1CS4B

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
190
Chain Sequence
YHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYPE V ADENYLATE CYCLASE
publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 62
structure length 190
sequence length 200
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cs4B00
3ET6B 1CJKA 1CULB 1YK9A 4OZ2A 1FX4A 1TL7A 1U0HA 3MAAB 4CLSA 4WP9A 1WC6A 5D0RA 4OYPA 1AB8A 1CJVA 3C16B 4WP8A 3R5GA 4USWA 4CLUA 4WP3A 1WC0A 1CJTA 4CLTA 2QV6A 3ET6A 2BW7A 1CULA 5D0EA 1WC5A 3MR7A 3MAAA 5IV4A 4CLYA 4OYOA 5IV3A 1Y10A 1Y11A 2WZ1A 1CS4B 2GVZB 3C16A 4USVA 4OYMA 4OYWA 2W01A 3UVJB 4CLLA 4OYZA 1CJUB 3C14B 4P2XA 4CM0A 1AZSB 2GVDB 4OYXA 1FX2A 4OZ3A 4CLFA 5D15A 3G82B 4WPAA 4NI2B 4OYIA 3C15B 2GVDA 1TL7B 1U0HB 4CLZA 4NI2A 3C15A 4OYBA 4P2FA 1CJVB 1YBTA 1WC3A 1CS4A 4CLWA 4CLPA 2GVZA 4OYAA 1WC1A 1YBUA 4USUA 3UVJA 1CJUA 4CLKA 3C14A 1CJTB 1CJKB 4P2MA 5D0HA 4USTA 1AZSA 5D0GA 3G82A 4CM2A 1WC4A
chains in the Genus database with same CATH superfamily
1RT4B 4MJKA 2POKA 9RUBA 1F5BA 4DV4F 1B3TA 1E6YB 4HR2A 3IAM9 3PYGA 1YWXA 1B4SA 5HLFA 2LDIA 3K17A 3M8PB 4C48A 5B0DA 4B3TF 2YPYA 2HQCA 2QLJB 2DHHA 2HS4A 5F9LA 2OSQA 3ZTRA 2FGCA 3CGIA 1S9GB 2XMVA 5LL6d 4O3NA 3PM9A 4QWDA 2ZH9A 2UUBJ 3PO5A 4EMDA 4QWCA 2HK2A 1H0HB 1HHSA 2RS2A 5E7OB 4CLFA 1LV5A 3FBBA 2WVEA 1UFWA 3OD2A 1FO1A 5EWFA 1HKAA 1LXJA 4PEOA 1A9NB 4QBUA 1VQ8S 4ZIWA 2O3DA 3LALA 3RBXA 2QT7A 4I2QB 4U9RA 4LF4F 3N9UC 4IDKB 3ZNJ1 2DGXA 5KG4A 4KRWA 3OFHA 1V3ZA 2NS1B 1TK5A 3HK2A 4B3OB 3MURP 1CULB 2HLTA 2IDLA 4ILLA 1REVB 4DR4J 1H74A 4PPZA 3IRXA 2W2OP 2F4FA 2EI5A 4DUZJ 3ENAA 5DQGA 4IYQA 1RBLA 4J9LA 1J27A 3EJMA 1QSYA 2HNDB 2GCFA 4WIIA 4TN2A 4A8KA 4ZLNA 4DQSA 1T7PA 1VQNS 3DDNA 3HD1A 1OSCA 5L38A 2VUGA 2J9EA 3PW4A 1WC5A 2V69A 3JTNA 2FDNA 3KFWX 2CAJA 1AXQA 1N8RT 4KGXB 1RHQB 3KK1A 4DLEA 1NZAA 1KC8T 1QLNA 1FK9A 4OYMA 1CJUB 4F7VA 1WI6A 1TELA 1FEHA 2WCXA 1WUUA 4DV4J 4B9UA 3NS6A 5LXYA 1WEYA 3M2RB 3KLIB 1BQXA 2E9RX 4PYDA 3TJAA 3JTOA 2LMIA 4J9OA 2DR7A 2XG8A 4FF2A 3GWCA 3KDOA 3GV5B 2BANA 1PGZA 2QX0A 1Y0HA 4RUCA 4CP5A 3HO1A 3T5JA 2H51B 2H4YB 5D3GB 2AZ3A 2ILZA 3IRWP 2RRBA 2HNZA 2RT3A 1Q8KA 2H1YA 3VAHA 2C22A 4ZCIA 4QYRA 5EX3A 3LW5C 3MOJB 2JLGA 1GK8A 1K47A 1VRUA 1O5JA 2V0NA 4KH1B 5GAEU 3ZXWA 3O2IA 3MUVP 4Q8FA 1R8AA 1WDDA 2R2RA 3EPGA 4F2RA 2YX4A 2CNLB 3PR5B 3IN5A 1OJ4A 3K8VA 1C1CA 1JLBA 4O44B 4UUXA 2VU5A 3A3OB 4DV6F 3MDFA 2QZ8A 3WIVA 2BA9A 3TA2A 4M5MA 4R8UA 1FRIA 4LREA 4CRJA 5CYMA 3FEXB 3TZWA 3ZTOA 4I1TA 4V1Ak 2D1CA 1R6VA 1ICEB 2O66A 3ZZYA 2P9EA 3HT3A 2QSWA 2FD2A 3TO8A 2RE1A 4WBFA 2NYIA 1S12A 2VPZB 2FC9A 5DLGA 3DRRA 1LWFB 3LOUA 4FKXA 2RU3A 4TVAB 3SBMA 2ZBQA 1RT3B 2M2BA 4N41A 3OTCA 5D8HB 3V2UC 1LWXA 3SEOA 1QUPA 3P4UB 4I67A 2EK6A 4RW4B 4KHPF 3PRDA 1ZM4A 1R27B 4O3QA 1U1NA 1DZ5A 1VCTA 1XC9A 3TVKA 3HFKA 2NSCA 3W62A 3P3DA 2JOQA 2GS8A 2IJNA 1N36J 2ADBA 1R43A 1PG5B 1D3WA 3R97A 3M8SA 2NQPA 4F2SA 2GVZB 1JLEA 2EFPA 1L3TA 4LFAJ 2OI2A 1U0SA 4TYBA 5E2QA 3THVA 2KFZA 2DH8A 2JLFA 3T5HA 1IVZA 1TKXA 2CQ2A 2G1HA 1ZH5A 2GVDA 2N4DA 1JLQA 1GFWB 1SUQA 2GJIA 3JSMA 3QRRA 1Q4RA 3LWMA 1D8YA 1RE1B 3F56A 1YJWS 1WF2A 5D0GA 4HVZA 1N54B 1N5VA 1NB7A 4DSJA 3T1HJ 3R27A 4IG3B 2XULA 2Q79A 3J81U 5J2MB 4DV6J 5F8HA 2AWZA 1RBOB 3FRZA 3A3NB 3CD5A 2YH1A 4FBUA 4E0DA 1HWLA 1VLOA 4KGZB 1SV5B 4OHWA 2E1CA 3LP1A 2A1BA 2B6AA 3V4IB 3UD4P 4BCAA 2VKRA 4LF2A 2K06A 3OL9A 2X1BA 2WVBA 3H4DA 4PWDA 1HNIA 4ENOA 4CM0A 1B0VA 4YQWA 4NI2B 1M90T 1WHWA 1JLGA 3JAMU 3CDBA 2V4JB 3DLGB 4P2FA 2FYXA 4DCJB 4ED0A 1WHVA 4L76A 3GLJA 4CT8A 4QW9A 1B99A 2NXNA 2P2CB 2RJZA 2CA9A 4LMZA 3MFIA 4LF1A 2J5AA 1NH7A 1FCAA 4UOFA 5ETOA 1VQPS 3M32A 2LP4A 1OYDA 2RQCA 3MAAB 1N5TA 1YG0A 5DZ7A 3DLEB 2PI5A 1RLCL 4RO0A 5KT4A 2R3VA 1O8BA 3M05A 5FIIA 3WX8A 3D1OA 5DM6Q 3DOMB 3P5BP 2DY9A 2HRTA 1RT2B 2DXFA 1OY8A 1V3RA 3MMAB 1X9MA 2MDAA 1WEZA 3MPWA 1RYRA 4A8XA 3CJQA 4G1QA 2VC1A 2RVJA 4NLYA 4M5KA 1YITS 2DNQA 4TU7A 5L1JA 1Q7YT 3CC2S 1U4BA 1RI7A 3C6TA 4P2XA 1Q0NA 1HI1A 3CJ8A 3RYLA 3RW7A 3VZIA 2EFNA 3MM6B 5KFGA 3MD1A 3OR2A 1RAGB 3DRSB 3I56S 3OQ2A 1UWAA 2V6AA 4IH5A 2DR9A 1NCLA 1NBEB 3FVYA 2QYCA 2E44A 3BYPA 2HVDA 4HDGA 2MHNA 2P8IA 2JC0A 3GJQB 1G3OA 3GQCA 4W92B 5AXLA 3AOAA 2BZ2A 2KHCA 1EKRA 4M5JA 1CJKA 4PRFA 1TL4A 5I3QA 3BBBA 3ZC4A 5LJ3Y 2DJWA 3ZTPA 2ZBPA 3R6GB 4M5LA 1TV6B 5IT0A 3KLHB 1V5VA 3ISZA 2JFDA 3BSAA 3NY0A 3R5DA 1N0VC 2QMUB 1NKBA 2HYIB 1NNDA 1RISA 2N4CA 1YGYA 1KD1T 5D0EA 2FJDB 3ISND 2K1RA 2W24A 4D3GA 5CYQA 4JI4F 2LA6A 2OPSB 2IA6A 2VF3A 4WE1B 3MEDA 3GTYX 3R7BB 3DLJA 4J9NA 4KR0B 3NS5A 4LSLA 5KOXA 2EFOA 3P45B 2EBGA 2COLA 1NJIT 1QJHA 1S72S 2VFTA 4Y3CA 5A8RB 3CCLS 3TJ9A 2GX8A 3GR0A 4DU7A 1S49A 3FMBA 1UVKA 3ENVA 2F63A 2I2YA 5I3PA 3QT5A 1MG7A 3A1YG 2HVZA 4ZPDA 1RT5B 1RWNB 3SXLA 3G96A 4I6WA 1BXNA 2ZH5A 2ZJPQ 1Q8IA 5KG6A 2BR0A 4KV8A 2DNMA 2FHKA 2K3IA 4U95A 2ZH7A 5LXRA 1EETA 3PYEA 5AXKA 2W4CA 3QT7A 2ZNYA 3KJVB 3ITHA 1IN0A 3GMGA 5IOLA 2PA3A 4CH1A 1R8CA 5KT7A 4J91A 1U09A 3N0VA 3C14B 1VISA 5L46A 5KG7A 1NK7A 1VK3A 3GSIA 2CJXB 1EB0A 3CCMS 1W25A 2JLEA 3SFGA 4ZN3A 1LK5A 3BSCA 1CJTB 3R5BA 4DR7F 2FPHX 3OFGA 1RAEB 4B9LA 1RACB 1S59A 2HFNA 4H4KA 1S1VA 1T11A 2VG7B 1WHXA 3V5RA 2Y0SD 1RGVA 3HPOA 1M5KC 3G71S 4LRDA 4HACA 1NO8A 4O23A 3GG0A 2A18A 4K5SA 4GO5X 3W8GA 1H6KX 4ID8A 2H5JB 1F5CA 1PSDA 3VTIA 2KDOA 5ETRA 4QOTA 3EZOA 3MD3A 1MSWD 2G2ZA 1JLAA 5EN1A 4C0BA 3DM2A 2CVIA 3A13A 2GMJA 4JUZA 1EARA 4RW6A 3SDEA 2BANB 3AH6A 3PVXA 2LEBA 3VGVA 3NGDA 2RILA 3J7Z5 2XSJA 2E5JA 3QFWA 6FD1A 3D28A 3KK3A 1JIHA 5CAAA 4FXDA 1FT8A 1HMVA 1FVSA 1EAYC 1UVIA 4R0EA 4ZJLA 3BJYA 3DDKA 2W9BB 1T03A 3GV7B 2IM0A 3FCVA 2PFFB 2VB6A 4K8RA 4ZP6A 3NEKA 1VRUB 3MCMA 3GCXP 1RLDA 2V2QA 3I96A 3M8YA 3K89A 1XMQJ 1ZYQA 2IYIA 4ANCA 1HFEL 3NS7B 4EBEA 5D4LA 4DR7J 5CZXA 4USVA 1KRPA 4OZ1A 1SKRA 2DD8S 2VICA 4RW8A 4MFBB 2FTRA 3OVBA 1RAAB 4YDDB 5KFTA 1P8GA 3HFVA 2X7IA 4MKAA 1SJ4P 4YB7A 3QGHA 4IR1A 2W2MP 4MKYA 2QMWA 2IDEA 4BBYA 1S0OA 4NCAA 4A8MP 5C2GA 2O5DA 3POTB 3M9OB 3LGMA 2BQ3A 1SL0A 1RTJB 2Z2YB 2F8EX 5DDRC 2UXDF 2YKMA 4FPIA 1RKJA 2CPFA 3I31A 4ZP7A 3DHXA 4P2MA 3HI9A 5E41A 3DGVA 4I7FA 1N5SA 3DRXA 1TKZB 2G2OA 4M5NA 2XS2A 4QWBA 2RIJA 3EXYA 1DRZA 3CO9A 2AQ4A 3CMES 1M1GA 4HHHA 2MKHA 4G3IA 4ZPVR 4HYKA 3DRPB 4NLTA 1VBZA 2AW0A 5J2NA 4LJMA 2E5GA 4XK8C 2XZWA 4DFKA 5DGAA 4IUFA 1FRKA 2VKZG 1RWUA 1SPBP 1IR2A 4XAKA 5CH7B 2CNKB 2BJ7A 2GVDB 2A3JA 1S9FA 3CCUS 1JLQB 3MMJA 3IR7B 1Z1ZA 1TK0A 2MKSA 3D68A 2YNGB 4YP3A 2HQ3A 5CCLA 2R42A 3C15A 4Q44A 4NL5A 1R89A 3I5BA 1S5ZA 1Q8BA 3PZPA 2GQQA 4OZ5A 2LEAA 1FJGF 4L6V3 1YZ7A 2MQOA 2XY7A 2HBYB 3MPVA 5HROB 3IBFB 1HD1A 3UR0A 2J8AA 1AB8A 4LBHA 4OL8A 3KUHA 2KVQE 5IT4A 2RDJA 3KTQA 4B3RF 1BD6A 3TAPA 4AFFA 1FE0A 1JNRB 4K0KF 1FXDA 4RJVA 2O67A 2UXDJ 2IFXA 1X4HA 3MEEB 1H2UX 2R9LA 4Q0BA 2K2PA 2KKHA 1PJ7A 2XGPA 4UUWA 4PG5A 3M4XA 2DHGA 4OYZA 2ZHBA 3EVOA 3Q83A 5LJ5Y 4C11B 1K0TA 4J90A 1GX5A 2XCAA 3HVTA 2H3EB 1KONA 3BH6B 4KSEB 5B0AA 2UU9F 2CPEA 2B9WA 2CJKA 3KJNB 1MW7A 3OBIA 5C2CA 4OZ0A 2AJFE 1FX4A 2RU9A 4C0OC 3HHLA 2ZH2A 3VR1A 1F5AA 2ZUAA 1IKYA 4C3MA 4ELVA 2KFNA 3FQKA 4JI7J 2MGZA 4DV5F 1NXIA 3ZTSA 4ZVQB 2QV6A 4TXSA 3RAMA 1SIWB 2YQ1A 1S6PB 2QN6B 5ETLA 1ZA1B 3G6YA 1HWUA 1S1UB 3HSJA 3NWRA 3GFYA 3M6XA 2RUSA 4HT7A 3L95X 1G4CA 5KT3A 1RT1B 1M1HA 1JK9B 5IM0B 5D15A 4C8YA 1X0PA 1HNXF 5BYQA 1YRUA 4IKAA 1U6ZA 2C42A 1SJFA 7AT1B 4B3RJ 4ID5A 2Y3YA 3UO0A 2BE9B 1S9EB 2Z2ZA 4ZN1A 1Y5LB 3N5BA 3PTWA 4K0KJ 1YBUA 3KMSA 3MECB 1CJKB 2AYEA 5KFIA 2F9JA 3O8WA 2KZMA 4CTAA 1FJEB 4KFBA 1QD1A 1HW9A 4K4WA 3D7SB 1BQNB 1HYSB 1FD8A 3GFXA 5HMZA 5D0RA 1HQUA 2IVMA 5I42A 2NZCA 1VIXA 4JI5F 1XNRF 4KGKA 2MZTA 1HBMA 4MK7A 4NLQA 2QL5B 1BGXT 2P6SA 3J81Y 2J76E 1T9UA 3MMCB 4JI6J 4H4OA 4RNFA 4IOBA 3VGSA 3OUYA 2GQCA 2UU9J 1IXKA 2D9PA 5CYQB 4B9SA 4RNOA 4PR6A 3Q2SC 4LRBA 1NLKL 2DEJA 2M88A 2F40A 3UNGC 4GKKF 3U1LA 3NNCA 1NDCA 2ZOGA 3L7PA 3IXQA 4FVMA 1TL3B 2VDIA 3CPWR 2DHSA 2AU0A 3Q89A 4CQ1A 1FE4A 1TL7B 2QYGA 4L75A 2RNEA 1NRKA 2HK3A 5KFPA 5I3UA 3W61A 3EUNA 2H9ZA 3DXSX 2MPUA 3JAMY 2ATCB 3MEGA 1DLOA 2CXEA 2D9OA 4X4OA 4QIWD 1S6QA 4YB6A 5B0EA 2OPPA 2AD9A 4WXOA 1VR6A 4UZBA 5SUHA 4YS2A 1ZBTA 2OPQA 3MTJA 2CVEA 3KLFA 2OP5A 3IGNA 4OJ3A 2E5LF 3ET6A 2ASYA 1HQEB 4DHVA 1VIOA 2JX2A 2YQ0A 1S4FA 1Y9OA 1P6TA 3L9ZA 2QA4G 4H54A 2KXNB 5C42A 4GKJF 1FDDA 1S0VA 2WB4A 4TLQA 2W8LA 3KDNA 4QPTA 3PJXA 2H5EA 4P71A 4JI5J 3BGUA 1U8SA 5DM7Q 2C3MA 4RPFA 4PXDA 1Q7LB 4USKA 4USHA 4DV1F 3CMQA 2AEJA 4FDFA 3BGLA 1XNQF 1QAXA 3CJ4A 5C25A 1FHTA 4ER8A 1KHWA 2BOAA 2ERRA 2DRAA 4CDIA 1HARA 3CB4A 1NH8A 3H2VE 3TUJC 4OJ1A 5KFAA 1HQ2A 3NGSA 1YJRA 5JVHQ 1VRTB 1P27B 2RF2B 1WOSA 3MPYA 4HACB 3DHWC 3G87A 3BDPA 1DAXA 1YX2A 3M2VB 3PRBA 1H7XA 1LEOA 1HNVA 5KFHA 1U8WA 2BMBA 1VC6A 2J9CA 2B8QA 4DCOB 1UP1A 3IP0A 4LT6A 4ZPCA 2KN4A 4JI1F 3WIUA 3EX7B 2IBOA 3DMJB 5HVGA 4FNIA 4X65J 3H0PA 1RTDB 3J7ZT 2BACA 2VPXB 4BLGA 4JV2A 3MM7B 1IKXB 1X60A 2JNJA 2R8HA 4KT0C 5KFOA 2BOPA 1F2GA 4DI6A 2WSFC 4AXJA 4N56A 3OT9A 1K0VA 2NUUG 3IWNC 1ZETA 4LF5F 4U8YA 2WK4A 4HDHA 4DV3F 1G7CB 4GKJJ 1XBWA 1NMEB 4X4PA 2YWHA 3M6UA 1N48A 1SKWA 5KFLA 2HSEB 1P1LA 1MROB 5HSPA 2YVSA 3KG0A 4U67Q 4E8UA 2C28A 2J6TA 3GYXB 3BPSP 4ATNA 3AT1B 2HBQB 2KO1A 1UEUA 2A0FB 4DV1J 3J81j 4WFBQ 1QTMA 1XNQJ 5GADU 4IRDA 4X4NA 3DDIA 5DG8A 4LRFA 1S57A 2RQKA 4NE9C 3WBZA 4RWWA 3M8ZA 3CD6S 2HW3A 1LXNA 2L08A 1N5YA 2LXFA 4ES3A 2MKJA 5HBMB 4NLOA 3SSSA 2E66A 1S1XB 3FFIB 2JSXA 2VG6B 2GHPA 2B51A 4FNHA 3JXOA 3OVSA 2J9DA 4OZNA 3AA8A 2YKAA 1G6BA 2CPXA 2AHOB 2VODA 2E7WA 3JYTB 5ETSA 1JJCB 3RRHA 4GVLA 2E1PA 3NCPA 3P96A 3N01A 3AODA 4NRTA 4UOCA 1BQMB 4DWIA 2H5IB 5J2NB 2JEGA 2MMYA 5GMEA 1F9HA 2X3DA 4PUOB 2MZSA 4LF5J 3K7RA 2YNHA 2BJ8A 4JI2F 2ZZTA 4DV3J 2DNOA 3JQMA 3EGNA 2YKNA 3D0HE 3H4BA 4CYUA 1F60B 1ZS6A 3T1YF 4RLEA 3OL6A 3C15B 2A2CA 2R2TA 3TAMB 3B82A 5KFBA 1QAYA 4B9MA 2DGSA 2M3DA 1Q1KA 3QAUA 4KIAA 3GSDA 3H25A 2HFZA 1YJNS 3W65A 4F4XA 3CULA 5F0UA 1SB6A 1TK8A 2ASDA 3MR6A 3GIKA 2Z4PA 4OZ2A 2FJVA 1AT1B 1YJVA 1RBAA 5DDQC 3NCQA 4F04B 1LKZA 3IBCB 5AT1B 4LBPA 2EBEA 5DS7A 2MQLA 3CTRA 4OI4A 1IQTA 2V8HA 3BGRB 2X3GA 4O4GA 1WC0A 2QLWA 2HGNA 5KOWA 2J7UA 3HHKA 3G6VA 4NASA 4AT1B 4IFVB 1SI9A 4DN0A 2OGUA 4U96A 3KLVA 2DCUB 4DPWA 3PXGa 2JEIA 1HBNA 1F1BB 1CS4B 4LSNA 3TWZA 3TAQA 3JQKA 2D69A 5C24A 3EGZA 1FESA 2WVCA 2HFUA 5K14A 4F8RA 2FY1A 2J0SD 5EDWA 3R5CA 4OYIA 1MU2B 3VAGA 4V19J 5F8GA 2LYVA 3D3BJ 1S6UA 1WKKA 3H5SA 4OLPA 2AGQA 3HHDA 2W7OA 4ED4A 1A6LA 2MTLA 1QM9A 3Q8VA 2JC1A 4AQYF 3OW2R 4QIGA 2MQNA 4NCGA 1PO6A 3TYTA 5EWGA 4UF4A 4J9RA 1FI4A 4JI2J 1RTHB 4QWAA 1I94F 2VV5A 5F9NA 3Q8YA 1CJVA 3FUYA 2HHPA 3M2UA 3IMQJ 2Y8WA 3OTEA 2MKYA 1NSQA 5LMUF 2BKPA 4DL5A 1U02A 4X62F 2XLKA 2L48A 4Q2MA 3CUNA 3PIOQ 1HWJA 1LWCA 2BW7A 4XDCA 1WG5A 4K4TA 1GT8A 1J5OB 3FBEA 2MEWA 3VHQA 1JXVA 2KI2A 1Y11A 2H54B 1ZAXA 2MXYA 4KKOB 4RNNA 3RZAA 2SXLA 1KP6A 1QUVA 1NK4A 3VAMA 2RKIA 3DYAA 5EWEA 4UQGA 3P8BB 3DGPA 3VVUA 2CPJA 3MPUB 2B43A 2CNNB 3UN5A 2UUCF 2G0CA 2J7WA 1YSJA 4ZVTB 1S6OA 2V9WA 3ZZPA 3LUYA 2XNQA 1URRA 2QLXA 4DEZA 2D74B 4CTAB 4ZVHA 2M8HA 4G1IA 4O3PA 3KHHA 1WSRA 1SJQA 2JHEA 5KG3A 8ATCB 1JJ2R 1KHVA 3R3TA 4IG0A 2HLUA 1DTTA 4O0NA 3F44A 4A8OA 3BQ2A 4HTIA 2J7KA 4ZIVA 3H5UA 4K50A 4X64J 1T02A 5DJBA 3OLBA 2MHEA 3LGHA 4WP3A 5D6GA 1T05B 3LWLA 1IKWB 1C0TB 4ZJQA 3HMJG 1VGYA 4X4UA 1OYEA 8RUCA 4AQYJ 1CBKA 3HSZA 1XMBA 1IJFB 2WW8A 2D3UA 5E3CA 3C16A 2HHQA 5LMNJ 1VLYA 2DO0A 3D0IE 1Y5NB 1I94J 3N79A 3GILA 3TUPA 1PC4A 4TY8B 4OZ3A 3US5A 3SV4A 3IBWA 1S1WB 1LFPA 2KHDA 4P7TA 4QU7A 2FHJD 4DG1B 1UMJA 2ZKUA 4X62J 3K57A 4MK8A 4A47A 1DLOB 4CH7A 2F3JA 3BR9A 3UDEA 2FHOB 5E3PA 3VF0B 2OPPB 3SI8A 2M7SA 2QL9B 2IC3A 1RSCA 1D9AA 1N34F 3IG1B 1Q53A 3HFZB 3SCJE 3CCWA 1U0HA 2DNHA 2UXCF 1UW9A 2GNKA 5K8PA 3AD8C 2P6TA 4DR3F 4HLBA 1FDNA 5FDLB 3CF5Q 3BGOP 3E3XA 1O6XA 4X4SA 3OR1B 5JJBA 2V94A 2DGQA 3QT6A 4YDXA 4YEAA 2I1RA 4DR2F 2FLOA 4F02A 3NBPB 2HHUA 2HHTA 5J2PB 3T3FA 1KLMB 1X5SA 4DUYF 5J1PA 1APSA 2LXIA 4EU0A 4J9SA 1UJ4A 4IFYA 3BQ0A 4OIXA 4LF7F 1Q86T 3PX4A 1EQMA 3DOKB 2C2OB 5L9NA 4TQRA 4Y2MA 4DLGA 1Q81T 4MYTA 4ECXA 1G2EA 1RWWB 3CDAA 1U1LA 1H98A 4ZVUB 4D3HA 2QG9B 2QFJA 1B7FA 2EKNA 2EC2A 2MJNA 3GIMA 2KG0A 4PZVA 4WP8A 1RWOB 4MTPA 4QJVA 4ERDA 3FBCA 1MWZA 2XHWA 2RQMA 4C4WA 7FDRA 4CLTA 3FMWA 3NGTA 1MLAA 2IM3A 2JH3A 3AOCA 2ZVIA 4MIAA 4ECYA 1RHMB 3VQTA 3CD7A 1Q8LA 5KFZA 4LF8F 1NZ8A 2KVIA 1FA0A 4NLRA 4NA1A 2WOMA 1EIYB 3S6EA 1NKEA 3UFCX 3J7YI 3SQGB 3EPIA 4ZVEA 1S99A 4DR3J 1XWLA 5ETMA 3CJSA 1ZM2A 2K7KA 2DGOA 1UJ6A 1KFSA 3SIPB 3OSPA 4L74A 2IRUA 3Q24A 1FNMA 1YJ7A 1N4LA 2PE8A 2KFYA 1TFYA 3KG1A 2V68A 4Y2AA 1OY9A 4Y34A 2ZH3A 3HD2A 4DUYJ 4MT1A 2DXEA 2ZHOA 4FN5A 2BKOA 1I3OB 1FKPB 4H4MA 4RW9A 3TX0A 3TI0A 5BJRA 3W9IA 3BO4A 2CDQA 3LANA 3NMAA 1OSDA 2AF6A 2XHCA 2DIVA 1RZMA 5M2UA 3ZNUA 1X7VA 4QW8A 1IBLJ 3CCRS 4KYZA 5J2QA 1VFJA 4DR5F 3I5AA 1SJ3P 3DRYA 2E9ZA 2RB7A 4TYAA 1T0TV 4ZPWR 1T8EA 2QTWA 4F36A 1HNZF 1KKHA 2NCKL 3W60A 2MZQA 3B78A 2FZKB 2DGTA 3QGIA 4J9QA 3AOBA 3SZ2A 4NMLA 3SSRA 4PQUB 3T9NA 4ZVOB 4IH7A 4J9UE 4ECZA 4K4ZA 1REGX 5D77A 4OV6A 5B0BA 4Z2XA 4F4YA 2PFDA 1S76D 4LF8J 4JI3F 1SH2A 2FJAB 4X2BA 2CIMA 2XSFA 3HDSA 2KT5A 5GAGU 2HPUA 3W2VA 1JJ4A 1EKSA 1SIZA 1XK8A 4FXVA 2IRYA 2FVRA 1TVRB 2YWEA 4FXWA 2VQEF 4QU6A 3E01B 2CPHA 2YNHB 4PABA 3GJTB 3H42A 2LFVA 4FYVB 1L3KA 2RHSB 3QZ7A 3C6UB 2JFKA 3DLKB 3BGFA 3W2WB 2Z57B 3J80U 4LVOP 4WKYA 2B0GA 3FGVA 1IBMF 5MLCV 3QZ8A 2HFSA 3QWUA 5DG9A 3BZQA 1JLCA 2DR5A 1YBTA 4LIWA 4DX5A 3N28A 1WC1A 2DPIA 1HWIA 4OI0A 3CDWA 1F3VA 3S7RA 1SC6A 3BKFA 3HJVA 1HR0J 4JI0F 4CO2A 1UWBA 5AE2A 3K59A 1RK8A 2M0GB 5B7WA 2VBWA 1RWKB 2HURA 4OX9F 4NYOA 1R0AA 3JSRA 4A8QA 1U26A 3KHRA 4WZMA 1EP4A 4YOEA 1C4AA 1VBXA 1SH0A 2R7TA 4NZ6A 3CD0A 1H2TZ 1K73T 4LSNB 4ED3A 1S10A 3M1VA 5D4PA 2V67A 1GTHA 4JI3J 2L9WA 2WVFA 4J9KA 2ASLA 1IKVB 1KOHA 2W01A 3TVYA 4LIRA 5HO4A 4DOZA 4KH0B 2VJUA 3F0NA 1FX2A 2PC6A 5HMWA 2UVVA 1U49A 2ZBRA 4GC6A 2OO4A 2HEKA 3FZBA 3OLAA 3KLGB 5HN0A 4B3MF 2Z56B 4LRAA 2MKIA 5GAHU 4KE5A 1UFLA 2ZBCA 2RQ4A 1GMUA 1YLXA 2Z8QA 2J6SA 4USTA 5F8MA 1AFJA 1XIQA 1H2VZ 1VS3A 2C3YA 1AW0A 2AIRB 4LR9A 3M2UB 1IJEB 4ANEA 2X1FA 1IUJA 4J7CA 3ICLA 2IRXA 1W2IA 3DNCA 1LW0B 4LFBF 4DR4F 2Y8YA 2DNGA 2C3UA 1TAUA 4DV7J 4QWEA 2N3LA 1LK7A 1S0MA 4DUZF 3UR3C 4ZHRA 2DH9A 4OHZA 1NJZA 5JXSA 3G6ES 1FJCA 3GIIA 4X4RA 4JI0J 2Q6CA 2GZOA 2L9NA 4OX9J 2BJDA 3L4BC 2M5YA 2E1RA 4KQZA 4ED6A 3PYFA 2VFUA 1VQ7S 1RTIB 1TMJA 2J9DE 1KOOA 3K2YA 1GTEA 3TQ1A 4DX7A 4NCBA 4GC7A 5ADZA 2VG5A 5D0HA 2KYZA 3PV8A 1GMWA 3FZ2A 3GV8B 4ZVGA 3SCLE 2R7XA 5ETTA 5CD4A 1RJJA 4NZ7A 2EKYA 3RW6A 4LQ3A 6FDRA 3CEDA 1FWLA 2YNFA 2B7CB 3UPFA 4B3MJ 1S97A 1NDKA 3WZ0A 1WWHA 5LT5A 3M30B 1NM2A 3AFGA 4B9NA 1HLWA 2IHR1 2QA2A 2FUG9 4PYAA 2BJ1A 4DS5A 3QSYB 2ZD1A 3QJLA 1K9MT 4N8OA 1VHIA 3D0GE 2FB0A 1TKTB 2OEKA 2MYFA 4NLSA 4P73A 2OEJA 1FVQA 4Y0FA 2E9TA 1RHRB 4M95A 2IJFA 4LFBJ 4DL0C 3H98A 1C0UA 3DU5A 5BXIA 3KLEA 4F3OA 1DBDA 5CCMA 3FK4A 5GMDA 3WC2A 2OMOA 1NK9A 3I0SB 5CYJA 4ECRA 1U24A 3AXKA 2GV1A 1CC8A 1RAFB 5HP1A 2O01C 1WC6A 1N56A 4A46A 4HI2A 4IH6A 1RHKB 2XI2A 2WW4A 1HIYA 4PAAA 3ZTQA 3MUMP 4WTOB 3KK2B 1ZAWA 5T7LB 4EGLA 5ETQA 4PG8A 1X4DA 2UVUA 2CQHA 1ZTTA 2XY5A 3OJUA 2OHDA 1F3FA 2CQ1A 4H4KC 2I9SA 2YWGA 3MR7A 1MWYA 1H73A 6AT1B 1YJUA 2H65B 2WAQD 3HVWA 1HBOB 4IFYB 3LQVA 1JB0C 2V9KA 1VBKA 1N36F 2C2EA 2ZDPA 3V81B 1HNWJ 2XZTB 2CJBA 2ZE2B 2P5VA 2B4UA 4DF8A 4A8FA 4LFAF 4F25A 1NK5A 5AJ3J 4NLXA 1JKHB 5HJYA 2BVZA 2GJFA 1LQ9A 5F3ZA 4PG6A 2IAJA 5A0YA 4CLKA 3GIRA 1SXLA 1IR1A 3PKMA 4KHMA 4NPOA 2XO7A 2X51A 3W66A 4NRUA 5H1SV 3PFOA 1WELA 3K0JA 2F4VJ 2UZAA 3LF0A 3BDEA 1UZDA 3UE2A 1PKUA 3T1HF 3UN2A 4GVBA 1EZZB 3U02A 3R1HA 5G0RA 5K20B 4DSEA 5D78A 1KQSR 3GJSB 1TUVA 5IWAF 1CEZA 1LWEB 3LP0B 1R8BA 3NNAA 2J0XA 3B4DA 8AT1B 3ONQA 3RR8A 1Y4ZB 2HHHF 1HPZA 3MM9B 2WVDA 3UWTA 4FS1A 1JLFA 1HWKA 1HBUB 2OPRA 2HMIB 1QE1B 2HQIA 3ENQA 1X8DA 1NSAA 5J1EA 3DCAA 4LFCJ 1OPIA 3ZZOA 1X4FA 5L9XA 3TA1A 3RG6A 3IAS9 5BYSA 3CJKB 2ZZMA 2VONA 1N6QA 3G82A 1V5IB 2N7CA 1YQHA 1HL6A 2O1PA 4PWWA 1C1BB 2K3KA 1XMOJ 5L1IA 2HHVA 1WDTA 3CJ0A 5FD1A 4EO8A 3O44A 2H48B 4Q2LA 1RT4A 3PHTA 3FRYA 3MMBB 3CO0P 3KWMA 5F8IA 5IV4A 1IR0A 2BE2B 4CO3A 3W5XA 3U7JA 2RD5C 4FF1A 1E6YA 2HS0A 4WKRA 1K8AT 1WTBA 4MIBA 4C8LA 3X3UA 4DUTA 1RP5A 2F9DA 3M8PA 2Z0GA 5JUMA 2D41A 4A8YA 3IR5B 2HHSA 2CPZA 4ILMA 1S9GA 4FF4A 3B4MA 3Q8RB 3O3LA 2B4VA 3A8EA 3L7OA 5IWAJ 2YXLA 3QGPA 4W90B 1YDLA 2KH9A 3ISNC 2HHHJ 2DH7A 2V2VA 1RT6B 2CJ9A 4I2QA 3MGJA 3DOLA 1SL2A 2XCPA 3IFEA 5D4OA 4U7CA 3N6NA 4F4ZA 3R8YA 3TZXA 2MLZA 2C2ZB 5IT9U 2E7XA 3ILOA 3TNVA 1LW2B 4B3OA 5HVHA 3M8QB 5IFMA 1CULA 4C8ZA 1REVA 3SFUA 1P9YA 2V5HG 2ZOMA 3RGIA 2AZ1A 4DCPB 4B3SF 4CNYA 3AAWB 4BC9A 1EJ7L 4Z7YA 2HNDA 2MY7A 3HULA 1Q16B 4Y2CA 1AZSB 4ICLB 5K5MA 1DHMA 4KO0B 3PG9A 2LCWA 5HQMA 4G1PA 4I69A 1TL1B 1UEVA 3AB2B 1X5TA 1U1RA 2C3PA 3V6DA 2W25A 3KG4A 1QSSA 4Y6IA 2M52A 1TZ0A 1CJUA 3FSXA 1RT7B 3QLHA 1CPZA 4U8VA 2JJ4D 2WHOA 4NXNJ 3B54A 2MQPA 3M2RA 3KLIA 5CHCB 1WSVA 2VQFF 1BUXA 2I8EA 2YX1A 2ATLA 1OQ6A 2HHXA 3GE9A 1S1TB 2YNIB 4MMOA 4DX8H 2NXEA 1VDHA 4RX6A 3BV8A 4ILRA 1NJXA 2PEHA 1I51B 4ZVFA 5KFEA 1U45A 2ZZNA 3C8YA 4LF6F 4DX6A 1UAWA 3HLUA 2RDIA 3HHLC 2HHWA 5F3TA 5D3GA 2NPFA 3D6MB 4CO5A 5M2PA 5A8KA 1D09B 5HL7Q 4ZVSB 4WIQA 1T9XA 3QIPB 4CNZA 2NLWA 3R9LA 3UVJB 2R7UA 2I38A 2CWKA 1S77D 5KFJA 1ZM3A 4Y28C 3THTA 3RBZA 5FLXU 3ILJA 3LP2B 3QATA 4S0MA 3V6HA 3QO9B 1VQSA 4DBQA 3VGUA 4CO0A 2Y1RI 1KQKA 3CDEA 1VQ4S 3Q8SB 4RWXA 2J0WA 3KNAA 4O44A 1D8ZA 2WONA 2XWYA 4B3SJ 2XYGB 5LSLA 1S0NA 5LOQA 1NSPA 4C8NA 4N7TA 3M7VA 3RB6A 1VBYA 4IO1A 5DDPC 4C0HA 2LXUA 4KHRA 4KJIA 3T9ZA 5IC6B 2ZH6A 4ZHRB 3HXMA 5GAEI 5B0GA 1RA6A 3R6LB 2Q43A 1KBRA 3GFHA 1L3UA 1QVGR 1RT3A 4BWJA 3PX0A 4C3LA 2OKQA 1BY9A 4QIEA 2VQFJ 4RW4A 3MUTP 2V4RA 3LPEA 2YBVA 4O0IA 2EXUA 2ZUGA 3NNHA 3NGRA 1TU0B 4WFXA 3PFEA 3V4MA 4NZ0A 4JOUA 3U1MA 4LVNP 4LF6J 2GVZA 3HKZD 3ETOA 5HLFB 4RL1A 3AXMA 3TOQA 1ZAVA 4I56A 2LA4A 3BF4A 2GAHC 2YKQA 1VQMS 4CT9A 4F4KA 2UXBF 2KZZA 3QPIA 4FYWB 4K2JA 2FJBB 1VOMA 2XMKA 2R7VA 3HX9A 5KFUA 2Y1JA 2XM3A 1ZM9A 1VRQC 4JV5F 4KBIA 4M1KA 2LECA 2OUGA 4IG3A 3PY8A 3FQLA 1I6JA 3IR6B 3TEGA 5KFCA 3LH2S 5J2MA 5H9FJ 1TKDA 2Q3PA 3HHLD 2HVHA 1SBRA 1XMQF 4RBVA 1UW4A 2RSQA 2K8GA 3NOCA 1B0TA 1SV5A 4F3MA 3IRXB 3ADAC 2D7SA 1SH3A 3V4IA 4YB1P 4X4TA 3PKYA 2BUNA 4TKTA 4ZCLA 3R7SB 1FFSB 3I32A 2ALZA 3C66A 3PHEA 2DY1A 4RUAA 4O3RA 1FNOA 5HP1B 2UUWA 3JSBA 3QSIA 3VALA 2V4JA 3DLGA 3TR5A 2B9XA 3KK1B 2R4FA 3MOZA 3E8OA 1FK9B 2BQRA 2W4PA 2B9EA 4M5HA 4WK1A 1FRXA 5HMXA 3F41A 4X4QA 1MNEA 1Y3KA 3MAAA 2CADA 4JI8J 2QMXA 3DLEA 2J8SA 4UY85 4QR2A 5IQQA 2UXBJ 2GQ2A 1SQGA 3MM8A 3DOMA 3D3CJ 3I5CA 1RT2A 4IOCQ 2NREA 3D6FB 3T6BA 3MMAA 3DFEA 5KFDA 3JQJA 2HNZB 1VI7A 4LSZB 1FTRA 5A0YB 1U7LA 4CH0S 4JV5J 4DFPA 1M5VC 2EG2A 1WORA 3THPA 2IVYA 3PW0A 3I82A 3AQOA 4RNMA 2HG4A 1WC4A 3KYLA 3C46A 2W4DA 1KVJA 4ED2A 4NXMF 1PC5A 3RJMB 3DRSA 3NAHA 2KJWA 1EX8A 1LNQA 2RRNA 2ZKTA 1C1CB 1JLBB 5F41A 2OTLS 1UVNA 1GXLA 1KDNA 1PIEA 5B09A 3GCWP 4R8UB 3J7A1 3BR8A 2XO6A 4OX7A 3DC2A 5CYMB 2Q1LA 3PX6A 1ZZFA 3W7BA 1TV6A 4P74A 4EBDA 4CO4A 2MZJA 2Z2LA 4EBCA 1QSLA 3M9NB 3KLHA 4OZJA 1R0BG 2QRRA 4C8MA 1KQGB 4K59A 3DRRB 4K4UA 3UDVA 3TQEA 2J0QD 3K5LA 4DZ6A 3GPAA 4JYAF 1ZA2B 2F1FA 2ACYA 3QQCD 1GMVA 3EVMA 2VPWB 1MN7A 2OPSA 5T14A 1WNEA 3G2XA 3G4SS 2CZ4A 3MHYA 4QIFA 3KHLA 5KFQA 2OEMA 2CPYA 5CQGA 3HVRA 3VAIA 1NPKA 2FIUA 3WQPA 2KXHA 4Z37A 1UKUA 4QR1A 1ACMB 2FZCB 4PXCA 2MSTA 2V8GA 2W1BA 1JLEB 3R5GA 2VFSA 2V63A 5A8RA 4AL5A 1XEZA 3NMRA 1S7IA 2CQCA 1TKXB 2V8PA 5LM7E 3QIDA 4KY3A 5KFMA 1ZTWA 1SUQB 4CLYA 4JI7F 3JSMB 1RT5A 2K7JA 1UETA 2MJUA 2EFVA 4NXMJ 2W2QP 3IS9A 4IO9Q 2CQIA 2DGUA 2I5JA 3QMQA 3AA9A 3G86A 3FKBA 1OWXA 2HWTA 1H7WA 4MH8A 3KJVA 4RKUC 3ZZTA 4UQTA 4OX6A 2FVSA 4JV1A 5DQHA 2CJYB 4YN3B 3V6KA 3C14A 2CQ4A 1R8HA 4KC5A 1U1QA 3LP1B 2B6AB 1S4EA 3DOLB 2X1GA 1RAIB 5ETVA 2VA2A 3V6JA 4PWDB 1HNIB 3AJDA 4WJBA 1CJTA 4PCQA 4YFUA 4JYAJ 1K44A 3N5FA 5KTQA 1MMNA 3CC4S 1JLGB 3OV7A 2NSBA 2OD4A 2ZOFA 4V19X 4G65A 1XN9A 2GMLA 2M4MA 2VG7A 3UDCA 5DZ6A 1DQ8A 3DLHA 2DNNA 4JI6F 2QO3A 5E3QA 1NB2A 1JXLA 4WPAA 2G0IA 3M32B 1R6YA 4ES1A 3QWPA 3V6DB 4OI6A 3OL7A 5A8WA 4OHVA 1RWPB 4FKYA 3QLHB 4DSLA 3PW7A 2GFFA 3D1QA 2NUHA 4F67A 1V3SA 4C97A 1BE4A 3OJSA 3KJFB 1Q82T 4OI3A 4BS2A 2FVQA 1X5OA 4B3TJ 1LOUA 4ELTA 4G1QB 1U47A 5AXNA 1N0UA 2E7VA 2NZ4A 4PKDB 1VHFA 3C6TB 4WCEQ 4W4MA 3BSNA 4Y00A 1ULRA 3CJRA 3JS9A 5A8KB 1B64A 4Y2KA 1RHJB 2FLLA 3OR2B 2L3MA 5HVFA 2XMMA 2YX7A 4J9MA 5K9FA 2W9BA 1K1SA 2XZDB 4F3QA 4DSKA 3I87A 4WYWA 2Y0BB 1XR6A 2CJQA 4M5DA 3O6QA 4LF4J 4IRCA 3OTOF 3HF5A 2JWNA 4DL6A 1WOPA 4M94A 1Q5YA 4OYBA 3UCUP 4TU9A 3GYGA 2N82B 3JTPA 1S48A 2WONB 4MFBA 3FSIA 3ILLA 1WHYA 4ED8A 4WFYA 2RH3A 1OPZA 1N88A 2ZVSA 3K58A 3ZO7A 4QIVA 2Y9HA 1BMQB 1AFIA 4U7UD 1X31C 2DT9A 2YKPA 3POTA 5KFKA 2K1RB 1RTJA 3GONA 3HCXA 1T9WA 4AXIA 1CLFA 5KG1A 3L3CA 3X1LB 3AJ1A 3E51A 1SJ1A 1W2BR 4OV1A 3FSYA 3MEDB 3Q8QB 1TL5A 1TKZA 3FDSA 4LSLB 2VBYA 3QJJA 5IT9Y 2AJQA 2NYHA 2XMAA 1SQFA 3PIPQ 3W5YA 1RADB 1VC0A 4RU9A 4DPXA 3KUEA 3DRPA 2DK2A 2HQFA 4P10A 2PSZA 3A8JA 2BYCA 1NUEA 3TX8A 4P75A 1B0PA 4F50A 2EG1A 2ZBIA 1C2PA 5E3RA 4USUA 1P9QC 4X65F 3NKYA 4KV8B 4PG4A 4NLGA 3HKWA 3GB0A 2V8DA 2R8IA 1EETB 5KG5A 1KSPA 5CA5A 1NPPA 1X0FA 2YNGA 4B02A 2ASJA 3H5XA 3TUIC 2QE5A 2FLPA 4DL7A 3ITHB 4C8KA 1T9YA 1VQ5S 4J37A 2UVWA 2HS3A 5HAOA 3OTOJ 4GMKA 1NAQA 1Z2LA 1BLUA 3EGVA 4NWBA 1U1KA 1KEKA 4E2FB 4L3NA 1F2HA 5JMNA 2B5JA 4Q5VA 3I4PA 5HROA 4GRSA 1UVJA 2MLXA 3CJTA 3CIMA 2OFHX 1RDRA 3SCIE 2IIHA 2KM8C 2ZFHA 4LQ9A 4NA2A 2IJRA 2DPJA 1GEHA 1NK6A 2DNYA 3U1NA 3W3SA 2PMWA 3OHBA 4FPRA 4YY3F 4DN9A 1VK8A 1IBCB 4HEA9 3MEEA 4X4VA 2MKCA 4FYXB 2MSSA 5K8MA 4DF4A 2A10A 3PJWA 4K2XA 2RMLA 3UCZP 1UJ5A 1S1VB 4CLWA 5KG0A 1FXLA 5CZVA 3D6HB 1D1UA 5FLXY 5KT2A 1UPPA 4URSA 4C11A 2ZH1A 2GIFA 1YKWA 5D4NA 3ZZUA 4KHPJ 1S79A 1YZ6A 1TR0A 2WSEC 2XMTA 1QTNB 1Q78A 4Q7AA 1UA0A 5IXUA 2GJ2A 5JVGQ 3GZ7A 4C2MA 4USMA 2KJVA 3OHAA 2UUAF 3LAMA 1FXRA 3MR5A 2I6WA 3NP5A 4AL6A 2CPIA 3A4TA 5A6WA 4UY8T 1D0EA 4CI0B 1JLAB 1NSKL 2X1AA 4HL9A 2KT2A 1AROP 3DM2B 3CCVS 3VAJA 2QC3A 1DFDA 2CWXA 3CW2C 2BV3A 1CC7A 2DGWA 4RW6B 2W9CA 1NKCA 3SDEB 3MM8B 1WJ9A 1RQ0A 1URNA 1N33F 3FC9A 1XR7A 4TLRA 4CLLA 3WX4A 2XSJB 1SQEA 2B4OA 2R2UA 1WEXA 4NLDA 3KK3B 2W2NP 2ZHAA 2Q6BA 3M6VA 1S6PA 1HMVB 1N52B 5HATA 3OFEA 1S1UA 1HI0P 4ZLLA 1T03B 1GAOA 1CVJA 1FFGB 1J2VA 1RT1A 4B17A 3E2EA 5IM0A 5EHHA 3EXCX 2LU2A 4FBTA 2WSCC 2GA7A 2CQ0A 2ILYA 3WDOA 2ZM6F 3R5AA 3DXBA 1VQLS 1S9EA 1RU1A 1YTYA 4J9VA 3QAEA 4YY3J 4HHJA 3CJ3A 2OSRA 3W9JA 4RW8B 3MECA 5U47A 4FZVA 2LQ8A 4DFJA 2DR6A 3TW0A 1UEKA 2JRSA 1BQNA 2EC0A 1HYSA 1VQYA 5KFFA 3NCRA 1NJYA 3NRBA 4N5SA 3R2DJ 1U25A 2WZ1A 1SC3B 4DS4A 3O1LA 2YKMB 2DCLA 1PCAA 1X9SA 4ECTA 2HWHA 3I0RA 3TANA 1QDUB 4I7FB 2FQQB 3M6WA 3MMCA 4DXLA 2PGCA 4N47A 2C2DA 3ZFVA 2UUAJ 2HZAA 4AE5A 5KT5A 2ACMA 4CWBA 3UQSA 4HTJA 5E33A 3LAKA 3T5KA 4NEYA 3IGVA 3RAQA 5LSOA 4ED5A 1TL3A 4NLUA 1N33J 2HIQA 1TL7A 4LR7A 5ETKA 1R3NA 2HQDA 4KGMA 1J5EF 2EWHA 1XJWB 5H9FK 4FVCA 2N3OA 2V34A 2XB2D 2B3TB 1U2RA 5K8OA 3LTOA 2V4QA 4ALZA 1FDBA 4FYDA 2HVIA 3W1YC 1PYSB 2MLYA 4OYOA 4R25A 4ZS6A 4E98A 4PG7A 2PN6A 4ECVA 3IS9B 4WFAQ 2I5JB 4ECUA 2ZM6J 4ZA1A 1PYTA 2RDDA 2AJ1A 2B8PA 3H2LA 1CSJA 2VASA 1HQEA 3Q22A 1V9OA 3RTVA 2FZGB 1RWMB 3MEKA 4ZCMA 1Z4UA 1TUWA 2MQ8A 2VOOA 3HVAA 4ZVRB 4RZRA 3TRGA 3CVKA 2IA0A 1FKAF 2LQBA 1ZZNA 1YJTA 2QGFB 4Q0BB 2C3OA 4WP9A 1X4EA 4KB7A 5AE1A 1BWVA 1UTAA 4K4YA 2W8KA 4EEYA 1YIJS 5CD4H 4B9TA 5HI7A 5E5NA 4AL7A 2MKKA 4JI4J 2OAUA 2L9DA 3C3LA 3HSGA 3JSYA 5CABA 2VH7A 1CQNA 4X64F 3HVTB 4C7QA 4Q8EA 4N76A 5SZTA 3H40A 2XNRA 1Y3JA 3WHIA 5DDOC 1NU4A 2VHGA 1VRTA 1DARA 2RF2A 3PEHA 4AD6A 3EICA 4DU8A 2RAQA 1PJ5A 2XTJP 1J5EJ 4A8WA 3NAIA 5A8WB 3M2VA 5LMNF 1RKIA 1RAHB 3HHLB 3PRVA 2V8VA 1IKYB 5KFRA 5B0FA 2C2KB 1MN9A 2MGZB 3BKUA 2VZ9A 3DMJA 2A2DA 1IQZA 1RTDA 3M8WA 2FY8A 3MM7A 1IKXA 2HGLA 5KT6A 4PWUA 4A8SA 1RWVB 2IM1A 1Y7PA 2F8MA 4IR9A 2BW2A 2CQGA 1T95A 2AV5A 4OQJA 3PNIA 5EX0A 3B8HA 4Z7CA 3W8PA 3OTBA 2VOPA 3RU0A 3PDNA 1RWXB 1WI8A 3UN3A 4ID5B 3TARA 1X4AA 2AP6A 1DQAA 1NDPA 4WU2A 4DQIA 1MROA 4M5DB 1TP7A 4I68A 4NLVA 2Y1IA 3GIJA 1D9DA 1K1QA 4URGA 3TUZC 4KFBB 4O4RA 3VCDA 3RB4A 1VQ9S 1HQUB 5I42B 2ZC4A 4QYZK 5L8RC 3N6LA 5EUHA 3WC0A 2L41A 2HBRB 4ZP9A 1FRLA 2DHAA 2RRAA 1KVKA 2YPZA 1HBMB 2G2YA 2IM2A 4RBUA 1EHWA 3AD9C 2E1AA 1ZPVA 4H4OB 1YK9A 2ZWOA 3OUYB 4CLSA 2OJ3A 4OFZA 1Q79A 4ECSA 1PBUA 3KXDA 1WF0A 3SQOP 4YB5A 4HHUA 1FWKA 2VBZA 1WTFA 5HBMA 2B7BB 2UUTA 2BQUA 1S1XA 3FJ2A 3FFIA 2YKOA 1RA7A 2VG6A 1FRJA 2QA1A 1HHQA 3T19A 2QEXS 3BBCA 3OFFA 5GADI 5I3UB 3JYTA 3BB5A 3BO3A 3AJ2A 1PYOB 4DQRA 3N4WA 1UL3A 4TY9A 1X4GA 3MEGB 3QYYA 1BQMA 1S6QB 4ZLJA 1SVDA 1RHUB 2Z58B 3GFZA 1P1TA 1RTZA 4PUOA 2BJEA 3HP6A 2U1AA 4P72A 3VVTA 2OPQB 3BREA 5F0WA 1CG2A 3KLFB 3Q0AA 2R7SA 4EUVA 3ET6B 2KL8A 5A76A 1QVFR 3TAMA 4UT4A 1YRTA 5M2RA 2EFGA 4OZLA 3TP2A 1M5OC 4YR2A 2DIUA 5C42B 1IM6A 2G13A 2AKWB 2JVRA 5BR8F 3BO2A 5KFYA 2BX6A 3LPYA 1FRMA 1FEEA 2B5JB 3G8TA 4CO1A 2CG8A 2A6MA 3PEJA 4I2PA 3HHNB 1OY6A 1BHNA 2B56A 2Z30B 4LF9F 2DEIA 4C6AA 3ILIA 1PBAA 2DXDA 4QQBA 3VAKA 2GW8A 4QCLA 3BGRA 3BSOA 1IWGA 2OLWA 4OYXA 1IBLF 5C25B 3HZGA 1Q95G 2HIYA 4OJHA 4KAIA 4IFVA 4DQPA 1RAOA 2BXJA 4JBCA 1CS4A 1GNKA 4USJC 3H7HB 2GIQA 1RAJA 4DSFA 3LO3A 2OH2A 5THWA 1MU2A 1JJHA 3CNQP 1YRXA 3ULHA 2IBKA 1HNVB 1UVMA 4CZCA 5KAKA 3BS9A 2JDJA 4RU2A 4F0KA 1U48A 4ZPTR 2HKEA 4LUBA 3MCSA 2AMCB 3P49B 2XQCA 4I4BA 3NGUA 2BRLA 1FF2A 2AYGA 3ZZZA 2W9CB 1RTHA 2VIHA 3TZZA 3EE3A 3GR1A 1GMWD 5IV3A 2XMWA 3IC1A 3LGNA 3Q8UA 4P2SA 4ED1A 2HQGA 1BWEA 2P9CA 3RRKA 1SKSA 1WG1A 2AEFA 2KB2A 1J5OA 1KNZA 1M5HA 5BR8J 4BHQA 1FJGJ 2C2NA 4KTQA 4JV0A 1WC3A 1UPMB 1DTQA 2XMJA 1W7WA 4KKOA 2GHWA 2V50A 4F4WA 3BM7A 4K5RA 4LF9J 1A7GE 5H9EJ 5HQ8A 1SL1A 3UCGA 4KGVB 3S8SA 4RW7A 4ZDNA 2ALYB 3G6XA 3I55S 4DL2A 1HR0F 4DDFA 1L3SA 4MKBA 3G9CA 1GXUA 3AD7C 1FKOA 5A2QU 3OXFA 3GP9A 2HNYA 2DRBA 5LSRA 1OO0B 4C3KA 1JMTA 2C2RA 3TJ8A 1T9TA 2ADCA 1N5YB 3I0RB 2WBMA 3Q2TC 5KG2A 1T05A 2CZ9A 1VQKS 2KRRA 3G8QA 2ZJRQ 2LDYA 1WOOA 4AUKA 1IKWA 3FBFA 1C0TA 1XTZA 2DBBA 2XEXA 4QZVB 2QSFA 4NYZA 3CE8A 1AA1B 1JX4A 1O0PA 4F0HA 2YY3A 2G4BA 4TY8A 3VAFA 1S1WA 1BC6A 4ZVPB 4WWSA 3VQSA 4DV5J 1B7YB 4DG1A 4DMZA 1HD0A 4DPOA 2R8JA 1T94A 2JEJA 4ZJOA 2HAIA 1OMSA 4UOGA 1VQOS 4HI1A 2YKNB 4I64A 4CYUB 4LR8A 5FJ4A 5HANA 2U2FA 2GMHA 4WFZA 1PILA 1KWMA 3IG1A 2HFVA 2DNKA 5BYRA 2B4PA 2XBPA 1HNXJ 3EZUA 2XWXA 2R8KA 3NLCA 3RBEA 1I1GA 2FHMA 2CNOB 3JB9k 5HJXA 4ZKAA 1S7HA 1FD2A 5FDLA 2DO4A 4DV7F 3HSDA 4X66F 2IMWP 3UW1A 3MXHP 3OR1A 4IQXA 2QLBB 3PO4A 2HRYA 2DR8A 2B9YA 1SJRA 4EYIB 4CLZA 3M8RA 1NDLA 2LEPA 1UVLA 4NEZA 3NBPA 5J2PA 4FYYB 4L73A 2MZRA 1KLMA 3BEGB 3D5MA 1E6VA 4O4GB 2ROEA 3MCOA 3DLLQ 2ABYA 4Q43A 1XNRJ 4L72B 4AYBD 2LU1A 3DOKA 2PMZD 4K4SA 1Y00A 1FJ7A 1HBNB 3TEHB 1RCXB 5F8LA 5GMKa 3EVWA 4R5PA 5C24B 2H4WB 2EVZA 1FNXH 4P6QA 5K14B 3BQ1A 1ELOA 2PIIA 4NX9A 2EFQA 5B08A 3K5OA 5L1KA 1R31A 4A48A 2XC9A 2CFXA 4GKKJ 4URQU 4HKQA 3CCQS 2XYHB 3C19A 1F6TA 2UV8G 1FWPA 3A8KA 4ETZA 1OQ3A 4NCGB 3OVAA 2IMOA 2NPIA 3IO1A 2W7PA 3D2WA 4EK2A 1L5UA 1H72C 1RXOB 4OMFG 4PXEA 4LRCA 1CJVB 1GQEA 1PAUB 2R7QA 2EK1A 3OL8A 3KUGA 3GYNA 4BDPA 4KPYA 4Q45A 5MAOA 2IYGA 4J9PA 4YR0A 3DI6A 3SQGA 1LWCB 5L1LA 2DITA 4ES2A 4B08A 5HMYA 2VJVA 2E5LJ 4O3OA 2E5IA 4X66J 2CG4A 4MIWA 4ZITA 2AYBA 2QLFB 1L3VA 1WD6A 3A8IA 2WB1D 2HFOA 4P9SA 2BABA 3CCSS 2RKIB 3DYAB 2OMLA 3DGPB 1SC4B 5CXTA 1C4CA 3H8YA 1VMBA 4MKVA 3EM1A 1V6HA 3ZZ0A 4XIUA 2JL9A 1NPRA 1FKPA 1FDAA 2ZH4A 2NXJA 4G6VB 3PACA 3PCOB 2YWWA 1SCJB 2BE7D 2RS8A 1YVFA 2VA3A 1VQ6S 4NMXA 4LBIA 1U1PA 2YH0A 1GH8A 3K8WA 4GO7X 1YJ9S 4OHYA 3AQPA 1HW8A 4IG0B 1DTTB 4ZK7M 4DR6F 5DO2A 3T1AA 3K5NA 2W9AA 3EWGA 2PI4A 3D6TB 5IC4B 4EZ6A 3MF5A 4F0MA 3SMZA 1HNWF 2HRUA 2I0XA 3CDUA 4DSIA 5AJ3F 1NK0A 5RUBA 4K4XA 2JVOA 3QJPA 2CPDA 4FF3A 3KNGA 4OJGA 4PQUA 1ROFA 3D67A 2R2SA 1D9FA 3C16B 3CCES 1U1OA 2NXCA 3VZHA 2C2MB 2F4VF 2XS5A 1U6FA 3OTDA 3NOGA 1KTQA 4W98A 4JI1J 4MK9A 4RR5A 3T6JA 3SV3A 4TQSA 3CJ2A 3DLBA 1NHVA 3T5LA 2VPYB 3KOAA 2AEMA 3HM9A 2G0JA 4U6PA 2Q66A 1OS5A 1A0OB 1TVRA 4WK3A 2RHQB 1IBKF 2IC3B 3E01A 1TAQA 4Y65A 1VJQA 3HT0A 1U0HB 1LFWA 2GAGC 2WRMA 3R7NB 2UP1A 4PXBA 3BYRA 5HK4A 3PYDA 1XERA 2UV8A 1N5QA 3MWBA 3J7AN 2AT1B 3DN9A 3KKFA 3C6UA 4HT5A 3RR7A 2KM8B 3DLKA 3W2WA 1WF1A 2BEFA 4LFCF 2EPIA 5GAGI 3W64A 2HGMA 2G1DA 2CQBA 3BBFA 5ETPA 1KVIA 3S01A 3GJRB 3SYZA 4DR6J 5KFNA 2GGPA 3NG8A 4I2PB 2BJ9A 4N8NA 4QR0A 4U7UK 2XLJA 2CJAA 3MM5A 1XMOF 2QIFA 3AB4B 2FVCA 2DVIA 2D3OR 5A6PA 1AUDA 1KLNA 4KPCA 5E3AA 4C98A 4XO0A 1FFWB 1M5SA 3OPKA 1KN6A 1NJWA 1TFWA 3MAHA 3DKDA 3MR2A 2CQ3A 2APOA 2UVRA 2GC8A 3FNNA 3H20A 3PJ9A 4BC7A 1R8PA 3ELHA 4OX8A 1DJ0A 2EW9A 3J7YU 3KHGA 3TA0A 2KXFA 2AX1A 3BPDA 4IRKA 1IKVA 1UZHA 4N77A 4NLPA 2EEYA 4IQMA 2LQJA 5L39A 2YQ3A 4CCHA 4EYHB 2R8GA 1QAIA 2A6OA 2QFIA 4I6YA 5DG7A 3KLGA 3MCNA 1DY3A 1IBKJ 3I9ZA 2R7WA 5B0CA 2WOMB 1T3OA 1R0CB 1TTHB 2DRDA 3QBCA 5HQLA 2BRKA 2CZVC 4X84A 3DU6A 3QRPA 2AJ2A 4ANDA 4DZDA 3QNWB 3D4JA 2GO8A 1I5OB 4I6AA 7FD1A 3W5ZA 3T1YJ 1CQMA 1TMMA 1VJWA 2VL1A 4ETXA 4YHHF 1RUSA 2HZVA 4DR1F 1JWWA 1LW0A 3EMTA 3EDRB 5ETNA 3GG1A 4DPUA 1MMDA 3BH7B 3PR4A 5GAHI 3ZZRA 4B9VA 4H4MB 4RW9B 2YWFA 1DTQB 3O5TB 2J6UA 1M5PC 2PO4A 2M8DB 4MAKA 1IM4A 2P9GA 3EDQB 4XPEA 1JXEA 1RABB 5IS2A 1NHKL 1M1KT 3MFHA 4P7VA 3H90A 2PT0A 1H3DA 2FVPA 4DPYA 2OTJS 2LKZA 4RW7B 5J2QB 1RTIA 2DYAA 2LVWA 3QT8A 3HHEA 5KFWA 4NXNF 3L09A 2JZ5A 1FKOB 1UFKA 2HNYB 2AJ0A 3KMQA 4ZPAA 2MQMA 4OHXA 4TNOA 3D9BA 3CSKA 4NLWA 5DQIA 3P5TL 3AHPA 3RB3A 2AJ4A 5GVQA 2PEBA 5IZHA 2DB1A 1RCOB 4OI2A 3M9MB 4I0WA 4C8OA 1RU2A 2BM0A 2N7YA 4YR3A 4PPDA 3Q8PB 4PQAA 1PAEX 3K5MA 2F7VA 1UCNA 3M30A 5F8NA 4XDDA 2RUGA 3MAQA 3W2VB 4UOHA 2R7OA 4WYLA 3IA0A 5DRKA 2E5HA 3W63A 3L7UA 2OIHA 3R5JB 2PMHA 1X4BA 4IDKA 1VYAA 1TKTA 1T9VA 3BKTA 5LMUJ 3MTKA 4YHHJ 1JNZB 4DR1J 3U27A 5F8JA 4USIA 2CQPA 2QJ3A 4NA3A 4WFNQ 4FP9A 4YUDA 4USWA 4CLUA 4YMEA 1RB0A 2E29A 3I0SA 4EZ9A 3UI3A 4ZCKA 4K7QA 1N32F 1KS2A 2GO9A 1FERA 2AX0A 3PW5A 2OELA 1M0SA 2OD6A 3IWXA 2NR0A 1JQGA 4WTYA 4F26A 1JLCB 2F8HA 1WKLA 3EGWB 2VD3A 4M63A 1XQIA 3Q23A 2UUCJ 2MB0B 1U1MA 3KK2A 5T7LA 2CYYA 3RB0A 2BM1A 3QRQA 2AGOA 3TZYA 1UWBB 3IM9A 4DL3A 1X9WA 2KG1A 2V2ZA 3SCKE 3T41A 4J5OA 2E1MC 3CCJS 1X4CA 1T3NA 1R0AB 1NK8A 2IY5B 1E6VB 2CQDA 1F0XA 2KYXA 4OYAA 2BBEA 3MR3A 3QGGA 2LLZA 1HBOA 3D66A 5I4MA 4RUBA 3CIZA 2KU7A 2AGPA 1EP4B 1KQFB 3NWGA 3V81A 2ZDOA 4F4AA 2ZE2A 4ZMMA 4OI1A 1WG4A 3M1VB 5J1NA 4R5PB 2XLIA 1JKHA 2F65A 3FEZA 3OXLA 4ZPBA 3H5YA 2FJXA 1UA1A 3P6YC 3MPDA 4NYPA 4K4VA 4ZOSA 4O3SA 1MWQA 2ZITA 3F73A 2CKWA 3NXZA 5E0OA 2BKNA 2VBXA 1SC1B 2ZH8A 1AYEA 2VDHA 1TUGB 3SSQA 3I9V9 3UD3P 3TVZA 5AE3A 3CXCR 5IQ6A 1G1XA 4L3KA 5A2QY 3RRGA 1Q5VA 4TU8A 1FTCA 4Y2IA 2OFGX 4UTGA 4P52A 3UDLA 3BN4A 4ED7A 4DFMA 1WACA 5C7PA 2JEFA 2XY6A 2IPOB 2ROPA 3CCTA 4JB8B 4FS2A 1LWEA 3LP0A 5H9EK 1N34J 2ZJQQ 1MMLA 2XI3A 2FJEB 4CLPA 4WF9Q 3VV2B 3RUBL 1N32J 3MM9A 1KR4A 2CUYA 1U2CA 3MZIA 2Z2MA 2UXCJ 3DI6B 4ECWA 1HBUA 2HMIA 1QE1A 1ZOTA 2ZWPA 5AXMA 1PJ6A 1LWFA 5KFVA 4C9DA 3BN7A 3D54A 1ZPWX 4DR2J 4EFAC 1TQLA 3CJKA 3VWSA 4UZCA 1KTVA 1NHUA 4OLOA 2XYPB 4WXWA 3QFHA 1F9EB 4A4JA 2IVFB 1C1BA 4LF7J 3UNYA 2WBRA 2PA8D 3J80Y 2YWKA 2LQ5A 1WKJA 3IM8A 2VG5B 2KT3A 2FGOA 4JI8F 2DNLA 3R1LA 3NL0A 1QY7A 4NOHA 3MMBA 2BE2A 3H59A 2DKOB 5KFSA 2YNFB 4RUHA 2ROGA 1QAJA 4DPTA 3PW2A 2CDRB 3RAXA 4ECQA 1Y5IB 3CC7S 3HZEA 3K5PA 2YTCA 4RNHA 2HAFA 3CT9A 2ZD1B 3S1TA 3EZ5A 3ENWA 1SKUB 1AUSL 2AYMA 2ZEJA 1YHQS 2VC0A 2FJWA 1RT6A 2QL7B 3RBDA 4DV2F 1ITPA 1C0UB 3KLEB 4R0JA 2M70A 2FLNA 2DTJA 2MY8A 1LW2A 4ZP8A 3M8QA 4NI2A 4HH1A 3UD5A 2DGVA 1VC5A 5KFXA 3FCWA 5K8NA 2XGQA 3C2PA 3LA0A 1EQ0A 4M5GA 2DHXA 2HZCA 1DQ9A 1OIAA 4XTTA 1GX6A 3OSNA 1DURA 5DLFA 1AZSA 2GIRA 1FRHA 4ICLA 3MI7X 4M8LA 3CMAS 5DGBA 4CM2A 4DQQA 4KO0A 1GXTA 4DV0F 5G4DA 1TL1A 2LQ9A 3N6MA 2FC8A 1KFDA 3G8SA 4M5IA 5DETA 5EGYA 1U6BA 5T41A 2G9OA 3HJFA 1YI2S 2GGPB 2W2PP 1U2FA 4JP8A 3MM5B 1X5PA 4ITSA 1O51A 1RT7A 2XS7A 4DR5J 3R2CJ 3I4HX 4BWMA 2FHJA 1F9FA 2M9KA 3OXGA 1HNZJ 5ITHA 1S1TA 2DNZA 1NEEA 2YNIA 1W26A 1Y10A 2HBZB 4WU3A 4DL4A 2IAJB 4MYUA 3W9HA 3FEYB 3CJ5A 3D1HA 2HVEA 2ZNZA 1Z2ZA 2VFVA 2V2KA 2PDAA 2KRBA 3CWJA 3IWLA 4DJBA 2VFRA 2W7AA 3MM6A 2KTQA 2DNRA 4WZQA 3QIPA 2PD1A 3UVJA 3VGTA 2MQQA 4GVBB 1R7IA 4DV2J 4UW2A 5G0RB 2UUBF 5C5JA 2HWIA 2VQEJ 3LP2A 3FCHA 4IOAQ 2BJ3A 4OYPA 3QO9A 3B6BA 3Q86A 1HPZB 1B70B 1JLFB 1H38A 2MZ1A 4XPCA 2OPRB 4CIOA 3AY0A 2WTFA 9ATCB 4EWTA 1RYSA 4QPXA 5J1EB 2XMUA 2QA4S 1IWAA 2R7RA 2NXUA 4HH0A 1YBAA 1IBMJ 4OYWA 4DV0J 2D3ZA 1HHTP 2CRLA 4RBTA 3GU0A 4ELUA 1N6QB 3EYZA 3G82B 3ETMA 3H2UB 2C1EB 3I6PA 4WE1A 3A3PB 3NGKA 3CCZA 2DNPA 2Y1LB 4EO6A 1XR5A 4QYZJ 2D3O1 1HI8A 4ZLPA 2GHVC 1HA1A 3A12A 2BDPA 2ZC3A 2DISA 4EI2A 3KJQB 2F5GA
chains in the Genus database with same CATH topology
3ET6B 1CJKA 1CULB 1YK9A 4OZ2A 1FX4A 1TL7A 1U0HA 3MAAB 4CLSA 4WP9A 1WC6A 5D0RA 4OYPA 1AB8A 1CJVA 3C16B 4WP8A 3R5GA 4USWA 4CLUA 4WP3A 1WC0A 1CJTA 4CLTA 2QV6A 3ET6A 2BW7A 1CULA 5D0EA 1WC5A 3MR7A 3MAAA 5IV4A 4CLYA 4OYOA 5IV3A 1Y10A 1Y11A 2WZ1A 1CS4B 2GVZB 3C16A 4USVA 4OYMA 4OYWA 2W01A 3UVJB 4CLLA 4OYZA 1CJUB 3C14B 4P2XA 4CM0A 1AZSB 2GVDB 4OYXA 1FX2A 4OZ3A 4CLFA 5D15A 3G82B 4WPAA 4NI2B 4OYIA 3C15B 2GVDA 1TL7B 1U0HB 4CLZA 4NI2A 3C15A 4OYBA 4P2FA 1CJVB 1YBTA 1WC3A 1CS4A 4CLWA 4CLPA 2GVZA 4OYAA 1WC1A 1YBUA 4USUA 3UVJA 1CJUA 4CLKA 3C14A 1CJTB 1CJKB 4P2MA 5D0HA 4USTA 1AZSA 5D0GA 3G82A 4CM2A 1WC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ET6 B;  1CJK A;  1CUL B;  1YK9 A;  4OZ2 A;  1FX4 A;  1TL7 A;  1U0H A;  3MAA B;  4CLS A;  4WP9 A;  1WC6 A;  5D0R A;  4OYP A;  1AB8 A;  1CJV A;  3C16 B;  4WP8 A;  3R5G A;  4USW A;  4CLU A;  4WP3 A;  1WC0 A;  1CJT A;  4CLT A;  2QV6 A;  3ET6 A;  2BW7 A;  1CUL A;  5D0E A;  1WC5 A;  3MR7 A;  3MAA A;  5IV4 A;  4CLY A;  4OYO A;  5IV3 A;  1Y10 A;  1Y11 A;  2WZ1 A;  1CS4 B;  2GVZ B;  3C16 A;  4USV A;  4OYM A;  4OYW A;  2W01 A;  3UVJ B;  4CLL A;  4OYZ A;  1CJU B;  3C14 B;  4P2X A;  4CM0 A;  1AZS B;  2GVD B;  4OYX A;  1FX2 A;  4OZ3 A;  4CLF A;  5D15 A;  3G82 B;  4WPA A;  4NI2 B;  4OYI A;  3C15 B;  2GVD A;  1TL7 B;  1U0H B;  4CLZ A;  4NI2 A;  3C15 A;  4OYB A;  4P2F A;  1CJV B;  1YBT A;  1WC3 A;  1CS4 A;  4CLW A;  4CLP A;  2GVZ A;  4OYA A;  1WC1 A;  1YBU A;  4USU A;  3UVJ A;  1CJU A;  4CLK A;  3C14 A;  1CJT B;  1CJK B;  4P2M A;  5D0H A;  4UST A;  1AZS A;  5D0G A;  3G82 A;  4CM2 A;  1WC4 A; 
#chains in the Genus database with same CATH topology
 1RT4 B;  4MJK A;  2POK A;  9RUB A;  1F5B A;  4DV4 F;  1B3T A;  1E6Y B;  4HR2 A;  3IAM 9;  3PYG A;  1YWX A;  1B4S A;  5HLF A;  2LDI A;  3K17 A;  3M8P B;  4C48 A;  5B0D A;  4B3T F;  2YPY A;  2HQC A;  2QLJ B;  2DHH A;  2HS4 A;  5F9L A;  2OSQ A;  3ZTR A;  2FGC A;  3CGI A;  1S9G B;  2XMV A;  5LL6 d;  4O3N A;  3PM9 A;  4QWD A;  2ZH9 A;  2UUB J;  3PO5 A;  4EMD A;  4QWC A;  2HK2 A;  1H0H B;  1HHS A;  2RS2 A;  5E7O B;  4CLF A;  1LV5 A;  3FBB A;  2WVE A;  1UFW A;  3OD2 A;  1FO1 A;  5EWF A;  1HKA A;  1LXJ A;  4PEO A;  1A9N B;  4QBU A;  1VQ8 S;  4ZIW A;  2O3D A;  3LAL A;  3RBX A;  2QT7 A;  4I2Q B;  4U9R A;  4LF4 F;  3N9U C;  4IDK B;  3ZNJ 1;  2DGX A;  5KG4 A;  4KRW A;  3OFH A;  1V3Z A;  2NS1 B;  1TK5 A;  3HK2 A;  4B3O B;  3MUR P;  1CUL B;  2HLT A;  2IDL A;  4ILL A;  1REV B;  4DR4 J;  1H74 A;  4PPZ A;  3IRX A;  2W2O P;  2F4F A;  2EI5 A;  4DUZ J;  3ENA A;  5DQG A;  4IYQ A;  1RBL A;  4J9L A;  1J27 A;  3EJM A;  1QSY A;  2HND B;  2GCF A;  4WII A;  4TN2 A;  4A8K A;  4ZLN A;  4DQS A;  1T7P A;  1VQN S;  3DDN A;  3HD1 A;  1OSC A;  5L38 A;  2VUG A;  2J9E A;  3PW4 A;  1WC5 A;  2V69 A;  3JTN A;  2FDN A;  3KFW X;  2CAJ A;  1AXQ A;  1N8R T;  4KGX B;  1RHQ B;  3KK1 A;  4DLE A;  1NZA A;  1KC8 T;  1QLN A;  1FK9 A;  4OYM A;  1CJU B;  4F7V A;  1WI6 A;  1TEL A;  1FEH A;  2WCX A;  1WUU A;  4DV4 J;  4B9U A;  3NS6 A;  5LXY A;  1WEY A;  3M2R B;  3KLI B;  1BQX A;  2E9R X;  4PYD A;  3TJA A;  3JTO A;  2LMI A;  4J9O A;  2DR7 A;  2XG8 A;  4FF2 A;  3GWC A;  3KDO A;  3GV5 B;  2BAN A;  1PGZ A;  2QX0 A;  1Y0H A;  4RUC A;  4CP5 A;  3HO1 A;  3T5J A;  2H51 B;  2H4Y B;  5D3G B;  2AZ3 A;  2ILZ A;  3IRW P;  2RRB A;  2HNZ A;  2RT3 A;  1Q8K A;  2H1Y A;  3VAH A;  2C22 A;  4ZCI A;  4QYR A;  5EX3 A;  3LW5 C;  3MOJ B;  2JLG A;  1GK8 A;  1K47 A;  1VRU A;  1O5J A;  2V0N A;  4KH1 B;  5GAE U;  3ZXW A;  3O2I A;  3MUV P;  4Q8F A;  1R8A A;  1WDD A;  2R2R A;  3EPG A;  4F2R A;  2YX4 A;  2CNL B;  3PR5 B;  3IN5 A;  1OJ4 A;  3K8V A;  1C1C A;  1JLB A;  4O44 B;  4UUX A;  2VU5 A;  3A3O B;  4DV6 F;  3MDF A;  2QZ8 A;  3WIV A;  2BA9 A;  3TA2 A;  4M5M A;  4R8U A;  1FRI A;  4LRE A;  4CRJ A;  5CYM A;  3FEX B;  3TZW A;  3ZTO A;  4I1T A;  4V1A k;  2D1C A;  1R6V A;  1ICE B;  2O66 A;  3ZZY A;  2P9E A;  3HT3 A;  2QSW A;  2FD2 A;  3TO8 A;  2RE1 A;  4WBF A;  2NYI A;  1S12 A;  2VPZ B;  2FC9 A;  5DLG A;  3DRR A;  1LWF B;  3LOU A;  4FKX A;  2RU3 A;  4TVA B;  3SBM A;  2ZBQ A;  1RT3 B;  2M2B A;  4N41 A;  3OTC A;  5D8H B;  3V2U C;  1LWX A;  3SEO A;  1QUP A;  3P4U B;  4I67 A;  2EK6 A;  4RW4 B;  4KHP F;  3PRD A;  1ZM4 A;  1R27 B;  4O3Q A;  1U1N A;  1DZ5 A;  1VCT A;  1XC9 A;  3TVK A;  3HFK A;  2NSC A;  3W62 A;  3P3D A;  2JOQ A;  2GS8 A;  2IJN A;  1N36 J;  2ADB A;  1R43 A;  1PG5 B;  1D3W A;  3R97 A;  3M8S A;  2NQP A;  4F2S A;  2GVZ B;  1JLE A;  2EFP A;  1L3T A;  4LFA J;  2OI2 A;  1U0S A;  4TYB A;  5E2Q A;  3THV A;  2KFZ A;  2DH8 A;  2JLF A;  3T5H A;  1IVZ A;  1TKX A;  2CQ2 A;  2G1H A;  1ZH5 A;  2GVD A;  2N4D A;  1JLQ A;  1GFW B;  1SUQ A;  2GJI A;  3JSM A;  3QRR A;  1Q4R A;  3LWM A;  1D8Y A;  1RE1 B;  3F56 A;  1YJW S;  1WF2 A;  5D0G A;  4HVZ A;  1N54 B;  1N5V A;  1NB7 A;  4DSJ A;  3T1H J;  3R27 A;  4IG3 B;  2XUL A;  2Q79 A;  3J81 U;  5J2M B;  4DV6 J;  5F8H A;  2AWZ A;  1RBO B;  3FRZ A;  3A3N B;  3CD5 A;  2YH1 A;  4FBU A;  4E0D A;  1HWL A;  1VLO A;  4KGZ B;  1SV5 B;  4OHW A;  2E1C A;  3LP1 A;  2A1B A;  2B6A A;  3V4I B;  3UD4 P;  4BCA A;  2VKR A;  4LF2 A;  2K06 A;  3OL9 A;  2X1B A;  2WVB A;  3H4D A;  4PWD A;  1HNI A;  4ENO A;  4CM0 A;  1B0V A;  4YQW A;  4NI2 B;  1M90 T;  1WHW A;  1JLG A;  3JAM U;  3CDB A;  2V4J B;  3DLG B;  4P2F A;  2FYX A;  4DCJ B;  4ED0 A;  1WHV A;  4L76 A;  3GLJ A;  4CT8 A;  4QW9 A;  1B99 A;  2NXN A;  2P2C B;  2RJZ A;  2CA9 A;  4LMZ A;  3MFI A;  4LF1 A;  2J5A A;  1NH7 A;  1FCA A;  4UOF A;  5ETO A;  1VQP S;  3M32 A;  2LP4 A;  1OYD A;  2RQC A;  3MAA B;  1N5T A;  1YG0 A;  5DZ7 A;  3DLE B;  2PI5 A;  1RLC L;  4RO0 A;  5KT4 A;  2R3V A;  1O8B A;  3M05 A;  5FII A;  3WX8 A;  3D1O A;  5DM6 Q;  3DOM B;  3P5B P;  2DY9 A;  2HRT A;  1RT2 B;  2DXF A;  1OY8 A;  1V3R A;  3MMA B;  1X9M A;  2MDA A;  1WEZ A;  3MPW A;  1RYR A;  4A8X A;  3CJQ A;  4G1Q A;  2VC1 A;  2RVJ A;  4NLY A;  4M5K A;  1YIT S;  2DNQ A;  4TU7 A;  5L1J A;  1Q7Y T;  3CC2 S;  1U4B A;  1RI7 A;  3C6T A;  4P2X A;  1Q0N A;  1HI1 A;  3CJ8 A;  3RYL A;  3RW7 A;  3VZI A;  2EFN A;  3MM6 B;  5KFG A;  3MD1 A;  3OR2 A;  1RAG B;  3DRS B;  3I56 S;  3OQ2 A;  1UWA A;  2V6A A;  4IH5 A;  2DR9 A;  1NCL A;  1NBE B;  3FVY A;  2QYC A;  2E44 A;  3BYP A;  2HVD A;  4HDG A;  2MHN A;  2P8I A;  2JC0 A;  3GJQ B;  1G3O A;  3GQC A;  4W92 B;  5AXL A;  3AOA A;  2BZ2 A;  2KHC A;  1EKR A;  4M5J A;  1CJK A;  4PRF A;  1TL4 A;  5I3Q A;  3BBB A;  3ZC4 A;  5LJ3 Y;  2DJW A;  3ZTP A;  2ZBP A;  3R6G B;  4M5L A;  1TV6 B;  5IT0 A;  3KLH B;  1V5V A;  3ISZ A;  2JFD A;  3BSA A;  3NY0 A;  3R5D A;  1N0V C;  2QMU B;  1NKB A;  2HYI B;  1NND A;  1RIS A;  2N4C A;  1YGY A;  1KD1 T;  5D0E A;  2FJD B;  3ISN D;  2K1R A;  2W24 A;  4D3G A;  5CYQ A;  4JI4 F;  2LA6 A;  2OPS B;  2IA6 A;  2VF3 A;  4WE1 B;  3MED A;  3GTY X;  3R7B B;  3DLJ A;  4J9N A;  4KR0 B;  3NS5 A;  4LSL A;  5KOX A;  2EFO A;  3P45 B;  2EBG A;  2COL A;  1NJI T;  1QJH A;  1S72 S;  2VFT A;  4Y3C A;  5A8R B;  3CCL S;  3TJ9 A;  2GX8 A;  3GR0 A;  4DU7 A;  1S49 A;  3FMB A;  1UVK A;  3ENV A;  2F63 A;  2I2Y A;  5I3P A;  3QT5 A;  1MG7 A;  3A1Y G;  2HVZ A;  4ZPD A;  1RT5 B;  1RWN B;  3SXL A;  3G96 A;  4I6W A;  1BXN A;  2ZH5 A;  2ZJP Q;  1Q8I A;  5KG6 A;  2BR0 A;  4KV8 A;  2DNM A;  2FHK A;  2K3I A;  4U95 A;  2ZH7 A;  5LXR A;  1EET A;  3PYE A;  5AXK A;  2W4C A;  3QT7 A;  2ZNY A;  3KJV B;  3ITH A;  1IN0 A;  3GMG A;  5IOL A;  2PA3 A;  4CH1 A;  1R8C A;  5KT7 A;  4J91 A;  1U09 A;  3N0V A;  3C14 B;  1VIS A;  5L46 A;  5KG7 A;  1NK7 A;  1VK3 A;  3GSI A;  2CJX B;  1EB0 A;  3CCM S;  1W25 A;  2JLE A;  3SFG A;  4ZN3 A;  1LK5 A;  3BSC A;  1CJT B;  3R5B A;  4DR7 F;  2FPH X;  3OFG A;  1RAE B;  4B9L A;  1RAC B;  1S59 A;  2HFN A;  4H4K A;  1S1V A;  1T11 A;  2VG7 B;  1WHX A;  3V5R A;  2Y0S D;  1RGV A;  3HPO A;  1M5K C;  3G71 S;  4LRD A;  4HAC A;  1NO8 A;  4O23 A;  3GG0 A;  2A18 A;  4K5S A;  4GO5 X;  3W8G A;  1H6K X;  4ID8 A;  2H5J B;  1F5C A;  1PSD A;  3VTI A;  2KDO A;  5ETR A;  4QOT A;  3EZO A;  3MD3 A;  1MSW D;  2G2Z A;  1JLA A;  5EN1 A;  4C0B A;  3DM2 A;  2CVI A;  3A13 A;  2GMJ A;  4JUZ A;  1EAR A;  4RW6 A;  3SDE A;  2BAN B;  3AH6 A;  3PVX A;  2LEB A;  3VGV A;  3NGD A;  2RIL A;  3J7Z 5;  2XSJ A;  2E5J A;  3QFW A;  6FD1 A;  3D28 A;  3KK3 A;  1JIH A;  5CAA A;  4FXD A;  1FT8 A;  1HMV A;  1FVS A;  1EAY C;  1UVI A;  4R0E A;  4ZJL A;  3BJY A;  3DDK A;  2W9B B;  1T03 A;  3GV7 B;  2IM0 A;  3FCV A;  2PFF B;  2VB6 A;  4K8R A;  4ZP6 A;  3NEK A;  1VRU B;  3MCM A;  3GCX P;  1RLD A;  2V2Q A;  3I96 A;  3M8Y A;  3K89 A;  1XMQ J;  1ZYQ A;  2IYI A;  4ANC A;  1HFE L;  3NS7 B;  4EBE A;  5D4L A;  4DR7 J;  5CZX A;  4USV A;  1KRP A;  4OZ1 A;  1SKR A;  2DD8 S;  2VIC A;  4RW8 A;  4MFB B;  2FTR A;  3OVB A;  1RAA B;  4YDD B;  5KFT A;  1P8G A;  3HFV A;  2X7I A;  4MKA A;  1SJ4 P;  4YB7 A;  3QGH A;  4IR1 A;  2W2M P;  4MKY A;  2QMW A;  2IDE A;  4BBY A;  1S0O A;  4NCA A;  4A8M P;  5C2G A;  2O5D A;  3POT B;  3M9O B;  3LGM A;  2BQ3 A;  1SL0 A;  1RTJ B;  2Z2Y B;  2F8E X;  5DDR C;  2UXD F;  2YKM A;  4FPI A;  1RKJ A;  2CPF A;  3I31 A;  4ZP7 A;  3DHX A;  4P2M A;  3HI9 A;  5E41 A;  3DGV A;  4I7F A;  1N5S A;  3DRX A;  1TKZ B;  2G2O A;  4M5N A;  2XS2 A;  4QWB A;  2RIJ A;  3EXY A;  1DRZ A;  3CO9 A;  2AQ4 A;  3CME S;  1M1G A;  4HHH A;  2MKH A;  4G3I A;  4ZPV R;  4HYK A;  3DRP B;  4NLT A;  1VBZ A;  2AW0 A;  5J2N A;  4LJM A;  2E5G A;  4XK8 C;  2XZW A;  4DFK A;  5DGA A;  4IUF A;  1FRK A;  2VKZ G;  1RWU A;  1SPB P;  1IR2 A;  4XAK A;  5CH7 B;  2CNK B;  2BJ7 A;  2GVD B;  2A3J A;  1S9F A;  3CCU S;  1JLQ B;  3MMJ A;  3IR7 B;  1Z1Z A;  1TK0 A;  2MKS A;  3D68 A;  2YNG B;  4YP3 A;  2HQ3 A;  5CCL A;  2R42 A;  3C15 A;  4Q44 A;  4NL5 A;  1R89 A;  3I5B A;  1S5Z A;  1Q8B A;  3PZP A;  2GQQ A;  4OZ5 A;  2LEA A;  1FJG F;  4L6V 3;  1YZ7 A;  2MQO A;  2XY7 A;  2HBY B;  3MPV A;  5HRO B;  3IBF B;  1HD1 A;  3UR0 A;  2J8A A;  1AB8 A;  4LBH A;  4OL8 A;  3KUH A;  2KVQ E;  5IT4 A;  2RDJ A;  3KTQ A;  4B3R F;  1BD6 A;  3TAP A;  4AFF A;  1FE0 A;  1JNR B;  4K0K F;  1FXD A;  4RJV A;  2O67 A;  2UXD J;  2IFX A;  1X4H A;  3MEE B;  1H2U X;  2R9L A;  4Q0B A;  2K2P A;  2KKH A;  1PJ7 A;  2XGP A;  4UUW A;  4PG5 A;  3M4X A;  2DHG A;  4OYZ A;  2ZHB A;  3EVO A;  3Q83 A;  5LJ5 Y;  4C11 B;  1K0T A;  4J90 A;  1GX5 A;  2XCA A;  3HVT A;  2H3E B;  1KON A;  3BH6 B;  4KSE B;  5B0A A;  2UU9 F;  2CPE A;  2B9W A;  2CJK A;  3KJN B;  1MW7 A;  3OBI A;  5C2C A;  4OZ0 A;  2AJF E;  1FX4 A;  2RU9 A;  4C0O C;  3HHL A;  2ZH2 A;  3VR1 A;  1F5A A;  2ZUA A;  1IKY A;  4C3M A;  4ELV A;  2KFN A;  3FQK A;  4JI7 J;  2MGZ A;  4DV5 F;  1NXI A;  3ZTS A;  4ZVQ B;  2QV6 A;  4TXS A;  3RAM A;  1SIW B;  2YQ1 A;  1S6P B;  2QN6 B;  5ETL A;  1ZA1 B;  3G6Y A;  1HWU A;  1S1U B;  3HSJ A;  3NWR A;  3GFY A;  3M6X A;  2RUS A;  4HT7 A;  3L95 X;  1G4C A;  5KT3 A;  1RT1 B;  1M1H A;  1JK9 B;  5IM0 B;  5D15 A;  4C8Y A;  1X0P A;  1HNX F;  5BYQ A;  1YRU A;  4IKA A;  1U6Z A;  2C42 A;  1SJF A;  7AT1 B;  4B3R J;  4ID5 A;  2Y3Y A;  3UO0 A;  2BE9 B;  1S9E B;  2Z2Z A;  4ZN1 A;  1Y5L B;  3N5B A;  3PTW A;  4K0K J;  1YBU A;  3KMS A;  3MEC B;  1CJK B;  2AYE A;  5KFI A;  2F9J A;  3O8W A;  2KZM A;  4CTA A;  1FJE B;  4KFB A;  1QD1 A;  1HW9 A;  4K4W A;  3D7S B;  1BQN B;  1HYS B;  1FD8 A;  3GFX A;  5HMZ A;  5D0R A;  1HQU A;  2IVM A;  5I42 A;  2NZC A;  1VIX A;  4JI5 F;  1XNR F;  4KGK A;  2MZT A;  1HBM A;  4MK7 A;  4NLQ A;  2QL5 B;  1BGX T;  2P6S A;  3J81 Y;  2J76 E;  1T9U A;  3MMC B;  4JI6 J;  4H4O A;  4RNF A;  4IOB A;  3VGS A;  3OUY A;  2GQC A;  2UU9 J;  1IXK A;  2D9P A;  5CYQ B;  4B9S A;  4RNO A;  4PR6 A;  3Q2S C;  4LRB A;  1NLK L;  2DEJ A;  2M88 A;  2F40 A;  3UNG C;  4GKK F;  3U1L A;  3NNC A;  1NDC A;  2ZOG A;  3L7P A;  3IXQ A;  4FVM A;  1TL3 B;  2VDI A;  3CPW R;  2DHS A;  2AU0 A;  3Q89 A;  4CQ1 A;  1FE4 A;  1TL7 B;  2QYG A;  4L75 A;  2RNE A;  1NRK A;  2HK3 A;  5KFP A;  5I3U A;  3W61 A;  3EUN A;  2H9Z A;  3DXS X;  2MPU A;  3JAM Y;  2ATC B;  3MEG A;  1DLO A;  2CXE A;  2D9O A;  4X4O A;  4QIW D;  1S6Q A;  4YB6 A;  5B0E A;  2OPP A;  2AD9 A;  4WXO A;  1VR6 A;  4UZB A;  5SUH A;  4YS2 A;  1ZBT A;  2OPQ A;  3MTJ A;  2CVE A;  3KLF A;  2OP5 A;  3IGN A;  4OJ3 A;  2E5L F;  3ET6 A;  2ASY A;  1HQE B;  4DHV A;  1VIO A;  2JX2 A;  2YQ0 A;  1S4F A;  1Y9O A;  1P6T A;  3L9Z A;  2QA4 G;  4H54 A;  2KXN B;  5C42 A;  4GKJ F;  1FDD A;  1S0V A;  2WB4 A;  4TLQ A;  2W8L A;  3KDN A;  4QPT A;  3PJX A;  2H5E A;  4P71 A;  4JI5 J;  3BGU A;  1U8S A;  5DM7 Q;  2C3M A;  4RPF A;  4PXD A;  1Q7L B;  4USK A;  4USH A;  4DV1 F;  3CMQ A;  2AEJ A;  4FDF A;  3BGL A;  1XNQ F;  1QAX A;  3CJ4 A;  5C25 A;  1FHT A;  4ER8 A;  1KHW A;  2BOA A;  2ERR A;  2DRA A;  4CDI A;  1HAR A;  3CB4 A;  1NH8 A;  3H2V E;  3TUJ C;  4OJ1 A;  5KFA A;  1HQ2 A;  3NGS A;  1YJR A;  5JVH Q;  1VRT B;  1P27 B;  2RF2 B;  1WOS A;  3MPY A;  4HAC B;  3DHW C;  3G87 A;  3BDP A;  1DAX A;  1YX2 A;  3M2V B;  3PRB A;  1H7X A;  1LEO A;  1HNV A;  5KFH A;  1U8W A;  2BMB A;  1VC6 A;  2J9C A;  2B8Q A;  4DCO B;  1UP1 A;  3IP0 A;  4LT6 A;  4ZPC A;  2KN4 A;  4JI1 F;  3WIU A;  3EX7 B;  2IBO A;  3DMJ B;  5HVG A;  4FNI A;  4X65 J;  3H0P A;  1RTD B;  3J7Z T;  2BAC A;  2VPX B;  4BLG A;  4JV2 A;  3MM7 B;  1IKX B;  1X60 A;  2JNJ A;  2R8H A;  4KT0 C;  5KFO A;  2BOP A;  1F2G A;  4DI6 A;  2WSF C;  4AXJ A;  4N56 A;  3OT9 A;  1K0V A;  2NUU G;  3IWN C;  1ZET A;  4LF5 F;  4U8Y A;  2WK4 A;  4HDH A;  4DV3 F;  1G7C B;  4GKJ J;  1XBW A;  1NME B;  4X4P A;  2YWH A;  3M6U A;  1N48 A;  1SKW A;  5KFL A;  2HSE B;  1P1L A;  1MRO B;  5HSP A;  2YVS A;  3KG0 A;  4U67 Q;  4E8U A;  2C28 A;  2J6T A;  3GYX B;  3BPS P;  4ATN A;  3AT1 B;  2HBQ B;  2KO1 A;  1UEU A;  2A0F B;  4DV1 J;  3J81 j;  4WFB Q;  1QTM A;  1XNQ J;  5GAD U;  4IRD A;  4X4N A;  3DDI A;  5DG8 A;  4LRF A;  1S57 A;  2RQK A;  4NE9 C;  3WBZ A;  4RWW A;  3M8Z A;  3CD6 S;  2HW3 A;  1LXN A;  2L08 A;  1N5Y A;  2LXF A;  4ES3 A;  2MKJ A;  5HBM B;  4NLO A;  3SSS A;  2E66 A;  1S1X B;  3FFI B;  2JSX A;  2VG6 B;  2GHP A;  2B51 A;  4FNH A;  3JXO A;  3OVS A;  2J9D A;  4OZN A;  3AA8 A;  2YKA A;  1G6B A;  2CPX A;  2AHO B;  2VOD A;  2E7W A;  3JYT B;  5ETS A;  1JJC B;  3RRH A;  4GVL A;  2E1P A;  3NCP A;  3P96 A;  3N01 A;  3AOD A;  4NRT A;  4UOC A;  1BQM B;  4DWI A;  2H5I B;  5J2N B;  2JEG A;  2MMY A;  5GME A;  1F9H A;  2X3D A;  4PUO B;  2MZS A;  4LF5 J;  3K7R A;  2YNH A;  2BJ8 A;  4JI2 F;  2ZZT A;  4DV3 J;  2DNO A;  3JQM A;  3EGN A;  2YKN A;  3D0H E;  3H4B A;  4CYU A;  1F60 B;  1ZS6 A;  3T1Y F;  4RLE A;  3OL6 A;  3C15 B;  2A2C A;  2R2T A;  3TAM B;  3B82 A;  5KFB A;  1QAY A;  4B9M A;  2DGS A;  2M3D A;  1Q1K A;  3QAU A;  4KIA A;  3GSD A;  3H25 A;  2HFZ A;  1YJN S;  3W65 A;  4F4X A;  3CUL A;  5F0U A;  1SB6 A;  1TK8 A;  2ASD A;  3MR6 A;  3GIK A;  2Z4P A;  4OZ2 A;  2FJV A;  1AT1 B;  1YJV A;  1RBA A;  5DDQ C;  3NCQ A;  4F04 B;  1LKZ A;  3IBC B;  5AT1 B;  4LBP A;  2EBE A;  5DS7 A;  2MQL A;  3CTR A;  4OI4 A;  1IQT A;  2V8H A;  3BGR B;  2X3G A;  4O4G A;  1WC0 A;  2QLW A;  2HGN A;  5KOW A;  2J7U A;  3HHK A;  3G6V A;  4NAS A;  4AT1 B;  4IFV B;  1SI9 A;  4DN0 A;  2OGU A;  4U96 A;  3KLV A;  2DCU B;  4DPW A;  3PXG a;  2JEI A;  1HBN A;  1F1B B;  1CS4 B;  4LSN A;  3TWZ A;  3TAQ A;  3JQK A;  2D69 A;  5C24 A;  3EGZ A;  1FES A;  2WVC A;  2HFU A;  5K14 A;  4F8R A;  2FY1 A;  2J0S D;  5EDW A;  3R5C A;  4OYI A;  1MU2 B;  3VAG A;  4V19 J;  5F8G A;  2LYV A;  3D3B J;  1S6U A;  1WKK A;  3H5S A;  4OLP A;  2AGQ A;  3HHD A;  2W7O A;  4ED4 A;  1A6L A;  2MTL A;  1QM9 A;  3Q8V A;  2JC1 A;  4AQY F;  3OW2 R;  4QIG A;  2MQN A;  4NCG A;  1PO6 A;  3TYT A;  5EWG A;  4UF4 A;  4J9R A;  1FI4 A;  4JI2 J;  1RTH B;  4QWA A;  1I94 F;  2VV5 A;  5F9N A;  3Q8Y A;  1CJV A;  3FUY A;  2HHP A;  3M2U A;  3IMQ J;  2Y8W A;  3OTE A;  2MKY A;  1NSQ A;  5LMU F;  2BKP A;  4DL5 A;  1U02 A;  4X62 F;  2XLK A;  2L48 A;  4Q2M A;  3CUN A;  3PIO Q;  1HWJ A;  1LWC A;  2BW7 A;  4XDC A;  1WG5 A;  4K4T A;  1GT8 A;  1J5O B;  3FBE A;  2MEW A;  3VHQ A;  1JXV A;  2KI2 A;  1Y11 A;  2H54 B;  1ZAX A;  2MXY A;  4KKO B;  4RNN A;  3RZA A;  2SXL A;  1KP6 A;  1QUV A;  1NK4 A;  3VAM A;  2RKI A;  3DYA A;  5EWE A;  4UQG A;  3P8B B;  3DGP A;  3VVU A;  2CPJ A;  3MPU B;  2B43 A;  2CNN B;  3UN5 A;  2UUC F;  2G0C A;  2J7W A;  1YSJ A;  4ZVT B;  1S6O A;  2V9W A;  3ZZP A;  3LUY A;  2XNQ A;  1URR A;  2QLX A;  4DEZ A;  2D74 B;  4CTA B;  4ZVH A;  2M8H A;  4G1I A;  4O3P A;  3KHH A;  1WSR A;  1SJQ A;  2JHE A;  5KG3 A;  8ATC B;  1JJ2 R;  1KHV A;  3R3T A;  4IG0 A;  2HLU A;  1DTT A;  4O0N A;  3F44 A;  4A8O A;  3BQ2 A;  4HTI A;  2J7K A;  4ZIV A;  3H5U A;  4K50 A;  4X64 J;  1T02 A;  5DJB A;  3OLB A;  2MHE A;  3LGH A;  4WP3 A;  5D6G A;  1T05 B;  3LWL A;  1IKW B;  1C0T B;  4ZJQ A;  3HMJ G;  1VGY A;  4X4U A;  1OYE A;  8RUC A;  4AQY J;  1CBK A;  3HSZ A;  1XMB A;  1IJF B;  2WW8 A;  2D3U A;  5E3C A;  3C16 A;  2HHQ A;  5LMN J;  1VLY A;  2DO0 A;  3D0I E;  1Y5N B;  1I94 J;  3N79 A;  3GIL A;  3TUP A;  1PC4 A;  4TY8 B;  4OZ3 A;  3US5 A;  3SV4 A;  3IBW A;  1S1W B;  1LFP A;  2KHD A;  4P7T A;  4QU7 A;  2FHJ D;  4DG1 B;  1UMJ A;  2ZKU A;  4X62 J;  3K57 A;  4MK8 A;  4A47 A;  1DLO B;  4CH7 A;  2F3J A;  3BR9 A;  3UDE A;  2FHO B;  5E3P A;  3VF0 B;  2OPP B;  3SI8 A;  2M7S A;  2QL9 B;  2IC3 A;  1RSC A;  1D9A A;  1N34 F;  3IG1 B;  1Q53 A;  3HFZ B;  3SCJ E;  3CCW A;  1U0H A;  2DNH A;  2UXC F;  1UW9 A;  2GNK A;  5K8P A;  3AD8 C;  2P6T A;  4DR3 F;  4HLB A;  1FDN A;  5FDL B;  3CF5 Q;  3BGO P;  3E3X A;  1O6X A;  4X4S A;  3OR1 B;  5JJB A;  2V94 A;  2DGQ A;  3QT6 A;  4YDX A;  4YEA A;  2I1R A;  4DR2 F;  2FLO A;  4F02 A;  3NBP B;  2HHU A;  2HHT A;  5J2P B;  3T3F A;  1KLM B;  1X5S A;  4DUY F;  5J1P A;  1APS A;  2LXI A;  4EU0 A;  4J9S A;  1UJ4 A;  4IFY A;  3BQ0 A;  4OIX A;  4LF7 F;  1Q86 T;  3PX4 A;  1EQM A;  3DOK B;  2C2O B;  5L9N A;  4TQR A;  4Y2M A;  4DLG A;  1Q81 T;  4MYT A;  4ECX A;  1G2E A;  1RWW B;  3CDA A;  1U1L A;  1H98 A;  4ZVU B;  4D3H A;  2QG9 B;  2QFJ A;  1B7F A;  2EKN A;  2EC2 A;  2MJN A;  3GIM A;  2KG0 A;  4PZV A;  4WP8 A;  1RWO B;  4MTP A;  4QJV A;  4ERD A;  3FBC A;  1MWZ A;  2XHW A;  2RQM A;  4C4W A;  7FDR A;  4CLT A;  3FMW A;  3NGT A;  1MLA A;  2IM3 A;  2JH3 A;  3AOC A;  2ZVI A;  4MIA A;  4ECY A;  1RHM B;  3VQT A;  3CD7 A;  1Q8L A;  5KFZ A;  4LF8 F;  1NZ8 A;  2KVI A;  1FA0 A;  4NLR A;  4NA1 A;  2WOM A;  1EIY B;  3S6E A;  1NKE A;  3UFC X;  3J7Y I;  3SQG B;  3EPI A;  4ZVE A;  1S99 A;  4DR3 J;  1XWL A;  5ETM A;  3CJS A;  1ZM2 A;  2K7K A;  2DGO A;  1UJ6 A;  1KFS A;  3SIP B;  3OSP A;  4L74 A;  2IRU A;  3Q24 A;  1FNM A;  1YJ7 A;  1N4L A;  2PE8 A;  2KFY A;  1TFY A;  3KG1 A;  2V68 A;  4Y2A A;  1OY9 A;  4Y34 A;  2ZH3 A;  3HD2 A;  4DUY J;  4MT1 A;  2DXE A;  2ZHO A;  4FN5 A;  2BKO A;  1I3O B;  1FKP B;  4H4M A;  4RW9 A;  3TX0 A;  3TI0 A;  5BJR A;  3W9I A;  3BO4 A;  2CDQ A;  3LAN A;  3NMA A;  1OSD A;  2AF6 A;  2XHC A;  2DIV A;  1RZM A;  5M2U A;  3ZNU A;  1X7V A;  4QW8 A;  1IBL J;  3CCR S;  4KYZ A;  5J2Q A;  1VFJ A;  4DR5 F;  3I5A A;  1SJ3 P;  3DRY A;  2E9Z A;  2RB7 A;  4TYA A;  1T0T V;  4ZPW R;  1T8E A;  2QTW A;  4F36 A;  1HNZ F;  1KKH A;  2NCK L;  3W60 A;  2MZQ A;  3B78 A;  2FZK B;  2DGT A;  3QGI A;  4J9Q A;  3AOB A;  3SZ2 A;  4NML A;  3SSR A;  4PQU B;  3T9N A;  4ZVO B;  4IH7 A;  4J9U E;  4ECZ A;  4K4Z A;  1REG X;  5D77 A;  4OV6 A;  5B0B A;  4Z2X A;  4F4Y A;  2PFD A;  1S76 D;  4LF8 J;  4JI3 F;  1SH2 A;  2FJA B;  4X2B A;  2CIM A;  2XSF A;  3HDS A;  2KT5 A;  5GAG U;  2HPU A;  3W2V A;  1JJ4 A;  1EKS A;  1SIZ A;  1XK8 A;  4FXV A;  2IRY A;  2FVR A;  1TVR B;  2YWE A;  4FXW A;  2VQE F;  4QU6 A;  3E01 B;  2CPH A;  2YNH B;  4PAB A;  3GJT B;  3H42 A;  2LFV A;  4FYV B;  1L3K A;  2RHS B;  3QZ7 A;  3C6U B;  2JFK A;  3DLK B;  3BGF A;  3W2W B;  2Z57 B;  3J80 U;  4LVO P;  4WKY A;  2B0G A;  3FGV A;  1IBM F;  5MLC V;  3QZ8 A;  2HFS A;  3QWU A;  5DG9 A;  3BZQ A;  1JLC A;  2DR5 A;  1YBT A;  4LIW A;  4DX5 A;  3N28 A;  1WC1 A;  2DPI A;  1HWI A;  4OI0 A;  3CDW A;  1F3V A;  3S7R A;  1SC6 A;  3BKF A;  3HJV A;  1HR0 J;  4JI0 F;  4CO2 A;  1UWB A;  5AE2 A;  3K59 A;  1RK8 A;  2M0G B;  5B7W A;  2VBW A;  1RWK B;  2HUR A;  4OX9 F;  4NYO A;  1R0A A;  3JSR A;  4A8Q A;  1U26 A;  3KHR A;  4WZM A;  1EP4 A;  4YOE A;  1C4A A;  1VBX A;  1SH0 A;  2R7T A;  4NZ6 A;  3CD0 A;  1H2T Z;  1K73 T;  4LSN B;  4ED3 A;  1S10 A;  3M1V A;  5D4P A;  2V67 A;  1GTH A;  4JI3 J;  2L9W A;  2WVF A;  4J9K A;  2ASL A;  1IKV B;  1KOH A;  2W01 A;  3TVY A;  4LIR A;  5HO4 A;  4DOZ A;  4KH0 B;  2VJU A;  3F0N A;  1FX2 A;  2PC6 A;  5HMW A;  2UVV A;  1U49 A;  2ZBR A;  4GC6 A;  2OO4 A;  2HEK A;  3FZB A;  3OLA A;  3KLG B;  5HN0 A;  4B3M F;  2Z56 B;  4LRA A;  2MKI A;  5GAH U;  4KE5 A;  1UFL A;  2ZBC A;  2RQ4 A;  1GMU A;  1YLX A;  2Z8Q A;  2J6S A;  4UST A;  5F8M A;  1AFJ A;  1XIQ A;  1H2V Z;  1VS3 A;  2C3Y A;  1AW0 A;  2AIR B;  4LR9 A;  3M2U B;  1IJE B;  4ANE A;  2X1F A;  1IUJ A;  4J7C A;  3ICL A;  2IRX A;  1W2I A;  3DNC A;  1LW0 B;  4LFB F;  4DR4 F;  2Y8Y A;  2DNG A;  2C3U A;  1TAU A;  4DV7 J;  4QWE A;  2N3L A;  1LK7 A;  1S0M A;  4DUZ F;  3UR3 C;  4ZHR A;  2DH9 A;  4OHZ A;  1NJZ A;  5JXS A;  3G6E S;  1FJC A;  3GII A;  4X4R A;  4JI0 J;  2Q6C A;  2GZO A;  2L9N A;  4OX9 J;  2BJD A;  3L4B C;  2M5Y A;  2E1R A;  4KQZ A;  4ED6 A;  3PYF A;  2VFU A;  1VQ7 S;  1RTI B;  1TMJ A;  2J9D E;  1KOO A;  3K2Y A;  1GTE A;  3TQ1 A;  4DX7 A;  4NCB A;  4GC7 A;  5ADZ A;  2VG5 A;  5D0H A;  2KYZ A;  3PV8 A;  1GMW A;  3FZ2 A;  3GV8 B;  4ZVG A;  3SCL E;  2R7X A;  5ETT A;  5CD4 A;  1RJJ A;  4NZ7 A;  2EKY A;  3RW6 A;  4LQ3 A;  6FDR A;  3CED A;  1FWL A;  2YNF A;  2B7C B;  3UPF A;  4B3M J;  1S97 A;  1NDK A;  3WZ0 A;  1WWH A;  5LT5 A;  3M30 B;  1NM2 A;  3AFG A;  4B9N A;  1HLW A;  2IHR 1;  2QA2 A;  2FUG 9;  4PYA A;  2BJ1 A;  4DS5 A;  3QSY B;  2ZD1 A;  3QJL A;  1K9M T;  4N8O A;  1VHI A;  3D0G E;  2FB0 A;  1TKT B;  2OEK A;  2MYF A;  4NLS A;  4P73 A;  2OEJ A;  1FVQ A;  4Y0F A;  2E9T A;  1RHR B;  4M95 A;  2IJF A;  4LFB J;  4DL0 C;  3H98 A;  1C0U A;  3DU5 A;  5BXI A;  3KLE A;  4F3O A;  1DBD A;  5CCM A;  3FK4 A;  5GMD A;  3WC2 A;  2OMO A;  1NK9 A;  3I0S B;  5CYJ A;  4ECR A;  1U24 A;  3AXK A;  2GV1 A;  1CC8 A;  1RAF B;  5HP1 A;  2O01 C;  1WC6 A;  1N56 A;  4A46 A;  4HI2 A;  4IH6 A;  1RHK B;  2XI2 A;  2WW4 A;  1HIY A;  4PAA A;  3ZTQ A;  3MUM P;  4WTO B;  3KK2 B;  1ZAW A;  5T7L B;  4EGL A;  5ETQ A;  4PG8 A;  1X4D A;  2UVU A;  2CQH A;  1ZTT A;  2XY5 A;  3OJU A;  2OHD A;  1F3F A;  2CQ1 A;  4H4K C;  2I9S A;  2YWG A;  3MR7 A;  1MWY A;  1H73 A;  6AT1 B;  1YJU A;  2H65 B;  2WAQ D;  3HVW A;  1HBO B;  4IFY B;  3LQV A;  1JB0 C;  2V9K A;  1VBK A;  1N36 F;  2C2E A;  2ZDP A;  3V81 B;  1HNW J;  2XZT B;  2CJB A;  2ZE2 B;  2P5V A;  2B4U A;  4DF8 A;  4A8F A;  4LFA F;  4F25 A;  1NK5 A;  5AJ3 J;  4NLX A;  1JKH B;  5HJY A;  2BVZ A;  2GJF A;  1LQ9 A;  5F3Z A;  4PG6 A;  2IAJ A;  5A0Y A;  4CLK A;  3GIR A;  1SXL A;  1IR1 A;  3PKM A;  4KHM A;  4NPO A;  2XO7 A;  2X51 A;  3W66 A;  4NRU A;  5H1S V;  3PFO A;  1WEL A;  3K0J A;  2F4V J;  2UZA A;  3LF0 A;  3BDE A;  1UZD A;  3UE2 A;  1PKU A;  3T1H F;  3UN2 A;  4GVB A;  1EZZ B;  3U02 A;  3R1H A;  5G0R A;  5K20 B;  4DSE A;  5D78 A;  1KQS R;  3GJS B;  1TUV A;  5IWA F;  1CEZ A;  1LWE B;  3LP0 B;  1R8B A;  3NNA A;  2J0X A;  3B4D A;  8AT1 B;  3ONQ A;  3RR8 A;  1Y4Z B;  2HHH F;  1HPZ A;  3MM9 B;  2WVD A;  3UWT A;  4FS1 A;  1JLF A;  1HWK A;  1HBU B;  2OPR A;  2HMI B;  1QE1 B;  2HQI A;  3ENQ A;  1X8D A;  1NSA A;  5J1E A;  3DCA A;  4LFC J;  1OPI A;  3ZZO A;  1X4F A;  5L9X A;  3TA1 A;  3RG6 A;  3IAS 9;  5BYS A;  3CJK B;  2ZZM A;  2VON A;  1N6Q A;  3G82 A;  1V5I B;  2N7C A;  1YQH A;  1HL6 A;  2O1P A;  4PWW A;  1C1B B;  2K3K A;  1XMO J;  5L1I A;  2HHV A;  1WDT A;  3CJ0 A;  5FD1 A;  4EO8 A;  3O44 A;  2H48 B;  4Q2L A;  1RT4 A;  3PHT A;  3FRY A;  3MMB B;  3CO0 P;  3KWM A;  5F8I A;  5IV4 A;  1IR0 A;  2BE2 B;  4CO3 A;  3W5X A;  3U7J A;  2RD5 C;  4FF1 A;  1E6Y A;  2HS0 A;  4WKR A;  1K8A T;  1WTB A;  4MIB A;  4C8L A;  3X3U A;  4DUT A;  1RP5 A;  2F9D A;  3M8P A;  2Z0G A;  5JUM A;  2D41 A;  4A8Y A;  3IR5 B;  2HHS A;  2CPZ A;  4ILM A;  1S9G A;  4FF4 A;  3B4M A;  3Q8R B;  3O3L A;  2B4V A;  3A8E A;  3L7O A;  5IWA J;  2YXL A;  3QGP A;  4W90 B;  1YDL A;  2KH9 A;  3ISN C;  2HHH J;  2DH7 A;  2V2V A;  1RT6 B;  2CJ9 A;  4I2Q A;  3MGJ A;  3DOL A;  1SL2 A;  2XCP A;  3IFE A;  5D4O A;  4U7C A;  3N6N A;  4F4Z A;  3R8Y A;  3TZX A;  2MLZ A;  2C2Z B;  5IT9 U;  2E7X A;  3ILO A;  3TNV A;  1LW2 B;  4B3O A;  5HVH A;  3M8Q B;  5IFM A;  1CUL A;  4C8Z A;  1REV A;  3SFU A;  1P9Y A;  2V5H G;  2ZOM A;  3RGI A;  2AZ1 A;  4DCP B;  4B3S F;  4CNY A;  3AAW B;  4BC9 A;  1EJ7 L;  4Z7Y A;  2HND A;  2MY7 A;  3HUL A;  1Q16 B;  4Y2C A;  1AZS B;  4ICL B;  5K5M A;  1DHM A;  4KO0 B;  3PG9 A;  2LCW A;  5HQM A;  4G1P A;  4I69 A;  1TL1 B;  1UEV A;  3AB2 B;  1X5T A;  1U1R A;  2C3P A;  3V6D A;  2W25 A;  3KG4 A;  1QSS A;  4Y6I A;  2M52 A;  1TZ0 A;  1CJU A;  3FSX A;  1RT7 B;  3QLH A;  1CPZ A;  4U8V A;  2JJ4 D;  2WHO A;  4NXN J;  3B54 A;  2MQP A;  3M2R A;  3KLI A;  5CHC B;  1WSV A;  2VQF F;  1BUX A;  2I8E A;  2YX1 A;  2ATL A;  1OQ6 A;  2HHX A;  3GE9 A;  1S1T B;  2YNI B;  4MMO A;  4DX8 H;  2NXE A;  1VDH A;  4RX6 A;  3BV8 A;  4ILR A;  1NJX A;  2PEH A;  1I51 B;  4ZVF A;  5KFE A;  1U45 A;  2ZZN A;  3C8Y A;  4LF6 F;  4DX6 A;  1UAW A;  3HLU A;  2RDI A;  3HHL C;  2HHW A;  5F3T A;  5D3G A;  2NPF A;  3D6M B;  4CO5 A;  5M2P A;  5A8K A;  1D09 B;  5HL7 Q;  4ZVS B;  4WIQ A;  1T9X A;  3QIP B;  4CNZ A;  2NLW A;  3R9L A;  3UVJ B;  2R7U A;  2I38 A;  2CWK A;  1S77 D;  5KFJ A;  1ZM3 A;  4Y28 C;  3THT A;  3RBZ A;  5FLX U;  3ILJ A;  3LP2 B;  3QAT A;  4S0M A;  3V6H A;  3QO9 B;  1VQS A;  4DBQ A;  3VGU A;  4CO0 A;  2Y1R I;  1KQK A;  3CDE A;  1VQ4 S;  3Q8S B;  4RWX A;  2J0W A;  3KNA A;  4O44 A;  1D8Z A;  2WON A;  2XWY A;  4B3S J;  2XYG B;  5LSL A;  1S0N A;  5LOQ A;  1NSP A;  4C8N A;  4N7T A;  3M7V A;  3RB6 A;  1VBY A;  4IO1 A;  5DDP C;  4C0H A;  2LXU A;  4KHR A;  4KJI A;  3T9Z A;  5IC6 B;  2ZH6 A;  4ZHR B;  3HXM A;  5GAE I;  5B0G A;  1RA6 A;  3R6L B;  2Q43 A;  1KBR A;  3GFH A;  1L3U A;  1QVG R;  1RT3 A;  4BWJ A;  3PX0 A;  4C3L A;  2OKQ A;  1BY9 A;  4QIE A;  2VQF J;  4RW4 A;  3MUT P;  2V4R A;  3LPE A;  2YBV A;  4O0I A;  2EXU A;  2ZUG A;  3NNH A;  3NGR A;  1TU0 B;  4WFX A;  3PFE A;  3V4M A;  4NZ0 A;  4JOU A;  3U1M A;  4LVN P;  4LF6 J;  2GVZ A;  3HKZ D;  3ETO A;  5HLF B;  4RL1 A;  3AXM A;  3TOQ A;  1ZAV A;  4I56 A;  2LA4 A;  3BF4 A;  2GAH C;  2YKQ A;  1VQM S;  4CT9 A;  4F4K A;  2UXB F;  2KZZ A;  3QPI A;  4FYW B;  4K2J A;  2FJB B;  1VOM A;  2XMK A;  2R7V A;  3HX9 A;  5KFU A;  2Y1J A;  2XM3 A;  1ZM9 A;  1VRQ C;  4JV5 F;  4KBI A;  4M1K A;  2LEC A;  2OUG A;  4IG3 A;  3PY8 A;  3FQL A;  1I6J A;  3IR6 B;  3TEG A;  5KFC A;  3LH2 S;  5J2M A;  5H9F J;  1TKD A;  2Q3P A;  3HHL D;  2HVH A;  1SBR A;  1XMQ F;  4RBV A;  1UW4 A;  2RSQ A;  2K8G A;  3NOC A;  1B0T A;  1SV5 A;  4F3M A;  3IRX B;  3ADA C;  2D7S A;  1SH3 A;  3V4I A;  4YB1 P;  4X4T A;  3PKY A;  2BUN A;  4TKT A;  4ZCL A;  3R7S B;  1FFS B;  3I32 A;  2ALZ A;  3C66 A;  3PHE A;  2DY1 A;  4RUA A;  4O3R A;  1FNO A;  5HP1 B;  2UUW A;  3JSB A;  3QSI A;  3VAL A;  2V4J A;  3DLG A;  3TR5 A;  2B9X A;  3KK1 B;  2R4F A;  3MOZ A;  3E8O A;  1FK9 B;  2BQR A;  2W4P A;  2B9E A;  4M5H A;  4WK1 A;  1FRX A;  5HMX A;  3F41 A;  4X4Q A;  1MNE A;  1Y3K A;  3MAA A;  2CAD A;  4JI8 J;  2QMX A;  3DLE A;  2J8S A;  4UY8 5;  4QR2 A;  5IQQ A;  2UXB J;  2GQ2 A;  1SQG A;  3MM8 A;  3DOM A;  3D3C J;  3I5C A;  1RT2 A;  4IOC Q;  2NRE A;  3D6F B;  3T6B A;  3MMA A;  3DFE A;  5KFD A;  3JQJ A;  2HNZ B;  1VI7 A;  4LSZ B;  1FTR A;  5A0Y B;  1U7L A;  4CH0 S;  4JV5 J;  4DFP A;  1M5V C;  2EG2 A;  1WOR A;  3THP A;  2IVY A;  3PW0 A;  3I82 A;  3AQO A;  4RNM A;  2HG4 A;  1WC4 A;  3KYL A;  3C46 A;  2W4D A;  1KVJ A;  4ED2 A;  4NXM F;  1PC5 A;  3RJM B;  3DRS A;  3NAH A;  2KJW A;  1EX8 A;  1LNQ A;  2RRN A;  2ZKT A;  1C1C B;  1JLB B;  5F41 A;  2OTL S;  1UVN A;  1GXL A;  1KDN A;  1PIE A;  5B09 A;  3GCW P;  4R8U B;  3J7A 1;  3BR8 A;  2XO6 A;  4OX7 A;  3DC2 A;  5CYM B;  2Q1L A;  3PX6 A;  1ZZF A;  3W7B A;  1TV6 A;  4P74 A;  4EBD A;  4CO4 A;  2MZJ A;  2Z2L A;  4EBC A;  1QSL A;  3M9N B;  3KLH A;  4OZJ A;  1R0B G;  2QRR A;  4C8M A;  1KQG B;  4K59 A;  3DRR B;  4K4U A;  3UDV A;  3TQE A;  2J0Q D;  3K5L A;  4DZ6 A;  3GPA A;  4JYA F;  1ZA2 B;  2F1F A;  2ACY A;  3QQC D;  1GMV A;  3EVM A;  2VPW B;  1MN7 A;  2OPS A;  5T14 A;  1WNE A;  3G2X A;  3G4S S;  2CZ4 A;  3MHY A;  4QIF A;  3KHL A;  5KFQ A;  2OEM A;  2CPY A;  5CQG A;  3HVR A;  3VAI A;  1NPK A;  2FIU A;  3WQP A;  2KXH A;  4Z37 A;  1UKU A;  4QR1 A;  1ACM B;  2FZC B;  4PXC A;  2MST A;  2V8G A;  2W1B A;  1JLE B;  3R5G A;  2VFS A;  2V63 A;  5A8R A;  4AL5 A;  1XEZ A;  3NMR A;  1S7I A;  2CQC A;  1TKX B;  2V8P A;  5LM7 E;  3QID A;  4KY3 A;  5KFM A;  1ZTW A;  1SUQ B;  4CLY A;  4JI7 F;  3JSM B;  1RT5 A;  2K7J A;  1UET A;  2MJU A;  2EFV A;  4NXM J;  2W2Q P;  3IS9 A;  4IO9 Q;  2CQI A;  2DGU A;  2I5J A;  3QMQ A;  3AA9 A;  3G86 A;  3FKB A;  1OWX A;  2HWT A;  1H7W A;  4MH8 A;  3KJV A;  4RKU C;  3ZZT A;  4UQT A;  4OX6 A;  2FVS A;  4JV1 A;  5DQH A;  2CJY B;  4YN3 B;  3V6K A;  3C14 A;  2CQ4 A;  1R8H A;  4KC5 A;  1U1Q A;  3LP1 B;  2B6A B;  1S4E A;  3DOL B;  2X1G A;  1RAI B;  5ETV A;  2VA2 A;  3V6J A;  4PWD B;  1HNI B;  3AJD A;  4WJB A;  1CJT A;  4PCQ A;  4YFU A;  4JYA J;  1K44 A;  3N5F A;  5KTQ A;  1MMN A;  3CC4 S;  1JLG B;  3OV7 A;  2NSB A;  2OD4 A;  2ZOF A;  4V19 X;  4G65 A;  1XN9 A;  2GML A;  2M4M A;  2VG7 A;  3UDC A;  5DZ6 A;  1DQ8 A;  3DLH A;  2DNN A;  4JI6 F;  2QO3 A;  5E3Q A;  1NB2 A;  1JXL A;  4WPA A;  2G0I A;  3M32 B;  1R6Y A;  4ES1 A;  3QWP A;  3V6D B;  4OI6 A;  3OL7 A;  5A8W A;  4OHV A;  1RWP B;  4FKY A;  3QLH B;  4DSL A;  3PW7 A;  2GFF A;  3D1Q A;  2NUH A;  4F67 A;  1V3S A;  4C97 A;  1BE4 A;  3OJS A;  3KJF B;  1Q82 T;  4OI3 A;  4BS2 A;  2FVQ A;  1X5O A;  4B3T J;  1LOU A;  4ELT A;  4G1Q B;  1U47 A;  5AXN A;  1N0U A;  2E7V A;  2NZ4 A;  4PKD B;  1VHF A;  3C6T B;  4WCE Q;  4W4M A;  3BSN A;  4Y00 A;  1ULR A;  3CJR A;  3JS9 A;  5A8K B;  1B64 A;  4Y2K A;  1RHJ B;  2FLL A;  3OR2 B;  2L3M A;  5HVF A;  2XMM A;  2YX7 A;  4J9M A;  5K9F A;  2W9B A;  1K1S A;  2XZD B;  4F3Q A;  4DSK A;  3I87 A;  4WYW A;  2Y0B B;  1XR6 A;  2CJQ A;  4M5D A;  3O6Q A;  4LF4 J;  4IRC A;  3OTO F;  3HF5 A;  2JWN A;  4DL6 A;  1WOP A;  4M94 A;  1Q5Y A;  4OYB A;  3UCU P;  4TU9 A;  3GYG A;  2N82 B;  3JTP A;  1S48 A;  2WON B;  4MFB A;  3FSI A;  3ILL A;  1WHY A;  4ED8 A;  4WFY A;  2RH3 A;  1OPZ A;  1N88 A;  2ZVS A;  3K58 A;  3ZO7 A;  4QIV A;  2Y9H A;  1BMQ B;  1AFI A;  4U7U D;  1X31 C;  2DT9 A;  2YKP A;  3POT A;  5KFK A;  2K1R B;  1RTJ A;  3GON A;  3HCX A;  1T9W A;  4AXI A;  1CLF A;  5KG1 A;  3L3C A;  3X1L B;  3AJ1 A;  3E51 A;  1SJ1 A;  1W2B R;  4OV1 A;  3FSY A;  3MED B;  3Q8Q B;  1TL5 A;  1TKZ A;  3FDS A;  4LSL B;  2VBY A;  3QJJ A;  5IT9 Y;  2AJQ A;  2NYH A;  2XMA A;  1SQF A;  3PIP Q;  3W5Y A;  1RAD B;  1VC0 A;  4RU9 A;  4DPX A;  3KUE A;  3DRP A;  2DK2 A;  2HQF A;  4P10 A;  2PSZ A;  3A8J A;  2BYC A;  1NUE A;  3TX8 A;  4P75 A;  1B0P A;  4F50 A;  2EG1 A;  2ZBI A;  1C2P A;  5E3R A;  4USU A;  1P9Q C;  4X65 F;  3NKY A;  4KV8 B;  4PG4 A;  4NLG A;  3HKW A;  3GB0 A;  2V8D A;  2R8I A;  1EET B;  5KG5 A;  1KSP A;  5CA5 A;  1NPP A;  1X0F A;  2YNG A;  4B02 A;  2ASJ A;  3H5X A;  3TUI C;  2QE5 A;  2FLP A;  4DL7 A;  3ITH B;  4C8K A;  1T9Y A;  1VQ5 S;  4J37 A;  2UVW A;  2HS3 A;  5HAO A;  3OTO J;  4GMK A;  1NAQ A;  1Z2L A;  1BLU A;  3EGV A;  4NWB A;  1U1K A;  1KEK A;  4E2F B;  4L3N A;  1F2H A;  5JMN A;  2B5J A;  4Q5V A;  3I4P A;  5HRO A;  4GRS A;  1UVJ A;  2MLX A;  3CJT A;  3CIM A;  2OFH X;  1RDR A;  3SCI E;  2IIH A;  2KM8 C;  2ZFH A;  4LQ9 A;  4NA2 A;  2IJR A;  2DPJ A;  1GEH A;  1NK6 A;  2DNY A;  3U1N A;  3W3S A;  2PMW A;  3OHB A;  4FPR A;  4YY3 F;  4DN9 A;  1VK8 A;  1IBC B;  4HEA 9;  3MEE A;  4X4V A;  2MKC A;  4FYX B;  2MSS A;  5K8M A;  4DF4 A;  2A10 A;  3PJW A;  4K2X A;  2RML A;  3UCZ P;  1UJ5 A;  1S1V B;  4CLW A;  5KG0 A;  1FXL A;  5CZV A;  3D6H B;  1D1U A;  5FLX Y;  5KT2 A;  1UPP A;  4URS A;  4C11 A;  2ZH1 A;  2GIF A;  1YKW A;  5D4N A;  3ZZU A;  4KHP J;  1S79 A;  1YZ6 A;  1TR0 A;  2WSE C;  2XMT A;  1QTN B;  1Q78 A;  4Q7A A;  1UA0 A;  5IXU A;  2GJ2 A;  5JVG Q;  3GZ7 A;  4C2M A;  4USM A;  2KJV A;  3OHA A;  2UUA F;  3LAM A;  1FXR A;  3MR5 A;  2I6W A;  3NP5 A;  4AL6 A;  2CPI A;  3A4T A;  5A6W A;  4UY8 T;  1D0E A;  4CI0 B;  1JLA B;  1NSK L;  2X1A A;  4HL9 A;  2KT2 A;  1ARO P;  3DM2 B;  3CCV S;  3VAJ A;  2QC3 A;  1DFD A;  2CWX A;  3CW2 C;  2BV3 A;  1CC7 A;  2DGW A;  4RW6 B;  2W9C A;  1NKC A;  3SDE B;  3MM8 B;  1WJ9 A;  1RQ0 A;  1URN A;  1N33 F;  3FC9 A;  1XR7 A;  4TLR A;  4CLL A;  3WX4 A;  2XSJ B;  1SQE A;  2B4O A;  2R2U A;  1WEX A;  4NLD A;  3KK3 B;  2W2N P;  2ZHA A;  2Q6B A;  3M6V A;  1S6P A;  1HMV B;  1N52 B;  5HAT A;  3OFE A;  1S1U A;  1HI0 P;  4ZLL A;  1T03 B;  1GAO A;  1CVJ A;  1FFG B;  1J2V A;  1RT1 A;  4B17 A;  3E2E A;  5IM0 A;  5EHH A;  3EXC X;  2LU2 A;  4FBT A;  2WSC C;  2GA7 A;  2CQ0 A;  2ILY A;  3WDO A;  2ZM6 F;  3R5A A;  3DXB A;  1VQL S;  1S9E A;  1RU1 A;  1YTY A;  4J9V A;  3QAE A;  4YY3 J;  4HHJ A;  3CJ3 A;  2OSR A;  3W9J A;  4RW8 B;  3MEC A;  5U47 A;  4FZV A;  2LQ8 A;  4DFJ A;  2DR6 A;  3TW0 A;  1UEK A;  2JRS A;  1BQN A;  2EC0 A;  1HYS A;  1VQY A;  5KFF A;  3NCR A;  1NJY A;  3NRB A;  4N5S A;  3R2D J;  1U25 A;  2WZ1 A;  1SC3 B;  4DS4 A;  3O1L A;  2YKM B;  2DCL A;  1PCA A;  1X9S A;  4ECT A;  2HWH A;  3I0R A;  3TAN A;  1QDU B;  4I7F B;  2FQQ B;  3M6W A;  3MMC A;  4DXL A;  2PGC A;  4N47 A;  2C2D A;  3ZFV A;  2UUA J;  2HZA A;  4AE5 A;  5KT5 A;  2ACM A;  4CWB A;  3UQS A;  4HTJ A;  5E33 A;  3LAK A;  3T5K A;  4NEY A;  3IGV A;  3RAQ A;  5LSO A;  4ED5 A;  1TL3 A;  4NLU A;  1N33 J;  2HIQ A;  1TL7 A;  4LR7 A;  5ETK A;  1R3N A;  2HQD A;  4KGM A;  1J5E F;  2EWH A;  1XJW B;  5H9F K;  4FVC A;  2N3O A;  2V34 A;  2XB2 D;  2B3T B;  1U2R A;  5K8O A;  3LTO A;  2V4Q A;  4ALZ A;  1FDB A;  4FYD A;  2HVI A;  3W1Y C;  1PYS B;  2MLY A;  4OYO A;  4R25 A;  4ZS6 A;  4E98 A;  4PG7 A;  2PN6 A;  4ECV A;  3IS9 B;  4WFA Q;  2I5J B;  4ECU A;  2ZM6 J;  4ZA1 A;  1PYT A;  2RDD A;  2AJ1 A;  2B8P A;  3H2L A;  1CSJ A;  2VAS A;  1HQE A;  3Q22 A;  1V9O A;  3RTV A;  2FZG B;  1RWM B;  3MEK A;  4ZCM A;  1Z4U A;  1TUW A;  2MQ8 A;  2VOO A;  3HVA A;  4ZVR B;  4RZR A;  3TRG A;  3CVK A;  2IA0 A;  1FKA F;  2LQB A;  1ZZN A;  1YJT A;  2QGF B;  4Q0B B;  2C3O A;  4WP9 A;  1X4E A;  4KB7 A;  5AE1 A;  1BWV A;  1UTA A;  4K4Y A;  2W8K A;  4EEY A;  1YIJ S;  5CD4 H;  4B9T A;  5HI7 A;  5E5N A;  4AL7 A;  2MKK A;  4JI4 J;  2OAU A;  2L9D A;  3C3L A;  3HSG A;  3JSY A;  5CAB A;  2VH7 A;  1CQN A;  4X64 F;  3HVT B;  4C7Q A;  4Q8E A;  4N76 A;  5SZT A;  3H40 A;  2XNR A;  1Y3J A;  3WHI A;  5DDO C;  1NU4 A;  2VHG A;  1VRT A;  1DAR A;  2RF2 A;  3PEH A;  4AD6 A;  3EIC A;  4DU8 A;  2RAQ A;  1PJ5 A;  2XTJ P;  1J5E J;  4A8W A;  3NAI A;  5A8W B;  3M2V A;  5LMN F;  1RKI A;  1RAH B;  3HHL B;  3PRV A;  2V8V A;  1IKY B;  5KFR A;  5B0F A;  2C2K B;  1MN9 A;  2MGZ B;  3BKU A;  2VZ9 A;  3DMJ A;  2A2D A;  1IQZ A;  1RTD A;  3M8W A;  2FY8 A;  3MM7 A;  1IKX A;  2HGL A;  5KT6 A;  4PWU A;  4A8S A;  1RWV B;  2IM1 A;  1Y7P A;  2F8M A;  4IR9 A;  2BW2 A;  2CQG A;  1T95 A;  2AV5 A;  4OQJ A;  3PNI A;  5EX0 A;  3B8H A;  4Z7C A;  3W8P A;  3OTB A;  2VOP A;  3RU0 A;  3PDN A;  1RWX B;  1WI8 A;  3UN3 A;  4ID5 B;  3TAR A;  1X4A A;  2AP6 A;  1DQA A;  1NDP A;  4WU2 A;  4DQI A;  1MRO A;  4M5D B;  1TP7 A;  4I68 A;  4NLV A;  2Y1I A;  3GIJ A;  1D9D A;  1K1Q A;  4URG A;  3TUZ C;  4KFB B;  4O4R A;  3VCD A;  3RB4 A;  1VQ9 S;  1HQU B;  5I42 B;  2ZC4 A;  4QYZ K;  5L8R C;  3N6L A;  5EUH A;  3WC0 A;  2L41 A;  2HBR B;  4ZP9 A;  1FRL A;  2DHA A;  2RRA A;  1KVK A;  2YPZ A;  1HBM B;  2G2Y A;  2IM2 A;  4RBU A;  1EHW A;  3AD9 C;  2E1A A;  1ZPV A;  4H4O B;  1YK9 A;  2ZWO A;  3OUY B;  4CLS A;  2OJ3 A;  4OFZ A;  1Q79 A;  4ECS A;  1PBU A;  3KXD A;  1WF0 A;  3SQO P;  4YB5 A;  4HHU A;  1FWK A;  2VBZ A;  1WTF A;  5HBM A;  2B7B B;  2UUT A;  2BQU A;  1S1X A;  3FJ2 A;  3FFI A;  2YKO A;  1RA7 A;  2VG6 A;  1FRJ A;  2QA1 A;  1HHQ A;  3T19 A;  2QEX S;  3BBC A;  3OFF A;  5GAD I;  5I3U B;  3JYT A;  3BB5 A;  3BO3 A;  3AJ2 A;  1PYO B;  4DQR A;  3N4W A;  1UL3 A;  4TY9 A;  1X4G A;  3MEG B;  3QYY A;  1BQM A;  1S6Q B;  4ZLJ A;  1SVD A;  1RHU B;  2Z58 B;  3GFZ A;  1P1T A;  1RTZ A;  4PUO A;  2BJE A;  3HP6 A;  2U1A A;  4P72 A;  3VVT A;  2OPQ B;  3BRE A;  5F0W A;  1CG2 A;  3KLF B;  3Q0A A;  2R7S A;  4EUV A;  3ET6 B;  2KL8 A;  5A76 A;  1QVF R;  3TAM A;  4UT4 A;  1YRT A;  5M2R A;  2EFG A;  4OZL A;  3TP2 A;  1M5O C;  4YR2 A;  2DIU A;  5C42 B;  1IM6 A;  2G13 A;  2AKW B;  2JVR A;  5BR8 F;  3BO2 A;  5KFY A;  2BX6 A;  3LPY A;  1FRM A;  1FEE A;  2B5J B;  3G8T A;  4CO1 A;  2CG8 A;  2A6M A;  3PEJ A;  4I2P A;  3HHN B;  1OY6 A;  1BHN A;  2B56 A;  2Z30 B;  4LF9 F;  2DEI A;  4C6A A;  3ILI A;  1PBA A;  2DXD A;  4QQB A;  3VAK A;  2GW8 A;  4QCL A;  3BGR A;  3BSO A;  1IWG A;  2OLW A;  4OYX A;  1IBL F;  5C25 B;  3HZG A;  1Q95 G;  2HIY A;  4OJH A;  4KAI A;  4IFV A;  4DQP A;  1RAO A;  2BXJ A;  4JBC A;  1CS4 A;  1GNK A;  4USJ C;  3H7H B;  2GIQ A;  1RAJ A;  4DSF A;  3LO3 A;  2OH2 A;  5THW A;  1MU2 A;  1JJH A;  3CNQ P;  1YRX A;  3ULH A;  2IBK A;  1HNV B;  1UVM A;  4CZC A;  5KAK A;  3BS9 A;  2JDJ A;  4RU2 A;  4F0K A;  1U48 A;  4ZPT R;  2HKE A;  4LUB A;  3MCS A;  2AMC B;  3P49 B;  2XQC A;  4I4B A;  3NGU A;  2BRL A;  1FF2 A;  2AYG A;  3ZZZ A;  2W9C B;  1RTH A;  2VIH A;  3TZZ A;  3EE3 A;  3GR1 A;  1GMW D;  5IV3 A;  2XMW A;  3IC1 A;  3LGN A;  3Q8U A;  4P2S A;  4ED1 A;  2HQG A;  1BWE A;  2P9C A;  3RRK A;  1SKS A;  1WG1 A;  2AEF A;  2KB2 A;  1J5O A;  1KNZ A;  1M5H A;  5BR8 J;  4BHQ A;  1FJG J;  2C2N A;  4KTQ A;  4JV0 A;  1WC3 A;  1UPM B;  1DTQ A;  2XMJ A;  1W7W A;  4KKO A;  2GHW A;  2V50 A;  4F4W A;  3BM7 A;  4K5R A;  4LF9 J;  1A7G E;  5H9E J;  5HQ8 A;  1SL1 A;  3UCG A;  4KGV B;  3S8S A;  4RW7 A;  4ZDN A;  2ALY B;  3G6X A;  3I55 S;  4DL2 A;  1HR0 F;  4DDF A;  1L3S A;  4MKB A;  3G9C A;  1GXU A;  3AD7 C;  1FKO A;  5A2Q U;  3OXF A;  3GP9 A;  2HNY A;  2DRB A;  5LSR A;  1OO0 B;  4C3K A;  1JMT A;  2C2R A;  3TJ8 A;  1T9T A;  2ADC A;  1N5Y B;  3I0R B;  2WBM A;  3Q2T C;  5KG2 A;  1T05 A;  2CZ9 A;  1VQK S;  2KRR A;  3G8Q A;  2ZJR Q;  2LDY A;  1WOO A;  4AUK A;  1IKW A;  3FBF A;  1C0T A;  1XTZ A;  2DBB A;  2XEX A;  4QZV B;  2QSF A;  4NYZ A;  3CE8 A;  1AA1 B;  1JX4 A;  1O0P A;  4F0H A;  2YY3 A;  2G4B A;  4TY8 A;  3VAF A;  1S1W A;  1BC6 A;  4ZVP B;  4WWS A;  3VQS A;  4DV5 J;  1B7Y B;  4DG1 A;  4DMZ A;  1HD0 A;  4DPO A;  2R8J A;  1T94 A;  2JEJ A;  4ZJO A;  2HAI A;  1OMS A;  4UOG A;  1VQO S;  4HI1 A;  2YKN B;  4I64 A;  4CYU B;  4LR8 A;  5FJ4 A;  5HAN A;  2U2F A;  2GMH A;  4WFZ A;  1PIL A;  1KWM A;  3IG1 A;  2HFV A;  2DNK A;  5BYR A;  2B4P A;  2XBP A;  1HNX J;  3EZU A;  2XWX A;  2R8K A;  3NLC A;  3RBE A;  1I1G A;  2FHM A;  2CNO B;  3JB9 k;  5HJX A;  4ZKA A;  1S7H A;  1FD2 A;  5FDL A;  2DO4 A;  4DV7 F;  3HSD A;  4X66 F;  2IMW P;  3UW1 A;  3MXH P;  3OR1 A;  4IQX A;  2QLB B;  3PO4 A;  2HRY A;  2DR8 A;  2B9Y A;  1SJR A;  4EYI B;  4CLZ A;  3M8R A;  1NDL A;  2LEP A;  1UVL A;  4NEZ A;  3NBP A;  5J2P A;  4FYY B;  4L73 A;  2MZR A;  1KLM A;  3BEG B;  3D5M A;  1E6V A;  4O4G B;  2ROE A;  3MCO A;  3DLL Q;  2ABY A;  4Q43 A;  1XNR J;  4L72 B;  4AYB D;  2LU1 A;  3DOK A;  2PMZ D;  4K4S A;  1Y00 A;  1FJ7 A;  1HBN B;  3TEH B;  1RCX B;  5F8L A;  5GMK a;  3EVW A;  4R5P A;  5C24 B;  2H4W B;  2EVZ A;  1FNX H;  4P6Q A;  5K14 B;  3BQ1 A;  1ELO A;  2PII A;  4NX9 A;  2EFQ A;  5B08 A;  3K5O A;  5L1K A;  1R31 A;  4A48 A;  2XC9 A;  2CFX A;  4GKK J;  4URQ U;  4HKQ A;  3CCQ S;  2XYH B;  3C19 A;  1F6T A;  2UV8 G;  1FWP A;  3A8K A;  4ETZ A;  1OQ3 A;  4NCG B;  3OVA A;  2IMO A;  2NPI A;  3IO1 A;  2W7P A;  3D2W A;  4EK2 A;  1L5U A;  1H72 C;  1RXO B;  4OMF G;  4PXE A;  4LRC A;  1CJV B;  1GQE A;  1PAU B;  2R7Q A;  2EK1 A;  3OL8 A;  3KUG A;  3GYN A;  4BDP A;  4KPY A;  4Q45 A;  5MAO A;  2IYG A;  4J9P A;  4YR0 A;  3DI6 A;  3SQG A;  1LWC B;  5L1L A;  2DIT A;  4ES2 A;  4B08 A;  5HMY A;  2VJV A;  2E5L J;  4O3O A;  2E5I A;  4X66 J;  2CG4 A;  4MIW A;  4ZIT A;  2AYB A;  2QLF B;  1L3V A;  1WD6 A;  3A8I A;  2WB1 D;  2HFO A;  4P9S A;  2BAB A;  3CCS S;  2RKI B;  3DYA B;  2OML A;  3DGP B;  1SC4 B;  5CXT A;  1C4C A;  3H8Y A;  1VMB A;  4MKV A;  3EM1 A;  1V6H A;  3ZZ0 A;  4XIU A;  2JL9 A;  1NPR A;  1FKP A;  1FDA A;  2ZH4 A;  2NXJ A;  4G6V B;  3PAC A;  3PCO B;  2YWW A;  1SCJ B;  2BE7 D;  2RS8 A;  1YVF A;  2VA3 A;  1VQ6 S;  4NMX A;  4LBI A;  1U1P A;  2YH0 A;  1GH8 A;  3K8W A;  4GO7 X;  1YJ9 S;  4OHY A;  3AQP A;  1HW8 A;  4IG0 B;  1DTT B;  4ZK7 M;  4DR6 F;  5DO2 A;  3T1A A;  3K5N A;  2W9A A;  3EWG A;  2PI4 A;  3D6T B;  5IC4 B;  4EZ6 A;  3MF5 A;  4F0M A;  3SMZ A;  1HNW F;  2HRU A;  2I0X A;  3CDU A;  4DSI A;  5AJ3 F;  1NK0 A;  5RUB A;  4K4X A;  2JVO A;  3QJP A;  2CPD A;  4FF3 A;  3KNG A;  4OJG A;  4PQU A;  1ROF A;  3D67 A;  2R2S A;  1D9F A;  3C16 B;  3CCE S;  1U1O A;  2NXC A;  3VZH A;  2C2M B;  2F4V F;  2XS5 A;  1U6F A;  3OTD A;  3NOG A;  1KTQ A;  4W98 A;  4JI1 J;  4MK9 A;  4RR5 A;  3T6J A;  3SV3 A;  4TQS A;  3CJ2 A;  3DLB A;  1NHV A;  3T5L A;  2VPY B;  3KOA A;  2AEM A;  3HM9 A;  2G0J A;  4U6P A;  2Q66 A;  1OS5 A;  1A0O B;  1TVR A;  4WK3 A;  2RHQ B;  1IBK F;  2IC3 B;  3E01 A;  1TAQ A;  4Y65 A;  1VJQ A;  3HT0 A;  1U0H B;  1LFW A;  2GAG C;  2WRM A;  3R7N B;  2UP1 A;  4PXB A;  3BYR A;  5HK4 A;  3PYD A;  1XER A;  2UV8 A;  1N5Q A;  3MWB A;  3J7A N;  2AT1 B;  3DN9 A;  3KKF A;  3C6U A;  4HT5 A;  3RR7 A;  2KM8 B;  3DLK A;  3W2W A;  1WF1 A;  2BEF A;  4LFC F;  2EPI A;  5GAG I;  3W64 A;  2HGM A;  2G1D A;  2CQB A;  3BBF A;  5ETP A;  1KVI A;  3S01 A;  3GJR B;  3SYZ A;  4DR6 J;  5KFN A;  2GGP A;  3NG8 A;  4I2P B;  2BJ9 A;  4N8N A;  4QR0 A;  4U7U K;  2XLJ A;  2CJA A;  3MM5 A;  1XMO F;  2QIF A;  3AB4 B;  2FVC A;  2DVI A;  2D3O R;  5A6P A;  1AUD A;  1KLN A;  4KPC A;  5E3A A;  4C98 A;  4XO0 A;  1FFW B;  1M5S A;  3OPK A;  1KN6 A;  1NJW A;  1TFW A;  3MAH A;  3DKD A;  3MR2 A;  2CQ3 A;  2APO A;  2UVR A;  2GC8 A;  3FNN A;  3H20 A;  3PJ9 A;  4BC7 A;  1R8P A;  3ELH A;  4OX8 A;  1DJ0 A;  2EW9 A;  3J7Y U;  3KHG A;  3TA0 A;  2KXF A;  2AX1 A;  3BPD A;  4IRK A;  1IKV A;  1UZH A;  4N77 A;  4NLP A;  2EEY A;  4IQM A;  2LQJ A;  5L39 A;  2YQ3 A;  4CCH A;  4EYH B;  2R8G A;  1QAI A;  2A6O A;  2QFI A;  4I6Y A;  5DG7 A;  3KLG A;  3MCN A;  1DY3 A;  1IBK J;  3I9Z A;  2R7W A;  5B0C A;  2WOM B;  1T3O A;  1R0C B;  1TTH B;  2DRD A;  3QBC A;  5HQL A;  2BRK A;  2CZV C;  4X84 A;  3DU6 A;  3QRP A;  2AJ2 A;  4AND A;  4DZD A;  3QNW B;  3D4J A;  2GO8 A;  1I5O B;  4I6A A;  7FD1 A;  3W5Z A;  3T1Y J;  1CQM A;  1TMM A;  1VJW A;  2VL1 A;  4ETX A;  4YHH F;  1RUS A;  2HZV A;  4DR1 F;  1JWW A;  1LW0 A;  3EMT A;  3EDR B;  5ETN A;  3GG1 A;  4DPU A;  1MMD A;  3BH7 B;  3PR4 A;  5GAH I;  3ZZR A;  4B9V A;  4H4M B;  4RW9 B;  2YWF A;  1DTQ B;  3O5T B;  2J6U A;  1M5P C;  2PO4 A;  2M8D B;  4MAK A;  1IM4 A;  2P9G A;  3EDQ B;  4XPE A;  1JXE A;  1RAB B;  5IS2 A;  1NHK L;  1M1K T;  3MFH A;  4P7V A;  3H90 A;  2PT0 A;  1H3D A;  2FVP A;  4DPY A;  2OTJ S;  2LKZ A;  4RW7 B;  5J2Q B;  1RTI A;  2DYA A;  2LVW A;  3QT8 A;  3HHE A;  5KFW A;  4NXN F;  3L09 A;  2JZ5 A;  1FKO B;  1UFK A;  2HNY B;  2AJ0 A;  3KMQ A;  4ZPA A;  2MQM A;  4OHX A;  4TNO A;  3D9B A;  3CSK A;  4NLW A;  5DQI A;  3P5T L;  3AHP A;  3RB3 A;  2AJ4 A;  5GVQ A;  2PEB A;  5IZH A;  2DB1 A;  1RCO B;  4OI2 A;  3M9M B;  4I0W A;  4C8O A;  1RU2 A;  2BM0 A;  2N7Y A;  4YR3 A;  4PPD A;  3Q8P B;  4PQA A;  1PAE X;  3K5M A;  2F7V A;  1UCN A;  3M30 A;  5F8N A;  4XDD A;  2RUG A;  3MAQ A;  3W2V B;  4UOH A;  2R7O A;  4WYL A;  3IA0 A;  5DRK A;  2E5H A;  3W63 A;  3L7U A;  2OIH A;  3R5J B;  2PMH A;  1X4B A;  4IDK A;  1VYA A;  1TKT A;  1T9V A;  3BKT A;  5LMU J;  3MTK A;  4YHH J;  1JNZ B;  4DR1 J;  3U27 A;  5F8J A;  4USI A;  2CQP A;  2QJ3 A;  4NA3 A;  4WFN Q;  4FP9 A;  4YUD A;  4USW A;  4CLU A;  4YME A;  1RB0 A;  2E29 A;  3I0S A;  4EZ9 A;  3UI3 A;  4ZCK A;  4K7Q A;  1N32 F;  1KS2 A;  2GO9 A;  1FER A;  2AX0 A;  3PW5 A;  2OEL A;  1M0S A;  2OD6 A;  3IWX A;  2NR0 A;  1JQG A;  4WTY A;  4F26 A;  1JLC B;  2F8H A;  1WKL A;  3EGW B;  2VD3 A;  4M63 A;  1XQI A;  3Q23 A;  2UUC J;  2MB0 B;  1U1M A;  3KK2 A;  5T7L A;  2CYY A;  3RB0 A;  2BM1 A;  3QRQ A;  2AGO A;  3TZY A;  1UWB B;  3IM9 A;  4DL3 A;  1X9W A;  2KG1 A;  2V2Z A;  3SCK E;  3T41 A;  4J5O A;  2E1M C;  3CCJ S;  1X4C A;  1T3N A;  1R0A B;  1NK8 A;  2IY5 B;  1E6V B;  2CQD A;  1F0X A;  2KYX A;  4OYA A;  2BBE A;  3MR3 A;  3QGG A;  2LLZ A;  1HBO A;  3D66 A;  5I4M A;  4RUB A;  3CIZ A;  2KU7 A;  2AGP A;  1EP4 B;  1KQF B;  3NWG A;  3V81 A;  2ZDO A;  4F4A A;  2ZE2 A;  4ZMM A;  4OI1 A;  1WG4 A;  3M1V B;  5J1N A;  4R5P B;  2XLI A;  1JKH A;  2F65 A;  3FEZ A;  3OXL A;  4ZPB A;  3H5Y A;  2FJX A;  1UA1 A;  3P6Y C;  3MPD A;  4NYP A;  4K4V A;  4ZOS A;  4O3S A;  1MWQ A;  2ZIT A;  3F73 A;  2CKW A;  3NXZ A;  5E0O A;  2BKN A;  2VBX A;  1SC1 B;  2ZH8 A;  1AYE A;  2VDH A;  1TUG B;  3SSQ A;  3I9V 9;  3UD3 P;  3TVZ A;  5AE3 A;  3CXC R;  5IQ6 A;  1G1X A;  4L3K A;  5A2Q Y;  3RRG A;  1Q5V A;  4TU8 A;  1FTC A;  4Y2I A;  2OFG X;  4UTG A;  4P52 A;  3UDL A;  3BN4 A;  4ED7 A;  4DFM A;  1WAC A;  5C7P A;  2JEF A;  2XY6 A;  2IPO B;  2ROP A;  3CCT A;  4JB8 B;  4FS2 A;  1LWE A;  3LP0 A;  5H9E K;  1N34 J;  2ZJQ Q;  1MML A;  2XI3 A;  2FJE B;  4CLP A;  4WF9 Q;  3VV2 B;  3RUB L;  1N32 J;  3MM9 A;  1KR4 A;  2CUY A;  1U2C A;  3MZI A;  2Z2M A;  2UXC J;  3DI6 B;  4ECW A;  1HBU A;  2HMI A;  1QE1 A;  1ZOT A;  2ZWP A;  5AXM A;  1PJ6 A;  1LWF A;  5KFV A;  4C9D A;  3BN7 A;  3D54 A;  1ZPW X;  4DR2 J;  4EFA C;  1TQL A;  3CJK A;  3VWS A;  4UZC A;  1KTV A;  1NHU A;  4OLO A;  2XYP B;  4WXW A;  3QFH A;  1F9E B;  4A4J A;  2IVF B;  1C1B A;  4LF7 J;  3UNY A;  2WBR A;  2PA8 D;  3J80 Y;  2YWK A;  2LQ5 A;  1WKJ A;  3IM8 A;  2VG5 B;  2KT3 A;  2FGO A;  4JI8 F;  2DNL A;  3R1L A;  3NL0 A;  1QY7 A;  4NOH A;  3MMB A;  2BE2 A;  3H59 A;  2DKO B;  5KFS A;  2YNF B;  4RUH A;  2ROG A;  1QAJ A;  4DPT A;  3PW2 A;  2CDR B;  3RAX A;  4ECQ A;  1Y5I B;  3CC7 S;  3HZE A;  3K5P A;  2YTC A;  4RNH A;  2HAF A;  3CT9 A;  2ZD1 B;  3S1T A;  3EZ5 A;  3ENW A;  1SKU B;  1AUS L;  2AYM A;  2ZEJ A;  1YHQ S;  2VC0 A;  2FJW A;  1RT6 A;  2QL7 B;  3RBD A;  4DV2 F;  1ITP A;  1C0U B;  3KLE B;  4R0J A;  2M70 A;  2FLN A;  2DTJ A;  2MY8 A;  1LW2 A;  4ZP8 A;  3M8Q A;  4NI2 A;  4HH1 A;  3UD5 A;  2DGV A;  1VC5 A;  5KFX A;  3FCW A;  5K8N A;  2XGQ A;  3C2P A;  3LA0 A;  1EQ0 A;  4M5G A;  2DHX A;  2HZC A;  1DQ9 A;  1OIA A;  4XTT A;  1GX6 A;  3OSN A;  1DUR A;  5DLF A;  1AZS A;  2GIR A;  1FRH A;  4ICL A;  3MI7 X;  4M8L A;  3CMA S;  5DGB A;  4CM2 A;  4DQQ A;  4KO0 A;  1GXT A;  4DV0 F;  5G4D A;  1TL1 A;  2LQ9 A;  3N6M A;  2FC8 A;  1KFD A;  3G8S A;  4M5I A;  5DET A;  5EGY A;  1U6B A;  5T41 A;  2G9O A;  3HJF A;  1YI2 S;  2GGP B;  2W2P P;  1U2F A;  4JP8 A;  3MM5 B;  1X5P A;  4ITS A;  1O51 A;  1RT7 A;  2XS7 A;  4DR5 J;  3R2C J;  3I4H X;  4BWM A;  2FHJ A;  1F9F A;  2M9K A;  3OXG A;  1HNZ J;  5ITH A;  1S1T A;  2DNZ A;  1NEE A;  2YNI A;  1W26 A;  1Y10 A;  2HBZ B;  4WU3 A;  4DL4 A;  2IAJ B;  4MYU A;  3W9H A;  3FEY B;  3CJ5 A;  3D1H A;  2HVE A;  2ZNZ A;  1Z2Z A;  2VFV A;  2V2K A;  2PDA A;  2KRB A;  3CWJ A;  3IWL A;  4DJB A;  2VFR A;  2W7A A;  3MM6 A;  2KTQ A;  2DNR A;  4WZQ A;  3QIP A;  2PD1 A;  3UVJ A;  3VGT A;  2MQQ A;  4GVB B;  1R7I A;  4DV2 J;  4UW2 A;  5G0R B;  2UUB F;  5C5J A;  2HWI A;  2VQE J;  3LP2 A;  3FCH A;  4IOA Q;  2BJ3 A;  4OYP A;  3QO9 A;  3B6B A;  3Q86 A;  1HPZ B;  1B70 B;  1JLF B;  1H38 A;  2MZ1 A;  4XPC A;  2OPR B;  4CIO A;  3AY0 A;  2WTF A;  9ATC B;  4EWT A;  1RYS A;  4QPX A;  5J1E B;  2XMU A;  2QA4 S;  1IWA A;  2R7R A;  2NXU A;  4HH0 A;  1YBA A;  1IBM J;  4OYW A;  4DV0 J;  2D3Z A;  1HHT P;  2CRL A;  4RBT A;  3GU0 A;  4ELU A;  1N6Q B;  3EYZ A;  3G82 B;  3ETM A;  3H2U B;  2C1E B;  3I6P A;  4WE1 A;  3A3P B;  3NGK A;  3CCZ A;  2DNP A;  2Y1L B;  4EO6 A;  1XR5 A;  4QYZ J;  2D3O 1;  1HI8 A;  4ZLP A;  2GHV C;  1HA1 A;  3A12 A;  2BDP A;  2ZC3 A;  2DIS A;  4EI2 A;  3KJQ B;  2F5G A; 
#chains in the Genus database with same CATH homology
 3ET6 B;  1CJK A;  1CUL B;  1YK9 A;  4OZ2 A;  1FX4 A;  1TL7 A;  1U0H A;  3MAA B;  4CLS A;  4WP9 A;  1WC6 A;  5D0R A;  4OYP A;  1AB8 A;  1CJV A;  3C16 B;  4WP8 A;  3R5G A;  4USW A;  4CLU A;  4WP3 A;  1WC0 A;  1CJT A;  4CLT A;  2QV6 A;  3ET6 A;  2BW7 A;  1CUL A;  5D0E A;  1WC5 A;  3MR7 A;  3MAA A;  5IV4 A;  4CLY A;  4OYO A;  5IV3 A;  1Y10 A;  1Y11 A;  2WZ1 A;  1CS4 B;  2GVZ B;  3C16 A;  4USV A;  4OYM A;  4OYW A;  2W01 A;  3UVJ B;  4CLL A;  4OYZ A;  1CJU B;  3C14 B;  4P2X A;  4CM0 A;  1AZS B;  2GVD B;  4OYX A;  1FX2 A;  4OZ3 A;  4CLF A;  5D15 A;  3G82 B;  4WPA A;  4NI2 B;  4OYI A;  3C15 B;  2GVD A;  1TL7 B;  1U0H B;  4CLZ A;  4NI2 A;  3C15 A;  4OYB A;  4P2F A;  1CJV B;  1YBT A;  1WC3 A;  1CS4 A;  4CLW A;  4CLP A;  2GVZ A;  4OYA A;  1WC1 A;  1YBU A;  4USU A;  3UVJ A;  1CJU A;  4CLK A;  3C14 A;  1CJT B;  1CJK B;  4P2M A;  5D0H A;  4UST A;  1AZS A;  5D0G A;  3G82 A;  4CM2 A;  1WC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...