1CS4B

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
190
Chain Sequence
YHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase/lyase/signaling protein
molecule keywords TYPE V ADENYLATE CYCLASE
publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 62
structure length 190
sequence length 200
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cs4B00
1FX2A 4WP3A 2W01A 3C14B 4OYPA 2WZ1A 4WP9A 3MAAB 4USTA 4USUA 2GVZA 3C16B 4OYMA 1YBUA 1YBTA 5IV4A 2GVDA 5D0RA 4CLKA 1CJUB 1WC6A 4CM0A 1TL7B 1CJKB 3ET6A 4NI2B 4USVA 1TL7A 2QV6A 4NI2A 1WC3A 4CLTA 4CLWA 4P2MA 2GVZB 4WPAA 4P2XA 1WC1A 4OYIA 4CLUA 1CJVA 2GVDB 4CLZA 4CM2A 4OYZA 1CULB 3ET6B 4OYWA 1CULA 4P2FA 1WC4A 1CS4B 4CLYA 4CLPA 1CS4A 3C15B 1Y11A 1CJTA 3C15A 1Y10A 1FX4A 1CJVB 4OYOA 1AZSA 5D15A 4OZ3A 3UVJB 1U0HA 3UVJA 4CLSA 3MR7A 5D0EA 4USWA 3G82A 4CLLA 1AB8A 1CJTB 3C14A 5IV3A 1AZSB 3MAAA 1U0HB 3C16A 5D0GA 1WC5A 3R5GA 4OYBA 4OYXA 1YK9A 4OZ2A 4CLFA 4WP8A 5D0HA 1CJUA 1WC0A 1CJKA 4OYAA 2BW7A 3G82B
chains in the Genus database with same CATH superfamily
1B7YB 3V5RA 5K8MA 4FYVB 2EBGA 5C2CA 5ETKA 3JSMB 3LP1B 2F7VA 1KFSA 4QWBA 4CWBA 1DFDA 1LK5A 1L3VA 3BF4A 3TWZA 2YBVA 4G1IA 3HHLD 3T5HA 4PYAA 3KK1B 2GS8A 3IGNA 2F4VF 5LMUJ 1YIJS 4LR9A 3TW0A 1S7HA 1PJ6A 3TUIC 3AT1B 4DL3A 5LJ3Y 5THWA 2CZ9A 2E1PA 3FBFA 2CQ4A 4DMZA 4AYBD 4D3GA 2RUSA 3CD6S 1H7WA 1U1LA 1Q81T 4C0HA 4L74A 2DK2A 3BSOA 3H40A 5F0UA 5L1IA 1HI1A 4LSZB 2CPZA 1QVFR 2ADCA 3LP0B 1HPZB 5ETMA 3MCSA 5DZ7A 4RNHA 2ERRA 1VBZA 1SC1B 4OYBA 1NRKA 1UVNA 2LYVA 4AXJA 1JLAA 1SUQB 5C24A 2M70A 3E01B 2VPZB 2M7SA 3K59A 4WP3A 2R8IA 1J5EJ 3VHQA 2FIUA 3OBIA 3PACA 4WKYA 5CZVA 3H2VE 1P1TA 3DOLA 4J9UE 4B3SF 3OSNA 1X5TA 2QV6A 4LF6J 2W9BA 2U1AA 2MKSA 3TRGA 3RTVA 3F41A 1TUWA 2O66A 1CPZA 1HYSA 2IBKA 3UR3C 1R27B 1ZZFA 3KNGA 4J9LA 4DUZF 3D3CJ 3PW0A 5K20B 4M5JA 4A8YA 2MZJA 3D6MB 5SUHA 1CC7A 3CF5Q 3OTBA 4OZLA 2ZNZA 4QW8A 5HL7Q 3L7OA 4LIRA 1UW9A 3ULHA 3DOKA 4Y34A 5DQGA 4DX5A 4B3TF 3VVTA 1U45A 1FNMA 2GIQA 1JNRB 1HNWJ 1ZM3A 2Q66A 3OLAA 2EBEA 3SQGB 4K4VA 2MKJA 1M0SA 2RD5C 3O3LA 2ASLA 3U7JA 1RE1B 4OHVA 5EN1A 2J6TA 1X4BA 2VH7A 5KFCA 3SSSA 3Q8YA 3KDNA 2AGOA 4K5SA 3UDLA 3KG0A 2ZH4A 2VOOA 3LP2B 4PR6A 5JXSA 2V68A 3KLVA 2DY9A 1EB0A 3I0RB 3GMGA 3PJ9A 5HROA 2G2YA 1U6ZA 1S1TB 1TL1A 2RB7A 2HEKA 1AA1B 5E3AA 3ZZRA 1PAUB 1IBKF 4OYIA 2BOAA 3R5BA 1NUEA 2JNJA 2DXEA 1TKZB 4LRBA 2V5HG 2AGQA 3MMAA 5IT9Y 4OV1A 5A0YB 2JLEA 3KJVB 1YJVA 4P52A 1RYSA 4F3MA 4OL8A 1TMMA 1IBCB 4I2QA 4KQZA 3MEDA 5H9FJ 4J9OA 4KH0B 3G82A 3L09A 5KFWA 1N36J 2YWKA 4NZ7A 2IRYA 3HHNB 2MPUA 4DN0A 2M8DB 5J2MB 5FJ4A 1R3NA 5T41A 1SC3B 2XS2A 4L3NA 4RW8A 1T9YA 4AFFA 5HJXA 7FD1A 3IFEA 4ZHRB 2WB1D 3LALA 4KPYA 3FMWA 1RWNB 4RZRA 2HNDA 3KK2B 1RT1B 5HMXA 4MJKA 3RRGA 5LOQA 1JB0C 1WC3A 4ECSA 4CIOA 3GIMA 2HMIB 1NHKL 1S1UB 4YHHJ 1HNZJ 1FCAA 3KHGA 1T95A 3MAQA 2HNYB 4IG3B 2W7PA 4A8OA 2HS4A 4F0KA 2IRUA 4UOHA 2HHWA 4X4PA 1MU2B 5IXUA 4WZMA 2VPYB 1PSDA 4OZ3A 5DQHA 4Z2XA 4LJMA 2E9RX 1TTHB 1KOHA 2E5HA 5I42B 2DRDA 1A6LA 3KDOA 1VQLS 3TEGA 1JIHA 2VG6A 5L8RC 4KPCA 4FP9A 5E0OA 4YR0A 4P71A 3MR6A 5K8OA 2LQ9A 1SQEA 5B0AA 4O3OA 3ELHA 4HHUA 2HQFA 1UZHA 1FX2A 1DHMA 1WHYA 2GX8A 1VQ5S 2XZTB 3SSRA 2JDJA 3CDAA 3N0VA 5U47A 2XGQA 4DFMA 5JVGQ 3BPDA 2WVDA 1LWEA 1C0TA 5M2PA 9ATCB 3OXGA 1TAQA 1ZS6A 2KTQA 4Y2IA 4QQBA 4KSEB 1LWCB 4ECQA 1UFWA 2IYGA 4RO0A 3BGRA 4EBEA 1UFKA 2B0GA 4L3KA 3FQKA 4ETXA 2OAUA 4KFBA 4RWWA 1U2CA 1RWVB 2DR5A 4B3RF 3CWJA 4USHA 3M2UA 2CKWA 2XNQA 2FVPA 2QEXS 5E5NA 3JQMA 4M94A 4TU9A 2XYGB 2CADA 2ZWPA 3QSYB 1RXOB 5J1EB 4CLLA 3JQKA 2HFUA 3R5GA 4KJIA 1FWPA 3FSIA 4GKKF 3AXKA 3BREA 4EFAC 3PKYA 5DETA 1VFJA 4DG1B 3HLUA 1D9FA 4WP9A 1KFDA 1HNIA 5K8NA 4AD6A 3KLHA 4PG6A 3GFXA 1YJ7A 1V6HA 4OI0A 4QR2A 1YRXA 2QRRA 2VKRA 5EHHA 5KFXA 1YJNS 3R9LA 3K0JA 3TEHB 3KHHA 1Q7LB 1NJIT 1HL6A 3Q23A 4JI3F 3G8SA 5LT5A 4ZPTR 4DLEA 3POTA 4KGKA 3Q86A 4IRDA 3EX7B 4OHXA 3ISZA 1I3OB 2MZ1A 1D8YA 1HW9A 1NDLA 2J7WA 4R0JA 4K4ZA 3CJ5A 1TL3A 5DDPC 1K9MT 1Y5NB 4KHPJ 3BGUA 4YB1P 4PG7A 3J81U 3IR5B 3NGUA 4DF4A 5KG7A 4JI8F 2HQCA 2O5DA 2K3KA 2M5YA 1SKRA 1JLBB 1NK9A 1S1XB 2ZJPQ 3DU5A 4ZA1A 4IDKB 2DNHA 2CIMA 2WBMA 3VGVA 2IM3A 1U02A 3I4HX 1PO6A 1CJUA 2VA2A 1JKHA 2VFTA 3HHDA 2LQJA 1RT4A 1UKUA 5CZXA 2ZH5A 3SCKE 4QIVA 5C2GA 4RWXA 1WG5A 1UTAA 2LDYA 3VQSA 3ZZYA 2RS2A 3HFKA 2AEMA 1RTJA 1ZTWA 4RUCA 4DS5A 4K2XA 2ZC3A 5A8WA 1AROP 2KO1A 1TKTB 2FZCB 4J7CA 4QU6A 2HPUA 2ZJQQ 4ZN3A 1CJVA 2FDNA 3BKTA 1NK7A 3MPWA 4DV0J 3DLKB 4JI5J 4JI1F 4ZLPA 3MMCA 2KRRA 2R4FA 4GO7X 4FXVA 3I31A 4NLRA 4U96A 2ATLA 1J5OB 2UUCF 1DTTB 3NG8A 2QYCA 2YKAA 1G1XA 2BJ3A 1H98A 5F8HA 3LGMA 4FYXB 2IJNA 5CAAA 4RPFA 2FHJA 3G71S 2MLXA 5BYSA 1GX5A 2HHVA 3EDQB 3PW4A 3V6HA 1JJ4A 4WCEQ 1M90T 3MF5A 1F3FA 3PO5A 1FJCA 1VRUA 3T19A 5KT7A 4IFYA 4URGA 2CQBA 1TP7A 5JVHQ 1DQAA 4DXLA 2KFYA 1CJKB 3NNCA 2R42A 1OSCA 3QT7A 1HQUA 3GR1A 2XY6A 4A47A 3PW7A 2KT5A 2V63A 2KKHA 1K73T 1URNA 4RBVA 4RLEA 3ISNC 2V8HA 3DOMB 2HVIA 3SBMA 3Q8VA 1V3RA 4PWDB 1X31C 1D3WA 5DLFA 4IG0B 4ZOSA 2MKKA 4QOTA 8AT1B 4KTQA 2KXNB 3N4WA 2C42A 4ZDNA 3HJVA 4C8NA 1HWKA 3BEGB 4QZVB 2MZQA 4YB5A 1VR6A 1E6YA 3UN2A 2YNGB 1KS2A 1UCNA 3G6YA 3FCWA 4BS2A 5CHCB 3PIOQ 2E44A 3J81j 3TQ1A 3AD8C 2WONB 1Q82T 2XCPA 3NNHA 4I2PA 3C66A 4K0KF 1UEKA 1GXLA 3A1YG 3M2VB 4GO5X 5F8NA 1UVMA 4NI2B 2FLNA 4USVA 2EK6A 3PDNA 4UQGA 3VAJA 4OJHA 5LL6d 1VHFA 4ZCKA 4DV1F 4OI4A 3BS9A 2D41A 2NXUA 2BKNA 3PXGa 2RQ4A 2I9SA 4ILMA 4H4MA 3MM9A 3QGPA 1QJHA 4ELVA 4OHZA 3KK3A 2I6WA 3DU6A 2B7BB 3K2YA 3JS9A 2D3OR 3QGHA 2J7KA 3AD9C 2KFNA 1Q78A 1RT7A 2JEIA 1SQFA 1T94A 3VGSA 5IV3A 5LMNJ 3NKYA 2HBRB 3MEEB 5D3GA 2BE7D 2V69A 3QLHB 3ADAC 3DXSX 1YLXA 4G1QA 3NWRA 1IUJA 1S6PB 3ZZTA 1TL4A 3D68A 4DR1F 3IRXA 1U6FA 4OYPA 2HWTA 2WRMA 4DV5J 2XULA 1I51B 2B4UA 2KN4A 2RKIA 4A8FA 1RLDA 3CJQA 4GKJF 3ZZZA 3WZ0A 2YX4A 4LIWA 1K47A 1HWUA 3HULA 3D2WA 1PJ7A 2IFXA 5F0WA 1RTDB 4Y2KA 2MLZA 2R7SA 1U1MA 2B8QA 2BRKA 4QCLA 3N6MA 3DRRA 1XNQJ 3PVXA 2MQOA 2IHR1 5BR8J 1FHTA 2CG8A 1RT5A 1QY7A 1OJ4A 4C4WA 4MIWA 2ZH1A 4FXWA 4PUOA 5D0EA 1U24A 2CG4A 1WDTA 3QWUA 2EFOA 3MCMA 2HURA 3OTEA 2QLJB 4ECUA 3AQPA 2BM0A 2FJAB 1S9GA 2GQ2A 2J5AA 4DR4J 4ERDA 4C98A 3GCWP 2DNYA 2F8HA 2N82B 5B0CA 4YB7A 2AT1B 3T9ZA 1VQYA 5MAOA 1JQGA 4O44A 2YKNB 2G1DA 2AYMA 2EI5A 2ZVIA 3DGPA 4OZ0A 2BQRA 4G3IA 2PGCA 2HGNA 4USMA 1S6QA 2IIHA 1H0HB 4CLUA 2GW8A 3DOLB 1SXLA 2DR8A 4UZCA 3GQCA 2XEXA 4P2FA 3Q89A 4AL6A 4DL5A 1CS4B 3GYXB 2JC1A 1XQIA 2B5JA 4QIWD 1U0HA 1RAIB 3QIPA 2X1BA 1HYSB 2DNPA 3QZ7A 2CJXB 3JTPA 3MM7A 4L73A 2B9YA 1RT6A 4I1TA 1S72S 4O3PA 1FJ7A 1RHUB 2KG1A 3GIIA 1UMJA 5CXTA 2ZBRA 5CYQB 3DOKB 2M3DA 2OUGA 3K89A 4OYXA 2Q1LA 1ZA1B 2BACA 4EMDA 1S59A 3CXCR 5KFZA 2NXCA 4MT1A 1H73A 4ATNA 1S57A 4ZPVR 3MM5A 3AY0A 2OI2A 4C11B 1VQSA 1NPKA 3AHPA 3LOUA 5GAGU 3FVYA 4DUTA 5IC4B 1UVJA 3CO0P 2MLYA 3M8SA 3HZGA 4DSEA 3CJRA 4OLPA 3A4TA 2FJXA 3LANA 1VCTA 1FJGF 1Q1KA 3RAXA 3NOCA 4IH6A 5HROB 1SVDA 1TL1B 3T6JA 4YY3J 4U67Q 1GXUA 4ZP6A 3G8TA 4B17A 4RJVA 1HNXJ 1YSJA 4RW6A 2V8PA 4IQXA 4ECWA 2GO9A 4J91A 2IYIA 3MMAB 5C25B 2OMOA 3OHAA 2GCFA 4M5DA 2QLXA 2JVRA 4UQTA 1NB2A 1RTHA 4PPDA 1KQKA 2V8DA 2ASYA 4I2QB 3MEDB 4OYAA 4IR9A 3G82B 2P9EA 5E3QA 4I0WA 1RACB 2RHSB 1WJ9A 4JI2F 1YBTA 2FJBB 4P6QA 4DR2F 1NH7A 2JC0A 2CPDA 5KFPA 4TNOA 4RW8B 2IAJA 4RBTA 2RDDA 4ELTA 4TN2A 1TK8A 4X62F 2HNDB 4X4QA 2PMHA 3PFEA 2WOMB 4U8YA 1S1VB 3ENWA 3OXLA 2AQ4A 4ALZA 3CO9A 4DLGA 3NLCA 3HPOA 3QATA 2L3MA 1BWVA 1IN0A 3NS6A 1XMQF 4K4XA 2R2RA 3NRBA 2AEJA 3BSAA 1AB8A 1ITPA 4PXEA 2OHDA 4G1PA 2KM8B 2F1FA 2UP1A 3WHIA 1Q79A 4F50A 2VG6B 5F8GA 5KT5A 4NA1A 5H9EK 1GH8A 1X0FA 4EK2A 4FKXA 1VQMS 3EGZA 1MSWD 5DGAA 3M6VA 2R2UA 3R3TA 3SMZA 1D9AA 2HGLA 1FE4A 3SV3A 1K44A 4P2XA 3GJSB 1JXEA 1QLNA 4FXDA 2B9WA 3T5LA 2F4FA 3T1HJ 1RA7A 1C0TB 3T9NA 1YWXA 4OYWA 3H90A 2Q6BA 1BQXA 3W62A 1UA0A 2JX2A 3SDEB 4NOHA 3QFWA 4ZLNA 1KDNA 2JVOA 5C42B 2MZRA 4W98A 4JI6F 5LSRA 1Q8BA 4F8RA 1I94J 2R8KA 2EVZA 3V6JA 2KJWA 1NJYA 4N77A 2B4PA 2Z8QA 4LF8F 4YOEA 4ES2A 3MXHP 3M2UB 3AOAA 4WFAQ 3D1HA 3J7Z5 3W9HA 4MIAA 3CCLS 3I5CA 4WBFA 1IJFB 4L72B 1SL1A 1VQNS 3RGIA 3FGVA 2R7WA 2DGWA 1UJ5A 4JI7F 1M5OC 5HQLA 1S6UA 1XJWB 2BZ2A 1DTQA 4DUYF 4Y0FA 1WF1A 1RWXB 3QMQA 2B51A 2FC8A 3MGJA 2ASDA 2YNIA 3KLHB 4F04B 2PSZA 1JLQA 4DJBA 1UVLA 4M63A 2HW3A 1ZOTA 5IQ6A 2FLPA 4DQQA 4RW4A 3Q8SB 4OFZA 2F40A 1GX6A 4DSLA 2VONA 4ZKAA 5DJBA 3CCMS 2MSSA 2X3GA 4DSKA 2UXDF 4K4SA 3POTB 3CUNA 3PW2A 1ZAXA 2V9KA 4OZ1A 2JH3A 4DFJA 3OJUA 3W64A 1UWAA 4LFCJ 3PYFA 3OD2A 4FF2A 2DXDA 1SJQA 5I3PA 2YKQA 4WFYA 1RBLA 2ZBQA 3IG1A 2LEBA 4NX9A 4NCBA 3WIVA 1TL3B 1B64A 2YKMB 2E29A 2ZZNA 4CH7A 2JHEA 4DEZA 3BQ1A 1Q8KA 4CNYA 5GAHU 5KFOA 2GNKA 3M8QB 1EP4A 4DZ6A 1RWKB 4DQPA 4IR1A 3GFZA 2JL9A 1FFWB 5D6GA 1CJUB 1ZTTA 1JLEB 1JKHB 3DDKA 1GXTA 2DNZA 3BN4A 1AYEA 1RT4B 4KKOA 3VZIA 2ZHAA 5A2QY 1GFWB 1JXVA 4DU7A 3QZ8A 2ACYA 4QWEA 3FKBA 1RI7A 3TA2A 3MPDA 1KQGB 1LEOA 1DLOB 5AXLA 1RTJB 3L7PA 4DV6F 5A8WB 4ZLJA 5M2UA 4ED5A 1BY9A 4DL7A 1TKDA 2BE2B 3C15B 1CJVB 1RAAB 3F0NA 5EGYA 2J9DA 3MMCB 2DJWA 3GTYX 1APSA 2DH7A 1S4EA 3MDFA 4ZVQB 4M5IA 5EWFA 3CCSS 1VISA 3UI3A 4KH1B 2VD3A 1M5PC 1U1OA 3I9ZA 4QR0A 2XO7A 4NEYA 2HHPA 1YK9A 1KNZA 1J2VA 2VBZA 2HHQA 1KN6A 5DQIA 2GJ2A 4MKYA 1U2FA 3LWMA 4JI0F 4DHVA 1RP5A 1NB7A 3G4SS 4DV7J 2DISA 4FNIA 4OJGA 1VC5A 4FF3A 5HP1A 4C8ZA 3OL6A 4I6YA 2E1RA 1FRMA 1VRUB 1FERA 2HBZB 5ETPA 4N76A 4IFYB 3JB9k 3RZAA 3KLEB 4B3SJ 3BSCA 3OTOF 3PV8A 4OI1A 3W60A 4MAKA 4KR0B 4UOGA 1LWXA 2BYCA 1HQUB 2D74B 2C3YA 2DTJA 3EICA 4DUZJ 1IQZA 3D54A 3S1TA 5F8MA 2FJDB 1YKWA 5IT4A 2UU9J 2N3OA 1SBRA 1W26A 4B3TJ 1XERA 2YWGA 2LP4A 3CMAS 1E6YB 4MTPA 2XYPB 3GG0A 2ACMA 4U6PA 2K8GA 4DSIA 1TVRA 2A6MA 3SXLA 4S0MA 4JI4J 3W63A 4P73A 3PCOB 2YTCA 2CQCA 4WTYA 3I9V9 1RUSA 2OP5A 4P2MA 4WPAA 3IBFB 3PZPA 4N5SA 3RAQA 3ZZ0A 2UXBF 1IBKJ 3MD1A 2DNRA 5AJ3F 1X9MA 4DOZA 2K1RA 3UD5A 1VJWA 1NAQA 3TOQA 4BWMA 1YRTA 1RAGB 3H7HB 1O5JA 4WFXA 1Y9OA 3KK3B 1H2UX 5CA5A 6AT1B 4DPTA 3C16A 5KFEA 5D0GA 4B9MA 2OFGX 3G9CA 3HVTB 2VODA 5AT1B 1JJHA 4X4UA 4AT1B 4M1KA 1MWZA 3HHLC 2PC6A 4QYRA 1RT7B 5J2QA 3PX6A 2QA4S 1S5ZA 1NLKL 2F9DA 3M8PB 2LXFA 4ED1A 4C3KA 1DURA 4G1QB 1XTZA 1IQTA 3DDIA 2HFNA 1KHWA 4ZVPB 2Q79A 2XQCA 2QN6B 4F02A 4HEA9 3IRXB 4G6VB 1F5BA 1NK0A 5J2PB 4Y2CA 3N5BA 3L3CA 2DO0A 5KFGA 4ZIWA 2RKIB 4EZ9A 1F3VA 3K8WA 4ECRA 3DN9A 3IR6B 2FY1A 3Q22A 2W8LA 2K3IA 3PX4A 4U9RA 3ZZOA 4NYPA 4PXCA 4DSFA 5A2QU 1V5VA 3PFOA 4N8NA 5LM7E 5J1PA 2MQLA 1T9VA 4OX7A 1NNDA 4BDPA 4IRCA 3MECB 3PYGA 2U2FA 1G4CA 3FUYA 4C3MA 1YJTA 2J0QD 3IBCB 4PUOB 3THPA 4XK8C 1FD8A 3M9NB 1HBOB 3NGTA 1PAEX 1X4GA 4CRJA 4O3QA 4R8UB 1S9GB 2WB4A 5G0RA 1EQMA 2G0IA 4R0EA 3LA0A 3AJ1A 2HNZA 1WOSA 2H5IB 1B0VA 1DAXA 1DARA 1FKPA 2DITA 3Q8UA 3PNIA 4O44B 2UZAA 1WSVA 5HVFA 2H48B 1XNRF 2ZE2B 5CD4H 4AL5A 1A0OB 2YNFA 3DGPB 1HARA 2GJFA 5KFRA 3AFGA 1T9WA 2H51B 2C2ZB 2MGZA 4K50A 4FVCA 4MIBA 3TARA 3ZO7A 1FDNA 2G2ZA 4CLSA 3M8RA 3DRYA 1NHUA 3VZHA 4ES3A 4B3RJ 3H5UA 4NXMJ 2ZZTA 2B4OA 1YG0A 2C22A 2IPOB 1M1HA 2LXUA 4K4TA 2B5JB 1U0HB 3QIPB 2E9TA 5F9LA 2W7AA 3FSXA 3GILA 5HK4A 3MM7B 1RT6B 1Z1ZA 3WC2A 3RU0A 3SCIE 4OZJA 1G2EA 3TP2A 4QIFA 4URSA 2QMWA 4TQRA 4GKKJ 4ZCLA 2XZDB 4Q7AA 3QJLA 1X5PA 1CEZA 2J9DE 1DRZA 1TZ0A 4CM0A 2KL8A 5K8PA 2IM0A 3US5A 2FVCA 1BMQB 3MM5B 2O1PA 3M2RA 1SB6A 3T5KA 1EETB 3HSDA 3B78A 2FY8A 4JI3J 1YZ7A 2XLJA 4M5NA 2IC3A 1H6KX 4DN9A 3MMBB 3DRPA 4HACA 2CQIA 1L3TA 1SI9A 1HQ2A 1SPBP 1F5CA 5KFNA 2ZOGA 1NEEA 3K57A 4HYKA 1LOUA 3T3FA 2W2PP 1FNOA 3OVBA 3M6UA 2MQPA 3PHEA 2HWHA 4ITSA 2P2CB 4JI8J 4DR3F 3EZOA 4HH1A 1OIAA 5DM6Q 5D0HA 2GGPA 4I7FA 2X1FA 1YX2A 2MEWA 3VAMA 1U48A 4U7CA 2WSCC 3EJMA 4M5MA 2VHGA 1WEYA 1HBMA 3P4UB 1ACMB 4M5DB 2Q43A 3CEDA 3RBXA 1RTHB 4OMFG 2E5LF 4FPRA 2AGPA 1PBAA 4DR6F 1NPPA 2CPHA 2QC3A 3OL8A 3FBCA 4A8QA 1RBOB 3NCQA 4NLWA 4CO0A 3FDSA 2ZC4A 2RNEA 2OPQA 2KI2A 3I96A 1B0PA 2OELA 1QSLA 3TR5A 1KHVA 4P72A 4CLZA 3A3OB 3TZXA 2UUBJ 1T02A 1K0VA 1P1LA 4DCPB 5F9NA 4TQSA 2R8HA 1F9FA 2IAJB 4A46A 4LFAF 3HD1A 1JLFA 4JI1J 2DCLA 5D15A 3A8KA 2ROGA 2MKCA 3EVOA 5B0DA 4USIA 3CGIA 2Y9HA 3OV7A 4RUBA 2UUCJ 3WC0A 4FDFA 2NR0A 3ZXWA 1BE4A 3VV2B 1OYDA 3BPSP 2POKA 1Q4RA 1DZ5A 1YRUA 4ZVUB 4A8MP 2ZBIA 2F9JA 4DV4F 2J6UA 1TUGB 3MMJA 4ELUA 1RK8A 2B56A 4ZN1A 3H59A 2XI3A 3MM6A 2DB1A 4OYMA 1QDUB 2ZUGA 5IT0A 5HATA 4GC7A 1F2GA 2BXJA 2AIRB 2LDIA 5M2RA 2HHXA 2LQ8A 2RH3A 1KLNA 2AZ3A 2D69A 5E7OB 3TUZC 1WUUA 5GMDA 2XY7A 2MB0B 2UXCF 2B9XA 2VJUA 3VAFA 4XPCA 3EVMA 5LMUF 4U95A 1ZA2B 5HVGA 2VKZG 4TVAB 2EKYA 4C8YA 1Z4UA 3W2VA 1KVKA 1C4CA 1FTCA 3A8JA 3DRXA 3CJKA 4QW9A 3VWSA 4NZ0A 2K7KA 2R9LA 2FHOB 2OSRA 2VG7A 5KTQA 2NS1B 2W2QP 8RUCA 4O3NA 1S12A 3P3DA 4TLQA 3CCUS 1KEKA 1IKXB 1L3SA 2XMAA 4XIUA 1RHJB 2DD8S 3W2WA 1FVQA 1T3OA 2LECA 1N8RT 3H4DA 2W24A 3ENQA 1F0XA 2EKNA 1TU0B 3U1NA 5A76A 3NS7B 4K0KJ 2IVMA 3E3XA 2CRLA 1U49A 1R7IA 3HI9A 2CNNB 3THVA 4YR2A 1VK8A 1S76D 1H7XA 3JSYA 4LF6F 2BANA 4FBTA 2RSQA 5KFKA 1DTQB 2YX1A 2HFZA 2YQ3A 1ZM9A 3HKWA 4CO5A 3HM9A 4EBDA 1A9NB 4DPYA 2ZHBA 1RWOB 4MKAA 5HMWA 4A8KA 4OX6A 1FRXA 2R7TA 1JLQB 5GAGI 1RTIB 4DF8A 4Y6IA 5CYMA 2XO6A 4LMZA 5CH7B 3W66A 2GZOA 3BJYA 4Q2LA 4DCOB 2DY1A 1VRQC 1FFSB 1HNWF 3IBWA 3MR3A 2EFGA 1PILA 4UY85 4CTAA 2ZM6F 3C6TB 3QRRA 4CO3A 1PC5A 4AQYJ 1Q8IA 5BJRA 3FC9A 2GFFA 2W4CA 1T11A 3FQLA 4DR1J 4X64J 1RBAA 2DGXA 2FJVA 4O4GA 2M4MA 1Y3JA 4NRUA 1EP4B 2HGMA 5ETQA 3THTA 2NZCA 3W5ZA 3Q0AA 4F2RA 2ZOFA 3DHWC 1LW2B 1WTBA 4QU7A 1LK7A 3Q8QB 4XDDA 4DV2F 4NMLA 2DNMA 4MK9A 3W5YA 2F3JA 3B6BA 2XS5A 3C19A 2OIHA 4K4WA 2KYZA 2XSFA 2XHCA 2Z30B 2AJ2A 5KFHA 4FKYA 2R2SA 2JSXA 1UW4A 2J0XA 1NDCA 3KG1A 1F2HA 1BXNA 3GE9A 5K14A 2IA6A 3K5NA 2W2OP 2ZH7A 1N36F 1DJ0A 1UWBA 3BKUA 3KLFA 3O5TB 1HR0J 1VMBA 3HT3A 1FO1A 4FF1A 2HIYA 4EO8A 5GADU 2QYGA 2CDQA 4CLKA 3R6GB 1V9OA 2HG4A 2M88A 1TL7A 5KG1A 2XHWA 4U7UD 4PABA 3EGWB 4LSNA 3QSIA 5HP1B 5A6PA 1WHVA 2IA0A 2FYXA 3NOGA 4Y28C 1WHXA 1HNZF 3IWLA 2R8JA 1WKLA 1GNKA 1FKAF 2BJDA 3MTJA 1S0VA 4EEYA 4HT7A 3MAHA 1IXKA 5KG6A 4V1Ak 5LJ5Y 4ZPAA 3UVJA 1IR2A 4LFBJ 2FVQA 4FYWB 4LBIA 4PWWA 2R2TA 2DXFA 1R8HA 1T05A 3HCXA 2GHPA 1SJ3P 2A1BA 1VK3A 3MR2A 4HDHA 3WX4A 2A18A 3R2CJ 3Q8PB 3NBPB 2YH1A 1D0EA 3CPWR 4KGMA 4Y00A 1VRTA 1B4SA 2G2OA 1H72C 2FVSA 2CFXA 4ICLA 2ZZMA 1ZH5A 3UFCX 2QMXA 5LSLA 3MPUB 1C4AA 5EWGA 2QA2A 1HIYA 3U27A 1WC6A 5L1LA 1VJQA 2MZTA 5L1JA 1FK9A 1TVRB 2NQPA 1FXLA 1WC1A 2R7XA 3I0SA 3M4XA 3V81B 3QRPA 1CULB 3H25A 4TY8A 1QSSA 1GMWD 1WKKA 1R0AA 4J9PA 3KKFA 2UVUA 1FNXH 2EFVA 5HAOA 3FJ2A 2YWEA 2F8EX 3VGTA 1X4EA 4WU3A 4KO0A 4N8OA 2Y1IA 3QYYA 3SCJE 4OHWA 2Z4PA 3QRQA 1S77D 4OI6A 3UN3A 2DEJA 1WD6A 3AJDA 2MQ8A 2LEPA 3I5BA 1OQ6A 3MAAA 4ED8A 2G0CA 4ZPDA 2ALYB 2LU1A 2MHEA 3CCZA 3D5MA 1M5VC 3SI8A 3LF0A 1TV6A 3GONA 2NYIA 1FDBA 2X7IA 2ZDPA 4O3RA 4PAAA 3C16B 1YBUA 1S6OA 2PO4A 1H38A 3HSZA 1MG7A 5H9EJ 4KE5A 4ZJOA 1WELA 4F2SA 4LF5F 2W9CA 4JI2J 3ONQA 3UE2A 4RNNA 2HSEB 4CT9A 2W4DA 5T7LA 2XSJA 1WF2A 4CM2A 2CQHA 3OR1B 2HFOA 2N4DA 2V4RA 2E9ZA 3NGSA 5GAHI 4E0DA 4WE1A 3IS9A 2W8KA 4EUVA 3I82A 1SIZA 5EX0A 2QSWA 1V5IB 1SIWB 1HBNA 3TUJC 3RG6A 5HMYA 4FN5A 3KMSA 4PG4A 1S48A 2YQ1A 4I6WA 4DPOA 4LT6A 1F9HA 5JMNA 4KHPF 3Q83A 2LMIA 1ROFA 4MYUA 2V67A 4I6AA 1XMQJ 3I32A 4P9SA 3KMQA 3G2XA 4X84A 3W3SA 2CZ4A 3J80U 1KR4A 3DLGB 3EE3A 3CD5A 4DR5J 1RAHB 2Z57B 3GLJA 4IO1A 2FQQB 5K9FA 4NLTA 3LP1A 1PBUA 2ZFHA 2FC9A 1KLMB 1LW0A 1T0TV 1EKRA 2QX0A 4C6AA 4CLWA 5KT4A 2V8GA 4LRDA 1P9YA 1T9UA 1F6TA 1AFIA 5KOXA 3MOZA 4LR8A 2HNZB 1FKPB 1L5UA 1RABB 1AXQA 4KV8B 3AB4B 4JI5F 2VC0A 3NP5A 4NE9C 4NPOA 1OY9A 2YNFB 1RHMB 4LF9J 3S7RA 2NSCA 3UPFA 4K59A 2Y8WA 2RUGA 1U47A 3N79A 1HPZA 3UD4P 3UNGC 1X0PA 3FEXB 1WF0A 1Z2LA 1BQMA 3B82A 2CJKA 1RDRA 4LF8J 4Q8EA 2DHGA 2HLUA 2NPFA 2KZZA 1NMEB 3GIKA 3BM7A 3NY0A 3W5XA 4RUAA 5HMZA 3OFFA 3VR1A 2CJYB 1N34J 4JI7J 4AE5A 2YQ0A 5LSOA 2JZ5A 4HLBA 3R97A 3V6KA 2A3JA 5DS7A 1KBRA 2DRBA 1RJJA 2ZH9A 2G9OA 4F26A 2OPPA 3M2RB 4I56A 1VC0A 5AXNA 1NK4A 2RU9A 4C0OC 1N32J 2FTRA 2UXDJ 2IC3B 1NK6A 1IKVA 2I5JA 4DL0C 2QA1A 2HBYB 3CDBA 4B9LA 3QIDA 1NJZA 2IDLA 2MKIA 4FYYB 4NLGA 4IO9Q 2YWFA 5HBMA 2B7CB 2KVQE 4N47A 3UDEA 2EC2A 1REGX 2BJ9A 2GGPB 3HP6A 2QO3A 5FLXY 3I0RA 1RWPB 4MMOA 4PXBA 4HH0A 3DI6A 2OPRA 4OYZA 4UOCA 3ITHA 3LQVA 4X66F 3RB6A 1HBUA 4WJBA 1TKZA 2UVRA 3D0GE 4CI0B 2XS7A 2DPIA 4XO0A 2AX0A 4DV6J 3RAMA 2MKYA 2XB2D 1YJRA 3TJ9A 4IYQA 2DVIA 1Q53A 5L39A 4EYHB 3G6ES 3UD3P 3SZ2A 4ECXA 1BC6A 2CUYA 4E98A 4KT0C 3JTNA 5LMNF 5J2MA 5DDQC 2ILYA 3QJPA 1MWQA 1PKUA 1HD0A 4LRFA 4QWCA 2L08A 2J6SA 2WW8A 1MWYA 3LW5C 1GTEA 3CCTA 4P74A 4JI0J 5DDOC 3KK2A 4KBIA 2KG0A 4WK1A 3BV8A 4NLVA 5GMKa 3MM6B 3IRWP 4ZVSB 2VJVA 5KFYA 3CD7A 2Y1JA 1TELA 2M9KA 3I4PA 1R89A 2OPSB 2VIHA 4B3OA 1TK0A 3RRKA 1VQ4S 2EFPA 3OTOJ 5GAEU 4HT5A 5C5JA 1N5YA 2H4WB 2XYHB 2B6AB 4J9SA 2PFFB 5BR8F 2H3EB 3NEKA 4O4RA 1NZ8A 2BQ3A 1MROA 4RBUA 2AF6A 4B9VA 5CQGA 3W2VB 1IM6A 4F3QA 1VC6A 1WC0A 4MH8A 3SIPB 3DM2B 3BH6B 5AXKA 2MY8A 3OFGA 4DR4F 3P96A 3MUTP 3W61A 4KYZA 2BM1A 4GVBA 5B08A 2XG8A 4X4VA 3Q24A 2RILA 2HFVA 1SV5B 4CO4A 4DCJB 4NXNJ 1IWGA 1DQ9A 1SKUB 1HHSA 4O0IA 3W2WB 2W4PA 1T7PA 4NLDA 5KFDA 1WWHA 1U25A 3G96A 2HAFA 5D77A 1XBWA 1LWCA 2R7RA 1RAFB 4DL6A 2VQFJ 2IY5B 3P5TL 4ID5A 2Y1RI 3M6WA 4Y2AA 2JRSA 5KFSA 1BD6A 5IT9U 1FEEA 1OO0B 2R7UA 4A8WA 2HAIA 1XR7A 2Q6CA 3M8WA 2BANB 2YH0A 1WSRA 3OT9A 3JAMY 2DIUA 2OSQA 1UAWA 3OSPA 3V4IB 2OTLS 4CYUA 4W90B 1M5KC 2VBXA 2DH8A 3NGRA 1YJWS 2FUG9 4NCGA 3E51A 3VGUA 2WCXA 1GT8A 5CYMB 1NK5A 1QAIA 3OFEA 1XEZA 4M8LA 1EZZB 1OSDA 3FZ2A 3M32B 2UUAJ 1UPPA 1S9EB 4JOUA 3QPIA 3UR0A 1XMOJ 2LA6A 3H42A 3VAGA 4ZVOB 2VU5A 3ZNUA 2QL7B 4CTAB 1ZPVA 1M1KT 1RU2A 2ATCB 4K4UA 4Y3CA 1IKYA 5HLFB 1BQNA 3AA8A 3R1HA 4P10A 2K7JA 1ZAVA 3SFGA 4MFBA 1ZPWX 4OX9J 1PG5B 1N48A 4Q2MA 1ZM4A 4Q5VA 4PG8A 1HMVB 2MZSA 3FZBA 2I0XA 4B9NA 2GMLA 3EXCX 4QIEA 3DFEA 1NK8A 4BC7A 3KLGA 4WKRA 1V3SA 2XMTA 2RHQB 4DR7J 1HNXF 2LFVA 1JLBA 1S1XA 2BVZA 4IDKA 2ZH6A 3E8OA 2V94A 4QYZK 5DGBA 4IFVA 1JWWA 4J37A 2LU2A 1X5SA 2V34A 4KGZB 3D7SB 3QO9B 4KHMA 3RRHA 2DPJA 1FF2A 2JLGA 1HWLA 2ZNYA 3ZZPA 3W7BA 3EYZA 1UJ6A 4DPXA 2VZ9A 5K14B 3NXZA 2V50A 3X3UA 3N6LA 4F0MA 2AD9A 3ENAA 1UWBB 4I69A 2VBWA 2C3OA 2MQQA 1WTFA 2VC1A 3C6UA 4U7UK 1RHKB 1NSQA 2BDPA 5FDLB 4TXSA 4ER8A 2ILZA 2V4QA 3BQ2A 3DLKA 4JV2A 1YJ9S 2AJFE 2L9WA 4EYIB 7AT1B 3TNVA 1KWMA 3BDPA 1XNRJ 2BW2A 3SCLE 1NSKL 4LSNB 4NMXA 1AZSA 2EK1A 3GZ7A 4C8OA 4J9RA 1K0TA 3GFHA 4UOFA 1SC6A 4DS4A 4LQ9A 4L6V3 4JB8B 1OY8A 3DLEA 5A8KA 3GPAA 4BC9A 1RADB 3IM8A 1X4CA 2YKPA 3GU0A 4EO6A 4I4BA 4F67A 2GIFA 2ZKTA 2I8EA 4BLGA 3FFIA 3SFUA 4ED4A 3NAHA 4ECZA 1X9SA 4J9MA 4FVMA 1RHRB 1EAYC 3TZZA 3H0PA 1VRTB 2CWKA 1KQFB 3D1QA 4YP3A 2NPIA 1H2TZ 3MFHA 1WEZA 2BUNA 2P9CA 3BGLA 1T03A 1V3ZA 2EG2A 3KFWX 5IWAF 4WF9Q 3M9OB 2AV5A 3DOMA 1RA6A 3HJFA 2DGOA 3D6HB 3M8YA 3G87A 2UUWA 3ILLA 2W9AA 2GIRA 1FK9B 1X8DA 2FHMA 3T1HF 3C46A 3CVKA 1TKXA 1B70B 1CJTA 3IR7B 3I0SB 3EPIA 3S8SA 5I4MA 4DV3F 1QTNB 5IFMA 2HLTA 1FESA 3PR5B 3GYGA 4TY8B 2E7WA 1T3NA 1KONA 3X1LB 1X9WA 1N4LA 2HVDA 3CJ3A 4P7VA 2F8MA 2YX7A 3TO8A 1WG1A 2QLWA 1I94F 3F56A 3HVRA 2PI5A 2HS0A 2H5EA 3A3NB 2WHOA 4KO0B 2IBOA 4K5RA 1LV5A 3TVKA 4UZBA 4DR3J 4X4NA 3MAAB 4BHQA 3M30A 2NXJA 3GSDA 4M5LA 1EKSA 1OYEA 2Y1LB 3UCZP 2QMUB 1TV6B 1NJXA 3ETOA 5LXYA 5DG8A 4FBUA 1OS5A 4NI2A 2NUHA 2WVBA 3IA0A 5B0GA 3IWNC 4DR6J 2VPWB 2RU3A 1M5HA 3K8VA 1E6VA 5GVQA 4CP5A 1R8AA 4IUFA 4ZVTB 3RW7A 3CDEA 2WSFC 2XSJB 5RUBA 2G1HA 4HL9A 3BB5A 4WE1B 3IS9B 4RUHA 5KT2A 5CD4A 2VB6A 3PJXA 3P8BB 3QNWB 1CVJA 3OPKA 4LFCF 3M6XA 5B7WA 2KHCA 3OW2R 3T1YJ 1URRA 1JLAB 2CJAA 3MI7X 5C24B 3GP9A 3TANA 1RCOB 2HWIA 1VQOS 2BW7A 1S6PA 1H74A 3IP0A 2C2MB 2XMUA 5IS2A 4DV4J 1AUDA 3SQOP 2IRXA 4ENOA 5D0RA 3TYTA 3K5LA 2KT3A 5IC6B 1IR1A 2PDAA 3ET6A 1EX8A 2DNGA 2W9BB 4LVNP 2DCUB 3HFZB 2F63A 3QBCA 2BBEA 2VQEF 1H2VZ 5BXIA 4WYWA 2ROPA 2ZUAA 1LW0B 1MMLA 2MJNA 4WTOB 2A2CA 4JV5F 1RTDA 1SJRA 3RB4A 2UXCJ 2OD6A 3TJ8A 5B0BA 2B43A 3CJ2A 2HHTA 2L41A 2BE9B 2RRBA 5GADI 1WOOA 4B02A 3TI0A 4PYDA 2MSTA 2PA8D 2QTWA 1U1PA 5I3QA 3IAS9 2XZWA 4M5GA 3FBBA 2VFRA 1OWXA 1VYAA 1IBLF 5JUMA 3PYEA 3TAMA 2EPIA 1R8PA 4QR1A 3W9IA 1YDLA 2W1BA 2VG5A 2QLFB 1N0VC 5KFIA 2RDIA 1EHWA 3IXQA 2J0SD 3K7RA 2XMJA 4DX7A 1FVSA 3KTQA 1FWKA 3FCHA 2HZAA 3CJ0A 2YKNA 3ZC4A 5IOLA 4LRAA 2PD1A 1M5SA 1BQMB 4DV7F 2QSFA 2L9DA 4LF7F 3D4JA 2HK3A 2CNOB 3MCNA 2J7UA 1N5SA 4M95A 1O0PA 4J9NA 5L9NA 1Y4ZB 3H2LA 2XLKA 1MW7A 1D1UA 2EG1A 3VALA 4TU8A 1TFYA 1CS4A 5F8JA 1JJCB 1NXIA 1DBDA 4YUDA 1R6YA 1GAOA 2HQDA 1UETA 4B9SA 2NLWA 2HZVA 4F36A 2VOPA 4EZ6A 1L3UA 1S79A 2OPPB 4LF2A 4CNZA 2B9EA 2COLA 4ZLLA 2UU9F 1DY3A 5CYQA 3R27A 5DLGA 3L7UA 3BO3A 1O51A 4OJ3A 3ZFVA 1NHVA 1IKVB 1OPZA 3H5XA 1D8ZA 1PCAA 2I5JB 2IMOA 5BYRA 3CTRA 3O44A 4OZ5A 4K8RA 1N33F 1RB0A 2XCAA 1WI8A 4KGXB 2RS8A 2ZM6J 3QWPA 3Q2TC 4JV1A 4C11A 1F5AA 4RW9A 2BX6A 1TK5A 3L4BC 2DT9A 5HBMB 4KIAA 3OL7A 4JI4F 1AFJA 2PEHA 1KSPA 2JJ4D 3U1LA 1JX4A 5J1NA 1ZBTA 2DEIA 2CPEA 3T41A 3OUYA 4C9DA 1GTHA 2O67A 5HO4A 1HHQA 4DQSA 2XMVA 4F4XA 2KZMA 2NUUG 3DI6B 1Y11A 2OPRB 5ITHA 4DV2J 3Q2SC 3J81Y 3ITHB 4O0NA 2D9OA 2ZBPA 1HBUB 4HR2A 5E33A 4UW2A 1GMWA 1CQMA 5C25A 1HKAA 3DCAA 2MHNA 4ZK7M 3BO2A 1REVA 4J90A 2DKOB 3H98A 2APOA 2BA9A 4UUXA 1PJ5A 1HQEA 2ZBCA 1UEUA 3F44A 3MWBA 1Q5YA 5SZTA 5IV4A 2GVDA 4LR7A 1RAJA 1LWEB 5E3PA 3WQPA 3DLBA 2QL9B 3D9BA 2N3LA 3HHLA 4OHYA 3BGRB 1N6QA 3EGVA 2N4CA 3BR9A 2E5IA 5KG3A 1RWMB 1Q95G 4KFBB 1QAXA 3W8GA 2XI2A 3GCXP 2ZWOA 4Q8FA 3BBBA 1QM9A 3N6NA 3HT0A 1RISA 3HXMA 2WOMA 2CJ9A 5HI7A 1QTMA 1S1VA 3CB4A 4Z7YA 4JBCA 2QGFB 4B3OB 2BV3A 2BRLA 1YTYA 3TAPA 2IVFB 3A13A 1IR0A 2BJ1A 3CIMA 1N5YB 3J7YI 3C14A 3OL9A 3I87A 1IBMF 3KLIA 1ZETA 4CLFA 3LTOA 2DGQA 3GSIA 3HVWA 1KVIA 1MROB 2I38A 3H20A 2W01A 2KVIA 1HNIB 1Q0NA 2J8SA 2PFDA 4UTGA 1RAEB 3CJSA 3BGOP 2GC8A 2X1GA 3KG4A 3GB0A 3JTOA 5E3CA 1MNEA 3QJJA 3VF0B 4GVBB 2ZH3A 3SYZA 3CD0A 4J9QA 3CDUA 2CQPA 2PN6A 2CPIA 1Y0HA 3K5OA 2Z56B 4CLYA 3CMES 3SDEA 3DLJA 4Q0BA 1C0UA 2H54B 5C42A 2WVEA 4IQMA 2IMWP 3UO0A 4ID5B 4LRCA 3MEKA 3GIJA 3FMBA 3WX8A 5KG0A 4NXMF 3P5BP 1S9FA 2CJQA 4JP8A 4DU8A 1SKWA 2IM2A 4WK3A 3M8ZA 4XDCA 2EXUA 4IKAA 4CYUB 2HHHF 1SJFA 2CZVC 2D3ZA 2J76E 4AL7A 2DGSA 3NMAA 2XC9A 2AJ1A 4PZVA 4ED3A 2D1CA 4NCGB 2CDRB 2AYBA 4PQAA 2F4VJ 2G13A 1QE1A 3B4MA 4ZPBA 5D8HB 2CJBA 1RZMA 3A8EA 3VVUA 1FKOA 4KY3A 2RF2A 1L3KA 4LF5J 3DC2A 3VAKA 4F25A 2AKWB 1FXDA 2VV5A 1UZDA 1IKYB 2DGVA 2C2RA 1Y10A 4I68A 4OYOA 1BQNB 1ELOA 1GK8A 1FI4A 3DYAA 5DG9A 4MFBB 3PIPQ 1NSPA 2RDJA 4OLOA 3PRBA 3HZEA 1VQ7S 3PO4A 2MMYA 4YDDB 4EBCA 1NDKA 2RQKA 4FZVA 4UY8T 1VLYA 5C7PA 3B4DA 4YMEA 3H5SA 2YKMA 5IM0A 3LO3A 2V8VA 3KLGB 2EFNA 5AE2A 3KHLA 1VLOA 1Z2ZA 2H4YB 1LFPA 4H4OA 3HMJG 2HIQA 3M8QA 4ED6A 3LUYA 2JLFA 3ZTQA 5CYJA 1WHWA 2FLLA 4IFVB 1JLEA 4X4OA 3RR8A 2C1EB 3RJMB 1ZM2A 3AJ2A 1S49A 2GHVC 3JXOA 1J27A 3RBEA 2FLOA 1U0SA 4W92B 1BUXA 4OX8A 2OLWA 2CQ0A 2HQGA 1DLOA 5B0EA 2UUBF 3FSYA 2CXEA 3C6UB 2EC0A 4WU2A 4LF4F 2G0JA 2BE2A 3C15A 3J7A1 4DL2A 2XWYA 2ZH8A 1SL0A 1QSYA 4HDGA 4C8LA 5KG4A 2VFUA 4ZS6A 2V2QA 5KFMA 1RLCL 1M1GA 2JOQA 3HO1A 2VBYA 2ZDOA 1PYOB 2QG9B 2W2NP 1AZSB 3DGVA 4J9KA 2C2KB 1XN9A 2DNKA 2MDAA 3VAIA 4FPIA 5GAEI 2J9EA 4I2PB 3DLEB 3MPVA 5A8KB 1U8SA 4ANCA 4NASA 4ZPCA 1I5OB 4TU7A 3B8HA 1FTRA 2IVYA 3CCJS 1CC8A 5K5MA 2FJWA 4JYAF 1YGYA 2V4JA 3FFIB 2BKPA 2XLIA 1IJEB 2EEYA 3KLEA 1AUSL 1TL5A 2O3DA 4AUKA 3M05A 1S1WA 4H4MB 3MM9B 4NLXA 1NPRA 1JLGA 2MYFA 2ASJA 4HVZA 3CW2C 4IOBA 1T03B 3EXYA 1JLCA 1SL2A 3FNNA 1BGXT 1HWJA 4OV6A 4E8UA 1R8CA 4ID8A 2ZITA 4GC6A 4ZP8A 4JV0A 3D28A 1YVFA 2AU0A 4LBHA 4CO1A 1TKXB 1CJTB 5D3GB 1Y00A 4NLPA 4OIXA 2G4BA 3G6XA 1TUVA 4DDFA 4ZVFA 3PTWA 3DNCA 1YZ6A 3VAHA 4NLSA 1MN7A 2L9NA 1D9DA 1QD1A 4ZVRB 2QT7A 3KJQB 4D3HA 1N5QA 3R7BB 2GHWA 1QAJA 1RYRA 1UPMB 4PCQA 1NDPA 2D9PA 2GQCA 2D7SA 4WFNQ 2A6OA 1YJUA 1YI2S 2D3O1 2PIIA 1XK8A 1SJ4P 2E1AA 4RNOA 3M30B 2KM8C 1BHNA 4KAIA 1XR6A 2F65A 3HF5A 4O3SA 2DGTA 3IN5A 1O8BA 3ZTOA 3DRRB 4ANDA 2FGCA 1S0MA 2RVJA 3RBDA 3N9UC 1RT5B 4Z37A 1E6VB 4X66J 3PEJA 3FK4A 2UUTA 4TYAA 3HKZD 3G86A 2V6AA 1OPIA 2MQNA 4QWAA 2CQDA 5GMEA 3RW6A 1GQEA 5KOWA 1IKWA 5KT3A 3OTCA 5KAKA 4QPXA 1T9XA 3HVTA 4WP8A 2YKOA 4PWUA 2YPYA 5KFJA 4V19X 2RAQA 4NLYA 1Y3KA 3M8PA 4AQYF 4C8KA 1SJ1A 1F1BB 3NGKA 4ECYA 1S6QB 4X64F 5J2PA 3M1VA 5KFVA 2FVRA 3QT6A 4J9VA 4I67A 1S4FA 3ET6B 1A7GE 3ETMA 1FRKA 3EWGA 3DDNA 3OLBA 2CQ1A 4KB7A 2NSBA 4PEOA 1FRJA 3KWMA 1IM4A 1PYTA 3R6LB 2M8HA 4QJVA 3JSBA 2DNOA 3BQ0A 3TUPA 3OVAA 4C7QA 2CA9A 3AD7C 4BBYA 2AJQA 4NA2A 1JJ2R 1S0OA 4RW7A 1HD1A 3G8QA 1WG4A 1NZAA 4ZMMA 1N0UA 4QWDA 3MECA 4BWJA 2FB0A 5ETOA 1B3TA 1VQ9S 2VPXB 3ZTSA 4C3LA 3TA0A 1HBOA 2C2OB 4CH0S 5A8RA 2ZHOA 1S10A 2DHAA 3DMJA 2UVWA 3TAMB 1N52B 4R8UA 1P27B 2VG5B 2YPZA 1HR0F 4CQ1A 1CG2A 2YWWA 3W65A 3EDRB 4PQUA 6FD1A 1KC8T 1LWFA 2DH9A 4IH5A 2AYEA 2LEAA 1K1QA 3B54A 1HWIA 1QAYA 2ZE2A 3KOAA 3CJ4A 4RU2A 1WEXA 3OTDA 3GYNA 2NCKL 3GIRA 2R7OA 1X4AA 1LFWA 1NU4A 2KXHA 5EUHA 2HBQB 2IJRA 3V6DA 1FX4A 4B9TA 4N41A 2PE8A 4RW6B 2AHOB 4C0BA 1FA0A 3R5AA 4B3MF 3CC2S 1EJ7L 4Z7CA 1O6XA 5F3ZA 1LKZA 4QPTA 4LFBF 2RE1A 4FYDA 3TA1A 4DPWA 1UEVA 3TZWA 2FPHX 2BJ8A 2OD4A 3BO4A 3UN5A 3KUEA 3PG9A 4YR3A 3WDOA 1EARA 3GG1A 4X4TA 3JSRA 2CPFA 4QYZJ 1WACA 3GJRB 5ETSA 2E5JA 1XWLA 1VOMA 3UCUP 4ZP7A 5HJYA 4LVOP 1H3DA 1R31A 4X65F 2Y8YA 1KP6A 2AP6A 4RNFA 3T1AA 3P45B 4DPUA 4A4JA 4O23A 4RW9B 1EETA 3RB3A 1FJEB 2Y3YA 2OJ3A 4DBQA 2DNNA 5DG7A 3ZZUA 5KFQA 1X4FA 2PEBA 3MMBA 1RQ0A 2N7YA 2C3UA 3BBFA 3ILIA 1Q86T 4WXOA 3OUYB 5J2NA 4Q45A 2RRAA 2KB2A 3MPYA 4HI1A 1OMSA 2YVSA 3OJSA 4GVLA 1WORA 2FD2A 3LWLA 3I55S 4F7VA 1PIEA 3D6FB 2J9CA 2BR0A 5L9XA 1TFWA 1U2RA 1T9TA 2XGPA 5KFAA 1UL3A 4OI2A 2E1CA 1UFLA 1REVB 3LAMA 1MMNA 5IQQA 4ES1A 1W2IA 1HQEB 3ZTRA 2WVCA 5DZ6A 2X51A 3TQEA 2Z2MA 1KRPA 2HZCA 1VHIA 3T6BA 1Q16B 4XAKA 1U1RA 4WFBQ 4RL1A 4X4SA 4ED7A 2GVDB 4OI3A 3R8YA 5E2QA 1NH8A 3KYLA 2DIVA 3IAM9 3HHLB 2WTFA 3A8IA 1VIOA 1N6QB 3KNAA 3AAWB 3ENVA 2M2BA 4DI6A 3Q8RB 3IWXA 2BQUA 4TKTA 4C97A 4YEAA 3UW1A 3CJTA 3O2IA 5CCMA 1RWWB 4F0HA 2JEFA 3BZQA 4L76A 2Z0GA 1WC5A 2R3VA 4DX6A 1J5EF 2LVWA 2B4VA 5ETVA 3K17A 3CJ8A 5I3UA 3NMRA 2E7XA 3C14B 3PJWA 3SEOA 4NLUA 3KLIB 2LCWA 4PG5A 2OH2A 2KDOA 2LKZA 4DR5F 1U6BA 2DO4A 3BH7B 4DV1J 1KKHA 2E5GA 4CDIA 3BR8A 2YNIB 2I2YA 1HNVA 3C3LA 3KHRA 2MJUA 4RW4B 1FDAA 3NCRA 1PGZA 1WC4A 2OMLA 5IWAJ 1VQPS 1K8AT 1LXNA 3MEGA 1FFGB 9RUBA 1C1CA 3QT5A 4LSLA 4NLOA 1NKEA 5HANA 1CBKA 4DV3J 4LF9F 1X4HA 2IM1A 3IG1B 2YNHA 4Q0BB 1BLUA 1C0UB 1LNQA 4ZIVA 2F5GA 2IDEA 2AJ0A 3DHXA 1D09B 1XMBA 5HQMA 1IKXA 2QLBB 2P5VA 4C8MA 1KTVA 4ECVA 1RT3A 2HKEA 2PMWA 2K06A 4GKJJ 2AEFA 4LF1A 3OHBA 2MTLA 1XR5A 3VCDA 4EWTA 3V4MA 4USKA 3MZIA 4DWIA 3ZNJ1 4DL4A 3AB2B 4KKOB 4C2MA 4K7QA 3UQSA 4Q44A 2QE5A 3EMTA 4TLRA 4LREA 2QA4G 1N34F 1QE1B 8ATCB 7FDRA 1YBAA 1FKOB 2FJEB 1KOOA 3FCVA 2RF2B 2VF3A 4DSJA 4N56A 5E3RA 2P8IA 2KJVA 1SH0A 1R43A 4ZVHA 2P6SA 2AZ1A 1RTIA 3OFHA 3N28A 4NEZA 4K2JA 1U8WA 5KG5A 4MYTA 1Y5IB 4DFKA 1RT2A 1N32F 3R7SB 1I1GA 1TR0A 1N88A 2W2MP 1FE0A 3OR2A 3DYAB 3PY8A 1WNEA 1HFEL 3C6TA 1NM2A 1R0CB 4HI2A 1HA1A 3AOCA 2BOPA 3UWTA 2XMKA 2PMZD 3LPEA 5IM0B 3EM1A 2GJIA 4YHHF 1TQLA 1GMUA 1U26A 1C1BA 3NWGA 4H4OB 4ETZA 3KXDA 1VDHA 5DDRC 3OXFA 5AE1A 5D4PA 3BN7A 2ZKUA 1FT8A 1LW2A 2OTJS 4HTJA 2YWHA 4DQIA 4CZCA 2VQEJ 3AA9A 4ZITA 5H1SV 3W1YC 5L46A 4YN3B 4JV5J 5H9FK 4PXDA 4F3OA 4RNMA 2JEJA 3JYTA 4LUBA 4MK7A 3FRZA 3MM8A 3I5AA 3PYDA 5L1KA 1UJ4A 4F4ZA 4FS1A 1Q7YT 4WIIA 3CCWA 1IBLJ 3TAQA 4PPZA 3DRSA 4YB6A 1U1KA 5HN0A 2VICA 2LQ5A 3BGFA 3M7VA 3ZTPA 2XMWA 1N5TA 4LBPA 2RIJA 4A48A 5KFLA 1G6BA 4AXIA 1FJGJ 5KFUA 2QZ8A 2NXNA 3P6YC 4LF7J 2GMJA 3RUBL 3V2UC 3SSQA 3EPGA 3BSNA 2V4JB 3GWCA 1JNZB 3RYLA 3T5JA 2RQCA 2K1RB 3LGHA 1AW0A 4PRFA 2K2PA 3MHYA 1S1WB 3ISND 5JJBA 4Q43A 3MUMP 2QFJA 1HLWA 1JLGB 2BMBA 3CIZA 2V0NA 1G7CB 3N01A 3BKFA 2BJ7A 3CCES 1JLCB 1S99A 2QJ3A 5DRKA 3ILOA 3R5JB 2KT2A 3NBPA 3CT9A 2VASA 2C2EA 2D3UA 1QUVA 4TYBA 1U1NA 4F4AA 4LQ3A 1AT1B 2YXLA 5J2QB 4W4MA 4DR2J 4QIGA 2VA3A 2OO4A 2HK2A 2GVZA 2ALZA 1VGYA 2GV1A 4R5PA 3MCOA 2O01C 1N33J 4RU9A 1MMDA 2QIFA 4NLQA 5KT6A 1VBXA 1MLAA 4X62J 3TVZA 2ZD1A 2NXEA 4NXNF 3BYRA 3W9JA 2NYHA 4OJ1A 3V81A 3LGNA 4ILLA 1UVKA 4RKUC 1CULA 5AXMA 3L95X 2IJFA 1FWLA 4CLPA 2RJZA 5F3TA 2VQFF 1SKSA 4MKBA 2WVFA 3KUGA 4ZCIA 1XIQA 3GFYA 2M52A 4HHHA 2HQ3A 2ZOMA 3N5FA 2RRNA 1SQGA 1IWAA 2ZH2A 1KD1T 2KH9A 2W25A 2DHSA 3P49B 2GA7A 3JSMA 1VQ6S 1UVIA 4OQJA 1RKJA 2LLZA 3D0HE 3H8YA 1UP1A 3KK1A 1IKWB 4F4WA 2P9GA 3J7YU 3DXBA 1VIXA 4G65A 4USTA 1RKIA 3QGGA 4USJC 3LPYA 5G0RB 3NCPA 4E2FB 4UUWA 1RU1A 3CMQA 1FRHA 3EUNA 3HHKA 3QT8A 5FD1A 2L48A 3CCVS 2UUAF 1SH2A 1XMOF 3EVWA 4DV0F 3TZYA 4R25A 3UDVA 2CWXA 2HRYA 1R6VA 4ZJLA 1WKJA 3OR1A 2RMLA 1PYSB 4K4YA 3WIUA 4EI2A 3LP0A 2MGZB 1Q5VA 1NJWA 2OGUA 4JI6J 1X5OA 3PEHA 1FRIA 3M1VB 3HVAA 4OX9F 2LA4A 5HSPA 4ED2A 4FNHA 2E7VA 1P6TA 1SH3A 4GMKA 2FZGB 1SUQA 3E01A 2HQIA 3PKMA 3CDWA 2ZEJA 4DR7F 2UV8A 4Y65A 2XTJP 3EZUA 2JEGA 5F8IA 1IBMJ 4EGLA 4RW7B 1T8EA 4NRTA 3DLGA 4DUYJ 2CQ3A 3CCQS 3BYPA 3HD2A 3TX8A 1BWEA 3K5MA 1LXJA 4H4KA 3NNAA 5DM7Q 2C2NA 3EZ5A 1KLMA 2VUGA 5A8RB 4CLTA 4ZVGA 3DMJB 2EFQA 3IGVA 1FRLA 4WIQA 3MFIA 2XNRA 4PQUB 2HHUA 3DRPB 4HACB 3PM9A 1N54B 1LWFB 2FHKA 3H5YA 2KHDA 4KV8A 3I6PA 3E2EA 2J0WA 3SQGA 2MY7A 5EDWA 2N7CA 1JK9B 4CCHA 2DR9A 2MKHA 4H54A 5B09A 4DX8H 3V6DB 4KHRA 2CNLB 3IMQJ 3GJTB 3LP2A 2LXIA 2Y0SD 4I7FB 2E1MC 4ZP9A 2HYIB 3FEYB 4JUZA 1RGVA 4A8XA 2V9WA 1JMTA 1N5VA 3R1LA 1S1TA 3VQTA 1HBMB 2Z2YB 2HHHJ 3FRYA 2GO8A 3HSGA 2ZVSA 2HVHA 2BABA 2CAJA 5CCLA 2C28A 2OPQB 3WBZA 4C48A 1U1QA 5A0YA 1KQSR 3NL0A 3DKDA 4NYZA 3R2DJ 2EW9A 4IOCQ 1XC9A 1FXRA 2M0GB 3KJVA 2GAHC 2AWZA 2XWXA 2FHJD 2QL5B 2J8AA 2R7VA 2KXFA 3CCRS 1VBYA 3CNQP 1JLFB 1NKCA 2CVEA 1F9EB 3W8PA 4HKQA 3IC1A 1W2BR 2OKQA 2DHXA 4YDXA 1S0NA 3F73A 4F4KA 1OY6A 3TVYA 5ETNA 3QQCD 1VI7A 5CABA 5G4DA 5HQ8A 2XY5A 4ZHRA 5J2NB 5ADZA 2LQBA 1RT1A 3S6EA 1S7IA 4DV5F 4IOAQ 5LXRA 3RR7A 1FD2A 3KJNB 5AE3A 2HMIA 3O6QA 3IM9A 1S1UA 1N56A 4DZDA 2HNYA 4IG3A 2H65B 1YITS 2P6TA 2AJ4A 2V2KA 1F60B 1MU2A 2W7OA 2DRAA 4ILRA 1FDDA 4X4RA 3OVSA 2GMHA 3PX0A 4U8VA 4A8SA 1XNQF 3J7AN 1GMVA 4URQU 2UVVA 2YY3A 1Y7PA 2CQ2A 1RHQB 1B99A 4NWBA 4XPEA 1P8GA 3LH2S 5I42A 3ICLA 5ETTA 1R0BG 3AODA 5KFBA 4WXWA 1LQ9A 3CJKB 4L75A 4KGVB 4LF4J 2CNKB 1RTZA 1S97A 2KRBA 2I1RA 3CSKA 3KJFB 3AOBA 2VG7B 3TJAA 3EGNA 5HVHA 4UT4A 3AH6A 2CVIA 1YQHA 2DNQA 3O1LA 2VFSA 1YHQS 4KRWA 2Y0BB 2UV8G 5FIIA 3D66A 3FEZA 2Q3PA 2NZ4A 3T1YF 2BJEA 3UCGA 3A3PB 5D4NA 3GV7B 2FGOA 2OEJA 5I3UB 3R7NB 1HW8A 2R8GA 2UXBJ 4HHJA 1VS3A 3BBCA 4JYAJ 3IO1A 4NYOA 3NGDA 5BYQA 2MQMA 4NCAA 5AJ3J 3D0IE 2NREA 3L9ZA 2OPSA 1QVGR 4MK8A 2Z2LA 5J1EA 3J7ZT 1RAOA 1HNVB 2Z2ZA 2DYAA 3MUVP 5KFFA 3KUHA 2A2DA 3FBEA 2VL1A 4RR5A 2B6AA 3MR7A 1Q8LA 4ZVEA 5A6WA 2AX1A 3QGIA 4GRSA 2RQMA 2PI4A 4DG1A 3PHTA 3MEGB 4ZCMA 4MKVA 1WOPA 3C2PA 3G6VA 3S01A 2OFHX 2KU7A 4WFZA 1C1CB 5KG2A 4LSLB 1RCXB 1VQ8S 1G3OA 3HX9A 2RT3A 3DM2A 3GV8B 2YNHB 3R5DA 1CSJA 2OEKA 1VQKS 3CULA 5EX3A 2GQQA 2WSEC 1NO8A 4O4GB 2Z58B 2H5JB 3GR0A 1SV5A 1RT3B 1NKBA 5E41A 5FLXU 4KC5A 1TAUA 1X7VA 3BDEA 3QAUA 2C3MA 4FS2A 2AYGA 1PC4A 2CPJA 5B0FA 4YY3F 5F8LA 4I64A 4CO2A 2HFSA 2C3PA 4ZPWR 1X4DA 1VBKA 4H4KC 1ULRA 2V2ZA 2DR6A 1K1SA 4TY9A 4WWSA 3UNYA 1P9QC 3DLHA 4V19J 3NAIA 1UA1A 3TX0A 6FDRA 4B9UA 3V4IA 5D4OA 3MOJB 2HHSA 4J5OA 1B7FA 4CT8A 1W25A 2AW0A 4M5KA 1R8BA 2ROEA 1QUPA 2WAQD 3KLFB 1SCJB 2GAGC 1RT2B 1TKTA 4USUA 4XTTA 3OR2B 3M32A 5ETRA 1S9EA 3PRDA 2CYYA 1IVZA 2DBBA 1TL7B 3HSJA 3M9MB 4PKDB 2A10A 4YQWA 2OEMA 1J5OA 5HLFA 3H4BA 3D67A 1DTTA 2AMCB 2B3TB 5EWEA 3CC4S 4YFUA 3HHEA 1C1BB 3RB0A 3MR5A 2HVEA 2C2DA 2JFKA 1WI6A 1JXLA 1HMVA 3K58A 3GV5B 3DLLQ 5MLCV 3UVJB 4X2BA 2H9ZA 2X3DA 3VTIA 2WW4A 1T05B 2BKOA 3AXMA 3HK2A 1U4BA 2ZJRQ 5T14A 2KFZA 1W7WA 1RWUA 4USWA 1FEHA 3CE8A 3GJQB 5ETLA 1TMJA 4HTIA 4OZ2A 2V2VA 3JYTB 3MTKA 4EU0A 1Y5LB 3MM8B 3J80Y 4ICLB 1CJKA 3NS5A 2CQGA 3U1MA 3SV4A 3O8WA 4WYLA 2HRUA 3QO9A 2FZKB 2H1YA 1ZAWA 2WZ1A 2XMMA 1EQ0A 4ECTA 3JQJA 4DFPA 2R7QA 2DNLA 3D1OA 1X60A 3K5PA 1ICEB 4PWDA 5KFTA 1KTQA 3DRSB 4IG0A 3LAKA 4CH1A 2BEFA 2DHHA 4IH7A 1EIYB 1ZZNA 1HI0P 5L38A 5FDLA 2SXLA 2VDIA 3RBZA 2WK4A 2YNGA 1OQ3A 1R0AB 4FF4A 3MD3A 3ILJA 2DGUA 2PA3A 2JWNA 2B8PA 3D3BJ 3HFVA 4P7TA 3JAMU 5F41A 2PT0A 2XBPA 3D6TB 1ZYQA 3PW5A 4F4YA 1C2PA 2WONA 4ZJQA 3PR4A 5IZHA 1HHTP 4B3MJ 4YS2A 2E66A 3M2VA 1NBEB 3H2UB 4QBUA 3CC7S 2VDHA 1HI8A 4P75A 2CPYA 2E5LJ 1MN9A 2HS3A 1U09A 4NZ6A 1U7LA 4M5HA 3QFHA 4NL5A 3PRVA 2MXYA 2ABYA 4B08A 2W9CB 1GEHA 4N7TA 1DQ8A 1NCLA 1B0TA 2HVZA 2VFVA 2GVZB 5D4LA 4X65J 5T7LB 2QFIA 1CQNA 2XM3A 3OQ2A 4R5PB 4OZNA 4BCAA 4LFAJ 3I56S 1RSCA 3AQOA 1CLFA 4ANEA 2KYXA 4NA3A 2ZD1B 3C8YA 1KVJA 1HBNB 2EWHA 3MEEA 2X1AA 4WZQA 3QLHA 2JFDA 1SC4B 3HDSA 1NSAA 2DR7A 3A12A 3U02A 2A0FB 5DO2A 2ADBA 2CPXA 1WDDA 4DQRA 2HRTA 4P2SA 4UF4A 4ED0A 4RX6A 3R5CA 5D78A 2WBRA 1I6JA 3QAEA 4Y2MA 3UDCA 3MURP 4IRKA
chains in the Genus database with same CATH topology
1FX2A 4WP3A 2W01A 3C14B 4OYPA 2WZ1A 4WP9A 3MAAB 4USTA 4USUA 2GVZA 3C16B 4OYMA 1YBUA 1YBTA 5IV4A 2GVDA 5D0RA 4CLKA 1CJUB 1WC6A 4CM0A 1TL7B 1CJKB 3ET6A 4NI2B 4USVA 1TL7A 2QV6A 4NI2A 1WC3A 4CLTA 4CLWA 4P2MA 2GVZB 4WPAA 4P2XA 1WC1A 4OYIA 4CLUA 1CJVA 2GVDB 4CLZA 4CM2A 4OYZA 1CULB 3ET6B 4OYWA 1CULA 4P2FA 1WC4A 1CS4B 4CLYA 4CLPA 1CS4A 3C15B 1Y11A 1CJTA 3C15A 1Y10A 1FX4A 1CJVB 4OYOA 1AZSA 5D15A 4OZ3A 3UVJB 1U0HA 3UVJA 4CLSA 3MR7A 5D0EA 4USWA 3G82A 4CLLA 1AB8A 1CJTB 3C14A 5IV3A 1AZSB 3MAAA 1U0HB 3C16A 5D0GA 1WC5A 3R5GA 4OYBA 4OYXA 1YK9A 4OZ2A 4CLFA 4WP8A 5D0HA 1CJUA 1WC0A 1CJKA 4OYAA 2BW7A 3G82B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FX2 A;  4WP3 A;  2W01 A;  3C14 B;  4OYP A;  2WZ1 A;  4WP9 A;  3MAA B;  4UST A;  4USU A;  2GVZ A;  3C16 B;  4OYM A;  1YBU A;  1YBT A;  5IV4 A;  2GVD A;  5D0R A;  4CLK A;  1CJU B;  1WC6 A;  4CM0 A;  1TL7 B;  1CJK B;  3ET6 A;  4NI2 B;  4USV A;  1TL7 A;  2QV6 A;  4NI2 A;  1WC3 A;  4CLT A;  4CLW A;  4P2M A;  2GVZ B;  4WPA A;  4P2X A;  1WC1 A;  4OYI A;  4CLU A;  1CJV A;  2GVD B;  4CLZ A;  4CM2 A;  4OYZ A;  1CUL B;  3ET6 B;  4OYW A;  1CUL A;  4P2F A;  1WC4 A;  1CS4 B;  4CLY A;  4CLP A;  1CS4 A;  3C15 B;  1Y11 A;  1CJT A;  3C15 A;  1Y10 A;  1FX4 A;  1CJV B;  4OYO A;  1AZS A;  5D15 A;  4OZ3 A;  3UVJ B;  1U0H A;  3UVJ A;  4CLS A;  3MR7 A;  5D0E A;  4USW A;  3G82 A;  4CLL A;  1AB8 A;  1CJT B;  3C14 A;  5IV3 A;  1AZS B;  3MAA A;  1U0H B;  3C16 A;  5D0G A;  1WC5 A;  3R5G A;  4OYB A;  4OYX A;  1YK9 A;  4OZ2 A;  4CLF A;  4WP8 A;  5D0H A;  1CJU A;  1WC0 A;  1CJK A;  4OYA A;  2BW7 A;  3G82 B; 
#chains in the Genus database with same CATH topology
 1B7Y B;  3V5R A;  5K8M A;  4FYV B;  2EBG A;  5C2C A;  5ETK A;  3JSM B;  3LP1 B;  2F7V A;  1KFS A;  4QWB A;  4CWB A;  1DFD A;  1LK5 A;  1L3V A;  3BF4 A;  3TWZ A;  2YBV A;  4G1I A;  3HHL D;  3T5H A;  4PYA A;  3KK1 B;  2GS8 A;  3IGN A;  2F4V F;  5LMU J;  1YIJ S;  4LR9 A;  3TW0 A;  1S7H A;  1PJ6 A;  3TUI C;  3AT1 B;  4DL3 A;  5LJ3 Y;  5THW A;  2CZ9 A;  2E1P A;  3FBF A;  2CQ4 A;  4DMZ A;  4AYB D;  4D3G A;  2RUS A;  3CD6 S;  1H7W A;  1U1L A;  1Q81 T;  4C0H A;  4L74 A;  2DK2 A;  3BSO A;  3H40 A;  5F0U A;  5L1I A;  1HI1 A;  4LSZ B;  2CPZ A;  1QVF R;  2ADC A;  3LP0 B;  1HPZ B;  5ETM A;  3MCS A;  5DZ7 A;  4RNH A;  2ERR A;  1VBZ A;  1SC1 B;  4OYB A;  1NRK A;  1UVN A;  2LYV A;  4AXJ A;  1JLA A;  1SUQ B;  5C24 A;  2M70 A;  3E01 B;  2VPZ B;  2M7S A;  3K59 A;  4WP3 A;  2R8I A;  1J5E J;  3VHQ A;  2FIU A;  3OBI A;  3PAC A;  4WKY A;  5CZV A;  3H2V E;  1P1T A;  3DOL A;  4J9U E;  4B3S F;  3OSN A;  1X5T A;  2QV6 A;  4LF6 J;  2W9B A;  2U1A A;  2MKS A;  3TRG A;  3RTV A;  3F41 A;  1TUW A;  2O66 A;  1CPZ A;  1HYS A;  2IBK A;  3UR3 C;  1R27 B;  1ZZF A;  3KNG A;  4J9L A;  4DUZ F;  3D3C J;  3PW0 A;  5K20 B;  4M5J A;  4A8Y A;  2MZJ A;  3D6M B;  5SUH A;  1CC7 A;  3CF5 Q;  3OTB A;  4OZL A;  2ZNZ A;  4QW8 A;  5HL7 Q;  3L7O A;  4LIR A;  1UW9 A;  3ULH A;  3DOK A;  4Y34 A;  5DQG A;  4DX5 A;  4B3T F;  3VVT A;  1U45 A;  1FNM A;  2GIQ A;  1JNR B;  1HNW J;  1ZM3 A;  2Q66 A;  3OLA A;  2EBE A;  3SQG B;  4K4V A;  2MKJ A;  1M0S A;  2RD5 C;  3O3L A;  2ASL A;  3U7J A;  1RE1 B;  4OHV A;  5EN1 A;  2J6T A;  1X4B A;  2VH7 A;  5KFC A;  3SSS A;  3Q8Y A;  3KDN A;  2AGO A;  4K5S A;  3UDL A;  3KG0 A;  2ZH4 A;  2VOO A;  3LP2 B;  4PR6 A;  5JXS A;  2V68 A;  3KLV A;  2DY9 A;  1EB0 A;  3I0R B;  3GMG A;  3PJ9 A;  5HRO A;  2G2Y A;  1U6Z A;  1S1T B;  1TL1 A;  2RB7 A;  2HEK A;  1AA1 B;  5E3A A;  3ZZR A;  1PAU B;  1IBK F;  4OYI A;  2BOA A;  3R5B A;  1NUE A;  2JNJ A;  2DXE A;  1TKZ B;  4LRB A;  2V5H G;  2AGQ A;  3MMA A;  5IT9 Y;  4OV1 A;  5A0Y B;  2JLE A;  3KJV B;  1YJV A;  4P52 A;  1RYS A;  4F3M A;  4OL8 A;  1TMM A;  1IBC B;  4I2Q A;  4KQZ A;  3MED A;  5H9F J;  4J9O A;  4KH0 B;  3G82 A;  3L09 A;  5KFW A;  1N36 J;  2YWK A;  4NZ7 A;  2IRY A;  3HHN B;  2MPU A;  4DN0 A;  2M8D B;  5J2M B;  5FJ4 A;  1R3N A;  5T41 A;  1SC3 B;  2XS2 A;  4L3N A;  4RW8 A;  1T9Y A;  4AFF A;  5HJX A;  7FD1 A;  3IFE A;  4ZHR B;  2WB1 D;  3LAL A;  4KPY A;  3FMW A;  1RWN B;  4RZR A;  2HND A;  3KK2 B;  1RT1 B;  5HMX A;  4MJK A;  3RRG A;  5LOQ A;  1JB0 C;  1WC3 A;  4ECS A;  4CIO A;  3GIM A;  2HMI B;  1NHK L;  1S1U B;  4YHH J;  1HNZ J;  1FCA A;  3KHG A;  1T95 A;  3MAQ A;  2HNY B;  4IG3 B;  2W7P A;  4A8O A;  2HS4 A;  4F0K A;  2IRU A;  4UOH A;  2HHW A;  4X4P A;  1MU2 B;  5IXU A;  4WZM A;  2VPY B;  1PSD A;  4OZ3 A;  5DQH A;  4Z2X A;  4LJM A;  2E9R X;  1TTH B;  1KOH A;  2E5H A;  5I42 B;  2DRD A;  1A6L A;  3KDO A;  1VQL S;  3TEG A;  1JIH A;  2VG6 A;  5L8R C;  4KPC A;  4FP9 A;  5E0O A;  4YR0 A;  4P71 A;  3MR6 A;  5K8O A;  2LQ9 A;  1SQE A;  5B0A A;  4O3O A;  3ELH A;  4HHU A;  2HQF A;  1UZH A;  1FX2 A;  1DHM A;  1WHY A;  2GX8 A;  1VQ5 S;  2XZT B;  3SSR A;  2JDJ A;  3CDA A;  3N0V A;  5U47 A;  2XGQ A;  4DFM A;  5JVG Q;  3BPD A;  2WVD A;  1LWE A;  1C0T A;  5M2P A;  9ATC B;  3OXG A;  1TAQ A;  1ZS6 A;  2KTQ A;  4Y2I A;  4QQB A;  4KSE B;  1LWC B;  4ECQ A;  1UFW A;  2IYG A;  4RO0 A;  3BGR A;  4EBE A;  1UFK A;  2B0G A;  4L3K A;  3FQK A;  4ETX A;  2OAU A;  4KFB A;  4RWW A;  1U2C A;  1RWV B;  2DR5 A;  4B3R F;  3CWJ A;  4USH A;  3M2U A;  2CKW A;  2XNQ A;  2FVP A;  2QEX S;  5E5N A;  3JQM A;  4M94 A;  4TU9 A;  2XYG B;  2CAD A;  2ZWP A;  3QSY B;  1RXO B;  5J1E B;  4CLL A;  3JQK A;  2HFU A;  3R5G A;  4KJI A;  1FWP A;  3FSI A;  4GKK F;  3AXK A;  3BRE A;  4EFA C;  3PKY A;  5DET A;  1VFJ A;  4DG1 B;  3HLU A;  1D9F A;  4WP9 A;  1KFD A;  1HNI A;  5K8N A;  4AD6 A;  3KLH A;  4PG6 A;  3GFX A;  1YJ7 A;  1V6H A;  4OI0 A;  4QR2 A;  1YRX A;  2QRR A;  2VKR A;  5EHH A;  5KFX A;  1YJN S;  3R9L A;  3K0J A;  3TEH B;  3KHH A;  1Q7L B;  1NJI T;  1HL6 A;  3Q23 A;  4JI3 F;  3G8S A;  5LT5 A;  4ZPT R;  4DLE A;  3POT A;  4KGK A;  3Q86 A;  4IRD A;  3EX7 B;  4OHX A;  3ISZ A;  1I3O B;  2MZ1 A;  1D8Y A;  1HW9 A;  1NDL A;  2J7W A;  4R0J A;  4K4Z A;  3CJ5 A;  1TL3 A;  5DDP C;  1K9M T;  1Y5N B;  4KHP J;  3BGU A;  4YB1 P;  4PG7 A;  3J81 U;  3IR5 B;  3NGU A;  4DF4 A;  5KG7 A;  4JI8 F;  2HQC A;  2O5D A;  2K3K A;  2M5Y A;  1SKR A;  1JLB B;  1NK9 A;  1S1X B;  2ZJP Q;  3DU5 A;  4ZA1 A;  4IDK B;  2DNH A;  2CIM A;  2WBM A;  3VGV A;  2IM3 A;  1U02 A;  3I4H X;  1PO6 A;  1CJU A;  2VA2 A;  1JKH A;  2VFT A;  3HHD A;  2LQJ A;  1RT4 A;  1UKU A;  5CZX A;  2ZH5 A;  3SCK E;  4QIV A;  5C2G A;  4RWX A;  1WG5 A;  1UTA A;  2LDY A;  3VQS A;  3ZZY A;  2RS2 A;  3HFK A;  2AEM A;  1RTJ A;  1ZTW A;  4RUC A;  4DS5 A;  4K2X A;  2ZC3 A;  5A8W A;  1ARO P;  2KO1 A;  1TKT B;  2FZC B;  4J7C A;  4QU6 A;  2HPU A;  2ZJQ Q;  4ZN3 A;  1CJV A;  2FDN A;  3BKT A;  1NK7 A;  3MPW A;  4DV0 J;  3DLK B;  4JI5 J;  4JI1 F;  4ZLP A;  3MMC A;  2KRR A;  2R4F A;  4GO7 X;  4FXV A;  3I31 A;  4NLR A;  4U96 A;  2ATL A;  1J5O B;  2UUC F;  1DTT B;  3NG8 A;  2QYC A;  2YKA A;  1G1X A;  2BJ3 A;  1H98 A;  5F8H A;  3LGM A;  4FYX B;  2IJN A;  5CAA A;  4RPF A;  2FHJ A;  3G71 S;  2MLX A;  5BYS A;  1GX5 A;  2HHV A;  3EDQ B;  3PW4 A;  3V6H A;  1JJ4 A;  4WCE Q;  1M90 T;  3MF5 A;  1F3F A;  3PO5 A;  1FJC A;  1VRU A;  3T19 A;  5KT7 A;  4IFY A;  4URG A;  2CQB A;  1TP7 A;  5JVH Q;  1DQA A;  4DXL A;  2KFY A;  1CJK B;  3NNC A;  2R42 A;  1OSC A;  3QT7 A;  1HQU A;  3GR1 A;  2XY6 A;  4A47 A;  3PW7 A;  2KT5 A;  2V63 A;  2KKH A;  1K73 T;  1URN A;  4RBV A;  4RLE A;  3ISN C;  2V8H A;  3DOM B;  2HVI A;  3SBM A;  3Q8V A;  1V3R A;  4PWD B;  1X31 C;  1D3W A;  5DLF A;  4IG0 B;  4ZOS A;  2MKK A;  4QOT A;  8AT1 B;  4KTQ A;  2KXN B;  3N4W A;  2C42 A;  4ZDN A;  3HJV A;  4C8N A;  1HWK A;  3BEG B;  4QZV B;  2MZQ A;  4YB5 A;  1VR6 A;  1E6Y A;  3UN2 A;  2YNG B;  1KS2 A;  1UCN A;  3G6Y A;  3FCW A;  4BS2 A;  5CHC B;  3PIO Q;  2E44 A;  3J81 j;  3TQ1 A;  3AD8 C;  2WON B;  1Q82 T;  2XCP A;  3NNH A;  4I2P A;  3C66 A;  4K0K F;  1UEK A;  1GXL A;  3A1Y G;  3M2V B;  4GO5 X;  5F8N A;  1UVM A;  4NI2 B;  2FLN A;  4USV A;  2EK6 A;  3PDN A;  4UQG A;  3VAJ A;  4OJH A;  5LL6 d;  1VHF A;  4ZCK A;  4DV1 F;  4OI4 A;  3BS9 A;  2D41 A;  2NXU A;  2BKN A;  3PXG a;  2RQ4 A;  2I9S A;  4ILM A;  4H4M A;  3MM9 A;  3QGP A;  1QJH A;  4ELV A;  4OHZ A;  3KK3 A;  2I6W A;  3DU6 A;  2B7B B;  3K2Y A;  3JS9 A;  2D3O R;  3QGH A;  2J7K A;  3AD9 C;  2KFN A;  1Q78 A;  1RT7 A;  2JEI A;  1SQF A;  1T94 A;  3VGS A;  5IV3 A;  5LMN J;  3NKY A;  2HBR B;  3MEE B;  5D3G A;  2BE7 D;  2V69 A;  3QLH B;  3ADA C;  3DXS X;  1YLX A;  4G1Q A;  3NWR A;  1IUJ A;  1S6P B;  3ZZT A;  1TL4 A;  3D68 A;  4DR1 F;  3IRX A;  1U6F A;  4OYP A;  2HWT A;  2WRM A;  4DV5 J;  2XUL A;  1I51 B;  2B4U A;  2KN4 A;  2RKI A;  4A8F A;  1RLD A;  3CJQ A;  4GKJ F;  3ZZZ A;  3WZ0 A;  2YX4 A;  4LIW A;  1K47 A;  1HWU A;  3HUL A;  3D2W A;  1PJ7 A;  2IFX A;  5F0W A;  1RTD B;  4Y2K A;  2MLZ A;  2R7S A;  1U1M A;  2B8Q A;  2BRK A;  4QCL A;  3N6M A;  3DRR A;  1XNQ J;  3PVX A;  2MQO A;  2IHR 1;  5BR8 J;  1FHT A;  2CG8 A;  1RT5 A;  1QY7 A;  1OJ4 A;  4C4W A;  4MIW A;  2ZH1 A;  4FXW A;  4PUO A;  5D0E A;  1U24 A;  2CG4 A;  1WDT A;  3QWU A;  2EFO A;  3MCM A;  2HUR A;  3OTE A;  2QLJ B;  4ECU A;  3AQP A;  2BM0 A;  2FJA B;  1S9G A;  2GQ2 A;  2J5A A;  4DR4 J;  4ERD A;  4C98 A;  3GCW P;  2DNY A;  2F8H A;  2N82 B;  5B0C A;  4YB7 A;  2AT1 B;  3T9Z A;  1VQY A;  5MAO A;  1JQG A;  4O44 A;  2YKN B;  2G1D A;  2AYM A;  2EI5 A;  2ZVI A;  3DGP A;  4OZ0 A;  2BQR A;  4G3I A;  2PGC A;  2HGN A;  4USM A;  1S6Q A;  2IIH A;  1H0H B;  4CLU A;  2GW8 A;  3DOL B;  1SXL A;  2DR8 A;  4UZC A;  3GQC A;  2XEX A;  4P2F A;  3Q89 A;  4AL6 A;  4DL5 A;  1CS4 B;  3GYX B;  2JC1 A;  1XQI A;  2B5J A;  4QIW D;  1U0H A;  1RAI B;  3QIP A;  2X1B A;  1HYS B;  2DNP A;  3QZ7 A;  2CJX B;  3JTP A;  3MM7 A;  4L73 A;  2B9Y A;  1RT6 A;  4I1T A;  1S72 S;  4O3P A;  1FJ7 A;  1RHU B;  2KG1 A;  3GII A;  1UMJ A;  5CXT A;  2ZBR A;  5CYQ B;  3DOK B;  2M3D A;  2OUG A;  3K89 A;  4OYX A;  2Q1L A;  1ZA1 B;  2BAC A;  4EMD A;  1S59 A;  3CXC R;  5KFZ A;  2NXC A;  4MT1 A;  1H73 A;  4ATN A;  1S57 A;  4ZPV R;  3MM5 A;  3AY0 A;  2OI2 A;  4C11 B;  1VQS A;  1NPK A;  3AHP A;  3LOU A;  5GAG U;  3FVY A;  4DUT A;  5IC4 B;  1UVJ A;  3CO0 P;  2MLY A;  3M8S A;  3HZG A;  4DSE A;  3CJR A;  4OLP A;  3A4T A;  2FJX A;  3LAN A;  1VCT A;  1FJG F;  1Q1K A;  3RAX A;  3NOC A;  4IH6 A;  5HRO B;  1SVD A;  1TL1 B;  3T6J A;  4YY3 J;  4U67 Q;  1GXU A;  4ZP6 A;  3G8T A;  4B17 A;  4RJV A;  1HNX J;  1YSJ A;  4RW6 A;  2V8P A;  4IQX A;  4ECW A;  2GO9 A;  4J91 A;  2IYI A;  3MMA B;  5C25 B;  2OMO A;  3OHA A;  2GCF A;  4M5D A;  2QLX A;  2JVR A;  4UQT A;  1NB2 A;  1RTH A;  4PPD A;  1KQK A;  2V8D A;  2ASY A;  4I2Q B;  3MED B;  4OYA A;  4IR9 A;  3G82 B;  2P9E A;  5E3Q A;  4I0W A;  1RAC B;  2RHS B;  1WJ9 A;  4JI2 F;  1YBT A;  2FJB B;  4P6Q A;  4DR2 F;  1NH7 A;  2JC0 A;  2CPD A;  5KFP A;  4TNO A;  4RW8 B;  2IAJ A;  4RBT A;  2RDD A;  4ELT A;  4TN2 A;  1TK8 A;  4X62 F;  2HND B;  4X4Q A;  2PMH A;  3PFE A;  2WOM B;  4U8Y A;  1S1V B;  3ENW A;  3OXL A;  2AQ4 A;  4ALZ A;  3CO9 A;  4DLG A;  3NLC A;  3HPO A;  3QAT A;  2L3M A;  1BWV A;  1IN0 A;  3NS6 A;  1XMQ F;  4K4X A;  2R2R A;  3NRB A;  2AEJ A;  3BSA A;  1AB8 A;  1ITP A;  4PXE A;  2OHD A;  4G1P A;  2KM8 B;  2F1F A;  2UP1 A;  3WHI A;  1Q79 A;  4F50 A;  2VG6 B;  5F8G A;  5KT5 A;  4NA1 A;  5H9E K;  1GH8 A;  1X0F A;  4EK2 A;  4FKX A;  1VQM S;  3EGZ A;  1MSW D;  5DGA A;  3M6V A;  2R2U A;  3R3T A;  3SMZ A;  1D9A A;  2HGL A;  1FE4 A;  3SV3 A;  1K44 A;  4P2X A;  3GJS B;  1JXE A;  1QLN A;  4FXD A;  2B9W A;  3T5L A;  2F4F A;  3T1H J;  1RA7 A;  1C0T B;  3T9N A;  1YWX A;  4OYW A;  3H90 A;  2Q6B A;  1BQX A;  3W62 A;  1UA0 A;  2JX2 A;  3SDE B;  4NOH A;  3QFW A;  4ZLN A;  1KDN A;  2JVO A;  5C42 B;  2MZR A;  4W98 A;  4JI6 F;  5LSR A;  1Q8B A;  4F8R A;  1I94 J;  2R8K A;  2EVZ A;  3V6J A;  2KJW A;  1NJY A;  4N77 A;  2B4P A;  2Z8Q A;  4LF8 F;  4YOE A;  4ES2 A;  3MXH P;  3M2U B;  3AOA A;  4WFA Q;  3D1H A;  3J7Z 5;  3W9H A;  4MIA A;  3CCL S;  3I5C A;  4WBF A;  1IJF B;  4L72 B;  1SL1 A;  1VQN S;  3RGI A;  3FGV A;  2R7W A;  2DGW A;  1UJ5 A;  4JI7 F;  1M5O C;  5HQL A;  1S6U A;  1XJW B;  2BZ2 A;  1DTQ A;  4DUY F;  4Y0F A;  1WF1 A;  1RWX B;  3QMQ A;  2B51 A;  2FC8 A;  3MGJ A;  2ASD A;  2YNI A;  3KLH B;  4F04 B;  2PSZ A;  1JLQ A;  4DJB A;  1UVL A;  4M63 A;  2HW3 A;  1ZOT A;  5IQ6 A;  2FLP A;  4DQQ A;  4RW4 A;  3Q8S B;  4OFZ A;  2F40 A;  1GX6 A;  4DSL A;  2VON A;  4ZKA A;  5DJB A;  3CCM S;  2MSS A;  2X3G A;  4DSK A;  2UXD F;  4K4S A;  3POT B;  3CUN A;  3PW2 A;  1ZAX A;  2V9K A;  4OZ1 A;  2JH3 A;  4DFJ A;  3OJU A;  3W64 A;  1UWA A;  4LFC J;  3PYF A;  3OD2 A;  4FF2 A;  2DXD A;  1SJQ A;  5I3P A;  2YKQ A;  4WFY A;  1RBL A;  2ZBQ A;  3IG1 A;  2LEB A;  4NX9 A;  4NCB A;  3WIV A;  1TL3 B;  1B64 A;  2YKM B;  2E29 A;  2ZZN A;  4CH7 A;  2JHE A;  4DEZ A;  3BQ1 A;  1Q8K A;  4CNY A;  5GAH U;  5KFO A;  2GNK A;  3M8Q B;  1EP4 A;  4DZ6 A;  1RWK B;  4DQP A;  4IR1 A;  3GFZ A;  2JL9 A;  1FFW B;  5D6G A;  1CJU B;  1ZTT A;  1JLE B;  1JKH B;  3DDK A;  1GXT A;  2DNZ A;  3BN4 A;  1AYE A;  1RT4 B;  4KKO A;  3VZI A;  2ZHA A;  5A2Q Y;  1GFW B;  1JXV A;  4DU7 A;  3QZ8 A;  2ACY A;  4QWE A;  3FKB A;  1RI7 A;  3TA2 A;  3MPD A;  1KQG B;  1LEO A;  1DLO B;  5AXL A;  1RTJ B;  3L7P A;  4DV6 F;  5A8W B;  4ZLJ A;  5M2U A;  4ED5 A;  1BY9 A;  4DL7 A;  1TKD A;  2BE2 B;  3C15 B;  1CJV B;  1RAA B;  3F0N A;  5EGY A;  2J9D A;  3MMC B;  2DJW A;  3GTY X;  1APS A;  2DH7 A;  1S4E A;  3MDF A;  4ZVQ B;  4M5I A;  5EWF A;  3CCS S;  1VIS A;  3UI3 A;  4KH1 B;  2VD3 A;  1M5P C;  1U1O A;  3I9Z A;  4QR0 A;  2XO7 A;  4NEY A;  2HHP A;  1YK9 A;  1KNZ A;  1J2V A;  2VBZ A;  2HHQ A;  1KN6 A;  5DQI A;  2GJ2 A;  4MKY A;  1U2F A;  3LWM A;  4JI0 F;  4DHV A;  1RP5 A;  1NB7 A;  3G4S S;  4DV7 J;  2DIS A;  4FNI A;  4OJG A;  1VC5 A;  4FF3 A;  5HP1 A;  4C8Z A;  3OL6 A;  4I6Y A;  2E1R A;  1FRM A;  1VRU B;  1FER A;  2HBZ B;  5ETP A;  4N76 A;  4IFY B;  3JB9 k;  3RZA A;  3KLE B;  4B3S J;  3BSC A;  3OTO F;  3PV8 A;  4OI1 A;  3W60 A;  4MAK A;  4KR0 B;  4UOG A;  1LWX A;  2BYC A;  1HQU B;  2D74 B;  2C3Y A;  2DTJ A;  3EIC A;  4DUZ J;  1IQZ A;  3D54 A;  3S1T A;  5F8M A;  2FJD B;  1YKW A;  5IT4 A;  2UU9 J;  2N3O A;  1SBR A;  1W26 A;  4B3T J;  1XER A;  2YWG A;  2LP4 A;  3CMA S;  1E6Y B;  4MTP A;  2XYP B;  3GG0 A;  2ACM A;  4U6P A;  2K8G A;  4DSI A;  1TVR A;  2A6M A;  3SXL A;  4S0M A;  4JI4 J;  3W63 A;  4P73 A;  3PCO B;  2YTC A;  2CQC A;  4WTY A;  3I9V 9;  1RUS A;  2OP5 A;  4P2M A;  4WPA A;  3IBF B;  3PZP A;  4N5S A;  3RAQ A;  3ZZ0 A;  2UXB F;  1IBK J;  3MD1 A;  2DNR A;  5AJ3 F;  1X9M A;  4DOZ A;  2K1R A;  3UD5 A;  1VJW A;  1NAQ A;  3TOQ A;  4BWM A;  1YRT A;  1RAG B;  3H7H B;  1O5J A;  4WFX A;  1Y9O A;  3KK3 B;  1H2U X;  5CA5 A;  6AT1 B;  4DPT A;  3C16 A;  5KFE A;  5D0G A;  4B9M A;  2OFG X;  3G9C A;  3HVT B;  2VOD A;  5AT1 B;  1JJH A;  4X4U A;  4AT1 B;  4M1K A;  1MWZ A;  3HHL C;  2PC6 A;  4QYR A;  1RT7 B;  5J2Q A;  3PX6 A;  2QA4 S;  1S5Z A;  1NLK L;  2F9D A;  3M8P B;  2LXF A;  4ED1 A;  4C3K A;  1DUR A;  4G1Q B;  1XTZ A;  1IQT A;  3DDI A;  2HFN A;  1KHW A;  4ZVP B;  2Q79 A;  2XQC A;  2QN6 B;  4F02 A;  4HEA 9;  3IRX B;  4G6V B;  1F5B A;  1NK0 A;  5J2P B;  4Y2C A;  3N5B A;  3L3C A;  2DO0 A;  5KFG A;  4ZIW A;  2RKI B;  4EZ9 A;  1F3V A;  3K8W A;  4ECR A;  3DN9 A;  3IR6 B;  2FY1 A;  3Q22 A;  2W8L A;  2K3I A;  3PX4 A;  4U9R A;  3ZZO A;  4NYP A;  4PXC A;  4DSF A;  5A2Q U;  1V5V A;  3PFO A;  4N8N A;  5LM7 E;  5J1P A;  2MQL A;  1T9V A;  4OX7 A;  1NND A;  4BDP A;  4IRC A;  3MEC B;  3PYG A;  2U2F A;  1G4C A;  3FUY A;  4C3M A;  1YJT A;  2J0Q D;  3IBC B;  4PUO B;  3THP A;  4XK8 C;  1FD8 A;  3M9N B;  1HBO B;  3NGT A;  1PAE X;  1X4G A;  4CRJ A;  4O3Q A;  4R8U B;  1S9G B;  2WB4 A;  5G0R A;  1EQM A;  2G0I A;  4R0E A;  3LA0 A;  3AJ1 A;  2HNZ A;  1WOS A;  2H5I B;  1B0V A;  1DAX A;  1DAR A;  1FKP A;  2DIT A;  3Q8U A;  3PNI A;  4O44 B;  2UZA A;  1WSV A;  5HVF A;  2H48 B;  1XNR F;  2ZE2 B;  5CD4 H;  4AL5 A;  1A0O B;  2YNF A;  3DGP B;  1HAR A;  2GJF A;  5KFR A;  3AFG A;  1T9W A;  2H51 B;  2C2Z B;  2MGZ A;  4K50 A;  4FVC A;  4MIB A;  3TAR A;  3ZO7 A;  1FDN A;  2G2Z A;  4CLS A;  3M8R A;  3DRY A;  1NHU A;  3VZH A;  4ES3 A;  4B3R J;  3H5U A;  4NXM J;  2ZZT A;  2B4O A;  1YG0 A;  2C22 A;  2IPO B;  1M1H A;  2LXU A;  4K4T A;  2B5J B;  1U0H B;  3QIP B;  2E9T A;  5F9L A;  2W7A A;  3FSX A;  3GIL A;  5HK4 A;  3MM7 B;  1RT6 B;  1Z1Z A;  3WC2 A;  3RU0 A;  3SCI E;  4OZJ A;  1G2E A;  3TP2 A;  4QIF A;  4URS A;  2QMW A;  4TQR A;  4GKK J;  4ZCL A;  2XZD B;  4Q7A A;  3QJL A;  1X5P A;  1CEZ A;  2J9D E;  1DRZ A;  1TZ0 A;  4CM0 A;  2KL8 A;  5K8P A;  2IM0 A;  3US5 A;  2FVC A;  1BMQ B;  3MM5 B;  2O1P A;  3M2R A;  1SB6 A;  3T5K A;  1EET B;  3HSD A;  3B78 A;  2FY8 A;  4JI3 J;  1YZ7 A;  2XLJ A;  4M5N A;  2IC3 A;  1H6K X;  4DN9 A;  3MMB B;  3DRP A;  4HAC A;  2CQI A;  1L3T A;  1SI9 A;  1HQ2 A;  1SPB P;  1F5C A;  5KFN A;  2ZOG A;  1NEE A;  3K57 A;  4HYK A;  1LOU A;  3T3F A;  2W2P P;  1FNO A;  3OVB A;  3M6U A;  2MQP A;  3PHE A;  2HWH A;  4ITS A;  2P2C B;  4JI8 J;  4DR3 F;  3EZO A;  4HH1 A;  1OIA A;  5DM6 Q;  5D0H A;  2GGP A;  4I7F A;  2X1F A;  1YX2 A;  2MEW A;  3VAM A;  1U48 A;  4U7C A;  2WSC C;  3EJM A;  4M5M A;  2VHG A;  1WEY A;  1HBM A;  3P4U B;  1ACM B;  4M5D B;  2Q43 A;  3CED A;  3RBX A;  1RTH B;  4OMF G;  2E5L F;  4FPR A;  2AGP A;  1PBA A;  4DR6 F;  1NPP A;  2CPH A;  2QC3 A;  3OL8 A;  3FBC A;  4A8Q A;  1RBO B;  3NCQ A;  4NLW A;  4CO0 A;  3FDS A;  2ZC4 A;  2RNE A;  2OPQ A;  2KI2 A;  3I96 A;  1B0P A;  2OEL A;  1QSL A;  3TR5 A;  1KHV A;  4P72 A;  4CLZ A;  3A3O B;  3TZX A;  2UUB J;  1T02 A;  1K0V A;  1P1L A;  4DCP B;  5F9N A;  4TQS A;  2R8H A;  1F9F A;  2IAJ B;  4A46 A;  4LFA F;  3HD1 A;  1JLF A;  4JI1 J;  2DCL A;  5D15 A;  3A8K A;  2ROG A;  2MKC A;  3EVO A;  5B0D A;  4USI A;  3CGI A;  2Y9H A;  3OV7 A;  4RUB A;  2UUC J;  3WC0 A;  4FDF A;  2NR0 A;  3ZXW A;  1BE4 A;  3VV2 B;  1OYD A;  3BPS P;  2POK A;  1Q4R A;  1DZ5 A;  1YRU A;  4ZVU B;  4A8M P;  2ZBI A;  2F9J A;  4DV4 F;  2J6U A;  1TUG B;  3MMJ A;  4ELU A;  1RK8 A;  2B56 A;  4ZN1 A;  3H59 A;  2XI3 A;  3MM6 A;  2DB1 A;  4OYM A;  1QDU B;  2ZUG A;  5IT0 A;  5HAT A;  4GC7 A;  1F2G A;  2BXJ A;  2AIR B;  2LDI A;  5M2R A;  2HHX A;  2LQ8 A;  2RH3 A;  1KLN A;  2AZ3 A;  2D69 A;  5E7O B;  3TUZ C;  1WUU A;  5GMD A;  2XY7 A;  2MB0 B;  2UXC F;  2B9X A;  2VJU A;  3VAF A;  4XPC A;  3EVM A;  5LMU F;  4U95 A;  1ZA2 B;  5HVG A;  2VKZ G;  4TVA B;  2EKY A;  4C8Y A;  1Z4U A;  3W2V A;  1KVK A;  1C4C A;  1FTC A;  3A8J A;  3DRX A;  3CJK A;  4QW9 A;  3VWS A;  4NZ0 A;  2K7K A;  2R9L A;  2FHO B;  2OSR A;  2VG7 A;  5KTQ A;  2NS1 B;  2W2Q P;  8RUC A;  4O3N A;  1S12 A;  3P3D A;  4TLQ A;  3CCU S;  1KEK A;  1IKX B;  1L3S A;  2XMA A;  4XIU A;  1RHJ B;  2DD8 S;  3W2W A;  1FVQ A;  1T3O A;  2LEC A;  1N8R T;  3H4D A;  2W24 A;  3ENQ A;  1F0X A;  2EKN A;  1TU0 B;  3U1N A;  5A76 A;  3NS7 B;  4K0K J;  2IVM A;  3E3X A;  2CRL A;  1U49 A;  1R7I A;  3HI9 A;  2CNN B;  3THV A;  4YR2 A;  1VK8 A;  1S76 D;  1H7X A;  3JSY A;  4LF6 F;  2BAN A;  4FBT A;  2RSQ A;  5KFK A;  1DTQ B;  2YX1 A;  2HFZ A;  2YQ3 A;  1ZM9 A;  3HKW A;  4CO5 A;  3HM9 A;  4EBD A;  1A9N B;  4DPY A;  2ZHB A;  1RWO B;  4MKA A;  5HMW A;  4A8K A;  4OX6 A;  1FRX A;  2R7T A;  1JLQ B;  5GAG I;  1RTI B;  4DF8 A;  4Y6I A;  5CYM A;  2XO6 A;  4LMZ A;  5CH7 B;  3W66 A;  2GZO A;  3BJY A;  4Q2L A;  4DCO B;  2DY1 A;  1VRQ C;  1FFS B;  1HNW F;  3IBW A;  3MR3 A;  2EFG A;  1PIL A;  4UY8 5;  4CTA A;  2ZM6 F;  3C6T B;  3QRR A;  4CO3 A;  1PC5 A;  4AQY J;  1Q8I A;  5BJR A;  3FC9 A;  2GFF A;  2W4C A;  1T11 A;  3FQL A;  4DR1 J;  4X64 J;  1RBA A;  2DGX A;  2FJV A;  4O4G A;  2M4M A;  1Y3J A;  4NRU A;  1EP4 B;  2HGM A;  5ETQ A;  3THT A;  2NZC A;  3W5Z A;  3Q0A A;  4F2R A;  2ZOF A;  3DHW C;  1LW2 B;  1WTB A;  4QU7 A;  1LK7 A;  3Q8Q B;  4XDD A;  4DV2 F;  4NML A;  2DNM A;  4MK9 A;  3W5Y A;  2F3J A;  3B6B A;  2XS5 A;  3C19 A;  2OIH A;  4K4W A;  2KYZ A;  2XSF A;  2XHC A;  2Z30 B;  2AJ2 A;  5KFH A;  4FKY A;  2R2S A;  2JSX A;  1UW4 A;  2J0X A;  1NDC A;  3KG1 A;  1F2H A;  1BXN A;  3GE9 A;  5K14 A;  2IA6 A;  3K5N A;  2W2O P;  2ZH7 A;  1N36 F;  1DJ0 A;  1UWB A;  3BKU A;  3KLF A;  3O5T B;  1HR0 J;  1VMB A;  3HT3 A;  1FO1 A;  4FF1 A;  2HIY A;  4EO8 A;  5GAD U;  2QYG A;  2CDQ A;  4CLK A;  3R6G B;  1V9O A;  2HG4 A;  2M88 A;  1TL7 A;  5KG1 A;  2XHW A;  4U7U D;  4PAB A;  3EGW B;  4LSN A;  3QSI A;  5HP1 B;  5A6P A;  1WHV A;  2IA0 A;  2FYX A;  3NOG A;  4Y28 C;  1WHX A;  1HNZ F;  3IWL A;  2R8J A;  1WKL A;  1GNK A;  1FKA F;  2BJD A;  3MTJ A;  1S0V A;  4EEY A;  4HT7 A;  3MAH A;  1IXK A;  5KG6 A;  4V1A k;  5LJ5 Y;  4ZPA A;  3UVJ A;  1IR2 A;  4LFB J;  2FVQ A;  4FYW B;  4LBI A;  4PWW A;  2R2T A;  2DXF A;  1R8H A;  1T05 A;  3HCX A;  2GHP A;  1SJ3 P;  2A1B A;  1VK3 A;  3MR2 A;  4HDH A;  3WX4 A;  2A18 A;  3R2C J;  3Q8P B;  3NBP B;  2YH1 A;  1D0E A;  3CPW R;  4KGM A;  4Y00 A;  1VRT A;  1B4S A;  2G2O A;  1H72 C;  2FVS A;  2CFX A;  4ICL A;  2ZZM A;  1ZH5 A;  3UFC X;  2QMX A;  5LSL A;  3MPU B;  1C4A A;  5EWG A;  2QA2 A;  1HIY A;  3U27 A;  1WC6 A;  5L1L A;  1VJQ A;  2MZT A;  5L1J A;  1FK9 A;  1TVR B;  2NQP A;  1FXL A;  1WC1 A;  2R7X A;  3I0S A;  3M4X A;  3V81 B;  3QRP A;  1CUL B;  3H25 A;  4TY8 A;  1QSS A;  1GMW D;  1WKK A;  1R0A A;  4J9P A;  3KKF A;  2UVU A;  1FNX H;  2EFV A;  5HAO A;  3FJ2 A;  2YWE A;  2F8E X;  3VGT A;  1X4E A;  4WU3 A;  4KO0 A;  4N8O A;  2Y1I A;  3QYY A;  3SCJ E;  4OHW A;  2Z4P A;  3QRQ A;  1S77 D;  4OI6 A;  3UN3 A;  2DEJ A;  1WD6 A;  3AJD A;  2MQ8 A;  2LEP A;  3I5B A;  1OQ6 A;  3MAA A;  4ED8 A;  2G0C A;  4ZPD A;  2ALY B;  2LU1 A;  2MHE A;  3CCZ A;  3D5M A;  1M5V C;  3SI8 A;  3LF0 A;  1TV6 A;  3GON A;  2NYI A;  1FDB A;  2X7I A;  2ZDP A;  4O3R A;  4PAA A;  3C16 B;  1YBU A;  1S6O A;  2PO4 A;  1H38 A;  3HSZ A;  1MG7 A;  5H9E J;  4KE5 A;  4ZJO A;  1WEL A;  4F2S A;  4LF5 F;  2W9C A;  4JI2 J;  3ONQ A;  3UE2 A;  4RNN A;  2HSE B;  4CT9 A;  2W4D A;  5T7L A;  2XSJ A;  1WF2 A;  4CM2 A;  2CQH A;  3OR1 B;  2HFO A;  2N4D A;  2V4R A;  2E9Z A;  3NGS A;  5GAH I;  4E0D A;  4WE1 A;  3IS9 A;  2W8K A;  4EUV A;  3I82 A;  1SIZ A;  5EX0 A;  2QSW A;  1V5I B;  1SIW B;  1HBN A;  3TUJ C;  3RG6 A;  5HMY A;  4FN5 A;  3KMS A;  4PG4 A;  1S48 A;  2YQ1 A;  4I6W A;  4DPO A;  4LT6 A;  1F9H A;  5JMN A;  4KHP F;  3Q83 A;  2LMI A;  1ROF A;  4MYU A;  2V67 A;  4I6A A;  1XMQ J;  3I32 A;  4P9S A;  3KMQ A;  3G2X A;  4X84 A;  3W3S A;  2CZ4 A;  3J80 U;  1KR4 A;  3DLG B;  3EE3 A;  3CD5 A;  4DR5 J;  1RAH B;  2Z57 B;  3GLJ A;  4IO1 A;  2FQQ B;  5K9F A;  4NLT A;  3LP1 A;  1PBU A;  2ZFH A;  2FC9 A;  1KLM B;  1LW0 A;  1T0T V;  1EKR A;  2QX0 A;  4C6A A;  4CLW A;  5KT4 A;  2V8G A;  4LRD A;  1P9Y A;  1T9U A;  1F6T A;  1AFI A;  5KOX A;  3MOZ A;  4LR8 A;  2HNZ B;  1FKP B;  1L5U A;  1RAB B;  1AXQ A;  4KV8 B;  3AB4 B;  4JI5 F;  2VC0 A;  3NP5 A;  4NE9 C;  4NPO A;  1OY9 A;  2YNF B;  1RHM B;  4LF9 J;  3S7R A;  2NSC A;  3UPF A;  4K59 A;  2Y8W A;  2RUG A;  1U47 A;  3N79 A;  1HPZ A;  3UD4 P;  3UNG C;  1X0P A;  3FEX B;  1WF0 A;  1Z2L A;  1BQM A;  3B82 A;  2CJK A;  1RDR A;  4LF8 J;  4Q8E A;  2DHG A;  2HLU A;  2NPF A;  2KZZ A;  1NME B;  3GIK A;  3BM7 A;  3NY0 A;  3W5X A;  4RUA A;  5HMZ A;  3OFF A;  3VR1 A;  2CJY B;  1N34 J;  4JI7 J;  4AE5 A;  2YQ0 A;  5LSO A;  2JZ5 A;  4HLB A;  3R97 A;  3V6K A;  2A3J A;  5DS7 A;  1KBR A;  2DRB A;  1RJJ A;  2ZH9 A;  2G9O A;  4F26 A;  2OPP A;  3M2R B;  4I56 A;  1VC0 A;  5AXN A;  1NK4 A;  2RU9 A;  4C0O C;  1N32 J;  2FTR A;  2UXD J;  2IC3 B;  1NK6 A;  1IKV A;  2I5J A;  4DL0 C;  2QA1 A;  2HBY B;  3CDB A;  4B9L A;  3QID A;  1NJZ A;  2IDL A;  2MKI A;  4FYY B;  4NLG A;  4IO9 Q;  2YWF A;  5HBM A;  2B7C B;  2KVQ E;  4N47 A;  3UDE A;  2EC2 A;  1REG X;  2BJ9 A;  2GGP B;  3HP6 A;  2QO3 A;  5FLX Y;  3I0R A;  1RWP B;  4MMO A;  4PXB A;  4HH0 A;  3DI6 A;  2OPR A;  4OYZ A;  4UOC A;  3ITH A;  3LQV A;  4X66 F;  3RB6 A;  1HBU A;  4WJB A;  1TKZ A;  2UVR A;  3D0G E;  4CI0 B;  2XS7 A;  2DPI A;  4XO0 A;  2AX0 A;  4DV6 J;  3RAM A;  2MKY A;  2XB2 D;  1YJR A;  3TJ9 A;  4IYQ A;  2DVI A;  1Q53 A;  5L39 A;  4EYH B;  3G6E S;  3UD3 P;  3SZ2 A;  4ECX A;  1BC6 A;  2CUY A;  4E98 A;  4KT0 C;  3JTN A;  5LMN F;  5J2M A;  5DDQ C;  2ILY A;  3QJP A;  1MWQ A;  1PKU A;  1HD0 A;  4LRF A;  4QWC A;  2L08 A;  2J6S A;  2WW8 A;  1MWY A;  3LW5 C;  1GTE A;  3CCT A;  4P74 A;  4JI0 J;  5DDO C;  3KK2 A;  4KBI A;  2KG0 A;  4WK1 A;  3BV8 A;  4NLV A;  5GMK a;  3MM6 B;  3IRW P;  4ZVS B;  2VJV A;  5KFY A;  3CD7 A;  2Y1J A;  1TEL A;  2M9K A;  3I4P A;  1R89 A;  2OPS B;  2VIH A;  4B3O A;  1TK0 A;  3RRK A;  1VQ4 S;  2EFP A;  3OTO J;  5GAE U;  4HT5 A;  5C5J A;  1N5Y A;  2H4W B;  2XYH B;  2B6A B;  4J9S A;  2PFF B;  5BR8 F;  2H3E B;  3NEK A;  4O4R A;  1NZ8 A;  2BQ3 A;  1MRO A;  4RBU A;  2AF6 A;  4B9V A;  5CQG A;  3W2V B;  1IM6 A;  4F3Q A;  1VC6 A;  1WC0 A;  4MH8 A;  3SIP B;  3DM2 B;  3BH6 B;  5AXK A;  2MY8 A;  3OFG A;  4DR4 F;  3P96 A;  3MUT P;  3W61 A;  4KYZ A;  2BM1 A;  4GVB A;  5B08 A;  2XG8 A;  4X4V A;  3Q24 A;  2RIL A;  2HFV A;  1SV5 B;  4CO4 A;  4DCJ B;  4NXN J;  1IWG A;  1DQ9 A;  1SKU B;  1HHS A;  4O0I A;  3W2W B;  2W4P A;  1T7P A;  4NLD A;  5KFD A;  1WWH A;  1U25 A;  3G96 A;  2HAF A;  5D77 A;  1XBW A;  1LWC A;  2R7R A;  1RAF B;  4DL6 A;  2VQF J;  2IY5 B;  3P5T L;  4ID5 A;  2Y1R I;  3M6W A;  4Y2A A;  2JRS A;  5KFS A;  1BD6 A;  5IT9 U;  1FEE A;  1OO0 B;  2R7U A;  4A8W A;  2HAI A;  1XR7 A;  2Q6C A;  3M8W A;  2BAN B;  2YH0 A;  1WSR A;  3OT9 A;  3JAM Y;  2DIU A;  2OSQ A;  1UAW A;  3OSP A;  3V4I B;  2OTL S;  4CYU A;  4W90 B;  1M5K C;  2VBX A;  2DH8 A;  3NGR A;  1YJW S;  2FUG 9;  4NCG A;  3E51 A;  3VGU A;  2WCX A;  1GT8 A;  5CYM B;  1NK5 A;  1QAI A;  3OFE A;  1XEZ A;  4M8L A;  1EZZ B;  1OSD A;  3FZ2 A;  3M32 B;  2UUA J;  1UPP A;  1S9E B;  4JOU A;  3QPI A;  3UR0 A;  1XMO J;  2LA6 A;  3H42 A;  3VAG A;  4ZVO B;  2VU5 A;  3ZNU A;  2QL7 B;  4CTA B;  1ZPV A;  1M1K T;  1RU2 A;  2ATC B;  4K4U A;  4Y3C A;  1IKY A;  5HLF B;  1BQN A;  3AA8 A;  3R1H A;  4P10 A;  2K7J A;  1ZAV A;  3SFG A;  4MFB A;  1ZPW X;  4OX9 J;  1PG5 B;  1N48 A;  4Q2M A;  1ZM4 A;  4Q5V A;  4PG8 A;  1HMV B;  2MZS A;  3FZB A;  2I0X A;  4B9N A;  2GML A;  3EXC X;  4QIE A;  3DFE A;  1NK8 A;  4BC7 A;  3KLG A;  4WKR A;  1V3S A;  2XMT A;  2RHQ B;  4DR7 J;  1HNX F;  2LFV A;  1JLB A;  1S1X A;  2BVZ A;  4IDK A;  2ZH6 A;  3E8O A;  2V94 A;  4QYZ K;  5DGB A;  4IFV A;  1JWW A;  4J37 A;  2LU2 A;  1X5S A;  2V34 A;  4KGZ B;  3D7S B;  3QO9 B;  4KHM A;  3RRH A;  2DPJ A;  1FF2 A;  2JLG A;  1HWL A;  2ZNY A;  3ZZP A;  3W7B A;  3EYZ A;  1UJ6 A;  4DPX A;  2VZ9 A;  5K14 B;  3NXZ A;  2V50 A;  3X3U A;  3N6L A;  4F0M A;  2AD9 A;  3ENA A;  1UWB B;  4I69 A;  2VBW A;  2C3O A;  2MQQ A;  1WTF A;  2VC1 A;  3C6U A;  4U7U K;  1RHK B;  1NSQ A;  2BDP A;  5FDL B;  4TXS A;  4ER8 A;  2ILZ A;  2V4Q A;  3BQ2 A;  3DLK A;  4JV2 A;  1YJ9 S;  2AJF E;  2L9W A;  4EYI B;  7AT1 B;  3TNV A;  1KWM A;  3BDP A;  1XNR J;  2BW2 A;  3SCL E;  1NSK L;  4LSN B;  4NMX A;  1AZS A;  2EK1 A;  3GZ7 A;  4C8O A;  4J9R A;  1K0T A;  3GFH A;  4UOF A;  1SC6 A;  4DS4 A;  4LQ9 A;  4L6V 3;  4JB8 B;  1OY8 A;  3DLE A;  5A8K A;  3GPA A;  4BC9 A;  1RAD B;  3IM8 A;  1X4C A;  2YKP A;  3GU0 A;  4EO6 A;  4I4B A;  4F67 A;  2GIF A;  2ZKT A;  2I8E A;  4BLG A;  3FFI A;  3SFU A;  4ED4 A;  3NAH A;  4ECZ A;  1X9S A;  4J9M A;  4FVM A;  1RHR B;  1EAY C;  3TZZ A;  3H0P A;  1VRT B;  2CWK A;  1KQF B;  3D1Q A;  4YP3 A;  2NPI A;  1H2T Z;  3MFH A;  1WEZ A;  2BUN A;  2P9C A;  3BGL A;  1T03 A;  1V3Z A;  2EG2 A;  3KFW X;  5IWA F;  4WF9 Q;  3M9O B;  2AV5 A;  3DOM A;  1RA6 A;  3HJF A;  2DGO A;  3D6H B;  3M8Y A;  3G87 A;  2UUW A;  3ILL A;  2W9A A;  2GIR A;  1FK9 B;  1X8D A;  2FHM A;  3T1H F;  3C46 A;  3CVK A;  1TKX A;  1B70 B;  1CJT A;  3IR7 B;  3I0S B;  3EPI A;  3S8S A;  5I4M A;  4DV3 F;  1QTN B;  5IFM A;  2HLT A;  1FES A;  3PR5 B;  3GYG A;  4TY8 B;  2E7W A;  1T3N A;  1KON A;  3X1L B;  1X9W A;  1N4L A;  2HVD A;  3CJ3 A;  4P7V A;  2F8M A;  2YX7 A;  3TO8 A;  1WG1 A;  2QLW A;  1I94 F;  3F56 A;  3HVR A;  2PI5 A;  2HS0 A;  2H5E A;  3A3N B;  2WHO A;  4KO0 B;  2IBO A;  4K5R A;  1LV5 A;  3TVK A;  4UZB A;  4DR3 J;  4X4N A;  3MAA B;  4BHQ A;  3M30 A;  2NXJ A;  3GSD A;  4M5L A;  1EKS A;  1OYE A;  2Y1L B;  3UCZ P;  2QMU B;  1TV6 B;  1NJX A;  3ETO A;  5LXY A;  5DG8 A;  4FBU A;  1OS5 A;  4NI2 A;  2NUH A;  2WVB A;  3IA0 A;  5B0G A;  3IWN C;  4DR6 J;  2VPW B;  2RU3 A;  1M5H A;  3K8V A;  1E6V A;  5GVQ A;  4CP5 A;  1R8A A;  4IUF A;  4ZVT B;  3RW7 A;  3CDE A;  2WSF C;  2XSJ B;  5RUB A;  2G1H A;  4HL9 A;  3BB5 A;  4WE1 B;  3IS9 B;  4RUH A;  5KT2 A;  5CD4 A;  2VB6 A;  3PJX A;  3P8B B;  3QNW B;  1CVJ A;  3OPK A;  4LFC F;  3M6X A;  5B7W A;  2KHC A;  3OW2 R;  3T1Y J;  1URR A;  1JLA B;  2CJA A;  3MI7 X;  5C24 B;  3GP9 A;  3TAN A;  1RCO B;  2HWI A;  1VQO S;  2BW7 A;  1S6P A;  1H74 A;  3IP0 A;  2C2M B;  2XMU A;  5IS2 A;  4DV4 J;  1AUD A;  3SQO P;  2IRX A;  4ENO A;  5D0R A;  3TYT A;  3K5L A;  2KT3 A;  5IC6 B;  1IR1 A;  2PDA A;  3ET6 A;  1EX8 A;  2DNG A;  2W9B B;  4LVN P;  2DCU B;  3HFZ B;  2F63 A;  3QBC A;  2BBE A;  2VQE F;  1H2V Z;  5BXI A;  4WYW A;  2ROP A;  2ZUA A;  1LW0 B;  1MML A;  2MJN A;  4WTO B;  2A2C A;  4JV5 F;  1RTD A;  1SJR A;  3RB4 A;  2UXC J;  2OD6 A;  3TJ8 A;  5B0B A;  2B43 A;  3CJ2 A;  2HHT A;  2L41 A;  2BE9 B;  2RRB A;  5GAD I;  1WOO A;  4B02 A;  3TI0 A;  4PYD A;  2MST A;  2PA8 D;  2QTW A;  1U1P A;  5I3Q A;  3IAS 9;  2XZW A;  4M5G A;  3FBB A;  2VFR A;  1OWX A;  1VYA A;  1IBL F;  5JUM A;  3PYE A;  3TAM A;  2EPI A;  1R8P A;  4QR1 A;  3W9I A;  1YDL A;  2W1B A;  2VG5 A;  2QLF B;  1N0V C;  5KFI A;  2RDI A;  1EHW A;  3IXQ A;  2J0S D;  3K7R A;  2XMJ A;  4DX7 A;  1FVS A;  3KTQ A;  1FWK A;  3FCH A;  2HZA A;  3CJ0 A;  2YKN A;  3ZC4 A;  5IOL A;  4LRA A;  2PD1 A;  1M5S A;  1BQM B;  4DV7 F;  2QSF A;  2L9D A;  4LF7 F;  3D4J A;  2HK3 A;  2CNO B;  3MCN A;  2J7U A;  1N5S A;  4M95 A;  1O0P A;  4J9N A;  5L9N A;  1Y4Z B;  3H2L A;  2XLK A;  1MW7 A;  1D1U A;  2EG1 A;  3VAL A;  4TU8 A;  1TFY A;  1CS4 A;  5F8J A;  1JJC B;  1NXI A;  1DBD A;  4YUD A;  1R6Y A;  1GAO A;  2HQD A;  1UET A;  4B9S A;  2NLW A;  2HZV A;  4F36 A;  2VOP A;  4EZ6 A;  1L3U A;  1S79 A;  2OPP B;  4LF2 A;  4CNZ A;  2B9E A;  2COL A;  4ZLL A;  2UU9 F;  1DY3 A;  5CYQ A;  3R27 A;  5DLG A;  3L7U A;  3BO3 A;  1O51 A;  4OJ3 A;  3ZFV A;  1NHV A;  1IKV B;  1OPZ A;  3H5X A;  1D8Z A;  1PCA A;  2I5J B;  2IMO A;  5BYR A;  3CTR A;  3O44 A;  4OZ5 A;  4K8R A;  1N33 F;  1RB0 A;  2XCA A;  1WI8 A;  4KGX B;  2RS8 A;  2ZM6 J;  3QWP A;  3Q2T C;  4JV1 A;  4C11 A;  1F5A A;  4RW9 A;  2BX6 A;  1TK5 A;  3L4B C;  2DT9 A;  5HBM B;  4KIA A;  3OL7 A;  4JI4 F;  1AFJ A;  2PEH A;  1KSP A;  2JJ4 D;  3U1L A;  1JX4 A;  5J1N A;  1ZBT A;  2DEI A;  2CPE A;  3T41 A;  3OUY A;  4C9D A;  1GTH A;  2O67 A;  5HO4 A;  1HHQ A;  4DQS A;  2XMV A;  4F4X A;  2KZM A;  2NUU G;  3DI6 B;  1Y11 A;  2OPR B;  5ITH A;  4DV2 J;  3Q2S C;  3J81 Y;  3ITH B;  4O0N A;  2D9O A;  2ZBP A;  1HBU B;  4HR2 A;  5E33 A;  4UW2 A;  1GMW A;  1CQM A;  5C25 A;  1HKA A;  3DCA A;  2MHN A;  4ZK7 M;  3BO2 A;  1REV A;  4J90 A;  2DKO B;  3H98 A;  2APO A;  2BA9 A;  4UUX A;  1PJ5 A;  1HQE A;  2ZBC A;  1UEU A;  3F44 A;  3MWB A;  1Q5Y A;  5SZT A;  5IV4 A;  2GVD A;  4LR7 A;  1RAJ A;  1LWE B;  5E3P A;  3WQP A;  3DLB A;  2QL9 B;  3D9B A;  2N3L A;  3HHL A;  4OHY A;  3BGR B;  1N6Q A;  3EGV A;  2N4C A;  3BR9 A;  2E5I A;  5KG3 A;  1RWM B;  1Q95 G;  4KFB B;  1QAX A;  3W8G A;  2XI2 A;  3GCX P;  2ZWO A;  4Q8F A;  3BBB A;  1QM9 A;  3N6N A;  3HT0 A;  1RIS A;  3HXM A;  2WOM A;  2CJ9 A;  5HI7 A;  1QTM A;  1S1V A;  3CB4 A;  4Z7Y A;  4JBC A;  2QGF B;  4B3O B;  2BV3 A;  2BRL A;  1YTY A;  3TAP A;  2IVF B;  3A13 A;  1IR0 A;  2BJ1 A;  3CIM A;  1N5Y B;  3J7Y I;  3C14 A;  3OL9 A;  3I87 A;  1IBM F;  3KLI A;  1ZET A;  4CLF A;  3LTO A;  2DGQ A;  3GSI A;  3HVW A;  1KVI A;  1MRO B;  2I38 A;  3H20 A;  2W01 A;  2KVI A;  1HNI B;  1Q0N A;  2J8S A;  2PFD A;  4UTG A;  1RAE B;  3CJS A;  3BGO P;  2GC8 A;  2X1G A;  3KG4 A;  3GB0 A;  3JTO A;  5E3C A;  1MNE A;  3QJJ A;  3VF0 B;  4GVB B;  2ZH3 A;  3SYZ A;  3CD0 A;  4J9Q A;  3CDU A;  2CQP A;  2PN6 A;  2CPI A;  1Y0H A;  3K5O A;  2Z56 B;  4CLY A;  3CME S;  3SDE A;  3DLJ A;  4Q0B A;  1C0U A;  2H54 B;  5C42 A;  2WVE A;  4IQM A;  2IMW P;  3UO0 A;  4ID5 B;  4LRC A;  3MEK A;  3GIJ A;  3FMB A;  3WX8 A;  5KG0 A;  4NXM F;  3P5B P;  1S9F A;  2CJQ A;  4JP8 A;  4DU8 A;  1SKW A;  2IM2 A;  4WK3 A;  3M8Z A;  4XDC A;  2EXU A;  4IKA A;  4CYU B;  2HHH F;  1SJF A;  2CZV C;  2D3Z A;  2J76 E;  4AL7 A;  2DGS A;  3NMA A;  2XC9 A;  2AJ1 A;  4PZV A;  4ED3 A;  2D1C A;  4NCG B;  2CDR B;  2AYB A;  4PQA A;  2F4V J;  2G13 A;  1QE1 A;  3B4M A;  4ZPB A;  5D8H B;  2CJB A;  1RZM A;  3A8E A;  3VVU A;  1FKO A;  4KY3 A;  2RF2 A;  1L3K A;  4LF5 J;  3DC2 A;  3VAK A;  4F25 A;  2AKW B;  1FXD A;  2VV5 A;  1UZD A;  1IKY B;  2DGV A;  2C2R A;  1Y10 A;  4I68 A;  4OYO A;  1BQN B;  1ELO A;  1GK8 A;  1FI4 A;  3DYA A;  5DG9 A;  4MFB B;  3PIP Q;  1NSP A;  2RDJ A;  4OLO A;  3PRB A;  3HZE A;  1VQ7 S;  3PO4 A;  2MMY A;  4YDD B;  4EBC A;  1NDK A;  2RQK A;  4FZV A;  4UY8 T;  1VLY A;  5C7P A;  3B4D A;  4YME A;  3H5S A;  2YKM A;  5IM0 A;  3LO3 A;  2V8V A;  3KLG B;  2EFN A;  5AE2 A;  3KHL A;  1VLO A;  1Z2Z A;  2H4Y B;  1LFP A;  4H4O A;  3HMJ G;  2HIQ A;  3M8Q A;  4ED6 A;  3LUY A;  2JLF A;  3ZTQ A;  5CYJ A;  1WHW A;  2FLL A;  4IFV B;  1JLE A;  4X4O A;  3RR8 A;  2C1E B;  3RJM B;  1ZM2 A;  3AJ2 A;  1S49 A;  2GHV C;  3JXO A;  1J27 A;  3RBE A;  2FLO A;  1U0S A;  4W92 B;  1BUX A;  4OX8 A;  2OLW A;  2CQ0 A;  2HQG A;  1DLO A;  5B0E A;  2UUB F;  3FSY A;  2CXE A;  3C6U B;  2EC0 A;  4WU2 A;  4LF4 F;  2G0J A;  2BE2 A;  3C15 A;  3J7A 1;  4DL2 A;  2XWY A;  2ZH8 A;  1SL0 A;  1QSY A;  4HDG A;  4C8L A;  5KG4 A;  2VFU A;  4ZS6 A;  2V2Q A;  5KFM A;  1RLC L;  1M1G A;  2JOQ A;  3HO1 A;  2VBY A;  2ZDO A;  1PYO B;  2QG9 B;  2W2N P;  1AZS B;  3DGV A;  4J9K A;  2C2K B;  1XN9 A;  2DNK A;  2MDA A;  3VAI A;  4FPI A;  5GAE I;  2J9E A;  4I2P B;  3DLE B;  3MPV A;  5A8K B;  1U8S A;  4ANC A;  4NAS A;  4ZPC A;  1I5O B;  4TU7 A;  3B8H A;  1FTR A;  2IVY A;  3CCJ S;  1CC8 A;  5K5M A;  2FJW A;  4JYA F;  1YGY A;  2V4J A;  3FFI B;  2BKP A;  2XLI A;  1IJE B;  2EEY A;  3KLE A;  1AUS L;  1TL5 A;  2O3D A;  4AUK A;  3M05 A;  1S1W A;  4H4M B;  3MM9 B;  4NLX A;  1NPR A;  1JLG A;  2MYF A;  2ASJ A;  4HVZ A;  3CW2 C;  4IOB A;  1T03 B;  3EXY A;  1JLC A;  1SL2 A;  3FNN A;  1BGX T;  1HWJ A;  4OV6 A;  4E8U A;  1R8C A;  4ID8 A;  2ZIT A;  4GC6 A;  4ZP8 A;  4JV0 A;  3D28 A;  1YVF A;  2AU0 A;  4LBH A;  4CO1 A;  1TKX B;  1CJT B;  5D3G B;  1Y00 A;  4NLP A;  4OIX A;  2G4B A;  3G6X A;  1TUV A;  4DDF A;  4ZVF A;  3PTW A;  3DNC A;  1YZ6 A;  3VAH A;  4NLS A;  1MN7 A;  2L9N A;  1D9D A;  1QD1 A;  4ZVR B;  2QT7 A;  3KJQ B;  4D3H A;  1N5Q A;  3R7B B;  2GHW A;  1QAJ A;  1RYR A;  1UPM B;  4PCQ A;  1NDP A;  2D9P A;  2GQC A;  2D7S A;  4WFN Q;  2A6O A;  1YJU A;  1YI2 S;  2D3O 1;  2PII A;  1XK8 A;  1SJ4 P;  2E1A A;  4RNO A;  3M30 B;  2KM8 C;  1BHN A;  4KAI A;  1XR6 A;  2F65 A;  3HF5 A;  4O3S A;  2DGT A;  3IN5 A;  1O8B A;  3ZTO A;  3DRR B;  4AND A;  2FGC A;  1S0M A;  2RVJ A;  3RBD A;  3N9U C;  1RT5 B;  4Z37 A;  1E6V B;  4X66 J;  3PEJ A;  3FK4 A;  2UUT A;  4TYA A;  3HKZ D;  3G86 A;  2V6A A;  1OPI A;  2MQN A;  4QWA A;  2CQD A;  5GME A;  3RW6 A;  1GQE A;  5KOW A;  1IKW A;  5KT3 A;  3OTC A;  5KAK A;  4QPX A;  1T9X A;  3HVT A;  4WP8 A;  2YKO A;  4PWU A;  2YPY A;  5KFJ A;  4V19 X;  2RAQ A;  4NLY A;  1Y3K A;  3M8P A;  4AQY F;  4C8K A;  1SJ1 A;  1F1B B;  3NGK A;  4ECY A;  1S6Q B;  4X64 F;  5J2P A;  3M1V A;  5KFV A;  2FVR A;  3QT6 A;  4J9V A;  4I67 A;  1S4F A;  3ET6 B;  1A7G E;  3ETM A;  1FRK A;  3EWG A;  3DDN A;  3OLB A;  2CQ1 A;  4KB7 A;  2NSB A;  4PEO A;  1FRJ A;  3KWM A;  1IM4 A;  1PYT A;  3R6L B;  2M8H A;  4QJV A;  3JSB A;  2DNO A;  3BQ0 A;  3TUP A;  3OVA A;  4C7Q A;  2CA9 A;  3AD7 C;  4BBY A;  2AJQ A;  4NA2 A;  1JJ2 R;  1S0O A;  4RW7 A;  1HD1 A;  3G8Q A;  1WG4 A;  1NZA A;  4ZMM A;  1N0U A;  4QWD A;  3MEC A;  4BWJ A;  2FB0 A;  5ETO A;  1B3T A;  1VQ9 S;  2VPX B;  3ZTS A;  4C3L A;  3TA0 A;  1HBO A;  2C2O B;  4CH0 S;  5A8R A;  2ZHO A;  1S10 A;  2DHA A;  3DMJ A;  2UVW A;  3TAM B;  1N52 B;  4R8U A;  1P27 B;  2VG5 B;  2YPZ A;  1HR0 F;  4CQ1 A;  1CG2 A;  2YWW A;  3W65 A;  3EDR B;  4PQU A;  6FD1 A;  1KC8 T;  1LWF A;  2DH9 A;  4IH5 A;  2AYE A;  2LEA A;  1K1Q A;  3B54 A;  1HWI A;  1QAY A;  2ZE2 A;  3KOA A;  3CJ4 A;  4RU2 A;  1WEX A;  3OTD A;  3GYN A;  2NCK L;  3GIR A;  2R7O A;  1X4A A;  1LFW A;  1NU4 A;  2KXH A;  5EUH A;  2HBQ B;  2IJR A;  3V6D A;  1FX4 A;  4B9T A;  4N41 A;  2PE8 A;  4RW6 B;  2AHO B;  4C0B A;  1FA0 A;  3R5A A;  4B3M F;  3CC2 S;  1EJ7 L;  4Z7C A;  1O6X A;  5F3Z A;  1LKZ A;  4QPT A;  4LFB F;  2RE1 A;  4FYD A;  3TA1 A;  4DPW A;  1UEV A;  3TZW A;  2FPH X;  2BJ8 A;  2OD4 A;  3BO4 A;  3UN5 A;  3KUE A;  3PG9 A;  4YR3 A;  3WDO A;  1EAR A;  3GG1 A;  4X4T A;  3JSR A;  2CPF A;  4QYZ J;  1WAC A;  3GJR B;  5ETS A;  2E5J A;  1XWL A;  1VOM A;  3UCU P;  4ZP7 A;  5HJY A;  4LVO P;  1H3D A;  1R31 A;  4X65 F;  2Y8Y A;  1KP6 A;  2AP6 A;  4RNF A;  3T1A A;  3P45 B;  4DPU A;  4A4J A;  4O23 A;  4RW9 B;  1EET A;  3RB3 A;  1FJE B;  2Y3Y A;  2OJ3 A;  4DBQ A;  2DNN A;  5DG7 A;  3ZZU A;  5KFQ A;  1X4F A;  2PEB A;  3MMB A;  1RQ0 A;  2N7Y A;  2C3U A;  3BBF A;  3ILI A;  1Q86 T;  4WXO A;  3OUY B;  5J2N A;  4Q45 A;  2RRA A;  2KB2 A;  3MPY A;  4HI1 A;  1OMS A;  2YVS A;  3OJS A;  4GVL A;  1WOR A;  2FD2 A;  3LWL A;  3I55 S;  4F7V A;  1PIE A;  3D6F B;  2J9C A;  2BR0 A;  5L9X A;  1TFW A;  1U2R A;  1T9T A;  2XGP A;  5KFA A;  1UL3 A;  4OI2 A;  2E1C A;  1UFL A;  1REV B;  3LAM A;  1MMN A;  5IQQ A;  4ES1 A;  1W2I A;  1HQE B;  3ZTR A;  2WVC A;  5DZ6 A;  2X51 A;  3TQE A;  2Z2M A;  1KRP A;  2HZC A;  1VHI A;  3T6B A;  1Q16 B;  4XAK A;  1U1R A;  4WFB Q;  4RL1 A;  4X4S A;  4ED7 A;  2GVD B;  4OI3 A;  3R8Y A;  5E2Q A;  1NH8 A;  3KYL A;  2DIV A;  3IAM 9;  3HHL B;  2WTF A;  3A8I A;  1VIO A;  1N6Q B;  3KNA A;  3AAW B;  3ENV A;  2M2B A;  4DI6 A;  3Q8R B;  3IWX A;  2BQU A;  4TKT A;  4C97 A;  4YEA A;  3UW1 A;  3CJT A;  3O2I A;  5CCM A;  1RWW B;  4F0H A;  2JEF A;  3BZQ A;  4L76 A;  2Z0G A;  1WC5 A;  2R3V A;  4DX6 A;  1J5E F;  2LVW A;  2B4V A;  5ETV A;  3K17 A;  3CJ8 A;  5I3U A;  3NMR A;  2E7X A;  3C14 B;  3PJW A;  3SEO A;  4NLU A;  3KLI B;  2LCW A;  4PG5 A;  2OH2 A;  2KDO A;  2LKZ A;  4DR5 F;  1U6B A;  2DO4 A;  3BH7 B;  4DV1 J;  1KKH A;  2E5G A;  4CDI A;  3BR8 A;  2YNI B;  2I2Y A;  1HNV A;  3C3L A;  3KHR A;  2MJU A;  4RW4 B;  1FDA A;  3NCR A;  1PGZ A;  1WC4 A;  2OML A;  5IWA J;  1VQP S;  1K8A T;  1LXN A;  3MEG A;  1FFG B;  9RUB A;  1C1C A;  3QT5 A;  4LSL A;  4NLO A;  1NKE A;  5HAN A;  1CBK A;  4DV3 J;  4LF9 F;  1X4H A;  2IM1 A;  3IG1 B;  2YNH A;  4Q0B B;  1BLU A;  1C0U B;  1LNQ A;  4ZIV A;  2F5G A;  2IDE A;  2AJ0 A;  3DHX A;  1D09 B;  1XMB A;  5HQM A;  1IKX A;  2QLB B;  2P5V A;  4C8M A;  1KTV A;  4ECV A;  1RT3 A;  2HKE A;  2PMW A;  2K06 A;  4GKJ J;  2AEF A;  4LF1 A;  3OHB A;  2MTL A;  1XR5 A;  3VCD A;  4EWT A;  3V4M A;  4USK A;  3MZI A;  4DWI A;  3ZNJ 1;  4DL4 A;  3AB2 B;  4KKO B;  4C2M A;  4K7Q A;  3UQS A;  4Q44 A;  2QE5 A;  3EMT A;  4TLR A;  4LRE A;  2QA4 G;  1N34 F;  1QE1 B;  8ATC B;  7FDR A;  1YBA A;  1FKO B;  2FJE B;  1KOO A;  3FCV A;  2RF2 B;  2VF3 A;  4DSJ A;  4N56 A;  5E3R A;  2P8I A;  2KJV A;  1SH0 A;  1R43 A;  4ZVH A;  2P6S A;  2AZ1 A;  1RTI A;  3OFH A;  3N28 A;  4NEZ A;  4K2J A;  1U8W A;  5KG5 A;  4MYT A;  1Y5I B;  4DFK A;  1RT2 A;  1N32 F;  3R7S B;  1I1G A;  1TR0 A;  1N88 A;  2W2M P;  1FE0 A;  3OR2 A;  3DYA B;  3PY8 A;  1WNE A;  1HFE L;  3C6T A;  1NM2 A;  1R0C B;  4HI2 A;  1HA1 A;  3AOC A;  2BOP A;  3UWT A;  2XMK A;  2PMZ D;  3LPE A;  5IM0 B;  3EM1 A;  2GJI A;  4YHH F;  1TQL A;  1GMU A;  1U26 A;  1C1B A;  3NWG A;  4H4O B;  4ETZ A;  3KXD A;  1VDH A;  5DDR C;  3OXF A;  5AE1 A;  5D4P A;  3BN7 A;  2ZKU A;  1FT8 A;  1LW2 A;  2OTJ S;  4HTJ A;  2YWH A;  4DQI A;  4CZC A;  2VQE J;  3AA9 A;  4ZIT A;  5H1S V;  3W1Y C;  5L46 A;  4YN3 B;  4JV5 J;  5H9F K;  4PXD A;  4F3O A;  4RNM A;  2JEJ A;  3JYT A;  4LUB A;  4MK7 A;  3FRZ A;  3MM8 A;  3I5A A;  3PYD A;  5L1K A;  1UJ4 A;  4F4Z A;  4FS1 A;  1Q7Y T;  4WII A;  3CCW A;  1IBL J;  3TAQ A;  4PPZ A;  3DRS A;  4YB6 A;  1U1K A;  5HN0 A;  2VIC A;  2LQ5 A;  3BGF A;  3M7V A;  3ZTP A;  2XMW A;  1N5T A;  4LBP A;  2RIJ A;  4A48 A;  5KFL A;  1G6B A;  4AXI A;  1FJG J;  5KFU A;  2QZ8 A;  2NXN A;  3P6Y C;  4LF7 J;  2GMJ A;  3RUB L;  3V2U C;  3SSQ A;  3EPG A;  3BSN A;  2V4J B;  3GWC A;  1JNZ B;  3RYL A;  3T5J A;  2RQC A;  2K1R B;  3LGH A;  1AW0 A;  4PRF A;  2K2P A;  3MHY A;  1S1W B;  3ISN D;  5JJB A;  4Q43 A;  3MUM P;  2QFJ A;  1HLW A;  1JLG B;  2BMB A;  3CIZ A;  2V0N A;  1G7C B;  3N01 A;  3BKF A;  2BJ7 A;  3CCE S;  1JLC B;  1S99 A;  2QJ3 A;  5DRK A;  3ILO A;  3R5J B;  2KT2 A;  3NBP A;  3CT9 A;  2VAS A;  2C2E A;  2D3U A;  1QUV A;  4TYB A;  1U1N A;  4F4A A;  4LQ3 A;  1AT1 B;  2YXL A;  5J2Q B;  4W4M A;  4DR2 J;  4QIG A;  2VA3 A;  2OO4 A;  2HK2 A;  2GVZ A;  2ALZ A;  1VGY A;  2GV1 A;  4R5P A;  3MCO A;  2O01 C;  1N33 J;  4RU9 A;  1MMD A;  2QIF A;  4NLQ A;  5KT6 A;  1VBX A;  1MLA A;  4X62 J;  3TVZ A;  2ZD1 A;  2NXE A;  4NXN F;  3BYR A;  3W9J A;  2NYH A;  4OJ1 A;  3V81 A;  3LGN A;  4ILL A;  1UVK A;  4RKU C;  1CUL A;  5AXM A;  3L95 X;  2IJF A;  1FWL A;  4CLP A;  2RJZ A;  5F3T A;  2VQF F;  1SKS A;  4MKB A;  2WVF A;  3KUG A;  4ZCI A;  1XIQ A;  3GFY A;  2M52 A;  4HHH A;  2HQ3 A;  2ZOM A;  3N5F A;  2RRN A;  1SQG A;  1IWA A;  2ZH2 A;  1KD1 T;  2KH9 A;  2W25 A;  2DHS A;  3P49 B;  2GA7 A;  3JSM A;  1VQ6 S;  1UVI A;  4OQJ A;  1RKJ A;  2LLZ A;  3D0H E;  3H8Y A;  1UP1 A;  3KK1 A;  1IKW B;  4F4W A;  2P9G A;  3J7Y U;  3DXB A;  1VIX A;  4G65 A;  4UST A;  1RKI A;  3QGG A;  4USJ C;  3LPY A;  5G0R B;  3NCP A;  4E2F B;  4UUW A;  1RU1 A;  3CMQ A;  1FRH A;  3EUN A;  3HHK A;  3QT8 A;  5FD1 A;  2L48 A;  3CCV S;  2UUA F;  1SH2 A;  1XMO F;  3EVW A;  4DV0 F;  3TZY A;  4R25 A;  3UDV A;  2CWX A;  2HRY A;  1R6V A;  4ZJL A;  1WKJ A;  3OR1 A;  2RML A;  1PYS B;  4K4Y A;  3WIU A;  4EI2 A;  3LP0 A;  2MGZ B;  1Q5V A;  1NJW A;  2OGU A;  4JI6 J;  1X5O A;  3PEH A;  1FRI A;  3M1V B;  3HVA A;  4OX9 F;  2LA4 A;  5HSP A;  4ED2 A;  4FNH A;  2E7V A;  1P6T A;  1SH3 A;  4GMK A;  2FZG B;  1SUQ A;  3E01 A;  2HQI A;  3PKM A;  3CDW A;  2ZEJ A;  4DR7 F;  2UV8 A;  4Y65 A;  2XTJ P;  3EZU A;  2JEG A;  5F8I A;  1IBM J;  4EGL A;  4RW7 B;  1T8E A;  4NRT A;  3DLG A;  4DUY J;  2CQ3 A;  3CCQ S;  3BYP A;  3HD2 A;  3TX8 A;  1BWE A;  3K5M A;  1LXJ A;  4H4K A;  3NNA A;  5DM7 Q;  2C2N A;  3EZ5 A;  1KLM A;  2VUG A;  5A8R B;  4CLT A;  4ZVG A;  3DMJ B;  2EFQ A;  3IGV A;  1FRL A;  4WIQ A;  3MFI A;  2XNR A;  4PQU B;  2HHU A;  3DRP B;  4HAC B;  3PM9 A;  1N54 B;  1LWF B;  2FHK A;  3H5Y A;  2KHD A;  4KV8 A;  3I6P A;  3E2E A;  2J0W A;  3SQG A;  2MY7 A;  5EDW A;  2N7C A;  1JK9 B;  4CCH A;  2DR9 A;  2MKH A;  4H54 A;  5B09 A;  4DX8 H;  3V6D B;  4KHR A;  2CNL B;  3IMQ J;  3GJT B;  3LP2 A;  2LXI A;  2Y0S D;  4I7F B;  2E1M C;  4ZP9 A;  2HYI B;  3FEY B;  4JUZ A;  1RGV A;  4A8X A;  2V9W A;  1JMT A;  1N5V A;  3R1L A;  1S1T A;  3VQT A;  1HBM B;  2Z2Y B;  2HHH J;  3FRY A;  2GO8 A;  3HSG A;  2ZVS A;  2HVH A;  2BAB A;  2CAJ A;  5CCL A;  2C28 A;  2OPQ B;  3WBZ A;  4C48 A;  1U1Q A;  5A0Y A;  1KQS R;  3NL0 A;  3DKD A;  4NYZ A;  3R2D J;  2EW9 A;  4IOC Q;  1XC9 A;  1FXR A;  2M0G B;  3KJV A;  2GAH C;  2AWZ A;  2XWX A;  2FHJ D;  2QL5 B;  2J8A A;  2R7V A;  2KXF A;  3CCR S;  1VBY A;  3CNQ P;  1JLF B;  1NKC A;  2CVE A;  1F9E B;  3W8P A;  4HKQ A;  3IC1 A;  1W2B R;  2OKQ A;  2DHX A;  4YDX A;  1S0N A;  3F73 A;  4F4K A;  1OY6 A;  3TVY A;  5ETN A;  3QQC D;  1VI7 A;  5CAB A;  5G4D A;  5HQ8 A;  2XY5 A;  4ZHR A;  5J2N B;  5ADZ A;  2LQB A;  1RT1 A;  3S6E A;  1S7I A;  4DV5 F;  4IOA Q;  5LXR A;  3RR7 A;  1FD2 A;  3KJN B;  5AE3 A;  2HMI A;  3O6Q A;  3IM9 A;  1S1U A;  1N56 A;  4DZD A;  2HNY A;  4IG3 A;  2H65 B;  1YIT S;  2P6T A;  2AJ4 A;  2V2K A;  1F60 B;  1MU2 A;  2W7O A;  2DRA A;  4ILR A;  1FDD A;  4X4R A;  3OVS A;  2GMH A;  3PX0 A;  4U8V A;  4A8S A;  1XNQ F;  3J7A N;  1GMV A;  4URQ U;  2UVV A;  2YY3 A;  1Y7P A;  2CQ2 A;  1RHQ B;  1B99 A;  4NWB A;  4XPE A;  1P8G A;  3LH2 S;  5I42 A;  3ICL A;  5ETT A;  1R0B G;  3AOD A;  5KFB A;  4WXW A;  1LQ9 A;  3CJK B;  4L75 A;  4KGV B;  4LF4 J;  2CNK B;  1RTZ A;  1S97 A;  2KRB A;  2I1R A;  3CSK A;  3KJF B;  3AOB A;  2VG7 B;  3TJA A;  3EGN A;  5HVH A;  4UT4 A;  3AH6 A;  2CVI A;  1YQH A;  2DNQ A;  3O1L A;  2VFS A;  1YHQ S;  4KRW A;  2Y0B B;  2UV8 G;  5FII A;  3D66 A;  3FEZ A;  2Q3P A;  2NZ4 A;  3T1Y F;  2BJE A;  3UCG A;  3A3P B;  5D4N A;  3GV7 B;  2FGO A;  2OEJ A;  5I3U B;  3R7N B;  1HW8 A;  2R8G A;  2UXB J;  4HHJ A;  1VS3 A;  3BBC A;  4JYA J;  3IO1 A;  4NYO A;  3NGD A;  5BYQ A;  2MQM A;  4NCA A;  5AJ3 J;  3D0I E;  2NRE A;  3L9Z A;  2OPS A;  1QVG R;  4MK8 A;  2Z2L A;  5J1E A;  3J7Z T;  1RAO A;  1HNV B;  2Z2Z A;  2DYA A;  3MUV P;  5KFF A;  3KUH A;  2A2D A;  3FBE A;  2VL1 A;  4RR5 A;  2B6A A;  3MR7 A;  1Q8L A;  4ZVE A;  5A6W A;  2AX1 A;  3QGI A;  4GRS A;  2RQM A;  2PI4 A;  4DG1 A;  3PHT A;  3MEG B;  4ZCM A;  4MKV A;  1WOP A;  3C2P A;  3G6V A;  3S01 A;  2OFH X;  2KU7 A;  4WFZ A;  1C1C B;  5KG2 A;  4LSL B;  1RCX B;  1VQ8 S;  1G3O A;  3HX9 A;  2RT3 A;  3DM2 A;  3GV8 B;  2YNH B;  3R5D A;  1CSJ A;  2OEK A;  1VQK S;  3CUL A;  5EX3 A;  2GQQ A;  2WSE C;  1NO8 A;  4O4G B;  2Z58 B;  2H5J B;  3GR0 A;  1SV5 A;  1RT3 B;  1NKB A;  5E41 A;  5FLX U;  4KC5 A;  1TAU A;  1X7V A;  3BDE A;  3QAU A;  2C3M A;  4FS2 A;  2AYG A;  1PC4 A;  2CPJ A;  5B0F A;  4YY3 F;  5F8L A;  4I64 A;  4CO2 A;  2HFS A;  2C3P A;  4ZPW R;  1X4D A;  1VBK A;  4H4K C;  1ULR A;  2V2Z A;  2DR6 A;  1K1S A;  4TY9 A;  4WWS A;  3UNY A;  1P9Q C;  3DLH A;  4V19 J;  3NAI A;  1UA1 A;  3TX0 A;  6FDR A;  4B9U A;  3V4I A;  5D4O A;  3MOJ B;  2HHS A;  4J5O A;  1B7F A;  4CT8 A;  1W25 A;  2AW0 A;  4M5K A;  1R8B A;  2ROE A;  1QUP A;  2WAQ D;  3KLF B;  1SCJ B;  2GAG C;  1RT2 B;  1TKT A;  4USU A;  4XTT A;  3OR2 B;  3M32 A;  5ETR A;  1S9E A;  3PRD A;  2CYY A;  1IVZ A;  2DBB A;  1TL7 B;  3HSJ A;  3M9M B;  4PKD B;  2A10 A;  4YQW A;  2OEM A;  1J5O A;  5HLF A;  3H4B A;  3D67 A;  1DTT A;  2AMC B;  2B3T B;  5EWE A;  3CC4 S;  4YFU A;  3HHE A;  1C1B B;  3RB0 A;  3MR5 A;  2HVE A;  2C2D A;  2JFK A;  1WI6 A;  1JXL A;  1HMV A;  3K58 A;  3GV5 B;  3DLL Q;  5MLC V;  3UVJ B;  4X2B A;  2H9Z A;  2X3D A;  3VTI A;  2WW4 A;  1T05 B;  2BKO A;  3AXM A;  3HK2 A;  1U4B A;  2ZJR Q;  5T14 A;  2KFZ A;  1W7W A;  1RWU A;  4USW A;  1FEH A;  3CE8 A;  3GJQ B;  5ETL A;  1TMJ A;  4HTI A;  4OZ2 A;  2V2V A;  3JYT B;  3MTK A;  4EU0 A;  1Y5L B;  3MM8 B;  3J80 Y;  4ICL B;  1CJK A;  3NS5 A;  2CQG A;  3U1M A;  3SV4 A;  3O8W A;  4WYL A;  2HRU A;  3QO9 A;  2FZK B;  2H1Y A;  1ZAW A;  2WZ1 A;  2XMM A;  1EQ0 A;  4ECT A;  3JQJ A;  4DFP A;  2R7Q A;  2DNL A;  3D1O A;  1X60 A;  3K5P A;  1ICE B;  4PWD A;  5KFT A;  1KTQ A;  3DRS B;  4IG0 A;  3LAK A;  4CH1 A;  2BEF A;  2DHH A;  4IH7 A;  1EIY B;  1ZZN A;  1HI0 P;  5L38 A;  5FDL A;  2SXL A;  2VDI A;  3RBZ A;  2WK4 A;  2YNG A;  1OQ3 A;  1R0A B;  4FF4 A;  3MD3 A;  3ILJ A;  2DGU A;  2PA3 A;  2JWN A;  2B8P A;  3D3B J;  3HFV A;  4P7T A;  3JAM U;  5F41 A;  2PT0 A;  2XBP A;  3D6T B;  1ZYQ A;  3PW5 A;  4F4Y A;  1C2P A;  2WON A;  4ZJQ A;  3PR4 A;  5IZH A;  1HHT P;  4B3M J;  4YS2 A;  2E66 A;  3M2V A;  1NBE B;  3H2U B;  4QBU A;  3CC7 S;  2VDH A;  1HI8 A;  4P75 A;  2CPY A;  2E5L J;  1MN9 A;  2HS3 A;  1U09 A;  4NZ6 A;  1U7L A;  4M5H A;  3QFH A;  4NL5 A;  3PRV A;  2MXY A;  2ABY A;  4B08 A;  2W9C B;  1GEH A;  4N7T A;  1DQ8 A;  1NCL A;  1B0T A;  2HVZ A;  2VFV A;  2GVZ B;  5D4L A;  4X65 J;  5T7L B;  2QFI A;  1CQN A;  2XM3 A;  3OQ2 A;  4R5P B;  4OZN A;  4BCA A;  4LFA J;  3I56 S;  1RSC A;  3AQO A;  1CLF A;  4ANE A;  2KYX A;  4NA3 A;  2ZD1 B;  3C8Y A;  1KVJ A;  1HBN B;  2EWH A;  3MEE A;  2X1A A;  4WZQ A;  3QLH A;  2JFD A;  1SC4 B;  3HDS A;  1NSA A;  2DR7 A;  3A12 A;  3U02 A;  2A0F B;  5DO2 A;  2ADB A;  2CPX A;  1WDD A;  4DQR A;  2HRT A;  4P2S A;  4UF4 A;  4ED0 A;  4RX6 A;  3R5C A;  5D78 A;  2WBR A;  1I6J A;  3QAE A;  4Y2M A;  3UDC A;  3MUR P;  4IRK A; 
#chains in the Genus database with same CATH homology
 1FX2 A;  4WP3 A;  2W01 A;  3C14 B;  4OYP A;  2WZ1 A;  4WP9 A;  3MAA B;  4UST A;  4USU A;  2GVZ A;  3C16 B;  4OYM A;  1YBU A;  1YBT A;  5IV4 A;  2GVD A;  5D0R A;  4CLK A;  1CJU B;  1WC6 A;  4CM0 A;  1TL7 B;  1CJK B;  3ET6 A;  4NI2 B;  4USV A;  1TL7 A;  2QV6 A;  4NI2 A;  1WC3 A;  4CLT A;  4CLW A;  4P2M A;  2GVZ B;  4WPA A;  4P2X A;  1WC1 A;  4OYI A;  4CLU A;  1CJV A;  2GVD B;  4CLZ A;  4CM2 A;  4OYZ A;  1CUL B;  3ET6 B;  4OYW A;  1CUL A;  4P2F A;  1WC4 A;  1CS4 B;  4CLY A;  4CLP A;  1CS4 A;  3C15 B;  1Y11 A;  1CJT A;  3C15 A;  1Y10 A;  1FX4 A;  1CJV B;  4OYO A;  1AZS A;  5D15 A;  4OZ3 A;  3UVJ B;  1U0H A;  3UVJ A;  4CLS A;  3MR7 A;  5D0E A;  4USW A;  3G82 A;  4CLL A;  1AB8 A;  1CJT B;  3C14 A;  5IV3 A;  1AZS B;  3MAA A;  1U0H B;  3C16 A;  5D0G A;  1WC5 A;  3R5G A;  4OYB A;  4OYX A;  1YK9 A;  4OZ2 A;  4CLF A;  4WP8 A;  5D0H A;  1CJU A;  1WC0 A;  1CJK A;  4OYA A;  2BW7 A;  3G82 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...