M5D A;  2EFN A;  1UFL A;  3OFE A;  1GH8 A;  4PG4 A;  2CQG A;  4FYW B;  4I7F A;  4WKR A;  2FJW A;  1TV6 A;  1VIO A;  4OJ3 A;  3EPI A;  2JVR A;  1UAW A;  5C24 A;  4QWC A;  3IA0 A;  2VV5 A;  3WC0 A;  4IQX A;  2YKO A;  3NCP A;  2FJE B;  1YZ7 A;  4DV3 F;  3KG0 A;  2Z4P A;  4AND A;  1OMS A;  1U09 A;  3LP2 B;  2GC8 A;  4I6A A;  1MN7 A;  4U96 A;  2FYX A;  3TUP A;  2ZH8 A;  3M05 A;  2QYC A;  2DNN A;  3V81 A;  4RW8 B;  1WOR A;  3PV8 A;  1I94 F;  2RAQ A;  2PO4 A;  3R9L A;  5JMN A;  1N32 J;  3U02 A;  3GJS B;  3M4X A;  1S12 A;  2ZH1 A;  4EI2 A;  2H3E B;  2R8I A;  1SUQ B;  3SSQ A;  2YTC A;  4XDD A;  2XEX A;  4CH7 A;  2JC1 A;  4LSL A;  2GX8 A;  1M90 T;  2NXN A;  1RE1 B;  1YJU A;  3A1Y G;  3IAS 9;  3IG1 B;  5IQ6 A;  1R0C B;  1RLC L;  3QZ7 A;  2MZQ A;  2O1P A;  1FNO A;  4Q2L A;  3LQV A;  2HHT A;  3ITH A;  4K4Y A;  2V8V A;  4FKY A;  2J9D A;  4TY8 B;  2EC2 A;  2HZV A;  3G6E S;  2W8L A;  1RBO B;  4Q0B B;  2XBP A;  3FSX A;  1GMW D;  4ITS A;  5U47 A;  2J8S A;  3QPI A;  5DQG A;  2J0X A;  1PBU A;  1HBU B;  3Q24 A;  3HCX A;  5GAG U;  1L3K A;  3TA0 A;  2XMA A;  3DXB A;  3VAK A;  5AE2 A;  1P8G A;  3W5Y A;  2V2Z A;  1TL3 B;  4B9S A;  1KLM A;  4GO7 X;  3G87 A;  1Q78 A;  5FD1 A;  3ILI A;  2OFH X;  3GPA A;  2GO9 A;  5DET A;  3G71 S;  3FRZ A;  4OI4 A;  2Z58 B;  3MD3 A;  1PAE X;  2KM8 C;  4R5P A;  1QLN A;  2AX1 A;  4ZVR B;  4JV5 F;  3RBZ A;  2NYI A;  1QSY A;  2UXC J;  2DGV A;  2L08 A;  2FVQ A;  4P72 A;  4DR3 F;  3QRQ A;  4Q5V A;  3M2R B;  3JXO A;  2HZA A;  3DLJ A;  3A13 A;  1JLG B;  3SEO A;  4LR9 A;  3RU0 A;  5HMY A;  4DCJ B;  1WG1 A;  1HQU A;  2YPY A;  3DC2 A;  4A8S A;  4ZVO B;  4OX9 F;  4FP9 A;  3V4I A;  4DBQ A;  4JI7 F;  1T7P A;  1Q7Y T;  5C42 A;  1FVS A;  3S8S A;  2MHN A;  4GKJ J;  2AJ4 A;  3LTO A;  3GCX P;  1CJK A;  2YNI B;  4B02 A;  2R7Q A;  5CCL A;  3AQO A;  2ZHB A;  2W7A A;  1S76 D;  3TVY A;  5E7O B;  4E8U A;  3NWG A;  3IR5 B;  1LOU A;  4A8F A;  4UT4 A;  2HFO A;  1FJE B;  4YR2 A;  4DV4 J;  1MSW D;  4NLP A;  2RKI A;  2CQC A;  1F5A A;  4M8L A;  4CO4 A;  5BYS A;  3KHG A;  1N5Y B;  2GQ2 A;  2UV8 A;  2VJU A;  1FEE A;  4I1T A;  2HLT A;  3KFW X;  4QIV A;  4PCQ A;  4KGM A;  2BJ1 A;  1HR0 J;  1RIS A;  2AP6 A;  3L3C A;  1YVF A;  4ER8 A;  4ENO A;  4Y65 A;  4IUF A;  3PDN A;  1B0V A;  2R2S A;  1ZZN A;  2NYH A;  3M6X A;  2G0J A;  4CCH A;  5CH7 B;  3MZI A;  3AH6 A;  4XPE A;  3T19 A;  2HHQ A;  3R5A A;  1U1O A;  5A0Y A;  1RTD B;  4DV7 J;  4DR4 J;  3PR5 B;  2CNO B;  2J9C A;  2LCW A;  1Z2L A;  2R7T A;  1FNM A;  2QTW A;  4IO1 A;  2BJE A;  4J5O A;  4CDI A;  5IS2 A;  2QG9 B;  2G13 A;  4UY8 T;  4CO5 A;  1BQM A;  3LPY A;  4OYA A;  1HLW A;  5KFD A;  1CEZ A;  4P9S A;  2UUA F;  2FJA B;  4NLQ A;  1FX4 A;  2HAI A;  1TKX B;  2WSE C;  3W2W B;  4MH8 A;  4IR1 A;  5KFR A;  4DS4 A;  2RUS A;  3HJF A;  5AE3 A;  4QR0 A;  1ROF A;  2YH1 A;  3SYZ A;  3NGS A;  5L1L A;  2K1R B;  4MKY A;  1CG2 A;  4ZK7 M;  3D1O A;  2OEL A;  3M6V A;  4Y2I A;  4C8K A;  2DT9 A;  2Y1R I;  1VOM A;  2KG0 A;  2W4C A;  1PKU A;  3HLU A;  1Y00 A;  3VQT A;  3ENV A;  4C0B A;  2XLI A;  2I9S A;  3BDE A;  2Z8Q A;  1WOS A;  4Y6I A;  4Y2A A;  1E6Y B;  2UXD J;  5FDL A;  4RX6 A;  4JI6 F;  3PW0 A;  1RSC A;  2RJZ A;  1JJC B;  4RU2 A;  1NDC A;  2CJ9 A;  4HAC B;  3SMZ A;  5CCM A;  4D3H A;  4LF7 F;  4RW9 B;  2HS4 A;  3N0V A;  5JVG Q;  2O66 A;  3EUN A;  2KXN B;  1TL7 B;  3M8W A;  2GAG C;  4LFB J;  2L48 A;  3NGD A;  1NKC A;  3BGR A;  4M5K A;  1G4C A;  4OYZ A;  3O2I A;  2VDH A;  1S6O A;  2NXU A;  1H3D A;  3CCV S;  3GMG A;  3CCT A;  4KV8 A;  5HN0 A;  2FTR A;  1IBK F;  3R1L A;  5J2P B;  2NXC A;  4LRE A;  3TJ8 A;  3K57 A;  2C2M B;  3M32 B;  4NRU A;  2C2K B;  4K0K J;  3VGV A;  3G6X A;  2BJ3 A;  4JI2 F;  3VCD A;  1N5V A;  2J0S D;  4X4Q A;  4USH A;  1Z4U A;  3MD1 A;  1WTF A;  3HFV A;  3QIP B;  1JLC A;  4OZL A;  5D4P A;  1TU0 B;  5IM0 B;  3OXL A;  2P8I A;  4IG0 B;  3LWM A;  1RT1 B;  4JI1 F;  1KFS A;  4ZPT R;  1B3T A;  3NMA A;  1S0O A;  3E2E A;  5A6P A;  5G4D A;  4USK A;  2Q6C A;  2U2F A;  4M5D B;  2CNL B;  3BQ0 A;  3OFG A;  1LWF A;  4A4J A;  4K4Z A;  2MY8 A;  2JLE A;  2IRX A;  3ZTQ A;  1FDD A;  4QYZ J;  1OQ6 A;  2XCA A;  2DO4 A;  5CYQ A;  3I82 A;  4LF5 F;  5KFL A;  3QQC D;  5C24 B;  4CLS A;  4EYI B;  3RBD A;  2R8G A;  3W2V A;  2LXI A;  2E29 A;  3RTV A;  3EDR B;  3BSA A;  3GQC A;  3L7P A;  4J9U E;  3HHL D;  2UUC F;  3HSJ A;  2XZD B;  4NCG A;  2GVD B;  3N4W A;  5D4N A;  3AAW B;  2JEG A;  2ZUA A;  3CJ0 A;  3HX9 A;  3D6F B;  4DPO A;  1B0P A;  2L9W A;  1REV A;  2ASD A;  2J7W A;  3CCJ S;  4NE9 C;  5DG7 A;  5EWG A;  2VD3 A;  4YQW A;  3NOG A;  1SV5 A;  2F8H A;  4DV0 F;  1RT7 B;  2CZV C;  1RAO A;  5GAH I;  3ZZT A;  4DPU A;  4USV A;  1XQI A;  2M70 A;  1JNZ B;  1WG5 A;  2RVJ A;  3QGG A;  4GC6 A;  4WFX A;  2HHS A;  5GVQ A;  2I6W A;  4LSN A;  2UUB F;  3W8G A;  1H38 A;  2YQ1 A;  3UDE A;  3DRX A;  4C8Y A;  3CCZ A;  2HBZ B;  5E3P A;  3BQ1 A;  4MIA A;  3BPD A;  4LF9 F;  4OJG A;  2ZBI A;  5HRO B;  3Q8Y A;  3KLI B;  1X4F A;  2IC3 A;  4HTI A;  3QAE A;  3AA8 A;  5F8M A;  3ZTR A;  1ARO P;  3MMC A;  1HNX J;  1ZZF A;  3MAQ A;  5KG2 A;  4ZHR B;  1X5O A;  1U2F A;  2EFO A;  2Y1J A;  2VQE J;  2IJN A;  4RPF A;  4A8K A;  2JLF A;  5LMU J;  4DV5 F;  4YOE A;  3I5B A;  4AL5 A;  4DUY F;  1FTC A;  3J7Y U;  2BE2 B;  4DPX A;  1PBA A;  3H98 A;  3CJK B;  1P9Q C;  2JL9 A;  3IWL A;  1QM9 A;  4OFZ A;  3Q8P B;  1UVN A;  4AL7 A;  1UVJ A;  1VRU A;  4ED0 A;  3FGV A;  2MKI A;  1PAU B;  1HMV B;  2CKW A;  2HBQ B;  4R5P B;  2B7C B;  2V2K A;  2XNQ A;  4DUZ J;  2R7S A;  2WOM A;  3CJ5 A;  3GR1 A;  3CED A;  3KJQ B;  3KXD A;  3H5S A;  2VKR A;  1ZET A;  2JJ4 D;  2ACY A;  1SIZ A;  1EAR A;  2KRR A;  3VZH A;  4ED7 A;  2CQ2 A;  2OJ3 A;  2AGQ A;  5KG3 A;  3RB0 A;  5IT4 A;  2NCK L;  3QAT A;  1N5T A;  3OJS A;  2YPZ A;  4BDP A;  1QAY A;  2CQH A;  3P8B B;  4JI5 J;  3MED B;  2LA4 A;  3Q8U A;  1CJK B;  3H59 A;  5JUM A;  4TYB A;  1URR A;  1FWK A;  3RR8 A;  5DLF A;  3VGU A;  4CLK A;  1EIY B;  1GX6 A;  2UXB J;  4ES1 A;  4LF8 J;  2XC9 A;  1IKY A;  2ATL A;  3OPK A;  3N79 A;  4DHV A;  4KRW A;  4P2S A;  2RKI B;  2GFF A;  3HT3 A;  3NCQ A;  4X64 J;  2VON A;  4K2J A;  3VAM A;  1SPB P;  5D6G A;  4WFY A;  2KHC A;  1HNI A;  3CC7 S;  2AU0 A;  1S1V A;  3A8J A;  1J5O B;  4KE5 A;  2LMI A;  3NGK A;  1DAR A;  3ILJ A;  3FNN A;  3TVK A;  3IBF B;  4QIW D;  2LQ5 A;  3RW6 A;  1FWP A;  5KFJ A;  4DPT A;  2WW8 A;  2OD4 A;  3ENA A;  1JMT A;  3DN9 A;  2L9N A;  1AA1 B;  2AIR B;  2XMJ A;  1C1B A;  1FES A;  2F3J A;  2XWX A;  4LT6 A;  2V8P A;  1IJE B;  3AJD A;  4KHM A;  4W4M A;  3B54 A;  1T3N A;  4LFC J;  2XQC A;  4DU7 A;  4RWX A;  1T9Y A;  4X4U A;  2CPD A;  4DL2 A;  3F44 A;  2UVW A;  5D3G B;  1RWW B;  2M8D B;  3H5U A;  2BDP A;  4DQS A;  3QO9 A;  4OX6 A;  2HVE A;  5KFZ A;  2NXE A;  3GIR A;  1KP6 A;  2D9P A;  5D4L A;  2ZKT A;  5T14 A;  1Q8I A;  2DNM A;  3BRE A;  5LSO A;  3IP0 A;  4OL8 A;  1F5C A;  4PG7 A;  3M8Y A;  5CD4 H;  2P5V A;  4Z2X A;  2VIH A;  4HT5 A;  3CME S;  2ZIT A;  3QGH A;  1QUP A;  4IRK A;  3DKD A;  1UZH A;  2KYZ A;  5JJB A;  4ZVP B;  4ED6 A;  4ECT A;  3TZX A;  4DL5 A;  3FDS A;  1IJF B;  4TU9 A;  4AXI A;  5FDL B;  1ELO A;  1VIX A;  4X4S A;  1JXE A;  4TN2 A;  1XBW A;  3LW5 C;  1M5O C;  5CYM A;  5ETV A;  2EK6 A;  2QMW A;  1TR0 A;  3TAR A;  4K4U A;  4A8Y A;  3GG0 A;  3KUE A;  3Q0A A;  2HQD A;  1Q79 A;  2YQ0 A;  2FHJ A;  1Q5Y A;  2QGF B;  2QMX A;  1FXD A;  4LRD A;  2HFN A;  2KZZ A;  2CZ9 A;  2N3L A;  1RAJ A;  3R3T A;  1PJ5 A;  5HQM A;  4G1P A;  3KLF A;  2AF6 A;  2QSW A;  2KHD A;  2V4J B;  1UA0 A;  2QA4 G;  5KFG A;  1YG0 A;  2AJ0 A;  3BYP A;  1EB0 A;  4O44 A;  1X5S A;  3SFU A;  1RCX B;  2MHE A;  4FF4 A;  2FPH X;  1Y10 A;  2BOP A;  1JLC B;  3RZA A;  3I0S B;  1HWI A;  2ZOG A;  2AJ2 A;  4DR4 F;  4WII A;  3I0R A;  3SDE A;  3FEY B;  1NDL A;  3FEZ A;  4QW9 A;  1FCA A;  3DLL Q;  4DZD A;  3TX8 A;  1NBE B;  3N28 A;  4ZPV R;  1P6T A;  3QSI A;  3QRP A;  4DZ6 A;  5JVH Q;  4FF2 A;  2AYG A;  3P4U B;  2BX6 A;  1FX2 A;  4CYU A;  2VPW B;  3KDO A;  1CJV B;  3C66 A;  2CQP A;  2HND B;  2N4C A;  2V8H A;  3CD6 S;  1FRX A;  3HHL C;  5CYQ B;  4RW6 A;  4PG6 A;  2YWW A;  3ZZU A;  4NLR A;  2YVS A;  1Q8K A;  2HYI B;  3SCL E;  1S6P B;  2LDY A;  2RE1 A;  3U27 A;  4K4S A;  4OV6 A;  2GGP B;  2M88 A;  1NND A;  2DHH A;  3O6Q A;  4ELV A;  2CPE A;  3RR7 A;  2V8G A;  3OR1 A;  2OSR A;  1C0T A;  1Z2Z A;  5KFA A;  3OTE A;  2EK1 A;  2V0N A;  2VBW A;  4FVM A;  5KFS A;  4MYU A;  1RWK B;  3SSR A;  1X4H A;  5D0E A;  1YJW S;  2J6U A;  2DR9 A;  4RNF A;  2DXE A;  1F6T A;  3SCI E;  4PUO A;  2RNE A;  2FVP A;  3NBP A;  1WC5 A;  4LFB F;  4ZCK A;  4RR5 A;  3PJW A;  1S1W A;  4OYP A;  4YB5 A;  2XYH B;  2GAH C;  2BQR A;  1CBK A;  2ZE2 A;  4DCO B;  1QAX A;  3VF0 B;  4O0I A;  4N56 A;  3RBX A;  2EFP A;  5GAG I;  2YBV A;  5LT5 A;  2F4V J;  1UL3 A;  2UZA A;  3Q86 A;  2KFZ A;  2O5D A;  3A4T A;  2IC3 B;  2VOD A;  1RUS A;  4MIB A;  2Y8Y A;  2JRS A;  2A2D A;  3MMC B;  2PMZ D;  4IH7 A;  4IG3 A;  1RWO B;  4BLG A;  4AQY F;  3FSI A;  4KJI A;  5KFX A;  4FXW A;  3PNI A;  2JFK A;  3KNG A;  4QR1 A;  4FVC A;  1GEH A;  2BXJ A;  3J7A 1;  2QL7 B;  3P5B P;  4KBI A;  4BWJ A;  4WP8 A;  4WXO A;  5ETM A;  2QSF A;  3MOJ B;  3R97 A;  3RAX A;  2ZNY A;  3CJ3 A;  1VRU B;  5F8L A;  1XMB A;  4NLW A;  1X4E A;  2DGS A;  2CPY A;  3GB0 A;  3R2D J;  2AYB A;  3TAM A;  1TAU A;  2WW4 A;  4NWB A;  2FB0 A;  2GCF A;  3ULH A;  2WOM B;  4DXL A;  2ZH7 A;  1FDN A;  3WIV A;  3G6Y A;  3UVJ B;  3MHY A;  5BYQ A;  2HQF A;  4B9M A;  3ADA C;  1UPM B;  2OAU A;  1ZBT A;  3BO4 A;  2MZJ A;  3DGP A;  2V69 A;  1X7V A;  1LFW A;  2QO3 A;  4K59 A;  1RT4 B;  4LF6 J;  2LXU A;  5J1E A;  4R0J A;  4JV1 A;  1LNQ A;  1SBR A;  3R5B A;  2RRA A;  1DQ9 A;  4R25 A;  1S1X B;  1OYD A;  1UWA A;  3ET6 A;  1WDT A;  2CQB A;  1U47 A;  2HWI A;  5K8N A;  2DGX A;  1R6V A;  4RW7 B;  4NI2 A;  2ZH4 A;  1Y5N B;  3D6H B;  4J9V A;  5F3T A;  2IBO A;  2XM3 A;  1HBN A;  1RAH B;  4CZC A;  3TRG A;  3CJ8 A;  5MLC V;  3HXM A;  2RS2 A;  1QTN B;  3P5T L;  3FBB A;  4PQA A;  2MMY A;  2W2M P;  4NA2 A;  4AXJ A;  1PO6 A;  2DNY A;  5E5N A;  2HEK A;  4PWW A;  3C6U A;  3DMJ A;  2XLJ A;  2MZR A;  3OVB A;  5C7P A;  1DLO A;  3MEC B;  4DSI A;  1K1S A;  1S97 A;  1R3N A;  4XIU A;  1TAQ A;  4LRA A;  5I3U B;  2MLY A;  1EP4 A;  2ZM6 F;  1YWX A;  3D9B A;  5KFC A;  1T11 A;  2C42 A;  3GIL A;  2YX4 A;  3KK2 B;  3SXL A;  2PEB A;  2GW8 A;  2HKE A;  4HVZ A;  4IR9 A;  2F9D A;  1C1B B;  2FJX A;  2JHE A;  3VR1 A;  1JLQ B;  4B3R J;  2ASL A;  4ED3 A;  2XHC A;  2VFR A;  1ZAV A;  2HVZ A;  5CAB A;  3Q83 A;  3ZNU A;  3SQG A;  2ROP A;  1UCN A;  2VQE F;  2DNQ A;  4LF4 J;  4E2F B;  5GMD A;  5LMU F;  4RNO A;  4OHY A;  3T1Y J;  2HNY A;  1YRX A;  1AW0 A;  2E5L J;  1RWN B;  4UW2 A;  3CDE A;  1U7L A;  3PXG a;  3IS9 A;  3DOK A;  5DM7 Q;  3MR7 A;  2OPP B;  4IQM A;  4OHZ A;  3FCV A;  2HHH J;  2YWK A;  2PA8 D;  2KO1 A;  2NSC A;  1S5Z A;  4LFA J;  3ZTP A;  1N6Q A;  1WOO A;  2G9O A;  2ZWO A;  1TK0 A;  1NKE A;  4L76 A;  5ETS A;  4DUZ F;  2XNR A;  3GLJ A;  4NZ6 A;  1FFG B;  3CJQ A;  4X65 J;  3CD0 A;  1U1M A;  1UWB B;  1RAC B;  3W9H A;  3J7A N;  5KG1 A;  3T9Z A;  2JDJ A;  2BRL A;  3G4S S;  4NCB A;  4ILM A;  1ICE B;  4Z7Y A;  2PMH A;  4F2S A;  2KH9 A;  4JI4 J;  1IBC B;  3EGW B;  1KVK A;  2NUH A;  5E3R A;  3FMB A;  2E7V A;  2G0C A;  4FS2 A;  1XTZ A;  1C4C A;  3KOA A;  4KKO B;  3WX4 A;  3BR9 A;  5CYM B;  2J5A A;  2FHK A;  3HHK A;  3FCW A;  1BQN B;  4ZS6 A;  2J7U A;  3D5M A;  4JI5 F;  1FRL A;  2HRT A;  1DTT B;  1XR7 A;  5IV3 A;  1NK7 A;  3TYT A;  3H25 A;  3BH7 B;  3JYT A;  2Y1I A;  1YIT S;  5FLX U;  1XC9 A;  1IKX B;  3EE3 A;  5AE1 A;  2UXB F;  3FBF A;  3DDN A;  1VQO S;  1PGZ A;  4MK7 A;  2ADC A;  4QBU A;  1H0H B;  4TVA B;  5D78 A;  2I8E A;  5DJB A;  1UJ5 A;  4ZIV A;  1MW7 A;  1HHT P;  4BHQ A;  4X64 F;  4UOF A;  2CXE A;  2YKN A;  1SKW A;  4JV2 A;  5ETT A;  4P74 A;  1L5U A;  3EGV A;  4CQ1 A;  3OXG A;  4F7V A;  1ITP A;  4MMO A;  3ZZ0 A;  4F4X A;  1GXL A;  3QZ8 A;  2OPQ A;  4QR2 A;  1KNZ A;  5THW A;  5KFQ A;  4I64 A;  1JLB B;  1ZA1 B;  4HDH A;  4NZ0 A;  4OHV A;  2WB1 D;  1FEH A;  5H9E J;  1RP5 A;  2FZC B;  3EZU A;  5E3A A;  3MMB A;  2A2C A;  4UST A;  1SKR A;  3SDE B;  2B5J A;  4WZM A;  5DQI A;  2VDI A;  1RWP B;  3PEJ A;  1A6L A;  4LBI A;  4EK2 A;  4LFC F;  2D3U A;  3MAA B;  3M8R A;  1D8Z A;  3OLB A;  4B9U A;  4F26 A;  3LP1 A;  3M30 B;  2ZJR Q;  3FCH A;  2F4F A;  3V6D A;  4CYU B;  3C14 A;  4YUD A;  1NZ8 A;  4C0O C;  4NLY A;  2NZC A;  3CUL A;  5KG6 A;  2QA1 A;  3JTO A;  4KYZ A;  2KI2 A;  1NEE A; 
#chains in the Genus database with same CATH homology
 4CLK A;  4CLT A;  1WC5 A;  1FX2 A;  1WC1 A;  1WC4 A;  4CLU A;  1CJV A;  1CJV B;  3C16 B;  4OYI A;  4WPA A;  4OYP A;  2W01 A;  1CJT A;  1CJT B;  1CJK A;  1WC3 A;  3R5G A;  3UVJ A;  1CJU B;  1WC0 A;  3UVJ B;  4USV A;  1YK9 A;  4OYA A;  4CLZ A;  4WP9 A;  4P2M A;  3G82 B;  1U0H B;  1TL7 A;  1TL7 B;  3ET6 B;  1FX4 A;  4CLP A;  4USU A;  4OYZ A;  1AB8 A;  3C16 A;  1AZS B;  4OYM A;  4NI2 B;  4OZ3 A;  2WZ1 A;  5D0R A;  4OYX A;  4CM0 A;  4CLW A;  1CJU A;  4P2F A;  4UST A;  4WP3 A;  5IV4 A;  3G82 A;  4CLS A;  1U0H A;  2GVZ A;  2GVZ B;  4P2X A;  3C14 B;  3ET6 A;  4CM2 A;  2BW7 A;  5D0H A;  3MAA A;  3C15 A;  3C15 B;  2QV6 A;  3MAA B;  1Y10 A;  1AZS A;  4OYO A;  4CLF A;  1CS4 B;  1YBU A;  4NI2 A;  4OZ2 A;  5D0E A;  1YBT A;  5IV3 A;  4WP8 A;  5D0G A;  2GVD A;  2GVD B;  3C14 A;  4USW A;  3MR7 A;  4OYW A;  4CLY A;  5D15 A;  1Y11 A;  1WC6 A;  1CS4 A;  1CJK B;  1CUL A;  1CUL B;  4OYB A;  4CLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...